data_2RMH
# 
_entry.id   2RMH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2RMH         
RCSB  RCSB150033   
WWPDB D_1000150033 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
2rm9 PDB Astressin-2B                    unspecified 
2rmd PDB Astressin-B                     unspecified 
2rme PDB Stressin                        unspecified 
2rmf PDB HUcn1                           unspecified 
2rmg PDB HUcn2                           unspecified 
2RMI PDB '3D NMR structure of astressin' unspecified 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2RMH 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2007-10-16 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Grace, C.R.R.' 1 
'Perrin, M.H.'  2 
'Cantle, J.P.'  3 
'Vale, W.W.'    4 
'Rivier, J.E.'  5 
'Riek, R.'      6 
# 
_citation.id                        primary 
_citation.title                     
'Common and divergent structural features of a series of corticotropin releasing factor-related peptides' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            129 
_citation.page_first                16102 
_citation.page_last                 16114 
_citation.year                      2007 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18052377 
_citation.pdbx_database_id_DOI      10.1021/ja0760933 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Grace, C.R.R.' 1 
primary 'Perrin, M.H.'  2 
primary 'Cantle, J.P.'  3 
primary 'Vale, W.W.'    4 
primary 'Rivier, J.E.'  5 
primary 'Riek, R.'      6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 syn 
_entity.pdbx_description           Urocortin-3 
_entity.formula_weight             4142.887 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HUcn3, Urocortin III, Ucn III, Stresscopin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI 
_entity_poly.pdbx_seq_one_letter_code_can   FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PHE n 
1 2  THR n 
1 3  LEU n 
1 4  SER n 
1 5  LEU n 
1 6  ASP n 
1 7  VAL n 
1 8  PRO n 
1 9  THR n 
1 10 ASN n 
1 11 ILE n 
1 12 MET n 
1 13 ASN n 
1 14 LEU n 
1 15 LEU n 
1 16 PHE n 
1 17 ASN n 
1 18 ILE n 
1 19 ALA n 
1 20 LYS n 
1 21 ALA n 
1 22 LYS n 
1 23 ASN n 
1 24 LEU n 
1 25 ARG n 
1 26 ALA n 
1 27 GLN n 
1 28 ALA n 
1 29 ALA n 
1 30 ALA n 
1 31 ASN n 
1 32 ALA n 
1 33 HIS n 
1 34 LEU n 
1 35 MET n 
1 36 ALA n 
1 37 GLN n 
1 38 ILE n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Solid-phase approach' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    UCN3_HUMAN 
_struct_ref.pdbx_db_accession          Q969E3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI 
_struct_ref.pdbx_align_begin           120 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2RMH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 38 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q969E3 
_struct_ref_seq.db_align_beg                  120 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  157 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       41 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-1H TOCSY' 
1 2 1 '2D DQF-COSY'    
1 3 1 '2D 1H-1H NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  . 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '1.5mM Human Ucn3, DMSO' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   DMSO 
# 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker INOVA' 
# 
_pdbx_nmr_refine.entry_id           2RMH 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2RMH 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2RMH 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1.0.6 1 
'Guntert, Mumenthaler and Wuthrich' refinement           CYANA 1.0.6 2 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'Human Urocortin 3' 
_exptl.entry_id                   2RMH 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2RMH 
_struct.title                     'Human Urocortin 3' 
_struct.pdbx_descriptor           Urocortin-3 
_struct.pdbx_model_details        'Human Urocortin 3' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2RMH 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            
'CRF ligand, Sauvagine, Astressin2B, Urocortins, Urotensins, CRF receptors, Amidation, Hormone, Secreted' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 1 ? LEU A 5  ? PHE A 4  LEU A 8  5 ? 5  
HELX_P HELX_P2 2 PRO A 8 ? ALA A 30 ? PRO A 11 ALA A 33 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2RMH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . PHE A 1 1  ? -11.638 11.801  4.457   1.00 0.00 ? 4  PHE A N    1  
ATOM 2     C CA   . PHE A 1 1  ? -11.225 12.401  3.155   1.00 0.00 ? 4  PHE A CA   1  
ATOM 3     C C    . PHE A 1 1  ? -12.357 13.231  2.543   1.00 0.00 ? 4  PHE A C    1  
ATOM 4     O O    . PHE A 1 1  ? -13.508 12.793  2.515   1.00 0.00 ? 4  PHE A O    1  
ATOM 5     C CB   . PHE A 1 1  ? -10.815 11.276  2.192   1.00 0.00 ? 4  PHE A CB   1  
ATOM 6     C CG   . PHE A 1 1  ? -9.887  10.258  2.799   1.00 0.00 ? 4  PHE A CG   1  
ATOM 7     C CD1  . PHE A 1 1  ? -8.553  10.562  3.024   1.00 0.00 ? 4  PHE A CD1  1  
ATOM 8     C CD2  . PHE A 1 1  ? -10.351 9.000   3.145   1.00 0.00 ? 4  PHE A CD2  1  
ATOM 9     C CE1  . PHE A 1 1  ? -7.700  9.628   3.584   1.00 0.00 ? 4  PHE A CE1  1  
ATOM 10    C CE2  . PHE A 1 1  ? -9.504  8.063   3.705   1.00 0.00 ? 4  PHE A CE2  1  
ATOM 11    C CZ   . PHE A 1 1  ? -8.177  8.377   3.925   1.00 0.00 ? 4  PHE A CZ   1  
ATOM 12    H H1   . PHE A 1 1  ? -10.794 11.386  4.900   1.00 0.00 ? 4  PHE A H1   1  
ATOM 13    H H2   . PHE A 1 1  ? -12.355 11.072  4.259   1.00 0.00 ? 4  PHE A H2   1  
ATOM 14    H H3   . PHE A 1 1  ? -12.032 12.562  5.048   1.00 0.00 ? 4  PHE A H3   1  
ATOM 15    H HA   . PHE A 1 1  ? -10.375 13.046  3.328   1.00 0.00 ? 4  PHE A HA   1  
ATOM 16    H HB2  . PHE A 1 1  ? -11.701 10.757  1.858   1.00 0.00 ? 4  PHE A HB2  1  
ATOM 17    H HB3  . PHE A 1 1  ? -10.317 11.709  1.336   1.00 0.00 ? 4  PHE A HB3  1  
ATOM 18    H HD1  . PHE A 1 1  ? -8.178  11.540  2.757   1.00 0.00 ? 4  PHE A HD1  1  
ATOM 19    H HD2  . PHE A 1 1  ? -11.388 8.751   2.972   1.00 0.00 ? 4  PHE A HD2  1  
ATOM 20    H HE1  . PHE A 1 1  ? -6.662  9.877   3.754   1.00 0.00 ? 4  PHE A HE1  1  
ATOM 21    H HE2  . PHE A 1 1  ? -9.878  7.085   3.971   1.00 0.00 ? 4  PHE A HE2  1  
ATOM 22    H HZ   . PHE A 1 1  ? -7.513  7.646   4.362   1.00 0.00 ? 4  PHE A HZ   1  
ATOM 23    N N    . THR A 1 2  ? -12.019 14.427  2.068   1.00 0.00 ? 5  THR A N    1  
ATOM 24    C CA   . THR A 1 2  ? -12.987 15.341  1.461   1.00 0.00 ? 5  THR A CA   1  
ATOM 25    C C    . THR A 1 2  ? -13.672 14.710  0.249   1.00 0.00 ? 5  THR A C    1  
ATOM 26    O O    . THR A 1 2  ? -13.194 14.817  -0.876  1.00 0.00 ? 5  THR A O    1  
ATOM 27    C CB   . THR A 1 2  ? -12.297 16.648  1.052   1.00 0.00 ? 5  THR A CB   1  
ATOM 28    O OG1  . THR A 1 2  ? -11.603 17.216  2.149   1.00 0.00 ? 5  THR A OG1  1  
ATOM 29    C CG2  . THR A 1 2  ? -13.254 17.699  0.536   1.00 0.00 ? 5  THR A CG2  1  
ATOM 30    H H    . THR A 1 2  ? -11.087 14.713  2.133   1.00 0.00 ? 5  THR A H    1  
ATOM 31    H HA   . THR A 1 2  ? -13.738 15.564  2.204   1.00 0.00 ? 5  THR A HA   1  
ATOM 32    H HB   . THR A 1 2  ? -11.581 16.438  0.268   1.00 0.00 ? 5  THR A HB   1  
ATOM 33    H HG1  . THR A 1 2  ? -10.751 16.754  2.271   1.00 0.00 ? 5  THR A HG1  1  
ATOM 34    H HG21 . THR A 1 2  ? -14.089 17.790  1.214   1.00 0.00 ? 5  THR A HG21 1  
ATOM 35    H HG22 . THR A 1 2  ? -13.612 17.411  -0.442  1.00 0.00 ? 5  THR A HG22 1  
ATOM 36    H HG23 . THR A 1 2  ? -12.742 18.647  0.467   1.00 0.00 ? 5  THR A HG23 1  
ATOM 37    N N    . LEU A 1 3  ? -14.796 14.048  0.500   1.00 0.00 ? 6  LEU A N    1  
ATOM 38    C CA   . LEU A 1 3  ? -15.582 13.390  -0.555  1.00 0.00 ? 6  LEU A CA   1  
ATOM 39    C C    . LEU A 1 3  ? -14.702 12.590  -1.532  1.00 0.00 ? 6  LEU A C    1  
ATOM 40    O O    . LEU A 1 3  ? -14.946 12.584  -2.740  1.00 0.00 ? 6  LEU A O    1  
ATOM 41    C CB   . LEU A 1 3  ? -16.411 14.434  -1.315  1.00 0.00 ? 6  LEU A CB   1  
ATOM 42    C CG   . LEU A 1 3  ? -17.899 14.106  -1.455  1.00 0.00 ? 6  LEU A CG   1  
ATOM 43    C CD1  . LEU A 1 3  ? -18.724 15.381  -1.510  1.00 0.00 ? 6  LEU A CD1  1  
ATOM 44    C CD2  . LEU A 1 3  ? -18.147 13.262  -2.696  1.00 0.00 ? 6  LEU A CD2  1  
ATOM 45    H H    . LEU A 1 3  ? -15.109 14.000  1.427   1.00 0.00 ? 6  LEU A H    1  
ATOM 46    H HA   . LEU A 1 3  ? -16.259 12.702  -0.071  1.00 0.00 ? 6  LEU A HA   1  
ATOM 47    H HB2  . LEU A 1 3  ? -16.318 15.380  -0.800  1.00 0.00 ? 6  LEU A HB2  1  
ATOM 48    H HB3  . LEU A 1 3  ? -15.994 14.542  -2.306  1.00 0.00 ? 6  LEU A HB3  1  
ATOM 49    H HG   . LEU A 1 3  ? -18.221 13.539  -0.593  1.00 0.00 ? 6  LEU A HG   1  
ATOM 50    H HD11 . LEU A 1 3  ? -18.708 15.863  -0.543  1.00 0.00 ? 6  LEU A HD11 1  
ATOM 51    H HD12 . LEU A 1 3  ? -19.743 15.140  -1.775  1.00 0.00 ? 6  LEU A HD12 1  
ATOM 52    H HD13 . LEU A 1 3  ? -18.308 16.048  -2.252  1.00 0.00 ? 6  LEU A HD13 1  
ATOM 53    H HD21 . LEU A 1 3  ? -17.269 12.670  -2.911  1.00 0.00 ? 6  LEU A HD21 1  
ATOM 54    H HD22 . LEU A 1 3  ? -18.359 13.909  -3.534  1.00 0.00 ? 6  LEU A HD22 1  
ATOM 55    H HD23 . LEU A 1 3  ? -18.988 12.609  -2.523  1.00 0.00 ? 6  LEU A HD23 1  
ATOM 56    N N    . SER A 1 4  ? -13.687 11.908  -0.993  1.00 0.00 ? 7  SER A N    1  
ATOM 57    C CA   . SER A 1 4  ? -12.767 11.084  -1.795  1.00 0.00 ? 7  SER A CA   1  
ATOM 58    C C    . SER A 1 4  ? -11.715 11.904  -2.553  1.00 0.00 ? 7  SER A C    1  
ATOM 59    O O    . SER A 1 4  ? -10.833 11.326  -3.190  1.00 0.00 ? 7  SER A O    1  
ATOM 60    C CB   . SER A 1 4  ? -13.539 10.203  -2.784  1.00 0.00 ? 7  SER A CB   1  
ATOM 61    O OG   . SER A 1 4  ? -12.689 9.222   -3.361  1.00 0.00 ? 7  SER A OG   1  
ATOM 62    H H    . SER A 1 4  ? -13.556 11.949  -0.023  1.00 0.00 ? 7  SER A H    1  
ATOM 63    H HA   . SER A 1 4  ? -12.245 10.441  -1.109  1.00 0.00 ? 7  SER A HA   1  
ATOM 64    H HB2  . SER A 1 4  ? -14.344 9.704   -2.266  1.00 0.00 ? 7  SER A HB2  1  
ATOM 65    H HB3  . SER A 1 4  ? -13.945 10.821  -3.573  1.00 0.00 ? 7  SER A HB3  1  
ATOM 66    H HG   . SER A 1 4  ? -11.860 9.633   -3.642  1.00 0.00 ? 7  SER A HG   1  
ATOM 67    N N    . LEU A 1 5  ? -11.782 13.232  -2.478  1.00 0.00 ? 8  LEU A N    1  
ATOM 68    C CA   . LEU A 1 5  ? -10.800 14.077  -3.160  1.00 0.00 ? 8  LEU A CA   1  
ATOM 69    C C    . LEU A 1 5  ? -9.772  14.619  -2.160  1.00 0.00 ? 8  LEU A C    1  
ATOM 70    O O    . LEU A 1 5  ? -9.466  15.812  -2.132  1.00 0.00 ? 8  LEU A O    1  
ATOM 71    C CB   . LEU A 1 5  ? -11.491 15.218  -3.931  1.00 0.00 ? 8  LEU A CB   1  
ATOM 72    C CG   . LEU A 1 5  ? -12.169 16.295  -3.078  1.00 0.00 ? 8  LEU A CG   1  
ATOM 73    C CD1  . LEU A 1 5  ? -11.605 17.667  -3.405  1.00 0.00 ? 8  LEU A CD1  1  
ATOM 74    C CD2  . LEU A 1 5  ? -13.672 16.277  -3.297  1.00 0.00 ? 8  LEU A CD2  1  
ATOM 75    H H    . LEU A 1 5  ? -12.491 13.652  -1.945  1.00 0.00 ? 8  LEU A H    1  
ATOM 76    H HA   . LEU A 1 5  ? -10.277 13.452  -3.869  1.00 0.00 ? 8  LEU A HA   1  
ATOM 77    H HB2  . LEU A 1 5  ? -10.750 15.699  -4.552  1.00 0.00 ? 8  LEU A HB2  1  
ATOM 78    H HB3  . LEU A 1 5  ? -12.240 14.780  -4.575  1.00 0.00 ? 8  LEU A HB3  1  
ATOM 79    H HG   . LEU A 1 5  ? -11.977 16.096  -2.034  1.00 0.00 ? 8  LEU A HG   1  
ATOM 80    H HD11 . LEU A 1 5  ? -11.764 17.881  -4.451  1.00 0.00 ? 8  LEU A HD11 1  
ATOM 81    H HD12 . LEU A 1 5  ? -10.547 17.682  -3.190  1.00 0.00 ? 8  LEU A HD12 1  
ATOM 82    H HD13 . LEU A 1 5  ? -12.104 18.412  -2.805  1.00 0.00 ? 8  LEU A HD13 1  
ATOM 83    H HD21 . LEU A 1 5  ? -14.136 17.020  -2.666  1.00 0.00 ? 8  LEU A HD21 1  
ATOM 84    H HD22 . LEU A 1 5  ? -14.061 15.301  -3.048  1.00 0.00 ? 8  LEU A HD22 1  
ATOM 85    H HD23 . LEU A 1 5  ? -13.888 16.498  -4.331  1.00 0.00 ? 8  LEU A HD23 1  
ATOM 86    N N    . ASP A 1 6  ? -9.237  13.711  -1.339  1.00 0.00 ? 9  ASP A N    1  
ATOM 87    C CA   . ASP A 1 6  ? -8.244  14.059  -0.330  1.00 0.00 ? 9  ASP A CA   1  
ATOM 88    C C    . ASP A 1 6  ? -6.971  13.237  -0.519  1.00 0.00 ? 9  ASP A C    1  
ATOM 89    O O    . ASP A 1 6  ? -6.703  12.291  0.228   1.00 0.00 ? 9  ASP A O    1  
ATOM 90    C CB   . ASP A 1 6  ? -8.824  13.835  1.071   1.00 0.00 ? 9  ASP A CB   1  
ATOM 91    C CG   . ASP A 1 6  ? -8.605  15.015  1.990   1.00 0.00 ? 9  ASP A CG   1  
ATOM 92    O OD1  . ASP A 1 6  ? -7.438  15.305  2.318   1.00 0.00 ? 9  ASP A OD1  1  
ATOM 93    O OD2  . ASP A 1 6  ? -9.609  15.641  2.391   1.00 0.00 ? 9  ASP A OD2  1  
ATOM 94    H H    . ASP A 1 6  ? -9.519  12.777  -1.420  1.00 0.00 ? 9  ASP A H    1  
ATOM 95    H HA   . ASP A 1 6  ? -7.998  15.100  -0.451  1.00 0.00 ? 9  ASP A HA   1  
ATOM 96    H HB2  . ASP A 1 6  ? -9.884  13.663  0.988   1.00 0.00 ? 9  ASP A HB2  1  
ATOM 97    H HB3  . ASP A 1 6  ? -8.357  12.969  1.512   1.00 0.00 ? 9  ASP A HB3  1  
ATOM 98    N N    . VAL A 1 7  ? -6.194  13.600  -1.532  1.00 0.00 ? 10 VAL A N    1  
ATOM 99    C CA   . VAL A 1 7  ? -4.955  12.894  -1.831  1.00 0.00 ? 10 VAL A CA   1  
ATOM 100   C C    . VAL A 1 7  ? -3.766  13.859  -1.966  1.00 0.00 ? 10 VAL A C    1  
ATOM 101   O O    . VAL A 1 7  ? -3.091  13.909  -2.997  1.00 0.00 ? 10 VAL A O    1  
ATOM 102   C CB   . VAL A 1 7  ? -5.128  12.036  -3.105  1.00 0.00 ? 10 VAL A CB   1  
ATOM 103   C CG1  . VAL A 1 7  ? -5.257  12.900  -4.353  1.00 0.00 ? 10 VAL A CG1  1  
ATOM 104   C CG2  . VAL A 1 7  ? -3.986  11.041  -3.249  1.00 0.00 ? 10 VAL A CG2  1  
ATOM 105   H H    . VAL A 1 7  ? -6.466  14.352  -2.097  1.00 0.00 ? 10 VAL A H    1  
ATOM 106   H HA   . VAL A 1 7  ? -4.757  12.229  -1.006  1.00 0.00 ? 10 VAL A HA   1  
ATOM 107   H HB   . VAL A 1 7  ? -6.048  11.479  -2.995  1.00 0.00 ? 10 VAL A HB   1  
ATOM 108   H HG11 . VAL A 1 7  ? -5.621  12.297  -5.171  1.00 0.00 ? 10 VAL A HG11 1  
ATOM 109   H HG12 . VAL A 1 7  ? -4.292  13.310  -4.610  1.00 0.00 ? 10 VAL A HG12 1  
ATOM 110   H HG13 . VAL A 1 7  ? -5.951  13.706  -4.164  1.00 0.00 ? 10 VAL A HG13 1  
ATOM 111   H HG21 . VAL A 1 7  ? -3.941  10.412  -2.372  1.00 0.00 ? 10 VAL A HG21 1  
ATOM 112   H HG22 . VAL A 1 7  ? -3.055  11.577  -3.357  1.00 0.00 ? 10 VAL A HG22 1  
ATOM 113   H HG23 . VAL A 1 7  ? -4.152  10.427  -4.123  1.00 0.00 ? 10 VAL A HG23 1  
ATOM 114   N N    . PRO A 1 8  ? -3.490  14.640  -0.900  1.00 0.00 ? 11 PRO A N    1  
ATOM 115   C CA   . PRO A 1 8  ? -2.378  15.602  -0.886  1.00 0.00 ? 11 PRO A CA   1  
ATOM 116   C C    . PRO A 1 8  ? -1.011  14.916  -0.812  1.00 0.00 ? 11 PRO A C    1  
ATOM 117   O O    . PRO A 1 8  ? -0.922  13.729  -0.502  1.00 0.00 ? 11 PRO A O    1  
ATOM 118   C CB   . PRO A 1 8  ? -2.640  16.418  0.382   1.00 0.00 ? 11 PRO A CB   1  
ATOM 119   C CG   . PRO A 1 8  ? -3.383  15.490  1.277   1.00 0.00 ? 11 PRO A CG   1  
ATOM 120   C CD   . PRO A 1 8  ? -4.234  14.638  0.375   1.00 0.00 ? 11 PRO A CD   1  
ATOM 121   H HA   . PRO A 1 8  ? -2.405  16.251  -1.749  1.00 0.00 ? 11 PRO A HA   1  
ATOM 122   H HB2  . PRO A 1 8  ? -1.700  16.725  0.820   1.00 0.00 ? 11 PRO A HB2  1  
ATOM 123   H HB3  . PRO A 1 8  ? -3.232  17.288  0.138   1.00 0.00 ? 11 PRO A HB3  1  
ATOM 124   H HG2  . PRO A 1 8  ? -2.687  14.873  1.828   1.00 0.00 ? 11 PRO A HG2  1  
ATOM 125   H HG3  . PRO A 1 8  ? -4.006  16.052  1.957   1.00 0.00 ? 11 PRO A HG3  1  
ATOM 126   H HD2  . PRO A 1 8  ? -4.320  13.637  0.770   1.00 0.00 ? 11 PRO A HD2  1  
ATOM 127   H HD3  . PRO A 1 8  ? -5.211  15.078  0.249   1.00 0.00 ? 11 PRO A HD3  1  
ATOM 128   N N    . THR A 1 9  ? 0.048   15.673  -1.092  1.00 0.00 ? 12 THR A N    1  
ATOM 129   C CA   . THR A 1 9  ? 1.419   15.143  -1.059  1.00 0.00 ? 12 THR A CA   1  
ATOM 130   C C    . THR A 1 9  ? 1.697   14.358  0.226   1.00 0.00 ? 12 THR A C    1  
ATOM 131   O O    . THR A 1 9  ? 2.323   13.294  0.185   1.00 0.00 ? 12 THR A O    1  
ATOM 132   C CB   . THR A 1 9  ? 2.434   16.282  -1.200  1.00 0.00 ? 12 THR A CB   1  
ATOM 133   O OG1  . THR A 1 9  ? 1.789   17.481  -1.591  1.00 0.00 ? 12 THR A OG1  1  
ATOM 134   C CG2  . THR A 1 9  ? 3.516   15.999  -2.218  1.00 0.00 ? 12 THR A CG2  1  
ATOM 135   H H    . THR A 1 9  ? -0.087  16.615  -1.329  1.00 0.00 ? 12 THR A H    1  
ATOM 136   H HA   . THR A 1 9  ? 1.532   14.475  -1.898  1.00 0.00 ? 12 THR A HA   1  
ATOM 137   H HB   . THR A 1 9  ? 2.911   16.447  -0.244  1.00 0.00 ? 12 THR A HB   1  
ATOM 138   H HG1  . THR A 1 9  ? 2.410   18.213  -1.539  1.00 0.00 ? 12 THR A HG1  1  
ATOM 139   H HG21 . THR A 1 9  ? 3.227   16.410  -3.173  1.00 0.00 ? 12 THR A HG21 1  
ATOM 140   H HG22 . THR A 1 9  ? 3.653   14.932  -2.312  1.00 0.00 ? 12 THR A HG22 1  
ATOM 141   H HG23 . THR A 1 9  ? 4.441   16.453  -1.895  1.00 0.00 ? 12 THR A HG23 1  
ATOM 142   N N    . ASN A 1 10 ? 1.231   14.883  1.363   1.00 0.00 ? 13 ASN A N    1  
ATOM 143   C CA   . ASN A 1 10 ? 1.431   14.225  2.660   1.00 0.00 ? 13 ASN A CA   1  
ATOM 144   C C    . ASN A 1 10 ? 0.666   12.908  2.751   1.00 0.00 ? 13 ASN A C    1  
ATOM 145   O O    . ASN A 1 10 ? 1.024   12.020  3.520   1.00 0.00 ? 13 ASN A O    1  
ATOM 146   C CB   . ASN A 1 10 ? 1.021   15.154  3.809   1.00 0.00 ? 13 ASN A CB   1  
ATOM 147   C CG   . ASN A 1 10 ? 1.559   16.562  3.643   1.00 0.00 ? 13 ASN A CG   1  
ATOM 148   O OD1  . ASN A 1 10 ? 1.088   17.319  2.798   1.00 0.00 ? 13 ASN A OD1  1  
ATOM 149   N ND2  . ASN A 1 10 ? 2.550   16.921  4.446   1.00 0.00 ? 13 ASN A ND2  1  
ATOM 150   H H    . ASN A 1 10 ? 0.742   15.733  1.329   1.00 0.00 ? 13 ASN A H    1  
ATOM 151   H HA   . ASN A 1 10 ? 2.469   14.003  2.745   1.00 0.00 ? 13 ASN A HA   1  
ATOM 152   H HB2  . ASN A 1 10 ? -0.057  15.208  3.853   1.00 0.00 ? 13 ASN A HB2  1  
ATOM 153   H HB3  . ASN A 1 10 ? 1.394   14.753  4.739   1.00 0.00 ? 13 ASN A HB3  1  
ATOM 154   H HD21 . ASN A 1 10 ? 2.881   16.268  5.096   1.00 0.00 ? 13 ASN A HD21 1  
ATOM 155   H HD22 . ASN A 1 10 ? 2.908   17.827  4.355   1.00 0.00 ? 13 ASN A HD22 1  
ATOM 156   N N    . ILE A 1 11 ? -0.374  12.796  1.948   1.00 0.00 ? 14 ILE A N    1  
ATOM 157   C CA   . ILE A 1 11 ? -1.197  11.598  1.903   1.00 0.00 ? 14 ILE A CA   1  
ATOM 158   C C    . ILE A 1 11 ? -0.761  10.700  0.744   1.00 0.00 ? 14 ILE A C    1  
ATOM 159   O O    . ILE A 1 11 ? -0.600  9.492   0.914   1.00 0.00 ? 14 ILE A O    1  
ATOM 160   C CB   . ILE A 1 11 ? -2.686  11.982  1.762   1.00 0.00 ? 14 ILE A CB   1  
ATOM 161   C CG1  . ILE A 1 11 ? -3.347  12.067  3.139   1.00 0.00 ? 14 ILE A CG1  1  
ATOM 162   C CG2  . ILE A 1 11 ? -3.441  11.000  0.870   1.00 0.00 ? 14 ILE A CG2  1  
ATOM 163   C CD1  . ILE A 1 11 ? -4.747  12.645  3.106   1.00 0.00 ? 14 ILE A CD1  1  
ATOM 164   H H    . ILE A 1 11 ? -0.590  13.540  1.355   1.00 0.00 ? 14 ILE A H    1  
ATOM 165   H HA   . ILE A 1 11 ? -1.065  11.063  2.831   1.00 0.00 ? 14 ILE A HA   1  
ATOM 166   H HB   . ILE A 1 11 ? -2.721  12.955  1.299   1.00 0.00 ? 14 ILE A HB   1  
ATOM 167   H HG12 . ILE A 1 11 ? -3.410  11.075  3.562   1.00 0.00 ? 14 ILE A HG12 1  
ATOM 168   H HG13 . ILE A 1 11 ? -2.744  12.690  3.783   1.00 0.00 ? 14 ILE A HG13 1  
ATOM 169   H HG21 . ILE A 1 11 ? -3.118  11.119  -0.154  1.00 0.00 ? 14 ILE A HG21 1  
ATOM 170   H HG22 . ILE A 1 11 ? -4.502  11.196  0.938   1.00 0.00 ? 14 ILE A HG22 1  
ATOM 171   H HG23 . ILE A 1 11 ? -3.240  9.990   1.196   1.00 0.00 ? 14 ILE A HG23 1  
ATOM 172   H HD11 . ILE A 1 11 ? -5.279  12.254  2.251   1.00 0.00 ? 14 ILE A HD11 1  
ATOM 173   H HD12 . ILE A 1 11 ? -4.692  13.721  3.034   1.00 0.00 ? 14 ILE A HD12 1  
ATOM 174   H HD13 . ILE A 1 11 ? -5.271  12.372  4.011   1.00 0.00 ? 14 ILE A HD13 1  
ATOM 175   N N    . MET A 1 12 ? -0.556  11.308  -0.427  1.00 0.00 ? 15 MET A N    1  
ATOM 176   C CA   . MET A 1 12 ? -0.120  10.587  -1.614  1.00 0.00 ? 15 MET A CA   1  
ATOM 177   C C    . MET A 1 12 ? 1.109   9.737   -1.303  1.00 0.00 ? 15 MET A C    1  
ATOM 178   O O    . MET A 1 12 ? 1.109   8.531   -1.545  1.00 0.00 ? 15 MET A O    1  
ATOM 179   C CB   . MET A 1 12 ? 0.186   11.581  -2.737  1.00 0.00 ? 15 MET A CB   1  
ATOM 180   C CG   . MET A 1 12 ? -0.561  11.292  -4.028  1.00 0.00 ? 15 MET A CG   1  
ATOM 181   S SD   . MET A 1 12 ? 0.537   10.810  -5.374  1.00 0.00 ? 15 MET A SD   1  
ATOM 182   C CE   . MET A 1 12 ? 0.225   12.121  -6.554  1.00 0.00 ? 15 MET A CE   1  
ATOM 183   H H    . MET A 1 12 ? -0.691  12.283  -0.493  1.00 0.00 ? 15 MET A H    1  
ATOM 184   H HA   . MET A 1 12 ? -0.924  9.936   -1.924  1.00 0.00 ? 15 MET A HA   1  
ATOM 185   H HB2  . MET A 1 12 ? -0.086  12.573  -2.407  1.00 0.00 ? 15 MET A HB2  1  
ATOM 186   H HB3  . MET A 1 12 ? 1.242   11.559  -2.942  1.00 0.00 ? 15 MET A HB3  1  
ATOM 187   H HG2  . MET A 1 12 ? -1.262  10.491  -3.850  1.00 0.00 ? 15 MET A HG2  1  
ATOM 188   H HG3  . MET A 1 12 ? -1.100  12.180  -4.320  1.00 0.00 ? 15 MET A HG3  1  
ATOM 189   H HE1  . MET A 1 12 ? 0.308   13.079  -6.061  1.00 0.00 ? 15 MET A HE1  1  
ATOM 190   H HE2  . MET A 1 12 ? -0.770  12.011  -6.961  1.00 0.00 ? 15 MET A HE2  1  
ATOM 191   H HE3  . MET A 1 12 ? 0.949   12.065  -7.354  1.00 0.00 ? 15 MET A HE3  1  
ATOM 192   N N    . ASN A 1 13 ? 2.145   10.369  -0.744  1.00 0.00 ? 16 ASN A N    1  
ATOM 193   C CA   . ASN A 1 13 ? 3.371   9.658   -0.378  1.00 0.00 ? 16 ASN A CA   1  
ATOM 194   C C    . ASN A 1 13 ? 3.054   8.490   0.555   1.00 0.00 ? 16 ASN A C    1  
ATOM 195   O O    . ASN A 1 13 ? 3.521   7.369   0.346   1.00 0.00 ? 16 ASN A O    1  
ATOM 196   C CB   . ASN A 1 13 ? 4.369   10.613  0.289   1.00 0.00 ? 16 ASN A CB   1  
ATOM 197   C CG   . ASN A 1 13 ? 5.105   11.483  -0.711  1.00 0.00 ? 16 ASN A CG   1  
ATOM 198   O OD1  . ASN A 1 13 ? 6.147   11.101  -1.233  1.00 0.00 ? 16 ASN A OD1  1  
ATOM 199   N ND2  . ASN A 1 13 ? 4.567   12.664  -0.983  1.00 0.00 ? 16 ASN A ND2  1  
ATOM 200   H H    . ASN A 1 13 ? 2.077   11.330  -0.558  1.00 0.00 ? 16 ASN A H    1  
ATOM 201   H HA   . ASN A 1 13 ? 3.807   9.265   -1.281  1.00 0.00 ? 16 ASN A HA   1  
ATOM 202   H HB2  . ASN A 1 13 ? 3.840   11.258  0.974   1.00 0.00 ? 16 ASN A HB2  1  
ATOM 203   H HB3  . ASN A 1 13 ? 5.099   10.036  0.838   1.00 0.00 ? 16 ASN A HB3  1  
ATOM 204   H HD21 . ASN A 1 13 ? 3.729   12.910  -0.528  1.00 0.00 ? 16 ASN A HD21 1  
ATOM 205   H HD22 . ASN A 1 13 ? 5.029   13.241  -1.625  1.00 0.00 ? 16 ASN A HD22 1  
ATOM 206   N N    . LEU A 1 14 ? 2.232   8.761   1.567   1.00 0.00 ? 17 LEU A N    1  
ATOM 207   C CA   . LEU A 1 14 ? 1.820   7.734   2.523   1.00 0.00 ? 17 LEU A CA   1  
ATOM 208   C C    . LEU A 1 14 ? 1.020   6.647   1.810   1.00 0.00 ? 17 LEU A C    1  
ATOM 209   O O    . LEU A 1 14 ? 1.347   5.462   1.905   1.00 0.00 ? 17 LEU A O    1  
ATOM 210   C CB   . LEU A 1 14 ? 0.988   8.353   3.653   1.00 0.00 ? 17 LEU A CB   1  
ATOM 211   C CG   . LEU A 1 14 ? 1.775   9.210   4.647   1.00 0.00 ? 17 LEU A CG   1  
ATOM 212   C CD1  . LEU A 1 14 ? 0.851   9.771   5.714   1.00 0.00 ? 17 LEU A CD1  1  
ATOM 213   C CD2  . LEU A 1 14 ? 2.892   8.399   5.287   1.00 0.00 ? 17 LEU A CD2  1  
ATOM 214   H H    . LEU A 1 14 ? 1.881   9.670   1.661   1.00 0.00 ? 17 LEU A H    1  
ATOM 215   H HA   . LEU A 1 14 ? 2.712   7.291   2.939   1.00 0.00 ? 17 LEU A HA   1  
ATOM 216   H HB2  . LEU A 1 14 ? 0.219   8.969   3.210   1.00 0.00 ? 17 LEU A HB2  1  
ATOM 217   H HB3  . LEU A 1 14 ? 0.513   7.553   4.201   1.00 0.00 ? 17 LEU A HB3  1  
ATOM 218   H HG   . LEU A 1 14 ? 2.221   10.043  4.122   1.00 0.00 ? 17 LEU A HG   1  
ATOM 219   H HD11 . LEU A 1 14 ? 0.132   9.017   5.999   1.00 0.00 ? 17 LEU A HD11 1  
ATOM 220   H HD12 . LEU A 1 14 ? 0.332   10.634  5.322   1.00 0.00 ? 17 LEU A HD12 1  
ATOM 221   H HD13 . LEU A 1 14 ? 1.431   10.061  6.576   1.00 0.00 ? 17 LEU A HD13 1  
ATOM 222   H HD21 . LEU A 1 14 ? 3.669   8.220   4.558   1.00 0.00 ? 17 LEU A HD21 1  
ATOM 223   H HD22 . LEU A 1 14 ? 2.499   7.455   5.633   1.00 0.00 ? 17 LEU A HD22 1  
ATOM 224   H HD23 . LEU A 1 14 ? 3.301   8.947   6.122   1.00 0.00 ? 17 LEU A HD23 1  
ATOM 225   N N    . LEU A 1 15 ? -0.010  7.062   1.070   1.00 0.00 ? 18 LEU A N    1  
ATOM 226   C CA   . LEU A 1 15 ? -0.839  6.127   0.311   1.00 0.00 ? 18 LEU A CA   1  
ATOM 227   C C    . LEU A 1 15 ? 0.036   5.307   -0.635  1.00 0.00 ? 18 LEU A C    1  
ATOM 228   O O    . LEU A 1 15 ? -0.066  4.076   -0.683  1.00 0.00 ? 18 LEU A O    1  
ATOM 229   C CB   . LEU A 1 15 ? -1.923  6.896   -0.464  1.00 0.00 ? 18 LEU A CB   1  
ATOM 230   C CG   . LEU A 1 15 ? -2.267  6.357   -1.857  1.00 0.00 ? 18 LEU A CG   1  
ATOM 231   C CD1  . LEU A 1 15 ? -3.455  5.414   -1.787  1.00 0.00 ? 18 LEU A CD1  1  
ATOM 232   C CD2  . LEU A 1 15 ? -2.555  7.504   -2.811  1.00 0.00 ? 18 LEU A CD2  1  
ATOM 233   H H    . LEU A 1 15 ? -0.205  8.030   1.018   1.00 0.00 ? 18 LEU A H    1  
ATOM 234   H HA   . LEU A 1 15 ? -1.311  5.455   1.012   1.00 0.00 ? 18 LEU A HA   1  
ATOM 235   H HB2  . LEU A 1 15 ? -2.825  6.892   0.130   1.00 0.00 ? 18 LEU A HB2  1  
ATOM 236   H HB3  . LEU A 1 15 ? -1.594  7.920   -0.573  1.00 0.00 ? 18 LEU A HB3  1  
ATOM 237   H HG   . LEU A 1 15 ? -1.426  5.802   -2.245  1.00 0.00 ? 18 LEU A HG   1  
ATOM 238   H HD11 . LEU A 1 15 ? -3.826  5.228   -2.784  1.00 0.00 ? 18 LEU A HD11 1  
ATOM 239   H HD12 . LEU A 1 15 ? -4.236  5.862   -1.190  1.00 0.00 ? 18 LEU A HD12 1  
ATOM 240   H HD13 . LEU A 1 15 ? -3.149  4.482   -1.337  1.00 0.00 ? 18 LEU A HD13 1  
ATOM 241   H HD21 . LEU A 1 15 ? -1.658  8.089   -2.950  1.00 0.00 ? 18 LEU A HD21 1  
ATOM 242   H HD22 . LEU A 1 15 ? -3.333  8.129   -2.397  1.00 0.00 ? 18 LEU A HD22 1  
ATOM 243   H HD23 . LEU A 1 15 ? -2.880  7.108   -3.761  1.00 0.00 ? 18 LEU A HD23 1  
