data_2RFI
# 
_entry.id   2RFI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2RFI         
RCSB  RCSB044795   
WWPDB D_1000044795 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2IGQ 
_pdbx_database_related.details        'Human euchromatic histone methyltransferase 1' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2RFI 
_pdbx_database_status.recvd_initial_deposition_date   2007-09-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Min, J.'                              1  
'Wu, H.'                               2  
'Loppnau, P.'                          3  
'Weigelt, J.'                          4  
'Sundstrom, M.'                        5  
'Arrowsmith, C.H.'                     6  
'Edwards, A.M.'                        7  
'Bochkarev, A.'                        8  
'Plotnikov, A.N.'                      9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     'Structural biology of human H3K9 methyltransferases' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            5 
_citation.page_first                e8570 
_citation.page_last                 e8570 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20084102 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0008570 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, H.'              1  
primary 'Min, J.'             2  
primary 'Lunin, V.V.'         3  
primary 'Antoshenko, T.'      4  
primary 'Dombrovski, L.'      5  
primary 'Zeng, H.'            6  
primary 'Allali-Hassani, A.'  7  
primary 'Campagna-Slater, V.' 8  
primary 'Vedadi, M.'          9  
primary 'Arrowsmith, C.H.'    10 
primary 'Plotnikov, A.N.'     11 
primary 'Schapira, M.'        12 
# 
_cell.entry_id           2RFI 
_cell.length_a           84.593 
_cell.length_b           85.627 
_cell.length_c           95.670 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2RFI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone-lysine N-methyltransferase, H3 lysine-9 specific 5' 32830.219 2   2.1.1.43 ? 
'Catalytic domain: Residues 951-1235' ? 
2 polymer     syn 'Histone H3'                                                 1164.314  2   ?        ? ? ? 
3 non-polymer syn 'ZINC ION'                                                   65.409    8   ?        ? ? ? 
4 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE                                    384.411   2   ?        ? ? ? 
5 water       nat water                                                        18.015    686 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Histone H3-K9 methyltransferase 5, H3-K9-HMTase 5, Euchromatic histone-lysine N-methyltransferase 1, Eu-HMTase1, G9a-like protein 1, GLP1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;NSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQY
CVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVR
SLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRF
PRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
;
;NSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQY
CVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVR
SLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRF
PRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
;
A,B ? 
2 'polypeptide(L)' no yes 'TKQTAR(MLY)STGG' TKQTARKSTGG P,Q ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   SER n 
1 3   GLN n 
1 4   VAL n 
1 5   TRP n 
1 6   SER n 
1 7   ALA n 
1 8   LEU n 
1 9   GLN n 
1 10  MET n 
1 11  SER n 
1 12  LYS n 
1 13  ALA n 
1 14  LEU n 
1 15  GLN n 
1 16  ASP n 
1 17  SER n 
1 18  ALA n 
1 19  PRO n 
1 20  ASP n 
1 21  ARG n 
1 22  PRO n 
1 23  SER n 
1 24  PRO n 
1 25  VAL n 
1 26  GLU n 
1 27  ARG n 
1 28  ILE n 
1 29  VAL n 
1 30  SER n 
1 31  ARG n 
1 32  ASP n 
1 33  ILE n 
1 34  ALA n 
1 35  ARG n 
1 36  GLY n 
1 37  TYR n 
1 38  GLU n 
1 39  ARG n 
1 40  ILE n 
1 41  PRO n 
1 42  ILE n 
1 43  PRO n 
1 44  CYS n 
1 45  VAL n 
1 46  ASN n 
1 47  ALA n 
1 48  VAL n 
1 49  ASP n 
1 50  SER n 
1 51  GLU n 
1 52  PRO n 
1 53  CYS n 
1 54  PRO n 
1 55  SER n 
1 56  ASN n 
1 57  TYR n 
1 58  LYS n 
1 59  TYR n 
1 60  VAL n 
1 61  SER n 
1 62  GLN n 
1 63  ASN n 
1 64  CYS n 
1 65  VAL n 
1 66  THR n 
1 67  SER n 
1 68  PRO n 
1 69  MET n 
1 70  ASN n 
1 71  ILE n 
1 72  ASP n 
1 73  ARG n 
1 74  ASN n 
1 75  ILE n 
1 76  THR n 
1 77  HIS n 
1 78  LEU n 
1 79  GLN n 
1 80  TYR n 
1 81  CYS n 
1 82  VAL n 
1 83  CYS n 
1 84  ILE n 
1 85  ASP n 
1 86  ASP n 
1 87  CYS n 
1 88  SER n 
1 89  SER n 
1 90  SER n 
1 91  ASN n 
1 92  CYS n 
1 93  MET n 
1 94  CYS n 
1 95  GLY n 
1 96  GLN n 
1 97  LEU n 
1 98  SER n 
1 99  MET n 
1 100 ARG n 
1 101 CYS n 
1 102 TRP n 
1 103 TYR n 
1 104 ASP n 
1 105 LYS n 
1 106 ASP n 
1 107 GLY n 
1 108 ARG n 
1 109 LEU n 
1 110 LEU n 
1 111 PRO n 
1 112 GLU n 
1 113 PHE n 
1 114 ASN n 
1 115 MET n 
1 116 ALA n 
1 117 GLU n 
1 118 PRO n 
1 119 PRO n 
1 120 LEU n 
1 121 ILE n 
1 122 PHE n 
1 123 GLU n 
1 124 CYS n 
1 125 ASN n 
1 126 HIS n 
1 127 ALA n 
1 128 CYS n 
1 129 SER n 
1 130 CYS n 
1 131 TRP n 
1 132 ARG n 
1 133 ASN n 
1 134 CYS n 
1 135 ARG n 
1 136 ASN n 
1 137 ARG n 
1 138 VAL n 
1 139 VAL n 
1 140 GLN n 
1 141 ASN n 
1 142 GLY n 
1 143 LEU n 
1 144 ARG n 
1 145 ALA n 
1 146 ARG n 
1 147 LEU n 
1 148 GLN n 
1 149 LEU n 
1 150 TYR n 
1 151 ARG n 
1 152 THR n 
1 153 ARG n 
1 154 ASP n 
1 155 MET n 
1 156 GLY n 
1 157 TRP n 
1 158 GLY n 
1 159 VAL n 
1 160 ARG n 
1 161 SER n 
1 162 LEU n 
1 163 GLN n 
1 164 ASP n 
1 165 ILE n 
1 166 PRO n 
1 167 PRO n 
1 168 GLY n 
1 169 THR n 
1 170 PHE n 
1 171 VAL n 
1 172 CYS n 
1 173 GLU n 
1 174 TYR n 
1 175 VAL n 
1 176 GLY n 
1 177 GLU n 
1 178 LEU n 
1 179 ILE n 
1 180 SER n 
1 181 ASP n 
1 182 SER n 
1 183 GLU n 
1 184 ALA n 
1 185 ASP n 
1 186 VAL n 
1 187 ARG n 
1 188 GLU n 
1 189 GLU n 
1 190 ASP n 
1 191 SER n 
1 192 TYR n 
1 193 LEU n 
1 194 PHE n 
1 195 ASP n 
1 196 LEU n 
1 197 ASP n 
1 198 ASN n 
1 199 LYS n 
1 200 ASP n 
1 201 GLY n 
1 202 GLU n 
1 203 VAL n 
1 204 TYR n 
1 205 CYS n 
1 206 ILE n 
1 207 ASP n 
1 208 ALA n 
1 209 ARG n 
1 210 PHE n 
1 211 TYR n 
1 212 GLY n 
1 213 ASN n 
1 214 VAL n 
1 215 SER n 
1 216 ARG n 
1 217 PHE n 
1 218 ILE n 
1 219 ASN n 
1 220 HIS n 
1 221 HIS n 
1 222 CYS n 
1 223 GLU n 
1 224 PRO n 
1 225 ASN n 
1 226 LEU n 
1 227 VAL n 
1 228 PRO n 
1 229 VAL n 
1 230 ARG n 
1 231 VAL n 
1 232 PHE n 
1 233 MET n 
1 234 ALA n 
1 235 HIS n 
1 236 GLN n 
1 237 ASP n 
1 238 LEU n 
1 239 ARG n 
1 240 PHE n 
1 241 PRO n 
1 242 ARG n 
1 243 ILE n 
1 244 ALA n 
1 245 PHE n 
1 246 PHE n 
1 247 SER n 
1 248 THR n 
1 249 ARG n 
1 250 LEU n 
1 251 ILE n 
1 252 GLU n 
1 253 ALA n 
1 254 GLY n 
1 255 GLU n 
1 256 GLN n 
1 257 LEU n 
1 258 GLY n 
1 259 PHE n 
1 260 ASP n 
1 261 TYR n 
1 262 GLY n 
1 263 GLU n 
1 264 ARG n 
1 265 PHE n 
1 266 TRP n 
1 267 ASP n 
1 268 ILE n 
1 269 LYS n 
1 270 GLY n 
1 271 LYS n 
1 272 LEU n 
1 273 PHE n 
1 274 SER n 
1 275 CYS n 
1 276 ARG n 
1 277 CYS n 
1 278 GLY n 
1 279 SER n 
1 280 PRO n 
1 281 LYS n 
1 282 CYS n 
1 283 ARG n 
1 284 HIS n 
1 285 SER n 
2 1   THR n 
2 2   LYS n 
2 3   GLN n 
2 4   THR n 
2 5   ALA n 
2 6   ARG n 
2 7   MLY n 
2 8   SER n 
2 9   THR n 
2 10  GLY n 
2 11  GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'EHMT1, EUHMTASE1, KIAA1876' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) Codon plus' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a-thrombin-lic 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthetic dimethylated H3K9 peptide' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP EHMT1_HUMAN Q9H9B1 1 
;NSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQY
CVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVR
SLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRF
PRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
;
951 ? 
2 PDB 2RFI        2RFI   2 TKQTARKSTGG 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2RFI A 1 ? 285 ? Q9H9B1 951 ? 1235 ? 951 1235 
2 1 2RFI B 1 ? 285 ? Q9H9B1 951 ? 1235 ? 951 1235 
3 2 2RFI P 1 ? 11  ? 2RFI   1   ? 11   ? 1   11   
4 2 2RFI Q 1 ? 11  ? 2RFI   1   ? 11   ? 1   11   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'   149.211 
MLY 'L-peptide linking' n N-DIMETHYL-LYSINE         ? 'C8 H18 N2 O2'    174.241 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'      115.130 
SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ? 'C14 H20 N6 O5 S' 384.411 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                ? 'Zn 2'            65.409  
# 
_exptl.entry_id          2RFI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   51.57 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    
'16% PEG 4000, 10% Isopropanol, 0.1M Bicine pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 300K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-12-10 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00000 
# 
_reflns.entry_id                     2RFI 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.59 
_reflns.d_resolution_low             42.8 
_reflns.number_all                   89676 
_reflns.number_obs                   89676 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            0.080 
_reflns.pdbx_Rsym_value              0.080 
_reflns.pdbx_netI_over_sigmaI        10.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 2RFI 
_refine.ls_number_reflns_obs                     85102 
_refine.ls_number_reflns_all                     85102 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.80 
_refine.ls_d_res_high                            1.59 
_refine.ls_percent_reflns_obs                    96.34 
_refine.ls_R_factor_obs                          0.19403 
_refine.ls_R_factor_all                          0.19403 
_refine.ls_R_factor_R_work                       0.19265 
_refine.ls_R_factor_R_free                       0.22014 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4475 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.949 
_refine.B_iso_mean                               26.655 
_refine.aniso_B[1][1]                            0.02 
_refine.aniso_B[2][2]                            0.03 
_refine.aniso_B[3][3]                            -0.05 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 2IGQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.088 
_refine.pdbx_overall_ESU_R_Free                  0.088 
_refine.overall_SU_ML                            0.061 
_refine.overall_SU_B                             1.708 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4322 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             686 
_refine_hist.number_atoms_total               5068 
_refine_hist.d_res_high                       1.59 
_refine_hist.d_res_low                        42.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.021  ? 4481 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.171  1.960  ? 6065 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.662  5.000  ? 534  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       30.280 22.511 ? 235  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.132 15.000 ? 733  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.861 15.000 ? 54   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.080  0.200  ? 629  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 3514 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.205  0.200  ? 2064 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.306  0.200  ? 3105 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.111  0.200  ? 582  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.185  0.200  ? 26   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.098  0.200  ? 17   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.763  1.500  ? 2772 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.272  2.000  ? 4345 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.773  3.000  ? 1974 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.740  4.500  ? 1720 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.59 
_refine_ls_shell.d_res_low                        1.64 
_refine_ls_shell.number_reflns_R_work             4267 
_refine_ls_shell.R_factor_R_work                  0.342 
_refine_ls_shell.percent_reflns_obs               66.58 
_refine_ls_shell.R_factor_R_free                  0.384 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             228 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2RFI 
_struct.title                     
;Crystal structure of catalytic domain of human euchromatic histone methyltransferase 1 in complex with SAH and dimethylated H3K9 peptide
;
_struct.pdbx_descriptor           'Histone-lysine N-methyltransferase, H3 lysine-9 specific 5 (E.C.2.1.1.43), Histone H3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2RFI 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;EUCHROMATIC HISTONE METHYLTRANSFERASE 1, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, SGC, Alternative splicing, ANK repeat, Chromatin regulator, Nucleus, Phosphorylation, Polymorphism, S-adenosyl-L-methionine, Acetylation, Chromosomal protein, DNA damage, DNA repair, DNA-binding, Methylation, Nucleosome core, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 74  ? LEU A 78  ? ASN A 1024 LEU A 1028 5 ? 5 
HELX_P HELX_P2  2  CYS A 92  ? SER A 98  ? CYS A 1042 SER A 1048 1 ? 7 
HELX_P HELX_P3  3  VAL A 138 ? GLY A 142 ? VAL A 1088 GLY A 1092 5 ? 5 
HELX_P HELX_P4  4  ASP A 181 ? ASP A 185 ? ASP A 1131 ASP A 1135 1 ? 5 
HELX_P HELX_P5  5  VAL A 214 ? ILE A 218 ? VAL A 1164 ILE A 1168 5 ? 5 
HELX_P HELX_P6  6  GLY A 262 ? GLY A 270 ? GLY A 1212 GLY A 1220 1 ? 9 
HELX_P HELX_P7  7  ASN B 74  ? LEU B 78  ? ASN B 1024 LEU B 1028 5 ? 5 
HELX_P HELX_P8  8  CYS B 92  ? SER B 98  ? CYS B 1042 SER B 1048 1 ? 7 
HELX_P HELX_P9  9  VAL B 138 ? GLY B 142 ? VAL B 1088 GLY B 1092 5 ? 5 
HELX_P HELX_P10 10 ASP B 181 ? ARG B 187 ? ASP B 1131 ARG B 1137 1 ? 7 
HELX_P HELX_P11 11 VAL B 214 ? ILE B 218 ? VAL B 1164 ILE B 1168 5 ? 5 
HELX_P HELX_P12 12 GLY B 262 ? GLY B 270 ? GLY B 1212 GLY B 1220 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 81  SG ? ? ? 1_555 E ZN  . ZN ? ? A CYS 1031 A ZN  501 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc2  metalc ? ? A CYS 81  SG ? ? ? 1_555 G ZN  . ZN ? ? A CYS 1031 A ZN  503 1_555 ? ? ? ? ? ? ? 2.440 ? 
metalc3  metalc ? ? A CYS 83  SG ? ? ? 1_555 G ZN  . ZN ? ? A CYS 1033 A ZN  503 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc4  metalc ? ? A CYS 87  SG ? ? ? 1_555 F ZN  . ZN ? ? A CYS 1037 A ZN  502 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc5  metalc ? ? A CYS 87  SG ? ? ? 1_555 G ZN  . ZN ? ? A CYS 1037 A ZN  503 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc6  metalc ? ? A CYS 92  SG ? ? ? 1_555 G ZN  . ZN ? ? A CYS 1042 A ZN  503 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc7  metalc ? ? A CYS 94  SG ? ? ? 1_555 E ZN  . ZN ? ? A CYS 1044 A ZN  501 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc8  metalc ? ? A CYS 124 SG ? ? ? 1_555 E ZN  . ZN ? ? A CYS 1074 A ZN  501 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc9  metalc ? ? A CYS 124 SG ? ? ? 1_555 F ZN  . ZN ? ? A CYS 1074 A ZN  502 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc10 metalc ? ? A CYS 128 SG ? ? ? 1_555 E ZN  . ZN ? ? A CYS 1078 A ZN  501 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc11 metalc ? ? A CYS 130 SG ? ? ? 1_555 F ZN  . ZN ? ? A CYS 1080 A ZN  502 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc12 metalc ? ? A CYS 134 SG ? ? ? 1_555 F ZN  . ZN ? ? A CYS 1084 A ZN  502 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc13 metalc ? ? A CYS 222 SG ? ? ? 1_555 H ZN  . ZN ? ? A CYS 1172 A ZN  504 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc14 metalc ? ? A CYS 275 SG ? ? ? 1_555 H ZN  . ZN ? ? A CYS 1225 A ZN  504 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc15 metalc ? ? A CYS 277 SG ? ? ? 1_555 H ZN  . ZN ? ? A CYS 1227 A ZN  504 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc16 metalc ? ? A CYS 282 SG ? ? ? 1_555 H ZN  . ZN ? ? A CYS 1232 A ZN  504 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc17 metalc ? ? B CYS 81  SG ? ? ? 1_555 K ZN  . ZN ? ? B CYS 1031 B ZN  501 1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc18 metalc ? ? B CYS 81  SG ? ? ? 1_555 M ZN  . ZN ? ? B CYS 1031 B ZN  503 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc19 metalc ? ? B CYS 83  SG ? ? ? 1_555 M ZN  . ZN ? ? B CYS 1033 B ZN  503 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc20 metalc ? ? B CYS 87  SG ? ? ? 1_555 M ZN  . ZN ? ? B CYS 1037 B ZN  503 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc21 metalc ? ? B CYS 87  SG ? ? ? 1_555 L ZN  . ZN ? ? B CYS 1037 B ZN  502 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc22 metalc ? ? B CYS 92  SG ? ? ? 1_555 M ZN  . ZN ? ? B CYS 1042 B ZN  503 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc23 metalc ? ? B CYS 94  SG ? ? ? 1_555 K ZN  . ZN ? ? B CYS 1044 B ZN  501 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc24 metalc ? ? B CYS 124 SG ? ? ? 1_555 K ZN  . ZN ? ? B CYS 1074 B ZN  501 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc25 metalc ? ? B CYS 124 SG ? ? ? 1_555 L ZN  . ZN ? ? B CYS 1074 B ZN  502 1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc26 metalc ? ? B CYS 128 SG ? ? ? 1_555 K ZN  . ZN ? ? B CYS 1078 B ZN  501 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc27 metalc ? ? B CYS 130 SG ? ? ? 1_555 L ZN  . ZN ? ? B CYS 1080 B ZN  502 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc28 metalc ? ? B CYS 134 SG ? ? ? 1_555 L ZN  . ZN ? ? B CYS 1084 B ZN  502 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc29 metalc ? ? B CYS 222 SG ? ? ? 1_555 N ZN  . ZN ? ? B CYS 1172 B ZN  504 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc30 metalc ? ? B CYS 275 SG ? ? ? 1_555 N ZN  . ZN ? ? B CYS 1225 B ZN  504 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc31 metalc ? ? B CYS 277 SG ? ? ? 1_555 N ZN  . ZN ? ? B CYS 1227 B ZN  504 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc32 metalc ? ? B CYS 282 SG ? ? ? 1_555 N ZN  . ZN ? ? B CYS 1232 B ZN  504 1_555 ? ? ? ? ? ? ? 2.758 ? 
covale1  covale ? ? C ARG 6   C  ? ? ? 1_555 C MLY 7 N  ? ? P ARG 6    P MLY 7   1_555 ? ? ? ? ? ? ? 1.520 ? 
covale2  covale ? ? C MLY 7   C  ? ? ? 1_555 C SER 8 N  ? ? P MLY 7    P SER 8   1_555 ? ? ? ? ? ? ? 1.550 ? 
covale3  covale ? ? D ARG 6   C  ? ? ? 1_555 D MLY 7 N  ? ? Q ARG 6    Q MLY 7   1_555 ? ? ? ? ? ? ? 1.326 ? 
covale4  covale ? ? D MLY 7   C  ? ? ? 1_555 D SER 8 N  ? ? Q MLY 7    Q SER 8   1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 3 ? 
D ? 4 ? 
E ? 2 ? 
F ? 3 ? 
G ? 3 ? 
H ? 3 ? 
I ? 4 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? parallel      
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 27  ? SER A 30  ? ARG A 977  SER A 980  
A 2 CYS A 44  ? ASN A 46  ? CYS A 994  ASN A 996  
A 3 LEU A 147 ? ARG A 151 ? LEU A 1097 ARG A 1101 
A 4 TRP A 157 ? SER A 161 ? TRP A 1107 SER A 1111 
B 1 LYS A 58  ? TYR A 59  ? LYS A 1008 TYR A 1009 
B 2 TYR A 204 ? GLY A 212 ? TYR A 1154 GLY A 1162 
B 3 GLY A 176 ? SER A 180 ? GLY A 1126 SER A 1130 
C 1 LYS A 58  ? TYR A 59  ? LYS A 1008 TYR A 1009 
C 2 TYR A 204 ? GLY A 212 ? TYR A 1154 GLY A 1162 
C 3 LEU A 193 ? ASP A 195 ? LEU A 1143 ASP A 1145 
D 1 ILE A 121 ? PHE A 122 ? ILE A 1071 PHE A 1072 
D 2 LEU A 226 ? PHE A 232 ? LEU A 1176 PHE A 1182 
D 3 ARG A 242 ? SER A 247 ? ARG A 1192 SER A 1197 
D 4 PHE A 170 ? TYR A 174 ? PHE A 1120 TYR A 1124 
E 1 ASN A 219 ? HIS A 220 ? ASN A 1169 HIS A 1170 
E 2 GLY A 258 ? PHE A 259 ? GLY A 1208 PHE A 1209 
F 1 CYS B 44  ? VAL B 45  ? CYS B 994  VAL B 995  
F 2 LEU B 147 ? ARG B 151 ? LEU B 1097 ARG B 1101 
F 3 TRP B 157 ? SER B 161 ? TRP B 1107 SER B 1111 
G 1 LYS B 58  ? TYR B 59  ? LYS B 1008 TYR B 1009 
G 2 TYR B 204 ? GLY B 212 ? TYR B 1154 GLY B 1162 
G 3 GLY B 176 ? SER B 180 ? GLY B 1126 SER B 1130 
H 1 LYS B 58  ? TYR B 59  ? LYS B 1008 TYR B 1009 
H 2 TYR B 204 ? GLY B 212 ? TYR B 1154 GLY B 1162 
H 3 LEU B 193 ? ASP B 195 ? LEU B 1143 ASP B 1145 
I 1 ILE B 121 ? PHE B 122 ? ILE B 1071 PHE B 1072 
I 2 LEU B 226 ? PHE B 232 ? LEU B 1176 PHE B 1182 
I 3 ARG B 242 ? SER B 247 ? ARG B 1192 SER B 1197 
I 4 PHE B 170 ? TYR B 174 ? PHE B 1120 TYR B 1124 
J 1 ASN B 219 ? HIS B 220 ? ASN B 1169 HIS B 1170 
J 2 GLY B 258 ? PHE B 259 ? GLY B 1208 PHE B 1209 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 27  ? N ARG A 977  O ASN A 46  ? O ASN A 996  
A 2 3 N VAL A 45  ? N VAL A 995  O LEU A 149 ? O LEU A 1099 
A 3 4 N TYR A 150 ? N TYR A 1100 O GLY A 158 ? O GLY A 1108 
B 1 2 N LYS A 58  ? N LYS A 1008 O PHE A 210 ? O PHE A 1160 
B 2 3 O CYS A 205 ? O CYS A 1155 N ILE A 179 ? N ILE A 1129 
C 1 2 N LYS A 58  ? N LYS A 1008 O PHE A 210 ? O PHE A 1160 
C 2 3 O ILE A 206 ? O ILE A 1156 N PHE A 194 ? N PHE A 1144 
D 1 2 N ILE A 121 ? N ILE A 1071 O ARG A 230 ? O ARG A 1180 
D 2 3 N VAL A 229 ? N VAL A 1179 O ALA A 244 ? O ALA A 1194 
D 3 4 O PHE A 245 ? O PHE A 1195 N CYS A 172 ? N CYS A 1122 
E 1 2 N ASN A 219 ? N ASN A 1169 O PHE A 259 ? O PHE A 1209 
F 1 2 N VAL B 45  ? N VAL B 995  O LEU B 149 ? O LEU B 1099 
F 2 3 N TYR B 150 ? N TYR B 1100 O GLY B 158 ? O GLY B 1108 
G 1 2 N LYS B 58  ? N LYS B 1008 O PHE B 210 ? O PHE B 1160 
G 2 3 O ASP B 207 ? O ASP B 1157 N GLU B 177 ? N GLU B 1127 
H 1 2 N LYS B 58  ? N LYS B 1008 O PHE B 210 ? O PHE B 1160 
H 2 3 O ILE B 206 ? O ILE B 1156 N PHE B 194 ? N PHE B 1144 
I 1 2 N ILE B 121 ? N ILE B 1071 O PHE B 232 ? O PHE B 1182 
I 2 3 N VAL B 229 ? N VAL B 1179 O ALA B 244 ? O ALA B 1194 
I 3 4 O PHE B 245 ? O PHE B 1195 N CYS B 172 ? N CYS B 1122 
J 1 2 N ASN B 219 ? N ASN B 1169 O PHE B 259 ? O PHE B 1209 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 501'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 502'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 503'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 504'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 501'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 502'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 503'  
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 504'  
AC9 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE SAH A 101' 
BC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SAH A 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS A 81  ? CYS A 1031 . ? 1_555 ? 
2  AC1 4  CYS A 94  ? CYS A 1044 . ? 1_555 ? 
3  AC1 4  CYS A 124 ? CYS A 1074 . ? 1_555 ? 
4  AC1 4  CYS A 128 ? CYS A 1078 . ? 1_555 ? 
5  AC2 4  CYS A 87  ? CYS A 1037 . ? 1_555 ? 
6  AC2 4  CYS A 124 ? CYS A 1074 . ? 1_555 ? 
7  AC2 4  CYS A 130 ? CYS A 1080 . ? 1_555 ? 
8  AC2 4  CYS A 134 ? CYS A 1084 . ? 1_555 ? 
9  AC3 4  CYS A 81  ? CYS A 1031 . ? 1_555 ? 
10 AC3 4  CYS A 83  ? CYS A 1033 . ? 1_555 ? 
11 AC3 4  CYS A 87  ? CYS A 1037 . ? 1_555 ? 
12 AC3 4  CYS A 92  ? CYS A 1042 . ? 1_555 ? 
13 AC4 4  CYS A 222 ? CYS A 1172 . ? 1_555 ? 
14 AC4 4  CYS A 275 ? CYS A 1225 . ? 1_555 ? 
15 AC4 4  CYS A 277 ? CYS A 1227 . ? 1_555 ? 
16 AC4 4  CYS A 282 ? CYS A 1232 . ? 1_555 ? 
17 AC5 4  CYS B 81  ? CYS B 1031 . ? 1_555 ? 
18 AC5 4  CYS B 94  ? CYS B 1044 . ? 1_555 ? 
19 AC5 4  CYS B 124 ? CYS B 1074 . ? 1_555 ? 
20 AC5 4  CYS B 128 ? CYS B 1078 . ? 1_555 ? 
21 AC6 4  CYS B 87  ? CYS B 1037 . ? 1_555 ? 
22 AC6 4  CYS B 124 ? CYS B 1074 . ? 1_555 ? 
23 AC6 4  CYS B 130 ? CYS B 1080 . ? 1_555 ? 
24 AC6 4  CYS B 134 ? CYS B 1084 . ? 1_555 ? 
25 AC7 4  CYS B 81  ? CYS B 1031 . ? 1_555 ? 
26 AC7 4  CYS B 83  ? CYS B 1033 . ? 1_555 ? 
27 AC7 4  CYS B 87  ? CYS B 1037 . ? 1_555 ? 
28 AC7 4  CYS B 92  ? CYS B 1042 . ? 1_555 ? 
29 AC8 4  CYS B 222 ? CYS B 1172 . ? 1_555 ? 
30 AC8 4  CYS B 275 ? CYS B 1225 . ? 1_555 ? 
31 AC8 4  CYS B 277 ? CYS B 1227 . ? 1_555 ? 
32 AC8 4  CYS B 282 ? CYS B 1232 . ? 1_555 ? 
33 AC9 21 MET A 155 ? MET A 1105 . ? 1_555 ? 
34 AC9 21 TRP A 157 ? TRP A 1107 . ? 1_555 ? 
35 AC9 21 SER A 191 ? SER A 1141 . ? 1_555 ? 
36 AC9 21 TYR A 192 ? TYR A 1142 . ? 1_555 ? 
37 AC9 21 ARG A 216 ? ARG A 1166 . ? 1_555 ? 
38 AC9 21 PHE A 217 ? PHE A 1167 . ? 1_555 ? 
39 AC9 21 ASN A 219 ? ASN A 1169 . ? 1_555 ? 
40 AC9 21 HIS A 220 ? HIS A 1170 . ? 1_555 ? 
41 AC9 21 TYR A 261 ? TYR A 1211 . ? 1_555 ? 
42 AC9 21 PHE A 265 ? PHE A 1215 . ? 1_555 ? 
43 AC9 21 PHE A 273 ? PHE A 1223 . ? 1_555 ? 
44 AC9 21 CYS A 275 ? CYS A 1225 . ? 1_555 ? 
45 AC9 21 ARG A 276 ? ARG A 1226 . ? 1_555 ? 
46 AC9 21 HOH O .   ? HOH A 1322 . ? 1_555 ? 
47 AC9 21 HOH O .   ? HOH A 1357 . ? 1_555 ? 
48 AC9 21 HOH O .   ? HOH A 1390 . ? 1_555 ? 
49 AC9 21 HOH O .   ? HOH A 1446 . ? 1_555 ? 
50 AC9 21 HOH O .   ? HOH A 1460 . ? 1_555 ? 
51 AC9 21 HOH O .   ? HOH A 1462 . ? 1_555 ? 
52 AC9 21 HOH O .   ? HOH A 1472 . ? 1_555 ? 
53 AC9 21 MLY C 7   ? MLY P 7    . ? 1_555 ? 
54 BC1 11 HOH O .   ? HOH A 1517 . ? 1_555 ? 
55 BC1 11 MET B 155 ? MET B 1105 . ? 1_555 ? 
56 BC1 11 TRP B 157 ? TRP B 1107 . ? 1_555 ? 
57 BC1 11 ARG B 216 ? ARG B 1166 . ? 1_555 ? 
58 BC1 11 ASN B 219 ? ASN B 1169 . ? 1_555 ? 
59 BC1 11 HIS B 220 ? HIS B 1170 . ? 1_555 ? 
60 BC1 11 TYR B 261 ? TYR B 1211 . ? 1_555 ? 
61 BC1 11 PHE B 273 ? PHE B 1223 . ? 1_555 ? 
62 BC1 11 SER B 274 ? SER B 1224 . ? 1_555 ? 
63 BC1 11 CYS B 275 ? CYS B 1225 . ? 1_555 ? 
64 BC1 11 ARG B 276 ? ARG B 1226 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2RFI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2RFI 
_atom_sites.fract_transf_matrix[1][1]   0.011821 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011679 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010453 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . VAL A 1 25  ? 41.818 3.194  -3.267  1.00 30.84 ? 975  VAL A N     1 
ATOM   2    C  CA    . VAL A 1 25  ? 42.475 3.964  -2.162  1.00 30.25 ? 975  VAL A CA    1 
ATOM   3    C  C     . VAL A 1 25  ? 41.872 5.377  -2.064  1.00 28.84 ? 975  VAL A C     1 
ATOM   4    O  O     . VAL A 1 25  ? 41.223 5.833  -3.004  1.00 29.35 ? 975  VAL A O     1 
ATOM   5    C  CB    . VAL A 1 25  ? 44.011 4.003  -2.347  1.00 30.52 ? 975  VAL A CB    1 
ATOM   6    C  CG1   . VAL A 1 25  ? 44.397 4.778  -3.597  1.00 31.11 ? 975  VAL A CG1   1 
ATOM   7    C  CG2   . VAL A 1 25  ? 44.703 4.545  -1.102  1.00 31.90 ? 975  VAL A CG2   1 
ATOM   8    N  N     . GLU A 1 26  ? 42.090 6.060  -0.941  1.00 27.57 ? 976  GLU A N     1 
ATOM   9    C  CA    . GLU A 1 26  ? 41.440 7.359  -0.700  1.00 25.65 ? 976  GLU A CA    1 
ATOM   10   C  C     . GLU A 1 26  ? 42.059 8.522  -1.471  1.00 24.26 ? 976  GLU A C     1 
ATOM   11   O  O     . GLU A 1 26  ? 43.281 8.732  -1.439  1.00 24.43 ? 976  GLU A O     1 
ATOM   12   C  CB    . GLU A 1 26  ? 41.389 7.688  0.793   1.00 26.32 ? 976  GLU A CB    1 
ATOM   13   C  CG    . GLU A 1 26  ? 40.394 8.795  1.141   1.00 28.35 ? 976  GLU A CG    1 
ATOM   14   C  CD    . GLU A 1 26  ? 39.980 8.765  2.599   1.00 32.54 ? 976  GLU A CD    1 
ATOM   15   O  OE1   . GLU A 1 26  ? 40.497 9.609  3.363   1.00 32.89 ? 976  GLU A OE1   1 
ATOM   16   O  OE2   . GLU A 1 26  ? 39.153 7.894  2.980   1.00 33.55 ? 976  GLU A OE2   1 
ATOM   17   N  N     . ARG A 1 27  ? 41.198 9.258  -2.170  1.00 21.86 ? 977  ARG A N     1 
ATOM   18   C  CA    . ARG A 1 27  ? 41.564 10.494 -2.860  1.00 20.14 ? 977  ARG A CA    1 
ATOM   19   C  C     . ARG A 1 27  ? 40.783 11.641 -2.228  1.00 19.74 ? 977  ARG A C     1 
ATOM   20   O  O     . ARG A 1 27  ? 39.578 11.520 -2.004  1.00 19.01 ? 977  ARG A O     1 
ATOM   21   C  CB    . ARG A 1 27  ? 41.203 10.418 -4.342  1.00 20.92 ? 977  ARG A CB    1 
ATOM   22   C  CG    . ARG A 1 27  ? 41.829 9.231  -5.086  1.00 19.55 ? 977  ARG A CG    1 
ATOM   23   C  CD    . ARG A 1 27  ? 41.377 9.171  -6.530  1.00 20.49 ? 977  ARG A CD    1 
ATOM   24   N  NE    . ARG A 1 27  ? 39.926 9.020  -6.646  1.00 21.32 ? 977  ARG A NE    1 
ATOM   25   C  CZ    . ARG A 1 27  ? 39.098 9.989  -7.034  1.00 22.19 ? 977  ARG A CZ    1 
ATOM   26   N  NH1   . ARG A 1 27  ? 39.579 11.185 -7.362  1.00 20.98 ? 977  ARG A NH1   1 
ATOM   27   N  NH2   . ARG A 1 27  ? 37.783 9.766  -7.100  1.00 22.82 ? 977  ARG A NH2   1 
ATOM   28   N  N     . ILE A 1 28  ? 41.465 12.745 -1.944  1.00 18.43 ? 978  ILE A N     1 
ATOM   29   C  CA    . ILE A 1 28  ? 40.785 13.933 -1.440  1.00 18.22 ? 978  ILE A CA    1 
ATOM   30   C  C     . ILE A 1 28  ? 40.343 14.732 -2.653  1.00 18.69 ? 978  ILE A C     1 
ATOM   31   O  O     . ILE A 1 28  ? 41.179 15.258 -3.399  1.00 18.43 ? 978  ILE A O     1 
ATOM   32   C  CB    . ILE A 1 28  ? 41.692 14.778 -0.489  1.00 18.16 ? 978  ILE A CB    1 
ATOM   33   C  CG1   . ILE A 1 28  ? 42.202 13.921 0.684   1.00 18.42 ? 978  ILE A CG1   1 
ATOM   34   C  CG2   . ILE A 1 28  ? 40.939 16.034 -0.014  1.00 18.86 ? 978  ILE A CG2   1 
ATOM   35   C  CD1   . ILE A 1 28  ? 43.348 14.552 1.514   1.00 18.52 ? 978  ILE A CD1   1 
ATOM   36   N  N     . VAL A 1 29  ? 39.025 14.814 -2.861  1.00 17.70 ? 979  VAL A N     1 
ATOM   37   C  CA    . VAL A 1 29  ? 38.484 15.475 -4.051  1.00 17.50 ? 979  VAL A CA    1 
ATOM   38   C  C     . VAL A 1 29  ? 38.024 16.925 -3.815  1.00 17.44 ? 979  VAL A C     1 
ATOM   39   O  O     . VAL A 1 29  ? 37.700 17.628 -4.763  1.00 17.34 ? 979  VAL A O     1 
ATOM   40   C  CB    . VAL A 1 29  ? 37.378 14.622 -4.754  1.00 17.68 ? 979  VAL A CB    1 
ATOM   41   C  CG1   . VAL A 1 29  ? 37.973 13.330 -5.284  1.00 18.59 ? 979  VAL A CG1   1 
ATOM   42   C  CG2   . VAL A 1 29  ? 36.239 14.290 -3.788  1.00 18.18 ? 979  VAL A CG2   1 
ATOM   43   N  N     . SER A 1 30  ? 37.986 17.355 -2.553  1.00 17.21 ? 980  SER A N     1 
ATOM   44   C  CA    . SER A 1 30  ? 37.826 18.784 -2.251  1.00 17.75 ? 980  SER A CA    1 
ATOM   45   C  C     . SER A 1 30  ? 38.404 19.104 -0.878  1.00 17.33 ? 980  SER A C     1 
ATOM   46   O  O     . SER A 1 30  ? 38.187 18.363 0.090   1.00 16.85 ? 980  SER A O     1 
ATOM   47   C  CB    . SER A 1 30  ? 36.351 19.210 -2.286  1.00 17.56 ? 980  SER A CB    1 
ATOM   48   O  OG    . SER A 1 30  ? 36.237 20.580 -1.931  1.00 19.36 ? 980  SER A OG    1 
ATOM   49   N  N     . ARG A 1 31  ? 39.132 20.220 -0.821  1.00 17.97 ? 981  ARG A N     1 
ATOM   50   C  CA    . ARG A 1 31  ? 39.673 20.800 0.395   1.00 18.64 ? 981  ARG A CA    1 
ATOM   51   C  C     . ARG A 1 31  ? 38.532 21.201 1.341   1.00 17.27 ? 981  ARG A C     1 
ATOM   52   O  O     . ARG A 1 31  ? 38.649 21.128 2.571   1.00 17.23 ? 981  ARG A O     1 
ATOM   53   C  CB    . ARG A 1 31  ? 40.438 22.089 -0.006  1.00 20.19 ? 981  ARG A CB    1 
ATOM   54   C  CG    . ARG A 1 31  ? 41.546 22.521 0.893   1.00 24.32 ? 981  ARG A CG    1 
ATOM   55   C  CD    . ARG A 1 31  ? 42.495 23.456 0.140   1.00 23.89 ? 981  ARG A CD    1 
ATOM   56   N  NE    . ARG A 1 31  ? 41.932 24.773 -0.211  1.00 26.22 ? 981  ARG A NE    1 
ATOM   57   C  CZ    . ARG A 1 31  ? 41.725 25.202 -1.452  1.00 26.78 ? 981  ARG A CZ    1 
ATOM   58   N  NH1   . ARG A 1 31  ? 41.239 26.416 -1.662  1.00 30.20 ? 981  ARG A NH1   1 
ATOM   59   N  NH2   . ARG A 1 31  ? 42.011 24.429 -2.496  1.00 28.74 ? 981  ARG A NH2   1 
ATOM   60   N  N     . ASP A 1 32  ? 37.434 21.668 0.749   1.00 16.64 ? 982  ASP A N     1 
ATOM   61   C  CA    . ASP A 1 32  ? 36.344 22.250 1.520   1.00 15.60 ? 982  ASP A CA    1 
ATOM   62   C  C     . ASP A 1 32  ? 35.144 22.446 0.614   1.00 14.64 ? 982  ASP A C     1 
ATOM   63   O  O     . ASP A 1 32  ? 35.148 23.350 -0.212  1.00 15.15 ? 982  ASP A O     1 
ATOM   64   C  CB    . ASP A 1 32  ? 36.754 23.627 2.070   1.00 15.89 ? 982  ASP A CB    1 
ATOM   65   C  CG    . ASP A 1 32  ? 35.676 24.257 2.955   1.00 15.97 ? 982  ASP A CG    1 
ATOM   66   O  OD1   . ASP A 1 32  ? 34.676 23.576 3.271   1.00 16.47 ? 982  ASP A OD1   1 
ATOM   67   O  OD2   . ASP A 1 32  ? 35.847 25.437 3.350   1.00 16.66 ? 982  ASP A OD2   1 
ATOM   68   N  N     . ILE A 1 33  ? 34.115 21.627 0.796   1.00 14.66 ? 983  ILE A N     1 
ATOM   69   C  CA    . ILE A 1 33  ? 32.907 21.768 -0.022  1.00 14.56 ? 983  ILE A CA    1 
ATOM   70   C  C     . ILE A 1 33  ? 32.180 23.092 0.223   1.00 14.69 ? 983  ILE A C     1 
ATOM   71   O  O     . ILE A 1 33  ? 31.377 23.519 -0.623  1.00 15.11 ? 983  ILE A O     1 
ATOM   72   C  CB    . ILE A 1 33  ? 31.912 20.594 0.149   1.00 15.32 ? 983  ILE A CB    1 
ATOM   73   C  CG1   . ILE A 1 33  ? 31.344 20.519 1.573   1.00 14.97 ? 983  ILE A CG1   1 
ATOM   74   C  CG2   . ILE A 1 33  ? 32.581 19.249 -0.241  1.00 15.36 ? 983  ILE A CG2   1 
ATOM   75   C  CD1   . ILE A 1 33  ? 30.174 19.517 1.713   1.00 15.54 ? 983  ILE A CD1   1 
ATOM   76   N  N     . ALA A 1 34  ? 32.454 23.717 1.375   1.00 14.12 ? 984  ALA A N     1 
ATOM   77   C  CA    . ALA A 1 34  ? 31.796 24.974 1.750   1.00 14.08 ? 984  ALA A CA    1 
ATOM   78   C  C     . ALA A 1 34  ? 32.505 26.242 1.278   1.00 14.48 ? 984  ALA A C     1 
ATOM   79   O  O     . ALA A 1 34  ? 32.027 27.346 1.542   1.00 14.75 ? 984  ALA A O     1 
ATOM   80   C  CB    . ALA A 1 34  ? 31.562 25.020 3.274   1.00 13.82 ? 984  ALA A CB    1 
ATOM   81   N  N     A ARG A 1 35  ? 33.633 26.117 0.575   0.50 14.60 ? 985  ARG A N     1 
ATOM   82   N  N     B ARG A 1 35  ? 33.640 26.054 0.593   0.50 14.48 ? 985  ARG A N     1 
ATOM   83   C  CA    A ARG A 1 35  ? 34.322 27.311 0.042   0.50 15.10 ? 985  ARG A CA    1 
ATOM   84   C  CA    B ARG A 1 35  ? 34.485 27.152 0.102   0.50 15.17 ? 985  ARG A CA    1 
ATOM   85   C  C     A ARG A 1 35  ? 34.618 28.368 1.123   0.50 15.00 ? 985  ARG A C     1 
ATOM   86   C  C     B ARG A 1 35  ? 34.599 28.304 1.108   0.50 14.89 ? 985  ARG A C     1 
ATOM   87   O  O     A ARG A 1 35  ? 34.581 29.568 0.837   0.50 15.05 ? 985  ARG A O     1 
ATOM   88   O  O     B ARG A 1 35  ? 34.413 29.473 0.766   0.50 14.95 ? 985  ARG A O     1 
ATOM   89   C  CB    A ARG A 1 35  ? 33.498 27.999 -1.071  0.50 15.44 ? 985  ARG A CB    1 
ATOM   90   C  CB    B ARG A 1 35  ? 34.026 27.649 -1.279  0.50 14.93 ? 985  ARG A CB    1 
ATOM   91   C  CG    A ARG A 1 35  ? 32.910 27.115 -2.148  0.50 16.40 ? 985  ARG A CG    1 
ATOM   92   C  CG    B ARG A 1 35  ? 34.137 26.620 -2.393  0.50 16.70 ? 985  ARG A CG    1 
ATOM   93   C  CD    A ARG A 1 35  ? 32.339 27.931 -3.336  0.50 15.92 ? 985  ARG A CD    1 
ATOM   94   C  CD    B ARG A 1 35  ? 33.720 27.195 -3.747  0.50 16.98 ? 985  ARG A CD    1 
ATOM   95   N  NE    A ARG A 1 35  ? 31.420 29.032 -2.993  0.50 16.90 ? 985  ARG A NE    1 
ATOM   96   N  NE    B ARG A 1 35  ? 33.745 26.156 -4.774  0.50 23.72 ? 985  ARG A NE    1 
ATOM   97   C  CZ    A ARG A 1 35  ? 30.172 28.893 -2.543  0.50 17.30 ? 985  ARG A CZ    1 
ATOM   98   C  CZ    B ARG A 1 35  ? 33.142 26.227 -5.960  0.50 23.94 ? 985  ARG A CZ    1 
ATOM   99   N  NH1   A ARG A 1 35  ? 29.446 29.967 -2.287  0.50 18.27 ? 985  ARG A NH1   1 
ATOM   100  N  NH1   B ARG A 1 35  ? 33.246 25.207 -6.800  0.50 26.08 ? 985  ARG A NH1   1 
ATOM   101  N  NH2   A ARG A 1 35  ? 29.640 27.693 -2.328  0.50 16.70 ? 985  ARG A NH2   1 
ATOM   102  N  NH2   B ARG A 1 35  ? 32.425 27.289 -6.309  0.50 25.12 ? 985  ARG A NH2   1 
ATOM   103  N  N     . GLY A 1 36  ? 34.893 27.948 2.356   1.00 14.96 ? 986  GLY A N     1 
ATOM   104  C  CA    . GLY A 1 36  ? 35.240 28.909 3.410   1.00 16.02 ? 986  GLY A CA    1 
ATOM   105  C  C     . GLY A 1 36  ? 34.067 29.536 4.144   1.00 17.06 ? 986  GLY A C     1 
ATOM   106  O  O     . GLY A 1 36  ? 34.253 30.421 4.995   1.00 17.66 ? 986  GLY A O     1 
ATOM   107  N  N     . TYR A 1 37  ? 32.860 29.069 3.841   1.00 16.85 ? 987  TYR A N     1 
ATOM   108  C  CA    . TYR A 1 37  ? 31.654 29.601 4.484   1.00 17.08 ? 987  TYR A CA    1 
ATOM   109  C  C     . TYR A 1 37  ? 31.361 29.050 5.876   1.00 17.68 ? 987  TYR A C     1 
ATOM   110  O  O     . TYR A 1 37  ? 30.487 29.582 6.586   1.00 19.23 ? 987  TYR A O     1 
ATOM   111  C  CB    . TYR A 1 37  ? 30.432 29.419 3.594   1.00 17.49 ? 987  TYR A CB    1 
ATOM   112  C  CG    . TYR A 1 37  ? 30.283 30.510 2.556   1.00 17.25 ? 987  TYR A CG    1 
ATOM   113  C  CD1   . TYR A 1 37  ? 30.932 30.415 1.319   1.00 18.09 ? 987  TYR A CD1   1 
ATOM   114  C  CD2   . TYR A 1 37  ? 29.482 31.627 2.801   1.00 19.17 ? 987  TYR A CD2   1 
ATOM   115  C  CE1   . TYR A 1 37  ? 30.793 31.417 0.351   1.00 20.66 ? 987  TYR A CE1   1 
ATOM   116  C  CE2   . TYR A 1 37  ? 29.327 32.632 1.826   1.00 19.60 ? 987  TYR A CE2   1 
ATOM   117  C  CZ    . TYR A 1 37  ? 29.988 32.515 0.617   1.00 19.65 ? 987  TYR A CZ    1 
ATOM   118  O  OH    . TYR A 1 37  ? 29.840 33.492 -0.341  1.00 20.20 ? 987  TYR A OH    1 
ATOM   119  N  N     . GLU A 1 38  ? 32.061 27.993 6.266   1.00 18.01 ? 988  GLU A N     1 
ATOM   120  C  CA    . GLU A 1 38  ? 31.888 27.459 7.618   1.00 18.06 ? 988  GLU A CA    1 
ATOM   121  C  C     . GLU A 1 38  ? 33.132 27.797 8.453   1.00 19.03 ? 988  GLU A C     1 
ATOM   122  O  O     . GLU A 1 38  ? 34.145 28.225 7.908   1.00 19.37 ? 988  GLU A O     1 
ATOM   123  C  CB    . GLU A 1 38  ? 31.611 25.949 7.596   1.00 18.12 ? 988  GLU A CB    1 
ATOM   124  C  CG    . GLU A 1 38  ? 30.452 25.516 6.673   1.00 18.03 ? 988  GLU A CG    1 
ATOM   125  C  CD    . GLU A 1 38  ? 29.054 25.762 7.225   1.00 19.73 ? 988  GLU A CD    1 
ATOM   126  O  OE1   . GLU A 1 38  ? 28.897 26.316 8.344   1.00 20.66 ? 988  GLU A OE1   1 
ATOM   127  O  OE2   . GLU A 1 38  ? 28.094 25.386 6.521   1.00 18.76 ? 988  GLU A OE2   1 
ATOM   128  N  N     . ARG A 1 39  ? 33.041 27.594 9.766   1.00 20.60 ? 989  ARG A N     1 
ATOM   129  C  CA    . ARG A 1 39  ? 34.144 27.899 10.690  1.00 22.07 ? 989  ARG A CA    1 
ATOM   130  C  C     . ARG A 1 39  ? 35.349 26.993 10.473  1.00 22.31 ? 989  ARG A C     1 
ATOM   131  O  O     . ARG A 1 39  ? 36.485 27.365 10.790  1.00 23.06 ? 989  ARG A O     1 
ATOM   132  C  CB    . ARG A 1 39  ? 33.670 27.779 12.139  1.00 23.00 ? 989  ARG A CB    1 
ATOM   133  C  CG    . ARG A 1 39  ? 32.490 28.670 12.445  1.00 26.25 ? 989  ARG A CG    1 
ATOM   134  C  CD    . ARG A 1 39  ? 31.808 28.226 13.721  1.00 32.74 ? 989  ARG A CD    1 
ATOM   135  N  NE    . ARG A 1 39  ? 32.180 29.076 14.839  1.00 37.55 ? 989  ARG A NE    1 
ATOM   136  C  CZ    . ARG A 1 39  ? 31.816 28.857 16.097  1.00 39.59 ? 989  ARG A CZ    1 
ATOM   137  N  NH1   . ARG A 1 39  ? 31.075 27.800 16.403  1.00 40.96 ? 989  ARG A NH1   1 
ATOM   138  N  NH2   . ARG A 1 39  ? 32.198 29.694 17.049  1.00 40.90 ? 989  ARG A NH2   1 
ATOM   139  N  N     . ILE A 1 40  ? 35.096 25.802 9.943   1.00 22.03 ? 990  ILE A N     1 
ATOM   140  C  CA    . ILE A 1 40  ? 36.174 24.892 9.554   1.00 22.48 ? 990  ILE A CA    1 
ATOM   141  C  C     . ILE A 1 40  ? 35.919 24.328 8.142   1.00 21.44 ? 990  ILE A C     1 
ATOM   142  O  O     . ILE A 1 40  ? 34.804 24.439 7.627   1.00 21.64 ? 990  ILE A O     1 
ATOM   143  C  CB    . ILE A 1 40  ? 36.372 23.746 10.589  1.00 23.19 ? 990  ILE A CB    1 
ATOM   144  C  CG1   . ILE A 1 40  ? 35.073 22.986 10.837  1.00 24.22 ? 990  ILE A CG1   1 
ATOM   145  C  CG2   . ILE A 1 40  ? 36.920 24.290 11.906  1.00 24.61 ? 990  ILE A CG2   1 
ATOM   146  C  CD1   . ILE A 1 40  ? 35.323 21.731 11.608  1.00 27.76 ? 990  ILE A CD1   1 
ATOM   147  N  N     . PRO A 1 41  ? 36.962 23.775 7.495   1.00 21.23 ? 991  PRO A N     1 
ATOM   148  C  CA    . PRO A 1 41  ? 36.714 23.123 6.202   1.00 20.11 ? 991  PRO A CA    1 
ATOM   149  C  C     . PRO A 1 41  ? 35.883 21.845 6.352   1.00 19.70 ? 991  PRO A C     1 
ATOM   150  O  O     . PRO A 1 41  ? 35.938 21.174 7.394   1.00 20.15 ? 991  PRO A O     1 
ATOM   151  C  CB    . PRO A 1 41  ? 38.122 22.802 5.678   1.00 20.80 ? 991  PRO A CB    1 
ATOM   152  C  CG    . PRO A 1 41  ? 38.989 22.777 6.890   1.00 21.22 ? 991  PRO A CG    1 
ATOM   153  C  CD    . PRO A 1 41  ? 38.388 23.742 7.875   1.00 20.79 ? 991  PRO A CD    1 
ATOM   154  N  N     . ILE A 1 42  ? 35.106 21.536 5.316   1.00 17.69 ? 992  ILE A N     1 
ATOM   155  C  CA    . ILE A 1 42  ? 34.434 20.242 5.210   1.00 17.25 ? 992  ILE A CA    1 
ATOM   156  C  C     . ILE A 1 42  ? 34.978 19.568 3.958   1.00 16.11 ? 992  ILE A C     1 
ATOM   157  O  O     . ILE A 1 42  ? 34.493 19.799 2.852   1.00 15.43 ? 992  ILE A O     1 
ATOM   158  C  CB    . ILE A 1 42  ? 32.887 20.384 5.114   1.00 16.83 ? 992  ILE A CB    1 
ATOM   159  C  CG1   . ILE A 1 42  ? 32.336 21.128 6.339   1.00 18.30 ? 992  ILE A CG1   1 
ATOM   160  C  CG2   . ILE A 1 42  ? 32.228 19.014 4.997   1.00 17.44 ? 992  ILE A CG2   1 
ATOM   161  C  CD1   . ILE A 1 42  ? 30.859 21.502 6.200   1.00 18.86 ? 992  ILE A CD1   1 
ATOM   162  N  N     . PRO A 1 43  ? 36.036 18.761 4.121   1.00 15.29 ? 993  PRO A N     1 
ATOM   163  C  CA    . PRO A 1 43  ? 36.629 18.144 2.937   1.00 15.38 ? 993  PRO A CA    1 
ATOM   164  C  C     . PRO A 1 43  ? 35.730 17.050 2.372   1.00 15.79 ? 993  PRO A C     1 
ATOM   165  O  O     . PRO A 1 43  ? 34.838 16.553 3.064   1.00 15.65 ? 993  PRO A O     1 
ATOM   166  C  CB    . PRO A 1 43  ? 37.933 17.521 3.470   1.00 15.57 ? 993  PRO A CB    1 
ATOM   167  C  CG    . PRO A 1 43  ? 37.709 17.314 4.925   1.00 16.44 ? 993  PRO A CG    1 
ATOM   168  C  CD    . PRO A 1 43  ? 36.723 18.389 5.372   1.00 15.56 ? 993  PRO A CD    1 
ATOM   169  N  N     . CYS A 1 44  ? 36.001 16.669 1.133   1.00 16.32 ? 994  CYS A N     1 
ATOM   170  C  CA    . CYS A 1 44  ? 35.313 15.543 0.506   1.00 15.90 ? 994  CYS A CA    1 
ATOM   171  C  C     . CYS A 1 44  ? 36.370 14.548 0.058   1.00 16.23 ? 994  CYS A C     1 
ATOM   172  O  O     . CYS A 1 44  ? 37.365 14.943 -0.567  1.00 16.17 ? 994  CYS A O     1 
ATOM   173  C  CB    . CYS A 1 44  ? 34.529 16.014 -0.706  1.00 16.54 ? 994  CYS A CB    1 
ATOM   174  S  SG    . CYS A 1 44  ? 33.615 14.679 -1.541  1.00 18.28 ? 994  CYS A SG    1 
ATOM   175  N  N     . VAL A 1 45  ? 36.140 13.275 0.361   1.00 16.22 ? 995  VAL A N     1 
ATOM   176  C  CA    . VAL A 1 45  ? 37.071 12.216 -0.043  1.00 16.72 ? 995  VAL A CA    1 
ATOM   177  C  C     . VAL A 1 45  ? 36.343 11.089 -0.762  1.00 16.68 ? 995  VAL A C     1 
ATOM   178  O  O     . VAL A 1 45  ? 35.124 10.916 -0.629  1.00 15.87 ? 995  VAL A O     1 
ATOM   179  C  CB    . VAL A 1 45  ? 37.872 11.650 1.150   1.00 16.50 ? 995  VAL A CB    1 
ATOM   180  C  CG1   . VAL A 1 45  ? 38.613 12.770 1.895   1.00 17.06 ? 995  VAL A CG1   1 
ATOM   181  C  CG2   . VAL A 1 45  ? 36.973 10.849 2.112   1.00 17.54 ? 995  VAL A CG2   1 
ATOM   182  N  N     . ASN A 1 46  ? 37.094 10.303 -1.519  1.00 16.90 ? 996  ASN A N     1 
ATOM   183  C  CA    . ASN A 1 46  ? 36.482 9.201  -2.241  1.00 17.39 ? 996  ASN A CA    1 
ATOM   184  C  C     . ASN A 1 46  ? 37.475 8.048  -2.246  1.00 18.28 ? 996  ASN A C     1 
ATOM   185  O  O     . ASN A 1 46  ? 38.516 8.117  -2.921  1.00 18.74 ? 996  ASN A O     1 
ATOM   186  C  CB    . ASN A 1 46  ? 36.106 9.639  -3.662  1.00 16.76 ? 996  ASN A CB    1 
ATOM   187  C  CG    . ASN A 1 46  ? 35.319 8.576  -4.437  1.00 17.72 ? 996  ASN A CG    1 
ATOM   188  O  OD1   . ASN A 1 46  ? 35.330 7.396  -4.088  1.00 19.00 ? 996  ASN A OD1   1 
ATOM   189  N  ND2   . ASN A 1 46  ? 34.649 9.000  -5.505  1.00 17.95 ? 996  ASN A ND2   1 
ATOM   190  N  N     . ALA A 1 47  ? 37.156 7.023  -1.464  1.00 19.09 ? 997  ALA A N     1 
ATOM   191  C  CA    . ALA A 1 47  ? 37.969 5.804  -1.391  1.00 20.21 ? 997  ALA A CA    1 
ATOM   192  C  C     . ALA A 1 47  ? 37.300 4.641  -2.130  1.00 21.47 ? 997  ALA A C     1 
ATOM   193  O  O     . ALA A 1 47  ? 37.655 3.484  -1.902  1.00 21.96 ? 997  ALA A O     1 
ATOM   194  C  CB    . ALA A 1 47  ? 38.240 5.426  0.068   1.00 20.72 ? 997  ALA A CB    1 
ATOM   195  N  N     . VAL A 1 48  ? 36.355 4.944  -3.017  1.00 22.03 ? 998  VAL A N     1 
ATOM   196  C  CA    . VAL A 1 48  ? 35.480 3.911  -3.591  1.00 22.98 ? 998  VAL A CA    1 
ATOM   197  C  C     . VAL A 1 48  ? 35.527 3.842  -5.108  1.00 23.85 ? 998  VAL A C     1 
ATOM   198  O  O     . VAL A 1 48  ? 35.646 2.750  -5.695  1.00 24.21 ? 998  VAL A O     1 
ATOM   199  C  CB    . VAL A 1 48  ? 34.006 4.097  -3.098  1.00 22.95 ? 998  VAL A CB    1 
ATOM   200  C  CG1   . VAL A 1 48  ? 33.016 3.257  -3.916  1.00 23.37 ? 998  VAL A CG1   1 
ATOM   201  C  CG2   . VAL A 1 48  ? 33.891 3.762  -1.622  1.00 23.22 ? 998  VAL A CG2   1 
ATOM   202  N  N     . ASP A 1 49  ? 35.430 4.998  -5.750  1.00 24.33 ? 999  ASP A N     1 
ATOM   203  C  CA    . ASP A 1 49  ? 35.356 5.064  -7.204  1.00 25.19 ? 999  ASP A CA    1 
ATOM   204  C  C     . ASP A 1 49  ? 35.989 6.350  -7.741  1.00 25.85 ? 999  ASP A C     1 
ATOM   205  O  O     . ASP A 1 49  ? 36.674 7.061  -7.005  1.00 24.96 ? 999  ASP A O     1 
ATOM   206  C  CB    . ASP A 1 49  ? 33.901 4.882  -7.690  1.00 25.61 ? 999  ASP A CB    1 
ATOM   207  C  CG    . ASP A 1 49  ? 32.941 5.918  -7.107  1.00 26.94 ? 999  ASP A CG    1 
ATOM   208  O  OD1   . ASP A 1 49  ? 33.310 7.112  -7.033  1.00 27.28 ? 999  ASP A OD1   1 
ATOM   209  O  OD2   . ASP A 1 49  ? 31.805 5.539  -6.742  1.00 28.72 ? 999  ASP A OD2   1 
ATOM   210  N  N     . SER A 1 50  ? 35.756 6.634  -9.018  1.00 26.20 ? 1000 SER A N     1 
ATOM   211  C  CA    . SER A 1 50  ? 36.439 7.715  -9.725  1.00 27.12 ? 1000 SER A CA    1 
ATOM   212  C  C     . SER A 1 50  ? 35.698 9.060  -9.682  1.00 26.98 ? 1000 SER A C     1 
ATOM   213  O  O     . SER A 1 50  ? 36.203 10.063 -10.205 1.00 27.50 ? 1000 SER A O     1 
ATOM   214  C  CB    . SER A 1 50  ? 36.696 7.296  -11.181 1.00 27.37 ? 1000 SER A CB    1 
ATOM   215  O  OG    . SER A 1 50  ? 35.469 7.102  -11.864 1.00 30.58 ? 1000 SER A OG    1 
ATOM   216  N  N     . GLU A 1 51  ? 34.521 9.085  -9.047  1.00 26.78 ? 1001 GLU A N     1 
ATOM   217  C  CA    . GLU A 1 51  ? 33.693 10.296 -8.980  1.00 26.56 ? 1001 GLU A CA    1 
ATOM   218  C  C     . GLU A 1 51  ? 34.420 11.459 -8.295  1.00 25.51 ? 1001 GLU A C     1 
ATOM   219  O  O     . GLU A 1 51  ? 35.041 11.269 -7.245  1.00 24.70 ? 1001 GLU A O     1 
ATOM   220  C  CB    . GLU A 1 51  ? 32.374 10.043 -8.237  1.00 27.35 ? 1001 GLU A CB    1 
ATOM   221  C  CG    . GLU A 1 51  ? 31.357 9.142  -8.953  1.00 30.33 ? 1001 GLU A CG    1 
ATOM   222  C  CD    . GLU A 1 51  ? 30.682 9.786  -10.175 1.00 34.33 ? 1001 GLU A CD    1 
ATOM   223  O  OE1   . GLU A 1 51  ? 30.685 11.031 -10.325 1.00 35.89 ? 1001 GLU A OE1   1 
ATOM   224  O  OE2   . GLU A 1 51  ? 30.127 9.029  -10.998 1.00 36.91 ? 1001 GLU A OE2   1 
ATOM   225  N  N     . PRO A 1 52  ? 34.327 12.666 -8.882  1.00 24.98 ? 1002 PRO A N     1 
ATOM   226  C  CA    . PRO A 1 52  ? 34.828 13.853 -8.205  1.00 24.51 ? 1002 PRO A CA    1 
ATOM   227  C  C     . PRO A 1 52  ? 33.816 14.348 -7.171  1.00 24.15 ? 1002 PRO A C     1 
ATOM   228  O  O     . PRO A 1 52  ? 32.760 13.733 -6.991  1.00 24.26 ? 1002 PRO A O     1 
ATOM   229  C  CB    . PRO A 1 52  ? 34.977 14.865 -9.345  1.00 24.46 ? 1002 PRO A CB    1 
ATOM   230  C  CG    . PRO A 1 52  ? 33.938 14.472 -10.326 1.00 24.69 ? 1002 PRO A CG    1 
ATOM   231  C  CD    . PRO A 1 52  ? 33.756 12.986 -10.206 1.00 25.16 ? 1002 PRO A CD    1 
ATOM   232  N  N     . CYS A 1 53  ? 34.154 15.443 -6.497  1.00 23.60 ? 1003 CYS A N     1 
ATOM   233  C  CA    . CYS A 1 53  ? 33.282 16.056 -5.515  1.00 22.92 ? 1003 CYS A CA    1 
ATOM   234  C  C     . CYS A 1 53  ? 31.960 16.422 -6.192  1.00 22.60 ? 1003 CYS A C     1 
ATOM   235  O  O     . CYS A 1 53  ? 31.983 17.010 -7.269  1.00 22.12 ? 1003 CYS A O     1 
ATOM   236  C  CB    . CYS A 1 53  ? 33.957 17.317 -5.000  1.00 23.23 ? 1003 CYS A CB    1 
ATOM   237  S  SG    . CYS A 1 53  ? 33.103 18.088 -3.623  1.00 24.86 ? 1003 CYS A SG    1 
ATOM   238  N  N     . PRO A 1 54  ? 30.811 16.085 -5.564  1.00 22.36 ? 1004 PRO A N     1 
ATOM   239  C  CA    . PRO A 1 54  ? 29.510 16.443 -6.154  1.00 22.39 ? 1004 PRO A CA    1 
ATOM   240  C  C     . PRO A 1 54  ? 29.374 17.944 -6.393  1.00 22.19 ? 1004 PRO A C     1 
ATOM   241  O  O     . PRO A 1 54  ? 29.756 18.743 -5.539  1.00 22.43 ? 1004 PRO A O     1 
ATOM   242  C  CB    . PRO A 1 54  ? 28.493 15.959 -5.110  1.00 22.16 ? 1004 PRO A CB    1 
ATOM   243  C  CG    . PRO A 1 54  ? 29.251 15.717 -3.883  1.00 23.76 ? 1004 PRO A CG    1 
ATOM   244  C  CD    . PRO A 1 54  ? 30.653 15.376 -4.286  1.00 22.35 ? 1004 PRO A CD    1 
ATOM   245  N  N     . SER A 1 55  ? 28.860 18.327 -7.562  1.00 22.19 ? 1005 SER A N     1 
ATOM   246  C  CA    . SER A 1 55  ? 28.792 19.737 -7.925  1.00 22.50 ? 1005 SER A CA    1 
ATOM   247  C  C     . SER A 1 55  ? 27.450 20.144 -8.552  1.00 22.41 ? 1005 SER A C     1 
ATOM   248  O  O     . SER A 1 55  ? 27.332 21.218 -9.135  1.00 23.20 ? 1005 SER A O     1 
ATOM   249  C  CB    . SER A 1 55  ? 29.968 20.116 -8.847  1.00 22.84 ? 1005 SER A CB    1 
ATOM   250  O  OG    . SER A 1 55  ? 29.844 19.491 -10.114 1.00 25.63 ? 1005 SER A OG    1 
ATOM   251  N  N     . ASN A 1 56  ? 26.444 19.292 -8.401  1.00 22.17 ? 1006 ASN A N     1 
ATOM   252  C  CA    . ASN A 1 56  ? 25.141 19.516 -9.026  1.00 22.37 ? 1006 ASN A CA    1 
ATOM   253  C  C     . ASN A 1 56  ? 24.181 20.244 -8.094  1.00 21.81 ? 1006 ASN A C     1 
ATOM   254  O  O     . ASN A 1 56  ? 22.963 20.069 -8.178  1.00 23.23 ? 1006 ASN A O     1 
ATOM   255  C  CB    . ASN A 1 56  ? 24.534 18.175 -9.423  1.00 22.84 ? 1006 ASN A CB    1 
ATOM   256  C  CG    . ASN A 1 56  ? 24.268 17.282 -8.231  1.00 25.21 ? 1006 ASN A CG    1 
ATOM   257  O  OD1   . ASN A 1 56  ? 24.991 17.321 -7.228  1.00 28.51 ? 1006 ASN A OD1   1 
ATOM   258  N  ND2   . ASN A 1 56  ? 23.216 16.480 -8.323  1.00 29.63 ? 1006 ASN A ND2   1 
ATOM   259  N  N     . TYR A 1 57  ? 24.741 21.020 -7.177  1.00 20.29 ? 1007 TYR A N     1 
ATOM   260  C  CA    . TYR A 1 57  ? 23.949 21.834 -6.253  1.00 18.58 ? 1007 TYR A CA    1 
ATOM   261  C  C     . TYR A 1 57  ? 24.804 23.025 -5.868  1.00 18.25 ? 1007 TYR A C     1 
ATOM   262  O  O     . TYR A 1 57  ? 26.017 23.052 -6.149  1.00 18.17 ? 1007 TYR A O     1 
ATOM   263  C  CB    . TYR A 1 57  ? 23.587 21.030 -5.000  1.00 18.54 ? 1007 TYR A CB    1 
ATOM   264  C  CG    . TYR A 1 57  ? 24.767 20.842 -4.070  1.00 17.87 ? 1007 TYR A CG    1 
ATOM   265  C  CD1   . TYR A 1 57  ? 24.860 21.563 -2.875  1.00 17.41 ? 1007 TYR A CD1   1 
ATOM   266  C  CD2   . TYR A 1 57  ? 25.797 19.966 -4.398  1.00 17.48 ? 1007 TYR A CD2   1 
ATOM   267  C  CE1   . TYR A 1 57  ? 25.946 21.402 -2.026  1.00 16.27 ? 1007 TYR A CE1   1 
ATOM   268  C  CE2   . TYR A 1 57  ? 26.889 19.804 -3.559  1.00 16.22 ? 1007 TYR A CE2   1 
ATOM   269  C  CZ    . TYR A 1 57  ? 26.954 20.528 -2.380  1.00 17.43 ? 1007 TYR A CZ    1 
ATOM   270  O  OH    . TYR A 1 57  ? 28.035 20.369 -1.560  1.00 17.78 ? 1007 TYR A OH    1 
ATOM   271  N  N     . LYS A 1 58  ? 24.194 24.012 -5.220  1.00 16.84 ? 1008 LYS A N     1 
ATOM   272  C  CA    . LYS A 1 58  ? 24.958 25.144 -4.713  1.00 16.61 ? 1008 LYS A CA    1 
ATOM   273  C  C     . LYS A 1 58  ? 25.055 25.049 -3.193  1.00 15.87 ? 1008 LYS A C     1 
ATOM   274  O  O     . LYS A 1 58  ? 24.033 25.003 -2.514  1.00 14.97 ? 1008 LYS A O     1 
ATOM   275  C  CB    . LYS A 1 58  ? 24.315 26.472 -5.124  1.00 17.07 ? 1008 LYS A CB    1 
ATOM   276  C  CG    . LYS A 1 58  ? 25.017 27.698 -4.597  1.00 19.82 ? 1008 LYS A CG    1 
ATOM   277  C  CD    . LYS A 1 58  ? 26.364 27.910 -5.276  1.00 24.35 ? 1008 LYS A CD    1 
ATOM   278  C  CE    . LYS A 1 58  ? 27.010 29.193 -4.819  1.00 27.20 ? 1008 LYS A CE    1 
ATOM   279  N  NZ    . LYS A 1 58  ? 28.272 29.408 -5.541  1.00 29.79 ? 1008 LYS A NZ    1 
ATOM   280  N  N     . TYR A 1 59  ? 26.275 25.006 -2.665  1.00 15.33 ? 1009 TYR A N     1 
ATOM   281  C  CA    . TYR A 1 59  ? 26.458 25.006 -1.212  1.00 14.84 ? 1009 TYR A CA    1 
ATOM   282  C  C     . TYR A 1 59  ? 26.091 26.375 -0.647  1.00 14.65 ? 1009 TYR A C     1 
ATOM   283  O  O     . TYR A 1 59  ? 26.632 27.397 -1.085  1.00 15.48 ? 1009 TYR A O     1 
ATOM   284  C  CB    . TYR A 1 59  ? 27.914 24.672 -0.811  1.00 14.93 ? 1009 TYR A CB    1 
ATOM   285  C  CG    . TYR A 1 59  ? 28.034 24.353 0.672   1.00 13.98 ? 1009 TYR A CG    1 
ATOM   286  C  CD1   . TYR A 1 59  ? 28.165 23.030 1.112   1.00 14.71 ? 1009 TYR A CD1   1 
ATOM   287  C  CD2   . TYR A 1 59  ? 27.952 25.365 1.637   1.00 13.65 ? 1009 TYR A CD2   1 
ATOM   288  C  CE1   . TYR A 1 59  ? 28.256 22.728 2.471   1.00 14.78 ? 1009 TYR A CE1   1 
ATOM   289  C  CE2   . TYR A 1 59  ? 28.036 25.071 2.994   1.00 15.24 ? 1009 TYR A CE2   1 
ATOM   290  C  CZ    . TYR A 1 59  ? 28.177 23.748 3.406   1.00 16.30 ? 1009 TYR A CZ    1 
ATOM   291  O  OH    . TYR A 1 59  ? 28.253 23.424 4.751   1.00 17.63 ? 1009 TYR A OH    1 
ATOM   292  N  N     . VAL A 1 60  ? 25.156 26.400 0.309   1.00 15.04 ? 1010 VAL A N     1 
ATOM   293  C  CA    . VAL A 1 60  ? 24.876 27.617 1.094   1.00 14.39 ? 1010 VAL A CA    1 
ATOM   294  C  C     . VAL A 1 60  ? 24.914 27.250 2.575   1.00 14.74 ? 1010 VAL A C     1 
ATOM   295  O  O     . VAL A 1 60  ? 24.479 26.166 2.957   1.00 14.25 ? 1010 VAL A O     1 
ATOM   296  C  CB    . VAL A 1 60  ? 23.490 28.249 0.761   1.00 14.92 ? 1010 VAL A CB    1 
ATOM   297  C  CG1   . VAL A 1 60  ? 23.486 28.746 -0.679  1.00 15.30 ? 1010 VAL A CG1   1 
ATOM   298  C  CG2   . VAL A 1 60  ? 22.361 27.265 0.994   1.00 14.86 ? 1010 VAL A CG2   1 
ATOM   299  N  N     . SER A 1 61  ? 25.440 28.157 3.395   1.00 14.74 ? 1011 SER A N     1 
ATOM   300  C  CA    . SER A 1 61  ? 25.603 27.871 4.819   1.00 15.72 ? 1011 SER A CA    1 
ATOM   301  C  C     . SER A 1 61  ? 24.382 28.300 5.642   1.00 16.10 ? 1011 SER A C     1 
ATOM   302  O  O     . SER A 1 61  ? 24.266 27.931 6.815   1.00 15.79 ? 1011 SER A O     1 
ATOM   303  C  CB    . SER A 1 61  ? 26.865 28.560 5.353   1.00 15.87 ? 1011 SER A CB    1 
ATOM   304  O  OG    . SER A 1 61  ? 26.815 29.943 5.053   1.00 18.11 ? 1011 SER A OG    1 
ATOM   305  N  N     . GLN A 1 62  ? 23.487 29.085 5.037   1.00 16.89 ? 1012 GLN A N     1 
ATOM   306  C  CA    . GLN A 1 62  ? 22.260 29.544 5.702   1.00 17.58 ? 1012 GLN A CA    1 
ATOM   307  C  C     . GLN A 1 62  ? 21.079 29.377 4.743   1.00 15.82 ? 1012 GLN A C     1 
ATOM   308  O  O     . GLN A 1 62  ? 21.267 29.374 3.528   1.00 15.37 ? 1012 GLN A O     1 
ATOM   309  C  CB    . GLN A 1 62  ? 22.387 31.011 6.125   1.00 18.04 ? 1012 GLN A CB    1 
ATOM   310  C  CG    . GLN A 1 62  ? 23.642 31.293 6.982   1.00 21.68 ? 1012 GLN A CG    1 
ATOM   311  C  CD    . GLN A 1 62  ? 23.664 32.685 7.595   1.00 23.20 ? 1012 GLN A CD    1 
ATOM   312  O  OE1   . GLN A 1 62  ? 23.280 33.674 6.958   1.00 31.36 ? 1012 GLN A OE1   1 
ATOM   313  N  NE2   . GLN A 1 62  ? 24.125 32.769 8.849   1.00 30.16 ? 1012 GLN A NE2   1 
ATOM   314  N  N     . ASN A 1 63  ? 19.871 29.220 5.295   1.00 14.73 ? 1013 ASN A N     1 
ATOM   315  C  CA    . ASN A 1 63  ? 18.680 29.062 4.461   1.00 14.37 ? 1013 ASN A CA    1 
ATOM   316  C  C     . ASN A 1 63  ? 18.481 30.224 3.513   1.00 14.81 ? 1013 ASN A C     1 
ATOM   317  O  O     . ASN A 1 63  ? 18.834 31.363 3.815   1.00 14.30 ? 1013 ASN A O     1 
ATOM   318  C  CB    . ASN A 1 63  ? 17.437 28.925 5.338   1.00 14.54 ? 1013 ASN A CB    1 
ATOM   319  C  CG    . ASN A 1 63  ? 17.405 27.622 6.106   1.00 14.43 ? 1013 ASN A CG    1 
ATOM   320  O  OD1   . ASN A 1 63  ? 17.862 26.605 5.613   1.00 15.60 ? 1013 ASN A OD1   1 
ATOM   321  N  ND2   . ASN A 1 63  ? 16.825 27.641 7.312   1.00 16.28 ? 1013 ASN A ND2   1 
ATOM   322  N  N     . CYS A 1 64  ? 17.910 29.914 2.353   1.00 14.65 ? 1014 CYS A N     1 
ATOM   323  C  CA    . CYS A 1 64  ? 17.588 30.935 1.369   1.00 14.83 ? 1014 CYS A CA    1 
ATOM   324  C  C     . CYS A 1 64  ? 16.139 30.745 0.916   1.00 14.64 ? 1014 CYS A C     1 
ATOM   325  O  O     . CYS A 1 64  ? 15.465 29.792 1.327   1.00 14.54 ? 1014 CYS A O     1 
ATOM   326  C  CB    . CYS A 1 64  ? 18.538 30.856 0.171   1.00 15.12 ? 1014 CYS A CB    1 
ATOM   327  S  SG    . CYS A 1 64  ? 18.450 29.316 -0.732  1.00 17.44 ? 1014 CYS A SG    1 
ATOM   328  N  N     . VAL A 1 65  ? 15.674 31.673 0.081   1.00 14.34 ? 1015 VAL A N     1 
ATOM   329  C  CA    . VAL A 1 65  ? 14.379 31.534 -0.583  1.00 14.47 ? 1015 VAL A CA    1 
ATOM   330  C  C     . VAL A 1 65  ? 14.525 31.857 -2.061  1.00 15.51 ? 1015 VAL A C     1 
ATOM   331  O  O     . VAL A 1 65  ? 15.468 32.547 -2.481  1.00 14.56 ? 1015 VAL A O     1 
ATOM   332  C  CB    . VAL A 1 65  ? 13.322 32.492 0.007   1.00 14.98 ? 1015 VAL A CB    1 
ATOM   333  C  CG1   . VAL A 1 65  ? 13.099 32.203 1.483   1.00 15.17 ? 1015 VAL A CG1   1 
ATOM   334  C  CG2   . VAL A 1 65  ? 13.758 33.942 -0.171  1.00 14.78 ? 1015 VAL A CG2   1 
ATOM   335  N  N     . THR A 1 66  ? 13.576 31.339 -2.840  1.00 15.59 ? 1016 THR A N     1 
ATOM   336  C  CA    . THR A 1 66  ? 13.373 31.821 -4.196  1.00 17.23 ? 1016 THR A CA    1 
ATOM   337  C  C     . THR A 1 66  ? 12.150 32.735 -4.065  1.00 17.77 ? 1016 THR A C     1 
ATOM   338  O  O     . THR A 1 66  ? 12.311 33.911 -3.793  1.00 17.64 ? 1016 THR A O     1 
ATOM   339  C  CB    . THR A 1 66  ? 13.271 30.689 -5.254  1.00 18.13 ? 1016 THR A CB    1 
ATOM   340  O  OG1   . THR A 1 66  ? 12.289 29.730 -4.851  1.00 17.69 ? 1016 THR A OG1   1 
ATOM   341  C  CG2   . THR A 1 66  ? 14.617 29.996 -5.418  1.00 18.32 ? 1016 THR A CG2   1 
ATOM   342  N  N     A SER A 1 67  ? 10.952 32.173 -4.193  0.50 18.08 ? 1017 SER A N     1 
ATOM   343  N  N     B SER A 1 67  ? 10.943 32.209 -4.239  0.50 18.11 ? 1017 SER A N     1 
ATOM   344  C  CA    A SER A 1 67  ? 9.713  32.915 -3.945  0.50 18.65 ? 1017 SER A CA    1 
ATOM   345  C  CA    B SER A 1 67  ? 9.756  33.044 -4.037  0.50 18.56 ? 1017 SER A CA    1 
ATOM   346  C  C     A SER A 1 67  ? 9.657  33.401 -2.496  0.50 18.71 ? 1017 SER A C     1 
ATOM   347  C  C     B SER A 1 67  ? 9.634  33.408 -2.555  0.50 18.71 ? 1017 SER A C     1 
ATOM   348  O  O     A SER A 1 67  ? 10.159 32.710 -1.593  0.50 17.79 ? 1017 SER A O     1 
ATOM   349  O  O     B SER A 1 67  ? 10.077 32.639 -1.684  0.50 17.94 ? 1017 SER A O     1 
ATOM   350  C  CB    A SER A 1 67  ? 8.500  32.037 -4.262  0.50 18.60 ? 1017 SER A CB    1 
ATOM   351  C  CB    B SER A 1 67  ? 8.485  32.373 -4.571  0.50 18.78 ? 1017 SER A CB    1 
ATOM   352  O  OG    A SER A 1 67  ? 8.389  31.821 -5.661  0.50 20.12 ? 1017 SER A OG    1 
ATOM   353  O  OG    B SER A 1 67  ? 8.102  31.263 -3.790  0.50 19.08 ? 1017 SER A OG    1 
ATOM   354  N  N     . PRO A 1 68  ? 9.061  34.591 -2.264  1.00 19.04 ? 1018 PRO A N     1 
ATOM   355  C  CA    . PRO A 1 68  ? 9.054  35.162 -0.914  1.00 19.42 ? 1018 PRO A CA    1 
ATOM   356  C  C     . PRO A 1 68  ? 8.316  34.337 0.125   1.00 19.54 ? 1018 PRO A C     1 
ATOM   357  O  O     . PRO A 1 68  ? 7.297  33.696 -0.176  1.00 19.00 ? 1018 PRO A O     1 
ATOM   358  C  CB    . PRO A 1 68  ? 8.366  36.520 -1.099  1.00 20.32 ? 1018 PRO A CB    1 
ATOM   359  C  CG    . PRO A 1 68  ? 7.599  36.394 -2.352  1.00 20.91 ? 1018 PRO A CG    1 
ATOM   360  C  CD    . PRO A 1 68  ? 8.378  35.483 -3.227  1.00 19.57 ? 1018 PRO A CD    1 
ATOM   361  N  N     . MET A 1 69  ? 8.842  34.363 1.349   1.00 19.21 ? 1019 MET A N     1 
ATOM   362  C  CA    . MET A 1 69  ? 8.267  33.574 2.438   1.00 19.70 ? 1019 MET A CA    1 
ATOM   363  C  C     . MET A 1 69  ? 7.602  34.407 3.545   1.00 20.63 ? 1019 MET A C     1 
ATOM   364  O  O     . MET A 1 69  ? 6.779  33.902 4.305   1.00 22.06 ? 1019 MET A O     1 
ATOM   365  C  CB    . MET A 1 69  ? 9.304  32.576 2.980   1.00 19.45 ? 1019 MET A CB    1 
ATOM   366  C  CG    . MET A 1 69  ? 9.565  31.427 1.999   1.00 19.07 ? 1019 MET A CG    1 
ATOM   367  S  SD    . MET A 1 69  ? 8.179  30.261 1.936   1.00 22.23 ? 1019 MET A SD    1 
ATOM   368  C  CE    . MET A 1 69  ? 7.840  30.203 0.187   1.00 21.46 ? 1019 MET A CE    1 
ATOM   369  N  N     . ASN A 1 70  ? 7.948  35.685 3.620   1.00 21.66 ? 1020 ASN A N     1 
ATOM   370  C  CA    . ASN A 1 70  ? 7.307  36.616 4.569   1.00 21.47 ? 1020 ASN A CA    1 
ATOM   371  C  C     . ASN A 1 70  ? 7.379  36.167 6.025   1.00 20.07 ? 1020 ASN A C     1 
ATOM   372  O  O     . ASN A 1 70  ? 6.421  36.271 6.794   1.00 20.07 ? 1020 ASN A O     1 
ATOM   373  C  CB    . ASN A 1 70  ? 5.872  36.936 4.129   1.00 22.32 ? 1020 ASN A CB    1 
ATOM   374  C  CG    . ASN A 1 70  ? 5.801  37.314 2.656   1.00 25.63 ? 1020 ASN A CG    1 
ATOM   375  O  OD1   . ASN A 1 70  ? 6.582  38.151 2.173   1.00 28.94 ? 1020 ASN A OD1   1 
ATOM   376  N  ND2   . ASN A 1 70  ? 4.893  36.677 1.924   1.00 28.15 ? 1020 ASN A ND2   1 
ATOM   377  N  N     . ILE A 1 71  ? 8.551  35.667 6.390   1.00 18.20 ? 1021 ILE A N     1 
ATOM   378  C  CA    . ILE A 1 71  ? 8.868  35.410 7.787   1.00 17.11 ? 1021 ILE A CA    1 
ATOM   379  C  C     . ILE A 1 71  ? 8.681  36.702 8.597   1.00 16.53 ? 1021 ILE A C     1 
ATOM   380  O  O     . ILE A 1 71  ? 9.129  37.789 8.187   1.00 16.71 ? 1021 ILE A O     1 
ATOM   381  C  CB    . ILE A 1 71  ? 10.315 34.900 7.920   1.00 16.48 ? 1021 ILE A CB    1 
ATOM   382  C  CG1   . ILE A 1 71  ? 10.526 33.641 7.058   1.00 16.44 ? 1021 ILE A CG1   1 
ATOM   383  C  CG2   . ILE A 1 71  ? 10.674 34.699 9.398   1.00 17.15 ? 1021 ILE A CG2   1 
ATOM   384  C  CD1   . ILE A 1 71  ? 11.986 33.146 7.042   1.00 17.80 ? 1021 ILE A CD1   1 
ATOM   385  N  N     . ASP A 1 72  ? 8.007  36.576 9.734   1.00 16.51 ? 1022 ASP A N     1 
ATOM   386  C  CA    . ASP A 1 72  ? 7.807  37.709 10.635  1.00 16.93 ? 1022 ASP A CA    1 
ATOM   387  C  C     . ASP A 1 72  ? 9.120  38.063 11.337  1.00 16.78 ? 1022 ASP A C     1 
ATOM   388  O  O     . ASP A 1 72  ? 9.550  37.357 12.257  1.00 17.53 ? 1022 ASP A O     1 
ATOM   389  C  CB    . ASP A 1 72  ? 6.728  37.370 11.676  1.00 16.13 ? 1022 ASP A CB    1 
ATOM   390  C  CG    . ASP A 1 72  ? 6.435  38.530 12.630  1.00 18.65 ? 1022 ASP A CG    1 
ATOM   391  O  OD1   . ASP A 1 72  ? 6.949  39.657 12.419  1.00 18.61 ? 1022 ASP A OD1   1 
ATOM   392  O  OD2   . ASP A 1 72  ? 5.658  38.311 13.587  1.00 20.52 ? 1022 ASP A OD2   1 
ATOM   393  N  N     . ARG A 1 73  ? 9.736  39.164 10.902  1.00 16.97 ? 1023 ARG A N     1 
ATOM   394  C  CA    . ARG A 1 73  ? 10.996 39.634 11.485  1.00 16.97 ? 1023 ARG A CA    1 
ATOM   395  C  C     . ARG A 1 73  ? 10.819 40.974 12.213  1.00 17.06 ? 1023 ARG A C     1 
ATOM   396  O  O     . ARG A 1 73  ? 11.790 41.705 12.421  1.00 16.83 ? 1023 ARG A O     1 
ATOM   397  C  CB    . ARG A 1 73  ? 12.080 39.724 10.406  1.00 17.52 ? 1023 ARG A CB    1 
ATOM   398  C  CG    . ARG A 1 73  ? 12.458 38.341 9.831   1.00 18.32 ? 1023 ARG A CG    1 
ATOM   399  C  CD    . ARG A 1 73  ? 13.617 38.451 8.863   1.00 21.26 ? 1023 ARG A CD    1 
ATOM   400  N  NE    . ARG A 1 73  ? 13.979 37.161 8.271   1.00 23.13 ? 1023 ARG A NE    1 
ATOM   401  C  CZ    . ARG A 1 73  ? 14.743 36.235 8.855   1.00 21.97 ? 1023 ARG A CZ    1 
ATOM   402  N  NH1   . ARG A 1 73  ? 15.241 36.426 10.083  1.00 21.88 ? 1023 ARG A NH1   1 
ATOM   403  N  NH2   . ARG A 1 73  ? 15.013 35.108 8.201   1.00 21.56 ? 1023 ARG A NH2   1 
ATOM   404  N  N     . ASN A 1 74  ? 9.582  41.299 12.599  1.00 16.33 ? 1024 ASN A N     1 
ATOM   405  C  CA    . ASN A 1 74  ? 9.347  42.486 13.411  1.00 16.84 ? 1024 ASN A CA    1 
ATOM   406  C  C     . ASN A 1 74  ? 10.066 42.321 14.751  1.00 16.39 ? 1024 ASN A C     1 
ATOM   407  O  O     . ASN A 1 74  ? 9.731  41.431 15.539  1.00 16.50 ? 1024 ASN A O     1 
ATOM   408  C  CB    . ASN A 1 74  ? 7.840  42.706 13.606  1.00 16.54 ? 1024 ASN A CB    1 
ATOM   409  C  CG    . ASN A 1 74  ? 7.517  44.009 14.315  1.00 17.98 ? 1024 ASN A CG    1 
ATOM   410  O  OD1   . ASN A 1 74  ? 8.287  44.494 15.149  1.00 18.38 ? 1024 ASN A OD1   1 
ATOM   411  N  ND2   . ASN A 1 74  ? 6.346  44.573 13.998  1.00 20.72 ? 1024 ASN A ND2   1 
ATOM   412  N  N     . ILE A 1 75  ? 11.066 43.166 15.003  1.00 16.36 ? 1025 ILE A N     1 
ATOM   413  C  CA    . ILE A 1 75  ? 11.867 43.041 16.217  1.00 17.48 ? 1025 ILE A CA    1 
ATOM   414  C  C     . ILE A 1 75  ? 11.018 43.145 17.497  1.00 17.62 ? 1025 ILE A C     1 
ATOM   415  O  O     . ILE A 1 75  ? 11.336 42.514 18.506  1.00 18.02 ? 1025 ILE A O     1 
ATOM   416  C  CB    . ILE A 1 75  ? 13.089 44.018 16.227  1.00 17.60 ? 1025 ILE A CB    1 
ATOM   417  C  CG1   . ILE A 1 75  ? 14.071 43.660 17.343  1.00 18.45 ? 1025 ILE A CG1   1 
ATOM   418  C  CG2   . ILE A 1 75  ? 12.631 45.496 16.263  1.00 17.42 ? 1025 ILE A CG2   1 
ATOM   419  C  CD1   . ILE A 1 75  ? 15.435 44.348 17.221  1.00 18.49 ? 1025 ILE A CD1   1 
ATOM   420  N  N     . THR A 1 76  ? 9.925  43.906 17.435  1.00 18.68 ? 1026 THR A N     1 
ATOM   421  C  CA    . THR A 1 76  ? 9.035  44.049 18.598  1.00 20.05 ? 1026 THR A CA    1 
ATOM   422  C  C     . THR A 1 76  ? 8.186  42.795 18.867  1.00 19.73 ? 1026 THR A C     1 
ATOM   423  O  O     . THR A 1 76  ? 7.508  42.704 19.890  1.00 20.75 ? 1026 THR A O     1 
ATOM   424  C  CB    . THR A 1 76  ? 8.125  45.301 18.495  1.00 20.44 ? 1026 THR A CB    1 
ATOM   425  O  OG1   . THR A 1 76  ? 7.098  45.089 17.518  1.00 21.86 ? 1026 THR A OG1   1 
ATOM   426  C  CG2   . THR A 1 76  ? 8.945  46.548 18.165  1.00 22.18 ? 1026 THR A CG2   1 
ATOM   427  N  N     . HIS A 1 77  ? 8.228  41.824 17.958  1.00 19.29 ? 1027 HIS A N     1 
ATOM   428  C  CA    . HIS A 1 77  ? 7.467  40.587 18.141  1.00 19.45 ? 1027 HIS A CA    1 
ATOM   429  C  C     . HIS A 1 77  ? 8.260  39.494 18.851  1.00 19.16 ? 1027 HIS A C     1 
ATOM   430  O  O     . HIS A 1 77  ? 7.705  38.448 19.212  1.00 20.43 ? 1027 HIS A O     1 
ATOM   431  C  CB    . HIS A 1 77  ? 6.924  40.082 16.799  1.00 19.82 ? 1027 HIS A CB    1 
ATOM   432  C  CG    . HIS A 1 77  ? 5.827  40.933 16.231  1.00 21.21 ? 1027 HIS A CG    1 
ATOM   433  N  ND1   . HIS A 1 77  ? 5.103  40.562 15.119  1.00 21.79 ? 1027 HIS A ND1   1 
ATOM   434  C  CD2   . HIS A 1 77  ? 5.325  42.132 16.623  1.00 22.38 ? 1027 HIS A CD2   1 
ATOM   435  C  CE1   . HIS A 1 77  ? 4.208  41.498 14.842  1.00 23.24 ? 1027 HIS A CE1   1 
ATOM   436  N  NE2   . HIS A 1 77  ? 4.324  42.463 15.737  1.00 23.31 ? 1027 HIS A NE2   1 
ATOM   437  N  N     . LEU A 1 78  ? 9.552  39.732 19.051  1.00 18.67 ? 1028 LEU A N     1 
ATOM   438  C  CA    . LEU A 1 78  ? 10.405 38.793 19.766  1.00 17.78 ? 1028 LEU A CA    1 
ATOM   439  C  C     . LEU A 1 78  ? 10.078 38.774 21.248  1.00 17.95 ? 1028 LEU A C     1 
ATOM   440  O  O     . LEU A 1 78  ? 9.922  39.827 21.866  1.00 19.10 ? 1028 LEU A O     1 
ATOM   441  C  CB    . LEU A 1 78  ? 11.873 39.195 19.600  1.00 17.20 ? 1028 LEU A CB    1 
ATOM   442  C  CG    . LEU A 1 78  ? 12.509 38.908 18.235  1.00 16.84 ? 1028 LEU A CG    1 
ATOM   443  C  CD1   . LEU A 1 78  ? 13.901 39.568 18.106  1.00 16.08 ? 1028 LEU A CD1   1 
ATOM   444  C  CD2   . LEU A 1 78  ? 12.612 37.409 18.031  1.00 17.63 ? 1028 LEU A CD2   1 
ATOM   445  N  N     . GLN A 1 79  ? 9.967  37.575 21.797  1.00 17.68 ? 1029 GLN A N     1 
ATOM   446  C  CA    . GLN A 1 79  ? 10.038 37.401 23.238  1.00 18.03 ? 1029 GLN A CA    1 
ATOM   447  C  C     . GLN A 1 79  ? 11.524 37.293 23.560  1.00 18.24 ? 1029 GLN A C     1 
ATOM   448  O  O     . GLN A 1 79  ? 12.310 36.728 22.785  1.00 18.12 ? 1029 GLN A O     1 
ATOM   449  C  CB    . GLN A 1 79  ? 9.269  36.164 23.680  1.00 19.21 ? 1029 GLN A CB    1 
ATOM   450  C  CG    . GLN A 1 79  ? 7.768  36.283 23.438  1.00 20.60 ? 1029 GLN A CG    1 
ATOM   451  C  CD    . GLN A 1 79  ? 7.019  35.055 23.888  1.00 25.43 ? 1029 GLN A CD    1 
ATOM   452  O  OE1   . GLN A 1 79  ? 6.714  34.180 23.084  1.00 27.65 ? 1029 GLN A OE1   1 
ATOM   453  N  NE2   . GLN A 1 79  ? 6.745  34.963 25.190  1.00 25.76 ? 1029 GLN A NE2   1 
ATOM   454  N  N     . TYR A 1 80  ? 11.914 37.883 24.683  1.00 18.20 ? 1030 TYR A N     1 
ATOM   455  C  CA    . TYR A 1 80  ? 13.324 38.030 25.023  1.00 18.39 ? 1030 TYR A CA    1 
ATOM   456  C  C     . TYR A 1 80  ? 13.477 37.948 26.542  1.00 17.55 ? 1030 TYR A C     1 
ATOM   457  O  O     . TYR A 1 80  ? 12.475 38.034 27.270  1.00 18.41 ? 1030 TYR A O     1 
ATOM   458  C  CB    . TYR A 1 80  ? 13.876 39.354 24.473  1.00 19.87 ? 1030 TYR A CB    1 
ATOM   459  C  CG    . TYR A 1 80  ? 13.171 40.571 25.033  1.00 21.13 ? 1030 TYR A CG    1 
ATOM   460  C  CD1   . TYR A 1 80  ? 13.583 41.142 26.247  1.00 22.34 ? 1030 TYR A CD1   1 
ATOM   461  C  CD2   . TYR A 1 80  ? 12.096 41.146 24.359  1.00 22.53 ? 1030 TYR A CD2   1 
ATOM   462  C  CE1   . TYR A 1 80  ? 12.927 42.250 26.771  1.00 23.98 ? 1030 TYR A CE1   1 
ATOM   463  C  CE2   . TYR A 1 80  ? 11.433 42.253 24.879  1.00 24.27 ? 1030 TYR A CE2   1 
ATOM   464  C  CZ    . TYR A 1 80  ? 11.863 42.799 26.083  1.00 24.33 ? 1030 TYR A CZ    1 
ATOM   465  O  OH    . TYR A 1 80  ? 11.213 43.895 26.596  1.00 25.28 ? 1030 TYR A OH    1 
ATOM   466  N  N     . CYS A 1 81  ? 14.714 37.779 27.006  1.00 16.96 ? 1031 CYS A N     1 
ATOM   467  C  CA    . CYS A 1 81  ? 15.001 37.725 28.442  1.00 15.94 ? 1031 CYS A CA    1 
ATOM   468  C  C     . CYS A 1 81  ? 15.688 39.002 28.883  1.00 16.39 ? 1031 CYS A C     1 
ATOM   469  O  O     . CYS A 1 81  ? 16.221 39.775 28.069  1.00 16.04 ? 1031 CYS A O     1 
ATOM   470  C  CB    . CYS A 1 81  ? 15.846 36.507 28.816  1.00 16.97 ? 1031 CYS A CB    1 
ATOM   471  S  SG    . CYS A 1 81  ? 17.517 36.606 28.197  1.00 16.16 ? 1031 CYS A SG    1 
ATOM   472  N  N     . VAL A 1 82  ? 15.619 39.238 30.194  1.00 16.36 ? 1032 VAL A N     1 
ATOM   473  C  CA    . VAL A 1 82  ? 16.180 40.436 30.806  1.00 17.80 ? 1032 VAL A CA    1 
ATOM   474  C  C     . VAL A 1 82  ? 17.290 40.071 31.783  1.00 18.11 ? 1032 VAL A C     1 
ATOM   475  O  O     . VAL A 1 82  ? 17.584 40.818 32.733  1.00 18.35 ? 1032 VAL A O     1 
ATOM   476  C  CB    . VAL A 1 82  ? 15.075 41.243 31.523  1.00 17.79 ? 1032 VAL A CB    1 
ATOM   477  C  CG1   . VAL A 1 82  ? 14.099 41.806 30.500  1.00 18.27 ? 1032 VAL A CG1   1 
ATOM   478  C  CG2   . VAL A 1 82  ? 14.322 40.370 32.561  1.00 17.74 ? 1032 VAL A CG2   1 
ATOM   479  N  N     . CYS A 1 83  ? 17.922 38.930 31.534  1.00 17.41 ? 1033 CYS A N     1 
ATOM   480  C  CA    . CYS A 1 83  ? 18.889 38.353 32.457  1.00 17.96 ? 1033 CYS A CA    1 
ATOM   481  C  C     . CYS A 1 83  ? 20.053 39.301 32.725  1.00 18.72 ? 1033 CYS A C     1 
ATOM   482  O  O     . CYS A 1 83  ? 20.511 39.999 31.816  1.00 18.87 ? 1033 CYS A O     1 
ATOM   483  C  CB    . CYS A 1 83  ? 19.401 37.016 31.903  1.00 18.08 ? 1033 CYS A CB    1 
ATOM   484  S  SG    . CYS A 1 83  ? 18.131 35.743 31.889  1.00 16.85 ? 1033 CYS A SG    1 
ATOM   485  N  N     . ILE A 1 84  ? 20.493 39.330 33.979  1.00 19.04 ? 1034 ILE A N     1 
ATOM   486  C  CA    . ILE A 1 84  ? 21.653 40.122 34.409  1.00 19.81 ? 1034 ILE A CA    1 
ATOM   487  C  C     . ILE A 1 84  ? 22.922 39.270 34.546  1.00 20.19 ? 1034 ILE A C     1 
ATOM   488  O  O     . ILE A 1 84  ? 23.988 39.787 34.903  1.00 21.03 ? 1034 ILE A O     1 
ATOM   489  C  CB    . ILE A 1 84  ? 21.360 40.856 35.749  1.00 19.59 ? 1034 ILE A CB    1 
ATOM   490  C  CG1   . ILE A 1 84  ? 21.044 39.846 36.862  1.00 21.00 ? 1034 ILE A CG1   1 
ATOM   491  C  CG2   . ILE A 1 84  ? 20.221 41.834 35.554  1.00 19.52 ? 1034 ILE A CG2   1 
ATOM   492  C  CD1   . ILE A 1 84  ? 20.837 40.497 38.271  1.00 20.66 ? 1034 ILE A CD1   1 
ATOM   493  N  N     . ASP A 1 85  ? 22.792 37.971 34.274  1.00 20.18 ? 1035 ASP A N     1 
ATOM   494  C  CA    . ASP A 1 85  ? 23.887 37.006 34.324  1.00 20.48 ? 1035 ASP A CA    1 
ATOM   495  C  C     . ASP A 1 85  ? 24.135 36.392 32.932  1.00 20.04 ? 1035 ASP A C     1 
ATOM   496  O  O     . ASP A 1 85  ? 23.926 37.044 31.904  1.00 20.48 ? 1035 ASP A O     1 
ATOM   497  C  CB    . ASP A 1 85  ? 23.594 35.904 35.364  1.00 20.95 ? 1035 ASP A CB    1 
ATOM   498  C  CG    . ASP A 1 85  ? 22.406 35.018 34.981  1.00 22.89 ? 1035 ASP A CG    1 
ATOM   499  O  OD1   . ASP A 1 85  ? 21.561 35.452 34.158  1.00 21.20 ? 1035 ASP A OD1   1 
ATOM   500  O  OD2   . ASP A 1 85  ? 22.325 33.879 35.494  1.00 25.98 ? 1035 ASP A OD2   1 
ATOM   501  N  N     . ASP A 1 86  ? 24.565 35.139 32.918  1.00 20.25 ? 1036 ASP A N     1 
ATOM   502  C  CA    . ASP A 1 86  ? 24.891 34.446 31.669  1.00 20.19 ? 1036 ASP A CA    1 
ATOM   503  C  C     . ASP A 1 86  ? 23.768 33.522 31.216  1.00 19.58 ? 1036 ASP A C     1 
ATOM   504  O  O     . ASP A 1 86  ? 24.025 32.555 30.486  1.00 20.08 ? 1036 ASP A O     1 
ATOM   505  C  CB    . ASP A 1 86  ? 26.178 33.637 31.858  1.00 20.59 ? 1036 ASP A CB    1 
ATOM   506  C  CG    . ASP A 1 86  ? 26.029 32.522 32.887  1.00 23.02 ? 1036 ASP A CG    1 
ATOM   507  O  OD1   . ASP A 1 86  ? 25.007 32.501 33.612  1.00 24.44 ? 1036 ASP A OD1   1 
ATOM   508  O  OD2   . ASP A 1 86  ? 26.944 31.666 32.967  1.00 24.96 ? 1036 ASP A OD2   1 
ATOM   509  N  N     . CYS A 1 87  ? 22.541 33.802 31.667  1.00 18.55 ? 1037 CYS A N     1 
ATOM   510  C  CA    . CYS A 1 87  ? 21.357 33.016 31.303  1.00 18.47 ? 1037 CYS A CA    1 
ATOM   511  C  C     . CYS A 1 87  ? 21.408 31.555 31.772  1.00 19.64 ? 1037 CYS A C     1 
ATOM   512  O  O     . CYS A 1 87  ? 20.761 30.685 31.191  1.00 20.00 ? 1037 CYS A O     1 
ATOM   513  C  CB    . CYS A 1 87  ? 21.054 33.139 29.786  1.00 18.03 ? 1037 CYS A CB    1 
ATOM   514  S  SG    . CYS A 1 87  ? 20.697 34.814 29.274  1.00 16.84 ? 1037 CYS A SG    1 
ATOM   515  N  N     . SER A 1 88  ? 22.158 31.289 32.848  1.00 20.65 ? 1038 SER A N     1 
ATOM   516  C  CA    . SER A 1 88  ? 22.209 29.936 33.405  1.00 22.38 ? 1038 SER A CA    1 
ATOM   517  C  C     . SER A 1 88  ? 21.287 29.770 34.618  1.00 22.81 ? 1038 SER A C     1 
ATOM   518  O  O     . SER A 1 88  ? 21.260 28.706 35.231  1.00 23.68 ? 1038 SER A O     1 
ATOM   519  C  CB    . SER A 1 88  ? 23.641 29.559 33.792  1.00 22.42 ? 1038 SER A CB    1 
ATOM   520  O  OG    . SER A 1 88  ? 24.086 30.360 34.879  1.00 25.22 ? 1038 SER A OG    1 
ATOM   521  N  N     . SER A 1 89  ? 20.541 30.815 34.968  1.00 23.60 ? 1039 SER A N     1 
ATOM   522  C  CA    . SER A 1 89  ? 19.634 30.726 36.111  1.00 23.78 ? 1039 SER A CA    1 
ATOM   523  C  C     . SER A 1 89  ? 18.252 30.208 35.719  1.00 23.85 ? 1039 SER A C     1 
ATOM   524  O  O     . SER A 1 89  ? 17.885 30.189 34.537  1.00 24.05 ? 1039 SER A O     1 
ATOM   525  C  CB    . SER A 1 89  ? 19.496 32.085 36.802  1.00 24.06 ? 1039 SER A CB    1 
ATOM   526  O  OG    . SER A 1 89  ? 18.419 32.828 36.254  1.00 22.71 ? 1039 SER A OG    1 
ATOM   527  N  N     . SER A 1 90  ? 17.501 29.813 36.749  1.00 24.12 ? 1040 SER A N     1 
ATOM   528  C  CA    . SER A 1 90  ? 16.087 29.448 36.669  1.00 23.83 ? 1040 SER A CA    1 
ATOM   529  C  C     . SER A 1 90  ? 15.199 30.499 36.009  1.00 22.49 ? 1040 SER A C     1 
ATOM   530  O  O     . SER A 1 90  ? 14.131 30.176 35.487  1.00 23.00 ? 1040 SER A O     1 
ATOM   531  C  CB    . SER A 1 90  ? 15.549 29.195 38.099  1.00 23.98 ? 1040 SER A CB    1 
ATOM   532  O  OG    . SER A 1 90  ? 15.899 30.263 39.003  1.00 25.50 ? 1040 SER A OG    1 
ATOM   533  N  N     . ASN A 1 91  ? 15.644 31.752 36.037  1.00 21.28 ? 1041 ASN A N     1 
ATOM   534  C  CA    . ASN A 1 91  ? 14.776 32.890 35.731  1.00 20.53 ? 1041 ASN A CA    1 
ATOM   535  C  C     . ASN A 1 91  ? 14.810 33.363 34.277  1.00 20.57 ? 1041 ASN A C     1 
ATOM   536  O  O     . ASN A 1 91  ? 14.087 34.300 33.915  1.00 21.24 ? 1041 ASN A O     1 
ATOM   537  C  CB    . ASN A 1 91  ? 15.101 34.077 36.661  1.00 20.42 ? 1041 ASN A CB    1 
ATOM   538  C  CG    . ASN A 1 91  ? 14.423 33.962 38.032  1.00 19.59 ? 1041 ASN A CG    1 
ATOM   539  O  OD1   . ASN A 1 91  ? 13.882 34.950 38.566  1.00 21.51 ? 1041 ASN A OD1   1 
ATOM   540  N  ND2   . ASN A 1 91  ? 14.432 32.770 38.592  1.00 17.53 ? 1041 ASN A ND2   1 
ATOM   541  N  N     . CYS A 1 92  ? 15.625 32.717 33.443  1.00 19.17 ? 1042 CYS A N     1 
ATOM   542  C  CA    . CYS A 1 92  ? 15.770 33.159 32.058  1.00 18.76 ? 1042 CYS A CA    1 
ATOM   543  C  C     . CYS A 1 92  ? 14.497 32.902 31.282  1.00 18.49 ? 1042 CYS A C     1 
ATOM   544  O  O     . CYS A 1 92  ? 14.067 31.756 31.136  1.00 18.68 ? 1042 CYS A O     1 
ATOM   545  C  CB    . CYS A 1 92  ? 16.946 32.456 31.385  1.00 18.28 ? 1042 CYS A CB    1 
ATOM   546  S  SG    . CYS A 1 92  ? 17.174 32.900 29.615  1.00 17.49 ? 1042 CYS A SG    1 
ATOM   547  N  N     . MET A 1 93  ? 13.902 33.973 30.777  1.00 18.70 ? 1043 MET A N     1 
ATOM   548  C  CA    . MET A 1 93  ? 12.642 33.839 30.056  1.00 19.75 ? 1043 MET A CA    1 
ATOM   549  C  C     . MET A 1 93  ? 12.757 33.026 28.763  1.00 19.40 ? 1043 MET A C     1 
ATOM   550  O  O     . MET A 1 93  ? 11.801 32.379 28.348  1.00 19.40 ? 1043 MET A O     1 
ATOM   551  C  CB    . MET A 1 93  ? 12.009 35.212 29.846  1.00 21.33 ? 1043 MET A CB    1 
ATOM   552  C  CG    . MET A 1 93  ? 11.659 35.859 31.197  1.00 25.08 ? 1043 MET A CG    1 
ATOM   553  S  SD    . MET A 1 93  ? 10.488 34.876 32.195  1.00 35.13 ? 1043 MET A SD    1 
ATOM   554  C  CE    . MET A 1 93  ? 8.924  35.461 31.532  1.00 34.23 ? 1043 MET A CE    1 
ATOM   555  N  N     . CYS A 1 94  ? 13.929 33.049 28.142  1.00 18.90 ? 1044 CYS A N     1 
ATOM   556  C  CA    . CYS A 1 94  ? 14.139 32.252 26.926  1.00 18.51 ? 1044 CYS A CA    1 
ATOM   557  C  C     . CYS A 1 94  ? 14.199 30.759 27.251  1.00 18.90 ? 1044 CYS A C     1 
ATOM   558  O  O     . CYS A 1 94  ? 13.697 29.917 26.485  1.00 18.83 ? 1044 CYS A O     1 
ATOM   559  C  CB    . CYS A 1 94  ? 15.387 32.759 26.195  1.00 18.51 ? 1044 CYS A CB    1 
ATOM   560  S  SG    . CYS A 1 94  ? 15.227 34.496 25.761  1.00 17.78 ? 1044 CYS A SG    1 
ATOM   561  N  N     . GLY A 1 95  ? 14.783 30.440 28.407  1.00 18.90 ? 1045 GLY A N     1 
ATOM   562  C  CA    . GLY A 1 95  ? 14.775 29.094 28.933  1.00 20.21 ? 1045 GLY A CA    1 
ATOM   563  C  C     . GLY A 1 95  ? 13.354 28.649 29.193  1.00 20.82 ? 1045 GLY A C     1 
ATOM   564  O  O     . GLY A 1 95  ? 12.986 27.521 28.875  1.00 20.98 ? 1045 GLY A O     1 
ATOM   565  N  N     . GLN A 1 96  ? 12.547 29.544 29.761  1.00 22.02 ? 1046 GLN A N     1 
ATOM   566  C  CA    . GLN A 1 96  ? 11.151 29.232 30.066  1.00 23.42 ? 1046 GLN A CA    1 
ATOM   567  C  C     . GLN A 1 96  ? 10.364 28.844 28.818  1.00 23.22 ? 1046 GLN A C     1 
ATOM   568  O  O     . GLN A 1 96  ? 9.568  27.898 28.849  1.00 23.61 ? 1046 GLN A O     1 
ATOM   569  C  CB    . GLN A 1 96  ? 10.466 30.394 30.802  1.00 24.25 ? 1046 GLN A CB    1 
ATOM   570  C  CG    . GLN A 1 96  ? 8.975  30.169 31.063  1.00 28.80 ? 1046 GLN A CG    1 
ATOM   571  C  CD    . GLN A 1 96  ? 8.437  30.985 32.231  1.00 33.37 ? 1046 GLN A CD    1 
ATOM   572  O  OE1   . GLN A 1 96  ? 8.267  32.203 32.132  1.00 37.69 ? 1046 GLN A OE1   1 
ATOM   573  N  NE2   . GLN A 1 96  ? 8.150  30.309 33.340  1.00 35.23 ? 1046 GLN A NE2   1 
ATOM   574  N  N     . LEU A 1 97  ? 10.595 29.574 27.727  1.00 22.85 ? 1047 LEU A N     1 
ATOM   575  C  CA    . LEU A 1 97  ? 9.951  29.297 26.439  1.00 23.30 ? 1047 LEU A CA    1 
ATOM   576  C  C     . LEU A 1 97  ? 10.325 27.911 25.926  1.00 23.57 ? 1047 LEU A C     1 
ATOM   577  O  O     . LEU A 1 97  ? 9.523  27.253 25.261  1.00 23.35 ? 1047 LEU A O     1 
ATOM   578  C  CB    . LEU A 1 97  ? 10.388 30.336 25.406  1.00 23.21 ? 1047 LEU A CB    1 
ATOM   579  C  CG    . LEU A 1 97  ? 9.931  31.790 25.534  1.00 22.94 ? 1047 LEU A CG    1 
ATOM   580  C  CD1   . LEU A 1 97  ? 10.594 32.637 24.459  1.00 24.44 ? 1047 LEU A CD1   1 
ATOM   581  C  CD2   . LEU A 1 97  ? 8.403  31.883 25.433  1.00 25.17 ? 1047 LEU A CD2   1 
ATOM   582  N  N     . SER A 1 98  ? 11.561 27.505 26.216  1.00 24.06 ? 1048 SER A N     1 
ATOM   583  C  CA    . SER A 1 98  ? 12.113 26.213 25.805  1.00 25.01 ? 1048 SER A CA    1 
ATOM   584  C  C     . SER A 1 98  ? 11.707 25.106 26.781  1.00 26.05 ? 1048 SER A C     1 
ATOM   585  O  O     . SER A 1 98  ? 12.205 23.980 26.679  1.00 26.45 ? 1048 SER A O     1 
ATOM   586  C  CB    . SER A 1 98  ? 13.648 26.300 25.753  1.00 24.46 ? 1048 SER A CB    1 
ATOM   587  O  OG    . SER A 1 98  ? 14.102 27.460 25.052  1.00 21.51 ? 1048 SER A OG    1 
ATOM   588  N  N     . MET A 1 99  ? 10.803 25.441 27.710  1.00 27.56 ? 1049 MET A N     1 
ATOM   589  C  CA    . MET A 1 99  ? 10.486 24.640 28.915  1.00 28.39 ? 1049 MET A CA    1 
ATOM   590  C  C     . MET A 1 99  ? 11.526 24.867 30.030  1.00 28.05 ? 1049 MET A C     1 
ATOM   591  O  O     . MET A 1 99  ? 11.194 25.309 31.135  1.00 28.24 ? 1049 MET A O     1 
ATOM   592  C  CB    . MET A 1 99  ? 10.298 23.143 28.593  1.00 29.64 ? 1049 MET A CB    1 
ATOM   593  C  CG    . MET A 1 99  ? 9.246  22.860 27.513  1.00 31.66 ? 1049 MET A CG    1 
ATOM   594  S  SD    . MET A 1 99  ? 7.673  23.674 27.855  1.00 39.01 ? 1049 MET A SD    1 
ATOM   595  C  CE    . MET A 1 99  ? 6.988  23.877 26.207  1.00 35.13 ? 1049 MET A CE    1 
ATOM   596  N  N     . ARG A 1 100 ? 12.777 24.550 29.725  1.00 27.33 ? 1050 ARG A N     1 
ATOM   597  C  CA    . ARG A 1 100 ? 13.934 25.005 30.492  1.00 27.22 ? 1050 ARG A CA    1 
ATOM   598  C  C     . ARG A 1 100 ? 15.049 25.177 29.474  1.00 25.85 ? 1050 ARG A C     1 
ATOM   599  O  O     . ARG A 1 100 ? 14.937 24.665 28.356  1.00 25.27 ? 1050 ARG A O     1 
ATOM   600  C  CB    . ARG A 1 100 ? 14.336 23.978 31.562  1.00 27.67 ? 1050 ARG A CB    1 
ATOM   601  C  CG    . ARG A 1 100 ? 14.655 22.586 31.013  1.00 28.42 ? 1050 ARG A CG    1 
ATOM   602  C  CD    . ARG A 1 100 ? 14.870 21.531 32.112  1.00 29.81 ? 1050 ARG A CD    1 
ATOM   603  N  NE    . ARG A 1 100 ? 16.095 21.755 32.880  1.00 35.20 ? 1050 ARG A NE    1 
ATOM   604  C  CZ    . ARG A 1 100 ? 16.666 20.854 33.683  1.00 37.02 ? 1050 ARG A CZ    1 
ATOM   605  N  NH1   . ARG A 1 100 ? 16.146 19.634 33.823  1.00 38.22 ? 1050 ARG A NH1   1 
ATOM   606  N  NH2   . ARG A 1 100 ? 17.774 21.168 34.344  1.00 38.37 ? 1050 ARG A NH2   1 
ATOM   607  N  N     . CYS A 1 101 ? 16.113 25.890 29.831  1.00 24.94 ? 1051 CYS A N     1 
ATOM   608  C  CA    . CYS A 1 101 ? 17.319 25.852 28.993  1.00 24.64 ? 1051 CYS A CA    1 
ATOM   609  C  C     . CYS A 1 101 ? 17.935 24.458 29.057  1.00 25.08 ? 1051 CYS A C     1 
ATOM   610  O  O     . CYS A 1 101 ? 18.266 23.957 30.137  1.00 25.31 ? 1051 CYS A O     1 
ATOM   611  C  CB    . CYS A 1 101 ? 18.344 26.904 29.405  1.00 24.64 ? 1051 CYS A CB    1 
ATOM   612  S  SG    . CYS A 1 101 ? 19.865 26.884 28.381  1.00 24.04 ? 1051 CYS A SG    1 
ATOM   613  N  N     . TRP A 1 102 ? 18.077 23.833 27.892  1.00 24.38 ? 1052 TRP A N     1 
ATOM   614  C  CA    . TRP A 1 102 ? 18.550 22.450 27.810  1.00 24.54 ? 1052 TRP A CA    1 
ATOM   615  C  C     . TRP A 1 102 ? 20.057 22.335 27.620  1.00 23.94 ? 1052 TRP A C     1 
ATOM   616  O  O     . TRP A 1 102 ? 20.590 21.230 27.521  1.00 24.65 ? 1052 TRP A O     1 
ATOM   617  C  CB    . TRP A 1 102 ? 17.817 21.715 26.687  1.00 25.28 ? 1052 TRP A CB    1 
ATOM   618  C  CG    . TRP A 1 102 ? 16.343 21.636 26.930  1.00 26.65 ? 1052 TRP A CG    1 
ATOM   619  C  CD1   . TRP A 1 102 ? 15.379 22.403 26.358  1.00 26.66 ? 1052 TRP A CD1   1 
ATOM   620  C  CD2   . TRP A 1 102 ? 15.671 20.752 27.834  1.00 26.44 ? 1052 TRP A CD2   1 
ATOM   621  N  NE1   . TRP A 1 102 ? 14.144 22.057 26.845  1.00 26.17 ? 1052 TRP A NE1   1 
ATOM   622  C  CE2   . TRP A 1 102 ? 14.292 21.040 27.750  1.00 27.09 ? 1052 TRP A CE2   1 
ATOM   623  C  CE3   . TRP A 1 102 ? 16.100 19.740 28.702  1.00 27.06 ? 1052 TRP A CE3   1 
ATOM   624  C  CZ2   . TRP A 1 102 ? 13.327 20.349 28.500  1.00 26.93 ? 1052 TRP A CZ2   1 
ATOM   625  C  CZ3   . TRP A 1 102 ? 15.138 19.046 29.452  1.00 27.48 ? 1052 TRP A CZ3   1 
ATOM   626  C  CH2   . TRP A 1 102 ? 13.771 19.360 29.346  1.00 26.95 ? 1052 TRP A CH2   1 
ATOM   627  N  N     . TYR A 1 103 ? 20.752 23.465 27.596  1.00 22.97 ? 1053 TYR A N     1 
ATOM   628  C  CA    . TYR A 1 103 ? 22.186 23.451 27.340  1.00 22.20 ? 1053 TYR A CA    1 
ATOM   629  C  C     . TYR A 1 103 ? 22.990 23.512 28.617  1.00 23.42 ? 1053 TYR A C     1 
ATOM   630  O  O     . TYR A 1 103 ? 22.711 24.336 29.490  1.00 23.52 ? 1053 TYR A O     1 
ATOM   631  C  CB    . TYR A 1 103 ? 22.599 24.634 26.471  1.00 21.09 ? 1053 TYR A CB    1 
ATOM   632  C  CG    . TYR A 1 103 ? 21.943 24.703 25.115  1.00 19.59 ? 1053 TYR A CG    1 
ATOM   633  C  CD1   . TYR A 1 103 ? 21.910 23.586 24.270  1.00 18.19 ? 1053 TYR A CD1   1 
ATOM   634  C  CD2   . TYR A 1 103 ? 21.415 25.903 24.647  1.00 19.36 ? 1053 TYR A CD2   1 
ATOM   635  C  CE1   . TYR A 1 103 ? 21.322 23.663 22.990  1.00 17.01 ? 1053 TYR A CE1   1 
ATOM   636  C  CE2   . TYR A 1 103 ? 20.829 25.995 23.378  1.00 18.52 ? 1053 TYR A CE2   1 
ATOM   637  C  CZ    . TYR A 1 103 ? 20.791 24.868 22.554  1.00 18.22 ? 1053 TYR A CZ    1 
ATOM   638  O  OH    . TYR A 1 103 ? 20.234 24.943 21.291  1.00 18.10 ? 1053 TYR A OH    1 
ATOM   639  N  N     . ASP A 1 104 ? 24.007 22.665 28.699  1.00 23.92 ? 1054 ASP A N     1 
ATOM   640  C  CA    . ASP A 1 104 ? 24.948 22.735 29.817  1.00 24.81 ? 1054 ASP A CA    1 
ATOM   641  C  C     . ASP A 1 104 ? 26.061 23.731 29.504  1.00 25.56 ? 1054 ASP A C     1 
ATOM   642  O  O     . ASP A 1 104 ? 26.035 24.387 28.457  1.00 25.16 ? 1054 ASP A O     1 
ATOM   643  C  CB    . ASP A 1 104 ? 25.483 21.338 30.196  1.00 25.16 ? 1054 ASP A CB    1 
ATOM   644  C  CG    . ASP A 1 104 ? 26.425 20.725 29.142  1.00 24.91 ? 1054 ASP A CG    1 
ATOM   645  O  OD1   . ASP A 1 104 ? 26.980 21.429 28.265  1.00 25.02 ? 1054 ASP A OD1   1 
ATOM   646  O  OD2   . ASP A 1 104 ? 26.634 19.496 29.217  1.00 28.39 ? 1054 ASP A OD2   1 
ATOM   647  N  N     . LYS A 1 105 ? 27.044 23.838 30.396  1.00 26.39 ? 1055 LYS A N     1 
ATOM   648  C  CA    . LYS A 1 105 ? 28.098 24.844 30.257  1.00 27.94 ? 1055 LYS A CA    1 
ATOM   649  C  C     . LYS A 1 105 ? 28.985 24.632 29.024  1.00 27.42 ? 1055 LYS A C     1 
ATOM   650  O  O     . LYS A 1 105 ? 29.697 25.545 28.607  1.00 27.42 ? 1055 LYS A O     1 
ATOM   651  C  CB    . LYS A 1 105 ? 28.942 24.927 31.540  1.00 28.17 ? 1055 LYS A CB    1 
ATOM   652  C  CG    . LYS A 1 105 ? 29.928 23.784 31.716  1.00 30.08 ? 1055 LYS A CG    1 
ATOM   653  C  CD    . LYS A 1 105 ? 30.490 23.734 33.140  1.00 30.33 ? 1055 LYS A CD    1 
ATOM   654  C  CE    . LYS A 1 105 ? 31.544 22.635 33.282  1.00 34.41 ? 1055 LYS A CE    1 
ATOM   655  N  NZ    . LYS A 1 105 ? 31.021 21.269 32.951  1.00 36.65 ? 1055 LYS A NZ    1 
ATOM   656  N  N     . ASP A 1 106 ? 28.923 23.428 28.451  1.00 27.21 ? 1056 ASP A N     1 
ATOM   657  C  CA    . ASP A 1 106 ? 29.699 23.062 27.267  1.00 27.38 ? 1056 ASP A CA    1 
ATOM   658  C  C     . ASP A 1 106 ? 28.864 23.127 25.985  1.00 26.42 ? 1056 ASP A C     1 
ATOM   659  O  O     . ASP A 1 106 ? 29.359 22.803 24.899  1.00 26.78 ? 1056 ASP A O     1 
ATOM   660  C  CB    . ASP A 1 106 ? 30.282 21.655 27.433  1.00 27.77 ? 1056 ASP A CB    1 
ATOM   661  C  CG    . ASP A 1 106 ? 31.270 21.567 28.585  1.00 30.09 ? 1056 ASP A CG    1 
ATOM   662  O  OD1   . ASP A 1 106 ? 32.179 22.427 28.657  1.00 32.85 ? 1056 ASP A OD1   1 
ATOM   663  O  OD2   . ASP A 1 106 ? 31.129 20.641 29.414  1.00 33.45 ? 1056 ASP A OD2   1 
ATOM   664  N  N     . GLY A 1 107 ? 27.612 23.557 26.116  1.00 25.51 ? 1057 GLY A N     1 
ATOM   665  C  CA    . GLY A 1 107 ? 26.724 23.714 24.966  1.00 24.46 ? 1057 GLY A CA    1 
ATOM   666  C  C     . GLY A 1 107 ? 26.049 22.424 24.540  1.00 24.26 ? 1057 GLY A C     1 
ATOM   667  O  O     . GLY A 1 107 ? 25.467 22.366 23.455  1.00 23.59 ? 1057 GLY A O     1 
ATOM   668  N  N     . ARG A 1 108 ? 26.114 21.403 25.394  1.00 23.38 ? 1058 ARG A N     1 
ATOM   669  C  CA    . ARG A 1 108 ? 25.502 20.102 25.110  1.00 23.98 ? 1058 ARG A CA    1 
ATOM   670  C  C     . ARG A 1 108 ? 24.143 19.986 25.777  1.00 23.90 ? 1058 ARG A C     1 
ATOM   671  O  O     . ARG A 1 108 ? 23.907 20.574 26.842  1.00 23.50 ? 1058 ARG A O     1 
ATOM   672  C  CB    . ARG A 1 108 ? 26.413 18.961 25.566  1.00 24.06 ? 1058 ARG A CB    1 
ATOM   673  C  CG    . ARG A 1 108 ? 27.772 18.998 24.913  1.00 26.65 ? 1058 ARG A CG    1 
ATOM   674  C  CD    . ARG A 1 108 ? 28.634 17.810 25.284  1.00 32.16 ? 1058 ARG A CD    1 
ATOM   675  N  NE    . ARG A 1 108 ? 30.009 18.067 24.865  1.00 36.05 ? 1058 ARG A NE    1 
ATOM   676  C  CZ    . ARG A 1 108 ? 31.043 18.221 25.690  1.00 37.97 ? 1058 ARG A CZ    1 
ATOM   677  N  NH1   . ARG A 1 108 ? 30.883 18.106 27.005  1.00 39.53 ? 1058 ARG A NH1   1 
ATOM   678  N  NH2   . ARG A 1 108 ? 32.249 18.464 25.194  1.00 39.14 ? 1058 ARG A NH2   1 
ATOM   679  N  N     . LEU A 1 109 ? 23.248 19.229 25.151  1.00 24.00 ? 1059 LEU A N     1 
ATOM   680  C  CA    . LEU A 1 109 ? 21.935 18.986 25.722  1.00 24.31 ? 1059 LEU A CA    1 
ATOM   681  C  C     . LEU A 1 109 ? 22.073 18.181 27.011  1.00 25.54 ? 1059 LEU A C     1 
ATOM   682  O  O     . LEU A 1 109 ? 22.888 17.251 27.087  1.00 25.44 ? 1059 LEU A O     1 
ATOM   683  C  CB    . LEU A 1 109 ? 21.045 18.227 24.741  1.00 23.69 ? 1059 LEU A CB    1 
ATOM   684  C  CG    . LEU A 1 109 ? 20.721 18.903 23.411  1.00 22.92 ? 1059 LEU A CG    1 
ATOM   685  C  CD1   . LEU A 1 109 ? 20.049 17.872 22.507  1.00 21.60 ? 1059 LEU A CD1   1 
ATOM   686  C  CD2   . LEU A 1 109 ? 19.850 20.132 23.601  1.00 21.68 ? 1059 LEU A CD2   1 
ATOM   687  N  N     . LEU A 1 110 ? 21.287 18.554 28.015  1.00 27.21 ? 1060 LEU A N     1 
ATOM   688  C  CA    . LEU A 1 110 ? 21.291 17.856 29.308  1.00 28.76 ? 1060 LEU A CA    1 
ATOM   689  C  C     . LEU A 1 110 ? 20.795 16.422 29.124  1.00 29.70 ? 1060 LEU A C     1 
ATOM   690  O  O     . LEU A 1 110 ? 19.974 16.171 28.236  1.00 29.32 ? 1060 LEU A O     1 
ATOM   691  C  CB    . LEU A 1 110 ? 20.380 18.577 30.301  1.00 28.92 ? 1060 LEU A CB    1 
ATOM   692  C  CG    . LEU A 1 110 ? 20.533 20.086 30.488  1.00 30.29 ? 1060 LEU A CG    1 
ATOM   693  C  CD1   . LEU A 1 110 ? 19.359 20.630 31.281  1.00 31.82 ? 1060 LEU A CD1   1 
ATOM   694  C  CD2   . LEU A 1 110 ? 21.846 20.448 31.158  1.00 32.67 ? 1060 LEU A CD2   1 
ATOM   695  N  N     . PRO A 1 111 ? 21.291 15.470 29.952  1.00 30.85 ? 1061 PRO A N     1 
ATOM   696  C  CA    . PRO A 1 111 ? 20.792 14.084 29.882  1.00 31.42 ? 1061 PRO A CA    1 
ATOM   697  C  C     . PRO A 1 111 ? 19.264 13.961 29.933  1.00 31.88 ? 1061 PRO A C     1 
ATOM   698  O  O     . PRO A 1 111 ? 18.708 13.019 29.365  1.00 32.19 ? 1061 PRO A O     1 
ATOM   699  C  CB    . PRO A 1 111 ? 21.421 13.415 31.113  1.00 31.54 ? 1061 PRO A CB    1 
ATOM   700  C  CG    . PRO A 1 111 ? 22.646 14.207 31.396  1.00 31.61 ? 1061 PRO A CG    1 
ATOM   701  C  CD    . PRO A 1 111 ? 22.364 15.624 30.955  1.00 31.03 ? 1061 PRO A CD    1 
ATOM   702  N  N     . GLU A 1 112 ? 18.606 14.920 30.583  1.00 32.35 ? 1062 GLU A N     1 
ATOM   703  C  CA    . GLU A 1 112 ? 17.146 14.936 30.752  1.00 33.06 ? 1062 GLU A CA    1 
ATOM   704  C  C     . GLU A 1 112 ? 16.371 15.252 29.471  1.00 32.55 ? 1062 GLU A C     1 
ATOM   705  O  O     . GLU A 1 112 ? 15.159 15.039 29.413  1.00 32.54 ? 1062 GLU A O     1 
ATOM   706  C  CB    . GLU A 1 112 ? 16.745 15.955 31.830  1.00 33.62 ? 1062 GLU A CB    1 
ATOM   707  C  CG    . GLU A 1 112 ? 17.102 15.566 33.264  1.00 36.74 ? 1062 GLU A CG    1 
ATOM   708  C  CD    . GLU A 1 112 ? 18.603 15.550 33.521  1.00 40.07 ? 1062 GLU A CD    1 
ATOM   709  O  OE1   . GLU A 1 112 ? 19.321 16.420 32.970  1.00 40.26 ? 1062 GLU A OE1   1 
ATOM   710  O  OE2   . GLU A 1 112 ? 19.063 14.660 34.273  1.00 41.68 ? 1062 GLU A OE2   1 
ATOM   711  N  N     . PHE A 1 113 ? 17.069 15.770 28.457  1.00 31.86 ? 1063 PHE A N     1 
ATOM   712  C  CA    . PHE A 1 113 ? 16.450 16.160 27.186  1.00 31.03 ? 1063 PHE A CA    1 
ATOM   713  C  C     . PHE A 1 113 ? 15.750 14.974 26.528  1.00 31.14 ? 1063 PHE A C     1 
ATOM   714  O  O     . PHE A 1 113 ? 16.347 13.909 26.359  1.00 31.30 ? 1063 PHE A O     1 
ATOM   715  C  CB    . PHE A 1 113 ? 17.515 16.748 26.244  1.00 30.01 ? 1063 PHE A CB    1 
ATOM   716  C  CG    . PHE A 1 113 ? 16.952 17.365 24.979  1.00 28.31 ? 1063 PHE A CG    1 
ATOM   717  C  CD1   . PHE A 1 113 ? 16.525 18.688 24.965  1.00 26.18 ? 1063 PHE A CD1   1 
ATOM   718  C  CD2   . PHE A 1 113 ? 16.875 16.624 23.798  1.00 27.06 ? 1063 PHE A CD2   1 
ATOM   719  C  CE1   . PHE A 1 113 ? 16.009 19.271 23.797  1.00 25.64 ? 1063 PHE A CE1   1 
ATOM   720  C  CE2   . PHE A 1 113 ? 16.362 17.198 22.620  1.00 25.38 ? 1063 PHE A CE2   1 
ATOM   721  C  CZ    . PHE A 1 113 ? 15.936 18.516 22.620  1.00 26.26 ? 1063 PHE A CZ    1 
ATOM   722  N  N     . ASN A 1 114 ? 14.487 15.164 26.160  1.00 31.55 ? 1064 ASN A N     1 
ATOM   723  C  CA    . ASN A 1 114 ? 13.700 14.101 25.539  1.00 32.18 ? 1064 ASN A CA    1 
ATOM   724  C  C     . ASN A 1 114 ? 14.005 13.956 24.054  1.00 32.35 ? 1064 ASN A C     1 
ATOM   725  O  O     . ASN A 1 114 ? 13.444 14.669 23.226  1.00 32.11 ? 1064 ASN A O     1 
ATOM   726  C  CB    . ASN A 1 114 ? 12.201 14.350 25.746  1.00 32.71 ? 1064 ASN A CB    1 
ATOM   727  C  CG    . ASN A 1 114 ? 11.338 13.171 25.300  1.00 33.65 ? 1064 ASN A CG    1 
ATOM   728  O  OD1   . ASN A 1 114 ? 11.806 12.249 24.622  1.00 34.79 ? 1064 ASN A OD1   1 
ATOM   729  N  ND2   . ASN A 1 114 ? 10.066 13.203 25.679  1.00 35.25 ? 1064 ASN A ND2   1 
ATOM   730  N  N     . MET A 1 115 ? 14.877 13.010 23.720  1.00 32.72 ? 1065 MET A N     1 
ATOM   731  C  CA    . MET A 1 115 ? 15.275 12.791 22.327  1.00 33.44 ? 1065 MET A CA    1 
ATOM   732  C  C     . MET A 1 115 ? 14.183 12.138 21.479  1.00 33.56 ? 1065 MET A C     1 
ATOM   733  O  O     . MET A 1 115 ? 14.156 12.303 20.255  1.00 33.83 ? 1065 MET A O     1 
ATOM   734  C  CB    . MET A 1 115 ? 16.568 11.991 22.255  1.00 33.76 ? 1065 MET A CB    1 
ATOM   735  C  CG    . MET A 1 115 ? 17.677 12.596 23.074  1.00 35.08 ? 1065 MET A CG    1 
ATOM   736  S  SD    . MET A 1 115 ? 19.093 12.945 22.039  1.00 38.93 ? 1065 MET A SD    1 
ATOM   737  C  CE    . MET A 1 115 ? 20.113 13.955 23.116  1.00 35.92 ? 1065 MET A CE    1 
ATOM   738  N  N     . ALA A 1 116 ? 13.287 11.403 22.135  1.00 33.35 ? 1066 ALA A N     1 
ATOM   739  C  CA    . ALA A 1 116 ? 12.161 10.772 21.461  1.00 33.52 ? 1066 ALA A CA    1 
ATOM   740  C  C     . ALA A 1 116 ? 11.113 11.793 21.039  1.00 33.49 ? 1066 ALA A C     1 
ATOM   741  O  O     . ALA A 1 116 ? 10.472 11.641 19.998  1.00 34.08 ? 1066 ALA A O     1 
ATOM   742  C  CB    . ALA A 1 116 ? 11.533 9.710  22.367  1.00 33.66 ? 1066 ALA A CB    1 
ATOM   743  N  N     . GLU A 1 117 ? 10.951 12.832 21.856  1.00 33.09 ? 1067 GLU A N     1 
ATOM   744  C  CA    . GLU A 1 117 ? 9.955  13.873 21.626  1.00 32.81 ? 1067 GLU A CA    1 
ATOM   745  C  C     . GLU A 1 117 ? 10.551 15.236 22.005  1.00 31.19 ? 1067 GLU A C     1 
ATOM   746  O  O     . GLU A 1 117 ? 10.204 15.799 23.049  1.00 30.87 ? 1067 GLU A O     1 
ATOM   747  C  CB    . GLU A 1 117 ? 8.706  13.582 22.462  1.00 32.88 ? 1067 GLU A CB    1 
ATOM   748  C  CG    . GLU A 1 117 ? 7.438  14.270 21.976  1.00 35.15 ? 1067 GLU A CG    1 
ATOM   749  C  CD    . GLU A 1 117 ? 6.290  14.164 22.974  1.00 35.45 ? 1067 GLU A CD    1 
ATOM   750  O  OE1   . GLU A 1 117 ? 5.644  15.207 23.244  1.00 39.18 ? 1067 GLU A OE1   1 
ATOM   751  O  OE2   . GLU A 1 117 ? 6.038  13.049 23.500  1.00 39.04 ? 1067 GLU A OE2   1 
ATOM   752  N  N     . PRO A 1 118 ? 11.466 15.765 21.164  1.00 29.85 ? 1068 PRO A N     1 
ATOM   753  C  CA    . PRO A 1 118 ? 12.166 17.003 21.520  1.00 28.66 ? 1068 PRO A CA    1 
ATOM   754  C  C     . PRO A 1 118 ? 11.239 18.206 21.646  1.00 27.30 ? 1068 PRO A C     1 
ATOM   755  O  O     . PRO A 1 118 ? 10.330 18.375 20.826  1.00 27.46 ? 1068 PRO A O     1 
ATOM   756  C  CB    . PRO A 1 118 ? 13.135 17.215 20.348  1.00 28.37 ? 1068 PRO A CB    1 
ATOM   757  C  CG    . PRO A 1 118 ? 13.272 15.868 19.713  1.00 29.55 ? 1068 PRO A CG    1 
ATOM   758  C  CD    . PRO A 1 118 ? 11.914 15.252 19.856  1.00 29.85 ? 1068 PRO A CD    1 
ATOM   759  N  N     . PRO A 1 119 ? 11.478 19.051 22.659  1.00 26.26 ? 1069 PRO A N     1 
ATOM   760  C  CA    . PRO A 1 119 ? 10.779 20.323 22.771  1.00 25.27 ? 1069 PRO A CA    1 
ATOM   761  C  C     . PRO A 1 119 ? 11.328 21.306 21.743  1.00 23.68 ? 1069 PRO A C     1 
ATOM   762  O  O     . PRO A 1 119 ? 12.375 21.047 21.148  1.00 24.07 ? 1069 PRO A O     1 
ATOM   763  C  CB    . PRO A 1 119 ? 11.144 20.797 24.181  1.00 25.69 ? 1069 PRO A CB    1 
ATOM   764  C  CG    . PRO A 1 119 ? 12.481 20.189 24.431  1.00 26.57 ? 1069 PRO A CG    1 
ATOM   765  C  CD    . PRO A 1 119 ? 12.444 18.853 23.755  1.00 26.23 ? 1069 PRO A CD    1 
ATOM   766  N  N     . LEU A 1 120 ? 10.617 22.404 21.530  1.00 22.54 ? 1070 LEU A N     1 
ATOM   767  C  CA    . LEU A 1 120 ? 11.134 23.523 20.748  1.00 21.07 ? 1070 LEU A CA    1 
ATOM   768  C  C     . LEU A 1 120 ? 12.181 24.233 21.578  1.00 20.21 ? 1070 LEU A C     1 
ATOM   769  O  O     . LEU A 1 120 ? 11.985 24.438 22.788  1.00 20.68 ? 1070 LEU A O     1 
ATOM   770  C  CB    . LEU A 1 120 ? 10.028 24.530 20.435  1.00 21.10 ? 1070 LEU A CB    1 
ATOM   771  C  CG    . LEU A 1 120 ? 8.756  24.072 19.728  1.00 21.93 ? 1070 LEU A CG    1 
ATOM   772  C  CD1   . LEU A 1 120 ? 7.780  25.207 19.659  1.00 22.30 ? 1070 LEU A CD1   1 
ATOM   773  C  CD2   . LEU A 1 120 ? 9.086  23.600 18.329  1.00 23.68 ? 1070 LEU A CD2   1 
ATOM   774  N  N     . ILE A 1 121 ? 13.279 24.635 20.944  1.00 18.03 ? 1071 ILE A N     1 
ATOM   775  C  CA    . ILE A 1 121 ? 14.299 25.402 21.656  1.00 17.04 ? 1071 ILE A CA    1 
ATOM   776  C  C     . ILE A 1 121 ? 14.243 26.845 21.197  1.00 16.39 ? 1071 ILE A C     1 
ATOM   777  O  O     . ILE A 1 121 ? 14.228 27.101 19.990  1.00 16.75 ? 1071 ILE A O     1 
ATOM   778  C  CB    . ILE A 1 121 ? 15.716 24.840 21.422  1.00 16.55 ? 1071 ILE A CB    1 
ATOM   779  C  CG1   . ILE A 1 121 ? 15.846 23.453 22.070  1.00 17.73 ? 1071 ILE A CG1   1 
ATOM   780  C  CG2   . ILE A 1 121 ? 16.796 25.812 21.938  1.00 15.96 ? 1071 ILE A CG2   1 
ATOM   781  C  CD1   . ILE A 1 121 ? 17.176 22.738 21.804  1.00 17.72 ? 1071 ILE A CD1   1 
ATOM   782  N  N     . PHE A 1 122 ? 14.162 27.768 22.160  1.00 15.72 ? 1072 PHE A N     1 
ATOM   783  C  CA    . PHE A 1 122 ? 14.278 29.190 21.891  1.00 15.48 ? 1072 PHE A CA    1 
ATOM   784  C  C     . PHE A 1 122 ? 15.602 29.666 22.439  1.00 15.39 ? 1072 PHE A C     1 
ATOM   785  O  O     . PHE A 1 122 ? 15.762 29.805 23.653  1.00 15.11 ? 1072 PHE A O     1 
ATOM   786  C  CB    . PHE A 1 122 ? 13.116 29.979 22.527  1.00 15.13 ? 1072 PHE A CB    1 
ATOM   787  C  CG    . PHE A 1 122 ? 11.780 29.698 21.881  1.00 15.59 ? 1072 PHE A CG    1 
ATOM   788  C  CD1   . PHE A 1 122 ? 11.256 30.556 20.926  1.00 16.33 ? 1072 PHE A CD1   1 
ATOM   789  C  CD2   . PHE A 1 122 ? 11.067 28.547 22.207  1.00 16.80 ? 1072 PHE A CD2   1 
ATOM   790  C  CE1   . PHE A 1 122 ? 10.015 30.270 20.300  1.00 16.49 ? 1072 PHE A CE1   1 
ATOM   791  C  CE2   . PHE A 1 122 ? 9.834  28.257 21.597  1.00 17.43 ? 1072 PHE A CE2   1 
ATOM   792  C  CZ    . PHE A 1 122 ? 9.306  29.122 20.654  1.00 16.99 ? 1072 PHE A CZ    1 
ATOM   793  N  N     . GLU A 1 123 ? 16.566 29.893 21.551  1.00 14.46 ? 1073 GLU A N     1 
ATOM   794  C  CA    . GLU A 1 123 ? 17.828 30.490 21.953  1.00 14.19 ? 1073 GLU A CA    1 
ATOM   795  C  C     . GLU A 1 123 ? 17.683 31.986 22.206  1.00 14.45 ? 1073 GLU A C     1 
ATOM   796  O  O     . GLU A 1 123 ? 16.712 32.626 21.775  1.00 14.77 ? 1073 GLU A O     1 
ATOM   797  C  CB    . GLU A 1 123 ? 18.922 30.231 20.903  1.00 14.03 ? 1073 GLU A CB    1 
ATOM   798  C  CG    . GLU A 1 123 ? 19.193 28.753 20.748  1.00 15.48 ? 1073 GLU A CG    1 
ATOM   799  C  CD    . GLU A 1 123 ? 20.506 28.431 20.077  1.00 14.01 ? 1073 GLU A CD    1 
ATOM   800  O  OE1   . GLU A 1 123 ? 21.179 29.348 19.554  1.00 14.96 ? 1073 GLU A OE1   1 
ATOM   801  O  OE2   . GLU A 1 123 ? 20.875 27.238 20.102  1.00 15.65 ? 1073 GLU A OE2   1 
ATOM   802  N  N     . CYS A 1 124 ? 18.652 32.550 22.913  1.00 14.02 ? 1074 CYS A N     1 
ATOM   803  C  CA    . CYS A 1 124 ? 18.656 33.985 23.077  1.00 14.90 ? 1074 CYS A CA    1 
ATOM   804  C  C     . CYS A 1 124 ? 18.860 34.698 21.748  1.00 15.27 ? 1074 CYS A C     1 
ATOM   805  O  O     . CYS A 1 124 ? 19.369 34.105 20.766  1.00 15.56 ? 1074 CYS A O     1 
ATOM   806  C  CB    . CYS A 1 124 ? 19.672 34.407 24.120  1.00 15.85 ? 1074 CYS A CB    1 
ATOM   807  S  SG    . CYS A 1 124 ? 19.136 33.964 25.804  1.00 15.57 ? 1074 CYS A SG    1 
ATOM   808  N  N     . ASN A 1 125 ? 18.422 35.948 21.712  1.00 15.35 ? 1075 ASN A N     1 
ATOM   809  C  CA    . ASN A 1 125 ? 18.438 36.727 20.487  1.00 15.72 ? 1075 ASN A CA    1 
ATOM   810  C  C     . ASN A 1 125 ? 18.928 38.149 20.742  1.00 15.82 ? 1075 ASN A C     1 
ATOM   811  O  O     . ASN A 1 125 ? 19.279 38.500 21.877  1.00 16.02 ? 1075 ASN A O     1 
ATOM   812  C  CB    . ASN A 1 125 ? 17.051 36.706 19.841  1.00 15.72 ? 1075 ASN A CB    1 
ATOM   813  C  CG    . ASN A 1 125 ? 15.990 37.256 20.760  1.00 16.44 ? 1075 ASN A CG    1 
ATOM   814  O  OD1   . ASN A 1 125 ? 16.029 38.432 21.095  1.00 16.92 ? 1075 ASN A OD1   1 
ATOM   815  N  ND2   . ASN A 1 125 ? 15.020 36.416 21.161  1.00 17.77 ? 1075 ASN A ND2   1 
ATOM   816  N  N     . HIS A 1 126 ? 18.969 38.947 19.681  1.00 16.06 ? 1076 HIS A N     1 
ATOM   817  C  CA    . HIS A 1 126 ? 19.492 40.322 19.737  1.00 17.10 ? 1076 HIS A CA    1 
ATOM   818  C  C     . HIS A 1 126 ? 18.591 41.282 20.520  1.00 17.38 ? 1076 HIS A C     1 
ATOM   819  O  O     . HIS A 1 126 ? 19.009 42.416 20.813  1.00 18.20 ? 1076 HIS A O     1 
ATOM   820  C  CB    . HIS A 1 126 ? 19.758 40.858 18.317  1.00 17.13 ? 1076 HIS A CB    1 
ATOM   821  C  CG    . HIS A 1 126 ? 18.585 40.721 17.398  1.00 17.76 ? 1076 HIS A CG    1 
ATOM   822  N  ND1   . HIS A 1 126 ? 18.143 39.499 16.932  1.00 18.10 ? 1076 HIS A ND1   1 
ATOM   823  C  CD2   . HIS A 1 126 ? 17.762 41.650 16.861  1.00 18.23 ? 1076 HIS A CD2   1 
ATOM   824  C  CE1   . HIS A 1 126 ? 17.089 39.684 16.154  1.00 17.88 ? 1076 HIS A CE1   1 
ATOM   825  N  NE2   . HIS A 1 126 ? 16.830 40.978 16.106  1.00 18.75 ? 1076 HIS A NE2   1 
ATOM   826  N  N     . ALA A 1 127 ? 17.376 40.842 20.872  1.00 17.42 ? 1077 ALA A N     1 
ATOM   827  C  CA    . ALA A 1 127 ? 16.494 41.655 21.731  1.00 17.79 ? 1077 ALA A CA    1 
ATOM   828  C  C     . ALA A 1 127 ? 16.717 41.382 23.235  1.00 18.02 ? 1077 ALA A C     1 
ATOM   829  O  O     . ALA A 1 127 ? 16.282 42.174 24.080  1.00 18.83 ? 1077 ALA A O     1 
ATOM   830  C  CB    . ALA A 1 127 ? 15.013 41.469 21.354  1.00 18.18 ? 1077 ALA A CB    1 
ATOM   831  N  N     . CYS A 1 128 ? 17.381 40.270 23.567  1.00 17.61 ? 1078 CYS A N     1 
ATOM   832  C  CA    . CYS A 1 128 ? 17.680 39.945 24.971  1.00 16.55 ? 1078 CYS A CA    1 
ATOM   833  C  C     . CYS A 1 128 ? 18.665 40.912 25.578  1.00 17.34 ? 1078 CYS A C     1 
ATOM   834  O  O     . CYS A 1 128 ? 19.473 41.512 24.871  1.00 16.69 ? 1078 CYS A O     1 
ATOM   835  C  CB    . CYS A 1 128 ? 18.242 38.533 25.103  1.00 16.18 ? 1078 CYS A CB    1 
ATOM   836  S  SG    . CYS A 1 128 ? 17.099 37.297 24.522  1.00 16.72 ? 1078 CYS A SG    1 
ATOM   837  N  N     . SER A 1 129 ? 18.609 41.032 26.905  1.00 16.98 ? 1079 SER A N     1 
ATOM   838  C  CA    . SER A 1 129 ? 19.513 41.920 27.635  1.00 18.33 ? 1079 SER A CA    1 
ATOM   839  C  C     . SER A 1 129 ? 20.886 41.314 27.862  1.00 17.99 ? 1079 SER A C     1 
ATOM   840  O  O     . SER A 1 129 ? 21.827 42.037 28.213  1.00 19.14 ? 1079 SER A O     1 
ATOM   841  C  CB    . SER A 1 129 ? 18.903 42.316 28.984  1.00 18.38 ? 1079 SER A CB    1 
ATOM   842  O  OG    . SER A 1 129 ? 17.686 43.011 28.774  1.00 20.09 ? 1079 SER A OG    1 
ATOM   843  N  N     . CYS A 1 130 ? 21.002 39.998 27.659  1.00 17.70 ? 1080 CYS A N     1 
ATOM   844  C  CA    . CYS A 1 130 ? 22.244 39.273 27.914  1.00 17.53 ? 1080 CYS A CA    1 
ATOM   845  C  C     . CYS A 1 130 ? 23.317 39.530 26.849  1.00 17.84 ? 1080 CYS A C     1 
ATOM   846  O  O     . CYS A 1 130 ? 23.072 40.193 25.828  1.00 18.22 ? 1080 CYS A O     1 
ATOM   847  C  CB    . CYS A 1 130 ? 21.975 37.780 28.017  1.00 17.09 ? 1080 CYS A CB    1 
ATOM   848  S  SG    . CYS A 1 130 ? 21.103 37.175 26.541  1.00 16.68 ? 1080 CYS A SG    1 
ATOM   849  N  N     . TRP A 1 131 ? 24.513 39.024 27.121  1.00 18.13 ? 1081 TRP A N     1 
ATOM   850  C  CA    . TRP A 1 131 ? 25.639 39.156 26.202  1.00 18.99 ? 1081 TRP A CA    1 
ATOM   851  C  C     . TRP A 1 131 ? 25.643 38.048 25.155  1.00 18.05 ? 1081 TRP A C     1 
ATOM   852  O  O     . TRP A 1 131 ? 25.040 36.988 25.354  1.00 18.09 ? 1081 TRP A O     1 
ATOM   853  C  CB    . TRP A 1 131 ? 26.941 39.129 26.992  1.00 20.36 ? 1081 TRP A CB    1 
ATOM   854  C  CG    . TRP A 1 131 ? 27.125 40.390 27.749  1.00 22.17 ? 1081 TRP A CG    1 
ATOM   855  C  CD1   . TRP A 1 131 ? 26.258 40.932 28.661  1.00 24.56 ? 1081 TRP A CD1   1 
ATOM   856  C  CD2   . TRP A 1 131 ? 28.235 41.285 27.666  1.00 22.96 ? 1081 TRP A CD2   1 
ATOM   857  N  NE1   . TRP A 1 131 ? 26.764 42.112 29.146  1.00 26.40 ? 1081 TRP A NE1   1 
ATOM   858  C  CE2   . TRP A 1 131 ? 27.977 42.351 28.554  1.00 23.92 ? 1081 TRP A CE2   1 
ATOM   859  C  CE3   . TRP A 1 131 ? 29.429 41.289 26.934  1.00 23.13 ? 1081 TRP A CE3   1 
ATOM   860  C  CZ2   . TRP A 1 131 ? 28.865 43.423 28.719  1.00 25.06 ? 1081 TRP A CZ2   1 
ATOM   861  C  CZ3   . TRP A 1 131 ? 30.313 42.355 27.104  1.00 23.74 ? 1081 TRP A CZ3   1 
ATOM   862  C  CH2   . TRP A 1 131 ? 30.023 43.403 27.988  1.00 23.28 ? 1081 TRP A CH2   1 
ATOM   863  N  N     . ARG A 1 132 ? 26.345 38.305 24.048  1.00 18.01 ? 1082 ARG A N     1 
ATOM   864  C  CA    . ARG A 1 132 ? 26.427 37.353 22.936  1.00 17.93 ? 1082 ARG A CA    1 
ATOM   865  C  C     . ARG A 1 132 ? 27.023 35.983 23.322  1.00 18.21 ? 1082 ARG A C     1 
ATOM   866  O  O     . ARG A 1 132 ? 26.845 34.992 22.597  1.00 18.19 ? 1082 ARG A O     1 
ATOM   867  C  CB    . ARG A 1 132 ? 27.200 37.997 21.766  1.00 17.75 ? 1082 ARG A CB    1 
ATOM   868  C  CG    . ARG A 1 132 ? 27.315 37.143 20.496  1.00 18.27 ? 1082 ARG A CG    1 
ATOM   869  C  CD    . ARG A 1 132 ? 25.950 36.796 19.939  1.00 18.35 ? 1082 ARG A CD    1 
ATOM   870  N  NE    . ARG A 1 132 ? 26.074 35.982 18.726  1.00 18.57 ? 1082 ARG A NE    1 
ATOM   871  C  CZ    . ARG A 1 132 ? 26.336 34.671 18.722  1.00 18.88 ? 1082 ARG A CZ    1 
ATOM   872  N  NH1   . ARG A 1 132 ? 26.493 34.004 19.862  1.00 17.43 ? 1082 ARG A NH1   1 
ATOM   873  N  NH2   . ARG A 1 132 ? 26.444 34.016 17.567  1.00 19.36 ? 1082 ARG A NH2   1 
ATOM   874  N  N     . ASN A 1 133 ? 27.709 35.914 24.467  1.00 17.73 ? 1083 ASN A N     1 
ATOM   875  C  CA    . ASN A 1 133 ? 28.318 34.674 24.919  1.00 18.66 ? 1083 ASN A CA    1 
ATOM   876  C  C     . ASN A 1 133 ? 27.546 33.940 26.039  1.00 18.31 ? 1083 ASN A C     1 
ATOM   877  O  O     . ASN A 1 133 ? 28.111 33.090 26.727  1.00 18.95 ? 1083 ASN A O     1 
ATOM   878  C  CB    . ASN A 1 133 ? 29.763 34.926 25.370  1.00 19.28 ? 1083 ASN A CB    1 
ATOM   879  C  CG    . ASN A 1 133 ? 29.847 35.780 26.629  1.00 21.36 ? 1083 ASN A CG    1 
ATOM   880  O  OD1   . ASN A 1 133 ? 28.875 36.432 27.025  1.00 21.87 ? 1083 ASN A OD1   1 
ATOM   881  N  ND2   . ASN A 1 133 ? 31.015 35.767 27.273  1.00 25.21 ? 1083 ASN A ND2   1 
ATOM   882  N  N     . CYS A 1 134 ? 26.264 34.261 26.212  1.00 17.96 ? 1084 CYS A N     1 
ATOM   883  C  CA    . CYS A 1 134 ? 25.464 33.604 27.247  1.00 17.78 ? 1084 CYS A CA    1 
ATOM   884  C  C     . CYS A 1 134 ? 25.279 32.118 26.960  1.00 17.94 ? 1084 CYS A C     1 
ATOM   885  O  O     . CYS A 1 134 ? 25.583 31.628 25.859  1.00 18.08 ? 1084 CYS A O     1 
ATOM   886  C  CB    . CYS A 1 134 ? 24.104 34.296 27.426  1.00 17.66 ? 1084 CYS A CB    1 
ATOM   887  S  SG    . CYS A 1 134 ? 22.820 33.659 26.303  1.00 16.67 ? 1084 CYS A SG    1 
ATOM   888  N  N     . ARG A 1 135 ? 24.777 31.408 27.969  1.00 17.78 ? 1085 ARG A N     1 
ATOM   889  C  CA    . ARG A 1 135 ? 24.636 29.964 27.950  1.00 18.08 ? 1085 ARG A CA    1 
ATOM   890  C  C     . ARG A 1 135 ? 23.663 29.505 26.867  1.00 17.60 ? 1085 ARG A C     1 
ATOM   891  O  O     . ARG A 1 135 ? 23.835 28.426 26.297  1.00 18.75 ? 1085 ARG A O     1 
ATOM   892  C  CB    . ARG A 1 135 ? 24.122 29.490 29.311  1.00 18.42 ? 1085 ARG A CB    1 
ATOM   893  C  CG    . ARG A 1 135 ? 23.745 28.021 29.368  1.00 22.43 ? 1085 ARG A CG    1 
ATOM   894  C  CD    . ARG A 1 135 ? 24.957 27.156 29.592  1.00 28.31 ? 1085 ARG A CD    1 
ATOM   895  N  NE    . ARG A 1 135 ? 25.549 27.378 30.913  1.00 31.11 ? 1085 ARG A NE    1 
ATOM   896  C  CZ    . ARG A 1 135 ? 25.220 26.699 32.010  1.00 33.40 ? 1085 ARG A CZ    1 
ATOM   897  N  NH1   . ARG A 1 135 ? 24.302 25.741 31.965  1.00 34.13 ? 1085 ARG A NH1   1 
ATOM   898  N  NH2   . ARG A 1 135 ? 25.817 26.977 33.159  1.00 33.71 ? 1085 ARG A NH2   1 
ATOM   899  N  N     . ASN A 1 136 ? 22.648 30.326 26.601  1.00 17.25 ? 1086 ASN A N     1 
ATOM   900  C  CA    . ASN A 1 136 ? 21.523 29.886 25.766  1.00 16.71 ? 1086 ASN A CA    1 
ATOM   901  C  C     . ASN A 1 136 ? 21.705 30.213 24.285  1.00 16.76 ? 1086 ASN A C     1 
ATOM   902  O  O     . ASN A 1 136 ? 20.797 30.731 23.627  1.00 16.69 ? 1086 ASN A O     1 
ATOM   903  C  CB    . ASN A 1 136 ? 20.214 30.448 26.299  1.00 16.75 ? 1086 ASN A CB    1 
ATOM   904  C  CG    . ASN A 1 136 ? 18.996 29.793 25.667  1.00 17.55 ? 1086 ASN A CG    1 
ATOM   905  O  OD1   . ASN A 1 136 ? 19.028 28.617 25.309  1.00 18.19 ? 1086 ASN A OD1   1 
ATOM   906  N  ND2   . ASN A 1 136 ? 17.914 30.565 25.520  1.00 16.82 ? 1086 ASN A ND2   1 
ATOM   907  N  N     . ARG A 1 137 ? 22.889 29.886 23.775  1.00 16.77 ? 1087 ARG A N     1 
ATOM   908  C  CA    . ARG A 1 137 ? 23.255 30.155 22.395  1.00 17.02 ? 1087 ARG A CA    1 
ATOM   909  C  C     . ARG A 1 137 ? 24.198 29.051 21.957  1.00 17.46 ? 1087 ARG A C     1 
ATOM   910  O  O     . ARG A 1 137 ? 25.314 28.911 22.489  1.00 17.91 ? 1087 ARG A O     1 
ATOM   911  C  CB    . ARG A 1 137 ? 23.944 31.513 22.285  1.00 16.81 ? 1087 ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 137 ? 23.050 32.689 22.655  1.00 15.62 ? 1087 ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 137 ? 23.854 33.957 22.673  1.00 17.12 ? 1087 ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 137 ? 23.170 35.078 23.321  1.00 16.04 ? 1087 ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 137 ? 22.583 36.086 22.669  1.00 18.26 ? 1087 ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 137 ? 22.528 36.095 21.336  1.00 18.73 ? 1087 ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 137 ? 22.036 37.092 23.341  1.00 18.23 ? 1087 ARG A NH2   1 
ATOM   918  N  N     . VAL A 1 138 ? 23.743 28.244 21.002  1.00 16.62 ? 1088 VAL A N     1 
ATOM   919  C  CA    . VAL A 1 138 ? 24.549 27.102 20.551  1.00 15.79 ? 1088 VAL A CA    1 
ATOM   920  C  C     . VAL A 1 138 ? 24.408 26.965 19.052  1.00 15.73 ? 1088 VAL A C     1 
ATOM   921  O  O     . VAL A 1 138 ? 25.385 27.076 18.314  1.00 15.56 ? 1088 VAL A O     1 
ATOM   922  C  CB    . VAL A 1 138 ? 24.124 25.797 21.266  1.00 16.44 ? 1088 VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 138 ? 24.739 24.567 20.593  1.00 15.04 ? 1088 VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 138 ? 24.513 25.854 22.748  1.00 16.89 ? 1088 VAL A CG2   1 
ATOM   925  N  N     . VAL A 1 139 ? 23.182 26.748 18.597  1.00 15.25 ? 1089 VAL A N     1 
ATOM   926  C  CA    . VAL A 1 139 ? 22.941 26.598 17.158  1.00 15.05 ? 1089 VAL A CA    1 
ATOM   927  C  C     . VAL A 1 139 ? 23.321 27.870 16.375  1.00 15.71 ? 1089 VAL A C     1 
ATOM   928  O  O     . VAL A 1 139 ? 23.825 27.797 15.244  1.00 15.85 ? 1089 VAL A O     1 
ATOM   929  C  CB    . VAL A 1 139 ? 21.482 26.144 16.904  1.00 14.76 ? 1089 VAL A CB    1 
ATOM   930  C  CG1   . VAL A 1 139 ? 21.184 26.023 15.403  1.00 15.26 ? 1089 VAL A CG1   1 
ATOM   931  C  CG2   . VAL A 1 139 ? 21.248 24.809 17.584  1.00 14.74 ? 1089 VAL A CG2   1 
ATOM   932  N  N     . GLN A 1 140 ? 23.120 29.032 16.989  1.00 15.42 ? 1090 GLN A N     1 
ATOM   933  C  CA    . GLN A 1 140 ? 23.395 30.305 16.328  1.00 15.96 ? 1090 GLN A CA    1 
ATOM   934  C  C     . GLN A 1 140 ? 24.882 30.569 16.142  1.00 16.47 ? 1090 GLN A C     1 
ATOM   935  O  O     . GLN A 1 140 ? 25.274 31.526 15.453  1.00 18.01 ? 1090 GLN A O     1 
ATOM   936  C  CB    . GLN A 1 140 ? 22.739 31.457 17.093  1.00 15.36 ? 1090 GLN A CB    1 
ATOM   937  C  CG    . GLN A 1 140 ? 23.286 31.648 18.499  1.00 15.99 ? 1090 GLN A CG    1 
ATOM   938  C  CD    . GLN A 1 140 ? 22.425 32.611 19.263  1.00 16.01 ? 1090 GLN A CD    1 
ATOM   939  O  OE1   . GLN A 1 140 ? 21.326 32.256 19.751  1.00 18.66 ? 1090 GLN A OE1   1 
ATOM   940  N  NE2   . GLN A 1 140 ? 22.886 33.844 19.360  1.00 14.81 ? 1090 GLN A NE2   1 
ATOM   941  N  N     . ASN A 1 141 ? 25.706 29.724 16.758  1.00 16.95 ? 1091 ASN A N     1 
ATOM   942  C  CA    . ASN A 1 141 ? 27.150 29.830 16.641  1.00 18.35 ? 1091 ASN A CA    1 
ATOM   943  C  C     . ASN A 1 141 ? 27.688 28.989 15.483  1.00 19.38 ? 1091 ASN A C     1 
ATOM   944  O  O     . ASN A 1 141 ? 28.884 29.028 15.176  1.00 20.70 ? 1091 ASN A O     1 
ATOM   945  C  CB    . ASN A 1 141 ? 27.804 29.435 17.955  1.00 18.47 ? 1091 ASN A CB    1 
ATOM   946  C  CG    . ASN A 1 141 ? 27.526 30.439 19.050  1.00 19.01 ? 1091 ASN A CG    1 
ATOM   947  O  OD1   . ASN A 1 141 ? 27.154 31.579 18.770  1.00 20.55 ? 1091 ASN A OD1   1 
ATOM   948  N  ND2   . ASN A 1 141 ? 27.694 30.029 20.300  1.00 21.92 ? 1091 ASN A ND2   1 
ATOM   949  N  N     . GLY A 1 142 ? 26.801 28.213 14.869  1.00 19.54 ? 1092 GLY A N     1 
ATOM   950  C  CA    . GLY A 1 142 ? 27.135 27.484 13.658  1.00 20.73 ? 1092 GLY A CA    1 
ATOM   951  C  C     . GLY A 1 142 ? 27.902 26.196 13.840  1.00 21.50 ? 1092 GLY A C     1 
ATOM   952  O  O     . GLY A 1 142 ? 28.231 25.781 14.959  1.00 19.58 ? 1092 GLY A O     1 
ATOM   953  N  N     . LEU A 1 143 ? 28.137 25.548 12.702  1.00 23.05 ? 1093 LEU A N     1 
ATOM   954  C  CA    . LEU A 1 143 ? 28.817 24.263 12.633  1.00 24.02 ? 1093 LEU A CA    1 
ATOM   955  C  C     . LEU A 1 143 ? 30.237 24.418 13.167  1.00 24.67 ? 1093 LEU A C     1 
ATOM   956  O  O     . LEU A 1 143 ? 30.972 25.303 12.721  1.00 25.14 ? 1093 LEU A O     1 
ATOM   957  C  CB    . LEU A 1 143 ? 28.830 23.797 11.161  1.00 24.54 ? 1093 LEU A CB    1 
ATOM   958  C  CG    . LEU A 1 143 ? 29.567 22.579 10.585  1.00 24.80 ? 1093 LEU A CG    1 
ATOM   959  C  CD1   . LEU A 1 143 ? 31.039 22.876 10.310  1.00 28.06 ? 1093 LEU A CD1   1 
ATOM   960  C  CD2   . LEU A 1 143 ? 29.416 21.336 11.443  1.00 27.29 ? 1093 LEU A CD2   1 
ATOM   961  N  N     . ARG A 1 144 ? 30.618 23.577 14.127  1.00 25.30 ? 1094 ARG A N     1 
ATOM   962  C  CA    . ARG A 1 144 ? 32.017 23.548 14.581  1.00 26.84 ? 1094 ARG A CA    1 
ATOM   963  C  C     . ARG A 1 144 ? 32.711 22.171 14.603  1.00 25.44 ? 1094 ARG A C     1 
ATOM   964  O  O     . ARG A 1 144 ? 33.956 22.109 14.598  1.00 25.81 ? 1094 ARG A O     1 
ATOM   965  C  CB    . ARG A 1 144 ? 32.189 24.280 15.918  1.00 27.45 ? 1094 ARG A CB    1 
ATOM   966  C  CG    . ARG A 1 144 ? 31.468 23.688 17.098  1.00 29.44 ? 1094 ARG A CG    1 
ATOM   967  C  CD    . ARG A 1 144 ? 31.882 24.405 18.390  1.00 30.85 ? 1094 ARG A CD    1 
ATOM   968  N  NE    . ARG A 1 144 ? 31.404 25.791 18.455  1.00 38.49 ? 1094 ARG A NE    1 
ATOM   969  C  CZ    . ARG A 1 144 ? 31.710 26.656 19.425  1.00 41.31 ? 1094 ARG A CZ    1 
ATOM   970  N  NH1   . ARG A 1 144 ? 32.500 26.287 20.437  1.00 42.67 ? 1094 ARG A NH1   1 
ATOM   971  N  NH2   . ARG A 1 144 ? 31.216 27.894 19.392  1.00 41.57 ? 1094 ARG A NH2   1 
ATOM   972  N  N     . ALA A 1 145 ? 31.926 21.088 14.647  1.00 23.31 ? 1095 ALA A N     1 
ATOM   973  C  CA    . ALA A 1 145 ? 32.451 19.717 14.525  1.00 21.86 ? 1095 ALA A CA    1 
ATOM   974  C  C     . ALA A 1 145 ? 33.184 19.512 13.203  1.00 20.97 ? 1095 ALA A C     1 
ATOM   975  O  O     . ALA A 1 145 ? 32.782 20.055 12.161  1.00 20.68 ? 1095 ALA A O     1 
ATOM   976  C  CB    . ALA A 1 145 ? 31.318 18.693 14.655  1.00 22.58 ? 1095 ALA A CB    1 
ATOM   977  N  N     . ARG A 1 146 ? 34.257 18.721 13.248  1.00 19.56 ? 1096 ARG A N     1 
ATOM   978  C  CA    . ARG A 1 146 ? 35.025 18.375 12.055  1.00 19.12 ? 1096 ARG A CA    1 
ATOM   979  C  C     . ARG A 1 146 ? 34.301 17.253 11.338  1.00 18.15 ? 1096 ARG A C     1 
ATOM   980  O  O     . ARG A 1 146 ? 34.289 16.107 11.816  1.00 18.53 ? 1096 ARG A O     1 
ATOM   981  C  CB    . ARG A 1 146 ? 36.432 17.897 12.454  1.00 18.72 ? 1096 ARG A CB    1 
ATOM   982  C  CG    . ARG A 1 146 ? 37.283 18.942 13.178  1.00 22.20 ? 1096 ARG A CG    1 
ATOM   983  C  CD    . ARG A 1 146 ? 38.336 19.490 12.247  1.00 25.31 ? 1096 ARG A CD    1 
ATOM   984  N  NE    . ARG A 1 146 ? 38.984 20.694 12.769  1.00 26.34 ? 1096 ARG A NE    1 
ATOM   985  C  CZ    . ARG A 1 146 ? 39.645 21.564 12.012  1.00 27.09 ? 1096 ARG A CZ    1 
ATOM   986  N  NH1   . ARG A 1 146 ? 39.755 21.366 10.697  1.00 25.73 ? 1096 ARG A NH1   1 
ATOM   987  N  NH2   . ARG A 1 146 ? 40.204 22.628 12.574  1.00 28.67 ? 1096 ARG A NH2   1 
ATOM   988  N  N     . LEU A 1 147 ? 33.672 17.600 10.216  1.00 17.03 ? 1097 LEU A N     1 
ATOM   989  C  CA    . LEU A 1 147 ? 32.934 16.642 9.384   1.00 16.07 ? 1097 LEU A CA    1 
ATOM   990  C  C     . LEU A 1 147 ? 33.636 16.425 8.050   1.00 16.16 ? 1097 LEU A C     1 
ATOM   991  O  O     . LEU A 1 147 ? 34.501 17.215 7.651   1.00 15.96 ? 1097 LEU A O     1 
ATOM   992  C  CB    . LEU A 1 147 ? 31.499 17.141 9.120   1.00 16.23 ? 1097 LEU A CB    1 
ATOM   993  C  CG    . LEU A 1 147 ? 30.692 17.474 10.376  1.00 16.72 ? 1097 LEU A CG    1 
ATOM   994  C  CD1   . LEU A 1 147 ? 29.278 17.895 9.977   1.00 17.11 ? 1097 LEU A CD1   1 
ATOM   995  C  CD2   . LEU A 1 147 ? 30.660 16.267 11.317  1.00 17.28 ? 1097 LEU A CD2   1 
ATOM   996  N  N     . GLN A 1 148 ? 33.230 15.368 7.355   1.00 15.54 ? 1098 GLN A N     1 
ATOM   997  C  CA    . GLN A 1 148 ? 33.820 15.015 6.067   1.00 15.69 ? 1098 GLN A CA    1 
ATOM   998  C  C     . GLN A 1 148 ? 32.759 14.360 5.181   1.00 15.21 ? 1098 GLN A C     1 
ATOM   999  O  O     . GLN A 1 148 ? 32.045 13.451 5.627   1.00 15.92 ? 1098 GLN A O     1 
ATOM   1000 C  CB    . GLN A 1 148 ? 34.984 14.039 6.289   1.00 16.08 ? 1098 GLN A CB    1 
ATOM   1001 C  CG    . GLN A 1 148 ? 35.785 13.664 5.045   1.00 17.03 ? 1098 GLN A CG    1 
ATOM   1002 C  CD    . GLN A 1 148 ? 36.737 12.515 5.341   1.00 17.50 ? 1098 GLN A CD    1 
ATOM   1003 O  OE1   . GLN A 1 148 ? 36.300 11.393 5.616   1.00 20.07 ? 1098 GLN A OE1   1 
ATOM   1004 N  NE2   . GLN A 1 148 ? 38.040 12.794 5.305   1.00 21.71 ? 1098 GLN A NE2   1 
ATOM   1005 N  N     . LEU A 1 149 ? 32.658 14.834 3.945   1.00 14.87 ? 1099 LEU A N     1 
ATOM   1006 C  CA    . LEU A 1 149 ? 31.790 14.224 2.948   1.00 14.43 ? 1099 LEU A CA    1 
ATOM   1007 C  C     . LEU A 1 149 ? 32.604 13.083 2.341   1.00 15.12 ? 1099 LEU A C     1 
ATOM   1008 O  O     . LEU A 1 149 ? 33.775 13.266 1.990   1.00 15.61 ? 1099 LEU A O     1 
ATOM   1009 C  CB    . LEU A 1 149 ? 31.403 15.255 1.874   1.00 14.66 ? 1099 LEU A CB    1 
ATOM   1010 C  CG    . LEU A 1 149 ? 30.486 14.776 0.733   1.00 13.84 ? 1099 LEU A CG    1 
ATOM   1011 C  CD1   . LEU A 1 149 ? 29.112 14.320 1.279   1.00 15.57 ? 1099 LEU A CD1   1 
ATOM   1012 C  CD2   . LEU A 1 149 ? 30.321 15.879 -0.274  1.00 14.20 ? 1099 LEU A CD2   1 
ATOM   1013 N  N     . TYR A 1 150 ? 32.009 11.900 2.233   1.00 15.11 ? 1100 TYR A N     1 
ATOM   1014 C  CA    . TYR A 1 150 ? 32.773 10.775 1.682   1.00 15.45 ? 1100 TYR A CA    1 
ATOM   1015 C  C     . TYR A 1 150 ? 31.901 9.862  0.827   1.00 16.36 ? 1100 TYR A C     1 
ATOM   1016 O  O     . TYR A 1 150 ? 30.665 9.862  0.937   1.00 16.08 ? 1100 TYR A O     1 
ATOM   1017 C  CB    . TYR A 1 150 ? 33.444 9.987  2.804   1.00 16.18 ? 1100 TYR A CB    1 
ATOM   1018 C  CG    . TYR A 1 150 ? 32.506 9.088  3.562   1.00 15.53 ? 1100 TYR A CG    1 
ATOM   1019 C  CD1   . TYR A 1 150 ? 32.509 7.704  3.356   1.00 17.64 ? 1100 TYR A CD1   1 
ATOM   1020 C  CD2   . TYR A 1 150 ? 31.630 9.611  4.517   1.00 15.36 ? 1100 TYR A CD2   1 
ATOM   1021 C  CE1   . TYR A 1 150 ? 31.647 6.870  4.065   1.00 17.89 ? 1100 TYR A CE1   1 
ATOM   1022 C  CE2   . TYR A 1 150 ? 30.761 8.778  5.243   1.00 16.47 ? 1100 TYR A CE2   1 
ATOM   1023 C  CZ    . TYR A 1 150 ? 30.767 7.418  4.995   1.00 17.58 ? 1100 TYR A CZ    1 
ATOM   1024 O  OH    . TYR A 1 150 ? 29.924 6.589  5.699   1.00 18.66 ? 1100 TYR A OH    1 
ATOM   1025 N  N     . ARG A 1 151 ? 32.563 9.076  -0.022  1.00 17.40 ? 1101 ARG A N     1 
ATOM   1026 C  CA    . ARG A 1 151 ? 31.862 8.153  -0.887  1.00 18.41 ? 1101 ARG A CA    1 
ATOM   1027 C  C     . ARG A 1 151 ? 31.635 6.842  -0.144  1.00 19.15 ? 1101 ARG A C     1 
ATOM   1028 O  O     . ARG A 1 151 ? 32.590 6.189  0.294   1.00 19.00 ? 1101 ARG A O     1 
ATOM   1029 C  CB    . ARG A 1 151 ? 32.666 7.927  -2.169  1.00 18.57 ? 1101 ARG A CB    1 
ATOM   1030 C  CG    . ARG A 1 151 ? 31.899 7.223  -3.262  1.00 19.86 ? 1101 ARG A CG    1 
ATOM   1031 C  CD    . ARG A 1 151 ? 30.785 8.080  -3.813  1.00 22.97 ? 1101 ARG A CD    1 
ATOM   1032 N  NE    . ARG A 1 151 ? 30.274 7.535  -5.061  1.00 24.75 ? 1101 ARG A NE    1 
ATOM   1033 C  CZ    . ARG A 1 151 ? 29.138 7.919  -5.638  1.00 26.99 ? 1101 ARG A CZ    1 
ATOM   1034 N  NH1   . ARG A 1 151 ? 28.381 8.856  -5.077  1.00 27.33 ? 1101 ARG A NH1   1 
ATOM   1035 N  NH2   . ARG A 1 151 ? 28.756 7.361  -6.785  1.00 28.30 ? 1101 ARG A NH2   1 
ATOM   1036 N  N     . THR A 1 152 ? 30.368 6.478  0.040   1.00 20.17 ? 1102 THR A N     1 
ATOM   1037 C  CA    . THR A 1 152 ? 30.054 5.202  0.676   1.00 21.37 ? 1102 THR A CA    1 
ATOM   1038 C  C     . THR A 1 152 ? 30.098 4.085  -0.368  1.00 22.87 ? 1102 THR A C     1 
ATOM   1039 O  O     . THR A 1 152 ? 30.070 4.343  -1.569  1.00 22.39 ? 1102 THR A O     1 
ATOM   1040 C  CB    . THR A 1 152 ? 28.659 5.202  1.346   1.00 21.18 ? 1102 THR A CB    1 
ATOM   1041 O  OG1   . THR A 1 152 ? 27.647 5.115  0.335   1.00 20.38 ? 1102 THR A OG1   1 
ATOM   1042 C  CG2   . THR A 1 152 ? 28.458 6.465  2.196   1.00 19.79 ? 1102 THR A CG2   1 
ATOM   1043 N  N     . ARG A 1 153 ? 30.143 2.845  0.110   1.00 25.55 ? 1103 ARG A N     1 
ATOM   1044 C  CA    . ARG A 1 153 ? 30.161 1.691  -0.787  1.00 28.44 ? 1103 ARG A CA    1 
ATOM   1045 C  C     . ARG A 1 153 ? 28.834 1.505  -1.517  1.00 28.95 ? 1103 ARG A C     1 
ATOM   1046 O  O     . ARG A 1 153 ? 28.828 1.179  -2.707  1.00 29.98 ? 1103 ARG A O     1 
ATOM   1047 C  CB    . ARG A 1 153 ? 30.565 0.417  -0.037  1.00 28.53 ? 1103 ARG A CB    1 
ATOM   1048 C  CG    . ARG A 1 153 ? 32.039 0.392  0.353   1.00 30.82 ? 1103 ARG A CG    1 
ATOM   1049 C  CD    . ARG A 1 153 ? 32.456 -0.940 0.982   1.00 31.40 ? 1103 ARG A CD    1 
ATOM   1050 N  NE    . ARG A 1 153 ? 33.669 -0.804 1.800   1.00 38.86 ? 1103 ARG A NE    1 
ATOM   1051 C  CZ    . ARG A 1 153 ? 33.690 -0.403 3.076   1.00 40.37 ? 1103 ARG A CZ    1 
ATOM   1052 N  NH1   . ARG A 1 153 ? 32.562 -0.082 3.712   1.00 41.94 ? 1103 ARG A NH1   1 
ATOM   1053 N  NH2   . ARG A 1 153 ? 34.847 -0.316 3.720   1.00 41.77 ? 1103 ARG A NH2   1 
ATOM   1054 N  N     . ASP A 1 154 ? 27.712 1.725  -0.831  1.00 29.62 ? 1104 ASP A N     1 
ATOM   1055 C  CA    . ASP A 1 154 ? 26.412 1.438  -1.453  1.00 30.17 ? 1104 ASP A CA    1 
ATOM   1056 C  C     . ASP A 1 154 ? 25.249 2.405  -1.196  1.00 29.83 ? 1104 ASP A C     1 
ATOM   1057 O  O     . ASP A 1 154 ? 24.097 2.064  -1.478  1.00 29.75 ? 1104 ASP A O     1 
ATOM   1058 C  CB    . ASP A 1 154 ? 25.984 -0.011 -1.163  1.00 31.16 ? 1104 ASP A CB    1 
ATOM   1059 C  CG    . ASP A 1 154 ? 25.877 -0.316 0.326   1.00 33.19 ? 1104 ASP A CG    1 
ATOM   1060 O  OD1   . ASP A 1 154 ? 25.481 0.572  1.116   1.00 35.36 ? 1104 ASP A OD1   1 
ATOM   1061 O  OD2   . ASP A 1 154 ? 26.186 -1.467 0.711   1.00 37.14 ? 1104 ASP A OD2   1 
ATOM   1062 N  N     . MET A 1 155 ? 25.537 3.602  -0.682  1.00 28.36 ? 1105 MET A N     1 
ATOM   1063 C  CA    . MET A 1 155 ? 24.496 4.623  -0.508  1.00 27.88 ? 1105 MET A CA    1 
ATOM   1064 C  C     . MET A 1 155 ? 24.935 5.994  -1.019  1.00 25.99 ? 1105 MET A C     1 
ATOM   1065 O  O     . MET A 1 155 ? 24.546 7.021  -0.455  1.00 26.24 ? 1105 MET A O     1 
ATOM   1066 C  CB    . MET A 1 155 ? 24.074 4.759  0.957   1.00 27.94 ? 1105 MET A CB    1 
ATOM   1067 C  CG    . MET A 1 155 ? 23.203 3.663  1.519   1.00 29.43 ? 1105 MET A CG    1 
ATOM   1068 S  SD    . MET A 1 155 ? 22.729 4.040  3.228   1.00 30.28 ? 1105 MET A SD    1 
ATOM   1069 C  CE    . MET A 1 155 ? 24.212 4.729  3.939   1.00 28.29 ? 1105 MET A CE    1 
ATOM   1070 N  N     . GLY A 1 156 ? 25.729 6.019  -2.085  1.00 24.06 ? 1106 GLY A N     1 
ATOM   1071 C  CA    . GLY A 1 156 ? 26.187 7.280  -2.661  1.00 21.82 ? 1106 GLY A CA    1 
ATOM   1072 C  C     . GLY A 1 156 ? 27.105 8.012  -1.691  1.00 20.79 ? 1106 GLY A C     1 
ATOM   1073 O  O     . GLY A 1 156 ? 27.926 7.388  -1.009  1.00 20.29 ? 1106 GLY A O     1 
ATOM   1074 N  N     . TRP A 1 157 ? 26.948 9.334  -1.622  1.00 19.46 ? 1107 TRP A N     1 
ATOM   1075 C  CA    . TRP A 1 157 ? 27.741 10.152 -0.703  1.00 18.17 ? 1107 TRP A CA    1 
ATOM   1076 C  C     . TRP A 1 157 ? 27.120 10.098 0.681   1.00 17.82 ? 1107 TRP A C     1 
ATOM   1077 O  O     . TRP A 1 157 ? 25.891 9.971  0.820   1.00 16.98 ? 1107 TRP A O     1 
ATOM   1078 C  CB    . TRP A 1 157 ? 27.819 11.599 -1.191  1.00 19.01 ? 1107 TRP A CB    1 
ATOM   1079 C  CG    . TRP A 1 157 ? 28.467 11.738 -2.533  1.00 18.77 ? 1107 TRP A CG    1 
ATOM   1080 C  CD1   . TRP A 1 157 ? 27.840 11.906 -3.733  1.00 20.78 ? 1107 TRP A CD1   1 
ATOM   1081 C  CD2   . TRP A 1 157 ? 29.877 11.717 -2.814  1.00 19.34 ? 1107 TRP A CD2   1 
ATOM   1082 N  NE1   . TRP A 1 157 ? 28.768 12.006 -4.745  1.00 22.12 ? 1107 TRP A NE1   1 
ATOM   1083 C  CE2   . TRP A 1 157 ? 30.026 11.889 -4.210  1.00 20.77 ? 1107 TRP A CE2   1 
ATOM   1084 C  CE3   . TRP A 1 157 ? 31.025 11.588 -2.018  1.00 18.85 ? 1107 TRP A CE3   1 
ATOM   1085 C  CZ2   . TRP A 1 157 ? 31.284 11.919 -4.836  1.00 20.61 ? 1107 TRP A CZ2   1 
ATOM   1086 C  CZ3   . TRP A 1 157 ? 32.285 11.631 -2.644  1.00 19.05 ? 1107 TRP A CZ3   1 
ATOM   1087 C  CH2   . TRP A 1 157 ? 32.394 11.788 -4.036  1.00 19.94 ? 1107 TRP A CH2   1 
ATOM   1088 N  N     . GLY A 1 158 ? 27.968 10.172 1.702   1.00 15.62 ? 1108 GLY A N     1 
ATOM   1089 C  CA    . GLY A 1 158 ? 27.502 10.242 3.088   1.00 15.65 ? 1108 GLY A CA    1 
ATOM   1090 C  C     . GLY A 1 158 ? 28.382 11.213 3.859   1.00 15.73 ? 1108 GLY A C     1 
ATOM   1091 O  O     . GLY A 1 158 ? 29.345 11.729 3.319   1.00 15.20 ? 1108 GLY A O     1 
ATOM   1092 N  N     . VAL A 1 159 ? 28.047 11.448 5.118   1.00 15.13 ? 1109 VAL A N     1 
ATOM   1093 C  CA    . VAL A 1 159 ? 28.836 12.362 5.952   1.00 15.41 ? 1109 VAL A CA    1 
ATOM   1094 C  C     . VAL A 1 159 ? 29.339 11.610 7.175   1.00 15.70 ? 1109 VAL A C     1 
ATOM   1095 O  O     . VAL A 1 159 ? 28.581 10.882 7.822   1.00 15.42 ? 1109 VAL A O     1 
ATOM   1096 C  CB    . VAL A 1 159 ? 28.016 13.593 6.387   1.00 15.13 ? 1109 VAL A CB    1 
ATOM   1097 C  CG1   . VAL A 1 159 ? 28.873 14.550 7.202   1.00 15.15 ? 1109 VAL A CG1   1 
ATOM   1098 C  CG2   . VAL A 1 159 ? 27.442 14.315 5.184   1.00 16.35 ? 1109 VAL A CG2   1 
ATOM   1099 N  N     . ARG A 1 160 ? 30.626 11.770 7.486   1.00 16.39 ? 1110 ARG A N     1 
ATOM   1100 C  CA    . ARG A 1 160 ? 31.150 11.203 8.724   1.00 17.05 ? 1110 ARG A CA    1 
ATOM   1101 C  C     . ARG A 1 160 ? 31.747 12.251 9.630   1.00 17.51 ? 1110 ARG A C     1 
ATOM   1102 O  O     . ARG A 1 160 ? 32.056 13.360 9.194   1.00 16.65 ? 1110 ARG A O     1 
ATOM   1103 C  CB    . ARG A 1 160 ? 32.207 10.128 8.447   1.00 17.79 ? 1110 ARG A CB    1 
ATOM   1104 C  CG    . ARG A 1 160 ? 33.425 10.634 7.709   1.00 18.89 ? 1110 ARG A CG    1 
ATOM   1105 C  CD    . ARG A 1 160 ? 34.651 9.784  8.003   1.00 23.27 ? 1110 ARG A CD    1 
ATOM   1106 N  NE    . ARG A 1 160 ? 34.461 8.396  7.591   1.00 23.13 ? 1110 ARG A NE    1 
ATOM   1107 C  CZ    . ARG A 1 160 ? 34.827 7.888  6.414   1.00 23.91 ? 1110 ARG A CZ    1 
ATOM   1108 N  NH1   . ARG A 1 160 ? 35.417 8.642  5.490   1.00 22.89 ? 1110 ARG A NH1   1 
ATOM   1109 N  NH2   . ARG A 1 160 ? 34.595 6.609  6.162   1.00 24.26 ? 1110 ARG A NH2   1 
ATOM   1110 N  N     . SER A 1 161 ? 31.909 11.871 10.892  1.00 18.44 ? 1111 SER A N     1 
ATOM   1111 C  CA    . SER A 1 161 ? 32.608 12.686 11.851  1.00 19.51 ? 1111 SER A CA    1 
ATOM   1112 C  C     . SER A 1 161 ? 34.090 12.297 11.850  1.00 20.14 ? 1111 SER A C     1 
ATOM   1113 O  O     . SER A 1 161 ? 34.418 11.114 11.848  1.00 20.94 ? 1111 SER A O     1 
ATOM   1114 C  CB    . SER A 1 161 ? 32.002 12.480 13.237  1.00 19.38 ? 1111 SER A CB    1 
ATOM   1115 O  OG    . SER A 1 161 ? 32.707 13.241 14.197  1.00 22.72 ? 1111 SER A OG    1 
ATOM   1116 N  N     . LEU A 1 162 ? 34.974 13.288 11.848  1.00 20.50 ? 1112 LEU A N     1 
ATOM   1117 C  CA    . LEU A 1 162 ? 36.426 13.023 11.905  1.00 21.31 ? 1112 LEU A CA    1 
ATOM   1118 C  C     . LEU A 1 162 ? 36.944 12.936 13.344  1.00 21.84 ? 1112 LEU A C     1 
ATOM   1119 O  O     . LEU A 1 162 ? 38.073 12.495 13.580  1.00 22.74 ? 1112 LEU A O     1 
ATOM   1120 C  CB    . LEU A 1 162 ? 37.195 14.096 11.130  1.00 21.81 ? 1112 LEU A CB    1 
ATOM   1121 C  CG    . LEU A 1 162 ? 37.020 14.094 9.609   1.00 22.14 ? 1112 LEU A CG    1 
ATOM   1122 C  CD1   . LEU A 1 162 ? 37.770 15.257 8.999   1.00 23.20 ? 1112 LEU A CD1   1 
ATOM   1123 C  CD2   . LEU A 1 162 ? 37.485 12.770 9.020   1.00 24.86 ? 1112 LEU A CD2   1 
ATOM   1124 N  N     A GLN A 1 163 ? 36.130 13.378 14.300  0.50 21.89 ? 1113 GLN A N     1 
ATOM   1125 N  N     B GLN A 1 163 ? 36.085 13.338 14.279  0.50 21.84 ? 1113 GLN A N     1 
ATOM   1126 C  CA    A GLN A 1 163 ? 36.514 13.396 15.712  0.50 22.29 ? 1113 GLN A CA    1 
ATOM   1127 C  CA    B GLN A 1 163 ? 36.397 13.444 15.697  0.50 22.15 ? 1113 GLN A CA    1 
ATOM   1128 C  C     A GLN A 1 163 ? 35.359 12.880 16.566  0.50 22.18 ? 1113 GLN A C     1 
ATOM   1129 C  C     B GLN A 1 163 ? 35.362 12.657 16.505  0.50 22.18 ? 1113 GLN A C     1 
ATOM   1130 O  O     A GLN A 1 163 ? 34.207 12.900 16.129  0.50 22.00 ? 1113 GLN A O     1 
ATOM   1131 O  O     B GLN A 1 163 ? 34.297 12.286 15.988  0.50 21.97 ? 1113 GLN A O     1 
ATOM   1132 C  CB    A GLN A 1 163 ? 36.910 14.813 16.153  0.50 22.30 ? 1113 GLN A CB    1 
ATOM   1133 C  CB    B GLN A 1 163 ? 36.349 14.920 16.122  0.50 22.31 ? 1113 GLN A CB    1 
ATOM   1134 C  CG    A GLN A 1 163 ? 38.126 15.393 15.434  0.50 23.15 ? 1113 GLN A CG    1 
ATOM   1135 C  CG    B GLN A 1 163 ? 34.997 15.578 15.832  0.50 22.66 ? 1113 GLN A CG    1 
ATOM   1136 C  CD    A GLN A 1 163 ? 38.578 16.735 15.991  0.50 22.98 ? 1113 GLN A CD    1 
ATOM   1137 C  CD    B GLN A 1 163 ? 34.789 16.904 16.533  0.50 22.35 ? 1113 GLN A CD    1 
ATOM   1138 O  OE1   A GLN A 1 163 ? 37.762 17.607 16.298  0.50 24.86 ? 1113 GLN A OE1   1 
ATOM   1139 O  OE1   B GLN A 1 163 ? 34.158 16.959 17.589  0.50 22.42 ? 1113 GLN A OE1   1 
ATOM   1140 N  NE2   A GLN A 1 163 ? 39.891 16.912 16.108  0.50 24.56 ? 1113 GLN A NE2   1 
ATOM   1141 N  NE2   B GLN A 1 163 ? 35.311 17.978 15.948  0.50 20.26 ? 1113 GLN A NE2   1 
ATOM   1142 N  N     . ASP A 1 164 ? 35.668 12.410 17.774  1.00 21.94 ? 1114 ASP A N     1 
ATOM   1143 C  CA    . ASP A 1 164 ? 34.646 11.958 18.713  1.00 22.27 ? 1114 ASP A CA    1 
ATOM   1144 C  C     . ASP A 1 164 ? 33.689 13.118 18.991  1.00 21.72 ? 1114 ASP A C     1 
ATOM   1145 O  O     . ASP A 1 164 ? 34.127 14.255 19.212  1.00 22.15 ? 1114 ASP A O     1 
ATOM   1146 C  CB    . ASP A 1 164 ? 35.268 11.487 20.031  1.00 22.81 ? 1114 ASP A CB    1 
ATOM   1147 C  CG    . ASP A 1 164 ? 35.923 10.104 19.932  1.00 25.51 ? 1114 ASP A CG    1 
ATOM   1148 O  OD1   . ASP A 1 164 ? 35.899 9.445  18.862  1.00 26.85 ? 1114 ASP A OD1   1 
ATOM   1149 O  OD2   . ASP A 1 164 ? 36.482 9.670  20.963  1.00 29.79 ? 1114 ASP A OD2   1 
ATOM   1150 N  N     . ILE A 1 165 ? 32.390 12.832 18.946  1.00 21.29 ? 1115 ILE A N     1 
ATOM   1151 C  CA    . ILE A 1 165 ? 31.351 13.814 19.272  1.00 21.17 ? 1115 ILE A CA    1 
ATOM   1152 C  C     . ILE A 1 165 ? 30.591 13.309 20.500  1.00 21.02 ? 1115 ILE A C     1 
ATOM   1153 O  O     . ILE A 1 165 ? 29.886 12.305 20.415  1.00 21.05 ? 1115 ILE A O     1 
ATOM   1154 C  CB    . ILE A 1 165 ? 30.371 14.064 18.085  1.00 20.91 ? 1115 ILE A CB    1 
ATOM   1155 C  CG1   . ILE A 1 165 ? 31.143 14.517 16.835  1.00 21.15 ? 1115 ILE A CG1   1 
ATOM   1156 C  CG2   . ILE A 1 165 ? 29.315 15.100 18.485  1.00 21.45 ? 1115 ILE A CG2   1 
ATOM   1157 C  CD1   . ILE A 1 165 ? 30.286 14.703 15.582  1.00 20.39 ? 1115 ILE A CD1   1 
ATOM   1158 N  N     . PRO A 1 166 ? 30.729 14.007 21.646  1.00 21.46 ? 1116 PRO A N     1 
ATOM   1159 C  CA    . PRO A 1 166 ? 29.997 13.597 22.850  1.00 21.62 ? 1116 PRO A CA    1 
ATOM   1160 C  C     . PRO A 1 166 ? 28.479 13.668 22.644  1.00 21.77 ? 1116 PRO A C     1 
ATOM   1161 O  O     . PRO A 1 166 ? 28.019 14.422 21.777  1.00 21.66 ? 1116 PRO A O     1 
ATOM   1162 C  CB    . PRO A 1 166 ? 30.440 14.625 23.905  1.00 21.94 ? 1116 PRO A CB    1 
ATOM   1163 C  CG    . PRO A 1 166 ? 31.725 15.202 23.379  1.00 22.41 ? 1116 PRO A CG    1 
ATOM   1164 C  CD    . PRO A 1 166 ? 31.571 15.195 21.887  1.00 21.48 ? 1116 PRO A CD    1 
ATOM   1165 N  N     . PRO A 1 167 ? 27.702 12.878 23.411  1.00 21.97 ? 1117 PRO A N     1 
ATOM   1166 C  CA    . PRO A 1 167 ? 26.245 12.959 23.330  1.00 21.74 ? 1117 PRO A CA    1 
ATOM   1167 C  C     . PRO A 1 167 ? 25.711 14.371 23.546  1.00 21.17 ? 1117 PRO A C     1 
ATOM   1168 O  O     . PRO A 1 167 ? 26.262 15.145 24.337  1.00 21.08 ? 1117 PRO A O     1 
ATOM   1169 C  CB    . PRO A 1 167 ? 25.756 12.052 24.475  1.00 22.55 ? 1117 PRO A CB    1 
ATOM   1170 C  CG    . PRO A 1 167 ? 26.968 11.690 25.265  1.00 22.99 ? 1117 PRO A CG    1 
ATOM   1171 C  CD    . PRO A 1 167 ? 28.149 11.850 24.375  1.00 22.35 ? 1117 PRO A CD    1 
ATOM   1172 N  N     . GLY A 1 168 ? 24.631 14.691 22.837  1.00 20.74 ? 1118 GLY A N     1 
ATOM   1173 C  CA    . GLY A 1 168 ? 23.917 15.951 23.027  1.00 19.49 ? 1118 GLY A CA    1 
ATOM   1174 C  C     . GLY A 1 168 ? 24.572 17.160 22.380  1.00 18.94 ? 1118 GLY A C     1 
ATOM   1175 O  O     . GLY A 1 168 ? 24.217 18.308 22.692  1.00 19.14 ? 1118 GLY A O     1 
ATOM   1176 N  N     . THR A 1 169 ? 25.520 16.914 21.474  1.00 18.01 ? 1119 THR A N     1 
ATOM   1177 C  CA    . THR A 1 169 ? 26.274 17.988 20.827  1.00 17.45 ? 1119 THR A CA    1 
ATOM   1178 C  C     . THR A 1 169 ? 25.552 18.450 19.567  1.00 17.16 ? 1119 THR A C     1 
ATOM   1179 O  O     . THR A 1 169 ? 25.019 17.626 18.822  1.00 16.68 ? 1119 THR A O     1 
ATOM   1180 C  CB    . THR A 1 169 ? 27.695 17.510 20.453  1.00 17.67 ? 1119 THR A CB    1 
ATOM   1181 O  OG1   . THR A 1 169 ? 28.395 17.129 21.647  1.00 18.80 ? 1119 THR A OG1   1 
ATOM   1182 C  CG2   . THR A 1 169 ? 28.478 18.612 19.741  1.00 18.11 ? 1119 THR A CG2   1 
ATOM   1183 N  N     . PHE A 1 170 ? 25.529 19.763 19.340  1.00 16.36 ? 1120 PHE A N     1 
ATOM   1184 C  CA    . PHE A 1 170 ? 25.056 20.282 18.057  1.00 15.92 ? 1120 PHE A CA    1 
ATOM   1185 C  C     . PHE A 1 170 ? 26.053 19.937 16.963  1.00 15.70 ? 1120 PHE A C     1 
ATOM   1186 O  O     . PHE A 1 170 ? 27.230 20.306 17.041  1.00 15.87 ? 1120 PHE A O     1 
ATOM   1187 C  CB    . PHE A 1 170 ? 24.872 21.800 18.125  1.00 15.51 ? 1120 PHE A CB    1 
ATOM   1188 C  CG    . PHE A 1 170 ? 24.605 22.428 16.788  1.00 15.40 ? 1120 PHE A CG    1 
ATOM   1189 C  CD1   . PHE A 1 170 ? 23.469 22.074 16.052  1.00 15.53 ? 1120 PHE A CD1   1 
ATOM   1190 C  CD2   . PHE A 1 170 ? 25.487 23.363 16.263  1.00 16.36 ? 1120 PHE A CD2   1 
ATOM   1191 C  CE1   . PHE A 1 170 ? 23.232 22.654 14.798  1.00 15.26 ? 1120 PHE A CE1   1 
ATOM   1192 C  CE2   . PHE A 1 170 ? 25.250 23.952 15.032  1.00 15.02 ? 1120 PHE A CE2   1 
ATOM   1193 C  CZ    . PHE A 1 170 ? 24.130 23.595 14.290  1.00 16.24 ? 1120 PHE A CZ    1 
ATOM   1194 N  N     . VAL A 1 171 ? 25.562 19.273 15.923  1.00 15.27 ? 1121 VAL A N     1 
ATOM   1195 C  CA    . VAL A 1 171 ? 26.419 18.818 14.830  1.00 15.51 ? 1121 VAL A CA    1 
ATOM   1196 C  C     . VAL A 1 171 ? 26.281 19.695 13.580  1.00 15.79 ? 1121 VAL A C     1 
ATOM   1197 O  O     . VAL A 1 171 ? 27.274 20.219 13.076  1.00 16.91 ? 1121 VAL A O     1 
ATOM   1198 C  CB    . VAL A 1 171 ? 26.171 17.324 14.502  1.00 15.92 ? 1121 VAL A CB    1 
ATOM   1199 C  CG1   . VAL A 1 171 ? 27.065 16.861 13.356  1.00 16.28 ? 1121 VAL A CG1   1 
ATOM   1200 C  CG2   . VAL A 1 171 ? 26.427 16.456 15.746  1.00 15.95 ? 1121 VAL A CG2   1 
ATOM   1201 N  N     . CYS A 1 172 ? 25.059 19.842 13.068  1.00 14.72 ? 1122 CYS A N     1 
ATOM   1202 C  CA    . CYS A 1 172 ? 24.826 20.698 11.905  1.00 15.12 ? 1122 CYS A CA    1 
ATOM   1203 C  C     . CYS A 1 172 ? 23.343 21.027 11.766  1.00 14.77 ? 1122 CYS A C     1 
ATOM   1204 O  O     . CYS A 1 172 ? 22.510 20.424 12.435  1.00 14.79 ? 1122 CYS A O     1 
ATOM   1205 C  CB    . CYS A 1 172 ? 25.363 20.042 10.618  1.00 15.69 ? 1122 CYS A CB    1 
ATOM   1206 S  SG    . CYS A 1 172 ? 24.744 18.378 10.327  1.00 20.60 ? 1122 CYS A SG    1 
ATOM   1207 N  N     . GLU A 1 173 ? 23.055 22.017 10.925  1.00 14.29 ? 1123 GLU A N     1 
ATOM   1208 C  CA    . GLU A 1 173 ? 21.680 22.436 10.640  1.00 14.23 ? 1123 GLU A CA    1 
ATOM   1209 C  C     . GLU A 1 173 ? 21.274 21.950 9.261   1.00 13.92 ? 1123 GLU A C     1 
ATOM   1210 O  O     . GLU A 1 173 ? 22.117 21.910 8.344   1.00 14.19 ? 1123 GLU A O     1 
ATOM   1211 C  CB    . GLU A 1 173 ? 21.592 23.966 10.693  1.00 14.14 ? 1123 GLU A CB    1 
ATOM   1212 C  CG    . GLU A 1 173 ? 20.213 24.556 10.391  1.00 15.69 ? 1123 GLU A CG    1 
ATOM   1213 C  CD    . GLU A 1 173 ? 20.189 26.076 10.474  1.00 15.21 ? 1123 GLU A CD    1 
ATOM   1214 O  OE1   . GLU A 1 173 ? 21.164 26.655 11.026  1.00 18.33 ? 1123 GLU A OE1   1 
ATOM   1215 O  OE2   . GLU A 1 173 ? 19.206 26.702 9.995   1.00 16.08 ? 1123 GLU A OE2   1 
ATOM   1216 N  N     . TYR A 1 174 ? 19.990 21.580 9.100   1.00 13.40 ? 1124 TYR A N     1 
ATOM   1217 C  CA    . TYR A 1 174 ? 19.462 21.271 7.767   1.00 13.34 ? 1124 TYR A CA    1 
ATOM   1218 C  C     . TYR A 1 174 ? 19.119 22.570 7.046   1.00 13.81 ? 1124 TYR A C     1 