ATOM 244   N N    . PHE A 1 16 ? 0.912   5.999   -1.368  1.00 0.00 ? 19 PHE A N    1  
ATOM 245   C CA   . PHE A 1 16 ? 1.832   5.352   -2.301  1.00 0.00 ? 19 PHE A CA   1  
ATOM 246   C C    . PHE A 1 16 ? 2.696   4.322   -1.576  1.00 0.00 ? 19 PHE A C    1  
ATOM 247   O O    . PHE A 1 16 ? 2.918   3.224   -2.083  1.00 0.00 ? 19 PHE A O    1  
ATOM 248   C CB   . PHE A 1 16 ? 2.721   6.399   -2.982  1.00 0.00 ? 19 PHE A CB   1  
ATOM 249   C CG   . PHE A 1 16 ? 2.622   6.389   -4.479  1.00 0.00 ? 19 PHE A CG   1  
ATOM 250   C CD1  . PHE A 1 16 ? 3.293   5.433   -5.224  1.00 0.00 ? 19 PHE A CD1  1  
ATOM 251   C CD2  . PHE A 1 16 ? 1.856   7.334   -5.139  1.00 0.00 ? 19 PHE A CD2  1  
ATOM 252   C CE1  . PHE A 1 16 ? 3.201   5.422   -6.602  1.00 0.00 ? 19 PHE A CE1  1  
ATOM 253   C CE2  . PHE A 1 16 ? 1.760   7.328   -6.518  1.00 0.00 ? 19 PHE A CE2  1  
ATOM 254   C CZ   . PHE A 1 16 ? 2.434   6.370   -7.250  1.00 0.00 ? 19 PHE A CZ   1  
ATOM 255   H H    . PHE A 1 16 ? 0.949   6.979   -1.267  1.00 0.00 ? 19 PHE A H    1  
ATOM 256   H HA   . PHE A 1 16 ? 1.244   4.845   -3.051  1.00 0.00 ? 19 PHE A HA   1  
ATOM 257   H HB2  . PHE A 1 16 ? 2.434   7.381   -2.642  1.00 0.00 ? 19 PHE A HB2  1  
ATOM 258   H HB3  . PHE A 1 16 ? 3.752   6.223   -2.713  1.00 0.00 ? 19 PHE A HB3  1  
ATOM 259   H HD1  . PHE A 1 16 ? 3.892   4.692   -4.718  1.00 0.00 ? 19 PHE A HD1  1  
ATOM 260   H HD2  . PHE A 1 16 ? 1.330   8.084   -4.567  1.00 0.00 ? 19 PHE A HD2  1  
ATOM 261   H HE1  . PHE A 1 16 ? 3.729   4.672   -7.173  1.00 0.00 ? 19 PHE A HE1  1  
ATOM 262   H HE2  . PHE A 1 16 ? 1.159   8.071   -7.022  1.00 0.00 ? 19 PHE A HE2  1  
ATOM 263   H HZ   . PHE A 1 16 ? 2.361   6.362   -8.327  1.00 0.00 ? 19 PHE A HZ   1  
ATOM 264   N N    . ASN A 1 17 ? 3.165   4.680   -0.376  1.00 0.00 ? 20 ASN A N    1  
ATOM 265   C CA   . ASN A 1 17 ? 3.988   3.782   0.425   1.00 0.00 ? 20 ASN A CA   1  
ATOM 266   C C    . ASN A 1 17 ? 3.147   2.632   0.967   1.00 0.00 ? 20 ASN A C    1  
ATOM 267   O O    . ASN A 1 17 ? 3.536   1.467   0.858   1.00 0.00 ? 20 ASN A O    1  
ATOM 268   C CB   . ASN A 1 17 ? 4.645   4.550   1.573   1.00 0.00 ? 20 ASN A CB   1  
ATOM 269   C CG   . ASN A 1 17 ? 6.075   4.116   1.819   1.00 0.00 ? 20 ASN A CG   1  
ATOM 270   O OD1  . ASN A 1 17 ? 6.440   3.749   2.932   1.00 0.00 ? 20 ASN A OD1  1  
ATOM 271   N ND2  . ASN A 1 17 ? 6.893   4.154   0.777   1.00 0.00 ? 20 ASN A ND2  1  
ATOM 272   H H    . ASN A 1 17 ? 2.937   5.567   -0.016  1.00 0.00 ? 20 ASN A H    1  
ATOM 273   H HA   . ASN A 1 17 ? 4.757   3.374   -0.215  1.00 0.00 ? 20 ASN A HA   1  
ATOM 274   H HB2  . ASN A 1 17 ? 4.644   5.604   1.341   1.00 0.00 ? 20 ASN A HB2  1  
ATOM 275   H HB3  . ASN A 1 17 ? 4.079   4.384   2.474   1.00 0.00 ? 20 ASN A HB3  1  
ATOM 276   H HD21 . ASN A 1 17 ? 6.537   4.456   -0.084  1.00 0.00 ? 20 ASN A HD21 1  
ATOM 277   H HD22 . ASN A 1 17 ? 7.821   3.875   0.913   1.00 0.00 ? 20 ASN A HD22 1  
ATOM 278   N N    . ILE A 1 18 ? 1.978   2.959   1.524   1.00 0.00 ? 21 ILE A N    1  
ATOM 279   C CA   . ILE A 1 18 ? 1.072   1.938   2.049   1.00 0.00 ? 21 ILE A CA   1  
ATOM 280   C C    . ILE A 1 18 ? 0.775   0.913   0.961   1.00 0.00 ? 21 ILE A C    1  
ATOM 281   O O    . ILE A 1 18 ? 1.062   -0.274  1.126   1.00 0.00 ? 21 ILE A O    1  
ATOM 282   C CB   . ILE A 1 18 ? -0.249  2.550   2.575   1.00 0.00 ? 21 ILE A CB   1  
ATOM 283   C CG1  . ILE A 1 18 ? -0.020  3.215   3.934   1.00 0.00 ? 21 ILE A CG1  1  
ATOM 284   C CG2  . ILE A 1 18 ? -1.338  1.489   2.684   1.00 0.00 ? 21 ILE A CG2  1  
ATOM 285   C CD1  . ILE A 1 18 ? 0.468   2.258   5.003   1.00 0.00 ? 21 ILE A CD1  1  
ATOM 286   H H    . ILE A 1 18 ? 1.712   3.911   1.562   1.00 0.00 ? 21 ILE A H    1  
ATOM 287   H HA   . ILE A 1 18 ? 1.568   1.435   2.867   1.00 0.00 ? 21 ILE A HA   1  
ATOM 288   H HB   . ILE A 1 18 ? -0.579  3.298   1.869   1.00 0.00 ? 21 ILE A HB   1  
ATOM 289   H HG12 . ILE A 1 18 ? 0.717   3.995   3.827   1.00 0.00 ? 21 ILE A HG12 1  
ATOM 290   H HG13 . ILE A 1 18 ? -0.949  3.647   4.276   1.00 0.00 ? 21 ILE A HG13 1  
ATOM 291   H HG21 . ILE A 1 18 ? -0.936  0.608   3.163   1.00 0.00 ? 21 ILE A HG21 1  
ATOM 292   H HG22 . ILE A 1 18 ? -1.693  1.231   1.696   1.00 0.00 ? 21 ILE A HG22 1  
ATOM 293   H HG23 . ILE A 1 18 ? -2.159  1.875   3.271   1.00 0.00 ? 21 ILE A HG23 1  
ATOM 294   H HD11 . ILE A 1 18 ? 1.547   2.224   4.990   1.00 0.00 ? 21 ILE A HD11 1  
ATOM 295   H HD12 . ILE A 1 18 ? 0.074   1.271   4.808   1.00 0.00 ? 21 ILE A HD12 1  
ATOM 296   H HD13 . ILE A 1 18 ? 0.130   2.595   5.971   1.00 0.00 ? 21 ILE A HD13 1  
ATOM 297   N N    . ALA A 1 19 ? 0.238   1.381   -0.167  1.00 0.00 ? 22 ALA A N    1  
ATOM 298   C CA   . ALA A 1 19 ? -0.051  0.497   -1.292  1.00 0.00 ? 22 ALA A CA   1  
ATOM 299   C C    . ALA A 1 19 ? 1.209   -0.276  -1.693  1.00 0.00 ? 22 ALA A C    1  
ATOM 300   O O    . ALA A 1 19 ? 1.144   -1.454  -2.052  1.00 0.00 ? 22 ALA A O    1  
ATOM 301   C CB   . ALA A 1 19 ? -0.594  1.299   -2.468  1.00 0.00 ? 22 ALA A CB   1  
ATOM 302   H H    . ALA A 1 19 ? 0.060   2.348   -0.253  1.00 0.00 ? 22 ALA A H    1  
ATOM 303   H HA   . ALA A 1 19 ? -0.808  -0.208  -0.978  1.00 0.00 ? 22 ALA A HA   1  
ATOM 304   H HB1  . ALA A 1 19 ? -1.434  1.893   -2.141  1.00 0.00 ? 22 ALA A HB1  1  
ATOM 305   H HB2  . ALA A 1 19 ? -0.914  0.623   -3.248  1.00 0.00 ? 22 ALA A HB2  1  
ATOM 306   H HB3  . ALA A 1 19 ? 0.181   1.949   -2.850  1.00 0.00 ? 22 ALA A HB3  1  
ATOM 307   N N    . LYS A 1 20 ? 2.358   0.399   -1.609  1.00 0.00 ? 23 LYS A N    1  
ATOM 308   C CA   . LYS A 1 20 ? 3.644   -0.210  -1.940  1.00 0.00 ? 23 LYS A CA   1  
ATOM 309   C C    . LYS A 1 20 ? 3.944   -1.390  -1.017  1.00 0.00 ? 23 LYS A C    1  
ATOM 310   O O    . LYS A 1 20 ? 4.157   -2.508  -1.481  1.00 0.00 ? 23 LYS A O    1  
ATOM 311   C CB   . LYS A 1 20 ? 4.769   0.828   -1.838  1.00 0.00 ? 23 LYS A CB   1  
ATOM 312   C CG   . LYS A 1 20 ? 5.596   0.970   -3.106  1.00 0.00 ? 23 LYS A CG   1  
ATOM 313   C CD   . LYS A 1 20 ? 6.147   -0.372  -3.573  1.00 0.00 ? 23 LYS A CD   1  
ATOM 314   C CE   . LYS A 1 20 ? 6.636   -0.310  -5.011  1.00 0.00 ? 23 LYS A CE   1  
ATOM 315   N NZ   . LYS A 1 20 ? 6.716   -1.668  -5.628  1.00 0.00 ? 23 LYS A NZ   1  
ATOM 316   H H    . LYS A 1 20 ? 2.342   1.331   -1.303  1.00 0.00 ? 23 LYS A H    1  
ATOM 317   H HA   . LYS A 1 20 ? 3.586   -0.571  -2.952  1.00 0.00 ? 23 LYS A HA   1  
ATOM 318   H HB2  . LYS A 1 20 ? 4.335   1.789   -1.612  1.00 0.00 ? 23 LYS A HB2  1  
ATOM 319   H HB3  . LYS A 1 20 ? 5.432   0.549   -1.031  1.00 0.00 ? 23 LYS A HB3  1  
ATOM 320   H HG2  . LYS A 1 20 ? 4.971   1.387   -3.881  1.00 0.00 ? 23 LYS A HG2  1  
ATOM 321   H HG3  . LYS A 1 20 ? 6.421   1.640   -2.910  1.00 0.00 ? 23 LYS A HG3  1  
ATOM 322   H HD2  . LYS A 1 20 ? 6.972   -0.652  -2.935  1.00 0.00 ? 23 LYS A HD2  1  
ATOM 323   H HD3  . LYS A 1 20 ? 5.367   -1.116  -3.499  1.00 0.00 ? 23 LYS A HD3  1  
ATOM 324   H HE2  . LYS A 1 20 ? 5.951   0.300   -5.585  1.00 0.00 ? 23 LYS A HE2  1  
ATOM 325   H HE3  . LYS A 1 20 ? 7.618   0.143   -5.025  1.00 0.00 ? 23 LYS A HE3  1  
ATOM 326   H HZ1  . LYS A 1 20 ? 7.316   -1.642  -6.479  1.00 0.00 ? 23 LYS A HZ1  1  
ATOM 327   H HZ2  . LYS A 1 20 ? 5.766   -1.996  -5.898  1.00 0.00 ? 23 LYS A HZ2  1  
ATOM 328   H HZ3  . LYS A 1 20 ? 7.124   -2.346  -4.952  1.00 0.00 ? 23 LYS A HZ3  1  
ATOM 329   N N    . ALA A 1 21 ? 3.966   -1.133  0.288   1.00 0.00 ? 24 ALA A N    1  
ATOM 330   C CA   . ALA A 1 21 ? 4.251   -2.176  1.270   1.00 0.00 ? 24 ALA A CA   1  
ATOM 331   C C    . ALA A 1 21 ? 3.108   -3.189  1.388   1.00 0.00 ? 24 ALA A C    1  
ATOM 332   O O    . ALA A 1 21 ? 3.355   -4.385  1.581   1.00 0.00 ? 24 ALA A O    1  
ATOM 333   C CB   . ALA A 1 21 ? 4.550   -1.551  2.626   1.00 0.00 ? 24 ALA A CB   1  
ATOM 334   H H    . ALA A 1 21 ? 3.790   -0.213  0.598   1.00 0.00 ? 24 ALA A H    1  
ATOM 335   H HA   . ALA A 1 21 ? 5.139   -2.699  0.941   1.00 0.00 ? 24 ALA A HA   1  
ATOM 336   H HB1  . ALA A 1 21 ? 5.055   -2.271  3.252   1.00 0.00 ? 24 ALA A HB1  1  
ATOM 337   H HB2  . ALA A 1 21 ? 3.625   -1.249  3.096   1.00 0.00 ? 24 ALA A HB2  1  
ATOM 338   H HB3  . ALA A 1 21 ? 5.183   -0.685  2.491   1.00 0.00 ? 24 ALA A HB3  1  
ATOM 339   N N    . LYS A 1 22 ? 1.863   -2.720  1.270   1.00 0.00 ? 25 LYS A N    1  
ATOM 340   C CA   . LYS A 1 22 ? 0.706   -3.603  1.370   1.00 0.00 ? 25 LYS A CA   1  
ATOM 341   C C    . LYS A 1 22 ? 0.672   -4.594  0.213   1.00 0.00 ? 25 LYS A C    1  
ATOM 342   O O    . LYS A 1 22 ? 0.460   -5.789  0.425   1.00 0.00 ? 25 LYS A O    1  
ATOM 343   C CB   . LYS A 1 22 ? -0.591  -2.792  1.421   1.00 0.00 ? 25 LYS A CB   1  
ATOM 344   C CG   . LYS A 1 22 ? -1.423  -3.067  2.663   1.00 0.00 ? 25 LYS A CG   1  
ATOM 345   C CD   . LYS A 1 22 ? -2.670  -3.877  2.335   1.00 0.00 ? 25 LYS A CD   1  
ATOM 346   C CE   . LYS A 1 22 ? -2.948  -4.933  3.394   1.00 0.00 ? 25 LYS A CE   1  
ATOM 347   N NZ   . LYS A 1 22 ? -4.086  -5.817  3.009   1.00 0.00 ? 25 LYS A NZ   1  
ATOM 348   H H    . LYS A 1 22 ? 1.718   -1.759  1.110   1.00 0.00 ? 25 LYS A H    1  
ATOM 349   H HA   . LYS A 1 22 ? 0.803   -4.161  2.291   1.00 0.00 ? 25 LYS A HA   1  
ATOM 350   H HB2  . LYS A 1 22 ? -0.346  -1.739  1.407   1.00 0.00 ? 25 LYS A HB2  1  
ATOM 351   H HB3  . LYS A 1 22 ? -1.187  -3.026  0.552   1.00 0.00 ? 25 LYS A HB3  1  
ATOM 352   H HG2  . LYS A 1 22 ? -0.822  -3.616  3.372   1.00 0.00 ? 25 LYS A HG2  1  
ATOM 353   H HG3  . LYS A 1 22 ? -1.719  -2.122  3.096   1.00 0.00 ? 25 LYS A HG3  1  
ATOM 354   H HD2  . LYS A 1 22 ? -3.516  -3.209  2.278   1.00 0.00 ? 25 LYS A HD2  1  
ATOM 355   H HD3  . LYS A 1 22 ? -2.530  -4.365  1.381   1.00 0.00 ? 25 LYS A HD3  1  
ATOM 356   H HE2  . LYS A 1 22 ? -2.059  -5.537  3.523   1.00 0.00 ? 25 LYS A HE2  1  
ATOM 357   H HE3  . LYS A 1 22 ? -3.182  -4.437  4.326   1.00 0.00 ? 25 LYS A HE3  1  
ATOM 358   H HZ1  . LYS A 1 22 ? -3.819  -6.413  2.198   1.00 0.00 ? 25 LYS A HZ1  1  
ATOM 359   H HZ2  . LYS A 1 22 ? -4.915  -5.242  2.747   1.00 0.00 ? 25 LYS A HZ2  1  
ATOM 360   H HZ3  . LYS A 1 22 ? -4.348  -6.433  3.806   1.00 0.00 ? 25 LYS A HZ3  1  
ATOM 361   N N    . ASN A 1 23 ? 0.901   -4.106  -1.008  1.00 0.00 ? 26 ASN A N    1  
ATOM 362   C CA   . ASN A 1 23 ? 0.907   -4.988  -2.176  1.00 0.00 ? 26 ASN A CA   1  
ATOM 363   C C    . ASN A 1 23 ? 2.118   -5.920  -2.126  1.00 0.00 ? 26 ASN A C    1  
ATOM 364   O O    . ASN A 1 23 ? 2.006   -7.109  -2.442  1.00 0.00 ? 26 ASN A O    1  
ATOM 365   C CB   . ASN A 1 23 ? 0.870   -4.181  -3.487  1.00 0.00 ? 26 ASN A CB   1  
ATOM 366   C CG   . ASN A 1 23 ? 2.244   -3.878  -4.054  1.00 0.00 ? 26 ASN A CG   1  
ATOM 367   O OD1  . ASN A 1 23 ? 2.858   -4.712  -4.712  1.00 0.00 ? 26 ASN A OD1  1  
ATOM 368   N ND2  . ASN A 1 23 ? 2.732   -2.679  -3.801  1.00 0.00 ? 26 ASN A ND2  1  
ATOM 369   H H    . ASN A 1 23 ? 1.085   -3.141  -1.120  1.00 0.00 ? 26 ASN A H    1  
ATOM 370   H HA   . ASN A 1 23 ? 0.016   -5.599  -2.122  1.00 0.00 ? 26 ASN A HA   1  
ATOM 371   H HB2  . ASN A 1 23 ? 0.321   -4.742  -4.228  1.00 0.00 ? 26 ASN A HB2  1  
ATOM 372   H HB3  . ASN A 1 23 ? 0.362   -3.245  -3.308  1.00 0.00 ? 26 ASN A HB3  1  
ATOM 373   H HD21 . ASN A 1 23 ? 2.186   -2.059  -3.267  1.00 0.00 ? 26 ASN A HD21 1  
ATOM 374   H HD22 . ASN A 1 23 ? 3.619   -2.462  -4.147  1.00 0.00 ? 26 ASN A HD22 1  
ATOM 375   N N    . LEU A 1 24 ? 3.269   -5.384  -1.703  1.00 0.00 ? 27 LEU A N    1  
ATOM 376   C CA   . LEU A 1 24 ? 4.492   -6.180  -1.586  1.00 0.00 ? 27 LEU A CA   1  
ATOM 377   C C    . LEU A 1 24 ? 4.248   -7.402  -0.713  1.00 0.00 ? 27 LEU A C    1  
ATOM 378   O O    . LEU A 1 24 ? 4.474   -8.540  -1.123  1.00 0.00 ? 27 LEU A O    1  
ATOM 379   C CB   . LEU A 1 24 ? 5.628   -5.333  -0.997  1.00 0.00 ? 27 LEU A CB   1  
ATOM 380   C CG   . LEU A 1 24 ? 6.326   -4.398  -1.984  1.00 0.00 ? 27 LEU A CG   1  
ATOM 381   C CD1  . LEU A 1 24 ? 7.313   -3.498  -1.258  1.00 0.00 ? 27 LEU A CD1  1  
ATOM 382   C CD2  . LEU A 1 24 ? 7.030   -5.195  -3.070  1.00 0.00 ? 27 LEU A CD2  1  
ATOM 383   H H    . LEU A 1 24 ? 3.290   -4.434  -1.449  1.00 0.00 ? 27 LEU A H    1  
ATOM 384   H HA   . LEU A 1 24 ? 4.766   -6.509  -2.560  1.00 0.00 ? 27 LEU A HA   1  
ATOM 385   H HB2  . LEU A 1 24 ? 5.221   -4.735  -0.193  1.00 0.00 ? 27 LEU A HB2  1  
ATOM 386   H HB3  . LEU A 1 24 ? 6.370   -6.001  -0.584  1.00 0.00 ? 27 LEU A HB3  1  
ATOM 387   H HG   . LEU A 1 24 ? 5.587   -3.766  -2.453  1.00 0.00 ? 27 LEU A HG   1  
ATOM 388   H HD11 . LEU A 1 24 ? 6.805   -2.611  -0.911  1.00 0.00 ? 27 LEU A HD11 1  
ATOM 389   H HD12 . LEU A 1 24 ? 8.108   -3.217  -1.934  1.00 0.00 ? 27 LEU A HD12 1  
ATOM 390   H HD13 . LEU A 1 24 ? 7.730   -4.028  -0.414  1.00 0.00 ? 27 LEU A HD13 1  
ATOM 391   H HD21 . LEU A 1 24 ? 6.342   -5.385  -3.881  1.00 0.00 ? 27 LEU A HD21 1  
ATOM 392   H HD22 . LEU A 1 24 ? 7.374   -6.135  -2.661  1.00 0.00 ? 27 LEU A HD22 1  
ATOM 393   H HD23 . LEU A 1 24 ? 7.876   -4.634  -3.438  1.00 0.00 ? 27 LEU A HD23 1  
ATOM 394   N N    . ARG A 1 25 ? 3.771   -7.136  0.487   1.00 0.00 ? 28 ARG A N    1  
ATOM 395   C CA   . ARG A 1 25 ? 3.461   -8.179  1.463   1.00 0.00 ? 28 ARG A CA   1  
ATOM 396   C C    . ARG A 1 25 ? 2.255   -9.017  1.029   1.00 0.00 ? 28 ARG A C    1  
ATOM 397   O O    . ARG A 1 25 ? 2.158   -10.193 1.380   1.00 0.00 ? 28 ARG A O    1  
ATOM 398   C CB   . ARG A 1 25 ? 3.194   -7.548  2.836   1.00 0.00 ? 28 ARG A CB   1  
ATOM 399   C CG   . ARG A 1 25 ? 4.091   -8.089  3.940   1.00 0.00 ? 28 ARG A CG   1  
ATOM 400   C CD   . ARG A 1 25 ? 3.280   -8.615  5.116   1.00 0.00 ? 28 ARG A CD   1  
ATOM 401   N NE   . ARG A 1 25 ? 3.508   -10.045 5.350   1.00 0.00 ? 28 ARG A NE   1  
ATOM 402   C CZ   . ARG A 1 25 ? 2.993   -10.731 6.365   1.00 0.00 ? 28 ARG A CZ   1  
ATOM 403   N NH1  . ARG A 1 25 ? 2.214   -10.139 7.252   1.00 0.00 ? 28 ARG A NH1  1  
ATOM 404   N NH2  . ARG A 1 25 ? 3.263   -12.014 6.491   1.00 0.00 ? 28 ARG A NH2  1  
ATOM 405   H H    . ARG A 1 25 ? 3.615   -6.200  0.719   1.00 0.00 ? 28 ARG A H    1  
ATOM 406   H HA   . ARG A 1 25 ? 4.319   -8.830  1.538   1.00 0.00 ? 28 ARG A HA   1  
ATOM 407   H HB2  . ARG A 1 25 ? 3.351   -6.482  2.766   1.00 0.00 ? 28 ARG A HB2  1  
ATOM 408   H HB3  . ARG A 1 25 ? 2.166   -7.734  3.111   1.00 0.00 ? 28 ARG A HB3  1  
ATOM 409   H HG2  . ARG A 1 25 ? 4.690   -8.891  3.538   1.00 0.00 ? 28 ARG A HG2  1  
ATOM 410   H HG3  . ARG A 1 25 ? 4.738   -7.295  4.285   1.00 0.00 ? 28 ARG A HG3  1  
ATOM 411   H HD2  . ARG A 1 25 ? 3.562   -8.064  6.003   1.00 0.00 ? 28 ARG A HD2  1  
ATOM 412   H HD3  . ARG A 1 25 ? 2.229   -8.454  4.914   1.00 0.00 ? 28 ARG A HD3  1  
ATOM 413   H HE   . ARG A 1 25 ? 4.081   -10.519 4.711   1.00 0.00 ? 28 ARG A HE   1  
ATOM 414   H HH11 . ARG A 1 25 ? 2.006   -9.168  7.164   1.00 0.00 ? 28 ARG A HH11 1  
ATOM 415   H HH12 . ARG A 1 25 ? 1.834   -10.662 8.012   1.00 0.00 ? 28 ARG A HH12 1  
ATOM 416   H HH21 . ARG A 1 25 ? 3.852   -12.468 5.827   1.00 0.00 ? 28 ARG A HH21 1  
ATOM 417   H HH22 . ARG A 1 25 ? 2.879   -12.533 7.251   1.00 0.00 ? 28 ARG A HH22 1  
ATOM 418   N N    . ALA A 1 26 ? 1.348   -8.419  0.253   1.00 0.00 ? 29 ALA A N    1  
ATOM 419   C CA   . ALA A 1 26 ? 0.166   -9.127  -0.226  1.00 0.00 ? 29 ALA A CA   1  
ATOM 420   C C    . ALA A 1 26 ? 0.561   -10.185 -1.246  1.00 0.00 ? 29 ALA A C    1  
ATOM 421   O O    . ALA A 1 26 ? 0.169   -11.345 -1.136  1.00 0.00 ? 29 ALA A O    1  
ATOM 422   C CB   . ALA A 1 26 ? -0.832  -8.145  -0.827  1.00 0.00 ? 29 ALA A CB   1  
ATOM 423   H H    . ALA A 1 26 ? 1.481   -7.487  -0.015  1.00 0.00 ? 29 ALA A H    1  
ATOM 424   H HA   . ALA A 1 26 ? -0.300  -9.612  0.619   1.00 0.00 ? 29 ALA A HA   1  
ATOM 425   H HB1  . ALA A 1 26 ? -0.389  -7.662  -1.685  1.00 0.00 ? 29 ALA A HB1  1  
ATOM 426   H HB2  . ALA A 1 26 ? -1.093  -7.401  -0.090  1.00 0.00 ? 29 ALA A HB2  1  
ATOM 427   H HB3  . ALA A 1 26 ? -1.722  -8.677  -1.133  1.00 0.00 ? 29 ALA A HB3  1  
ATOM 428   N N    . GLN A 1 27 ? 1.360   -9.783  -2.227  1.00 0.00 ? 30 GLN A N    1  
ATOM 429   C CA   . GLN A 1 27 ? 1.817   -10.720 -3.258  1.00 0.00 ? 30 GLN A CA   1  
ATOM 430   C C    . GLN A 1 27 ? 3.005   -11.565 -2.775  1.00 0.00 ? 30 GLN A C    1  
ATOM 431   O O    . GLN A 1 27 ? 3.486   -12.443 -3.493  1.00 0.00 ? 30 GLN A O    1  
ATOM 432   C CB   . GLN A 1 27 ? 2.158   -9.976  -4.558  1.00 0.00 ? 30 GLN A CB   1  
ATOM 433   C CG   . GLN A 1 27 ? 3.637   -9.643  -4.725  1.00 0.00 ? 30 GLN A CG   1  
ATOM 434   C CD   . GLN A 1 27 ? 3.862   -8.281  -5.347  1.00 0.00 ? 30 GLN A CD   1  
ATOM 435   O OE1  . GLN A 1 27 ? 4.449   -8.165  -6.419  1.00 0.00 ? 30 GLN A OE1  1  
ATOM 436   N NE2  . GLN A 1 27 ? 3.394   -7.245  -4.673  1.00 0.00 ? 30 GLN A NE2  1  
ATOM 437   H H    . GLN A 1 27 ? 1.656   -8.839  -2.250  1.00 0.00 ? 30 GLN A H    1  
ATOM 438   H HA   . GLN A 1 27 ? 0.996   -11.397 -3.451  1.00 0.00 ? 30 GLN A HA   1  
ATOM 439   H HB2  . GLN A 1 27 ? 1.857   -10.587 -5.396  1.00 0.00 ? 30 GLN A HB2  1  
ATOM 440   H HB3  . GLN A 1 27 ? 1.598   -9.051  -4.583  1.00 0.00 ? 30 GLN A HB3  1  
ATOM 441   H HG2  . GLN A 1 27 ? 4.111   -9.657  -3.755  1.00 0.00 ? 30 GLN A HG2  1  
ATOM 442   H HG3  . GLN A 1 27 ? 4.093   -10.391 -5.357  1.00 0.00 ? 30 GLN A HG3  1  
ATOM 443   H HE21 . GLN A 1 27 ? 2.935   -7.414  -3.823  1.00 0.00 ? 30 GLN A HE21 1  
ATOM 444   H HE22 . GLN A 1 27 ? 3.519   -6.348  -5.055  1.00 0.00 ? 30 GLN A HE22 1  
ATOM 445   N N    . ALA A 1 28 ? 3.460   -11.314 -1.552  1.00 0.00 ? 31 ALA A N    1  
ATOM 446   C CA   . ALA A 1 28 ? 4.561   -12.067 -0.977  1.00 0.00 ? 31 ALA A CA   1  
ATOM 447   C C    . ALA A 1 28 ? 4.035   -13.072 0.046   1.00 0.00 ? 31 ALA A C    1  
ATOM 448   O O    . ALA A 1 28 ? 4.339   -14.264 -0.026  1.00 0.00 ? 31 ALA A O    1  
ATOM 449   C CB   . ALA A 1 28 ? 5.576   -11.125 -0.340  1.00 0.00 ? 31 ALA A CB   1  
ATOM 450   H H    . ALA A 1 28 ? 3.036   -10.618 -1.018  1.00 0.00 ? 31 ALA A H    1  
ATOM 451   H HA   . ALA A 1 28 ? 5.051   -12.604 -1.776  1.00 0.00 ? 31 ALA A HA   1  
ATOM 452   H HB1  . ALA A 1 28 ? 6.423   -11.694 0.014   1.00 0.00 ? 31 ALA A HB1  1  
ATOM 453   H HB2  . ALA A 1 28 ? 5.116   -10.609 0.490   1.00 0.00 ? 31 ALA A HB2  1  
ATOM 454   H HB3  . ALA A 1 28 ? 5.907   -10.404 -1.073  1.00 0.00 ? 31 ALA A HB3  1  
ATOM 455   N N    . ALA A 1 29 ? 3.240   -12.584 0.997   1.00 0.00 ? 32 ALA A N    1  
ATOM 456   C CA   . ALA A 1 29 ? 2.674   -13.440 2.037   1.00 0.00 ? 32 ALA A CA   1  
ATOM 457   C C    . ALA A 1 29 ? 1.321   -14.053 1.644   1.00 0.00 ? 32 ALA A C    1  
ATOM 458   O O    . ALA A 1 29 ? 0.873   -15.003 2.285   1.00 0.00 ? 32 ALA A O    1  
ATOM 459   C CB   . ALA A 1 29 ? 2.539   -12.654 3.332   1.00 0.00 ? 32 ALA A CB   1  
ATOM 460   H H    . ALA A 1 29 ? 3.030   -11.619 1.003   1.00 0.00 ? 32 ALA A H    1  
ATOM 461   H HA   . ALA A 1 29 ? 3.373   -14.245 2.214   1.00 0.00 ? 32 ALA A HA   1  
ATOM 462   H HB1  . ALA A 1 29 ? 3.481   -12.183 3.565   1.00 0.00 ? 32 ALA A HB1  1  
ATOM 463   H HB2  . ALA A 1 29 ? 2.263   -13.325 4.133   1.00 0.00 ? 32 ALA A HB2  1  
ATOM 464   H HB3  . ALA A 1 29 ? 1.777   -11.898 3.216   1.00 0.00 ? 32 ALA A HB3  1  
ATOM 465   N N    . ALA A 1 30 ? 0.659   -13.516 0.611   1.00 0.00 ? 33 ALA A N    1  
ATOM 466   C CA   . ALA A 1 30 ? -0.646  -14.044 0.199   1.00 0.00 ? 33 ALA A CA   1  
ATOM 467   C C    . ALA A 1 30 ? -0.632  -14.707 -1.187  1.00 0.00 ? 33 ALA A C    1  
ATOM 468   O O    . ALA A 1 30 ? -1.676  -15.151 -1.666  1.00 0.00 ? 33 ALA A O    1  
ATOM 469   C CB   . ALA A 1 30 ? -1.690  -12.937 0.245   1.00 0.00 ? 33 ALA A CB   1  
ATOM 470   H H    . ALA A 1 30 ? 1.042   -12.750 0.129   1.00 0.00 ? 33 ALA A H    1  
ATOM 471   H HA   . ALA A 1 30 ? -0.934  -14.791 0.922   1.00 0.00 ? 33 ALA A HA   1  
ATOM 472   H HB1  . ALA A 1 30 ? -1.461  -12.258 1.052   1.00 0.00 ? 33 ALA A HB1  1  
ATOM 473   H HB2  . ALA A 1 30 ? -2.667  -13.370 0.403   1.00 0.00 ? 33 ALA A HB2  1  
ATOM 474   H HB3  . ALA A 1 30 ? -1.684  -12.398 -0.692  1.00 0.00 ? 33 ALA A HB3  1  
ATOM 475   N N    . ASN A 1 31 ? 0.533   -14.777 -1.833  1.00 0.00 ? 34 ASN A N    1  
ATOM 476   C CA   . ASN A 1 31 ? 0.621   -15.391 -3.160  1.00 0.00 ? 34 ASN A CA   1  
ATOM 477   C C    . ASN A 1 31 ? 0.966   -16.881 -3.081  1.00 0.00 ? 34 ASN A C    1  
ATOM 478   O O    . ASN A 1 31 ? 0.239   -17.715 -3.620  1.00 0.00 ? 34 ASN A O    1  
ATOM 479   C CB   . ASN A 1 31 ? 1.617   -14.622 -4.047  1.00 0.00 ? 34 ASN A CB   1  
ATOM 480   C CG   . ASN A 1 31 ? 2.851   -15.421 -4.428  1.00 0.00 ? 34 ASN A CG   1  
ATOM 481   O OD1  . ASN A 1 31 ? 2.805   -16.275 -5.306  1.00 0.00 ? 34 ASN A OD1  1  
ATOM 482   N ND2  . ASN A 1 31 ? 3.964   -15.146 -3.767  1.00 0.00 ? 34 ASN A ND2  1  
ATOM 483   H H    . ASN A 1 31 ? 1.336   -14.407 -1.420  1.00 0.00 ? 34 ASN A H    1  
ATOM 484   H HA   . ASN A 1 31 ? -0.353  -15.312 -3.601  1.00 0.00 ? 34 ASN A HA   1  
ATOM 485   H HB2  . ASN A 1 31 ? 1.119   -14.328 -4.956  1.00 0.00 ? 34 ASN A HB2  1  
ATOM 486   H HB3  . ASN A 1 31 ? 1.934   -13.736 -3.522  1.00 0.00 ? 34 ASN A HB3  1  
ATOM 487   H HD21 . ASN A 1 31 ? 3.935   -14.451 -3.077  1.00 0.00 ? 34 ASN A HD21 1  
ATOM 488   H HD22 . ASN A 1 31 ? 4.771   -15.648 -3.999  1.00 0.00 ? 34 ASN A HD22 1  
ATOM 489   N N    . ALA A 1 32 ? 2.068   -17.213 -2.414  1.00 0.00 ? 35 ALA A N    1  
ATOM 490   C CA   . ALA A 1 32 ? 2.484   -18.606 -2.284  1.00 0.00 ? 35 ALA A CA   1  
ATOM 491   C C    . ALA A 1 32 ? 2.249   -19.147 -0.867  1.00 0.00 ? 35 ALA A C    1  
ATOM 492   O O    . ALA A 1 32 ? 2.710   -20.238 -0.538  1.00 0.00 ? 35 ALA A O    1  
ATOM 493   C CB   . ALA A 1 32 ? 3.948   -18.750 -2.677  1.00 0.00 ? 35 ALA A CB   1  
ATOM 494   H H    . ALA A 1 32 ? 2.613   -16.510 -2.004  1.00 0.00 ? 35 ALA A H    1  
ATOM 495   H HA   . ALA A 1 32 ? 1.896   -19.190 -2.976  1.00 0.00 ? 35 ALA A HA   1  
ATOM 496   H HB1  . ALA A 1 32 ? 4.110   -18.283 -3.638  1.00 0.00 ? 35 ALA A HB1  1  
ATOM 497   H HB2  . ALA A 1 32 ? 4.204   -19.798 -2.738  1.00 0.00 ? 35 ALA A HB2  1  
ATOM 498   H HB3  . ALA A 1 32 ? 4.570   -18.271 -1.936  1.00 0.00 ? 35 ALA A HB3  1  
ATOM 499   N N    . HIS A 1 33 ? 1.538   -18.370 -0.035  1.00 0.00 ? 36 HIS A N    1  
ATOM 500   C CA   . HIS A 1 33 ? 1.240   -18.753 1.359   1.00 0.00 ? 36 HIS A CA   1  
ATOM 501   C C    . HIS A 1 33 ? 2.470   -19.322 2.098   1.00 0.00 ? 36 HIS A C    1  
ATOM 502   O O    . HIS A 1 33 ? 2.334   -20.071 3.072   1.00 0.00 ? 36 HIS A O    1  
ATOM 503   C CB   . HIS A 1 33 ? 0.064   -19.742 1.403   1.00 0.00 ? 36 HIS A CB   1  
ATOM 504   C CG   . HIS A 1 33 ? 0.387   -21.114 0.899   1.00 0.00 ? 36 HIS A CG   1  
ATOM 505   N ND1  . HIS A 1 33 ? 1.187   -21.997 1.588   1.00 0.00 ? 36 HIS A ND1  1  
ATOM 506   C CD2  . HIS A 1 33 ? 0.006   -21.756 -0.230  1.00 0.00 ? 36 HIS A CD2  1  
ATOM 507   C CE1  . HIS A 1 33 ? 1.285   -23.127 0.907   1.00 0.00 ? 36 HIS A CE1  1  
ATOM 508   N NE2  . HIS A 1 33 ? 0.577   -23.006 -0.202  1.00 0.00 ? 36 HIS A NE2  1  
ATOM 509   H H    . HIS A 1 33 ? 1.203   -17.507 -0.365  1.00 0.00 ? 36 HIS A H    1  
ATOM 510   H HA   . HIS A 1 33 ? 0.943   -17.849 1.874   1.00 0.00 ? 36 HIS A HA   1  
ATOM 511   H HB2  . HIS A 1 33 ? -0.272  -19.840 2.425   1.00 0.00 ? 36 HIS A HB2  1  
ATOM 512   H HB3  . HIS A 1 33 ? -0.745  -19.350 0.804   1.00 0.00 ? 36 HIS A HB3  1  
ATOM 513   H HD1  . HIS A 1 33 ? 1.631   -21.816 2.446   1.00 0.00 ? 36 HIS A HD1  1  
ATOM 514   H HD2  . HIS A 1 33 ? -0.629  -21.357 -1.009  1.00 0.00 ? 36 HIS A HD2  1  
ATOM 515   H HE1  . HIS A 1 33 ? 1.846   -23.999 1.207   1.00 0.00 ? 36 HIS A HE1  1  
ATOM 516   H HE2  . HIS A 1 33 ? 0.591   -23.638 -0.949  1.00 0.00 ? 36 HIS A HE2  1  
ATOM 517   N N    . LEU A 1 34 ? 3.664   -18.947 1.632   1.00 0.00 ? 37 LEU A N    1  
ATOM 518   C CA   . LEU A 1 34 ? 4.928   -19.392 2.238   1.00 0.00 ? 37 LEU A CA   1  
ATOM 519   C C    . LEU A 1 34 ? 6.141   -18.651 1.638   1.00 0.00 ? 37 LEU A C    1  
ATOM 520   O O    . LEU A 1 34 ? 7.271   -19.134 1.712   1.00 0.00 ? 37 LEU A O    1  
ATOM 521   C CB   . LEU A 1 34 ? 5.096   -20.914 2.078   1.00 0.00 ? 37 LEU A CB   1  
ATOM 522   C CG   . LEU A 1 34 ? 5.374   -21.410 0.653   1.00 0.00 ? 37 LEU A CG   1  
ATOM 523   C CD1  . LEU A 1 34 ? 6.842   -21.764 0.485   1.00 0.00 ? 37 LEU A CD1  1  
ATOM 524   C CD2  . LEU A 1 34 ? 4.504   -22.614 0.332   1.00 0.00 ? 37 LEU A CD2  1  
ATOM 525   H H    . LEU A 1 34 ? 3.695   -18.351 0.863   1.00 0.00 ? 37 LEU A H    1  
ATOM 526   H HA   . LEU A 1 34 ? 4.879   -19.161 3.292   1.00 0.00 ? 37 LEU A HA   1  
ATOM 527   H HB2  . LEU A 1 34 ? 5.914   -21.229 2.710   1.00 0.00 ? 37 LEU A HB2  1  
ATOM 528   H HB3  . LEU A 1 34 ? 4.193   -21.389 2.430   1.00 0.00 ? 37 LEU A HB3  1  
ATOM 529   H HG   . LEU A 1 34 ? 5.135   -20.625 -0.050  1.00 0.00 ? 37 LEU A HG   1  
ATOM 530   H HD11 . LEU A 1 34 ? 7.422   -20.859 0.384   1.00 0.00 ? 37 LEU A HD11 1  
ATOM 531   H HD12 . LEU A 1 34 ? 6.967   -22.371 -0.399  1.00 0.00 ? 37 LEU A HD12 1  
ATOM 532   H HD13 . LEU A 1 34 ? 7.181   -22.315 1.350   1.00 0.00 ? 37 LEU A HD13 1  
ATOM 533   H HD21 . LEU A 1 34 ? 4.475   -23.276 1.184   1.00 0.00 ? 37 LEU A HD21 1  
ATOM 534   H HD22 . LEU A 1 34 ? 4.917   -23.139 -0.518  1.00 0.00 ? 37 LEU A HD22 1  
ATOM 535   H HD23 . LEU A 1 34 ? 3.504   -22.282 0.097   1.00 0.00 ? 37 LEU A HD23 1  
ATOM 536   N N    . MET A 1 35 ? 5.905   -17.467 1.060   1.00 0.00 ? 38 MET A N    1  
ATOM 537   C CA   . MET A 1 35 ? 6.967   -16.668 0.463   1.00 0.00 ? 38 MET A CA   1  
ATOM 538   C C    . MET A 1 35 ? 7.522   -15.640 1.461   1.00 0.00 ? 38 MET A C    1  