ATOM   1219 O  O     . TYR A 1 174 ? 18.114 23.202 7.351   1.00 14.07 ? 1124 TYR A O     1 
ATOM   1220 C  CB    . TYR A 1 174 ? 18.221 20.376 7.834   1.00 13.58 ? 1124 TYR A CB    1 
ATOM   1221 C  CG    . TYR A 1 174 ? 18.008 19.640 6.532   1.00 13.16 ? 1124 TYR A CG    1 
ATOM   1222 C  CD1   . TYR A 1 174 ? 18.779 18.520 6.232   1.00 13.66 ? 1124 TYR A CD1   1 
ATOM   1223 C  CD2   . TYR A 1 174 ? 17.075 20.069 5.582   1.00 13.92 ? 1124 TYR A CD2   1 
ATOM   1224 C  CE1   . TYR A 1 174 ? 18.631 17.842 5.035   1.00 13.26 ? 1124 TYR A CE1   1 
ATOM   1225 C  CE2   . TYR A 1 174 ? 16.912 19.382 4.365   1.00 13.69 ? 1124 TYR A CE2   1 
ATOM   1226 C  CZ    . TYR A 1 174 ? 17.694 18.255 4.106   1.00 14.65 ? 1124 TYR A CZ    1 
ATOM   1227 O  OH    . TYR A 1 174 ? 17.585 17.517 2.927   1.00 15.52 ? 1124 TYR A OH    1 
ATOM   1228 N  N     . VAL A 1 175 ? 19.971 22.941 6.096   1.00 14.22 ? 1125 VAL A N     1 
ATOM   1229 C  CA    . VAL A 1 175 ? 19.880 24.208 5.410   1.00 14.23 ? 1125 VAL A CA    1 
ATOM   1230 C  C     . VAL A 1 175 ? 19.499 23.990 3.959   1.00 14.54 ? 1125 VAL A C     1 
ATOM   1231 O  O     . VAL A 1 175 ? 19.938 23.028 3.333   1.00 14.54 ? 1125 VAL A O     1 
ATOM   1232 C  CB    . VAL A 1 175 ? 21.245 24.933 5.497   1.00 14.57 ? 1125 VAL A CB    1 
ATOM   1233 C  CG1   . VAL A 1 175 ? 21.364 26.061 4.515   1.00 15.44 ? 1125 VAL A CG1   1 
ATOM   1234 C  CG2   . VAL A 1 175 ? 21.453 25.444 6.929   1.00 14.91 ? 1125 VAL A CG2   1 
ATOM   1235 N  N     . GLY A 1 176 ? 18.704 24.918 3.436   1.00 14.30 ? 1126 GLY A N     1 
ATOM   1236 C  CA    . GLY A 1 176 ? 18.341 24.870 2.025   1.00 15.11 ? 1126 GLY A CA    1 
ATOM   1237 C  C     . GLY A 1 176 ? 17.360 25.943 1.664   1.00 15.23 ? 1126 GLY A C     1 
ATOM   1238 O  O     . GLY A 1 176 ? 17.341 27.006 2.276   1.00 15.89 ? 1126 GLY A O     1 
ATOM   1239 N  N     . GLU A 1 177 ? 16.560 25.650 0.643   1.00 14.72 ? 1127 GLU A N     1 
ATOM   1240 C  CA    . GLU A 1 177 ? 15.615 26.614 0.093   1.00 13.96 ? 1127 GLU A CA    1 
ATOM   1241 C  C     . GLU A 1 177 ? 14.268 26.470 0.818   1.00 14.18 ? 1127 GLU A C     1 
ATOM   1242 O  O     . GLU A 1 177 ? 13.694 25.389 0.806   1.00 14.29 ? 1127 GLU A O     1 
ATOM   1243 C  CB    . GLU A 1 177 ? 15.466 26.323 -1.404  1.00 14.59 ? 1127 GLU A CB    1 
ATOM   1244 C  CG    . GLU A 1 177 ? 14.585 27.273 -2.172  1.00 14.67 ? 1127 GLU A CG    1 
ATOM   1245 C  CD    . GLU A 1 177 ? 14.226 26.723 -3.543  1.00 18.42 ? 1127 GLU A CD    1 
ATOM   1246 O  OE1   . GLU A 1 177 ? 14.832 25.712 -3.977  1.00 17.22 ? 1127 GLU A OE1   1 
ATOM   1247 O  OE2   . GLU A 1 177 ? 13.328 27.320 -4.178  1.00 20.07 ? 1127 GLU A OE2   1 
ATOM   1248 N  N     . LEU A 1 178 ? 13.780 27.549 1.426   1.00 14.31 ? 1128 LEU A N     1 
ATOM   1249 C  CA    . LEU A 1 178 ? 12.513 27.509 2.155   1.00 15.28 ? 1128 LEU A CA    1 
ATOM   1250 C  C     . LEU A 1 178 ? 11.378 27.661 1.157   1.00 14.75 ? 1128 LEU A C     1 
ATOM   1251 O  O     . LEU A 1 178 ? 11.309 28.660 0.448   1.00 15.42 ? 1128 LEU A O     1 
ATOM   1252 C  CB    . LEU A 1 178 ? 12.420 28.644 3.200   1.00 15.52 ? 1128 LEU A CB    1 
ATOM   1253 C  CG    . LEU A 1 178 ? 13.280 28.592 4.451   1.00 18.49 ? 1128 LEU A CG    1 
ATOM   1254 C  CD1   . LEU A 1 178 ? 13.023 29.847 5.291   1.00 19.43 ? 1128 LEU A CD1   1 
ATOM   1255 C  CD2   . LEU A 1 178 ? 12.927 27.345 5.244   1.00 22.43 ? 1128 LEU A CD2   1 
ATOM   1256 N  N     . ILE A 1 179 ? 10.495 26.665 1.132   1.00 14.23 ? 1129 ILE A N     1 
ATOM   1257 C  CA    . ILE A 1 179 ? 9.362  26.624 0.198   1.00 14.51 ? 1129 ILE A CA    1 
ATOM   1258 C  C     . ILE A 1 179 ? 8.041  26.247 0.889   1.00 14.25 ? 1129 ILE A C     1 
ATOM   1259 O  O     . ILE A 1 179 ? 8.026  25.789 2.047   1.00 13.93 ? 1129 ILE A O     1 
ATOM   1260 C  CB    . ILE A 1 179 ? 9.659  25.665 -0.989  1.00 14.32 ? 1129 ILE A CB    1 
ATOM   1261 C  CG1   . ILE A 1 179 ? 9.798  24.211 -0.523  1.00 15.30 ? 1129 ILE A CG1   1 
ATOM   1262 C  CG2   . ILE A 1 179 ? 10.931 26.125 -1.737  1.00 14.47 ? 1129 ILE A CG2   1 
ATOM   1263 C  CD1   . ILE A 1 179 ? 9.965  23.189 -1.670  1.00 14.70 ? 1129 ILE A CD1   1 
ATOM   1264 N  N     . SER A 1 180 ? 6.928  26.448 0.184   1.00 14.52 ? 1130 SER A N     1 
ATOM   1265 C  CA    . SER A 1 180 ? 5.638  26.045 0.724   1.00 15.55 ? 1130 SER A CA    1 
ATOM   1266 C  C     . SER A 1 180 ? 5.456  24.526 0.574   1.00 16.03 ? 1130 SER A C     1 
ATOM   1267 O  O     . SER A 1 180 ? 6.064  23.888 -0.288  1.00 16.26 ? 1130 SER A O     1 
ATOM   1268 C  CB    . SER A 1 180 ? 4.492  26.774 0.006   1.00 15.66 ? 1130 SER A CB    1 
ATOM   1269 O  OG    . SER A 1 180 ? 4.407  26.340 -1.346  1.00 16.40 ? 1130 SER A OG    1 
ATOM   1270 N  N     . ASP A 1 181 ? 4.586  23.969 1.410   1.00 16.54 ? 1131 ASP A N     1 
ATOM   1271 C  CA    . ASP A 1 181 ? 4.162  22.560 1.319   1.00 17.17 ? 1131 ASP A CA    1 
ATOM   1272 C  C     . ASP A 1 181 ? 3.626  22.262 -0.099  1.00 17.52 ? 1131 ASP A C     1 
ATOM   1273 O  O     . ASP A 1 181 ? 3.898  21.202 -0.682  1.00 17.60 ? 1131 ASP A O     1 
ATOM   1274 C  CB    . ASP A 1 181 ? 3.084  22.331 2.385   1.00 17.64 ? 1131 ASP A CB    1 
ATOM   1275 C  CG    . ASP A 1 181 ? 2.594  20.893 2.460   1.00 19.91 ? 1131 ASP A CG    1 
ATOM   1276 O  OD1   . ASP A 1 181 ? 3.382  19.936 2.267   1.00 20.78 ? 1131 ASP A OD1   1 
ATOM   1277 O  OD2   . ASP A 1 181 ? 1.383  20.732 2.749   1.00 22.01 ? 1131 ASP A OD2   1 
ATOM   1278 N  N     . SER A 1 182 ? 2.866  23.215 -0.643  1.00 17.94 ? 1132 SER A N     1 
ATOM   1279 C  CA    . SER A 1 182 ? 2.324  23.098 -2.007  1.00 18.51 ? 1132 SER A CA    1 
ATOM   1280 C  C     . SER A 1 182 ? 3.410  22.978 -3.067  1.00 18.66 ? 1132 SER A C     1 
ATOM   1281 O  O     . SER A 1 182 ? 3.313  22.142 -3.958  1.00 19.17 ? 1132 SER A O     1 
ATOM   1282 C  CB    . SER A 1 182 ? 1.462  24.308 -2.357  1.00 19.24 ? 1132 SER A CB    1 
ATOM   1283 O  OG    . SER A 1 182 ? 0.282  24.309 -1.609  1.00 21.77 ? 1132 SER A OG    1 
ATOM   1284 N  N     . GLU A 1 183 ? 4.412  23.852 -2.983  1.00 18.01 ? 1133 GLU A N     1 
ATOM   1285 C  CA    . GLU A 1 183 ? 5.540  23.840 -3.909  1.00 18.37 ? 1133 GLU A CA    1 
ATOM   1286 C  C     . GLU A 1 183 ? 6.333  22.544 -3.762  1.00 18.08 ? 1133 GLU A C     1 
ATOM   1287 O  O     . GLU A 1 183 ? 6.770  21.964 -4.760  1.00 18.59 ? 1133 GLU A O     1 
ATOM   1288 C  CB    . GLU A 1 183 ? 6.451  25.047 -3.652  1.00 18.56 ? 1133 GLU A CB    1 
ATOM   1289 C  CG    . GLU A 1 183 ? 7.760  25.092 -4.459  1.00 20.50 ? 1133 GLU A CG    1 
ATOM   1290 C  CD    . GLU A 1 183 ? 7.562  25.135 -5.965  1.00 25.07 ? 1133 GLU A CD    1 
ATOM   1291 O  OE1   . GLU A 1 183 ? 6.486  25.595 -6.423  1.00 25.18 ? 1133 GLU A OE1   1 
ATOM   1292 O  OE2   . GLU A 1 183 ? 8.503  24.725 -6.695  1.00 24.89 ? 1133 GLU A OE2   1 
ATOM   1293 N  N     . ALA A 1 184 ? 6.539  22.106 -2.523  1.00 17.74 ? 1134 ALA A N     1 
ATOM   1294 C  CA    . ALA A 1 184 ? 7.287  20.868 -2.258  1.00 18.10 ? 1134 ALA A CA    1 
ATOM   1295 C  C     . ALA A 1 184 ? 6.619  19.679 -2.918  1.00 19.04 ? 1134 ALA A C     1 
ATOM   1296 O  O     . ALA A 1 184 ? 7.283  18.720 -3.318  1.00 19.18 ? 1134 ALA A O     1 
ATOM   1297 C  CB    . ALA A 1 184 ? 7.433  20.626 -0.762  1.00 18.06 ? 1134 ALA A CB    1 
ATOM   1298 N  N     . ASP A 1 185 ? 5.299  19.757 -3.041  1.00 19.25 ? 1135 ASP A N     1 
ATOM   1299 C  CA    . ASP A 1 185 ? 4.521  18.664 -3.609  1.00 21.00 ? 1135 ASP A CA    1 
ATOM   1300 C  C     . ASP A 1 185 ? 4.669  18.503 -5.119  1.00 21.85 ? 1135 ASP A C     1 
ATOM   1301 O  O     . ASP A 1 185 ? 4.226  17.487 -5.683  1.00 23.04 ? 1135 ASP A O     1 
ATOM   1302 C  CB    . ASP A 1 185 ? 3.041  18.863 -3.262  1.00 20.92 ? 1135 ASP A CB    1 
ATOM   1303 C  CG    . ASP A 1 185 ? 2.395  17.605 -2.732  1.00 22.88 ? 1135 ASP A CG    1 
ATOM   1304 O  OD1   . ASP A 1 185 ? 3.076  16.786 -2.070  1.00 22.19 ? 1135 ASP A OD1   1 
ATOM   1305 O  OD2   . ASP A 1 185 ? 1.176  17.432 -2.973  1.00 26.73 ? 1135 ASP A OD2   1 
ATOM   1306 N  N     . VAL A 1 186 ? 5.256  19.496 -5.782  1.00 22.80 ? 1136 VAL A N     1 
ATOM   1307 C  CA    . VAL A 1 186 ? 5.519  19.415 -7.230  1.00 24.14 ? 1136 VAL A CA    1 
ATOM   1308 C  C     . VAL A 1 186 ? 7.018  19.393 -7.580  1.00 24.96 ? 1136 VAL A C     1 
ATOM   1309 O  O     . VAL A 1 186 ? 7.395  19.545 -8.745  1.00 25.88 ? 1136 VAL A O     1 
ATOM   1310 C  CB    . VAL A 1 186 ? 4.752  20.503 -8.058  1.00 24.39 ? 1136 VAL A CB    1 
ATOM   1311 C  CG1   . VAL A 1 186 ? 3.240  20.350 -7.892  1.00 25.12 ? 1136 VAL A CG1   1 
ATOM   1312 C  CG2   . VAL A 1 186 ? 5.202  21.915 -7.690  1.00 24.65 ? 1136 VAL A CG2   1 
ATOM   1313 N  N     . ARG A 1 187 ? 7.865  19.217 -6.565  1.00 25.53 ? 1137 ARG A N     1 
ATOM   1314 C  CA    . ARG A 1 187 ? 9.305  19.091 -6.769  1.00 26.16 ? 1137 ARG A CA    1 
ATOM   1315 C  C     . ARG A 1 187 ? 9.592  17.631 -7.108  1.00 27.07 ? 1137 ARG A C     1 
ATOM   1316 O  O     . ARG A 1 187 ? 9.582  16.776 -6.221  1.00 28.25 ? 1137 ARG A O     1 
ATOM   1317 C  CB    . ARG A 1 187 ? 10.073 19.498 -5.506  1.00 25.86 ? 1137 ARG A CB    1 
ATOM   1318 C  CG    . ARG A 1 187 ? 10.003 20.988 -5.115  1.00 24.84 ? 1137 ARG A CG    1 
ATOM   1319 C  CD    . ARG A 1 187 ? 11.041 21.790 -5.860  1.00 21.45 ? 1137 ARG A CD    1 
ATOM   1320 N  NE    . ARG A 1 187 ? 10.845 23.241 -5.823  1.00 20.39 ? 1137 ARG A NE    1 
ATOM   1321 C  CZ    . ARG A 1 187 ? 11.683 24.117 -5.261  1.00 20.24 ? 1137 ARG A CZ    1 
ATOM   1322 N  NH1   . ARG A 1 187 ? 12.788 23.705 -4.640  1.00 20.00 ? 1137 ARG A NH1   1 
ATOM   1323 N  NH2   . ARG A 1 187 ? 11.415 25.416 -5.326  1.00 20.10 ? 1137 ARG A NH2   1 
ATOM   1324 N  N     . GLU A 1 188 ? 9.853  17.361 -8.382  1.00 27.80 ? 1138 GLU A N     1 
ATOM   1325 C  CA    . GLU A 1 188 ? 10.069 15.991 -8.873  1.00 28.73 ? 1138 GLU A CA    1 
ATOM   1326 C  C     . GLU A 1 188 ? 11.252 15.310 -8.186  1.00 27.65 ? 1138 GLU A C     1 
ATOM   1327 O  O     . GLU A 1 188 ? 11.196 14.121 -7.851  1.00 27.12 ? 1138 GLU A O     1 
ATOM   1328 C  CB    . GLU A 1 188 ? 10.271 15.998 -10.390 1.00 29.57 ? 1138 GLU A CB    1 
ATOM   1329 C  CG    . GLU A 1 188 ? 9.268  16.876 -11.157 1.00 34.06 ? 1138 GLU A CG    1 
ATOM   1330 C  CD    . GLU A 1 188 ? 7.871  16.261 -11.219 1.00 38.60 ? 1138 GLU A CD    1 
ATOM   1331 O  OE1   . GLU A 1 188 ? 7.740  15.147 -11.778 1.00 40.75 ? 1138 GLU A OE1   1 
ATOM   1332 O  OE2   . GLU A 1 188 ? 6.911  16.895 -10.714 1.00 40.49 ? 1138 GLU A OE2   1 
ATOM   1333 N  N     . GLU A 1 189 ? 12.319 16.073 -7.969  1.00 26.82 ? 1139 GLU A N     1 
ATOM   1334 C  CA    . GLU A 1 189 ? 13.475 15.563 -7.248  1.00 26.75 ? 1139 GLU A CA    1 
ATOM   1335 C  C     . GLU A 1 189 ? 13.231 15.811 -5.767  1.00 25.72 ? 1139 GLU A C     1 
ATOM   1336 O  O     . GLU A 1 189 ? 13.471 16.917 -5.267  1.00 25.57 ? 1139 GLU A O     1 
ATOM   1337 C  CB    . GLU A 1 189 ? 14.757 16.240 -7.737  1.00 26.74 ? 1139 GLU A CB    1 
ATOM   1338 C  CG    . GLU A 1 189 ? 15.061 15.951 -9.212  1.00 28.35 ? 1139 GLU A CG    1 
ATOM   1339 C  CD    . GLU A 1 189 ? 16.306 16.669 -9.717  1.00 29.44 ? 1139 GLU A CD    1 
ATOM   1340 O  OE1   . GLU A 1 189 ? 16.157 17.740 -10.343 1.00 34.01 ? 1139 GLU A OE1   1 
ATOM   1341 O  OE2   . GLU A 1 189 ? 17.427 16.164 -9.484  1.00 33.30 ? 1139 GLU A OE2   1 
ATOM   1342 N  N     . ASP A 1 190 ? 12.729 14.782 -5.084  1.00 24.24 ? 1140 ASP A N     1 
ATOM   1343 C  CA    . ASP A 1 190 ? 12.189 14.919 -3.735  1.00 23.66 ? 1140 ASP A CA    1 
ATOM   1344 C  C     . ASP A 1 190 ? 13.045 14.320 -2.621  1.00 22.80 ? 1140 ASP A C     1 
ATOM   1345 O  O     . ASP A 1 190 ? 12.605 14.265 -1.468  1.00 24.07 ? 1140 ASP A O     1 
ATOM   1346 C  CB    . ASP A 1 190 ? 10.760 14.347 -3.654  1.00 23.63 ? 1140 ASP A CB    1 
ATOM   1347 C  CG    . ASP A 1 190 ? 10.667 12.869 -4.063  1.00 25.52 ? 1140 ASP A CG    1 
ATOM   1348 O  OD1   . ASP A 1 190 ? 11.633 12.325 -4.643  1.00 25.46 ? 1140 ASP A OD1   1 
ATOM   1349 O  OD2   . ASP A 1 190 ? 9.597  12.253 -3.814  1.00 25.04 ? 1140 ASP A OD2   1 
ATOM   1350 N  N     . SER A 1 191 ? 14.269 13.910 -2.956  1.00 21.40 ? 1141 SER A N     1 
ATOM   1351 C  CA    . SER A 1 191 ? 15.131 13.230 -2.000  1.00 20.32 ? 1141 SER A CA    1 
ATOM   1352 C  C     . SER A 1 191 ? 15.679 14.124 -0.889  1.00 18.99 ? 1141 SER A C     1 
ATOM   1353 O  O     . SER A 1 191 ? 16.203 13.610 0.108   1.00 18.51 ? 1141 SER A O     1 
ATOM   1354 C  CB    . SER A 1 191 ? 16.297 12.551 -2.721  1.00 20.68 ? 1141 SER A CB    1 
ATOM   1355 O  OG    . SER A 1 191 ? 15.795 11.593 -3.647  1.00 22.85 ? 1141 SER A OG    1 
ATOM   1356 N  N     . TYR A 1 192 ? 15.540 15.444 -1.054  1.00 17.30 ? 1142 TYR A N     1 
ATOM   1357 C  CA    . TYR A 1 192 ? 16.167 16.407 -0.125  1.00 16.44 ? 1142 TYR A CA    1 
ATOM   1358 C  C     . TYR A 1 192 ? 15.170 17.308 0.612   1.00 16.06 ? 1142 TYR A C     1 
ATOM   1359 O  O     . TYR A 1 192 ? 15.565 18.260 1.276   1.00 15.97 ? 1142 TYR A O     1 
ATOM   1360 C  CB    . TYR A 1 192 ? 17.235 17.246 -0.836  1.00 17.24 ? 1142 TYR A CB    1 
ATOM   1361 C  CG    . TYR A 1 192 ? 18.302 16.415 -1.521  1.00 16.44 ? 1142 TYR A CG    1 
ATOM   1362 C  CD1   . TYR A 1 192 ? 19.441 15.997 -0.830  1.00 17.81 ? 1142 TYR A CD1   1 
ATOM   1363 C  CD2   . TYR A 1 192 ? 18.157 16.029 -2.856  1.00 18.62 ? 1142 TYR A CD2   1 
ATOM   1364 C  CE1   . TYR A 1 192 ? 20.411 15.197 -1.462  1.00 17.27 ? 1142 TYR A CE1   1 
ATOM   1365 C  CE2   . TYR A 1 192 ? 19.122 15.254 -3.499  1.00 17.83 ? 1142 TYR A CE2   1 
ATOM   1366 C  CZ    . TYR A 1 192 ? 20.237 14.832 -2.798  1.00 19.33 ? 1142 TYR A CZ    1 
ATOM   1367 O  OH    . TYR A 1 192 ? 21.195 14.061 -3.441  1.00 19.52 ? 1142 TYR A OH    1 
ATOM   1368 N  N     . LEU A 1 193 ? 13.882 16.987 0.515   1.00 15.28 ? 1143 LEU A N     1 
ATOM   1369 C  CA    . LEU A 1 193 ? 12.841 17.802 1.163   1.00 14.60 ? 1143 LEU A CA    1 
ATOM   1370 C  C     . LEU A 1 193 ? 12.733 17.459 2.639   1.00 14.07 ? 1143 LEU A C     1 
ATOM   1371 O  O     . LEU A 1 193 ? 12.811 16.292 3.013   1.00 15.23 ? 1143 LEU A O     1 
ATOM   1372 C  CB    . LEU A 1 193 ? 11.484 17.558 0.480   1.00 15.07 ? 1143 LEU A CB    1 
ATOM   1373 C  CG    . LEU A 1 193 ? 11.406 17.899 -1.003  1.00 15.24 ? 1143 LEU A CG    1 
ATOM   1374 C  CD1   . LEU A 1 193 ? 10.131 17.293 -1.603  1.00 17.19 ? 1143 LEU A CD1   1 
ATOM   1375 C  CD2   . LEU A 1 193 ? 11.439 19.375 -1.225  1.00 16.58 ? 1143 LEU A CD2   1 
ATOM   1376 N  N     . PHE A 1 194 ? 12.569 18.486 3.477   1.00 14.03 ? 1144 PHE A N     1 
ATOM   1377 C  CA    . PHE A 1 194 ? 12.374 18.321 4.921   1.00 13.73 ? 1144 PHE A CA    1 
ATOM   1378 C  C     . PHE A 1 194 ? 11.190 19.182 5.397   1.00 13.63 ? 1144 PHE A C     1 
ATOM   1379 O  O     . PHE A 1 194 ? 11.244 20.419 5.372   1.00 14.25 ? 1144 PHE A O     1 
ATOM   1380 C  CB    . PHE A 1 194 ? 13.656 18.722 5.673   1.00 13.70 ? 1144 PHE A CB    1 
ATOM   1381 C  CG    . PHE A 1 194 ? 13.760 18.169 7.061   1.00 14.98 ? 1144 PHE A CG    1 
ATOM   1382 C  CD1   . PHE A 1 194 ? 14.873 17.413 7.423   1.00 14.72 ? 1144 PHE A CD1   1 
ATOM   1383 C  CD2   . PHE A 1 194 ? 12.777 18.408 8.019   1.00 14.97 ? 1144 PHE A CD2   1 
ATOM   1384 C  CE1   . PHE A 1 194 ? 15.008 16.870 8.709   1.00 14.83 ? 1144 PHE A CE1   1 
ATOM   1385 C  CE2   . PHE A 1 194 ? 12.903 17.881 9.305   1.00 14.36 ? 1144 PHE A CE2   1 
ATOM   1386 C  CZ    . PHE A 1 194 ? 14.029 17.091 9.651   1.00 13.85 ? 1144 PHE A CZ    1 
ATOM   1387 N  N     . ASP A 1 195 ? 10.103 18.531 5.818   1.00 14.46 ? 1145 ASP A N     1 
ATOM   1388 C  CA    . ASP A 1 195 ? 8.935  19.268 6.296   1.00 14.70 ? 1145 ASP A CA    1 
ATOM   1389 C  C     . ASP A 1 195 ? 9.209  19.910 7.657   1.00 14.73 ? 1145 ASP A C     1 
ATOM   1390 O  O     . ASP A 1 195 ? 9.698  19.243 8.587   1.00 14.83 ? 1145 ASP A O     1 
ATOM   1391 C  CB    . ASP A 1 195 ? 7.737  18.332 6.453   1.00 15.39 ? 1145 ASP A CB    1 
ATOM   1392 C  CG    . ASP A 1 195 ? 7.022  18.061 5.164   1.00 17.26 ? 1145 ASP A CG    1 
ATOM   1393 O  OD1   . ASP A 1 195 ? 7.374  18.656 4.116   1.00 19.00 ? 1145 ASP A OD1   1 
ATOM   1394 O  OD2   . ASP A 1 195 ? 6.075  17.223 5.210   1.00 20.14 ? 1145 ASP A OD2   1 
ATOM   1395 N  N     . LEU A 1 196 ? 8.820  21.172 7.802   1.00 14.55 ? 1146 LEU A N     1 
ATOM   1396 C  CA    . LEU A 1 196 ? 9.043  21.878 9.062   1.00 14.85 ? 1146 LEU A CA    1 
ATOM   1397 C  C     . LEU A 1 196 ? 7.937  21.661 10.103  1.00 16.55 ? 1146 LEU A C     1 
ATOM   1398 O  O     . LEU A 1 196 ? 8.124  21.962 11.289  1.00 17.03 ? 1146 LEU A O     1 
ATOM   1399 C  CB    . LEU A 1 196 ? 9.230  23.380 8.812   1.00 15.15 ? 1146 LEU A CB    1 
ATOM   1400 C  CG    . LEU A 1 196 ? 10.418 23.773 7.935   1.00 13.83 ? 1146 LEU A CG    1 
ATOM   1401 C  CD1   . LEU A 1 196 ? 10.489 25.292 7.791   1.00 13.32 ? 1146 LEU A CD1   1 
ATOM   1402 C  CD2   . LEU A 1 196 ? 11.706 23.247 8.551   1.00 16.09 ? 1146 LEU A CD2   1 
ATOM   1403 N  N     . ASP A 1 197 ? 6.795  21.152 9.646   1.00 17.82 ? 1147 ASP A N     1 
ATOM   1404 C  CA    . ASP A 1 197 ? 5.608  20.959 10.500  1.00 20.10 ? 1147 ASP A CA    1 
ATOM   1405 C  C     . ASP A 1 197 ? 4.892  19.764 9.898   1.00 20.67 ? 1147 ASP A C     1 
ATOM   1406 O  O     . ASP A 1 197 ? 4.791  19.663 8.671   1.00 20.37 ? 1147 ASP A O     1 
ATOM   1407 C  CB    . ASP A 1 197 ? 4.726  22.216 10.439  1.00 20.53 ? 1147 ASP A CB    1 
ATOM   1408 C  CG    . ASP A 1 197 ? 3.454  22.137 11.318  1.00 24.48 ? 1147 ASP A CG    1 
ATOM   1409 O  OD1   . ASP A 1 197 ? 3.173  21.114 11.987  1.00 25.65 ? 1147 ASP A OD1   1 
ATOM   1410 O  OD2   . ASP A 1 197 ? 2.715  23.149 11.330  1.00 28.65 ? 1147 ASP A OD2   1 
ATOM   1411 N  N     . ASN A 1 198 ? 4.388  18.875 10.755  1.00 22.13 ? 1148 ASN A N     1 
ATOM   1412 C  CA    . ASN A 1 198 ? 3.734  17.660 10.280  1.00 23.18 ? 1148 ASN A CA    1 
ATOM   1413 C  C     . ASN A 1 198 ? 2.220  17.788 10.180  1.00 24.72 ? 1148 ASN A C     1 
ATOM   1414 O  O     . ASN A 1 198 ? 1.547  16.883 9.675   1.00 24.37 ? 1148 ASN A O     1 
ATOM   1415 C  CB    . ASN A 1 198 ? 4.102  16.489 11.178  1.00 23.00 ? 1148 ASN A CB    1 
ATOM   1416 C  CG    . ASN A 1 198 ? 5.587  16.194 11.153  1.00 23.25 ? 1148 ASN A CG    1 
ATOM   1417 O  OD1   . ASN A 1 198 ? 6.261  16.418 10.142  1.00 21.65 ? 1148 ASN A OD1   1 
ATOM   1418 N  ND2   . ASN A 1 198 ? 6.103  15.705 12.264  1.00 24.45 ? 1148 ASN A ND2   1 
ATOM   1419 N  N     . LYS A 1 199 ? 1.698  18.918 10.646  1.00 25.96 ? 1149 LYS A N     1 
ATOM   1420 C  CA    . LYS A 1 199 ? 0.258  19.159 10.646  1.00 27.93 ? 1149 LYS A CA    1 
ATOM   1421 C  C     . LYS A 1 199 ? -0.251 19.491 9.251   1.00 28.05 ? 1149 LYS A C     1 
ATOM   1422 O  O     . LYS A 1 199 ? 0.525  19.664 8.307   1.00 27.39 ? 1149 LYS A O     1 
ATOM   1423 C  CB    . LYS A 1 199 ? -0.090 20.274 11.638  1.00 28.01 ? 1149 LYS A CB    1 
ATOM   1424 C  CG    . LYS A 1 199 ? 0.270  19.921 13.091  1.00 29.80 ? 1149 LYS A CG    1 
ATOM   1425 C  CD    . LYS A 1 199 ? -0.398 20.842 14.108  1.00 30.44 ? 1149 LYS A CD    1 
ATOM   1426 C  CE    . LYS A 1 199 ? 0.357  22.154 14.246  1.00 33.87 ? 1149 LYS A CE    1 
ATOM   1427 N  NZ    . LYS A 1 199 ? -0.211 22.984 15.341  1.00 37.17 ? 1149 LYS A NZ    1 
ATOM   1428 N  N     . ASP A 1 200 ? -1.569 19.562 9.108   1.00 28.83 ? 1150 ASP A N     1 
ATOM   1429 C  CA    . ASP A 1 200 ? -2.137 20.047 7.869   1.00 29.58 ? 1150 ASP A CA    1 
ATOM   1430 C  C     . ASP A 1 200 ? -2.216 21.576 7.962   1.00 28.82 ? 1150 ASP A C     1 
ATOM   1431 O  O     . ASP A 1 200 ? -1.951 22.157 9.026   1.00 30.40 ? 1150 ASP A O     1 
ATOM   1432 C  CB    . ASP A 1 200 ? -3.512 19.419 7.619   1.00 30.33 ? 1150 ASP A CB    1 
ATOM   1433 C  CG    . ASP A 1 200 ? -3.779 19.168 6.142   1.00 34.04 ? 1150 ASP A CG    1 
ATOM   1434 O  OD1   . ASP A 1 200 ? -3.830 20.142 5.355   1.00 38.40 ? 1150 ASP A OD1   1 
ATOM   1435 O  OD2   . ASP A 1 200 ? -3.953 17.986 5.761   1.00 38.73 ? 1150 ASP A OD2   1 
ATOM   1436 N  N     . GLY A 1 201 ? -2.538 22.234 6.857   1.00 27.26 ? 1151 GLY A N     1 
ATOM   1437 C  CA    . GLY A 1 201 ? -2.686 23.680 6.880   1.00 25.21 ? 1151 GLY A CA    1 
ATOM   1438 C  C     . GLY A 1 201 ? -1.487 24.399 6.295   1.00 23.57 ? 1151 GLY A C     1 
ATOM   1439 O  O     . GLY A 1 201 ? -0.826 23.889 5.384   1.00 24.06 ? 1151 GLY A O     1 
ATOM   1440 N  N     . GLU A 1 202 ? -1.218 25.591 6.812   1.00 21.88 ? 1152 GLU A N     1 
ATOM   1441 C  CA    . GLU A 1 202 ? -0.132 26.415 6.306   1.00 20.38 ? 1152 GLU A CA    1 
ATOM   1442 C  C     . GLU A 1 202 ? 1.179  25.863 6.850   1.00 19.79 ? 1152 GLU A C     1 
ATOM   1443 O  O     . GLU A 1 202 ? 1.498  26.039 8.031   1.00 20.76 ? 1152 GLU A O     1 
ATOM   1444 C  CB    . GLU A 1 202 ? -0.326 27.881 6.712   1.00 20.12 ? 1152 GLU A CB    1 
ATOM   1445 C  CG    . GLU A 1 202 ? 0.579  28.844 5.990   1.00 19.79 ? 1152 GLU A CG    1 
ATOM   1446 C  CD    . GLU A 1 202 ? 0.732  30.159 6.701   1.00 19.60 ? 1152 GLU A CD    1 
ATOM   1447 O  OE1   . GLU A 1 202 ? -0.064 30.441 7.626   1.00 20.01 ? 1152 GLU A OE1   1 
ATOM   1448 O  OE2   . GLU A 1 202 ? 1.644  30.920 6.313   1.00 19.16 ? 1152 GLU A OE2   1 
ATOM   1449 N  N     . VAL A 1 203 ? 1.921  25.187 5.978   1.00 18.92 ? 1153 VAL A N     1 
ATOM   1450 C  CA    . VAL A 1 203 ? 3.116  24.435 6.379   1.00 18.15 ? 1153 VAL A CA    1 
ATOM   1451 C  C     . VAL A 1 203 ? 4.221  24.734 5.375   1.00 16.49 ? 1153 VAL A C     1 
ATOM   1452 O  O     . VAL A 1 203 ? 3.935  24.966 4.206   1.00 16.38 ? 1153 VAL A O     1 
ATOM   1453 C  CB    . VAL A 1 203 ? 2.817  22.912 6.405   1.00 19.00 ? 1153 VAL A CB    1 
ATOM   1454 C  CG1   . VAL A 1 203 ? 4.090  22.068 6.294   1.00 21.23 ? 1153 VAL A CG1   1 
ATOM   1455 C  CG2   . VAL A 1 203 ? 2.029  22.563 7.673   1.00 20.79 ? 1153 VAL A CG2   1 
ATOM   1456 N  N     . TYR A 1 204 ? 5.475  24.716 5.841   1.00 15.05 ? 1154 TYR A N     1 
ATOM   1457 C  CA    . TYR A 1 204 ? 6.627  25.012 4.981   1.00 14.86 ? 1154 TYR A CA    1 
ATOM   1458 C  C     . TYR A 1 204 ? 7.639  23.859 5.009   1.00 14.24 ? 1154 TYR A C     1 
ATOM   1459 O  O     . TYR A 1 204 ? 7.547  22.954 5.838   1.00 14.16 ? 1154 TYR A O     1 
ATOM   1460 C  CB    . TYR A 1 204 ? 7.258  26.362 5.364   1.00 15.14 ? 1154 TYR A CB    1 
ATOM   1461 C  CG    . TYR A 1 204 ? 6.254  27.481 5.163   1.00 14.84 ? 1154 TYR A CG    1 
ATOM   1462 C  CD1   . TYR A 1 204 ? 6.162  28.138 3.945   1.00 15.82 ? 1154 TYR A CD1   1 
ATOM   1463 C  CD2   . TYR A 1 204 ? 5.360  27.830 6.185   1.00 15.24 ? 1154 TYR A CD2   1 
ATOM   1464 C  CE1   . TYR A 1 204 ? 5.213  29.151 3.737   1.00 13.04 ? 1154 TYR A CE1   1 
ATOM   1465 C  CE2   . TYR A 1 204 ? 4.418  28.845 5.991   1.00 15.15 ? 1154 TYR A CE2   1 
ATOM   1466 C  CZ    . TYR A 1 204 ? 4.349  29.488 4.766   1.00 14.89 ? 1154 TYR A CZ    1 
ATOM   1467 O  OH    . TYR A 1 204 ? 3.415  30.490 4.545   1.00 15.81 ? 1154 TYR A OH    1 
ATOM   1468 N  N     A CYS A 1 205 ? 8.617  23.923 4.115   0.50 13.18 ? 1155 CYS A N     1 
ATOM   1469 N  N     B CYS A 1 205 ? 8.584  23.907 4.082   0.50 14.18 ? 1155 CYS A N     1 
ATOM   1470 C  CA    A CYS A 1 205 ? 9.516  22.805 3.864   0.50 13.29 ? 1155 CYS A CA    1 
ATOM   1471 C  CA    B CYS A 1 205 ? 9.574  22.857 3.936   0.50 15.04 ? 1155 CYS A CA    1 
ATOM   1472 C  C     A CYS A 1 205 ? 10.864 23.353 3.410   0.50 13.37 ? 1155 CYS A C     1 
ATOM   1473 C  C     B CYS A 1 205 ? 10.906 23.488 3.626   0.50 14.24 ? 1155 CYS A C     1 
ATOM   1474 O  O     A CYS A 1 205 ? 10.904 24.359 2.715   0.50 12.73 ? 1155 CYS A O     1 
ATOM   1475 O  O     B CYS A 1 205 ? 10.978 24.652 3.245   0.50 13.36 ? 1155 CYS A O     1 
ATOM   1476 C  CB    A CYS A 1 205 ? 8.899  21.953 2.753   0.50 13.48 ? 1155 CYS A CB    1 
ATOM   1477 C  CB    B CYS A 1 205 ? 9.188  21.943 2.777   0.50 15.64 ? 1155 CYS A CB    1 
ATOM   1478 S  SG    A CYS A 1 205 ? 9.787  20.460 2.303   0.50 12.48 ? 1155 CYS A SG    1 
ATOM   1479 S  SG    B CYS A 1 205 ? 7.531  21.310 2.902   0.50 21.30 ? 1155 CYS A SG    1 
ATOM   1480 N  N     . ILE A 1 206 ? 11.962 22.708 3.809   1.00 13.74 ? 1156 ILE A N     1 
ATOM   1481 C  CA    . ILE A 1 206 ? 13.277 23.066 3.284   1.00 14.69 ? 1156 ILE A CA    1 
ATOM   1482 C  C     . ILE A 1 206 ? 13.628 22.074 2.179   1.00 14.15 ? 1156 ILE A C     1 
ATOM   1483 O  O     . ILE A 1 206 ? 13.660 20.861 2.422   1.00 15.19 ? 1156 ILE A O     1 
ATOM   1484 C  CB    . ILE A 1 206 ? 14.344 23.057 4.399   1.00 14.59 ? 1156 ILE A CB    1 
ATOM   1485 C  CG1   . ILE A 1 206 ? 14.027 24.158 5.415   1.00 15.38 ? 1156 ILE A CG1   1 
ATOM   1486 C  CG2   . ILE A 1 206 ? 15.755 23.294 3.801   1.00 15.31 ? 1156 ILE A CG2   1 
ATOM   1487 C  CD1   . ILE A 1 206 ? 14.838 24.059 6.722   1.00 17.43 ? 1156 ILE A CD1   1 
ATOM   1488 N  N     . ASP A 1 207 ? 13.897 22.587 0.980   1.00 14.06 ? 1157 ASP A N     1 
ATOM   1489 C  CA    . ASP A 1 207 ? 14.386 21.749 -0.101  1.00 13.88 ? 1157 ASP A CA    1 
ATOM   1490 C  C     . ASP A 1 207 ? 15.881 21.981 -0.258  1.00 13.58 ? 1157 ASP A C     1 
ATOM   1491 O  O     . ASP A 1 207 ? 16.300 23.091 -0.575  1.00 13.84 ? 1157 ASP A O     1 
ATOM   1492 C  CB    . ASP A 1 207 ? 13.678 22.058 -1.433  1.00 14.05 ? 1157 ASP A CB    1 
ATOM   1493 C  CG    . ASP A 1 207 ? 14.049 21.064 -2.515  1.00 16.68 ? 1157 ASP A CG    1 
ATOM   1494 O  OD1   . ASP A 1 207 ? 14.825 20.127 -2.209  1.00 16.03 ? 1157 ASP A OD1   1 
ATOM   1495 O  OD2   . ASP A 1 207 ? 13.615 21.235 -3.678  1.00 17.31 ? 1157 ASP A OD2   1 
ATOM   1496 N  N     . ALA A 1 208 ? 16.669 20.953 0.031   1.00 13.64 ? 1158 ALA A N     1 
ATOM   1497 C  CA    . ALA A 1 208 ? 18.132 21.079 -0.047  1.00 14.19 ? 1158 ALA A CA    1 
ATOM   1498 C  C     . ALA A 1 208 ? 18.663 20.584 -1.394  1.00 15.27 ? 1158 ALA A C     1 
ATOM   1499 O  O     . ALA A 1 208 ? 19.876 20.424 -1.580  1.00 15.90 ? 1158 ALA A O     1 
ATOM   1500 C  CB    . ALA A 1 208 ? 18.821 20.370 1.137   1.00 14.47 ? 1158 ALA A CB    1 
ATOM   1501 N  N     . ARG A 1 209 ? 17.761 20.362 -2.354  1.00 15.44 ? 1159 ARG A N     1 
ATOM   1502 C  CA    . ARG A 1 209 ? 18.196 19.835 -3.657  1.00 16.34 ? 1159 ARG A CA    1 
ATOM   1503 C  C     . ARG A 1 209 ? 19.104 20.791 -4.431  1.00 16.32 ? 1159 ARG A C     1 
ATOM   1504 O  O     . ARG A 1 209 ? 20.178 20.393 -4.883  1.00 16.83 ? 1159 ARG A O     1 
ATOM   1505 C  CB    . ARG A 1 209 ? 16.996 19.415 -4.521  1.00 16.29 ? 1159 ARG A CB    1 
ATOM   1506 C  CG    . ARG A 1 209 ? 17.326 19.186 -6.007  1.00 18.89 ? 1159 ARG A CG    1 
ATOM   1507 C  CD    . ARG A 1 209 ? 18.288 18.010 -6.224  1.00 21.40 ? 1159 ARG A CD    1 
ATOM   1508 N  NE    . ARG A 1 209 ? 18.630 17.865 -7.645  1.00 23.51 ? 1159 ARG A NE    1 
ATOM   1509 C  CZ    . ARG A 1 209 ? 19.598 18.537 -8.270  1.00 24.94 ? 1159 ARG A CZ    1 
ATOM   1510 N  NH1   . ARG A 1 209 ? 20.365 19.400 -7.609  1.00 23.13 ? 1159 ARG A NH1   1 
ATOM   1511 N  NH2   . ARG A 1 209 ? 19.813 18.327 -9.568  1.00 25.58 ? 1159 ARG A NH2   1 
ATOM   1512 N  N     . PHE A 1 210 ? 18.667 22.030 -4.597  1.00 16.09 ? 1160 PHE A N     1 
ATOM   1513 C  CA    . PHE A 1 210 ? 19.389 22.999 -5.434  1.00 16.23 ? 1160 PHE A CA    1 
ATOM   1514 C  C     . PHE A 1 210 ? 20.339 23.874 -4.630  1.00 15.54 ? 1160 PHE A C     1 
ATOM   1515 O  O     . PHE A 1 210 ? 21.385 24.286 -5.141  1.00 15.77 ? 1160 PHE A O     1 
ATOM   1516 C  CB    . PHE A 1 210 ? 18.399 23.836 -6.246  1.00 17.32 ? 1160 PHE A CB    1 
ATOM   1517 C  CG    . PHE A 1 210 ? 17.519 22.995 -7.122  1.00 18.90 ? 1160 PHE A CG    1 
ATOM   1518 C  CD1   . PHE A 1 210 ? 18.047 22.367 -8.250  1.00 21.37 ? 1160 PHE A CD1   1 
ATOM   1519 C  CD2   . PHE A 1 210 ? 16.184 22.786 -6.794  1.00 20.59 ? 1160 PHE A CD2   1 
ATOM   1520 C  CE1   . PHE A 1 210 ? 17.240 21.559 -9.054  1.00 22.24 ? 1160 PHE A CE1   1 
ATOM   1521 C  CE2   . PHE A 1 210 ? 15.368 21.982 -7.591  1.00 21.97 ? 1160 PHE A CE2   1 
ATOM   1522 C  CZ    . PHE A 1 210 ? 15.903 21.366 -8.718  1.00 20.43 ? 1160 PHE A CZ    1 
ATOM   1523 N  N     . TYR A 1 211 ? 19.949 24.164 -3.389  1.00 15.08 ? 1161 TYR A N     1 
ATOM   1524 C  CA    . TYR A 1 211 ? 20.742 24.959 -2.447  1.00 15.21 ? 1161 TYR A CA    1 
ATOM   1525 C  C     . TYR A 1 211 ? 20.718 24.194 -1.142  1.00 15.41 ? 1161 TYR A C     1 
ATOM   1526 O  O     . TYR A 1 211 ? 19.647 23.887 -0.626  1.00 15.45 ? 1161 TYR A O     1 
ATOM   1527 C  CB    . TYR A 1 211 ? 20.119 26.352 -2.220  1.00 16.11 ? 1161 TYR A CB    1 
ATOM   1528 C  CG    . TYR A 1 211 ? 19.829 27.076 -3.505  1.00 17.53 ? 1161 TYR A CG    1 
ATOM   1529 C  CD1   . TYR A 1 211 ? 20.816 27.799 -4.165  1.00 19.41 ? 1161 TYR A CD1   1 
ATOM   1530 C  CD2   . TYR A 1 211 ? 18.566 26.989 -4.079  1.00 19.85 ? 1161 TYR A CD2   1 
ATOM   1531 C  CE1   . TYR A 1 211 ? 20.530 28.440 -5.379  1.00 20.07 ? 1161 TYR A CE1   1 
ATOM   1532 C  CE2   . TYR A 1 211 ? 18.274 27.619 -5.263  1.00 20.81 ? 1161 TYR A CE2   1 
ATOM   1533 C  CZ    . TYR A 1 211 ? 19.249 28.342 -5.898  1.00 19.39 ? 1161 TYR A CZ    1 
ATOM   1534 O  OH    . TYR A 1 211 ? 18.924 28.949 -7.094  1.00 23.89 ? 1161 TYR A OH    1 
ATOM   1535 N  N     . GLY A 1 212 ? 21.883 23.869 -0.602  1.00 14.26 ? 1162 GLY A N     1 
ATOM   1536 C  CA    . GLY A 1 212 ? 21.921 23.100 0.624   1.00 13.70 ? 1162 GLY A CA    1 
ATOM   1537 C  C     . GLY A 1 212 ? 23.299 23.123 1.241   1.00 14.23 ? 1162 GLY A C     1 
ATOM   1538 O  O     . GLY A 1 212 ? 24.241 23.652 0.653   1.00 14.72 ? 1162 GLY A O     1 
ATOM   1539 N  N     . ASN A 1 213 ? 23.409 22.609 2.455   1.00 13.83 ? 1163 ASN A N     1 
ATOM   1540 C  CA    . ASN A 1 213 ? 24.719 22.520 3.080   1.00 13.78 ? 1163 ASN A CA    1 
ATOM   1541 C  C     . ASN A 1 213 ? 25.090 21.049 3.244   1.00 13.63 ? 1163 ASN A C     1 
ATOM   1542 O  O     . ASN A 1 213 ? 24.487 20.166 2.620   1.00 14.34 ? 1163 ASN A O     1 
ATOM   1543 C  CB    . ASN A 1 213 ? 24.759 23.316 4.400   1.00 13.73 ? 1163 ASN A CB    1 
ATOM   1544 C  CG    . ASN A 1 213 ? 23.996 22.625 5.530   1.00 13.65 ? 1163 ASN A CG    1 
ATOM   1545 O  OD1   . ASN A 1 213 ? 23.246 21.681 5.301   1.00 15.30 ? 1163 ASN A OD1   1 
ATOM   1546 N  ND2   . ASN A 1 213 ? 24.215 23.090 6.758   1.00 12.85 ? 1163 ASN A ND2   1 
ATOM   1547 N  N     . VAL A 1 214 ? 26.080 20.766 4.089   1.00 14.02 ? 1164 VAL A N     1 
ATOM   1548 C  CA    . VAL A 1 214 ? 26.553 19.396 4.252   1.00 14.46 ? 1164 VAL A CA    1 
ATOM   1549 C  C     . VAL A 1 214 ? 25.451 18.386 4.667   1.00 14.06 ? 1164 VAL A C     1 
ATOM   1550 O  O     . VAL A 1 214 ? 25.536 17.203 4.348   1.00 14.34 ? 1164 VAL A O     1 
ATOM   1551 C  CB    . VAL A 1 214 ? 27.736 19.383 5.262   1.00 15.09 ? 1164 VAL A CB    1 
ATOM   1552 C  CG1   . VAL A 1 214 ? 27.284 19.840 6.648   1.00 15.55 ? 1164 VAL A CG1   1 
ATOM   1553 C  CG2   . VAL A 1 214 ? 28.411 18.030 5.291   1.00 15.97 ? 1164 VAL A CG2   1 
ATOM   1554 N  N     A SER A 1 215 ? 24.424 18.871 5.369   0.50 13.99 ? 1165 SER A N     1 
ATOM   1555 N  N     B SER A 1 215 ? 24.433 18.876 5.374   0.50 14.02 ? 1165 SER A N     1 
ATOM   1556 C  CA    A SER A 1 215 ? 23.374 17.993 5.899   0.50 13.74 ? 1165 SER A CA    1 
ATOM   1557 C  CA    B SER A 1 215 ? 23.382 18.013 5.913   0.50 13.82 ? 1165 SER A CA    1 
ATOM   1558 C  C     A SER A 1 215 ? 22.545 17.323 4.812   0.50 13.65 ? 1165 SER A C     1 
ATOM   1559 C  C     B SER A 1 215 ? 22.545 17.337 4.822   0.50 13.69 ? 1165 SER A C     1 
ATOM   1560 O  O     A SER A 1 215 ? 21.877 16.320 5.071   0.50 14.46 ? 1165 SER A O     1 
ATOM   1561 O  O     B SER A 1 215 ? 21.873 16.340 5.092   0.50 14.50 ? 1165 SER A O     1 
ATOM   1562 C  CB    A SER A 1 215 ? 22.445 18.768 6.823   0.50 12.97 ? 1165 SER A CB    1 
ATOM   1563 C  CB    B SER A 1 215 ? 22.469 18.824 6.822   0.50 13.06 ? 1165 SER A CB    1 
ATOM   1564 O  OG    A SER A 1 215 ? 23.182 19.384 7.845   0.50 13.04 ? 1165 SER A OG    1 
ATOM   1565 O  OG    B SER A 1 215 ? 21.798 19.808 6.058   0.50 13.45 ? 1165 SER A OG    1 
ATOM   1566 N  N     . ARG A 1 216 ? 22.583 17.880 3.603   1.00 13.87 ? 1166 ARG A N     1 
ATOM   1567 C  CA    . ARG A 1 216 ? 21.852 17.275 2.469   1.00 13.70 ? 1166 ARG A CA    1 
ATOM   1568 C  C     . ARG A 1 216 ? 22.383 15.863 2.143   1.00 13.89 ? 1166 ARG A C     1 
ATOM   1569 O  O     . ARG A 1 216 ? 21.682 15.055 1.531   1.00 14.92 ? 1166 ARG A O     1 
ATOM   1570 C  CB    . ARG A 1 216 ? 21.901 18.178 1.239   1.00 13.66 ? 1166 ARG A CB    1 
ATOM   1571 C  CG    . ARG A 1 216 ? 23.200 18.121 0.478   1.00 13.21 ? 1166 ARG A CG    1 
ATOM   1572 C  CD    . ARG A 1 216 ? 23.266 19.220 -0.565  1.00 14.53 ? 1166 ARG A CD    1 
ATOM   1573 N  NE    . ARG A 1 216 ? 22.336 19.070 -1.702  1.00 15.43 ? 1166 ARG A NE    1 
ATOM   1574 C  CZ    . ARG A 1 216 ? 22.473 18.194 -2.707  1.00 17.55 ? 1166 ARG A CZ    1 
ATOM   1575 N  NH1   . ARG A 1 216 ? 23.468 17.300 -2.730  1.00 16.76 ? 1166 ARG A NH1   1 
ATOM   1576 N  NH2   . ARG A 1 216 ? 21.597 18.185 -3.720  1.00 18.38 ? 1166 ARG A NH2   1 
ATOM   1577 N  N     . PHE A 1 217 ? 23.616 15.580 2.582   1.00 14.18 ? 1167 PHE A N     1 
ATOM   1578 C  CA    . PHE A 1 217 ? 24.266 14.311 2.295   1.00 14.50 ? 1167 PHE A CA    1 
ATOM   1579 C  C     . PHE A 1 217 ? 24.161 13.273 3.424   1.00 14.23 ? 1167 PHE A C     1 
ATOM   1580 O  O     . PHE A 1 217 ? 24.710 12.181 3.301   1.00 15.24 ? 1167 PHE A O     1 
ATOM   1581 C  CB    . PHE A 1 217 ? 25.752 14.544 1.956   1.00 14.35 ? 1167 PHE A CB    1 
ATOM   1582 C  CG    . PHE A 1 217 ? 25.983 15.289 0.661   1.00 14.10 ? 1167 PHE A CG    1 
ATOM   1583 C  CD1   . PHE A 1 217 ? 25.733 14.673 -0.574  1.00 15.69 ? 1167 PHE A CD1   1 
ATOM   1584 C  CD2   . PHE A 1 217 ? 26.448 16.618 0.679   1.00 13.91 ? 1167 PHE A CD2   1 
ATOM   1585 C  CE1   . PHE A 1 217 ? 25.959 15.352 -1.763  1.00 14.32 ? 1167 PHE A CE1   1 
ATOM   1586 C  CE2   . PHE A 1 217 ? 26.675 17.301 -0.527  1.00 15.00 ? 1167 PHE A CE2   1 
ATOM   1587 C  CZ    . PHE A 1 217 ? 26.431 16.648 -1.740  1.00 14.15 ? 1167 PHE A CZ    1 
ATOM   1588 N  N     . ILE A 1 218 ? 23.468 13.608 4.519   1.00 14.06 ? 1168 ILE A N     1 
ATOM   1589 C  CA    . ILE A 1 218 ? 23.358 12.693 5.645   1.00 14.21 ? 1168 ILE A CA    1 
ATOM   1590 C  C     . ILE A 1 218 ? 22.353 11.605 5.313   1.00 14.80 ? 1168 ILE A C     1 
ATOM   1591 O  O     . ILE A 1 218 ? 21.184 11.907 5.052   1.00 15.01 ? 1168 ILE A O     1 
ATOM   1592 C  CB    . ILE A 1 218 ? 22.928 13.415 6.941   1.00 14.18 ? 1168 ILE A CB    1 
ATOM   1593 C  CG1   . ILE A 1 218 ? 23.995 14.438 7.340   1.00 14.11 ? 1168 ILE A CG1   1 
ATOM   1594 C  CG2   . ILE A 1 218 ? 22.692 12.405 8.076   1.00 15.30 ? 1168 ILE A CG2   1 
ATOM   1595 C  CD1   . ILE A 1 218 ? 23.604 15.259 8.573   1.00 14.43 ? 1168 ILE A CD1   1 
ATOM   1596 N  N     . ASN A 1 219 ? 22.820 10.362 5.326   1.00 15.54 ? 1169 ASN A N     1 
ATOM   1597 C  CA    . ASN A 1 219 ? 21.964 9.215  5.030   1.00 15.70 ? 1169 ASN A CA    1 
ATOM   1598 C  C     . ASN A 1 219 ? 21.035 8.822  6.183   1.00 15.88 ? 1169 ASN A C     1 
ATOM   1599 O  O     . ASN A 1 219 ? 21.253 9.199  7.347   1.00 15.47 ? 1169 ASN A O     1 
ATOM   1600 C  CB    . ASN A 1 219 ? 22.822 8.021  4.575   1.00 16.36 ? 1169 ASN A CB    1 
ATOM   1601 C  CG    . ASN A 1 219 ? 23.468 8.254  3.218   1.00 17.91 ? 1169 ASN A CG    1 
ATOM   1602 O  OD1   . ASN A 1 219 ? 24.670 7.955  3.018   1.00 23.06 ? 1169 ASN A OD1   1 
ATOM   1603 N  ND2   . ASN A 1 219 ? 22.709 8.804  2.286   1.00 15.06 ? 1169 ASN A ND2   1 
ATOM   1604 N  N     . HIS A 1 220 ? 19.981 8.087  5.824   1.00 16.33 ? 1170 HIS A N     1 
ATOM   1605 C  CA    . HIS A 1 220 ? 19.010 7.577  6.783   1.00 17.56 ? 1170 HIS A CA    1 
ATOM   1606 C  C     . HIS A 1 220 ? 19.553 6.408  7.580   1.00 17.94 ? 1170 HIS A C     1 
ATOM   1607 O  O     . HIS A 1 220 ? 20.171 5.497  7.011   1.00 18.93 ? 1170 HIS A O     1 
ATOM   1608 C  CB    . HIS A 1 220 ? 17.748 7.109  6.053   1.00 18.16 ? 1170 HIS A CB    1 
ATOM   1609 C  CG    . HIS A 1 220 ? 16.774 6.430  6.958   1.00 18.79 ? 1170 HIS A CG    1 
ATOM   1610 N  ND1   . HIS A 1 220 ? 16.725 5.060  7.115   1.00 20.97 ? 1170 HIS A ND1   1 
ATOM   1611 C  CD2   . HIS A 1 220 ? 15.857 6.941  7.812   1.00 17.12 ? 1170 HIS A CD2   1 
ATOM   1612 C  CE1   . HIS A 1 220 ? 15.805 4.758  8.013   1.00 18.22 ? 1170 HIS A CE1   1 
ATOM   1613 N  NE2   . HIS A 1 220 ? 15.264 5.883  8.452   1.00 23.57 ? 1170 HIS A NE2   1 
ATOM   1614 N  N     . HIS A 1 221 ? 19.271 6.401  8.880   1.00 18.23 ? 1171 HIS A N     1 
ATOM   1615 C  CA    . HIS A 1 221 ? 19.594 5.241  9.710   1.00 19.61 ? 1171 HIS A CA    1 
ATOM   1616 C  C     . HIS A 1 221 ? 18.446 4.933  10.653  1.00 20.69 ? 1171 HIS A C     1 
ATOM   1617 O  O     . HIS A 1 221 ? 17.870 5.842  11.240  1.00 20.86 ? 1171 HIS A O     1 
ATOM   1618 C  CB    . HIS A 1 221 ? 20.873 5.461  10.499  1.00 19.93 ? 1171 HIS A CB    1 
ATOM   1619 C  CG    . HIS A 1 221 ? 21.541 4.188  10.922  1.00 21.56 ? 1171 HIS A CG    1 
ATOM   1620 N  ND1   . HIS A 1 221 ? 21.107 3.442  11.997  1.00 23.35 ? 1171 HIS A ND1   1 
ATOM   1621 C  CD2   . HIS A 1 221 ? 22.614 3.535  10.418  1.00 23.50 ? 1171 HIS A CD2   1 
ATOM   1622 C  CE1   . HIS A 1 221 ? 21.893 2.387  12.143  1.00 24.11 ? 1171 HIS A CE1   1 
ATOM   1623 N  NE2   . HIS A 1 221 ? 22.817 2.424  11.202  1.00 24.22 ? 1171 HIS A NE2   1 
ATOM   1624 N  N     . CYS A 1 222 ? 18.108 3.650  10.789  1.00 21.77 ? 1172 CYS A N     1 
ATOM   1625 C  CA    . CYS A 1 222 ? 16.974 3.252  11.620  1.00 23.02 ? 1172 CYS A CA    1 
ATOM   1626 C  C     . CYS A 1 222 ? 17.258 3.311  13.125  1.00 23.86 ? 1172 CYS A C     1 
ATOM   1627 O  O     . CYS A 1 222 ? 16.325 3.388  13.930  1.00 24.83 ? 1172 CYS A O     1 
ATOM   1628 C  CB    . CYS A 1 222 ? 16.454 1.866  11.195  1.00 22.55 ? 1172 CYS A CB    1 
ATOM   1629 S  SG    . CYS A 1 222 ? 15.649 1.887  9.584   1.00 23.48 ? 1172 CYS A SG    1 
ATOM   1630 N  N     . GLU A 1 223 ? 18.539 3.282  13.495  1.00 24.40 ? 1173 GLU A N     1 
ATOM   1631 C  CA    . GLU A 1 223 ? 18.966 3.503  14.881  1.00 25.24 ? 1173 GLU A CA    1 
ATOM   1632 C  C     . GLU A 1 223 ? 19.945 4.678  14.921  1.00 24.14 ? 1173 GLU A C     1 
ATOM   1633 O  O     . GLU A 1 223 ? 21.144 4.500  15.146  1.00 24.72 ? 1173 GLU A O     1 
ATOM   1634 C  CB    . GLU A 1 223 ? 19.577 2.234  15.488  1.00 26.46 ? 1173 GLU A CB    1 
ATOM   1635 C  CG    . GLU A 1 223 ? 18.542 1.130  15.750  1.00 30.35 ? 1173 GLU A CG    1 
ATOM   1636 C  CD    . GLU A 1 223 ? 17.544 1.493  16.845  1.00 34.89 ? 1173 GLU A CD    1 
ATOM   1637 O  OE1   . GLU A 1 223 ? 17.975 1.982  17.918  1.00 37.79 ? 1173 GLU A OE1   1 
ATOM   1638 O  OE2   . GLU A 1 223 ? 16.325 1.287  16.634  1.00 36.98 ? 1173 GLU A OE2   1 
ATOM   1639 N  N     . PRO A 1 224 ? 19.415 5.894  14.723  1.00 22.65 ? 1174 PRO A N     1 
ATOM   1640 C  CA    . PRO A 1 224 ? 20.246 7.035  14.333  1.00 21.57 ? 1174 PRO A CA    1 
ATOM   1641 C  C     . PRO A 1 224 ? 21.118 7.627  15.433  1.00 20.15 ? 1174 PRO A C     1 
ATOM   1642 O  O     . PRO A 1 224 ? 20.743 7.625  16.613  1.00 20.46 ? 1174 PRO A O     1 
ATOM   1643 C  CB    . PRO A 1 224 ? 19.212 8.067  13.895  1.00 21.57 ? 1174 PRO A CB    1 
ATOM   1644 C  CG    . PRO A 1 224 ? 18.023 7.772  14.747  1.00 21.96 ? 1174 PRO A CG    1 
ATOM   1645 C  CD    . PRO A 1 224 ? 17.993 6.265  14.837  1.00 22.82 ? 1174 PRO A CD    1 
ATOM   1646 N  N     . ASN A 1 225 ? 22.261 8.178  15.035  1.00 18.35 ? 1175 ASN A N     1 
ATOM   1647 C  CA    . ASN A 1 225 ? 23.089 8.882  15.995  1.00 17.24 ? 1175 ASN A CA    1 
ATOM   1648 C  C     . ASN A 1 225 ? 22.855 10.381 16.020  1.00 16.38 ? 1175 ASN A C     1 
ATOM   1649 O  O     . ASN A 1 225 ? 23.495 11.072 16.785  1.00 16.63 ? 1175 ASN A O     1 
ATOM   1650 C  CB    . ASN A 1 225 ? 24.578 8.556  15.835  1.00 18.03 ? 1175 ASN A CB    1 
ATOM   1651 C  CG    . ASN A 1 225 ? 25.104 8.803  14.440  1.00 18.43 ? 1175 ASN A CG    1 
ATOM   1652 O  OD1   . ASN A 1 225 ? 24.589 9.634  13.685  1.00 17.65 ? 1175 ASN A OD1   1 
ATOM   1653 N  ND2   . ASN A 1 225 ? 26.172 8.082  14.094  1.00 16.82 ? 1175 ASN A ND2   1 
ATOM   1654 N  N     . LEU A 1 226 ? 21.934 10.859 15.181  1.00 15.81 ? 1176 LEU A N     1 
ATOM   1655 C  CA    . LEU A 1 226 ? 21.484 12.256 15.237  1.00 15.67 ? 1176 LEU A CA    1 
ATOM   1656 C  C     . LEU A 1 226 ? 19.976 12.334 15.408  1.00 15.47 ? 1176 LEU A C     1 
ATOM   1657 O  O     . LEU A 1 226 ? 19.257 11.475 14.907  1.00 15.64 ? 1176 LEU A O     1 
ATOM   1658 C  CB    . LEU A 1 226 ? 21.840 12.988 13.933  1.00 15.60 ? 1176 LEU A CB    1 
ATOM   1659 C  CG    . LEU A 1 226 ? 23.325 13.092 13.547  1.00 15.34 ? 1176 LEU A CG    1 
ATOM   1660 C  CD1   . LEU A 1 226 ? 23.430 13.737 12.178  1.00 14.86 ? 1176 LEU A CD1   1 
ATOM   1661 C  CD2   . LEU A 1 226 ? 24.073 13.909 14.592  1.00 15.20 ? 1176 LEU A CD2   1 
ATOM   1662 N  N     . VAL A 1 227 ? 19.504 13.401 16.049  1.00 15.68 ? 1177 VAL A N     1 
ATOM   1663 C  CA    . VAL A 1 227 ? 18.062 13.699 16.114  1.00 16.11 ? 1177 VAL A CA    1 
ATOM   1664 C  C     . VAL A 1 227 ? 17.840 15.155 15.676  1.00 16.01 ? 1177 VAL A C     1 
ATOM   1665 O  O     . VAL A 1 227 ? 18.590 16.031 16.096  1.00 15.57 ? 1177 VAL A O     1 
ATOM   1666 C  CB    . VAL A 1 227 ? 17.484 13.440 17.538  1.00 16.09 ? 1177 VAL A CB    1 
ATOM   1667 C  CG1   . VAL A 1 227 ? 18.160 14.321 18.602  1.00 17.27 ? 1177 VAL A CG1   1 
ATOM   1668 C  CG2   . VAL A 1 227 ? 15.962 13.623 17.557  1.00 18.19 ? 1177 VAL A CG2   1 
ATOM   1669 N  N     . PRO A 1 228 ? 16.841 15.405 14.808  1.00 16.39 ? 1178 PRO A N     1 
ATOM   1670 C  CA    . PRO A 1 228 ? 16.508 16.782 14.462  1.00 16.42 ? 1178 PRO A CA    1 
ATOM   1671 C  C     . PRO A 1 228 ? 15.672 17.461 15.534  1.00 16.69 ? 1178 PRO A C     1 
ATOM   1672 O  O     . PRO A 1 228 ? 14.704 16.873 16.058  1.00 17.18 ? 1178 PRO A O     1 
ATOM   1673 C  CB    . PRO A 1 228 ? 15.705 16.635 13.161  1.00 17.02 ? 1178 PRO A CB    1 
ATOM   1674 C  CG    . PRO A 1 228 ? 15.091 15.297 13.256  1.00 17.76 ? 1178 PRO A CG    1 
ATOM   1675 C  CD    . PRO A 1 228 ? 16.012 14.434 14.064  1.00 16.55 ? 1178 PRO A CD    1 
ATOM   1676 N  N     . VAL A 1 229 ? 16.046 18.698 15.838  1.00 15.87 ? 1179 VAL A N     1 
ATOM   1677 C  CA    . VAL A 1 229 ? 15.359 19.523 16.838  1.00 15.69 ? 1179 VAL A CA    1 
ATOM   1678 C  C     . VAL A 1 229 ? 14.952 20.875 16.208  1.00 15.39 ? 1179 VAL A C     1 
ATOM   1679 O  O     . VAL A 1 229 ? 15.725 21.461 15.444  1.00 15.52 ? 1179 VAL A O     1 
ATOM   1680 C  CB    . VAL A 1 229 ? 16.273 19.762 18.075  1.00 15.76 ? 1179 VAL A CB    1 
ATOM   1681 C  CG1   . VAL A 1 229 ? 15.576 20.633 19.101  1.00 16.62 ? 1179 VAL A CG1   1 
ATOM   1682 C  CG2   . VAL A 1 229 ? 16.703 18.419 18.717  1.00 16.03 ? 1179 VAL A CG2   1 
ATOM   1683 N  N     . ARG A 1 230 ? 13.737 21.364 16.505  1.00 14.93 ? 1180 ARG A N     1 
ATOM   1684 C  CA    . ARG A 1 230 ? 13.278 22.659 15.984  1.00 14.64 ? 1180 ARG A CA    1 
ATOM   1685 C  C     . ARG A 1 230 ? 13.765 23.783 16.890  1.00 14.53 ? 1180 ARG A C     1 
ATOM   1686 O  O     . ARG A 1 230 ? 13.534 23.749 18.104  1.00 15.21 ? 1180 ARG A O     1 
ATOM   1687 C  CB    . ARG A 1 230 ? 11.750 22.709 15.903  1.00 15.28 ? 1180 ARG A CB    1 
ATOM   1688 C  CG    . ARG A 1 230 ? 11.138 21.739 14.905  1.00 16.10 ? 1180 ARG A CG    1 
ATOM   1689 C  CD    . ARG A 1 230 ? 9.613  21.824 14.982  1.00 19.87 ? 1180 ARG A CD    1 
ATOM   1690 N  NE    . ARG A 1 230 ? 9.020  21.030 13.925  1.00 24.56 ? 1180 ARG A NE    1 
ATOM   1691 C  CZ    . ARG A 1 230 ? 8.735  19.736 14.033  1.00 27.14 ? 1180 ARG A CZ    1 
ATOM   1692 N  NH1   . ARG A 1 230 ? 8.987  19.090 15.167  1.00 29.15 ? 1180 ARG A NH1   1 
ATOM   1693 N  NH2   . ARG A 1 230 ? 8.200  19.086 13.009  1.00 25.75 ? 1180 ARG A NH2   1 
ATOM   1694 N  N     . VAL A 1 231 ? 14.401 24.784 16.285  1.00 13.98 ? 1181 VAL A N     1 
ATOM   1695 C  CA    . VAL A 1 231 ? 15.077 25.848 17.038  1.00 13.68 ? 1181 VAL A CA    1 
ATOM   1696 C  C     . VAL A 1 231 ? 14.693 27.204 16.477  1.00 14.30 ? 1181 VAL A C     1 
ATOM   1697 O  O     . VAL A 1 231 ? 14.497 27.349 15.258  1.00 13.65 ? 1181 VAL A O     1 
ATOM   1698 C  CB    . VAL A 1 231 ? 16.639 25.687 17.012  1.00 14.46 ? 1181 VAL A CB    1 
ATOM   1699 C  CG1   . VAL A 1 231 ? 17.330 26.706 17.920  1.00 14.56 ? 1181 VAL A CG1   1 
ATOM   1700 C  CG2   . VAL A 1 231 ? 17.038 24.297 17.455  1.00 15.02 ? 1181 VAL A CG2   1 
ATOM   1701 N  N     . PHE A 1 232 ? 14.560 28.176 17.379  1.00 13.49 ? 1182 PHE A N     1 
ATOM   1702 C  CA    . PHE A 1 232 ? 14.322 29.562 17.030  1.00 13.97 ? 1182 PHE A CA    1 
ATOM   1703 C  C     . PHE A 1 232 ? 15.457 30.388 17.568  1.00 14.55 ? 1182 PHE A C     1 
ATOM   1704 O  O     . PHE A 1 232 ? 15.877 30.177 18.704  1.00 14.56 ? 1182 PHE A O     1 
ATOM   1705 C  CB    . PHE A 1 232 ? 12.979 30.025 17.585  1.00 14.40 ? 1182 PHE A CB    1 
ATOM   1706 C  CG    . PHE A 1 232 ? 11.848 29.263 16.996  1.00 15.05 ? 1182 PHE A CG    1 
ATOM   1707 C  CD1   . PHE A 1 232 ? 11.323 29.645 15.771  1.00 14.39 ? 1182 PHE A CD1   1 
ATOM   1708 C  CD2   . PHE A 1 232 ? 11.380 28.105 17.610  1.00 16.27 ? 1182 PHE A CD2   1 
ATOM   1709 C  CE1   . PHE A 1 232 ? 10.289 28.907 15.183  1.00 15.63 ? 1182 PHE A CE1   1 
ATOM   1710 C  CE2   . PHE A 1 232 ? 10.364 27.356 17.035  1.00 16.72 ? 1182 PHE A CE2   1 
ATOM   1711 C  CZ    . PHE A 1 232 ? 9.811  27.764 15.826  1.00 16.44 ? 1182 PHE A CZ    1 
ATOM   1712 N  N     . MET A 1 233 ? 15.940 31.308 16.733  1.00 14.44 ? 1183 MET A N     1 
ATOM   1713 C  CA    . MET A 1 233 ? 17.060 32.176 17.069  1.00 15.55 ? 1183 MET A CA    1 
ATOM   1714 C  C     . MET A 1 233 ? 16.684 33.633 16.756  1.00 15.62 ? 1183 MET A C     1 
ATOM   1715 O  O     . MET A 1 233 ? 16.079 34.316 17.588  1.00 16.07 ? 1183 MET A O     1 
ATOM   1716 C  CB    . MET A 1 233 ? 18.330 31.703 16.336  1.00 15.21 ? 1183 MET A CB    1 
ATOM   1717 C  CG    . MET A 1 233 ? 18.877 30.439 16.963  1.00 16.36 ? 1183 MET A CG    1 
ATOM   1718 S  SD    . MET A 1 233 ? 19.847 29.444 15.817  1.00 16.94 ? 1183 MET A SD    1 
ATOM   1719 C  CE    . MET A 1 233 ? 18.513 28.609 14.971  1.00 18.35 ? 1183 MET A CE    1 
ATOM   1720 N  N     . ALA A 1 234 ? 16.977 34.106 15.547  1.00 15.47 ? 1184 ALA A N     1 
ATOM   1721 C  CA    . ALA A 1 234 ? 16.811 35.536 15.253  1.00 14.79 ? 1184 ALA A CA    1 
ATOM   1722 C  C     . ALA A 1 234 ? 15.352 35.985 15.123  1.00 14.98 ? 1184 ALA A C     1 
ATOM   1723 O  O     . ALA A 1 234 ? 15.060 37.164 15.269  1.00 15.86 ? 1184 ALA A O     1 
ATOM   1724 C  CB    . ALA A 1 234 ? 17.608 35.934 14.004  1.00 15.53 ? 1184 ALA A CB    1 
ATOM   1725 N  N     . HIS A 1 235 ? 14.460 35.040 14.822  1.00 14.82 ? 1185 HIS A N     1 
ATOM   1726 C  CA    . HIS A 1 235 ? 13.014 35.314 14.730  1.00 14.34 ? 1185 HIS A CA    1 
ATOM   1727 C  C     . HIS A 1 235 ? 12.287 34.197 15.467  1.00 13.99 ? 1185 HIS A C     1 
ATOM   1728 O  O     . HIS A 1 235 ? 12.873 33.131 15.733  1.00 13.33 ? 1185 HIS A O     1 
ATOM   1729 C  CB    . HIS A 1 235 ? 12.538 35.384 13.257  1.00 14.13 ? 1185 HIS A CB    1 
ATOM   1730 C  CG    . HIS A 1 235 ? 12.512 34.052 12.571  1.00 14.77 ? 1185 HIS A CG    1 
ATOM   1731 N  ND1   . HIS A 1 235 ? 11.543 33.106 12.832  1.00 13.21 ? 1185 HIS A ND1   1 
ATOM   1732 C  CD2   . HIS A 1 235 ? 13.346 33.496 11.662  1.00 15.47 ? 1185 HIS A CD2   1 
ATOM   1733 C  CE1   . HIS A 1 235 ? 11.773 32.029 12.097  1.00 15.07 ? 1185 HIS A CE1   1 
ATOM   1734 N  NE2   . HIS A 1 235 ? 12.870 32.237 11.388  1.00 14.62 ? 1185 HIS A NE2   1 
ATOM   1735 N  N     . GLN A 1 236 ? 11.003 34.417 15.754  1.00 14.21 ? 1186 GLN A N     1 
ATOM   1736 C  CA    . GLN A 1 236 ? 10.195 33.415 16.471  1.00 14.78 ? 1186 GLN A CA    1 
ATOM   1737 C  C     . GLN A 1 236 ? 8.870  33.154 15.756  1.00 15.11 ? 1186 GLN A C     1 
ATOM   1738 O  O     . GLN A 1 236 ? 7.828  32.926 16.398  1.00 15.64 ? 1186 GLN A O     1 
ATOM   1739 C  CB    . GLN A 1 236 ? 9.981  33.835 17.923  1.00 14.34 ? 1186 GLN A CB    1 
ATOM   1740 C  CG    . GLN A 1 236 ? 11.287 33.870 18.710  1.00 15.59 ? 1186 GLN A CG    1 
ATOM   1741 C  CD    . GLN A 1 236 ? 11.146 34.541 20.044  1.00 15.88 ? 1186 GLN A CD    1 
ATOM   1742 O  OE1   . GLN A 1 236 ? 10.129 35.188 20.329  1.00 16.58 ? 1186 GLN A OE1   1 
ATOM   1743 N  NE2   . GLN A 1 236 ? 12.181 34.413 20.874  1.00 15.46 ? 1186 GLN A NE2   1 
ATOM   1744 N  N     . ASP A 1 237 ? 8.932  33.213 14.427  1.00 14.95 ? 1187 ASP A N     1 
ATOM   1745 C  CA    . ASP A 1 237 ? 7.807  32.882 13.578  1.00 15.07 ? 1187 ASP A CA    1 
ATOM   1746 C  C     . ASP A 1 237 ? 7.674  31.360 13.579  1.00 15.05 ? 1187 ASP A C     1 
ATOM   1747 O  O     . ASP A 1 237 ? 8.498  30.649 12.989  1.00 15.70 ? 1187 ASP A O     1 
ATOM   1748 C  CB    . ASP A 1 237 ? 8.054  33.406 12.164  1.00 14.90 ? 1187 ASP A CB    1 
ATOM   1749 C  CG    . ASP A 1 237 ? 6.833  33.289 11.281  1.00 14.81 ? 1187 ASP A CG    1 
ATOM   1750 O  OD1   . ASP A 1 237 ? 6.045  32.336 11.487  1.00 16.86 ? 1187 ASP A OD1   1 
ATOM   1751 O  OD2   . ASP A 1 237 ? 6.674  34.152 10.391  1.00 16.15 ? 1187 ASP A OD2   1 
ATOM   1752 N  N     . LEU A 1 238 ? 6.637  30.856 14.253  1.00 15.16 ? 1188 LEU A N     1 
ATOM   1753 C  CA    . LEU A 1 238 ? 6.505  29.410 14.474  1.00 15.22 ? 1188 LEU A CA    1 
ATOM   1754 C  C     . LEU A 1 238 ? 6.308  28.563 13.210  1.00 15.10 ? 1188 LEU A C     1 
ATOM   1755 O  O     . LEU A 1 238 ? 6.416  27.325 13.240  1.00 15.05 ? 1188 LEU A O     1 
ATOM   1756 C  CB    . LEU A 1 238 ? 5.383  29.124 15.478  1.00 16.23 ? 1188 LEU A CB    1 
ATOM   1757 C  CG    . LEU A 1 238 ? 5.616  29.693 16.873  1.00 17.07 ? 1188 LEU A CG    1 
ATOM   1758 C  CD1   . LEU A 1 238 ? 4.390  29.440 17.736  1.00 20.91 ? 1188 LEU A CD1   1 
ATOM   1759 C  CD2   . LEU A 1 238 ? 6.875  29.114 17.532  1.00 20.10 ? 1188 LEU A CD2   1 
ATOM   1760 N  N     . ARG A 1 239 ? 6.041  29.236 12.102  1.00 13.78 ? 1189 ARG A N     1 
ATOM   1761 C  CA    . ARG A 1 239 ? 5.891  28.563 10.813  1.00 14.13 ? 1189 ARG A CA    1 
ATOM   1762 C  C     . ARG A 1 239 ? 7.248  28.141 10.261  1.00 13.80 ? 1189 ARG A C     1 
ATOM   1763 O  O     . ARG A 1 239 ? 7.336  27.289 9.355   1.00 14.57 ? 1189 ARG A O     1 
ATOM   1764 C  CB    . ARG A 1 239 ? 5.227  29.503 9.827   1.00 13.13 ? 1189 ARG A CB    1 
ATOM   1765 C  CG    . ARG A 1 239 ? 3.815  29.921 10.215  1.00 14.97 ? 1189 ARG A CG    1 
ATOM   1766 C  CD    . ARG A 1 239 ? 3.266  30.910 9.223   1.00 17.33 ? 1189 ARG A CD    1 
ATOM   1767 N  NE    . ARG A 1 239 ? 3.986  32.184 9.268   1.00 17.60 ? 1189 ARG A NE    1 
ATOM   1768 C  CZ    . ARG A 1 239 ? 3.760  33.204 8.449   1.00 19.35 ? 1189 ARG A CZ    1 
ATOM   1769 N  NH1   . ARG A 1 239 ? 2.839  33.105 7.504   1.00 16.73 ? 1189 ARG A NH1   1 
ATOM   1770 N  NH2   . ARG A 1 239 ? 4.469  34.324 8.565   1.00 20.08 ? 1189 ARG A NH2   1 
ATOM   1771 N  N     . PHE A 1 240 ? 8.302  28.760 10.793  1.00 13.79 ? 1190 PHE A N     1 
ATOM   1772 C  CA    . PHE A 1 240 ? 9.635  28.633 10.203  1.00 13.67 ? 1190 PHE A CA    1 
ATOM   1773 C  C     . PHE A 1 240 ? 10.711 28.233 11.230  1.00 13.41 ? 1190 PHE A C     1 
ATOM   1774 O  O     . PHE A 1 240 ? 11.695 28.972 11.421  1.00 13.48 ? 1190 PHE A O     1 
ATOM   1775 C  CB    . PHE A 1 240 ? 10.020 29.938 9.496   1.00 14.10 ? 1190 PHE A CB    1 
ATOM   1776 C  CG    . PHE A 1 240 ? 9.082  30.331 8.388   1.00 14.43 ? 1190 PHE A CG    1 
ATOM   1777 C  CD1   . PHE A 1 240 ? 9.176  29.723 7.145   1.00 17.21 ? 1190 PHE A CD1   1 
ATOM   1778 C  CD2   . PHE A 1 240 ? 8.148  31.349 8.581   1.00 16.20 ? 1190 PHE A CD2   1 
ATOM   1779 C  CE1   . PHE A 1 240 ? 8.302  30.104 6.095   1.00 16.24 ? 1190 PHE A CE1   1 
ATOM   1780 C  CE2   . PHE A 1 240 ? 7.279  31.735 7.552   1.00 17.42 ? 1190 PHE A CE2   1 
ATOM   1781 C  CZ    . PHE A 1 240 ? 7.360  31.108 6.314   1.00 16.19 ? 1190 PHE A CZ    1 
ATOM   1782 N  N     . PRO A 1 241 ? 10.548 27.062 11.880  1.00 13.83 ? 1191 PRO A N     1 
ATOM   1783 C  CA    . PRO A 1 241 ? 11.614 26.594 12.764  1.00 13.91 ? 1191 PRO A CA    1 
ATOM   1784 C  C     . PRO A 1 241 ? 12.836 26.274 11.895  1.00 13.76 ? 1191 PRO A C     1 
ATOM   1785 O  O     . PRO A 1 241 ? 12.697 25.987 10.688  1.00 13.28 ? 1191 PRO A O     1 
ATOM   1786 C  CB    . PRO A 1 241 ? 11.051 25.296 13.349  1.00 14.16 ? 1191 PRO A CB    1 
ATOM   1787 C  CG    . PRO A 1 241 ? 10.065 24.805 12.301  1.00 13.44 ? 1191 PRO A CG    1 
ATOM   1788 C  CD    . PRO A 1 241 ? 9.440  26.091 11.786  1.00 14.25 ? 1191 PRO A CD    1 
ATOM   1789 N  N     . ARG A 1 242 ? 14.012 26.360 12.500  1.00 13.55 ? 1192 ARG A N     1 
ATOM   1790 C  CA    . ARG A 1 242 ? 15.232 25.868 11.875  1.00 13.62 ? 1192 ARG A CA    1 
ATOM   1791 C  C     . ARG A 1 242 ? 15.538 24.487 12.426  1.00 14.46 ? 1192 ARG A C     1 
ATOM   1792 O  O     . ARG A 1 242 ? 15.215 24.196 13.587  1.00 14.77 ? 1192 ARG A O     1 
ATOM   1793 C  CB    . ARG A 1 242 ? 16.368 26.880 12.083  1.00 13.64 ? 1192 ARG A CB    1 
ATOM   1794 C  CG    . ARG A 1 242 ? 16.169 28.123 11.212  1.00 14.08 ? 1192 ARG A CG    1 
ATOM   1795 C  CD    . ARG A 1 242 ? 17.054 29.295 11.591  1.00 14.54 ? 1192 ARG A CD    1 
ATOM   1796 N  NE    . ARG A 1 242 ? 18.470 28.971 11.490  1.00 13.46 ? 1192 ARG A NE    1 
ATOM   1797 C  CZ    . ARG A 1 242 ? 19.443 29.778 11.904  1.00 15.03 ? 1192 ARG A CZ    1 
ATOM   1798 N  NH1   . ARG A 1 242 ? 19.137 30.962 12.437  1.00 15.73 ? 1192 ARG A NH1   1 
ATOM   1799 N  NH2   . ARG A 1 242 ? 20.710 29.390 11.813  1.00 16.37 ? 1192 ARG A NH2   1 
ATOM   1800 N  N     . ILE A 1 243 ? 16.109 23.625 11.594  1.00 13.84 ? 1193 ILE A N     1 
ATOM   1801 C  CA    . ILE A 1 243 ? 16.280 22.222 11.962  1.00 13.50 ? 1193 ILE A CA    1 
ATOM   1802 C  C     . ILE A 1 243 ? 17.725 21.964 12.358  1.00 13.73 ? 1193 ILE A C     1 
ATOM   1803 O  O     . ILE A 1 243 ? 18.615 22.046 11.520  1.00 14.15 ? 1193 ILE A O     1 
ATOM   1804 C  CB    . ILE A 1 243 ? 15.856 21.257 10.810  1.00 13.48 ? 1193 ILE A CB    1 
ATOM   1805 C  CG1   . ILE A 1 243 ? 14.387 21.486 10.413  1.00 14.10 ? 1193 ILE A CG1   1 
ATOM   1806 C  CG2   . ILE A 1 243 ? 16.133 19.803 11.207  1.00 14.82 ? 1193 ILE A CG2   1 
ATOM   1807 C  CD1   . ILE A 1 243 ? 13.363 21.276 11.543  1.00 17.28 ? 1193 ILE A CD1   1 
ATOM   1808 N  N     . ALA A 1 244 ? 17.947 21.674 13.637  1.00 13.12 ? 1194 ALA A N     1 
ATOM   1809 C  CA    . ALA A 1 244 ? 19.307 21.414 14.153  1.00 13.33 ? 1194 ALA A CA    1 
ATOM   1810 C  C     . ALA A 1 244 ? 19.473 19.941 14.513  1.00 13.66 ? 1194 ALA A C     1 
ATOM   1811 O  O     . ALA A 1 244 ? 18.638 19.391 15.233  1.00 13.45 ? 1194 ALA A O     1 
ATOM   1812 C  CB    . ALA A 1 244 ? 19.590 22.291 15.372  1.00 13.25 ? 1194 ALA A CB    1 
ATOM   1813 N  N     . PHE A 1 245 ? 20.544 19.301 14.021  1.00 13.56 ? 1195 PHE A N     1 
ATOM   1814 C  CA    . PHE A 1 245 ? 20.852 17.902 14.401  1.00 13.89 ? 1195 PHE A CA    1 
ATOM   1815 C  C     . PHE A 1 245 ? 21.770 17.889 15.607  1.00 14.99 ? 1195 PHE A C     1 
ATOM   1816 O  O     . PHE A 1 245 ? 22.811 18.556 15.606  1.00 15.16 ? 1195 PHE A O     1 
ATOM   1817 C  CB    . PHE A 1 245 ? 21.511 17.124 13.252  1.00 13.73 ? 1195 PHE A CB    1 
ATOM   1818 C  CG    . PHE A 1 245 ? 20.658 17.032 12.035  1.00 14.43 ? 1195 PHE A CG    1 
ATOM   1819 C  CD1   . PHE A 1 245 ? 19.622 16.094 11.964  1.00 13.42 ? 1195 PHE A CD1   1 
ATOM   1820 C  CD2   . PHE A 1 245 ? 20.882 17.881 10.954  1.00 14.98 ? 1195 PHE A CD2   1 
ATOM   1821 C  CE1   . PHE A 1 245 ? 18.800 16.020 10.825  1.00 15.31 ? 1195 PHE A CE1   1 
ATOM   1822 C  CE2   . PHE A 1 245 ? 20.082 17.801 9.808   1.00 16.91 ? 1195 PHE A CE2   1 
ATOM   1823 C  CZ    . PHE A 1 245 ? 19.028 16.870 9.753   1.00 16.91 ? 1195 PHE A CZ    1 
ATOM   1824 N  N     . PHE A 1 246 ? 21.355 17.143 16.633  1.00 15.11 ? 1196 PHE A N     1 
ATOM   1825 C  CA    . PHE A 1 246 ? 22.167 16.912 17.823  1.00 15.19 ? 1196 PHE A CA    1 
ATOM   1826 C  C     . PHE A 1 246 ? 22.485 15.425 17.928  1.00 15.63 ? 1196 PHE A C     1 
ATOM   1827 O  O     . PHE A 1 246 ? 21.665 14.583 17.560  1.00 15.25 ? 1196 PHE A O     1 
ATOM   1828 C  CB    . PHE A 1 246 ? 21.418 17.326 19.099  1.00 16.01 ? 1196 PHE A CB    1 
ATOM   1829 C  CG    . PHE A 1 246 ? 21.281 18.824 19.282  1.00 14.94 ? 1196 PHE A CG    1 
ATOM   1830 C  CD1   . PHE A 1 246 ? 22.167 19.526 20.115  1.00 14.89 ? 1196 PHE A CD1   1 
ATOM   1831 C  CD2   . PHE A 1 246 ? 20.261 19.532 18.641  1.00 16.86 ? 1196 PHE A CD2   1 
ATOM   1832 C  CE1   . PHE A 1 246 ? 22.036 20.915 20.314  1.00 15.45 ? 1196 PHE A CE1   1 
ATOM   1833 C  CE2   . PHE A 1 246 ? 20.141 20.935 18.823  1.00 17.10 ? 1196 PHE A CE2   1 
ATOM   1834 C  CZ    . PHE A 1 246 ? 21.021 21.613 19.671  1.00 17.25 ? 1196 PHE A CZ    1 
ATOM   1835 N  N     . SER A 1 247 ? 23.662 15.103 18.450  1.00 15.70 ? 1197 SER A N     1 
ATOM   1836 C  CA    . SER A 1 247 ? 24.025 13.689 18.608  1.00 16.13 ? 1197 SER A CA    1 
ATOM   1837 C  C     . SER A 1 247 ? 23.205 13.055 19.739  1.00 16.72 ? 1197 SER A C     1 
ATOM   1838 O  O     . SER A 1 247 ? 22.945 13.692 20.773  1.00 17.29 ? 1197 SER A O     1 
ATOM   1839 C  CB    . SER A 1 247 ? 25.517 13.570 18.893  1.00 15.72 ? 1197 SER A CB    1 
ATOM   1840 O  OG    . SER A 1 247 ? 25.808 14.235 20.097  1.00 16.64 ? 1197 SER A OG    1 
ATOM   1841 N  N     . THR A 1 248 ? 22.811 11.802 19.541  1.00 17.52 ? 1198 THR A N     1 
ATOM   1842 C  CA    . THR A 1 248 ? 21.956 11.095 20.498  1.00 19.04 ? 1198 THR A CA    1 
ATOM   1843 C  C     . THR A 1 248 ? 22.772 10.213 21.436  1.00 20.36 ? 1198 THR A C     1 
ATOM   1844 O  O     . THR A 1 248 ? 22.231 9.622  22.386  1.00 20.29 ? 1198 THR A O     1 
ATOM   1845 C  CB    . THR A 1 248 ? 20.989 10.177 19.772  1.00 19.63 ? 1198 THR A CB    1 
ATOM   1846 O  OG1   . THR A 1 248 ? 21.743 9.204  19.040  1.00 20.33 ? 1198 THR A OG1   1 
ATOM   1847 C  CG2   . THR A 1 248 ? 20.133 10.967 18.804  1.00 19.82 ? 1198 THR A CG2   1 
ATOM   1848 N  N     . ARG A 1 249 ? 24.059 10.106 21.134  1.00 20.70 ? 1199 ARG A N     1 
ATOM   1849 C  CA    . ARG A 1 249 ? 25.011 9.295  21.887  1.00 21.85 ? 1199 ARG A CA    1 
ATOM   1850 C  C     . ARG A 1 249 ? 26.406 9.743  21.479  1.00 21.97 ? 1199 ARG A C     1 
ATOM   1851 O  O     . ARG A 1 249 ? 26.553 10.609 20.608  1.00 21.20 ? 1199 ARG A O     1 
ATOM   1852 C  CB    . ARG A 1 249 ? 24.835 7.807  21.546  1.00 22.10 ? 1199 ARG A CB    1 
ATOM   1853 C  CG    . ARG A 1 249 ? 24.884 7.491  20.047  1.00 23.35 ? 1199 ARG A CG    1 
ATOM   1854 C  CD    . ARG A 1 249 ? 25.068 6.004  19.793  1.00 23.55 ? 1199 ARG A CD    1 
ATOM   1855 N  NE    . ARG A 1 249 ? 24.983 5.616  18.383  1.00 26.46 ? 1199 ARG A NE    1 
ATOM   1856 C  CZ    . ARG A 1 249 ? 25.997 5.623  17.515  1.00 27.28 ? 1199 ARG A CZ    1 
ATOM   1857 N  NH1   . ARG A 1 249 ? 27.210 6.043  17.876  1.00 27.64 ? 1199 ARG A NH1   1 
ATOM   1858 N  NH2   . ARG A 1 249 ? 25.794 5.217  16.262  1.00 29.91 ? 1199 ARG A NH2   1 
ATOM   1859 N  N     . LEU A 1 250 ? 27.430 9.140  22.081  1.00 22.02 ? 1200 LEU A N     1 
ATOM   1860 C  CA    . LEU A 1 250 ? 28.792 9.360  21.618  1.00 22.73 ? 1200 LEU A CA    1 
ATOM   1861 C  C     . LEU A 1 250 ? 28.941 8.843  20.190  1.00 22.43 ? 1200 LEU A C     1 
ATOM   1862 O  O     . LEU A 1 250 ? 28.613 7.687  19.888  1.00 22.54 ? 1200 LEU A O     1 
ATOM   1863 C  CB    . LEU A 1 250 ? 29.814 8.670  22.535  1.00 23.10 ? 1200 LEU A CB    1 
ATOM   1864 C  CG    . LEU A 1 250 ? 31.287 8.659  22.085  1.00 23.31 ? 1200 LEU A CG    1 
ATOM   1865 C  CD1   . LEU A 1 250 ? 31.927 10.040 22.111  1.00 24.82 ? 1200 LEU A CD1   1 
ATOM   1866 C  CD2   . LEU A 1 250 ? 32.087 7.671  22.950  1.00 24.33 ? 1200 LEU A CD2   1 
ATOM   1867 N  N     . ILE A 1 251 ? 29.400 9.724  19.311  1.00 21.70 ? 1201 ILE A N     1 
ATOM   1868 C  CA    . ILE A 1 251 ? 29.711 9.359  17.943  1.00 21.75 ? 1201 ILE A CA    1 
ATOM   1869 C  C     . ILE A 1 251 ? 31.225 9.278  17.858  1.00 23.00 ? 1201 ILE A C     1 
ATOM   1870 O  O     . ILE A 1 251 ? 31.917 10.262 18.101  1.00 23.32 ? 1201 ILE A O     1 
ATOM   1871 C  CB    . ILE A 1 251 ? 29.149 10.386 16.920  1.00 21.46 ? 1201 ILE A CB    1 
ATOM   1872 C  CG1   . ILE A 1 251 ? 27.618 10.475 17.043  1.00 20.41 ? 1201 ILE A CG1   1 
ATOM   1873 C  CG2   . ILE A 1 251 ? 29.566 10.026 15.501  1.00 20.52 ? 1201 ILE A CG2   1 
ATOM   1874 C  CD1   . ILE A 1 251 ? 26.962 11.570 16.163  1.00 20.31 ? 1201 ILE A CD1   1 
ATOM   1875 N  N     . GLU A 1 252 ? 31.729 8.092  17.538  1.00 24.02 ? 1202 GLU A N     1 
ATOM   1876 C  CA    . GLU A 1 252 ? 33.175 7.888  17.491  1.00 24.90 ? 1202 GLU A CA    1 
ATOM   1877 C  C     . GLU A 1 252 ? 33.754 8.438  16.200  1.00 24.47 ? 1202 GLU A C     1 
ATOM   1878 O  O     . GLU A 1 252 ? 33.086 8.451  15.159  1.00 23.94 ? 1202 GLU A O     1 
ATOM   1879 C  CB    . GLU A 1 252 ? 33.516 6.409  17.659  1.00 25.72 ? 1202 GLU A CB    1 
ATOM   1880 C  CG    . GLU A 1 252 ? 33.007 5.815  18.970  1.00 29.72 ? 1202 GLU A CG    1 
ATOM   1881 C  CD    . GLU A 1 252 ? 33.696 4.514  19.334  1.00 35.14 ? 1202 GLU A CD    1 
ATOM   1882 O  OE1   . GLU A 1 252 ? 33.910 3.678  18.429  1.00 38.47 ? 1202 GLU A OE1   1 
ATOM   1883 O  OE2   . GLU A 1 252 ? 34.025 4.332  20.529  1.00 38.23 ? 1202 GLU A OE2   1 
ATOM   1884 N  N     . ALA A 1 253 ? 34.993 8.921  16.277  1.00 23.96 ? 1203 ALA A N     1 
ATOM   1885 C  CA    . ALA A 1 253 ? 35.714 9.391  15.105  1.00 23.15 ? 1203 ALA A CA    1 
ATOM   1886 C  C     . ALA A 1 253 ? 35.632 8.348  13.997  1.00 23.02 ? 1203 ALA A C     1 
ATOM   1887 O  O     . ALA A 1 253 ? 35.868 7.147  14.238  1.00 23.00 ? 1203 ALA A O     1 
ATOM   1888 C  CB    . ALA A 1 253 ? 37.173 9.669  15.466  1.00 23.49 ? 1203 ALA A CB    1 
ATOM   1889 N  N     . GLY A 1 254 ? 35.284 8.803  12.797  1.00 22.15 ? 1204 GLY A N     1 
ATOM   1890 C  CA    . GLY A 1 254 ? 35.169 7.923  11.637  1.00 21.76 ? 1204 GLY A CA    1 
ATOM   1891 C  C     . GLY A 1 254 ? 33.750 7.448  11.325  1.00 21.13 ? 1204 GLY A C     1 
ATOM   1892 O  O     . GLY A 1 254 ? 33.478 7.034  10.193  1.00 21.67 ? 1204 GLY A O     1 
ATOM   1893 N  N     . GLU A 1 255 ? 32.863 7.510  12.323  1.00 20.69 ? 1205 GLU A N     1 
ATOM   1894 C  CA    . GLU A 1 255 ? 31.481 7.021  12.213  1.00 20.39 ? 1205 GLU A CA    1 
ATOM   1895 C  C     . GLU A 1 255 ? 30.664 7.846  11.233  1.00 19.48 ? 1205 GLU A C     1 
ATOM   1896 O  O     . GLU A 1 255 ? 30.761 9.074  11.219  1.00 19.40 ? 1205 GLU A O     1 
ATOM   1897 C  CB    . GLU A 1 255 ? 30.770 7.106  13.561  1.00 20.85 ? 1205 GLU A CB    1 
ATOM   1898 C  CG    . GLU A 1 255 ? 30.768 5.862  14.426  1.00 24.87 ? 1205 GLU A CG    1 
ATOM   1899 C  CD    . GLU A 1 255 ? 29.627 5.894  15.440  1.00 28.91 ? 1205 GLU A CD    1 
ATOM   1900 O  OE1   . GLU A 1 255 ? 29.907 5.934  16.657  1.00 31.16 ? 1205 GLU A OE1   1 
ATOM   1901 O  OE2   . GLU A 1 255 ? 28.441 5.899  15.017  1.00 30.94 ? 1205 GLU A OE2   1 
ATOM   1902 N  N     . GLN A 1 256 ? 29.831 7.169  10.443  1.00 17.95 ? 1206 GLN A N     1 
ATOM   1903 C  CA    . GLN A 1 256 ? 28.923 7.874  9.534   1.00 16.77 ? 1206 GLN A CA    1 
ATOM   1904 C  C     . GLN A 1 256 ? 27.796 8.501  10.351  1.00 16.28 ? 1206 GLN A C     1 
ATOM   1905 O  O     . GLN A 1 256 ? 27.290 7.871  11.290  1.00 16.91 ? 1206 GLN A O     1 
ATOM   1906 C  CB    . GLN A 1 256 ? 28.331 6.934  8.498   1.00 17.14 ? 1206 GLN A CB    1 
ATOM   1907 C  CG    . GLN A 1 256 ? 27.428 7.675  7.503   1.00 16.78 ? 1206 GLN A CG    1 
ATOM   1908 C  CD    . GLN A 1 256 ? 26.880 6.797  6.396   1.00 17.33 ? 1206 GLN A CD    1 
ATOM   1909 O  OE1   . GLN A 1 256 ? 26.927 5.560  6.477   1.00 20.62 ? 1206 GLN A OE1   1 
ATOM   1910 N  NE2   . GLN A 1 256 ? 26.348 7.426  5.357   1.00 15.19 ? 1206 GLN A NE2   1 
ATOM   1911 N  N     . LEU A 1 257 ? 27.403 9.721  9.992   1.00 15.60 ? 1207 LEU A N     1 
ATOM   1912 C  CA    . LEU A 1 257 ? 26.243 10.359 10.617  1.00 15.02 ? 1207 LEU A CA    1 
ATOM   1913 C  C     . LEU A 1 257 ? 24.960 9.793  10.021  1.00 15.54 ? 1207 LEU A C     1 
ATOM   1914 O  O     . LEU A 1 257 ? 24.895 9.520  8.834   1.00 15.23 ? 1207 LEU A O     1 
ATOM   1915 C  CB    . LEU A 1 257 ? 26.254 11.869 10.376  1.00 15.26 ? 1207 LEU A CB    1 
ATOM   1916 C  CG    . LEU A 1 257 ? 27.473 12.661 10.858  1.00 14.95 ? 1207 LEU A CG    1 
ATOM   1917 C  CD1   . LEU A 1 257 ? 27.328 14.151 10.477  1.00 16.90 ? 1207 LEU A CD1   1 
ATOM   1918 C  CD2   . LEU A 1 257 ? 27.720 12.474 12.357  1.00 15.85 ? 1207 LEU A CD2   1 
ATOM   1919 N  N     . GLY A 1 258 ? 23.932 9.645  10.848  1.00 15.65 ? 1208 GLY A N     1 
ATOM   1920 C  CA    . GLY A 1 258 ? 22.621 9.281  10.318  1.00 16.31 ? 1208 GLY A CA    1 
ATOM   1921 C  C     . GLY A 1 258 ? 21.501 9.811  11.171  1.00 16.19 ? 1208 GLY A C     1 
ATOM   1922 O  O     . GLY A 1 258 ? 21.657 9.972  12.375  1.00 16.72 ? 1208 GLY A O     1 
ATOM   1923 N  N     . PHE A 1 259 ? 20.367 10.084 10.539  1.00 16.23 ? 1209 PHE A N     1 
ATOM   1924 C  CA    . PHE A 1 259 ? 19.139 10.315 11.303  1.00 16.05 ? 1209 PHE A CA    1 
ATOM   1925 C  C     . PHE A 1 259 ? 17.971 9.554  10.681  1.00 15.91 ? 1209 PHE A C     1 
ATOM   1926 O  O     . PHE A 1 259 ? 18.078 9.037  9.576   1.00 15.71 ? 1209 PHE A O     1 
ATOM   1927 C  CB    . PHE A 1 259 ? 18.841 11.815 11.475  1.00 16.70 ? 1209 PHE A CB    1 
ATOM   1928 C  CG    . PHE A 1 259 ? 18.281 12.499 10.244  1.00 15.82 ? 1209 PHE A CG    1 
ATOM   1929 C  CD1   . PHE A 1 259 ? 16.907 12.772 10.145  1.00 15.96 ? 1209 PHE A CD1   1 
ATOM   1930 C  CD2   . PHE A 1 259 ? 19.128 12.934 9.211   1.00 16.57 ? 1209 PHE A CD2   1 
ATOM   1931 C  CE1   . PHE A 1 259 ? 16.379 13.426 9.032   1.00 16.34 ? 1209 PHE A CE1   1 
ATOM   1932 C  CE2   . PHE A 1 259 ? 18.602 13.606 8.103   1.00 17.67 ? 1209 PHE A CE2   1 
ATOM   1933 C  CZ    . PHE A 1 259 ? 17.224 13.844 8.017   1.00 17.56 ? 1209 PHE A CZ    1 
ATOM   1934 N  N     . ASP A 1 260 ? 16.863 9.486  11.410  1.00 16.38 ? 1210 ASP A N     1 
ATOM   1935 C  CA    . ASP A 1 260 ? 15.670 8.799  10.931  1.00 16.71 ? 1210 ASP A CA    1 
ATOM   1936 C  C     . ASP A 1 260 ? 14.866 9.773  10.081  1.00 16.67 ? 1210 ASP A C     1 
ATOM   1937 O  O     . ASP A 1 260 ? 14.307 10.729 10.613  1.00 16.39 ? 1210 ASP A O     1 
ATOM   1938 C  CB    . ASP A 1 260 ? 14.858 8.327  12.137  1.00 17.40 ? 1210 ASP A CB    1 
ATOM   1939 C  CG    . ASP A 1 260 ? 13.672 7.453  11.758  1.00 19.26 ? 1210 ASP A CG    1 
ATOM   1940 O  OD1   . ASP A 1 260 ? 13.252 7.424  10.585  1.00 20.75 ? 1210 ASP A OD1   1 
ATOM   1941 O  OD2   . ASP A 1 260 ? 13.147 6.803  12.694  1.00 22.45 ? 1210 ASP A OD2   1 
ATOM   1942 N  N     . TYR A 1 261 ? 14.832 9.539  8.773   1.00 16.76 ? 1211 TYR A N     1 
ATOM   1943 C  CA    . TYR A 1 261 ? 14.106 10.407 7.831   1.00 16.69 ? 1211 TYR A CA    1 
ATOM   1944 C  C     . TYR A 1 261 ? 12.615 10.458 8.136   1.00 18.03 ? 1211 TYR A C     1 
ATOM   1945 O  O     . TYR A 1 261 ? 11.942 11.439 7.802   1.00 17.81 ? 1211 TYR A O     1 
ATOM   1946 C  CB    . TYR A 1 261 ? 14.283 9.901  6.410   1.00 17.06 ? 1211 TYR A CB    1 
ATOM   1947 C  CG    . TYR A 1 261 ? 15.628 10.157 5.746   1.00 16.24 ? 1211 TYR A CG    1 
ATOM   1948 C  CD1   . TYR A 1 261 ? 16.733 10.657 6.462   1.00 15.74 ? 1211 TYR A CD1   1 
ATOM   1949 C  CD2   . TYR A 1 261 ? 15.795 9.863  4.394   1.00 15.96 ? 1211 TYR A CD2   1 
ATOM   1950 C  CE1   . TYR A 1 261 ? 17.973 10.861 5.809   1.00 15.85 ? 1211 TYR A CE1   1 
ATOM   1951 C  CE2   . TYR A 1 261 ? 17.006 10.065 3.743   1.00 15.87 ? 1211 TYR A CE2   1 
ATOM   1952 C  CZ    . TYR A 1 261 ? 18.079 10.567 4.456   1.00 16.04 ? 1211 TYR A CZ    1 
ATOM   1953 O  OH    . TYR A 1 261 ? 19.233 10.735 3.745   1.00 16.63 ? 1211 TYR A OH    1 
ATOM   1954 N  N     . GLY A 1 262 ? 12.112 9.385  8.739   1.00 18.36 ? 1212 GLY A N     1 
ATOM   1955 C  CA    . GLY A 1 262 ? 10.699 9.323  9.141   1.00 20.60 ? 1212 GLY A CA    1 
ATOM   1956 C  C     . GLY A 1 262 ? 9.775  8.685  8.118   1.00 21.82 ? 1212 GLY A C     1 
ATOM   1957 O  O     . GLY A 1 262 ? 10.157 8.409  6.986   1.00 21.67 ? 1212 GLY A O     1 
ATOM   1958 N  N     . GLU A 1 263 ? 8.522  8.484  8.531   1.00 23.69 ? 1213 GLU A N     1 
ATOM   1959 C  CA    . GLU A 1 263 ? 7.566  7.734  7.721   1.00 25.52 ? 1213 GLU A CA    1 
ATOM   1960 C  C     . GLU A 1 263 ? 7.107  8.446  6.445   1.00 25.32 ? 1213 GLU A C     1 
ATOM   1961 O  O     . GLU A 1 263 ? 6.793  7.778  5.464   1.00 26.12 ? 1213 GLU A O     1 
ATOM   1962 C  CB    . GLU A 1 263 ? 6.352  7.318  8.561   1.00 26.17 ? 1213 GLU A CB    1 
ATOM   1963 C  CG    . GLU A 1 263 ? 6.690  6.517  9.817   1.00 29.69 ? 1213 GLU A CG    1 
ATOM   1964 C  CD    . GLU A 1 263 ? 7.271  5.135  9.531   1.00 34.69 ? 1213 GLU A CD    1 
ATOM   1965 O  OE1   . GLU A 1 263 ? 7.162  4.639  8.384   1.00 37.45 ? 1213 GLU A OE1   1 
ATOM   1966 O  OE2   . GLU A 1 263 ? 7.839  4.544  10.475  1.00 37.83 ? 1213 GLU A OE2   1 