ATOM 539   O O    . MET A 1 35 ? 8.469   -14.914 1.154   1.00 0.00 ? 38 MET A O    1  
ATOM 540   C CB   . MET A 1 35 ? 6.418   -15.959 -0.777  1.00 0.00 ? 38 MET A CB   1  
ATOM 541   C CG   . MET A 1 35 ? 7.008   -16.449 -2.090  1.00 0.00 ? 38 MET A CG   1  
ATOM 542   S SD   . MET A 1 35 ? 8.331   -15.386 -2.697  1.00 0.00 ? 38 MET A SD   1  
ATOM 543   C CE   . MET A 1 35 ? 7.388   -14.085 -3.488  1.00 0.00 ? 38 MET A CE   1  
ATOM 544   H H    . MET A 1 35 ? 4.998   -17.113 1.040   1.00 0.00 ? 38 MET A H    1  
ATOM 545   H HA   . MET A 1 35 ? 7.762   -17.332 0.169   1.00 0.00 ? 38 MET A HA   1  
ATOM 546   H HB2  . MET A 1 35 ? 5.350   -16.109 -0.814  1.00 0.00 ? 38 MET A HB2  1  
ATOM 547   H HB3  . MET A 1 35 ? 6.616   -14.906 -0.684  1.00 0.00 ? 38 MET A HB3  1  
ATOM 548   H HG2  . MET A 1 35 ? 7.402   -17.445 -1.945  1.00 0.00 ? 38 MET A HG2  1  
ATOM 549   H HG3  . MET A 1 35 ? 6.220   -16.479 -2.831  1.00 0.00 ? 38 MET A HG3  1  
ATOM 550   H HE1  . MET A 1 35 ? 6.457   -13.943 -2.960  1.00 0.00 ? 38 MET A HE1  1  
ATOM 551   H HE2  . MET A 1 35 ? 7.183   -14.360 -4.512  1.00 0.00 ? 38 MET A HE2  1  
ATOM 552   H HE3  . MET A 1 35 ? 7.956   -13.166 -3.469  1.00 0.00 ? 38 MET A HE3  1  
ATOM 553   N N    . ALA A 1 36 ? 6.925   -15.586 2.654   1.00 0.00 ? 39 ALA A N    1  
ATOM 554   C CA   . ALA A 1 36 ? 7.349   -14.656 3.697   1.00 0.00 ? 39 ALA A CA   1  
ATOM 555   C C    . ALA A 1 36 ? 7.718   -15.406 4.983   1.00 0.00 ? 39 ALA A C    1  
ATOM 556   O O    . ALA A 1 36 ? 7.394   -14.968 6.089   1.00 0.00 ? 39 ALA A O    1  
ATOM 557   C CB   . ALA A 1 36 ? 6.242   -13.643 3.957   1.00 0.00 ? 39 ALA A CB   1  
ATOM 558   H H    . ALA A 1 36 ? 6.179   -16.189 2.838   1.00 0.00 ? 39 ALA A H    1  
ATOM 559   H HA   . ALA A 1 36 ? 8.220   -14.124 3.341   1.00 0.00 ? 39 ALA A HA   1  
ATOM 560   H HB1  . ALA A 1 36 ? 6.383   -12.785 3.316   1.00 0.00 ? 39 ALA A HB1  1  
ATOM 561   H HB2  . ALA A 1 36 ? 6.274   -13.330 4.990   1.00 0.00 ? 39 ALA A HB2  1  
ATOM 562   H HB3  . ALA A 1 36 ? 5.282   -14.096 3.745   1.00 0.00 ? 39 ALA A HB3  1  
ATOM 563   N N    . GLN A 1 37 ? 8.389   -16.546 4.825   1.00 0.00 ? 40 GLN A N    1  
ATOM 564   C CA   . GLN A 1 37 ? 8.796   -17.369 5.957   1.00 0.00 ? 40 GLN A CA   1  
ATOM 565   C C    . GLN A 1 37 ? 10.304  -17.279 6.201   1.00 0.00 ? 40 GLN A C    1  
ATOM 566   O O    . GLN A 1 37 ? 10.733  -16.935 7.303   1.00 0.00 ? 40 GLN A O    1  
ATOM 567   C CB   . GLN A 1 37 ? 8.387   -18.824 5.710   1.00 0.00 ? 40 GLN A CB   1  
ATOM 568   C CG   . GLN A 1 37 ? 7.310   -19.328 6.661   1.00 0.00 ? 40 GLN A CG   1  
ATOM 569   C CD   . GLN A 1 37 ? 5.989   -18.603 6.484   1.00 0.00 ? 40 GLN A CD   1  
ATOM 570   O OE1  . GLN A 1 37 ? 5.386   -18.640 5.413   1.00 0.00 ? 40 GLN A OE1  1  
ATOM 571   N NE2  . GLN A 1 37 ? 5.530   -17.937 7.533   1.00 0.00 ? 40 GLN A NE2  1  
ATOM 572   H H    . GLN A 1 37 ? 8.610   -16.847 3.922   1.00 0.00 ? 40 GLN A H    1  
ATOM 573   H HA   . GLN A 1 37 ? 8.283   -17.004 6.831   1.00 0.00 ? 40 GLN A HA   1  
ATOM 574   H HB2  . GLN A 1 37 ? 8.013   -18.913 4.699   1.00 0.00 ? 40 GLN A HB2  1  
ATOM 575   H HB3  . GLN A 1 37 ? 9.257   -19.453 5.816   1.00 0.00 ? 40 GLN A HB3  1  
ATOM 576   H HG2  . GLN A 1 37 ? 7.151   -20.379 6.479   1.00 0.00 ? 40 GLN A HG2  1  
ATOM 577   H HG3  . GLN A 1 37 ? 7.650   -19.186 7.676   1.00 0.00 ? 40 GLN A HG3  1  
ATOM 578   H HE21 . GLN A 1 37 ? 6.058   -17.947 8.358   1.00 0.00 ? 40 GLN A HE21 1  
ATOM 579   H HE22 . GLN A 1 37 ? 4.679   -17.464 7.439   1.00 0.00 ? 40 GLN A HE22 1  
ATOM 580   N N    . ILE A 1 38 ? 11.089  -17.590 5.160   1.00 0.00 ? 41 ILE A N    1  
ATOM 581   C CA   . ILE A 1 38 ? 12.550  -17.556 5.220   1.00 0.00 ? 41 ILE A CA   1  
ATOM 582   C C    . ILE A 1 38 ? 13.099  -18.157 6.526   1.00 0.00 ? 41 ILE A C    1  
ATOM 583   O O    . ILE A 1 38 ? 12.603  -19.231 6.932   1.00 0.00 ? 41 ILE A O    1  
ATOM 584   C CB   . ILE A 1 38 ? 13.084  -16.121 5.004   1.00 0.00 ? 41 ILE A CB   1  
ATOM 585   C CG1  . ILE A 1 38 ? 12.567  -15.164 6.083   1.00 0.00 ? 41 ILE A CG1  1  
ATOM 586   C CG2  . ILE A 1 38 ? 12.703  -15.614 3.620   1.00 0.00 ? 41 ILE A CG2  1  
ATOM 587   C CD1  . ILE A 1 38 ? 13.339  -13.865 6.158   1.00 0.00 ? 41 ILE A CD1  1  
ATOM 588   O OXT  . ILE A 1 38 ? 14.032  -17.569 7.118   1.00 0.00 ? 41 ILE A OXT  1  
ATOM 589   H H    . ILE A 1 38 ? 10.675  -17.846 4.321   1.00 0.00 ? 41 ILE A H    1  
ATOM 590   H HA   . ILE A 1 38 ? 12.912  -18.163 4.402   1.00 0.00 ? 41 ILE A HA   1  
ATOM 591   H HB   . ILE A 1 38 ? 14.153  -16.165 5.056   1.00 0.00 ? 41 ILE A HB   1  
ATOM 592   H HG12 . ILE A 1 38 ? 11.535  -14.925 5.879   1.00 0.00 ? 41 ILE A HG12 1  
ATOM 593   H HG13 . ILE A 1 38 ? 12.635  -15.648 7.047   1.00 0.00 ? 41 ILE A HG13 1  
ATOM 594   H HG21 . ILE A 1 38 ? 13.350  -14.792 3.350   1.00 0.00 ? 41 ILE A HG21 1  
ATOM 595   H HG22 . ILE A 1 38 ? 11.678  -15.277 3.630   1.00 0.00 ? 41 ILE A HG22 1  
ATOM 596   H HG23 . ILE A 1 38 ? 12.815  -16.411 2.901   1.00 0.00 ? 41 ILE A HG23 1  
ATOM 597   H HD11 . ILE A 1 38 ? 14.168  -13.979 6.840   1.00 0.00 ? 41 ILE A HD11 1  
ATOM 598   H HD12 . ILE A 1 38 ? 12.688  -13.079 6.512   1.00 0.00 ? 41 ILE A HD12 1  
ATOM 599   H HD13 . ILE A 1 38 ? 13.711  -13.610 5.177   1.00 0.00 ? 41 ILE A HD13 1  
ATOM 600   N N    . PHE A 1 1  ? -8.143  7.538   6.046   1.00 0.00 ? 4  PHE A N    2  
ATOM 601   C CA   . PHE A 1 1  ? -7.810  6.997   4.692   1.00 0.00 ? 4  PHE A CA   2  
ATOM 602   C C    . PHE A 1 1  ? -8.006  8.056   3.604   1.00 0.00 ? 4  PHE A C    2  
ATOM 603   O O    . PHE A 1 1  ? -8.782  8.996   3.780   1.00 0.00 ? 4  PHE A O    2  
ATOM 604   C CB   . PHE A 1 1  ? -8.699  5.773   4.405   1.00 0.00 ? 4  PHE A CB   2  
ATOM 605   C CG   . PHE A 1 1  ? -10.095 5.880   4.957   1.00 0.00 ? 4  PHE A CG   2  
ATOM 606   C CD1  . PHE A 1 1  ? -10.954 6.877   4.523   1.00 0.00 ? 4  PHE A CD1  2  
ATOM 607   C CD2  . PHE A 1 1  ? -10.547 4.981   5.909   1.00 0.00 ? 4  PHE A CD2  2  
ATOM 608   C CE1  . PHE A 1 1  ? -12.235 6.977   5.030   1.00 0.00 ? 4  PHE A CE1  2  
ATOM 609   C CE2  . PHE A 1 1  ? -11.827 5.076   6.420   1.00 0.00 ? 4  PHE A CE2  2  
ATOM 610   C CZ   . PHE A 1 1  ? -12.672 6.075   5.980   1.00 0.00 ? 4  PHE A CZ   2  
ATOM 611   H H1   . PHE A 1 1  ? -7.369  8.168   6.336   1.00 0.00 ? 4  PHE A H1   2  
ATOM 612   H H2   . PHE A 1 1  ? -8.236  6.732   6.698   1.00 0.00 ? 4  PHE A H2   2  
ATOM 613   H H3   . PHE A 1 1  ? -9.040  8.062   5.968   1.00 0.00 ? 4  PHE A H3   2  
ATOM 614   H HA   . PHE A 1 1  ? -6.775  6.689   4.694   1.00 0.00 ? 4  PHE A HA   2  
ATOM 615   H HB2  . PHE A 1 1  ? -8.779  5.638   3.337   1.00 0.00 ? 4  PHE A HB2  2  
ATOM 616   H HB3  . PHE A 1 1  ? -8.237  4.896   4.836   1.00 0.00 ? 4  PHE A HB3  2  
ATOM 617   H HD1  . PHE A 1 1  ? -10.613 7.584   3.781   1.00 0.00 ? 4  PHE A HD1  2  
ATOM 618   H HD2  . PHE A 1 1  ? -9.887  4.198   6.253   1.00 0.00 ? 4  PHE A HD2  2  
ATOM 619   H HE1  . PHE A 1 1  ? -12.894 7.761   4.684   1.00 0.00 ? 4  PHE A HE1  2  
ATOM 620   H HE2  . PHE A 1 1  ? -12.167 4.368   7.162   1.00 0.00 ? 4  PHE A HE2  2  
ATOM 621   H HZ   . PHE A 1 1  ? -13.674 6.151   6.378   1.00 0.00 ? 4  PHE A HZ   2  
ATOM 622   N N    . THR A 1 2  ? -7.303  7.895   2.481   1.00 0.00 ? 5  THR A N    2  
ATOM 623   C CA   . THR A 1 2  ? -7.404  8.842   1.364   1.00 0.00 ? 5  THR A CA   2  
ATOM 624   C C    . THR A 1 2  ? -8.703  8.628   0.574   1.00 0.00 ? 5  THR A C    2  
ATOM 625   O O    . THR A 1 2  ? -8.702  8.066   -0.522  1.00 0.00 ? 5  THR A O    2  
ATOM 626   C CB   . THR A 1 2  ? -6.177  8.720   0.445   1.00 0.00 ? 5  THR A CB   2  
ATOM 627   O OG1  . THR A 1 2  ? -6.242  9.650   -0.622  1.00 0.00 ? 5  THR A OG1  2  
ATOM 628   C CG2  . THR A 1 2  ? -6.003  7.346   -0.165  1.00 0.00 ? 5  THR A CG2  2  
ATOM 629   H H    . THR A 1 2  ? -6.704  7.125   2.399   1.00 0.00 ? 5  THR A H    2  
ATOM 630   H HA   . THR A 1 2  ? -7.423  9.838   1.783   1.00 0.00 ? 5  THR A HA   2  
ATOM 631   H HB   . THR A 1 2  ? -5.289  8.936   1.024   1.00 0.00 ? 5  THR A HB   2  
ATOM 632   H HG1  . THR A 1 2  ? -6.569  10.506  -0.291  1.00 0.00 ? 5  THR A HG1  2  
ATOM 633   H HG21 . THR A 1 2  ? -5.887  7.442   -1.235  1.00 0.00 ? 5  THR A HG21 2  
ATOM 634   H HG22 . THR A 1 2  ? -6.873  6.743   0.048   1.00 0.00 ? 5  THR A HG22 2  
ATOM 635   H HG23 . THR A 1 2  ? -5.126  6.875   0.251   1.00 0.00 ? 5  THR A HG23 2  
ATOM 636   N N    . LEU A 1 3  ? -9.814  9.081   1.150   1.00 0.00 ? 6  LEU A N    2  
ATOM 637   C CA   . LEU A 1 3  ? -11.125 8.948   0.515   1.00 0.00 ? 6  LEU A CA   2  
ATOM 638   C C    . LEU A 1 3  ? -11.875 10.283  0.516   1.00 0.00 ? 6  LEU A C    2  
ATOM 639   O O    . LEU A 1 3  ? -11.431 11.253  1.129   1.00 0.00 ? 6  LEU A O    2  
ATOM 640   C CB   . LEU A 1 3  ? -11.953 7.877   1.234   1.00 0.00 ? 6  LEU A CB   2  
ATOM 641   C CG   . LEU A 1 3  ? -11.845 6.470   0.643   1.00 0.00 ? 6  LEU A CG   2  
ATOM 642   C CD1  . LEU A 1 3  ? -12.102 5.421   1.711   1.00 0.00 ? 6  LEU A CD1  2  
ATOM 643   C CD2  . LEU A 1 3  ? -12.819 6.300   -0.511  1.00 0.00 ? 6  LEU A CD2  2  
ATOM 644   H H    . LEU A 1 3  ? -9.754  9.518   2.026   1.00 0.00 ? 6  LEU A H    2  
ATOM 645   H HA   . LEU A 1 3  ? -10.967 8.641   -0.507  1.00 0.00 ? 6  LEU A HA   2  
ATOM 646   H HB2  . LEU A 1 3  ? -11.634 7.837   2.264   1.00 0.00 ? 6  LEU A HB2  2  
ATOM 647   H HB3  . LEU A 1 3  ? -12.992 8.173   1.209   1.00 0.00 ? 6  LEU A HB3  2  
ATOM 648   H HG   . LEU A 1 3  ? -10.845 6.323   0.263   1.00 0.00 ? 6  LEU A HG   2  
ATOM 649   H HD11 . LEU A 1 3  ? -12.318 4.473   1.240   1.00 0.00 ? 6  LEU A HD11 2  
ATOM 650   H HD12 . LEU A 1 3  ? -12.944 5.721   2.318   1.00 0.00 ? 6  LEU A HD12 2  
ATOM 651   H HD13 . LEU A 1 3  ? -11.227 5.320   2.335   1.00 0.00 ? 6  LEU A HD13 2  
ATOM 652   H HD21 . LEU A 1 3  ? -12.666 5.337   -0.973  1.00 0.00 ? 6  LEU A HD21 2  
ATOM 653   H HD22 . LEU A 1 3  ? -12.654 7.079   -1.240  1.00 0.00 ? 6  LEU A HD22 2  
ATOM 654   H HD23 . LEU A 1 3  ? -13.832 6.364   -0.140  1.00 0.00 ? 6  LEU A HD23 2  
ATOM 655   N N    . SER A 1 4  ? -13.018 10.322  -0.172  1.00 0.00 ? 7  SER A N    2  
ATOM 656   C CA   . SER A 1 4  ? -13.839 11.536  -0.251  1.00 0.00 ? 7  SER A CA   2  
ATOM 657   C C    . SER A 1 4  ? -13.069 12.700  -0.887  1.00 0.00 ? 7  SER A C    2  
ATOM 658   O O    . SER A 1 4  ? -13.145 13.836  -0.415  1.00 0.00 ? 7  SER A O    2  
ATOM 659   C CB   . SER A 1 4  ? -14.334 11.933  1.144   1.00 0.00 ? 7  SER A CB   2  
ATOM 660   O OG   . SER A 1 4  ? -15.313 11.021  1.615   1.00 0.00 ? 7  SER A OG   2  
ATOM 661   H H    . SER A 1 4  ? -13.321 9.513   -0.636  1.00 0.00 ? 7  SER A H    2  
ATOM 662   H HA   . SER A 1 4  ? -14.695 11.313  -0.870  1.00 0.00 ? 7  SER A HA   2  
ATOM 663   H HB2  . SER A 1 4  ? -13.501 11.937  1.832   1.00 0.00 ? 7  SER A HB2  2  
ATOM 664   H HB3  . SER A 1 4  ? -14.769 12.923  1.100   1.00 0.00 ? 7  SER A HB3  2  
ATOM 665   H HG   . SER A 1 4  ? -15.979 11.494  2.123   1.00 0.00 ? 7  SER A HG   2  
ATOM 666   N N    . LEU A 1 5  ? -12.338 12.408  -1.968  1.00 0.00 ? 8  LEU A N    2  
ATOM 667   C CA   . LEU A 1 5  ? -11.556 13.423  -2.682  1.00 0.00 ? 8  LEU A CA   2  
ATOM 668   C C    . LEU A 1 5  ? -10.444 14.012  -1.799  1.00 0.00 ? 8  LEU A C    2  
ATOM 669   O O    . LEU A 1 5  ? -10.242 15.227  -1.761  1.00 0.00 ? 8  LEU A O    2  
ATOM 670   C CB   . LEU A 1 5  ? -12.480 14.536  -3.198  1.00 0.00 ? 8  LEU A CB   2  
ATOM 671   C CG   . LEU A 1 5  ? -12.542 14.672  -4.721  1.00 0.00 ? 8  LEU A CG   2  
ATOM 672   C CD1  . LEU A 1 5  ? -13.777 15.452  -5.135  1.00 0.00 ? 8  LEU A CD1  2  
ATOM 673   C CD2  . LEU A 1 5  ? -11.287 15.346  -5.247  1.00 0.00 ? 8  LEU A CD2  2  
ATOM 674   H H    . LEU A 1 5  ? -12.328 11.486  -2.297  1.00 0.00 ? 8  LEU A H    2  
ATOM 675   H HA   . LEU A 1 5  ? -11.094 12.940  -3.530  1.00 0.00 ? 8  LEU A HA   2  
ATOM 676   H HB2  . LEU A 1 5  ? -13.479 14.344  -2.834  1.00 0.00 ? 8  LEU A HB2  2  
ATOM 677   H HB3  . LEU A 1 5  ? -12.143 15.477  -2.789  1.00 0.00 ? 8  LEU A HB3  2  
ATOM 678   H HG   . LEU A 1 5  ? -12.606 13.687  -5.161  1.00 0.00 ? 8  LEU A HG   2  
ATOM 679   H HD11 . LEU A 1 5  ? -13.804 16.392  -4.602  1.00 0.00 ? 8  LEU A HD11 2  
ATOM 680   H HD12 . LEU A 1 5  ? -14.661 14.879  -4.899  1.00 0.00 ? 8  LEU A HD12 2  
ATOM 681   H HD13 . LEU A 1 5  ? -13.743 15.642  -6.197  1.00 0.00 ? 8  LEU A HD13 2  
ATOM 682   H HD21 . LEU A 1 5  ? -10.424 14.960  -4.726  1.00 0.00 ? 8  LEU A HD21 2  
ATOM 683   H HD22 . LEU A 1 5  ? -11.357 16.412  -5.086  1.00 0.00 ? 8  LEU A HD22 2  
ATOM 684   H HD23 . LEU A 1 5  ? -11.189 15.149  -6.303  1.00 0.00 ? 8  LEU A HD23 2  
ATOM 685   N N    . ASP A 1 6  ? -9.714  13.140  -1.104  1.00 0.00 ? 9  ASP A N    2  
ATOM 686   C CA   . ASP A 1 6  ? -8.619  13.567  -0.240  1.00 0.00 ? 9  ASP A CA   2  
ATOM 687   C C    . ASP A 1 6  ? -7.340  12.800  -0.572  1.00 0.00 ? 9  ASP A C    2  
ATOM 688   O O    . ASP A 1 6  ? -6.977  11.828  0.100   1.00 0.00 ? 9  ASP A O    2  
ATOM 689   C CB   . ASP A 1 6  ? -8.996  13.379  1.236   1.00 0.00 ? 9  ASP A CB   2  
ATOM 690   C CG   . ASP A 1 6  ? -8.229  14.312  2.154   1.00 0.00 ? 9  ASP A CG   2  
ATOM 691   O OD1  . ASP A 1 6  ? -6.988  14.181  2.235   1.00 0.00 ? 9  ASP A OD1  2  
ATOM 692   O OD2  . ASP A 1 6  ? -8.870  15.171  2.792   1.00 0.00 ? 9  ASP A OD2  2  
ATOM 693   H H    . ASP A 1 6  ? -9.906  12.185  -1.185  1.00 0.00 ? 9  ASP A H    2  
ATOM 694   H HA   . ASP A 1 6  ? -8.444  14.615  -0.426  1.00 0.00 ? 9  ASP A HA   2  
ATOM 695   H HB2  . ASP A 1 6  ? -10.050 13.574  1.359   1.00 0.00 ? 9  ASP A HB2  2  
ATOM 696   H HB3  . ASP A 1 6  ? -8.785  12.362  1.529   1.00 0.00 ? 9  ASP A HB3  2  
ATOM 697   N N    . VAL A 1 7  ? -6.667  13.238  -1.630  1.00 0.00 ? 10 VAL A N    2  
ATOM 698   C CA   . VAL A 1 7  ? -5.430  12.600  -2.075  1.00 0.00 ? 10 VAL A CA   2  
ATOM 699   C C    . VAL A 1 7  ? -4.301  13.628  -2.278  1.00 0.00 ? 10 VAL A C    2  
ATOM 700   O O    . VAL A 1 7  ? -3.696  13.712  -3.349  1.00 0.00 ? 10 VAL A O    2  
ATOM 701   C CB   . VAL A 1 7  ? -5.678  11.789  -3.369  1.00 0.00 ? 10 VAL A CB   2  
ATOM 702   C CG1  . VAL A 1 7  ? -5.922  12.704  -4.563  1.00 0.00 ? 10 VAL A CG1  2  
ATOM 703   C CG2  . VAL A 1 7  ? -4.522  10.838  -3.644  1.00 0.00 ? 10 VAL A CG2  2  
ATOM 704   H H    . VAL A 1 7  ? -7.017  14.001  -2.131  1.00 0.00 ? 10 VAL A H    2  
ATOM 705   H HA   . VAL A 1 7  ? -5.125  11.911  -1.301  1.00 0.00 ? 10 VAL A HA   2  
ATOM 706   H HB   . VAL A 1 7  ? -6.570  11.198  -3.219  1.00 0.00 ? 10 VAL A HB   2  
ATOM 707   H HG11 . VAL A 1 7  ? -6.574  12.209  -5.268  1.00 0.00 ? 10 VAL A HG11 2  
ATOM 708   H HG12 . VAL A 1 7  ? -4.980  12.928  -5.041  1.00 0.00 ? 10 VAL A HG12 2  
ATOM 709   H HG13 . VAL A 1 7  ? -6.382  13.621  -4.228  1.00 0.00 ? 10 VAL A HG13 2  
ATOM 710   H HG21 . VAL A 1 7  ? -4.423  10.144  -2.823  1.00 0.00 ? 10 VAL A HG21 2  
ATOM 711   H HG22 . VAL A 1 7  ? -3.608  11.404  -3.750  1.00 0.00 ? 10 VAL A HG22 2  
ATOM 712   H HG23 . VAL A 1 7  ? -4.715  10.293  -4.556  1.00 0.00 ? 10 VAL A HG23 2  
ATOM 713   N N    . PRO A 1 8  ? -3.997  14.428  -1.232  1.00 0.00 ? 11 PRO A N    2  
ATOM 714   C CA   . PRO A 1 8  ? -2.940  15.447  -1.290  1.00 0.00 ? 11 PRO A CA   2  
ATOM 715   C C    . PRO A 1 8  ? -1.536  14.844  -1.209  1.00 0.00 ? 11 PRO A C    2  
ATOM 716   O O    . PRO A 1 8  ? -1.378  13.672  -0.871  1.00 0.00 ? 11 PRO A O    2  
ATOM 717   C CB   . PRO A 1 8  ? -3.227  16.311  -0.061  1.00 0.00 ? 11 PRO A CB   2  
ATOM 718   C CG   . PRO A 1 8  ? -3.865  15.378  0.911   1.00 0.00 ? 11 PRO A CG   2  
ATOM 719   C CD   . PRO A 1 8  ? -4.658  14.395  0.090   1.00 0.00 ? 11 PRO A CD   2  
ATOM 720   H HA   . PRO A 1 8  ? -3.020  16.049  -2.183  1.00 0.00 ? 11 PRO A HA   2  
ATOM 721   H HB2  . PRO A 1 8  ? -2.302  16.715  0.326   1.00 0.00 ? 11 PRO A HB2  2  
ATOM 722   H HB3  . PRO A 1 8  ? -3.894  17.116  -0.330  1.00 0.00 ? 11 PRO A HB3  2  
ATOM 723   H HG2  . PRO A 1 8  ? -3.105  14.864  1.478   1.00 0.00 ? 11 PRO A HG2  2  
ATOM 724   H HG3  . PRO A 1 8  ? -4.520  15.927  1.571   1.00 0.00 ? 11 PRO A HG3  2  
ATOM 725   H HD2  . PRO A 1 8  ? -4.600  13.408  0.525   1.00 0.00 ? 11 PRO A HD2  2  
ATOM 726   H HD3  . PRO A 1 8  ? -5.688  14.711  0.013   1.00 0.00 ? 11 PRO A HD3  2  
ATOM 727   N N    . THR A 1 9  ? -0.520  15.651  -1.513  1.00 0.00 ? 12 THR A N    2  
ATOM 728   C CA   . THR A 1 9  ? 0.876   15.199  -1.474  1.00 0.00 ? 12 THR A CA   2  
ATOM 729   C C    . THR A 1 9  ? 1.192   14.475  -0.167  1.00 0.00 ? 12 THR A C    2  
ATOM 730   O O    . THR A 1 9  ? 1.702   13.352  -0.178  1.00 0.00 ? 12 THR A O    2  
ATOM 731   C CB   . THR A 1 9  ? 1.826   16.383  -1.652  1.00 0.00 ? 12 THR A CB   2  
ATOM 732   O OG1  . THR A 1 9  ? 1.271   17.347  -2.532  1.00 0.00 ? 12 THR A OG1  2  
ATOM 733   C CG2  . THR A 1 9  ? 3.185   15.989  -2.191  1.00 0.00 ? 12 THR A CG2  2  
ATOM 734   H H    . THR A 1 9  ? -0.708  16.579  -1.769  1.00 0.00 ? 12 THR A H    2  
ATOM 735   H HA   . THR A 1 9  ? 1.025   14.514  -2.289  1.00 0.00 ? 12 THR A HA   2  
ATOM 736   H HB   . THR A 1 9  ? 1.975   16.849  -0.692  1.00 0.00 ? 12 THR A HB   2  
ATOM 737   H HG1  . THR A 1 9  ? 1.649   17.246  -3.411  1.00 0.00 ? 12 THR A HG1  2  
ATOM 738   H HG21 . THR A 1 9  ? 3.699   15.379  -1.462  1.00 0.00 ? 12 THR A HG21 2  
ATOM 739   H HG22 . THR A 1 9  ? 3.765   16.879  -2.388  1.00 0.00 ? 12 THR A HG22 2  
ATOM 740   H HG23 . THR A 1 9  ? 3.062   15.429  -3.106  1.00 0.00 ? 12 THR A HG23 2  
ATOM 741   N N    . ASN A 1 10 ? 0.878   15.123  0.957   1.00 0.00 ? 13 ASN A N    2  
ATOM 742   C CA   . ASN A 1 10 ? 1.122   14.544  2.283   1.00 0.00 ? 13 ASN A CA   2  
ATOM 743   C C    . ASN A 1 10 ? 0.540   13.145  2.391   1.00 0.00 ? 13 ASN A C    2  
ATOM 744   O O    . ASN A 1 10 ? 1.139   12.243  2.976   1.00 0.00 ? 13 ASN A O    2  
ATOM 745   C CB   . ASN A 1 10 ? 0.545   15.441  3.387   1.00 0.00 ? 13 ASN A CB   2  
ATOM 746   C CG   . ASN A 1 10 ? 0.970   16.890  3.248   1.00 0.00 ? 13 ASN A CG   2  
ATOM 747   O OD1  . ASN A 1 10 ? 0.705   17.532  2.233   1.00 0.00 ? 13 ASN A OD1  2  
ATOM 748   N ND2  . ASN A 1 10 ? 1.633   17.417  4.267   1.00 0.00 ? 13 ASN A ND2  2  
ATOM 749   H H    . ASN A 1 10 ? 0.468   16.015  0.893   1.00 0.00 ? 13 ASN A H    2  
ATOM 750   H HA   . ASN A 1 10 ? 2.172   14.466  2.409   1.00 0.00 ? 13 ASN A HA   2  
ATOM 751   H HB2  . ASN A 1 10 ? -0.533  15.401  3.347   1.00 0.00 ? 13 ASN A HB2  2  
ATOM 752   H HB3  . ASN A 1 10 ? 0.879   15.079  4.347   1.00 0.00 ? 13 ASN A HB3  2  
ATOM 753   H HD21 . ASN A 1 10 ? 1.812   16.852  5.046   1.00 0.00 ? 13 ASN A HD21 2  
ATOM 754   H HD22 . ASN A 1 10 ? 1.912   18.352  4.198   1.00 0.00 ? 13 ASN A HD22 2  
ATOM 755   N N    . ILE A 1 11 ? -0.620  12.980  1.798   1.00 0.00 ? 14 ILE A N    2  
ATOM 756   C CA   . ILE A 1 11 ? -1.313  11.702  1.782   1.00 0.00 ? 14 ILE A CA   2  
ATOM 757   C C    . ILE A 1 11 ? -0.761  10.817  0.669   1.00 0.00 ? 14 ILE A C    2  
ATOM 758   O O    . ILE A 1 11 ? -0.466  9.645   0.889   1.00 0.00 ? 14 ILE A O    2  
ATOM 759   C CB   . ILE A 1 11 ? -2.829  11.928  1.608   1.00 0.00 ? 14 ILE A CB   2  
ATOM 760   C CG1  . ILE A 1 11 ? -3.524  11.961  2.969   1.00 0.00 ? 14 ILE A CG1  2  
ATOM 761   C CG2  . ILE A 1 11 ? -3.464  10.868  0.715   1.00 0.00 ? 14 ILE A CG2  2  
ATOM 762   C CD1  . ILE A 1 11 ? -3.514  13.325  3.624   1.00 0.00 ? 14 ILE A CD1  2  
ATOM 763   H H    . ILE A 1 11 ? -1.017  13.744  1.340   1.00 0.00 ? 14 ILE A H    2  
ATOM 764   H HA   . ILE A 1 11 ? -1.142  11.215  2.732   1.00 0.00 ? 14 ILE A HA   2  
ATOM 765   H HB   . ILE A 1 11 ? -2.953  12.889  1.132   1.00 0.00 ? 14 ILE A HB   2  
ATOM 766   H HG12 . ILE A 1 11 ? -4.555  11.662  2.846   1.00 0.00 ? 14 ILE A HG12 2  
ATOM 767   H HG13 . ILE A 1 11 ? -3.031  11.267  3.635   1.00 0.00 ? 14 ILE A HG13 2  
ATOM 768   H HG21 . ILE A 1 11 ? -3.082  10.965  -0.291  1.00 0.00 ? 14 ILE A HG21 2  
ATOM 769   H HG22 . ILE A 1 11 ? -4.535  11.000  0.707   1.00 0.00 ? 14 ILE A HG22 2  
ATOM 770   H HG23 . ILE A 1 11 ? -3.225  9.886   1.097   1.00 0.00 ? 14 ILE A HG23 2  
ATOM 771   H HD11 . ILE A 1 11 ? -4.454  13.823  3.432   1.00 0.00 ? 14 ILE A HD11 2  
ATOM 772   H HD12 . ILE A 1 11 ? -2.704  13.913  3.220   1.00 0.00 ? 14 ILE A HD12 2  
ATOM 773   H HD13 . ILE A 1 11 ? -3.379  13.211  4.690   1.00 0.00 ? 14 ILE A HD13 2  
ATOM 774   N N    . MET A 1 12 ? -0.601  11.393  -0.521  1.00 0.00 ? 15 MET A N    2  
ATOM 775   C CA   . MET A 1 12 ? -0.061  10.671  -1.659  1.00 0.00 ? 15 MET A CA   2  
ATOM 776   C C    . MET A 1 12 ? 1.266   10.014  -1.286  1.00 0.00 ? 15 MET A C    2  
ATOM 777   O O    . MET A 1 12 ? 1.470   8.832   -1.546  1.00 0.00 ? 15 MET A O    2  
ATOM 778   C CB   . MET A 1 12 ? 0.130   11.629  -2.837  1.00 0.00 ? 15 MET A CB   2  
ATOM 779   C CG   . MET A 1 12 ? -0.566  11.178  -4.109  1.00 0.00 ? 15 MET A CG   2  
ATOM 780   S SD   . MET A 1 12 ? 0.593   10.737  -5.418  1.00 0.00 ? 15 MET A SD   2  
ATOM 781   C CE   . MET A 1 12 ? -0.384  11.103  -6.874  1.00 0.00 ? 15 MET A CE   2  
ATOM 782   H H    . MET A 1 12 ? -0.841  12.344  -0.635  1.00 0.00 ? 15 MET A H    2  
ATOM 783   H HA   . MET A 1 12 ? -0.766  9.902   -1.935  1.00 0.00 ? 15 MET A HA   2  
ATOM 784   H HB2  . MET A 1 12 ? -0.264  12.597  -2.563  1.00 0.00 ? 15 MET A HB2  2  
ATOM 785   H HB3  . MET A 1 12 ? 1.183   11.726  -3.039  1.00 0.00 ? 15 MET A HB3  2  
ATOM 786   H HG2  . MET A 1 12 ? -1.177  10.317  -3.884  1.00 0.00 ? 15 MET A HG2  2  
ATOM 787   H HG3  . MET A 1 12 ? -1.196  11.983  -4.459  1.00 0.00 ? 15 MET A HG3  2  
ATOM 788   H HE1  . MET A 1 12 ? -0.738  12.123  -6.824  1.00 0.00 ? 15 MET A HE1  2  
ATOM 789   H HE2  . MET A 1 12 ? -1.229  10.430  -6.920  1.00 0.00 ? 15 MET A HE2  2  
ATOM 790   H HE3  . MET A 1 12 ? 0.225   10.976  -7.756  1.00 0.00 ? 15 MET A HE3  2  
ATOM 791   N N    . ASN A 1 13 ? 2.157   10.785  -0.654  1.00 0.00 ? 16 ASN A N    2  
ATOM 792   C CA   . ASN A 1 13 ? 3.460   10.271  -0.228  1.00 0.00 ? 16 ASN A CA   2  
ATOM 793   C C    . ASN A 1 13 ? 3.304   9.027   0.646   1.00 0.00 ? 16 ASN A C    2  
ATOM 794   O O    . ASN A 1 13 ? 3.915   7.990   0.375   1.00 0.00 ? 16 ASN A O    2  
ATOM 795   C CB   . ASN A 1 13 ? 4.244   11.353  0.527   1.00 0.00 ? 16 ASN A CB   2  
ATOM 796   C CG   . ASN A 1 13 ? 5.044   12.252  -0.396  1.00 0.00 ? 16 ASN A CG   2  
ATOM 797   O OD1  . ASN A 1 13 ? 4.696   13.412  -0.604  1.00 0.00 ? 16 ASN A OD1  2  
ATOM 798   N ND2  . ASN A 1 13 ? 6.125   11.725  -0.951  1.00 0.00 ? 16 ASN A ND2  2  
ATOM 799   H H    . ASN A 1 13 ? 1.926   11.726  -0.462  1.00 0.00 ? 16 ASN A H    2  
ATOM 800   H HA   . ASN A 1 13 ? 4.005   9.990   -1.113  1.00 0.00 ? 16 ASN A HA   2  
ATOM 801   H HB2  . ASN A 1 13 ? 3.552   11.969  1.080   1.00 0.00 ? 16 ASN A HB2  2  
ATOM 802   H HB3  . ASN A 1 13 ? 4.927   10.880  1.216   1.00 0.00 ? 16 ASN A HB3  2  
ATOM 803   H HD21 . ASN A 1 13 ? 6.348   10.796  -0.742  1.00 0.00 ? 16 ASN A HD21 2  
ATOM 804   H HD22 . ASN A 1 13 ? 6.655   12.290  -1.550  1.00 0.00 ? 16 ASN A HD22 2  
ATOM 805   N N    . LEU A 1 14 ? 2.475   9.127   1.683   1.00 0.00 ? 17 LEU A N    2  
ATOM 806   C CA   . LEU A 1 14 ? 2.241   7.989   2.572   1.00 0.00 ? 17 LEU A CA   2  
ATOM 807   C C    . LEU A 1 14 ? 1.435   6.911   1.848   1.00 0.00 ? 17 LEU A C    2  
ATOM 808   O O    . LEU A 1 14 ? 1.762   5.728   1.926   1.00 0.00 ? 17 LEU A O    2  
ATOM 809   C CB   . LEU A 1 14 ? 1.548   8.409   3.880   1.00 0.00 ? 17 LEU A CB   2  
ATOM 810   C CG   . LEU A 1 14 ? 0.306   9.287   3.728   1.00 0.00 ? 17 LEU A CG   2  
ATOM 811   C CD1  . LEU A 1 14 ? -0.946  8.436   3.588   1.00 0.00 ? 17 LEU A CD1  2  
ATOM 812   C CD2  . LEU A 1 14 ? 0.172   10.226  4.916   1.00 0.00 ? 17 LEU A CD2  2  
ATOM 813   H H    . LEU A 1 14 ? 2.006   9.973   1.840   1.00 0.00 ? 17 LEU A H    2  
ATOM 814   H HA   . LEU A 1 14 ? 3.206   7.575   2.814   1.00 0.00 ? 17 LEU A HA   2  
ATOM 815   H HB2  . LEU A 1 14 ? 1.262   7.514   4.413   1.00 0.00 ? 17 LEU A HB2  2  
ATOM 816   H HB3  . LEU A 1 14 ? 2.266   8.946   4.481   1.00 0.00 ? 17 LEU A HB3  2  
ATOM 817   H HG   . LEU A 1 14 ? 0.410   9.883   2.839   1.00 0.00 ? 17 LEU A HG   2  
ATOM 818   H HD11 . LEU A 1 14 ? -1.607  8.890   2.865   1.00 0.00 ? 17 LEU A HD11 2  
ATOM 819   H HD12 . LEU A 1 14 ? -1.446  8.371   4.542   1.00 0.00 ? 17 LEU A HD12 2  
ATOM 820   H HD13 . LEU A 1 14 ? -0.674  7.446   3.255   1.00 0.00 ? 17 LEU A HD13 2  
ATOM 821   H HD21 . LEU A 1 14 ? 0.931   10.992  4.857   1.00 0.00 ? 17 LEU A HD21 2  
ATOM 822   H HD22 . LEU A 1 14 ? 0.294   9.668   5.833   1.00 0.00 ? 17 LEU A HD22 2  
ATOM 823   H HD23 . LEU A 1 14 ? -0.805  10.686  4.903   1.00 0.00 ? 17 LEU A HD23 2  
ATOM 824   N N    . LEU A 1 15 ? 0.396   7.328   1.124   1.00 0.00 ? 18 LEU A N    2  
ATOM 825   C CA   . LEU A 1 15 ? -0.441  6.401   0.365   1.00 0.00 ? 18 LEU A CA   2  
ATOM 826   C C    . LEU A 1 15 ? 0.405   5.620   -0.640  1.00 0.00 ? 18 LEU A C    2  
ATOM 827   O O    . LEU A 1 15 ? 0.326   4.392   -0.705  1.00 0.00 ? 18 LEU A O    2  
ATOM 828   C CB   . LEU A 1 15 ? -1.561  7.165   -0.352  1.00 0.00 ? 18 LEU A CB   2  
ATOM 829   C CG   . LEU A 1 15 ? -2.225  6.424   -1.513  1.00 0.00 ? 18 LEU A CG   2  
ATOM 830   C CD1  . LEU A 1 15 ? -3.047  5.255   -1.001  1.00 0.00 ? 18 LEU A CD1  2  
ATOM 831   C CD2  . LEU A 1 15 ? -3.095  7.374   -2.320  1.00 0.00 ? 18 LEU A CD2  2  
ATOM 832   H H    . LEU A 1 15 ? 0.194   8.294   1.085   1.00 0.00 ? 18 LEU A H    2  
ATOM 833   H HA   . LEU A 1 15 ? -0.879  5.703   1.060   1.00 0.00 ? 18 LEU A HA   2  
ATOM 834   H HB2  . LEU A 1 15 ? -2.323  7.408   0.375   1.00 0.00 ? 18 LEU A HB2  2  
ATOM 835   H HB3  . LEU A 1 15 ? -1.148  8.088   -0.733  1.00 0.00 ? 18 LEU A HB3  2  
ATOM 836   H HG   . LEU A 1 15 ? -1.459  6.033   -2.166  1.00 0.00 ? 18 LEU A HG   2  
ATOM 837   H HD11 . LEU A 1 15 ? -2.464  4.690   -0.290  1.00 0.00 ? 18 LEU A HD11 2  
ATOM 838   H HD12 . LEU A 1 15 ? -3.321  4.619   -1.830  1.00 0.00 ? 18 LEU A HD12 2  
ATOM 839   H HD13 . LEU A 1 15 ? -3.941  5.625   -0.522  1.00 0.00 ? 18 LEU A HD13 2  
ATOM 840   H HD21 . LEU A 1 15 ? -2.471  7.960   -2.979  1.00 0.00 ? 18 LEU A HD21 2  
ATOM 841   H HD22 . LEU A 1 15 ? -3.628  8.032   -1.650  1.00 0.00 ? 18 LEU A HD22 2  
ATOM 842   H HD23 . LEU A 1 15 ? -3.802  6.805   -2.905  1.00 0.00 ? 18 LEU A HD23 2  
ATOM 843   N N    . PHE A 1 16 ? 1.224   6.343   -1.404  1.00 0.00 ? 19 PHE A N    2  
ATOM 844   C CA   . PHE A 1 16 ? 2.109   5.732   -2.395  1.00 0.00 ? 19 PHE A CA   2  
ATOM 845   C C    . PHE A 1 16 ? 3.020   4.700   -1.740  1.00 0.00 ? 19 PHE A C    2  
ATOM 846   O O    . PHE A 1 16 ? 3.246   3.618   -2.284  1.00 0.00 ? 19 PHE A O    2  
ATOM 847   C CB   . PHE A 1 16 ? 2.954   6.814   -3.074  1.00 0.00 ? 19 PHE A CB   2  
ATOM 848   C CG   . PHE A 1 16 ? 3.241   6.534   -4.522  1.00 0.00 ? 19 PHE A CG   2  
ATOM 849   C CD1  . PHE A 1 16 ? 4.048   5.469   -4.889  1.00 0.00 ? 19 PHE A CD1  2  
ATOM 850   C CD2  . PHE A 1 16 ? 2.700   7.332   -5.516  1.00 0.00 ? 19 PHE A CD2  2  
ATOM 851   C CE1  . PHE A 1 16 ? 4.310   5.206   -6.220  1.00 0.00 ? 19 PHE A CE1  2  
ATOM 852   C CE2  . PHE A 1 16 ? 2.957   7.073   -6.849  1.00 0.00 ? 19 PHE A CE2  2  
ATOM 853   C CZ   . PHE A 1 16 ? 3.764   6.009   -7.201  1.00 0.00 ? 19 PHE A CZ   2  
ATOM 854   H H    . PHE A 1 16 ? 1.244   7.323   -1.288  1.00 0.00 ? 19 PHE A H    2  
ATOM 855   H HA   . PHE A 1 16 ? 1.497   5.241   -3.137  1.00 0.00 ? 19 PHE A HA   2  
ATOM 856   H HB2  . PHE A 1 16 ? 2.430   7.752   -3.014  1.00 0.00 ? 19 PHE A HB2  2  
ATOM 857   H HB3  . PHE A 1 16 ? 3.899   6.910   -2.555  1.00 0.00 ? 19 PHE A HB3  2  
ATOM 858   H HD1  . PHE A 1 16 ? 4.476   4.840   -4.122  1.00 0.00 ? 19 PHE A HD1  2  
ATOM 859   H HD2  . PHE A 1 16 ? 2.069   8.165   -5.242  1.00 0.00 ? 19 PHE A HD2  2  
ATOM 860   H HE1  . PHE A 1 16 ? 4.941   4.372   -6.492  1.00 0.00 ? 19 PHE A HE1  2  
ATOM 861   H HE2  . PHE A 1 16 ? 2.527   7.703   -7.615  1.00 0.00 ? 19 PHE A HE2  2  
ATOM 862   H HZ   . PHE A 1 16 ? 3.965   5.805   -8.242  1.00 0.00 ? 19 PHE A HZ   2  
ATOM 863   N N    . ASN A 1 17 ? 3.534   5.047   -0.563  1.00 0.00 ? 20 ASN A N    2  
ATOM 864   C CA   . ASN A 1 17 ? 4.421   4.161   0.184   1.00 0.00 ? 20 ASN A CA   2  
ATOM 865   C C    . ASN A 1 17 ? 3.641   3.015   0.825   1.00 0.00 ? 20 ASN A C    2  
ATOM 866   O O    . ASN A 1 17 ? 4.032   1.852   0.705   1.00 0.00 ? 20 ASN A O    2  
ATOM 867   C CB   . ASN A 1 17 ? 5.182   4.952   1.249   1.00 0.00 ? 20 ASN A CB   2  
ATOM 868   C CG   . ASN A 1 17 ? 6.630   4.523   1.358   1.00 0.00 ? 20 ASN A CG   2  
ATOM 869   O OD1  . ASN A 1 17 ? 7.096   4.140   2.425   1.00 0.00 ? 20 ASN A OD1  2  
ATOM 870   N ND2  . ASN A 1 17 ? 7.350   4.580   0.246   1.00 0.00 ? 20 ASN A ND2  2  
ATOM 871   H H    . ASN A 1 17 ? 3.306   5.927   -0.185  1.00 0.00 ? 20 ASN A H    2  
ATOM 872   H HA   . ASN A 1 17 ? 5.131   3.740   -0.514  1.00 0.00 ? 20 ASN A HA   2  
ATOM 873   H HB2  . ASN A 1 17 ? 5.155   6.001   0.999   1.00 0.00 ? 20 ASN A HB2  2  
ATOM 874   H HB3  . ASN A 1 17 ? 4.708   4.802   2.205   1.00 0.00 ? 20 ASN A HB3  2  
ATOM 875   H HD21 . ASN A 1 17 ? 6.914   4.891   -0.574  1.00 0.00 ? 20 ASN A HD21 2  
ATOM 876   H HD22 . ASN A 1 17 ? 8.288   4.306   0.293   1.00 0.00 ? 20 ASN A HD22 2  
ATOM 877   N N    . ILE A 1 18 ? 2.533   3.344   1.492   1.00 0.00 ? 21 ILE A N    2  
ATOM 878   C CA   . ILE A 1 18 ? 1.696   2.325   2.130   1.00 0.00 ? 21 ILE A CA   2  
ATOM 879   C C    . ILE A 1 18 ? 1.358   1.228   1.129   1.00 0.00 ? 21 ILE A C    2  
ATOM 880   O O    . ILE A 1 18 ? 1.719   0.069   1.330   1.00 0.00 ? 21 ILE A O    2  
ATOM 881   C CB   . ILE A 1 18 ? 0.394   2.927   2.711   1.00 0.00 ? 21 ILE A CB   2  
ATOM 882   C CG1  . ILE A 1 18 ? 0.707   3.799   3.929   1.00 0.00 ? 21 ILE A CG1  2  
ATOM 883   C CG2  . ILE A 1 18 ? -0.591  1.826   3.089   1.00 0.00 ? 21 ILE A CG2  2  
ATOM 884   C CD1  . ILE A 1 18 ? -0.304  4.901   4.163   1.00 0.00 ? 21 ILE A CD1  2  
ATOM 885   H H    . ILE A 1 18 ? 2.264   4.295   1.543   1.00 0.00 ? 21 ILE A H    2  
ATOM 886   H HA   . ILE A 1 18 ? 2.262   1.886   2.940   1.00 0.00 ? 21 ILE A HA   2  
ATOM 887   H HB   . ILE A 1 18 ? -0.064  3.540   1.948   1.00 0.00 ? 21 ILE A HB   2  
ATOM 888   H HG12 . ILE A 1 18 ? 0.728   3.178   4.813   1.00 0.00 ? 21 ILE A HG12 2  
ATOM 889   H HG13 . ILE A 1 18 ? 1.675   4.259   3.796   1.00 0.00 ? 21 ILE A HG13 2  
ATOM 890   H HG21 . ILE A 1 18 ? -1.388  2.248   3.685   1.00 0.00 ? 21 ILE A HG21 2  
ATOM 891   H HG22 . ILE A 1 18 ? -0.079  1.066   3.661   1.00 0.00 ? 21 ILE A HG22 2  
ATOM 892   H HG23 . ILE A 1 18 ? -1.004  1.388   2.193   1.00 0.00 ? 21 ILE A HG23 2  
ATOM 893   H HD11 . ILE A 1 18 ? -0.515  4.977   5.220   1.00 0.00 ? 21 ILE A HD11 2  
ATOM 894   H HD12 . ILE A 1 18 ? -1.214  4.674   3.629   1.00 0.00 ? 21 ILE A HD12 2  
ATOM 895   H HD13 . ILE A 1 18 ? 0.098   5.837   3.808   1.00 0.00 ? 21 ILE A HD13 2  
ATOM 896   N N    . ALA A 1 19 ? 0.697   1.604   0.033   1.00 0.00 ? 22 ALA A N    2  
ATOM 897   C CA   . ALA A 1 19 ? 0.349   0.643   -1.012  1.00 0.00 ? 22 ALA A CA   2  
ATOM 898   C C    . ALA A 1 19 ? 1.601   -0.094  -1.498  1.00 0.00 ? 22 ALA A C    2  
ATOM 899   O O    . ALA A 1 19 ? 1.561   -1.296  -1.775  1.00 0.00 ? 22 ALA A O    2  
ATOM 900   C CB   . ALA A 1 19 ? -0.343  1.350   -2.169  1.00 0.00 ? 22 ALA A CB   2  
ATOM 901   H H    . ALA A 1 19 ? 0.459   2.552   -0.086  1.00 0.00 ? 22 ALA A H    2  
ATOM 902   H HA   . ALA A 1 19 ? -0.339  -0.076  -0.591  1.00 0.00 ? 22 ALA A HA   2  
ATOM 903   H HB1  . ALA A 1 19 ? 0.327   2.082   -2.598  1.00 0.00 ? 22 ALA A HB1  2  
ATOM 904   H HB2  . ALA A 1 19 ? -1.232  1.846   -1.809  1.00 0.00 ? 22 ALA A HB2  2  
ATOM 905   H HB3  . ALA A 1 19 ? -0.615  0.627   -2.924  1.00 0.00 ? 22 ALA A HB3  2  
ATOM 906   N N    . LYS A 1 20 ? 2.714   0.638   -1.584  1.00 0.00 ? 23 LYS A N    2  
ATOM 907   C CA   . LYS A 1 20 ? 3.990   0.073   -2.021  1.00 0.00 ? 23 LYS A CA   2  
ATOM 908   C C    . LYS A 1 20 ? 4.448   -1.052  -1.094  1.00 0.00 ? 23 LYS A C    2  
ATOM 909   O O    . LYS A 1 20 ? 4.782   -2.144  -1.551  1.00 0.00 ? 23 LYS A O    2  
ATOM 910   C CB   . LYS A 1 20 ? 5.063   1.170   -2.083  1.00 0.00 ? 23 LYS A CB   2  
ATOM 911   C CG   . LYS A 1 20 ? 5.688   1.347   -3.459  1.00 0.00 ? 23 LYS A CG   2  
ATOM 912   C CD   . LYS A 1 20 ? 6.239   0.035   -4.006  1.00 0.00 ? 23 LYS A CD   2  
ATOM 913   C CE   . LYS A 1 20 ? 7.472   -0.421  -3.241  1.00 0.00 ? 23 LYS A CE   2  
ATOM 914   N NZ   . LYS A 1 20 ? 8.156   -1.558  -3.923  1.00 0.00 ? 23 LYS A NZ   2  
ATOM 915   H H    . LYS A 1 20 ? 2.677   1.587   -1.341  1.00 0.00 ? 23 LYS A H    2  
ATOM 916   H HA   . LYS A 1 20 ? 3.846   -0.335  -3.007  1.00 0.00 ? 23 LYS A HA   2  
ATOM 917   H HB2  . LYS A 1 20 ? 4.612   2.108   -1.798  1.00 0.00 ? 23 LYS A HB2  2  
ATOM 918   H HB3  . LYS A 1 20 ? 5.846   0.935   -1.379  1.00 0.00 ? 23 LYS A HB3  2  
ATOM 919   H HG2  . LYS A 1 20 ? 4.936   1.720   -4.137  1.00 0.00 ? 23 LYS A HG2  2  
ATOM 920   H HG3  . LYS A 1 20 ? 6.494   2.064   -3.387  1.00 0.00 ? 23 LYS A HG3  2  
ATOM 921   H HD2  . LYS A 1 20 ? 5.479   -0.726  -3.927  1.00 0.00 ? 23 LYS A HD2  2  
ATOM 922   H HD3  . LYS A 1 20 ? 6.503   0.175   -5.044  1.00 0.00 ? 23 LYS A HD3  2  
ATOM 923   H HE2  . LYS A 1 20 ? 8.160   0.410   -3.162  1.00 0.00 ? 23 LYS A HE2  2  
ATOM 924   H HE3  . LYS A 1 20 ? 7.170   -0.733  -2.250  1.00 0.00 ? 23 LYS A HE3  2  
ATOM 925   H HZ1  . LYS A 1 20 ? 7.607   -2.435  -3.802  1.00 0.00 ? 23 LYS A HZ1  2  
ATOM 926   H HZ2  . LYS A 1 20 ? 9.106   -1.700  -3.521  1.00 0.00 ? 23 LYS A HZ2  2  
ATOM 927   H HZ3  . LYS A 1 20 ? 8.252   -1.362  -4.941  1.00 0.00 ? 23 LYS A HZ3  2  
ATOM 928   N N    . ALA A 1 21 ? 4.466   -0.778  0.208   1.00 0.00 ? 24 ALA A N    2  
ATOM 929   C CA   . ALA A 1 21 ? 4.888   -1.771  1.194   1.00 0.00 ? 24 ALA A CA   2  
ATOM 930   C C    . ALA A 1 21 ? 3.788   -2.802  1.457   1.00 0.00 ? 24 ALA A C    2  
ATOM 931   O O    . ALA A 1 21 ? 4.073   -3.985  1.657   1.00 0.00 ? 24 ALA A O    2  
ATOM 932   C CB   . ALA A 1 21 ? 5.303   -1.082  2.488   1.00 0.00 ? 24 ALA A CB   2  
ATOM 933   H H    . ALA A 1 21 ? 4.192   0.118   0.513   1.00 0.00 ? 24 ALA A H    2  
ATOM 934   H HA   . ALA A 1 21 ? 5.750   -2.285  0.795   1.00 0.00 ? 24 ALA A HA   2  
ATOM 935   H HB1  . ALA A 1 21 ? 6.128   -1.618  2.932   1.00 0.00 ? 24 ALA A HB1  2  
ATOM 936   H HB2  . ALA A 1 21 ? 4.469   -1.069  3.174   1.00 0.00 ? 24 ALA A HB2  2  
ATOM 937   H HB3  . ALA A 1 21 ? 5.607   -0.067  2.273   1.00 0.00 ? 24 ALA A HB3  2  
ATOM 938   N N    . LYS A 1 22 ? 2.531   -2.350  1.450   1.00 0.00 ? 25 LYS A N    2  
ATOM 939   C CA   . LYS A 1 22 ? 1.397   -3.232  1.686   1.00 0.00 ? 25 LYS A CA   2  
ATOM 940   C C    . LYS A 1 22 ? 1.283   -4.289  0.596   1.00 0.00 ? 25 LYS A C    2  
ATOM 941   O O    . LYS A 1 22 ? 1.080   -5.469  0.888   1.00 0.00 ? 25 LYS A O    2  
ATOM 942   C CB   . LYS A 1 22 ? 0.102   -2.420  1.760   1.00 0.00 ? 25 LYS A CB   2  
ATOM 943   C CG   . LYS A 1 22 ? -0.723  -2.715  2.994   1.00 0.00 ? 25 LYS A CG   2  
ATOM 944   C CD   . LYS A 1 22 ? -2.031  -3.402  2.635   1.00 0.00 ? 25 LYS A CD   2  
ATOM 945   C CE   . LYS A 1 22 ? -2.649  -4.095  3.837   1.00 0.00 ? 25 LYS A CE   2  
ATOM 946   N NZ   . LYS A 1 22 ? -3.147  -3.114  4.843   1.00 0.00 ? 25 LYS A NZ   2  
ATOM 947   H H    . LYS A 1 22 ? 2.361   -1.395  1.280   1.00 0.00 ? 25 LYS A H    2  
ATOM 948   H HA   . LYS A 1 22 ? 1.553   -3.728  2.632   1.00 0.00 ? 25 LYS A HA   2  
ATOM 949   H HB2  . LYS A 1 22 ? 0.348   -1.369  1.763   1.00 0.00 ? 25 LYS A HB2  2  
ATOM 950   H HB3  . LYS A 1 22 ? -0.499  -2.637  0.889   1.00 0.00 ? 25 LYS A HB3  2  
ATOM 951   H HG2  . LYS A 1 22 ? -0.153  -3.357  3.649   1.00 0.00 ? 25 LYS A HG2  2  
ATOM 952   H HG3  . LYS A 1 22 ? -0.936  -1.783  3.497   1.00 0.00 ? 25 LYS A HG3  2  
ATOM 953   H HD2  . LYS A 1 22 ? -2.725  -2.663  2.263   1.00 0.00 ? 25 LYS A HD2  2  
ATOM 954   H HD3  . LYS A 1 22 ? -1.840  -4.137  1.866   1.00 0.00 ? 25 LYS A HD3  2  
ATOM 955   H HE2  . LYS A 1 22 ? -3.475  -4.707  3.498   1.00 0.00 ? 25 LYS A HE2  2  
ATOM 956   H HE3  . LYS A 1 22 ? -1.901  -4.727  4.297   1.00 0.00 ? 25 LYS A HE3  2  
ATOM 957   H HZ1  . LYS A 1 22 ? -2.412  -2.407  5.051   1.00 0.00 ? 25 LYS A HZ1  2  
ATOM 958   H HZ2  . LYS A 1 22 ? -3.398  -3.604  5.726   1.00 0.00 ? 25 LYS A HZ2  2  
ATOM 959   H HZ3  . LYS A 1 22 ? -3.991  -2.625  4.481   1.00 0.00 ? 25 LYS A HZ3  2  
ATOM 960   N N    . ASN A 1 23 ? 1.418   -3.871  -0.664  1.00 0.00 ? 26 ASN A N    2  
ATOM 961   C CA   . ASN A 1 23 ? 1.322   -4.817  -1.776  1.00 0.00 ? 26 ASN A CA   2  
ATOM 962   C C    . ASN A 1 23 ? 2.473   -5.827  -1.733  1.00 0.00 ? 26 ASN A C    2  
ATOM 963   O O    . ASN A 1 23 ? 2.264   -7.016  -1.978  1.00 0.00 ? 26 ASN A O    2  
ATOM 964   C CB   . ASN A 1 23 ? 1.267   -4.084  -3.126  1.00 0.00 ? 26 ASN A CB   2  
ATOM 965   C CG   . ASN A 1 23 ? 2.632   -3.804  -3.720  1.00 0.00 ? 26 ASN A CG   2  
ATOM 966   O OD1  . ASN A 1 23 ? 3.279   -4.691  -4.269  1.00 0.00 ? 26 ASN A OD1  2  
ATOM 967   N ND2  . ASN A 1 23 ? 3.074   -2.566  -3.614  1.00 0.00 ? 26 ASN A ND2  2  
ATOM 968   H H    . ASN A 1 23 ? 1.587   -2.910  -0.844  1.00 0.00 ? 26 ASN A H    2  
ATOM 969   H HA   . ASN A 1 23 ? 0.399   -5.364  -1.647  1.00 0.00 ? 26 ASN A HA   2  
ATOM 970   H HB2  . ASN A 1 23 ? 0.715   -4.687  -3.831  1.00 0.00 ? 26 ASN A HB2  2  
ATOM 971   H HB3  . ASN A 1 23 ? 0.754   -3.142  -2.994  1.00 0.00 ? 26 ASN A HB3  2  
ATOM 972   H HD21 . ASN A 1 23 ? 2.502   -1.906  -3.163  1.00 0.00 ? 26 ASN A HD21 2  
ATOM 973   H HD22 . ASN A 1 23 ? 3.954   -2.359  -3.986  1.00 0.00 ? 26 ASN A HD22 2  
ATOM 974   N N    . LEU A 1 24 ? 3.678   -5.353  -1.396  1.00 0.00 ? 27 LEU A N    2  
ATOM 975   C CA   . LEU A 1 24 ? 4.851   -6.226  -1.305  1.00 0.00 ? 27 LEU A CA   2  
ATOM 976   C C    . LEU A 1 24 ? 4.582   -7.418  -0.395  1.00 0.00 ? 27 LEU A C    2  
ATOM 977   O O    . LEU A 1 24 ? 4.739   -8.573  -0.790  1.00 0.00 ? 27 LEU A O    2  
ATOM 978   C CB   . LEU A 1 24 ? 6.065   -5.443  -0.792  1.00 0.00 ? 27 LEU A CB   2  
ATOM 979   C CG   . LEU A 1 24 ? 6.678   -4.454  -1.786  1.00 0.00 ? 27 LEU A CG   2  
ATOM 980   C CD1  . LEU A 1 24 ? 7.551   -3.445  -1.059  1.00 0.00 ? 27 LEU A CD1  2  
ATOM 981   C CD2  . LEU A 1 24 ? 7.485   -5.190  -2.845  1.00 0.00 ? 27 LEU A CD2  2  
ATOM 982   H H    . LEU A 1 24 ? 3.778   -4.397  -1.194  1.00 0.00 ? 27 LEU A H    2  
ATOM 983   H HA   . LEU A 1 24 ? 5.059   -6.593  -2.282  1.00 0.00 ? 27 LEU A HA   2  
ATOM 984   H HB2  . LEU A 1 24 ? 5.765   -4.894  0.088   1.00 0.00 ? 27 LEU A HB2  2  
ATOM 985   H HB3  . LEU A 1 24 ? 6.830   -6.151  -0.509  1.00 0.00 ? 27 LEU A HB3  2  
ATOM 986   H HG   . LEU A 1 24 ? 5.885   -3.915  -2.283  1.00 0.00 ? 27 LEU A HG   2  
ATOM 987   H HD11 . LEU A 1 24 ? 7.021   -2.508  -0.971  1.00 0.00 ? 27 LEU A HD11 2  
ATOM 988   H HD12 . LEU A 1 24 ? 8.465   -3.293  -1.613  1.00 0.00 ? 27 LEU A HD12 2  
ATOM 989   H HD13 . LEU A 1 24 ? 7.787   -3.818  -0.072  1.00 0.00 ? 27 LEU A HD13 2  
ATOM 990   H HD21 . LEU A 1 24 ? 6.851   -5.412  -3.690  1.00 0.00 ? 27 LEU A HD21 2  
ATOM 991   H HD22 . LEU A 1 24 ? 7.867   -6.111  -2.431  1.00 0.00 ? 27 LEU A HD22 2  
ATOM 992   H HD23 . LEU A 1 24 ? 8.310   -4.571  -3.166  1.00 0.00 ? 27 LEU A HD23 2  
ATOM 993   N N    . ARG A 1 25 ? 4.174   -7.116  0.821   1.00 0.00 ? 28 ARG A N    2  
ATOM 994   C CA   . ARG A 1 25 ? 3.873   -8.141  1.821   1.00 0.00 ? 28 ARG A CA   2  
ATOM 995   C C    . ARG A 1 25 ? 2.609   -8.926  1.469   1.00 0.00 ? 28 ARG A C    2  
ATOM 996   O O    . ARG A 1 25 ? 2.489   -10.096 1.829   1.00 0.00 ? 28 ARG A O    2  
ATOM 997   C CB   . ARG A 1 25 ? 3.735   -7.504  3.205   1.00 0.00 ? 28 ARG A CB   2  
ATOM 998   C CG   . ARG A 1 25 ? 5.044   -7.448  3.978   1.00 0.00 ? 28 ARG A CG   2  
ATOM 999   C CD   . ARG A 1 25 ? 4.809   -7.413  5.481   1.00 0.00 ? 28 ARG A CD   2  
ATOM 1000  N NE   . ARG A 1 25 ? 5.377   -8.589  6.151   1.00 0.00 ? 28 ARG A NE   2  
ATOM 1001  C CZ   . ARG A 1 25 ? 5.572   -8.685  7.459   1.00 0.00 ? 28 ARG A CZ   2  
ATOM 1002  N NH1  . ARG A 1 25 ? 5.253   -7.687  8.260   1.00 0.00 ? 28 ARG A NH1  2  
ATOM 1003  N NH2  . ARG A 1 25 ? 6.090   -9.786  7.967   1.00 0.00 ? 28 ARG A NH2  2  
ATOM 1004  H H    . ARG A 1 25 ? 4.073   -6.174  1.052   1.00 0.00 ? 28 ARG A H    2  
ATOM 1005  H HA   . ARG A 1 25 ? 4.700   -8.836  1.839   1.00 0.00 ? 28 ARG A HA   2  
ATOM 1006  H HB2  . ARG A 1 25 ? 3.365   -6.495  3.090   1.00 0.00 ? 28 ARG A HB2  2  
ATOM 1007  H HB3  . ARG A 1 25 ? 3.023   -8.073  3.781   1.00 0.00 ? 28 ARG A HB3  2  
ATOM 1008  H HG2  . ARG A 1 25 ? 5.630   -8.321  3.736   1.00 0.00 ? 28 ARG A HG2  2  
ATOM 1009  H HG3  . ARG A 1 25 ? 5.584   -6.559  3.687   1.00 0.00 ? 28 ARG A HG3  2  
ATOM 1010  H HD2  . ARG A 1 25 ? 5.271   -6.522  5.881   1.00 0.00 ? 28 ARG A HD2  2  
ATOM 1011  H HD3  . ARG A 1 25 ? 3.745   -7.382  5.667   1.00 0.00 ? 28 ARG A HD3  2  
ATOM 1012  H HE   . ARG A 1 25 ? 5.628   -9.349  5.586   1.00 0.00 ? 28 ARG A HE   2  
ATOM 1013  H HH11 . ARG A 1 25 ? 4.864   -6.850  7.886   1.00 0.00 ? 28 ARG A HH11 2  
ATOM 1014  H HH12 . ARG A 1 25 ? 5.405   -7.769  9.243   1.00 0.00 ? 28 ARG A HH12 2  
ATOM 1015  H HH21 . ARG A 1 25 ? 6.336   -10.545 7.367   1.00 0.00 ? 28 ARG A HH21 2  
ATOM 1016  H HH22 . ARG A 1 25 ? 6.239   -9.862  8.951   1.00 0.00 ? 28 ARG A HH22 2  
ATOM 1017  N N    . ALA A 1 26 ? 1.680   -8.299  0.748   1.00 0.00 ? 29 ALA A N    2  
ATOM 1018  C CA   . ALA A 1 26 ? 0.453   -8.971  0.348   1.00 0.00 ? 29 ALA A CA   2  
ATOM 1019  C C    . ALA A 1 26 ? 0.760   -10.030 -0.703  1.00 0.00 ? 29 ALA A C    2  
ATOM 1020  O O    . ALA A 1 26 ? 0.371   -11.191 -0.566  1.00 0.00 ? 29 ALA A O    2  
ATOM 1021  C CB   . ALA A 1 26 ? -0.559  -7.961  -0.177  1.00 0.00 ? 29 ALA A CB   2  
ATOM 1022  H H    . ALA A 1 26 ? 1.830   -7.374  0.463   1.00 0.00 ? 29 ALA A H    2  
ATOM 1023  H HA   . ALA A 1 26 ? 0.032   -9.454  1.220   1.00 0.00 ? 29 ALA A HA   2  
ATOM 1024  H HB1  . ALA A 1 26 ? -0.272  -7.646  -1.169  1.00 0.00 ? 29 ALA A HB1  2  
ATOM 1025  H HB2  . ALA A 1 26 ? -0.583  -7.103  0.480   1.00 0.00 ? 29 ALA A HB2  2  
ATOM 1026  H HB3  . ALA A 1 26 ? -1.539  -8.415  -0.211  1.00 0.00 ? 29 ALA A HB3  2  
ATOM 1027  N N    . GLN A 1 27 ? 1.482   -9.621  -1.743  1.00 0.00 ? 30 GLN A N    2  
ATOM 1028  C CA   . GLN A 1 27 ? 1.861   -10.536 -2.821  1.00 0.00 ? 30 GLN A CA   2  
ATOM 1029  C C    . GLN A 1 27 ? 2.918   -11.539 -2.363  1.00 0.00 ? 30 GLN A C    2  
ATOM 1030  O O    . GLN A 1 27 ? 3.022   -12.642 -2.906  1.00 0.00 ? 30 GLN A O    2  
ATOM 1031  C CB   . GLN A 1 27 ? 2.353   -9.756  -4.048  1.00 0.00 ? 30 GLN A CB   2  
ATOM 1032  C CG   . GLN A 1 27 ? 3.665   -9.011  -3.826  1.00 0.00 ? 30 GLN A CG   2  
ATOM 1033  C CD   . GLN A 1 27 ? 4.803   -9.562  -4.664  1.00 0.00 ? 30 GLN A CD   2  
ATOM 1034  O OE1  . GLN A 1 27 ? 4.937   -9.235  -5.839  1.00 0.00 ? 30 GLN A OE1  2  
ATOM 1035  N NE2  . GLN A 1 27 ? 5.632   -10.403 -4.063  1.00 0.00 ? 30 GLN A NE2  2  
ATOM 1036  H H    . GLN A 1 27 ? 1.776   -8.677  -1.779  1.00 0.00 ? 30 GLN A H    2  
ATOM 1037  H HA   . GLN A 1 27 ? 0.985   -11.086 -3.088  1.00 0.00 ? 30 GLN A HA   2  
ATOM 1038  H HB2  . GLN A 1 27 ? 2.491   -10.447 -4.867  1.00 0.00 ? 30 GLN A HB2  2  
ATOM 1039  H HB3  . GLN A 1 27 ? 1.598   -9.033  -4.325  1.00 0.00 ? 30 GLN A HB3  2  
ATOM 1040  H HG2  . GLN A 1 27 ? 3.522   -7.972  -4.086  1.00 0.00 ? 30 GLN A HG2  2  
ATOM 1041  H HG3  . GLN A 1 27 ? 3.936   -9.084  -2.785  1.00 0.00 ? 30 GLN A HG3  2  
ATOM 1042  H HE21 . GLN A 1 27 ? 5.470   -10.622 -3.123  1.00 0.00 ? 30 GLN A HE21 2  
ATOM 1043  H HE22 . GLN A 1 27 ? 6.372   -10.771 -4.588  1.00 0.00 ? 30 GLN A HE22 2  
ATOM 1044  N N    . ALA A 1 28 ? 3.683   -11.158 -1.352  1.00 0.00 ? 31 ALA A N    2  
ATOM 1045  C CA   . ALA A 1 28 ? 4.722   -12.022 -0.800  1.00 0.00 ? 31 ALA A CA   2  
ATOM 1046  C C    . ALA A 1 28 ? 4.126   -13.023 0.186   1.00 0.00 ? 31 ALA A C    2  
ATOM 1047  O O    . ALA A 1 28 ? 4.348   -14.228 0.069   1.00 0.00 ? 31 ALA A O    2  
ATOM 1048  C CB   . ALA A 1 28 ? 5.807   -11.188 -0.128  1.00 0.00 ? 31 ALA A CB   2  
ATOM 1049  H H    . ALA A 1 28 ? 3.535   -10.276 -0.961  1.00 0.00 ? 31 ALA A H    2  
ATOM 1050  H HA   . ALA A 1 28 ? 5.173   -12.566 -1.617  1.00 0.00 ? 31 ALA A HA   2  
ATOM 1051  H HB1  . ALA A 1 28 ? 6.657   -11.816 0.096   1.00 0.00 ? 31 ALA A HB1  2  
ATOM 1052  H HB2  . ALA A 1 28 ? 5.421   -10.764 0.787   1.00 0.00 ? 31 ALA A HB2  2  
ATOM 1053  H HB3  . ALA A 1 28 ? 6.112   -10.394 -0.792  1.00 0.00 ? 31 ALA A HB3  2  
ATOM 1054  N N    . ALA A 1 29 ? 3.363   -12.518 1.154   1.00 0.00 ? 32 ALA A N    2  
ATOM 1055  C CA   . ALA A 1 29 ? 2.733   -13.376 2.159   1.00 0.00 ? 32 ALA A CA   2  
ATOM 1056  C C    . ALA A 1 29 ? 1.642   -14.273 1.556   1.00 0.00 ? 32 ALA A C    2  
ATOM 1057  O O    . ALA A 1 29 ? 1.483   -15.424 1.970   1.00 0.00 ? 32 ALA A O    2  
ATOM 1058  C CB   . ALA A 1 29 ? 2.161   -12.529 3.288   1.00 0.00 ? 32 ALA A CB   2  
ATOM 1059  H H    . ALA A 1 29 ? 3.220   -11.539 1.195   1.00 0.00 ? 32 ALA A H    2  
ATOM 1060  H HA   . ALA A 1 29 ? 3.502   -14.009 2.576   1.00 0.00 ? 32 ALA A HA   2  
ATOM 1061  H HB1  . ALA A 1 29 ? 2.909   -11.827 3.625   1.00 0.00 ? 32 ALA A HB1  2  
ATOM 1062  H HB2  . ALA A 1 29 ? 1.873   -13.170 4.109   1.00 0.00 ? 32 ALA A HB2  2  
ATOM 1063  H HB3  . ALA A 1 29 ? 1.297   -11.989 2.931   1.00 0.00 ? 32 ALA A HB3  2  
ATOM 1064  N N    . ALA A 1 30 ? 0.881   -13.743 0.592   1.00 0.00 ? 33 ALA A N    2  
ATOM 1065  C CA   . ALA A 1 30 ? -0.203  -14.505 -0.038  1.00 0.00 ? 33 ALA A CA   2  
ATOM 1066  C C    . ALA A 1 30 ? 0.306   -15.662 -0.888  1.00 0.00 ? 33 ALA A C    2  
ATOM 1067  O O    . ALA A 1 30 ? -0.102  -16.812 -0.708  1.00 0.00 ? 33 ALA A O    2  
ATOM 1068  C CB   . ALA A 1 30 ? -1.087  -13.582 -0.867  1.00 0.00 ? 33 ALA A CB   2  
ATOM 1069  H H    . ALA A 1 30 ? 1.041   -12.816 0.307   1.00 0.00 ? 33 ALA A H    2  
ATOM 1070  H HA   . ALA A 1 30 ? -0.800  -14.913 0.740   1.00 0.00 ? 33 ALA A HA   2  
ATOM 1071  H HB1  . ALA A 1 30 ? -1.922  -14.141 -1.262  1.00 0.00 ? 33 ALA A HB1  2  
ATOM 1072  H HB2  . ALA A 1 30 ? -0.512  -13.169 -1.683  1.00 0.00 ? 33 ALA A HB2  2  
ATOM 1073  H HB3  . ALA A 1 30 ? -1.454  -12.779 -0.244  1.00 0.00 ? 33 ALA A HB3  2  
ATOM 1074  N N    . ASN A 1 31 ? 1.192   -15.347 -1.810  1.00 0.00 ? 34 ASN A N    2  
ATOM 1075  C CA   . ASN A 1 31 ? 1.763   -16.352 -2.708  1.00 0.00 ? 34 ASN A CA   2  
ATOM 1076  C C    . ASN A 1 31 ? 2.500   -17.436 -1.919  1.00 0.00 ? 34 ASN A C    2  
ATOM 1077  O O    . ASN A 1 31 ? 2.391   -18.621 -2.233  1.00 0.00 ? 34 ASN A O    2  
ATOM 1078  C CB   . ASN A 1 31 ? 2.683   -15.698 -3.755  1.00 0.00 ? 34 ASN A CB   2  
ATOM 1079  C CG   . ASN A 1 31 ? 4.153   -15.738 -3.385  1.00 0.00 ? 34 ASN A CG   2  
ATOM 1080  O OD1  . ASN A 1 31 ? 4.816   -16.759 -3.537  1.00 0.00 ? 34 ASN A OD1  2  
ATOM 1081  N ND2  . ASN A 1 31 ? 4.671   -14.623 -2.903  1.00 0.00 ? 34 ASN A ND2  2  
ATOM 1082  H H    . ASN A 1 31 ? 1.465   -14.416 -1.886  1.00 0.00 ? 34 ASN A H    2  
ATOM 1083  H HA   . ASN A 1 31 ? 0.939   -16.822 -3.225  1.00 0.00 ? 34 ASN A HA   2  
ATOM 1084  H HB2  . ASN A 1 31 ? 2.562   -16.211 -4.696  1.00 0.00 ? 34 ASN A HB2  2  
ATOM 1085  H HB3  . ASN A 1 31 ? 2.391   -14.665 -3.879  1.00 0.00 ? 34 ASN A HB3  2  
ATOM 1086  H HD21 . ASN A 1 31 ? 4.083   -13.839 -2.814  1.00 0.00 ? 34 ASN A HD21 2  
ATOM 1087  H HD22 . ASN A 1 31 ? 5.617   -14.625 -2.655  1.00 0.00 ? 34 ASN A HD22 2  
ATOM 1088  N N    . ALA A 1 32 ? 3.233   -17.022 -0.883  1.00 0.00 ? 35 ALA A N    2  
ATOM 1089  C CA   . ALA A 1 32 ? 3.976   -17.965 -0.045  1.00 0.00 ? 35 ALA A CA   2  
ATOM 1090  C C    . ALA A 1 32 ? 3.060   -19.013 0.588   1.00 0.00 ? 35 ALA A C    2  
ATOM 1091  O O    . ALA A 1 32 ? 3.491   -20.118 0.910   1.00 0.00 ? 35 ALA A O    2  
ATOM 1092  C CB   . ALA A 1 32 ? 4.757   -17.218 1.028   1.00 0.00 ? 35 ALA A CB   2  
ATOM 1093  H H    . ALA A 1 32 ? 3.269   -16.063 -0.676  1.00 0.00 ? 35 ALA A H    2  
ATOM 1094  H HA   . ALA A 1 32 ? 4.673   -18.472 -0.675  1.00 0.00 ? 35 ALA A HA   2  
ATOM 1095  H HB1  . ALA A 1 32 ? 5.566   -17.840 1.383   1.00 0.00 ? 35 ALA A HB1  2  
ATOM 1096  H HB2  . ALA A 1 32 ? 4.100   -16.977 1.850   1.00 0.00 ? 35 ALA A HB2  2  
ATOM 1097  H HB3  . ALA A 1 32 ? 5.160   -16.307 0.611   1.00 0.00 ? 35 ALA A HB3  2  
ATOM 1098  N N    . HIS A 1 33 ? 1.795   -18.655 0.748   1.00 0.00 ? 36 HIS A N    2  
ATOM 1099  C CA   . HIS A 1 33 ? 0.801   -19.554 1.330   1.00 0.00 ? 36 HIS A CA   2  
ATOM 1100  C C    . HIS A 1 33 ? 0.280   -20.546 0.288   1.00 0.00 ? 36 HIS A C    2  
ATOM 1101  O O    . HIS A 1 33 ? 0.286   -21.756 0.517   1.00 0.00 ? 36 HIS A O    2  
ATOM 1102  C CB   . HIS A 1 33 ? -0.363  -18.751 1.923   1.00 0.00 ? 36 HIS A CB   2  
ATOM 1103  C CG   . HIS A 1 33 ? -0.089  -18.231 3.299   1.00 0.00 ? 36 HIS A CG   2  
ATOM 1104  N ND1  . HIS A 1 33 ? 0.616   -17.072 3.538   1.00 0.00 ? 36 HIS A ND1  2  
ATOM 1105  C CD2  . HIS A 1 33 ? -0.427  -18.721 4.514   1.00 0.00 ? 36 HIS A CD2  2  
ATOM 1106  C CE1  . HIS A 1 33 ? 0.702   -16.870 4.842   1.00 0.00 ? 36 HIS A CE1  2  
ATOM 1107  N NE2  . HIS A 1 33 ? 0.075   -17.857 5.456   1.00 0.00 ? 36 HIS A NE2  2  
ATOM 1108  H H    . HIS A 1 33 ? 1.524   -17.764 0.459   1.00 0.00 ? 36 HIS A H    2  
ATOM 1109  H HA   . HIS A 1 33 ? 1.282   -20.110 2.123   1.00 0.00 ? 36 HIS A HA   2  
ATOM 1110  H HB2  . HIS A 1 33 ? -0.570  -17.905 1.285   1.00 0.00 ? 36 HIS A HB2  2  
ATOM 1111  H HB3  . HIS A 1 33 ? -1.239  -19.381 1.973   1.00 0.00 ? 36 HIS A HB3  2  
ATOM 1112  H HD1  . HIS A 1 33 ? 1.002   -16.472 2.844   1.00 0.00 ? 36 HIS A HD1  2  
ATOM 1113  H HD2  . HIS A 1 33 ? -0.988  -19.624 4.705   1.00 0.00 ? 36 HIS A HD2  2  
ATOM 1114  H HE1  . HIS A 1 33 ? 1.200   -16.039 5.323   1.00 0.00 ? 36 HIS A HE1  2  
ATOM 1115  H HE2  . HIS A 1 33 ? -0.113  -17.891 6.418   1.00 0.00 ? 36 HIS A HE2  2  
ATOM 1116  N N    . LEU A 1 34 ? -0.165  -20.029 -0.859  1.00 0.00 ? 37 LEU A N    2  
ATOM 1117  C CA   . LEU A 1 34 ? -0.685  -20.881 -1.933  1.00 0.00 ? 37 LEU A CA   2  
ATOM 1118  C C    . LEU A 1 34 ? 0.425   -21.701 -2.591  1.00 0.00 ? 37 LEU A C    2  
ATOM 1119  O O    . LEU A 1 34 ? 0.195   -22.821 -3.049  1.00 0.00 ? 37 LEU A O    2  
ATOM 1120  C CB   . LEU A 1 34 ? -1.430  -20.043 -2.980  1.00 0.00 ? 37 LEU A CB   2  
ATOM 1121  C CG   . LEU A 1 34 ? -0.581  -19.012 -3.727  1.00 0.00 ? 37 LEU A CG   2  
ATOM 1122  C CD1  . LEU A 1 34 ? -0.310  -19.475 -5.148  1.00 0.00 ? 37 LEU A CD1  2  
ATOM 1123  C CD2  . LEU A 1 34 ? -1.274  -17.660 -3.733  1.00 0.00 ? 37 LEU A CD2  2  
ATOM 1124  H H    . LEU A 1 34 ? -0.142  -19.055 -0.986  1.00 0.00 ? 37 LEU A H    2  
ATOM 1125  H HA   . LEU A 1 34 ? -1.372  -21.565 -1.485  1.00 0.00 ? 37 LEU A HA   2  
ATOM 1126  H HB2  . LEU A 1 34 ? -1.861  -20.718 -3.705  1.00 0.00 ? 37 LEU A HB2  2  
ATOM 1127  H HB3  . LEU A 1 34 ? -2.234  -19.520 -2.482  1.00 0.00 ? 37 LEU A HB3  2  