ATOM   1967 N  N     . ARG A 1 264 ? 7.069  9.781  6.455   1.00 25.12 ? 1214 ARG A N     1 
ATOM   1968 C  CA    . ARG A 1 264 ? 6.665  10.539 5.258   1.00 25.27 ? 1214 ARG A CA    1 
ATOM   1969 C  C     . ARG A 1 264 ? 7.696  10.470 4.130   1.00 23.96 ? 1214 ARG A C     1 
ATOM   1970 O  O     . ARG A 1 264 ? 7.419  10.849 2.996   1.00 23.69 ? 1214 ARG A O     1 
ATOM   1971 C  CB    . ARG A 1 264 ? 6.320  12.001 5.588   1.00 25.79 ? 1214 ARG A CB    1 
ATOM   1972 C  CG    . ARG A 1 264 ? 5.161  12.196 6.591   1.00 30.36 ? 1214 ARG A CG    1 
ATOM   1973 C  CD    . ARG A 1 264 ? 4.104  11.096 6.537   1.00 36.11 ? 1214 ARG A CD    1 
ATOM   1974 N  NE    . ARG A 1 264 ? 3.593  10.789 7.879   1.00 39.72 ? 1214 ARG A NE    1 
ATOM   1975 C  CZ    . ARG A 1 264 ? 3.138  9.598  8.276   1.00 41.22 ? 1214 ARG A CZ    1 
ATOM   1976 N  NH1   . ARG A 1 264 ? 3.114  8.558  7.446   1.00 41.56 ? 1214 ARG A NH1   1 
ATOM   1977 N  NH2   . ARG A 1 264 ? 2.707  9.447  9.524   1.00 42.26 ? 1214 ARG A NH2   1 
ATOM   1978 N  N     . PHE A 1 265 ? 8.895  9.993  4.453   1.00 22.83 ? 1215 PHE A N     1 
ATOM   1979 C  CA    . PHE A 1 265 ? 9.894  9.749  3.431   1.00 21.85 ? 1215 PHE A CA    1 
ATOM   1980 C  C     . PHE A 1 265 ? 9.714  8.325  2.878   1.00 22.47 ? 1215 PHE A C     1 
ATOM   1981 O  O     . PHE A 1 265 ? 9.606  8.126  1.665   1.00 22.08 ? 1215 PHE A O     1 
ATOM   1982 C  CB    . PHE A 1 265 ? 11.309 9.946  4.005   1.00 21.57 ? 1215 PHE A CB    1 
ATOM   1983 C  CG    . PHE A 1 265 ? 12.403 9.674  3.013   1.00 19.86 ? 1215 PHE A CG    1 
ATOM   1984 C  CD1   . PHE A 1 265 ? 12.937 10.707 2.239   1.00 19.25 ? 1215 PHE A CD1   1 
ATOM   1985 C  CD2   . PHE A 1 265 ? 12.905 8.375  2.844   1.00 18.26 ? 1215 PHE A CD2   1 
ATOM   1986 C  CE1   . PHE A 1 265 ? 13.952 10.455 1.306   1.00 18.38 ? 1215 PHE A CE1   1 
ATOM   1987 C  CE2   . PHE A 1 265 ? 13.918 8.113  1.919   1.00 19.73 ? 1215 PHE A CE2   1 
ATOM   1988 C  CZ    . PHE A 1 265 ? 14.449 9.152  1.149   1.00 19.65 ? 1215 PHE A CZ    1 
ATOM   1989 N  N     . TRP A 1 266 ? 9.702  7.355  3.789   1.00 23.40 ? 1216 TRP A N     1 
ATOM   1990 C  CA    . TRP A 1 266 ? 9.675  5.937  3.428   1.00 25.30 ? 1216 TRP A CA    1 
ATOM   1991 C  C     . TRP A 1 266 ? 8.325  5.471  2.886   1.00 26.69 ? 1216 TRP A C     1 
ATOM   1992 O  O     . TRP A 1 266 ? 8.268  4.476  2.157   1.00 27.15 ? 1216 TRP A O     1 
ATOM   1993 C  CB    . TRP A 1 266 ? 10.157 5.079  4.601   1.00 24.76 ? 1216 TRP A CB    1 
ATOM   1994 C  CG    . TRP A 1 266 ? 11.647 5.211  4.785   1.00 25.19 ? 1216 TRP A CG    1 
ATOM   1995 C  CD1   . TRP A 1 266 ? 12.307 5.914  5.762   1.00 24.25 ? 1216 TRP A CD1   1 
ATOM   1996 C  CD2   . TRP A 1 266 ? 12.658 4.668  3.928   1.00 24.01 ? 1216 TRP A CD2   1 
ATOM   1997 N  NE1   . TRP A 1 266 ? 13.669 5.816  5.572   1.00 22.93 ? 1216 TRP A NE1   1 
ATOM   1998 C  CE2   . TRP A 1 266 ? 13.909 5.064  4.452   1.00 24.44 ? 1216 TRP A CE2   1 
ATOM   1999 C  CE3   . TRP A 1 266 ? 12.627 3.874  2.770   1.00 24.38 ? 1216 TRP A CE3   1 
ATOM   2000 C  CZ2   . TRP A 1 266 ? 15.125 4.682  3.858   1.00 23.64 ? 1216 TRP A CZ2   1 
ATOM   2001 C  CZ3   . TRP A 1 266 ? 13.827 3.502  2.178   1.00 24.01 ? 1216 TRP A CZ3   1 
ATOM   2002 C  CH2   . TRP A 1 266 ? 15.064 3.908  2.727   1.00 25.07 ? 1216 TRP A CH2   1 
ATOM   2003 N  N     . ASP A 1 267 ? 7.259  6.203  3.210   1.00 28.06 ? 1217 ASP A N     1 
ATOM   2004 C  CA    . ASP A 1 267 ? 5.947  5.941  2.602   1.00 29.44 ? 1217 ASP A CA    1 
ATOM   2005 C  C     . ASP A 1 267 ? 6.023  6.049  1.082   1.00 29.97 ? 1217 ASP A C     1 
ATOM   2006 O  O     . ASP A 1 267 ? 5.373  5.284  0.358   1.00 30.74 ? 1217 ASP A O     1 
ATOM   2007 C  CB    . ASP A 1 267 ? 4.878  6.901  3.147   1.00 29.78 ? 1217 ASP A CB    1 
ATOM   2008 C  CG    . ASP A 1 267 ? 4.313  6.459  4.492   1.00 31.71 ? 1217 ASP A CG    1 
ATOM   2009 O  OD1   . ASP A 1 267 ? 4.638  5.339  4.968   1.00 33.24 ? 1217 ASP A OD1   1 
ATOM   2010 O  OD2   . ASP A 1 267 ? 3.541  7.243  5.088   1.00 33.41 ? 1217 ASP A OD2   1 
ATOM   2011 N  N     . ILE A 1 268 ? 6.820  7.001  0.603   1.00 29.76 ? 1218 ILE A N     1 
ATOM   2012 C  CA    . ILE A 1 268 ? 7.003  7.217  -0.826  1.00 29.82 ? 1218 ILE A CA    1 
ATOM   2013 C  C     . ILE A 1 268 ? 8.177  6.398  -1.367  1.00 30.15 ? 1218 ILE A C     1 
ATOM   2014 O  O     . ILE A 1 268 ? 8.033  5.676  -2.352  1.00 30.27 ? 1218 ILE A O     1 
ATOM   2015 C  CB    . ILE A 1 268 ? 7.202  8.735  -1.160  1.00 29.82 ? 1218 ILE A CB    1 
ATOM   2016 C  CG1   . ILE A 1 268 ? 6.007  9.585  -0.677  1.00 30.77 ? 1218 ILE A CG1   1 
ATOM   2017 C  CG2   . ILE A 1 268 ? 7.498  8.946  -2.642  1.00 29.54 ? 1218 ILE A CG2   1 
ATOM   2018 C  CD1   . ILE A 1 268 ? 4.697  9.375  -1.439  1.00 31.77 ? 1218 ILE A CD1   1 
ATOM   2019 N  N     . LYS A 1 269 ? 9.334  6.498  -0.715  1.00 30.09 ? 1219 LYS A N     1 
ATOM   2020 C  CA    . LYS A 1 269 ? 10.565 5.925  -1.260  1.00 30.62 ? 1219 LYS A CA    1 
ATOM   2021 C  C     . LYS A 1 269 ? 10.657 4.408  -1.108  1.00 31.63 ? 1219 LYS A C     1 
ATOM   2022 O  O     . LYS A 1 269 ? 11.312 3.746  -1.917  1.00 31.69 ? 1219 LYS A O     1 
ATOM   2023 C  CB    . LYS A 1 269 ? 11.799 6.608  -0.654  1.00 30.13 ? 1219 LYS A CB    1 
ATOM   2024 C  CG    . LYS A 1 269 ? 11.938 8.065  -1.054  1.00 29.29 ? 1219 LYS A CG    1 
ATOM   2025 C  CD    . LYS A 1 269 ? 12.311 8.209  -2.515  1.00 29.35 ? 1219 LYS A CD    1 
ATOM   2026 C  CE    . LYS A 1 269 ? 12.580 9.649  -2.876  1.00 29.85 ? 1219 LYS A CE    1 
ATOM   2027 N  NZ    . LYS A 1 269 ? 12.655 9.855  -4.341  1.00 30.70 ? 1219 LYS A NZ    1 
ATOM   2028 N  N     . GLY A 1 270 ? 9.996  3.877  -0.078  1.00 32.84 ? 1220 GLY A N     1 
ATOM   2029 C  CA    . GLY A 1 270 ? 9.971  2.439  0.206   1.00 34.46 ? 1220 GLY A CA    1 
ATOM   2030 C  C     . GLY A 1 270 ? 9.355  1.602  -0.904  1.00 35.63 ? 1220 GLY A C     1 
ATOM   2031 O  O     . GLY A 1 270 ? 9.610  0.398  -0.999  1.00 35.77 ? 1220 GLY A O     1 
ATOM   2032 N  N     . LYS A 1 271 ? 8.545  2.243  -1.746  1.00 36.31 ? 1221 LYS A N     1 
ATOM   2033 C  CA    . LYS A 1 271 ? 7.986  1.593  -2.932  1.00 37.43 ? 1221 LYS A CA    1 
ATOM   2034 C  C     . LYS A 1 271 ? 9.024  1.487  -4.052  1.00 37.36 ? 1221 LYS A C     1 
ATOM   2035 O  O     . LYS A 1 271 ? 8.827  0.738  -5.016  1.00 37.83 ? 1221 LYS A O     1 
ATOM   2036 C  CB    . LYS A 1 271 ? 6.741  2.341  -3.428  1.00 37.23 ? 1221 LYS A CB    1 
ATOM   2037 C  CG    . LYS A 1 271 ? 5.576  2.342  -2.436  1.00 38.43 ? 1221 LYS A CG    1 
ATOM   2038 C  CD    . LYS A 1 271 ? 4.301  2.927  -3.043  1.00 38.65 ? 1221 LYS A CD    1 
ATOM   2039 C  CE    . LYS A 1 271 ? 4.320  4.454  -3.042  1.00 41.36 ? 1221 LYS A CE    1 
ATOM   2040 N  NZ    . LYS A 1 271 ? 3.291  5.027  -3.961  1.00 42.55 ? 1221 LYS A NZ    1 
ATOM   2041 N  N     . LEU A 1 272 ? 10.125 2.230  -3.920  1.00 37.21 ? 1222 LEU A N     1 
ATOM   2042 C  CA    . LEU A 1 272 ? 11.148 2.307  -4.963  1.00 36.89 ? 1222 LEU A CA    1 
ATOM   2043 C  C     . LEU A 1 272 ? 12.440 1.575  -4.596  1.00 36.49 ? 1222 LEU A C     1 
ATOM   2044 O  O     . LEU A 1 272 ? 13.101 0.999  -5.466  1.00 36.68 ? 1222 LEU A O     1 
ATOM   2045 C  CB    . LEU A 1 272 ? 11.447 3.767  -5.330  1.00 37.24 ? 1222 LEU A CB    1 
ATOM   2046 C  CG    . LEU A 1 272 ? 10.297 4.605  -5.911  1.00 38.16 ? 1222 LEU A CG    1 
ATOM   2047 C  CD1   . LEU A 1 272 ? 10.638 6.096  -5.909  1.00 39.06 ? 1222 LEU A CD1   1 
ATOM   2048 C  CD2   . LEU A 1 272 ? 9.892  4.140  -7.320  1.00 38.91 ? 1222 LEU A CD2   1 
ATOM   2049 N  N     . PHE A 1 273 ? 12.805 1.620  -3.315  1.00 35.61 ? 1223 PHE A N     1 
ATOM   2050 C  CA    . PHE A 1 273 ? 13.993 0.926  -2.813  1.00 34.67 ? 1223 PHE A CA    1 
ATOM   2051 C  C     . PHE A 1 273 ? 13.886 0.651  -1.321  1.00 34.22 ? 1223 PHE A C     1 
ATOM   2052 O  O     . PHE A 1 273 ? 13.054 1.240  -0.624  1.00 34.30 ? 1223 PHE A O     1 
ATOM   2053 C  CB    . PHE A 1 273 ? 15.286 1.696  -3.132  1.00 34.67 ? 1223 PHE A CB    1 
ATOM   2054 C  CG    . PHE A 1 273 ? 15.325 3.094  -2.568  1.00 34.05 ? 1223 PHE A CG    1 
ATOM   2055 C  CD1   . PHE A 1 273 ? 15.727 3.323  -1.253  1.00 33.81 ? 1223 PHE A CD1   1 
ATOM   2056 C  CD2   . PHE A 1 273 ? 14.980 4.182  -3.363  1.00 33.96 ? 1223 PHE A CD2   1 
ATOM   2057 C  CE1   . PHE A 1 273 ? 15.762 4.618  -0.731  1.00 33.78 ? 1223 PHE A CE1   1 
ATOM   2058 C  CE2   . PHE A 1 273 ? 15.016 5.481  -2.851  1.00 33.17 ? 1223 PHE A CE2   1 
ATOM   2059 C  CZ    . PHE A 1 273 ? 15.408 5.695  -1.535  1.00 33.65 ? 1223 PHE A CZ    1 
ATOM   2060 N  N     . SER A 1 274 ? 14.739 -0.250 -0.846  1.00 33.52 ? 1224 SER A N     1 
ATOM   2061 C  CA    . SER A 1 274 ? 14.746 -0.675 0.548   1.00 32.70 ? 1224 SER A CA    1 
ATOM   2062 C  C     . SER A 1 274 ? 15.878 0.006  1.316   1.00 31.66 ? 1224 SER A C     1 
ATOM   2063 O  O     . SER A 1 274 ? 16.882 0.414  0.723   1.00 31.49 ? 1224 SER A O     1 
ATOM   2064 C  CB    . SER A 1 274 ? 14.914 -2.192 0.611   1.00 33.15 ? 1224 SER A CB    1 
ATOM   2065 O  OG    . SER A 1 274 ? 15.993 -2.597 -0.216  1.00 35.13 ? 1224 SER A OG    1 
ATOM   2066 N  N     . CYS A 1 275 ? 15.714 0.115  2.631   1.00 30.20 ? 1225 CYS A N     1 
ATOM   2067 C  CA    . CYS A 1 275 ? 16.746 0.703  3.483   1.00 30.00 ? 1225 CYS A CA    1 
ATOM   2068 C  C     . CYS A 1 275 ? 17.978 -0.191 3.584   1.00 30.39 ? 1225 CYS A C     1 
ATOM   2069 O  O     . CYS A 1 275 ? 17.866 -1.397 3.790   1.00 30.51 ? 1225 CYS A O     1 
ATOM   2070 C  CB    . CYS A 1 275 ? 16.209 0.983  4.883   1.00 29.77 ? 1225 CYS A CB    1 
ATOM   2071 S  SG    . CYS A 1 275 ? 17.432 1.760  5.947   1.00 28.10 ? 1225 CYS A SG    1 
ATOM   2072 N  N     . ARG A 1 276 ? 19.146 0.421  3.437   1.00 30.54 ? 1226 ARG A N     1 
ATOM   2073 C  CA    . ARG A 1 276 ? 20.410 -0.294 3.522   1.00 31.01 ? 1226 ARG A CA    1 
ATOM   2074 C  C     . ARG A 1 276 ? 21.247 0.152  4.734   1.00 30.38 ? 1226 ARG A C     1 
ATOM   2075 O  O     . ARG A 1 276 ? 22.470 0.001  4.732   1.00 30.33 ? 1226 ARG A O     1 
ATOM   2076 C  CB    . ARG A 1 276 ? 21.175 -0.167 2.195   1.00 31.00 ? 1226 ARG A CB    1 
ATOM   2077 C  CG    . ARG A 1 276 ? 20.447 -0.861 1.028   1.00 32.13 ? 1226 ARG A CG    1 
ATOM   2078 C  CD    . ARG A 1 276 ? 21.110 -0.662 -0.339  1.00 33.23 ? 1226 ARG A CD    1 
ATOM   2079 N  NE    . ARG A 1 276 ? 20.544 0.442  -1.122  1.00 38.60 ? 1226 ARG A NE    1 
ATOM   2080 C  CZ    . ARG A 1 276 ? 19.301 0.494  -1.620  1.00 40.37 ? 1226 ARG A CZ    1 
ATOM   2081 N  NH1   . ARG A 1 276 ? 18.427 -0.491 -1.416  1.00 41.19 ? 1226 ARG A NH1   1 
ATOM   2082 N  NH2   . ARG A 1 276 ? 18.922 1.555  -2.322  1.00 41.69 ? 1226 ARG A NH2   1 
ATOM   2083 N  N     . CYS A 1 277 ? 20.588 0.660  5.784   1.00 29.66 ? 1227 CYS A N     1 
ATOM   2084 C  CA    . CYS A 1 277 ? 21.312 1.135  6.971   1.00 29.07 ? 1227 CYS A CA    1 
ATOM   2085 C  C     . CYS A 1 277 ? 22.092 0.028  7.678   1.00 29.42 ? 1227 CYS A C     1 
ATOM   2086 O  O     . CYS A 1 277 ? 23.115 0.290  8.306   1.00 29.34 ? 1227 CYS A O     1 
ATOM   2087 C  CB    . CYS A 1 277 ? 20.398 1.874  7.961   1.00 28.78 ? 1227 CYS A CB    1 
ATOM   2088 S  SG    . CYS A 1 277 ? 19.350 0.844  9.028   1.00 26.91 ? 1227 CYS A SG    1 
ATOM   2089 N  N     . GLY A 1 278 ? 21.596 -1.204 7.575   1.00 29.87 ? 1228 GLY A N     1 
ATOM   2090 C  CA    . GLY A 1 278 ? 22.298 -2.373 8.097   1.00 30.40 ? 1228 GLY A CA    1 
ATOM   2091 C  C     . GLY A 1 278 ? 22.013 -2.710 9.546   1.00 30.88 ? 1228 GLY A C     1 
ATOM   2092 O  O     . GLY A 1 278 ? 22.567 -3.673 10.077  1.00 31.25 ? 1228 GLY A O     1 
ATOM   2093 N  N     . SER A 1 279 ? 21.152 -1.930 10.195  1.00 30.95 ? 1229 SER A N     1 
ATOM   2094 C  CA    . SER A 1 279 ? 20.776 -2.205 11.578  1.00 31.20 ? 1229 SER A CA    1 
ATOM   2095 C  C     . SER A 1 279 ? 20.013 -3.529 11.689  1.00 31.52 ? 1229 SER A C     1 
ATOM   2096 O  O     . SER A 1 279 ? 19.158 -3.816 10.846  1.00 31.54 ? 1229 SER A O     1 
ATOM   2097 C  CB    . SER A 1 279 ? 19.901 -1.081 12.131  1.00 31.16 ? 1229 SER A CB    1 
ATOM   2098 O  OG    . SER A 1 279 ? 19.564 -1.336 13.481  1.00 30.94 ? 1229 SER A OG    1 
ATOM   2099 N  N     . PRO A 1 280 ? 20.308 -4.328 12.737  1.00 31.94 ? 1230 PRO A N     1 
ATOM   2100 C  CA    . PRO A 1 280 ? 19.475 -5.499 13.041  1.00 32.15 ? 1230 PRO A CA    1 
ATOM   2101 C  C     . PRO A 1 280 ? 18.026 -5.070 13.284  1.00 32.33 ? 1230 PRO A C     1 
ATOM   2102 O  O     . PRO A 1 280 ? 17.098 -5.842 13.026  1.00 32.69 ? 1230 PRO A O     1 
ATOM   2103 C  CB    . PRO A 1 280 ? 20.079 -6.043 14.342  1.00 32.18 ? 1230 PRO A CB    1 
ATOM   2104 C  CG    . PRO A 1 280 ? 21.444 -5.488 14.413  1.00 32.32 ? 1230 PRO A CG    1 
ATOM   2105 C  CD    . PRO A 1 280 ? 21.428 -4.180 13.688  1.00 31.90 ? 1230 PRO A CD    1 
ATOM   2106 N  N     . LYS A 1 281 ? 17.854 -3.831 13.753  1.00 32.05 ? 1231 LYS A N     1 
ATOM   2107 C  CA    . LYS A 1 281 ? 16.541 -3.260 14.046  1.00 31.57 ? 1231 LYS A CA    1 
ATOM   2108 C  C     . LYS A 1 281 ? 16.000 -2.392 12.894  1.00 30.76 ? 1231 LYS A C     1 
ATOM   2109 O  O     . LYS A 1 281 ? 15.093 -1.590 13.102  1.00 30.28 ? 1231 LYS A O     1 
ATOM   2110 C  CB    . LYS A 1 281 ? 16.594 -2.449 15.351  1.00 32.14 ? 1231 LYS A CB    1 
ATOM   2111 C  CG    . LYS A 1 281 ? 16.936 -3.261 16.616  1.00 32.28 ? 1231 LYS A CG    1 
ATOM   2112 C  CD    . LYS A 1 281 ? 16.845 -2.392 17.870  1.00 32.62 ? 1231 LYS A CD    1 
ATOM   2113 C  CE    . LYS A 1 281 ? 17.150 -3.172 19.154  1.00 34.99 ? 1231 LYS A CE    1 
ATOM   2114 N  NZ    . LYS A 1 281 ? 18.609 -3.500 19.318  1.00 36.77 ? 1231 LYS A NZ    1 
ATOM   2115 N  N     . CYS A 1 282 ? 16.541 -2.570 11.687  1.00 29.36 ? 1232 CYS A N     1 
ATOM   2116 C  CA    . CYS A 1 282 ? 16.048 -1.863 10.501  1.00 29.42 ? 1232 CYS A CA    1 
ATOM   2117 C  C     . CYS A 1 282 ? 14.539 -2.042 10.308  1.00 29.99 ? 1232 CYS A C     1 
ATOM   2118 O  O     . CYS A 1 282 ? 14.014 -3.156 10.392  1.00 29.66 ? 1232 CYS A O     1 
ATOM   2119 C  CB    . CYS A 1 282 ? 16.828 -2.279 9.248   1.00 29.23 ? 1232 CYS A CB    1 
ATOM   2120 S  SG    . CYS A 1 282 ? 16.348 -1.443 7.726   1.00 26.88 ? 1232 CYS A SG    1 
ATOM   2121 N  N     . ARG A 1 283 ? 13.847 -0.931 10.080  1.00 30.30 ? 1233 ARG A N     1 
ATOM   2122 C  CA    . ARG A 1 283 ? 12.394 -0.937 9.958   1.00 31.04 ? 1233 ARG A CA    1 
ATOM   2123 C  C     . ARG A 1 283 ? 11.914 -0.706 8.520   1.00 31.18 ? 1233 ARG A C     1 
ATOM   2124 O  O     . ARG A 1 283 ? 10.706 -0.616 8.271   1.00 31.55 ? 1233 ARG A O     1 
ATOM   2125 C  CB    . ARG A 1 283 ? 11.785 0.088  10.922  1.00 30.96 ? 1233 ARG A CB    1 
ATOM   2126 C  CG    . ARG A 1 283 ? 11.974 -0.274 12.390  1.00 31.59 ? 1233 ARG A CG    1 
ATOM   2127 C  CD    . ARG A 1 283 ? 11.606 0.861  13.343  1.00 32.12 ? 1233 ARG A CD    1 
ATOM   2128 N  NE    . ARG A 1 283 ? 12.638 1.904  13.391  1.00 35.08 ? 1233 ARG A NE    1 
ATOM   2129 C  CZ    . ARG A 1 283 ? 12.556 3.079  12.769  1.00 35.41 ? 1233 ARG A CZ    1 
ATOM   2130 N  NH1   . ARG A 1 283 ? 11.486 3.383  12.043  1.00 36.54 ? 1233 ARG A NH1   1 
ATOM   2131 N  NH2   . ARG A 1 283 ? 13.546 3.953  12.875  1.00 35.32 ? 1233 ARG A NH2   1 
ATOM   2132 N  N     . HIS A 1 284 ? 12.851 -0.623 7.577   1.00 31.49 ? 1234 HIS A N     1 
ATOM   2133 C  CA    . HIS A 1 284 ? 12.517 -0.287 6.193   1.00 31.93 ? 1234 HIS A CA    1 
ATOM   2134 C  C     . HIS A 1 284 ? 13.222 -1.177 5.168   1.00 32.76 ? 1234 HIS A C     1 
ATOM   2135 O  O     . HIS A 1 284 ? 13.314 -0.830 3.991   1.00 32.93 ? 1234 HIS A O     1 
ATOM   2136 C  CB    . HIS A 1 284 ? 12.792 1.205  5.913   1.00 31.54 ? 1234 HIS A CB    1 
ATOM   2137 C  CG    . HIS A 1 284 ? 12.044 2.137  6.815   1.00 30.23 ? 1234 HIS A CG    1 
ATOM   2138 N  ND1   . HIS A 1 284 ? 10.681 2.341  6.715   1.00 29.36 ? 1234 HIS A ND1   1 
ATOM   2139 C  CD2   . HIS A 1 284 ? 12.466 2.916  7.840   1.00 29.47 ? 1234 HIS A CD2   1 
ATOM   2140 C  CE1   . HIS A 1 284 ? 10.299 3.204  7.639   1.00 29.60 ? 1234 HIS A CE1   1 
ATOM   2141 N  NE2   . HIS A 1 284 ? 11.363 3.569  8.334   1.00 29.33 ? 1234 HIS A NE2   1 
ATOM   2142 N  N     . SER A 1 285 ? 13.698 -2.334 5.622   1.00 34.18 ? 1235 SER A N     1 
ATOM   2143 C  CA    . SER A 1 285 ? 14.426 -3.266 4.766   1.00 35.56 ? 1235 SER A CA    1 
ATOM   2144 C  C     . SER A 1 285 ? 13.481 -4.103 3.907   1.00 36.07 ? 1235 SER A C     1 
ATOM   2145 O  O     . SER A 1 285 ? 13.918 -4.750 2.950   1.00 36.90 ? 1235 SER A O     1 
ATOM   2146 C  CB    . SER A 1 285 ? 15.340 -4.172 5.600   1.00 35.64 ? 1235 SER A CB    1 
ATOM   2147 O  OG    . SER A 1 285 ? 14.607 -4.884 6.589   1.00 37.30 ? 1235 SER A OG    1 
ATOM   2148 N  N     . ILE B 1 28  ? 35.709 54.799 32.700  1.00 35.38 ? 978  ILE B N     1 
ATOM   2149 C  CA    . ILE B 1 28  ? 35.138 53.600 31.997  1.00 35.74 ? 978  ILE B CA    1 
ATOM   2150 C  C     . ILE B 1 28  ? 33.720 53.312 32.490  1.00 35.50 ? 978  ILE B C     1 
ATOM   2151 O  O     . ILE B 1 28  ? 33.534 52.770 33.592  1.00 35.87 ? 978  ILE B O     1 
ATOM   2152 C  CB    . ILE B 1 28  ? 36.016 52.328 32.179  1.00 35.70 ? 978  ILE B CB    1 
ATOM   2153 C  CG1   . ILE B 1 28  ? 37.483 52.626 31.858  1.00 36.43 ? 978  ILE B CG1   1 
ATOM   2154 C  CG2   . ILE B 1 28  ? 35.496 51.182 31.293  1.00 35.94 ? 978  ILE B CG2   1 
ATOM   2155 C  CD1   . ILE B 1 28  ? 38.449 51.509 32.223  1.00 36.03 ? 978  ILE B CD1   1 
ATOM   2156 N  N     . VAL B 1 29  ? 32.730 53.678 31.676  1.00 34.78 ? 979  VAL B N     1 
ATOM   2157 C  CA    . VAL B 1 29  ? 31.316 53.519 32.042  1.00 33.95 ? 979  VAL B CA    1 
ATOM   2158 C  C     . VAL B 1 29  ? 30.636 52.329 31.341  1.00 33.42 ? 979  VAL B C     1 
ATOM   2159 O  O     . VAL B 1 29  ? 29.463 52.040 31.597  1.00 33.37 ? 979  VAL B O     1 
ATOM   2160 C  CB    . VAL B 1 29  ? 30.498 54.826 31.846  1.00 34.15 ? 979  VAL B CB    1 
ATOM   2161 C  CG1   . VAL B 1 29  ? 31.003 55.934 32.789  1.00 34.10 ? 979  VAL B CG1   1 
ATOM   2162 C  CG2   . VAL B 1 29  ? 30.542 55.296 30.399  1.00 34.69 ? 979  VAL B CG2   1 
ATOM   2163 N  N     . SER B 1 30  ? 31.384 51.663 30.459  1.00 32.39 ? 980  SER B N     1 
ATOM   2164 C  CA    . SER B 1 30  ? 30.979 50.396 29.834  1.00 31.72 ? 980  SER B CA    1 
ATOM   2165 C  C     . SER B 1 30  ? 32.182 49.729 29.175  1.00 30.80 ? 980  SER B C     1 
ATOM   2166 O  O     . SER B 1 30  ? 32.943 50.381 28.453  1.00 31.07 ? 980  SER B O     1 
ATOM   2167 C  CB    . SER B 1 30  ? 29.871 50.606 28.795  1.00 31.90 ? 980  SER B CB    1 
ATOM   2168 O  OG    . SER B 1 30  ? 29.534 49.370 28.179  1.00 32.94 ? 980  SER B OG    1 
ATOM   2169 N  N     . ARG B 1 31  ? 32.351 48.435 29.427  1.00 29.82 ? 981  ARG B N     1 
ATOM   2170 C  CA    . ARG B 1 31  ? 33.420 47.653 28.811  1.00 29.11 ? 981  ARG B CA    1 
ATOM   2171 C  C     . ARG B 1 31  ? 33.121 47.375 27.339  1.00 27.44 ? 981  ARG B C     1 
ATOM   2172 O  O     . ARG B 1 31  ? 34.040 47.169 26.555  1.00 27.48 ? 981  ARG B O     1 
ATOM   2173 C  CB    . ARG B 1 31  ? 33.600 46.315 29.514  1.00 29.99 ? 981  ARG B CB    1 
ATOM   2174 C  CG    . ARG B 1 31  ? 34.219 46.376 30.898  1.00 32.94 ? 981  ARG B CG    1 
ATOM   2175 C  CD    . ARG B 1 31  ? 34.331 44.972 31.491  1.00 38.62 ? 981  ARG B CD    1 
ATOM   2176 N  NE    . ARG B 1 31  ? 33.018 44.370 31.745  1.00 42.66 ? 981  ARG B NE    1 
ATOM   2177 C  CZ    . ARG B 1 31  ? 32.441 43.439 30.982  1.00 44.05 ? 981  ARG B CZ    1 
ATOM   2178 N  NH1   . ARG B 1 31  ? 33.049 42.971 29.893  1.00 44.12 ? 981  ARG B NH1   1 
ATOM   2179 N  NH2   . ARG B 1 31  ? 31.245 42.967 31.317  1.00 45.24 ? 981  ARG B NH2   1 
ATOM   2180 N  N     . ASP B 1 32  ? 31.837 47.340 26.983  1.00 25.82 ? 982  ASP B N     1 
ATOM   2181 C  CA    . ASP B 1 32  ? 31.427 47.043 25.600  1.00 23.88 ? 982  ASP B CA    1 
ATOM   2182 C  C     . ASP B 1 32  ? 29.963 47.384 25.373  1.00 23.10 ? 982  ASP B C     1 
ATOM   2183 O  O     . ASP B 1 32  ? 29.080 46.666 25.827  1.00 22.66 ? 982  ASP B O     1 
ATOM   2184 C  CB    . ASP B 1 32  ? 31.665 45.564 25.275  1.00 23.79 ? 982  ASP B CB    1 
ATOM   2185 C  CG    . ASP B 1 32  ? 31.367 45.221 23.811  1.00 22.31 ? 982  ASP B CG    1 
ATOM   2186 O  OD1   . ASP B 1 32  ? 31.182 46.152 23.001  1.00 22.73 ? 982  ASP B OD1   1 
ATOM   2187 O  OD2   . ASP B 1 32  ? 31.329 44.019 23.483  1.00 21.66 ? 982  ASP B OD2   1 
ATOM   2188 N  N     . ILE B 1 33  ? 29.700 48.464 24.641  1.00 22.18 ? 983  ILE B N     1 
ATOM   2189 C  CA    . ILE B 1 33  ? 28.321 48.887 24.406  1.00 21.64 ? 983  ILE B CA    1 
ATOM   2190 C  C     . ILE B 1 33  ? 27.582 47.857 23.526  1.00 20.90 ? 983  ILE B C     1 
ATOM   2191 O  O     . ILE B 1 33  ? 26.352 47.784 23.522  1.00 20.41 ? 983  ILE B O     1 
ATOM   2192 C  CB    . ILE B 1 33  ? 28.225 50.317 23.801  1.00 22.14 ? 983  ILE B CB    1 
ATOM   2193 C  CG1   . ILE B 1 33  ? 28.876 50.383 22.413  1.00 22.34 ? 983  ILE B CG1   1 
ATOM   2194 C  CG2   . ILE B 1 33  ? 28.839 51.368 24.765  1.00 23.03 ? 983  ILE B CG2   1 
ATOM   2195 C  CD1   . ILE B 1 33  ? 28.452 51.549 21.605  1.00 22.50 ? 983  ILE B CD1   1 
ATOM   2196 N  N     . ALA B 1 34  ? 28.363 47.047 22.826  1.00 20.94 ? 984  ALA B N     1 
ATOM   2197 C  CA    . ALA B 1 34  ? 27.818 46.058 21.889  1.00 21.17 ? 984  ALA B CA    1 
ATOM   2198 C  C     . ALA B 1 34  ? 27.493 44.712 22.540  1.00 21.15 ? 984  ALA B C     1 
ATOM   2199 O  O     . ALA B 1 34  ? 26.920 43.838 21.895  1.00 20.86 ? 984  ALA B O     1 
ATOM   2200 C  CB    . ALA B 1 34  ? 28.776 45.869 20.718  1.00 21.09 ? 984  ALA B CB    1 
ATOM   2201 N  N     . ARG B 1 35  ? 27.868 44.529 23.809  1.00 21.29 ? 985  ARG B N     1 
ATOM   2202 C  CA    . ARG B 1 35  ? 27.577 43.287 24.549  1.00 21.94 ? 985  ARG B CA    1 
ATOM   2203 C  C     . ARG B 1 35  ? 28.072 42.018 23.847  1.00 21.02 ? 985  ARG B C     1 
ATOM   2204 O  O     . ARG B 1 35  ? 27.405 40.973 23.905  1.00 20.48 ? 985  ARG B O     1 
ATOM   2205 C  CB    . ARG B 1 35  ? 26.070 43.135 24.846  1.00 22.02 ? 985  ARG B CB    1 
ATOM   2206 C  CG    . ARG B 1 35  ? 25.379 44.317 25.495  1.00 24.25 ? 985  ARG B CG    1 
ATOM   2207 C  CD    . ARG B 1 35  ? 23.868 44.034 25.782  1.00 24.84 ? 985  ARG B CD    1 
ATOM   2208 N  NE    . ARG B 1 35  ? 23.194 43.192 24.777  1.00 29.23 ? 985  ARG B NE    1 
ATOM   2209 C  CZ    . ARG B 1 35  ? 22.692 43.629 23.618  1.00 31.63 ? 985  ARG B CZ    1 
ATOM   2210 N  NH1   . ARG B 1 35  ? 22.098 42.776 22.787  1.00 31.50 ? 985  ARG B NH1   1 
ATOM   2211 N  NH2   . ARG B 1 35  ? 22.780 44.913 23.276  1.00 31.59 ? 985  ARG B NH2   1 
ATOM   2212 N  N     . GLY B 1 36  ? 29.224 42.106 23.181  1.00 20.42 ? 986  GLY B N     1 
ATOM   2213 C  CA    . GLY B 1 36  ? 29.845 40.945 22.553  1.00 20.62 ? 986  GLY B CA    1 
ATOM   2214 C  C     . GLY B 1 36  ? 29.394 40.660 21.130  1.00 20.47 ? 986  GLY B C     1 
ATOM   2215 O  O     . GLY B 1 36  ? 29.834 39.681 20.528  1.00 20.90 ? 986  GLY B O     1 
ATOM   2216 N  N     . TYR B 1 37  ? 28.530 41.514 20.589  1.00 20.43 ? 987  TYR B N     1 
ATOM   2217 C  CA    . TYR B 1 37  ? 28.007 41.308 19.227  1.00 20.89 ? 987  TYR B CA    1 
ATOM   2218 C  C     . TYR B 1 37  ? 28.963 41.711 18.109  1.00 22.24 ? 987  TYR B C     1 
ATOM   2219 O  O     . TYR B 1 37  ? 28.728 41.378 16.942  1.00 22.27 ? 987  TYR B O     1 
ATOM   2220 C  CB    . TYR B 1 37  ? 26.660 42.006 19.048  1.00 21.02 ? 987  TYR B CB    1 
ATOM   2221 C  CG    . TYR B 1 37  ? 25.488 41.213 19.590  1.00 20.46 ? 987  TYR B CG    1 
ATOM   2222 C  CD1   . TYR B 1 37  ? 25.144 41.291 20.944  1.00 20.76 ? 987  TYR B CD1   1 
ATOM   2223 C  CD2   . TYR B 1 37  ? 24.720 40.377 18.760  1.00 21.19 ? 987  TYR B CD2   1 
ATOM   2224 C  CE1   . TYR B 1 37  ? 24.074 40.570 21.465  1.00 22.55 ? 987  TYR B CE1   1 
ATOM   2225 C  CE2   . TYR B 1 37  ? 23.627 39.646 19.283  1.00 21.15 ? 987  TYR B CE2   1 
ATOM   2226 C  CZ    . TYR B 1 37  ? 23.321 39.756 20.632  1.00 20.65 ? 987  TYR B CZ    1 
ATOM   2227 O  OH    . TYR B 1 37  ? 22.262 39.076 21.188  1.00 22.46 ? 987  TYR B OH    1 
ATOM   2228 N  N     . GLU B 1 38  ? 30.010 42.458 18.442  1.00 22.79 ? 988  GLU B N     1 
ATOM   2229 C  CA    . GLU B 1 38  ? 31.003 42.829 17.435  1.00 23.87 ? 988  GLU B CA    1 
ATOM   2230 C  C     . GLU B 1 38  ? 32.249 41.971 17.606  1.00 25.41 ? 988  GLU B C     1 
ATOM   2231 O  O     . GLU B 1 38  ? 32.394 41.274 18.616  1.00 25.47 ? 988  GLU B O     1 
ATOM   2232 C  CB    . GLU B 1 38  ? 31.338 44.328 17.499  1.00 23.73 ? 988  GLU B CB    1 
ATOM   2233 C  CG    . GLU B 1 38  ? 30.132 45.277 17.426  1.00 23.55 ? 988  GLU B CG    1 
ATOM   2234 C  CD    . GLU B 1 38  ? 29.472 45.414 16.048  1.00 23.96 ? 988  GLU B CD    1 
ATOM   2235 O  OE1   . GLU B 1 38  ? 29.907 44.753 15.073  1.00 23.12 ? 988  GLU B OE1   1 
ATOM   2236 O  OE2   . GLU B 1 38  ? 28.504 46.211 15.953  1.00 21.27 ? 988  GLU B OE2   1 
ATOM   2237 N  N     . ARG B 1 39  ? 33.145 42.014 16.617  1.00 26.83 ? 989  ARG B N     1 
ATOM   2238 C  CA    . ARG B 1 39  ? 34.384 41.226 16.656  1.00 29.26 ? 989  ARG B CA    1 
ATOM   2239 C  C     . ARG B 1 39  ? 35.275 41.645 17.825  1.00 29.63 ? 989  ARG B C     1 
ATOM   2240 O  O     . ARG B 1 39  ? 36.016 40.834 18.381  1.00 30.30 ? 989  ARG B O     1 
ATOM   2241 C  CB    . ARG B 1 39  ? 35.178 41.410 15.365  1.00 29.62 ? 989  ARG B CB    1 
ATOM   2242 C  CG    . ARG B 1 39  ? 34.589 40.781 14.137  1.00 33.31 ? 989  ARG B CG    1 
ATOM   2243 C  CD    . ARG B 1 39  ? 35.675 40.743 13.066  1.00 38.25 ? 989  ARG B CD    1 
ATOM   2244 N  NE    . ARG B 1 39  ? 35.185 40.304 11.767  1.00 41.81 ? 989  ARG B NE    1 
ATOM   2245 C  CZ    . ARG B 1 39  ? 35.080 39.031 11.392  1.00 43.44 ? 989  ARG B CZ    1 
ATOM   2246 N  NH1   . ARG B 1 39  ? 35.419 38.047 12.222  1.00 44.48 ? 989  ARG B NH1   1 
ATOM   2247 N  NH2   . ARG B 1 39  ? 34.628 38.739 10.182  1.00 44.26 ? 989  ARG B NH2   1 
ATOM   2248 N  N     . ILE B 1 40  ? 35.209 42.923 18.169  1.00 29.91 ? 990  ILE B N     1 
ATOM   2249 C  CA    . ILE B 1 40  ? 35.949 43.470 19.299  1.00 30.34 ? 990  ILE B CA    1 
ATOM   2250 C  C     . ILE B 1 40  ? 35.018 44.360 20.134  1.00 29.76 ? 990  ILE B C     1 
ATOM   2251 O  O     . ILE B 1 40  ? 34.000 44.836 19.623  1.00 30.04 ? 990  ILE B O     1 
ATOM   2252 C  CB    . ILE B 1 40  ? 37.210 44.246 18.824  1.00 30.83 ? 990  ILE B CB    1 
ATOM   2253 C  CG1   . ILE B 1 40  ? 36.875 45.145 17.636  1.00 31.77 ? 990  ILE B CG1   1 
ATOM   2254 C  CG2   . ILE B 1 40  ? 38.330 43.288 18.453  1.00 31.46 ? 990  ILE B CG2   1 
ATOM   2255 C  CD1   . ILE B 1 40  ? 36.488 46.522 18.054  1.00 34.00 ? 990  ILE B CD1   1 
ATOM   2256 N  N     . PRO B 1 41  ? 35.349 44.581 21.421  1.00 29.30 ? 991  PRO B N     1 
ATOM   2257 C  CA    . PRO B 1 41  ? 34.457 45.419 22.209  1.00 28.60 ? 991  PRO B CA    1 
ATOM   2258 C  C     . PRO B 1 41  ? 34.539 46.884 21.802  1.00 28.19 ? 991  PRO B C     1 
ATOM   2259 O  O     . PRO B 1 41  ? 35.533 47.311 21.202  1.00 28.48 ? 991  PRO B O     1 
ATOM   2260 C  CB    . PRO B 1 41  ? 34.964 45.226 23.645  1.00 29.17 ? 991  PRO B CB    1 
ATOM   2261 C  CG    . PRO B 1 41  ? 36.370 44.839 23.511  1.00 29.21 ? 991  PRO B CG    1 
ATOM   2262 C  CD    . PRO B 1 41  ? 36.501 44.099 22.208  1.00 29.51 ? 991  PRO B CD    1 
ATOM   2263 N  N     . ILE B 1 42  ? 33.481 47.626 22.104  1.00 27.03 ? 992  ILE B N     1 
ATOM   2264 C  CA    . ILE B 1 42  ? 33.461 49.061 21.921  1.00 26.81 ? 992  ILE B CA    1 
ATOM   2265 C  C     . ILE B 1 42  ? 33.204 49.651 23.305  1.00 27.00 ? 992  ILE B C     1 
ATOM   2266 O  O     . ILE B 1 42  ? 32.056 49.792 23.718  1.00 26.37 ? 992  ILE B O     1 
ATOM   2267 C  CB    . ILE B 1 42  ? 32.362 49.516 20.913  1.00 26.83 ? 992  ILE B CB    1 
ATOM   2268 C  CG1   . ILE B 1 42  ? 32.577 48.867 19.536  1.00 26.71 ? 992  ILE B CG1   1 
ATOM   2269 C  CG2   . ILE B 1 42  ? 32.351 51.050 20.774  1.00 25.33 ? 992  ILE B CG2   1 
ATOM   2270 C  CD1   . ILE B 1 42  ? 31.358 48.961 18.605  1.00 27.22 ? 992  ILE B CD1   1 
ATOM   2271 N  N     . PRO B 1 43  ? 34.280 49.977 24.038  1.00 27.68 ? 993  PRO B N     1 
ATOM   2272 C  CA    . PRO B 1 43  ? 34.085 50.527 25.383  1.00 28.23 ? 993  PRO B CA    1 
ATOM   2273 C  C     . PRO B 1 43  ? 33.499 51.928 25.349  1.00 29.05 ? 993  PRO B C     1 
ATOM   2274 O  O     . PRO B 1 43  ? 33.535 52.593 24.311  1.00 28.07 ? 993  PRO B O     1 
ATOM   2275 C  CB    . PRO B 1 43  ? 35.502 50.572 25.965  1.00 28.25 ? 993  PRO B CB    1 
ATOM   2276 C  CG    . PRO B 1 43  ? 36.370 49.802 25.025  1.00 28.28 ? 993  PRO B CG    1 
ATOM   2277 C  CD    . PRO B 1 43  ? 35.706 49.881 23.684  1.00 27.87 ? 993  PRO B CD    1 
ATOM   2278 N  N     . CYS B 1 44  ? 32.949 52.366 26.482  1.00 30.31 ? 994  CYS B N     1 
ATOM   2279 C  CA    . CYS B 1 44  ? 32.497 53.737 26.634  1.00 31.34 ? 994  CYS B CA    1 
ATOM   2280 C  C     . CYS B 1 44  ? 33.266 54.379 27.787  1.00 32.31 ? 994  CYS B C     1 
ATOM   2281 O  O     . CYS B 1 44  ? 33.334 53.805 28.875  1.00 32.18 ? 994  CYS B O     1 
ATOM   2282 C  CB    . CYS B 1 44  ? 30.993 53.806 26.907  1.00 31.64 ? 994  CYS B CB    1 
ATOM   2283 S  SG    . CYS B 1 44  ? 30.331 55.496 26.968  1.00 32.18 ? 994  CYS B SG    1 
ATOM   2284 N  N     . VAL B 1 45  ? 33.852 55.550 27.529  1.00 33.34 ? 995  VAL B N     1 
ATOM   2285 C  CA    . VAL B 1 45  ? 34.571 56.309 28.569  1.00 34.27 ? 995  VAL B CA    1 
ATOM   2286 C  C     . VAL B 1 45  ? 34.030 57.729 28.730  1.00 35.24 ? 995  VAL B C     1 
ATOM   2287 O  O     . VAL B 1 45  ? 33.517 58.329 27.783  1.00 35.04 ? 995  VAL B O     1 
ATOM   2288 C  CB    . VAL B 1 45  ? 36.120 56.327 28.352  1.00 34.18 ? 995  VAL B CB    1 
ATOM   2289 C  CG1   . VAL B 1 45  ? 36.693 54.916 28.356  1.00 34.24 ? 995  VAL B CG1   1 
ATOM   2290 C  CG2   . VAL B 1 45  ? 36.509 57.076 27.078  1.00 33.77 ? 995  VAL B CG2   1 
ATOM   2291 N  N     . ASN B 1 46  ? 34.140 58.266 29.945  1.00 36.44 ? 996  ASN B N     1 
ATOM   2292 C  CA    . ASN B 1 46  ? 33.742 59.643 30.200  1.00 37.85 ? 996  ASN B CA    1 
ATOM   2293 C  C     . ASN B 1 46  ? 34.814 60.361 31.014  1.00 38.83 ? 996  ASN B C     1 
ATOM   2294 O  O     . ASN B 1 46  ? 35.285 59.841 32.031  1.00 38.91 ? 996  ASN B O     1 
ATOM   2295 C  CB    . ASN B 1 46  ? 32.386 59.703 30.913  1.00 37.63 ? 996  ASN B CB    1 
ATOM   2296 C  CG    . ASN B 1 46  ? 31.741 61.079 30.839  1.00 37.71 ? 996  ASN B CG    1 
ATOM   2297 O  OD1   . ASN B 1 46  ? 32.423 62.102 30.706  1.00 37.92 ? 996  ASN B OD1   1 
ATOM   2298 N  ND2   . ASN B 1 46  ? 30.417 61.112 30.923  1.00 36.62 ? 996  ASN B ND2   1 
ATOM   2299 N  N     . ALA B 1 47  ? 35.196 61.547 30.545  1.00 39.88 ? 997  ALA B N     1 
ATOM   2300 C  CA    . ALA B 1 47  ? 36.254 62.335 31.179  1.00 40.96 ? 997  ALA B CA    1 
ATOM   2301 C  C     . ALA B 1 47  ? 35.852 63.787 31.414  1.00 41.71 ? 997  ALA B C     1 
ATOM   2302 O  O     . ALA B 1 47  ? 36.587 64.534 32.074  1.00 42.18 ? 997  ALA B O     1 
ATOM   2303 C  CB    . ALA B 1 47  ? 37.539 62.271 30.345  1.00 40.88 ? 997  ALA B CB    1 
ATOM   2304 N  N     . VAL B 1 48  ? 34.702 64.197 30.879  1.00 42.28 ? 998  VAL B N     1 
ATOM   2305 C  CA    . VAL B 1 48  ? 34.305 65.605 30.963  1.00 43.04 ? 998  VAL B CA    1 
ATOM   2306 C  C     . VAL B 1 48  ? 33.183 65.874 31.971  1.00 43.48 ? 998  VAL B C     1 
ATOM   2307 O  O     . VAL B 1 48  ? 33.176 66.926 32.623  1.00 43.67 ? 998  VAL B O     1 
ATOM   2308 C  CB    . VAL B 1 48  ? 33.997 66.254 29.566  1.00 43.12 ? 998  VAL B CB    1 
ATOM   2309 C  CG1   . VAL B 1 48  ? 34.787 65.570 28.446  1.00 43.15 ? 998  VAL B CG1   1 
ATOM   2310 C  CG2   . VAL B 1 48  ? 32.508 66.267 29.252  1.00 43.36 ? 998  VAL B CG2   1 
ATOM   2311 N  N     . ASP B 1 49  ? 32.245 64.936 32.106  1.00 43.57 ? 999  ASP B N     1 
ATOM   2312 C  CA    . ASP B 1 49  ? 31.116 65.130 33.022  1.00 43.71 ? 999  ASP B CA    1 
ATOM   2313 C  C     . ASP B 1 49  ? 30.662 63.868 33.759  1.00 43.51 ? 999  ASP B C     1 
ATOM   2314 O  O     . ASP B 1 49  ? 31.423 62.907 33.907  1.00 43.50 ? 999  ASP B O     1 
ATOM   2315 C  CB    . ASP B 1 49  ? 29.936 65.842 32.322  1.00 43.89 ? 999  ASP B CB    1 
ATOM   2316 C  CG    . ASP B 1 49  ? 29.286 65.000 31.228  1.00 44.65 ? 999  ASP B CG    1 
ATOM   2317 O  OD1   . ASP B 1 49  ? 28.573 65.586 30.384  1.00 44.94 ? 999  ASP B OD1   1 
ATOM   2318 O  OD2   . ASP B 1 49  ? 29.467 63.763 31.214  1.00 45.64 ? 999  ASP B OD2   1 
ATOM   2319 N  N     . SER B 1 50  ? 29.409 63.883 34.205  1.00 43.53 ? 1000 SER B N     1 
ATOM   2320 C  CA    . SER B 1 50  ? 28.872 62.865 35.107  1.00 43.49 ? 1000 SER B CA    1 
ATOM   2321 C  C     . SER B 1 50  ? 28.011 61.809 34.412  1.00 43.52 ? 1000 SER B C     1 
ATOM   2322 O  O     . SER B 1 50  ? 27.630 60.809 35.032  1.00 43.51 ? 1000 SER B O     1 
ATOM   2323 C  CB    . SER B 1 50  ? 28.045 63.552 36.196  1.00 43.54 ? 1000 SER B CB    1 
ATOM   2324 O  OG    . SER B 1 50  ? 27.072 64.409 35.619  1.00 43.33 ? 1000 SER B OG    1 
ATOM   2325 N  N     . GLU B 1 51  ? 27.713 62.041 33.133  1.00 43.24 ? 1001 GLU B N     1 
ATOM   2326 C  CA    . GLU B 1 51  ? 26.798 61.200 32.353  1.00 43.07 ? 1001 GLU B CA    1 
ATOM   2327 C  C     . GLU B 1 51  ? 27.205 59.727 32.298  1.00 42.23 ? 1001 GLU B C     1 
ATOM   2328 O  O     . GLU B 1 51  ? 28.367 59.408 32.019  1.00 42.22 ? 1001 GLU B O     1 
ATOM   2329 C  CB    . GLU B 1 51  ? 26.651 61.747 30.928  1.00 43.37 ? 1001 GLU B CB    1 
ATOM   2330 C  CG    . GLU B 1 51  ? 25.736 62.955 30.809  1.00 45.36 ? 1001 GLU B CG    1 
ATOM   2331 C  CD    . GLU B 1 51  ? 24.266 62.584 30.833  1.00 47.74 ? 1001 GLU B CD    1 
ATOM   2332 O  OE1   . GLU B 1 51  ? 23.816 61.847 29.923  1.00 48.35 ? 1001 GLU B OE1   1 
ATOM   2333 O  OE2   . GLU B 1 51  ? 23.557 63.044 31.755  1.00 48.52 ? 1001 GLU B OE2   1 
ATOM   2334 N  N     . PRO B 1 52  ? 26.242 58.823 32.569  1.00 41.40 ? 1002 PRO B N     1 
ATOM   2335 C  CA    . PRO B 1 52  ? 26.492 57.392 32.424  1.00 40.73 ? 1002 PRO B CA    1 
ATOM   2336 C  C     . PRO B 1 52  ? 26.366 56.981 30.957  1.00 39.95 ? 1002 PRO B C     1 
ATOM   2337 O  O     . PRO B 1 52  ? 25.910 57.778 30.128  1.00 39.69 ? 1002 PRO B O     1 
ATOM   2338 C  CB    . PRO B 1 52  ? 25.371 56.758 33.250  1.00 40.64 ? 1002 PRO B CB    1 
ATOM   2339 C  CG    . PRO B 1 52  ? 24.244 57.727 33.151  1.00 41.13 ? 1002 PRO B CG    1 
ATOM   2340 C  CD    . PRO B 1 52  ? 24.864 59.101 33.021  1.00 41.41 ? 1002 PRO B CD    1 
ATOM   2341 N  N     . CYS B 1 53  ? 26.766 55.749 30.656  1.00 39.19 ? 1003 CYS B N     1 
ATOM   2342 C  CA    . CYS B 1 53  ? 26.660 55.194 29.306  1.00 38.32 ? 1003 CYS B CA    1 
ATOM   2343 C  C     . CYS B 1 53  ? 25.237 55.321 28.750  1.00 37.51 ? 1003 CYS B C     1 
ATOM   2344 O  O     . CYS B 1 53  ? 24.272 54.955 29.436  1.00 37.39 ? 1003 CYS B O     1 
ATOM   2345 C  CB    . CYS B 1 53  ? 27.093 53.730 29.312  1.00 38.35 ? 1003 CYS B CB    1 
ATOM   2346 S  SG    . CYS B 1 53  ? 27.261 53.016 27.663  1.00 39.43 ? 1003 CYS B SG    1 
ATOM   2347 N  N     . PRO B 1 54  ? 25.095 55.853 27.513  1.00 36.73 ? 1004 PRO B N     1 
ATOM   2348 C  CA    . PRO B 1 54  ? 23.765 56.013 26.916  1.00 36.26 ? 1004 PRO B CA    1 
ATOM   2349 C  C     . PRO B 1 54  ? 23.029 54.681 26.899  1.00 35.78 ? 1004 PRO B C     1 
ATOM   2350 O  O     . PRO B 1 54  ? 23.632 53.651 26.586  1.00 35.92 ? 1004 PRO B O     1 
ATOM   2351 C  CB    . PRO B 1 54  ? 24.070 56.473 25.486  1.00 36.37 ? 1004 PRO B CB    1 
ATOM   2352 C  CG    . PRO B 1 54  ? 25.398 57.100 25.571  1.00 36.44 ? 1004 PRO B CG    1 
ATOM   2353 C  CD    . PRO B 1 54  ? 26.157 56.332 26.609  1.00 36.54 ? 1004 PRO B CD    1 
ATOM   2354 N  N     . SER B 1 55  ? 21.750 54.700 27.258  1.00 35.06 ? 1005 SER B N     1 
ATOM   2355 C  CA    . SER B 1 55  ? 20.978 53.469 27.404  1.00 34.51 ? 1005 SER B CA    1 
ATOM   2356 C  C     . SER B 1 55  ? 19.532 53.608 26.938  1.00 33.60 ? 1005 SER B C     1 
ATOM   2357 O  O     . SER B 1 55  ? 18.710 52.736 27.205  1.00 33.78 ? 1005 SER B O     1 
ATOM   2358 C  CB    . SER B 1 55  ? 21.021 52.990 28.863  1.00 34.72 ? 1005 SER B CB    1 
ATOM   2359 O  OG    . SER B 1 55  ? 20.304 53.877 29.711  1.00 36.21 ? 1005 SER B OG    1 
ATOM   2360 N  N     . ASN B 1 56  ? 19.221 54.700 26.245  1.00 32.70 ? 1006 ASN B N     1 
ATOM   2361 C  CA    . ASN B 1 56  ? 17.859 54.960 25.771  1.00 31.99 ? 1006 ASN B CA    1 
ATOM   2362 C  C     . ASN B 1 56  ? 17.584 54.413 24.356  1.00 30.70 ? 1006 ASN B C     1 
ATOM   2363 O  O     . ASN B 1 56  ? 16.627 54.815 23.689  1.00 31.19 ? 1006 ASN B O     1 
ATOM   2364 C  CB    . ASN B 1 56  ? 17.546 56.456 25.843  1.00 32.66 ? 1006 ASN B CB    1 
ATOM   2365 C  CG    . ASN B 1 56  ? 18.452 57.281 24.958  1.00 34.70 ? 1006 ASN B CG    1 
ATOM   2366 O  OD1   . ASN B 1 56  ? 19.616 56.930 24.735  1.00 36.78 ? 1006 ASN B OD1   1 
ATOM   2367 N  ND2   . ASN B 1 56  ? 17.923 58.385 24.441  1.00 36.53 ? 1006 ASN B ND2   1 
ATOM   2368 N  N     . TYR B 1 57  ? 18.437 53.493 23.921  1.00 28.64 ? 1007 TYR B N     1 
ATOM   2369 C  CA    . TYR B 1 57  ? 18.290 52.815 22.633  1.00 26.85 ? 1007 TYR B CA    1 
ATOM   2370 C  C     . TYR B 1 57  ? 18.683 51.362 22.847  1.00 25.96 ? 1007 TYR B C     1 
ATOM   2371 O  O     . TYR B 1 57  ? 19.250 51.021 23.884  1.00 26.09 ? 1007 TYR B O     1 
ATOM   2372 C  CB    . TYR B 1 57  ? 19.208 53.457 21.584  1.00 26.68 ? 1007 TYR B CB    1 
ATOM   2373 C  CG    . TYR B 1 57  ? 20.662 53.087 21.770  1.00 26.25 ? 1007 TYR B CG    1 
ATOM   2374 C  CD1   . TYR B 1 57  ? 21.302 52.236 20.872  1.00 24.64 ? 1007 TYR B CD1   1 
ATOM   2375 C  CD2   . TYR B 1 57  ? 21.396 53.570 22.857  1.00 25.55 ? 1007 TYR B CD2   1 
ATOM   2376 C  CE1   . TYR B 1 57  ? 22.631 51.880 21.043  1.00 25.23 ? 1007 TYR B CE1   1 
ATOM   2377 C  CE2   . TYR B 1 57  ? 22.728 53.219 23.036  1.00 25.38 ? 1007 TYR B CE2   1 
ATOM   2378 C  CZ    . TYR B 1 57  ? 23.338 52.371 22.126  1.00 25.51 ? 1007 TYR B CZ    1 
ATOM   2379 O  OH    . TYR B 1 57  ? 24.651 52.015 22.298  1.00 25.76 ? 1007 TYR B OH    1 
ATOM   2380 N  N     . LYS B 1 58  ? 18.407 50.512 21.862  1.00 24.20 ? 1008 LYS B N     1 
ATOM   2381 C  CA    . LYS B 1 58  ? 18.864 49.127 21.890  1.00 22.93 ? 1008 LYS B CA    1 
ATOM   2382 C  C     . LYS B 1 58  ? 20.006 48.956 20.890  1.00 21.76 ? 1008 LYS B C     1 
ATOM   2383 O  O     . LYS B 1 58  ? 19.818 49.221 19.704  1.00 21.76 ? 1008 LYS B O     1 
ATOM   2384 C  CB    . LYS B 1 58  ? 17.716 48.182 21.523  1.00 23.74 ? 1008 LYS B CB    1 
ATOM   2385 C  CG    . LYS B 1 58  ? 18.083 46.689 21.531  1.00 22.96 ? 1008 LYS B CG    1 
ATOM   2386 C  CD    . LYS B 1 58  ? 18.487 46.202 22.936  1.00 26.33 ? 1008 LYS B CD    1 
ATOM   2387 C  CE    . LYS B 1 58  ? 18.697 44.690 22.978  1.00 27.19 ? 1008 LYS B CE    1 
ATOM   2388 N  NZ    . LYS B 1 58  ? 19.518 44.280 24.132  1.00 29.56 ? 1008 LYS B NZ    1 
ATOM   2389 N  N     . TYR B 1 59  ? 21.172 48.514 21.358  1.00 20.38 ? 1009 TYR B N     1 
ATOM   2390 C  CA    . TYR B 1 59  ? 22.292 48.279 20.443  1.00 19.88 ? 1009 TYR B CA    1 
ATOM   2391 C  C     . TYR B 1 59  ? 21.970 47.056 19.604  1.00 19.39 ? 1009 TYR B C     1 
ATOM   2392 O  O     . TYR B 1 59  ? 21.700 45.987 20.154  1.00 19.01 ? 1009 TYR B O     1 
ATOM   2393 C  CB    . TYR B 1 59  ? 23.622 48.082 21.174  1.00 19.98 ? 1009 TYR B CB    1 
ATOM   2394 C  CG    . TYR B 1 59  ? 24.819 48.139 20.235  1.00 19.63 ? 1009 TYR B CG    1 
ATOM   2395 C  CD1   . TYR B 1 59  ? 25.641 49.272 20.194  1.00 20.28 ? 1009 TYR B CD1   1 
ATOM   2396 C  CD2   . TYR B 1 59  ? 25.126 47.063 19.392  1.00 20.47 ? 1009 TYR B CD2   1 
ATOM   2397 C  CE1   . TYR B 1 59  ? 26.732 49.335 19.336  1.00 20.34 ? 1009 TYR B CE1   1 
ATOM   2398 C  CE2   . TYR B 1 59  ? 26.213 47.122 18.516  1.00 20.28 ? 1009 TYR B CE2   1 
ATOM   2399 C  CZ    . TYR B 1 59  ? 27.018 48.260 18.500  1.00 20.82 ? 1009 TYR B CZ    1 
ATOM   2400 O  OH    . TYR B 1 59  ? 28.105 48.355 17.641  1.00 20.69 ? 1009 TYR B OH    1 
ATOM   2401 N  N     . VAL B 1 60  ? 21.980 47.226 18.278  1.00 18.83 ? 1010 VAL B N     1 
ATOM   2402 C  CA    . VAL B 1 60  ? 21.933 46.087 17.345  1.00 18.42 ? 1010 VAL B CA    1 
ATOM   2403 C  C     . VAL B 1 60  ? 23.091 46.181 16.353  1.00 18.26 ? 1010 VAL B C     1 
ATOM   2404 O  O     . VAL B 1 60  ? 23.420 47.274 15.898  1.00 18.06 ? 1010 VAL B O     1 
ATOM   2405 C  CB    . VAL B 1 60  ? 20.600 46.003 16.564  1.00 18.21 ? 1010 VAL B CB    1 
ATOM   2406 C  CG1   . VAL B 1 60  ? 19.430 45.667 17.529  1.00 17.81 ? 1010 VAL B CG1   1 
ATOM   2407 C  CG2   . VAL B 1 60  ? 20.339 47.286 15.762  1.00 18.53 ? 1010 VAL B CG2   1 
ATOM   2408 N  N     . SER B 1 61  ? 23.687 45.043 16.015  1.00 18.01 ? 1011 SER B N     1 
ATOM   2409 C  CA    . SER B 1 61  ? 24.883 45.057 15.160  1.00 18.44 ? 1011 SER B CA    1 
ATOM   2410 C  C     . SER B 1 61  ? 24.539 44.992 13.674  1.00 18.92 ? 1011 SER B C     1 
ATOM   2411 O  O     . SER B 1 61  ? 25.404 45.239 12.830  1.00 18.48 ? 1011 SER B O     1 
ATOM   2412 C  CB    . SER B 1 61  ? 25.835 43.918 15.541  1.00 18.48 ? 1011 SER B CB    1 
ATOM   2413 O  OG    . SER B 1 61  ? 25.138 42.693 15.523  1.00 19.74 ? 1011 SER B OG    1 
ATOM   2414 N  N     . GLN B 1 62  ? 23.287 44.642 13.370  1.00 18.76 ? 1012 GLN B N     1 
ATOM   2415 C  CA    . GLN B 1 62  ? 22.789 44.590 11.987  1.00 19.70 ? 1012 GLN B CA    1 
ATOM   2416 C  C     . GLN B 1 62  ? 21.416 45.247 11.905  1.00 18.13 ? 1012 GLN B C     1 
ATOM   2417 O  O     . GLN B 1 62  ? 20.700 45.352 12.913  1.00 17.18 ? 1012 GLN B O     1 
ATOM   2418 C  CB    . GLN B 1 62  ? 22.704 43.131 11.499  1.00 20.09 ? 1012 GLN B CB    1 
ATOM   2419 C  CG    . GLN B 1 62  ? 24.051 42.393 11.412  1.00 23.20 ? 1012 GLN B CG    1 
ATOM   2420 C  CD    . GLN B 1 62  ? 23.907 40.867 11.376  1.00 24.51 ? 1012 GLN B CD    1 
ATOM   2421 O  OE1   . GLN B 1 62  ? 22.808 40.324 11.505  1.00 30.20 ? 1012 GLN B OE1   1 
ATOM   2422 N  NE2   . GLN B 1 62  ? 25.034 40.172 11.209  1.00 29.55 ? 1012 GLN B NE2   1 
ATOM   2423 N  N     . ASN B 1 63  ? 21.048 45.700 10.707  1.00 17.00 ? 1013 ASN B N     1 
ATOM   2424 C  CA    . ASN B 1 63  ? 19.768 46.367 10.506  1.00 16.78 ? 1013 ASN B CA    1 
ATOM   2425 C  C     . ASN B 1 63  ? 18.590 45.492 10.911  1.00 16.87 ? 1013 ASN B C     1 
ATOM   2426 O  O     . ASN B 1 63  ? 18.638 44.257 10.797  1.00 16.83 ? 1013 ASN B O     1 
ATOM   2427 C  CB    . ASN B 1 63  ? 19.611 46.775 9.043   1.00 16.68 ? 1013 ASN B CB    1 
ATOM   2428 C  CG    . ASN B 1 63  ? 20.554 47.905 8.648   1.00 17.73 ? 1013 ASN B CG    1 
ATOM   2429 O  OD1   . ASN B 1 63  ? 20.905 48.759 9.470   1.00 18.03 ? 1013 ASN B OD1   1 
ATOM   2430 N  ND2   . ASN B 1 63  ? 20.959 47.920 7.377   1.00 17.03 ? 1013 ASN B ND2   1 
ATOM   2431 N  N     . CYS B 1 64  ? 17.530 46.133 11.382  1.00 16.69 ? 1014 CYS B N     1 
ATOM   2432 C  CA    . CYS B 1 64  ? 16.315 45.402 11.747  1.00 17.35 ? 1014 CYS B CA    1 
ATOM   2433 C  C     . CYS B 1 64  ? 15.104 46.108 11.157  1.00 17.12 ? 1014 CYS B C     1 
ATOM   2434 O  O     . CYS B 1 64  ? 15.235 47.159 10.522  1.00 17.39 ? 1014 CYS B O     1 
ATOM   2435 C  CB    . CYS B 1 64  ? 16.201 45.296 13.269  1.00 17.77 ? 1014 CYS B CB    1 
ATOM   2436 S  SG    . CYS B 1 64  ? 16.024 46.905 14.102  1.00 19.95 ? 1014 CYS B SG    1 
ATOM   2437 N  N     . VAL B 1 65  ? 13.927 45.518 11.343  1.00 17.20 ? 1015 VAL B N     1 
ATOM   2438 C  CA    . VAL B 1 65  ? 12.675 46.167 10.962  1.00 18.05 ? 1015 VAL B CA    1 
ATOM   2439 C  C     . VAL B 1 65  ? 11.674 46.043 12.092  1.00 18.14 ? 1015 VAL B C     1 
ATOM   2440 O  O     . VAL B 1 65  ? 11.779 45.144 12.931  1.00 18.21 ? 1015 VAL B O     1 
ATOM   2441 C  CB    . VAL B 1 65  ? 12.030 45.542 9.686   1.00 18.09 ? 1015 VAL B CB    1 
ATOM   2442 C  CG1   . VAL B 1 65  ? 12.923 45.728 8.463   1.00 18.01 ? 1015 VAL B CG1   1 
ATOM   2443 C  CG2   . VAL B 1 65  ? 11.720 44.080 9.904   1.00 18.42 ? 1015 VAL B CG2   1 
ATOM   2444 N  N     . THR B 1 66  ? 10.707 46.957 12.109  1.00 18.97 ? 1016 THR B N     1 
ATOM   2445 C  CA    . THR B 1 66  ? 9.492  46.733 12.877  1.00 20.15 ? 1016 THR B CA    1 
ATOM   2446 C  C     . THR B 1 66  ? 8.455  46.325 11.833  1.00 20.80 ? 1016 THR B C     1 
ATOM   2447 O  O     . THR B 1 66  ? 8.295  45.137 11.583  1.00 20.90 ? 1016 THR B O     1 
ATOM   2448 C  CB    . THR B 1 66  ? 9.092  47.951 13.740  1.00 20.49 ? 1016 THR B CB    1 
ATOM   2449 O  OG1   . THR B 1 66  ? 9.062  49.130 12.926  1.00 20.82 ? 1016 THR B OG1   1 
ATOM   2450 C  CG2   . THR B 1 66  ? 10.085 48.136 14.892  1.00 20.22 ? 1016 THR B CG2   1 
ATOM   2451 N  N     . SER B 1 67  ? 7.803  47.293 11.185  1.00 21.52 ? 1017 SER B N     1 
ATOM   2452 C  CA    . SER B 1 67  ? 6.910  47.010 10.043  1.00 22.65 ? 1017 SER B CA    1 
ATOM   2453 C  C     . SER B 1 67  ? 7.672  46.348 8.893   1.00 22.45 ? 1017 SER B C     1 
ATOM   2454 O  O     . SER B 1 67  ? 8.832  46.688 8.650   1.00 21.89 ? 1017 SER B O     1 
ATOM   2455 C  CB    . SER B 1 67  ? 6.273  48.299 9.518   1.00 22.79 ? 1017 SER B CB    1 
ATOM   2456 O  OG    . SER B 1 67  ? 5.452  48.891 10.502  1.00 28.04 ? 1017 SER B OG    1 
ATOM   2457 N  N     . PRO B 1 68  ? 7.020  45.413 8.169   1.00 22.52 ? 1018 PRO B N     1 
ATOM   2458 C  CA    . PRO B 1 68  ? 7.747  44.656 7.148   1.00 22.68 ? 1018 PRO B CA    1 
ATOM   2459 C  C     . PRO B 1 68  ? 8.294  45.501 6.009   1.00 23.02 ? 1018 PRO B C     1 
ATOM   2460 O  O     . PRO B 1 68  ? 7.626  46.424 5.530   1.00 22.21 ? 1018 PRO B O     1 
ATOM   2461 C  CB    . PRO B 1 68  ? 6.700  43.654 6.630   1.00 22.87 ? 1018 PRO B CB    1 
ATOM   2462 C  CG    . PRO B 1 68  ? 5.389  44.243 6.980   1.00 23.36 ? 1018 PRO B CG    1 
ATOM   2463 C  CD    . PRO B 1 68  ? 5.607  44.991 8.260   1.00 22.89 ? 1018 PRO B CD    1 
ATOM   2464 N  N     . MET B 1 69  ? 9.514  45.175 5.591   1.00 23.23 ? 1019 MET B N     1 
ATOM   2465 C  CA    . MET B 1 69  ? 10.119 45.754 4.407   1.00 24.26 ? 1019 MET B CA    1 
ATOM   2466 C  C     . MET B 1 69  ? 10.276 44.607 3.427   1.00 24.70 ? 1019 MET B C     1 
ATOM   2467 O  O     . MET B 1 69  ? 10.932 43.598 3.727   1.00 25.65 ? 1019 MET B O     1 
ATOM   2468 C  CB    . MET B 1 69  ? 11.480 46.381 4.730   1.00 24.76 ? 1019 MET B CB    1 
ATOM   2469 C  CG    . MET B 1 69  ? 11.395 47.538 5.716   1.00 25.73 ? 1019 MET B CG    1 
ATOM   2470 S  SD    . MET B 1 69  ? 10.717 49.035 4.972   1.00 28.89 ? 1019 MET B SD    1 
ATOM   2471 C  CE    . MET B 1 69  ? 9.473  49.416 6.189   1.00 26.63 ? 1019 MET B CE    1 
ATOM   2472 N  N     . ASN B 1 70  ? 9.666  44.750 2.264   1.00 24.38 ? 1020 ASN B N     1 
ATOM   2473 C  CA    . ASN B 1 70  ? 9.628  43.653 1.312   1.00 24.07 ? 1020 ASN B CA    1 
ATOM   2474 C  C     . ASN B 1 70  ? 10.905 43.574 0.476   1.00 22.42 ? 1020 ASN B C     1 
ATOM   2475 O  O     . ASN B 1 70  ? 10.855 43.624 -0.749  1.00 22.40 ? 1020 ASN B O     1 
ATOM   2476 C  CB    . ASN B 1 70  ? 8.355  43.717 0.445   1.00 24.84 ? 1020 ASN B CB    1 
ATOM   2477 C  CG    . ASN B 1 70  ? 8.310  44.935 -0.494  1.00 27.98 ? 1020 ASN B CG    1 
ATOM   2478 O  OD1   . ASN B 1 70  ? 9.095  45.886 -0.379  1.00 31.35 ? 1020 ASN B OD1   1 
ATOM   2479 N  ND2   . ASN B 1 70  ? 7.364  44.903 -1.431  1.00 32.55 ? 1020 ASN B ND2   1 
ATOM   2480 N  N     . ILE B 1 71  ? 12.049 43.455 1.153   1.00 20.41 ? 1021 ILE B N     1 
ATOM   2481 C  CA    . ILE B 1 71  ? 13.337 43.349 0.457   1.00 19.44 ? 1021 ILE B CA    1 
ATOM   2482 C  C     . ILE B 1 71  ? 13.329 42.095 -0.417  1.00 18.63 ? 1021 ILE B C     1 
ATOM   2483 O  O     . ILE B 1 71  ? 12.910 41.027 0.030   1.00 18.79 ? 1021 ILE B O     1 
ATOM   2484 C  CB    . ILE B 1 71  ? 14.513 43.291 1.455   1.00 19.35 ? 1021 ILE B CB    1 
ATOM   2485 C  CG1   . ILE B 1 71  ? 14.477 44.530 2.366   1.00 18.74 ? 1021 ILE B CG1   1 
ATOM   2486 C  CG2   . ILE B 1 71  ? 15.851 43.184 0.719   1.00 18.74 ? 1021 ILE B CG2   1 
ATOM   2487 C  CD1   . ILE B 1 71  ? 15.511 44.507 3.512   1.00 20.08 ? 1021 ILE B CD1   1 
ATOM   2488 N  N     . ASP B 1 72  ? 13.768 42.244 -1.666  1.00 18.28 ? 1022 ASP B N     1 
ATOM   2489 C  CA    . ASP B 1 72  ? 13.840 41.115 -2.593  1.00 17.77 ? 1022 ASP B CA    1 
ATOM   2490 C  C     . ASP B 1 72  ? 15.032 40.246 -2.211  1.00 17.49 ? 1022 ASP B C     1 
ATOM   2491 O  O     . ASP B 1 72  ? 16.183 40.653 -2.418  1.00 18.02 ? 1022 ASP B O     1 
ATOM   2492 C  CB    . ASP B 1 72  ? 13.994 41.617 -4.034  1.00 18.17 ? 1022 ASP B CB    1 
ATOM   2493 C  CG    . ASP B 1 72  ? 14.041 40.484 -5.064  1.00 19.58 ? 1022 ASP B CG    1 
ATOM   2494 O  OD1   . ASP B 1 72  ? 13.791 39.302 -4.718  1.00 19.13 ? 1022 ASP B OD1   1 
ATOM   2495 O  OD2   . ASP B 1 72  ? 14.351 40.800 -6.238  1.00 21.14 ? 1022 ASP B OD2   1 
ATOM   2496 N  N     . ARG B 1 73  ? 14.742 39.084 -1.631  1.00 17.11 ? 1023 ARG B N     1 
ATOM   2497 C  CA    . ARG B 1 73  ? 15.782 38.127 -1.242  1.00 16.89 ? 1023 ARG B CA    1 
ATOM   2498 C  C     . ARG B 1 73  ? 15.754 36.842 -2.070  1.00 16.47 ? 1023 ARG B C     1 
ATOM   2499 O  O     . ARG B 1 73  ? 16.297 35.817 -1.658  1.00 16.60 ? 1023 ARG B O     1 
ATOM   2500 C  CB    . ARG B 1 73  ? 15.709 37.815 0.259   1.00 17.36 ? 1023 ARG B CB    1 
ATOM   2501 C  CG    . ARG B 1 73  ? 15.995 39.040 1.116   1.00 19.22 ? 1023 ARG B CG    1 
ATOM   2502 C  CD    . ARG B 1 73  ? 16.176 38.661 2.570   1.00 22.93 ? 1023 ARG B CD    1 
ATOM   2503 N  NE    . ARG B 1 73  ? 16.406 39.842 3.403   1.00 23.29 ? 1023 ARG B NE    1 
ATOM   2504 C  CZ    . ARG B 1 73  ? 17.596 40.405 3.601   1.00 23.80 ? 1023 ARG B CZ    1 
ATOM   2505 N  NH1   . ARG B 1 73  ? 18.694 39.897 3.028   1.00 24.17 ? 1023 ARG B NH1   1 
ATOM   2506 N  NH2   . ARG B 1 73  ? 17.698 41.477 4.382   1.00 24.37 ? 1023 ARG B NH2   1 
ATOM   2507 N  N     . ASN B 1 74  ? 15.123 36.892 -3.245  1.00 15.75 ? 1024 ASN B N     1 
ATOM   2508 C  CA    . ASN B 1 74  ? 15.089 35.717 -4.110  1.00 15.67 ? 1024 ASN B CA    1 
ATOM   2509 C  C     . ASN B 1 74  ? 16.507 35.430 -4.578  1.00 15.25 ? 1024 ASN B C     1 
ATOM   2510 O  O     . ASN B 1 74  ? 17.101 36.253 -5.276  1.00 15.12 ? 1024 ASN B O     1 
ATOM   2511 C  CB    . ASN B 1 74  ? 14.174 35.968 -5.312  1.00 16.02 ? 1024 ASN B CB    1 
ATOM   2512 C  CG    . ASN B 1 74  ? 13.993 34.729 -6.191  1.00 16.37 ? 1024 ASN B CG    1 
ATOM   2513 O  OD1   . ASN B 1 74  ? 14.895 33.915 -6.342  1.00 16.28 ? 1024 ASN B OD1   1 
ATOM   2514 N  ND2   . ASN B 1 74  ? 12.807 34.611 -6.809  1.00 18.43 ? 1024 ASN B ND2   1 
ATOM   2515 N  N     . ILE B 1 75  ? 17.045 34.270 -4.197  1.00 15.00 ? 1025 ILE B N     1 
ATOM   2516 C  CA    . ILE B 1 75  ? 18.449 33.964 -4.504  1.00 16.07 ? 1025 ILE B CA    1 
ATOM   2517 C  C     . ILE B 1 75  ? 18.727 33.945 -6.020  1.00 16.63 ? 1025 ILE B C     1 
ATOM   2518 O  O     . ILE B 1 75  ? 19.832 34.282 -6.461  1.00 17.09 ? 1025 ILE B O     1 
ATOM   2519 C  CB    . ILE B 1 75  ? 18.930 32.668 -3.797  1.00 15.78 ? 1025 ILE B CB    1 
ATOM   2520 C  CG1   . ILE B 1 75  ? 20.437 32.476 -3.962  1.00 16.81 ? 1025 ILE B CG1   1 
ATOM   2521 C  CG2   . ILE B 1 75  ? 18.178 31.446 -4.311  1.00 15.55 ? 1025 ILE B CG2   1 
ATOM   2522 C  CD1   . ILE B 1 75  ? 21.036 31.487 -2.993  1.00 16.64 ? 1025 ILE B CD1   1 
ATOM   2523 N  N     . THR B 1 76  ? 17.711 33.603 -6.815  1.00 16.71 ? 1026 THR B N     1 
ATOM   2524 C  CA    . THR B 1 76  ? 17.900 33.559 -8.269  1.00 17.62 ? 1026 THR B CA    1 
ATOM   2525 C  C     . THR B 1 76  ? 17.934 34.956 -8.907  1.00 17.34 ? 1026 THR B C     1 
ATOM   2526 O  O     . THR B 1 76  ? 18.241 35.083 -10.092 1.00 18.23 ? 1026 THR B O     1 
ATOM   2527 C  CB    . THR B 1 76  ? 16.834 32.688 -8.970  1.00 18.32 ? 1026 THR B CB    1 
ATOM   2528 O  OG1   . THR B 1 76  ? 15.558 33.321 -8.866  1.00 19.49 ? 1026 THR B OG1   1 
ATOM   2529 C  CG2   . THR B 1 76  ? 16.795 31.300 -8.345  1.00 18.77 ? 1026 THR B CG2   1 
ATOM   2530 N  N     . HIS B 1 77  ? 17.613 35.986 -8.133  1.00 16.63 ? 1027 HIS B N     1 
ATOM   2531 C  CA    . HIS B 1 77  ? 17.669 37.368 -8.613  1.00 16.90 ? 1027 HIS B CA    1 
ATOM   2532 C  C     . HIS B 1 77  ? 19.051 37.997 -8.454  1.00 17.27 ? 1027 HIS B C     1 
ATOM   2533 O  O     . HIS B 1 77  ? 19.285 39.107 -8.955  1.00 18.29 ? 1027 HIS B O     1 
ATOM   2534 C  CB    . HIS B 1 77  ? 16.621 38.243 -7.909  1.00 17.01 ? 1027 HIS B CB    1 
ATOM   2535 C  CG    . HIS B 1 77  ? 15.207 37.965 -8.339  1.00 17.61 ? 1027 HIS B CG    1 
ATOM   2536 N  ND1   . HIS B 1 77  ? 14.133 38.702 -7.887  1.00 18.84 ? 1027 HIS B ND1   1 
ATOM   2537 C  CD2   . HIS B 1 77  ? 14.695 37.041 -9.188  1.00 20.49 ? 1027 HIS B CD2   1 
ATOM   2538 C  CE1   . HIS B 1 77  ? 13.019 38.235 -8.426  1.00 20.06 ? 1027 HIS B CE1   1 
ATOM   2539 N  NE2   . HIS B 1 77  ? 13.332 37.229 -9.220  1.00 20.16 ? 1027 HIS B NE2   1 
ATOM   2540 N  N     . LEU B 1 78  ? 19.956 37.306 -7.758  1.00 16.86 ? 1028 LEU B N     1 
ATOM   2541 C  CA    . LEU B 1 78  ? 21.318 37.812 -7.570  1.00 17.17 ? 1028 LEU B CA    1 
ATOM   2542 C  C     . LEU B 1 78  ? 22.146 37.687 -8.821  1.00 17.54 ? 1028 LEU B C     1 
ATOM   2543 O  O     . LEU B 1 78  ? 22.153 36.633 -9.463  1.00 18.52 ? 1028 LEU B O     1 
ATOM   2544 C  CB    . LEU B 1 78  ? 22.046 37.050 -6.461  1.00 16.99 ? 1028 LEU B CB    1 
ATOM   2545 C  CG    . LEU B 1 78  ? 21.623 37.348 -5.031  1.00 16.96 ? 1028 LEU B CG    1 
ATOM   2546 C  CD1   . LEU B 1 78  ? 22.307 36.388 -4.043  1.00 16.67 ? 1028 LEU B CD1   1 
ATOM   2547 C  CD2   . LEU B 1 78  ? 21.927 38.813 -4.687  1.00 14.92 ? 1028 LEU B CD2   1 
ATOM   2548 N  N     . GLN B 1 79  ? 22.844 38.765 -9.150  1.00 17.55 ? 1029 GLN B N     1 
ATOM   2549 C  CA    . GLN B 1 79  ? 23.965 38.682 -10.076 1.00 18.13 ? 1029 GLN B CA    1 
ATOM   2550 C  C     . GLN B 1 79  ? 25.166 38.207 -9.274  1.00 17.86 ? 1029 GLN B C     1 
ATOM   2551 O  O     . GLN B 1 79  ? 25.309 38.525 -8.079  1.00 17.74 ? 1029 GLN B O     1 
ATOM   2552 C  CB    . GLN B 1 79  ? 24.266 40.039 -10.717 1.00 18.69 ? 1029 GLN B CB    1 
ATOM   2553 C  CG    . GLN B 1 79  ? 23.118 40.620 -11.503 1.00 22.88 ? 1029 GLN B CG    1 
ATOM   2554 C  CD    . GLN B 1 79  ? 22.742 39.806 -12.738 1.00 28.84 ? 1029 GLN B CD    1 
ATOM   2555 O  OE1   . GLN B 1 79  ? 23.593 39.179 -13.382 1.00 33.11 ? 1029 GLN B OE1   1 
ATOM   2556 N  NE2   . GLN B 1 79  ? 21.459 39.822 -13.076 1.00 31.67 ? 1029 GLN B NE2   1 
ATOM   2557 N  N     . TYR B 1 80  ? 26.005 37.407 -9.911  1.00 17.63 ? 1030 TYR B N     1 
ATOM   2558 C  CA    . TYR B 1 80  ? 27.101 36.763 -9.203  1.00 18.04 ? 1030 TYR B CA    1 
ATOM   2559 C  C     . TYR B 1 80  ? 28.226 36.514 -10.184 1.00 17.95 ? 1030 TYR B C     1 
ATOM   2560 O  O     . TYR B 1 80  ? 28.024 36.641 -11.401 1.00 18.76 ? 1030 TYR B O     1 
ATOM   2561 C  CB    . TYR B 1 80  ? 26.638 35.464 -8.533  1.00 19.32 ? 1030 TYR B CB    1 
ATOM   2562 C  CG    . TYR B 1 80  ? 26.120 34.422 -9.492  1.00 19.65 ? 1030 TYR B CG    1 
ATOM   2563 C  CD1   . TYR B 1 80  ? 26.972 33.453 -10.026 1.00 20.37 ? 1030 TYR B CD1   1 
ATOM   2564 C  CD2   . TYR B 1 80  ? 24.774 34.411 -9.872  1.00 20.34 ? 1030 TYR B CD2   1 
ATOM   2565 C  CE1   . TYR B 1 80  ? 26.492 32.500 -10.932 1.00 23.04 ? 1030 TYR B CE1   1 
ATOM   2566 C  CE2   . TYR B 1 80  ? 24.289 33.462 -10.763 1.00 22.56 ? 1030 TYR B CE2   1 
ATOM   2567 C  CZ    . TYR B 1 80  ? 25.147 32.516 -11.289 1.00 22.76 ? 1030 TYR B CZ    1 
ATOM   2568 O  OH    . TYR B 1 80  ? 24.647 31.579 -12.173 1.00 24.46 ? 1030 TYR B OH    1 
ATOM   2569 N  N     . CYS B 1 81  ? 29.397 36.173 -9.656  1.00 18.04 ? 1031 CYS B N     1 
ATOM   2570 C  CA    . CYS B 1 81  ? 30.562 35.890 -10.483 1.00 17.71 ? 1031 CYS B CA    1 
ATOM   2571 C  C     . CYS B 1 81  ? 30.918 34.419 -10.440 1.00 18.83 ? 1031 CYS B C     1 
ATOM   2572 O  O     . CYS B 1 81  ? 30.477 33.677 -9.552  1.00 18.08 ? 1031 CYS B O     1 
ATOM   2573 C  CB    . CYS B 1 81  ? 31.759 36.732 -10.035 1.00 17.49 ? 1031 CYS B CB    1 
ATOM   2574 S  SG    . CYS B 1 81  ? 32.450 36.213 -8.459  1.00 16.26 ? 1031 CYS B SG    1 
ATOM   2575 N  N     . VAL B 1 82  ? 31.692 34.003 -11.446 1.00 20.64 ? 1032 VAL B N     1 
ATOM   2576 C  CA    . VAL B 1 82  ? 32.108 32.614 -11.595 1.00 22.76 ? 1032 VAL B CA    1 
ATOM   2577 C  C     . VAL B 1 82  ? 33.638 32.508 -11.562 1.00 23.78 ? 1032 VAL B C     1 
ATOM   2578 O  O     . VAL B 1 82  ? 34.233 31.593 -12.141 1.00 24.26 ? 1032 VAL B O     1 
ATOM   2579 C  CB    . VAL B 1 82  ? 31.504 31.959 -12.879 1.00 23.06 ? 1032 VAL B CB    1 
ATOM   2580 C  CG1   . VAL B 1 82  ? 30.009 31.723 -12.695 1.00 24.09 ? 1032 VAL B CG1   1 
ATOM   2581 C  CG2   . VAL B 1 82  ? 31.770 32.816 -14.117 1.00 24.30 ? 1032 VAL B CG2   1 
ATOM   2582 N  N     . CYS B 1 83  ? 34.263 33.442 -10.853 1.00 24.28 ? 1033 CYS B N     1 
ATOM   2583 C  CA    . CYS B 1 83  ? 35.720 33.541 -10.808 1.00 24.93 ? 1033 CYS B CA    1 
ATOM   2584 C  C     . CYS B 1 83  ? 36.371 32.288 -10.254 1.00 27.33 ? 1033 CYS B C     1 
ATOM   2585 O  O     . CYS B 1 83  ? 35.863 31.686 -9.308  1.00 27.92 ? 1033 CYS B O     1 
ATOM   2586 C  CB    . CYS B 1 83  ? 36.143 34.757 -9.982  1.00 24.42 ? 1033 CYS B CB    1 
ATOM   2587 S  SG    . CYS B 1 83  ? 35.564 36.305 -10.657 1.00 19.20 ? 1033 CYS B SG    1 
ATOM   2588 N  N     . ILE B 1 84  ? 37.491 31.910 -10.871 1.00 29.03 ? 1034 ILE B N     1 
ATOM   2589 C  CA    . ILE B 1 84  ? 38.303 30.769 -10.438 1.00 30.73 ? 1034 ILE B CA    1 
ATOM   2590 C  C     . ILE B 1 84  ? 39.531 31.255 -9.666  1.00 31.18 ? 1034 ILE B C     1 
ATOM   2591 O  O     . ILE B 1 84  ? 40.402 30.465 -9.293  1.00 32.38 ? 1034 ILE B O     1 
ATOM   2592 C  CB    . ILE B 1 84  ? 38.732 29.874 -11.650 1.00 30.74 ? 1034 ILE B CB    1 
ATOM   2593 C  CG1   . ILE B 1 84  ? 39.557 30.688 -12.665 1.00 31.08 ? 1034 ILE B CG1   1 
ATOM   2594 C  CG2   . ILE B 1 84  ? 37.494 29.216 -12.300 1.00 31.42 ? 1034 ILE B CG2   1 
ATOM   2595 C  CD1   . ILE B 1 84  ? 40.302 29.850 -13.711 1.00 30.84 ? 1034 ILE B CD1   1 
ATOM   2596 N  N     . ASP B 1 85  ? 39.593 32.564 -9.437  1.00 31.59 ? 1035 ASP B N     1 
ATOM   2597 C  CA    . ASP B 1 85  ? 40.675 33.192 -8.686  1.00 31.45 ? 1035 ASP B CA    1 
ATOM   2598 C  C     . ASP B 1 85  ? 40.126 33.873 -7.416  1.00 30.52 ? 1035 ASP B C     1 
ATOM   2599 O  O     . ASP B 1 85  ? 39.071 33.484 -6.905  1.00 31.36 ? 1035 ASP B O     1 
ATOM   2600 C  CB    . ASP B 1 85  ? 41.446 34.175 -9.584  1.00 31.79 ? 1035 ASP B CB    1 
ATOM   2601 C  CG    . ASP B 1 85  ? 40.611 35.385 -10.004 1.00 33.62 ? 1035 ASP B CG    1 
ATOM   2602 O  OD1   . ASP B 1 85  ? 39.367 35.310 -9.972  1.00 34.41 ? 1035 ASP B OD1   1 
ATOM   2603 O  OD2   . ASP B 1 85  ? 41.208 36.423 -10.354 1.00 36.67 ? 1035 ASP B OD2   1 
ATOM   2604 N  N     . ASP B 1 86  ? 40.836 34.876 -6.910  1.00 29.51 ? 1036 ASP B N     1 
ATOM   2605 C  CA    . ASP B 1 86  ? 40.397 35.584 -5.706  1.00 27.95 ? 1036 ASP B CA    1 
ATOM   2606 C  C     . ASP B 1 86  ? 39.607 36.848 -6.051  1.00 25.67 ? 1036 ASP B C     1 
ATOM   2607 O  O     . ASP B 1 86  ? 39.568 37.789 -5.275  1.00 24.45 ? 1036 ASP B O     1 
ATOM   2608 C  CB    . ASP B 1 86  ? 41.584 35.890 -4.773  1.00 28.86 ? 1036 ASP B CB    1 
ATOM   2609 C  CG    . ASP B 1 86  ? 42.467 37.043 -5.271  1.00 31.22 ? 1036 ASP B CG    1 
ATOM   2610 O  OD1   . ASP B 1 86  ? 42.638 37.209 -6.508  1.00 34.46 ? 1036 ASP B OD1   1 
ATOM   2611 O  OD2   . ASP B 1 86  ? 42.998 37.784 -4.407  1.00 33.06 ? 1036 ASP B OD2   1 
ATOM   2612 N  N     . CYS B 1 87  ? 38.997 36.857 -7.237  1.00 24.31 ? 1037 CYS B N     1 
ATOM   2613 C  CA    . CYS B 1 87  ? 38.199 37.988 -7.702  1.00 22.66 ? 1037 CYS B CA    1 
ATOM   2614 C  C     . CYS B 1 87  ? 38.992 39.286 -7.851  1.00 23.77 ? 1037 CYS B C     1 
ATOM   2615 O  O     . CYS B 1 87  ? 38.544 40.357 -7.452  1.00 22.95 ? 1037 CYS B O     1 
ATOM   2616 C  CB    . CYS B 1 87  ? 36.965 38.180 -6.805  1.00 22.11 ? 1037 CYS B CB    1 
ATOM   2617 S  SG    . CYS B 1 87  ? 35.864 36.775 -6.904  1.00 17.70 ? 1037 CYS B SG    1 
ATOM   2618 N  N     . SER B 1 88  ? 40.184 39.175 -8.431  1.00 24.82 ? 1038 SER B N     1 
ATOM   2619 C  CA    . SER B 1 88  ? 41.019 40.351 -8.656  1.00 26.63 ? 1038 SER B CA    1 
ATOM   2620 C  C     . SER B 1 88  ? 41.178 40.695 -10.144 1.00 27.09 ? 1038 SER B C     1 
ATOM   2621 O  O     . SER B 1 88  ? 41.889 41.643 -10.493 1.00 28.08 ? 1038 SER B O     1 
ATOM   2622 C  CB    . SER B 1 88  ? 42.391 40.179 -7.972  1.00 26.84 ? 1038 SER B CB    1 
ATOM   2623 O  OG    . SER B 1 88  ? 43.003 38.995 -8.420  1.00 28.71 ? 1038 SER B OG    1 
ATOM   2624 N  N     . SER B 1 89  ? 40.513 39.945 -11.019 1.00 27.09 ? 1039 SER B N     1 
ATOM   2625 C  CA    . SER B 1 89  ? 40.549 40.255 -12.446 1.00 27.35 ? 1039 SER B CA    1 
ATOM   2626 C  C     . SER B 1 89  ? 39.345 41.103 -12.870 1.00 27.73 ? 1039 SER B C     1 
ATOM   2627 O  O     . SER B 1 89  ? 38.323 41.139 -12.183 1.00 27.39 ? 1039 SER B O     1 
ATOM   2628 C  CB    . SER B 1 89  ? 40.634 38.976 -13.280 1.00 27.73 ? 1039 SER B CB    1 
ATOM   2629 O  OG    . SER B 1 89  ? 39.350 38.453 -13.574 1.00 27.66 ? 1039 SER B OG    1 
ATOM   2630 N  N     . SER B 1 90  ? 39.470 41.771 -14.015 1.00 27.53 ? 1040 SER B N     1 
ATOM   2631 C  CA    . SER B 1 90  ? 38.398 42.588 -14.568 1.00 27.58 ? 1040 SER B CA    1 
ATOM   2632 C  C     . SER B 1 90  ? 37.215 41.741 -15.062 1.00 27.00 ? 1040 SER B C     1 
ATOM   2633 O  O     . SER B 1 90  ? 36.174 42.289 -15.424 1.00 27.85 ? 1040 SER B O     1 
ATOM   2634 C  CB    . SER B 1 90  ? 38.944 43.465 -15.705 1.00 27.81 ? 1040 SER B CB    1 
ATOM   2635 O  OG    . SER B 1 90  ? 39.387 42.655 -16.781 1.00 29.95 ? 1040 SER B OG    1 
ATOM   2636 N  N     . ASN B 1 91  ? 37.379 40.416 -15.073 1.00 26.19 ? 1041 ASN B N     1 
ATOM   2637 C  CA    . ASN B 1 91  ? 36.321 39.493 -15.487 1.00 25.33 ? 1041 ASN B CA    1 
ATOM   2638 C  C     . ASN B 1 91  ? 35.261 39.212 -14.414 1.00 23.66 ? 1041 ASN B C     1 
ATOM   2639 O  O     . ASN B 1 91  ? 34.191 38.681 -14.713 1.00 24.03 ? 1041 ASN B O     1 
ATOM   2640 C  CB    . ASN B 1 91  ? 36.919 38.169 -15.971 1.00 26.35 ? 1041 ASN B CB    1 
ATOM   2641 C  CG    . ASN B 1 91  ? 37.733 38.331 -17.247 1.00 28.91 ? 1041 ASN B CG    1 
ATOM   2642 O  OD1   . ASN B 1 91  ? 38.858 37.833 -17.343 1.00 33.50 ? 1041 ASN B OD1   1 
ATOM   2643 N  ND2   . ASN B 1 91  ? 37.174 39.039 -18.224 1.00 30.31 ? 1041 ASN B ND2   1 
ATOM   2644 N  N     . CYS B 1 92  ? 35.577 39.546 -13.170 1.00 21.45 ? 1042 CYS B N     1 
ATOM   2645 C  CA    . CYS B 1 92  ? 34.624 39.373 -12.070 1.00 20.08 ? 1042 CYS B CA    1 
ATOM   2646 C  C     . CYS B 1 92  ? 33.361 40.200 -12.269 1.00 18.91 ? 1042 CYS B C     1 
ATOM   2647 O  O     . CYS B 1 92  ? 33.422 41.435 -12.285 1.00 18.91 ? 1042 CYS B O     1 
ATOM   2648 C  CB    . CYS B 1 92  ? 35.292 39.756 -10.749 1.00 19.85 ? 1042 CYS B CB    1 
ATOM   2649 S  SG    . CYS B 1 92  ? 34.242 39.526 -9.300  1.00 18.91 ? 1042 CYS B SG    1 
ATOM   2650 N  N     . MET B 1 93  ? 32.212 39.519 -12.354 1.00 18.00 ? 1043 MET B N     1 
ATOM   2651 C  CA    . MET B 1 93  ? 30.936 40.201 -12.569 1.00 18.01 ? 1043 MET B CA    1 
ATOM   2652 C  C     . MET B 1 93  ? 30.645 41.192 -11.460 1.00 16.88 ? 1043 MET B C     1 
ATOM   2653 O  O     . MET B 1 93  ? 30.099 42.273 -11.695 1.00 16.98 ? 1043 MET B O     1 
ATOM   2654 C  CB    . MET B 1 93  ? 29.779 39.197 -12.654 1.00 18.60 ? 1043 MET B CB    1 
ATOM   2655 C  CG    . MET B 1 93  ? 28.398 39.833 -12.766 1.00 20.79 ? 1043 MET B CG    1 
ATOM   2656 S  SD    . MET B 1 93  ? 28.219 40.988 -14.178 1.00 27.01 ? 1043 MET B SD    1 
ATOM   2657 C  CE    . MET B 1 93  ? 28.415 39.852 -15.541 1.00 27.89 ? 1043 MET B CE    1 
ATOM   2658 N  N     . CYS B 1 94  ? 30.996 40.815 -10.231 1.00 15.99 ? 1044 CYS B N     1 
ATOM   2659 C  CA    . CYS B 1 94  ? 30.719 41.692 -9.101  1.00 15.66 ? 1044 CYS B CA    1 
ATOM   2660 C  C     . CYS B 1 94  ? 31.547 42.981 -9.139  1.00 15.26 ? 1044 CYS B C     1 
ATOM   2661 O  O     . CYS B 1 94  ? 31.041 44.048 -8.811  1.00 15.68 ? 1044 CYS B O     1 
ATOM   2662 C  CB    . CYS B 1 94  ? 30.941 40.901 -7.816  1.00 15.80 ? 1044 CYS B CB    1 
ATOM   2663 S  SG    . CYS B 1 94  ? 30.002 39.359 -7.890  1.00 17.56 ? 1044 CYS B SG    1 
ATOM   2664 N  N     . GLY B 1 95  ? 32.808 42.874 -9.550  1.00 15.96 ? 1045 GLY B N     1 
ATOM   2665 C  CA    . GLY B 1 95  ? 33.649 44.044 -9.800  1.00 17.31 ? 1045 GLY B CA    1 
ATOM   2666 C  C     . GLY B 1 95  ? 33.061 44.880 -10.927 1.00 17.76 ? 1045 GLY B C     1 
ATOM   2667 O  O     . GLY B 1 95  ? 33.074 46.108 -10.867 1.00 18.78 ? 1045 GLY B O     1 
ATOM   2668 N  N     . GLN B 1 96  ? 32.526 44.217 -11.950 1.00 18.52 ? 1046 GLN B N     1 
ATOM   2669 C  CA    . GLN B 1 96  ? 31.887 44.944 -13.062 1.00 18.81 ? 1046 GLN B CA    1 
ATOM   2670 C  C     . GLN B 1 96  ? 30.651 45.743 -12.632 1.00 17.87 ? 1046 GLN B C     1 
ATOM   2671 O  O     . GLN B 1 96  ? 30.460 46.908 -13.035 1.00 18.10 ? 1046 GLN B O     1 
ATOM   2672 C  CB    . GLN B 1 96  ? 31.568 43.996 -14.224 1.00 18.97 ? 1046 GLN B CB    1 
ATOM   2673 C  CG    . GLN B 1 96  ? 32.818 43.453 -14.898 1.00 20.22 ? 1046 GLN B CG    1 
ATOM   2674 C  CD    . GLN B 1 96  ? 32.521 42.501 -16.042 1.00 21.43 ? 1046 GLN B CD    1 
ATOM   2675 O  OE1   . GLN B 1 96  ? 31.374 42.327 -16.453 1.00 25.96 ? 1046 GLN B OE1   1 
ATOM   2676 N  NE2   . GLN B 1 96  ? 33.570 41.879 -16.569 1.00 26.76 ? 1046 GLN B NE2   1 
ATOM   2677 N  N     . LEU B 1 97  ? 29.829 45.144 -11.777 1.00 17.33 ? 1047 LEU B N     1 
ATOM   2678 C  CA    . LEU B 1 97  ? 28.682 45.846 -11.237 1.00 17.29 ? 1047 LEU B CA    1 
ATOM   2679 C  C     . LEU B 1 97  ? 29.113 47.090 -10.457 1.00 17.06 ? 1047 LEU B C     1 
ATOM   2680 O  O     . LEU B 1 97  ? 28.403 48.086 -10.435 1.00 17.07 ? 1047 LEU B O     1 
ATOM   2681 C  CB    . LEU B 1 97  ? 27.872 44.919 -10.341 1.00 17.17 ? 1047 LEU B CB    1 
ATOM   2682 C  CG    . LEU B 1 97  ? 27.069 43.827 -11.050 1.00 17.14 ? 1047 LEU B CG    1 
ATOM   2683 C  CD1   . LEU B 1 97  ? 26.605 42.770 -10.030 1.00 17.06 ? 1047 LEU B CD1   1 
ATOM   2684 C  CD2   . LEU B 1 97  ? 25.879 44.419 -11.786 1.00 19.09 ? 1047 LEU B CD2   1 
ATOM   2685 N  N     . SER B 1 98  ? 30.283 47.002 -9.821  1.00 17.83 ? 1048 SER B N     1 
ATOM   2686 C  CA    . SER B 1 98  ? 30.848 48.073 -9.013  1.00 18.31 ? 1048 SER B CA    1 
ATOM   2687 C  C     . SER B 1 98  ? 31.634 49.076 -9.872  1.00 19.16 ? 1048 SER B C     1 
ATOM   2688 O  O     . SER B 1 98  ? 32.246 50.006 -9.337  1.00 18.69 ? 1048 SER B O     1 
ATOM   2689 C  CB    . SER B 1 98  ? 31.802 47.465 -7.973  1.00 17.73 ? 1048 SER B CB    1 
ATOM   2690 O  OG    . SER B 1 98  ? 31.141 46.488 -7.174  1.00 18.21 ? 1048 SER B OG    1 
ATOM   2691 N  N     . MET B 1 99  ? 31.603 48.869 -11.190 1.00 19.98 ? 1049 MET B N     1 
ATOM   2692 C  CA    . MET B 1 99  ? 32.486 49.540 -12.172 1.00 22.47 ? 1049 MET B CA    1 
ATOM   2693 C  C     . MET B 1 99  ? 33.850 48.847 -12.234 1.00 21.84 ? 1049 MET B C     1 
ATOM   2694 O  O     . MET B 1 99  ? 34.297 48.423 -13.298 1.00 22.28 ? 1049 MET B O     1 
ATOM   2695 C  CB    . MET B 1 99  ? 32.611 51.052 -11.922 1.00 22.25 ? 1049 MET B CB    1 
ATOM   2696 C  CG    . MET B 1 99  ? 31.263 51.769 -11.796 1.00 25.32 ? 1049 MET B CG    1 
ATOM   2697 S  SD    . MET B 1 99  ? 31.357 53.560 -11.533 1.00 27.89 ? 1049 MET B SD    1 
ATOM   2698 C  CE    . MET B 1 99  ? 31.354 54.077 -13.243 1.00 29.79 ? 1049 MET B CE    1 
ATOM   2699 N  N     . ARG B 1 100 ? 34.507 48.746 -11.083 1.00 20.98 ? 1050 ARG B N     1 
ATOM   2700 C  CA    . ARG B 1 100 ? 35.637 47.843 -10.887 1.00 21.24 ? 1050 ARG B CA    1 
ATOM   2701 C  C     . ARG B 1 100 ? 35.623 47.456 -9.411  1.00 20.39 ? 1050 ARG B C     1 
ATOM   2702 O  O     . ARG B 1 100 ? 34.929 48.090 -8.616  1.00 20.40 ? 1050 ARG B O     1 
ATOM   2703 C  CB    . ARG B 1 100 ? 36.963 48.531 -11.233 1.00 21.57 ? 1050 ARG B CB    1 
ATOM   2704 C  CG    . ARG B 1 100 ? 37.263 49.760 -10.401 1.00 23.40 ? 1050 ARG B CG    1 
ATOM   2705 C  CD    . ARG B 1 100 ? 38.464 50.512 -10.935 1.00 28.62 ? 1050 ARG B CD    1 
ATOM   2706 N  NE    . ARG B 1 100 ? 39.689 49.750 -10.750 1.00 32.38 ? 1050 ARG B NE    1 
ATOM   2707 C  CZ    . ARG B 1 100 ? 40.917 50.237 -10.926 1.00 34.10 ? 1050 ARG B CZ    1 
ATOM   2708 N  NH1   . ARG B 1 100 ? 41.968 49.454 -10.727 1.00 33.59 ? 1050 ARG B NH1   1 
ATOM   2709 N  NH2   . ARG B 1 100 ? 41.095 51.504 -11.292 1.00 35.19 ? 1050 ARG B NH2   1 
ATOM   2710 N  N     . CYS B 1 101 ? 36.384 46.430 -9.047  1.00 20.97 ? 1051 CYS B N     1 
ATOM   2711 C  CA    . CYS B 1 101 ? 36.604 46.154 -7.633  1.00 20.52 ? 1051 CYS B CA    1 
ATOM   2712 C  C     . CYS B 1 101 ? 37.491 47.257 -7.065  1.00 21.27 ? 1051 CYS B C     1 
ATOM   2713 O  O     . CYS B 1 101 ? 38.592 47.518 -7.569  1.00 21.20 ? 1051 CYS B O     1 
ATOM   2714 C  CB    . CYS B 1 101 ? 37.218 44.780 -7.405  1.00 20.97 ? 1051 CYS B CB    1 