ATOM 1128  H HG   . LEU A 1 34 ? 0.369   -18.902 -3.225  1.00 0.00 ? 37 LEU A HG   2  
ATOM 1129  H HD11 . LEU A 1 34 ? 0.527   -18.926 -5.552  1.00 0.00 ? 37 LEU A HD11 2  
ATOM 1130  H HD12 . LEU A 1 34 ? -1.184  -19.297 -5.756  1.00 0.00 ? 37 LEU A HD12 2  
ATOM 1131  H HD13 . LEU A 1 34 ? -0.082  -20.531 -5.146  1.00 0.00 ? 37 LEU A HD13 2  
ATOM 1132  H HD21 . LEU A 1 34 ? -1.260  -17.243 -2.737  1.00 0.00 ? 37 LEU A HD21 2  
ATOM 1133  H HD22 . LEU A 1 34 ? -2.297  -17.780 -4.058  1.00 0.00 ? 37 LEU A HD22 2  
ATOM 1134  H HD23 . LEU A 1 34 ? -0.759  -16.994 -4.409  1.00 0.00 ? 37 LEU A HD23 2  
ATOM 1135  N N    . MET A 1 35 ? 1.625   -21.142 -2.613  1.00 0.00 ? 38 MET A N    2  
ATOM 1136  C CA   . MET A 1 35 ? 2.786   -21.820 -3.197  1.00 0.00 ? 38 MET A CA   2  
ATOM 1137  C C    . MET A 1 35 ? 3.283   -22.945 -2.290  1.00 0.00 ? 38 MET A C    2  
ATOM 1138  O O    . MET A 1 35 ? 3.907   -23.901 -2.753  1.00 0.00 ? 38 MET A O    2  
ATOM 1139  C CB   . MET A 1 35 ? 3.913   -20.817 -3.468  1.00 0.00 ? 38 MET A CB   2  
ATOM 1140  C CG   . MET A 1 35 ? 4.942   -21.313 -4.472  1.00 0.00 ? 38 MET A CG   2  
ATOM 1141  S SD   . MET A 1 35 ? 6.513   -20.437 -4.345  1.00 0.00 ? 38 MET A SD   2  
ATOM 1142  C CE   . MET A 1 35 ? 6.160   -18.968 -5.308  1.00 0.00 ? 38 MET A CE   2  
ATOM 1143  H H    . MET A 1 35 ? 1.735   -20.254 -2.218  1.00 0.00 ? 38 MET A H    2  
ATOM 1144  H HA   . MET A 1 35 ? 2.472   -22.253 -4.123  1.00 0.00 ? 38 MET A HA   2  
ATOM 1145  H HB2  . MET A 1 35 ? 3.482   -19.903 -3.849  1.00 0.00 ? 38 MET A HB2  2  
ATOM 1146  H HB3  . MET A 1 35 ? 4.421   -20.604 -2.539  1.00 0.00 ? 38 MET A HB3  2  
ATOM 1147  H HG2  . MET A 1 35 ? 5.120   -22.365 -4.297  1.00 0.00 ? 38 MET A HG2  2  
ATOM 1148  H HG3  . MET A 1 35 ? 4.549   -21.178 -5.469  1.00 0.00 ? 38 MET A HG3  2  
ATOM 1149  H HE1  . MET A 1 35 ? 5.194   -18.576 -5.026  1.00 0.00 ? 38 MET A HE1  2  
ATOM 1150  H HE2  . MET A 1 35 ? 6.156   -19.218 -6.358  1.00 0.00 ? 38 MET A HE2  2  
ATOM 1151  H HE3  . MET A 1 35 ? 6.920   -18.223 -5.119  1.00 0.00 ? 38 MET A HE3  2  
ATOM 1152  N N    . ALA A 1 36 ? 2.987   -22.826 -1.003  1.00 0.00 ? 39 ALA A N    2  
ATOM 1153  C CA   . ALA A 1 36 ? 3.381   -23.827 -0.013  1.00 0.00 ? 39 ALA A CA   2  
ATOM 1154  C C    . ALA A 1 36 ? 2.163   -24.615 0.489   1.00 0.00 ? 39 ALA A C    2  
ATOM 1155  O O    . ALA A 1 36 ? 2.111   -25.031 1.648   1.00 0.00 ? 39 ALA A O    2  
ATOM 1156  C CB   . ALA A 1 36 ? 4.105   -23.153 1.147   1.00 0.00 ? 39 ALA A CB   2  
ATOM 1157  H H    . ALA A 1 36 ? 2.478   -22.045 -0.712  1.00 0.00 ? 39 ALA A H    2  
ATOM 1158  H HA   . ALA A 1 36 ? 4.069   -24.513 -0.487  1.00 0.00 ? 39 ALA A HA   2  
ATOM 1159  H HB1  . ALA A 1 36 ? 3.518   -22.317 1.500   1.00 0.00 ? 39 ALA A HB1  2  
ATOM 1160  H HB2  . ALA A 1 36 ? 5.069   -22.800 0.813   1.00 0.00 ? 39 ALA A HB2  2  
ATOM 1161  H HB3  . ALA A 1 36 ? 4.238   -23.863 1.949   1.00 0.00 ? 39 ALA A HB3  2  
ATOM 1162  N N    . GLN A 1 37 ? 1.184   -24.813 -0.396  1.00 0.00 ? 40 GLN A N    2  
ATOM 1163  C CA   . GLN A 1 37 ? -0.036  -25.544 -0.050  1.00 0.00 ? 40 GLN A CA   2  
ATOM 1164  C C    . GLN A 1 37 ? 0.244   -27.030 0.191   1.00 0.00 ? 40 GLN A C    2  
ATOM 1165  O O    . GLN A 1 37 ? -0.347  -27.639 1.086   1.00 0.00 ? 40 GLN A O    2  
ATOM 1166  C CB   . GLN A 1 37 ? -1.083  -25.379 -1.157  1.00 0.00 ? 40 GLN A CB   2  
ATOM 1167  C CG   . GLN A 1 37 ? -2.458  -25.922 -0.787  1.00 0.00 ? 40 GLN A CG   2  
ATOM 1168  C CD   . GLN A 1 37 ? -3.053  -25.238 0.429   1.00 0.00 ? 40 GLN A CD   2  
ATOM 1169  O OE1  . GLN A 1 37 ? -3.855  -24.316 0.306   1.00 0.00 ? 40 GLN A OE1  2  
ATOM 1170  N NE2  . GLN A 1 37 ? -2.659  -25.682 1.613   1.00 0.00 ? 40 GLN A NE2  2  
ATOM 1171  H H    . GLN A 1 37 ? 1.281   -24.454 -1.303  1.00 0.00 ? 40 GLN A H    2  
ATOM 1172  H HA   . GLN A 1 37 ? -0.425  -25.117 0.862   1.00 0.00 ? 40 GLN A HA   2  
ATOM 1173  H HB2  . GLN A 1 37 ? -1.185  -24.328 -1.387  1.00 0.00 ? 40 GLN A HB2  2  
ATOM 1174  H HB3  . GLN A 1 37 ? -0.741  -25.899 -2.040  1.00 0.00 ? 40 GLN A HB3  2  
ATOM 1175  H HG2  . GLN A 1 37 ? -3.127  -25.776 -1.621  1.00 0.00 ? 40 GLN A HG2  2  
ATOM 1176  H HG3  . GLN A 1 37 ? -2.370  -26.979 -0.579  1.00 0.00 ? 40 GLN A HG3  2  
ATOM 1177  H HE21 . GLN A 1 37 ? -2.013  -26.420 1.642   1.00 0.00 ? 40 GLN A HE21 2  
ATOM 1178  H HE22 . GLN A 1 37 ? -3.029  -25.253 2.411   1.00 0.00 ? 40 GLN A HE22 2  
ATOM 1179  N N    . ILE A 1 38 ? 1.142   -27.603 -0.612  1.00 0.00 ? 41 ILE A N    2  
ATOM 1180  C CA   . ILE A 1 38 ? 1.504   -29.016 -0.490  1.00 0.00 ? 41 ILE A CA   2  
ATOM 1181  C C    . ILE A 1 38 ? 3.023   -29.187 -0.427  1.00 0.00 ? 41 ILE A C    2  
ATOM 1182  O O    . ILE A 1 38 ? 3.720   -28.627 -1.303  1.00 0.00 ? 41 ILE A O    2  
ATOM 1183  C CB   . ILE A 1 38 ? 0.946   -29.849 -1.667  1.00 0.00 ? 41 ILE A CB   2  
ATOM 1184  C CG1  . ILE A 1 38 ? -0.576  -29.703 -1.762  1.00 0.00 ? 41 ILE A CG1  2  
ATOM 1185  C CG2  . ILE A 1 38 ? 1.331   -31.317 -1.518  1.00 0.00 ? 41 ILE A CG2  2  
ATOM 1186  C CD1  . ILE A 1 38 ? -1.322  -30.277 -0.575  1.00 0.00 ? 41 ILE A CD1  2  
ATOM 1187  O OXT  . ILE A 1 38 ? 3.502   -29.877 0.497   1.00 0.00 ? 41 ILE A OXT  2  
ATOM 1188  H H    . ILE A 1 38 ? 1.577   -27.064 -1.304  1.00 0.00 ? 41 ILE A H    2  
ATOM 1189  H HA   . ILE A 1 38 ? 1.075   -29.393 0.425   1.00 0.00 ? 41 ILE A HA   2  
ATOM 1190  H HB   . ILE A 1 38 ? 1.393   -29.478 -2.575  1.00 0.00 ? 41 ILE A HB   2  
ATOM 1191  H HG12 . ILE A 1 38 ? -0.827  -28.655 -1.834  1.00 0.00 ? 41 ILE A HG12 2  
ATOM 1192  H HG13 . ILE A 1 38 ? -0.924  -30.212 -2.650  1.00 0.00 ? 41 ILE A HG13 2  
ATOM 1193  H HG21 . ILE A 1 38 ? 0.795   -31.745 -0.685  1.00 0.00 ? 41 ILE A HG21 2  
ATOM 1194  H HG22 . ILE A 1 38 ? 2.394   -31.394 -1.341  1.00 0.00 ? 41 ILE A HG22 2  
ATOM 1195  H HG23 . ILE A 1 38 ? 1.076   -31.849 -2.423  1.00 0.00 ? 41 ILE A HG23 2  
ATOM 1196  H HD11 . ILE A 1 38 ? -2.350  -30.461 -0.849  1.00 0.00 ? 41 ILE A HD11 2  
ATOM 1197  H HD12 . ILE A 1 38 ? -1.287  -29.576 0.246   1.00 0.00 ? 41 ILE A HD12 2  
ATOM 1198  H HD13 . ILE A 1 38 ? -0.858  -31.206 -0.275  1.00 0.00 ? 41 ILE A HD13 2  
ATOM 1199  N N    . PHE A 1 1  ? -18.015 11.538  6.650   1.00 0.00 ? 4  PHE A N    3  
ATOM 1200  C CA   . PHE A 1 1  ? -18.400 10.821  5.399   1.00 0.00 ? 4  PHE A CA   3  
ATOM 1201  C C    . PHE A 1 1  ? -18.333 11.751  4.190   1.00 0.00 ? 4  PHE A C    3  
ATOM 1202  O O    . PHE A 1 1  ? -18.486 12.964  4.333   1.00 0.00 ? 4  PHE A O    3  
ATOM 1203  C CB   . PHE A 1 1  ? -19.821 10.268  5.564   1.00 0.00 ? 4  PHE A CB   3  
ATOM 1204  C CG   . PHE A 1 1  ? -19.887 9.029   6.413   1.00 0.00 ? 4  PHE A CG   3  
ATOM 1205  C CD1  . PHE A 1 1  ? -19.366 7.830   5.955   1.00 0.00 ? 4  PHE A CD1  3  
ATOM 1206  C CD2  . PHE A 1 1  ? -20.470 9.065   7.670   1.00 0.00 ? 4  PHE A CD2  3  
ATOM 1207  C CE1  . PHE A 1 1  ? -19.424 6.691   6.734   1.00 0.00 ? 4  PHE A CE1  3  
ATOM 1208  C CE2  . PHE A 1 1  ? -20.531 7.928   8.454   1.00 0.00 ? 4  PHE A CE2  3  
ATOM 1209  C CZ   . PHE A 1 1  ? -20.007 6.740   7.986   1.00 0.00 ? 4  PHE A CZ   3  
ATOM 1210  H H1   . PHE A 1 1  ? -18.139 10.880  7.446   1.00 0.00 ? 4  PHE A H1   3  
ATOM 1211  H H2   . PHE A 1 1  ? -18.641 12.366  6.745   1.00 0.00 ? 4  PHE A H2   3  
ATOM 1212  H H3   . PHE A 1 1  ? -17.021 11.828  6.557   1.00 0.00 ? 4  PHE A H3   3  
ATOM 1213  H HA   . PHE A 1 1  ? -17.714 10.000  5.249   1.00 0.00 ? 4  PHE A HA   3  
ATOM 1214  H HB2  . PHE A 1 1  ? -20.444 11.020  6.024   1.00 0.00 ? 4  PHE A HB2  3  
ATOM 1215  H HB3  . PHE A 1 1  ? -20.221 10.025  4.590   1.00 0.00 ? 4  PHE A HB3  3  
ATOM 1216  H HD1  . PHE A 1 1  ? -18.910 7.789   4.977   1.00 0.00 ? 4  PHE A HD1  3  
ATOM 1217  H HD2  . PHE A 1 1  ? -20.883 9.994   8.038   1.00 0.00 ? 4  PHE A HD2  3  
ATOM 1218  H HE1  . PHE A 1 1  ? -19.013 5.762   6.366   1.00 0.00 ? 4  PHE A HE1  3  
ATOM 1219  H HE2  . PHE A 1 1  ? -20.988 7.970   9.432   1.00 0.00 ? 4  PHE A HE2  3  
ATOM 1220  H HZ   . PHE A 1 1  ? -20.054 5.850   8.596   1.00 0.00 ? 4  PHE A HZ   3  
ATOM 1221  N N    . THR A 1 2  ? -18.097 11.173  3.007   1.00 0.00 ? 5  THR A N    3  
ATOM 1222  C CA   . THR A 1 2  ? -18.002 11.943  1.760   1.00 0.00 ? 5  THR A CA   3  
ATOM 1223  C C    . THR A 1 2  ? -16.681 12.713  1.683   1.00 0.00 ? 5  THR A C    3  
ATOM 1224  O O    . THR A 1 2  ? -16.249 13.323  2.660   1.00 0.00 ? 5  THR A O    3  
ATOM 1225  C CB   . THR A 1 2  ? -19.182 12.913  1.620   1.00 0.00 ? 5  THR A CB   3  
ATOM 1226  O OG1  . THR A 1 2  ? -20.413 12.244  1.843   1.00 0.00 ? 5  THR A OG1  3  
ATOM 1227  C CG2  . THR A 1 2  ? -19.263 13.571  0.259   1.00 0.00 ? 5  THR A CG2  3  
ATOM 1228  H H    . THR A 1 2  ? -17.982 10.201  2.969   1.00 0.00 ? 5  THR A H    3  
ATOM 1229  H HA   . THR A 1 2  ? -18.034 11.240  0.941   1.00 0.00 ? 5  THR A HA   3  
ATOM 1230  H HB   . THR A 1 2  ? -19.083 13.695  2.360   1.00 0.00 ? 5  THR A HB   3  
ATOM 1231  H HG1  . THR A 1 2  ? -20.670 11.763  1.051   1.00 0.00 ? 5  THR A HG1  3  
ATOM 1232  H HG21 . THR A 1 2  ? -20.222 14.058  0.152   1.00 0.00 ? 5  THR A HG21 3  
ATOM 1233  H HG22 . THR A 1 2  ? -19.151 12.824  -0.512  1.00 0.00 ? 5  THR A HG22 3  
ATOM 1234  H HG23 . THR A 1 2  ? -18.476 14.305  0.167   1.00 0.00 ? 5  THR A HG23 3  
ATOM 1235  N N    . LEU A 1 3  ? -16.049 12.674  0.513   1.00 0.00 ? 6  LEU A N    3  
ATOM 1236  C CA   . LEU A 1 3  ? -14.778 13.364  0.297   1.00 0.00 ? 6  LEU A CA   3  
ATOM 1237  C C    . LEU A 1 3  ? -14.957 14.570  -0.632  1.00 0.00 ? 6  LEU A C    3  
ATOM 1238  O O    . LEU A 1 3  ? -16.057 14.830  -1.128  1.00 0.00 ? 6  LEU A O    3  
ATOM 1239  C CB   . LEU A 1 3  ? -13.745 12.395  -0.293  1.00 0.00 ? 6  LEU A CB   3  
ATOM 1240  C CG   . LEU A 1 3  ? -13.566 11.084  0.475   1.00 0.00 ? 6  LEU A CG   3  
ATOM 1241  C CD1  . LEU A 1 3  ? -12.854 10.056  -0.388  1.00 0.00 ? 6  LEU A CD1  3  
ATOM 1242  C CD2  . LEU A 1 3  ? -12.793 11.322  1.761   1.00 0.00 ? 6  LEU A CD2  3  
ATOM 1243  H H    . LEU A 1 3  ? -16.446 12.170  -0.226  1.00 0.00 ? 6  LEU A H    3  
ATOM 1244  H HA   . LEU A 1 3  ? -14.423 13.715  1.254   1.00 0.00 ? 6  LEU A HA   3  
ATOM 1245  H HB2  . LEU A 1 3  ? -14.043 12.158  -1.305  1.00 0.00 ? 6  LEU A HB2  3  
ATOM 1246  H HB3  . LEU A 1 3  ? -12.790 12.898  -0.327  1.00 0.00 ? 6  LEU A HB3  3  
ATOM 1247  H HG   . LEU A 1 3  ? -14.537 10.688  0.734   1.00 0.00 ? 6  LEU A HG   3  
ATOM 1248  H HD11 . LEU A 1 3  ? -13.391 9.930   -1.316  1.00 0.00 ? 6  LEU A HD11 3  
ATOM 1249  H HD12 . LEU A 1 3  ? -12.814 9.114   0.137   1.00 0.00 ? 6  LEU A HD12 3  
ATOM 1250  H HD13 . LEU A 1 3  ? -11.850 10.395  -0.596  1.00 0.00 ? 6  LEU A HD13 3  
ATOM 1251  H HD21 . LEU A 1 3  ? -11.820 11.729  1.527   1.00 0.00 ? 6  LEU A HD21 3  
ATOM 1252  H HD22 . LEU A 1 3  ? -12.674 10.387  2.288   1.00 0.00 ? 6  LEU A HD22 3  
ATOM 1253  H HD23 . LEU A 1 3  ? -13.334 12.019  2.383   1.00 0.00 ? 6  LEU A HD23 3  
ATOM 1254  N N    . SER A 1 4  ? -13.876 15.310  -0.862  1.00 0.00 ? 7  SER A N    3  
ATOM 1255  C CA   . SER A 1 4  ? -13.920 16.487  -1.731  1.00 0.00 ? 7  SER A CA   3  
ATOM 1256  C C    . SER A 1 4  ? -12.520 16.868  -2.219  1.00 0.00 ? 7  SER A C    3  
ATOM 1257  O O    . SER A 1 4  ? -12.034 17.971  -1.958  1.00 0.00 ? 7  SER A O    3  
ATOM 1258  C CB   . SER A 1 4  ? -14.575 17.663  -0.997  1.00 0.00 ? 7  SER A CB   3  
ATOM 1259  O OG   . SER A 1 4  ? -15.993 17.556  -1.020  1.00 0.00 ? 7  SER A OG   3  
ATOM 1260  H H    . SER A 1 4  ? -13.019 15.060  -0.430  1.00 0.00 ? 7  SER A H    3  
ATOM 1261  H HA   . SER A 1 4  ? -14.525 16.237  -2.592  1.00 0.00 ? 7  SER A HA   3  
ATOM 1262  H HB2  . SER A 1 4  ? -14.243 17.672  0.031   1.00 0.00 ? 7  SER A HB2  3  
ATOM 1263  H HB3  . SER A 1 4  ? -14.288 18.590  -1.475  1.00 0.00 ? 7  SER A HB3  3  
ATOM 1264  H HG   . SER A 1 4  ? -16.250 16.623  -1.029  1.00 0.00 ? 7  SER A HG   3  
ATOM 1265  N N    . LEU A 1 5  ? -11.876 15.936  -2.928  1.00 0.00 ? 8  LEU A N    3  
ATOM 1266  C CA   . LEU A 1 5  ? -10.526 16.147  -3.462  1.00 0.00 ? 8  LEU A CA   3  
ATOM 1267  C C    . LEU A 1 5  ? -9.520  16.439  -2.342  1.00 0.00 ? 8  LEU A C    3  
ATOM 1268  O O    . LEU A 1 5  ? -8.592  17.235  -2.509  1.00 0.00 ? 8  LEU A O    3  
ATOM 1269  C CB   . LEU A 1 5  ? -10.532 17.282  -4.494  1.00 0.00 ? 8  LEU A CB   3  
ATOM 1270  C CG   . LEU A 1 5  ? -10.797 16.847  -5.936  1.00 0.00 ? 8  LEU A CG   3  
ATOM 1271  C CD1  . LEU A 1 5  ? -12.288 16.847  -6.229  1.00 0.00 ? 8  LEU A CD1  3  
ATOM 1272  C CD2  . LEU A 1 5  ? -10.067 17.756  -6.909  1.00 0.00 ? 8  LEU A CD2  3  
ATOM 1273  H H    . LEU A 1 5  ? -12.322 15.081  -3.097  1.00 0.00 ? 8  LEU A H    3  
ATOM 1274  H HA   . LEU A 1 5  ? -10.227 15.234  -3.950  1.00 0.00 ? 8  LEU A HA   3  
ATOM 1275  H HB2  . LEU A 1 5  ? -11.292 17.996  -4.209  1.00 0.00 ? 8  LEU A HB2  3  
ATOM 1276  H HB3  . LEU A 1 5  ? -9.571  17.774  -4.462  1.00 0.00 ? 8  LEU A HB3  3  
ATOM 1277  H HG   . LEU A 1 5  ? -10.430 15.841  -6.077  1.00 0.00 ? 8  LEU A HG   3  
ATOM 1278  H HD11 . LEU A 1 5  ? -12.644 17.866  -6.279  1.00 0.00 ? 8  LEU A HD11 3  
ATOM 1279  H HD12 . LEU A 1 5  ? -12.810 16.322  -5.443  1.00 0.00 ? 8  LEU A HD12 3  
ATOM 1280  H HD13 . LEU A 1 5  ? -12.469 16.356  -7.173  1.00 0.00 ? 8  LEU A HD13 3  
ATOM 1281  H HD21 . LEU A 1 5  ? -10.425 17.574  -7.911  1.00 0.00 ? 8  LEU A HD21 3  
ATOM 1282  H HD22 . LEU A 1 5  ? -9.007  17.556  -6.863  1.00 0.00 ? 8  LEU A HD22 3  
ATOM 1283  H HD23 . LEU A 1 5  ? -10.250 18.787  -6.643  1.00 0.00 ? 8  LEU A HD23 3  
ATOM 1284  N N    . ASP A 1 6  ? -9.706  15.776  -1.207  1.00 0.00 ? 9  ASP A N    3  
ATOM 1285  C CA   . ASP A 1 6  ? -8.831  15.943  -0.056  1.00 0.00 ? 9  ASP A CA   3  
ATOM 1286  C C    . ASP A 1 6  ? -7.675  14.943  -0.104  1.00 0.00 ? 9  ASP A C    3  
ATOM 1287  O O    . ASP A 1 6  ? -7.522  14.085  0.769   1.00 0.00 ? 9  ASP A O    3  
ATOM 1288  C CB   . ASP A 1 6  ? -9.641  15.797  1.242   1.00 0.00 ? 9  ASP A CB   3  
ATOM 1289  C CG   . ASP A 1 6  ? -10.671 14.680  1.189   1.00 0.00 ? 9  ASP A CG   3  
ATOM 1290  O OD1  . ASP A 1 6  ? -11.643 14.799  0.409   1.00 0.00 ? 9  ASP A OD1  3  
ATOM 1291  O OD2  . ASP A 1 6  ? -10.505 13.688  1.926   1.00 0.00 ? 9  ASP A OD2  3  
ATOM 1292  H H    . ASP A 1 6  ? -10.453 15.152  -1.138  1.00 0.00 ? 9  ASP A H    3  
ATOM 1293  H HA   . ASP A 1 6  ? -8.416  16.935  -0.106  1.00 0.00 ? 9  ASP A HA   3  
ATOM 1294  H HB2  . ASP A 1 6  ? -8.967  15.586  2.049   1.00 0.00 ? 9  ASP A HB2  3  
ATOM 1295  H HB3  . ASP A 1 6  ? -10.157 16.724  1.443   1.00 0.00 ? 9  ASP A HB3  3  
ATOM 1296  N N    . VAL A 1 7  ? -6.868  15.068  -1.146  1.00 0.00 ? 10 VAL A N    3  
ATOM 1297  C CA   . VAL A 1 7  ? -5.724  14.187  -1.347  1.00 0.00 ? 10 VAL A CA   3  
ATOM 1298  C C    . VAL A 1 7  ? -4.398  14.958  -1.256  1.00 0.00 ? 10 VAL A C    3  
ATOM 1299  O O    . VAL A 1 7  ? -3.884  15.458  -2.260  1.00 0.00 ? 10 VAL A O    3  
ATOM 1300  C CB   . VAL A 1 7  ? -5.837  13.482  -2.714  1.00 0.00 ? 10 VAL A CB   3  
ATOM 1301  C CG1  . VAL A 1 7  ? -4.510  12.867  -3.140  1.00 0.00 ? 10 VAL A CG1  3  
ATOM 1302  C CG2  . VAL A 1 7  ? -6.925  12.420  -2.677  1.00 0.00 ? 10 VAL A CG2  3  
ATOM 1303  H H    . VAL A 1 7  ? -7.053  15.770  -1.806  1.00 0.00 ? 10 VAL A H    3  
ATOM 1304  H HA   . VAL A 1 7  ? -5.744  13.432  -0.576  1.00 0.00 ? 10 VAL A HA   3  
ATOM 1305  H HB   . VAL A 1 7  ? -6.123  14.228  -3.444  1.00 0.00 ? 10 VAL A HB   3  
ATOM 1306  H HG11 . VAL A 1 7  ? -3.966  12.543  -2.264  1.00 0.00 ? 10 VAL A HG11 3  
ATOM 1307  H HG12 . VAL A 1 7  ? -3.927  13.604  -3.673  1.00 0.00 ? 10 VAL A HG12 3  
ATOM 1308  H HG13 . VAL A 1 7  ? -4.696  12.020  -3.782  1.00 0.00 ? 10 VAL A HG13 3  
ATOM 1309  H HG21 . VAL A 1 7  ? -7.196  12.145  -3.685  1.00 0.00 ? 10 VAL A HG21 3  
ATOM 1310  H HG22 . VAL A 1 7  ? -7.794  12.810  -2.165  1.00 0.00 ? 10 VAL A HG22 3  
ATOM 1311  H HG23 . VAL A 1 7  ? -6.560  11.550  -2.152  1.00 0.00 ? 10 VAL A HG23 3  
ATOM 1312  N N    . PRO A 1 8  ? -3.829  15.067  -0.039  1.00 0.00 ? 11 PRO A N    3  
ATOM 1313  C CA   . PRO A 1 8  ? -2.568  15.776  0.185   1.00 0.00 ? 11 PRO A CA   3  
ATOM 1314  C C    . PRO A 1 8  ? -1.339  14.900  -0.073  1.00 0.00 ? 11 PRO A C    3  
ATOM 1315  O O    . PRO A 1 8  ? -1.410  13.668  -0.006  1.00 0.00 ? 11 PRO A O    3  
ATOM 1316  C CB   . PRO A 1 8  ? -2.661  16.151  1.661   1.00 0.00 ? 11 PRO A CB   3  
ATOM 1317  C CG   . PRO A 1 8  ? -3.437  15.038  2.282   1.00 0.00 ? 11 PRO A CG   3  
ATOM 1318  C CD   . PRO A 1 8  ? -4.377  14.518  1.217   1.00 0.00 ? 11 PRO A CD   3  
ATOM 1319  H HA   . PRO A 1 8  ? -2.504  16.672  -0.416  1.00 0.00 ? 11 PRO A HA   3  
ATOM 1320  H HB2  . PRO A 1 8  ? -1.667  16.226  2.080   1.00 0.00 ? 11 PRO A HB2  3  
ATOM 1321  H HB3  . PRO A 1 8  ? -3.174  17.095  1.764   1.00 0.00 ? 11 PRO A HB3  3  
ATOM 1322  H HG2  . PRO A 1 8  ? -2.763  14.257  2.599   1.00 0.00 ? 11 PRO A HG2  3  
ATOM 1323  H HG3  . PRO A 1 8  ? -4.000  15.412  3.125   1.00 0.00 ? 11 PRO A HG3  3  
ATOM 1324  H HD2  . PRO A 1 8  ? -4.366  13.438  1.201   1.00 0.00 ? 11 PRO A HD2  3  
ATOM 1325  H HD3  . PRO A 1 8  ? -5.379  14.881  1.392   1.00 0.00 ? 11 PRO A HD3  3  
ATOM 1326  N N    . THR A 1 9  ? -0.205  15.543  -0.356  1.00 0.00 ? 12 THR A N    3  
ATOM 1327  C CA   . THR A 1 9  ? 1.051   14.828  -0.614  1.00 0.00 ? 12 THR A CA   3  
ATOM 1328  C C    . THR A 1 9  ? 1.369   13.852  0.519   1.00 0.00 ? 12 THR A C    3  
ATOM 1329  O O    . THR A 1 9  ? 1.699   12.690  0.271   1.00 0.00 ? 12 THR A O    3  
ATOM 1330  C CB   . THR A 1 9  ? 2.208   15.817  -0.792  1.00 0.00 ? 12 THR A CB   3  
ATOM 1331  O OG1  . THR A 1 9  ? 1.726   17.144  -0.937  1.00 0.00 ? 12 THR A OG1  3  
ATOM 1332  C CG2  . THR A 1 9  ? 3.079   15.511  -1.992  1.00 0.00 ? 12 THR A CG2  3  
ATOM 1333  H H    . THR A 1 9  ? -0.208  16.524  -0.385  1.00 0.00 ? 12 THR A H    3  
ATOM 1334  H HA   . THR A 1 9  ? 0.928   14.267  -1.527  1.00 0.00 ? 12 THR A HA   3  
ATOM 1335  H HB   . THR A 1 9  ? 2.836   15.779  0.088   1.00 0.00 ? 12 THR A HB   3  
ATOM 1336  H HG1  . THR A 1 9  ? 1.526   17.319  -1.861  1.00 0.00 ? 12 THR A HG1  3  
ATOM 1337  H HG21 . THR A 1 9  ? 3.668   14.626  -1.792  1.00 0.00 ? 12 THR A HG21 3  
ATOM 1338  H HG22 . THR A 1 9  ? 3.737   16.345  -2.181  1.00 0.00 ? 12 THR A HG22 3  
ATOM 1339  H HG23 . THR A 1 9  ? 2.455   15.341  -2.856  1.00 0.00 ? 12 THR A HG23 3  
ATOM 1340  N N    . ASN A 1 10 ? 1.252   14.331  1.762   1.00 0.00 ? 13 ASN A N    3  
ATOM 1341  C CA   . ASN A 1 10 ? 1.516   13.504  2.945   1.00 0.00 ? 13 ASN A CA   3  
ATOM 1342  C C    . ASN A 1 10 ? 0.703   12.215  2.928   1.00 0.00 ? 13 ASN A C    3  
ATOM 1343  O O    . ASN A 1 10 ? 1.117   11.198  3.481   1.00 0.00 ? 13 ASN A O    3  
ATOM 1344  C CB   . ASN A 1 10 ? 1.230   14.291  4.228   1.00 0.00 ? 13 ASN A CB   3  
ATOM 1345  C CG   . ASN A 1 10 ? 2.289   15.336  4.515   1.00 0.00 ? 13 ASN A CG   3  
ATOM 1346  O OD1  . ASN A 1 10 ? 3.468   15.021  4.633   1.00 0.00 ? 13 ASN A OD1  3  
ATOM 1347  N ND2  . ASN A 1 10 ? 1.874   16.588  4.632   1.00 0.00 ? 13 ASN A ND2  3  
ATOM 1348  H H    . ASN A 1 10 ? 0.976   15.263  1.886   1.00 0.00 ? 13 ASN A H    3  
ATOM 1349  H HA   . ASN A 1 10 ? 2.545   13.238  2.922   1.00 0.00 ? 13 ASN A HA   3  
ATOM 1350  H HB2  . ASN A 1 10 ? 0.277   14.789  4.133   1.00 0.00 ? 13 ASN A HB2  3  
ATOM 1351  H HB3  . ASN A 1 10 ? 1.192   13.606  5.062   1.00 0.00 ? 13 ASN A HB3  3  
ATOM 1352  H HD21 . ASN A 1 10 ? 0.918   16.774  4.528   1.00 0.00 ? 13 ASN A HD21 3  
ATOM 1353  H HD22 . ASN A 1 10 ? 2.544   17.278  4.817   1.00 0.00 ? 13 ASN A HD22 3  
ATOM 1354  N N    . ILE A 1 11 ? -0.438  12.269  2.272   1.00 0.00 ? 14 ILE A N    3  
ATOM 1355  C CA   . ILE A 1 11 ? -1.318  11.117  2.146   1.00 0.00 ? 14 ILE A CA   3  
ATOM 1356  C C    . ILE A 1 11 ? -0.968  10.324  0.887   1.00 0.00 ? 14 ILE A C    3  
ATOM 1357  O O    . ILE A 1 11 ? -0.845  9.099   0.931   1.00 0.00 ? 14 ILE A O    3  
ATOM 1358  C CB   . ILE A 1 11 ? -2.794  11.574  2.115   1.00 0.00 ? 14 ILE A CB   3  
ATOM 1359  C CG1  . ILE A 1 11 ? -3.422  11.434  3.504   1.00 0.00 ? 14 ILE A CG1  3  
ATOM 1360  C CG2  . ILE A 1 11 ? -3.607  10.798  1.085   1.00 0.00 ? 14 ILE A CG2  3  
ATOM 1361  C CD1  . ILE A 1 11 ? -4.797  12.060  3.615   1.00 0.00 ? 14 ILE A CD1  3  
ATOM 1362  H H    . ILE A 1 11 ? -0.691  13.108  1.844   1.00 0.00 ? 14 ILE A H    3  
ATOM 1363  H HA   . ILE A 1 11 ? -1.169  10.486  3.009   1.00 0.00 ? 14 ILE A HA   3  
ATOM 1364  H HB   . ILE A 1 11 ? -2.799  12.615  1.834   1.00 0.00 ? 14 ILE A HB   3  
ATOM 1365  H HG12 . ILE A 1 11 ? -3.516  10.386  3.745   1.00 0.00 ? 14 ILE A HG12 3  
ATOM 1366  H HG13 . ILE A 1 11 ? -2.781  11.910  4.231   1.00 0.00 ? 14 ILE A HG13 3  
ATOM 1367  H HG21 . ILE A 1 11 ? -3.427  9.741   1.205   1.00 0.00 ? 14 ILE A HG21 3  
ATOM 1368  H HG22 . ILE A 1 11 ? -3.316  11.103  0.090   1.00 0.00 ? 14 ILE A HG22 3  
ATOM 1369  H HG23 . ILE A 1 11 ? -4.658  11.002  1.230   1.00 0.00 ? 14 ILE A HG23 3  
ATOM 1370  H HD11 . ILE A 1 11 ? -5.284  11.700  4.511   1.00 0.00 ? 14 ILE A HD11 3  
ATOM 1371  H HD12 . ILE A 1 11 ? -5.386  11.788  2.751   1.00 0.00 ? 14 ILE A HD12 3  
ATOM 1372  H HD13 . ILE A 1 11 ? -4.702  13.134  3.664   1.00 0.00 ? 14 ILE A HD13 3  
ATOM 1373  N N    . MET A 1 12 ? -0.788  11.036  -0.231  1.00 0.00 ? 15 MET A N    3  
ATOM 1374  C CA   . MET A 1 12 ? -0.430  10.411  -1.497  1.00 0.00 ? 15 MET A CA   3  
ATOM 1375  C C    . MET A 1 12 ? 0.848   9.587   -1.346  1.00 0.00 ? 15 MET A C    3  
ATOM 1376  O O    . MET A 1 12 ? 0.885   8.409   -1.711  1.00 0.00 ? 15 MET A O    3  
ATOM 1377  C CB   . MET A 1 12 ? -0.251  11.487  -2.568  1.00 0.00 ? 15 MET A CB   3  
ATOM 1378  C CG   . MET A 1 12 ? -1.123  11.276  -3.794  1.00 0.00 ? 15 MET A CG   3  
ATOM 1379  S SD   . MET A 1 12 ? -0.164  10.911  -5.276  1.00 0.00 ? 15 MET A SD   3  
ATOM 1380  C CE   . MET A 1 12 ? -0.698  12.233  -6.362  1.00 0.00 ? 15 MET A CE   3  
ATOM 1381  H H    . MET A 1 12 ? -0.887  12.013  -0.199  1.00 0.00 ? 15 MET A H    3  
ATOM 1382  H HA   . MET A 1 12 ? -1.236  9.753   -1.785  1.00 0.00 ? 15 MET A HA   3  
ATOM 1383  H HB2  . MET A 1 12 ? -0.496  12.448  -2.142  1.00 0.00 ? 15 MET A HB2  3  
ATOM 1384  H HB3  . MET A 1 12 ? 0.780   11.498  -2.882  1.00 0.00 ? 15 MET A HB3  3  
ATOM 1385  H HG2  . MET A 1 12 ? -1.793  10.452  -3.603  1.00 0.00 ? 15 MET A HG2  3  
ATOM 1386  H HG3  . MET A 1 12 ? -1.699  12.174  -3.963  1.00 0.00 ? 15 MET A HG3  3  
ATOM 1387  H HE1  . MET A 1 12 ? -0.504  13.186  -5.893  1.00 0.00 ? 15 MET A HE1  3  
ATOM 1388  H HE2  . MET A 1 12 ? -1.756  12.135  -6.555  1.00 0.00 ? 15 MET A HE2  3  
ATOM 1389  H HE3  . MET A 1 12 ? -0.155  12.174  -7.294  1.00 0.00 ? 15 MET A HE3  3  
ATOM 1390  N N    . ASN A 1 13 ? 1.890   10.209  -0.781  1.00 0.00 ? 16 ASN A N    3  
ATOM 1391  C CA   . ASN A 1 13 ? 3.163   9.527   -0.557  1.00 0.00 ? 16 ASN A CA   3  
ATOM 1392  C C    . ASN A 1 13 ? 2.948   8.260   0.269   1.00 0.00 ? 16 ASN A C    3  
ATOM 1393  O O    . ASN A 1 13 ? 3.523   7.208   -0.020  1.00 0.00 ? 16 ASN A O    3  
ATOM 1394  C CB   . ASN A 1 13 ? 4.153   10.462  0.150   1.00 0.00 ? 16 ASN A CB   3  
ATOM 1395  C CG   . ASN A 1 13 ? 4.775   11.475  -0.791  1.00 0.00 ? 16 ASN A CG   3  
ATOM 1396  O OD1  . ASN A 1 13 ? 4.478   12.665  -0.727  1.00 0.00 ? 16 ASN A OD1  3  
ATOM 1397  N ND2  . ASN A 1 13 ? 5.649   11.010  -1.671  1.00 0.00 ? 16 ASN A ND2  3  
ATOM 1398  H H    . ASN A 1 13 ? 1.791   11.146  -0.495  1.00 0.00 ? 16 ASN A H    3  
ATOM 1399  H HA   . ASN A 1 13 ? 3.562   9.247   -1.517  1.00 0.00 ? 16 ASN A HA   3  
ATOM 1400  H HB2  . ASN A 1 13 ? 3.636   10.999  0.930   1.00 0.00 ? 16 ASN A HB2  3  
ATOM 1401  H HB3  . ASN A 1 13 ? 4.945   9.873   0.589   1.00 0.00 ? 16 ASN A HB3  3  
ATOM 1402  H HD21 . ASN A 1 13 ? 5.845   10.051  -1.669  1.00 0.00 ? 16 ASN A HD21 3  
ATOM 1403  H HD22 . ASN A 1 13 ? 6.063   11.647  -2.288  1.00 0.00 ? 16 ASN A HD22 3  
ATOM 1404  N N    . LEU A 1 14 ? 2.093   8.368   1.287   1.00 0.00 ? 17 LEU A N    3  
ATOM 1405  C CA   . LEU A 1 14 ? 1.772   7.232   2.146   1.00 0.00 ? 17 LEU A CA   3  
ATOM 1406  C C    . LEU A 1 14 ? 0.964   6.198   1.369   1.00 0.00 ? 17 LEU A C    3  
ATOM 1407  O O    . LEU A 1 14 ? 1.346   5.029   1.300   1.00 0.00 ? 17 LEU A O    3  
ATOM 1408  C CB   . LEU A 1 14 ? 0.989   7.693   3.382   1.00 0.00 ? 17 LEU A CB   3  
ATOM 1409  C CG   . LEU A 1 14 ? 1.807   8.458   4.423   1.00 0.00 ? 17 LEU A CG   3  
ATOM 1410  C CD1  . LEU A 1 14 ? 0.926   8.879   5.587   1.00 0.00 ? 17 LEU A CD1  3  
ATOM 1411  C CD2  . LEU A 1 14 ? 2.971   7.615   4.916   1.00 0.00 ? 17 LEU A CD2  3  
ATOM 1412  H H    . LEU A 1 14 ? 1.655   9.228   1.450   1.00 0.00 ? 17 LEU A H    3  
ATOM 1413  H HA   . LEU A 1 14 ? 2.700   6.780   2.461   1.00 0.00 ? 17 LEU A HA   3  
ATOM 1414  H HB2  . LEU A 1 14 ? 0.180   8.330   3.052   1.00 0.00 ? 17 LEU A HB2  3  
ATOM 1415  H HB3  . LEU A 1 14 ? 0.566   6.822   3.859   1.00 0.00 ? 17 LEU A HB3  3  
ATOM 1416  H HG   . LEU A 1 14 ? 2.208   9.353   3.970   1.00 0.00 ? 17 LEU A HG   3  
ATOM 1417  H HD11 . LEU A 1 14 ? 0.171   8.126   5.758   1.00 0.00 ? 17 LEU A HD11 3  
ATOM 1418  H HD12 . LEU A 1 14 ? 0.450   9.821   5.356   1.00 0.00 ? 17 LEU A HD12 3  
ATOM 1419  H HD13 . LEU A 1 14 ? 1.531   8.990   6.475   1.00 0.00 ? 17 LEU A HD13 3  
ATOM 1420  H HD21 . LEU A 1 14 ? 3.695   7.499   4.124   1.00 0.00 ? 17 LEU A HD21 3  
ATOM 1421  H HD22 . LEU A 1 14 ? 2.608   6.642   5.217   1.00 0.00 ? 17 LEU A HD22 3  