ATOM   2715 S  SG    . CYS B 1 101 ? 37.463 44.447 -5.644  1.00 21.27 ? 1051 CYS B SG    1 
ATOM   2716 N  N     . TRP B 1 102 ? 36.979 47.924 -6.038  1.00 21.50 ? 1052 TRP B N     1 
ATOM   2717 C  CA    . TRP B 1 102 ? 37.641 49.090 -5.472  1.00 22.18 ? 1052 TRP B CA    1 
ATOM   2718 C  C     . TRP B 1 102 ? 38.571 48.745 -4.332  1.00 22.15 ? 1052 TRP B C     1 
ATOM   2719 O  O     . TRP B 1 102 ? 39.228 49.637 -3.795  1.00 22.82 ? 1052 TRP B O     1 
ATOM   2720 C  CB    . TRP B 1 102 ? 36.607 50.116 -5.004  1.00 22.53 ? 1052 TRP B CB    1 
ATOM   2721 C  CG    . TRP B 1 102 ? 35.791 50.628 -6.143  1.00 23.33 ? 1052 TRP B CG    1 
ATOM   2722 C  CD1   . TRP B 1 102 ? 34.504 50.310 -6.434  1.00 23.06 ? 1052 TRP B CD1   1 
ATOM   2723 C  CD2   . TRP B 1 102 ? 36.232 51.526 -7.173  1.00 23.57 ? 1052 TRP B CD2   1 
ATOM   2724 N  NE1   . TRP B 1 102 ? 34.100 50.963 -7.582  1.00 22.15 ? 1052 TRP B NE1   1 
ATOM   2725 C  CE2   . TRP B 1 102 ? 35.140 51.722 -8.049  1.00 22.98 ? 1052 TRP B CE2   1 
ATOM   2726 C  CE3   . TRP B 1 102 ? 37.438 52.197 -7.428  1.00 24.57 ? 1052 TRP B CE3   1 
ATOM   2727 C  CZ2   . TRP B 1 102 ? 35.221 52.554 -9.173  1.00 23.12 ? 1052 TRP B CZ2   1 
ATOM   2728 C  CZ3   . TRP B 1 102 ? 37.515 53.027 -8.544  1.00 23.88 ? 1052 TRP B CZ3   1 
ATOM   2729 C  CH2   . TRP B 1 102 ? 36.412 53.195 -9.402  1.00 22.99 ? 1052 TRP B CH2   1 
ATOM   2730 N  N     . TYR B 1 103 ? 38.635 47.465 -3.971  1.00 21.94 ? 1053 TYR B N     1 
ATOM   2731 C  CA    . TYR B 1 103 ? 39.432 47.030 -2.826  1.00 21.92 ? 1053 TYR B CA    1 
ATOM   2732 C  C     . TYR B 1 103 ? 40.809 46.523 -3.235  1.00 22.69 ? 1053 TYR B C     1 
ATOM   2733 O  O     . TYR B 1 103 ? 40.933 45.670 -4.120  1.00 22.68 ? 1053 TYR B O     1 
ATOM   2734 C  CB    . TYR B 1 103 ? 38.724 45.908 -2.077  1.00 20.72 ? 1053 TYR B CB    1 
ATOM   2735 C  CG    . TYR B 1 103 ? 37.362 46.262 -1.557  1.00 19.15 ? 1053 TYR B CG    1 
ATOM   2736 C  CD1   . TYR B 1 103 ? 37.149 47.438 -0.822  1.00 17.92 ? 1053 TYR B CD1   1 
ATOM   2737 C  CD2   . TYR B 1 103 ? 36.275 45.401 -1.769  1.00 18.21 ? 1053 TYR B CD2   1 
ATOM   2738 C  CE1   . TYR B 1 103 ? 35.888 47.752 -0.312  1.00 17.24 ? 1053 TYR B CE1   1 
ATOM   2739 C  CE2   . TYR B 1 103 ? 35.015 45.698 -1.267  1.00 17.30 ? 1053 TYR B CE2   1 
ATOM   2740 C  CZ    . TYR B 1 103 ? 34.819 46.870 -0.541  1.00 17.01 ? 1053 TYR B CZ    1 
ATOM   2741 O  OH    . TYR B 1 103 ? 33.572 47.168 -0.035  1.00 17.67 ? 1053 TYR B OH    1 
ATOM   2742 N  N     . ASP B 1 104 ? 41.840 47.022 -2.559  1.00 24.12 ? 1054 ASP B N     1 
ATOM   2743 C  CA    . ASP B 1 104 ? 43.185 46.497 -2.749  1.00 25.61 ? 1054 ASP B CA    1 
ATOM   2744 C  C     . ASP B 1 104 ? 43.362 45.198 -1.940  1.00 26.99 ? 1054 ASP B C     1 
ATOM   2745 O  O     . ASP B 1 104 ? 42.394 44.706 -1.334  1.00 27.17 ? 1054 ASP B O     1 
ATOM   2746 C  CB    . ASP B 1 104 ? 44.239 47.572 -2.430  1.00 25.71 ? 1054 ASP B CB    1 
ATOM   2747 C  CG    . ASP B 1 104 ? 44.375 47.866 -0.935  1.00 26.57 ? 1054 ASP B CG    1 
ATOM   2748 O  OD1   . ASP B 1 104 ? 43.876 47.091 -0.086  1.00 27.73 ? 1054 ASP B OD1   1 
ATOM   2749 O  OD2   . ASP B 1 104 ? 44.999 48.896 -0.605  1.00 28.25 ? 1054 ASP B OD2   1 
ATOM   2750 N  N     . LYS B 1 105 ? 44.569 44.631 -1.933  1.00 28.40 ? 1055 LYS B N     1 
ATOM   2751 C  CA    . LYS B 1 105 ? 44.790 43.339 -1.257  1.00 29.87 ? 1055 LYS B CA    1 
ATOM   2752 C  C     . LYS B 1 105 ? 44.570 43.384 0.266   1.00 29.74 ? 1055 LYS B C     1 
ATOM   2753 O  O     . LYS B 1 105 ? 44.345 42.347 0.897   1.00 30.05 ? 1055 LYS B O     1 
ATOM   2754 C  CB    . LYS B 1 105 ? 46.175 42.764 -1.594  1.00 30.47 ? 1055 LYS B CB    1 
ATOM   2755 C  CG    . LYS B 1 105 ? 47.318 43.181 -0.661  1.00 33.33 ? 1055 LYS B CG    1 
ATOM   2756 C  CD    . LYS B 1 105 ? 48.004 44.465 -1.118  1.00 36.92 ? 1055 LYS B CD    1 
ATOM   2757 C  CE    . LYS B 1 105 ? 49.411 44.561 -0.532  1.00 38.46 ? 1055 LYS B CE    1 
ATOM   2758 N  NZ    . LYS B 1 105 ? 50.276 45.489 -1.313  1.00 40.38 ? 1055 LYS B NZ    1 
ATOM   2759 N  N     . ASP B 1 106 ? 44.634 44.587 0.839   1.00 29.63 ? 1056 ASP B N     1 
ATOM   2760 C  CA    . ASP B 1 106 ? 44.444 44.789 2.278   1.00 29.29 ? 1056 ASP B CA    1 
ATOM   2761 C  C     . ASP B 1 106 ? 43.003 45.169 2.625   1.00 28.33 ? 1056 ASP B C     1 
ATOM   2762 O  O     . ASP B 1 106 ? 42.707 45.496 3.775   1.00 28.24 ? 1056 ASP B O     1 
ATOM   2763 C  CB    . ASP B 1 106 ? 45.394 45.876 2.794   1.00 29.81 ? 1056 ASP B CB    1 
ATOM   2764 C  CG    . ASP B 1 106 ? 46.862 45.506 2.627   1.00 32.09 ? 1056 ASP B CG    1 
ATOM   2765 O  OD1   . ASP B 1 106 ? 47.226 44.337 2.889   1.00 34.59 ? 1056 ASP B OD1   1 
ATOM   2766 O  OD2   . ASP B 1 106 ? 47.653 46.388 2.233   1.00 33.76 ? 1056 ASP B OD2   1 
ATOM   2767 N  N     . GLY B 1 107 ? 42.116 45.128 1.629   1.00 27.22 ? 1057 GLY B N     1 
ATOM   2768 C  CA    . GLY B 1 107 ? 40.712 45.495 1.821   1.00 25.91 ? 1057 GLY B CA    1 
ATOM   2769 C  C     . GLY B 1 107 ? 40.446 46.990 1.870   1.00 25.21 ? 1057 GLY B C     1 
ATOM   2770 O  O     . GLY B 1 107 ? 39.374 47.420 2.304   1.00 25.39 ? 1057 GLY B O     1 
ATOM   2771 N  N     A ARG B 1 108 ? 41.427 47.773 1.422   0.50 24.83 ? 1058 ARG B N     1 
ATOM   2772 N  N     B ARG B 1 108 ? 41.415 47.780 1.415   0.50 24.78 ? 1058 ARG B N     1 
ATOM   2773 C  CA    A ARG B 1 108 ? 41.343 49.227 1.412   0.50 24.85 ? 1058 ARG B CA    1 
ATOM   2774 C  CA    B ARG B 1 108 ? 41.308 49.232 1.444   0.50 24.72 ? 1058 ARG B CA    1 
ATOM   2775 C  C     A ARG B 1 108 ? 40.887 49.726 0.046   0.50 24.35 ? 1058 ARG B C     1 
ATOM   2776 C  C     B ARG B 1 108 ? 40.944 49.767 0.062   0.50 24.31 ? 1058 ARG B C     1 
ATOM   2777 O  O     A ARG B 1 108 ? 41.216 49.129 -0.981  0.50 24.37 ? 1058 ARG B O     1 
ATOM   2778 O  O     B ARG B 1 108 ? 41.374 49.221 -0.957  0.50 24.33 ? 1058 ARG B O     1 
ATOM   2779 C  CB    A ARG B 1 108 ? 42.710 49.843 1.736   0.50 24.84 ? 1058 ARG B CB    1 
ATOM   2780 C  CB    B ARG B 1 108 ? 42.619 49.858 1.943   0.50 24.77 ? 1058 ARG B CB    1 
ATOM   2781 C  CG    A ARG B 1 108 ? 43.210 49.639 3.169   0.50 25.81 ? 1058 ARG B CG    1 
ATOM   2782 C  CG    B ARG B 1 108 ? 43.090 49.315 3.299   0.50 25.13 ? 1058 ARG B CG    1 
ATOM   2783 C  CD    A ARG B 1 108 ? 44.590 50.290 3.352   0.50 25.99 ? 1058 ARG B CD    1 
ATOM   2784 C  CD    B ARG B 1 108 ? 44.562 49.627 3.561   0.50 25.78 ? 1058 ARG B CD    1 
ATOM   2785 N  NE    A ARG B 1 108 ? 44.604 51.647 2.809   0.50 29.35 ? 1058 ARG B NE    1 
ATOM   2786 N  NE    B ARG B 1 108 ? 45.074 48.874 4.706   0.50 28.02 ? 1058 ARG B NE    1 
ATOM   2787 C  CZ    A ARG B 1 108 ? 45.680 52.301 2.377   0.50 29.82 ? 1058 ARG B CZ    1 
ATOM   2788 C  CZ    B ARG B 1 108 ? 46.361 48.727 5.007   0.50 28.71 ? 1058 ARG B CZ    1 
ATOM   2789 N  NH1   A ARG B 1 108 ? 46.889 51.745 2.417   0.50 30.59 ? 1058 ARG B NH1   1 
ATOM   2790 N  NH1   B ARG B 1 108 ? 47.299 49.276 4.246   0.50 29.15 ? 1058 ARG B NH1   1 
ATOM   2791 N  NH2   A ARG B 1 108 ? 45.535 53.530 1.900   0.50 30.37 ? 1058 ARG B NH2   1 
ATOM   2792 N  NH2   B ARG B 1 108 ? 46.710 48.019 6.074   0.50 30.14 ? 1058 ARG B NH2   1 
ATOM   2793 N  N     . LEU B 1 109 ? 40.143 50.828 0.039   1.00 24.22 ? 1059 LEU B N     1 
ATOM   2794 C  CA    . LEU B 1 109 ? 39.734 51.482 -1.212  1.00 24.30 ? 1059 LEU B CA    1 
ATOM   2795 C  C     . LEU B 1 109 ? 40.935 51.992 -2.001  1.00 25.35 ? 1059 LEU B C     1 
ATOM   2796 O  O     . LEU B 1 109 ? 41.871 52.558 -1.421  1.00 25.44 ? 1059 LEU B O     1 
ATOM   2797 C  CB    . LEU B 1 109 ? 38.792 52.650 -0.932  1.00 23.74 ? 1059 LEU B CB    1 
ATOM   2798 C  CG    . LEU B 1 109 ? 37.442 52.289 -0.312  1.00 23.31 ? 1059 LEU B CG    1 
ATOM   2799 C  CD1   . LEU B 1 109 ? 36.685 53.563 0.003   1.00 22.64 ? 1059 LEU B CD1   1 
ATOM   2800 C  CD2   . LEU B 1 109 ? 36.659 51.401 -1.264  1.00 23.17 ? 1059 LEU B CD2   1 
ATOM   2801 N  N     . LEU B 1 110 ? 40.894 51.778 -3.311  1.00 26.28 ? 1060 LEU B N     1 
ATOM   2802 C  CA    . LEU B 1 110 ? 41.953 52.228 -4.214  1.00 28.05 ? 1060 LEU B CA    1 
ATOM   2803 C  C     . LEU B 1 110 ? 42.062 53.745 -4.217  1.00 28.74 ? 1060 LEU B C     1 
ATOM   2804 O  O     . LEU B 1 110 ? 41.058 54.434 -4.010  1.00 28.54 ? 1060 LEU B O     1 
ATOM   2805 C  CB    . LEU B 1 110 ? 41.672 51.744 -5.640  1.00 28.51 ? 1060 LEU B CB    1 
ATOM   2806 C  CG    . LEU B 1 110 ? 41.635 50.238 -5.893  1.00 29.31 ? 1060 LEU B CG    1 
ATOM   2807 C  CD1   . LEU B 1 110 ? 41.302 49.969 -7.357  1.00 31.32 ? 1060 LEU B CD1   1 
ATOM   2808 C  CD2   . LEU B 1 110 ? 42.942 49.570 -5.505  1.00 30.96 ? 1060 LEU B CD2   1 
ATOM   2809 N  N     . PRO B 1 111 ? 43.283 54.277 -4.460  1.00 29.85 ? 1061 PRO B N     1 
ATOM   2810 C  CA    . PRO B 1 111 ? 43.472 55.721 -4.640  1.00 30.76 ? 1061 PRO B CA    1 
ATOM   2811 C  C     . PRO B 1 111 ? 42.483 56.341 -5.637  1.00 31.22 ? 1061 PRO B C     1 
ATOM   2812 O  O     . PRO B 1 111 ? 42.034 57.473 -5.430  1.00 31.72 ? 1061 PRO B O     1 
ATOM   2813 C  CB    . PRO B 1 111 ? 44.898 55.810 -5.192  1.00 30.79 ? 1061 PRO B CB    1 
ATOM   2814 C  CG    . PRO B 1 111 ? 45.597 54.648 -4.593  1.00 30.75 ? 1061 PRO B CG    1 
ATOM   2815 C  CD    . PRO B 1 111 ? 44.562 53.544 -4.546  1.00 30.00 ? 1061 PRO B CD    1 
ATOM   2816 N  N     . GLU B 1 112 ? 42.143 55.587 -6.685  1.00 31.62 ? 1062 GLU B N     1 
ATOM   2817 C  CA    . GLU B 1 112 ? 41.220 56.019 -7.746  1.00 32.29 ? 1062 GLU B CA    1 
ATOM   2818 C  C     . GLU B 1 112 ? 39.763 56.202 -7.301  1.00 31.83 ? 1062 GLU B C     1 
ATOM   2819 O  O     . GLU B 1 112 ? 38.959 56.794 -8.026  1.00 31.86 ? 1062 GLU B O     1 
ATOM   2820 C  CB    . GLU B 1 112 ? 41.263 55.034 -8.926  1.00 32.79 ? 1062 GLU B CB    1 
ATOM   2821 C  CG    . GLU B 1 112 ? 42.634 54.870 -9.585  1.00 35.55 ? 1062 GLU B CG    1 
ATOM   2822 C  CD    . GLU B 1 112 ? 43.443 53.710 -9.011  1.00 39.04 ? 1062 GLU B CD    1 
ATOM   2823 O  OE1   . GLU B 1 112 ? 43.559 53.599 -7.771  1.00 39.55 ? 1062 GLU B OE1   1 
ATOM   2824 O  OE2   . GLU B 1 112 ? 43.984 52.912 -9.808  1.00 41.26 ? 1062 GLU B OE2   1 
ATOM   2825 N  N     . PHE B 1 113 ? 39.418 55.691 -6.119  1.00 31.33 ? 1063 PHE B N     1 
ATOM   2826 C  CA    . PHE B 1 113 ? 38.039 55.759 -5.624  1.00 30.45 ? 1063 PHE B CA    1 
ATOM   2827 C  C     . PHE B 1 113 ? 37.587 57.212 -5.475  1.00 31.00 ? 1063 PHE B C     1 
ATOM   2828 O  O     . PHE B 1 113 ? 38.281 58.028 -4.872  1.00 31.03 ? 1063 PHE B O     1 
ATOM   2829 C  CB    . PHE B 1 113 ? 37.909 55.015 -4.285  1.00 29.75 ? 1063 PHE B CB    1 
ATOM   2830 C  CG    . PHE B 1 113 ? 36.487 54.846 -3.811  1.00 27.55 ? 1063 PHE B CG    1 
ATOM   2831 C  CD1   . PHE B 1 113 ? 35.728 53.759 -4.232  1.00 26.84 ? 1063 PHE B CD1   1 
ATOM   2832 C  CD2   . PHE B 1 113 ? 35.919 55.757 -2.928  1.00 26.07 ? 1063 PHE B CD2   1 
ATOM   2833 C  CE1   . PHE B 1 113 ? 34.411 53.588 -3.791  1.00 26.14 ? 1063 PHE B CE1   1 
ATOM   2834 C  CE2   . PHE B 1 113 ? 34.613 55.601 -2.482  1.00 26.00 ? 1063 PHE B CE2   1 
ATOM   2835 C  CZ    . PHE B 1 113 ? 33.852 54.513 -2.918  1.00 26.04 ? 1063 PHE B CZ    1 
ATOM   2836 N  N     . ASN B 1 114 ? 36.423 57.529 -6.029  1.00 31.45 ? 1064 ASN B N     1 
ATOM   2837 C  CA    . ASN B 1 114 ? 35.902 58.890 -5.960  1.00 32.41 ? 1064 ASN B CA    1 
ATOM   2838 C  C     . ASN B 1 114 ? 35.177 59.156 -4.642  1.00 32.78 ? 1064 ASN B C     1 
ATOM   2839 O  O     . ASN B 1 114 ? 33.986 58.890 -4.514  1.00 32.56 ? 1064 ASN B O     1 
ATOM   2840 C  CB    . ASN B 1 114 ? 34.986 59.172 -7.159  1.00 32.53 ? 1064 ASN B CB    1 
ATOM   2841 C  CG    . ASN B 1 114 ? 34.640 60.652 -7.307  1.00 33.57 ? 1064 ASN B CG    1 
ATOM   2842 O  OD1   . ASN B 1 114 ? 34.560 61.389 -6.325  1.00 34.34 ? 1064 ASN B OD1   1 
ATOM   2843 N  ND2   . ASN B 1 114 ? 34.417 61.085 -8.544  1.00 33.27 ? 1064 ASN B ND2   1 
ATOM   2844 N  N     . MET B 1 115 ? 35.889 59.701 -3.661  1.00 33.64 ? 1065 MET B N     1 
ATOM   2845 C  CA    . MET B 1 115 ? 35.274 59.936 -2.351  1.00 35.00 ? 1065 MET B CA    1 
ATOM   2846 C  C     . MET B 1 115 ? 34.267 61.083 -2.310  1.00 34.60 ? 1065 MET B C     1 
ATOM   2847 O  O     . MET B 1 115 ? 33.446 61.159 -1.400  1.00 34.89 ? 1065 MET B O     1 
ATOM   2848 C  CB    . MET B 1 115 ? 36.332 60.048 -1.257  1.00 34.85 ? 1065 MET B CB    1 
ATOM   2849 C  CG    . MET B 1 115 ? 36.804 58.675 -0.817  1.00 35.81 ? 1065 MET B CG    1 
ATOM   2850 S  SD    . MET B 1 115 ? 38.136 58.696 0.367   1.00 38.47 ? 1065 MET B SD    1 
ATOM   2851 C  CE    . MET B 1 115 ? 39.505 59.311 -0.624  1.00 39.42 ? 1065 MET B CE    1 
ATOM   2852 N  N     . ALA B 1 116 ? 34.322 61.959 -3.309  1.00 34.62 ? 1066 ALA B N     1 
ATOM   2853 C  CA    . ALA B 1 116 ? 33.351 63.041 -3.450  1.00 34.41 ? 1066 ALA B CA    1 
ATOM   2854 C  C     . ALA B 1 116 ? 32.023 62.526 -3.995  1.00 34.10 ? 1066 ALA B C     1 
ATOM   2855 O  O     . ALA B 1 116 ? 30.951 62.915 -3.518  1.00 34.74 ? 1066 ALA B O     1 
ATOM   2856 C  CB    . ALA B 1 116 ? 33.910 64.137 -4.356  1.00 34.60 ? 1066 ALA B CB    1 
ATOM   2857 N  N     . GLU B 1 117 ? 32.101 61.647 -4.993  1.00 33.23 ? 1067 GLU B N     1 
ATOM   2858 C  CA    . GLU B 1 117 ? 30.921 61.069 -5.625  1.00 32.45 ? 1067 GLU B CA    1 
ATOM   2859 C  C     . GLU B 1 117 ? 31.085 59.554 -5.699  1.00 30.52 ? 1067 GLU B C     1 
ATOM   2860 O  O     . GLU B 1 117 ? 31.371 59.017 -6.776  1.00 30.65 ? 1067 GLU B O     1 
ATOM   2861 C  CB    . GLU B 1 117 ? 30.743 61.633 -7.040  1.00 32.87 ? 1067 GLU B CB    1 
ATOM   2862 C  CG    . GLU B 1 117 ? 29.322 62.060 -7.348  1.00 36.29 ? 1067 GLU B CG    1 
ATOM   2863 C  CD    . GLU B 1 117 ? 28.892 63.238 -6.487  1.00 40.08 ? 1067 GLU B CD    1 
ATOM   2864 O  OE1   . GLU B 1 117 ? 27.898 63.103 -5.740  1.00 42.17 ? 1067 GLU B OE1   1 
ATOM   2865 O  OE2   . GLU B 1 117 ? 29.571 64.289 -6.534  1.00 42.98 ? 1067 GLU B OE2   1 
ATOM   2866 N  N     . PRO B 1 118 ? 30.926 58.857 -4.552  1.00 28.68 ? 1068 PRO B N     1 
ATOM   2867 C  CA    . PRO B 1 118 ? 31.238 57.429 -4.550  1.00 26.78 ? 1068 PRO B CA    1 
ATOM   2868 C  C     . PRO B 1 118 ? 30.280 56.609 -5.403  1.00 24.87 ? 1068 PRO B C     1 
ATOM   2869 O  O     . PRO B 1 118 ? 29.089 56.904 -5.450  1.00 24.31 ? 1068 PRO B O     1 
ATOM   2870 C  CB    . PRO B 1 118 ? 31.089 57.029 -3.076  1.00 26.77 ? 1068 PRO B CB    1 
ATOM   2871 C  CG    . PRO B 1 118 ? 31.105 58.294 -2.313  1.00 28.19 ? 1068 PRO B CG    1 
ATOM   2872 C  CD    . PRO B 1 118 ? 30.489 59.312 -3.222  1.00 28.59 ? 1068 PRO B CD    1 
ATOM   2873 N  N     . PRO B 1 119 ? 30.804 55.575 -6.072  1.00 23.21 ? 1069 PRO B N     1 
ATOM   2874 C  CA    . PRO B 1 119 ? 29.961 54.606 -6.773  1.00 22.40 ? 1069 PRO B CA    1 
ATOM   2875 C  C     . PRO B 1 119 ? 29.264 53.669 -5.786  1.00 21.12 ? 1069 PRO B C     1 
ATOM   2876 O  O     . PRO B 1 119 ? 29.566 53.694 -4.587  1.00 21.20 ? 1069 PRO B O     1 
ATOM   2877 C  CB    . PRO B 1 119 ? 30.970 53.823 -7.613  1.00 22.74 ? 1069 PRO B CB    1 
ATOM   2878 C  CG    . PRO B 1 119 ? 32.243 53.884 -6.809  1.00 23.52 ? 1069 PRO B CG    1 
ATOM   2879 C  CD    . PRO B 1 119 ? 32.241 55.269 -6.209  1.00 23.87 ? 1069 PRO B CD    1 
ATOM   2880 N  N     . LEU B 1 120 ? 28.326 52.871 -6.289  1.00 19.69 ? 1070 LEU B N     1 
ATOM   2881 C  CA    . LEU B 1 120 ? 27.753 51.767 -5.519  1.00 18.19 ? 1070 LEU B CA    1 
ATOM   2882 C  C     . LEU B 1 120 ? 28.753 50.629 -5.549  1.00 17.76 ? 1070 LEU B C     1 
ATOM   2883 O  O     . LEU B 1 120 ? 29.370 50.356 -6.583  1.00 17.31 ? 1070 LEU B O     1 
ATOM   2884 C  CB    . LEU B 1 120 ? 26.443 51.285 -6.146  1.00 17.85 ? 1070 LEU B CB    1 
ATOM   2885 C  CG    . LEU B 1 120 ? 25.341 52.297 -6.445  1.00 19.35 ? 1070 LEU B CG    1 
ATOM   2886 C  CD1   . LEU B 1 120 ? 24.212 51.588 -7.186  1.00 21.49 ? 1070 LEU B CD1   1 
ATOM   2887 C  CD2   . LEU B 1 120 ? 24.827 52.913 -5.180  1.00 20.39 ? 1070 LEU B CD2   1 
ATOM   2888 N  N     . ILE B 1 121 ? 28.914 49.958 -4.412  1.00 16.03 ? 1071 ILE B N     1 
ATOM   2889 C  CA    . ILE B 1 121 ? 29.803 48.823 -4.322  1.00 15.21 ? 1071 ILE B CA    1 
ATOM   2890 C  C     . ILE B 1 121 ? 28.963 47.553 -4.236  1.00 15.19 ? 1071 ILE B C     1 
ATOM   2891 O  O     . ILE B 1 121 ? 28.088 47.461 -3.373  1.00 14.93 ? 1071 ILE B O     1 
ATOM   2892 C  CB    . ILE B 1 121 ? 30.736 48.923 -3.085  1.00 15.03 ? 1071 ILE B CB    1 
ATOM   2893 C  CG1   . ILE B 1 121 ? 31.763 50.053 -3.296  1.00 15.53 ? 1071 ILE B CG1   1 
ATOM   2894 C  CG2   . ILE B 1 121 ? 31.480 47.602 -2.874  1.00 15.75 ? 1071 ILE B CG2   1 
ATOM   2895 C  CD1   . ILE B 1 121 ? 32.673 50.311 -2.087  1.00 15.86 ? 1071 ILE B CD1   1 
ATOM   2896 N  N     . PHE B 1 122 ? 29.225 46.611 -5.145  1.00 14.46 ? 1072 PHE B N     1 
ATOM   2897 C  CA    . PHE B 1 122 ? 28.632 45.265 -5.095  1.00 14.30 ? 1072 PHE B CA    1 
ATOM   2898 C  C     . PHE B 1 122 ? 29.702 44.268 -4.663  1.00 14.73 ? 1072 PHE B C     1 
ATOM   2899 O  O     . PHE B 1 122 ? 30.648 43.971 -5.424  1.00 14.86 ? 1072 PHE B O     1 
ATOM   2900 C  CB    . PHE B 1 122 ? 28.068 44.888 -6.463  1.00 14.13 ? 1072 PHE B CB    1 
ATOM   2901 C  CG    . PHE B 1 122 ? 26.866 45.695 -6.847  1.00 13.25 ? 1072 PHE B CG    1 
ATOM   2902 C  CD1   . PHE B 1 122 ? 25.583 45.180 -6.688  1.00 15.69 ? 1072 PHE B CD1   1 
ATOM   2903 C  CD2   . PHE B 1 122 ? 27.012 46.989 -7.343  1.00 15.42 ? 1072 PHE B CD2   1 
ATOM   2904 C  CE1   . PHE B 1 122 ? 24.457 45.948 -7.019  1.00 16.78 ? 1072 PHE B CE1   1 
ATOM   2905 C  CE2   . PHE B 1 122 ? 25.903 47.755 -7.685  1.00 15.41 ? 1072 PHE B CE2   1 
ATOM   2906 C  CZ    . PHE B 1 122 ? 24.622 47.241 -7.528  1.00 16.36 ? 1072 PHE B CZ    1 
ATOM   2907 N  N     . GLU B 1 123 ? 29.589 43.782 -3.428  1.00 14.20 ? 1073 GLU B N     1 
ATOM   2908 C  CA    . GLU B 1 123 ? 30.512 42.772 -2.955  1.00 14.74 ? 1073 GLU B CA    1 
ATOM   2909 C  C     . GLU B 1 123 ? 30.075 41.410 -3.460  1.00 14.07 ? 1073 GLU B C     1 
ATOM   2910 O  O     . GLU B 1 123 ? 28.919 41.222 -3.889  1.00 14.89 ? 1073 GLU B O     1 
ATOM   2911 C  CB    . GLU B 1 123 ? 30.628 42.787 -1.416  1.00 14.10 ? 1073 GLU B CB    1 
ATOM   2912 C  CG    . GLU B 1 123 ? 31.125 44.124 -0.871  1.00 14.63 ? 1073 GLU B CG    1 
ATOM   2913 C  CD    . GLU B 1 123 ? 31.709 44.038 0.528   1.00 15.39 ? 1073 GLU B CD    1 
ATOM   2914 O  OE1   . GLU B 1 123 ? 31.503 43.032 1.246   1.00 15.55 ? 1073 GLU B OE1   1 
ATOM   2915 O  OE2   . GLU B 1 123 ? 32.366 45.016 0.923   1.00 17.59 ? 1073 GLU B OE2   1 
ATOM   2916 N  N     . CYS B 1 124 ? 30.995 40.450 -3.395  1.00 14.52 ? 1074 CYS B N     1 
ATOM   2917 C  CA    . CYS B 1 124 ? 30.624 39.076 -3.696  1.00 14.35 ? 1074 CYS B CA    1 
ATOM   2918 C  C     . CYS B 1 124 ? 29.584 38.567 -2.709  1.00 14.78 ? 1074 CYS B C     1 
ATOM   2919 O  O     . CYS B 1 124 ? 29.411 39.108 -1.609  1.00 14.62 ? 1074 CYS B O     1 
ATOM   2920 C  CB    . CYS B 1 124 ? 31.856 38.190 -3.770  1.00 14.86 ? 1074 CYS B CB    1 
ATOM   2921 S  SG    . CYS B 1 124 ? 32.742 38.532 -5.310  1.00 15.20 ? 1074 CYS B SG    1 
ATOM   2922 N  N     . ASN B 1 125 ? 28.875 37.529 -3.126  1.00 14.46 ? 1075 ASN B N     1 
ATOM   2923 C  CA    . ASN B 1 125 ? 27.772 37.044 -2.303  1.00 14.83 ? 1075 ASN B CA    1 
ATOM   2924 C  C     . ASN B 1 125 ? 27.721 35.524 -2.305  1.00 14.87 ? 1075 ASN B C     1 
ATOM   2925 O  O     . ASN B 1 125 ? 28.587 34.869 -2.882  1.00 15.84 ? 1075 ASN B O     1 
ATOM   2926 C  CB    . ASN B 1 125 ? 26.456 37.680 -2.773  1.00 14.80 ? 1075 ASN B CB    1 
ATOM   2927 C  CG    . ASN B 1 125 ? 26.155 37.360 -4.211  1.00 14.65 ? 1075 ASN B CG    1 
ATOM   2928 O  OD1   . ASN B 1 125 ? 26.016 36.198 -4.569  1.00 15.50 ? 1075 ASN B OD1   1 
ATOM   2929 N  ND2   . ASN B 1 125 ? 26.083 38.394 -5.057  1.00 15.25 ? 1075 ASN B ND2   1 
ATOM   2930 N  N     . HIS B 1 126 ? 26.731 34.947 -1.627  1.00 15.65 ? 1076 HIS B N     1 
ATOM   2931 C  CA    . HIS B 1 126 ? 26.673 33.496 -1.492  1.00 15.99 ? 1076 HIS B CA    1 
ATOM   2932 C  C     . HIS B 1 126 ? 26.269 32.753 -2.784  1.00 16.32 ? 1076 HIS B C     1 
ATOM   2933 O  O     . HIS B 1 126 ? 26.337 31.529 -2.825  1.00 17.03 ? 1076 HIS B O     1 
ATOM   2934 C  CB    . HIS B 1 126 ? 25.730 33.115 -0.346  1.00 15.57 ? 1076 HIS B CB    1 
ATOM   2935 C  CG    . HIS B 1 126 ? 24.384 33.753 -0.453  1.00 16.49 ? 1076 HIS B CG    1 
ATOM   2936 N  ND1   . HIS B 1 126 ? 24.184 35.106 -0.257  1.00 16.18 ? 1076 HIS B ND1   1 
ATOM   2937 C  CD2   . HIS B 1 126 ? 23.172 33.229 -0.753  1.00 16.68 ? 1076 HIS B CD2   1 
ATOM   2938 C  CE1   . HIS B 1 126 ? 22.899 35.382 -0.426  1.00 16.92 ? 1076 HIS B CE1   1 
ATOM   2939 N  NE2   . HIS B 1 126 ? 22.265 34.260 -0.719  1.00 16.17 ? 1076 HIS B NE2   1 
ATOM   2940 N  N     . ALA B 1 127 ? 25.873 33.478 -3.835  1.00 15.54 ? 1077 ALA B N     1 
ATOM   2941 C  CA    . ALA B 1 127 ? 25.613 32.857 -5.143  1.00 15.57 ? 1077 ALA B CA    1 
ATOM   2942 C  C     . ALA B 1 127 ? 26.886 32.721 -5.988  1.00 15.69 ? 1077 ALA B C     1 
ATOM   2943 O  O     . ALA B 1 127 ? 26.928 31.912 -6.929  1.00 16.66 ? 1077 ALA B O     1 
ATOM   2944 C  CB    . ALA B 1 127 ? 24.552 33.641 -5.917  1.00 15.64 ? 1077 ALA B CB    1 
ATOM   2945 N  N     . CYS B 1 128 ? 27.905 33.531 -5.674  1.00 15.32 ? 1078 CYS B N     1 
ATOM   2946 C  CA    . CYS B 1 128 ? 29.177 33.514 -6.411  1.00 14.97 ? 1078 CYS B CA    1 
ATOM   2947 C  C     . CYS B 1 128 ? 29.914 32.185 -6.260  1.00 15.81 ? 1078 CYS B C     1 
ATOM   2948 O  O     . CYS B 1 128 ? 29.767 31.500 -5.255  1.00 16.13 ? 1078 CYS B O     1 
ATOM   2949 C  CB    . CYS B 1 128 ? 30.091 34.650 -5.924  1.00 15.69 ? 1078 CYS B CB    1 
ATOM   2950 S  SG    . CYS B 1 128 ? 29.448 36.303 -6.150  1.00 14.61 ? 1078 CYS B SG    1 
ATOM   2951 N  N     . SER B 1 129 ? 30.708 31.829 -7.268  1.00 15.87 ? 1079 SER B N     1 
ATOM   2952 C  CA    . SER B 1 129 ? 31.501 30.601 -7.254  1.00 17.59 ? 1079 SER B CA    1 
ATOM   2953 C  C     . SER B 1 129 ? 32.757 30.719 -6.393  1.00 16.79 ? 1079 SER B C     1 
ATOM   2954 O  O     . SER B 1 129 ? 33.360 29.700 -6.019  1.00 18.13 ? 1079 SER B O     1 
ATOM   2955 C  CB    . SER B 1 129 ? 31.924 30.249 -8.693  1.00 17.75 ? 1079 SER B CB    1 
ATOM   2956 O  OG    . SER B 1 129 ? 30.785 30.035 -9.501  1.00 23.13 ? 1079 SER B OG    1 
ATOM   2957 N  N     . CYS B 1 130 ? 33.147 31.956 -6.097  1.00 16.48 ? 1080 CYS B N     1 
ATOM   2958 C  CA    . CYS B 1 130 ? 34.388 32.249 -5.373  1.00 16.05 ? 1080 CYS B CA    1 
ATOM   2959 C  C     . CYS B 1 130 ? 34.285 31.857 -3.897  1.00 16.85 ? 1080 CYS B C     1 
ATOM   2960 O  O     . CYS B 1 130 ? 33.205 31.504 -3.401  1.00 17.31 ? 1080 CYS B O     1 
ATOM   2961 C  CB    . CYS B 1 130 ? 34.747 33.731 -5.526  1.00 16.35 ? 1080 CYS B CB    1 
ATOM   2962 S  SG    . CYS B 1 130 ? 33.446 34.789 -4.907  1.00 16.85 ? 1080 CYS B SG    1 
ATOM   2963 N  N     . TRP B 1 131 ? 35.430 31.894 -3.218  1.00 17.00 ? 1081 TRP B N     1 
ATOM   2964 C  CA    . TRP B 1 131 ? 35.529 31.549 -1.806  1.00 17.90 ? 1081 TRP B CA    1 
ATOM   2965 C  C     . TRP B 1 131 ? 35.140 32.730 -0.921  1.00 18.26 ? 1081 TRP B C     1 
ATOM   2966 O  O     . TRP B 1 131 ? 35.168 33.883 -1.360  1.00 18.85 ? 1081 TRP B O     1 
ATOM   2967 C  CB    . TRP B 1 131 ? 36.954 31.063 -1.501  1.00 18.78 ? 1081 TRP B CB    1 
ATOM   2968 C  CG    . TRP B 1 131 ? 37.159 29.673 -1.995  1.00 20.49 ? 1081 TRP B CG    1 
ATOM   2969 C  CD1   . TRP B 1 131 ? 36.992 29.221 -3.276  1.00 22.04 ? 1081 TRP B CD1   1 
ATOM   2970 C  CD2   . TRP B 1 131 ? 37.548 28.539 -1.214  1.00 21.91 ? 1081 TRP B CD2   1 
ATOM   2971 N  NE1   . TRP B 1 131 ? 37.245 27.866 -3.334  1.00 24.18 ? 1081 TRP B NE1   1 
ATOM   2972 C  CE2   . TRP B 1 131 ? 37.594 27.429 -2.083  1.00 21.70 ? 1081 TRP B CE2   1 
ATOM   2973 C  CE3   . TRP B 1 131 ? 37.866 28.354 0.141   1.00 20.20 ? 1081 TRP B CE3   1 
ATOM   2974 C  CZ2   . TRP B 1 131 ? 37.940 26.147 -1.639  1.00 22.05 ? 1081 TRP B CZ2   1 
ATOM   2975 C  CZ3   . TRP B 1 131 ? 38.209 27.082 0.574   1.00 21.82 ? 1081 TRP B CZ3   1 
ATOM   2976 C  CH2   . TRP B 1 131 ? 38.242 26.002 -0.308  1.00 19.99 ? 1081 TRP B CH2   1 
ATOM   2977 N  N     . ARG B 1 132 ? 34.777 32.423 0.327   1.00 18.14 ? 1082 ARG B N     1 
ATOM   2978 C  CA    . ARG B 1 132 ? 34.300 33.418 1.284   1.00 18.71 ? 1082 ARG B CA    1 
ATOM   2979 C  C     . ARG B 1 132 ? 35.360 34.469 1.625   1.00 19.01 ? 1082 ARG B C     1 
ATOM   2980 O  O     . ARG B 1 132 ? 35.037 35.535 2.146   1.00 19.21 ? 1082 ARG B O     1 
ATOM   2981 C  CB    . ARG B 1 132 ? 33.787 32.712 2.559   1.00 19.21 ? 1082 ARG B CB    1 
ATOM   2982 C  CG    . ARG B 1 132 ? 33.267 33.626 3.673   1.00 19.08 ? 1082 ARG B CG    1 
ATOM   2983 C  CD    . ARG B 1 132 ? 32.072 34.471 3.272   1.00 20.02 ? 1082 ARG B CD    1 
ATOM   2984 N  NE    . ARG B 1 132 ? 31.649 35.367 4.353   1.00 19.02 ? 1082 ARG B NE    1 
ATOM   2985 C  CZ    . ARG B 1 132 ? 32.304 36.475 4.709   1.00 19.23 ? 1082 ARG B CZ    1 
ATOM   2986 N  NH1   . ARG B 1 132 ? 31.838 37.225 5.702   1.00 19.42 ? 1082 ARG B NH1   1 
ATOM   2987 N  NH2   . ARG B 1 132 ? 33.418 36.830 4.069   1.00 17.12 ? 1082 ARG B NH2   1 
ATOM   2988 N  N     . ASN B 1 133 ? 36.615 34.169 1.305   1.00 19.29 ? 1083 ASN B N     1 
ATOM   2989 C  CA    . ASN B 1 133 ? 37.718 35.097 1.530   1.00 20.20 ? 1083 ASN B CA    1 
ATOM   2990 C  C     . ASN B 1 133 ? 38.321 35.687 0.241   1.00 20.07 ? 1083 ASN B C     1 
ATOM   2991 O  O     . ASN B 1 133 ? 39.507 36.024 0.188   1.00 19.92 ? 1083 ASN B O     1 
ATOM   2992 C  CB    . ASN B 1 133 ? 38.787 34.427 2.403   1.00 21.50 ? 1083 ASN B CB    1 
ATOM   2993 C  CG    . ASN B 1 133 ? 39.453 33.245 1.725   1.00 23.21 ? 1083 ASN B CG    1 
ATOM   2994 O  OD1   . ASN B 1 133 ? 39.183 32.927 0.563   1.00 26.37 ? 1083 ASN B OD1   1 
ATOM   2995 N  ND2   . ASN B 1 133 ? 40.364 32.592 2.453   1.00 28.52 ? 1083 ASN B ND2   1 
ATOM   2996 N  N     . CYS B 1 134 ? 37.504 35.840 -0.803  1.00 19.33 ? 1084 CYS B N     1 
ATOM   2997 C  CA    . CYS B 1 134 ? 37.984 36.522 -2.009  1.00 18.81 ? 1084 CYS B CA    1 
ATOM   2998 C  C     . CYS B 1 134 ? 38.245 38.018 -1.747  1.00 18.97 ? 1084 CYS B C     1 
ATOM   2999 O  O     . CYS B 1 134 ? 37.919 38.538 -0.678  1.00 19.23 ? 1084 CYS B O     1 
ATOM   3000 C  CB    . CYS B 1 134 ? 37.011 36.323 -3.173  1.00 18.70 ? 1084 CYS B CB    1 
ATOM   3001 S  SG    . CYS B 1 134 ? 35.631 37.481 -3.125  1.00 16.46 ? 1084 CYS B SG    1 
ATOM   3002 N  N     . ARG B 1 135 ? 38.850 38.698 -2.723  1.00 19.37 ? 1085 ARG B N     1 
ATOM   3003 C  CA    . ARG B 1 135 ? 39.209 40.104 -2.588  1.00 19.25 ? 1085 ARG B CA    1 
ATOM   3004 C  C     . ARG B 1 135 ? 37.991 41.015 -2.396  1.00 18.75 ? 1085 ARG B C     1 
ATOM   3005 O  O     . ARG B 1 135 ? 38.082 42.059 -1.750  1.00 19.22 ? 1085 ARG B O     1 
ATOM   3006 C  CB    . ARG B 1 135 ? 39.988 40.557 -3.831  1.00 20.37 ? 1085 ARG B CB    1 
ATOM   3007 C  CG    . ARG B 1 135 ? 40.302 42.041 -3.848  1.00 23.97 ? 1085 ARG B CG    1 
ATOM   3008 C  CD    . ARG B 1 135 ? 40.982 42.418 -5.131  1.00 29.97 ? 1085 ARG B CD    1 
ATOM   3009 N  NE    . ARG B 1 135 ? 42.379 42.027 -5.079  1.00 35.03 ? 1085 ARG B NE    1 
ATOM   3010 C  CZ    . ARG B 1 135 ? 43.393 42.875 -5.172  1.00 36.23 ? 1085 ARG B CZ    1 
ATOM   3011 N  NH1   . ARG B 1 135 ? 43.162 44.176 -5.339  1.00 36.30 ? 1085 ARG B NH1   1 
ATOM   3012 N  NH2   . ARG B 1 135 ? 44.636 42.414 -5.106  1.00 37.46 ? 1085 ARG B NH2   1 
ATOM   3013 N  N     . ASN B 1 136 ? 36.855 40.616 -2.965  1.00 17.92 ? 1086 ASN B N     1 
ATOM   3014 C  CA    . ASN B 1 136 ? 35.707 41.516 -3.045  1.00 17.17 ? 1086 ASN B CA    1 
ATOM   3015 C  C     . ASN B 1 136 ? 34.710 41.355 -1.893  1.00 17.29 ? 1086 ASN B C     1 
ATOM   3016 O  O     . ASN B 1 136 ? 33.498 41.303 -2.109  1.00 17.59 ? 1086 ASN B O     1 
ATOM   3017 C  CB    . ASN B 1 136 ? 35.019 41.375 -4.406  1.00 17.00 ? 1086 ASN B CB    1 
ATOM   3018 C  CG    . ASN B 1 136 ? 34.023 42.492 -4.672  1.00 17.18 ? 1086 ASN B CG    1 
ATOM   3019 O  OD1   . ASN B 1 136 ? 34.217 43.627 -4.243  1.00 19.29 ? 1086 ASN B OD1   1 
ATOM   3020 N  ND2   . ASN B 1 136 ? 32.946 42.172 -5.388  1.00 16.35 ? 1086 ASN B ND2   1 
ATOM   3021 N  N     . ARG B 1 137 ? 35.243 41.292 -0.675  1.00 17.12 ? 1087 ARG B N     1 
ATOM   3022 C  CA    . ARG B 1 137 ? 34.465 41.069 0.524   1.00 17.45 ? 1087 ARG B CA    1 
ATOM   3023 C  C     . ARG B 1 137 ? 35.151 41.848 1.639   1.00 17.31 ? 1087 ARG B C     1 
ATOM   3024 O  O     . ARG B 1 137 ? 36.266 41.495 2.043   1.00 18.02 ? 1087 ARG B O     1 
ATOM   3025 C  CB    . ARG B 1 137 ? 34.427 39.585 0.851   1.00 18.23 ? 1087 ARG B CB    1 
ATOM   3026 C  CG    . ARG B 1 137 ? 33.615 38.769 -0.174  1.00 18.37 ? 1087 ARG B CG    1 
ATOM   3027 C  CD    . ARG B 1 137 ? 33.715 37.329 0.143   1.00 18.23 ? 1087 ARG B CD    1 
ATOM   3028 N  NE    . ARG B 1 137 ? 33.309 36.453 -0.937  1.00 19.37 ? 1087 ARG B NE    1 
ATOM   3029 C  CZ    . ARG B 1 137 ? 32.120 35.877 -1.028  1.00 17.40 ? 1087 ARG B CZ    1 
ATOM   3030 N  NH1   . ARG B 1 137 ? 31.889 35.051 -2.038  1.00 18.26 ? 1087 ARG B NH1   1 
ATOM   3031 N  NH2   . ARG B 1 137 ? 31.167 36.115 -0.111  1.00 16.63 ? 1087 ARG B NH2   1 
ATOM   3032 N  N     . VAL B 1 138 ? 34.520 42.935 2.078   1.00 16.35 ? 1088 VAL B N     1 
ATOM   3033 C  CA    . VAL B 1 138 ? 35.094 43.800 3.118   1.00 16.18 ? 1088 VAL B CA    1 
ATOM   3034 C  C     . VAL B 1 138 ? 34.010 44.196 4.127   1.00 16.04 ? 1088 VAL B C     1 
ATOM   3035 O  O     . VAL B 1 138 ? 34.084 43.844 5.310   1.00 16.37 ? 1088 VAL B O     1 
ATOM   3036 C  CB    . VAL B 1 138 ? 35.781 45.066 2.513   1.00 16.07 ? 1088 VAL B CB    1 
ATOM   3037 C  CG1   . VAL B 1 138 ? 36.177 46.051 3.614   1.00 16.38 ? 1088 VAL B CG1   1 
ATOM   3038 C  CG2   . VAL B 1 138 ? 37.016 44.681 1.721   1.00 16.19 ? 1088 VAL B CG2   1 
ATOM   3039 N  N     . VAL B 1 139 ? 32.985 44.900 3.657   1.00 15.50 ? 1089 VAL B N     1 
ATOM   3040 C  CA    . VAL B 1 139 ? 31.908 45.346 4.534   1.00 15.61 ? 1089 VAL B CA    1 
ATOM   3041 C  C     . VAL B 1 139 ? 31.168 44.158 5.164   1.00 16.05 ? 1089 VAL B C     1 
ATOM   3042 O  O     . VAL B 1 139 ? 30.728 44.225 6.316   1.00 16.25 ? 1089 VAL B O     1 
ATOM   3043 C  CB    . VAL B 1 139 ? 30.951 46.295 3.792   1.00 16.00 ? 1089 VAL B CB    1 
ATOM   3044 C  CG1   . VAL B 1 139 ? 29.809 46.743 4.693   1.00 16.99 ? 1089 VAL B CG1   1 
ATOM   3045 C  CG2   . VAL B 1 139 ? 31.728 47.495 3.257   1.00 15.98 ? 1089 VAL B CG2   1 
ATOM   3046 N  N     . GLN B 1 140 ? 31.078 43.051 4.430   1.00 16.55 ? 1090 GLN B N     1 
ATOM   3047 C  CA    . GLN B 1 140 ? 30.369 41.877 4.938   1.00 16.75 ? 1090 GLN B CA    1 
ATOM   3048 C  C     . GLN B 1 140 ? 31.117 41.159 6.062   1.00 17.77 ? 1090 GLN B C     1 
ATOM   3049 O  O     . GLN B 1 140 ? 30.564 40.249 6.702   1.00 18.56 ? 1090 GLN B O     1 
ATOM   3050 C  CB    . GLN B 1 140 ? 30.048 40.914 3.797   1.00 16.70 ? 1090 GLN B CB    1 
ATOM   3051 C  CG    . GLN B 1 140 ? 31.256 40.295 3.119   1.00 15.28 ? 1090 GLN B CG    1 
ATOM   3052 C  CD    . GLN B 1 140 ? 30.844 39.608 1.836   1.00 17.05 ? 1090 GLN B CD    1 
ATOM   3053 O  OE1   . GLN B 1 140 ? 30.599 40.266 0.813   1.00 17.46 ? 1090 GLN B OE1   1 
ATOM   3054 N  NE2   . GLN B 1 140 ? 30.738 38.300 1.887   1.00 15.11 ? 1090 GLN B NE2   1 
ATOM   3055 N  N     . ASN B 1 141 ? 32.368 41.556 6.287   1.00 17.85 ? 1091 ASN B N     1 
ATOM   3056 C  CA    . ASN B 1 141 ? 33.188 40.989 7.355   1.00 19.76 ? 1091 ASN B CA    1 
ATOM   3057 C  C     . ASN B 1 141 ? 33.017 41.718 8.689   1.00 20.69 ? 1091 ASN B C     1 
ATOM   3058 O  O     . ASN B 1 141 ? 33.526 41.262 9.724   1.00 21.74 ? 1091 ASN B O     1 
ATOM   3059 C  CB    . ASN B 1 141 ? 34.649 40.963 6.921   1.00 19.96 ? 1091 ASN B CB    1 
ATOM   3060 C  CG    . ASN B 1 141 ? 34.904 39.946 5.813   1.00 20.80 ? 1091 ASN B CG    1 
ATOM   3061 O  OD1   . ASN B 1 141 ? 34.124 39.006 5.633   1.00 22.21 ? 1091 ASN B OD1   1 
ATOM   3062 N  ND2   . ASN B 1 141 ? 35.998 40.111 5.087   1.00 21.92 ? 1091 ASN B ND2   1 
ATOM   3063 N  N     . GLY B 1 142 ? 32.313 42.844 8.649   1.00 21.18 ? 1092 GLY B N     1 
ATOM   3064 C  CA    . GLY B 1 142 ? 31.944 43.575 9.858   1.00 22.44 ? 1092 GLY B CA    1 
ATOM   3065 C  C     . GLY B 1 142 ? 33.020 44.473 10.426  1.00 23.63 ? 1092 GLY B C     1 
ATOM   3066 O  O     . GLY B 1 142 ? 34.148 44.538 9.920   1.00 22.01 ? 1092 GLY B O     1 
ATOM   3067 N  N     . LEU B 1 143 ? 32.639 45.167 11.495  1.00 24.85 ? 1093 LEU B N     1 
ATOM   3068 C  CA    . LEU B 1 143 ? 33.497 46.104 12.200  1.00 26.93 ? 1093 LEU B CA    1 
ATOM   3069 C  C     . LEU B 1 143 ? 34.740 45.373 12.686  1.00 27.13 ? 1093 LEU B C     1 
ATOM   3070 O  O     . LEU B 1 143 ? 34.639 44.312 13.320  1.00 27.70 ? 1093 LEU B O     1 
ATOM   3071 C  CB    . LEU B 1 143 ? 32.711 46.708 13.374  1.00 26.78 ? 1093 LEU B CB    1 
ATOM   3072 C  CG    . LEU B 1 143 ? 33.330 47.635 14.417  1.00 28.85 ? 1093 LEU B CG    1 
ATOM   3073 C  CD1   . LEU B 1 143 ? 32.210 48.282 15.196  1.00 28.69 ? 1093 LEU B CD1   1 
ATOM   3074 C  CD2   . LEU B 1 143 ? 34.200 46.858 15.367  1.00 31.22 ? 1093 LEU B CD2   1 
ATOM   3075 N  N     . ARG B 1 144 ? 35.903 45.932 12.363  1.00 27.94 ? 1094 ARG B N     1 
ATOM   3076 C  CA    . ARG B 1 144 ? 37.191 45.384 12.790  1.00 29.28 ? 1094 ARG B CA    1 
ATOM   3077 C  C     . ARG B 1 144 ? 37.992 46.355 13.663  1.00 29.25 ? 1094 ARG B C     1 
ATOM   3078 O  O     . ARG B 1 144 ? 38.661 45.934 14.608  1.00 29.98 ? 1094 ARG B O     1 
ATOM   3079 C  CB    . ARG B 1 144 ? 38.050 45.003 11.585  1.00 29.70 ? 1094 ARG B CB    1 
ATOM   3080 C  CG    . ARG B 1 144 ? 37.576 43.771 10.824  1.00 31.89 ? 1094 ARG B CG    1 
ATOM   3081 C  CD    . ARG B 1 144 ? 38.629 43.382 9.795   1.00 35.09 ? 1094 ARG B CD    1 
ATOM   3082 N  NE    . ARG B 1 144 ? 38.161 42.384 8.832   1.00 37.52 ? 1094 ARG B NE    1 
ATOM   3083 C  CZ    . ARG B 1 144 ? 38.171 41.068 9.036   1.00 38.57 ? 1094 ARG B CZ    1 
ATOM   3084 N  NH1   . ARG B 1 144 ? 38.587 40.564 10.194  1.00 39.34 ? 1094 ARG B NH1   1 
ATOM   3085 N  NH2   . ARG B 1 144 ? 37.747 40.251 8.082   1.00 38.73 ? 1094 ARG B NH2   1 
ATOM   3086 N  N     . ALA B 1 145 ? 37.932 47.643 13.319  1.00 29.15 ? 1095 ALA B N     1 
ATOM   3087 C  CA    . ALA B 1 145 ? 38.701 48.697 13.986  1.00 28.94 ? 1095 ALA B CA    1 
ATOM   3088 C  C     . ALA B 1 145 ? 38.376 48.800 15.472  1.00 28.77 ? 1095 ALA B C     1 
ATOM   3089 O  O     . ALA B 1 145 ? 37.226 48.625 15.865  1.00 28.24 ? 1095 ALA B O     1 
ATOM   3090 C  CB    . ALA B 1 145 ? 38.433 50.021 13.308  1.00 28.95 ? 1095 ALA B CB    1 
ATOM   3091 N  N     . ARG B 1 146 ? 39.391 49.102 16.290  1.00 28.74 ? 1096 ARG B N     1 
ATOM   3092 C  CA    . ARG B 1 146 ? 39.171 49.370 17.717  1.00 28.86 ? 1096 ARG B CA    1 
ATOM   3093 C  C     . ARG B 1 146 ? 38.605 50.768 17.884  1.00 28.43 ? 1096 ARG B C     1 
ATOM   3094 O  O     . ARG B 1 146 ? 39.319 51.765 17.728  1.00 28.41 ? 1096 ARG B O     1 
ATOM   3095 C  CB    . ARG B 1 146 ? 40.460 49.241 18.546  1.00 29.45 ? 1096 ARG B CB    1 
ATOM   3096 C  CG    . ARG B 1 146 ? 41.322 48.020 18.281  1.00 32.30 ? 1096 ARG B CG    1 
ATOM   3097 C  CD    . ARG B 1 146 ? 40.697 46.701 18.708  1.00 36.58 ? 1096 ARG B CD    1 
ATOM   3098 N  NE    . ARG B 1 146 ? 40.335 46.638 20.126  1.00 40.51 ? 1096 ARG B NE    1 
ATOM   3099 C  CZ    . ARG B 1 146 ? 40.415 45.539 20.880  1.00 41.01 ? 1096 ARG B CZ    1 
ATOM   3100 N  NH1   . ARG B 1 146 ? 40.888 44.400 20.375  1.00 42.42 ? 1096 ARG B NH1   1 
ATOM   3101 N  NH2   . ARG B 1 146 ? 40.045 45.584 22.152  1.00 41.34 ? 1096 ARG B NH2   1 
ATOM   3102 N  N     . LEU B 1 147 ? 37.311 50.824 18.180  1.00 27.41 ? 1097 LEU B N     1 
ATOM   3103 C  CA    . LEU B 1 147 ? 36.590 52.073 18.383  1.00 26.89 ? 1097 LEU B CA    1 
ATOM   3104 C  C     . LEU B 1 147 ? 36.224 52.241 19.861  1.00 27.02 ? 1097 LEU B C     1 
ATOM   3105 O  O     . LEU B 1 147 ? 36.305 51.292 20.646  1.00 26.36 ? 1097 LEU B O     1 
ATOM   3106 C  CB    . LEU B 1 147 ? 35.323 52.116 17.507  1.00 26.93 ? 1097 LEU B CB    1 
ATOM   3107 C  CG    . LEU B 1 147 ? 35.504 52.044 15.981  1.00 26.29 ? 1097 LEU B CG    1 
ATOM   3108 C  CD1   . LEU B 1 147 ? 34.158 52.198 15.275  1.00 24.73 ? 1097 LEU B CD1   1 
ATOM   3109 C  CD2   . LEU B 1 147 ? 36.494 53.106 15.469  1.00 25.68 ? 1097 LEU B CD2   1 
ATOM   3110 N  N     . GLN B 1 148 ? 35.803 53.454 20.214  1.00 27.46 ? 1098 GLN B N     1 
ATOM   3111 C  CA    . GLN B 1 148 ? 35.474 53.794 21.593  1.00 28.00 ? 1098 GLN B CA    1 
ATOM   3112 C  C     . GLN B 1 148 ? 34.476 54.935 21.617  1.00 27.97 ? 1098 GLN B C     1 
ATOM   3113 O  O     . GLN B 1 148 ? 34.672 55.961 20.965  1.00 27.81 ? 1098 GLN B O     1 
ATOM   3114 C  CB    . GLN B 1 148 ? 36.749 54.181 22.355  1.00 28.03 ? 1098 GLN B CB    1 
ATOM   3115 C  CG    . GLN B 1 148 ? 36.565 54.407 23.851  1.00 28.80 ? 1098 GLN B CG    1 
ATOM   3116 C  CD    . GLN B 1 148 ? 37.773 55.104 24.460  1.00 29.04 ? 1098 GLN B CD    1 
ATOM   3117 O  OE1   . GLN B 1 148 ? 38.016 56.279 24.191  1.00 31.21 ? 1098 GLN B OE1   1 
ATOM   3118 N  NE2   . GLN B 1 148 ? 38.542 54.377 25.267  1.00 30.84 ? 1098 GLN B NE2   1 
ATOM   3119 N  N     . LEU B 1 149 ? 33.392 54.742 22.362  1.00 28.46 ? 1099 LEU B N     1 
ATOM   3120 C  CA    . LEU B 1 149 ? 32.433 55.799 22.607  1.00 28.96 ? 1099 LEU B CA    1 
ATOM   3121 C  C     . LEU B 1 149 ? 33.013 56.654 23.735  1.00 30.10 ? 1099 LEU B C     1 
ATOM   3122 O  O     . LEU B 1 149 ? 33.518 56.107 24.712  1.00 29.61 ? 1099 LEU B O     1 
ATOM   3123 C  CB    . LEU B 1 149 ? 31.080 55.204 23.018  1.00 28.99 ? 1099 LEU B CB    1 
ATOM   3124 C  CG    . LEU B 1 149 ? 29.870 56.126 23.202  1.00 28.93 ? 1099 LEU B CG    1 
ATOM   3125 C  CD1   . LEU B 1 149 ? 29.582 56.969 21.969  1.00 29.37 ? 1099 LEU B CD1   1 
ATOM   3126 C  CD2   . LEU B 1 149 ? 28.631 55.333 23.609  1.00 28.60 ? 1099 LEU B CD2   1 
ATOM   3127 N  N     . TYR B 1 150 ? 32.959 57.975 23.580  1.00 31.19 ? 1100 TYR B N     1 
ATOM   3128 C  CA    . TYR B 1 150 ? 33.542 58.888 24.579  1.00 32.82 ? 1100 TYR B CA    1 
ATOM   3129 C  C     . TYR B 1 150 ? 32.751 60.180 24.709  1.00 33.70 ? 1100 TYR B C     1 
ATOM   3130 O  O     . TYR B 1 150 ? 32.041 60.581 23.794  1.00 33.54 ? 1100 TYR B O     1 
ATOM   3131 C  CB    . TYR B 1 150 ? 35.031 59.160 24.282  1.00 32.82 ? 1100 TYR B CB    1 
ATOM   3132 C  CG    . TYR B 1 150 ? 35.302 60.209 23.226  1.00 33.51 ? 1100 TYR B CG    1 
ATOM   3133 C  CD1   . TYR B 1 150 ? 35.665 61.514 23.583  1.00 33.11 ? 1100 TYR B CD1   1 
ATOM   3134 C  CD2   . TYR B 1 150 ? 35.212 59.899 21.869  1.00 33.26 ? 1100 TYR B CD2   1 
ATOM   3135 C  CE1   . TYR B 1 150 ? 35.917 62.484 22.615  1.00 32.84 ? 1100 TYR B CE1   1 
ATOM   3136 C  CE2   . TYR B 1 150 ? 35.460 60.861 20.893  1.00 33.69 ? 1100 TYR B CE2   1 
ATOM   3137 C  CZ    . TYR B 1 150 ? 35.816 62.149 21.273  1.00 33.50 ? 1100 TYR B CZ    1 
ATOM   3138 O  OH    . TYR B 1 150 ? 36.064 63.092 20.307  1.00 34.10 ? 1100 TYR B OH    1 
ATOM   3139 N  N     . ARG B 1 151 ? 32.872 60.831 25.865  1.00 35.39 ? 1101 ARG B N     1 
ATOM   3140 C  CA    . ARG B 1 151 ? 32.189 62.099 26.090  1.00 36.90 ? 1101 ARG B CA    1 
ATOM   3141 C  C     . ARG B 1 151 ? 33.050 63.245 25.566  1.00 37.62 ? 1101 ARG B C     1 
ATOM   3142 O  O     . ARG B 1 151 ? 34.236 63.329 25.887  1.00 37.93 ? 1101 ARG B O     1 
ATOM   3143 C  CB    . ARG B 1 151 ? 31.888 62.281 27.581  1.00 37.14 ? 1101 ARG B CB    1 
ATOM   3144 C  CG    . ARG B 1 151 ? 30.905 63.397 27.910  1.00 37.89 ? 1101 ARG B CG    1 
ATOM   3145 C  CD    . ARG B 1 151 ? 29.472 63.024 27.574  1.00 39.63 ? 1101 ARG B CD    1 
ATOM   3146 N  NE    . ARG B 1 151 ? 28.527 64.074 27.946  1.00 40.89 ? 1101 ARG B NE    1 
ATOM   3147 C  CZ    . ARG B 1 151 ? 27.288 64.170 27.473  1.00 42.14 ? 1101 ARG B CZ    1 
ATOM   3148 N  NH1   . ARG B 1 151 ? 26.833 63.283 26.599  1.00 42.65 ? 1101 ARG B NH1   1 
ATOM   3149 N  NH2   . ARG B 1 151 ? 26.500 65.160 27.867  1.00 42.72 ? 1101 ARG B NH2   1 
ATOM   3150 N  N     . THR B 1 152 ? 32.458 64.102 24.740  1.00 38.87 ? 1102 THR B N     1 
ATOM   3151 C  CA    . THR B 1 152 ? 33.159 65.280 24.234  1.00 39.95 ? 1102 THR B CA    1 
ATOM   3152 C  C     . THR B 1 152 ? 32.852 66.490 25.116  1.00 41.03 ? 1102 THR B C     1 
ATOM   3153 O  O     . THR B 1 152 ? 31.859 66.505 25.858  1.00 40.90 ? 1102 THR B O     1 
ATOM   3154 C  CB    . THR B 1 152 ? 32.794 65.622 22.768  1.00 39.72 ? 1102 THR B CB    1 
ATOM   3155 O  OG1   . THR B 1 152 ? 31.486 66.203 22.711  1.00 39.09 ? 1102 THR B OG1   1 
ATOM   3156 C  CG2   . THR B 1 152 ? 32.855 64.387 21.870  1.00 40.11 ? 1102 THR B CG2   1 
ATOM   3157 N  N     . ARG B 1 153 ? 33.706 67.506 25.009  1.00 42.11 ? 1103 ARG B N     1 
ATOM   3158 C  CA    . ARG B 1 153 ? 33.533 68.760 25.734  1.00 43.27 ? 1103 ARG B CA    1 
ATOM   3159 C  C     . ARG B 1 153 ? 32.314 69.542 25.246  1.00 43.55 ? 1103 ARG B C     1 
ATOM   3160 O  O     . ARG B 1 153 ? 31.590 70.140 26.046  1.00 43.93 ? 1103 ARG B O     1 
ATOM   3161 C  CB    . ARG B 1 153 ? 34.791 69.627 25.586  1.00 43.60 ? 1103 ARG B CB    1 
ATOM   3162 C  CG    . ARG B 1 153 ? 36.035 69.079 26.282  1.00 45.06 ? 1103 ARG B CG    1 
ATOM   3163 C  CD    . ARG B 1 153 ? 36.032 69.422 27.764  1.00 47.57 ? 1103 ARG B CD    1 
ATOM   3164 N  NE    . ARG B 1 153 ? 37.151 68.807 28.473  1.00 49.59 ? 1103 ARG B NE    1 
ATOM   3165 C  CZ    . ARG B 1 153 ? 37.235 68.699 29.798  1.00 50.47 ? 1103 ARG B CZ    1 
ATOM   3166 N  NH1   . ARG B 1 153 ? 36.262 69.164 30.576  1.00 50.47 ? 1103 ARG B NH1   1 
ATOM   3167 N  NH2   . ARG B 1 153 ? 38.296 68.121 30.348  1.00 51.06 ? 1103 ARG B NH2   1 
ATOM   3168 N  N     . ASP B 1 154 ? 32.078 69.501 23.936  1.00 43.93 ? 1104 ASP B N     1 
ATOM   3169 C  CA    . ASP B 1 154 ? 31.186 70.450 23.269  1.00 44.12 ? 1104 ASP B CA    1 
ATOM   3170 C  C     . ASP B 1 154 ? 29.997 69.856 22.504  1.00 43.90 ? 1104 ASP B C     1 
ATOM   3171 O  O     . ASP B 1 154 ? 29.042 70.580 22.201  1.00 44.03 ? 1104 ASP B O     1 
ATOM   3172 C  CB    . ASP B 1 154 ? 32.007 71.356 22.331  1.00 44.54 ? 1104 ASP B CB    1 
ATOM   3173 C  CG    . ASP B 1 154 ? 32.857 70.568 21.318  1.00 45.57 ? 1104 ASP B CG    1 
ATOM   3174 O  OD1   . ASP B 1 154 ? 33.279 69.421 21.607  1.00 45.43 ? 1104 ASP B OD1   1 
ATOM   3175 O  OD2   . ASP B 1 154 ? 33.112 71.115 20.220  1.00 46.89 ? 1104 ASP B OD2   1 
ATOM   3176 N  N     . MET B 1 155 ? 30.049 68.558 22.192  1.00 43.33 ? 1105 MET B N     1 
ATOM   3177 C  CA    . MET B 1 155 ? 29.035 67.934 21.321  1.00 42.97 ? 1105 MET B CA    1 
ATOM   3178 C  C     . MET B 1 155 ? 28.298 66.736 21.927  1.00 42.03 ? 1105 MET B C     1 
ATOM   3179 O  O     . MET B 1 155 ? 27.477 66.105 21.252  1.00 42.44 ? 1105 MET B O     1 
ATOM   3180 C  CB    . MET B 1 155 ? 29.668 67.490 20.001  1.00 42.88 ? 1105 MET B CB    1 
ATOM   3181 C  CG    . MET B 1 155 ? 30.094 68.608 19.080  1.00 43.72 ? 1105 MET B CG    1 
ATOM   3182 S  SD    . MET B 1 155 ? 30.870 67.941 17.597  1.00 43.86 ? 1105 MET B SD    1 
ATOM   3183 C  CE    . MET B 1 155 ? 32.318 67.133 18.282  1.00 44.17 ? 1105 MET B CE    1 
ATOM   3184 N  N     . GLY B 1 156 ? 28.598 66.418 23.183  1.00 40.99 ? 1106 GLY B N     1 
ATOM   3185 C  CA    . GLY B 1 156 ? 28.002 65.262 23.855  1.00 39.27 ? 1106 GLY B CA    1 
ATOM   3186 C  C     . GLY B 1 156 ? 28.855 64.023 23.681  1.00 38.00 ? 1106 GLY B C     1 
ATOM   3187 O  O     . GLY B 1 156 ? 30.056 64.045 23.946  1.00 38.16 ? 1106 GLY B O     1 
ATOM   3188 N  N     . TRP B 1 157 ? 28.233 62.932 23.245  1.00 36.48 ? 1107 TRP B N     1 
ATOM   3189 C  CA    . TRP B 1 157 ? 28.967 61.713 22.939  1.00 34.91 ? 1107 TRP B CA    1 
ATOM   3190 C  C     . TRP B 1 157 ? 29.535 61.781 21.527  1.00 33.73 ? 1107 TRP B C     1 
ATOM   3191 O  O     . TRP B 1 157 ? 28.921 62.353 20.627  1.00 34.13 ? 1107 TRP B O     1 
ATOM   3192 C  CB    . TRP B 1 157 ? 28.071 60.479 23.085  1.00 34.89 ? 1107 TRP B CB    1 
ATOM   3193 C  CG    . TRP B 1 157 ? 27.541 60.293 24.477  1.00 34.62 ? 1107 TRP B CG    1 
ATOM   3194 C  CD1   . TRP B 1 157 ? 26.278 60.559 24.913  1.00 35.03 ? 1107 TRP B CD1   1 
ATOM   3195 C  CD2   . TRP B 1 157 ? 28.268 59.813 25.615  1.00 34.14 ? 1107 TRP B CD2   1 
ATOM   3196 N  NE1   . TRP B 1 157 ? 26.166 60.269 26.255  1.00 34.49 ? 1107 TRP B NE1   1 
ATOM   3197 C  CE2   . TRP B 1 157 ? 27.372 59.806 26.709  1.00 34.66 ? 1107 TRP B CE2   1 
ATOM   3198 C  CE3   . TRP B 1 157 ? 29.586 59.382 25.816  1.00 33.67 ? 1107 TRP B CE3   1 
ATOM   3199 C  CZ2   . TRP B 1 157 ? 27.754 59.391 27.987  1.00 33.99 ? 1107 TRP B CZ2   1 
ATOM   3200 C  CZ3   . TRP B 1 157 ? 29.966 58.965 27.086  1.00 34.42 ? 1107 TRP B CZ3   1 
ATOM   3201 C  CH2   . TRP B 1 157 ? 29.049 58.975 28.156  1.00 34.64 ? 1107 TRP B CH2   1 
ATOM   3202 N  N     . GLY B 1 158 ? 30.715 61.198 21.357  1.00 32.62 ? 1108 GLY B N     1 
ATOM   3203 C  CA    . GLY B 1 158 ? 31.328 61.028 20.043  1.00 30.79 ? 1108 GLY B CA    1 
ATOM   3204 C  C     . GLY B 1 158 ? 32.022 59.685 19.954  1.00 29.83 ? 1108 GLY B C     1 
ATOM   3205 O  O     . GLY B 1 158 ? 32.102 58.946 20.936  1.00 29.03 ? 1108 GLY B O     1 
ATOM   3206 N  N     . VAL B 1 159 ? 32.533 59.365 18.769  1.00 28.53 ? 1109 VAL B N     1 
ATOM   3207 C  CA    . VAL B 1 159 ? 33.265 58.125 18.586  1.00 28.18 ? 1109 VAL B CA    1 
ATOM   3208 C  C     . VAL B 1 159 ? 34.695 58.419 18.156  1.00 28.00 ? 1109 VAL B C     1 
ATOM   3209 O  O     . VAL B 1 159 ? 34.928 59.263 17.295  1.00 28.26 ? 1109 VAL B O     1 
ATOM   3210 C  CB    . VAL B 1 159 ? 32.580 57.193 17.546  1.00 27.71 ? 1109 VAL B CB    1 
ATOM   3211 C  CG1   . VAL B 1 159 ? 33.322 55.868 17.441  1.00 27.45 ? 1109 VAL B CG1   1 
ATOM   3212 C  CG2   . VAL B 1 159 ? 31.128 56.950 17.921  1.00 27.48 ? 1109 VAL B CG2   1 
ATOM   3213 N  N     . ARG B 1 160 ? 35.645 57.720 18.759  1.00 28.64 ? 1110 ARG B N     1 
ATOM   3214 C  CA    . ARG B 1 160 ? 37.035 57.834 18.333  1.00 29.52 ? 1110 ARG B CA    1 
ATOM   3215 C  C     . ARG B 1 160 ? 37.665 56.491 17.990  1.00 29.56 ? 1110 ARG B C     1 
ATOM   3216 O  O     . ARG B 1 160 ? 37.185 55.429 18.408  1.00 29.49 ? 1110 ARG B O     1 
ATOM   3217 C  CB    . ARG B 1 160 ? 37.871 58.594 19.372  1.00 30.24 ? 1110 ARG B CB    1 
ATOM   3218 C  CG    . ARG B 1 160 ? 38.133 57.863 20.666  1.00 31.61 ? 1110 ARG B CG    1 
ATOM   3219 C  CD    . ARG B 1 160 ? 39.305 58.502 21.402  1.00 35.45 ? 1110 ARG B CD    1 
ATOM   3220 N  NE    . ARG B 1 160 ? 39.201 58.287 22.837  1.00 39.14 ? 1110 ARG B NE    1 
ATOM   3221 C  CZ    . ARG B 1 160 ? 38.968 59.243 23.732  1.00 40.44 ? 1110 ARG B CZ    1 
ATOM   3222 N  NH1   . ARG B 1 160 ? 38.832 60.513 23.356  1.00 41.59 ? 1110 ARG B NH1   1 
ATOM   3223 N  NH2   . ARG B 1 160 ? 38.885 58.921 25.013  1.00 41.54 ? 1110 ARG B NH2   1 
ATOM   3224 N  N     . SER B 1 161 ? 38.740 56.544 17.209  1.00 29.60 ? 1111 SER B N     1 
ATOM   3225 C  CA    . SER B 1 161 ? 39.560 55.373 16.962  1.00 30.12 ? 1111 SER B CA    1 
ATOM   3226 C  C     . SER B 1 161 ? 40.650 55.259 18.030  1.00 30.70 ? 1111 SER B C     1 
ATOM   3227 O  O     . SER B 1 161 ? 41.195 56.269 18.469  1.00 31.18 ? 1111 SER B O     1 
ATOM   3228 C  CB    . SER B 1 161 ? 40.190 55.445 15.567  1.00 29.91 ? 1111 SER B CB    1 
ATOM   3229 O  OG    . SER B 1 161 ? 40.947 54.276 15.309  1.00 30.84 ? 1111 SER B OG    1 
ATOM   3230 N  N     . LEU B 1 162 ? 40.960 54.033 18.445  1.00 30.86 ? 1112 LEU B N     1 
ATOM   3231 C  CA    . LEU B 1 162 ? 42.023 53.781 19.427  1.00 31.36 ? 1112 LEU B CA    1 
ATOM   3232 C  C     . LEU B 1 162 ? 43.315 53.350 18.736  1.00 31.56 ? 1112 LEU B C     1 
ATOM   3233 O  O     . LEU B 1 162 ? 44.338 53.094 19.385  1.00 32.09 ? 1112 LEU B O     1 
ATOM   3234 C  CB    . LEU B 1 162 ? 41.580 52.720 20.441  1.00 31.28 ? 1112 LEU B CB    1 
ATOM   3235 C  CG    . LEU B 1 162 ? 40.346 53.051 21.290  1.00 31.81 ? 1112 LEU B CG    1 
ATOM   3236 C  CD1   . LEU B 1 162 ? 39.917 51.843 22.101  1.00 32.43 ? 1112 LEU B CD1   1 
ATOM   3237 C  CD2   . LEU B 1 162 ? 40.586 54.270 22.203  1.00 32.12 ? 1112 LEU B CD2   1 
ATOM   3238 N  N     . GLN B 1 163 ? 43.256 53.293 17.409  1.00 31.53 ? 1113 GLN B N     1 
ATOM   3239 C  CA    . GLN B 1 163 ? 44.348 52.809 16.574  1.00 31.48 ? 1113 GLN B CA    1 
ATOM   3240 C  C     . GLN B 1 163 ? 44.446 53.683 15.328  1.00 30.83 ? 1113 GLN B C     1 
ATOM   3241 O  O     . GLN B 1 163 ? 43.475 54.350 14.952  1.00 30.44 ? 1113 GLN B O     1 
ATOM   3242 C  CB    . GLN B 1 163 ? 44.068 51.363 16.152  1.00 32.04 ? 1113 GLN B CB    1 
ATOM   3243 C  CG    . GLN B 1 163 ? 42.727 51.211 15.414  1.00 33.78 ? 1113 GLN B CG    1 
ATOM   3244 C  CD    . GLN B 1 163 ? 42.598 49.899 14.677  1.00 36.14 ? 1113 GLN B CD    1 
ATOM   3245 O  OE1   . GLN B 1 163 ? 42.253 48.870 15.265  1.00 36.59 ? 1113 GLN B OE1   1 
ATOM   3246 N  NE2   . GLN B 1 163 ? 42.866 49.928 13.373  1.00 36.37 ? 1113 GLN B NE2   1 
ATOM   3247 N  N     . ASP B 1 164 ? 45.622 53.693 14.699  1.00 30.11 ? 1114 ASP B N     1 
ATOM   3248 C  CA    . ASP B 1 164 ? 45.769 54.284 13.376  1.00 29.50 ? 1114 ASP B CA    1 
ATOM   3249 C  C     . ASP B 1 164 ? 44.866 53.515 12.399  1.00 28.32 ? 1114 ASP B C     1 
ATOM   3250 O  O     . ASP B 1 164 ? 44.877 52.279 12.370  1.00 28.27 ? 1114 ASP B O     1 
ATOM   3251 C  CB    . ASP B 1 164 ? 47.228 54.215 12.899  1.00 30.20 ? 1114 ASP B CB    1 
ATOM   3252 C  CG    . ASP B 1 164 ? 48.143 55.241 13.587  1.00 32.15 ? 1114 ASP B CG    1 
ATOM   3253 O  OD1   . ASP B 1 164 ? 47.660 56.118 14.337  1.00 33.00 ? 1114 ASP B OD1   1 
ATOM   3254 O  OD2   . ASP B 1 164 ? 49.370 55.165 13.348  1.00 35.21 ? 1114 ASP B OD2   1 
ATOM   3255 N  N     . ILE B 1 165 ? 44.086 54.257 11.621  1.00 27.01 ? 1115 ILE B N     1 
ATOM   3256 C  CA    . ILE B 1 165 ? 43.284 53.689 10.537  1.00 25.85 ? 1115 ILE B CA    1 
ATOM   3257 C  C     . ILE B 1 165 ? 43.796 54.278 9.223   1.00 25.60 ? 1115 ILE B C     1 
ATOM   3258 O  O     . ILE B 1 165 ? 43.618 55.472 8.973   1.00 24.83 ? 1115 ILE B O     1 
ATOM   3259 C  CB    . ILE B 1 165 ? 41.774 54.014 10.696  1.00 26.00 ? 1115 ILE B CB    1 
ATOM   3260 C  CG1   . ILE B 1 165 ? 41.225 53.426 12.001  1.00 25.53 ? 1115 ILE B CG1   1 
ATOM   3261 C  CG2   . ILE B 1 165 ? 40.968 53.486 9.482   1.00 25.59 ? 1115 ILE B CG2   1 
ATOM   3262 C  CD1   . ILE B 1 165 ? 39.809 53.867 12.327  1.00 24.95 ? 1115 ILE B CD1   1 
ATOM   3263 N  N     . PRO B 1 166 ? 44.416 53.435 8.376   1.00 25.59 ? 1116 PRO B N     1 
ATOM   3264 C  CA    . PRO B 1 166 ? 44.927 53.875 7.070   1.00 25.68 ? 1116 PRO B CA    1 
ATOM   3265 C  C     . PRO B 1 166 ? 43.811 54.395 6.161   1.00 25.96 ? 1116 PRO B C     1 
ATOM   3266 O  O     . PRO B 1 166 ? 42.637 54.047 6.371   1.00 25.41 ? 1116 PRO B O     1 
ATOM   3267 C  CB    . PRO B 1 166 ? 45.538 52.599 6.477   1.00 25.73 ? 1116 PRO B CB    1 
ATOM   3268 C  CG    . PRO B 1 166 ? 45.764 51.692 7.641   1.00 26.79 ? 1116 PRO B CG    1 
ATOM   3269 C  CD    . PRO B 1 166 ? 44.667 52.002 8.605   1.00 25.36 ? 1116 PRO B CD    1 
ATOM   3270 N  N     . PRO B 1 167 ? 44.159 55.224 5.154   1.00 25.61 ? 1117 PRO B N     1 
ATOM   3271 C  CA    . PRO B 1 167 ? 43.181 55.738 4.189   1.00 25.17 ? 1117 PRO B CA    1 
ATOM   3272 C  C     . PRO B 1 167 ? 42.395 54.631 3.479   1.00 24.42 ? 1117 PRO B C     1 
ATOM   3273 O  O     . PRO B 1 167 ? 42.953 53.578 3.175   1.00 24.69 ? 1117 PRO B O     1 
ATOM   3274 C  CB    . PRO B 1 167 ? 44.057 56.497 3.175   1.00 25.38 ? 1117 PRO B CB    1 
ATOM   3275 C  CG    . PRO B 1 167 ? 45.267 56.872 3.937   1.00 26.14 ? 1117 PRO B CG    1 
ATOM   3276 C  CD    . PRO B 1 167 ? 45.522 55.725 4.864   1.00 26.09 ? 1117 PRO B CD    1 
ATOM   3277 N  N     . GLY B 1 168 ? 41.106 54.873 3.245   1.00 23.92 ? 1118 GLY B N     1 
ATOM   3278 C  CA    . GLY B 1 168 ? 40.236 53.921 2.528   1.00 22.80 ? 1118 GLY B CA    1 
ATOM   3279 C  C     . GLY B 1 168 ? 39.861 52.637 3.263   1.00 22.51 ? 1118 GLY B C     1 
ATOM   3280 O  O     . GLY B 1 168 ? 39.496 51.638 2.638   1.00 22.54 ? 1118 GLY B O     1 
ATOM   3281 N  N     . THR B 1 169 ? 39.937 52.657 4.588   1.00 21.57 ? 1119 THR B N     1 
ATOM   3282 C  CA    . THR B 1 169 ? 39.607 51.490 5.408   1.00 20.53 ? 1119 THR B CA    1 
ATOM   3283 C  C     . THR B 1 169 ? 38.122 51.496 5.785   1.00 19.67 ? 1119 THR B C     1 
ATOM   3284 O  O     . THR B 1 169 ? 37.584 52.541 6.139   1.00 19.22 ? 1119 THR B O     1 
ATOM   3285 C  CB    . THR B 1 169 ? 40.446 51.479 6.713   1.00 21.26 ? 1119 THR B CB    1 
ATOM   3286 O  OG1   . THR B 1 169 ? 41.842 51.489 6.386   1.00 22.15 ? 1119 THR B OG1   1 
ATOM   3287 C  CG2   . THR B 1 169 ? 40.135 50.238 7.562   1.00 21.31 ? 1119 THR B CG2   1 
ATOM   3288 N  N     . PHE B 1 170 ? 37.467 50.332 5.720   1.00 18.67 ? 1120 PHE B N     1 
ATOM   3289 C  CA    . PHE B 1 170 ? 36.097 50.213 6.226   1.00 18.33 ? 1120 PHE B CA    1 
ATOM   3290 C  C     . PHE B 1 170 ? 36.117 50.340 7.745   1.00 18.78 ? 1120 PHE B C     1 
ATOM   3291 O  O     . PHE B 1 170 ? 36.816 49.584 8.430   1.00 19.55 ? 1120 PHE B O     1 
ATOM   3292 C  CB    . PHE B 1 170 ? 35.443 48.883 5.811   1.00 17.61 ? 1120 PHE B CB    1 
ATOM   3293 C  CG    . PHE B 1 170 ? 34.131 48.615 6.508   1.00 17.05 ? 1120 PHE B CG    1 
ATOM   3294 C  CD1   . PHE B 1 170 ? 33.039 49.442 6.294   1.00 16.74 ? 1120 PHE B CD1   1 
ATOM   3295 C  CD2   . PHE B 1 170 ? 34.013 47.554 7.402   1.00 17.27 ? 1120 PHE B CD2   1 
ATOM   3296 C  CE1   . PHE B 1 170 ? 31.835 49.214 6.964   1.00 17.62 ? 1120 PHE B CE1   1 
ATOM   3297 C  CE2   . PHE B 1 170 ? 32.818 47.312 8.071   1.00 17.92 ? 1120 PHE B CE2   1 
ATOM   3298 C  CZ    . PHE B 1 170 ? 31.728 48.152 7.858   1.00 16.69 ? 1120 PHE B CZ    1 
ATOM   3299 N  N     . VAL B 1 171 ? 35.338 51.287 8.253   1.00 19.10 ? 1121 VAL B N     1 
ATOM   3300 C  CA    . VAL B 1 171 ? 35.330 51.572 9.692   1.00 19.62 ? 1121 VAL B CA    1 
ATOM   3301 C  C     . VAL B 1 171 ? 34.093 50.997 10.388  1.00 19.66 ? 1121 VAL B C     1 
ATOM   3302 O  O     . VAL B 1 171 ? 34.216 50.191 11.313  1.00 20.99 ? 1121 VAL B O     1 
ATOM   3303 C  CB    . VAL B 1 171 ? 35.488 53.095 9.963   1.00 19.51 ? 1121 VAL B CB    1 
ATOM   3304 C  CG1   . VAL B 1 171 ? 35.443 53.368 11.441  1.00 20.93 ? 1121 VAL B CG1   1 
ATOM   3305 C  CG2   . VAL B 1 171 ? 36.812 53.611 9.375   1.00 20.06 ? 1121 VAL B CG2   1 
ATOM   3306 N  N     . CYS B 1 172 ? 32.911 51.411 9.951   1.00 19.47 ? 1122 CYS B N     1 
ATOM   3307 C  CA    . CYS B 1 172 ? 31.664 50.876 10.511  1.00 19.60 ? 1122 CYS B CA    1 
ATOM   3308 C  C     . CYS B 1 172 ? 30.486 51.102 9.558   1.00 19.01 ? 1122 CYS B C     1 
ATOM   3309 O  O     . CYS B 1 172 ? 30.579 51.878 8.603   1.00 18.37 ? 1122 CYS B O     1 
ATOM   3310 C  CB    . CYS B 1 172 ? 31.382 51.464 11.908  1.00 20.36 ? 1122 CYS B CB    1 
ATOM   3311 S  SG    . CYS B 1 172 ? 31.285 53.253 11.945  1.00 25.07 ? 1122 CYS B SG    1 
ATOM   3312 N  N     . GLU B 1 173 ? 29.386 50.398 9.817   1.00 18.44 ? 1123 GLU B N     1 
ATOM   3313 C  CA    . GLU B 1 173 ? 28.150 50.551 9.056   1.00 18.30 ? 1123 GLU B CA    1 
ATOM   3314 C  C     . GLU B 1 173 ? 27.145 51.404 9.829   1.00 18.23 ? 1123 GLU B C     1 
ATOM   3315 O  O     . GLU B 1 173 ? 27.095 51.331 11.071  1.00 18.63 ? 1123 GLU B O     1 
ATOM   3316 C  CB    . GLU B 1 173 ? 27.559 49.161 8.778   1.00 18.68 ? 1123 GLU B CB    1 
ATOM   3317 C  CG    . GLU B 1 173 ? 26.278 49.150 7.942   1.00 18.42 ? 1123 GLU B CG    1 
ATOM   3318 C  CD    . GLU B 1 173 ? 25.765 47.737 7.623   1.00 18.05 ? 1123 GLU B CD    1 
ATOM   3319 O  OE1   . GLU B 1 173 ? 26.524 46.759 7.808   1.00 20.37 ? 1123 GLU B OE1   1 
ATOM   3320 O  OE2   . GLU B 1 173 ? 24.594 47.610 7.178   1.00 18.96 ? 1123 GLU B OE2   1 
ATOM   3321 N  N     . TYR B 1 174 ? 26.347 52.195 9.112   1.00 17.59 ? 1124 TYR B N     1 
ATOM   3322 C  CA    . TYR B 1 174 ? 25.214 52.876 9.724   1.00 17.67 ? 1124 TYR B CA    1 
ATOM   3323 C  C     . TYR B 1 174 ? 24.050 51.904 9.839   1.00 17.63 ? 1124 TYR B C     1 
ATOM   3324 O  O     . TYR B 1 174 ? 23.362 51.606 8.848   1.00 16.74 ? 1124 TYR B O     1 
ATOM   3325 C  CB    . TYR B 1 174 ? 24.787 54.118 8.946   1.00 18.84 ? 1124 TYR B CB    1 
ATOM   3326 C  CG    . TYR B 1 174 ? 23.954 55.037 9.815   1.00 19.10 ? 1124 TYR B CG    1 
ATOM   3327 C  CD1   . TYR B 1 174 ? 24.573 55.907 10.718  1.00 21.03 ? 1124 TYR B CD1   1 
ATOM   3328 C  CD2   . TYR B 1 174 ? 22.559 55.004 9.776   1.00 20.26 ? 1124 TYR B CD2   1 
ATOM   3329 C  CE1   . TYR B 1 174 ? 23.822 56.745 11.538  1.00 21.44 ? 1124 TYR B CE1   1 
ATOM   3330 C  CE2   . TYR B 1 174 ? 21.790 55.849 10.606  1.00 21.17 ? 1124 TYR B CE2   1 
ATOM   3331 C  CZ    . TYR B 1 174 ? 22.441 56.713 11.478  1.00 21.48 ? 1124 TYR B CZ    1 
ATOM   3332 O  OH    . TYR B 1 174 ? 21.705 57.551 12.293  1.00 21.96 ? 1124 TYR B OH    1 
ATOM   3333 N  N     . VAL B 1 175 ? 23.843 51.419 11.055  1.00 17.30 ? 1125 VAL B N     1 
ATOM   3334 C  CA    . VAL B 1 175 ? 22.866 50.363 11.315  1.00 17.40 ? 1125 VAL B CA    1 
ATOM   3335 C  C     . VAL B 1 175 ? 21.677 50.913 12.105  1.00 18.22 ? 1125 VAL B C     1 
ATOM   3336 O  O     . VAL B 1 175 ? 21.841 51.769 12.979  1.00 18.72 ? 1125 VAL B O     1 
ATOM   3337 C  CB    . VAL B 1 175 ? 23.534 49.201 12.090  1.00 18.18 ? 1125 VAL B CB    1 
ATOM   3338 C  CG1   . VAL B 1 175 ? 22.497 48.324 12.781  1.00 18.84 ? 1125 VAL B CG1   1 
ATOM   3339 C  CG2   . VAL B 1 175 ? 24.414 48.380 11.156  1.00 17.58 ? 1125 VAL B CG2   1 
ATOM   3340 N  N     . GLY B 1 176 ? 20.486 50.415 11.803  1.00 17.59 ? 1126 GLY B N     1 
ATOM   3341 C  CA    . GLY B 1 176 ? 19.296 50.811 12.547  1.00 18.62 ? 1126 GLY B CA    1 
ATOM   3342 C  C     . GLY B 1 176 ? 18.045 50.138 12.042  1.00 18.56 ? 1126 GLY B C     1 
ATOM   3343 O  O     . GLY B 1 176 ? 18.095 49.066 11.434  1.00 19.20 ? 1126 GLY B O     1 
ATOM   3344 N  N     . GLU B 1 177 ? 16.918 50.790 12.293  1.00 18.56 ? 1127 GLU B N     1 
ATOM   3345 C  CA    . GLU B 1 177 ? 15.610 50.302 11.887  1.00 19.27 ? 1127 GLU B CA    1 
ATOM   3346 C  C     . GLU B 1 177 ? 15.308 50.783 10.470  1.00 19.68 ? 1127 GLU B C     1 
ATOM   3347 O  O     . GLU B 1 177 ? 15.326 51.981 10.198  1.00 19.49 ? 1127 GLU B O     1 
ATOM   3348 C  CB    . GLU B 1 177 ? 14.572 50.859 12.873  1.00 19.05 ? 1127 GLU B CB    1 
ATOM   3349 C  CG    . GLU B 1 177 ? 13.149 50.337 12.702  1.00 19.69 ? 1127 GLU B CG    1 
ATOM   3350 C  CD    . GLU B 1 177 ? 12.155 51.089 13.583  1.00 20.68 ? 1127 GLU B CD    1 
ATOM   3351 O  OE1   . GLU B 1 177 ? 12.592 51.819 14.504  1.00 22.94 ? 1127 GLU B OE1   1 
ATOM   3352 O  OE2   . GLU B 1 177 ? 10.945 50.949 13.344  1.00 23.45 ? 1127 GLU B OE2   1 
ATOM   3353 N  N     . LEU B 1 178 ? 15.031 49.854 9.564   1.00 19.63 ? 1128 LEU B N     1 
ATOM   3354 C  CA    . LEU B 1 178 ? 14.681 50.222 8.197   1.00 20.19 ? 1128 LEU B CA    1 
ATOM   3355 C  C     . LEU B 1 178 ? 13.198 50.595 8.119   1.00 20.42 ? 1128 LEU B C     1 
ATOM   3356 O  O     . LEU B 1 178 ? 12.329 49.775 8.442   1.00 20.45 ? 1128 LEU B O     1 
ATOM   3357 C  CB    . LEU B 1 178 ? 15.018 49.049 7.273   1.00 20.49 ? 1128 LEU B CB    1 
ATOM   3358 C  CG    . LEU B 1 178 ? 14.740 49.149 5.782   1.00 23.09 ? 1128 LEU B CG    1 
ATOM   3359 C  CD1   . LEU B 1 178 ? 15.484 50.322 5.142   1.00 25.06 ? 1128 LEU B CD1   1 
ATOM   3360 C  CD2   . LEU B 1 178 ? 15.159 47.826 5.149   1.00 25.10 ? 1128 LEU B CD2   1 
ATOM   3361 N  N     . ILE B 1 179 ? 12.916 51.828 7.694   1.00 20.59 ? 1129 ILE B N     1 
ATOM   3362 C  CA    . ILE B 1 179 ? 11.538 52.346 7.633   1.00 20.99 ? 1129 ILE B CA    1 
ATOM   3363 C  C     . ILE B 1 179 ? 11.252 53.094 6.325   1.00 21.86 ? 1129 ILE B C     1 
ATOM   3364 O  O     . ILE B 1 179 ? 12.178 53.471 5.613   1.00 21.73 ? 1129 ILE B O     1 
ATOM   3365 C  CB    . ILE B 1 179 ? 11.252 53.298 8.829   1.00 20.77 ? 1129 ILE B CB    1 
ATOM   3366 C  CG1   . ILE B 1 179 ? 12.135 54.551 8.751   1.00 21.38 ? 1129 ILE B CG1   1 
ATOM   3367 C  CG2   . ILE B 1 179 ? 11.464 52.566 10.158  1.00 20.84 ? 1129 ILE B CG2   1 
ATOM   3368 C  CD1   . ILE B 1 179 ? 11.838 55.585 9.830   1.00 21.78 ? 1129 ILE B CD1   1 
ATOM   3369 N  N     . SER B 1 180 ? 9.972  53.303 6.020   1.00 22.99 ? 1130 SER B N     1 
ATOM   3370 C  CA    . SER B 1 180 ? 9.591  54.059 4.823   1.00 25.16 ? 1130 SER B CA    1 
ATOM   3371 C  C     . SER B 1 180 ? 9.829  55.552 5.022   1.00 26.16 ? 1130 SER B C     1 
ATOM   3372 O  O     . SER B 1 180 ? 9.932  56.039 6.154   1.00 26.22 ? 1130 SER B O     1 
ATOM   3373 C  CB    . SER B 1 180 ? 8.122  53.818 4.458   1.00 24.96 ? 1130 SER B CB    1 
ATOM   3374 O  OG    . SER B 1 180 ? 7.246  54.386 5.428   1.00 26.55 ? 1130 SER B OG    1 
ATOM   3375 N  N     . ASP B 1 181 ? 9.912  56.270 3.907   1.00 28.15 ? 1131 ASP B N     1 
ATOM   3376 C  CA    . ASP B 1 181 ? 10.009 57.731 3.923   1.00 29.96 ? 1131 ASP B CA    1 
ATOM   3377 C  C     . ASP B 1 181 ? 8.829  58.367 4.672   1.00 30.60 ? 1131 ASP B C     1 
ATOM   3378 O  O     . ASP B 1 181 ? 9.016  59.318 5.431   1.00 30.95 ? 1131 ASP B O     1 
ATOM   3379 C  CB    . ASP B 1 181 ? 10.088 58.262 2.489   1.00 30.31 ? 1131 ASP B CB    1 
ATOM   3380 C  CG    . ASP B 1 181 ? 10.297 59.762 2.427   1.00 32.92 ? 1131 ASP B CG    1 
ATOM   3381 O  OD1   . ASP B 1 181 ? 11.137 60.292 3.190   1.00 35.02 ? 1131 ASP B OD1   1 
ATOM   3382 O  OD2   . ASP B 1 181 ? 9.620  60.408 1.597   1.00 35.85 ? 1131 ASP B OD2   1 
ATOM   3383 N  N     . SER B 1 182 ? 7.628  57.827 4.463   1.00 31.75 ? 1132 SER B N     1 
ATOM   3384 C  CA    . SER B 1 182 ? 6.413  58.335 5.119   1.00 32.74 ? 1132 SER B CA    1 
ATOM   3385 C  C     . SER B 1 182 ? 6.425  58.118 6.635   1.00 33.12 ? 1132 SER B C     1 
ATOM   3386 O  O     . SER B 1 182 ? 5.983  58.986 7.396   1.00 33.50 ? 1132 SER B O     1 
ATOM   3387 C  CB    . SER B 1 182 ? 5.155  57.728 4.495   1.00 32.84 ? 1132 SER B CB    1 
ATOM   3388 O  OG    . SER B 1 182 ? 5.101  56.321 4.685   1.00 34.53 ? 1132 SER B OG    1 
ATOM   3389 N  N     . GLU B 1 183 ? 6.936  56.964 7.067   1.00 32.97 ? 1133 GLU B N     1 
ATOM   3390 C  CA    . GLU B 1 183 ? 7.135  56.695 8.491   1.00 33.07 ? 1133 GLU B CA    1 
ATOM   3391 C  C     . GLU B 1 183 ? 8.190  57.632 9.086   1.00 33.48 ? 1133 GLU B C     1 
ATOM   3392 O  O     . GLU B 1 183 ? 8.016  58.131 10.196  1.00 33.19 ? 1133 GLU B O     1 
ATOM   3393 C  CB    . GLU B 1 183 ? 7.494  55.220 8.733   1.00 33.15 ? 1133 GLU B CB    1 
ATOM   3394 C  CG    . GLU B 1 183 ? 7.823  54.846 10.188  1.00 33.32 ? 1133 GLU B CG    1 
ATOM   3395 C  CD    . GLU B 1 183 ? 6.683  55.096 11.181  1.00 34.24 ? 1133 GLU B CD    1 
ATOM   3396 O  OE1   . GLU B 1 183 ? 5.493  55.048 10.791  1.00 35.12 ? 1133 GLU B OE1   1 
ATOM   3397 O  OE2   . GLU B 1 183 ? 6.986  55.323 12.370  1.00 34.10 ? 1133 GLU B OE2   1 
ATOM   3398 N  N     . ALA B 1 184 ? 9.262  57.885 8.334   1.00 33.63 ? 1134 ALA B N     1 
ATOM   3399 C  CA    . ALA B 1 184 ? 10.327 58.801 8.763   1.00 34.58 ? 1134 ALA B CA    1 
ATOM   3400 C  C     . ALA B 1 184 ? 9.811  60.214 9.056   1.00 35.35 ? 1134 ALA B C     1 
ATOM   3401 O  O     . ALA B 1 184 ? 10.303 60.887 9.970   1.00 35.49 ? 1134 ALA B O     1 
ATOM   3402 C  CB    . ALA B 1 184 ? 11.432 58.855 7.725   1.00 34.25 ? 1134 ALA B CB    1 
ATOM   3403 N  N     . ASP B 1 185 ? 8.815  60.644 8.283   1.00 36.43 ? 1135 ASP B N     1 
ATOM   3404 C  CA    . ASP B 1 185 ? 8.259  61.996 8.404   1.00 37.61 ? 1135 ASP B CA    1 
ATOM   3405 C  C     . ASP B 1 185 ? 7.439  62.226 9.674   1.00 38.01 ? 1135 ASP B C     1 
ATOM   3406 O  O     . ASP B 1 185 ? 7.353  63.359 10.149  1.00 38.61 ? 1135 ASP B O     1 
ATOM   3407 C  CB    . ASP B 1 185 ? 7.431  62.358 7.167   1.00 37.78 ? 1135 ASP B CB    1 
ATOM   3408 C  CG    . ASP B 1 185 ? 8.256  63.045 6.084   1.00 39.39 ? 1135 ASP B CG    1 
ATOM   3409 O  OD1   . ASP B 1 185 ? 9.203  63.800 6.418   1.00 40.62 ? 1135 ASP B OD1   1 
ATOM   3410 O  OD2   . ASP B 1 185 ? 7.945  62.845 4.889   1.00 40.79 ? 1135 ASP B OD2   1 
ATOM   3411 N  N     . VAL B 1 186 ? 6.832  61.170 10.215  1.00 38.43 ? 1136 VAL B N     1 
ATOM   3412 C  CA    . VAL B 1 186 ? 6.018  61.294 11.438  1.00 38.62 ? 1136 VAL B CA    1 
ATOM   3413 C  C     . VAL B 1 186 ? 6.803  60.992 12.720  1.00 38.66 ? 1136 VAL B C     1 
ATOM   3414 O  O     . VAL B 1 186 ? 6.293  61.195 13.828  1.00 39.07 ? 1136 VAL B O     1 
ATOM   3415 C  CB    . VAL B 1 186 ? 4.714  60.433 11.395  1.00 38.85 ? 1136 VAL B CB    1 
ATOM   3416 C  CG1   . VAL B 1 186 ? 3.811  60.862 10.241  1.00 39.16 ? 1136 VAL B CG1   1 
ATOM   3417 C  CG2   . VAL B 1 186 ? 5.027  58.937 11.326  1.00 38.57 ? 1136 VAL B CG2   1 
ATOM   3418 N  N     . ARG B 1 187 ? 8.035  60.508 12.567  1.00 38.46 ? 1137 ARG B N     1 
ATOM   3419 C  CA    . ARG B 1 187 ? 8.901  60.208 13.709  1.00 38.07 ? 1137 ARG B CA    1 
ATOM   3420 C  C     . ARG B 1 187 ? 9.144  61.464 14.550  1.00 38.51 ? 1137 ARG B C     1 
ATOM   3421 O  O     . ARG B 1 187 ? 9.504  62.513 14.013  1.00 38.43 ? 1137 ARG B O     1 
ATOM   3422 C  CB    . ARG B 1 187 ? 10.235 59.599 13.241  1.00 37.69 ? 1137 ARG B CB    1 
ATOM   3423 C  CG    . ARG B 1 187 ? 10.140 58.145 12.720  1.00 35.50 ? 1137 ARG B CG    1 
ATOM   3424 C  CD    . ARG B 1 187 ? 10.238 57.125 13.851  1.00 31.18 ? 1137 ARG B CD    1 
ATOM   3425 N  NE    . ARG B 1 187 ? 9.639  55.825 13.520  1.00 28.89 ? 1137 ARG B NE    1 
ATOM   3426 C  CZ    . ARG B 1 187 ? 10.284 54.659 13.552  1.00 27.98 ? 1137 ARG B CZ    1 
ATOM   3427 N  NH1   . ARG B 1 187 ? 11.568 54.604 13.895  1.00 25.63 ? 1137 ARG B NH1   1 
ATOM   3428 N  NH2   . ARG B 1 187 ? 9.636  53.537 13.260  1.00 25.57 ? 1137 ARG B NH2   1 
ATOM   3429 N  N     . GLU B 1 188 ? 8.925  61.347 15.860  1.00 38.92 ? 1138 GLU B N     1 
ATOM   3430 C  CA    . GLU B 1 188 ? 9.139  62.451 16.810  1.00 39.68 ? 1138 GLU B CA    1 
ATOM   3431 C  C     . GLU B 1 188 ? 10.583 62.983 16.761  1.00 39.06 ? 1138 GLU B C     1 
ATOM   3432 O  O     . GLU B 1 188 ? 10.798 64.189 16.624  1.00 39.16 ? 1138 GLU B O     1 
ATOM   3433 C  CB    . GLU B 1 188 ? 8.763  62.005 18.234  1.00 39.57 ? 1138 GLU B CB    1 
ATOM   3434 C  CG    . GLU B 1 188 ? 8.825  63.100 19.302  1.00 41.31 ? 1138 GLU B CG    1 
ATOM   3435 C  CD    . GLU B 1 188 ? 8.779  62.552 20.735  1.00 41.68 ? 1138 GLU B CD    1 
ATOM   3436 O  OE1   . GLU B 1 188 ? 8.170  61.479 20.965  1.00 44.57 ? 1138 GLU B OE1   1 
ATOM   3437 O  OE2   . GLU B 1 188 ? 9.352  63.204 21.640  1.00 44.71 ? 1138 GLU B OE2   1 
ATOM   3438 N  N     . GLU B 1 189 ? 11.558 62.079 16.871  1.00 38.30 ? 1139 GLU B N     1 
ATOM   3439 C  CA    . GLU B 1 189 ? 12.972 62.434 16.807  1.00 37.53 ? 1139 GLU B CA    1 
ATOM   3440 C  C     . GLU B 1 189 ? 13.535 62.120 15.424  1.00 36.81 ? 1139 GLU B C     1 
ATOM   3441 O  O     . GLU B 1 189 ? 13.462 60.980 14.950  1.00 36.48 ? 1139 GLU B O     1 
ATOM   3442 C  CB    . GLU B 1 189 ? 13.759 61.706 17.902  1.00 37.82 ? 1139 GLU B CB    1 
ATOM   3443 C  CG    . GLU B 1 189 ? 15.285 61.748 17.754  1.00 39.60 ? 1139 GLU B CG    1 
ATOM   3444 C  CD    . GLU B 1 189 ? 15.899 63.112 18.078  1.00 41.74 ? 1139 GLU B CD    1 
ATOM   3445 O  OE1   . GLU B 1 189 ? 16.462 63.255 19.186  1.00 43.22 ? 1139 GLU B OE1   1 
ATOM   3446 O  OE2   . GLU B 1 189 ? 15.829 64.032 17.227  1.00 41.96 ? 1139 GLU B OE2   1 
ATOM   3447 N  N     . ASP B 1 190 ? 14.095 63.141 14.782  1.00 35.51 ? 1140 ASP B N     1 
ATOM   3448 C  CA    . ASP B 1 190 ? 14.585 63.017 13.411  1.00 34.45 ? 1140 ASP B CA    1 
ATOM   3449 C  C     . ASP B 1 190 ? 16.115 63.038 13.289  1.00 33.66 ? 1140 ASP B C     1 
ATOM   3450 O  O     . ASP B 1 190 ? 16.653 62.957 12.178  1.00 33.82 ? 1140 ASP B O     1 
ATOM   3451 C  CB    . ASP B 1 190 ? 13.955 64.099 12.523  1.00 34.77 ? 1140 ASP B CB    1 
ATOM   3452 C  CG    . ASP B 1 190 ? 14.285 65.509 12.984  1.00 34.93 ? 1140 ASP B CG    1 
ATOM   3453 O  OD1   . ASP B 1 190 ? 14.654 65.689 14.165  1.00 36.16 ? 1140 ASP B OD1   1 
ATOM   3454 O  OD2   . ASP B 1 190 ? 14.172 66.438 12.158  1.00 36.28 ? 1140 ASP B OD2   1 
ATOM   3455 N  N     . SER B 1 191 ? 16.807 63.114 14.427  1.00 32.47 ? 1141 SER B N     1 
ATOM   3456 C  CA    . SER B 1 191 ? 18.266 63.277 14.445  1.00 31.35 ? 1141 SER B CA    1 
ATOM   3457 C  C     . SER B 1 191 ? 19.068 62.043 14.034  1.00 30.42 ? 1141 SER B C     1 
ATOM   3458 O  O     . SER B 1 191 ? 20.270 62.150 13.783  1.00 30.00 ? 1141 SER B O     1 
ATOM   3459 C  CB    . SER B 1 191 ? 18.740 63.730 15.825  1.00 31.69 ? 1141 SER B CB    1 
ATOM   3460 O  OG    . SER B 1 191 ? 18.170 64.980 16.167  1.00 32.05 ? 1141 SER B OG    1 
ATOM   3461 N  N     . TYR B 1 192 ? 18.411 60.885 13.985  1.00 29.21 ? 1142 TYR B N     1 
ATOM   3462 C  CA    . TYR B 1 192 ? 19.096 59.619 13.695  1.00 28.44 ? 1142 TYR B CA    1 