ATOM 1422  H HD23 . LEU A 1 14 ? 3.435   8.101   5.761   1.00 0.00 ? 17 LEU A HD23 3  
ATOM 1423  N N    . LEU A 1 15 ? -0.145  6.638   0.769   1.00 0.00 ? 18 LEU A N    3  
ATOM 1424  C CA   . LEU A 1 15 ? -0.996  5.749   -0.021  1.00 0.00 ? 18 LEU A CA   3  
ATOM 1425  C C    . LEU A 1 15 ? -0.173  5.009   -1.071  1.00 0.00 ? 18 LEU A C    3  
ATOM 1426  O O    . LEU A 1 15 ? -0.283  3.787   -1.210  1.00 0.00 ? 18 LEU A O    3  
ATOM 1427  C CB   . LEU A 1 15 ? -2.121  6.545   -0.692  1.00 0.00 ? 18 LEU A CB   3  
ATOM 1428  C CG   . LEU A 1 15 ? -3.250  6.992   0.239   1.00 0.00 ? 18 LEU A CG   3  
ATOM 1429  C CD1  . LEU A 1 15 ? -4.284  7.797   -0.529  1.00 0.00 ? 18 LEU A CD1  3  
ATOM 1430  C CD2  . LEU A 1 15 ? -3.901  5.790   0.904   1.00 0.00 ? 18 LEU A CD2  3  
ATOM 1431  H H    . LEU A 1 15 ? -0.390  7.592   0.851   1.00 0.00 ? 18 LEU A H    3  
ATOM 1432  H HA   . LEU A 1 15 ? -1.428  5.021   0.649   1.00 0.00 ? 18 LEU A HA   3  
ATOM 1433  H HB2  . LEU A 1 15 ? -1.688  7.425   -1.146  1.00 0.00 ? 18 LEU A HB2  3  
ATOM 1434  H HB3  . LEU A 1 15 ? -2.551  5.935   -1.472  1.00 0.00 ? 18 LEU A HB3  3  
ATOM 1435  H HG   . LEU A 1 15 ? -2.841  7.624   1.015   1.00 0.00 ? 18 LEU A HG   3  
ATOM 1436  H HD11 . LEU A 1 15 ? -4.552  7.271   -1.432  1.00 0.00 ? 18 LEU A HD11 3  
ATOM 1437  H HD12 . LEU A 1 15 ? -3.873  8.763   -0.782  1.00 0.00 ? 18 LEU A HD12 3  
ATOM 1438  H HD13 . LEU A 1 15 ? -5.164  7.931   0.085   1.00 0.00 ? 18 LEU A HD13 3  
ATOM 1439  H HD21 . LEU A 1 15 ? -4.800  6.105   1.414   1.00 0.00 ? 18 LEU A HD21 3  
ATOM 1440  H HD22 . LEU A 1 15 ? -3.216  5.356   1.617   1.00 0.00 ? 18 LEU A HD22 3  
ATOM 1441  H HD23 . LEU A 1 15 ? -4.153  5.056   0.154   1.00 0.00 ? 18 LEU A HD23 3  
ATOM 1442  N N    . PHE A 1 16 ? 0.669   5.754   -1.788  1.00 0.00 ? 19 PHE A N    3  
ATOM 1443  C CA   . PHE A 1 16 ? 1.536   5.172   -2.810  1.00 0.00 ? 19 PHE A CA   3  
ATOM 1444  C C    . PHE A 1 16 ? 2.406   4.070   -2.211  1.00 0.00 ? 19 PHE A C    3  
ATOM 1445  O O    . PHE A 1 16 ? 2.573   3.005   -2.807  1.00 0.00 ? 19 PHE A O    3  
ATOM 1446  C CB   . PHE A 1 16 ? 2.420   6.255   -3.434  1.00 0.00 ? 19 PHE A CB   3  
ATOM 1447  C CG   . PHE A 1 16 ? 2.606   6.098   -4.917  1.00 0.00 ? 19 PHE A CG   3  
ATOM 1448  C CD1  . PHE A 1 16 ? 3.222   4.970   -5.436  1.00 0.00 ? 19 PHE A CD1  3  
ATOM 1449  C CD2  . PHE A 1 16 ? 2.162   7.076   -5.791  1.00 0.00 ? 19 PHE A CD2  3  
ATOM 1450  C CE1  . PHE A 1 16 ? 3.392   4.821   -6.799  1.00 0.00 ? 19 PHE A CE1  3  
ATOM 1451  C CE2  . PHE A 1 16 ? 2.329   6.932   -7.155  1.00 0.00 ? 19 PHE A CE2  3  
ATOM 1452  C CZ   . PHE A 1 16 ? 2.945   5.803   -7.660  1.00 0.00 ? 19 PHE A CZ   3  
ATOM 1453  H H    . PHE A 1 16 ? 0.719   6.723   -1.613  1.00 0.00 ? 19 PHE A H    3  
ATOM 1454  H HA   . PHE A 1 16 ? 0.907   4.742   -3.576  1.00 0.00 ? 19 PHE A HA   3  
ATOM 1455  H HB2  . PHE A 1 16 ? 1.973   7.220   -3.253  1.00 0.00 ? 19 PHE A HB2  3  
ATOM 1456  H HB3  . PHE A 1 16 ? 3.396   6.228   -2.969  1.00 0.00 ? 19 PHE A HB3  3  
ATOM 1457  H HD1  . PHE A 1 16 ? 3.571   4.200   -4.763  1.00 0.00 ? 19 PHE A HD1  3  
ATOM 1458  H HD2  . PHE A 1 16 ? 1.681   7.959   -5.399  1.00 0.00 ? 19 PHE A HD2  3  
ATOM 1459  H HE1  . PHE A 1 16 ? 3.874   3.937   -7.191  1.00 0.00 ? 19 PHE A HE1  3  
ATOM 1460  H HE2  . PHE A 1 16 ? 1.978   7.702   -7.828  1.00 0.00 ? 19 PHE A HE2  3  
ATOM 1461  H HZ   . PHE A 1 16 ? 3.076   5.688   -8.726  1.00 0.00 ? 19 PHE A HZ   3  
ATOM 1462  N N    . ASN A 1 17 ? 2.951   4.333   -1.022  1.00 0.00 ? 20 ASN A N    3  
ATOM 1463  C CA   . ASN A 1 17 ? 3.798   3.361   -0.338  1.00 0.00 ? 20 ASN A CA   3  
ATOM 1464  C C    . ASN A 1 17 ? 2.959   2.232   0.262   1.00 0.00 ? 20 ASN A C    3  
ATOM 1465  O O    . ASN A 1 17 ? 3.296   1.056   0.107   1.00 0.00 ? 20 ASN A O    3  
ATOM 1466  C CB   . ASN A 1 17 ? 4.621   4.046   0.747   1.00 0.00 ? 20 ASN A CB   3  
ATOM 1467  C CG   . ASN A 1 17 ? 6.055   3.563   0.775   1.00 0.00 ? 20 ASN A CG   3  
ATOM 1468  O OD1  . ASN A 1 17 ? 6.501   2.965   1.750   1.00 0.00 ? 20 ASN A OD1  3  
ATOM 1469  N ND2  . ASN A 1 17 ? 6.787   3.812   -0.301  1.00 0.00 ? 20 ASN A ND2  3  
ATOM 1470  H H    . ASN A 1 17 ? 2.772   5.199   -0.591  1.00 0.00 ? 20 ASN A H    3  
ATOM 1471  H HA   . ASN A 1 17 ? 4.468   2.937   -1.071  1.00 0.00 ? 20 ASN A HA   3  
ATOM 1472  H HB2  . ASN A 1 17 ? 4.622   5.111   0.573   1.00 0.00 ? 20 ASN A HB2  3  
ATOM 1473  H HB3  . ASN A 1 17 ? 4.173   3.843   1.702   1.00 0.00 ? 20 ASN A HB3  3  
ATOM 1474  H HD21 . ASN A 1 17 ? 6.368   4.290   -1.047  1.00 0.00 ? 20 ASN A HD21 3  
ATOM 1475  H HD22 . ASN A 1 17 ? 7.716   3.509   -0.304  1.00 0.00 ? 20 ASN A HD22 3  
ATOM 1476  N N    . ILE A 1 18 ? 1.857   2.589   0.929   1.00 0.00 ? 21 ILE A N    3  
ATOM 1477  C CA   . ILE A 1 18 ? 0.962   1.591   1.521   1.00 0.00 ? 21 ILE A CA   3  
ATOM 1478  C C    . ILE A 1 18 ? 0.639   0.524   0.491   1.00 0.00 ? 21 ILE A C    3  
ATOM 1479  O O    . ILE A 1 18 ? 0.988   -0.642  0.673   1.00 0.00 ? 21 ILE A O    3  
ATOM 1480  C CB   . ILE A 1 18 ? -0.347  2.226   2.046   1.00 0.00 ? 21 ILE A CB   3  
ATOM 1481  C CG1  . ILE A 1 18 ? -0.059  3.134   3.243   1.00 0.00 ? 21 ILE A CG1  3  
ATOM 1482  C CG2  . ILE A 1 18 ? -1.352  1.147   2.433   1.00 0.00 ? 21 ILE A CG2  3  
ATOM 1483  C CD1  . ILE A 1 18 ? -1.083  4.235   3.427   1.00 0.00 ? 21 ILE A CD1  3  
ATOM 1484  H H    . ILE A 1 18 ? 1.630   3.548   1.007   1.00 0.00 ? 21 ILE A H    3  
ATOM 1485  H HA   . ILE A 1 18 ? 1.473   1.119   2.347   1.00 0.00 ? 21 ILE A HA   3  
ATOM 1486  H HB   . ILE A 1 18 ? -0.778  2.816   1.251   1.00 0.00 ? 21 ILE A HB   3  
ATOM 1487  H HG12 . ILE A 1 18 ? -0.049  2.539   4.144   1.00 0.00 ? 21 ILE A HG12 3  
ATOM 1488  H HG13 . ILE A 1 18 ? 0.908   3.597   3.112   1.00 0.00 ? 21 ILE A HG13 3  
ATOM 1489  H HG21 . ILE A 1 18 ? -2.125  1.581   3.051   1.00 0.00 ? 21 ILE A HG21 3  
ATOM 1490  H HG22 . ILE A 1 18 ? -0.848  0.366   2.984   1.00 0.00 ? 21 ILE A HG22 3  
ATOM 1491  H HG23 . ILE A 1 18 ? -1.795  0.731   1.541   1.00 0.00 ? 21 ILE A HG23 3  
ATOM 1492  H HD11 . ILE A 1 18 ? -2.060  3.865   3.157   1.00 0.00 ? 21 ILE A HD11 3  
ATOM 1493  H HD12 . ILE A 1 18 ? -0.827  5.073   2.795   1.00 0.00 ? 21 ILE A HD12 3  
ATOM 1494  H HD13 . ILE A 1 18 ? -1.089  4.552   4.459   1.00 0.00 ? 21 ILE A HD13 3  
ATOM 1495  N N    . ALA A 1 19 ? 0.015   0.933   -0.614  1.00 0.00 ? 22 ALA A N    3  
ATOM 1496  C CA   . ALA A 1 19 ? -0.306  0.003   -1.690  1.00 0.00 ? 22 ALA A CA   3  
ATOM 1497  C C    . ALA A 1 19 ? 0.955   -0.737  -2.135  1.00 0.00 ? 22 ALA A C    3  
ATOM 1498  O O    . ALA A 1 19 ? 0.916   -1.941  -2.396  1.00 0.00 ? 22 ALA A O    3  
ATOM 1499  C CB   . ALA A 1 19 ? -0.941  0.744   -2.860  1.00 0.00 ? 22 ALA A CB   3  
ATOM 1500  H H    . ALA A 1 19 ? -0.206  1.888   -0.718  1.00 0.00 ? 22 ALA A H    3  
ATOM 1501  H HA   . ALA A 1 19 ? -1.017  -0.720  -1.315  1.00 0.00 ? 22 ALA A HA   3  
ATOM 1502  H HB1  . ALA A 1 19 ? -0.201  1.369   -3.337  1.00 0.00 ? 22 ALA A HB1  3  
ATOM 1503  H HB2  . ALA A 1 19 ? -1.753  1.359   -2.499  1.00 0.00 ? 22 ALA A HB2  3  
ATOM 1504  H HB3  . ALA A 1 19 ? -1.323  0.030   -3.576  1.00 0.00 ? 22 ALA A HB3  3  
ATOM 1505  N N    . LYS A 1 20 ? 2.075   -0.007  -2.193  1.00 0.00 ? 23 LYS A N    3  
ATOM 1506  C CA   . LYS A 1 20 ? 3.365   -0.576  -2.581  1.00 0.00 ? 23 LYS A CA   3  
ATOM 1507  C C    . LYS A 1 20 ? 3.748   -1.747  -1.680  1.00 0.00 ? 23 LYS A C    3  
ATOM 1508  O O    . LYS A 1 20 ? 4.020   -2.852  -2.166  1.00 0.00 ? 23 LYS A O    3  
ATOM 1509  C CB   . LYS A 1 20 ? 4.461   0.496   -2.517  1.00 0.00 ? 23 LYS A CB   3  
ATOM 1510  C CG   . LYS A 1 20 ? 5.497   0.392   -3.624  1.00 0.00 ? 23 LYS A CG   3  
ATOM 1511  C CD   . LYS A 1 20 ? 6.165   -0.981  -3.658  1.00 0.00 ? 23 LYS A CD   3  
ATOM 1512  C CE   . LYS A 1 20 ? 5.565   -1.882  -4.730  1.00 0.00 ? 23 LYS A CE   3  
ATOM 1513  N NZ   . LYS A 1 20 ? 5.289   -3.256  -4.208  1.00 0.00 ? 23 LYS A NZ   3  
ATOM 1514  H H    . LYS A 1 20 ? 2.031   0.945   -1.955  1.00 0.00 ? 23 LYS A H    3  
ATOM 1515  H HA   . LYS A 1 20 ? 3.279   -0.930  -3.592  1.00 0.00 ? 23 LYS A HA   3  
ATOM 1516  H HB2  . LYS A 1 20 ? 3.998   1.468   -2.581  1.00 0.00 ? 23 LYS A HB2  3  
ATOM 1517  H HB3  . LYS A 1 20 ? 4.972   0.415   -1.568  1.00 0.00 ? 23 LYS A HB3  3  
ATOM 1518  H HG2  . LYS A 1 20 ? 5.011   0.574   -4.567  1.00 0.00 ? 23 LYS A HG2  3  
ATOM 1519  H HG3  . LYS A 1 20 ? 6.256   1.145   -3.461  1.00 0.00 ? 23 LYS A HG3  3  
ATOM 1520  H HD2  . LYS A 1 20 ? 7.217   -0.852  -3.861  1.00 0.00 ? 23 LYS A HD2  3  
ATOM 1521  H HD3  . LYS A 1 20 ? 6.042   -1.454  -2.692  1.00 0.00 ? 23 LYS A HD3  3  
ATOM 1522  H HE2  . LYS A 1 20 ? 4.642   -1.442  -5.078  1.00 0.00 ? 23 LYS A HE2  3  
ATOM 1523  H HE3  . LYS A 1 20 ? 6.263   -1.951  -5.554  1.00 0.00 ? 23 LYS A HE3  3  
ATOM 1524  H HZ1  . LYS A 1 20 ? 6.180   -3.775  -4.077  1.00 0.00 ? 23 LYS A HZ1  3  
ATOM 1525  H HZ2  . LYS A 1 20 ? 4.686   -3.787  -4.878  1.00 0.00 ? 23 LYS A HZ2  3  
ATOM 1526  H HZ3  . LYS A 1 20 ? 4.789   -3.201  -3.282  1.00 0.00 ? 23 LYS A HZ3  3  
ATOM 1527  N N    . ALA A 1 21 ? 3.776   -1.504  -0.373  1.00 0.00 ? 24 ALA A N    3  
ATOM 1528  C CA   . ALA A 1 21 ? 4.129   -2.540  0.592   1.00 0.00 ? 24 ALA A CA   3  
ATOM 1529  C C    . ALA A 1 21 ? 2.986   -3.536  0.778   1.00 0.00 ? 24 ALA A C    3  
ATOM 1530  O O    . ALA A 1 21 ? 3.225   -4.734  0.933   1.00 0.00 ? 24 ALA A O    3  
ATOM 1531  C CB   . ALA A 1 21 ? 4.519   -1.913  1.924   1.00 0.00 ? 24 ALA A CB   3  
ATOM 1532  H H    . ALA A 1 21 ? 3.554   -0.597  -0.049  1.00 0.00 ? 24 ALA A H    3  
ATOM 1533  H HA   . ALA A 1 21 ? 4.988   -3.074  0.206   1.00 0.00 ? 24 ALA A HA   3  
ATOM 1534  H HB1  . ALA A 1 21 ? 4.943   -2.670  2.568   1.00 0.00 ? 24 ALA A HB1  3  
ATOM 1535  H HB2  . ALA A 1 21 ? 3.643   -1.490  2.393   1.00 0.00 ? 24 ALA A HB2  3  
ATOM 1536  H HB3  . ALA A 1 21 ? 5.248   -1.134  1.756   1.00 0.00 ? 24 ALA A HB3  3  
ATOM 1537  N N    . LYS A 1 22 ? 1.745   -3.040  0.742   1.00 0.00 ? 25 LYS A N    3  
ATOM 1538  C CA   . LYS A 1 22 ? 0.576   -3.893  0.892   1.00 0.00 ? 25 LYS A CA   3  
ATOM 1539  C C    . LYS A 1 22 ? 0.600   -4.993  -0.162  1.00 0.00 ? 25 LYS A C    3  
ATOM 1540  O O    . LYS A 1 22 ? 0.388   -6.166  0.151   1.00 0.00 ? 25 LYS A O    3  
ATOM 1541  C CB   . LYS A 1 22 ? -0.709  -3.060  0.793   1.00 0.00 ? 25 LYS A CB   3  
ATOM 1542  C CG   . LYS A 1 22 ? -1.587  -3.160  2.029   1.00 0.00 ? 25 LYS A CG   3  
ATOM 1543  C CD   . LYS A 1 22 ? -3.051  -3.373  1.666   1.00 0.00 ? 25 LYS A CD   3  
ATOM 1544  C CE   . LYS A 1 22 ? -3.738  -4.328  2.631   1.00 0.00 ? 25 LYS A CE   3  
ATOM 1545  N NZ   . LYS A 1 22 ? -3.939  -3.711  3.978   1.00 0.00 ? 25 LYS A NZ   3  
ATOM 1546  H H    . LYS A 1 22 ? 1.614   -2.079  0.593   1.00 0.00 ? 25 LYS A H    3  
ATOM 1547  H HA   . LYS A 1 22 ? 0.625   -4.353  1.868   1.00 0.00 ? 25 LYS A HA   3  
ATOM 1548  H HB2  . LYS A 1 22 ? -0.440  -2.020  0.659   1.00 0.00 ? 25 LYS A HB2  3  
ATOM 1549  H HB3  . LYS A 1 22 ? -1.280  -3.391  -0.061  1.00 0.00 ? 25 LYS A HB3  3  
ATOM 1550  H HG2  . LYS A 1 22 ? -1.246  -3.992  2.627   1.00 0.00 ? 25 LYS A HG2  3  
ATOM 1551  H HG3  . LYS A 1 22 ? -1.493  -2.246  2.597   1.00 0.00 ? 25 LYS A HG3  3  
ATOM 1552  H HD2  . LYS A 1 22 ? -3.560  -2.420  1.697   1.00 0.00 ? 25 LYS A HD2  3  
ATOM 1553  H HD3  . LYS A 1 22 ? -3.110  -3.781  0.667   1.00 0.00 ? 25 LYS A HD3  3  
ATOM 1554  H HE2  . LYS A 1 22 ? -4.700  -4.602  2.221   1.00 0.00 ? 25 LYS A HE2  3  
ATOM 1555  H HE3  . LYS A 1 22 ? -3.127  -5.214  2.735   1.00 0.00 ? 25 LYS A HE3  3  
ATOM 1556  H HZ1  . LYS A 1 22 ? -3.194  -3.011  4.168   1.00 0.00 ? 25 LYS A HZ1  3  
ATOM 1557  H HZ2  . LYS A 1 22 ? -3.906  -4.444  4.716   1.00 0.00 ? 25 LYS A HZ2  3  
ATOM 1558  H HZ3  . LYS A 1 22 ? -4.864  -3.235  4.021   1.00 0.00 ? 25 LYS A HZ3  3  
ATOM 1559  N N    . ASN A 1 23 ? 0.897   -4.614  -1.407  1.00 0.00 ? 26 ASN A N    3  
ATOM 1560  C CA   . ASN A 1 23 ? 0.985   -5.597  -2.486  1.00 0.00 ? 26 ASN A CA   3  
ATOM 1561  C C    . ASN A 1 23 ? 2.289   -6.393  -2.369  1.00 0.00 ? 26 ASN A C    3  
ATOM 1562  O O    . ASN A 1 23 ? 2.294   -7.614  -2.518  1.00 0.00 ? 26 ASN A O    3  
ATOM 1563  C CB   . ASN A 1 23 ? 0.854   -4.931  -3.868  1.00 0.00 ? 26 ASN A CB   3  
ATOM 1564  C CG   . ASN A 1 23 ? 2.129   -4.269  -4.364  1.00 0.00 ? 26 ASN A CG   3  
ATOM 1565  O OD1  . ASN A 1 23 ? 3.075   -4.932  -4.787  1.00 0.00 ? 26 ASN A OD1  3  
ATOM 1566  N ND2  . ASN A 1 23 ? 2.167   -2.951  -4.309  1.00 0.00 ? 26 ASN A ND2  3  
ATOM 1567  H H    . ASN A 1 23 ? 1.085   -3.657  -1.591  1.00 0.00 ? 26 ASN A H    3  
ATOM 1568  H HA   . ASN A 1 23 ? 0.163   -6.287  -2.356  1.00 0.00 ? 26 ASN A HA   3  
ATOM 1569  H HB2  . ASN A 1 23 ? 0.569   -5.681  -4.589  1.00 0.00 ? 26 ASN A HB2  3  
ATOM 1570  H HB3  . ASN A 1 23 ? 0.079   -4.180  -3.821  1.00 0.00 ? 26 ASN A HB3  3  
ATOM 1571  H HD21 . ASN A 1 23 ? 1.387   -2.478  -3.947  1.00 0.00 ? 26 ASN A HD21 3  
ATOM 1572  H HD22 . ASN A 1 23 ? 2.964   -2.501  -4.643  1.00 0.00 ? 26 ASN A HD22 3  
ATOM 1573  N N    . LEU A 1 24 ? 3.385   -5.691  -2.069  1.00 0.00 ? 27 LEU A N    3  
ATOM 1574  C CA   . LEU A 1 24 ? 4.694   -6.325  -1.903  1.00 0.00 ? 27 LEU A CA   3  
ATOM 1575  C C    . LEU A 1 24 ? 4.654   -7.411  -0.833  1.00 0.00 ? 27 LEU A C    3  
ATOM 1576  O O    . LEU A 1 24 ? 5.046   -8.551  -1.073  1.00 0.00 ? 27 LEU A O    3  
ATOM 1577  C CB   . LEU A 1 24 ? 5.753   -5.261  -1.581  1.00 0.00 ? 27 LEU A CB   3  
ATOM 1578  C CG   . LEU A 1 24 ? 6.818   -5.680  -0.575  1.00 0.00 ? 27 LEU A CG   3  
ATOM 1579  C CD1  . LEU A 1 24 ? 7.992   -6.339  -1.278  1.00 0.00 ? 27 LEU A CD1  3  
ATOM 1580  C CD2  . LEU A 1 24 ? 7.283   -4.485  0.240   1.00 0.00 ? 27 LEU A CD2  3  
ATOM 1581  H H    . LEU A 1 24 ? 3.309   -4.722  -1.941  1.00 0.00 ? 27 LEU A H    3  
ATOM 1582  H HA   . LEU A 1 24 ? 4.949   -6.790  -2.818  1.00 0.00 ? 27 LEU A HA   3  
ATOM 1583  H HB2  . LEU A 1 24 ? 6.249   -4.990  -2.499  1.00 0.00 ? 27 LEU A HB2  3  
ATOM 1584  H HB3  . LEU A 1 24 ? 5.250   -4.389  -1.193  1.00 0.00 ? 27 LEU A HB3  3  
ATOM 1585  H HG   . LEU A 1 24 ? 6.387   -6.398  0.098   1.00 0.00 ? 27 LEU A HG   3  
ATOM 1586  H HD11 . LEU A 1 24 ? 7.641   -7.187  -1.847  1.00 0.00 ? 27 LEU A HD11 3  
ATOM 1587  H HD12 . LEU A 1 24 ? 8.709   -6.671  -0.543  1.00 0.00 ? 27 LEU A HD12 3  
ATOM 1588  H HD13 . LEU A 1 24 ? 8.460   -5.628  -1.942  1.00 0.00 ? 27 LEU A HD13 3  
ATOM 1589  H HD21 . LEU A 1 24 ? 6.648   -4.371  1.105   1.00 0.00 ? 27 LEU A HD21 3  
ATOM 1590  H HD22 . LEU A 1 24 ? 7.231   -3.593  -0.366  1.00 0.00 ? 27 LEU A HD22 3  
ATOM 1591  H HD23 . LEU A 1 24 ? 8.303   -4.644  0.559   1.00 0.00 ? 27 LEU A HD23 3  
ATOM 1592  N N    . ARG A 1 25 ? 4.171   -7.042  0.337   1.00 0.00 ? 28 ARG A N    3  
ATOM 1593  C CA   . ARG A 1 25 ? 4.062   -7.970  1.466   1.00 0.00 ? 28 ARG A CA   3  
ATOM 1594  C C    . ARG A 1 25 ? 3.046   -9.076  1.179   1.00 0.00 ? 28 ARG A C    3  
ATOM 1595  O O    . ARG A 1 25 ? 3.259   -10.230 1.550   1.00 0.00 ? 28 ARG A O    3  
ATOM 1596  C CB   . ARG A 1 25 ? 3.672   -7.217  2.745   1.00 0.00 ? 28 ARG A CB   3  
ATOM 1597  C CG   . ARG A 1 25 ? 4.732   -7.275  3.833   1.00 0.00 ? 28 ARG A CG   3  
ATOM 1598  C CD   . ARG A 1 25 ? 4.122   -7.540  5.204   1.00 0.00 ? 28 ARG A CD   3  
ATOM 1599  N NE   . ARG A 1 25 ? 4.309   -6.405  6.114   1.00 0.00 ? 28 ARG A NE   3  
ATOM 1600  C CZ   . ARG A 1 25 ? 4.035   -6.429  7.417   1.00 0.00 ? 28 ARG A CZ   3  
ATOM 1601  N NH1  . ARG A 1 25 ? 3.553   -7.520  7.982   1.00 0.00 ? 28 ARG A NH1  3  
ATOM 1602  N NH2  . ARG A 1 25 ? 4.244   -5.354  8.152   1.00 0.00 ? 28 ARG A NH2  3  
ATOM 1603  H H    . ARG A 1 25 ? 3.875   -6.114  0.442   1.00 0.00 ? 28 ARG A H    3  
ATOM 1604  H HA   . ARG A 1 25 ? 5.030   -8.427  1.611   1.00 0.00 ? 28 ARG A HA   3  
ATOM 1605  H HB2  . ARG A 1 25 ? 3.495   -6.181  2.501   1.00 0.00 ? 28 ARG A HB2  3  
ATOM 1606  H HB3  . ARG A 1 25 ? 2.760   -7.644  3.137   1.00 0.00 ? 28 ARG A HB3  3  
ATOM 1607  H HG2  . ARG A 1 25 ? 5.428   -8.068  3.601   1.00 0.00 ? 28 ARG A HG2  3  
ATOM 1608  H HG3  . ARG A 1 25 ? 5.259   -6.332  3.858   1.00 0.00 ? 28 ARG A HG3  3  
ATOM 1609  H HD2  . ARG A 1 25 ? 3.064   -7.726  5.083   1.00 0.00 ? 28 ARG A HD2  3  
ATOM 1610  H HD3  . ARG A 1 25 ? 4.594   -8.414  5.629   1.00 0.00 ? 28 ARG A HD3  3  
ATOM 1611  H HE   . ARG A 1 25 ? 4.662   -5.575  5.730   1.00 0.00 ? 28 ARG A HE   3  
ATOM 1612  H HH11 . ARG A 1 25 ? 3.390   -8.335  7.432   1.00 0.00 ? 28 ARG A HH11 3  
ATOM 1613  H HH12 . ARG A 1 25 ? 3.352   -7.531  8.959   1.00 0.00 ? 28 ARG A HH12 3  
ATOM 1614  H HH21 . ARG A 1 25 ? 4.608   -4.526  7.731   1.00 0.00 ? 28 ARG A HH21 3  
ATOM 1615  H HH22 . ARG A 1 25 ? 4.039   -5.367  9.129   1.00 0.00 ? 28 ARG A HH22 3  
ATOM 1616  N N    . ALA A 1 26 ? 1.952   -8.724  0.505   1.00 0.00 ? 29 ALA A N    3  
ATOM 1617  C CA   . ALA A 1 26 ? 0.923   -9.697  0.167   1.00 0.00 ? 29 ALA A CA   3  
ATOM 1618  C C    . ALA A 1 26 ? 1.427   -10.667 -0.893  1.00 0.00 ? 29 ALA A C    3  
ATOM 1619  O O    . ALA A 1 26 ? 1.194   -11.866 -0.818  1.00 0.00 ? 29 ALA A O    3  
ATOM 1620  C CB   . ALA A 1 26 ? -0.340  -8.989  -0.310  1.00 0.00 ? 29 ALA A CB   3  
ATOM 1621  H H    . ALA A 1 26 ? 1.841   -7.794  0.218   1.00 0.00 ? 29 ALA A H    3  
ATOM 1622  H HA   . ALA A 1 26 ? 0.680   -10.253 1.062   1.00 0.00 ? 29 ALA A HA   3  
ATOM 1623  H HB1  . ALA A 1 26 ? -0.072  -8.189  -0.983  1.00 0.00 ? 29 ALA A HB1  3  
ATOM 1624  H HB2  . ALA A 1 26 ? -0.867  -8.582  0.540   1.00 0.00 ? 29 ALA A HB2  3  
ATOM 1625  H HB3  . ALA A 1 26 ? -0.976  -9.694  -0.824  1.00 0.00 ? 29 ALA A HB3  3  
ATOM 1626  N N    . GLN A 1 27 ? 2.126   -10.149 -1.887  1.00 0.00 ? 30 GLN A N    3  
ATOM 1627  C CA   . GLN A 1 27 ? 2.643   -11.007 -2.946  1.00 0.00 ? 30 GLN A CA   3  
ATOM 1628  C C    . GLN A 1 27 ? 3.904   -11.762 -2.512  1.00 0.00 ? 30 GLN A C    3  
ATOM 1629  O O    . GLN A 1 27 ? 4.280   -12.763 -3.120  1.00 0.00 ? 30 GLN A O    3  
ATOM 1630  C CB   . GLN A 1 27 ? 2.882   -10.184 -4.228  1.00 0.00 ? 30 GLN A CB   3  
ATOM 1631  C CG   . GLN A 1 27 ? 4.075   -10.631 -5.070  1.00 0.00 ? 30 GLN A CG   3  
ATOM 1632  C CD   . GLN A 1 27 ? 3.733   -11.757 -6.027  1.00 0.00 ? 30 GLN A CD   3  
ATOM 1633  O OE1  . GLN A 1 27 ? 3.190   -11.527 -7.102  1.00 0.00 ? 30 GLN A OE1  3  
ATOM 1634  N NE2  . GLN A 1 27 ? 4.047   -12.982 -5.638  1.00 0.00 ? 30 GLN A NE2  3  
ATOM 1635  H H    . GLN A 1 27 ? 2.292   -9.174  -1.912  1.00 0.00 ? 30 GLN A H    3  
ATOM 1636  H HA   . GLN A 1 27 ? 1.882   -11.739 -3.133  1.00 0.00 ? 30 GLN A HA   3  
ATOM 1637  H HB2  . GLN A 1 27 ? 1.998   -10.244 -4.845  1.00 0.00 ? 30 GLN A HB2  3  
ATOM 1638  H HB3  . GLN A 1 27 ? 3.038   -9.151  -3.949  1.00 0.00 ? 30 GLN A HB3  3  
ATOM 1639  H HG2  . GLN A 1 27 ? 4.422   -9.789  -5.650  1.00 0.00 ? 30 GLN A HG2  3  
ATOM 1640  H HG3  . GLN A 1 27 ? 4.865   -10.962 -4.415  1.00 0.00 ? 30 GLN A HG3  3  
ATOM 1641  H HE21 . GLN A 1 27 ? 4.475   -13.094 -4.759  1.00 0.00 ? 30 GLN A HE21 3  
ATOM 1642  H HE22 . GLN A 1 27 ? 3.835   -13.728 -6.238  1.00 0.00 ? 30 GLN A HE22 3  
ATOM 1643  N N    . ALA A 1 28 ? 4.545   -11.294 -1.457  1.00 0.00 ? 31 ALA A N    3  
ATOM 1644  C CA   . ALA A 1 28 ? 5.747   -11.946 -0.952  1.00 0.00 ? 31 ALA A CA   3  
ATOM 1645  C C    . ALA A 1 28 ? 5.429   -12.873 0.219   1.00 0.00 ? 31 ALA A C    3  
ATOM 1646  O O    . ALA A 1 28 ? 5.858   -14.028 0.239   1.00 0.00 ? 31 ALA A O    3  
ATOM 1647  C CB   . ALA A 1 28 ? 6.789   -10.908 -0.555  1.00 0.00 ? 31 ALA A CB   3  
ATOM 1648  H H    . ALA A 1 28 ? 4.200   -10.502 -1.006  1.00 0.00 ? 31 ALA A H    3  
ATOM 1649  H HA   . ALA A 1 28 ? 6.155   -12.542 -1.754  1.00 0.00 ? 31 ALA A HA   3  
ATOM 1650  H HB1  . ALA A 1 28 ? 7.562   -11.379 0.034   1.00 0.00 ? 31 ALA A HB1  3  
ATOM 1651  H HB2  . ALA A 1 28 ? 6.319   -10.128 0.026   1.00 0.00 ? 31 ALA A HB2  3  
ATOM 1652  H HB3  . ALA A 1 28 ? 7.226   -10.478 -1.445  1.00 0.00 ? 31 ALA A HB3  3  
ATOM 1653  N N    . ALA A 1 29 ? 4.678   -12.363 1.194   1.00 0.00 ? 32 ALA A N    3  
ATOM 1654  C CA   . ALA A 1 29 ? 4.311   -13.148 2.369   1.00 0.00 ? 32 ALA A CA   3  
ATOM 1655  C C    . ALA A 1 29 ? 2.904   -13.758 2.264   1.00 0.00 ? 32 ALA A C    3  
ATOM 1656  O O    . ALA A 1 29 ? 2.489   -14.501 3.156   1.00 0.00 ? 32 ALA A O    3  
ATOM 1657  C CB   . ALA A 1 29 ? 4.423   -12.286 3.619   1.00 0.00 ? 32 ALA A CB   3  
ATOM 1658  H H    . ALA A 1 29 ? 4.364   -11.430 1.125   1.00 0.00 ? 32 ALA A H    3  
ATOM 1659  H HA   . ALA A 1 29 ? 5.026   -13.953 2.462   1.00 0.00 ? 32 ALA A HA   3  
ATOM 1660  H HB1  . ALA A 1 29 ? 5.391   -11.808 3.642   1.00 0.00 ? 32 ALA A HB1  3  
ATOM 1661  H HB2  . ALA A 1 29 ? 4.306   -12.906 4.497   1.00 0.00 ? 32 ALA A HB2  3  
ATOM 1662  H HB3  . ALA A 1 29 ? 3.650   -11.531 3.607   1.00 0.00 ? 32 ALA A HB3  3  
ATOM 1663  N N    . ALA A 1 30 ? 2.160   -13.449 1.195   1.00 0.00 ? 33 ALA A N    3  
ATOM 1664  C CA   . ALA A 1 30 ? 0.805   -13.989 1.045   1.00 0.00 ? 33 ALA A CA   3  
ATOM 1665  C C    . ALA A 1 30 ? 0.592   -14.744 -0.273  1.00 0.00 ? 33 ALA A C    3  
ATOM 1666  O O    . ALA A 1 30 ? -0.470  -15.334 -0.481  1.00 0.00 ? 33 ALA A O    3  
ATOM 1667  C CB   . ALA A 1 30 ? -0.217  -12.869 1.181   1.00 0.00 ? 33 ALA A CB   3  
ATOM 1668  H H    . ALA A 1 30 ? 2.517   -12.844 0.506   1.00 0.00 ? 33 ALA A H    3  
ATOM 1669  H HA   . ALA A 1 30 ? 0.644   -14.679 1.851   1.00 0.00 ? 33 ALA A HA   3  
ATOM 1670  H HB1  . ALA A 1 30 ? 0.180   -12.097 1.823   1.00 0.00 ? 33 ALA A HB1  3  
ATOM 1671  H HB2  . ALA A 1 30 ? -1.129  -13.260 1.606   1.00 0.00 ? 33 ALA A HB2  3  
ATOM 1672  H HB3  . ALA A 1 30 ? -0.423  -12.452 0.202   1.00 0.00 ? 33 ALA A HB3  3  
ATOM 1673  N N    . ASN A 1 31 ? 1.581   -14.728 -1.162  1.00 0.00 ? 34 ASN A N    3  
ATOM 1674  C CA   . ASN A 1 31 ? 1.463   -15.408 -2.441  1.00 0.00 ? 34 ASN A CA   3  
ATOM 1675  C C    . ASN A 1 31 ? 1.880   -16.878 -2.348  1.00 0.00 ? 34 ASN A C    3  
ATOM 1676  O O    . ASN A 1 31 ? 1.060   -17.776 -2.549  1.00 0.00 ? 34 ASN A O    3  
ATOM 1677  C CB   . ASN A 1 31 ? 2.307   -14.680 -3.489  1.00 0.00 ? 34 ASN A CB   3  
ATOM 1678  C CG   . ASN A 1 31 ? 2.180   -15.296 -4.858  1.00 0.00 ? 34 ASN A CG   3  
ATOM 1679  O OD1  . ASN A 1 31 ? 3.170   -15.511 -5.551  1.00 0.00 ? 34 ASN A OD1  3  
ATOM 1680  N ND2  . ASN A 1 31 ? 0.958   -15.581 -5.260  1.00 0.00 ? 34 ASN A ND2  3  
ATOM 1681  H H    . ASN A 1 31 ? 2.400   -14.245 -0.962  1.00 0.00 ? 34 ASN A H    3  
ATOM 1682  H HA   . ASN A 1 31 ? 0.427   -15.363 -2.738  1.00 0.00 ? 34 ASN A HA   3  
ATOM 1683  H HB2  . ASN A 1 31 ? 1.989   -13.651 -3.548  1.00 0.00 ? 34 ASN A HB2  3  
ATOM 1684  H HB3  . ASN A 1 31 ? 3.346   -14.714 -3.195  1.00 0.00 ? 34 ASN A HB3  3  
ATOM 1685  H HD21 . ASN A 1 31 ? 0.209   -15.376 -4.665  1.00 0.00 ? 34 ASN A HD21 3  
ATOM 1686  H HD22 . ASN A 1 31 ? 0.857   -15.995 -6.126  1.00 0.00 ? 34 ASN A HD22 3  
ATOM 1687  N N    . ALA A 1 32 ? 3.157   -17.117 -2.058  1.00 0.00 ? 35 ALA A N    3  
ATOM 1688  C CA   . ALA A 1 32 ? 3.680   -18.480 -1.962  1.00 0.00 ? 35 ALA A CA   3  
ATOM 1689  C C    . ALA A 1 32 ? 3.465   -19.109 -0.574  1.00 0.00 ? 35 ALA A C    3  
ATOM 1690  O O    . ALA A 1 32 ? 3.936   -20.217 -0.318  1.00 0.00 ? 35 ALA A O    3  
ATOM 1691  C CB   . ALA A 1 32 ? 5.160   -18.488 -2.323  1.00 0.00 ? 35 ALA A CB   3  
ATOM 1692  H H    . ALA A 1 32 ? 3.765   -16.360 -1.920  1.00 0.00 ? 35 ALA A H    3  
ATOM 1693  H HA   . ALA A 1 32 ? 3.160   -19.081 -2.694  1.00 0.00 ? 35 ALA A HA   3  
ATOM 1694  H HB1  . ALA A 1 32 ? 5.535   -19.500 -2.284  1.00 0.00 ? 35 ALA A HB1  3  
ATOM 1695  H HB2  . ALA A 1 32 ? 5.706   -17.875 -1.622  1.00 0.00 ? 35 ALA A HB2  3  
ATOM 1696  H HB3  . ALA A 1 32 ? 5.289   -18.095 -3.322  1.00 0.00 ? 35 ALA A HB3  3  
ATOM 1697  N N    . HIS A 1 33 ? 2.756   -18.410 0.316   1.00 0.00 ? 36 HIS A N    3  
ATOM 1698  C CA   . HIS A 1 33 ? 2.498   -18.924 1.662   1.00 0.00 ? 36 HIS A CA   3  
ATOM 1699  C C    . HIS A 1 33 ? 1.027   -19.335 1.830   1.00 0.00 ? 36 HIS A C    3  
ATOM 1700  O O    . HIS A 1 33 ? 0.732   -20.509 2.052   1.00 0.00 ? 36 HIS A O    3  
ATOM 1701  C CB   . HIS A 1 33 ? 2.923   -17.880 2.714   1.00 0.00 ? 36 HIS A CB   3  
ATOM 1702  C CG   . HIS A 1 33 ? 1.956   -17.686 3.845   1.00 0.00 ? 36 HIS A CG   3  
ATOM 1703  N ND1  . HIS A 1 33 ? 1.528   -16.445 4.253   1.00 0.00 ? 36 HIS A ND1  3  
ATOM 1704  C CD2  . HIS A 1 33 ? 1.329   -18.580 4.645   1.00 0.00 ? 36 HIS A CD2  3  
ATOM 1705  C CE1  . HIS A 1 33 ? 0.676   -16.579 5.255   1.00 0.00 ? 36 HIS A CE1  3  
ATOM 1706  N NE2  . HIS A 1 33 ? 0.537   -17.868 5.513   1.00 0.00 ? 36 HIS A NE2  3  
ATOM 1707  H H    . HIS A 1 33 ? 2.402   -17.534 0.064   1.00 0.00 ? 36 HIS A H    3  
ATOM 1708  H HA   . HIS A 1 33 ? 3.108   -19.808 1.791   1.00 0.00 ? 36 HIS A HA   3  
ATOM 1709  H HB2  . HIS A 1 33 ? 3.867   -18.182 3.143   1.00 0.00 ? 36 HIS A HB2  3  
ATOM 1710  H HB3  . HIS A 1 33 ? 3.054   -16.925 2.224   1.00 0.00 ? 36 HIS A HB3  3  
ATOM 1711  H HD1  . HIS A 1 33 ? 1.821   -15.576 3.864   1.00 0.00 ? 36 HIS A HD1  3  
ATOM 1712  H HD2  . HIS A 1 33 ? 1.433   -19.656 4.606   1.00 0.00 ? 36 HIS A HD2  3  
ATOM 1713  H HE1  . HIS A 1 33 ? 0.178   -15.773 5.774   1.00 0.00 ? 36 HIS A HE1  3  
ATOM 1714  H HE2  . HIS A 1 33 ? -0.156  -18.252 6.091   1.00 0.00 ? 36 HIS A HE2  3  
ATOM 1715  N N    . LEU A 1 34 ? 0.110   -18.367 1.727   1.00 0.00 ? 37 LEU A N    3  