ATOM   3463 C  C     . TYR B 1 192 ? 18.677 58.994 12.367  1.00 27.70 ? 1142 TYR B C     1 
ATOM   3464 O  O     . TYR B 1 192 ? 19.034 57.844 12.074  1.00 26.70 ? 1142 TYR B O     1 
ATOM   3465 C  CB    . TYR B 1 192 ? 18.887 58.629 14.843  1.00 29.24 ? 1142 TYR B CB    1 
ATOM   3466 C  CG    . TYR B 1 192 ? 19.433 59.109 16.162  1.00 29.14 ? 1142 TYR B CG    1 
ATOM   3467 C  CD1   . TYR B 1 192 ? 20.790 58.994 16.456  1.00 29.33 ? 1142 TYR B CD1   1 
ATOM   3468 C  CD2   . TYR B 1 192 ? 18.591 59.681 17.119  1.00 29.76 ? 1142 TYR B CD2   1 
ATOM   3469 C  CE1   . TYR B 1 192 ? 21.303 59.437 17.663  1.00 30.11 ? 1142 TYR B CE1   1 
ATOM   3470 C  CE2   . TYR B 1 192 ? 19.092 60.121 18.339  1.00 30.14 ? 1142 TYR B CE2   1 
ATOM   3471 C  CZ    . TYR B 1 192 ? 20.455 60.001 18.599  1.00 30.05 ? 1142 TYR B CZ    1 
ATOM   3472 O  OH    . TYR B 1 192 ? 20.983 60.428 19.793  1.00 31.04 ? 1142 TYR B OH    1 
ATOM   3473 N  N     . LEU B 1 193 ? 17.924 59.751 11.574  1.00 26.82 ? 1143 LEU B N     1 
ATOM   3474 C  CA    . LEU B 1 193 ? 17.475 59.291 10.266  1.00 26.63 ? 1143 LEU B CA    1 
ATOM   3475 C  C     . LEU B 1 193 ? 18.580 59.425 9.225   1.00 26.12 ? 1143 LEU B C     1 
ATOM   3476 O  O     . LEU B 1 193 ? 19.285 60.435 9.182   1.00 26.07 ? 1143 LEU B O     1 
ATOM   3477 C  CB    . LEU B 1 193 ? 16.233 60.064 9.806   1.00 26.55 ? 1143 LEU B CB    1 
ATOM   3478 C  CG    . LEU B 1 193 ? 14.955 59.985 10.644  1.00 26.99 ? 1143 LEU B CG    1 
ATOM   3479 C  CD1   . LEU B 1 193 ? 14.004 61.082 10.226  1.00 27.92 ? 1143 LEU B CD1   1 
ATOM   3480 C  CD2   . LEU B 1 193 ? 14.282 58.617 10.528  1.00 27.77 ? 1143 LEU B CD2   1 
ATOM   3481 N  N     . PHE B 1 194 ? 18.722 58.393 8.396   1.00 25.32 ? 1144 PHE B N     1 
ATOM   3482 C  CA    . PHE B 1 194 ? 19.644 58.401 7.269   1.00 24.92 ? 1144 PHE B CA    1 
ATOM   3483 C  C     . PHE B 1 194 ? 18.880 57.984 6.013   1.00 25.45 ? 1144 PHE B C     1 
ATOM   3484 O  O     . PHE B 1 194 ? 18.361 56.871 5.940   1.00 24.58 ? 1144 PHE B O     1 
ATOM   3485 C  CB    . PHE B 1 194 ? 20.810 57.434 7.526   1.00 24.44 ? 1144 PHE B CB    1 
ATOM   3486 C  CG    . PHE B 1 194 ? 22.038 57.708 6.691   1.00 24.18 ? 1144 PHE B CG    1 
ATOM   3487 C  CD1   . PHE B 1 194 ? 23.236 58.079 7.301   1.00 23.24 ? 1144 PHE B CD1   1 
ATOM   3488 C  CD2   . PHE B 1 194 ? 22.000 57.588 5.300   1.00 23.60 ? 1144 PHE B CD2   1 
ATOM   3489 C  CE1   . PHE B 1 194 ? 24.378 58.330 6.536   1.00 24.16 ? 1144 PHE B CE1   1 
ATOM   3490 C  CE2   . PHE B 1 194 ? 23.132 57.845 4.532   1.00 23.40 ? 1144 PHE B CE2   1 
ATOM   3491 C  CZ    . PHE B 1 194 ? 24.326 58.220 5.157   1.00 23.64 ? 1144 PHE B CZ    1 
ATOM   3492 N  N     . ASP B 1 195 ? 18.802 58.886 5.030   1.00 25.77 ? 1145 ASP B N     1 
ATOM   3493 C  CA    . ASP B 1 195 ? 18.146 58.599 3.747   1.00 26.81 ? 1145 ASP B CA    1 
ATOM   3494 C  C     . ASP B 1 195 ? 18.960 57.648 2.878   1.00 26.58 ? 1145 ASP B C     1 
ATOM   3495 O  O     . ASP B 1 195 ? 20.168 57.828 2.707   1.00 26.74 ? 1145 ASP B O     1 
ATOM   3496 C  CB    . ASP B 1 195 ? 17.907 59.899 2.969   1.00 27.28 ? 1145 ASP B CB    1 
ATOM   3497 C  CG    . ASP B 1 195 ? 16.595 60.577 3.330   1.00 29.75 ? 1145 ASP B CG    1 
ATOM   3498 O  OD1   . ASP B 1 195 ? 15.842 60.054 4.176   1.00 32.24 ? 1145 ASP B OD1   1 
ATOM   3499 O  OD2   . ASP B 1 195 ? 16.314 61.660 2.760   1.00 34.42 ? 1145 ASP B OD2   1 
ATOM   3500 N  N     . LEU B 1 196 ? 18.290 56.648 2.311   1.00 26.79 ? 1146 LEU B N     1 
ATOM   3501 C  CA    . LEU B 1 196 ? 18.963 55.626 1.501   1.00 27.04 ? 1146 LEU B CA    1 
ATOM   3502 C  C     . LEU B 1 196 ? 19.066 55.945 0.000   1.00 28.01 ? 1146 LEU B C     1 
ATOM   3503 O  O     . LEU B 1 196 ? 18.713 57.038 -0.454  1.00 29.92 ? 1146 LEU B O     1 
ATOM   3504 C  CB    . LEU B 1 196 ? 18.304 54.259 1.711   1.00 26.66 ? 1146 LEU B CB    1 
ATOM   3505 C  CG    . LEU B 1 196 ? 18.391 53.670 3.127   1.00 25.71 ? 1146 LEU B CG    1 
ATOM   3506 C  CD1   . LEU B 1 196 ? 17.800 52.275 3.130   1.00 25.23 ? 1146 LEU B CD1   1 
ATOM   3507 C  CD2   . LEU B 1 196 ? 19.836 53.648 3.639   1.00 25.43 ? 1146 LEU B CD2   1 
ATOM   3508 N  N     . VAL B 1 203 ? 11.258 55.451 -1.580  1.00 29.70 ? 1153 VAL B N     1 
ATOM   3509 C  CA    . VAL B 1 203 ? 12.464 55.888 -0.879  1.00 29.20 ? 1153 VAL B CA    1 
ATOM   3510 C  C     . VAL B 1 203 ? 12.408 55.468 0.596   1.00 28.18 ? 1153 VAL B C     1 
ATOM   3511 O  O     . VAL B 1 203 ? 11.372 55.621 1.258   1.00 28.72 ? 1153 VAL B O     1 
ATOM   3512 C  CB    . VAL B 1 203 ? 12.675 57.420 -1.044  1.00 29.47 ? 1153 VAL B CB    1 
ATOM   3513 C  CG1   . VAL B 1 203 ? 13.577 57.999 0.045   1.00 30.08 ? 1153 VAL B CG1   1 
ATOM   3514 C  CG2   . VAL B 1 203 ? 13.227 57.716 -2.437  1.00 30.41 ? 1153 VAL B CG2   1 
ATOM   3515 N  N     . TYR B 1 204 ? 13.522 54.932 1.095   1.00 26.36 ? 1154 TYR B N     1 
ATOM   3516 C  CA    . TYR B 1 204 ? 13.571 54.385 2.446   1.00 24.77 ? 1154 TYR B CA    1 
ATOM   3517 C  C     . TYR B 1 204 ? 14.632 55.024 3.320   1.00 24.12 ? 1154 TYR B C     1 
ATOM   3518 O  O     . TYR B 1 204 ? 15.497 55.756 2.836   1.00 23.95 ? 1154 TYR B O     1 
ATOM   3519 C  CB    . TYR B 1 204 ? 13.734 52.859 2.402   1.00 24.55 ? 1154 TYR B CB    1 
ATOM   3520 C  CG    . TYR B 1 204 ? 12.547 52.184 1.769   1.00 24.19 ? 1154 TYR B CG    1 
ATOM   3521 C  CD1   . TYR B 1 204 ? 11.482 51.734 2.544   1.00 23.56 ? 1154 TYR B CD1   1 
ATOM   3522 C  CD2   . TYR B 1 204 ? 12.474 52.016 0.385   1.00 25.17 ? 1154 TYR B CD2   1 
ATOM   3523 C  CE1   . TYR B 1 204 ? 10.377 51.125 1.956   1.00 24.34 ? 1154 TYR B CE1   1 
ATOM   3524 C  CE2   . TYR B 1 204 ? 11.383 51.414 -0.211  1.00 24.09 ? 1154 TYR B CE2   1 
ATOM   3525 C  CZ    . TYR B 1 204 ? 10.334 50.975 0.574   1.00 24.25 ? 1154 TYR B CZ    1 
ATOM   3526 O  OH    . TYR B 1 204 ? 9.246  50.365 -0.008  1.00 25.87 ? 1154 TYR B OH    1 
ATOM   3527 N  N     A CYS B 1 205 ? 14.532 54.772 4.623   0.50 23.43 ? 1155 CYS B N     1 
ATOM   3528 N  N     B CYS B 1 205 ? 14.572 54.710 4.609   0.50 23.80 ? 1155 CYS B N     1 
ATOM   3529 C  CA    A CYS B 1 205 ? 15.420 55.378 5.613   0.50 23.09 ? 1155 CYS B CA    1 
ATOM   3530 C  CA    B CYS B 1 205 ? 15.389 55.375 5.608   0.50 23.14 ? 1155 CYS B CA    1 
ATOM   3531 C  C     A CYS B 1 205 ? 15.884 54.353 6.632   0.50 22.44 ? 1155 CYS B C     1 
ATOM   3532 C  C     B CYS B 1 205 ? 15.847 54.393 6.682   0.50 22.53 ? 1155 CYS B C     1 
ATOM   3533 O  O     A CYS B 1 205 ? 15.201 53.359 6.882   0.50 21.81 ? 1155 CYS B O     1 
ATOM   3534 O  O     B CYS B 1 205 ? 15.125 53.450 7.009   0.50 21.87 ? 1155 CYS B O     1 
ATOM   3535 C  CB    A CYS B 1 205 ? 14.702 56.501 6.366   0.50 23.52 ? 1155 CYS B CB    1 
ATOM   3536 C  CB    B CYS B 1 205 ? 14.563 56.487 6.252   0.50 23.61 ? 1155 CYS B CB    1 
ATOM   3537 S  SG    A CYS B 1 205 ? 14.063 57.816 5.335   0.50 25.87 ? 1155 CYS B SG    1 
ATOM   3538 S  SG    B CYS B 1 205 ? 15.513 57.629 7.226   0.50 25.28 ? 1155 CYS B SG    1 
ATOM   3539 N  N     . ILE B 1 206 ? 17.043 54.618 7.224   1.00 21.86 ? 1156 ILE B N     1 
ATOM   3540 C  CA    . ILE B 1 206 ? 17.494 53.892 8.408   1.00 21.53 ? 1156 ILE B CA    1 
ATOM   3541 C  C     . ILE B 1 206 ? 17.313 54.852 9.581   1.00 21.78 ? 1156 ILE B C     1 
ATOM   3542 O  O     . ILE B 1 206 ? 17.877 55.953 9.572   1.00 22.07 ? 1156 ILE B O     1 
ATOM   3543 C  CB    . ILE B 1 206 ? 18.977 53.475 8.309   1.00 21.52 ? 1156 ILE B CB    1 
ATOM   3544 C  CG1   . ILE B 1 206 ? 19.167 52.466 7.176   1.00 21.07 ? 1156 ILE B CG1   1 
ATOM   3545 C  CG2   . ILE B 1 206 ? 19.462 52.896 9.626   1.00 20.59 ? 1156 ILE B CG2   1 
ATOM   3546 C  CD1   . ILE B 1 206 ? 20.625 52.142 6.861   1.00 22.12 ? 1156 ILE B CD1   1 
ATOM   3547 N  N     . ASP B 1 207 ? 16.527 54.440 10.572  1.00 21.27 ? 1157 ASP B N     1 
ATOM   3548 C  CA    . ASP B 1 207 ? 16.364 55.221 11.805  1.00 21.58 ? 1157 ASP B CA    1 
ATOM   3549 C  C     . ASP B 1 207 ? 17.127 54.533 12.937  1.00 21.31 ? 1157 ASP B C     1 
ATOM   3550 O  O     . ASP B 1 207 ? 16.790 53.405 13.345  1.00 20.68 ? 1157 ASP B O     1 
ATOM   3551 C  CB    . ASP B 1 207 ? 14.882 55.393 12.180  1.00 21.92 ? 1157 ASP B CB    1 
ATOM   3552 C  CG    . ASP B 1 207 ? 14.670 56.411 13.322  1.00 22.55 ? 1157 ASP B CG    1 
ATOM   3553 O  OD1   . ASP B 1 207 ? 15.660 57.023 13.788  1.00 22.41 ? 1157 ASP B OD1   1 
ATOM   3554 O  OD2   . ASP B 1 207 ? 13.506 56.597 13.753  1.00 25.20 ? 1157 ASP B OD2   1 
ATOM   3555 N  N     . ALA B 1 208 ? 18.167 55.208 13.425  1.00 21.24 ? 1158 ALA B N     1 
ATOM   3556 C  CA    . ALA B 1 208 ? 19.007 54.658 14.479  1.00 21.33 ? 1158 ALA B CA    1 
ATOM   3557 C  C     . ALA B 1 208 ? 18.587 55.122 15.878  1.00 21.59 ? 1158 ALA B C     1 
ATOM   3558 O  O     . ALA B 1 208 ? 19.306 54.878 16.848  1.00 22.28 ? 1158 ALA B O     1 
ATOM   3559 C  CB    . ALA B 1 208 ? 20.490 54.963 14.225  1.00 21.62 ? 1158 ALA B CB    1 
ATOM   3560 N  N     . ARG B 1 209 ? 17.424 55.768 15.977  1.00 22.06 ? 1159 ARG B N     1 
ATOM   3561 C  CA    . ARG B 1 209 ? 16.942 56.284 17.271  1.00 22.50 ? 1159 ARG B CA    1 
ATOM   3562 C  C     . ARG B 1 209 ? 16.670 55.186 18.313  1.00 22.55 ? 1159 ARG B C     1 
ATOM   3563 O  O     . ARG B 1 209 ? 17.206 55.239 19.429  1.00 22.44 ? 1159 ARG B O     1 
ATOM   3564 C  CB    . ARG B 1 209 ? 15.703 57.177 17.077  1.00 22.57 ? 1159 ARG B CB    1 
ATOM   3565 C  CG    . ARG B 1 209 ? 14.903 57.466 18.349  1.00 24.23 ? 1159 ARG B CG    1 
ATOM   3566 C  CD    . ARG B 1 209 ? 15.683 58.292 19.360  1.00 25.49 ? 1159 ARG B CD    1 
ATOM   3567 N  NE    . ARG B 1 209 ? 14.916 58.440 20.599  1.00 27.97 ? 1159 ARG B NE    1 
ATOM   3568 C  CZ    . ARG B 1 209 ? 14.973 57.605 21.635  1.00 28.46 ? 1159 ARG B CZ    1 
ATOM   3569 N  NH1   . ARG B 1 209 ? 15.776 56.547 21.619  1.00 27.06 ? 1159 ARG B NH1   1 
ATOM   3570 N  NH2   . ARG B 1 209 ? 14.223 57.839 22.706  1.00 29.64 ? 1159 ARG B NH2   1 
ATOM   3571 N  N     . PHE B 1 210 ? 15.845 54.205 17.951  1.00 22.47 ? 1160 PHE B N     1 
ATOM   3572 C  CA    . PHE B 1 210 ? 15.431 53.154 18.897  1.00 21.98 ? 1160 PHE B CA    1 
ATOM   3573 C  C     . PHE B 1 210 ? 16.324 51.917 18.860  1.00 21.69 ? 1160 PHE B C     1 
ATOM   3574 O  O     . PHE B 1 210 ? 16.546 51.275 19.890  1.00 21.78 ? 1160 PHE B O     1 
ATOM   3575 C  CB    . PHE B 1 210 ? 13.965 52.764 18.681  1.00 22.96 ? 1160 PHE B CB    1 
ATOM   3576 C  CG    . PHE B 1 210 ? 13.018 53.932 18.753  1.00 23.87 ? 1160 PHE B CG    1 
ATOM   3577 C  CD1   . PHE B 1 210 ? 12.658 54.477 19.989  1.00 26.44 ? 1160 PHE B CD1   1 
ATOM   3578 C  CD2   . PHE B 1 210 ? 12.500 54.496 17.590  1.00 25.29 ? 1160 PHE B CD2   1 
ATOM   3579 C  CE1   . PHE B 1 210 ? 11.794 55.568 20.055  1.00 26.96 ? 1160 PHE B CE1   1 
ATOM   3580 C  CE2   . PHE B 1 210 ? 11.626 55.579 17.647  1.00 27.62 ? 1160 PHE B CE2   1 
ATOM   3581 C  CZ    . PHE B 1 210 ? 11.276 56.119 18.888  1.00 26.94 ? 1160 PHE B CZ    1 
ATOM   3582 N  N     . TYR B 1 211 ? 16.825 51.595 17.662  1.00 20.91 ? 1161 TYR B N     1 
ATOM   3583 C  CA    . TYR B 1 211 ? 17.731 50.476 17.444  1.00 20.45 ? 1161 TYR B CA    1 
ATOM   3584 C  C     . TYR B 1 211 ? 18.881 51.012 16.616  1.00 19.68 ? 1161 TYR B C     1 
ATOM   3585 O  O     . TYR B 1 211 ? 18.647 51.651 15.608  1.00 19.65 ? 1161 TYR B O     1 
ATOM   3586 C  CB    . TYR B 1 211 ? 17.027 49.364 16.658  1.00 21.03 ? 1161 TYR B CB    1 
ATOM   3587 C  CG    . TYR B 1 211 ? 15.717 48.947 17.278  1.00 21.37 ? 1161 TYR B CG    1 
ATOM   3588 C  CD1   . TYR B 1 211 ? 15.680 48.023 18.314  1.00 21.55 ? 1161 TYR B CD1   1 
ATOM   3589 C  CD2   . TYR B 1 211 ? 14.516 49.508 16.843  1.00 21.63 ? 1161 TYR B CD2   1 
ATOM   3590 C  CE1   . TYR B 1 211 ? 14.466 47.653 18.910  1.00 23.05 ? 1161 TYR B CE1   1 
ATOM   3591 C  CE2   . TYR B 1 211 ? 13.297 49.142 17.420  1.00 23.76 ? 1161 TYR B CE2   1 
ATOM   3592 C  CZ    . TYR B 1 211 ? 13.286 48.219 18.456  1.00 23.29 ? 1161 TYR B CZ    1 
ATOM   3593 O  OH    . TYR B 1 211 ? 12.080 47.853 19.026  1.00 24.98 ? 1161 TYR B OH    1 
ATOM   3594 N  N     . GLY B 1 212 ? 20.108 50.783 17.066  1.00 18.71 ? 1162 GLY B N     1 
ATOM   3595 C  CA    . GLY B 1 212 ? 21.276 51.261 16.330  1.00 18.67 ? 1162 GLY B CA    1 
ATOM   3596 C  C     . GLY B 1 212 ? 22.578 50.689 16.828  1.00 18.77 ? 1162 GLY B C     1 
ATOM   3597 O  O     . GLY B 1 212 ? 22.607 49.940 17.800  1.00 17.90 ? 1162 GLY B O     1 
ATOM   3598 N  N     . ASN B 1 213 ? 23.663 51.014 16.129  1.00 18.78 ? 1163 ASN B N     1 
ATOM   3599 C  CA    . ASN B 1 213 ? 24.981 50.598 16.543  1.00 19.12 ? 1163 ASN B CA    1 
ATOM   3600 C  C     . ASN B 1 213 ? 25.840 51.827 16.875  1.00 19.68 ? 1163 ASN B C     1 
ATOM   3601 O  O     . ASN B 1 213 ? 25.312 52.927 17.023  1.00 20.80 ? 1163 ASN B O     1 
ATOM   3602 C  CB    . ASN B 1 213 ? 25.633 49.698 15.478  1.00 19.12 ? 1163 ASN B CB    1 
ATOM   3603 C  CG    . ASN B 1 213 ? 26.113 50.478 14.264  1.00 17.77 ? 1163 ASN B CG    1 
ATOM   3604 O  OD1   . ASN B 1 213 ? 25.762 51.644 14.082  1.00 19.17 ? 1163 ASN B OD1   1 
ATOM   3605 N  ND2   . ASN B 1 213 ? 26.912 49.832 13.428  1.00 17.33 ? 1163 ASN B ND2   1 
ATOM   3606 N  N     . VAL B 1 214 ? 27.151 51.630 16.954  1.00 20.65 ? 1164 VAL B N     1 
ATOM   3607 C  CA    . VAL B 1 214 ? 28.094 52.691 17.341  1.00 21.62 ? 1164 VAL B CA    1 
ATOM   3608 C  C     . VAL B 1 214 ? 28.016 53.930 16.446  1.00 21.91 ? 1164 VAL B C     1 
ATOM   3609 O  O     . VAL B 1 214 ? 28.275 55.046 16.901  1.00 22.39 ? 1164 VAL B O     1 
ATOM   3610 C  CB    . VAL B 1 214 ? 29.549 52.139 17.419  1.00 21.59 ? 1164 VAL B CB    1 
ATOM   3611 C  CG1   . VAL B 1 214 ? 30.035 51.603 16.055  1.00 22.36 ? 1164 VAL B CG1   1 
ATOM   3612 C  CG2   . VAL B 1 214 ? 30.504 53.192 18.013  1.00 21.81 ? 1164 VAL B CG2   1 
ATOM   3613 N  N     . SER B 1 215 ? 27.643 53.736 15.179  1.00 21.98 ? 1165 SER B N     1 
ATOM   3614 C  CA    . SER B 1 215 ? 27.574 54.842 14.211  1.00 22.56 ? 1165 SER B CA    1 
ATOM   3615 C  C     . SER B 1 215 ? 26.576 55.955 14.560  1.00 22.59 ? 1165 SER B C     1 
ATOM   3616 O  O     . SER B 1 215 ? 26.698 57.091 14.083  1.00 22.86 ? 1165 SER B O     1 
ATOM   3617 C  CB    . SER B 1 215 ? 27.294 54.299 12.805  1.00 22.38 ? 1165 SER B CB    1 
ATOM   3618 O  OG    . SER B 1 215 ? 28.196 53.255 12.503  1.00 25.48 ? 1165 SER B OG    1 
ATOM   3619 N  N     . ARG B 1 216 ? 25.582 55.630 15.384  1.00 23.15 ? 1166 ARG B N     1 
ATOM   3620 C  CA    . ARG B 1 216 ? 24.561 56.594 15.773  1.00 24.05 ? 1166 ARG B CA    1 
ATOM   3621 C  C     . ARG B 1 216 ? 25.152 57.715 16.636  1.00 24.87 ? 1166 ARG B C     1 
ATOM   3622 O  O     . ARG B 1 216 ? 24.488 58.724 16.883  1.00 25.70 ? 1166 ARG B O     1 
ATOM   3623 C  CB    . ARG B 1 216 ? 23.428 55.886 16.520  1.00 23.95 ? 1166 ARG B CB    1 
ATOM   3624 C  CG    . ARG B 1 216 ? 23.742 55.565 17.972  1.00 23.54 ? 1166 ARG B CG    1 
ATOM   3625 C  CD    . ARG B 1 216 ? 22.690 54.651 18.603  1.00 23.28 ? 1166 ARG B CD    1 
ATOM   3626 N  NE    . ARG B 1 216 ? 21.368 55.254 18.805  1.00 24.12 ? 1166 ARG B NE    1 
ATOM   3627 C  CZ    . ARG B 1 216 ? 21.067 56.142 19.757  1.00 25.21 ? 1166 ARG B CZ    1 
ATOM   3628 N  NH1   . ARG B 1 216 ? 22.007 56.593 20.585  1.00 24.25 ? 1166 ARG B NH1   1 
ATOM   3629 N  NH2   . ARG B 1 216 ? 19.827 56.600 19.868  1.00 25.17 ? 1166 ARG B NH2   1 
ATOM   3630 N  N     . PHE B 1 217 ? 26.399 57.526 17.071  1.00 25.51 ? 1167 PHE B N     1 
ATOM   3631 C  CA    . PHE B 1 217 ? 27.092 58.481 17.945  1.00 26.09 ? 1167 PHE B CA    1 
ATOM   3632 C  C     . PHE B 1 217 ? 28.169 59.294 17.214  1.00 26.69 ? 1167 PHE B C     1 
ATOM   3633 O  O     . PHE B 1 217 ? 28.877 60.083 17.839  1.00 26.77 ? 1167 PHE B O     1 
ATOM   3634 C  CB    . PHE B 1 217 ? 27.731 57.764 19.132  1.00 26.27 ? 1167 PHE B CB    1 
ATOM   3635 C  CG    . PHE B 1 217 ? 26.741 57.113 20.071  1.00 26.94 ? 1167 PHE B CG    1 
ATOM   3636 C  CD1   . PHE B 1 217 ? 25.958 57.883 20.935  1.00 27.49 ? 1167 PHE B CD1   1 
ATOM   3637 C  CD2   . PHE B 1 217 ? 26.620 55.728 20.113  1.00 27.42 ? 1167 PHE B CD2   1 
ATOM   3638 C  CE1   . PHE B 1 217 ? 25.051 57.277 21.813  1.00 26.59 ? 1167 PHE B CE1   1 
ATOM   3639 C  CE2   . PHE B 1 217 ? 25.714 55.115 20.987  1.00 27.69 ? 1167 PHE B CE2   1 
ATOM   3640 C  CZ    . PHE B 1 217 ? 24.935 55.892 21.838  1.00 27.63 ? 1167 PHE B CZ    1 
ATOM   3641 N  N     . ILE B 1 218 ? 28.307 59.092 15.907  1.00 26.72 ? 1168 ILE B N     1 
ATOM   3642 C  CA    . ILE B 1 218 ? 29.311 59.833 15.135  1.00 27.24 ? 1168 ILE B CA    1 
ATOM   3643 C  C     . ILE B 1 218 ? 28.821 61.255 14.824  1.00 27.52 ? 1168 ILE B C     1 
ATOM   3644 O  O     . ILE B 1 218 ? 27.759 61.444 14.233  1.00 27.01 ? 1168 ILE B O     1 
ATOM   3645 C  CB    . ILE B 1 218 ? 29.735 59.082 13.832  1.00 27.24 ? 1168 ILE B CB    1 
ATOM   3646 C  CG1   . ILE B 1 218 ? 30.276 57.688 14.164  1.00 26.77 ? 1168 ILE B CG1   1 
ATOM   3647 C  CG2   . ILE B 1 218 ? 30.793 59.895 13.067  1.00 27.53 ? 1168 ILE B CG2   1 
ATOM   3648 C  CD1   . ILE B 1 218 ? 30.497 56.801 12.942  1.00 26.66 ? 1168 ILE B CD1   1 
ATOM   3649 N  N     . ASN B 1 219 ? 29.609 62.245 15.243  1.00 28.65 ? 1169 ASN B N     1 
ATOM   3650 C  CA    . ASN B 1 219 ? 29.277 63.657 15.035  1.00 29.48 ? 1169 ASN B CA    1 
ATOM   3651 C  C     . ASN B 1 219 ? 29.586 64.144 13.619  1.00 30.26 ? 1169 ASN B C     1 
ATOM   3652 O  O     . ASN B 1 219 ? 30.366 63.520 12.893  1.00 30.49 ? 1169 ASN B O     1 
ATOM   3653 C  CB    . ASN B 1 219 ? 30.002 64.534 16.068  1.00 29.68 ? 1169 ASN B CB    1 
ATOM   3654 C  CG    . ASN B 1 219 ? 29.525 64.279 17.497  1.00 29.05 ? 1169 ASN B CG    1 
ATOM   3655 O  OD1   . ASN B 1 219 ? 30.327 64.062 18.398  1.00 31.84 ? 1169 ASN B OD1   1 
ATOM   3656 N  ND2   . ASN B 1 219 ? 28.218 64.301 17.697  1.00 30.37 ? 1169 ASN B ND2   1 
ATOM   3657 N  N     . HIS B 1 220 ? 28.960 65.253 13.236  1.00 31.27 ? 1170 HIS B N     1 
ATOM   3658 C  CA    . HIS B 1 220 ? 29.212 65.899 11.955  1.00 32.35 ? 1170 HIS B CA    1 
ATOM   3659 C  C     . HIS B 1 220 ? 30.559 66.620 11.949  1.00 33.05 ? 1170 HIS B C     1 
ATOM   3660 O  O     . HIS B 1 220 ? 30.958 67.214 12.954  1.00 33.05 ? 1170 HIS B O     1 
ATOM   3661 C  CB    . HIS B 1 220 ? 28.099 66.896 11.625  1.00 32.49 ? 1170 HIS B CB    1 
ATOM   3662 C  CG    . HIS B 1 220 ? 28.347 67.681 10.374  1.00 33.44 ? 1170 HIS B CG    1 
ATOM   3663 N  ND1   . HIS B 1 220 ? 29.103 68.836 10.355  1.00 34.49 ? 1170 HIS B ND1   1 
ATOM   3664 C  CD2   . HIS B 1 220 ? 27.953 67.468 9.097   1.00 33.69 ? 1170 HIS B CD2   1 
ATOM   3665 C  CE1   . HIS B 1 220 ? 29.158 69.300 9.119   1.00 34.83 ? 1170 HIS B CE1   1 
ATOM   3666 N  NE2   . HIS B 1 220 ? 28.466 68.491 8.337   1.00 35.15 ? 1170 HIS B NE2   1 
ATOM   3667 N  N     . HIS B 1 221 ? 31.249 66.548 10.811  1.00 33.77 ? 1171 HIS B N     1 
ATOM   3668 C  CA    . HIS B 1 221 ? 32.437 67.362 10.558  1.00 34.53 ? 1171 HIS B CA    1 
ATOM   3669 C  C     . HIS B 1 221 ? 32.404 67.884 9.120   1.00 34.88 ? 1171 HIS B C     1 
ATOM   3670 O  O     . HIS B 1 221 ? 32.024 67.160 8.198   1.00 34.82 ? 1171 HIS B O     1 
ATOM   3671 C  CB    . HIS B 1 221 ? 33.711 66.563 10.822  1.00 34.61 ? 1171 HIS B CB    1 
ATOM   3672 C  CG    . HIS B 1 221 ? 34.926 67.413 11.036  1.00 36.23 ? 1171 HIS B CG    1 
ATOM   3673 N  ND1   . HIS B 1 221 ? 35.564 67.508 12.255  1.00 37.21 ? 1171 HIS B ND1   1 
ATOM   3674 C  CD2   . HIS B 1 221 ? 35.620 68.206 10.187  1.00 37.18 ? 1171 HIS B CD2   1 
ATOM   3675 C  CE1   . HIS B 1 221 ? 36.601 68.320 12.145  1.00 37.52 ? 1171 HIS B CE1   1 
ATOM   3676 N  NE2   . HIS B 1 221 ? 36.657 68.757 10.900  1.00 37.93 ? 1171 HIS B NE2   1 
ATOM   3677 N  N     . CYS B 1 222 ? 32.795 69.145 8.929   1.00 35.14 ? 1172 CYS B N     1 
ATOM   3678 C  CA    . CYS B 1 222 ? 32.755 69.767 7.601   1.00 35.53 ? 1172 CYS B CA    1 
ATOM   3679 C  C     . CYS B 1 222 ? 33.903 69.320 6.687   1.00 34.96 ? 1172 CYS B C     1 
ATOM   3680 O  O     . CYS B 1 222 ? 33.788 69.403 5.464   1.00 35.25 ? 1172 CYS B O     1 
ATOM   3681 C  CB    . CYS B 1 222 ? 32.700 71.292 7.722   1.00 35.63 ? 1172 CYS B CB    1 
ATOM   3682 S  SG    . CYS B 1 222 ? 31.180 71.871 8.496   1.00 38.84 ? 1172 CYS B SG    1 
ATOM   3683 N  N     . GLU B 1 223 ? 34.991 68.847 7.294   1.00 34.28 ? 1173 GLU B N     1 
ATOM   3684 C  CA    . GLU B 1 223 ? 36.121 68.236 6.579   1.00 34.17 ? 1173 GLU B CA    1 
ATOM   3685 C  C     . GLU B 1 223 ? 36.324 66.797 7.082   1.00 32.51 ? 1173 GLU B C     1 
ATOM   3686 O  O     . GLU B 1 223 ? 37.320 66.487 7.748   1.00 32.34 ? 1173 GLU B O     1 
ATOM   3687 C  CB    . GLU B 1 223 ? 37.401 69.062 6.770   1.00 34.17 ? 1173 GLU B CB    1 
ATOM   3688 C  CG    . GLU B 1 223 ? 37.415 70.369 5.990   1.00 35.92 ? 1173 GLU B CG    1 
ATOM   3689 C  CD    . GLU B 1 223 ? 38.750 71.102 6.090   1.00 36.33 ? 1173 GLU B CD    1 
ATOM   3690 O  OE1   . GLU B 1 223 ? 39.320 71.443 5.029   1.00 39.82 ? 1173 GLU B OE1   1 
ATOM   3691 O  OE2   . GLU B 1 223 ? 39.230 71.332 7.227   1.00 38.89 ? 1173 GLU B OE2   1 
ATOM   3692 N  N     . PRO B 1 224 ? 35.380 65.904 6.741   1.00 31.21 ? 1174 PRO B N     1 
ATOM   3693 C  CA    . PRO B 1 224 ? 35.229 64.658 7.488   1.00 29.90 ? 1174 PRO B CA    1 
ATOM   3694 C  C     . PRO B 1 224 ? 36.316 63.625 7.211   1.00 28.57 ? 1174 PRO B C     1 
ATOM   3695 O  O     . PRO B 1 224 ? 36.852 63.571 6.099   1.00 28.70 ? 1174 PRO B O     1 
ATOM   3696 C  CB    . PRO B 1 224 ? 33.867 64.147 7.015   1.00 30.29 ? 1174 PRO B CB    1 
ATOM   3697 C  CG    . PRO B 1 224 ? 33.729 64.672 5.633   1.00 30.75 ? 1174 PRO B CG    1 
ATOM   3698 C  CD    . PRO B 1 224 ? 34.429 66.003 5.620   1.00 31.23 ? 1174 PRO B CD    1 
ATOM   3699 N  N     . ASN B 1 225 ? 36.637 62.815 8.222   1.00 26.82 ? 1175 ASN B N     1 
ATOM   3700 C  CA    . ASN B 1 225 ? 37.568 61.707 8.040   1.00 25.48 ? 1175 ASN B CA    1 
ATOM   3701 C  C     . ASN B 1 225 ? 36.871 60.400 7.641   1.00 24.43 ? 1175 ASN B C     1 
ATOM   3702 O  O     . ASN B 1 225 ? 37.535 59.383 7.453   1.00 23.89 ? 1175 ASN B O     1 
ATOM   3703 C  CB    . ASN B 1 225 ? 38.491 61.504 9.254   1.00 26.00 ? 1175 ASN B CB    1 
ATOM   3704 C  CG    . ASN B 1 225 ? 37.739 61.314 10.568  1.00 25.92 ? 1175 ASN B CG    1 
ATOM   3705 O  OD1   . ASN B 1 225 ? 36.581 60.894 10.592  1.00 27.02 ? 1175 ASN B OD1   1 
ATOM   3706 N  ND2   . ASN B 1 225 ? 38.414 61.623 11.679  1.00 27.77 ? 1175 ASN B ND2   1 
ATOM   3707 N  N     . LEU B 1 226 ? 35.546 60.459 7.506   1.00 23.31 ? 1176 LEU B N     1 
ATOM   3708 C  CA    . LEU B 1 226 ? 34.742 59.319 7.016   1.00 22.61 ? 1176 LEU B CA    1 
ATOM   3709 C  C     . LEU B 1 226 ? 33.820 59.737 5.882   1.00 22.31 ? 1176 LEU B C     1 
ATOM   3710 O  O     . LEU B 1 226 ? 33.285 60.846 5.886   1.00 21.91 ? 1176 LEU B O     1 
ATOM   3711 C  CB    . LEU B 1 226 ? 33.871 58.738 8.138   1.00 22.62 ? 1176 LEU B CB    1 
ATOM   3712 C  CG    . LEU B 1 226 ? 34.501 58.098 9.373   1.00 22.12 ? 1176 LEU B CG    1 
ATOM   3713 C  CD1   . LEU B 1 226 ? 33.386 57.700 10.342  1.00 21.79 ? 1176 LEU B CD1   1 
ATOM   3714 C  CD2   . LEU B 1 226 ? 35.367 56.906 9.028   1.00 21.60 ? 1176 LEU B CD2   1 
ATOM   3715 N  N     . VAL B 1 227 ? 33.602 58.829 4.930   1.00 21.75 ? 1177 VAL B N     1 
ATOM   3716 C  CA    . VAL B 1 227 ? 32.625 59.043 3.862   1.00 21.24 ? 1177 VAL B CA    1 
ATOM   3717 C  C     . VAL B 1 227 ? 31.666 57.843 3.799   1.00 20.80 ? 1177 VAL B C     1 
ATOM   3718 O  O     . VAL B 1 227 ? 32.122 56.706 3.841   1.00 20.35 ? 1177 VAL B O     1 
ATOM   3719 C  CB    . VAL B 1 227 ? 33.309 59.247 2.485   1.00 21.41 ? 1177 VAL B CB    1 
ATOM   3720 C  CG1   . VAL B 1 227 ? 34.196 58.061 2.137   1.00 21.51 ? 1177 VAL B CG1   1 
ATOM   3721 C  CG2   . VAL B 1 227 ? 32.288 59.505 1.393   1.00 22.72 ? 1177 VAL B CG2   1 
ATOM   3722 N  N     . PRO B 1 228 ? 30.345 58.101 3.737   1.00 20.76 ? 1178 PRO B N     1 
ATOM   3723 C  CA    . PRO B 1 228 ? 29.409 56.978 3.570   1.00 20.64 ? 1178 PRO B CA    1 
ATOM   3724 C  C     . PRO B 1 228 ? 29.309 56.514 2.117   1.00 20.44 ? 1178 PRO B C     1 
ATOM   3725 O  O     . PRO B 1 228 ? 29.239 57.336 1.193   1.00 20.76 ? 1178 PRO B O     1 
ATOM   3726 C  CB    . PRO B 1 228 ? 28.077 57.563 4.046   1.00 20.99 ? 1178 PRO B CB    1 
ATOM   3727 C  CG    . PRO B 1 228 ? 28.181 59.022 3.766   1.00 21.77 ? 1178 PRO B CG    1 
ATOM   3728 C  CD    . PRO B 1 228 ? 29.639 59.394 3.864   1.00 21.24 ? 1178 PRO B CD    1 
ATOM   3729 N  N     . VAL B 1 229 ? 29.304 55.194 1.941   1.00 19.34 ? 1179 VAL B N     1 
ATOM   3730 C  CA    . VAL B 1 229 ? 29.231 54.542 0.634   1.00 18.73 ? 1179 VAL B CA    1 
ATOM   3731 C  C     . VAL B 1 229 ? 28.087 53.519 0.660   1.00 18.21 ? 1179 VAL B C     1 
ATOM   3732 O  O     . VAL B 1 229 ? 27.905 52.801 1.651   1.00 17.53 ? 1179 VAL B O     1 
ATOM   3733 C  CB    . VAL B 1 229 ? 30.554 53.818 0.300   1.00 19.07 ? 1179 VAL B CB    1 
ATOM   3734 C  CG1   . VAL B 1 229 ? 30.501 53.204 -1.091  1.00 19.39 ? 1179 VAL B CG1   1 
ATOM   3735 C  CG2   . VAL B 1 229 ? 31.742 54.805 0.383   1.00 19.15 ? 1179 VAL B CG2   1 
ATOM   3736 N  N     . ARG B 1 230 ? 27.323 53.464 -0.432  1.00 17.20 ? 1180 ARG B N     1 
ATOM   3737 C  CA    . ARG B 1 230 ? 26.219 52.519 -0.557  1.00 17.20 ? 1180 ARG B CA    1 
ATOM   3738 C  C     . ARG B 1 230 ? 26.771 51.176 -1.013  1.00 16.67 ? 1180 ARG B C     1 
ATOM   3739 O  O     . ARG B 1 230 ? 27.512 51.106 -1.999  1.00 16.13 ? 1180 ARG B O     1 
ATOM   3740 C  CB    . ARG B 1 230 ? 25.177 53.057 -1.548  1.00 17.47 ? 1180 ARG B CB    1 
ATOM   3741 C  CG    . ARG B 1 230 ? 24.409 54.265 -1.001  1.00 19.98 ? 1180 ARG B CG    1 
ATOM   3742 C  CD    . ARG B 1 230 ? 23.442 54.849 -1.997  1.00 24.65 ? 1180 ARG B CD    1 
ATOM   3743 N  NE    . ARG B 1 230 ? 24.164 55.502 -3.085  1.00 30.14 ? 1180 ARG B NE    1 
ATOM   3744 C  CZ    . ARG B 1 230 ? 23.601 55.993 -4.187  1.00 32.66 ? 1180 ARG B CZ    1 
ATOM   3745 N  NH1   . ARG B 1 230 ? 22.289 55.918 -4.372  1.00 33.19 ? 1180 ARG B NH1   1 
ATOM   3746 N  NH2   . ARG B 1 230 ? 24.364 56.562 -5.111  1.00 35.20 ? 1180 ARG B NH2   1 
ATOM   3747 N  N     . VAL B 1 231 ? 26.422 50.113 -0.282  1.00 15.79 ? 1181 VAL B N     1 
ATOM   3748 C  CA    . VAL B 1 231 ? 26.994 48.788 -0.549  1.00 15.14 ? 1181 VAL B CA    1 
ATOM   3749 C  C     . VAL B 1 231 ? 25.891 47.741 -0.636  1.00 14.82 ? 1181 VAL B C     1 
ATOM   3750 O  O     . VAL B 1 231 ? 24.893 47.828 0.074   1.00 15.07 ? 1181 VAL B O     1 
ATOM   3751 C  CB    . VAL B 1 231 ? 28.033 48.381 0.528   1.00 15.24 ? 1181 VAL B CB    1 
ATOM   3752 C  CG1   . VAL B 1 231 ? 28.774 47.099 0.134   1.00 15.60 ? 1181 VAL B CG1   1 
ATOM   3753 C  CG2   . VAL B 1 231 ? 29.066 49.504 0.702   1.00 15.40 ? 1181 VAL B CG2   1 
ATOM   3754 N  N     . PHE B 1 232 ? 26.103 46.761 -1.517  1.00 14.31 ? 1182 PHE B N     1 
ATOM   3755 C  CA    . PHE B 1 232 ? 25.221 45.599 -1.657  1.00 14.05 ? 1182 PHE B CA    1 
ATOM   3756 C  C     . PHE B 1 232 ? 26.006 44.338 -1.402  1.00 15.00 ? 1182 PHE B C     1 
ATOM   3757 O  O     . PHE B 1 232 ? 27.121 44.199 -1.898  1.00 15.27 ? 1182 PHE B O     1 
ATOM   3758 C  CB    . PHE B 1 232 ? 24.599 45.565 -3.054  1.00 14.40 ? 1182 PHE B CB    1 
ATOM   3759 C  CG    . PHE B 1 232 ? 23.692 46.714 -3.280  1.00 14.25 ? 1182 PHE B CG    1 
ATOM   3760 C  CD1   . PHE B 1 232 ? 22.356 46.647 -2.866  1.00 15.22 ? 1182 PHE B CD1   1 
ATOM   3761 C  CD2   . PHE B 1 232 ? 24.203 47.922 -3.755  1.00 15.85 ? 1182 PHE B CD2   1 
ATOM   3762 C  CE1   . PHE B 1 232 ? 21.507 47.744 -3.006  1.00 16.03 ? 1182 PHE B CE1   1 
ATOM   3763 C  CE2   . PHE B 1 232 ? 23.365 49.037 -3.898  1.00 16.31 ? 1182 PHE B CE2   1 
ATOM   3764 C  CZ    . PHE B 1 232 ? 22.017 48.952 -3.528  1.00 16.83 ? 1182 PHE B CZ    1 
ATOM   3765 N  N     . MET B 1 233 ? 25.413 43.440 -0.615  1.00 14.76 ? 1183 MET B N     1 
ATOM   3766 C  CA    . MET B 1 233 ? 26.075 42.207 -0.206  1.00 15.02 ? 1183 MET B CA    1 
ATOM   3767 C  C     . MET B 1 233 ? 25.132 41.020 -0.430  1.00 14.76 ? 1183 MET B C     1 
ATOM   3768 O  O     . MET B 1 233 ? 25.121 40.448 -1.514  1.00 15.32 ? 1183 MET B O     1 
ATOM   3769 C  CB    . MET B 1 233 ? 26.570 42.312 1.256   1.00 15.16 ? 1183 MET B CB    1 
ATOM   3770 C  CG    . MET B 1 233 ? 27.808 43.212 1.373   1.00 16.14 ? 1183 MET B CG    1 
ATOM   3771 S  SD    . MET B 1 233 ? 28.007 43.970 3.015   1.00 17.21 ? 1183 MET B SD    1 
ATOM   3772 C  CE    . MET B 1 233 ? 26.849 45.317 2.858   1.00 18.26 ? 1183 MET B CE    1 
ATOM   3773 N  N     . ALA B 1 234 ? 24.312 40.683 0.565   1.00 14.03 ? 1184 ALA B N     1 
ATOM   3774 C  CA    . ALA B 1 234 ? 23.510 39.448 0.482   1.00 13.22 ? 1184 ALA B CA    1 
ATOM   3775 C  C     . ALA B 1 234 ? 22.307 39.564 -0.454  1.00 14.11 ? 1184 ALA B C     1 
ATOM   3776 O  O     . ALA B 1 234 ? 21.753 38.545 -0.884  1.00 14.92 ? 1184 ALA B O     1 
ATOM   3777 C  CB    . ALA B 1 234 ? 23.054 38.997 1.864   1.00 14.48 ? 1184 ALA B CB    1 
ATOM   3778 N  N     . HIS B 1 235 ? 21.871 40.792 -0.710  1.00 13.39 ? 1185 HIS B N     1 
ATOM   3779 C  CA    . HIS B 1 235 ? 20.797 41.047 -1.682  1.00 13.78 ? 1185 HIS B CA    1 
ATOM   3780 C  C     . HIS B 1 235 ? 21.202 42.195 -2.598  1.00 14.28 ? 1185 HIS B C     1 
ATOM   3781 O  O     . HIS B 1 235 ? 22.141 42.956 -2.303  1.00 14.04 ? 1185 HIS B O     1 
ATOM   3782 C  CB    . HIS B 1 235 ? 19.469 41.375 -0.976  1.00 14.41 ? 1185 HIS B CB    1 
ATOM   3783 C  CG    . HIS B 1 235 ? 19.456 42.708 -0.300  1.00 15.51 ? 1185 HIS B CG    1 
ATOM   3784 N  ND1   . HIS B 1 235 ? 19.338 43.895 -0.994  1.00 14.44 ? 1185 HIS B ND1   1 
ATOM   3785 C  CD2   . HIS B 1 235 ? 19.557 43.045 1.007   1.00 14.98 ? 1185 HIS B CD2   1 
ATOM   3786 C  CE1   . HIS B 1 235 ? 19.361 44.906 -0.139  1.00 15.98 ? 1185 HIS B CE1   1 
ATOM   3787 N  NE2   . HIS B 1 235 ? 19.489 44.414 1.083   1.00 15.87 ? 1185 HIS B NE2   1 
ATOM   3788 N  N     . GLN B 1 236 ? 20.503 42.326 -3.721  1.00 14.39 ? 1186 GLN B N     1 
ATOM   3789 C  CA    . GLN B 1 236 ? 20.795 43.426 -4.629  1.00 15.43 ? 1186 GLN B CA    1 
ATOM   3790 C  C     . GLN B 1 236 ? 19.517 44.214 -4.935  1.00 15.43 ? 1186 GLN B C     1 
ATOM   3791 O  O     . GLN B 1 236 ? 19.283 44.626 -6.073  1.00 16.66 ? 1186 GLN B O     1 
ATOM   3792 C  CB    . GLN B 1 236 ? 21.467 42.906 -5.900  1.00 14.87 ? 1186 GLN B CB    1 
ATOM   3793 C  CG    . GLN B 1 236 ? 22.861 42.361 -5.619  1.00 14.89 ? 1186 GLN B CG    1 
ATOM   3794 C  CD    . GLN B 1 236 ? 23.410 41.535 -6.739  1.00 15.02 ? 1186 GLN B CD    1 
ATOM   3795 O  OE1   . GLN B 1 236 ? 22.725 41.266 -7.743  1.00 15.58 ? 1186 GLN B OE1   1 
ATOM   3796 N  NE2   . GLN B 1 236 ? 24.659 41.127 -6.591  1.00 15.72 ? 1186 GLN B NE2   1 
ATOM   3797 N  N     . ASP B 1 237 ? 18.695 44.402 -3.903  1.00 15.65 ? 1187 ASP B N     1 
ATOM   3798 C  CA    . ASP B 1 237 ? 17.490 45.222 -4.011  1.00 16.49 ? 1187 ASP B CA    1 
ATOM   3799 C  C     . ASP B 1 237 ? 17.921 46.680 -3.865  1.00 16.78 ? 1187 ASP B C     1 
ATOM   3800 O  O     . ASP B 1 237 ? 18.268 47.127 -2.757  1.00 16.69 ? 1187 ASP B O     1 
ATOM   3801 C  CB    . ASP B 1 237 ? 16.480 44.831 -2.930  1.00 16.88 ? 1187 ASP B CB    1 
ATOM   3802 C  CG    . ASP B 1 237 ? 15.132 45.520 -3.104  1.00 17.95 ? 1187 ASP B CG    1 
ATOM   3803 O  OD1   . ASP B 1 237 ? 15.086 46.674 -3.611  1.00 19.25 ? 1187 ASP B OD1   1 
ATOM   3804 O  OD2   . ASP B 1 237 ? 14.126 44.902 -2.716  1.00 19.81 ? 1187 ASP B OD2   1 
ATOM   3805 N  N     . LEU B 1 238 ? 17.917 47.414 -4.980  1.00 17.58 ? 1188 LEU B N     1 
ATOM   3806 C  CA    . LEU B 1 238 ? 18.526 48.762 -5.027  1.00 18.05 ? 1188 LEU B CA    1 
ATOM   3807 C  C     . LEU B 1 238 ? 17.810 49.819 -4.163  1.00 17.96 ? 1188 LEU B C     1 
ATOM   3808 O  O     . LEU B 1 238 ? 18.340 50.921 -3.948  1.00 18.60 ? 1188 LEU B O     1 
ATOM   3809 C  CB    . LEU B 1 238 ? 18.668 49.259 -6.469  1.00 18.81 ? 1188 LEU B CB    1 
ATOM   3810 C  CG    . LEU B 1 238 ? 19.493 48.391 -7.412  1.00 20.64 ? 1188 LEU B CG    1 
ATOM   3811 C  CD1   . LEU B 1 238 ? 19.548 49.053 -8.785  1.00 23.13 ? 1188 LEU B CD1   1 
ATOM   3812 C  CD2   . LEU B 1 238 ? 20.900 48.152 -6.868  1.00 21.86 ? 1188 LEU B CD2   1 
ATOM   3813 N  N     . ARG B 1 239 ? 16.617 49.477 -3.682  1.00 17.99 ? 1189 ARG B N     1 
ATOM   3814 C  CA    . ARG B 1 239 ? 15.873 50.335 -2.747  1.00 18.18 ? 1189 ARG B CA    1 
ATOM   3815 C  C     . ARG B 1 239 ? 16.542 50.349 -1.377  1.00 17.88 ? 1189 ARG B C     1 
ATOM   3816 O  O     . ARG B 1 239 ? 16.310 51.264 -0.564  1.00 18.73 ? 1189 ARG B O     1 
ATOM   3817 C  CB    . ARG B 1 239 ? 14.422 49.848 -2.606  1.00 17.61 ? 1189 ARG B CB    1 
ATOM   3818 C  CG    . ARG B 1 239 ? 13.648 49.803 -3.907  1.00 19.82 ? 1189 ARG B CG    1 
ATOM   3819 C  CD    . ARG B 1 239 ? 12.261 49.206 -3.698  1.00 19.58 ? 1189 ARG B CD    1 
ATOM   3820 N  NE    . ARG B 1 239 ? 12.332 47.800 -3.308  1.00 21.00 ? 1189 ARG B NE    1 
ATOM   3821 C  CZ    . ARG B 1 239 ? 11.360 47.120 -2.705  1.00 24.04 ? 1189 ARG B CZ    1 
ATOM   3822 N  NH1   . ARG B 1 239 ? 10.198 47.697 -2.406  1.00 24.09 ? 1189 ARG B NH1   1 
ATOM   3823 N  NH2   . ARG B 1 239 ? 11.551 45.849 -2.389  1.00 22.94 ? 1189 ARG B NH2   1 
ATOM   3824 N  N     . PHE B 1 240 ? 17.382 49.342 -1.131  1.00 17.26 ? 1190 PHE B N     1 
ATOM   3825 C  CA    . PHE B 1 240 ? 17.891 49.059 0.210   1.00 16.47 ? 1190 PHE B CA    1 
ATOM   3826 C  C     . PHE B 1 240 ? 19.411 48.914 0.278   1.00 15.99 ? 1190 PHE B C     1 
ATOM   3827 O  O     . PHE B 1 240 ? 19.924 47.872 0.701   1.00 15.02 ? 1190 PHE B O     1 
ATOM   3828 C  CB    . PHE B 1 240 ? 17.197 47.811 0.777   1.00 17.00 ? 1190 PHE B CB    1 
ATOM   3829 C  CG    . PHE B 1 240 ? 15.716 47.989 0.983   1.00 17.23 ? 1190 PHE B CG    1 
ATOM   3830 C  CD1   . PHE B 1 240 ? 15.250 48.800 2.005   1.00 20.08 ? 1190 PHE B CD1   1 
ATOM   3831 C  CD2   . PHE B 1 240 ? 14.795 47.353 0.159   1.00 19.50 ? 1190 PHE B CD2   1 
ATOM   3832 C  CE1   . PHE B 1 240 ? 13.886 48.972 2.213   1.00 21.07 ? 1190 PHE B CE1   1 
ATOM   3833 C  CE2   . PHE B 1 240 ? 13.417 47.527 0.366   1.00 20.14 ? 1190 PHE B CE2   1 
ATOM   3834 C  CZ    . PHE B 1 240 ? 12.978 48.341 1.390   1.00 19.53 ? 1190 PHE B CZ    1 
ATOM   3835 N  N     . PRO B 1 241 ? 20.141 49.972 -0.118  1.00 15.63 ? 1191 PRO B N     1 
ATOM   3836 C  CA    . PRO B 1 241 ? 21.583 49.912 0.057   1.00 15.59 ? 1191 PRO B CA    1 
ATOM   3837 C  C     . PRO B 1 241 ? 21.899 49.903 1.550   1.00 15.41 ? 1191 PRO B C     1 
ATOM   3838 O  O     . PRO B 1 241 ? 21.079 50.377 2.348   1.00 16.48 ? 1191 PRO B O     1 
ATOM   3839 C  CB    . PRO B 1 241 ? 22.057 51.228 -0.545  1.00 15.81 ? 1191 PRO B CB    1 
ATOM   3840 C  CG    . PRO B 1 241 ? 20.880 52.165 -0.368  1.00 14.95 ? 1191 PRO B CG    1 
ATOM   3841 C  CD    . PRO B 1 241 ? 19.702 51.281 -0.646  1.00 16.11 ? 1191 PRO B CD    1 
ATOM   3842 N  N     . ARG B 1 242 ? 23.054 49.348 1.913   1.00 15.16 ? 1192 ARG B N     1 
ATOM   3843 C  CA    . ARG B 1 242 ? 23.553 49.442 3.284   1.00 15.40 ? 1192 ARG B CA    1 
ATOM   3844 C  C     . ARG B 1 242 ? 24.617 50.529 3.283   1.00 16.05 ? 1192 ARG B C     1 
ATOM   3845 O  O     . ARG B 1 242 ? 25.279 50.758 2.254   1.00 16.38 ? 1192 ARG B O     1 
ATOM   3846 C  CB    . ARG B 1 242 ? 24.078 48.093 3.764   1.00 14.71 ? 1192 ARG B CB    1 
ATOM   3847 C  CG    . ARG B 1 242 ? 22.930 47.107 3.953   1.00 14.95 ? 1192 ARG B CG    1 
ATOM   3848 C  CD    . ARG B 1 242 ? 23.350 45.687 4.214   1.00 14.90 ? 1192 ARG B CD    1 
ATOM   3849 N  NE    . ARG B 1 242 ? 24.334 45.528 5.290   1.00 14.53 ? 1192 ARG B NE    1 
ATOM   3850 C  CZ    . ARG B 1 242 ? 24.984 44.395 5.525   1.00 16.15 ? 1192 ARG B CZ    1 
ATOM   3851 N  NH1   . ARG B 1 242 ? 24.731 43.313 4.779   1.00 15.06 ? 1192 ARG B NH1   1 
ATOM   3852 N  NH2   . ARG B 1 242 ? 25.893 44.341 6.492   1.00 16.65 ? 1192 ARG B NH2   1 
ATOM   3853 N  N     . ILE B 1 243 ? 24.755 51.221 4.413   1.00 16.69 ? 1193 ILE B N     1 
ATOM   3854 C  CA    . ILE B 1 243 ? 25.593 52.421 4.449   1.00 16.78 ? 1193 ILE B CA    1 
ATOM   3855 C  C     . ILE B 1 243 ? 26.891 52.097 5.165   1.00 16.58 ? 1193 ILE B C     1 
ATOM   3856 O  O     . ILE B 1 243 ? 26.885 51.750 6.350   1.00 16.68 ? 1193 ILE B O     1 
ATOM   3857 C  CB    . ILE B 1 243 ? 24.857 53.628 5.106   1.00 17.19 ? 1193 ILE B CB    1 
ATOM   3858 C  CG1   . ILE B 1 243 ? 23.554 53.947 4.357   1.00 17.50 ? 1193 ILE B CG1   1 
ATOM   3859 C  CG2   . ILE B 1 243 ? 25.803 54.846 5.195   1.00 17.23 ? 1193 ILE B CG2   1 
ATOM   3860 C  CD1   . ILE B 1 243 ? 23.714 54.257 2.858   1.00 19.55 ? 1193 ILE B CD1   1 
ATOM   3861 N  N     . ALA B 1 244 ? 28.003 52.196 4.436   1.00 16.48 ? 1194 ALA B N     1 
ATOM   3862 C  CA    . ALA B 1 244 ? 29.315 51.839 4.979   1.00 16.36 ? 1194 ALA B CA    1 
ATOM   3863 C  C     . ALA B 1 244 ? 30.211 53.071 5.042   1.00 17.09 ? 1194 ALA B C     1 
ATOM   3864 O  O     . ALA B 1 244 ? 30.377 53.762 4.040   1.00 18.01 ? 1194 ALA B O     1 
ATOM   3865 C  CB    . ALA B 1 244 ? 29.973 50.760 4.126   1.00 16.33 ? 1194 ALA B CB    1 
ATOM   3866 N  N     . PHE B 1 245 ? 30.783 53.334 6.216   1.00 17.25 ? 1195 PHE B N     1 
ATOM   3867 C  CA    . PHE B 1 245 ? 31.729 54.445 6.375   1.00 17.85 ? 1195 PHE B CA    1 
ATOM   3868 C  C     . PHE B 1 245 ? 33.154 53.982 6.149   1.00 17.70 ? 1195 PHE B C     1 
ATOM   3869 O  O     . PHE B 1 245 ? 33.626 53.047 6.810   1.00 18.06 ? 1195 PHE B O     1 
ATOM   3870 C  CB    . PHE B 1 245 ? 31.621 55.060 7.780   1.00 17.39 ? 1195 PHE B CB    1 
ATOM   3871 C  CG    . PHE B 1 245 ? 30.300 55.680 8.067   1.00 18.49 ? 1195 PHE B CG    1 
ATOM   3872 C  CD1   . PHE B 1 245 ? 29.945 56.913 7.505   1.00 18.34 ? 1195 PHE B CD1   1 
ATOM   3873 C  CD2   . PHE B 1 245 ? 29.398 55.038 8.928   1.00 18.69 ? 1195 PHE B CD2   1 
ATOM   3874 C  CE1   . PHE B 1 245 ? 28.717 57.494 7.780   1.00 20.22 ? 1195 PHE B CE1   1 
ATOM   3875 C  CE2   . PHE B 1 245 ? 28.163 55.613 9.217   1.00 19.16 ? 1195 PHE B CE2   1 
ATOM   3876 C  CZ    . PHE B 1 245 ? 27.811 56.848 8.641   1.00 19.87 ? 1195 PHE B CZ    1 
ATOM   3877 N  N     . PHE B 1 246 ? 33.845 54.647 5.221   1.00 18.25 ? 1196 PHE B N     1 
ATOM   3878 C  CA    . PHE B 1 246 ? 35.260 54.377 4.956   1.00 18.67 ? 1196 PHE B CA    1 
ATOM   3879 C  C     . PHE B 1 246 ? 36.063 55.625 5.314   1.00 19.61 ? 1196 PHE B C     1 
ATOM   3880 O  O     . PHE B 1 246 ? 35.565 56.734 5.166   1.00 19.58 ? 1196 PHE B O     1 
ATOM   3881 C  CB    . PHE B 1 246 ? 35.509 54.061 3.479   1.00 18.31 ? 1196 PHE B CB    1 
ATOM   3882 C  CG    . PHE B 1 246 ? 35.014 52.708 3.038   1.00 17.39 ? 1196 PHE B CG    1 
ATOM   3883 C  CD1   . PHE B 1 246 ? 35.899 51.642 2.913   1.00 17.78 ? 1196 PHE B CD1   1 
ATOM   3884 C  CD2   . PHE B 1 246 ? 33.674 52.512 2.697   1.00 18.61 ? 1196 PHE B CD2   1 
ATOM   3885 C  CE1   . PHE B 1 246 ? 35.451 50.384 2.488   1.00 17.95 ? 1196 PHE B CE1   1 
ATOM   3886 C  CE2   . PHE B 1 246 ? 33.219 51.249 2.265   1.00 17.37 ? 1196 PHE B CE2   1 
ATOM   3887 C  CZ    . PHE B 1 246 ? 34.104 50.200 2.159   1.00 18.08 ? 1196 PHE B CZ    1 
ATOM   3888 N  N     . SER B 1 247 ? 37.292 55.431 5.773   1.00 21.16 ? 1197 SER B N     1 
ATOM   3889 C  CA    . SER B 1 247 ? 38.169 56.567 6.098   1.00 22.01 ? 1197 SER B CA    1 
ATOM   3890 C  C     . SER B 1 247 ? 38.615 57.274 4.815   1.00 23.09 ? 1197 SER B C     1 
ATOM   3891 O  O     . SER B 1 247 ? 38.913 56.621 3.811   1.00 22.84 ? 1197 SER B O     1 
ATOM   3892 C  CB    . SER B 1 247 ? 39.374 56.112 6.923   1.00 21.54 ? 1197 SER B CB    1 
ATOM   3893 O  OG    . SER B 1 247 ? 40.146 55.146 6.241   1.00 21.43 ? 1197 SER B OG    1 
ATOM   3894 N  N     . THR B 1 248 ? 38.634 58.606 4.854   1.00 24.48 ? 1198 THR B N     1 
ATOM   3895 C  CA    . THR B 1 248 ? 38.998 59.428 3.687   1.00 26.07 ? 1198 THR B CA    1 
ATOM   3896 C  C     . THR B 1 248 ? 40.483 59.769 3.700   1.00 27.34 ? 1198 THR B C     1 
ATOM   3897 O  O     . THR B 1 248 ? 41.030 60.297 2.717   1.00 27.84 ? 1198 THR B O     1 
ATOM   3898 C  CB    . THR B 1 248 ? 38.203 60.749 3.638   1.00 26.02 ? 1198 THR B CB    1 
ATOM   3899 O  OG1   . THR B 1 248 ? 38.442 61.498 4.835   1.00 25.47 ? 1198 THR B OG1   1 
ATOM   3900 C  CG2   . THR B 1 248 ? 36.710 60.488 3.489   1.00 26.25 ? 1198 THR B CG2   1 
ATOM   3901 N  N     A ARG B 1 249 ? 41.126 59.465 4.822   0.50 27.86 ? 1199 ARG B N     1 
ATOM   3902 N  N     B ARG B 1 249 ? 41.122 59.445 4.819   0.50 27.90 ? 1199 ARG B N     1 
ATOM   3903 C  CA    A ARG B 1 249 ? 42.527 59.786 5.066   0.50 28.66 ? 1199 ARG B CA    1 
ATOM   3904 C  CA    B ARG B 1 249 ? 42.530 59.721 5.052   0.50 28.78 ? 1199 ARG B CA    1 
ATOM   3905 C  C     A ARG B 1 249 ? 42.986 58.994 6.279   0.50 29.20 ? 1199 ARG B C     1 
ATOM   3906 C  C     B ARG B 1 249 ? 43.049 58.793 6.142   0.50 29.25 ? 1199 ARG B C     1 
ATOM   3907 O  O     A ARG B 1 249 ? 42.163 58.376 6.965   0.50 29.06 ? 1199 ARG B O     1 
ATOM   3908 O  O     B ARG B 1 249 ? 42.340 57.895 6.605   0.50 29.24 ? 1199 ARG B O     1 
ATOM   3909 C  CB    A ARG B 1 249 ? 42.708 61.290 5.317   0.50 28.64 ? 1199 ARG B CB    1 
ATOM   3910 C  CB    B ARG B 1 249 ? 42.729 61.187 5.468   0.50 28.74 ? 1199 ARG B CB    1 
ATOM   3911 C  CG    A ARG B 1 249 ? 41.785 61.877 6.388   0.50 28.84 ? 1199 ARG B CG    1 
ATOM   3912 C  CG    B ARG B 1 249 ? 42.007 61.602 6.761   0.50 28.89 ? 1199 ARG B CG    1 
ATOM   3913 C  CD    A ARG B 1 249 ? 42.276 63.243 6.855   0.50 28.49 ? 1199 ARG B CD    1 
ATOM   3914 C  CD    B ARG B 1 249 ? 42.344 63.042 7.143   0.50 28.94 ? 1199 ARG B CD    1 
ATOM   3915 N  NE    A ARG B 1 249 ? 41.378 63.847 7.839   0.50 27.87 ? 1199 ARG B NE    1 
ATOM   3916 N  NE    B ARG B 1 249 ? 41.528 63.534 8.252   0.50 29.46 ? 1199 ARG B NE    1 
ATOM   3917 C  CZ    A ARG B 1 249 ? 41.429 63.632 9.155   0.50 26.81 ? 1199 ARG B CZ    1 
ATOM   3918 C  CZ    B ARG B 1 249 ? 40.429 64.279 8.117   0.50 29.08 ? 1199 ARG B CZ    1 
ATOM   3919 N  NH1   A ARG B 1 249 ? 40.559 64.238 9.953   0.50 27.04 ? 1199 ARG B NH1   1 
ATOM   3920 N  NH1   B ARG B 1 249 ? 39.992 64.635 6.917   0.50 29.50 ? 1199 ARG B NH1   1 
ATOM   3921 N  NH2   A ARG B 1 249 ? 42.332 62.813 9.681   0.50 25.94 ? 1199 ARG B NH2   1 
ATOM   3922 N  NH2   B ARG B 1 249 ? 39.763 64.673 9.193   0.50 29.60 ? 1199 ARG B NH2   1 
ATOM   3923 N  N     . LEU B 1 250 ? 44.292 59.019 6.547   1.00 29.64 ? 1200 LEU B N     1 
ATOM   3924 C  CA    . LEU B 1 250 ? 44.838 58.393 7.735   1.00 30.66 ? 1200 LEU B CA    1 
ATOM   3925 C  C     . LEU B 1 250 ? 44.146 59.018 8.947   1.00 31.17 ? 1200 LEU B C     1 
ATOM   3926 O  O     . LEU B 1 250 ? 44.089 60.245 9.081   1.00 31.63 ? 1200 LEU B O     1 
ATOM   3927 C  CB    . LEU B 1 250 ? 46.353 58.611 7.799   1.00 30.72 ? 1200 LEU B CB    1 
ATOM   3928 C  CG    . LEU B 1 250 ? 47.177 58.082 8.980   1.00 31.43 ? 1200 LEU B CG    1 
ATOM   3929 C  CD1   . LEU B 1 250 ? 46.809 56.668 9.398   1.00 31.14 ? 1200 LEU B CD1   1 
ATOM   3930 C  CD2   . LEU B 1 250 ? 48.665 58.157 8.621   1.00 31.48 ? 1200 LEU B CD2   1 
ATOM   3931 N  N     . ILE B 1 251 ? 43.565 58.164 9.783   1.00 31.74 ? 1201 ILE B N     1 
ATOM   3932 C  CA    . ILE B 1 251 ? 42.958 58.595 11.037  1.00 32.29 ? 1201 ILE B CA    1 
ATOM   3933 C  C     . ILE B 1 251 ? 43.892 58.122 12.133  1.00 32.79 ? 1201 ILE B C     1 
ATOM   3934 O  O     . ILE B 1 251 ? 44.125 56.923 12.286  1.00 33.17 ? 1201 ILE B O     1 
ATOM   3935 C  CB    . ILE B 1 251 ? 41.540 57.997 11.248  1.00 32.31 ? 1201 ILE B CB    1 
ATOM   3936 C  CG1   . ILE B 1 251 ? 40.584 58.485 10.152  1.00 31.53 ? 1201 ILE B CG1   1 
ATOM   3937 C  CG2   . ILE B 1 251 ? 41.005 58.359 12.640  1.00 32.39 ? 1201 ILE B CG2   1 
ATOM   3938 C  CD1   . ILE B 1 251 ? 39.177 57.898 10.225  1.00 31.96 ? 1201 ILE B CD1   1 
ATOM   3939 N  N     . GLU B 1 252 ? 44.462 59.070 12.869  1.00 33.61 ? 1202 GLU B N     1 
ATOM   3940 C  CA    . GLU B 1 252 ? 45.435 58.737 13.899  1.00 34.21 ? 1202 GLU B CA    1 
ATOM   3941 C  C     . GLU B 1 252 ? 44.749 58.231 15.159  1.00 33.90 ? 1202 GLU B C     1 
ATOM   3942 O  O     . GLU B 1 252 ? 43.620 58.618 15.449  1.00 33.86 ? 1202 GLU B O     1 
ATOM   3943 C  CB    . GLU B 1 252 ? 46.321 59.946 14.210  1.00 34.52 ? 1202 GLU B CB    1 
ATOM   3944 C  CG    . GLU B 1 252 ? 47.278 60.293 13.086  1.00 36.73 ? 1202 GLU B CG    1 
ATOM   3945 C  CD    . GLU B 1 252 ? 48.332 61.290 13.517  1.00 40.83 ? 1202 GLU B CD    1 
ATOM   3946 O  OE1   . GLU B 1 252 ? 48.013 62.498 13.597  1.00 41.19 ? 1202 GLU B OE1   1 
ATOM   3947 O  OE2   . GLU B 1 252 ? 49.480 60.857 13.771  1.00 42.50 ? 1202 GLU B OE2   1 
ATOM   3948 N  N     . ALA B 1 253 ? 45.434 57.350 15.883  1.00 33.97 ? 1203 ALA B N     1 
ATOM   3949 C  CA    . ALA B 1 253 ? 44.957 56.844 17.169  1.00 34.04 ? 1203 ALA B CA    1 
ATOM   3950 C  C     . ALA B 1 253 ? 44.531 57.991 18.078  1.00 34.10 ? 1203 ALA B C     1 
ATOM   3951 O  O     . ALA B 1 253 ? 45.300 58.932 18.304  1.00 34.08 ? 1203 ALA B O     1 
ATOM   3952 C  CB    . ALA B 1 253 ? 46.039 56.002 17.845  1.00 34.21 ? 1203 ALA B CB    1 
ATOM   3953 N  N     . GLY B 1 254 ? 43.296 57.916 18.569  1.00 33.86 ? 1204 GLY B N     1 
ATOM   3954 C  CA    . GLY B 1 254 ? 42.729 58.927 19.456  1.00 33.59 ? 1204 GLY B CA    1 
ATOM   3955 C  C     . GLY B 1 254 ? 41.836 59.950 18.783  1.00 33.46 ? 1204 GLY B C     1 
ATOM   3956 O  O     . GLY B 1 254 ? 41.100 60.675 19.449  1.00 33.55 ? 1204 GLY B O     1 
ATOM   3957 N  N     . GLU B 1 255 ? 41.897 60.018 17.457  1.00 33.41 ? 1205 GLU B N     1 
ATOM   3958 C  CA    . GLU B 1 255 ? 41.141 61.009 16.706  1.00 33.40 ? 1205 GLU B CA    1 
ATOM   3959 C  C     . GLU B 1 255 ? 39.649 60.687 16.678  1.00 32.83 ? 1205 GLU B C     1 
ATOM   3960 O  O     . GLU B 1 255 ? 39.262 59.523 16.539  1.00 33.16 ? 1205 GLU B O     1 
ATOM   3961 C  CB    . GLU B 1 255 ? 41.679 61.099 15.279  1.00 33.67 ? 1205 GLU B CB    1 
ATOM   3962 C  CG    . GLU B 1 255 ? 41.302 62.371 14.534  1.00 34.49 ? 1205 GLU B CG    1 
ATOM   3963 C  CD    . GLU B 1 255 ? 41.913 62.431 13.141  1.00 34.84 ? 1205 GLU B CD    1 
ATOM   3964 O  OE1   . GLU B 1 255 ? 43.056 61.945 12.959  1.00 36.45 ? 1205 GLU B OE1   1 
ATOM   3965 O  OE2   . GLU B 1 255 ? 41.245 62.963 12.229  1.00 37.28 ? 1205 GLU B OE2   1 
ATOM   3966 N  N     . GLN B 1 256 ? 38.823 61.723 16.805  1.00 32.09 ? 1206 GLN B N     1 
ATOM   3967 C  CA    . GLN B 1 256 ? 37.378 61.570 16.698  1.00 31.35 ? 1206 GLN B CA    1 
ATOM   3968 C  C     . GLN B 1 256 ? 36.958 61.278 15.259  1.00 30.68 ? 1206 GLN B C     1 
ATOM   3969 O  O     . GLN B 1 256 ? 37.413 61.938 14.320  1.00 30.35 ? 1206 GLN B O     1 
ATOM   3970 C  CB    . GLN B 1 256 ? 36.648 62.819 17.188  1.00 31.54 ? 1206 GLN B CB    1 
ATOM   3971 C  CG    . GLN B 1 256 ? 35.131 62.649 17.218  1.00 32.01 ? 1206 GLN B CG    1 
ATOM   3972 C  CD    . GLN B 1 256 ? 34.371 63.857 17.740  1.00 32.10 ? 1206 GLN B CD    1 
ATOM   3973 O  OE1   . GLN B 1 256 ? 34.936 64.945 17.921  1.00 34.29 ? 1206 GLN B OE1   1 
ATOM   3974 N  NE2   . GLN B 1 256 ? 33.076 63.671 17.985  1.00 30.33 ? 1206 GLN B NE2   1 
ATOM   3975 N  N     . LEU B 1 257 ? 36.068 60.299 15.101  1.00 29.38 ? 1207 LEU B N     1 
ATOM   3976 C  CA    . LEU B 1 257 ? 35.441 60.025 13.815  1.00 28.33 ? 1207 LEU B CA    1 
ATOM   3977 C  C     . LEU B 1 257 ? 34.389 61.075 13.503  1.00 28.01 ? 1207 LEU B C     1 
ATOM   3978 O  O     . LEU B 1 257 ? 33.661 61.517 14.394  1.00 28.20 ? 1207 LEU B O     1 
ATOM   3979 C  CB    . LEU B 1 257 ? 34.782 58.638 13.825  1.00 27.73 ? 1207 LEU B CB    1 
ATOM   3980 C  CG    . LEU B 1 257 ? 35.599 57.390 14.162  1.00 27.43 ? 1207 LEU B CG    1 
ATOM   3981 C  CD1   . LEU B 1 257 ? 34.726 56.151 13.975  1.00 26.94 ? 1207 LEU B CD1   1 
ATOM   3982 C  CD2   . LEU B 1 257 ? 36.880 57.288 13.338  1.00 27.21 ? 1207 LEU B CD2   1 
ATOM   3983 N  N     . GLY B 1 258 ? 34.310 61.475 12.236  1.00 28.07 ? 1208 GLY B N     1 
ATOM   3984 C  CA    . GLY B 1 258 ? 33.260 62.369 11.777  1.00 27.82 ? 1208 GLY B CA    1 
ATOM   3985 C  C     . GLY B 1 258 ? 32.911 62.128 10.320  1.00 28.01 ? 1208 GLY B C     1 
ATOM   3986 O  O     . GLY B 1 258 ? 33.736 61.622 9.557   1.00 28.04 ? 1208 GLY B O     1 
ATOM   3987 N  N     . PHE B 1 259 ? 31.681 62.463 9.945   1.00 27.87 ? 1209 PHE B N     1 
ATOM   3988 C  CA    . PHE B 1 259 ? 31.272 62.469 8.542   1.00 28.56 ? 1209 PHE B CA    1 
ATOM   3989 C  C     . PHE B 1 259 ? 30.352 63.653 8.252   1.00 29.00 ? 1209 PHE B C     1 
ATOM   3990 O  O     . PHE B 1 259 ? 29.804 64.266 9.176   1.00 29.22 ? 1209 PHE B O     1 
ATOM   3991 C  CB    . PHE B 1 259 ? 30.657 61.123 8.092   1.00 28.26 ? 1209 PHE B CB    1 
ATOM   3992 C  CG    . PHE B 1 259 ? 29.206 60.930 8.479   1.00 27.58 ? 1209 PHE B CG    1 
ATOM   3993 C  CD1   . PHE B 1 259 ? 28.185 61.181 7.558   1.00 27.66 ? 1209 PHE B CD1   1 
ATOM   3994 C  CD2   . PHE B 1 259 ? 28.861 60.463 9.744   1.00 27.71 ? 1209 PHE B CD2   1 
ATOM   3995 C  CE1   . PHE B 1 259 ? 26.849 60.992 7.895   1.00 27.70 ? 1209 PHE B CE1   1 
ATOM   3996 C  CE2   . PHE B 1 259 ? 27.522 60.263 10.088  1.00 28.19 ? 1209 PHE B CE2   1 
ATOM   3997 C  CZ    . PHE B 1 259 ? 26.515 60.534 9.163   1.00 27.29 ? 1209 PHE B CZ    1 
ATOM   3998 N  N     . ASP B 1 260 ? 30.213 63.991 6.975   1.00 29.62 ? 1210 ASP B N     1 
ATOM   3999 C  CA    . ASP B 1 260 ? 29.344 65.084 6.564   1.00 30.68 ? 1210 ASP B CA    1 
ATOM   4000 C  C     . ASP B 1 260 ? 27.883 64.619 6.561   1.00 31.06 ? 1210 ASP B C     1 
ATOM   4001 O  O     . ASP B 1 260 ? 27.476 63.830 5.700   1.00 31.04 ? 1210 ASP B O     1 
ATOM   4002 C  CB    . ASP B 1 260 ? 29.769 65.608 5.180   1.00 30.96 ? 1210 ASP B CB    1 
ATOM   4003 C  CG    . ASP B 1 260 ? 29.064 66.908 4.785   1.00 32.25 ? 1210 ASP B CG    1 
ATOM   4004 O  OD1   . ASP B 1 260 ? 28.123 67.342 5.484   1.00 33.16 ? 1210 ASP B OD1   1 
ATOM   4005 O  OD2   . ASP B 1 260 ? 29.456 67.497 3.753   1.00 34.20 ? 1210 ASP B OD2   1 
ATOM   4006 N  N     . TYR B 1 261 ? 27.104 65.100 7.530   1.00 31.47 ? 1211 TYR B N     1 
ATOM   4007 C  CA    . TYR B 1 261 ? 25.669 64.781 7.620   1.00 32.44 ? 1211 TYR B CA    1 
ATOM   4008 C  C     . TYR B 1 261 ? 24.917 65.180 6.357   1.00 33.84 ? 1211 TYR B C     1 
ATOM   4009 O  O     . TYR B 1 261 ? 23.941 64.535 5.984   1.00 33.94 ? 1211 TYR B O     1 
ATOM   4010 C  CB    . TYR B 1 261 ? 25.020 65.480 8.820   1.00 31.75 ? 1211 TYR B CB    1 
ATOM   4011 C  CG    . TYR B 1 261 ? 25.334 64.909 10.186  1.00 31.06 ? 1211 TYR B CG    1 
ATOM   4012 C  CD1   . TYR B 1 261 ? 26.331 63.951 10.367  1.00 29.51 ? 1211 TYR B CD1   1 
ATOM   4013 C  CD2   . TYR B 1 261 ? 24.648 65.365 11.315  1.00 31.26 ? 1211 TYR B CD2   1 
ATOM   4014 C  CE1   . TYR B 1 261 ? 26.617 63.440 11.629  1.00 30.24 ? 1211 TYR B CE1   1 
ATOM   4015 C  CE2   . TYR B 1 261 ? 24.928 64.866 12.581  1.00 31.06 ? 1211 TYR B CE2   1 
ATOM   4016 C  CZ    . TYR B 1 261 ? 25.915 63.902 12.735  1.00 30.84 ? 1211 TYR B CZ    1 
ATOM   4017 O  OH    . TYR B 1 261 ? 26.197 63.403 13.984  1.00 30.73 ? 1211 TYR B OH    1 
ATOM   4018 N  N     . GLY B 1 262 ? 25.366 66.257 5.711   1.00 35.33 ? 1212 GLY B N     1 
ATOM   4019 C  CA    . GLY B 1 262 ? 24.789 66.703 4.450   1.00 37.27 ? 1212 GLY B CA    1 
ATOM   4020 C  C     . GLY B 1 262 ? 23.766 67.814 4.585   1.00 38.70 ? 1212 GLY B C     1 
ATOM   4021 O  O     . GLY B 1 262 ? 23.380 68.192 5.698   1.00 38.80 ? 1212 GLY B O     1 
ATOM   4022 N  N     . GLU B 1 263 ? 23.323 68.318 3.434   1.00 40.18 ? 1213 GLU B N     1 
ATOM   4023 C  CA    . GLU B 1 263 ? 22.396 69.451 3.348   1.00 41.82 ? 1213 GLU B CA    1 
ATOM   4024 C  C     . GLU B 1 263 ? 20.999 69.138 3.884   1.00 42.23 ? 1213 GLU B C     1 
ATOM   4025 O  O     . GLU B 1 263 ? 20.355 70.005 4.474   1.00 42.54 ? 1213 GLU B O     1 
ATOM   4026 C  CB    . GLU B 1 263 ? 22.297 69.958 1.901   1.00 42.14 ? 1213 GLU B CB    1 
ATOM   4027 C  CG    . GLU B 1 263 ? 23.639 70.305 1.231   1.00 44.60 ? 1213 GLU B CG    1 
ATOM   4028 C  CD    . GLU B 1 263 ? 24.366 71.474 1.886   1.00 47.64 ? 1213 GLU B CD    1 
ATOM   4029 O  OE1   . GLU B 1 263 ? 23.716 72.507 2.173   1.00 49.21 ? 1213 GLU B OE1   1 
ATOM   4030 O  OE2   . GLU B 1 263 ? 25.594 71.359 2.106   1.00 48.90 ? 1213 GLU B OE2   1 
ATOM   4031 N  N     . ARG B 1 264 ? 20.538 67.903 3.683   1.00 42.79 ? 1214 ARG B N     1 
ATOM   4032 C  CA    . ARG B 1 264 ? 19.201 67.482 4.127   1.00 43.48 ? 1214 ARG B CA    1 
ATOM   4033 C  C     . ARG B 1 264 ? 19.053 67.413 5.652   1.00 43.33 ? 1214 ARG B C     1 
ATOM   4034 O  O     . ARG B 1 264 ? 17.940 67.260 6.163   1.00 43.43 ? 1214 ARG B O     1 
ATOM   4035 C  CB    . ARG B 1 264 ? 18.811 66.140 3.493   1.00 43.41 ? 1214 ARG B CB    1 
ATOM   4036 C  CG    . ARG B 1 264 ? 18.164 66.251 2.121   1.00 44.14 ? 1214 ARG B CG    1 
ATOM   4037 C  CD    . ARG B 1 264 ? 17.844 64.873 1.555   1.00 44.67 ? 1214 ARG B CD    1 
ATOM   4038 N  NE    . ARG B 1 264 ? 18.964 64.320 0.793   1.00 46.99 ? 1214 ARG B NE    1 
ATOM   4039 C  CZ    . ARG B 1 264 ? 19.034 63.063 0.355   1.00 48.03 ? 1214 ARG B CZ    1 
ATOM   4040 N  NH1   . ARG B 1 264 ? 18.051 62.208 0.610   1.00 47.84 ? 1214 ARG B NH1   1 
ATOM   4041 N  NH2   . ARG B 1 264 ? 20.093 62.657 -0.340  1.00 47.62 ? 1214 ARG B NH2   1 
ATOM   4042 N  N     . PHE B 1 265 ? 20.176 67.514 6.364   1.00 43.45 ? 1215 PHE B N     1 
ATOM   4043 C  CA    . PHE B 1 265 ? 20.185 67.565 7.823   1.00 43.60 ? 1215 PHE B CA    1 
ATOM   4044 C  C     . PHE B 1 265 ? 20.236 69.014 8.320   1.00 44.11 ? 1215 PHE B C     1 
ATOM   4045 O  O     . PHE B 1 265 ? 19.396 69.430 9.126   1.00 44.15 ? 1215 PHE B O     1 
ATOM   4046 C  CB    . PHE B 1 265 ? 21.370 66.764 8.381   1.00 43.30 ? 1215 PHE B CB    1 
ATOM   4047 C  CG    . PHE B 1 265 ? 21.495 66.811 9.884   1.00 42.67 ? 1215 PHE B CG    1 
ATOM   4048 C  CD1   . PHE B 1 265 ? 20.884 65.845 10.678  1.00 42.14 ? 1215 PHE B CD1   1 
ATOM   4049 C  CD2   . PHE B 1 265 ? 22.235 67.818 10.506  1.00 41.94 ? 1215 PHE B CD2   1 
ATOM   4050 C  CE1   . PHE B 1 265 ? 20.998 65.884 12.069  1.00 42.05 ? 1215 PHE B CE1   1 
ATOM   4051 C  CE2   . PHE B 1 265 ? 22.357 67.865 11.889  1.00 41.40 ? 1215 PHE B CE2   1 
ATOM   4052 C  CZ    . PHE B 1 265 ? 21.738 66.896 12.675  1.00 42.22 ? 1215 PHE B CZ    1 
ATOM   4053 N  N     . TRP B 1 266 ? 21.223 69.769 7.832   1.00 44.58 ? 1216 TRP B N     1 
ATOM   4054 C  CA    . TRP B 1 266 ? 21.494 71.126 8.328   1.00 45.05 ? 1216 TRP B CA    1 
ATOM   4055 C  C     . TRP B 1 266 ? 20.447 72.169 7.932   1.00 45.85 ? 1216 TRP B C     1 
ATOM   4056 O  O     . TRP B 1 266 ? 20.257 73.156 8.649   1.00 46.10 ? 1216 TRP B O     1 
ATOM   4057 C  CB    . TRP B 1 266 ? 22.902 71.580 7.939   1.00 44.29 ? 1216 TRP B CB    1 
ATOM   4058 C  CG    . TRP B 1 266 ? 23.968 70.888 8.724   1.00 43.59 ? 1216 TRP B CG    1 
ATOM   4059 C  CD1   . TRP B 1 266 ? 24.786 69.889 8.286   1.00 42.66 ? 1216 TRP B CD1   1 
ATOM   4060 C  CD2   . TRP B 1 266 ? 24.322 71.127 10.094  1.00 42.90 ? 1216 TRP B CD2   1 
ATOM   4061 N  NE1   . TRP B 1 266 ? 25.635 69.496 9.292   1.00 42.22 ? 1216 TRP B NE1   1 
ATOM   4062 C  CE2   . TRP B 1 266 ? 25.373 70.238 10.413  1.00 42.75 ? 1216 TRP B CE2   1 
ATOM   4063 C  CE3   . TRP B 1 266 ? 23.859 72.012 11.082  1.00 43.01 ? 1216 TRP B CE3   1 
ATOM   4064 C  CZ2   . TRP B 1 266 ? 25.968 70.200 11.681  1.00 43.06 ? 1216 TRP B CZ2   1 
ATOM   4065 C  CZ3   . TRP B 1 266 ? 24.452 71.976 12.342  1.00 42.67 ? 1216 TRP B CZ3   1 
ATOM   4066 C  CH2   . TRP B 1 266 ? 25.497 71.075 12.628  1.00 43.40 ? 1216 TRP B CH2   1 
ATOM   4067 N  N     . ASP B 1 267 ? 19.768 71.947 6.805   1.00 46.88 ? 1217 ASP B N     1 
ATOM   4068 C  CA    . ASP B 1 267 ? 18.640 72.793 6.397   1.00 47.96 ? 1217 ASP B CA    1 
ATOM   4069 C  C     . ASP B 1 267 ? 17.530 72.814 7.449   1.00 48.42 ? 1217 ASP B C     1 
ATOM   4070 O  O     . ASP B 1 267 ? 16.757 73.773 7.530   1.00 48.57 ? 1217 ASP B O     1 
ATOM   4071 C  CB    . ASP B 1 267 ? 18.066 72.336 5.054   1.00 48.05 ? 1217 ASP B CB    1 
ATOM   4072 C  CG    . ASP B 1 267 ? 18.946 72.720 3.873   1.00 49.52 ? 1217 ASP B CG    1 
ATOM   4073 O  OD1   . ASP B 1 267 ? 20.051 73.270 4.082   1.00 50.28 ? 1217 ASP B OD1   1 
ATOM   4074 O  OD2   . ASP B 1 267 ? 18.529 72.462 2.722   1.00 51.21 ? 1217 ASP B OD2   1 
ATOM   4075 N  N     . ILE B 1 268 ? 17.461 71.751 8.249   1.00 48.82 ? 1218 ILE B N     1 
ATOM   4076 C  CA    . ILE B 1 268 ? 16.463 71.623 9.306   1.00 49.18 ? 1218 ILE B CA    1 
ATOM   4077 C  C     . ILE B 1 268 ? 17.083 71.949 10.664  1.00 49.54 ? 1218 ILE B C     1 
ATOM   4078 O  O     . ILE B 1 268 ? 16.524 72.734 11.435  1.00 49.63 ? 1218 ILE B O     1 
ATOM   4079 C  CB    . ILE B 1 268 ? 15.830 70.189 9.331   1.00 49.15 ? 1218 ILE B CB    1 
ATOM   4080 C  CG1   . ILE B 1 268 ? 15.267 69.794 7.952   1.00 49.08 ? 1218 ILE B CG1   1 
ATOM   4081 C  CG2   . ILE B 1 268 ? 14.783 70.054 10.448  1.00 48.90 ? 1218 ILE B CG2   1 
ATOM   4082 C  CD1   . ILE B 1 268 ? 14.064 70.599 7.464   1.00 49.36 ? 1218 ILE B CD1   1 
ATOM   4083 N  N     . LYS B 1 269 ? 18.246 71.360 10.937  1.00 49.96 ? 1219 LYS B N     1 
ATOM   4084 C  CA    . LYS B 1 269 ? 18.871 71.429 12.260  1.00 50.40 ? 1219 LYS B CA    1 
ATOM   4085 C  C     . LYS B 1 269 ? 19.736 72.667 12.498  1.00 50.95 ? 1219 LYS B C     1 
ATOM   4086 O  O     . LYS B 1 269 ? 20.080 72.970 13.644  1.00 50.82 ? 1219 LYS B O     1 
ATOM   4087 C  CB    . LYS B 1 269 ? 19.688 70.160 12.537  1.00 50.30 ? 1219 LYS B CB    1 
ATOM   4088 C  CG    . LYS B 1 269 ? 18.861 68.891 12.705  1.00 49.54 ? 1219 LYS B CG    1 
ATOM   4089 C  CD    . LYS B 1 269 ? 18.042 68.909 13.981  1.00 48.61 ? 1219 LYS B CD    1 
ATOM   4090 C  CE    . LYS B 1 269 ? 17.247 67.629 14.130  1.00 48.24 ? 1219 LYS B CE    1 
ATOM   4091 N  NZ    . LYS B 1 269 ? 16.114 67.789 15.079  1.00 47.54 ? 1219 LYS B NZ    1 
ATOM   4092 N  N     . GLY B 1 270 ? 20.089 73.369 11.422  1.00 51.60 ? 1220 GLY B N     1 
ATOM   4093 C  CA    . GLY B 1 270 ? 20.829 74.629 11.523  1.00 52.55 ? 1220 GLY B CA    1 
ATOM   4094 C  C     . GLY B 1 270 ? 20.019 75.685 12.252  1.00 53.18 ? 1220 GLY B C     1 
ATOM   4095 O  O     . GLY B 1 270 ? 20.576 76.565 12.914  1.00 53.38 ? 1220 GLY B O     1 
ATOM   4096 N  N     . LYS B 1 271 ? 18.697 75.571 12.138  1.00 53.79 ? 1221 LYS B N     1 
ATOM   4097 C  CA    . LYS B 1 271 ? 17.746 76.471 12.787  1.00 54.40 ? 1221 LYS B CA    1 
ATOM   4098 C  C     . LYS B 1 271 ? 17.618 76.251 14.300  1.00 54.86 ? 1221 LYS B C     1 
ATOM   4099 O  O     . LYS B 1 271 ? 16.879 76.977 14.971  1.00 55.06 ? 1221 LYS B O     1 
ATOM   4100 C  CB    . LYS B 1 271 ? 16.373 76.348 12.116  1.00 54.41 ? 1221 LYS B CB    1 
ATOM   4101 C  CG    . LYS B 1 271 ? 16.371 76.765 10.651  1.00 54.93 ? 1221 LYS B CG    1 
ATOM   4102 C  CD    . LYS B 1 271 ? 15.077 76.393 9.948   1.00 55.45 ? 1221 LYS B CD    1 
ATOM   4103 C  CE    . LYS B 1 271 ? 15.155 76.744 8.468   1.00 55.83 ? 1221 LYS B CE    1 
ATOM   4104 N  NZ    . LYS B 1 271 ? 13.966 76.281 7.695   1.00 56.17 ? 1221 LYS B NZ    1 
ATOM   4105 N  N     . LEU B 1 272 ? 18.341 75.264 14.831  1.00 55.28 ? 1222 LEU B N     1 
ATOM   4106 C  CA    . LEU B 1 272 ? 18.284 74.922 16.260  1.00 55.76 ? 1222 LEU B CA    1 
ATOM   4107 C  C     . LEU B 1 272 ? 19.645 75.014 16.942  1.00 55.97 ? 1222 LEU B C     1 
ATOM   4108 O  O     . LEU B 1 272 ? 19.734 75.367 18.120  1.00 56.07 ? 1222 LEU B O     1 
ATOM   4109 C  CB    . LEU B 1 272 ? 17.708 73.514 16.461  1.00 55.78 ? 1222 LEU B CB    1 
ATOM   4110 C  CG    . LEU B 1 272 ? 16.189 73.336 16.395  1.00 56.11 ? 1222 LEU B CG    1 
ATOM   4111 C  CD1   . LEU B 1 272 ? 15.835 71.860 16.264  1.00 56.51 ? 1222 LEU B CD1   1 
ATOM   4112 C  CD2   . LEU B 1 272 ? 15.506 73.951 17.616  1.00 56.11 ? 1222 LEU B CD2   1 
ATOM   4113 N  N     . PHE B 1 273 ? 20.692 74.668 16.197  1.00 56.14 ? 1223 PHE B N     1 
ATOM   4114 C  CA    . PHE B 1 273 ? 22.071 74.763 16.665  1.00 56.27 ? 1223 PHE B CA    1 
ATOM   4115 C  C     . PHE B 1 273 ? 23.002 74.945 15.471  1.00 56.18 ? 1223 PHE B C     1 
ATOM   4116 O  O     . PHE B 1 273 ? 22.606 74.732 14.321  1.00 56.15 ? 1223 PHE B O     1 
ATOM   4117 C  CB    . PHE B 1 273 ? 22.471 73.530 17.494  1.00 56.44 ? 1223 PHE B CB    1 
ATOM   4118 C  CG    . PHE B 1 273 ? 22.329 72.221 16.757  1.00 57.01 ? 1223 PHE B CG    1 
ATOM   4119 C  CD1   . PHE B 1 273 ? 23.400 71.688 16.042  1.00 57.20 ? 1223 PHE B CD1   1 
ATOM   4120 C  CD2   . PHE B 1 273 ? 21.125 71.517 16.783  1.00 57.48 ? 1223 PHE B CD2   1 
ATOM   4121 C  CE1   . PHE B 1 273 ? 23.271 70.483 15.356  1.00 57.30 ? 1223 PHE B CE1   1 
ATOM   4122 C  CE2   . PHE B 1 273 ? 20.988 70.310 16.101  1.00 57.47 ? 1223 PHE B CE2   1 
ATOM   4123 C  CZ    . PHE B 1 273 ? 22.063 69.794 15.387  1.00 57.11 ? 1223 PHE B CZ    1 
ATOM   4124 N  N     . SER B 1 274 ? 24.235 75.353 15.749  1.00 56.11 ? 1224 SER B N     1 
ATOM   4125 C  CA    . SER B 1 274 ? 25.243 75.512 14.708  1.00 55.90 ? 1224 SER B CA    1 
ATOM   4126 C  C     . SER B 1 274 ? 26.397 74.542 14.938  1.00 55.63 ? 1224 SER B C     1 
ATOM   4127 O  O     . SER B 1 274 ? 26.589 74.031 16.047  1.00 55.52 ? 1224 SER B O     1 
ATOM   4128 C  CB    . SER B 1 274 ? 25.738 76.964 14.640  1.00 56.02 ? 1224 SER B CB    1 
ATOM   4129 O  OG    . SER B 1 274 ? 26.217 77.410 15.898  1.00 56.29 ? 1224 SER B OG    1 
ATOM   4130 N  N     . CYS B 1 275 ? 27.159 74.295 13.877  1.00 55.33 ? 1225 CYS B N     1 
ATOM   4131 C  CA    . CYS B 1 275 ? 28.238 73.318 13.905  1.00 55.31 ? 1225 CYS B CA    1 
ATOM   4132 C  C     . CYS B 1 275 ? 29.424 73.766 14.764  1.00 55.34 ? 1225 CYS B C     1 
ATOM   4133 O  O     . CYS B 1 275 ? 29.866 74.916 14.688  1.00 55.53 ? 1225 CYS B O     1 
ATOM   4134 C  CB    . CYS B 1 275 ? 28.691 73.002 12.479  1.00 55.26 ? 1225 CYS B CB    1 
ATOM   4135 S  SG    . CYS B 1 275 ? 30.016 71.811 12.390  1.00 54.85 ? 1225 CYS B SG    1 
ATOM   4136 N  N     . ARG B 1 276 ? 29.925 72.840 15.577  1.00 55.26 ? 1226 ARG B N     1 
ATOM   4137 C  CA    . ARG B 1 276 ? 31.080 73.073 16.441  1.00 55.26 ? 1226 ARG B CA    1 
ATOM   4138 C  C     . ARG B 1 276 ? 32.251 72.145 16.107  1.00 54.94 ? 1226 ARG B C     1 
ATOM   4139 O  O     . ARG B 1 276 ? 33.007 71.747 16.999  1.00 54.82 ? 1226 ARG B O     1 
ATOM   4140 C  CB    . ARG B 1 276 ? 30.682 72.929 17.915  1.00 55.46 ? 1226 ARG B CB    1 
ATOM   4141 C  CG    . ARG B 1 276 ? 30.588 74.254 18.666  1.00 56.58 ? 1226 ARG B CG    1 
ATOM   4142 C  CD    . ARG B 1 276 ? 29.827 74.121 19.981  1.00 58.00 ? 1226 ARG B CD    1 
ATOM   4143 N  NE    . ARG B 1 276 ? 28.384 74.220 19.773  1.00 59.50 ? 1226 ARG B NE    1 
ATOM   4144 C  CZ    . ARG B 1 276 ? 27.539 73.191 19.781  1.00 60.12 ? 1226 ARG B CZ    1 
ATOM   4145 N  NH1   . ARG B 1 276 ? 27.976 71.955 20.002  1.00 60.85 ? 1226 ARG B NH1   1 
ATOM   4146 N  NH2   . ARG B 1 276 ? 26.245 73.402 19.575  1.00 60.60 ? 1226 ARG B NH2   1 
ATOM   4147 N  N     . CYS B 1 277 ? 32.402 71.813 14.822  1.00 54.82 ? 1227 CYS B N     1 
ATOM   4148 C  CA    . CYS B 1 277 ? 33.482 70.928 14.364  1.00 54.55 ? 1227 CYS B CA    1 
ATOM   4149 C  C     . CYS B 1 277 ? 34.847 71.603 14.454  1.00 54.74 ? 1227 CYS B C     1 
ATOM   4150 O  O     . CYS B 1 277 ? 35.861 70.939 14.678  1.00 54.63 ? 1227 CYS B O     1 
ATOM   4151 C  CB    . CYS B 1 277 ? 33.225 70.404 12.942  1.00 54.47 ? 1227 CYS B CB    1 
ATOM   4152 S  SG    . CYS B 1 277 ? 33.440 71.594 11.577  1.00 53.34 ? 1227 CYS B SG    1 
ATOM   4153 N  N     . GLY B 1 278 ? 34.859 72.923 14.276  1.00 54.97 ? 1228 GLY B N     1 
ATOM   4154 C  CA    . GLY B 1 278 ? 36.071 73.722 14.447  1.00 55.27 ? 1228 GLY B CA    1 
ATOM   4155 C  C     . GLY B 1 278 ? 36.861 73.965 13.175  1.00 55.44 ? 1228 GLY B C     1 
ATOM   4156 O  O     . GLY B 1 278 ? 37.779 74.787 13.163  1.00 55.51 ? 1228 GLY B O     1 
ATOM   4157 N  N     . SER B 1 279 ? 36.504 73.258 12.105  1.00 55.49 ? 1229 SER B N     1 
ATOM   4158 C  CA    . SER B 1 279 ? 37.218 73.357 10.833  1.00 55.61 ? 1229 SER B CA    1 
ATOM   4159 C  C     . SER B 1 279 ? 37.315 74.799 10.326  1.00 55.76 ? 1229 SER B C     1 
ATOM   4160 O  O     . SER B 1 279 ? 36.309 75.517 10.308  1.00 55.68 ? 1229 SER B O     1 
ATOM   4161 C  CB    . SER B 1 279 ? 36.554 72.474 9.771   1.00 55.58 ? 1229 SER B CB    1 
ATOM   4162 O  OG    . SER B 1 279 ? 37.132 72.681 8.492   1.00 55.33 ? 1229 SER B OG    1 
ATOM   4163 N  N     . PRO B 1 280 ? 38.530 75.224 9.915   1.00 55.95 ? 1230 PRO B N     1 
ATOM   4164 C  CA    . PRO B 1 280 ? 38.732 76.511 9.242   1.00 56.07 ? 1230 PRO B CA    1 
ATOM   4165 C  C     . PRO B 1 280 ? 37.856 76.644 7.997   1.00 56.20 ? 1230 PRO B C     1 
ATOM   4166 O  O     . PRO B 1 280 ? 37.568 77.762 7.564   1.00 56.27 ? 1230 PRO B O     1 
ATOM   4167 C  CB    . PRO B 1 280 ? 40.207 76.465 8.834   1.00 56.10 ? 1230 PRO B CB    1 
ATOM   4168 C  CG    . PRO B 1 280 ? 40.838 75.535 9.800   1.00 56.07 ? 1230 PRO B CG    1 
ATOM   4169 C  CD    . PRO B 1 280 ? 39.800 74.493 10.087  1.00 55.96 ? 1230 PRO B CD    1 
ATOM   4170 N  N     . LYS B 1 281 ? 37.441 75.506 7.439   1.00 56.23 ? 1231 LYS B N     1 
ATOM   4171 C  CA    . LYS B 1 281 ? 36.549 75.470 6.281   1.00 56.33 ? 1231 LYS B CA    1 
ATOM   4172 C  C     . LYS B 1 281 ? 35.113 75.050 6.632   1.00 56.19 ? 1231 LYS B C     1 
ATOM   4173 O  O     . LYS B 1 281 ? 34.423 74.427 5.820   1.00 56.01 ? 1231 LYS B O     1 
ATOM   4174 C  CB    . LYS B 1 281 ? 37.130 74.570 5.180   1.00 56.45 ? 1231 LYS B CB    1 
ATOM   4175 C  CG    . LYS B 1 281 ? 37.877 75.319 4.073   1.00 57.28 ? 1231 LYS B CG    1 
ATOM   4176 C  CD    . LYS B 1 281 ? 36.932 76.236 3.279   1.00 58.38 ? 1231 LYS B CD    1 
ATOM   4177 C  CE    . LYS B 1 281 ? 37.577 76.770 2.008   1.00 58.89 ? 1231 LYS B CE    1 
ATOM   4178 N  NZ    . LYS B 1 281 ? 37.650 75.724 0.950   1.00 59.21 ? 1231 LYS B NZ    1 
ATOM   4179 N  N     . CYS B 1 282 ? 34.667 75.406 7.836   1.00 56.15 ? 1232 CYS B N     1 
ATOM   4180 C  CA    . CYS B 1 282 ? 33.305 75.098 8.280   1.00 56.10 ? 1232 CYS B CA    1 
ATOM   4181 C  C     . CYS B 1 282 ? 32.249 75.766 7.400   1.00 56.01 ? 1232 CYS B C     1 
ATOM   4182 O  O     . CYS B 1 282 ? 32.401 76.918 6.992   1.00 56.02 ? 1232 CYS B O     1 
ATOM   4183 C  CB    . CYS B 1 282 ? 33.097 75.495 9.742   1.00 55.99 ? 1232 CYS B CB    1 
ATOM   4184 S  SG    . CYS B 1 282 ? 31.442 75.104 10.374  1.00 56.36 ? 1232 CYS B SG    1 
ATOM   4185 N  N     . ARG B 1 283 ? 31.181 75.027 7.115   1.00 55.91 ? 1233 ARG B N     1 
ATOM   4186 C  CA    . ARG B 1 283 ? 30.113 75.503 6.244   1.00 55.89 ? 1233 ARG B CA    1 
ATOM   4187 C  C     . ARG B 1 283 ? 28.788 75.648 6.995   1.00 55.85 ? 1233 ARG B C     1 
ATOM   4188 O  O     . ARG B 1 283 ? 27.756 75.955 6.392   1.00 55.91 ? 1233 ARG B O     1 
ATOM   4189 C  CB    . ARG B 1 283 ? 29.960 74.570 5.035   1.00 55.88 ? 1233 ARG B CB    1 
ATOM   4190 C  CG    . ARG B 1 283 ? 31.132 74.629 4.062   1.00 55.96 ? 1233 ARG B CG    1 
ATOM   4191 C  CD    . ARG B 1 283 ? 31.113 73.489 3.054   1.00 56.02 ? 1233 ARG B CD    1 
ATOM   4192 N  NE    . ARG B 1 283 ? 31.573 72.230 3.641   1.00 56.88 ? 1233 ARG B NE    1 
ATOM   4193 C  CZ    . ARG B 1 283 ? 30.800 71.168 3.861   1.00 56.76 ? 1233 ARG B CZ    1 
ATOM   4194 N  NH1   . ARG B 1 283 ? 31.322 70.077 4.405   1.00 56.69 ? 1233 ARG B NH1   1 
ATOM   4195 N  NH2   . ARG B 1 283 ? 29.513 71.187 3.538   1.00 56.53 ? 1233 ARG B NH2   1 
ATOM   4196 N  N     . HIS B 1 284 ? 28.828 75.429 8.310   1.00 55.85 ? 1234 HIS B N     1 
ATOM   4197 C  CA    . HIS B 1 284 ? 27.638 75.503 9.165   1.00 55.89 ? 1234 HIS B CA    1 
ATOM   4198 C  C     . HIS B 1 284 ? 27.944 76.133 10.532  1.00 56.11 ? 1234 HIS B C     1 
ATOM   4199 O  O     . HIS B 1 284 ? 27.382 75.726 11.554  1.00 56.19 ? 1234 HIS B O     1 
ATOM   4200 C  CB    . HIS B 1 284 ? 27.015 74.108 9.351   1.00 55.73 ? 1234 HIS B CB    1 
ATOM   4201 C  CG    . HIS B 1 284 ? 26.684 73.412 8.068   1.00 55.18 ? 1234 HIS B CG    1 
ATOM   4202 N  ND1   . HIS B 1 284 ? 27.440 72.372 7.571   1.00 54.90 ? 1234 HIS B ND1   1 
ATOM   4203 C  CD2   . HIS B 1 284 ? 25.684 73.610 7.177   1.00 54.71 ? 1234 HIS B CD2   1 
ATOM   4204 C  CE1   . HIS B 1 284 ? 26.918 71.958 6.430   1.00 54.34 ? 1234 HIS B CE1   1 
ATOM   4205 N  NE2   . HIS B 1 284 ? 25.851 72.693 6.169   1.00 54.46 ? 1234 HIS B NE2   1 
ATOM   4206 N  N     . SER B 1 285 ? 28.829 77.131 10.541  1.00 56.26 ? 1235 SER B N     1 
ATOM   4207 C  CA    . SER B 1 285 ? 29.236 77.808 11.777  1.00 56.34 ? 1235 SER B CA    1 
ATOM   4208 C  C     . SER B 1 285 ? 28.168 78.779 12.277  1.00 56.40 ? 1235 SER B C     1 
ATOM   4209 O  O     . SER B 1 285 ? 27.306 79.222 11.515  1.00 56.50 ? 1235 SER B O     1 
ATOM   4210 C  CB    . SER B 1 285 ? 30.563 78.529 11.578  1.00 56.26 ? 1235 SER B CB    1 