ATOM 1716  C CA   . LEU A 1 34 ? -1.325  -18.647 1.877   1.00 0.00 ? 37 LEU A CA   3  
ATOM 1717  C C    . LEU A 1 34 ? -1.787  -19.758 0.935   1.00 0.00 ? 37 LEU A C    3  
ATOM 1718  O O    . LEU A 1 34 ? -2.710  -20.516 1.251   1.00 0.00 ? 37 LEU A O    3  
ATOM 1719  C CB   . LEU A 1 34 ? -2.151  -17.377 1.646   1.00 0.00 ? 37 LEU A CB   3  
ATOM 1720  C CG   . LEU A 1 34 ? -2.836  -16.817 2.894   1.00 0.00 ? 37 LEU A CG   3  
ATOM 1721  C CD1  . LEU A 1 34 ? -3.469  -15.467 2.596   1.00 0.00 ? 37 LEU A CD1  3  
ATOM 1722  C CD2  . LEU A 1 34 ? -3.884  -17.791 3.412   1.00 0.00 ? 37 LEU A CD2  3  
ATOM 1723  H H    . LEU A 1 34 ? 0.403   -17.449 1.552   1.00 0.00 ? 37 LEU A H    3  
ATOM 1724  H HA   . LEU A 1 34 ? -1.478  -18.983 2.878   1.00 0.00 ? 37 LEU A HA   3  
ATOM 1725  H HB2  . LEU A 1 34 ? -1.499  -16.614 1.245   1.00 0.00 ? 37 LEU A HB2  3  
ATOM 1726  H HB3  . LEU A 1 34 ? -2.913  -17.595 0.913   1.00 0.00 ? 37 LEU A HB3  3  
ATOM 1727  H HG   . LEU A 1 34 ? -2.098  -16.674 3.670   1.00 0.00 ? 37 LEU A HG   3  
ATOM 1728  H HD11 . LEU A 1 34 ? -3.107  -14.737 3.302   1.00 0.00 ? 37 LEU A HD11 3  
ATOM 1729  H HD12 . LEU A 1 34 ? -4.543  -15.548 2.678   1.00 0.00 ? 37 LEU A HD12 3  
ATOM 1730  H HD13 . LEU A 1 34 ? -3.208  -15.160 1.594   1.00 0.00 ? 37 LEU A HD13 3  
ATOM 1731  H HD21 . LEU A 1 34 ? -4.668  -17.245 3.914   1.00 0.00 ? 37 LEU A HD21 3  
ATOM 1732  H HD22 . LEU A 1 34 ? -3.424  -18.479 4.106   1.00 0.00 ? 37 LEU A HD22 3  
ATOM 1733  H HD23 . LEU A 1 34 ? -4.305  -18.344 2.584   1.00 0.00 ? 37 LEU A HD23 3  
ATOM 1734  N N    . MET A 1 35 ? -1.124  -19.854 -0.210  1.00 0.00 ? 38 MET A N    3  
ATOM 1735  C CA   . MET A 1 35 ? -1.437  -20.876 -1.212  1.00 0.00 ? 38 MET A CA   3  
ATOM 1736  C C    . MET A 1 35 ? -1.307  -22.291 -0.642  1.00 0.00 ? 38 MET A C    3  
ATOM 1737  O O    . MET A 1 35 ? -1.909  -23.234 -1.156  1.00 0.00 ? 38 MET A O    3  
ATOM 1738  C CB   . MET A 1 35 ? -0.527  -20.715 -2.435  1.00 0.00 ? 38 MET A CB   3  
ATOM 1739  C CG   . MET A 1 35 ? -1.154  -21.202 -3.733  1.00 0.00 ? 38 MET A CG   3  
ATOM 1740  S SD   . MET A 1 35 ? 0.054   -21.395 -5.057  1.00 0.00 ? 38 MET A SD   3  
ATOM 1741  C CE   . MET A 1 35 ? 0.463   -19.683 -5.398  1.00 0.00 ? 38 MET A CE   3  
ATOM 1742  H H    . MET A 1 35 ? -0.399  -19.225 -0.378  1.00 0.00 ? 38 MET A H    3  
ATOM 1743  H HA   . MET A 1 35 ? -2.453  -20.731 -1.512  1.00 0.00 ? 38 MET A HA   3  
ATOM 1744  H HB2  . MET A 1 35 ? -0.282  -19.669 -2.552  1.00 0.00 ? 38 MET A HB2  3  
ATOM 1745  H HB3  . MET A 1 35 ? 0.383   -21.272 -2.269  1.00 0.00 ? 38 MET A HB3  3  
ATOM 1746  H HG2  . MET A 1 35 ? -1.624  -22.158 -3.554  1.00 0.00 ? 38 MET A HG2  3  
ATOM 1747  H HG3  . MET A 1 35 ? -1.902  -20.488 -4.047  1.00 0.00 ? 38 MET A HG3  3  
ATOM 1748  H HE1  . MET A 1 35 ? 0.871   -19.227 -4.508  1.00 0.00 ? 38 MET A HE1  3  
ATOM 1749  H HE2  . MET A 1 35 ? -0.429  -19.153 -5.698  1.00 0.00 ? 38 MET A HE2  3  
ATOM 1750  H HE3  . MET A 1 35 ? 1.193   -19.639 -6.192  1.00 0.00 ? 38 MET A HE3  3  
ATOM 1751  N N    . ALA A 1 36 ? -0.530  -22.424 0.426   1.00 0.00 ? 39 ALA A N    3  
ATOM 1752  C CA   . ALA A 1 36 ? -0.323  -23.715 1.083   1.00 0.00 ? 39 ALA A CA   3  
ATOM 1753  C C    . ALA A 1 36 ? -1.241  -23.885 2.305   1.00 0.00 ? 39 ALA A C    3  
ATOM 1754  O O    . ALA A 1 36 ? -1.048  -24.797 3.111   1.00 0.00 ? 39 ALA A O    3  
ATOM 1755  C CB   . ALA A 1 36 ? 1.138   -23.859 1.487   1.00 0.00 ? 39 ALA A CB   3  
ATOM 1756  H H    . ALA A 1 36 ? -0.090  -21.629 0.788   1.00 0.00 ? 39 ALA A H    3  
ATOM 1757  H HA   . ALA A 1 36 ? -0.551  -24.492 0.368   1.00 0.00 ? 39 ALA A HA   3  
ATOM 1758  H HB1  . ALA A 1 36 ? 1.454   -22.972 2.017   1.00 0.00 ? 39 ALA A HB1  3  
ATOM 1759  H HB2  . ALA A 1 36 ? 1.745   -23.985 0.603   1.00 0.00 ? 39 ALA A HB2  3  
ATOM 1760  H HB3  . ALA A 1 36 ? 1.252   -24.721 2.128   1.00 0.00 ? 39 ALA A HB3  3  
ATOM 1761  N N    . GLN A 1 37 ? -2.238  -23.005 2.437   1.00 0.00 ? 40 GLN A N    3  
ATOM 1762  C CA   . GLN A 1 37 ? -3.175  -23.060 3.556   1.00 0.00 ? 40 GLN A CA   3  
ATOM 1763  C C    . GLN A 1 37 ? -4.620  -22.916 3.072   1.00 0.00 ? 40 GLN A C    3  
ATOM 1764  O O    . GLN A 1 37 ? -5.462  -23.767 3.366   1.00 0.00 ? 40 GLN A O    3  
ATOM 1765  C CB   . GLN A 1 37 ? -2.843  -21.957 4.566   1.00 0.00 ? 40 GLN A CB   3  
ATOM 1766  C CG   . GLN A 1 37 ? -3.843  -21.843 5.710   1.00 0.00 ? 40 GLN A CG   3  
ATOM 1767  C CD   . GLN A 1 37 ? -4.281  -20.414 5.961   1.00 0.00 ? 40 GLN A CD   3  
ATOM 1768  O OE1  . GLN A 1 37 ? -3.540  -19.618 6.534   1.00 0.00 ? 40 GLN A OE1  3  
ATOM 1769  N NE2  . GLN A 1 37 ? -5.487  -20.075 5.531   1.00 0.00 ? 40 GLN A NE2  3  
ATOM 1770  H H    . GLN A 1 37 ? -2.344  -22.299 1.769   1.00 0.00 ? 40 GLN A H    3  
ATOM 1771  H HA   . GLN A 1 37 ? -3.064  -24.019 4.033   1.00 0.00 ? 40 GLN A HA   3  
ATOM 1772  H HB2  . GLN A 1 37 ? -1.868  -22.156 4.986   1.00 0.00 ? 40 GLN A HB2  3  
ATOM 1773  H HB3  . GLN A 1 37 ? -2.812  -21.010 4.047   1.00 0.00 ? 40 GLN A HB3  3  
ATOM 1774  H HG2  . GLN A 1 37 ? -4.715  -22.433 5.473   1.00 0.00 ? 40 GLN A HG2  3  
ATOM 1775  H HG3  . GLN A 1 37 ? -3.385  -22.226 6.610   1.00 0.00 ? 40 GLN A HG3  3  
ATOM 1776  H HE21 . GLN A 1 37 ? -6.032  -20.759 5.075   1.00 0.00 ? 40 GLN A HE21 3  
ATOM 1777  H HE22 . GLN A 1 37 ? -5.788  -19.158 5.683   1.00 0.00 ? 40 GLN A HE22 3  
ATOM 1778  N N    . ILE A 1 38 ? -4.887  -21.833 2.331   1.00 0.00 ? 41 ILE A N    3  
ATOM 1779  C CA   . ILE A 1 38 ? -6.222  -21.548 1.792   1.00 0.00 ? 41 ILE A CA   3  
ATOM 1780  C C    . ILE A 1 38 ? -7.147  -20.963 2.865   1.00 0.00 ? 41 ILE A C    3  
ATOM 1781  O O    . ILE A 1 38 ? -7.207  -21.530 3.980   1.00 0.00 ? 41 ILE A O    3  
ATOM 1782  C CB   . ILE A 1 38 ? -6.884  -22.799 1.167   1.00 0.00 ? 41 ILE A CB   3  
ATOM 1783  C CG1  . ILE A 1 38 ? -5.907  -23.524 0.232   1.00 0.00 ? 41 ILE A CG1  3  
ATOM 1784  C CG2  . ILE A 1 38 ? -8.146  -22.411 0.414   1.00 0.00 ? 41 ILE A CG2  3  
ATOM 1785  C CD1  . ILE A 1 38 ? -5.387  -22.659 -0.898  1.00 0.00 ? 41 ILE A CD1  3  
ATOM 1786  O OXT  . ILE A 1 38 ? -7.797  -19.936 2.582   1.00 0.00 ? 41 ILE A OXT  3  
ATOM 1787  H H    . ILE A 1 38 ? -4.160  -21.203 2.140   1.00 0.00 ? 41 ILE A H    3  
ATOM 1788  H HA   . ILE A 1 38 ? -6.105  -20.811 1.012   1.00 0.00 ? 41 ILE A HA   3  
ATOM 1789  H HB   . ILE A 1 38 ? -7.164  -23.464 1.970   1.00 0.00 ? 41 ILE A HB   3  
ATOM 1790  H HG12 . ILE A 1 38 ? -5.059  -23.867 0.803   1.00 0.00 ? 41 ILE A HG12 3  
ATOM 1791  H HG13 . ILE A 1 38 ? -6.408  -24.375 -0.206  1.00 0.00 ? 41 ILE A HG13 3  
ATOM 1792  H HG21 . ILE A 1 38 ? -8.628  -23.300 0.036   1.00 0.00 ? 41 ILE A HG21 3  
ATOM 1793  H HG22 . ILE A 1 38 ? -7.889  -21.763 -0.410  1.00 0.00 ? 41 ILE A HG22 3  
ATOM 1794  H HG23 . ILE A 1 38 ? -8.819  -21.893 1.082   1.00 0.00 ? 41 ILE A HG23 3  
ATOM 1795  H HD11 . ILE A 1 38 ? -4.896  -21.789 -0.488  1.00 0.00 ? 41 ILE A HD11 3  
ATOM 1796  H HD12 . ILE A 1 38 ? -6.212  -22.348 -1.521  1.00 0.00 ? 41 ILE A HD12 3  
ATOM 1797  H HD13 . ILE A 1 38 ? -4.682  -23.225 -1.489  1.00 0.00 ? 41 ILE A HD13 3  
ATOM 1798  N N    . PHE A 1 1  ? -17.784 12.075  7.095   1.00 0.00 ? 4  PHE A N    4  
ATOM 1799  C CA   . PHE A 1 1  ? -17.596 13.319  6.288   1.00 0.00 ? 4  PHE A CA   4  
ATOM 1800  C C    . PHE A 1 1  ? -16.535 13.119  5.203   1.00 0.00 ? 4  PHE A C    4  
ATOM 1801  O O    . PHE A 1 1  ? -15.700 12.224  5.313   1.00 0.00 ? 4  PHE A O    4  
ATOM 1802  C CB   . PHE A 1 1  ? -17.187 14.466  7.227   1.00 0.00 ? 4  PHE A CB   4  
ATOM 1803  C CG   . PHE A 1 1  ? -16.140 14.086  8.239   1.00 0.00 ? 4  PHE A CG   4  
ATOM 1804  C CD1  . PHE A 1 1  ? -14.833 13.846  7.848   1.00 0.00 ? 4  PHE A CD1  4  
ATOM 1805  C CD2  . PHE A 1 1  ? -16.466 13.964  9.580   1.00 0.00 ? 4  PHE A CD2  4  
ATOM 1806  C CE1  . PHE A 1 1  ? -13.870 13.493  8.774   1.00 0.00 ? 4  PHE A CE1  4  
ATOM 1807  C CE2  . PHE A 1 1  ? -15.508 13.611  10.511  1.00 0.00 ? 4  PHE A CE2  4  
ATOM 1808  C CZ   . PHE A 1 1  ? -14.209 13.375  10.107  1.00 0.00 ? 4  PHE A CZ   4  
ATOM 1809  H H1   . PHE A 1 1  ? -16.840 11.706  7.336   1.00 0.00 ? 4  PHE A H1   4  
ATOM 1810  H H2   . PHE A 1 1  ? -18.313 11.395  6.510   1.00 0.00 ? 4  PHE A H2   4  
ATOM 1811  H H3   . PHE A 1 1  ? -18.317 12.326  7.952   1.00 0.00 ? 4  PHE A H3   4  
ATOM 1812  H HA   . PHE A 1 1  ? -18.536 13.566  5.816   1.00 0.00 ? 4  PHE A HA   4  
ATOM 1813  H HB2  . PHE A 1 1  ? -16.794 15.281  6.639   1.00 0.00 ? 4  PHE A HB2  4  
ATOM 1814  H HB3  . PHE A 1 1  ? -18.059 14.809  7.765   1.00 0.00 ? 4  PHE A HB3  4  
ATOM 1815  H HD1  . PHE A 1 1  ? -14.566 13.937  6.805   1.00 0.00 ? 4  PHE A HD1  4  
ATOM 1816  H HD2  . PHE A 1 1  ? -17.482 14.148  9.897   1.00 0.00 ? 4  PHE A HD2  4  
ATOM 1817  H HE1  . PHE A 1 1  ? -12.854 13.310  8.455   1.00 0.00 ? 4  PHE A HE1  4  
ATOM 1818  H HE2  . PHE A 1 1  ? -15.775 13.520  11.554  1.00 0.00 ? 4  PHE A HE2  4  
ATOM 1819  H HZ   . PHE A 1 1  ? -13.458 13.100  10.834  1.00 0.00 ? 4  PHE A HZ   4  
ATOM 1820  N N    . THR A 1 2  ? -16.583 13.961  4.162   1.00 0.00 ? 5  THR A N    4  
ATOM 1821  C CA   . THR A 1 2  ? -15.632 13.892  3.042   1.00 0.00 ? 5  THR A CA   4  
ATOM 1822  C C    . THR A 1 2  ? -15.922 12.691  2.136   1.00 0.00 ? 5  THR A C    4  
ATOM 1823  O O    . THR A 1 2  ? -16.183 11.586  2.612   1.00 0.00 ? 5  THR A O    4  
ATOM 1824  C CB   . THR A 1 2  ? -14.178 13.863  3.547   1.00 0.00 ? 5  THR A CB   4  
ATOM 1825  O OG1  . THR A 1 2  ? -13.389 14.775  2.807   1.00 0.00 ? 5  THR A OG1  4  
ATOM 1826  C CG2  . THR A 1 2  ? -13.502 12.509  3.448   1.00 0.00 ? 5  THR A CG2  4  
ATOM 1827  H H    . THR A 1 2  ? -17.279 14.650  4.143   1.00 0.00 ? 5  THR A H    4  
ATOM 1828  H HA   . THR A 1 2  ? -15.769 14.789  2.456   1.00 0.00 ? 5  THR A HA   4  
ATOM 1829  H HB   . THR A 1 2  ? -14.164 14.167  4.585   1.00 0.00 ? 5  THR A HB   4  
ATOM 1830  H HG1  . THR A 1 2  ? -12.529 14.873  3.228   1.00 0.00 ? 5  THR A HG1  4  
ATOM 1831  H HG21 . THR A 1 2  ? -14.207 11.734  3.708   1.00 0.00 ? 5  THR A HG21 4  
ATOM 1832  H HG22 . THR A 1 2  ? -12.664 12.476  4.130   1.00 0.00 ? 5  THR A HG22 4  
ATOM 1833  H HG23 . THR A 1 2  ? -13.151 12.356  2.440   1.00 0.00 ? 5  THR A HG23 4  
ATOM 1834  N N    . LEU A 1 3  ? -15.884 12.921  0.825   1.00 0.00 ? 6  LEU A N    4  
ATOM 1835  C CA   . LEU A 1 3  ? -16.152 11.864  -0.149  1.00 0.00 ? 6  LEU A CA   4  
ATOM 1836  C C    . LEU A 1 3  ? -14.884 11.474  -0.920  1.00 0.00 ? 6  LEU A C    4  
ATOM 1837  O O    . LEU A 1 3  ? -14.883 11.428  -2.152  1.00 0.00 ? 6  LEU A O    4  
ATOM 1838  C CB   . LEU A 1 3  ? -17.255 12.311  -1.116  1.00 0.00 ? 6  LEU A CB   4  
ATOM 1839  C CG   . LEU A 1 3  ? -18.653 11.780  -0.793  1.00 0.00 ? 6  LEU A CG   4  
ATOM 1840  C CD1  . LEU A 1 3  ? -19.718 12.738  -1.298  1.00 0.00 ? 6  LEU A CD1  4  
ATOM 1841  C CD2  . LEU A 1 3  ? -18.852 10.399  -1.399  1.00 0.00 ? 6  LEU A CD2  4  
ATOM 1842  H H    . LEU A 1 3  ? -15.678 13.824  0.506   1.00 0.00 ? 6  LEU A H    4  
ATOM 1843  H HA   . LEU A 1 3  ? -16.499 10.998  0.396   1.00 0.00 ? 6  LEU A HA   4  
ATOM 1844  H HB2  . LEU A 1 3  ? -17.294 13.390  -1.113  1.00 0.00 ? 6  LEU A HB2  4  
ATOM 1845  H HB3  . LEU A 1 3  ? -16.992 11.981  -2.111  1.00 0.00 ? 6  LEU A HB3  4  
ATOM 1846  H HG   . LEU A 1 3  ? -18.762 11.695  0.278   1.00 0.00 ? 6  LEU A HG   4  
ATOM 1847  H HD11 . LEU A 1 3  ? -19.721 13.628  -0.687  1.00 0.00 ? 6  LEU A HD11 4  
ATOM 1848  H HD12 . LEU A 1 3  ? -20.686 12.262  -1.245  1.00 0.00 ? 6  LEU A HD12 4  
ATOM 1849  H HD13 . LEU A 1 3  ? -19.504 13.007  -2.322  1.00 0.00 ? 6  LEU A HD13 4  
ATOM 1850  H HD21 . LEU A 1 3  ? -17.891 9.955   -1.610  1.00 0.00 ? 6  LEU A HD21 4  
ATOM 1851  H HD22 . LEU A 1 3  ? -19.417 10.486  -2.315  1.00 0.00 ? 6  LEU A HD22 4  
ATOM 1852  H HD23 . LEU A 1 3  ? -19.392 9.775   -0.702  1.00 0.00 ? 6  LEU A HD23 4  
ATOM 1853  N N    . SER A 1 4  ? -13.807 11.186  -0.184  1.00 0.00 ? 7  SER A N    4  
ATOM 1854  C CA   . SER A 1 4  ? -12.532 10.791  -0.794  1.00 0.00 ? 7  SER A CA   4  
ATOM 1855  C C    . SER A 1 4  ? -12.008 11.880  -1.737  1.00 0.00 ? 7  SER A C    4  
ATOM 1856  O O    . SER A 1 4  ? -11.612 11.601  -2.872  1.00 0.00 ? 7  SER A O    4  
ATOM 1857  C CB   . SER A 1 4  ? -12.700 9.466   -1.551  1.00 0.00 ? 7  SER A CB   4  
ATOM 1858  O OG   . SER A 1 4  ? -11.489 9.072   -2.173  1.00 0.00 ? 7  SER A OG   4  
ATOM 1859  H H    . SER A 1 4  ? -13.871 11.235  0.791   1.00 0.00 ? 7  SER A H    4  
ATOM 1860  H HA   . SER A 1 4  ? -11.814 10.650  0.000   1.00 0.00 ? 7  SER A HA   4  
ATOM 1861  H HB2  . SER A 1 4  ? -12.999 8.695   -0.857  1.00 0.00 ? 7  SER A HB2  4  
ATOM 1862  H HB3  . SER A 1 4  ? -13.461 9.582   -2.310  1.00 0.00 ? 7  SER A HB3  4  
ATOM 1863  H HG   . SER A 1 4  ? -11.217 9.750   -2.806  1.00 0.00 ? 7  SER A HG   4  
ATOM 1864  N N    . LEU A 1 5  ? -12.011 13.123  -1.257  1.00 0.00 ? 8  LEU A N    4  
ATOM 1865  C CA   . LEU A 1 5  ? -11.544 14.258  -2.054  1.00 0.00 ? 8  LEU A CA   4  
ATOM 1866  C C    . LEU A 1 5  ? -10.397 15.001  -1.361  1.00 0.00 ? 8  LEU A C    4  
ATOM 1867  O O    . LEU A 1 5  ? -10.475 16.209  -1.125  1.00 0.00 ? 8  LEU A O    4  
ATOM 1868  C CB   . LEU A 1 5  ? -12.710 15.212  -2.333  1.00 0.00 ? 8  LEU A CB   4  
ATOM 1869  C CG   . LEU A 1 5  ? -13.721 14.713  -3.367  1.00 0.00 ? 8  LEU A CG   4  
ATOM 1870  C CD1  . LEU A 1 5  ? -15.141 14.901  -2.861  1.00 0.00 ? 8  LEU A CD1  4  
ATOM 1871  C CD2  . LEU A 1 5  ? -13.531 15.438  -4.690  1.00 0.00 ? 8  LEU A CD2  4  
ATOM 1872  H H    . LEU A 1 5  ? -12.338 13.283  -0.349  1.00 0.00 ? 8  LEU A H    4  
ATOM 1873  H HA   . LEU A 1 5  ? -11.182 13.870  -2.994  1.00 0.00 ? 8  LEU A HA   4  
ATOM 1874  H HB2  . LEU A 1 5  ? -13.232 15.390  -1.404  1.00 0.00 ? 8  LEU A HB2  4  
ATOM 1875  H HB3  . LEU A 1 5  ? -12.305 16.151  -2.683  1.00 0.00 ? 8  LEU A HB3  4  
ATOM 1876  H HG   . LEU A 1 5  ? -13.564 13.658  -3.537  1.00 0.00 ? 8  LEU A HG   4  
ATOM 1877  H HD11 . LEU A 1 5  ? -15.198 15.805  -2.272  1.00 0.00 ? 8  LEU A HD11 4  
ATOM 1878  H HD12 . LEU A 1 5  ? -15.419 14.055  -2.250  1.00 0.00 ? 8  LEU A HD12 4  
ATOM 1879  H HD13 . LEU A 1 5  ? -15.816 14.976  -3.701  1.00 0.00 ? 8  LEU A HD13 4  
ATOM 1880  H HD21 . LEU A 1 5  ? -12.505 15.335  -5.011  1.00 0.00 ? 8  LEU A HD21 4  
ATOM 1881  H HD22 . LEU A 1 5  ? -13.767 16.484  -4.564  1.00 0.00 ? 8  LEU A HD22 4  
ATOM 1882  H HD23 . LEU A 1 5  ? -14.186 15.007  -5.433  1.00 0.00 ? 8  LEU A HD23 4  
ATOM 1883  N N    . ASP A 1 6  ? -9.326  14.271  -1.050  1.00 0.00 ? 9  ASP A N    4  
ATOM 1884  C CA   . ASP A 1 6  ? -8.155  14.854  -0.399  1.00 0.00 ? 9  ASP A CA   4  
ATOM 1885  C C    . ASP A 1 6  ? -6.925  13.963  -0.580  1.00 0.00 ? 9  ASP A C    4  
ATOM 1886  O O    . ASP A 1 6  ? -6.702  13.014  0.176   1.00 0.00 ? 9  ASP A O    4  
ATOM 1887  C CB   . ASP A 1 6  ? -8.421  15.099  1.091   1.00 0.00 ? 9  ASP A CB   4  
ATOM 1888  C CG   . ASP A 1 6  ? -7.317  15.903  1.747   1.00 0.00 ? 9  ASP A CG   4  
ATOM 1889  O OD1  . ASP A 1 6  ? -7.316  17.142  1.598   1.00 0.00 ? 9  ASP A OD1  4  
ATOM 1890  O OD2  . ASP A 1 6  ? -6.445  15.293  2.401   1.00 0.00 ? 9  ASP A OD2  4  
ATOM 1891  H H    . ASP A 1 6  ? -9.318  13.318  -1.273  1.00 0.00 ? 9  ASP A H    4  
ATOM 1892  H HA   . ASP A 1 6  ? -7.956  15.802  -0.878  1.00 0.00 ? 9  ASP A HA   4  
ATOM 1893  H HB2  . ASP A 1 6  ? -9.348  15.642  1.200   1.00 0.00 ? 9  ASP A HB2  4  
ATOM 1894  H HB3  . ASP A 1 6  ? -8.502  14.150  1.599   1.00 0.00 ? 9  ASP A HB3  4  
ATOM 1895  N N    . VAL A 1 7  ? -6.132  14.282  -1.594  1.00 0.00 ? 10 VAL A N    4  
ATOM 1896  C CA   . VAL A 1 7  ? -4.919  13.528  -1.891  1.00 0.00 ? 10 VAL A CA   4  
ATOM 1897  C C    . VAL A 1 7  ? -3.690  14.447  -1.893  1.00 0.00 ? 10 VAL A C    4  
ATOM 1898  O O    . VAL A 1 7  ? -3.019  14.613  -2.914  1.00 0.00 ? 10 VAL A O    4  
ATOM 1899  C CB   . VAL A 1 7  ? -5.037  12.800  -3.248  1.00 0.00 ? 10 VAL A CB   4  
ATOM 1900  C CG1  . VAL A 1 7  ? -3.807  11.946  -3.518  1.00 0.00 ? 10 VAL A CG1  4  
ATOM 1901  C CG2  . VAL A 1 7  ? -6.295  11.946  -3.295  1.00 0.00 ? 10 VAL A CG2  4  
ATOM 1902  H H    . VAL A 1 7  ? -6.369  15.045  -2.158  1.00 0.00 ? 10 VAL A H    4  
ATOM 1903  H HA   . VAL A 1 7  ? -4.793  12.784  -1.117  1.00 0.00 ? 10 VAL A HA   4  
ATOM 1904  H HB   . VAL A 1 7  ? -5.109  13.549  -4.024  1.00 0.00 ? 10 VAL A HB   4  
ATOM 1905  H HG11 . VAL A 1 7  ? -3.420  11.565  -2.584  1.00 0.00 ? 10 VAL A HG11 4  
ATOM 1906  H HG12 . VAL A 1 7  ? -3.051  12.546  -4.002  1.00 0.00 ? 10 VAL A HG12 4  
ATOM 1907  H HG13 . VAL A 1 7  ? -4.076  11.119  -4.159  1.00 0.00 ? 10 VAL A HG13 4  
ATOM 1908  H HG21 . VAL A 1 7  ? -7.146  12.570  -3.524  1.00 0.00 ? 10 VAL A HG21 4  
ATOM 1909  H HG22 . VAL A 1 7  ? -6.443  11.472  -2.335  1.00 0.00 ? 10 VAL A HG22 4  
ATOM 1910  H HG23 . VAL A 1 7  ? -6.187  11.188  -4.057  1.00 0.00 ? 10 VAL A HG23 4  
ATOM 1911  N N    . PRO A 1 8  ? -3.381  15.065  -0.734  1.00 0.00 ? 11 PRO A N    4  
ATOM 1912  C CA   . PRO A 1 8  ? -2.231  15.971  -0.602  1.00 0.00 ? 11 PRO A CA   4  
ATOM 1913  C C    . PRO A 1 8  ? -0.895  15.235  -0.697  1.00 0.00 ? 11 PRO A C    4  
ATOM 1914  O O    . PRO A 1 8  ? -0.844  14.007  -0.608  1.00 0.00 ? 11 PRO A O    4  
ATOM 1915  C CB   . PRO A 1 8  ? -2.417  16.582  0.792   1.00 0.00 ? 11 PRO A CB   4  
ATOM 1916  C CG   . PRO A 1 8  ? -3.217  15.574  1.542   1.00 0.00 ? 11 PRO A CG   4  
ATOM 1917  C CD   . PRO A 1 8  ? -4.126  14.932  0.532   1.00 0.00 ? 11 PRO A CD   4  
ATOM 1918  H HA   . PRO A 1 8  ? -2.260  16.753  -1.346  1.00 0.00 ? 11 PRO A HA   4  
ATOM 1919  H HB2  . PRO A 1 8  ? -1.452  16.744  1.250   1.00 0.00 ? 11 PRO A HB2  4  
ATOM 1920  H HB3  . PRO A 1 8  ? -2.945  17.520  0.709   1.00 0.00 ? 11 PRO A HB3  4  
ATOM 1921  H HG2  . PRO A 1 8  ? -2.562  14.838  1.981   1.00 0.00 ? 11 PRO A HG2  4  
ATOM 1922  H HG3  . PRO A 1 8  ? -3.799  16.065  2.309   1.00 0.00 ? 11 PRO A HG3  4  
ATOM 1923  H HD2  . PRO A 1 8  ? -4.290  13.893  0.777   1.00 0.00 ? 11 PRO A HD2  4  
ATOM 1924  H HD3  . PRO A 1 8  ? -5.067  15.460  0.481   1.00 0.00 ? 11 PRO A HD3  4  
ATOM 1925  N N    . THR A 1 9  ? 0.186   15.994  -0.872  1.00 0.00 ? 12 THR A N    4  
ATOM 1926  C CA   . THR A 1 9  ? 1.531   15.421  -0.981  1.00 0.00 ? 12 THR A CA   4  
ATOM 1927  C C    . THR A 1 9  ? 1.791   14.397  0.121   1.00 0.00 ? 12 THR A C    4  
ATOM 1928  O O    . THR A 1 9  ? 2.254   13.286  -0.152  1.00 0.00 ? 12 THR A O    4  
ATOM 1929  C CB   . THR A 1 9  ? 2.590   16.527  -0.925  1.00 0.00 ? 12 THR A CB   4  
ATOM 1930  O OG1  . THR A 1 9  ? 2.020   17.791  -1.215  1.00 0.00 ? 12 THR A OG1  4  
ATOM 1931  C CG2  . THR A 1 9  ? 3.736   16.310  -1.891  1.00 0.00 ? 12 THR A CG2  4  
ATOM 1932  H H    . THR A 1 9  ? 0.079   16.967  -0.929  1.00 0.00 ? 12 THR A H    4  
ATOM 1933  H HA   . THR A 1 9  ? 1.600   14.923  -1.933  1.00 0.00 ? 12 THR A HA   4  
ATOM 1934  H HB   . THR A 1 9  ? 3.003   16.562  0.072   1.00 0.00 ? 12 THR A HB   4  
ATOM 1935  H HG1  . THR A 1 9  ? 1.874   17.874  -2.162  1.00 0.00 ? 12 THR A HG1  4  
ATOM 1936  H HG21 . THR A 1 9  ? 4.457   15.640  -1.449  1.00 0.00 ? 12 THR A HG21 4  
ATOM 1937  H HG22 . THR A 1 9  ? 4.208   17.257  -2.104  1.00 0.00 ? 12 THR A HG22 4  
ATOM 1938  H HG23 . THR A 1 9  ? 3.358   15.882  -2.808  1.00 0.00 ? 12 THR A HG23 4  
ATOM 1939  N N    . ASN A 1 10 ? 1.486   14.775  1.363   1.00 0.00 ? 13 ASN A N    4  
ATOM 1940  C CA   . ASN A 1 10 ? 1.682   13.888  2.510   1.00 0.00 ? 13 ASN A CA   4  
ATOM 1941  C C    . ASN A 1 10 ? 0.924   12.588  2.323   1.00 0.00 ? 13 ASN A C    4  
ATOM 1942  O O    . ASN A 1 10 ? 1.489   11.496  2.393   1.00 0.00 ? 13 ASN A O    4  
ATOM 1943  C CB   . ASN A 1 10 ? 1.243   14.579  3.810   1.00 0.00 ? 13 ASN A CB   4  
ATOM 1944  C CG   . ASN A 1 10 ? 2.013   15.858  4.089   1.00 0.00 ? 13 ASN A CG   4  
ATOM 1945  O OD1  . ASN A 1 10 ? 2.802   16.317  3.268   1.00 0.00 ? 13 ASN A OD1  4  
ATOM 1946  N ND2  . ASN A 1 10 ? 1.784   16.444  5.254   1.00 0.00 ? 13 ASN A ND2  4  
ATOM 1947  H H    . ASN A 1 10 ? 1.119   15.674  1.509   1.00 0.00 ? 13 ASN A H    4  
ATOM 1948  H HA   . ASN A 1 10 ? 2.711   13.658  2.567   1.00 0.00 ? 13 ASN A HA   4  
ATOM 1949  H HB2  . ASN A 1 10 ? 0.194   14.825  3.742   1.00 0.00 ? 13 ASN A HB2  4  
ATOM 1950  H HB3  . ASN A 1 10 ? 1.395   13.902  4.637   1.00 0.00 ? 13 ASN A HB3  4  
ATOM 1951  H HD21 . ASN A 1 10 ? 1.141   16.030  5.864   1.00 0.00 ? 13 ASN A HD21 4  
ATOM 1952  H HD22 . ASN A 1 10 ? 2.269   17.270  5.457   1.00 0.00 ? 13 ASN A HD22 4  
ATOM 1953  N N    . ILE A 1 11 ? -0.353  12.731  2.065   1.00 0.00 ? 14 ILE A N    4  
ATOM 1954  C CA   . ILE A 1 11 ? -1.238  11.599  1.837   1.00 0.00 ? 14 ILE A CA   4  
ATOM 1955  C C    . ILE A 1 11 ? -0.798  10.809  0.604   1.00 0.00 ? 14 ILE A C    4  
ATOM 1956  O O    . ILE A 1 11 ? -0.684  9.585   0.658   1.00 0.00 ? 14 ILE A O    4  
ATOM 1957  C CB   . ILE A 1 11 ? -2.692  12.090  1.682   1.00 0.00 ? 14 ILE A CB   4  
ATOM 1958  C CG1  . ILE A 1 11 ? -3.409  12.048  3.033   1.00 0.00 ? 14 ILE A CG1  4  
ATOM 1959  C CG2  . ILE A 1 11 ? -3.461  11.277  0.646   1.00 0.00 ? 14 ILE A CG2  4  
ATOM 1960  C CD1  . ILE A 1 11 ? -4.769  12.712  3.019   1.00 0.00 ? 14 ILE A CD1  4  
ATOM 1961  H H    . ILE A 1 11 ? -0.709  13.637  2.010   1.00 0.00 ? 14 ILE A H    4  
ATOM 1962  H HA   . ILE A 1 11 ? -1.183  10.952  2.702   1.00 0.00 ? 14 ILE A HA   4  
ATOM 1963  H HB   . ILE A 1 11 ? -2.645  13.113  1.344   1.00 0.00 ? 14 ILE A HB   4  
ATOM 1964  H HG12 . ILE A 1 11 ? -3.549  11.018  3.326   1.00 0.00 ? 14 ILE A HG12 4  
ATOM 1965  H HG13 . ILE A 1 11 ? -2.801  12.548  3.773   1.00 0.00 ? 14 ILE A HG13 4  
ATOM 1966  H HG21 . ILE A 1 11 ? -3.322  10.223  0.839   1.00 0.00 ? 14 ILE A HG21 4  
ATOM 1967  H HG22 . ILE A 1 11 ? -3.094  11.512  -0.343  1.00 0.00 ? 14 ILE A HG22 4  
ATOM 1968  H HG23 . ILE A 1 11 ? -4.512  11.519  0.708   1.00 0.00 ? 14 ILE A HG23 4  
ATOM 1969  H HD11 . ILE A 1 11 ? -5.350  12.361  3.859   1.00 0.00 ? 14 ILE A HD11 4  
ATOM 1970  H HD12 . ILE A 1 11 ? -5.281  12.466  2.101   1.00 0.00 ? 14 ILE A HD12 4  
ATOM 1971  H HD13 . ILE A 1 11 ? -4.649  13.783  3.088   1.00 0.00 ? 14 ILE A HD13 4  
ATOM 1972  N N    . MET A 1 12 ? -0.532  11.517  -0.498  1.00 0.00 ? 15 MET A N    4  
ATOM 1973  C CA   . MET A 1 12 ? -0.084  10.882  -1.729  1.00 0.00 ? 15 MET A CA   4  
ATOM 1974  C C    . MET A 1 12 ? 1.138   10.009  -1.459  1.00 0.00 ? 15 MET A C    4  
ATOM 1975  O O    . MET A 1 12 ? 1.150   8.822   -1.793  1.00 0.00 ? 15 MET A O    4  
ATOM 1976  C CB   . MET A 1 12 ? 0.244   11.950  -2.773  1.00 0.00 ? 15 MET A CB   4  
ATOM 1977  C CG   . MET A 1 12 ? -0.494  11.764  -4.084  1.00 0.00 ? 15 MET A CG   4  
ATOM 1978  S SD   . MET A 1 12 ? 0.608   11.361  -5.452  1.00 0.00 ? 15 MET A SD   4  
ATOM 1979  C CE   . MET A 1 12 ? 0.545   12.880  -6.398  1.00 0.00 ? 15 MET A CE   4  
ATOM 1980  H H    . MET A 1 12 ? -0.626  12.499  -0.479  1.00 0.00 ? 15 MET A H    4  
ATOM 1981  H HA   . MET A 1 12 ? -0.885  10.258  -2.095  1.00 0.00 ? 15 MET A HA   4  
ATOM 1982  H HB2  . MET A 1 12 ? -0.019  12.919  -2.373  1.00 0.00 ? 15 MET A HB2  4  
ATOM 1983  H HB3  . MET A 1 12 ? 1.303   11.931  -2.970  1.00 0.00 ? 15 MET A HB3  4  
ATOM 1984  H HG2  . MET A 1 12 ? -1.210  10.964  -3.967  1.00 0.00 ? 15 MET A HG2  4  
ATOM 1985  H HG3  . MET A 1 12 ? -1.017  12.681  -4.317  1.00 0.00 ? 15 MET A HG3  4  
ATOM 1986  H HE1  . MET A 1 12 ? 0.747   13.719  -5.749  1.00 0.00 ? 15 MET A HE1  4  
ATOM 1987  H HE2  . MET A 1 12 ? -0.435  12.991  -6.836  1.00 0.00 ? 15 MET A HE2  4  
ATOM 1988  H HE3  . MET A 1 12 ? 1.288   12.846  -7.183  1.00 0.00 ? 15 MET A HE3  4  
ATOM 1989  N N    . ASN A 1 13 ? 2.157   10.602  -0.829  1.00 0.00 ? 16 ASN A N    4  
ATOM 1990  C CA   . ASN A 1 13 ? 3.378   9.877   -0.488  1.00 0.00 ? 16 ASN A CA   4  
ATOM 1991  C C    . ASN A 1 13 ? 3.055   8.666   0.386   1.00 0.00 ? 16 ASN A C    4  
ATOM 1992  O O    . ASN A 1 13 ? 3.531   7.557   0.133   1.00 0.00 ? 16 ASN A O    4  
ATOM 1993  C CB   . ASN A 1 13 ? 4.367   10.801  0.234   1.00 0.00 ? 16 ASN A CB   4  
ATOM 1994  C CG   . ASN A 1 13 ? 5.187   11.642  -0.725  1.00 0.00 ? 16 ASN A CG   4  
ATOM 1995  O OD1  . ASN A 1 13 ? 6.310   11.290  -1.070  1.00 0.00 ? 16 ASN A OD1  4  
ATOM 1996  N ND2  . ASN A 1 13 ? 4.631   12.763  -1.160  1.00 0.00 ? 16 ASN A ND2  4  
ATOM 1997  H H    . ASN A 1 13 ? 2.075   11.547  -0.573  1.00 0.00 ? 16 ASN A H    4  
ATOM 1998  H HA   . ASN A 1 13 ? 3.822   9.531   -1.404  1.00 0.00 ? 16 ASN A HA   4  
ATOM 1999  H HB2  . ASN A 1 13 ? 3.819   11.466  0.884   1.00 0.00 ? 16 ASN A HB2  4  
ATOM 2000  H HB3  . ASN A 1 13 ? 5.044   10.203  0.825   1.00 0.00 ? 16 ASN A HB3  4  
ATOM 2001  H HD21 . ASN A 1 13 ? 3.727   12.988  -0.843  1.00 0.00 ? 16 ASN A HD21 4  
ATOM 2002  H HD22 . ASN A 1 13 ? 5.144   13.320  -1.780  1.00 0.00 ? 16 ASN A HD22 4  
ATOM 2003  N N    . LEU A 1 14 ? 2.226   8.889   1.403   1.00 0.00 ? 17 LEU A N    4  
ATOM 2004  C CA   . LEU A 1 14 ? 1.817   7.819   2.311   1.00 0.00 ? 17 LEU A CA   4  
ATOM 2005  C C    . LEU A 1 14 ? 1.018   6.753   1.566   1.00 0.00 ? 17 LEU A C    4  
ATOM 2006  O O    . LEU A 1 14 ? 1.339   5.567   1.639   1.00 0.00 ? 17 LEU A O    4  
ATOM 2007  C CB   . LEU A 1 14 ? 0.991   8.383   3.473   1.00 0.00 ? 17 LEU A CB   4  
ATOM 2008  C CG   . LEU A 1 14 ? 1.769   9.243   4.471   1.00 0.00 ? 17 LEU A CG   4  
ATOM 2009  C CD1  . LEU A 1 14 ? 0.850   9.744   5.571   1.00 0.00 ? 17 LEU A CD1  4  
ATOM 2010  C CD2  . LEU A 1 14 ? 2.930   8.458   5.063   1.00 0.00 ? 17 LEU A CD2  4  