ATOM   4211 N  N     . LYS C 2 2   ? 1.193  12.926 0.884   1.00 22.94 ? 2    LYS P N     1 
ATOM   4212 C  CA    . LYS C 2 2   ? 1.753  13.903 -0.077  1.00 22.84 ? 2    LYS P CA    1 
ATOM   4213 C  C     . LYS C 2 2   ? 2.252  13.221 -1.355  1.00 22.92 ? 2    LYS P C     1 
ATOM   4214 O  O     . LYS C 2 2   ? 2.429  11.997 -1.395  1.00 24.03 ? 2    LYS P O     1 
ATOM   4215 C  CB    . LYS C 2 2   ? 2.875  14.690 0.612   1.00 22.47 ? 2    LYS P CB    1 
ATOM   4216 C  CG    . LYS C 2 2   ? 2.472  15.126 2.005   1.00 22.15 ? 2    LYS P CG    1 
ATOM   4217 C  CD    . LYS C 2 2   ? 3.205  16.373 2.458   1.00 22.29 ? 2    LYS P CD    1 
ATOM   4218 C  CE    . LYS C 2 2   ? 2.787  16.782 3.858   1.00 21.18 ? 2    LYS P CE    1 
ATOM   4219 N  NZ    . LYS C 2 2   ? 3.533  18.004 4.319   1.00 20.91 ? 2    LYS P NZ    1 
ATOM   4220 N  N     . GLN C 2 3   ? 2.477  14.016 -2.392  1.00 23.20 ? 3    GLN P N     1 
ATOM   4221 C  CA    . GLN C 2 3   ? 2.907  13.508 -3.690  1.00 23.53 ? 3    GLN P CA    1 
ATOM   4222 C  C     . GLN C 2 3   ? 4.410  13.276 -3.744  1.00 23.23 ? 3    GLN P C     1 
ATOM   4223 O  O     . GLN C 2 3   ? 4.905  12.540 -4.599  1.00 23.74 ? 3    GLN P O     1 
ATOM   4224 C  CB    . GLN C 2 3   ? 2.504  14.491 -4.793  1.00 23.89 ? 3    GLN P CB    1 
ATOM   4225 C  CG    . GLN C 2 3   ? 1.002  14.485 -5.088  1.00 26.71 ? 3    GLN P CG    1 
ATOM   4226 C  CD    . GLN C 2 3   ? 0.547  13.149 -5.639  1.00 29.74 ? 3    GLN P CD    1 
ATOM   4227 O  OE1   . GLN C 2 3   ? 0.930  12.765 -6.742  1.00 32.36 ? 3    GLN P OE1   1 
ATOM   4228 N  NE2   . GLN C 2 3   ? -0.246 12.421 -4.860  1.00 31.35 ? 3    GLN P NE2   1 
ATOM   4229 N  N     . THR C 2 4   ? 5.130  13.931 -2.835  1.00 21.93 ? 4    THR P N     1 
ATOM   4230 C  CA    . THR C 2 4   ? 6.584  13.820 -2.766  1.00 20.65 ? 4    THR P CA    1 
ATOM   4231 C  C     . THR C 2 4   ? 7.048  13.347 -1.384  1.00 20.43 ? 4    THR P C     1 
ATOM   4232 O  O     . THR C 2 4   ? 6.383  13.592 -0.366  1.00 20.70 ? 4    THR P O     1 
ATOM   4233 C  CB    . THR C 2 4   ? 7.248  15.162 -3.102  1.00 20.47 ? 4    THR P CB    1 
ATOM   4234 O  OG1   . THR C 2 4   ? 6.675  16.183 -2.273  1.00 19.76 ? 4    THR P OG1   1 
ATOM   4235 C  CG2   . THR C 2 4   ? 7.041  15.512 -4.574  1.00 21.05 ? 4    THR P CG2   1 
ATOM   4236 N  N     . ALA C 2 5   ? 8.187  12.651 -1.371  1.00 20.05 ? 5    ALA P N     1 
ATOM   4237 C  CA    . ALA C 2 5   ? 8.834  12.204 -0.137  1.00 19.02 ? 5    ALA P CA    1 
ATOM   4238 C  C     . ALA C 2 5   ? 9.276  13.425 0.658   1.00 18.49 ? 5    ALA P C     1 
ATOM   4239 O  O     . ALA C 2 5   ? 9.805  14.381 0.077   1.00 18.87 ? 5    ALA P O     1 
ATOM   4240 C  CB    . ALA C 2 5   ? 10.043 11.330 -0.455  1.00 19.40 ? 5    ALA P CB    1 
ATOM   4241 N  N     . ARG C 2 6   ? 9.044  13.375 1.965   1.00 17.84 ? 6    ARG P N     1 
ATOM   4242 C  CA    . ARG C 2 6   ? 9.445  14.437 2.889   1.00 17.59 ? 6    ARG P CA    1 
ATOM   4243 C  C     . ARG C 2 6   ? 10.155 13.777 4.057   1.00 17.47 ? 6    ARG P C     1 
ATOM   4244 O  O     . ARG C 2 6   ? 9.623  12.897 4.741   1.00 17.53 ? 6    ARG P O     1 
ATOM   4245 C  CB    . ARG C 2 6   ? 8.254  15.248 3.424   1.00 18.01 ? 6    ARG P CB    1 
ATOM   4246 C  CG    . ARG C 2 6   ? 7.192  15.631 2.387   1.00 17.93 ? 6    ARG P CG    1 
ATOM   4247 C  CD    . ARG C 2 6   ? 7.679  16.639 1.360   1.00 19.84 ? 6    ARG P CD    1 
ATOM   4248 N  NE    . ARG C 2 6   ? 6.572  16.997 0.471   1.00 18.14 ? 6    ARG P NE    1 
ATOM   4249 C  CZ    . ARG C 2 6   ? 5.708  17.981 0.708   1.00 17.90 ? 6    ARG P CZ    1 
ATOM   4250 N  NH1   . ARG C 2 6   ? 4.735  18.223 -0.157  1.00 19.37 ? 6    ARG P NH1   1 
ATOM   4251 N  NH2   . ARG C 2 6   ? 5.816  18.729 1.803   1.00 17.67 ? 6    ARG P NH2   1 
HETATM 4252 N  N     . MLY C 2 7   ? 11.549 14.323 4.318   1.00 14.28 ? 7    MLY P N     1 
HETATM 4253 C  CA    . MLY C 2 7   ? 12.024 14.032 5.675   1.00 14.16 ? 7    MLY P CA    1 
HETATM 4254 C  CB    . MLY C 2 7   ? 13.490 14.473 5.813   1.00 14.12 ? 7    MLY P CB    1 
HETATM 4255 C  CG    . MLY C 2 7   ? 14.322 13.819 4.708   1.00 13.95 ? 7    MLY P CG    1 
HETATM 4256 C  CD    . MLY C 2 7   ? 15.657 14.568 4.506   1.00 15.68 ? 7    MLY P CD    1 
HETATM 4257 C  CE    . MLY C 2 7   ? 16.552 13.884 3.460   1.00 16.64 ? 7    MLY P CE    1 
HETATM 4258 N  NZ    . MLY C 2 7   ? 17.893 14.527 3.384   1.00 16.37 ? 7    MLY P NZ    1 
HETATM 4259 C  CH1   . MLY C 2 7   ? 18.627 13.951 2.263   1.00 17.64 ? 7    MLY P CH1   1 
HETATM 4260 C  CH2   . MLY C 2 7   ? 18.725 14.340 4.590   1.00 17.39 ? 7    MLY P CH2   1 
HETATM 4261 C  C     . MLY C 2 7   ? 11.179 14.797 6.682   1.00 14.95 ? 7    MLY P C     1 
HETATM 4262 O  O     . MLY C 2 7   ? 10.503 15.771 6.371   1.00 15.29 ? 7    MLY P O     1 
ATOM   4263 N  N     . SER C 2 8   ? 11.139 14.313 8.154   1.00 24.18 ? 8    SER P N     1 
ATOM   4264 C  CA    . SER C 2 8   ? 10.328 15.091 9.110   1.00 24.84 ? 8    SER P CA    1 
ATOM   4265 C  C     . SER C 2 8   ? 10.893 14.770 10.460  1.00 25.29 ? 8    SER P C     1 
ATOM   4266 O  O     . SER C 2 8   ? 11.698 13.847 10.600  1.00 24.96 ? 8    SER P O     1 
ATOM   4267 C  CB    . SER C 2 8   ? 8.857  14.669 9.017   1.00 24.58 ? 8    SER P CB    1 
ATOM   4268 O  OG    . SER C 2 8   ? 8.712  13.281 9.274   1.00 25.64 ? 8    SER P OG    1 
ATOM   4269 N  N     . THR C 2 9   ? 10.479 15.538 11.454  1.00 26.15 ? 9    THR P N     1 
ATOM   4270 C  CA    . THR C 2 9   ? 10.777 15.206 12.837  1.00 27.52 ? 9    THR P CA    1 
ATOM   4271 C  C     . THR C 2 9   ? 9.794  14.124 13.305  1.00 28.57 ? 9    THR P C     1 
ATOM   4272 O  O     . THR C 2 9   ? 8.721  13.939 12.709  1.00 29.11 ? 9    THR P O     1 
ATOM   4273 C  CB    . THR C 2 9   ? 10.613 16.414 13.721  1.00 28.25 ? 9    THR P CB    1 
ATOM   4274 O  OG1   . THR C 2 9   ? 9.253  16.858 13.628  1.00 29.48 ? 9    THR P OG1   1 
ATOM   4275 C  CG2   . THR C 2 9   ? 11.553 17.534 13.290  1.00 28.01 ? 9    THR P CG2   1 
ATOM   4276 N  N     . THR D 2 4   ? 11.293 66.479 8.268   1.00 39.46 ? 4    THR Q N     1 
ATOM   4277 C  CA    . THR D 2 4   ? 12.287 65.923 9.233   1.00 39.17 ? 4    THR Q CA    1 
ATOM   4278 C  C     . THR D 2 4   ? 13.706 66.020 8.673   1.00 38.87 ? 4    THR Q C     1 
ATOM   4279 O  O     . THR D 2 4   ? 13.905 66.018 7.454   1.00 38.57 ? 4    THR Q O     1 
ATOM   4280 C  CB    . THR D 2 4   ? 11.976 64.445 9.575   1.00 39.37 ? 4    THR Q CB    1 
ATOM   4281 O  OG1   . THR D 2 4   ? 11.819 63.694 8.364   1.00 39.64 ? 4    THR Q OG1   1 
ATOM   4282 C  CG2   . THR D 2 4   ? 10.696 64.336 10.409  1.00 39.54 ? 4    THR Q CG2   1 
ATOM   4283 N  N     . ALA D 2 5   ? 14.687 66.117 9.567   1.00 38.78 ? 5    ALA Q N     1 
ATOM   4284 C  CA    . ALA D 2 5   ? 16.092 66.108 9.171   1.00 38.77 ? 5    ALA Q CA    1 
ATOM   4285 C  C     . ALA D 2 5   ? 16.485 64.717 8.685   1.00 38.95 ? 5    ALA Q C     1 
ATOM   4286 O  O     . ALA D 2 5   ? 16.125 63.709 9.300   1.00 39.01 ? 5    ALA Q O     1 
ATOM   4287 C  CB    . ALA D 2 5   ? 16.983 66.536 10.330  1.00 38.60 ? 5    ALA Q CB    1 
ATOM   4288 N  N     . ARG D 2 6   ? 17.281 64.638 7.620   1.00 39.07 ? 6    ARG Q N     1 
ATOM   4289 C  CA    . ARG D 2 6   ? 17.919 63.383 7.190   1.00 39.33 ? 6    ARG Q CA    1 
ATOM   4290 C  C     . ARG D 2 6   ? 19.422 63.482 6.935   1.00 39.41 ? 6    ARG Q C     1 
ATOM   4291 O  O     . ARG D 2 6   ? 19.859 64.325 6.212   1.00 39.62 ? 6    ARG Q O     1 
ATOM   4292 C  CB    . ARG D 2 6   ? 17.261 62.797 5.943   1.00 39.39 ? 6    ARG Q CB    1 
ATOM   4293 C  CG    . ARG D 2 6   ? 15.783 62.932 5.828   1.00 39.51 ? 6    ARG Q CG    1 
ATOM   4294 C  CD    . ARG D 2 6   ? 15.075 61.956 6.635   1.00 39.32 ? 6    ARG Q CD    1 
ATOM   4295 N  NE    . ARG D 2 6   ? 13.634 62.156 6.636   1.00 39.22 ? 6    ARG Q NE    1 
ATOM   4296 C  CZ    . ARG D 2 6   ? 12.837 61.708 5.685   1.00 39.58 ? 6    ARG Q CZ    1 
ATOM   4297 N  NH1   . ARG D 2 6   ? 11.561 61.873 5.758   1.00 39.43 ? 6    ARG Q NH1   1 
ATOM   4298 N  NH2   . ARG D 2 6   ? 13.334 61.096 4.652   1.00 40.16 ? 6    ARG Q NH2   1 
HETATM 4299 N  N     . MLY D 2 7   ? 20.217 62.586 7.504   1.00 20.00 ? 7    MLY Q N     1 
HETATM 4300 C  CA    . MLY D 2 7   ? 21.547 62.320 6.956   1.00 20.00 ? 7    MLY Q CA    1 
HETATM 4301 C  CB    . MLY D 2 7   ? 22.378 61.572 7.963   1.00 34.23 ? 7    MLY Q CB    1 
HETATM 4302 C  CG    . MLY D 2 7   ? 22.287 62.253 9.333   1.00 34.58 ? 7    MLY Q CG    1 
HETATM 4303 C  CD    . MLY D 2 7   ? 22.039 61.222 10.431  1.00 36.03 ? 7    MLY Q CD    1 
HETATM 4304 C  CE    . MLY D 2 7   ? 22.612 61.683 11.781  1.00 36.51 ? 7    MLY Q CE    1 
HETATM 4305 N  NZ    . MLY D 2 7   ? 22.919 60.510 12.621  1.00 36.67 ? 7    MLY Q NZ    1 
HETATM 4306 C  CH1   . MLY D 2 7   ? 22.482 60.774 13.992  1.00 37.60 ? 7    MLY Q CH1   1 
HETATM 4307 C  CH2   . MLY D 2 7   ? 24.364 60.221 12.658  1.00 36.43 ? 7    MLY Q CH2   1 
HETATM 4308 C  C     . MLY D 2 7   ? 21.499 61.691 5.555   1.00 20.00 ? 7    MLY Q C     1 
HETATM 4309 O  O     . MLY D 2 7   ? 20.506 61.160 5.192   1.00 33.11 ? 7    MLY Q O     1 
ATOM   4310 N  N     . SER D 2 8   ? 22.551 61.833 4.756   1.00 47.12 ? 8    SER Q N     1 
ATOM   4311 C  CA    . SER D 2 8   ? 22.496 61.487 3.320   1.00 46.97 ? 8    SER Q CA    1 
ATOM   4312 C  C     . SER D 2 8   ? 23.829 61.105 2.644   1.00 46.96 ? 8    SER Q C     1 
ATOM   4313 O  O     . SER D 2 8   ? 24.847 61.436 3.186   1.00 46.88 ? 8    SER Q O     1 
ATOM   4314 C  CB    . SER D 2 8   ? 21.816 62.600 2.545   1.00 47.08 ? 8    SER Q CB    1 
ATOM   4315 O  OG    . SER D 2 8   ? 22.719 63.655 2.361   1.00 46.48 ? 8    SER Q OG    1 
ATOM   4316 N  N     . THR D 2 9   ? 23.757 60.393 1.497   1.00 47.04 ? 9    THR Q N     1 
ATOM   4317 C  CA    . THR D 2 9   ? 24.790 60.048 0.511   1.00 47.10 ? 9    THR Q CA    1 
ATOM   4318 C  C     . THR D 2 9   ? 25.812 59.036 1.030   1.00 47.14 ? 9    THR Q C     1 
ATOM   4319 O  O     . THR D 2 9   ? 25.533 57.834 1.087   1.00 47.08 ? 9    THR Q O     1 
ATOM   4320 C  CB    . THR D 2 9   ? 25.459 61.331 -0.055  1.00 47.09 ? 9    THR Q CB    1 
ATOM   4321 O  OG1   . THR D 2 9   ? 24.490 62.061 -0.817  1.00 47.47 ? 9    THR Q OG1   1 
ATOM   4322 C  CG2   . THR D 2 9   ? 26.639 61.013 -0.936  1.00 46.74 ? 9    THR Q CG2   1 
HETATM 4323 ZN ZN    . ZN  E 3 .   ? 17.300 35.512 26.092  1.00 17.51 ? 501  ZN  A ZN    1 
HETATM 4324 ZN ZN    . ZN  F 3 .   ? 20.981 34.916 27.011  1.00 16.76 ? 502  ZN  A ZN    1 
HETATM 4325 ZN ZN    . ZN  G 3 .   ? 18.362 34.934 29.761  1.00 17.13 ? 503  ZN  A ZN    1 
HETATM 4326 ZN ZN    . ZN  H 3 .   ? 17.213 0.743  8.075   1.00 25.01 ? 504  ZN  A ZN    1 
HETATM 4327 N  N     . SAH I 4 .   ? 23.440 9.440  -0.429  1.00 17.57 ? 101  SAH A N     1 
HETATM 4328 C  CA    . SAH I 4 .   ? 22.835 10.729 -0.881  1.00 18.76 ? 101  SAH A CA    1 
HETATM 4329 C  CB    . SAH I 4 .   ? 22.685 11.707 0.294   1.00 19.01 ? 101  SAH A CB    1 
HETATM 4330 C  CG    . SAH I 4 .   ? 21.343 11.566 1.003   1.00 18.97 ? 101  SAH A CG    1 
HETATM 4331 S  SD    . SAH I 4 .   ? 19.993 12.101 -0.084  1.00 20.22 ? 101  SAH A SD    1 
HETATM 4332 C  C     . SAH I 4 .   ? 23.613 11.325 -2.057  1.00 19.09 ? 101  SAH A C     1 
HETATM 4333 O  O     . SAH I 4 .   ? 23.296 12.400 -2.584  1.00 19.45 ? 101  SAH A O     1 
HETATM 4334 O  OXT   . SAH I 4 .   ? 24.584 10.716 -2.523  1.00 20.12 ? 101  SAH A OXT   1 
HETATM 4335 C  "C5'" . SAH I 4 .   ? 18.866 10.741 0.339   1.00 21.56 ? 101  SAH A "C5'" 1 
HETATM 4336 C  "C4'" . SAH I 4 .   ? 18.965 9.604  -0.668  1.00 21.23 ? 101  SAH A "C4'" 1 
HETATM 4337 O  "O4'" . SAH I 4 .   ? 20.153 8.869  -0.397  1.00 21.54 ? 101  SAH A "O4'" 1 
HETATM 4338 C  "C3'" . SAH I 4 .   ? 17.833 8.576  -0.617  1.00 21.82 ? 101  SAH A "C3'" 1 
HETATM 4339 O  "O3'" . SAH I 4 .   ? 16.781 8.895  -1.500  1.00 23.65 ? 101  SAH A "O3'" 1 
HETATM 4340 C  "C2'" . SAH I 4 .   ? 18.545 7.313  -1.055  1.00 22.27 ? 101  SAH A "C2'" 1 
HETATM 4341 O  "O2'" . SAH I 4 .   ? 18.730 7.317  -2.454  1.00 23.40 ? 101  SAH A "O2'" 1 
HETATM 4342 C  "C1'" . SAH I 4 .   ? 19.904 7.469  -0.387  1.00 21.13 ? 101  SAH A "C1'" 1 
HETATM 4343 N  N9    . SAH I 4 .   ? 19.839 6.911  0.983   1.00 21.26 ? 101  SAH A N9    1 
HETATM 4344 C  C8    . SAH I 4 .   ? 19.948 7.584  2.175   1.00 20.16 ? 101  SAH A C8    1 
HETATM 4345 N  N7    . SAH I 4 .   ? 19.825 6.711  3.200   1.00 19.90 ? 101  SAH A N7    1 
HETATM 4346 C  C5    . SAH I 4 .   ? 19.619 5.478  2.689   1.00 21.17 ? 101  SAH A C5    1 
HETATM 4347 C  C6    . SAH I 4 .   ? 19.429 4.235  3.289   1.00 20.92 ? 101  SAH A C6    1 
HETATM 4348 N  N6    . SAH I 4 .   ? 19.419 4.099  4.615   1.00 21.40 ? 101  SAH A N6    1 
HETATM 4349 N  N1    . SAH I 4 .   ? 19.229 3.125  2.481   1.00 22.24 ? 101  SAH A N1    1 
HETATM 4350 C  C2    . SAH I 4 .   ? 19.242 3.258  1.113   1.00 21.02 ? 101  SAH A C2    1 
HETATM 4351 N  N3    . SAH I 4 .   ? 19.449 4.486  0.521   1.00 22.66 ? 101  SAH A N3    1 
HETATM 4352 C  C4    . SAH I 4 .   ? 19.632 5.587  1.299   1.00 20.54 ? 101  SAH A C4    1 
HETATM 4353 N  N     . SAH J 4 .   ? 26.477 63.941 20.034  1.00 44.36 ? 102  SAH A N     1 
HETATM 4354 C  CA    . SAH J 4 .   ? 25.407 62.911 19.913  1.00 44.46 ? 102  SAH A CA    1 
HETATM 4355 C  CB    . SAH J 4 .   ? 25.791 61.884 18.846  1.00 44.32 ? 102  SAH A CB    1 
HETATM 4356 C  CG    . SAH J 4 .   ? 25.425 62.258 17.410  1.00 44.33 ? 102  SAH A CG    1 
HETATM 4357 S  SD    . SAH J 4 .   ? 23.639 62.378 17.135  1.00 44.16 ? 102  SAH A SD    1 
HETATM 4358 C  C     . SAH J 4 .   ? 25.123 62.241 21.262  1.00 44.59 ? 102  SAH A C     1 
HETATM 4359 O  O     . SAH J 4 .   ? 24.307 61.321 21.362  1.00 44.74 ? 102  SAH A O     1 
HETATM 4360 O  OXT   . SAH J 4 .   ? 25.698 62.601 22.291  1.00 44.76 ? 102  SAH A OXT   1 
HETATM 4361 C  "C5'" . SAH J 4 .   ? 23.753 63.968 16.288  1.00 45.93 ? 102  SAH A "C5'" 1 
HETATM 4362 C  "C4'" . SAH J 4 .   ? 23.482 65.103 17.264  1.00 46.55 ? 102  SAH A "C4'" 1 
HETATM 4363 O  "O4'" . SAH J 4 .   ? 24.694 65.475 17.905  1.00 46.90 ? 102  SAH A "O4'" 1 
HETATM 4364 C  "C3'" . SAH J 4 .   ? 22.935 66.344 16.575  1.00 46.79 ? 102  SAH A "C3'" 1 
HETATM 4365 O  "O3'" . SAH J 4 .   ? 21.532 66.444 16.682  1.00 46.80 ? 102  SAH A "O3'" 1 
HETATM 4366 C  "C2'" . SAH J 4 .   ? 23.610 67.471 17.322  1.00 47.36 ? 102  SAH A "C2'" 1 
HETATM 4367 O  "O2'" . SAH J 4 .   ? 22.798 67.855 18.411  1.00 47.59 ? 102  SAH A "O2'" 1 
HETATM 4368 C  "C1'" . SAH J 4 .   ? 24.916 66.869 17.818  1.00 47.55 ? 102  SAH A "C1'" 1 
HETATM 4369 N  N9    . SAH J 4 .   ? 26.010 67.167 16.862  1.00 47.78 ? 102  SAH A N9    1 
HETATM 4370 C  C8    . SAH J 4 .   ? 26.568 66.305 15.948  1.00 47.60 ? 102  SAH A C8    1 
HETATM 4371 N  N7    . SAH J 4 .   ? 27.537 66.954 15.262  1.00 47.72 ? 102  SAH A N7    1 
HETATM 4372 C  C5    . SAH J 4 .   ? 27.611 68.228 15.717  1.00 47.84 ? 102  SAH A C5    1 
HETATM 4373 C  C6    . SAH J 4 .   ? 28.416 69.314 15.369  1.00 47.95 ? 102  SAH A C6    1 
HETATM 4374 N  N6    . SAH J 4 .   ? 29.338 69.210 14.413  1.00 47.46 ? 102  SAH A N6    1 
HETATM 4375 N  N1    . SAH J 4 .   ? 28.252 70.516 16.030  1.00 47.95 ? 102  SAH A N1    1 
HETATM 4376 C  C2    . SAH J 4 .   ? 27.300 70.643 17.027  1.00 47.88 ? 102  SAH A C2    1 
HETATM 4377 N  N3    . SAH J 4 .   ? 26.505 69.565 17.367  1.00 47.71 ? 102  SAH A N3    1 
HETATM 4378 C  C4    . SAH J 4 .   ? 26.656 68.375 16.724  1.00 48.06 ? 102  SAH A C4    1 
HETATM 4379 ZN ZN    . ZN  K 3 .   ? 31.224 37.620 -6.913  1.00 16.78 ? 501  ZN  B ZN    1 
HETATM 4380 ZN ZN    . ZN  L 3 .   ? 34.472 36.868 -5.030  1.00 16.50 ? 502  ZN  B ZN    1 
HETATM 4381 ZN ZN    . ZN  M 3 .   ? 34.545 37.271 -8.792  1.00 17.43 ? 503  ZN  B ZN    1 
HETATM 4382 ZN ZN    . ZN  N 3 .   ? 31.766 72.406 10.843  1.00 43.74 ? 504  ZN  B ZN    1 
HETATM 4383 O  O     . HOH O 5 .   ? 17.081 25.123 9.184   1.00 12.51 ? 1236 HOH A O     1 
HETATM 4384 O  O     . HOH O 5 .   ? 13.819 29.316 13.270  1.00 13.46 ? 1237 HOH A O     1 
HETATM 4385 O  O     . HOH O 5 .   ? 14.643 31.663 14.229  1.00 14.53 ? 1238 HOH A O     1 
HETATM 4386 O  O     . HOH O 5 .   ? 25.641 10.008 6.084   1.00 14.99 ? 1239 HOH A O     1 
HETATM 4387 O  O     . HOH O 5 .   ? 5.861  25.119 8.711   1.00 16.27 ? 1240 HOH A O     1 
HETATM 4388 O  O     . HOH O 5 .   ? 14.803 33.516 19.924  1.00 16.16 ? 1241 HOH A O     1 
HETATM 4389 O  O     . HOH O 5 .   ? 16.727 10.832 14.015  1.00 16.41 ? 1242 HOH A O     1 
HETATM 4390 O  O     . HOH O 5 .   ? 25.682 25.438 7.433   1.00 16.72 ? 1243 HOH A O     1 
HETATM 4391 O  O     . HOH O 5 .   ? 2.056  29.623 2.314   1.00 17.09 ? 1244 HOH A O     1 
HETATM 4392 O  O     . HOH O 5 .   ? 16.809 32.661 12.958  1.00 17.14 ? 1245 HOH A O     1 
HETATM 4393 O  O     . HOH O 5 .   ? 11.143 30.159 -1.747  1.00 17.18 ? 1246 HOH A O     1 
HETATM 4394 O  O     . HOH O 5 .   ? 27.722 25.885 17.706  1.00 17.52 ? 1247 HOH A O     1 
HETATM 4395 O  O     . HOH O 5 .   ? 13.695 30.122 9.712   1.00 17.54 ? 1248 HOH A O     1 
HETATM 4396 O  O     . HOH O 5 .   ? 34.312 26.319 5.360   1.00 17.56 ? 1249 HOH A O     1 
HETATM 4397 O  O     . HOH O 5 .   ? 19.956 28.810 8.230   1.00 18.09 ? 1250 HOH A O     1 
HETATM 4398 O  O     . HOH O 5 .   ? 25.122 23.800 9.943   1.00 18.84 ? 1251 HOH A O     1 
HETATM 4399 O  O     . HOH O 5 .   ? 14.245 42.811 12.226  1.00 18.59 ? 1252 HOH A O     1 
HETATM 4400 O  O     . HOH O 5 .   ? 13.388 38.954 14.240  1.00 18.79 ? 1253 HOH A O     1 
HETATM 4401 O  O     . HOH O 5 .   ? 14.518 17.502 -2.855  1.00 19.18 ? 1254 HOH A O     1 
HETATM 4402 O  O     . HOH O 5 .   ? 16.788 23.721 -3.273  1.00 18.93 ? 1255 HOH A O     1 
HETATM 4403 O  O     . HOH O 5 .   ? 28.941 21.360 14.917  1.00 18.47 ? 1256 HOH A O     1 
HETATM 4404 O  O     . HOH O 5 .   ? 8.727  17.689 10.560  1.00 18.97 ? 1257 HOH A O     1 
HETATM 4405 O  O     . HOH O 5 .   ? 35.127 7.340  0.427   1.00 19.28 ? 1258 HOH A O     1 
HETATM 4406 O  O     . HOH O 5 .   ? 26.648 30.466 1.935   1.00 19.35 ? 1259 HOH A O     1 
HETATM 4407 O  O     . HOH O 5 .   ? 9.371  11.625 7.162   1.00 19.46 ? 1260 HOH A O     1 
HETATM 4408 O  O     . HOH O 5 .   ? 13.766 19.545 -5.798  1.00 19.75 ? 1261 HOH A O     1 
HETATM 4409 O  O     . HOH O 5 .   ? 16.906 33.615 10.171  1.00 20.19 ? 1262 HOH A O     1 
HETATM 4410 O  O     . HOH O 5 .   ? 2.255  26.794 2.826   1.00 19.85 ? 1263 HOH A O     1 
HETATM 4411 O  O     . HOH O 5 .   ? 7.168  27.952 -2.238  1.00 20.14 ? 1264 HOH A O     1 
HETATM 4412 O  O     . HOH O 5 .   ? 21.779 31.394 1.674   1.00 20.35 ? 1265 HOH A O     1 
HETATM 4413 O  O     . HOH O 5 .   ? 22.882 4.781  7.061   1.00 20.52 ? 1266 HOH A O     1 
HETATM 4414 O  O     . HOH O 5 .   ? 28.792 25.033 -4.156  1.00 20.21 ? 1267 HOH A O     1 
HETATM 4415 O  O     . HOH O 5 .   ? 7.201  25.422 14.933  1.00 20.32 ? 1268 HOH A O     1 
HETATM 4416 O  O     . HOH O 5 .   ? 14.872 36.832 31.744  1.00 20.47 ? 1269 HOH A O     1 
HETATM 4417 O  O     . HOH O 5 .   ? 14.258 33.748 22.885  1.00 20.70 ? 1270 HOH A O     1 
HETATM 4418 O  O     . HOH O 5 .   ? 14.525 41.426 14.665  1.00 20.80 ? 1271 HOH A O     1 
HETATM 4419 O  O     . HOH O 5 .   ? 1.268  24.977 1.066   1.00 21.17 ? 1272 HOH A O     1 
HETATM 4420 O  O     . HOH O 5 .   ? 9.404  28.861 -3.565  1.00 20.94 ? 1273 HOH A O     1 
HETATM 4421 O  O     . HOH O 5 .   ? 26.739 21.546 21.193  1.00 21.57 ? 1274 HOH A O     1 
HETATM 4422 O  O     . HOH O 5 .   ? 30.331 27.099 10.618  1.00 21.68 ? 1275 HOH A O     1 
HETATM 4423 O  O     . HOH O 5 .   ? 4.701  32.681 3.619   1.00 21.92 ? 1276 HOH A O     1 
HETATM 4424 O  O     . HOH O 5 .   ? 21.195 20.741 3.419   1.00 22.38 ? 1277 HOH A O     1 
HETATM 4425 O  O     . HOH O 5 .   ? 27.301 29.959 -0.694  1.00 22.09 ? 1278 HOH A O     1 
HETATM 4426 O  O     . HOH O 5 .   ? 19.464 33.798 33.954  1.00 21.97 ? 1279 HOH A O     1 
HETATM 4427 O  O     . HOH O 5 .   ? 10.733 38.950 15.094  1.00 22.30 ? 1280 HOH A O     1 
HETATM 4428 O  O     . HOH O 5 .   ? 36.250 18.951 8.842   1.00 22.04 ? 1281 HOH A O     1 
HETATM 4429 O  O     . HOH O 5 .   ? 6.768  23.097 13.387  1.00 22.19 ? 1282 HOH A O     1 
HETATM 4430 O  O     . HOH O 5 .   ? 23.565 26.690 12.639  1.00 22.51 ? 1283 HOH A O     1 
HETATM 4431 O  O     . HOH O 5 .   ? 25.101 37.443 29.362  1.00 22.27 ? 1284 HOH A O     1 
HETATM 4432 O  O     . HOH O 5 .   ? 11.113 36.243 1.663   1.00 22.62 ? 1285 HOH A O     1 
HETATM 4433 O  O     . HOH O 5 .   ? 23.959 6.866  8.355   1.00 22.89 ? 1286 HOH A O     1 
HETATM 4434 O  O     . HOH O 5 .   ? 36.628 16.943 -7.226  1.00 23.26 ? 1287 HOH A O     1 
HETATM 4435 O  O     . HOH O 5 .   ? 15.980 30.395 8.212   1.00 22.63 ? 1288 HOH A O     1 
HETATM 4436 O  O     . HOH O 5 .   ? 23.262 39.799 31.298  1.00 23.61 ? 1289 HOH A O     1 
HETATM 4437 O  O     . HOH O 5 .   ? 4.371  32.483 15.046  1.00 23.29 ? 1290 HOH A O     1 
HETATM 4438 O  O     . HOH O 5 .   ? 18.896 32.605 6.191   1.00 22.90 ? 1291 HOH A O     1 
HETATM 4439 O  O     . HOH O 5 .   ? 16.799 27.050 25.600  1.00 23.55 ? 1292 HOH A O     1 
HETATM 4440 O  O     . HOH O 5 .   ? 23.341 6.536  12.902  1.00 23.25 ? 1293 HOH A O     1 
HETATM 4441 O  O     . HOH O 5 .   ? 4.842  32.748 0.833   1.00 23.80 ? 1294 HOH A O     1 
HETATM 4442 O  O     . HOH O 5 .   ? 9.406  36.693 14.976  1.00 23.12 ? 1295 HOH A O     1 
HETATM 4443 O  O     . HOH O 5 .   ? 2.861  18.656 6.985   1.00 23.72 ? 1296 HOH A O     1 
HETATM 4444 O  O     . HOH O 5 .   ? 12.853 13.928 1.201   1.00 24.04 ? 1297 HOH A O     1 
HETATM 4445 O  O     . HOH O 5 .   ? 10.841 42.492 21.300  1.00 24.59 ? 1298 HOH A O     1 
HETATM 4446 O  O     . HOH O 5 .   ? 6.557  32.448 18.850  1.00 24.36 ? 1299 HOH A O     1 
HETATM 4447 O  O     . HOH O 5 .   ? 5.418  12.328 2.108   1.00 24.09 ? 1300 HOH A O     1 
HETATM 4448 O  O     . HOH O 5 .   ? 38.001 26.609 4.358   1.00 24.40 ? 1301 HOH A O     1 
HETATM 4449 O  O     . HOH O 5 .   ? 29.225 21.346 22.584  1.00 24.30 ? 1302 HOH A O     1 
HETATM 4450 O  O     . HOH O 5 .   ? 3.708  30.306 0.198   1.00 24.56 ? 1303 HOH A O     1 
HETATM 4451 O  O     . HOH O 5 .   ? 15.136 38.603 11.949  1.00 24.76 ? 1304 HOH A O     1 
HETATM 4452 O  O     . HOH O 5 .   ? 30.113 19.508 -2.875  1.00 24.20 ? 1305 HOH A O     1 
HETATM 4453 O  O     . HOH O 5 .   ? 38.858 6.696  -5.231  1.00 24.86 ? 1306 HOH A O     1 
HETATM 4454 O  O     . HOH O 5 .   ? 19.452 34.541 17.881  1.00 24.89 ? 1307 HOH A O     1 
HETATM 4455 O  O     . HOH O 5 .   ? 45.094 8.020  -3.378  1.00 24.62 ? 1308 HOH A O     1 
HETATM 4456 O  O     . HOH O 5 .   ? 25.993 26.588 26.385  1.00 24.66 ? 1309 HOH A O     1 
HETATM 4457 O  O     . HOH O 5 .   ? 36.280 7.279  2.833   1.00 24.87 ? 1310 HOH A O     1 
HETATM 4458 O  O     . HOH O 5 .   ? 11.984 20.220 18.344  1.00 25.17 ? 1311 HOH A O     1 
HETATM 4459 O  O     . HOH O 5 .   ? 33.418 3.995  2.001   1.00 24.71 ? 1312 HOH A O     1 
HETATM 4460 O  O     . HOH O 5 .   ? 2.347  35.721 5.991   1.00 25.04 ? 1313 HOH A O     1 
HETATM 4461 O  O     . HOH O 5 .   ? 9.047  41.095 8.724   1.00 24.88 ? 1314 HOH A O     1 
HETATM 4462 O  O     . HOH O 5 .   ? 18.527 30.186 29.487  1.00 25.00 ? 1315 HOH A O     1 
HETATM 4463 O  O     . HOH O 5 .   ? 24.173 31.423 2.866   1.00 26.05 ? 1316 HOH A O     1 
HETATM 4464 O  O     . HOH O 5 .   ? 18.496 28.962 32.209  1.00 25.97 ? 1317 HOH A O     1 
HETATM 4465 O  O     . HOH O 5 .   ? 22.915 28.397 9.063   1.00 25.73 ? 1318 HOH A O     1 
HETATM 4466 O  O     . HOH O 5 .   ? 40.688 20.156 4.095   1.00 25.95 ? 1319 HOH A O     1 
HETATM 4467 O  O     . HOH O 5 .   ? 25.148 6.088  10.788  1.00 25.69 ? 1320 HOH A O     1 
HETATM 4468 O  O     . HOH O 5 .   ? 40.003 14.906 4.634   1.00 26.15 ? 1321 HOH A O     1 
HETATM 4469 O  O     . HOH O 5 .   ? 22.621 7.830  -2.656  1.00 25.87 ? 1322 HOH A O     1 
HETATM 4470 O  O     . HOH O 5 .   ? 0.712  21.299 -4.805  1.00 25.57 ? 1323 HOH A O     1 
HETATM 4471 O  O     . HOH O 5 .   ? -2.683 21.136 3.256   1.00 25.52 ? 1324 HOH A O     1 
HETATM 4472 O  O     . HOH O 5 .   ? 7.308  39.783 7.131   1.00 26.57 ? 1325 HOH A O     1 
HETATM 4473 O  O     . HOH O 5 .   ? 27.678 32.158 22.420  1.00 26.90 ? 1326 HOH A O     1 
HETATM 4474 O  O     . HOH O 5 .   ? 5.544  15.858 7.535   1.00 26.77 ? 1327 HOH A O     1 
HETATM 4475 O  O     . HOH O 5 .   ? 38.759 29.246 3.655   1.00 26.20 ? 1328 HOH A O     1 
HETATM 4476 O  O     . HOH O 5 .   ? -0.164 18.706 -4.756  1.00 27.33 ? 1329 HOH A O     1 
HETATM 4477 O  O     . HOH O 5 .   ? 19.390 37.091 35.455  1.00 22.34 ? 1330 HOH A O     1 
HETATM 4478 O  O     . HOH O 5 .   ? 18.982 31.455 8.746   1.00 26.42 ? 1331 HOH A O     1 
HETATM 4479 O  O     . HOH O 5 .   ? 17.213 44.782 30.537  1.00 26.37 ? 1332 HOH A O     1 
HETATM 4480 O  O     . HOH O 5 .   ? 17.911 43.672 32.701  1.00 27.22 ? 1333 HOH A O     1 
HETATM 4481 O  O     . HOH O 5 .   ? 21.561 24.724 -7.829  1.00 27.07 ? 1334 HOH A O     1 
HETATM 4482 O  O     . HOH O 5 .   ? 12.938 19.273 -8.342  1.00 27.44 ? 1335 HOH A O     1 
HETATM 4483 O  O     . HOH O 5 .   ? 27.290 35.635 29.357  1.00 27.03 ? 1336 HOH A O     1 
HETATM 4484 O  O     . HOH O 5 .   ? 7.463  34.740 20.236  1.00 27.37 ? 1337 HOH A O     1 
HETATM 4485 O  O     . HOH O 5 .   ? 3.494  25.544 10.009  1.00 27.87 ? 1338 HOH A O     1 
HETATM 4486 O  O     . HOH O 5 .   ? -0.814 16.077 -1.789  1.00 27.36 ? 1339 HOH A O     1 
HETATM 4487 O  O     . HOH O 5 .   ? 12.968 27.982 8.517   1.00 27.32 ? 1340 HOH A O     1 
HETATM 4488 O  O     . HOH O 5 .   ? 14.806 26.279 -6.984  1.00 27.41 ? 1341 HOH A O     1 
HETATM 4489 O  O     . HOH O 5 .   ? 11.700 36.391 -2.795  1.00 27.90 ? 1342 HOH A O     1 
HETATM 4490 O  O     . HOH O 5 .   ? 36.801 27.422 6.871   1.00 29.11 ? 1343 HOH A O     1 
HETATM 4491 O  O     . HOH O 5 .   ? 11.244 5.672  10.138  1.00 27.83 ? 1344 HOH A O     1 
HETATM 4492 O  O     . HOH O 5 .   ? 20.866 33.106 13.693  1.00 27.97 ? 1345 HOH A O     1 
HETATM 4493 O  O     . HOH O 5 .   ? 4.568  43.730 11.839  1.00 28.78 ? 1346 HOH A O     1 
HETATM 4494 O  O     . HOH O 5 .   ? 21.111 34.286 15.886  1.00 28.96 ? 1347 HOH A O     1 
HETATM 4495 O  O     . HOH O 5 .   ? 35.076 4.830  3.950   1.00 28.26 ? 1348 HOH A O     1 
HETATM 4496 O  O     . HOH O 5 .   ? 4.740  37.706 8.861   1.00 28.68 ? 1349 HOH A O     1 
HETATM 4497 O  O     . HOH O 5 .   ? 29.387 21.715 17.974  1.00 28.60 ? 1350 HOH A O     1 
HETATM 4498 O  O     . HOH O 5 .   ? 14.993 9.756  15.800  1.00 27.81 ? 1351 HOH A O     1 
HETATM 4499 O  O     . HOH O 5 .   ? 19.080 -2.498 6.469   1.00 28.50 ? 1352 HOH A O     1 
HETATM 4500 O  O     . HOH O 5 .   ? 16.169 27.430 32.258  1.00 28.58 ? 1353 HOH A O     1 
HETATM 4501 O  O     . HOH O 5 .   ? 5.923  32.822 -2.370  1.00 28.83 ? 1354 HOH A O     1 
HETATM 4502 O  O     . HOH O 5 .   ? 20.351 33.350 2.335   1.00 28.17 ? 1355 HOH A O     1 
HETATM 4503 O  O     . HOH O 5 .   ? 24.302 16.004 -5.170  1.00 30.20 ? 1356 HOH A O     1 
HETATM 4504 O  O     . HOH O 5 .   ? 24.422 13.306 -4.807  1.00 28.91 ? 1357 HOH A O     1 
HETATM 4505 O  O     . HOH O 5 .   ? 12.545 11.892 12.238  1.00 29.02 ? 1358 HOH A O     1 
HETATM 4506 O  O     . HOH O 5 .   ? 33.475 20.220 9.405   1.00 30.28 ? 1359 HOH A O     1 
HETATM 4507 O  O     . HOH O 5 .   ? 38.919 19.018 8.943   1.00 28.72 ? 1360 HOH A O     1 
HETATM 4508 O  O     . HOH O 5 .   ? 30.483 13.441 -8.545  1.00 29.16 ? 1361 HOH A O     1 
HETATM 4509 O  O     . HOH O 5 .   ? -3.256 26.744 8.696   1.00 29.60 ? 1362 HOH A O     1 
HETATM 4510 O  O     . HOH O 5 .   ? 29.788 38.205 24.559  1.00 30.01 ? 1363 HOH A O     1 
HETATM 4511 O  O     . HOH O 5 .   ? 19.523 37.124 16.977  1.00 30.29 ? 1364 HOH A O     1 
HETATM 4512 O  O     . HOH O 5 .   ? 24.386 2.577  7.565   1.00 29.74 ? 1365 HOH A O     1 
HETATM 4513 O  O     . HOH O 5 .   ? 0.229  22.259 -7.460  1.00 31.31 ? 1366 HOH A O     1 
HETATM 4514 O  O     . HOH O 5 .   ? 9.443  39.102 26.302  1.00 30.29 ? 1367 HOH A O     1 
HETATM 4515 O  O     . HOH O 5 .   ? 17.912 24.751 25.262  1.00 29.70 ? 1368 HOH A O     1 
HETATM 4516 O  O     . HOH O 5 .   ? 26.982 7.397  24.328  1.00 29.19 ? 1369 HOH A O     1 
HETATM 4517 O  O     . HOH O 5 .   ? 28.016 16.439 -9.534  1.00 30.94 ? 1370 HOH A O     1 
HETATM 4518 O  O     . HOH O 5 .   ? 29.784 3.978  5.074   1.00 29.96 ? 1371 HOH A O     1 
HETATM 4519 O  O     . HOH O 5 .   ? 30.763 25.342 -2.418  1.00 32.11 ? 1372 HOH A O     1 
HETATM 4520 O  O     . HOH O 5 .   ? 5.106  25.029 16.730  1.00 30.40 ? 1373 HOH A O     1 
HETATM 4521 O  O     . HOH O 5 .   ? 9.553  24.692 24.190  1.00 29.99 ? 1374 HOH A O     1 
HETATM 4522 O  O     . HOH O 5 .   ? -0.257 23.035 2.788   1.00 30.54 ? 1375 HOH A O     1 
HETATM 4523 O  O     . HOH O 5 .   ? 20.993 24.657 31.306  1.00 29.98 ? 1376 HOH A O     1 
HETATM 4524 O  O     . HOH O 5 .   ? 28.466 23.820 19.277  1.00 31.17 ? 1377 HOH A O     1 
HETATM 4525 O  O     . HOH O 5 .   ? 29.667 26.999 -5.847  1.00 30.42 ? 1378 HOH A O     1 
HETATM 4526 O  O     . HOH O 5 .   ? 38.350 12.278 18.500  1.00 31.47 ? 1379 HOH A O     1 
HETATM 4527 O  O     . HOH O 5 .   ? 4.977  19.046 13.538  1.00 30.27 ? 1380 HOH A O     1 
HETATM 4528 O  O     . HOH O 5 .   ? 30.452 18.803 22.531  1.00 32.30 ? 1381 HOH A O     1 
HETATM 4529 O  O     . HOH O 5 .   ? 31.017 2.725  2.887   1.00 30.80 ? 1382 HOH A O     1 
HETATM 4530 O  O     . HOH O 5 .   ? 29.933 4.346  10.415  1.00 30.91 ? 1383 HOH A O     1 
HETATM 4531 O  O     . HOH O 5 .   ? -2.256 17.698 -3.379  1.00 31.93 ? 1384 HOH A O     1 
HETATM 4532 O  O     . HOH O 5 .   ? 41.806 22.613 8.933   1.00 31.48 ? 1385 HOH A O     1 
HETATM 4533 O  O     . HOH O 5 .   ? 11.767 44.598 29.123  1.00 30.91 ? 1386 HOH A O     1 
HETATM 4534 O  O     . HOH O 5 .   ? 10.547 38.463 6.040   1.00 31.56 ? 1387 HOH A O     1 
HETATM 4535 O  O     . HOH O 5 .   ? 5.316  47.088 14.890  1.00 30.10 ? 1388 HOH A O     1 
HETATM 4536 O  O     . HOH O 5 .   ? 16.592 43.717 26.308  1.00 31.68 ? 1389 HOH A O     1 
HETATM 4537 O  O     . HOH O 5 .   ? 25.115 10.132 -5.195  1.00 30.91 ? 1390 HOH A O     1 
HETATM 4538 O  O     . HOH O 5 .   ? -1.036 25.683 -3.790  1.00 31.63 ? 1391 HOH A O     1 
HETATM 4539 O  O     . HOH O 5 .   ? 35.008 23.628 -3.094  1.00 32.33 ? 1392 HOH A O     1 
HETATM 4540 O  O     . HOH O 5 .   ? 28.595 31.431 6.585   1.00 31.23 ? 1393 HOH A O     1 
HETATM 4541 O  O     . HOH O 5 .   ? 7.911  9.236  11.227  1.00 32.00 ? 1394 HOH A O     1 
HETATM 4542 O  O     . HOH O 5 .   ? 4.115  28.196 -3.309  1.00 30.87 ? 1395 HOH A O     1 
HETATM 4543 O  O     . HOH O 5 .   ? 12.975 17.559 26.724  1.00 31.96 ? 1396 HOH A O     1 
HETATM 4544 O  O     . HOH O 5 .   ? 37.182 5.902  16.259  1.00 32.25 ? 1397 HOH A O     1 
HETATM 4545 O  O     . HOH O 5 .   ? 14.364 29.415 32.577  1.00 33.06 ? 1398 HOH A O     1 
HETATM 4546 O  O     . HOH O 5 .   ? 26.991 26.897 9.970   1.00 33.49 ? 1399 HOH A O     1 
HETATM 4547 O  O     . HOH O 5 .   ? 21.585 16.053 -5.875  1.00 33.41 ? 1400 HOH A O     1 
HETATM 4548 O  O     . HOH O 5 .   ? 6.836  36.100 15.431  1.00 34.03 ? 1401 HOH A O     1 
HETATM 4549 O  O     . HOH O 5 .   ? 21.809 36.731 18.110  1.00 33.94 ? 1402 HOH A O     1 
HETATM 4550 O  O     . HOH O 5 .   ? 21.662 44.770 28.124  1.00 32.89 ? 1403 HOH A O     1 
HETATM 4551 O  O     . HOH O 5 .   ? 40.331 19.211 6.815   1.00 33.95 ? 1404 HOH A O     1 
HETATM 4552 O  O     . HOH O 5 .   ? 28.432 3.561  8.337   1.00 33.55 ? 1405 HOH A O     1 
HETATM 4553 O  O     . HOH O 5 .   ? 27.332 1.899  2.032   1.00 35.40 ? 1406 HOH A O     1 
HETATM 4554 O  O     . HOH O 5 .   ? 27.259 3.274  4.250   1.00 35.48 ? 1407 HOH A O     1 
HETATM 4555 O  O     . HOH O 5 .   ? 41.898 12.802 4.421   1.00 33.04 ? 1408 HOH A O     1 
HETATM 4556 O  O     . HOH O 5 .   ? 11.556 35.580 3.990   1.00 33.35 ? 1409 HOH A O     1 
HETATM 4557 O  O     . HOH O 5 .   ? 8.167  22.572 23.328  1.00 35.25 ? 1410 HOH A O     1 
HETATM 4558 O  O     . HOH O 5 .   ? 15.849 13.681 -5.826  1.00 34.55 ? 1411 HOH A O     1 
HETATM 4559 O  O     . HOH O 5 .   ? 22.207 4.973  -2.912  1.00 35.00 ? 1412 HOH A O     1 
HETATM 4560 O  O     . HOH O 5 .   ? 14.591 0.513  14.902  1.00 35.49 ? 1413 HOH A O     1 
HETATM 4561 O  O     . HOH O 5 .   ? 12.950 14.707 16.149  1.00 35.46 ? 1414 HOH A O     1 
HETATM 4562 O  O     . HOH O 5 .   ? 20.880 43.086 32.078  1.00 35.02 ? 1415 HOH A O     1 
HETATM 4563 O  O     . HOH O 5 .   ? 0.598  27.340 10.387  1.00 35.83 ? 1416 HOH A O     1 
HETATM 4564 O  O     . HOH O 5 .   ? 35.028 1.940  1.060   1.00 33.92 ? 1417 HOH A O     1 
HETATM 4565 O  O     . HOH O 5 .   ? 20.532 26.801 32.665  1.00 36.89 ? 1418 HOH A O     1 
HETATM 4566 O  O     . HOH O 5 .   ? 19.338 -4.699 8.200   1.00 36.56 ? 1419 HOH A O     1 
HETATM 4567 O  O     . HOH O 5 .   ? 39.878 10.538 5.673   1.00 34.64 ? 1420 HOH A O     1 
HETATM 4568 O  O     . HOH O 5 .   ? 27.296 30.503 24.359  1.00 35.01 ? 1421 HOH A O     1 
HETATM 4569 O  O     . HOH O 5 .   ? 2.853  15.237 7.486   1.00 36.82 ? 1422 HOH A O     1 
HETATM 4570 O  O     . HOH O 5 .   ? 12.901 37.537 5.631   1.00 35.00 ? 1423 HOH A O     1 
HETATM 4571 O  O     . HOH O 5 .   ? 28.724 22.503 -5.409  1.00 36.90 ? 1424 HOH A O     1 
HETATM 4572 O  O     . HOH O 5 .   ? 19.104 29.810 39.659  1.00 35.46 ? 1425 HOH A O     1 
HETATM 4573 O  O     . HOH O 5 .   ? 3.663  33.568 12.496  1.00 36.05 ? 1426 HOH A O     1 
HETATM 4574 O  O     . HOH O 5 .   ? 14.055 7.071  15.389  1.00 36.34 ? 1427 HOH A O     1 
HETATM 4575 O  O     . HOH O 5 .   ? 26.002 1.497  5.894   1.00 38.17 ? 1428 HOH A O     1 
HETATM 4576 O  O     . HOH O 5 .   ? 5.455  41.488 10.942  1.00 35.93 ? 1429 HOH A O     1 
HETATM 4577 O  O     . HOH O 5 .   ? 26.955 22.521 32.947  1.00 37.11 ? 1430 HOH A O     1 
HETATM 4578 O  O     . HOH O 5 .   ? 22.625 5.124  17.690  1.00 37.28 ? 1431 HOH A O     1 
HETATM 4579 O  O     . HOH O 5 .   ? 3.984  33.172 17.558  1.00 36.73 ? 1432 HOH A O     1 
HETATM 4580 O  O     . HOH O 5 .   ? 42.099 25.001 7.434   1.00 38.02 ? 1433 HOH A O     1 
HETATM 4581 O  O     . HOH O 5 .   ? 9.971  28.147 -6.209  1.00 36.92 ? 1434 HOH A O     1 
HETATM 4582 O  O     . HOH O 5 .   ? 38.211 13.322 -8.874  1.00 36.78 ? 1435 HOH A O     1 
HETATM 4583 O  O     . HOH O 5 .   ? 27.158 15.259 26.970  1.00 37.24 ? 1436 HOH A O     1 
HETATM 4584 O  O     . HOH O 5 .   ? 16.623 27.286 -8.474  1.00 37.22 ? 1437 HOH A O     1 
HETATM 4585 O  O     . HOH O 5 .   ? 2.384  9.209  3.849   1.00 39.41 ? 1438 HOH A O     1 
HETATM 4586 O  O     . HOH O 5 .   ? 45.239 8.209  0.226   1.00 37.40 ? 1439 HOH A O     1 
HETATM 4587 O  O     . HOH O 5 .   ? 15.347 41.858 9.810   1.00 34.00 ? 1440 HOH A O     1 
HETATM 4588 O  O     . HOH O 5 .   ? -0.343 20.711 4.970   1.00 37.51 ? 1441 HOH A O     1 
HETATM 4589 O  O     . HOH O 5 .   ? 11.495 38.636 29.837  1.00 38.67 ? 1442 HOH A O     1 
HETATM 4590 O  O     . HOH O 5 .   ? 4.128  25.767 19.171  1.00 37.15 ? 1443 HOH A O     1 
HETATM 4591 O  O     . HOH O 5 .   ? 26.222 4.024  -4.271  1.00 38.12 ? 1444 HOH A O     1 
HETATM 4592 O  O     . HOH O 5 .   ? -0.597 29.650 10.156  1.00 39.27 ? 1445 HOH A O     1 
HETATM 4593 O  O     . HOH O 5 .   ? 19.722 4.048  -2.340  1.00 35.62 ? 1446 HOH A O     1 
HETATM 4594 O  O     . HOH O 5 .   ? 19.950 11.463 -4.427  1.00 39.51 ? 1447 HOH A O     1 
HETATM 4595 O  O     . HOH O 5 .   ? 20.096 34.572 11.416  1.00 39.72 ? 1448 HOH A O     1 
HETATM 4596 O  O     . HOH O 5 .   ? 25.342 17.166 28.427  1.00 38.81 ? 1449 HOH A O     1 
HETATM 4597 O  O     . HOH O 5 .   ? 4.692  25.479 12.250  1.00 40.56 ? 1450 HOH A O     1 
HETATM 4598 O  O     . HOH O 5 .   ? 31.422 17.024 -9.903  1.00 39.13 ? 1451 HOH A O     1 
HETATM 4599 O  O     . HOH O 5 .   ? 43.402 5.054  1.812   1.00 39.19 ? 1452 HOH A O     1 
HETATM 4600 O  O     . HOH O 5 .   ? 35.878 20.892 16.119  1.00 38.81 ? 1453 HOH A O     1 
HETATM 4601 O  O     . HOH O 5 .   ? 6.954  49.171 16.864  1.00 40.01 ? 1454 HOH A O     1 
HETATM 4602 O  O     . HOH O 5 .   ? 28.343 12.448 -7.560  1.00 38.31 ? 1455 HOH A O     1 
HETATM 4603 O  O     . HOH O 5 .   ? 26.019 3.573  10.049  1.00 39.02 ? 1456 HOH A O     1 
HETATM 4604 O  O     . HOH O 5 .   ? 18.809 6.700  18.167  1.00 37.90 ? 1457 HOH A O     1 
HETATM 4605 O  O     . HOH O 5 .   ? 21.610 22.827 -9.698  1.00 40.60 ? 1458 HOH A O     1 
HETATM 4606 O  O     . HOH O 5 .   ? 23.331 35.132 16.879  1.00 39.65 ? 1459 HOH A O     1 
HETATM 4607 O  O     . HOH O 5 .   ? 20.552 9.158  -3.884  1.00 40.82 ? 1460 HOH A O     1 
HETATM 4608 O  O     . HOH O 5 .   ? 18.753 36.059 37.444  1.00 40.35 ? 1461 HOH A O     1 
HETATM 4609 O  O     . HOH O 5 .   ? 16.761 9.351  -4.157  1.00 41.18 ? 1462 HOH A O     1 
HETATM 4610 O  O     . HOH O 5 .   ? 28.588 26.832 20.520  1.00 42.38 ? 1463 HOH A O     1 
HETATM 4611 O  O     . HOH O 5 .   ? 23.434 32.716 37.414  1.00 40.80 ? 1464 HOH A O     1 
HETATM 4612 O  O     . HOH O 5 .   ? 22.762 31.496 12.623  1.00 42.69 ? 1465 HOH A O     1 
HETATM 4613 O  O     . HOH O 5 .   ? 43.993 10.755 1.791   1.00 40.59 ? 1466 HOH A O     1 
HETATM 4614 O  O     . HOH O 5 .   ? 25.055 41.579 31.997  1.00 43.01 ? 1467 HOH A O     1 
HETATM 4615 O  O     . HOH O 5 .   ? 8.803  17.222 19.076  1.00 41.54 ? 1468 HOH A O     1 
HETATM 4616 O  O     . HOH O 5 .   ? 29.239 29.528 11.084  1.00 40.36 ? 1469 HOH A O     1 
HETATM 4617 O  O     . HOH O 5 .   ? 15.373 -5.607 10.336  1.00 41.73 ? 1470 HOH A O     1 
HETATM 4618 O  O     . HOH O 5 .   ? 37.579 7.383  18.524  1.00 39.15 ? 1471 HOH A O     1 
HETATM 4619 O  O     . HOH O 5 .   ? 18.765 5.462  -4.404  1.00 41.60 ? 1472 HOH A O     1 
HETATM 4620 O  O     . HOH O 5 .   ? 4.801  40.363 8.658   1.00 38.48 ? 1473 HOH A O     1 
HETATM 4621 O  O     . HOH O 5 .   ? 30.999 22.395 -3.061  1.00 43.43 ? 1474 HOH A O     1 
HETATM 4622 O  O     . HOH O 5 .   ? 26.596 14.458 -8.066  1.00 41.38 ? 1475 HOH A O     1 
HETATM 4623 O  O     . HOH O 5 .   ? 30.443 3.249  -6.597  1.00 41.61 ? 1476 HOH A O     1 
HETATM 4624 O  O     . HOH O 5 .   ? 24.622 42.684 34.792  1.00 40.36 ? 1477 HOH A O     1 
HETATM 4625 O  O     . HOH O 5 .   ? 9.215  33.573 28.871  1.00 42.06 ? 1478 HOH A O     1 
HETATM 4626 O  O     . HOH O 5 .   ? 1.450  13.565 5.254   1.00 43.53 ? 1479 HOH A O     1 
HETATM 4627 O  O     . HOH O 5 .   ? 4.915  30.183 -2.120  1.00 42.28 ? 1480 HOH A O     1 
HETATM 4628 O  O     . HOH O 5 .   ? 5.973  30.895 21.043  1.00 39.86 ? 1481 HOH A O     1 
HETATM 4629 O  O     . HOH O 5 .   ? 17.959 23.952 32.726  1.00 43.46 ? 1482 HOH A O     1 
HETATM 4630 O  O     . HOH O 5 .   ? 35.997 19.328 -8.679  1.00 40.64 ? 1483 HOH A O     1 
HETATM 4631 O  O     . HOH O 5 .   ? 2.186  30.581 13.952  1.00 41.73 ? 1484 HOH A O     1 
HETATM 4632 O  O     . HOH O 5 .   ? 28.559 5.137  -3.929  1.00 43.04 ? 1485 HOH A O     1 
HETATM 4633 O  O     . HOH O 5 .   ? 4.668  34.589 -3.934  1.00 40.42 ? 1486 HOH A O     1 
HETATM 4634 O  O     . HOH O 5 .   ? 7.059  28.188 24.325  1.00 41.26 ? 1487 HOH A O     1 
HETATM 4635 O  O     . HOH O 5 .   ? 22.618 14.479 26.141  1.00 41.98 ? 1488 HOH A O     1 
HETATM 4636 O  O     . HOH O 5 .   ? 24.774 40.092 38.054  1.00 41.98 ? 1489 HOH A O     1 
HETATM 4637 O  O     . HOH O 5 .   ? 20.984 35.837 3.049   1.00 43.05 ? 1490 HOH A O     1 
HETATM 4638 O  O     . HOH O 5 .   ? 41.425 27.746 -4.192  1.00 41.48 ? 1491 HOH A O     1 
HETATM 4639 O  O     . HOH O 5 .   ? 18.983 13.215 26.255  1.00 44.30 ? 1492 HOH A O     1 
HETATM 4640 O  O     . HOH O 5 .   ? 11.873 17.617 16.756  1.00 41.82 ? 1493 HOH A O     1 
HETATM 4641 O  O     . HOH O 5 .   ? 1.268  32.463 11.975  1.00 42.35 ? 1494 HOH A O     1 
HETATM 4642 O  O     . HOH O 5 .   ? 42.529 5.710  -6.793  1.00 41.75 ? 1495 HOH A O     1 
HETATM 4643 O  O     . HOH O 5 .   ? 9.516  1.153  4.583   1.00 40.04 ? 1496 HOH A O     1 
HETATM 4644 O  O     . HOH O 5 .   ? 12.922 12.309 14.844  1.00 41.41 ? 1497 HOH A O     1 
HETATM 4645 O  O     . HOH O 5 .   ? 30.088 14.871 -10.627 1.00 44.44 ? 1498 HOH A O     1 
HETATM 4646 O  O     . HOH O 5 .   ? 6.942  4.157  5.760   1.00 42.42 ? 1499 HOH A O     1 
HETATM 4647 O  O     . HOH O 5 .   ? 8.703  34.809 -7.219  1.00 41.89 ? 1500 HOH A O     1 
HETATM 4648 O  O     . HOH O 5 .   ? 12.932 12.610 17.795  1.00 42.89 ? 1501 HOH A O     1 
HETATM 4649 O  O     . HOH O 5 .   ? 3.391  46.013 10.849  1.00 43.18 ? 1502 HOH A O     1 
HETATM 4650 O  O     . HOH O 5 .   ? 9.186  19.947 17.810  1.00 40.51 ? 1503 HOH A O     1 
HETATM 4651 O  O     . HOH O 5 .   ? 36.307 34.573 5.737   1.00 40.75 ? 1504 HOH A O     1 
HETATM 4652 O  O     . HOH O 5 .   ? 12.441 28.106 -7.618  1.00 44.03 ? 1505 HOH A O     1 
HETATM 4653 O  O     . HOH O 5 .   ? 24.486 24.659 -8.847  1.00 44.49 ? 1506 HOH A O     1 
HETATM 4654 O  O     . HOH O 5 .   ? 29.040 35.895 31.355  1.00 42.96 ? 1507 HOH A O     1 
HETATM 4655 O  O     . HOH O 5 .   ? 32.980 5.373  8.101   1.00 44.23 ? 1508 HOH A O     1 
HETATM 4656 O  O     . HOH O 5 .   ? 21.469 32.903 9.790   1.00 45.36 ? 1509 HOH A O     1 
HETATM 4657 O  O     . HOH O 5 .   ? 7.082  6.128  -4.755  1.00 46.46 ? 1510 HOH A O     1 
HETATM 4658 O  O     . HOH O 5 .   ? -0.456 16.126 7.958   1.00 41.42 ? 1511 HOH A O     1 
HETATM 4659 O  O     . HOH O 5 .   ? 2.595  28.006 13.210  1.00 45.17 ? 1512 HOH A O     1 
HETATM 4660 O  O     . HOH O 5 .   ? 39.266 26.722 10.225  1.00 45.93 ? 1513 HOH A O     1 
HETATM 4661 O  O     . HOH O 5 .   ? 15.612 29.444 41.454  1.00 45.91 ? 1514 HOH A O     1 
HETATM 4662 O  O     . HOH O 5 .   ? -3.308 18.888 11.292  1.00 45.51 ? 1515 HOH A O     1 
HETATM 4663 O  O     . HOH O 5 .   ? 15.010 4.629  16.372  1.00 45.87 ? 1516 HOH A O     1 
HETATM 4664 O  O     . HOH O 5 .   ? 22.647 60.331 23.394  1.00 42.80 ? 1517 HOH A O     1 
HETATM 4665 O  O     . HOH O 5 .   ? 36.757 31.850 4.771   1.00 47.82 ? 1518 HOH A O     1 
HETATM 4666 O  O     . HOH O 5 .   ? 28.961 24.537 21.791  1.00 44.38 ? 1519 HOH A O     1 
HETATM 4667 O  O     . HOH O 5 .   ? 40.589 4.676  -5.310  1.00 43.33 ? 1520 HOH A O     1 
HETATM 4668 O  O     . HOH O 5 .   ? 22.715 27.146 -8.607  1.00 43.68 ? 1521 HOH A O     1 
HETATM 4669 O  O     . HOH O 5 .   ? 25.594 33.596 3.889   1.00 43.26 ? 1522 HOH A O     1 
HETATM 4670 O  O     . HOH O 5 .   ? 25.923 12.215 -6.681  1.00 49.07 ? 1523 HOH A O     1 
HETATM 4671 O  O     . HOH O 5 .   ? 39.534 10.966 11.797  1.00 43.50 ? 1524 HOH A O     1 
HETATM 4672 O  O     . HOH O 5 .   ? 26.966 34.734 35.284  1.00 44.80 ? 1525 HOH A O     1 
HETATM 4673 O  O     . HOH O 5 .   ? 31.825 17.662 18.660  1.00 46.04 ? 1526 HOH A O     1 
HETATM 4674 O  O     . HOH O 5 .   ? 20.625 45.284 30.585  1.00 45.39 ? 1527 HOH A O     1 
HETATM 4675 O  O     . HOH O 5 .   ? 35.715 24.170 15.121  1.00 44.24 ? 1528 HOH A O     1 
HETATM 4676 O  O     . HOH O 5 .   ? 29.098 5.326  21.014  1.00 44.43 ? 1529 HOH A O     1 
HETATM 4677 O  O     . HOH O 5 .   ? 22.218 23.453 33.401  1.00 42.38 ? 1530 HOH A O     1 
HETATM 4678 O  O     . HOH O 5 .   ? -0.033 32.394 9.609   1.00 43.82 ? 1531 HOH A O     1 
HETATM 4679 O  O     . HOH O 5 .   ? -0.005 23.583 11.166  1.00 41.00 ? 1532 HOH A O     1 
HETATM 4680 O  O     . HOH O 5 .   ? 8.800  2.229  11.081  1.00 45.87 ? 1533 HOH A O     1 
HETATM 4681 O  O     . HOH O 5 .   ? 21.487 6.523  19.913  1.00 46.80 ? 1534 HOH A O     1 
HETATM 4682 O  O     . HOH O 5 .   ? 20.140 14.627 -7.447  1.00 46.61 ? 1535 HOH A O     1 
HETATM 4683 O  O     . HOH O 5 .   ? 15.613 10.776 25.439  1.00 48.14 ? 1536 HOH A O     1 
HETATM 4684 O  O     . HOH O 5 .   ? 29.554 8.239  25.888  1.00 44.85 ? 1537 HOH A O     1 
HETATM 4685 O  O     . HOH O 5 .   ? 16.434 -1.524 -3.034  1.00 48.43 ? 1538 HOH A O     1 
HETATM 4686 O  O     . HOH O 5 .   ? 14.434 8.056  -5.277  1.00 46.09 ? 1539 HOH A O     1 
HETATM 4687 O  O     . HOH O 5 .   ? 31.735 3.067  12.002  1.00 44.13 ? 1540 HOH A O     1 
HETATM 4688 O  O     . HOH O 5 .   ? 26.506 28.294 35.901  1.00 44.64 ? 1541 HOH A O     1 
HETATM 4689 O  O     . HOH O 5 .   ? 23.844 4.339  14.475  1.00 46.49 ? 1542 HOH A O     1 
HETATM 4690 O  O     . HOH O 5 .   ? 34.676 4.411  13.194  1.00 49.78 ? 1543 HOH A O     1 
HETATM 4691 O  O     . HOH O 5 .   ? 8.107  40.637 23.907  1.00 44.43 ? 1544 HOH A O     1 
HETATM 4692 O  O     . HOH O 5 .   ? 30.333 0.917  -4.896  1.00 44.38 ? 1545 HOH A O     1 
HETATM 4693 O  O     . HOH O 5 .   ? 5.642  8.761  12.241  1.00 47.72 ? 1546 HOH A O     1 
HETATM 4694 O  O     . HOH O 5 .   ? 16.514 25.990 34.523  1.00 46.78 ? 1547 HOH A O     1 
HETATM 4695 O  O     . HOH O 5 .   ? 16.600 43.730 7.691   1.00 43.79 ? 1548 HOH A O     1 
HETATM 4696 O  O     . HOH O 5 .   ? 21.262 28.705 38.387  1.00 48.28 ? 1549 HOH A O     1 
HETATM 4697 O  O     . HOH O 5 .   ? 24.622 30.132 11.510  1.00 47.26 ? 1550 HOH A O     1 
HETATM 4698 O  O     . HOH O 5 .   ? 4.974  33.284 26.413  1.00 44.45 ? 1551 HOH A O     1 
HETATM 4699 O  O     . HOH O 5 .   ? 27.488 29.329 30.530  1.00 52.33 ? 1552 HOH A O     1 
HETATM 4700 O  O     . HOH O 5 .   ? 15.271 44.675 23.141  1.00 47.18 ? 1553 HOH A O     1 
HETATM 4701 O  O     . HOH O 5 .   ? 2.934  44.695 15.345  1.00 47.96 ? 1554 HOH A O     1 
HETATM 4702 O  O     . HOH O 5 .   ? 4.491  44.627 18.615  1.00 47.25 ? 1555 HOH A O     1 
HETATM 4703 O  O     . HOH O 5 .   ? 1.279  26.277 -5.162  1.00 45.54 ? 1556 HOH A O     1 
HETATM 4704 O  O     . HOH O 5 .   ? 38.181 9.529  7.338   1.00 47.78 ? 1557 HOH A O     1 
HETATM 4705 O  O     . HOH O 5 .   ? 37.858 9.161  9.951   1.00 46.71 ? 1558 HOH A O     1 
HETATM 4706 O  O     . HOH O 5 .   ? 24.631 26.305 35.936  1.00 48.12 ? 1559 HOH A O     1 
HETATM 4707 O  O     . HOH O 5 .   ? 40.135 5.076  2.952   1.00 45.77 ? 1560 HOH A O     1 
HETATM 4708 O  O     . HOH O 5 .   ? 33.665 18.368 -8.670  1.00 52.07 ? 1561 HOH A O     1 
HETATM 4709 O  O     . HOH O 5 .   ? 17.633 39.336 12.272  1.00 45.84 ? 1562 HOH A O     1 
HETATM 4710 O  O     . HOH O 5 .   ? 35.373 0.273  -4.643  1.00 49.04 ? 1563 HOH A O     1 
HETATM 4711 O  O     . HOH O 5 .   ? 24.793 34.667 14.768  1.00 50.09 ? 1564 HOH A O     1 
HETATM 4712 O  O     . HOH O 5 .   ? 2.399  39.666 11.989  1.00 47.94 ? 1565 HOH A O     1 
HETATM 4713 O  O     . HOH O 5 .   ? 22.226 26.168 34.821  1.00 47.30 ? 1566 HOH A O     1 
HETATM 4714 O  O     . HOH O 5 .   ? 9.186  44.473 22.331  1.00 47.07 ? 1567 HOH A O     1 
HETATM 4715 O  O     . HOH O 5 .   ? 24.438 22.014 33.391  1.00 50.96 ? 1568 HOH A O     1 
HETATM 4716 O  O     . HOH O 5 .   ? 23.526 -0.620 13.181  1.00 50.33 ? 1569 HOH A O     1 
HETATM 4717 O  O     . HOH O 5 .   ? 27.826 27.963 23.330  1.00 47.53 ? 1570 HOH A O     1 
HETATM 4718 O  O     . HOH O 5 .   ? 5.457  31.745 23.522  1.00 46.42 ? 1571 HOH A O     1 
HETATM 4719 O  O     . HOH O 5 .   ? 39.132 7.285  12.642  1.00 50.43 ? 1572 HOH A O     1 
HETATM 4720 O  O     . HOH O 5 .   ? 27.428 18.646 -12.095 1.00 48.16 ? 1573 HOH A O     1 
HETATM 4721 O  O     . HOH O 5 .   ? 28.803 33.262 29.497  1.00 51.37 ? 1574 HOH A O     1 
HETATM 4722 O  O     . HOH O 5 .   ? 21.585 -0.410 15.011  1.00 49.19 ? 1575 HOH A O     1 
HETATM 4723 O  O     . HOH O 5 .   ? 30.365 32.589 17.469  1.00 49.45 ? 1576 HOH A O     1 
HETATM 4724 O  O     . HOH O 5 .   ? 35.996 15.402 20.775  1.00 46.25 ? 1577 HOH A O     1 
HETATM 4725 O  O     . HOH O 5 .   ? 18.050 18.590 -12.567 1.00 48.93 ? 1578 HOH A O     1 
HETATM 4726 O  O     . HOH O 5 .   ? 6.386  26.063 -8.979  1.00 48.82 ? 1579 HOH A O     1 
HETATM 4727 O  O     . HOH O 5 .   ? 32.488 31.161 9.372   1.00 48.71 ? 1580 HOH A O     1 
HETATM 4728 O  O     . HOH O 5 .   ? 13.837 25.673 34.692  1.00 50.73 ? 1581 HOH A O     1 
HETATM 4729 O  O     . HOH O 5 .   ? 16.716 9.478  18.741  1.00 48.67 ? 1582 HOH A O     1 
HETATM 4730 O  O     . HOH O 5 .   ? 43.157 20.671 15.414  1.00 51.44 ? 1583 HOH A O     1 
HETATM 4731 O  O     . HOH O 5 .   ? 22.419 16.118 -11.042 1.00 49.09 ? 1584 HOH A O     1 
HETATM 4732 O  O     . HOH O 5 .   ? 37.431 12.535 -11.389 1.00 48.15 ? 1585 HOH A O     1 
HETATM 4733 O  O     . HOH O 5 .   ? 40.282 27.178 7.784   1.00 49.03 ? 1586 HOH A O     1 
HETATM 4734 O  O     . HOH O 5 .   ? 34.667 17.151 22.275  1.00 55.08 ? 1587 HOH A O     1 
HETATM 4735 O  O     . HOH O 5 .   ? 2.551  24.633 -7.129  1.00 50.85 ? 1588 HOH A O     1 
HETATM 4736 O  O     . HOH O 5 .   ? 24.587 8.930  25.781  1.00 41.70 ? 1589 HOH A O     1 
HETATM 4737 O  O     . HOH O 5 .   ? 27.220 10.153 -8.464  1.00 50.86 ? 1590 HOH A O     1 
HETATM 4738 O  O     . HOH O 5 .   ? 36.895 29.792 7.819   1.00 45.11 ? 1591 HOH A O     1 
HETATM 4739 O  O     . HOH O 5 .   ? 28.565 0.916  7.000   1.00 49.18 ? 1592 HOH A O     1 
HETATM 4740 O  O     . HOH O 5 .   ? 2.705  40.631 6.977   1.00 51.52 ? 1593 HOH A O     1 
HETATM 4741 O  O     . HOH O 5 .   ? 4.050  23.449 20.739  1.00 56.70 ? 1594 HOH A O     1 
HETATM 4742 O  O     . HOH O 5 .   ? 37.446 6.419  8.589   1.00 47.77 ? 1595 HOH A O     1 
HETATM 4743 O  O     . HOH O 5 .   ? 35.895 10.975 23.335  1.00 50.89 ? 1596 HOH A O     1 
HETATM 4744 O  O     . HOH O 5 .   ? 11.132 -1.736 -3.589  1.00 51.04 ? 1597 HOH A O     1 
HETATM 4745 O  O     . HOH O 5 .   ? 0.488  34.279 13.995  1.00 54.01 ? 1598 HOH A O     1 
HETATM 4746 O  O     . HOH O 5 .   ? 33.517 34.691 25.845  1.00 52.34 ? 1599 HOH A O     1 
HETATM 4747 O  O     . HOH O 5 .   ? 4.351  14.703 14.770  1.00 55.77 ? 1600 HOH A O     1 
HETATM 4748 O  O     . HOH O 5 .   ? 33.464 32.074 7.059   1.00 48.99 ? 1601 HOH A O     1 
HETATM 4749 O  O     . HOH O 5 .   ? 18.932 -3.515 -1.115  1.00 52.34 ? 1602 HOH A O     1 
HETATM 4750 O  O     . HOH O 5 .   ? 6.555  26.408 28.410  1.00 56.93 ? 1603 HOH A O     1 
HETATM 4751 O  O     . HOH O 5 .   ? 24.584 13.415 27.829  1.00 52.78 ? 1604 HOH A O     1 
HETATM 4752 O  O     . HOH O 5 .   ? 2.750  36.979 10.353  1.00 48.43 ? 1605 HOH A O     1 
HETATM 4753 O  O     . HOH O 5 .   ? 25.072 -0.248 4.008   1.00 51.48 ? 1606 HOH A O     1 
HETATM 4754 O  O     . HOH O 5 .   ? 40.568 20.512 16.124  1.00 59.84 ? 1607 HOH A O     1 
HETATM 4755 O  O     . HOH O 5 .   ? 10.060 38.567 32.111  1.00 57.30 ? 1608 HOH A O     1 
HETATM 4756 O  O     . HOH O 5 .   ? 41.475 13.757 8.836   1.00 52.07 ? 1609 HOH A O     1 
HETATM 4757 O  O     . HOH O 5 .   ? 2.867  26.634 23.862  1.00 52.13 ? 1610 HOH A O     1 
HETATM 4758 O  O     . HOH O 5 .   ? 5.742  36.754 19.887  1.00 51.79 ? 1611 HOH A O     1 
HETATM 4759 O  O     . HOH O 5 .   ? 21.996 19.920 -10.984 1.00 53.95 ? 1612 HOH A O     1 
HETATM 4760 O  O     . HOH O 5 .   ? 33.204 24.331 26.482  1.00 52.57 ? 1613 HOH A O     1 
HETATM 4761 O  O     . HOH O 5 .   ? 9.474  6.678  12.143  1.00 56.44 ? 1614 HOH A O     1 
HETATM 4762 O  O     . HOH O 5 .   ? 34.689 4.595  -11.223 1.00 53.91 ? 1615 HOH A O     1 
HETATM 4763 O  O     . HOH O 5 .   ? 9.805  40.104 28.666  1.00 65.88 ? 1616 HOH A O     1 
HETATM 4764 O  O     . HOH O 5 .   ? 31.359 31.071 19.526  1.00 55.66 ? 1617 HOH A O     1 
HETATM 4765 O  O     . HOH O 5 .   ? 27.220 5.002  23.077  1.00 57.69 ? 1618 HOH A O     1 
HETATM 4766 O  O     . HOH O 5 .   ? 12.411 3.537  16.727  1.00 55.70 ? 1619 HOH A O     1 
HETATM 4767 O  O     . HOH O 5 .   ? 30.067 32.582 21.364  1.00 52.92 ? 1620 HOH A O     1 
HETATM 4768 O  O     . HOH O 5 .   ? 32.015 20.505 18.118  1.00 57.16 ? 1621 HOH A O     1 
HETATM 4769 O  O     . HOH O 5 .   ? 8.101  40.310 0.372   1.00 55.79 ? 1622 HOH A O     1 
HETATM 4770 O  O     . HOH O 5 .   ? 23.779 42.753 30.066  1.00 49.22 ? 1623 HOH A O     1 
HETATM 4771 O  O     . HOH O 5 .   ? 19.445 9.904  25.863  1.00 52.19 ? 1624 HOH A O     1 
HETATM 4772 O  O     . HOH O 5 .   ? 7.339  18.889 21.468  1.00 56.95 ? 1625 HOH A O     1 
HETATM 4773 O  O     . HOH P 5 .   ? 36.505 52.426 -13.205 1.00 43.01 ? 1236 HOH B O     1 
HETATM 4774 O  O     . HOH P 5 .   ? 40.491 59.587 33.616  1.00 42.78 ? 1237 HOH B O     1 
HETATM 4775 O  O     . HOH P 5 .   ? 22.772 43.903 0.222   1.00 13.67 ? 1238 HOH B O     1 
HETATM 4776 O  O     . HOH P 5 .   ? 22.400 46.526 0.752   1.00 14.86 ? 1239 HOH B O     1 
HETATM 4777 O  O     . HOH P 5 .   ? 23.249 49.923 6.632   1.00 15.70 ? 1240 HOH B O     1 
HETATM 4778 O  O     . HOH P 5 .   ? 19.404 37.536 -1.508  1.00 17.00 ? 1241 HOH B O     1 
HETATM 4779 O  O     . HOH P 5 .   ? 23.013 42.499 2.587   1.00 17.08 ? 1242 HOH B O     1 
HETATM 4780 O  O     . HOH P 5 .   ? 26.118 41.285 -3.965  1.00 17.12 ? 1243 HOH B O     1 
HETATM 4781 O  O     . HOH P 5 .   ? 17.352 34.021 0.029   1.00 17.41 ? 1244 HOH B O     1 
HETATM 4782 O  O     . HOH P 5 .   ? 20.366 41.498 -9.116  1.00 18.37 ? 1245 HOH B O     1 
HETATM 4783 O  O     . HOH P 5 .   ? 35.675 44.218 7.515   1.00 18.77 ? 1246 HOH B O     1 
HETATM 4784 O  O     . HOH P 5 .   ? 19.571 46.293 3.114   1.00 18.99 ? 1247 HOH B O     1 
HETATM 4785 O  O     . HOH P 5 .   ? 18.089 40.950 -4.383  1.00 19.30 ? 1248 HOH B O     1 
HETATM 4786 O  O     . HOH P 5 .   ? 18.360 38.295 -3.870  1.00 19.58 ? 1249 HOH B O     1 
HETATM 4787 O  O     . HOH P 5 .   ? 23.238 45.559 8.699   1.00 20.07 ? 1250 HOH B O     1 
HETATM 4788 O  O     . HOH P 5 .   ? 10.343 48.759 9.835   1.00 19.83 ? 1251 HOH B O     1 
HETATM 4789 O  O     . HOH P 5 .   ? 27.596 46.898 13.525  1.00 20.63 ? 1252 HOH B O     1 
HETATM 4790 O  O     . HOH P 5 .   ? 19.653 34.852 -1.370  1.00 20.45 ? 1253 HOH B O     1 
HETATM 4791 O  O     . HOH P 5 .   ? 20.911 41.901 4.569   1.00 20.95 ? 1254 HOH B O     1 
HETATM 4792 O  O     . HOH P 5 .   ? 30.702 32.591 -2.853  1.00 20.56 ? 1255 HOH B O     1 
HETATM 4793 O  O     . HOH P 5 .   ? 27.670 40.959 -6.495  1.00 21.56 ? 1256 HOH B O     1 
HETATM 4794 O  O     . HOH P 5 .   ? 21.575 40.000 23.522  1.00 21.10 ? 1257 HOH B O     1 
HETATM 4795 O  O     . HOH P 5 .   ? 31.488 43.447 20.883  1.00 21.30 ? 1258 HOH B O     1 
HETATM 4796 O  O     . HOH P 5 .   ? 33.512 45.892 -5.534  1.00 21.91 ? 1259 HOH B O     1 
HETATM 4797 O  O     . HOH P 5 .   ? 36.091 41.713 -8.097  1.00 21.99 ? 1260 HOH B O     1 
HETATM 4798 O  O     . HOH P 5 .   ? 21.306 33.976 -8.679  1.00 22.62 ? 1261 HOH B O     1 
HETATM 4799 O  O     . HOH P 5 .   ? 27.793 54.983 -2.757  1.00 22.53 ? 1262 HOH B O     1 
HETATM 4800 O  O     . HOH P 5 .   ? 19.736 42.715 8.886   1.00 22.30 ? 1263 HOH B O     1 
HETATM 4801 O  O     . HOH P 5 .   ? 21.536 43.356 20.002  1.00 22.86 ? 1264 HOH B O     1 
HETATM 4802 O  O     . HOH P 5 .   ? 22.721 42.766 17.561  1.00 22.57 ? 1265 HOH B O     1 
HETATM 4803 O  O     . HOH P 5 .   ? 32.231 36.538 -13.294 1.00 23.69 ? 1266 HOH B O     1 
HETATM 4804 O  O     . HOH P 5 .   ? 29.364 48.337 11.670  1.00 23.07 ? 1267 HOH B O     1 
HETATM 4805 O  O     . HOH P 5 .   ? 14.996 52.954 15.360  1.00 23.67 ? 1268 HOH B O     1 
HETATM 4806 O  O     . HOH P 5 .   ? 19.111 43.539 14.436  1.00 24.55 ? 1269 HOH B O     1 
HETATM 4807 O  O     . HOH P 5 .   ? 32.133 43.287 14.158  1.00 24.98 ? 1270 HOH B O     1 
HETATM 4808 O  O     . HOH P 5 .   ? 27.310 39.248 0.523   1.00 24.93 ? 1271 HOH B O     1 
HETATM 4809 O  O     . HOH P 5 .   ? 36.224 48.435 11.112  1.00 24.82 ? 1272 HOH B O     1 
HETATM 4810 O  O     . HOH P 5 .   ? 38.886 47.903 4.946   1.00 25.01 ? 1273 HOH B O     1 
HETATM 4811 O  O     . HOH P 5 .   ? 15.848 59.555 14.436  1.00 24.74 ? 1274 HOH B O     1 
HETATM 4812 O  O     . HOH P 5 .   ? 12.861 58.370 15.677  1.00 24.81 ? 1275 HOH B O     1 
HETATM 4813 O  O     . HOH P 5 .   ? 29.149 45.649 8.166   1.00 25.72 ? 1276 HOH B O     1 
HETATM 4814 O  O     . HOH P 5 .   ? 25.115 37.458 -12.710 1.00 24.75 ? 1277 HOH B O     1 
HETATM 4815 O  O     . HOH P 5 .   ? 19.128 37.822 1.362   1.00 25.85 ? 1278 HOH B O     1 
HETATM 4816 O  O     . HOH P 5 .   ? 10.604 42.427 6.672   1.00 25.16 ? 1279 HOH B O     1 
HETATM 4817 O  O     . HOH P 5 .   ? 40.260 42.854 -0.208  1.00 25.44 ? 1280 HOH B O     1 
HETATM 4818 O  O     . HOH P 5 .   ? 12.190 37.840 -0.796  1.00 24.99 ? 1281 HOH B O     1 
HETATM 4819 O  O     . HOH P 5 .   ? 32.288 61.295 16.760  1.00 25.30 ? 1282 HOH B O     1 
HETATM 4820 O  O     . HOH P 5 .   ? 38.479 37.507 -11.135 1.00 26.29 ? 1283 HOH B O     1 
HETATM 4821 O  O     . HOH P 5 .   ? 20.080 45.383 5.828   1.00 26.22 ? 1284 HOH B O     1 
HETATM 4822 O  O     . HOH P 5 .   ? 28.509 48.614 -13.742 1.00 26.26 ? 1285 HOH B O     1 
HETATM 4823 O  O     . HOH P 5 .   ? 15.512 53.773 -1.062  1.00 25.90 ? 1286 HOH B O     1 
HETATM 4824 O  O     . HOH P 5 .   ? 7.676  43.030 10.011  1.00 26.15 ? 1287 HOH B O     1 
HETATM 4825 O  O     . HOH P 5 .   ? 37.681 49.005 20.881  1.00 26.35 ? 1288 HOH B O     1 
HETATM 4826 O  O     . HOH P 5 .   ? 12.078 40.190 2.460   1.00 26.55 ? 1289 HOH B O     1 
HETATM 4827 O  O     . HOH P 5 .   ? 23.548 53.452 14.158  1.00 26.20 ? 1290 HOH B O     1 
HETATM 4828 O  O     . HOH P 5 .   ? 18.400 43.396 -8.327  1.00 26.00 ? 1291 HOH B O     1 
HETATM 4829 O  O     . HOH P 5 .   ? 25.810 40.389 4.836   1.00 27.51 ? 1292 HOH B O     1 
HETATM 4830 O  O     . HOH P 5 .   ? 19.142 48.826 3.881   1.00 26.60 ? 1293 HOH B O     1 
HETATM 4831 O  O     . HOH P 5 .   ? 21.476 42.411 15.186  1.00 27.02 ? 1294 HOH B O     1 
HETATM 4832 O  O     . HOH P 5 .   ? 37.815 32.624 -4.520  1.00 27.24 ? 1295 HOH B O     1 
HETATM 4833 O  O     . HOH P 5 .   ? 34.770 47.509 -4.381  1.00 27.76 ? 1296 HOH B O     1 
HETATM 4834 O  O     . HOH P 5 .   ? 25.947 36.789 1.092   1.00 27.58 ? 1297 HOH B O     1 
HETATM 4835 O  O     . HOH P 5 .   ? 16.852 41.869 -6.586  1.00 28.24 ? 1298 HOH B O     1 
HETATM 4836 O  O     . HOH P 5 .   ? 21.551 47.912 24.212  1.00 28.00 ? 1299 HOH B O     1 
HETATM 4837 O  O     . HOH P 5 .   ? 25.884 44.910 10.144  1.00 28.99 ? 1300 HOH B O     1 
HETATM 4838 O  O     . HOH P 5 .   ? 41.541 47.151 5.678   1.00 28.94 ? 1301 HOH B O     1 
HETATM 4839 O  O     . HOH P 5 .   ? 37.905 45.074 -11.062 1.00 29.21 ? 1302 HOH B O     1 
HETATM 4840 O  O     . HOH P 5 .   ? 28.134 29.993 -8.637  1.00 28.57 ? 1303 HOH B O     1 
HETATM 4841 O  O     . HOH P 5 .   ? 36.481 37.752 3.475   1.00 29.76 ? 1304 HOH B O     1 
HETATM 4842 O  O     . HOH P 5 .   ? 21.993 43.547 7.369   1.00 29.05 ? 1305 HOH B O     1 
HETATM 4843 O  O     . HOH P 5 .   ? 10.363 51.734 16.352  1.00 29.10 ? 1306 HOH B O     1 
HETATM 4844 O  O     . HOH P 5 .   ? 8.005  52.040 7.698   1.00 29.35 ? 1307 HOH B O     1 
HETATM 4845 O  O     . HOH P 5 .   ? 20.794 52.312 -4.400  1.00 29.29 ? 1308 HOH B O     1 
HETATM 4846 O  O     . HOH P 5 .   ? 22.312 31.212 -7.738  1.00 28.47 ? 1309 HOH B O     1 
HETATM 4847 O  O     . HOH P 5 .   ? 14.610 50.892 21.814  1.00 31.08 ? 1310 HOH B O     1 
HETATM 4848 O  O     . HOH P 5 .   ? 16.485 46.530 -7.412  1.00 29.87 ? 1311 HOH B O     1 
HETATM 4849 O  O     . HOH P 5 .   ? 35.004 55.814 -7.820  1.00 30.48 ? 1312 HOH B O     1 
HETATM 4850 O  O     . HOH P 5 .   ? 11.296 38.295 -4.641  1.00 30.24 ? 1313 HOH B O     1 
HETATM 4851 O  O     . HOH P 5 .   ? 10.379 39.921 -0.712  1.00 30.75 ? 1314 HOH B O     1 
HETATM 4852 O  O     . HOH P 5 .   ? 32.954 42.017 24.462  1.00 31.52 ? 1315 HOH B O     1 
HETATM 4853 O  O     . HOH P 5 .   ? 10.574 36.550 -6.511  1.00 30.86 ? 1316 HOH B O     1 
HETATM 4854 O  O     . HOH P 5 .   ? 38.289 39.062 1.933   1.00 30.77 ? 1317 HOH B O     1 
HETATM 4855 O  O     . HOH P 5 .   ? 35.338 61.633 27.405  1.00 31.43 ? 1318 HOH B O     1 
HETATM 4856 O  O     . HOH P 5 .   ? 37.939 45.754 7.077   1.00 32.65 ? 1319 HOH B O     1 
HETATM 4857 O  O     . HOH P 5 .   ? 31.292 62.465 4.913   1.00 31.53 ? 1320 HOH B O     1 
HETATM 4858 O  O     . HOH P 5 .   ? 29.696 44.505 12.486  1.00 32.23 ? 1321 HOH B O     1 
HETATM 4859 O  O     . HOH P 5 .   ? 29.012 59.884 0.376   1.00 32.81 ? 1322 HOH B O     1 
HETATM 4860 O  O     . HOH P 5 .   ? 28.302 35.777 -13.965 1.00 34.75 ? 1323 HOH B O     1 
HETATM 4861 O  O     . HOH P 5 .   ? 13.732 53.273 -3.353  1.00 31.66 ? 1324 HOH B O     1 
HETATM 4862 O  O     . HOH P 5 .   ? 9.036  50.333 -2.717  1.00 32.64 ? 1325 HOH B O     1 
HETATM 4863 O  O     . HOH P 5 .   ? 27.148 39.052 3.153   1.00 33.48 ? 1326 HOH B O     1 
HETATM 4864 O  O     . HOH P 5 .   ? 21.332 59.522 1.120   1.00 33.30 ? 1327 HOH B O     1 
HETATM 4865 O  O     . HOH P 5 .   ? 9.691  40.152 -3.345  1.00 34.15 ? 1328 HOH B O     1 
HETATM 4866 O  O     . HOH P 5 .   ? 21.484 57.949 22.973  1.00 33.70 ? 1329 HOH B O     1 
HETATM 4867 O  O     . HOH P 5 .   ? 17.971 42.031 12.537  1.00 33.38 ? 1330 HOH B O     1 
HETATM 4868 O  O     . HOH P 5 .   ? 19.144 63.047 10.824  1.00 32.91 ? 1331 HOH B O     1 
HETATM 4869 O  O     . HOH P 5 .   ? 35.503 48.797 18.038  1.00 36.42 ? 1332 HOH B O     1 
HETATM 4870 O  O     . HOH P 5 .   ? 20.062 54.819 -3.032  1.00 34.73 ? 1333 HOH B O     1 
HETATM 4871 O  O     . HOH P 5 .   ? 27.062 41.747 7.180   1.00 35.57 ? 1334 HOH B O     1 
HETATM 4872 O  O     . HOH P 5 .   ? 5.481  47.847 6.036   1.00 35.42 ? 1335 HOH B O     1 
HETATM 4873 O  O     . HOH P 5 .   ? 10.953 59.265 17.417  1.00 35.94 ? 1336 HOH B O     1 
HETATM 4874 O  O     . HOH P 5 .   ? 36.405 64.283 10.786  1.00 34.37 ? 1337 HOH B O     1 
HETATM 4875 O  O     . HOH P 5 .   ? 24.715 30.124 -7.371  1.00 34.87 ? 1338 HOH B O     1 
HETATM 4876 O  O     . HOH P 5 .   ? 25.347 52.299 24.863  1.00 36.32 ? 1339 HOH B O     1 
HETATM 4877 O  O     . HOH P 5 .   ? 40.880 45.948 -6.779  1.00 35.31 ? 1340 HOH B O     1 
HETATM 4878 O  O     . HOH P 5 .   ? 36.409 65.614 21.146  1.00 35.51 ? 1341 HOH B O     1 
HETATM 4879 O  O     . HOH P 5 .   ? 36.646 46.674 26.887  1.00 36.27 ? 1342 HOH B O     1 
HETATM 4880 O  O     . HOH P 5 .   ? 33.149 66.852 14.937  1.00 36.12 ? 1343 HOH B O     1 
HETATM 4881 O  O     . HOH P 5 .   ? 46.111 60.567 4.628   1.00 35.58 ? 1344 HOH B O     1 
HETATM 4882 O  O     . HOH P 5 .   ? 12.104 32.453 -8.555  1.00 33.94 ? 1345 HOH B O     1 
HETATM 4883 O  O     . HOH P 5 .   ? 13.973 40.470 4.332   1.00 35.78 ? 1346 HOH B O     1 
HETATM 4884 O  O     . HOH P 5 .   ? 37.406 42.634 -10.170 1.00 37.91 ? 1347 HOH B O     1 
HETATM 4885 O  O     . HOH P 5 .   ? 43.326 48.886 6.698   1.00 34.95 ? 1348 HOH B O     1 
HETATM 4886 O  O     . HOH P 5 .   ? 37.740 60.702 26.603  1.00 37.97 ? 1349 HOH B O     1 
HETATM 4887 O  O     . HOH P 5 .   ? 33.874 64.449 14.366  1.00 40.27 ? 1350 HOH B O     1 
HETATM 4888 O  O     . HOH P 5 .   ? 28.934 37.150 3.702   1.00 37.29 ? 1351 HOH B O     1 
HETATM 4889 O  O     . HOH P 5 .   ? 10.350 42.722 -3.312  1.00 37.39 ? 1352 HOH B O     1 
HETATM 4890 O  O     . HOH P 5 .   ? 30.491 36.554 -15.394 1.00 37.39 ? 1353 HOH B O     1 
HETATM 4891 O  O     . HOH P 5 .   ? 35.774 43.530 -12.517 1.00 37.68 ? 1354 HOH B O     1 
HETATM 4892 O  O     . HOH P 5 .   ? 36.424 64.252 13.574  1.00 36.54 ? 1355 HOH B O     1 
HETATM 4893 O  O     . HOH P 5 .   ? 33.491 41.271 21.364  1.00 36.82 ? 1356 HOH B O     1 
HETATM 4894 O  O     . HOH P 5 .   ? 30.173 38.386 18.104  1.00 38.30 ? 1357 HOH B O     1 
HETATM 4895 O  O     . HOH P 5 .   ? 20.759 52.944 -6.992  1.00 38.96 ? 1358 HOH B O     1 
HETATM 4896 O  O     . HOH P 5 .   ? 38.281 47.370 9.127   1.00 38.65 ? 1359 HOH B O     1 
HETATM 4897 O  O     . HOH P 5 .   ? 27.581 57.301 -1.358  1.00 39.58 ? 1360 HOH B O     1 
HETATM 4898 O  O     . HOH P 5 .   ? 32.207 39.513 25.460  1.00 36.65 ? 1361 HOH B O     1 
HETATM 4899 O  O     . HOH P 5 .   ? 39.673 64.636 16.921  1.00 37.61 ? 1362 HOH B O     1 
HETATM 4900 O  O     . HOH P 5 .   ? 44.419 51.283 -1.295  1.00 37.08 ? 1363 HOH B O     1 
HETATM 4901 O  O     . HOH P 5 .   ? 28.460 35.891 1.541   1.00 39.64 ? 1364 HOH B O     1 
HETATM 4902 O  O     . HOH P 5 .   ? 16.594 34.921 2.818   1.00 38.99 ? 1365 HOH B O     1 
HETATM 4903 O  O     . HOH P 5 .   ? 10.124 50.122 18.797  1.00 38.74 ? 1366 HOH B O     1 
HETATM 4904 O  O     . HOH P 5 .   ? 20.668 45.843 25.839  1.00 41.43 ? 1367 HOH B O     1 
HETATM 4905 O  O     . HOH P 5 .   ? 31.185 28.254 -11.330 1.00 38.91 ? 1368 HOH B O     1 
HETATM 4906 O  O     . HOH P 5 .   ? 40.194 47.228 -9.882  1.00 40.07 ? 1369 HOH B O     1 
HETATM 4907 O  O     . HOH P 5 .   ? 4.267  60.843 6.477   1.00 39.88 ? 1370 HOH B O     1 
HETATM 4908 O  O     . HOH P 5 .   ? 13.087 44.468 21.515  1.00 38.19 ? 1371 HOH B O     1 
HETATM 4909 O  O     . HOH P 5 .   ? 8.810  48.052 1.328   1.00 39.23 ? 1372 HOH B O     1 
HETATM 4910 O  O     . HOH P 5 .   ? 26.710 49.202 27.922  1.00 42.23 ? 1373 HOH B O     1 
HETATM 4911 O  O     . HOH P 5 .   ? 27.055 69.687 4.297   1.00 41.63 ? 1374 HOH B O     1 
HETATM 4912 O  O     . HOH P 5 .   ? 42.224 41.558 -15.058 1.00 40.59 ? 1375 HOH B O     1 
HETATM 4913 O  O     . HOH P 5 .   ? 30.949 37.320 22.315  1.00 38.67 ? 1376 HOH B O     1 
HETATM 4914 O  O     . HOH P 5 .   ? 39.382 48.152 22.750  1.00 40.84 ? 1377 HOH B O     1 
HETATM 4915 O  O     . HOH P 5 .   ? 19.526 41.295 -11.824 1.00 42.17 ? 1378 HOH B O     1 
HETATM 4916 O  O     . HOH P 5 .   ? 36.641 64.984 25.302  1.00 43.10 ? 1379 HOH B O     1 
HETATM 4917 O  O     . HOH P 5 .   ? 11.799 46.717 21.349  1.00 40.69 ? 1380 HOH B O     1 
HETATM 4918 O  O     . HOH P 5 .   ? 35.280 68.173 15.799  1.00 40.49 ? 1381 HOH B O     1 
HETATM 4919 O  O     . HOH P 5 .   ? 37.806 42.610 6.009   1.00 40.08 ? 1382 HOH B O     1 
HETATM 4920 O  O     . HOH P 5 .   ? 21.679 50.354 25.224  1.00 40.62 ? 1383 HOH B O     1 
HETATM 4921 O  O     . HOH P 5 .   ? 31.608 66.376 2.344   1.00 40.73 ? 1384 HOH B O     1 
HETATM 4922 O  O     . HOH P 5 .   ? 42.291 40.346 -0.212  1.00 42.64 ? 1385 HOH B O     1 
HETATM 4923 O  O     . HOH P 5 .   ? 26.701 57.163 -3.777  1.00 42.89 ? 1386 HOH B O     1 
HETATM 4924 O  O     . HOH P 5 .   ? 36.018 28.674 -6.351  1.00 42.89 ? 1387 HOH B O     1 
HETATM 4925 O  O     . HOH P 5 .   ? 29.071 34.651 5.222   1.00 43.90 ? 1388 HOH B O     1 
HETATM 4926 O  O     . HOH P 5 .   ? 15.596 33.497 4.805   1.00 41.93 ? 1389 HOH B O     1 
HETATM 4927 O  O     . HOH P 5 .   ? 46.473 45.479 -3.919  1.00 41.38 ? 1390 HOH B O     1 
HETATM 4928 O  O     . HOH P 5 .   ? 31.947 63.667 2.521   1.00 42.07 ? 1391 HOH B O     1 
HETATM 4929 O  O     . HOH P 5 .   ? 39.979 62.567 21.036  1.00 40.60 ? 1392 HOH B O     1 
HETATM 4930 O  O     . HOH P 5 .   ? 17.400 59.349 -1.064  1.00 45.00 ? 1393 HOH B O     1 
HETATM 4931 O  O     . HOH P 5 .   ? 35.420 57.067 34.229  1.00 44.43 ? 1394 HOH B O     1 
HETATM 4932 O  O     . HOH P 5 .   ? 11.714 35.101 -10.372 1.00 44.04 ? 1395 HOH B O     1 
HETATM 4933 O  O     . HOH P 5 .   ? 23.289 39.599 5.684   1.00 42.69 ? 1396 HOH B O     1 
HETATM 4934 O  O     . HOH P 5 .   ? 20.470 32.849 -10.994 1.00 41.45 ? 1397 HOH B O     1 
HETATM 4935 O  O     . HOH P 5 .   ? 15.550 66.765 5.247   1.00 42.24 ? 1398 HOH B O     1 
HETATM 4936 O  O     . HOH P 5 .   ? 49.349 57.752 15.617  1.00 43.56 ? 1399 HOH B O     1 
HETATM 4937 O  O     . HOH P 5 .   ? 42.419 32.633 -4.857  1.00 44.27 ? 1400 HOH B O     1 
HETATM 4938 O  O     . HOH P 5 .   ? 33.794 56.655 -10.047 1.00 46.58 ? 1401 HOH B O     1 
HETATM 4939 O  O     . HOH P 5 .   ? 11.914 51.139 21.158  1.00 43.47 ? 1402 HOH B O     1 
HETATM 4940 O  O     . HOH P 5 .   ? 27.900 39.462 6.514   1.00 44.65 ? 1403 HOH B O     1 
HETATM 4941 O  O     . HOH P 5 .   ? 27.343 53.965 32.920  1.00 44.57 ? 1404 HOH B O     1 
HETATM 4942 O  O     . HOH P 5 .   ? 30.043 46.249 10.639  1.00 45.47 ? 1405 HOH B O     1 
HETATM 4943 O  O     . HOH P 5 .   ? 8.904  54.603 1.054   1.00 42.33 ? 1406 HOH B O     1 
HETATM 4944 O  O     . HOH P 5 .   ? 31.656 38.934 -16.070 1.00 43.73 ? 1407 HOH B O     1 
HETATM 4945 O  O     . HOH P 5 .   ? 24.039 47.209 24.696  1.00 45.53 ? 1408 HOH B O     1 
HETATM 4946 O  O     . HOH P 5 .   ? 39.645 45.854 -12.657 1.00 44.17 ? 1409 HOH B O     1 
HETATM 4947 O  O     . HOH P 5 .   ? 38.845 34.382 -13.039 1.00 44.23 ? 1410 HOH B O     1 
HETATM 4948 O  O     . HOH P 5 .   ? 48.262 58.951 17.735  1.00 45.49 ? 1411 HOH B O     1 
HETATM 4949 O  O     . HOH P 5 .   ? 40.598 43.774 -8.761  1.00 44.60 ? 1412 HOH B O     1 
HETATM 4950 O  O     . HOH P 5 .   ? 27.735 46.747 28.114  1.00 43.05 ? 1413 HOH B O     1 
HETATM 4951 O  O     . HOH P 5 .   ? 41.131 57.247 24.948  1.00 44.93 ? 1414 HOH B O     1 
HETATM 4952 O  O     . HOH P 5 .   ? 30.696 41.180 12.788  1.00 46.34 ? 1415 HOH B O     1 
HETATM 4953 O  O     . HOH P 5 .   ? 31.809 38.764 16.076  1.00 45.22 ? 1416 HOH B O     1 
HETATM 4954 O  O     . HOH P 5 .   ? 7.026  56.324 1.742   1.00 43.89 ? 1417 HOH B O     1 
HETATM 4955 O  O     . HOH P 5 .   ? 25.815 35.573 -14.607 1.00 43.77 ? 1418 HOH B O     1 
HETATM 4956 O  O     . HOH P 5 .   ? 19.156 38.552 -12.140 1.00 45.82 ? 1419 HOH B O     1 
HETATM 4957 O  O     . HOH P 5 .   ? 14.097 33.931 -11.156 1.00 48.15 ? 1420 HOH B O     1 
HETATM 4958 O  O     . HOH P 5 .   ? 7.310  52.335 0.678   1.00 45.42 ? 1421 HOH B O     1 
HETATM 4959 O  O     . HOH P 5 .   ? 34.542 72.374 4.002   1.00 46.24 ? 1422 HOH B O     1 
HETATM 4960 O  O     . HOH P 5 .   ? 41.989 49.752 10.633  1.00 44.78 ? 1423 HOH B O     1 
HETATM 4961 O  O     . HOH P 5 .   ? 7.606  42.006 3.318   1.00 46.14 ? 1424 HOH B O     1 
HETATM 4962 O  O     . HOH P 5 .   ? 46.982 48.696 1.054   1.00 44.90 ? 1425 HOH B O     1 
HETATM 4963 O  O     . HOH P 5 .   ? 34.368 40.011 -18.847 1.00 45.13 ? 1426 HOH B O     1 
HETATM 4964 O  O     . HOH P 5 .   ? 7.150  51.561 12.557  1.00 45.24 ? 1427 HOH B O     1 
HETATM 4965 O  O     . HOH P 5 .   ? 9.570  40.773 4.709   1.00 46.55 ? 1428 HOH B O     1 
HETATM 4966 O  O     . HOH P 5 .   ? 8.400  58.662 17.405  1.00 47.47 ? 1429 HOH B O     1 
HETATM 4967 O  O     . HOH P 5 .   ? 19.019 29.804 -11.208 1.00 44.69 ? 1430 HOH B O     1 
HETATM 4968 O  O     . HOH P 5 .   ? 23.607 60.543 27.322  1.00 45.67 ? 1431 HOH B O     1 
HETATM 4969 O  O     . HOH P 5 .   ? 34.804 35.691 -13.659 1.00 48.20 ? 1432 HOH B O     1 
HETATM 4970 O  O     . HOH P 5 .   ? 17.372 52.761 -6.291  1.00 42.20 ? 1433 HOH B O     1 
HETATM 4971 O  O     . HOH P 5 .   ? 2.990  43.308 4.658   1.00 47.36 ? 1434 HOH B O     1 
HETATM 4972 O  O     . HOH P 5 .   ? 31.038 57.564 -9.545  1.00 45.06 ? 1435 HOH B O     1 
HETATM 4973 O  O     . HOH P 5 .   ? 9.694  58.211 21.527  1.00 47.82 ? 1436 HOH B O     1 
HETATM 4974 O  O     . HOH P 5 .   ? 39.093 41.615 2.278   1.00 43.42 ? 1437 HOH B O     1 
HETATM 4975 O  O     . HOH P 5 .   ? 30.754 47.094 31.216  1.00 46.32 ? 1438 HOH B O     1 
HETATM 4976 O  O     . HOH P 5 .   ? 36.011 67.180 23.333  1.00 46.93 ? 1439 HOH B O     1 
HETATM 4977 O  O     . HOH P 5 .   ? 33.058 37.336 8.806   1.00 51.60 ? 1440 HOH B O     1 
HETATM 4978 O  O     . HOH P 5 .   ? 5.189  41.273 4.238   1.00 47.89 ? 1441 HOH B O     1 
HETATM 4979 O  O     . HOH P 5 .   ? 37.429 58.334 33.071  1.00 50.90 ? 1442 HOH B O     1 
HETATM 4980 O  O     . HOH P 5 .   ? 21.226 36.245 -12.112 1.00 47.46 ? 1443 HOH B O     1 
HETATM 4981 O  O     . HOH P 5 .   ? 24.636 36.219 3.479   1.00 46.96 ? 1444 HOH B O     1 
HETATM 4982 O  O     . HOH P 5 .   ? 30.712 59.570 34.159  1.00 48.09 ? 1445 HOH B O     1 
HETATM 4983 O  O     . HOH P 5 .   ? 38.528 46.639 -14.848 1.00 47.26 ? 1446 HOH B O     1 
HETATM 4984 O  O     . HOH P 5 .   ? 42.808 61.133 22.432  1.00 43.74 ? 1447 HOH B O     1 
HETATM 4985 O  O     . HOH P 5 .   ? 46.326 61.926 8.828   1.00 47.70 ? 1448 HOH B O     1 
HETATM 4986 O  O     . HOH P 5 .   ? 9.947  37.302 -9.690  1.00 42.68 ? 1449 HOH B O     1 
HETATM 4987 O  O     . HOH P 5 .   ? 13.698 48.463 22.680  1.00 50.81 ? 1450 HOH B O     1 
HETATM 4988 O  O     . HOH P 5 .   ? 40.002 57.670 28.222  1.00 43.01 ? 1451 HOH B O     1 
HETATM 4989 O  O     . HOH P 5 .   ? 17.830 56.132 -3.776  1.00 42.25 ? 1452 HOH B O     1 
HETATM 4990 O  O     . HOH P 5 .   ? 38.471 61.333 -4.000  1.00 48.07 ? 1453 HOH B O     1 
HETATM 4991 O  O     . HOH P 5 .   ? 40.454 57.401 -3.112  1.00 52.35 ? 1454 HOH B O     1 
HETATM 4992 O  O     . HOH P 5 .   ? 29.018 77.566 15.425  1.00 50.01 ? 1455 HOH B O     1 
HETATM 4993 O  O     . HOH P 5 .   ? 11.445 59.757 20.067  1.00 46.58 ? 1456 HOH B O     1 
HETATM 4994 O  O     . HOH P 5 .   ? 27.754 38.180 16.768  1.00 47.68 ? 1457 HOH B O     1 
HETATM 4995 O  O     . HOH P 5 .   ? 43.986 39.262 -12.134 1.00 47.73 ? 1458 HOH B O     1 
HETATM 4996 O  O     . HOH P 5 .   ? 15.633 35.653 -12.554 1.00 47.41 ? 1459 HOH B O     1 
HETATM 4997 O  O     . HOH P 5 .   ? 47.995 52.532 16.252  1.00 44.16 ? 1460 HOH B O     1 
HETATM 4998 O  O     . HOH P 5 .   ? 12.756 58.795 -8.363  1.00 46.09 ? 1461 HOH B O     1 
HETATM 4999 O  O     . HOH P 5 .   ? 37.352 48.541 28.847  1.00 55.21 ? 1462 HOH B O     1 
HETATM 5000 O  O     . HOH P 5 .   ? 30.403 34.709 -17.206 1.00 46.36 ? 1463 HOH B O     1 
HETATM 5001 O  O     . HOH P 5 .   ? 38.077 56.281 -10.601 1.00 49.85 ? 1464 HOH B O     1 
HETATM 5002 O  O     . HOH P 5 .   ? 30.669 32.978 6.438   1.00 45.37 ? 1465 HOH B O     1 
HETATM 5003 O  O     . HOH P 5 .   ? 30.751 61.884 -0.439  1.00 47.74 ? 1466 HOH B O     1 
HETATM 5004 O  O     . HOH P 5 .   ? 30.778 38.608 9.025   1.00 50.00 ? 1467 HOH B O     1 
HETATM 5005 O  O     . HOH P 5 .   ? 26.352 41.219 13.607  1.00 47.72 ? 1468 HOH B O     1 
HETATM 5006 O  O     . HOH P 5 .   ? 42.116 55.420 -0.599  1.00 54.16 ? 1469 HOH B O     1 
HETATM 5007 O  O     . HOH P 5 .   ? 26.631 59.882 -3.621  1.00 57.10 ? 1470 HOH B O     1 
HETATM 5008 O  O     . HOH P 5 .   ? 12.835 60.113 23.653  1.00 48.12 ? 1471 HOH B O     1 
HETATM 5009 O  O     . HOH P 5 .   ? 39.602 48.860 -14.354 1.00 49.71 ? 1472 HOH B O     1 
HETATM 5010 O  O     . HOH P 5 .   ? 15.623 40.865 -10.552 1.00 49.15 ? 1473 HOH B O     1 
HETATM 5011 O  O     . HOH P 5 .   ? 42.335 44.544 17.124  1.00 51.12 ? 1474 HOH B O     1 
HETATM 5012 O  O     . HOH P 5 .   ? 44.543 55.209 21.583  1.00 44.68 ? 1475 HOH B O     1 
HETATM 5013 O  O     . HOH P 5 .   ? 35.316 45.812 -16.721 1.00 44.58 ? 1476 HOH B O     1 
HETATM 5014 O  O     . HOH P 5 .   ? 36.835 64.812 3.543   1.00 48.18 ? 1477 HOH B O     1 
HETATM 5015 O  O     . HOH P 5 .   ? 40.936 47.398 10.250  1.00 51.85 ? 1478 HOH B O     1 
HETATM 5016 O  O     . HOH P 5 .   ? 35.930 45.614 -14.043 1.00 51.22 ? 1479 HOH B O     1 
HETATM 5017 O  O     . HOH P 5 .   ? 9.884  56.094 -3.916  1.00 51.66 ? 1480 HOH B O     1 
HETATM 5018 O  O     . HOH P 5 .   ? 5.788  44.646 2.965   1.00 50.97 ? 1481 HOH B O     1 
HETATM 5019 O  O     . HOH P 5 .   ? 24.524 66.190 21.003  1.00 54.82 ? 1482 HOH B O     1 
HETATM 5020 O  O     . HOH P 5 .   ? 28.631 67.990 25.757  1.00 49.96 ? 1483 HOH B O     1 
HETATM 5021 O  O     . HOH P 5 .   ? 44.870 62.158 18.635  1.00 49.72 ? 1484 HOH B O     1 
HETATM 5022 O  O     . HOH P 5 .   ? 13.960 53.470 23.405  1.00 50.75 ? 1485 HOH B O     1 
HETATM 5023 O  O     . HOH P 5 .   ? 39.166 53.590 -12.179 1.00 49.65 ? 1486 HOH B O     1 
HETATM 5024 O  O     . HOH P 5 .   ? 8.614  53.803 19.543  1.00 46.92 ? 1487 HOH B O     1 
HETATM 5025 O  O     . HOH P 5 .   ? 8.418  64.944 12.968  1.00 47.80 ? 1488 HOH B O     1 
HETATM 5026 O  O     . HOH P 5 .   ? 43.986 48.560 9.312   1.00 48.23 ? 1489 HOH B O     1 
HETATM 5027 O  O     . HOH P 5 .   ? 41.061 30.116 -2.048  1.00 48.94 ? 1490 HOH B O     1 
HETATM 5028 O  O     . HOH P 5 .   ? 16.823 61.442 -3.641  1.00 50.96 ? 1491 HOH B O     1 
HETATM 5029 O  O     . HOH P 5 .   ? 24.332 49.853 25.373  1.00 51.02 ? 1492 HOH B O     1 
HETATM 5030 O  O     . HOH P 5 .   ? 37.665 66.198 17.655  1.00 51.02 ? 1493 HOH B O     1 
HETATM 5031 O  O     . HOH P 5 .   ? 38.909 56.201 33.120  1.00 51.75 ? 1494 HOH B O     1 
HETATM 5032 O  O     . HOH P 5 .   ? 14.053 46.079 -6.295  1.00 49.69 ? 1495 HOH B O     1 
HETATM 5033 O  O     . HOH P 5 .   ? 27.246 68.468 1.732   1.00 52.24 ? 1496 HOH B O     1 
HETATM 5034 O  O     . HOH P 5 .   ? 40.040 36.074 -15.326 1.00 57.62 ? 1497 HOH B O     1 
HETATM 5035 O  O     . HOH P 5 .   ? 29.208 62.474 2.006   1.00 53.48 ? 1498 HOH B O     1 
HETATM 5036 O  O     . HOH P 5 .   ? 35.279 36.227 7.697   1.00 56.70 ? 1499 HOH B O     1 
HETATM 5037 O  O     . HOH P 5 .   ? 44.173 44.364 -9.639  1.00 51.15 ? 1500 HOH B O     1 
HETATM 5038 O  O     . HOH P 5 .   ? 11.026 59.512 -5.421  1.00 52.53 ? 1501 HOH B O     1 
HETATM 5039 O  O     . HOH P 5 .   ? 23.947 53.599 31.923  1.00 52.84 ? 1502 HOH B O     1 
HETATM 5040 O  O     . HOH P 5 .   ? 8.276  54.562 16.505  1.00 50.80 ? 1503 HOH B O     1 
HETATM 5041 O  O     . HOH P 5 .   ? 16.184 58.246 -3.999  1.00 58.18 ? 1504 HOH B O     1 
HETATM 5042 O  O     . HOH P 5 .   ? 43.611 46.298 -7.136  1.00 56.66 ? 1505 HOH B O     1 
HETATM 5043 O  O     . HOH P 5 .   ? 24.247 51.395 27.986  1.00 52.23 ? 1506 HOH B O     1 
HETATM 5044 O  O     . HOH P 5 .   ? 23.969 41.465 7.845   1.00 47.74 ? 1507 HOH B O     1 
HETATM 5045 O  O     . HOH P 5 .   ? 21.843 61.466 -1.718  1.00 51.16 ? 1508 HOH B O     1 
HETATM 5046 O  O     . HOH P 5 .   ? 33.979 62.209 33.824  1.00 50.44 ? 1509 HOH B O     1 
HETATM 5047 O  O     . HOH P 5 .   ? 22.418 40.009 15.121  1.00 49.69 ? 1510 HOH B O     1 
HETATM 5048 O  O     . HOH P 5 .   ? 41.169 37.042 2.312   1.00 50.65 ? 1511 HOH B O     1 
HETATM 5049 O  O     . HOH P 5 .   ? 46.136 43.193 5.059   1.00 51.74 ? 1512 HOH B O     1 
HETATM 5050 O  O     . HOH P 5 .   ? 12.540 68.585 12.940  1.00 49.92 ? 1513 HOH B O     1 
HETATM 5051 O  O     . HOH P 5 .   ? 12.528 32.282 -12.463 1.00 54.23 ? 1514 HOH B O     1 
HETATM 5052 O  O     . HOH P 5 .   ? 14.121 57.487 -6.180  1.00 53.19 ? 1515 HOH B O     1 
HETATM 5053 O  O     . HOH P 5 .   ? 34.403 63.100 1.467   1.00 58.13 ? 1516 HOH B O     1 
HETATM 5054 O  O     . HOH P 5 .   ? 17.006 68.360 17.477  1.00 52.18 ? 1517 HOH B O     1 
HETATM 5055 O  O     . HOH P 5 .   ? 30.122 62.259 38.431  1.00 53.50 ? 1518 HOH B O     1 
HETATM 5056 O  O     . HOH P 5 .   ? 41.117 55.147 26.556  1.00 52.52 ? 1519 HOH B O     1 
HETATM 5057 O  O     . HOH P 5 .   ? 39.136 62.400 0.624   1.00 58.72 ? 1520 HOH B O     1 
HETATM 5058 O  O     . HOH P 5 .   ? 14.118 55.645 25.075  1.00 55.93 ? 1521 HOH B O     1 
HETATM 5059 O  O     . HOH P 5 .   ? 40.208 32.964 -2.741  1.00 48.72 ? 1522 HOH B O     1 
HETATM 5060 O  O     . HOH P 5 .   ? 18.326 48.017 26.398  1.00 52.10 ? 1523 HOH B O     1 
HETATM 5061 O  O     . HOH P 5 .   ? 14.117 66.351 17.433  1.00 54.15 ? 1524 HOH B O     1 
HETATM 5062 O  O     . HOH P 5 .   ? 17.306 55.789 -6.583  1.00 54.70 ? 1525 HOH B O     1 
HETATM 5063 O  O     . HOH P 5 .   ? 9.745  52.842 -3.539  1.00 50.42 ? 1526 HOH B O     1 
HETATM 5064 O  O     . HOH Q 5 .   ? -1.282 13.424 -2.225  1.00 29.02 ? 12   HOH P O     1 
HETATM 5065 O  O     . HOH Q 5 .   ? 2.901  11.588 2.610   1.00 37.73 ? 13   HOH P O     1 
HETATM 5066 O  O     . HOH Q 5 .   ? 9.567  16.326 16.850  1.00 38.51 ? 14   HOH P O     1 
HETATM 5067 O  O     . HOH Q 5 .   ? -1.573 9.884  -5.310  1.00 45.37 ? 15   HOH P O     1 
HETATM 5068 O  O     . HOH R 5 .   ? 21.769 65.186 4.664   1.00 33.10 ? 12   HOH Q O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   951  ?    ?   ?   A . n 
A 1 2   SER 2   952  ?    ?   ?   A . n 
A 1 3   GLN 3   953  ?    ?   ?   A . n 
A 1 4   VAL 4   954  ?    ?   ?   A . n 
A 1 5   TRP 5   955  ?    ?   ?   A . n 
A 1 6   SER 6   956  ?    ?   ?   A . n 
A 1 7   ALA 7   957  ?    ?   ?   A . n 
A 1 8   LEU 8   958  ?    ?   ?   A . n 
A 1 9   GLN 9   959  ?    ?   ?   A . n 
A 1 10  MET 10  960  ?    ?   ?   A . n 
A 1 11  SER 11  961  ?    ?   ?   A . n 
A 1 12  LYS 12  962  ?    ?   ?   A . n 
A 1 13  ALA 13  963  ?    ?   ?   A . n 
A 1 14  LEU 14  964  ?    ?   ?   A . n 
A 1 15  GLN 15  965  ?    ?   ?   A . n 
A 1 16  ASP 16  966  ?    ?   ?   A . n 
A 1 17  SER 17  967  ?    ?   ?   A . n 
A 1 18  ALA 18  968  ?    ?   ?   A . n 
A 1 19  PRO 19  969  ?    ?   ?   A . n 
A 1 20  ASP 20  970  ?    ?   ?   A . n 
A 1 21  ARG 21  971  ?    ?   ?   A . n 
A 1 22  PRO 22  972  ?    ?   ?   A . n 
A 1 23  SER 23  973  ?    ?   ?   A . n 
A 1 24  PRO 24  974  ?    ?   ?   A . n 
A 1 25  VAL 25  975  975  VAL VAL A . n 
A 1 26  GLU 26  976  976  GLU GLU A . n 
A 1 27  ARG 27  977  977  ARG ARG A . n 
A 1 28  ILE 28  978  978  ILE ILE A . n 
A 1 29  VAL 29  979  979  VAL VAL A . n 
A 1 30  SER 30  980  980  SER SER A . n 
A 1 31  ARG 31  981  981  ARG ARG A . n 
A 1 32  ASP 32  982  982  ASP ASP A . n 
A 1 33  ILE 33  983  983  ILE ILE A . n 
A 1 34  ALA 34  984  984  ALA ALA A . n 
A 1 35  ARG 35  985  985  ARG ARG A . n 
A 1 36  GLY 36  986  986  GLY GLY A . n 
A 1 37  TYR 37  987  987  TYR TYR A . n 
A 1 38  GLU 38  988  988  GLU GLU A . n 
A 1 39  ARG 39  989  989  ARG ARG A . n 
A 1 40  ILE 40  990  990  ILE ILE A . n 
A 1 41  PRO 41  991  991  PRO PRO A . n 
A 1 42  ILE 42  992  992  ILE ILE A . n 
A 1 43  PRO 43  993  993  PRO PRO A . n 
A 1 44  CYS 44  994  994  CYS CYS A . n 
A 1 45  VAL 45  995  995  VAL VAL A . n 
A 1 46  ASN 46  996  996  ASN ASN A . n 
A 1 47  ALA 47  997  997  ALA ALA A . n 
A 1 48  VAL 48  998  998  VAL VAL A . n 
A 1 49  ASP 49  999  999  ASP ASP A . n 
A 1 50  SER 50  1000 1000 SER SER A . n 
A 1 51  GLU 51  1001 1001 GLU GLU A . n 
A 1 52  PRO 52  1002 1002 PRO PRO A . n 
A 1 53  CYS 53  1003 1003 CYS CYS A . n 
A 1 54  PRO 54  1004 1004 PRO PRO A . n 
A 1 55  SER 55  1005 1005 SER SER A . n 
A 1 56  ASN 56  1006 1006 ASN ASN A . n 
A 1 57  TYR 57  1007 1007 TYR TYR A . n 
A 1 58  LYS 58  1008 1008 LYS LYS A . n 
A 1 59  TYR 59  1009 1009 TYR TYR A . n 
A 1 60  VAL 60  1010 1010 VAL VAL A . n 
A 1 61  SER 61  1011 1011 SER SER A . n 
A 1 62  GLN 62  1012 1012 GLN GLN A . n 
A 1 63  ASN 63  1013 1013 ASN ASN A . n 
A 1 64  CYS 64  1014 1014 CYS CYS A . n 
A 1 65  VAL 65  1015 1015 VAL VAL A . n 
A 1 66  THR 66  1016 1016 THR THR A . n 
A 1 67  SER 67  1017 1017 SER SER A . n 
A 1 68  PRO 68  1018 1018 PRO PRO A . n 
A 1 69  MET 69  1019 1019 MET MET A . n 
A 1 70  ASN 70  1020 1020 ASN ASN A . n 
A 1 71  ILE 71  1021 1021 ILE ILE A . n 
A 1 72  ASP 72  1022 1022 ASP ASP A . n 
A 1 73  ARG 73  1023 1023 ARG ARG A . n 
A 1 74  ASN 74  1024 1024 ASN ASN A . n 
A 1 75  ILE 75  1025 1025 ILE ILE A . n 
A 1 76  THR 76  1026 1026 THR THR A . n 
A 1 77  HIS 77  1027 1027 HIS HIS A . n 
A 1 78  LEU 78  1028 1028 LEU LEU A . n 
A 1 79  GLN 79  1029 1029 GLN GLN A . n 
A 1 80  TYR 80  1030 1030 TYR TYR A . n 
A 1 81  CYS 81  1031 1031 CYS CYS A . n 
A 1 82  VAL 82  1032 1032 VAL VAL A . n 
A 1 83  CYS 83  1033 1033 CYS CYS A . n 
A 1 84  ILE 84  1034 1034 ILE ILE A . n 
A 1 85  ASP 85  1035 1035 ASP ASP A . n 
A 1 86  ASP 86  1036 1036 ASP ASP A . n 
A 1 87  CYS 87  1037 1037 CYS CYS A . n 
A 1 88  SER 88  1038 1038 SER SER A . n 
A 1 89  SER 89  1039 1039 SER SER A . n 
A 1 90  SER 90  1040 1040 SER SER A . n 
A 1 91  ASN 91  1041 1041 ASN ASN A . n 
A 1 92  CYS 92  1042 1042 CYS CYS A . n 
A 1 93  MET 93  1043 1043 MET MET A . n 
A 1 94  CYS 94  1044 1044 CYS CYS A . n 
A 1 95  GLY 95  1045 1045 GLY GLY A . n 
A 1 96  GLN 96  1046 1046 GLN GLN A . n 
A 1 97  LEU 97  1047 1047 LEU LEU A . n 
A 1 98  SER 98  1048 1048 SER SER A . n 
A 1 99  MET 99  1049 1049 MET MET A . n 
A 1 100 ARG 100 1050 1050 ARG ARG A . n 
A 1 101 CYS 101 1051 1051 CYS CYS A . n 
A 1 102 TRP 102 1052 1052 TRP TRP A . n 
A 1 103 TYR 103 1053 1053 TYR TYR A . n 
A 1 104 ASP 104 1054 1054 ASP ASP A . n 
A 1 105 LYS 105 1055 1055 LYS LYS A . n 
A 1 106 ASP 106 1056 1056 ASP ASP A . n 
A 1 107 GLY 107 1057 1057 GLY GLY A . n 
A 1 108 ARG 108 1058 1058 ARG ARG A . n 
A 1 109 LEU 109 1059 1059 LEU LEU A . n 
A 1 110 LEU 110 1060 1060 LEU LEU A . n 
A 1 111 PRO 111 1061 1061 PRO PRO A . n 
A 1 112 GLU 112 1062 1062 GLU GLU A . n 
A 1 113 PHE 113 1063 1063 PHE PHE A . n 
A 1 114 ASN 114 1064 1064 ASN ASN A . n 
A 1 115 MET 115 1065 1065 MET MET A . n 
A 1 116 ALA 116 1066 1066 ALA ALA A . n 
A 1 117 GLU 117 1067 1067 GLU GLU A . n 
A 1 118 PRO 118 1068 1068 PRO PRO A . n 
A 1 119 PRO 119 1069 1069 PRO PRO A . n 
A 1 120 LEU 120 1070 1070 LEU LEU A . n 
A 1 121 ILE 121 1071 1071 ILE ILE A . n 
A 1 122 PHE 122 1072 1072 PHE PHE A . n 
A 1 123 GLU 123 1073 1073 GLU GLU A . n 
A 1 124 CYS 124 1074 1074 CYS CYS A . n 
A 1 125 ASN 125 1075 1075 ASN ASN A . n 
A 1 126 HIS 126 1076 1076 HIS HIS A . n 
A 1 127 ALA 127 1077 1077 ALA ALA A . n 
A 1 128 CYS 128 1078 1078 CYS CYS A . n 
A 1 129 SER 129 1079 1079 SER SER A . n 
A 1 130 CYS 130 1080 1080 CYS CYS A . n 
A 1 131 TRP 131 1081 1081 TRP TRP A . n 
A 1 132 ARG 132 1082 1082 ARG ARG A . n 
A 1 133 ASN 133 1083 1083 ASN ASN A . n 
A 1 134 CYS 134 1084 1084 CYS CYS A . n 
A 1 135 ARG 135 1085 1085 ARG ARG A . n 
A 1 136 ASN 136 1086 1086 ASN ASN A . n 
A 1 137 ARG 137 1087 1087 ARG ARG A . n 
A 1 138 VAL 138 1088 1088 VAL VAL A . n 
A 1 139 VAL 139 1089 1089 VAL VAL A . n 
A 1 140 GLN 140 1090 1090 GLN GLN A . n 
A 1 141 ASN 141 1091 1091 ASN ASN A . n 
A 1 142 GLY 142 1092 1092 GLY GLY A . n 
A 1 143 LEU 143 1093 1093 LEU LEU A . n 
A 1 144 ARG 144 1094 1094 ARG ARG A . n 
A 1 145 ALA 145 1095 1095 ALA ALA A . n 
A 1 146 ARG 146 1096 1096 ARG ARG A . n 
A 1 147 LEU 147 1097 1097 LEU LEU A . n 
A 1 148 GLN 148 1098 1098 GLN GLN A . n 
A 1 149 LEU 149 1099 1099 LEU LEU A . n 
A 1 150 TYR 150 1100 1100 TYR TYR A . n 
A 1 151 ARG 151 1101 1101 ARG ARG A . n 
A 1 152 THR 152 1102 1102 THR THR A . n 
A 1 153 ARG 153 1103 1103 ARG ARG A . n 
A 1 154 ASP 154 1104 1104 ASP ASP A . n 
A 1 155 MET 155 1105 1105 MET MET A . n 
A 1 156 GLY 156 1106 1106 GLY GLY A . n 
A 1 157 TRP 157 1107 1107 TRP TRP A . n 
A 1 158 GLY 158 1108 1108 GLY GLY A . n 
A 1 159 VAL 159 1109 1109 VAL VAL A . n 
A 1 160 ARG 160 1110 1110 ARG ARG A . n 
A 1 161 SER 161 1111 1111 SER SER A . n 
A 1 162 LEU 162 1112 1112 LEU LEU A . n 
A 1 163 GLN 163 1113 1113 GLN GLN A . n 
A 1 164 ASP 164 1114 1114 ASP ASP A . n 
A 1 165 ILE 165 1115 1115 ILE ILE A . n 
A 1 166 PRO 166 1116 1116 PRO PRO A . n 
A 1 167 PRO 167 1117 1117 PRO PRO A . n 
A 1 168 GLY 168 1118 1118 GLY GLY A . n 
A 1 169 THR 169 1119 1119 THR THR A . n 
A 1 170 PHE 170 1120 1120 PHE PHE A . n 
A 1 171 VAL 171 1121 1121 VAL VAL A . n 
A 1 172 CYS 172 1122 1122 CYS CYS A . n 
A 1 173 GLU 173 1123 1123 GLU GLU A . n 
A 1 174 TYR 174 1124 1124 TYR TYR A . n 
A 1 175 VAL 175 1125 1125 VAL VAL A . n 
A 1 176 GLY 176 1126 1126 GLY GLY A . n 
A 1 177 GLU 177 1127 1127 GLU GLU A . n 
A 1 178 LEU 178 1128 1128 LEU LEU A . n 
A 1 179 ILE 179 1129 1129 ILE ILE A . n 
A 1 180 SER 180 1130 1130 SER SER A . n 
A 1 181 ASP 181 1131 1131 ASP ASP A . n 
A 1 182 SER 182 1132 1132 SER SER A . n 
A 1 183 GLU 183 1133 1133 GLU GLU A . n 
A 1 184 ALA 184 1134 1134 ALA ALA A . n 
A 1 185 ASP 185 1135 1135 ASP ASP A . n 
A 1 186 VAL 186 1136 1136 VAL VAL A . n 
A 1 187 ARG 187 1137 1137 ARG ARG A . n 
A 1 188 GLU 188 1138 1138 GLU GLU A . n 
A 1 189 GLU 189 1139 1139 GLU GLU A . n 
A 1 190 ASP 190 1140 1140 ASP ASP A . n 
A 1 191 SER 191 1141 1141 SER SER A . n 
A 1 192 TYR 192 1142 1142 TYR TYR A . n 
A 1 193 LEU 193 1143 1143 LEU LEU A . n 
A 1 194 PHE 194 1144 1144 PHE PHE A . n 
A 1 195 ASP 195 1145 1145 ASP ASP A . n 
A 1 196 LEU 196 1146 1146 LEU LEU A . n 
A 1 197 ASP 197 1147 1147 ASP ASP A . n 
A 1 198 ASN 198 1148 1148 ASN ASN A . n 
A 1 199 LYS 199 1149 1149 LYS LYS A . n 
A 1 200 ASP 200 1150 1150 ASP ASP A . n 
A 1 201 GLY 201 1151 1151 GLY GLY A . n 
A 1 202 GLU 202 1152 1152 GLU GLU A . n 
A 1 203 VAL 203 1153 1153 VAL VAL A . n 
A 1 204 TYR 204 1154 1154 TYR TYR A . n 
A 1 205 CYS 205 1155 1155 CYS CYS A . n 
A 1 206 ILE 206 1156 1156 ILE ILE A . n 
A 1 207 ASP 207 1157 1157 ASP ASP A . n 
A 1 208 ALA 208 1158 1158 ALA ALA A . n 
A 1 209 ARG 209 1159 1159 ARG ARG A . n 
A 1 210 PHE 210 1160 1160 PHE PHE A . n 
A 1 211 TYR 211 1161 1161 TYR TYR A . n 
A 1 212 GLY 212 1162 1162 GLY GLY A . n 
A 1 213 ASN 213 1163 1163 ASN ASN A . n 
A 1 214 VAL 214 1164 1164 VAL VAL A . n 
A 1 215 SER 215 1165 1165 SER SER A . n 
A 1 216 ARG 216 1166 1166 ARG ARG A . n 
A 1 217 PHE 217 1167 1167 PHE PHE A . n 
A 1 218 ILE 218 1168 1168 ILE ILE A . n 
A 1 219 ASN 219 1169 1169 ASN ASN A . n 
A 1 220 HIS 220 1170 1170 HIS HIS A . n 
A 1 221 HIS 221 1171 1171 HIS HIS A . n 
A 1 222 CYS 222 1172 1172 CYS CYS A . n 
A 1 223 GLU 223 1173 1173 GLU GLU A . n 
A 1 224 PRO 224 1174 1174 PRO PRO A . n 
A 1 225 ASN 225 1175 1175 ASN ASN A . n 
A 1 226 LEU 226 1176 1176 LEU LEU A . n 
A 1 227 VAL 227 1177 1177 VAL VAL A . n 
A 1 228 PRO 228 1178 1178 PRO PRO A . n 
A 1 229 VAL 229 1179 1179 VAL VAL A . n 
A 1 230 ARG 230 1180 1180 ARG ARG A . n 
A 1 231 VAL 231 1181 1181 VAL VAL A . n 
A 1 232 PHE 232 1182 1182 PHE PHE A . n 
A 1 233 MET 233 1183 1183 MET MET A . n 
A 1 234 ALA 234 1184 1184 ALA ALA A . n 
A 1 235 HIS 235 1185 1185 HIS HIS A . n 
A 1 236 GLN 236 1186 1186 GLN GLN A . n 
A 1 237 ASP 237 1187 1187 ASP ASP A . n 
A 1 238 LEU 238 1188 1188 LEU LEU A . n 
A 1 239 ARG 239 1189 1189 ARG ARG A . n 
A 1 240 PHE 240 1190 1190 PHE PHE A . n 
A 1 241 PRO 241 1191 1191 PRO PRO A . n 
A 1 242 ARG 242 1192 1192 ARG ARG A . n 
A 1 243 ILE 243 1193 1193 ILE ILE A . n 
A 1 244 ALA 244 1194 1194 ALA ALA A . n 
A 1 245 PHE 245 1195 1195 PHE PHE A . n 
A 1 246 PHE 246 1196 1196 PHE PHE A . n 
A 1 247 SER 247 1197 1197 SER SER A . n 
A 1 248 THR 248 1198 1198 THR THR A . n 
A 1 249 ARG 249 1199 1199 ARG ARG A . n 
A 1 250 LEU 250 1200 1200 LEU LEU A . n 
A 1 251 ILE 251 1201 1201 ILE ILE A . n 
A 1 252 GLU 252 1202 1202 GLU GLU A . n 
A 1 253 ALA 253 1203 1203 ALA ALA A . n 
A 1 254 GLY 254 1204 1204 GLY GLY A . n 
A 1 255 GLU 255 1205 1205 GLU GLU A . n 
A 1 256 GLN 256 1206 1206 GLN GLN A . n 
A 1 257 LEU 257 1207 1207 LEU LEU A . n 
A 1 258 GLY 258 1208 1208 GLY GLY A . n 
A 1 259 PHE 259 1209 1209 PHE PHE A . n 
A 1 260 ASP 260 1210 1210 ASP ASP A . n 
A 1 261 TYR 261 1211 1211 TYR TYR A . n 
A 1 262 GLY 262 1212 1212 GLY GLY A . n 
A 1 263 GLU 263 1213 1213 GLU GLU A . n 
A 1 264 ARG 264 1214 1214 ARG ARG A . n 
A 1 265 PHE 265 1215 1215 PHE PHE A . n 
A 1 266 TRP 266 1216 1216 TRP TRP A . n 
A 1 267 ASP 267 1217 1217 ASP ASP A . n 
A 1 268 ILE 268 1218 1218 ILE ILE A . n 
A 1 269 LYS 269 1219 1219 LYS LYS A . n 
A 1 270 GLY 270 1220 1220 GLY GLY A . n 
A 1 271 LYS 271 1221 1221 LYS LYS A . n 
A 1 272 LEU 272 1222 1222 LEU LEU A . n 
A 1 273 PHE 273 1223 1223 PHE PHE A . n 
A 1 274 SER 274 1224 1224 SER SER A . n 
A 1 275 CYS 275 1225 1225 CYS CYS A . n 
A 1 276 ARG 276 1226 1226 ARG ARG A . n 
A 1 277 CYS 277 1227 1227 CYS CYS A . n 
A 1 278 GLY 278 1228 1228 GLY GLY A . n 
A 1 279 SER 279 1229 1229 SER SER A . n 
A 1 280 PRO 280 1230 1230 PRO PRO A . n 
A 1 281 LYS 281 1231 1231 LYS LYS A . n 
A 1 282 CYS 282 1232 1232 CYS CYS A . n 
A 1 283 ARG 283 1233 1233 ARG ARG A . n 
A 1 284 HIS 284 1234 1234 HIS HIS A . n 
A 1 285 SER 285 1235 1235 SER SER A . n 
B 1 1   ASN 1   951  ?    ?   ?   B . n 
B 1 2   SER 2   952  ?    ?   ?   B . n 
B 1 3   GLN 3   953  ?    ?   ?   B . n 
B 1 4   VAL 4   954  ?    ?   ?   B . n 
B 1 5   TRP 5   955  ?    ?   ?   B . n 
B 1 6   SER 6   956  ?    ?   ?   B . n 
B 1 7   ALA 7   957  ?    ?   ?   B . n 
B 1 8   LEU 8   958  ?    ?   ?   B . n 
B 1 9   GLN 9   959  ?    ?   ?   B . n 
B 1 10  MET 10  960  ?    ?   ?   B . n 
B 1 11  SER 11  961  ?    ?   ?   B . n 
B 1 12  LYS 12  962  ?    ?   ?   B . n 
B 1 13  ALA 13  963  ?    ?   ?   B . n 
B 1 14  LEU 14  964  ?    ?   ?   B . n 
B 1 15  GLN 15  965  ?    ?   ?   B . n 
B 1 16  ASP 16  966  ?    ?   ?   B . n 
B 1 17  SER 17  967  ?    ?   ?   B . n 
B 1 18  ALA 18  968  ?    ?   ?   B . n 
B 1 19  PRO 19  969  ?    ?   ?   B . n 
B 1 20  ASP 20  970  ?    ?   ?   B . n 
B 1 21  ARG 21  971  ?    ?   ?   B . n 
B 1 22  PRO 22  972  ?    ?   ?   B . n 
B 1 23  SER 23  973  ?    ?   ?   B . n 
B 1 24  PRO 24  974  ?    ?   ?   B . n 
B 1 25  VAL 25  975  ?    ?   ?   B . n 
B 1 26  GLU 26  976  ?    ?   ?   B . n 
B 1 27  ARG 27  977  ?    ?   ?   B . n 
B 1 28  ILE 28  978  978  ILE ILE B . n 
B 1 29  VAL 29  979  979  VAL VAL B . n 
B 1 30  SER 30  980  980  SER SER B . n 
B 1 31  ARG 31  981  981  ARG ARG B . n 
B 1 32  ASP 32  982  982  ASP ASP B . n 
B 1 33  ILE 33  983  983  ILE ILE B . n 
B 1 34  ALA 34  984  984  ALA ALA B . n 
B 1 35  ARG 35  985  985  ARG ARG B . n 
B 1 36  GLY 36  986  986  GLY GLY B . n 
B 1 37  TYR 37  987  987  TYR TYR B . n 
B 1 38  GLU 38  988  988  GLU GLU B . n 
B 1 39  ARG 39  989  989  ARG ARG B . n 
B 1 40  ILE 40  990  990  ILE ILE B . n 
B 1 41  PRO 41  991  991  PRO PRO B . n 
B 1 42  ILE 42  992  992  ILE ILE B . n 
B 1 43  PRO 43  993  993  PRO PRO B . n 
B 1 44  CYS 44  994  994  CYS CYS B . n 
B 1 45  VAL 45  995  995  VAL VAL B . n 
B 1 46  ASN 46  996  996  ASN ASN B . n 
B 1 47  ALA 47  997  997  ALA ALA B . n 
B 1 48  VAL 48  998  998  VAL VAL B . n 
B 1 49  ASP 49  999  999  ASP ASP B . n 
B 1 50  SER 50  1000 1000 SER SER B . n 
B 1 51  GLU 51  1001 1001 GLU GLU B . n 
B 1 52  PRO 52  1002 1002 PRO PRO B . n 
B 1 53  CYS 53  1003 1003 CYS CYS B . n 
B 1 54  PRO 54  1004 1004 PRO PRO B . n 
B 1 55  SER 55  1005 1005 SER SER B . n 
B 1 56  ASN 56  1006 1006 ASN ASN B . n 
B 1 57  TYR 57  1007 1007 TYR TYR B . n 
B 1 58  LYS 58  1008 1008 LYS LYS B . n 
B 1 59  TYR 59  1009 1009 TYR TYR B . n 
B 1 60  VAL 60  1010 1010 VAL VAL B . n 
B 1 61  SER 61  1011 1011 SER SER B . n 
B 1 62  GLN 62  1012 1012 GLN GLN B . n 
B 1 63  ASN 63  1013 1013 ASN ASN B . n 
B 1 64  CYS 64  1014 1014 CYS CYS B . n 
B 1 65  VAL 65  1015 1015 VAL VAL B . n 
B 1 66  THR 66  1016 1016 THR THR B . n 
B 1 67  SER 67  1017 1017 SER SER B . n 
B 1 68  PRO 68  1018 1018 PRO PRO B . n 
B 1 69  MET 69  1019 1019 MET MET B . n 
B 1 70  ASN 70  1020 1020 ASN ASN B . n 
B 1 71  ILE 71  1021 1021 ILE ILE B . n 
B 1 72  ASP 72  1022 1022 ASP ASP B . n 
B 1 73  ARG 73  1023 1023 ARG ARG B . n 
B 1 74  ASN 74  1024 1024 ASN ASN B . n 
B 1 75  ILE 75  1025 1025 ILE ILE B . n 
B 1 76  THR 76  1026 1026 THR THR B . n 
B 1 77  HIS 77  1027 1027 HIS HIS B . n 
B 1 78  LEU 78  1028 1028 LEU LEU B . n 
B 1 79  GLN 79  1029 1029 GLN GLN B . n 
B 1 80  TYR 80  1030 1030 TYR TYR B . n 
B 1 81  CYS 81  1031 1031 CYS CYS B . n 
B 1 82  VAL 82  1032 1032 VAL VAL B . n 
B 1 83  CYS 83  1033 1033 CYS CYS B . n 
B 1 84  ILE 84  1034 1034 ILE ILE B . n 
B 1 85  ASP 85  1035 1035 ASP ASP B . n 
B 1 86  ASP 86  1036 1036 ASP ASP B . n 
B 1 87  CYS 87  1037 1037 CYS CYS B . n 
B 1 88  SER 88  1038 1038 SER SER B . n 
B 1 89  SER 89  1039 1039 SER SER B . n 
B 1 90  SER 90  1040 1040 SER SER B . n 
B 1 91  ASN 91  1041 1041 ASN ASN B . n 
B 1 92  CYS 92  1042 1042 CYS CYS B . n 
B 1 93  MET 93  1043 1043 MET MET B . n 
B 1 94  CYS 94  1044 1044 CYS CYS B . n 
B 1 95  GLY 95  1045 1045 GLY GLY B . n 
B 1 96  GLN 96  1046 1046 GLN GLN B . n 
B 1 97  LEU 97  1047 1047 LEU LEU B . n 
B 1 98  SER 98  1048 1048 SER SER B . n 
B 1 99  MET 99  1049 1049 MET MET B . n 
B 1 100 ARG 100 1050 1050 ARG ARG B . n 
B 1 101 CYS 101 1051 1051 CYS CYS B . n 
B 1 102 TRP 102 1052 1052 TRP TRP B . n 
B 1 103 TYR 103 1053 1053 TYR TYR B . n 
B 1 104 ASP 104 1054 1054 ASP ASP B . n 
B 1 105 LYS 105 1055 1055 LYS LYS B . n 
B 1 106 ASP 106 1056 1056 ASP ASP B . n 
B 1 107 GLY 107 1057 1057 GLY GLY B . n 
B 1 108 ARG 108 1058 1058 ARG ARG B . n 
B 1 109 LEU 109 1059 1059 LEU LEU B . n 
B 1 110 LEU 110 1060 1060 LEU LEU B . n 
B 1 111 PRO 111 1061 1061 PRO PRO B . n 
B 1 112 GLU 112 1062 1062 GLU GLU B . n 
B 1 113 PHE 113 1063 1063 PHE PHE B . n 
B 1 114 ASN 114 1064 1064 ASN ASN B . n 
B 1 115 MET 115 1065 1065 MET MET B . n 
B 1 116 ALA 116 1066 1066 ALA ALA B . n 
B 1 117 GLU 117 1067 1067 GLU GLU B . n 
B 1 118 PRO 118 1068 1068 PRO PRO B . n 
B 1 119 PRO 119 1069 1069 PRO PRO B . n 
B 1 120 LEU 120 1070 1070 LEU LEU B . n 
B 1 121 ILE 121 1071 1071 ILE ILE B . n 
B 1 122 PHE 122 1072 1072 PHE PHE B . n 
B 1 123 GLU 123 1073 1073 GLU GLU B . n 
B 1 124 CYS 124 1074 1074 CYS CYS B . n 
B 1 125 ASN 125 1075 1075 ASN ASN B . n 
B 1 126 HIS 126 1076 1076 HIS HIS B . n 
B 1 127 ALA 127 1077 1077 ALA ALA B . n 
B 1 128 CYS 128 1078 1078 CYS CYS B . n 
B 1 129 SER 129 1079 1079 SER SER B . n 
B 1 130 CYS 130 1080 1080 CYS CYS B . n 
B 1 131 TRP 131 1081 1081 TRP TRP B . n 
B 1 132 ARG 132 1082 1082 ARG ARG B . n 
B 1 133 ASN 133 1083 1083 ASN ASN B . n 
B 1 134 CYS 134 1084 1084 CYS CYS B . n 
B 1 135 ARG 135 1085 1085 ARG ARG B . n 
B 1 136 ASN 136 1086 1086 ASN ASN B . n 
B 1 137 ARG 137 1087 1087 ARG ARG B . n 
B 1 138 VAL 138 1088 1088 VAL VAL B . n 
B 1 139 VAL 139 1089 1089 VAL VAL B . n 
B 1 140 GLN 140 1090 1090 GLN GLN B . n 
B 1 141 ASN 141 1091 1091 ASN ASN B . n 
B 1 142 GLY 142 1092 1092 GLY GLY B . n 
B 1 143 LEU 143 1093 1093 LEU LEU B . n 
B 1 144 ARG 144 1094 1094 ARG ARG B . n 
B 1 145 ALA 145 1095 1095 ALA ALA B . n 
B 1 146 ARG 146 1096 1096 ARG ARG B . n 
B 1 147 LEU 147 1097 1097 LEU LEU B . n 
B 1 148 GLN 148 1098 1098 GLN GLN B . n 
B 1 149 LEU 149 1099 1099 LEU LEU B . n 
B 1 150 TYR 150 1100 1100 TYR TYR B . n 
B 1 151 ARG 151 1101 1101 ARG ARG B . n 
B 1 152 THR 152 1102 1102 THR THR B . n 
B 1 153 ARG 153 1103 1103 ARG ARG B . n 
B 1 154 ASP 154 1104 1104 ASP ASP B . n 
B 1 155 MET 155 1105 1105 MET MET B . n 
B 1 156 GLY 156 1106 1106 GLY GLY B . n 
B 1 157 TRP 157 1107 1107 TRP TRP B . n 
B 1 158 GLY 158 1108 1108 GLY GLY B . n 
B 1 159 VAL 159 1109 1109 VAL VAL B . n 
B 1 160 ARG 160 1110 1110 ARG ARG B . n 
B 1 161 SER 161 1111 1111 SER SER B . n 
B 1 162 LEU 162 1112 1112 LEU LEU B . n 
B 1 163 GLN 163 1113 1113 GLN GLN B . n 
B 1 164 ASP 164 1114 1114 ASP ASP B . n 
B 1 165 ILE 165 1115 1115 ILE ILE B . n 
B 1 166 PRO 166 1116 1116 PRO PRO B . n 
B 1 167 PRO 167 1117 1117 PRO PRO B . n 
B 1 168 GLY 168 1118 1118 GLY GLY B . n 
B 1 169 THR 169 1119 1119 THR THR B . n 
B 1 170 PHE 170 1120 1120 PHE PHE B . n 
B 1 171 VAL 171 1121 1121 VAL VAL B . n 
B 1 172 CYS 172 1122 1122 CYS CYS B . n 
B 1 173 GLU 173 1123 1123 GLU GLU B . n 
B 1 174 TYR 174 1124 1124 TYR TYR B . n 
B 1 175 VAL 175 1125 1125 VAL VAL B . n 
B 1 176 GLY 176 1126 1126 GLY GLY B . n 
B 1 177 GLU 177 1127 1127 GLU GLU B . n 
B 1 178 LEU 178 1128 1128 LEU LEU B . n 
B 1 179 ILE 179 1129 1129 ILE ILE B . n 
B 1 180 SER 180 1130 1130 SER SER B . n 
B 1 181 ASP 181 1131 1131 ASP ASP B . n 
B 1 182 SER 182 1132 1132 SER SER B . n 
B 1 183 GLU 183 1133 1133 GLU GLU B . n 
B 1 184 ALA 184 1134 1134 ALA ALA B . n 
B 1 185 ASP 185 1135 1135 ASP ASP B . n 
B 1 186 VAL 186 1136 1136 VAL VAL B . n 
B 1 187 ARG 187 1137 1137 ARG ARG B . n 
B 1 188 GLU 188 1138 1138 GLU GLU B . n 
B 1 189 GLU 189 1139 1139 GLU GLU B . n 
B 1 190 ASP 190 1140 1140 ASP ASP B . n 
B 1 191 SER 191 1141 1141 SER SER B . n 
B 1 192 TYR 192 1142 1142 TYR TYR B . n 
B 1 193 LEU 193 1143 1143 LEU LEU B . n 
B 1 194 PHE 194 1144 1144 PHE PHE B . n 
B 1 195 ASP 195 1145 1145 ASP ASP B . n 
B 1 196 LEU 196 1146 1146 LEU LEU B . n 
B 1 197 ASP 197 1147 ?    ?   ?   B . n 
B 1 198 ASN 198 1148 ?    ?   ?   B . n 
B 1 199 LYS 199 1149 ?    ?   ?   B . n 
B 1 200 ASP 200 1150 ?    ?   ?   B . n 
B 1 201 GLY 201 1151 ?    ?   ?   B . n 
B 1 202 GLU 202 1152 ?    ?   ?   B . n 
B 1 203 VAL 203 1153 1153 VAL VAL B . n 
B 1 204 TYR 204 1154 1154 TYR TYR B . n 
B 1 205 CYS 205 1155 1155 CYS CYS B . n 
B 1 206 ILE 206 1156 1156 ILE ILE B . n 
B 1 207 ASP 207 1157 1157 ASP ASP B . n 
B 1 208 ALA 208 1158 1158 ALA ALA B . n 
B 1 209 ARG 209 1159 1159 ARG ARG B . n 
B 1 210 PHE 210 1160 1160 PHE PHE B . n 
B 1 211 TYR 211 1161 1161 TYR TYR B . n 
B 1 212 GLY 212 1162 1162 GLY GLY B . n 
B 1 213 ASN 213 1163 1163 ASN ASN B . n 
B 1 214 VAL 214 1164 1164 VAL VAL B . n 
B 1 215 SER 215 1165 1165 SER SER B . n 
B 1 216 ARG 216 1166 1166 ARG ARG B . n 
B 1 217 PHE 217 1167 1167 PHE PHE B . n 
B 1 218 ILE 218 1168 1168 ILE ILE B . n 
B 1 219 ASN 219 1169 1169 ASN ASN B . n 
B 1 220 HIS 220 1170 1170 HIS HIS B . n 
B 1 221 HIS 221 1171 1171 HIS HIS B . n 
B 1 222 CYS 222 1172 1172 CYS CYS B . n 
B 1 223 GLU 223 1173 1173 GLU GLU B . n 
B 1 224 PRO 224 1174 1174 PRO PRO B . n 
B 1 225 ASN 225 1175 1175 ASN ASN B . n 
B 1 226 LEU 226 1176 1176 LEU LEU B . n 
B 1 227 VAL 227 1177 1177 VAL VAL B . n 
B 1 228 PRO 228 1178 1178 PRO PRO B . n 
B 1 229 VAL 229 1179 1179 VAL VAL B . n 
B 1 230 ARG 230 1180 1180 ARG ARG B . n 
B 1 231 VAL 231 1181 1181 VAL VAL B . n 
B 1 232 PHE 232 1182 1182 PHE PHE B . n 
B 1 233 MET 233 1183 1183 MET MET B . n 
B 1 234 ALA 234 1184 1184 ALA ALA B . n 
B 1 235 HIS 235 1185 1185 HIS HIS B . n 
B 1 236 GLN 236 1186 1186 GLN GLN B . n 
B 1 237 ASP 237 1187 1187 ASP ASP B . n 
B 1 238 LEU 238 1188 1188 LEU LEU B . n 
B 1 239 ARG 239 1189 1189 ARG ARG B . n 
B 1 240 PHE 240 1190 1190 PHE PHE B . n 
B 1 241 PRO 241 1191 1191 PRO PRO B . n 
B 1 242 ARG 242 1192 1192 ARG ARG B . n 
B 1 243 ILE 243 1193 1193 ILE ILE B . n 
B 1 244 ALA 244 1194 1194 ALA ALA B . n 
B 1 245 PHE 245 1195 1195 PHE PHE B . n 
B 1 246 PHE 246 1196 1196 PHE PHE B . n 
B 1 247 SER 247 1197 1197 SER SER B . n 
B 1 248 THR 248 1198 1198 THR THR B . n 
B 1 249 ARG 249 1199 1199 ARG ARG B . n 
B 1 250 LEU 250 1200 1200 LEU LEU B . n 
B 1 251 ILE 251 1201 1201 ILE ILE B . n 
B 1 252 GLU 252 1202 1202 GLU GLU B . n 
B 1 253 ALA 253 1203 1203 ALA ALA B . n 
B 1 254 GLY 254 1204 1204 GLY GLY B . n 
B 1 255 GLU 255 1205 1205 GLU GLU B . n 
B 1 256 GLN 256 1206 1206 GLN GLN B . n 
B 1 257 LEU 257 1207 1207 LEU LEU B . n 
B 1 258 GLY 258 1208 1208 GLY GLY B . n 
B 1 259 PHE 259 1209 1209 PHE PHE B . n 
B 1 260 ASP 260 1210 1210 ASP ASP B . n 
B 1 261 TYR 261 1211 1211 TYR TYR B . n 
B 1 262 GLY 262 1212 1212 GLY GLY B . n 
B 1 263 GLU 263 1213 1213 GLU GLU B . n 
B 1 264 ARG 264 1214 1214 ARG ARG B . n 
B 1 265 PHE 265 1215 1215 PHE PHE B . n 
B 1 266 TRP 266 1216 1216 TRP TRP B . n 
B 1 267 ASP 267 1217 1217 ASP ASP B . n 
B 1 268 ILE 268 1218 1218 ILE ILE B . n 
B 1 269 LYS 269 1219 1219 LYS LYS B . n 
B 1 270 GLY 270 1220 1220 GLY GLY B . n 
B 1 271 LYS 271 1221 1221 LYS LYS B . n 
B 1 272 LEU 272 1222 1222 LEU LEU B . n 
B 1 273 PHE 273 1223 1223 PHE PHE B . n 
B 1 274 SER 274 1224 1224 SER SER B . n 
B 1 275 CYS 275 1225 1225 CYS CYS B . n 
B 1 276 ARG 276 1226 1226 ARG ARG B . n 
B 1 277 CYS 277 1227 1227 CYS CYS B . n 
B 1 278 GLY 278 1228 1228 GLY GLY B . n 
B 1 279 SER 279 1229 1229 SER SER B . n 
B 1 280 PRO 280 1230 1230 PRO PRO B . n 
B 1 281 LYS 281 1231 1231 LYS LYS B . n 
B 1 282 CYS 282 1232 1232 CYS CYS B . n 
B 1 283 ARG 283 1233 1233 ARG ARG B . n 
B 1 284 HIS 284 1234 1234 HIS HIS B . n 
B 1 285 SER 285 1235 1235 SER SER B . n 
C 2 1   THR 1   1    ?    ?   ?   P . n 
C 2 2   LYS 2   2    2    LYS LYS P . n 
C 2 3   GLN 3   3    3    GLN GLN P . n 
C 2 4   THR 4   4    4    THR THR P . n 
C 2 5   ALA 5   5    5    ALA ALA P . n 
C 2 6   ARG 6   6    6    ARG ARG P . n 
C 2 7   MLY 7   7    7    MLY MLY P . n 
C 2 8   SER 8   8    8    SER SER P . n 
C 2 9   THR 9   9    9    THR THR P . n 
C 2 10  GLY 10  10   ?    ?   ?   P . n 
C 2 11  GLY 11  11   ?    ?   ?   P . n 
D 2 1   THR 1   1    ?    ?   ?   Q . n 
D 2 2   LYS 2   2    ?    ?   ?   Q . n 
D 2 3   GLN 3   3    ?    ?   ?   Q . n 
D 2 4   THR 4   4    4    THR THR Q . n 
D 2 5   ALA 5   5    5    ALA ALA Q . n 
D 2 6   ARG 6   6    6    ARG ARG Q . n 
D 2 7   MLY 7   7    7    MLY MLY Q . n 
D 2 8   SER 8   8    8    SER SER Q . n 
D 2 9   THR 9   9    9    THR THR Q . n 
D 2 10  GLY 10  10   ?    ?   ?   Q . n 
D 2 11  GLY 11  11   ?    ?   ?   Q . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 ZN  1   501  501  ZN  ZN  A . 
F 3 ZN  1   502  502  ZN  ZN  A . 
G 3 ZN  1   503  503  ZN  ZN  A . 
H 3 ZN  1   504  504  ZN  ZN  A . 
I 4 SAH 1   101  101  SAH SAH A . 
J 4 SAH 1   102  102  SAH SAH A . 
K 3 ZN  1   501  501  ZN  ZN  B . 
L 3 ZN  1   502  502  ZN  ZN  B . 
M 3 ZN  1   503  503  ZN  ZN  B . 
N 3 ZN  1   504  504  ZN  ZN  B . 
O 5 HOH 1   1236 1236 HOH HOH A . 
O 5 HOH 2   1237 1237 HOH HOH A . 
O 5 HOH 3   1238 1238 HOH HOH A . 
O 5 HOH 4   1239 1239 HOH HOH A . 
O 5 HOH 5   1240 1240 HOH HOH A . 
O 5 HOH 6   1241 1241 HOH HOH A . 
O 5 HOH 7   1242 1242 HOH HOH A . 
O 5 HOH 8   1243 1243 HOH HOH A . 
O 5 HOH 9   1244 1244 HOH HOH A . 
O 5 HOH 10  1245 1245 HOH HOH A . 
O 5 HOH 11  1246 1246 HOH HOH A . 
O 5 HOH 12  1247 1247 HOH HOH A . 
O 5 HOH 13  1248 1248 HOH HOH A . 
O 5 HOH 14  1249 1249 HOH HOH A . 
O 5 HOH 15  1250 1250 HOH HOH A . 
O 5 HOH 16  1251 1251 HOH HOH A . 
O 5 HOH 17  1252 1252 HOH HOH A . 
O 5 HOH 18  1253 1253 HOH HOH A . 
O 5 HOH 19  1254 1254 HOH HOH A . 
O 5 HOH 20  1255 1255 HOH HOH A . 
O 5 HOH 21  1256 1256 HOH HOH A . 
O 5 HOH 22  1257 1257 HOH HOH A . 
O 5 HOH 23  1258 1258 HOH HOH A . 
O 5 HOH 24  1259 1259 HOH HOH A . 
O 5 HOH 25  1260 1260 HOH HOH A . 
O 5 HOH 26  1261 1261 HOH HOH A . 
O 5 HOH 27  1262 1262 HOH HOH A . 
O 5 HOH 28  1263 1263 HOH HOH A . 
O 5 HOH 29  1264 1264 HOH HOH A . 
O 5 HOH 30  1265 1265 HOH HOH A . 
O 5 HOH 31  1266 1266 HOH HOH A . 
O 5 HOH 32  1267 1267 HOH HOH A . 
O 5 HOH 33  1268 1268 HOH HOH A . 
O 5 HOH 34  1269 1269 HOH HOH A . 
O 5 HOH 35  1270 1270 HOH HOH A . 
O 5 HOH 36  1271 1271 HOH HOH A . 
O 5 HOH 37  1272 1272 HOH HOH A . 
O 5 HOH 38  1273 1273 HOH HOH A . 
O 5 HOH 39  1274 1274 HOH HOH A . 
O 5 HOH 40  1275 1275 HOH HOH A . 
O 5 HOH 41  1276 1276 HOH HOH A . 
O 5 HOH 42  1277 1277 HOH HOH A . 
O 5 HOH 43  1278 1278 HOH HOH A . 
O 5 HOH 44  1279 1279 HOH HOH A . 
O 5 HOH 45  1280 1280 HOH HOH A . 
O 5 HOH 46  1281 1281 HOH HOH A . 
O 5 HOH 47  1282 1282 HOH HOH A . 
O 5 HOH 48  1283 1283 HOH HOH A . 
O 5 HOH 49  1284 1284 HOH HOH A . 
O 5 HOH 50  1285 1285 HOH HOH A . 
O 5 HOH 51  1286 1286 HOH HOH A . 
O 5 HOH 52  1287 1287 HOH HOH A . 
O 5 HOH 53  1288 1288 HOH HOH A . 
O 5 HOH 54  1289 1289 HOH HOH A . 
O 5 HOH 55  1290 1290 HOH HOH A . 
O 5 HOH 56  1291 1291 HOH HOH A . 
O 5 HOH 57  1292 1292 HOH HOH A . 
O 5 HOH 58  1293 1293 HOH HOH A . 
O 5 HOH 59  1294 1294 HOH HOH A . 
O 5 HOH 60  1295 1295 HOH HOH A . 
O 5 HOH 61  1296 1296 HOH HOH A . 
O 5 HOH 62  1297 1297 HOH HOH A . 
O 5 HOH 63  1298 1298 HOH HOH A . 
O 5 HOH 64  1299 1299 HOH HOH A . 
O 5 HOH 65  1300 1300 HOH HOH A . 
O 5 HOH 66  1301 1301 HOH HOH A . 
O 5 HOH 67  1302 1302 HOH HOH A . 
O 5 HOH 68  1303 1303 HOH HOH A . 
O 5 HOH 69  1304 1304 HOH HOH A . 
O 5 HOH 70  1305 1305 HOH HOH A . 
O 5 HOH 71  1306 1306 HOH HOH A . 
O 5 HOH 72  1307 1307 HOH HOH A . 
O 5 HOH 73  1308 1308 HOH HOH A . 
O 5 HOH 74  1309 1309 HOH HOH A . 
O 5 HOH 75  1310 1310 HOH HOH A . 
O 5 HOH 76  1311 1311 HOH HOH A . 
O 5 HOH 77  1312 1312 HOH HOH A . 
O 5 HOH 78  1313 1313 HOH HOH A . 
O 5 HOH 79  1314 1314 HOH HOH A . 
O 5 HOH 80  1315 1315 HOH HOH A . 
O 5 HOH 81  1316 1316 HOH HOH A . 
O 5 HOH 82  1317 1317 HOH HOH A . 
O 5 HOH 83  1318 1318 HOH HOH A . 
O 5 HOH 84  1319 1319 HOH HOH A . 
O 5 HOH 85  1320 1320 HOH HOH A . 
O 5 HOH 86  1321 1321 HOH HOH A . 
O 5 HOH 87  1322 1322 HOH HOH A . 
O 5 HOH 88  1323 1323 HOH HOH A . 
O 5 HOH 89  1324 1324 HOH HOH A . 
O 5 HOH 90  1325 1325 HOH HOH A . 
O 5 HOH 91  1326 1326 HOH HOH A . 
O 5 HOH 92  1327 1327 HOH HOH A . 
O 5 HOH 93  1328 1328 HOH HOH A . 
O 5 HOH 94  1329 1329 HOH HOH A . 
O 5 HOH 95  1330 1330 HOH HOH A . 
O 5 HOH 96  1331 1331 HOH HOH A . 
O 5 HOH 97  1332 1332 HOH HOH A . 
O 5 HOH 98  1333 1333 HOH HOH A . 
O 5 HOH 99  1334 1334 HOH HOH A . 
O 5 HOH 100 1335 1335 HOH HOH A . 
O 5 HOH 101 1336 1336 HOH HOH A . 
O 5 HOH 102 1337 1337 HOH HOH A . 
O 5 HOH 103 1338 1338 HOH HOH A . 
O 5 HOH 104 1339 1339 HOH HOH A . 
O 5 HOH 105 1340 1340 HOH HOH A . 
O 5 HOH 106 1341 1341 HOH HOH A . 
O 5 HOH 107 1342 1342 HOH HOH A . 
O 5 HOH 108 1343 1343 HOH HOH A . 
O 5 HOH 109 1344 1344 HOH HOH A . 
O 5 HOH 110 1345 1345 HOH HOH A . 
O 5 HOH 111 1346 1346 HOH HOH A . 
O 5 HOH 112 1347 1347 HOH HOH A . 
O 5 HOH 113 1348 1348 HOH HOH A . 
O 5 HOH 114 1349 1349 HOH HOH A . 
O 5 HOH 115 1350 1350 HOH HOH A . 
O 5 HOH 116 1351 1351 HOH HOH A . 
O 5 HOH 117 1352 1352 HOH HOH A . 
O 5 HOH 118 1353 1353 HOH HOH A . 
O 5 HOH 119 1354 1354 HOH HOH A . 
O 5 HOH 120 1355 1355 HOH HOH A . 
O 5 HOH 121 1356 1356 HOH HOH A . 
O 5 HOH 122 1357 1357 HOH HOH A . 
O 5 HOH 123 1358 1358 HOH HOH A . 
O 5 HOH 124 1359 1359 HOH HOH A . 
O 5 HOH 125 1360 1360 HOH HOH A . 
O 5 HOH 126 1361 1361 HOH HOH A . 
O 5 HOH 127 1362 1362 HOH HOH A . 
O 5 HOH 128 1363 1363 HOH HOH A . 
O 5 HOH 129 1364 1364 HOH HOH A . 
O 5 HOH 130 1365 1365 HOH HOH A . 
O 5 HOH 131 1366 1366 HOH HOH A . 
O 5 HOH 132 1367 1367 HOH HOH A . 
O 5 HOH 133 1368 1368 HOH HOH A . 
O 5 HOH 134 1369 1369 HOH HOH A . 
O 5 HOH 135 1370 1370 HOH HOH A . 
O 5 HOH 136 1371 1371 HOH HOH A . 
O 5 HOH 137 1372 1372 HOH HOH A . 
O 5 HOH 138 1373 1373 HOH HOH A . 
O 5 HOH 139 1374 1374 HOH HOH A . 
O 5 HOH 140 1375 1375 HOH HOH A . 
O 5 HOH 141 1376 1376 HOH HOH A . 
O 5 HOH 142 1377 1377 HOH HOH A . 
O 5 HOH 143 1378 1378 HOH HOH A . 
O 5 HOH 144 1379 1379 HOH HOH A . 
O 5 HOH 145 1380 1380 HOH HOH A . 
O 5 HOH 146 1381 1381 HOH HOH A . 
O 5 HOH 147 1382 1382 HOH HOH A . 
O 5 HOH 148 1383 1383 HOH HOH A . 
O 5 HOH 149 1384 1384 HOH HOH A . 
O 5 HOH 150 1385 1385 HOH HOH A . 
O 5 HOH 151 1386 1386 HOH HOH A . 
O 5 HOH 152 1387 1387 HOH HOH A . 
O 5 HOH 153 1388 1388 HOH HOH A . 
O 5 HOH 154 1389 1389 HOH HOH A . 
O 5 HOH 155 1390 1390 HOH HOH A . 
O 5 HOH 156 1391 1391 HOH HOH A . 
O 5 HOH 157 1392 1392 HOH HOH A . 
O 5 HOH 158 1393 1393 HOH HOH A . 
O 5 HOH 159 1394 1394 HOH HOH A . 
O 5 HOH 160 1395 1395 HOH HOH A . 
O 5 HOH 161 1396 1396 HOH HOH A . 
O 5 HOH 162 1397 1397 HOH HOH A . 
O 5 HOH 163 1398 1398 HOH HOH A . 
O 5 HOH 164 1399 1399 HOH HOH A . 
O 5 HOH 165 1400 1400 HOH HOH A . 
O 5 HOH 166 1401 1401 HOH HOH A . 
O 5 HOH 167 1402 1402 HOH HOH A . 
O 5 HOH 168 1403 1403 HOH HOH A . 
O 5 HOH 169 1404 1404 HOH HOH A . 
O 5 HOH 170 1405 1405 HOH HOH A . 
O 5 HOH 171 1406 1406 HOH HOH A . 
O 5 HOH 172 1407 1407 HOH HOH A . 
O 5 HOH 173 1408 1408 HOH HOH A . 
O 5 HOH 174 1409 1409 HOH HOH A . 
O 5 HOH 175 1410 1410 HOH HOH A . 
O 5 HOH 176 1411 1411 HOH HOH A . 
O 5 HOH 177 1412 1412 HOH HOH A . 
O 5 HOH 178 1413 1413 HOH HOH A . 
O 5 HOH 179 1414 1414 HOH HOH A . 
O 5 HOH 180 1415 1415 HOH HOH A . 
O 5 HOH 181 1416 1416 HOH HOH A . 
O 5 HOH 182 1417 1417 HOH HOH A . 
O 5 HOH 183 1418 1418 HOH HOH A . 
O 5 HOH 184 1419 1419 HOH HOH A . 
O 5 HOH 185 1420 1420 HOH HOH A . 
O 5 HOH 186 1421 1421 HOH HOH A . 
O 5 HOH 187 1422 1422 HOH HOH A . 
O 5 HOH 188 1423 1423 HOH HOH A . 
O 5 HOH 189 1424 1424 HOH HOH A . 
O 5 HOH 190 1425 1425 HOH HOH A . 
O 5 HOH 191 1426 1426 HOH HOH A . 
O 5 HOH 192 1427 1427 HOH HOH A . 
O 5 HOH 193 1428 1428 HOH HOH A . 
O 5 HOH 194 1429 1429 HOH HOH A . 
O 5 HOH 195 1430 1430 HOH HOH A . 
O 5 HOH 196 1431 1431 HOH HOH A . 
O 5 HOH 197 1432 1432 HOH HOH A . 
O 5 HOH 198 1433 1433 HOH HOH A . 
O 5 HOH 199 1434 1434 HOH HOH A . 
O 5 HOH 200 1435 1435 HOH HOH A . 
O 5 HOH 201 1436 1436 HOH HOH A . 
O 5 HOH 202 1437 1437 HOH HOH A . 
O 5 HOH 203 1438 1438 HOH HOH A . 
O 5 HOH 204 1439 1439 HOH HOH A . 
O 5 HOH 205 1440 1440 HOH HOH A . 
O 5 HOH 206 1441 1441 HOH HOH A . 
O 5 HOH 207 1442 1442 HOH HOH A . 
O 5 HOH 208 1443 1443 HOH HOH A . 
O 5 HOH 209 1444 1444 HOH HOH A . 
O 5 HOH 210 1445 1445 HOH HOH A . 
O 5 HOH 211 1446 1446 HOH HOH A . 
O 5 HOH 212 1447 1447 HOH HOH A . 
O 5 HOH 213 1448 1448 HOH HOH A . 
O 5 HOH 214 1449 1449 HOH HOH A . 
O 5 HOH 215 1450 1450 HOH HOH A . 
O 5 HOH 216 1451 1451 HOH HOH A . 
O 5 HOH 217 1452 1452 HOH HOH A . 
O 5 HOH 218 1453 1453 HOH HOH A . 
O 5 HOH 219 1454 1454 HOH HOH A . 
O 5 HOH 220 1455 1455 HOH HOH A . 
O 5 HOH 221 1456 1456 HOH HOH A . 
O 5 HOH 222 1457 1457 HOH HOH A . 
O 5 HOH 223 1458 1458 HOH HOH A . 
O 5 HOH 224 1459 1459 HOH HOH A . 
O 5 HOH 225 1460 1460 HOH HOH A . 
O 5 HOH 226 1461 1461 HOH HOH A . 
O 5 HOH 227 1462 1462 HOH HOH A . 
O 5 HOH 228 1463 1463 HOH HOH A . 
O 5 HOH 229 1464 1464 HOH HOH A . 
O 5 HOH 230 1465 1465 HOH HOH A . 
O 5 HOH 231 1466 1466 HOH HOH A . 
O 5 HOH 232 1467 1467 HOH HOH A . 
O 5 HOH 233 1468 1468 HOH HOH A . 
O 5 HOH 234 1469 1469 HOH HOH A . 
O 5 HOH 235 1470 1470 HOH HOH A . 
O 5 HOH 236 1471 1471 HOH HOH A . 
O 5 HOH 237 1472 1472 HOH HOH A . 
O 5 HOH 238 1473 1473 HOH HOH A . 
O 5 HOH 239 1474 1474 HOH HOH A . 
O 5 HOH 240 1475 1475 HOH HOH A . 
O 5 HOH 241 1476 1476 HOH HOH A . 
O 5 HOH 242 1477 1477 HOH HOH A . 
O 5 HOH 243 1478 1478 HOH HOH A . 
O 5 HOH 244 1479 1479 HOH HOH A . 
O 5 HOH 245 1480 1480 HOH HOH A . 
O 5 HOH 246 1481 1481 HOH HOH A . 
O 5 HOH 247 1482 1482 HOH HOH A . 
O 5 HOH 248 1483 1483 HOH HOH A . 
O 5 HOH 249 1484 1484 HOH HOH A . 
O 5 HOH 250 1485 1485 HOH HOH A . 
O 5 HOH 251 1486 1486 HOH HOH A . 
O 5 HOH 252 1487 1487 HOH HOH A . 
O 5 HOH 253 1488 1488 HOH HOH A . 
O 5 HOH 254 1489 1489 HOH HOH A . 
O 5 HOH 255 1490 1490 HOH HOH A . 
O 5 HOH 256 1491 1491 HOH HOH A . 
O 5 HOH 257 1492 1492 HOH HOH A . 
O 5 HOH 258 1493 1493 HOH HOH A . 
O 5 HOH 259 1494 1494 HOH HOH A . 
O 5 HOH 260 1495 1495 HOH HOH A . 
O 5 HOH 261 1496 1496 HOH HOH A . 
O 5 HOH 262 1497 1497 HOH HOH A . 
O 5 HOH 263 1498 1498 HOH HOH A . 
O 5 HOH 264 1499 1499 HOH HOH A . 
O 5 HOH 265 1500 1500 HOH HOH A . 
O 5 HOH 266 1501 1501 HOH HOH A . 
O 5 HOH 267 1502 1502 HOH HOH A . 
O 5 HOH 268 1503 1503 HOH HOH A . 
O 5 HOH 269 1504 1504 HOH HOH A . 
O 5 HOH 270 1505 1505 HOH HOH A . 
O 5 HOH 271 1506 1506 HOH HOH A . 
O 5 HOH 272 1507 1507 HOH HOH A . 
O 5 HOH 273 1508 1508 HOH HOH A . 
O 5 HOH 274 1509 1509 HOH HOH A . 
O 5 HOH 275 1510 1510 HOH HOH A . 
O 5 HOH 276 1511 1511 HOH HOH A . 
O 5 HOH 277 1512 1512 HOH HOH A . 
O 5 HOH 278 1513 1513 HOH HOH A . 
O 5 HOH 279 1514 1514 HOH HOH A . 
O 5 HOH 280 1515 1515 HOH HOH A . 
O 5 HOH 281 1516 1516 HOH HOH A . 
O 5 HOH 282 1517 1517 HOH HOH A . 
O 5 HOH 283 1518 1518 HOH HOH A . 
O 5 HOH 284 1519 1519 HOH HOH A . 
O 5 HOH 285 1520 1520 HOH HOH A . 
O 5 HOH 286 1521 1521 HOH HOH A . 
O 5 HOH 287 1522 1522 HOH HOH A . 
O 5 HOH 288 1523 1523 HOH HOH A . 
O 5 HOH 289 1524 1524 HOH HOH A . 
O 5 HOH 290 1525 1525 HOH HOH A . 
O 5 HOH 291 1526 1526 HOH HOH A . 
O 5 HOH 292 1527 1527 HOH HOH A . 
O 5 HOH 293 1528 1528 HOH HOH A . 
O 5 HOH 294 1529 1529 HOH HOH A . 
O 5 HOH 295 1530 1530 HOH HOH A . 
O 5 HOH 296 1531 1531 HOH HOH A . 
O 5 HOH 297 1532 1532 HOH HOH A . 
O 5 HOH 298 1533 1533 HOH HOH A . 
O 5 HOH 299 1534 1534 HOH HOH A . 
O 5 HOH 300 1535 1535 HOH HOH A . 
O 5 HOH 301 1536 1536 HOH HOH A . 
O 5 HOH 302 1537 1537 HOH HOH A . 
O 5 HOH 303 1538 1538 HOH HOH A . 
O 5 HOH 304 1539 1539 HOH HOH A . 
O 5 HOH 305 1540 1540 HOH HOH A . 
O 5 HOH 306 1541 1541 HOH HOH A . 
O 5 HOH 307 1542 1542 HOH HOH A . 
O 5 HOH 308 1543 1543 HOH HOH A . 
O 5 HOH 309 1544 1544 HOH HOH A . 
O 5 HOH 310 1545 1545 HOH HOH A . 
O 5 HOH 311 1546 1546 HOH HOH A . 
O 5 HOH 312 1547 1547 HOH HOH A . 
O 5 HOH 313 1548 1548 HOH HOH A . 
O 5 HOH 314 1549 1549 HOH HOH A . 
O 5 HOH 315 1550 1550 HOH HOH A . 
O 5 HOH 316 1551 1551 HOH HOH A . 
O 5 HOH 317 1552 1552 HOH HOH A . 
O 5 HOH 318 1553 1553 HOH HOH A . 
O 5 HOH 319 1554 1554 HOH HOH A . 
O 5 HOH 320 1555 1555 HOH HOH A . 
O 5 HOH 321 1556 1556 HOH HOH A . 
O 5 HOH 322 1557 1557 HOH HOH A . 
O 5 HOH 323 1558 1558 HOH HOH A . 
O 5 HOH 324 1559 1559 HOH HOH A . 
O 5 HOH 325 1560 1560 HOH HOH A . 
O 5 HOH 326 1561 1561 HOH HOH A . 
O 5 HOH 327 1562 1562 HOH HOH A . 
O 5 HOH 328 1563 1563 HOH HOH A . 
O 5 HOH 329 1564 1564 HOH HOH A . 
O 5 HOH 330 1565 1565 HOH HOH A . 
O 5 HOH 331 1566 1566 HOH HOH A . 
O 5 HOH 332 1567 1567 HOH HOH A . 
O 5 HOH 333 1568 1568 HOH HOH A . 
O 5 HOH 334 1569 1569 HOH HOH A . 
O 5 HOH 335 1570 1570 HOH HOH A . 
O 5 HOH 336 1571 1571 HOH HOH A . 
O 5 HOH 337 1572 1572 HOH HOH A . 
O 5 HOH 338 1573 1573 HOH HOH A . 
O 5 HOH 339 1574 1574 HOH HOH A . 
O 5 HOH 340 1575 1575 HOH HOH A . 
O 5 HOH 341 1576 1576 HOH HOH A . 
O 5 HOH 342 1577 1577 HOH HOH A . 
O 5 HOH 343 1578 1578 HOH HOH A . 
O 5 HOH 344 1579 1579 HOH HOH A . 
O 5 HOH 345 1580 1580 HOH HOH A . 
O 5 HOH 346 1581 1581 HOH HOH A . 
O 5 HOH 347 1582 1582 HOH HOH A . 
O 5 HOH 348 1583 1583 HOH HOH A . 
O 5 HOH 349 1584 1584 HOH HOH A . 
O 5 HOH 350 1585 1585 HOH HOH A . 
O 5 HOH 351 1586 1586 HOH HOH A . 
O 5 HOH 352 1587 1587 HOH HOH A . 
O 5 HOH 353 1588 1588 HOH HOH A . 
O 5 HOH 354 1589 1589 HOH HOH A . 
O 5 HOH 355 1590 1590 HOH HOH A . 
O 5 HOH 356 1591 1591 HOH HOH A . 
O 5 HOH 357 1592 1592 HOH HOH A . 
O 5 HOH 358 1593 1593 HOH HOH A . 
O 5 HOH 359 1594 1594 HOH HOH A . 
O 5 HOH 360 1595 1595 HOH HOH A . 
O 5 HOH 361 1596 1596 HOH HOH A . 
O 5 HOH 362 1597 1597 HOH HOH A . 
O 5 HOH 363 1598 1598 HOH HOH A . 
O 5 HOH 364 1599 1599 HOH HOH A . 
O 5 HOH 365 1600 1600 HOH HOH A . 
O 5 HOH 366 1601 1601 HOH HOH A . 
O 5 HOH 367 1602 1602 HOH HOH A . 
O 5 HOH 368 1603 1603 HOH HOH A . 
O 5 HOH 369 1604 1604 HOH HOH A . 
O 5 HOH 370 1605 1605 HOH HOH A . 
O 5 HOH 371 1606 1606 HOH HOH A . 
O 5 HOH 372 1607 1607 HOH HOH A . 
O 5 HOH 373 1608 1608 HOH HOH A . 
O 5 HOH 374 1609 1609 HOH HOH A . 
O 5 HOH 375 1610 1610 HOH HOH A . 
O 5 HOH 376 1611 1611 HOH HOH A . 
O 5 HOH 377 1612 1612 HOH HOH A . 
O 5 HOH 378 1613 1613 HOH HOH A . 
O 5 HOH 379 1614 1614 HOH HOH A . 
O 5 HOH 380 1615 1615 HOH HOH A . 
O 5 HOH 381 1616 1616 HOH HOH A . 
O 5 HOH 382 1617 1617 HOH HOH A . 
O 5 HOH 383 1618 1618 HOH HOH A . 
O 5 HOH 384 1619 1619 HOH HOH A . 
O 5 HOH 385 1620 1620 HOH HOH A . 
O 5 HOH 386 1621 1621 HOH HOH A . 
O 5 HOH 387 1622 1622 HOH HOH A . 
O 5 HOH 388 1623 1623 HOH HOH A . 
O 5 HOH 389 1624 1624 HOH HOH A . 
O 5 HOH 390 1625 1625 HOH HOH A . 
P 5 HOH 1   1236 1236 HOH HOH B . 
P 5 HOH 2   1237 1237 HOH HOH B . 
P 5 HOH 3   1238 1238 HOH HOH B . 
P 5 HOH 4   1239 1239 HOH HOH B . 
P 5 HOH 5   1240 1240 HOH HOH B . 
P 5 HOH 6   1241 1241 HOH HOH B . 
P 5 HOH 7   1242 1242 HOH HOH B . 
P 5 HOH 8   1243 1243 HOH HOH B . 
P 5 HOH 9   1244 1244 HOH HOH B . 
P 5 HOH 10  1245 1245 HOH HOH B . 
P 5 HOH 11  1246 1246 HOH HOH B . 
P 5 HOH 12  1247 1247 HOH HOH B . 
P 5 HOH 13  1248 1248 HOH HOH B . 
P 5 HOH 14  1249 1249 HOH HOH B . 
P 5 HOH 15  1250 1250 HOH HOH B . 
P 5 HOH 16  1251 1251 HOH HOH B . 
P 5 HOH 17  1252 1252 HOH HOH B . 
P 5 HOH 18  1253 1253 HOH HOH B . 
P 5 HOH 19  1254 1254 HOH HOH B . 
P 5 HOH 20  1255 1255 HOH HOH B . 
P 5 HOH 21  1256 1256 HOH HOH B . 
P 5 HOH 22  1257 1257 HOH HOH B . 
P 5 HOH 23  1258 1258 HOH HOH B . 
P 5 HOH 24  1259 1259 HOH HOH B . 
P 5 HOH 25  1260 1260 HOH HOH B . 
P 5 HOH 26  1261 1261 HOH HOH B . 
P 5 HOH 27  1262 1262 HOH HOH B . 
P 5 HOH 28  1263 1263 HOH HOH B . 
P 5 HOH 29  1264 1264 HOH HOH B . 
P 5 HOH 30  1265 1265 HOH HOH B . 
P 5 HOH 31  1266 1266 HOH HOH B . 
P 5 HOH 32  1267 1267 HOH HOH B . 
P 5 HOH 33  1268 1268 HOH HOH B . 
P 5 HOH 34  1269 1269 HOH HOH B . 
P 5 HOH 35  1270 1270 HOH HOH B . 
P 5 HOH 36  1271 1271 HOH HOH B . 
P 5 HOH 37  1272 1272 HOH HOH B . 
P 5 HOH 38  1273 1273 HOH HOH B . 
P 5 HOH 39  1274 1274 HOH HOH B . 
P 5 HOH 40  1275 1275 HOH HOH B . 
P 5 HOH 41  1276 1276 HOH HOH B . 
P 5 HOH 42  1277 1277 HOH HOH B . 
P 5 HOH 43  1278 1278 HOH HOH B . 
P 5 HOH 44  1279 1279 HOH HOH B . 
P 5 HOH 45  1280 1280 HOH HOH B . 
P 5 HOH 46  1281 1281 HOH HOH B . 
P 5 HOH 47  1282 1282 HOH HOH B . 
P 5 HOH 48  1283 1283 HOH HOH B . 
P 5 HOH 49  1284 1284 HOH HOH B . 
P 5 HOH 50  1285 1285 HOH HOH B . 
P 5 HOH 51  1286 1286 HOH HOH B . 
P 5 HOH 52  1287 1287 HOH HOH B . 
P 5 HOH 53  1288 1288 HOH HOH B . 
P 5 HOH 54  1289 1289 HOH HOH B . 
P 5 HOH 55  1290 1290 HOH HOH B . 
P 5 HOH 56  1291 1291 HOH HOH B . 
P 5 HOH 57  1292 1292 HOH HOH B . 
P 5 HOH 58  1293 1293 HOH HOH B . 
P 5 HOH 59  1294 1294 HOH HOH B . 
P 5 HOH 60  1295 1295 HOH HOH B . 
P 5 HOH 61  1296 1296 HOH HOH B . 
P 5 HOH 62  1297 1297 HOH HOH B . 
P 5 HOH 63  1298 1298 HOH HOH B . 
P 5 HOH 64  1299 1299 HOH HOH B . 
P 5 HOH 65  1300 1300 HOH HOH B . 
P 5 HOH 66  1301 1301 HOH HOH B . 
P 5 HOH 67  1302 1302 HOH HOH B . 
P 5 HOH 68  1303 1303 HOH HOH B . 
P 5 HOH 69  1304 1304 HOH HOH B . 
P 5 HOH 70  1305 1305 HOH HOH B . 
P 5 HOH 71  1306 1306 HOH HOH B . 
P 5 HOH 72  1307 1307 HOH HOH B . 
P 5 HOH 73  1308 1308 HOH HOH B . 
P 5 HOH 74  1309 1309 HOH HOH B . 
P 5 HOH 75  1310 1310 HOH HOH B . 
P 5 HOH 76  1311 1311 HOH HOH B . 
P 5 HOH 77  1312 1312 HOH HOH B . 
P 5 HOH 78  1313 1313 HOH HOH B . 
P 5 HOH 79  1314 1314 HOH HOH B . 
P 5 HOH 80  1315 1315 HOH HOH B . 
P 5 HOH 81  1316 1316 HOH HOH B . 
P 5 HOH 82  1317 1317 HOH HOH B . 
P 5 HOH 83  1318 1318 HOH HOH B . 
P 5 HOH 84  1319 1319 HOH HOH B . 
P 5 HOH 85  1320 1320 HOH HOH B . 
P 5 HOH 86  1321 1321 HOH HOH B . 
P 5 HOH 87  1322 1322 HOH HOH B . 
P 5 HOH 88  1323 1323 HOH HOH B . 
P 5 HOH 89  1324 1324 HOH HOH B . 
P 5 HOH 90  1325 1325 HOH HOH B . 
P 5 HOH 91  1326 1326 HOH HOH B . 
P 5 HOH 92  1327 1327 HOH HOH B . 
P 5 HOH 93  1328 1328 HOH HOH B . 
P 5 HOH 94  1329 1329 HOH HOH B . 
P 5 HOH 95  1330 1330 HOH HOH B . 
P 5 HOH 96  1331 1331 HOH HOH B . 
P 5 HOH 97  1332 1332 HOH HOH B . 
P 5 HOH 98  1333 1333 HOH HOH B . 
P 5 HOH 99  1334 1334 HOH HOH B . 
P 5 HOH 100 1335 1335 HOH HOH B . 
P 5 HOH 101 1336 1336 HOH HOH B . 
P 5 HOH 102 1337 1337 HOH HOH B . 
P 5 HOH 103 1338 1338 HOH HOH B . 
P 5 HOH 104 1339 1339 HOH HOH B . 
P 5 HOH 105 1340 1340 HOH HOH B . 
P 5 HOH 106 1341 1341 HOH HOH B . 
P 5 HOH 107 1342 1342 HOH HOH B . 
P 5 HOH 108 1343 1343 HOH HOH B . 
P 5 HOH 109 1344 1344 HOH HOH B . 
P 5 HOH 110 1345 1345 HOH HOH B . 
P 5 HOH 111 1346 1346 HOH HOH B . 
P 5 HOH 112 1347 1347 HOH HOH B . 
P 5 HOH 113 1348 1348 HOH HOH B . 
P 5 HOH 114 1349 1349 HOH HOH B . 
P 5 HOH 115 1350 1350 HOH HOH B . 
P 5 HOH 116 1351 1351 HOH HOH B . 
P 5 HOH 117 1352 1352 HOH HOH B . 
P 5 HOH 118 1353 1353 HOH HOH B . 
P 5 HOH 119 1354 1354 HOH HOH B . 
P 5 HOH 120 1355 1355 HOH HOH B . 
P 5 HOH 121 1356 1356 HOH HOH B . 
P 5 HOH 122 1357 1357 HOH HOH B . 
P 5 HOH 123 1358 1358 HOH HOH B . 
P 5 HOH 124 1359 1359 HOH HOH B . 
P 5 HOH 125 1360 1360 HOH HOH B . 
P 5 HOH 126 1361 1361 HOH HOH B . 
P 5 HOH 127 1362 1362 HOH HOH B . 
P 5 HOH 128 1363 1363 HOH HOH B . 
P 5 HOH 129 1364 1364 HOH HOH B . 
P 5 HOH 130 1365 1365 HOH HOH B . 
P 5 HOH 131 1366 1366 HOH HOH B . 
P 5 HOH 132 1367 1367 HOH HOH B . 
P 5 HOH 133 1368 1368 HOH HOH B . 
P 5 HOH 134 1369 1369 HOH HOH B . 
P 5 HOH 135 1370 1370 HOH HOH B . 
P 5 HOH 136 1371 1371 HOH HOH B . 
P 5 HOH 137 1372 1372 HOH HOH B . 
P 5 HOH 138 1373 1373 HOH HOH B . 
P 5 HOH 139 1374 1374 HOH HOH B . 
P 5 HOH 140 1375 1375 HOH HOH B . 
P 5 HOH 141 1376 1376 HOH HOH B . 
P 5 HOH 142 1377 1377 HOH HOH B . 
P 5 HOH 143 1378 1378 HOH HOH B . 
P 5 HOH 144 1379 1379 HOH HOH B . 
P 5 HOH 145 1380 1380 HOH HOH B . 
P 5 HOH 146 1381 1381 HOH HOH B . 
P 5 HOH 147 1382 1382 HOH HOH B . 
P 5 HOH 148 1383 1383 HOH HOH B . 
P 5 HOH 149 1384 1384 HOH HOH B . 
P 5 HOH 150 1385 1385 HOH HOH B . 
P 5 HOH 151 1386 1386 HOH HOH B . 
P 5 HOH 152 1387 1387 HOH HOH B . 
P 5 HOH 153 1388 1388 HOH HOH B . 
P 5 HOH 154 1389 1389 HOH HOH B . 
P 5 HOH 155 1390 1390 HOH HOH B . 
P 5 HOH 156 1391 1391 HOH HOH B . 
P 5 HOH 157 1392 1392 HOH HOH B . 
P 5 HOH 158 1393 1393 HOH HOH B . 
P 5 HOH 159 1394 1394 HOH HOH B . 
P 5 HOH 160 1395 1395 HOH HOH B . 
P 5 HOH 161 1396 1396 HOH HOH B . 
P 5 HOH 162 1397 1397 HOH HOH B . 
P 5 HOH 163 1398 1398 HOH HOH B . 
P 5 HOH 164 1399 1399 HOH HOH B . 
P 5 HOH 165 1400 1400 HOH HOH B . 
P 5 HOH 166 1401 1401 HOH HOH B . 
P 5 HOH 167 1402 1402 HOH HOH B . 
P 5 HOH 168 1403 1403 HOH HOH B . 
P 5 HOH 169 1404 1404 HOH HOH B . 
P 5 HOH 170 1405 1405 HOH HOH B . 
P 5 HOH 171 1406 1406 HOH HOH B . 
P 5 HOH 172 1407 1407 HOH HOH B . 
P 5 HOH 173 1408 1408 HOH HOH B . 
P 5 HOH 174 1409 1409 HOH HOH B . 
P 5 HOH 175 1410 1410 HOH HOH B . 
P 5 HOH 176 1411 1411 HOH HOH B . 
P 5 HOH 177 1412 1412 HOH HOH B . 
P 5 HOH 178 1413 1413 HOH HOH B . 
P 5 HOH 179 1414 1414 HOH HOH B . 
P 5 HOH 180 1415 1415 HOH HOH B . 
P 5 HOH 181 1416 1416 HOH HOH B . 
P 5 HOH 182 1417 1417 HOH HOH B . 
P 5 HOH 183 1418 1418 HOH HOH B . 
P 5 HOH 184 1419 1419 HOH HOH B . 
P 5 HOH 185 1420 1420 HOH HOH B . 
P 5 HOH 186 1421 1421 HOH HOH B . 
P 5 HOH 187 1422 1422 HOH HOH B . 
P 5 HOH 188 1423 1423 HOH HOH B . 
P 5 HOH 189 1424 1424 HOH HOH B . 
P 5 HOH 190 1425 1425 HOH HOH B . 
P 5 HOH 191 1426 1426 HOH HOH B . 
P 5 HOH 192 1427 1427 HOH HOH B . 
P 5 HOH 193 1428 1428 HOH HOH B . 
P 5 HOH 194 1429 1429 HOH HOH B . 
P 5 HOH 195 1430 1430 HOH HOH B . 
P 5 HOH 196 1431 1431 HOH HOH B . 
P 5 HOH 197 1432 1432 HOH HOH B . 
P 5 HOH 198 1433 1433 HOH HOH B . 
P 5 HOH 199 1434 1434 HOH HOH B . 
P 5 HOH 200 1435 1435 HOH HOH B . 
P 5 HOH 201 1436 1436 HOH HOH B . 
P 5 HOH 202 1437 1437 HOH HOH B . 
P 5 HOH 203 1438 1438 HOH HOH B . 
P 5 HOH 204 1439 1439 HOH HOH B . 
P 5 HOH 205 1440 1440 HOH HOH B . 
P 5 HOH 206 1441 1441 HOH HOH B . 
P 5 HOH 207 1442 1442 HOH HOH B . 
P 5 HOH 208 1443 1443 HOH HOH B . 
P 5 HOH 209 1444 1444 HOH HOH B . 
P 5 HOH 210 1445 1445 HOH HOH B . 
P 5 HOH 211 1446 1446 HOH HOH B . 
P 5 HOH 212 1447 1447 HOH HOH B . 
P 5 HOH 213 1448 1448 HOH HOH B . 
P 5 HOH 214 1449 1449 HOH HOH B . 
P 5 HOH 215 1450 1450 HOH HOH B . 
P 5 HOH 216 1451 1451 HOH HOH B . 
P 5 HOH 217 1452 1452 HOH HOH B . 
P 5 HOH 218 1453 1453 HOH HOH B . 
P 5 HOH 219 1454 1454 HOH HOH B . 
P 5 HOH 220 1455 1455 HOH HOH B . 
P 5 HOH 221 1456 1456 HOH HOH B . 
P 5 HOH 222 1457 1457 HOH HOH B . 
P 5 HOH 223 1458 1458 HOH HOH B . 
P 5 HOH 224 1459 1459 HOH HOH B . 
P 5 HOH 225 1460 1460 HOH HOH B . 
P 5 HOH 226 1461 1461 HOH HOH B . 
P 5 HOH 227 1462 1462 HOH HOH B . 
P 5 HOH 228 1463 1463 HOH HOH B . 
P 5 HOH 229 1464 1464 HOH HOH B . 
P 5 HOH 230 1465 1465 HOH HOH B . 
P 5 HOH 231 1466 1466 HOH HOH B . 
P 5 HOH 232 1467 1467 HOH HOH B . 
P 5 HOH 233 1468 1468 HOH HOH B . 
P 5 HOH 234 1469 1469 HOH HOH B . 
P 5 HOH 235 1470 1470 HOH HOH B . 
P 5 HOH 236 1471 1471 HOH HOH B . 
P 5 HOH 237 1472 1472 HOH HOH B . 
P 5 HOH 238 1473 1473 HOH HOH B . 
P 5 HOH 239 1474 1474 HOH HOH B . 
P 5 HOH 240 1475 1475 HOH HOH B . 
P 5 HOH 241 1476 1476 HOH HOH B . 
P 5 HOH 242 1477 1477 HOH HOH B . 
P 5 HOH 243 1478 1478 HOH HOH B . 
P 5 HOH 244 1479 1479 HOH HOH B . 
P 5 HOH 245 1480 1480 HOH HOH B . 
P 5 HOH 246 1481 1481 HOH HOH B . 
P 5 HOH 247 1482 1482 HOH HOH B . 
P 5 HOH 248 1483 1483 HOH HOH B . 
P 5 HOH 249 1484 1484 HOH HOH B . 
P 5 HOH 250 1485 1485 HOH HOH B . 
P 5 HOH 251 1486 1486 HOH HOH B . 
P 5 HOH 252 1487 1487 HOH HOH B . 
P 5 HOH 253 1488 1488 HOH HOH B . 
P 5 HOH 254 1489 1489 HOH HOH B . 
P 5 HOH 255 1490 1490 HOH HOH B . 
P 5 HOH 256 1491 1491 HOH HOH B . 
P 5 HOH 257 1492 1492 HOH HOH B . 
P 5 HOH 258 1493 1493 HOH HOH B . 
P 5 HOH 259 1494 1494 HOH HOH B . 
P 5 HOH 260 1495 1495 HOH HOH B . 
P 5 HOH 261 1496 1496 HOH HOH B . 
P 5 HOH 262 1497 1497 HOH HOH B . 
P 5 HOH 263 1498 1498 HOH HOH B . 
P 5 HOH 264 1499 1499 HOH HOH B . 
P 5 HOH 265 1500 1500 HOH HOH B . 
P 5 HOH 266 1501 1501 HOH HOH B . 
P 5 HOH 267 1502 1502 HOH HOH B . 
P 5 HOH 268 1503 1503 HOH HOH B . 
P 5 HOH 269 1504 1504 HOH HOH B . 
P 5 HOH 270 1505 1505 HOH HOH B . 
P 5 HOH 271 1506 1506 HOH HOH B . 
P 5 HOH 272 1507 1507 HOH HOH B . 
P 5 HOH 273 1508 1508 HOH HOH B . 
P 5 HOH 274 1509 1509 HOH HOH B . 
P 5 HOH 275 1510 1510 HOH HOH B . 
P 5 HOH 276 1511 1511 HOH HOH B . 
P 5 HOH 277 1512 1512 HOH HOH B . 
P 5 HOH 278 1513 1513 HOH HOH B . 
P 5 HOH 279 1514 1514 HOH HOH B . 
P 5 HOH 280 1515 1515 HOH HOH B . 
P 5 HOH 281 1516 1516 HOH HOH B . 
P 5 HOH 282 1517 1517 HOH HOH B . 
P 5 HOH 283 1518 1518 HOH HOH B . 
P 5 HOH 284 1519 1519 HOH HOH B . 
P 5 HOH 285 1520 1520 HOH HOH B . 
P 5 HOH 286 1521 1521 HOH HOH B . 
P 5 HOH 287 1522 1522 HOH HOH B . 
P 5 HOH 288 1523 1523 HOH HOH B . 
P 5 HOH 289 1524 1524 HOH HOH B . 
P 5 HOH 290 1525 1525 HOH HOH B . 
P 5 HOH 291 1526 1526 HOH HOH B . 
Q 5 HOH 1   12   12   HOH HOH P . 
Q 5 HOH 2   13   13   HOH HOH P . 
Q 5 HOH 3   14   14   HOH HOH P . 
Q 5 HOH 4   15   15   HOH HOH P . 
R 5 HOH 1   12   12   HOH HOH Q . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C MLY 7 P MLY 7 ? LYS N-DIMETHYL-LYSINE 
2 D MLY 7 Q MLY 7 ? LYS N-DIMETHYL-LYSINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 author_and_software_defined_assembly PISA dimeric    2 
3 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,G,H,I,J,O,Q                 
2 1 B,D,K,L,M,N,P,R                     
3 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1560 ? 
2 'ABSA (A^2)' 1360 ? 
3 'ABSA (A^2)' 5780 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 81  ? A CYS 1031 ? 1_555 ZN ? E ZN . ? A ZN 501 ? 1_555 SG ? A CYS 94  ? A CYS 1044 ? 1_555 114.0 ? 
2  SG ? A CYS 81  ? A CYS 1031 ? 1_555 ZN ? E ZN . ? A ZN 501 ? 1_555 SG ? A CYS 124 ? A CYS 1074 ? 1_555 109.3 ? 
3  SG ? A CYS 94  ? A CYS 1044 ? 1_555 ZN ? E ZN . ? A ZN 501 ? 1_555 SG ? A CYS 124 ? A CYS 1074 ? 1_555 112.3 ? 
4  SG ? A CYS 81  ? A CYS 1031 ? 1_555 ZN ? E ZN . ? A ZN 501 ? 1_555 SG ? A CYS 128 ? A CYS 1078 ? 1_555 104.2 ? 
5  SG ? A CYS 94  ? A CYS 1044 ? 1_555 ZN ? E ZN . ? A ZN 501 ? 1_555 SG ? A CYS 128 ? A CYS 1078 ? 1_555 99.1  ? 
6  SG ? A CYS 124 ? A CYS 1074 ? 1_555 ZN ? E ZN . ? A ZN 501 ? 1_555 SG ? A CYS 128 ? A CYS 1078 ? 1_555 117.7 ? 
7  SG ? A CYS 81  ? A CYS 1031 ? 1_555 ZN ? G ZN . ? A ZN 503 ? 1_555 SG ? A CYS 83  ? A CYS 1033 ? 1_555 108.6 ? 
8  SG ? A CYS 81  ? A CYS 1031 ? 1_555 ZN ? G ZN . ? A ZN 503 ? 1_555 SG ? A CYS 87  ? A CYS 1037 ? 1_555 104.0 ? 
9  SG ? A CYS 83  ? A CYS 1033 ? 1_555 ZN ? G ZN . ? A ZN 503 ? 1_555 SG ? A CYS 87  ? A CYS 1037 ? 1_555 107.8 ? 
10 SG ? A CYS 81  ? A CYS 1031 ? 1_555 ZN ? G ZN . ? A ZN 503 ? 1_555 SG ? A CYS 92  ? A CYS 1042 ? 1_555 112.1 ? 
11 SG ? A CYS 83  ? A CYS 1033 ? 1_555 ZN ? G ZN . ? A ZN 503 ? 1_555 SG ? A CYS 92  ? A CYS 1042 ? 1_555 108.1 ? 
12 SG ? A CYS 87  ? A CYS 1037 ? 1_555 ZN ? G ZN . ? A ZN 503 ? 1_555 SG ? A CYS 92  ? A CYS 1042 ? 1_555 115.9 ? 
13 SG ? A CYS 87  ? A CYS 1037 ? 1_555 ZN ? F ZN . ? A ZN 502 ? 1_555 SG ? A CYS 124 ? A CYS 1074 ? 1_555 112.6 ? 
14 SG ? A CYS 87  ? A CYS 1037 ? 1_555 ZN ? F ZN . ? A ZN 502 ? 1_555 SG ? A CYS 130 ? A CYS 1080 ? 1_555 104.6 ? 
15 SG ? A CYS 124 ? A CYS 1074 ? 1_555 ZN ? F ZN . ? A ZN 502 ? 1_555 SG ? A CYS 130 ? A CYS 1080 ? 1_555 109.0 ? 
16 SG ? A CYS 87  ? A CYS 1037 ? 1_555 ZN ? F ZN . ? A ZN 502 ? 1_555 SG ? A CYS 134 ? A CYS 1084 ? 1_555 112.0 ? 
17 SG ? A CYS 124 ? A CYS 1074 ? 1_555 ZN ? F ZN . ? A ZN 502 ? 1_555 SG ? A CYS 134 ? A CYS 1084 ? 1_555 103.8 ? 
18 SG ? A CYS 130 ? A CYS 1080 ? 1_555 ZN ? F ZN . ? A ZN 502 ? 1_555 SG ? A CYS 134 ? A CYS 1084 ? 1_555 115.0 ? 
19 SG ? A CYS 222 ? A CYS 1172 ? 1_555 ZN ? H ZN . ? A ZN 504 ? 1_555 SG ? A CYS 275 ? A CYS 1225 ? 1_555 114.3 ? 
20 SG ? A CYS 222 ? A CYS 1172 ? 1_555 ZN ? H ZN . ? A ZN 504 ? 1_555 SG ? A CYS 277 ? A CYS 1227 ? 1_555 108.1 ? 
21 SG ? A CYS 275 ? A CYS 1225 ? 1_555 ZN ? H ZN . ? A ZN 504 ? 1_555 SG ? A CYS 277 ? A CYS 1227 ? 1_555 105.2 ? 
22 SG ? A CYS 222 ? A CYS 1172 ? 1_555 ZN ? H ZN . ? A ZN 504 ? 1_555 SG ? A CYS 282 ? A CYS 1232 ? 1_555 106.7 ? 
23 SG ? A CYS 275 ? A CYS 1225 ? 1_555 ZN ? H ZN . ? A ZN 504 ? 1_555 SG ? A CYS 282 ? A CYS 1232 ? 1_555 107.3 ? 
24 SG ? A CYS 277 ? A CYS 1227 ? 1_555 ZN ? H ZN . ? A ZN 504 ? 1_555 SG ? A CYS 282 ? A CYS 1232 ? 1_555 115.6 ? 
25 SG ? B CYS 81  ? B CYS 1031 ? 1_555 ZN ? K ZN . ? B ZN 501 ? 1_555 SG ? B CYS 94  ? B CYS 1044 ? 1_555 115.4 ? 
26 SG ? B CYS 81  ? B CYS 1031 ? 1_555 ZN ? K ZN . ? B ZN 501 ? 1_555 SG ? B CYS 124 ? B CYS 1074 ? 1_555 109.2 ? 
27 SG ? B CYS 94  ? B CYS 1044 ? 1_555 ZN ? K ZN . ? B ZN 501 ? 1_555 SG ? B CYS 124 ? B CYS 1074 ? 1_555 109.2 ? 
28 SG ? B CYS 81  ? B CYS 1031 ? 1_555 ZN ? K ZN . ? B ZN 501 ? 1_555 SG ? B CYS 128 ? B CYS 1078 ? 1_555 105.4 ? 
29 SG ? B CYS 94  ? B CYS 1044 ? 1_555 ZN ? K ZN . ? B ZN 501 ? 1_555 SG ? B CYS 128 ? B CYS 1078 ? 1_555 99.1  ? 
30 SG ? B CYS 124 ? B CYS 1074 ? 1_555 ZN ? K ZN . ? B ZN 501 ? 1_555 SG ? B CYS 128 ? B CYS 1078 ? 1_555 118.6 ? 
31 SG ? B CYS 81  ? B CYS 1031 ? 1_555 ZN ? M ZN . ? B ZN 503 ? 1_555 SG ? B CYS 83  ? B CYS 1033 ? 1_555 108.3 ? 
32 SG ? B CYS 81  ? B CYS 1031 ? 1_555 ZN ? M ZN . ? B ZN 503 ? 1_555 SG ? B CYS 87  ? B CYS 1037 ? 1_555 106.8 ? 
33 SG ? B CYS 83  ? B CYS 1033 ? 1_555 ZN ? M ZN . ? B ZN 503 ? 1_555 SG ? B CYS 87  ? B CYS 1037 ? 1_555 108.0 ? 
34 SG ? B CYS 81  ? B CYS 1031 ? 1_555 ZN ? M ZN . ? B ZN 503 ? 1_555 SG ? B CYS 92  ? B CYS 1042 ? 1_555 110.3 ? 
35 SG ? B CYS 83  ? B CYS 1033 ? 1_555 ZN ? M ZN . ? B ZN 503 ? 1_555 SG ? B CYS 92  ? B CYS 1042 ? 1_555 106.4 ? 
36 SG ? B CYS 87  ? B CYS 1037 ? 1_555 ZN ? M ZN . ? B ZN 503 ? 1_555 SG ? B CYS 92  ? B CYS 1042 ? 1_555 116.8 ? 
37 SG ? B CYS 87  ? B CYS 1037 ? 1_555 ZN ? L ZN . ? B ZN 502 ? 1_555 SG ? B CYS 124 ? B CYS 1074 ? 1_555 111.2 ? 
38 SG ? B CYS 87  ? B CYS 1037 ? 1_555 ZN ? L ZN . ? B ZN 502 ? 1_555 SG ? B CYS 130 ? B CYS 1080 ? 1_555 105.7 ? 
39 SG ? B CYS 124 ? B CYS 1074 ? 1_555 ZN ? L ZN . ? B ZN 502 ? 1_555 SG ? B CYS 130 ? B CYS 1080 ? 1_555 107.8 ? 
40 SG ? B CYS 87  ? B CYS 1037 ? 1_555 ZN ? L ZN . ? B ZN 502 ? 1_555 SG ? B CYS 134 ? B CYS 1084 ? 1_555 111.9 ? 
41 SG ? B CYS 124 ? B CYS 1074 ? 1_555 ZN ? L ZN . ? B ZN 502 ? 1_555 SG ? B CYS 134 ? B CYS 1084 ? 1_555 105.8 ? 
42 SG ? B CYS 130 ? B CYS 1080 ? 1_555 ZN ? L ZN . ? B ZN 502 ? 1_555 SG ? B CYS 134 ? B CYS 1084 ? 1_555 114.5 ? 
43 SG ? B CYS 222 ? B CYS 1172 ? 1_555 ZN ? N ZN . ? B ZN 504 ? 1_555 SG ? B CYS 275 ? B CYS 1225 ? 1_555 112.5 ? 
44 SG ? B CYS 222 ? B CYS 1172 ? 1_555 ZN ? N ZN . ? B ZN 504 ? 1_555 SG ? B CYS 277 ? B CYS 1227 ? 1_555 117.3 ? 
45 SG ? B CYS 275 ? B CYS 1225 ? 1_555 ZN ? N ZN . ? B ZN 504 ? 1_555 SG ? B CYS 277 ? B CYS 1227 ? 1_555 105.8 ? 
46 SG ? B CYS 222 ? B CYS 1172 ? 1_555 ZN ? N ZN . ? B ZN 504 ? 1_555 SG ? B CYS 282 ? B CYS 1232 ? 1_555 91.3  ? 
47 SG ? B CYS 275 ? B CYS 1225 ? 1_555 ZN ? N ZN . ? B ZN 504 ? 1_555 SG ? B CYS 282 ? B CYS 1232 ? 1_555 105.4 ? 
48 SG ? B CYS 277 ? B CYS 1227 ? 1_555 ZN ? N ZN . ? B ZN 504 ? 1_555 SG ? B CYS 282 ? B CYS 1232 ? 1_555 123.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-10-23 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
HKL-2000 'data collection' .        ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
MOLREP   phasing           .        ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C P ARG 6 ? ? N P MLY 7 ? ? 1.520 1.336 0.184 0.023 Y 
2 1 C P MLY 7 ? ? N P SER 8 ? ? 1.550 1.336 0.214 0.023 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 982  ? ? -169.42 107.83  
2  1 ARG A 985  ? B 39.78   48.52   
3  1 THR A 1016 ? ? -101.63 -88.02  
4  1 THR A 1016 ? ? -101.63 -90.55  
5  1 ASP A 1035 ? ? -117.56 -148.01 
6  1 MET A 1049 ? ? 80.50   -60.09  
7  1 ASN A 1086 ? ? -92.31  47.77   
8  1 VAL A 1088 ? ? -141.04 -60.52  
9  1 ASP A 1104 ? ? -140.83 14.87   
10 1 ASN A 1163 ? ? -113.91 -163.46 
11 1 MET A 1183 ? ? -130.44 -91.18  
12 1 ASP B 982  ? ? -166.44 107.01  
13 1 ASP B 999  ? ? -142.99 -157.21 
14 1 SER B 1005 ? ? -142.96 12.20   
15 1 THR B 1016 ? ? -102.14 -84.89  
16 1 ASP B 1035 ? ? -118.01 -155.30 
17 1 MET B 1049 ? ? 81.63   -56.08  
18 1 ASN B 1086 ? ? -94.29  46.31   
19 1 VAL B 1088 ? ? -136.90 -62.07  
20 1 ASN B 1163 ? ? -116.62 -164.15 
21 1 MET B 1183 ? ? -131.74 -89.19  
22 1 HIS B 1234 ? ? -141.79 36.73   
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     SER 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      1235 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     OG 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    B 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    SER 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     285 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    OG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASN 951  ? A ASN 1   
2  1 Y 1 A SER 952  ? A SER 2   
3  1 Y 1 A GLN 953  ? A GLN 3   
4  1 Y 1 A VAL 954  ? A VAL 4   
5  1 Y 1 A TRP 955  ? A TRP 5   
6  1 Y 1 A SER 956  ? A SER 6   
7  1 Y 1 A ALA 957  ? A ALA 7   
8  1 Y 1 A LEU 958  ? A LEU 8   
9  1 Y 1 A GLN 959  ? A GLN 9   
10 1 Y 1 A MET 960  ? A MET 10  
11 1 Y 1 A SER 961  ? A SER 11  
12 1 Y 1 A LYS 962  ? A LYS 12  
13 1 Y 1 A ALA 963  ? A ALA 13  
14 1 Y 1 A LEU 964  ? A LEU 14  
15 1 Y 1 A GLN 965  ? A GLN 15  
16 1 Y 1 A ASP 966  ? A ASP 16  
17 1 Y 1 A SER 967  ? A SER 17  
18 1 Y 1 A ALA 968  ? A ALA 18  
19 1 Y 1 A PRO 969  ? A PRO 19  
20 1 Y 1 A ASP 970  ? A ASP 20  
21 1 Y 1 A ARG 971  ? A ARG 21  
22 1 Y 1 A PRO 972  ? A PRO 22  
23 1 Y 1 A SER 973  ? A SER 23  
24 1 Y 1 A PRO 974  ? A PRO 24  
25 1 Y 1 B ASN 951  ? B ASN 1   
26 1 Y 1 B SER 952  ? B SER 2   
27 1 Y 1 B GLN 953  ? B GLN 3   
28 1 Y 1 B VAL 954  ? B VAL 4   
29 1 Y 1 B TRP 955  ? B TRP 5   
30 1 Y 1 B SER 956  ? B SER 6   
31 1 Y 1 B ALA 957  ? B ALA 7   
32 1 Y 1 B LEU 958  ? B LEU 8   
33 1 Y 1 B GLN 959  ? B GLN 9   
34 1 Y 1 B MET 960  ? B MET 10  
35 1 Y 1 B SER 961  ? B SER 11  
36 1 Y 1 B LYS 962  ? B LYS 12  
37 1 Y 1 B ALA 963  ? B ALA 13  
38 1 Y 1 B LEU 964  ? B LEU 14  
39 1 Y 1 B GLN 965  ? B GLN 15  
40 1 Y 1 B ASP 966  ? B ASP 16  
41 1 Y 1 B SER 967  ? B SER 17  
42 1 Y 1 B ALA 968  ? B ALA 18  
43 1 Y 1 B PRO 969  ? B PRO 19  
44 1 Y 1 B ASP 970  ? B ASP 20  
45 1 Y 1 B ARG 971  ? B ARG 21  
46 1 Y 1 B PRO 972  ? B PRO 22  
47 1 Y 1 B SER 973  ? B SER 23  
48 1 Y 1 B PRO 974  ? B PRO 24  
49 1 Y 1 B VAL 975  ? B VAL 25  
50 1 Y 1 B GLU 976  ? B GLU 26  
51 1 Y 1 B ARG 977  ? B ARG 27  
52 1 Y 1 B ASP 1147 ? B ASP 197 
53 1 Y 1 B ASN 1148 ? B ASN 198 
54 1 Y 1 B LYS 1149 ? B LYS 199 
55 1 Y 1 B ASP 1150 ? B ASP 200 
56 1 Y 1 B GLY 1151 ? B GLY 201 
57 1 Y 1 B GLU 1152 ? B GLU 202 
58 1 Y 1 P THR 1    ? C THR 1   
59 1 Y 1 P GLY 10   ? C GLY 10  
60 1 Y 1 P GLY 11   ? C GLY 11  
61 1 Y 1 Q THR 1    ? D THR 1   
62 1 Y 1 Q LYS 2    ? D LYS 2   
63 1 Y 1 Q GLN 3    ? D GLN 3   
64 1 Y 1 Q GLY 10   ? D GLY 10  
65 1 Y 1 Q GLY 11   ? D GLY 11  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION'                ZN  
4 S-ADENOSYL-L-HOMOCYSTEINE SAH 
5 water                     HOH 
#