ATOM 2011  H H    . LEU A 1 14 ? 1.872   9.795   1.539   1.00 0.00 ? 17 LEU A H    4  
ATOM 2012  H HA   . LEU A 1 14 ? 2.712   7.360   2.705   1.00 0.00 ? 17 LEU A HA   4  
ATOM 2013  H HB2  . LEU A 1 14 ? 0.192   8.982   3.060   1.00 0.00 ? 17 LEU A HB2  4  
ATOM 2014  H HB3  . LEU A 1 14 ? 0.555   7.555   4.011   1.00 0.00 ? 17 LEU A HB3  4  
ATOM 2015  H HG   . LEU A 1 14 ? 2.173   10.103  3.956   1.00 0.00 ? 17 LEU A HG   4  
ATOM 2016  H HD11 . LEU A 1 14 ? 0.391   10.671  5.262   1.00 0.00 ? 17 LEU A HD11 4  
ATOM 2017  H HD12 . LEU A 1 14 ? 1.424   9.908   6.472   1.00 0.00 ? 17 LEU A HD12 4  
ATOM 2018  H HD13 . LEU A 1 14 ? 0.083   9.009   5.763   1.00 0.00 ? 17 LEU A HD13 4  
ATOM 2019  H HD21 . LEU A 1 14 ? 3.675   8.287   4.301   1.00 0.00 ? 17 LEU A HD21 4  
ATOM 2020  H HD22 . LEU A 1 14 ? 2.570   7.511   5.436   1.00 0.00 ? 17 LEU A HD22 4  
ATOM 2021  H HD23 . LEU A 1 14 ? 3.367   9.022   5.874   1.00 0.00 ? 17 LEU A HD23 4  
ATOM 2022  N N    . LEU A 1 15 ? -0.013  7.178   0.833   1.00 0.00 ? 18 LEU A N    4  
ATOM 2023  C CA   . LEU A 1 15 ? -0.837  6.247   0.064   1.00 0.00 ? 18 LEU A CA   4  
ATOM 2024  C C    . LEU A 1 15 ? 0.029   5.439   -0.894  1.00 0.00 ? 18 LEU A C    4  
ATOM 2025  O O    . LEU A 1 15 ? -0.086  4.210   -0.963  1.00 0.00 ? 18 LEU A O    4  
ATOM 2026  C CB   . LEU A 1 15 ? -1.926  7.001   -0.708  1.00 0.00 ? 18 LEU A CB   4  
ATOM 2027  C CG   . LEU A 1 15 ? -3.107  7.487   0.138   1.00 0.00 ? 18 LEU A CG   4  
ATOM 2028  C CD1  . LEU A 1 15 ? -4.189  8.075   -0.752  1.00 0.00 ? 18 LEU A CD1  4  
ATOM 2029  C CD2  . LEU A 1 15 ? -3.670  6.351   0.977   1.00 0.00 ? 18 LEU A CD2  4  
ATOM 2030  H H    . LEU A 1 15 ? -0.218  8.146   0.801   1.00 0.00 ? 18 LEU A H    4  
ATOM 2031  H HA   . LEU A 1 15 ? -1.301  5.567   0.759   1.00 0.00 ? 18 LEU A HA   4  
ATOM 2032  H HB2  . LEU A 1 15 ? -1.473  7.859   -1.182  1.00 0.00 ? 18 LEU A HB2  4  
ATOM 2033  H HB3  . LEU A 1 15 ? -2.309  6.347   -1.477  1.00 0.00 ? 18 LEU A HB3  4  
ATOM 2034  H HG   . LEU A 1 15 ? -2.767  8.264   0.808   1.00 0.00 ? 18 LEU A HG   4  
ATOM 2035  H HD11 . LEU A 1 15 ? -4.344  7.429   -1.603  1.00 0.00 ? 18 LEU A HD11 4  
ATOM 2036  H HD12 . LEU A 1 15 ? -3.885  9.053   -1.092  1.00 0.00 ? 18 LEU A HD12 4  
ATOM 2037  H HD13 . LEU A 1 15 ? -5.109  8.158   -0.192  1.00 0.00 ? 18 LEU A HD13 4  
ATOM 2038  H HD21 . LEU A 1 15 ? -4.570  6.684   1.473   1.00 0.00 ? 18 LEU A HD21 4  
ATOM 2039  H HD22 . LEU A 1 15 ? -2.941  6.053   1.716   1.00 0.00 ? 18 LEU A HD22 4  
ATOM 2040  H HD23 . LEU A 1 15 ? -3.900  5.513   0.338   1.00 0.00 ? 18 LEU A HD23 4  
ATOM 2041  N N    . PHE A 1 16 ? 0.915   6.132   -1.612  1.00 0.00 ? 19 PHE A N    4  
ATOM 2042  C CA   . PHE A 1 16 ? 1.827   5.481   -2.546  1.00 0.00 ? 19 PHE A CA   4  
ATOM 2043  C C    . PHE A 1 16 ? 2.647   4.410   -1.828  1.00 0.00 ? 19 PHE A C    4  
ATOM 2044  O O    . PHE A 1 16 ? 2.807   3.298   -2.334  1.00 0.00 ? 19 PHE A O    4  
ATOM 2045  C CB   . PHE A 1 16 ? 2.758   6.514   -3.192  1.00 0.00 ? 19 PHE A CB   4  
ATOM 2046  C CG   . PHE A 1 16 ? 2.954   6.306   -4.665  1.00 0.00 ? 19 PHE A CG   4  
ATOM 2047  C CD1  . PHE A 1 16 ? 3.809   5.321   -5.132  1.00 0.00 ? 19 PHE A CD1  4  
ATOM 2048  C CD2  . PHE A 1 16 ? 2.282   7.096   -5.584  1.00 0.00 ? 19 PHE A CD2  4  
ATOM 2049  C CE1  . PHE A 1 16 ? 3.989   5.125   -6.488  1.00 0.00 ? 19 PHE A CE1  4  
ATOM 2050  C CE2  . PHE A 1 16 ? 2.459   6.906   -6.941  1.00 0.00 ? 19 PHE A CE2  4  
ATOM 2051  C CZ   . PHE A 1 16 ? 3.314   5.920   -7.394  1.00 0.00 ? 19 PHE A CZ   4  
ATOM 2052  H H    . PHE A 1 16 ? 0.968   7.110   -1.494  1.00 0.00 ? 19 PHE A H    4  
ATOM 2053  H HA   . PHE A 1 16 ? 1.235   5.008   -3.316  1.00 0.00 ? 19 PHE A HA   4  
ATOM 2054  H HB2  . PHE A 1 16 ? 2.344   7.499   -3.049  1.00 0.00 ? 19 PHE A HB2  4  
ATOM 2055  H HB3  . PHE A 1 16 ? 3.727   6.465   -2.716  1.00 0.00 ? 19 PHE A HB3  4  
ATOM 2056  H HD1  . PHE A 1 16 ? 4.336   4.699   -4.423  1.00 0.00 ? 19 PHE A HD1  4  
ATOM 2057  H HD2  . PHE A 1 16 ? 1.614   7.867   -5.231  1.00 0.00 ? 19 PHE A HD2  4  
ATOM 2058  H HE1  . PHE A 1 16 ? 4.659   4.354   -6.839  1.00 0.00 ? 19 PHE A HE1  4  
ATOM 2059  H HE2  . PHE A 1 16 ? 1.929   7.529   -7.647  1.00 0.00 ? 19 PHE A HE2  4  
ATOM 2060  H HZ   . PHE A 1 16 ? 3.454   5.771   -8.454  1.00 0.00 ? 19 PHE A HZ   4  
ATOM 2061  N N    . ASN A 1 17 ? 3.144   4.746   -0.633  1.00 0.00 ? 20 ASN A N    4  
ATOM 2062  C CA   . ASN A 1 17 ? 3.925   3.814   0.164   1.00 0.00 ? 20 ASN A CA   4  
ATOM 2063  C C    . ASN A 1 17 ? 3.042   2.678   0.668   1.00 0.00 ? 20 ASN A C    4  
ATOM 2064  O O    . ASN A 1 17 ? 3.418   1.506   0.583   1.00 0.00 ? 20 ASN A O    4  
ATOM 2065  C CB   . ASN A 1 17 ? 4.566   4.549   1.340   1.00 0.00 ? 20 ASN A CB   4  
ATOM 2066  C CG   . ASN A 1 17 ? 5.978   4.084   1.603   1.00 0.00 ? 20 ASN A CG   4  
ATOM 2067  O OD1  . ASN A 1 17 ? 6.897   4.889   1.709   1.00 0.00 ? 20 ASN A OD1  4  
ATOM 2068  N ND2  . ASN A 1 17 ? 6.162   2.781   1.710   1.00 0.00 ? 20 ASN A ND2  4  
ATOM 2069  H H    . ASN A 1 17 ? 2.966   5.640   -0.272  1.00 0.00 ? 20 ASN A H    4  
ATOM 2070  H HA   . ASN A 1 17 ? 4.701   3.400   -0.465  1.00 0.00 ? 20 ASN A HA   4  
ATOM 2071  H HB2  . ASN A 1 17 ? 4.590   5.607   1.128   1.00 0.00 ? 20 ASN A HB2  4  
ATOM 2072  H HB3  . ASN A 1 17 ? 3.978   4.376   2.227   1.00 0.00 ? 20 ASN A HB3  4  
ATOM 2073  H HD21 . ASN A 1 17 ? 5.385   2.189   1.618   1.00 0.00 ? 20 ASN A HD21 4  
ATOM 2074  H HD22 . ASN A 1 17 ? 7.065   2.462   1.870   1.00 0.00 ? 20 ASN A HD22 4  
ATOM 2075  N N    . ILE A 1 18 ? 1.858   3.031   1.174   1.00 0.00 ? 21 ILE A N    4  
ATOM 2076  C CA   . ILE A 1 18 ? 0.911   2.034   1.669   1.00 0.00 ? 21 ILE A CA   4  
ATOM 2077  C C    . ILE A 1 18 ? 0.619   1.017   0.575   1.00 0.00 ? 21 ILE A C    4  
ATOM 2078  O O    . ILE A 1 18 ? 0.892   -0.170  0.742   1.00 0.00 ? 21 ILE A O    4  
ATOM 2079  C CB   . ILE A 1 18 ? -0.407  2.684   2.155   1.00 0.00 ? 21 ILE A CB   4  
ATOM 2080  C CG1  . ILE A 1 18 ? -0.185  3.403   3.488   1.00 0.00 ? 21 ILE A CG1  4  
ATOM 2081  C CG2  . ILE A 1 18 ? -1.510  1.641   2.295   1.00 0.00 ? 21 ILE A CG2  4  
ATOM 2082  C CD1  . ILE A 1 18 ? 0.374   2.509   4.576   1.00 0.00 ? 21 ILE A CD1  4  
ATOM 2083  H H    . ILE A 1 18 ? 1.614   3.986   1.201   1.00 0.00 ? 21 ILE A H    4  
ATOM 2084  H HA   . ILE A 1 18 ? 1.368   1.519   2.501   1.00 0.00 ? 21 ILE A HA   4  
ATOM 2085  H HB   . ILE A 1 18 ? -0.720  3.406   1.414   1.00 0.00 ? 21 ILE A HB   4  
ATOM 2086  H HG12 . ILE A 1 18 ? 0.509   4.217   3.340   1.00 0.00 ? 21 ILE A HG12 4  
ATOM 2087  H HG13 . ILE A 1 18 ? -1.127  3.800   3.836   1.00 0.00 ? 21 ILE A HG13 4  
ATOM 2088  H HG21 . ILE A 1 18 ? -2.334  2.063   2.852   1.00 0.00 ? 21 ILE A HG21 4  
ATOM 2089  H HG22 . ILE A 1 18 ? -1.124  0.779   2.819   1.00 0.00 ? 21 ILE A HG22 4  
ATOM 2090  H HG23 . ILE A 1 18 ? -1.852  1.343   1.316   1.00 0.00 ? 21 ILE A HG23 4  
ATOM 2091  H HD11 . ILE A 1 18 ? -0.049  1.520   4.481   1.00 0.00 ? 21 ILE A HD11 4  
ATOM 2092  H HD12 . ILE A 1 18 ? 0.120   2.917   5.543   1.00 0.00 ? 21 ILE A HD12 4  
ATOM 2093  H HD13 . ILE A 1 18 ? 1.448   2.452   4.480   1.00 0.00 ? 21 ILE A HD13 4  
ATOM 2094  N N    . ALA A 1 19 ? 0.102   1.492   -0.560  1.00 0.00 ? 22 ALA A N    4  
ATOM 2095  C CA   . ALA A 1 19 ? -0.184  0.611   -1.692  1.00 0.00 ? 22 ALA A CA   4  
ATOM 2096  C C    . ALA A 1 19 ? 1.061   -0.196  -2.070  1.00 0.00 ? 22 ALA A C    4  
ATOM 2097  O O    . ALA A 1 19 ? 0.967   -1.365  -2.455  1.00 0.00 ? 22 ALA A O    4  
ATOM 2098  C CB   . ALA A 1 19 ? -0.684  1.421   -2.880  1.00 0.00 ? 22 ALA A CB   4  
ATOM 2099  H H    . ALA A 1 19 ? -0.065  2.460   -0.647  1.00 0.00 ? 22 ALA A H    4  
ATOM 2100  H HA   . ALA A 1 19 ? -0.965  -0.075  -1.393  1.00 0.00 ? 22 ALA A HA   4  
ATOM 2101  H HB1  . ALA A 1 19 ? 0.156   1.884   -3.380  1.00 0.00 ? 22 ALA A HB1  4  
ATOM 2102  H HB2  . ALA A 1 19 ? -1.362  2.188   -2.535  1.00 0.00 ? 22 ALA A HB2  4  
ATOM 2103  H HB3  . ALA A 1 19 ? -1.199  0.769   -3.570  1.00 0.00 ? 22 ALA A HB3  4  
ATOM 2104  N N    . LYS A 1 20 ? 2.230   0.436   -1.939  1.00 0.00 ? 23 LYS A N    4  
ATOM 2105  C CA   . LYS A 1 20 ? 3.501   -0.211  -2.247  1.00 0.00 ? 23 LYS A CA   4  
ATOM 2106  C C    . LYS A 1 20 ? 3.787   -1.355  -1.274  1.00 0.00 ? 23 LYS A C    4  
ATOM 2107  O O    . LYS A 1 20 ? 4.075   -2.475  -1.691  1.00 0.00 ? 23 LYS A O    4  
ATOM 2108  C CB   . LYS A 1 20 ? 4.644   0.814   -2.198  1.00 0.00 ? 23 LYS A CB   4  
ATOM 2109  C CG   . LYS A 1 20 ? 5.490   0.870   -3.464  1.00 0.00 ? 23 LYS A CG   4  
ATOM 2110  C CD   . LYS A 1 20 ? 5.634   -0.501  -4.116  1.00 0.00 ? 23 LYS A CD   4  
ATOM 2111  C CE   . LYS A 1 20 ? 7.002   -0.681  -4.754  1.00 0.00 ? 23 LYS A CE   4  
ATOM 2112  N NZ   . LYS A 1 20 ? 7.803   -1.726  -4.054  1.00 0.00 ? 23 LYS A NZ   4  
ATOM 2113  H H    . LYS A 1 20 ? 2.237   1.365   -1.619  1.00 0.00 ? 23 LYS A H    4  
ATOM 2114  H HA   . LYS A 1 20 ? 3.431   -0.616  -3.243  1.00 0.00 ? 23 LYS A HA   4  
ATOM 2115  H HB2  . LYS A 1 20 ? 4.223   1.793   -2.037  1.00 0.00 ? 23 LYS A HB2  4  
ATOM 2116  H HB3  . LYS A 1 20 ? 5.293   0.577   -1.367  1.00 0.00 ? 23 LYS A HB3  4  
ATOM 2117  H HG2  . LYS A 1 20 ? 5.018   1.544   -4.164  1.00 0.00 ? 23 LYS A HG2  4  
ATOM 2118  H HG3  . LYS A 1 20 ? 6.471   1.245   -3.209  1.00 0.00 ? 23 LYS A HG3  4  
ATOM 2119  H HD2  . LYS A 1 20 ? 5.498   -1.263  -3.365  1.00 0.00 ? 23 LYS A HD2  4  
ATOM 2120  H HD3  . LYS A 1 20 ? 4.875   -0.605  -4.879  1.00 0.00 ? 23 LYS A HD3  4  
ATOM 2121  H HE2  . LYS A 1 20 ? 6.869   -0.971  -5.788  1.00 0.00 ? 23 LYS A HE2  4  
ATOM 2122  H HE3  . LYS A 1 20 ? 7.533   0.261   -4.711  1.00 0.00 ? 23 LYS A HE3  4  
ATOM 2123  H HZ1  . LYS A 1 20 ? 7.864   -1.507  -3.037  1.00 0.00 ? 23 LYS A HZ1  4  
ATOM 2124  H HZ2  . LYS A 1 20 ? 8.767   -1.764  -4.447  1.00 0.00 ? 23 LYS A HZ2  4  
ATOM 2125  H HZ3  . LYS A 1 20 ? 7.358   -2.659  -4.169  1.00 0.00 ? 23 LYS A HZ3  4  
ATOM 2126  N N    . ALA A 1 21 ? 3.709   -1.070  0.023   1.00 0.00 ? 24 ALA A N    4  
ATOM 2127  C CA   . ALA A 1 21 ? 3.966   -2.084  1.043   1.00 0.00 ? 24 ALA A CA   4  
ATOM 2128  C C    . ALA A 1 21 ? 2.798   -3.067  1.177   1.00 0.00 ? 24 ALA A C    4  
ATOM 2129  O O    . ALA A 1 21 ? 3.009   -4.261  1.415   1.00 0.00 ? 24 ALA A O    4  
ATOM 2130  C CB   . ALA A 1 21 ? 4.259   -1.416  2.381   1.00 0.00 ? 24 ALA A CB   4  
ATOM 2131  H H    . ALA A 1 21 ? 3.477   -0.152  0.300   1.00 0.00 ? 24 ALA A H    4  
ATOM 2132  H HA   . ALA A 1 21 ? 4.846   -2.635  0.744   1.00 0.00 ? 24 ALA A HA   4  
ATOM 2133  H HB1  . ALA A 1 21 ? 4.576   -2.163  3.094   1.00 0.00 ? 24 ALA A HB1  4  
ATOM 2134  H HB2  . ALA A 1 21 ? 3.367   -0.928  2.743   1.00 0.00 ? 24 ALA A HB2  4  
ATOM 2135  H HB3  . ALA A 1 21 ? 5.043   -0.685  2.253   1.00 0.00 ? 24 ALA A HB3  4  
ATOM 2136  N N    . LYS A 1 22 ? 1.571   -2.567  1.016   1.00 0.00 ? 25 LYS A N    4  
ATOM 2137  C CA   . LYS A 1 22 ? 0.378   -3.398  1.119   1.00 0.00 ? 25 LYS A CA   4  
ATOM 2138  C C    . LYS A 1 22 ? 0.366   -4.469  0.035   1.00 0.00 ? 25 LYS A C    4  
ATOM 2139  O O    . LYS A 1 22 ? 0.092   -5.639  0.315   1.00 0.00 ? 25 LYS A O    4  
ATOM 2140  C CB   . LYS A 1 22 ? -0.879  -2.528  1.032   1.00 0.00 ? 25 LYS A CB   4  
ATOM 2141  C CG   . LYS A 1 22 ? -1.683  -2.497  2.321   1.00 0.00 ? 25 LYS A CG   4  
ATOM 2142  C CD   . LYS A 1 22 ? -3.180  -2.498  2.047   1.00 0.00 ? 25 LYS A CD   4  
ATOM 2143  C CE   . LYS A 1 22 ? -3.914  -1.502  2.930   1.00 0.00 ? 25 LYS A CE   4  
ATOM 2144  N NZ   . LYS A 1 22 ? -4.251  -2.087  4.260   1.00 0.00 ? 25 LYS A NZ   4  
ATOM 2145  H H    . LYS A 1 22 ? 1.462   -1.610  0.817   1.00 0.00 ? 25 LYS A H    4  
ATOM 2146  H HA   . LYS A 1 22 ? 0.400   -3.886  2.082   1.00 0.00 ? 25 LYS A HA   4  
ATOM 2147  H HB2  . LYS A 1 22 ? -0.587  -1.515  0.795   1.00 0.00 ? 25 LYS A HB2  4  
ATOM 2148  H HB3  . LYS A 1 22 ? -1.513  -2.902  0.244   1.00 0.00 ? 25 LYS A HB3  4  
ATOM 2149  H HG2  . LYS A 1 22 ? -1.430  -3.367  2.908   1.00 0.00 ? 25 LYS A HG2  4  
ATOM 2150  H HG3  . LYS A 1 22 ? -1.425  -1.602  2.870   1.00 0.00 ? 25 LYS A HG3  4  
ATOM 2151  H HD2  . LYS A 1 22 ? -3.347  -2.237  1.013   1.00 0.00 ? 25 LYS A HD2  4  
ATOM 2152  H HD3  . LYS A 1 22 ? -3.568  -3.488  2.235   1.00 0.00 ? 25 LYS A HD3  4  
ATOM 2153  H HE2  . LYS A 1 22 ? -3.285  -0.634  3.074   1.00 0.00 ? 25 LYS A HE2  4  
ATOM 2154  H HE3  . LYS A 1 22 ? -4.827  -1.203  2.433   1.00 0.00 ? 25 LYS A HE3  4  
ATOM 2155  H HZ1  . LYS A 1 22 ? -4.997  -2.806  4.156   1.00 0.00 ? 25 LYS A HZ1  4  
ATOM 2156  H HZ2  . LYS A 1 22 ? -4.589  -1.344  4.905   1.00 0.00 ? 25 LYS A HZ2  4  
ATOM 2157  H HZ3  . LYS A 1 22 ? -3.411  -2.536  4.678   1.00 0.00 ? 25 LYS A HZ3  4  
ATOM 2158  N N    . ASN A 1 23 ? 0.682   -4.074  -1.199  1.00 0.00 ? 26 ASN A N    4  
ATOM 2159  C CA   . ASN A 1 23 ? 0.716   -5.030  -2.305  1.00 0.00 ? 26 ASN A CA   4  
ATOM 2160  C C    . ASN A 1 23 ? 1.891   -5.996  -2.136  1.00 0.00 ? 26 ASN A C    4  
ATOM 2161  O O    . ASN A 1 23 ? 1.738   -7.203  -2.330  1.00 0.00 ? 26 ASN A O    4  
ATOM 2162  C CB   . ASN A 1 23 ? 0.774   -4.308  -3.664  1.00 0.00 ? 26 ASN A CB   4  
ATOM 2163  C CG   . ASN A 1 23 ? 2.183   -4.016  -4.140  1.00 0.00 ? 26 ASN A CG   4  
ATOM 2164  O OD1  . ASN A 1 23 ? 2.872   -4.893  -4.654  1.00 0.00 ? 26 ASN A OD1  4  
ATOM 2165  N ND2  . ASN A 1 23 ? 2.617   -2.782  -3.972  1.00 0.00 ? 26 ASN A ND2  4  
ATOM 2166  H H    . ASN A 1 23 ? 0.911   -3.126  -1.361  1.00 0.00 ? 26 ASN A H    4  
ATOM 2167  H HA   . ASN A 1 23 ? -0.197  -5.607  -2.258  1.00 0.00 ? 26 ASN A HA   4  
ATOM 2168  H HB2  . ASN A 1 23 ? 0.290   -4.923  -4.407  1.00 0.00 ? 26 ASN A HB2  4  
ATOM 2169  H HB3  . ASN A 1 23 ? 0.241   -3.370  -3.584  1.00 0.00 ? 26 ASN A HB3  4  
ATOM 2170  H HD21 . ASN A 1 23 ? 2.011   -2.130  -3.553  1.00 0.00 ? 26 ASN A HD21 4  
ATOM 2171  H HD22 . ASN A 1 23 ? 3.523   -2.569  -4.268  1.00 0.00 ? 26 ASN A HD22 4  
ATOM 2172  N N    . LEU A 1 24 ? 3.053   -5.465  -1.743  1.00 0.00 ? 27 LEU A N    4  
ATOM 2173  C CA   . LEU A 1 24 ? 4.242   -6.290  -1.523  1.00 0.00 ? 27 LEU A CA   4  
ATOM 2174  C C    . LEU A 1 24 ? 3.950   -7.404  -0.529  1.00 0.00 ? 27 LEU A C    4  
ATOM 2175  O O    . LEU A 1 24 ? 4.139   -8.586  -0.816  1.00 0.00 ? 27 LEU A O    4  
ATOM 2176  C CB   . LEU A 1 24 ? 5.407   -5.430  -1.016  1.00 0.00 ? 27 LEU A CB   4  
ATOM 2177  C CG   . LEU A 1 24 ? 6.108   -4.580  -2.076  1.00 0.00 ? 27 LEU A CG   4  
ATOM 2178  C CD1  . LEU A 1 24 ? 7.169   -3.702  -1.434  1.00 0.00 ? 27 LEU A CD1  4  
ATOM 2179  C CD2  . LEU A 1 24 ? 6.723   -5.465  -3.150  1.00 0.00 ? 27 LEU A CD2  4  
ATOM 2180  H H    . LEU A 1 24 ? 3.107   -4.498  -1.583  1.00 0.00 ? 27 LEU A H    4  
ATOM 2181  H HA   . LEU A 1 24 ? 4.511   -6.732  -2.453  1.00 0.00 ? 27 LEU A HA   4  
ATOM 2182  H HB2  . LEU A 1 24 ? 5.030   -4.769  -0.248  1.00 0.00 ? 27 LEU A HB2  4  
ATOM 2183  H HB3  . LEU A 1 24 ? 6.142   -6.084  -0.571  1.00 0.00 ? 27 LEU A HB3  4  
ATOM 2184  H HG   . LEU A 1 24 ? 5.380   -3.935  -2.546  1.00 0.00 ? 27 LEU A HG   4  
ATOM 2185  H HD11 . LEU A 1 24 ? 6.765   -2.713  -1.268  1.00 0.00 ? 27 LEU A HD11 4  
ATOM 2186  H HD12 . LEU A 1 24 ? 8.027   -3.637  -2.086  1.00 0.00 ? 27 LEU A HD12 4  
ATOM 2187  H HD13 . LEU A 1 24 ? 7.468   -4.131  -0.488  1.00 0.00 ? 27 LEU A HD13 4  
ATOM 2188  H HD21 . LEU A 1 24 ? 6.129   -5.406  -4.049  1.00 0.00 ? 27 LEU A HD21 4  
ATOM 2189  H HD22 . LEU A 1 24 ? 6.750   -6.488  -2.803  1.00 0.00 ? 27 LEU A HD22 4  
ATOM 2190  H HD23 . LEU A 1 24 ? 7.728   -5.131  -3.360  1.00 0.00 ? 27 LEU A HD23 4  
ATOM 2191  N N    . ARG A 1 25 ? 3.481   -7.002  0.635   1.00 0.00 ? 28 ARG A N    4  
ATOM 2192  C CA   . ARG A 1 25 ? 3.139   -7.932  1.712   1.00 0.00 ? 28 ARG A CA   4  
ATOM 2193  C C    . ARG A 1 25 ? 2.055   -8.915  1.285   1.00 0.00 ? 28 ARG A C    4  
ATOM 2194  O O    . ARG A 1 25 ? 2.156   -10.105 1.569   1.00 0.00 ? 28 ARG A O    4  
ATOM 2195  C CB   . ARG A 1 25 ? 2.684   -7.156  2.953   1.00 0.00 ? 28 ARG A CB   4  
ATOM 2196  C CG   . ARG A 1 25 ? 3.786   -6.934  3.979   1.00 0.00 ? 28 ARG A CG   4  
ATOM 2197  C CD   . ARG A 1 25 ? 3.260   -7.078  5.399   1.00 0.00 ? 28 ARG A CD   4  
ATOM 2198  N NE   . ARG A 1 25 ? 3.868   -6.104  6.313   1.00 0.00 ? 28 ARG A NE   4  
ATOM 2199  C CZ   . ARG A 1 25 ? 4.077   -6.318  7.609   1.00 0.00 ? 28 ARG A CZ   4  
ATOM 2200  N NH1  . ARG A 1 25 ? 3.708   -7.456  8.170   1.00 0.00 ? 28 ARG A NH1  4  
ATOM 2201  N NH2  . ARG A 1 25 ? 4.651   -5.386  8.345   1.00 0.00 ? 28 ARG A NH2  4  
ATOM 2202  H H    . ARG A 1 25 ? 3.357   -6.041  0.771   1.00 0.00 ? 28 ARG A H    4  
ATOM 2203  H HA   . ARG A 1 25 ? 4.025   -8.501  1.957   1.00 0.00 ? 28 ARG A HA   4  
ATOM 2204  H HB2  . ARG A 1 25 ? 2.314   -6.189  2.642   1.00 0.00 ? 28 ARG A HB2  4  
ATOM 2205  H HB3  . ARG A 1 25 ? 1.882   -7.700  3.429   1.00 0.00 ? 28 ARG A HB3  4  
ATOM 2206  H HG2  . ARG A 1 25 ? 4.567   -7.663  3.819   1.00 0.00 ? 28 ARG A HG2  4  
ATOM 2207  H HG3  . ARG A 1 25 ? 4.188   -5.939  3.850   1.00 0.00 ? 28 ARG A HG3  4  
ATOM 2208  H HD2  . ARG A 1 25 ? 2.189   -6.931  5.389   1.00 0.00 ? 28 ARG A HD2  4  
ATOM 2209  H HD3  . ARG A 1 25 ? 3.482   -8.076  5.746   1.00 0.00 ? 28 ARG A HD3  4  
ATOM 2210  H HE   . ARG A 1 25 ? 4.142   -5.242  5.934   1.00 0.00 ? 28 ARG A HE   4  
ATOM 2211  H HH11 . ARG A 1 25 ? 3.266   -8.161  7.623   1.00 0.00 ? 28 ARG A HH11 4  
ATOM 2212  H HH12 . ARG A 1 25 ? 3.873   -7.609  9.142   1.00 0.00 ? 28 ARG A HH12 4  
ATOM 2213  H HH21 . ARG A 1 25 ? 4.926   -4.522  7.929   1.00 0.00 ? 28 ARG A HH21 4  
ATOM 2214  H HH22 . ARG A 1 25 ? 4.810   -5.544  9.319   1.00 0.00 ? 28 ARG A HH22 4  
ATOM 2215  N N    . ALA A 1 26 ? 1.030   -8.425  0.590   1.00 0.00 ? 29 ALA A N    4  
ATOM 2216  C CA   . ALA A 1 26 ? -0.048  -9.290  0.126   1.00 0.00 ? 29 ALA A CA   4  
ATOM 2217  C C    . ALA A 1 26 ? 0.484   -10.277 -0.905  1.00 0.00 ? 29 ALA A C    4  
ATOM 2218  O O    . ALA A 1 26 ? 0.197   -11.472 -0.846  1.00 0.00 ? 29 ALA A O    4  
ATOM 2219  C CB   . ALA A 1 26 ? -1.185  -8.460  -0.457  1.00 0.00 ? 29 ALA A CB   4  
ATOM 2220  H H    . ALA A 1 26 ? 1.007   -7.470  0.369   1.00 0.00 ? 29 ALA A H    4  
ATOM 2221  H HA   . ALA A 1 26 ? -0.426  -9.842  0.974   1.00 0.00 ? 29 ALA A HA   4  
ATOM 2222  H HB1  . ALA A 1 26 ? -0.875  -8.038  -1.402  1.00 0.00 ? 29 ALA A HB1  4  
ATOM 2223  H HB2  . ALA A 1 26 ? -1.436  -7.663  0.228   1.00 0.00 ? 29 ALA A HB2  4  
ATOM 2224  H HB3  . ALA A 1 26 ? -2.048  -9.089  -0.609  1.00 0.00 ? 29 ALA A HB3  4  
ATOM 2225  N N    . GLN A 1 27 ? 1.275   -9.761  -1.839  1.00 0.00 ? 30 GLN A N    4  
ATOM 2226  C CA   . GLN A 1 27 ? 1.867   -10.584 -2.888  1.00 0.00 ? 30 GLN A CA   4  
ATOM 2227  C C    . GLN A 1 27 ? 2.895   -11.559 -2.330  1.00 0.00 ? 30 GLN A C    4  
ATOM 2228  O O    . GLN A 1 27 ? 2.969   -12.711 -2.759  1.00 0.00 ? 30 GLN A O    4  
ATOM 2229  C CB   . GLN A 1 27 ? 2.493   -9.685  -3.959  1.00 0.00 ? 30 GLN A CB   4  
ATOM 2230  C CG   . GLN A 1 27 ? 3.330   -10.434 -4.983  1.00 0.00 ? 30 GLN A CG   4  
ATOM 2231  C CD   . GLN A 1 27 ? 2.990   -10.054 -6.411  1.00 0.00 ? 30 GLN A CD   4  
ATOM 2232  O OE1  . GLN A 1 27 ? 2.537   -10.885 -7.193  1.00 0.00 ? 30 GLN A OE1  4  
ATOM 2233  N NE2  . GLN A 1 27 ? 3.204   -8.795  -6.762  1.00 0.00 ? 30 GLN A NE2  4  
ATOM 2234  H H    . GLN A 1 27 ? 1.472   -8.792  -1.818  1.00 0.00 ? 30 GLN A H    4  
ATOM 2235  H HA   . GLN A 1 27 ? 1.085   -11.158 -3.324  1.00 0.00 ? 30 GLN A HA   4  
ATOM 2236  H HB2  . GLN A 1 27 ? 1.700   -9.168  -4.483  1.00 0.00 ? 30 GLN A HB2  4  
ATOM 2237  H HB3  . GLN A 1 27 ? 3.123   -8.954  -3.474  1.00 0.00 ? 30 GLN A HB3  4  
ATOM 2238  H HG2  . GLN A 1 27 ? 4.371   -10.212 -4.808  1.00 0.00 ? 30 GLN A HG2  4  
ATOM 2239  H HG3  . GLN A 1 27 ? 3.163   -11.493 -4.859  1.00 0.00 ? 30 GLN A HG3  4  
ATOM 2240  H HE21 . GLN A 1 27 ? 3.566   -8.180  -6.091  1.00 0.00 ? 30 GLN A HE21 4  
ATOM 2241  H HE22 . GLN A 1 27 ? 2.990   -8.532  -7.679  1.00 0.00 ? 30 GLN A HE22 4  
ATOM 2242  N N    . ALA A 1 28 ? 3.664   -11.098 -1.367  1.00 0.00 ? 31 ALA A N    4  
ATOM 2243  C CA   . ALA A 1 28 ? 4.680   -11.928 -0.732  1.00 0.00 ? 31 ALA A CA   4  
ATOM 2244  C C    . ALA A 1 28 ? 4.029   -12.923 0.219   1.00 0.00 ? 31 ALA A C    4  
ATOM 2245  O O    . ALA A 1 28 ? 4.261   -14.131 0.124   1.00 0.00 ? 31 ALA A O    4  
ATOM 2246  C CB   . ALA A 1 28 ? 5.695   -11.061 0.003   1.00 0.00 ? 31 ALA A CB   4  
ATOM 2247  H H    . ALA A 1 28 ? 3.532   -10.178 -1.065  1.00 0.00 ? 31 ALA A H    4  
ATOM 2248  H HA   . ALA A 1 28 ? 5.198   -12.474 -1.507  1.00 0.00 ? 31 ALA A HA   4  
ATOM 2249  H HB1  . ALA A 1 28 ? 6.619   -11.608 0.121   1.00 0.00 ? 31 ALA A HB1  4  
ATOM 2250  H HB2  . ALA A 1 28 ? 5.306   -10.795 0.975   1.00 0.00 ? 31 ALA A HB2  4  
ATOM 2251  H HB3  . ALA A 1 28 ? 5.881   -10.162 -0.568  1.00 0.00 ? 31 ALA A HB3  4  
ATOM 2252  N N    . ALA A 1 29 ? 3.198   -12.406 1.124   1.00 0.00 ? 32 ALA A N    4  
ATOM 2253  C CA   . ALA A 1 29 ? 2.495   -13.253 2.091   1.00 0.00 ? 32 ALA A CA   4  
ATOM 2254  C C    . ALA A 1 29 ? 1.600   -14.283 1.397   1.00 0.00 ? 32 ALA A C    4  
ATOM 2255  O O    . ALA A 1 29 ? 1.545   -15.438 1.817   1.00 0.00 ? 32 ALA A O    4  
ATOM 2256  C CB   . ALA A 1 29 ? 1.678   -12.399 3.052   1.00 0.00 ? 32 ALA A CB   4  
ATOM 2257  H H    . ALA A 1 29 ? 3.047   -11.423 1.136   1.00 0.00 ? 32 ALA A H    4  
ATOM 2258  H HA   . ALA A 1 29 ? 3.240   -13.783 2.666   1.00 0.00 ? 32 ALA A HA   4  
ATOM 2259  H HB1  . ALA A 1 29 ? 2.334   -11.722 3.578   1.00 0.00 ? 32 ALA A HB1  4  
ATOM 2260  H HB2  . ALA A 1 29 ? 1.174   -13.039 3.762   1.00 0.00 ? 32 ALA A HB2  4  
ATOM 2261  H HB3  . ALA A 1 29 ? 0.946   -11.832 2.495   1.00 0.00 ? 32 ALA A HB3  4  
ATOM 2262  N N    . ALA A 1 30 ? 0.898   -13.866 0.338   1.00 0.00 ? 33 ALA A N    4  
ATOM 2263  C CA   . ALA A 1 30 ? 0.014   -14.774 -0.394  1.00 0.00 ? 33 ALA A CA   4  
ATOM 2264  C C    . ALA A 1 30 ? 0.800   -15.800 -1.197  1.00 0.00 ? 33 ALA A C    4  
ATOM 2265  O O    . ALA A 1 30 ? 0.478   -16.989 -1.195  1.00 0.00 ? 33 ALA A O    4  
ATOM 2266  C CB   . ALA A 1 30 ? -0.932  -13.991 -1.296  1.00 0.00 ? 33 ALA A CB   4  
ATOM 2267  H H    . ALA A 1 30 ? 0.976   -12.930 0.044   1.00 0.00 ? 33 ALA A H    4  
ATOM 2268  H HA   . ALA A 1 30 ? -0.570  -15.299 0.324   1.00 0.00 ? 33 ALA A HA   4  
ATOM 2269  H HB1  . ALA A 1 30 ? -1.437  -13.233 -0.716  1.00 0.00 ? 33 ALA A HB1  4  
ATOM 2270  H HB2  . ALA A 1 30 ? -1.662  -14.663 -1.722  1.00 0.00 ? 33 ALA A HB2  4  
ATOM 2271  H HB3  . ALA A 1 30 ? -0.368  -13.523 -2.089  1.00 0.00 ? 33 ALA A HB3  4  
ATOM 2272  N N    . ASN A 1 31 ? 1.828   -15.326 -1.874  1.00 0.00 ? 34 ASN A N    4  
ATOM 2273  C CA   . ASN A 1 31 ? 2.681   -16.182 -2.691  1.00 0.00 ? 34 ASN A CA   4  
ATOM 2274  C C    . ASN A 1 31 ? 3.509   -17.137 -1.822  1.00 0.00 ? 34 ASN A C    4  
ATOM 2275  O O    . ASN A 1 31 ? 3.576   -18.333 -2.102  1.00 0.00 ? 34 ASN A O    4  
ATOM 2276  C CB   . ASN A 1 31 ? 3.600   -15.325 -3.569  1.00 0.00 ? 34 ASN A CB   4  
ATOM 2277  C CG   . ASN A 1 31 ? 4.673   -16.134 -4.260  1.00 0.00 ? 34 ASN A CG   4  
ATOM 2278  O OD1  . ASN A 1 31 ? 4.472   -16.645 -5.359  1.00 0.00 ? 34 ASN A OD1  4  
ATOM 2279  N ND2  . ASN A 1 31 ? 5.822   -16.257 -3.619  1.00 0.00 ? 34 ASN A ND2  4  
ATOM 2280  H H    . ASN A 1 31 ? 2.018   -14.368 -1.820  1.00 0.00 ? 34 ASN A H    4  
ATOM 2281  H HA   . ASN A 1 31 ? 2.040   -16.772 -3.331  1.00 0.00 ? 34 ASN A HA   4  
ATOM 2282  H HB2  . ASN A 1 31 ? 3.007   -14.834 -4.325  1.00 0.00 ? 34 ASN A HB2  4  
ATOM 2283  H HB3  . ASN A 1 31 ? 4.078   -14.577 -2.954  1.00 0.00 ? 34 ASN A HB3  4  
ATOM 2284  H HD21 . ASN A 1 31 ? 5.917   -15.823 -2.748  1.00 0.00 ? 34 ASN A HD21 4  
ATOM 2285  H HD22 . ASN A 1 31 ? 6.527   -16.778 -4.043  1.00 0.00 ? 34 ASN A HD22 4  
ATOM 2286  N N    . ALA A 1 32 ? 4.135   -16.608 -0.769  1.00 0.00 ? 35 ALA A N    4  
ATOM 2287  C CA   . ALA A 1 32 ? 4.956   -17.427 0.128   1.00 0.00 ? 35 ALA A CA   4  
ATOM 2288  C C    . ALA A 1 32 ? 4.126   -18.083 1.242   1.00 0.00 ? 35 ALA A C    4  
ATOM 2289  O O    . ALA A 1 32 ? 4.576   -18.186 2.385   1.00 0.00 ? 35 ALA A O    4  
ATOM 2290  C CB   . ALA A 1 32 ? 6.079   -16.582 0.717   1.00 0.00 ? 35 ALA A CB   4  
ATOM 2291  H H    . ALA A 1 32 ? 4.045   -15.643 -0.588  1.00 0.00 ? 35 ALA A H    4  
ATOM 2292  H HA   . ALA A 1 32 ? 5.409   -18.209 -0.466  1.00 0.00 ? 35 ALA A HA   4  
ATOM 2293  H HB1  . ALA A 1 32 ? 6.801   -16.352 -0.053  1.00 0.00 ? 35 ALA A HB1  4  
ATOM 2294  H HB2  . ALA A 1 32 ? 6.563   -17.130 1.512   1.00 0.00 ? 35 ALA A HB2  4  
ATOM 2295  H HB3  . ALA A 1 32 ? 5.669   -15.664 1.111   1.00 0.00 ? 35 ALA A HB3  4  
ATOM 2296  N N    . HIS A 1 33 ? 2.919   -18.535 0.902   1.00 0.00 ? 36 HIS A N    4  
ATOM 2297  C CA   . HIS A 1 33 ? 2.039   -19.188 1.871   1.00 0.00 ? 36 HIS A CA   4  
ATOM 2298  C C    . HIS A 1 33 ? 1.852   -20.669 1.531   1.00 0.00 ? 36 HIS A C    4  
ATOM 2299  O O    . HIS A 1 33 ? 2.124   -21.544 2.356   1.00 0.00 ? 36 HIS A O    4  
ATOM 2300  C CB   . HIS A 1 33 ? 0.680   -18.481 1.913   1.00 0.00 ? 36 HIS A CB   4  
ATOM 2301  C CG   . HIS A 1 33 ? 0.044   -18.488 3.267   1.00 0.00 ? 36 HIS A CG   4  
ATOM 2302  N ND1  . HIS A 1 33 ? -0.712  -19.539 3.738   1.00 0.00 ? 36 HIS A ND1  4  
ATOM 2303  C CD2  . HIS A 1 33 ? 0.058   -17.565 4.255   1.00 0.00 ? 36 HIS A CD2  4  
ATOM 2304  C CE1  . HIS A 1 33 ? -1.138  -19.262 4.958   1.00 0.00 ? 36 HIS A CE1  4  
ATOM 2305  N NE2  . HIS A 1 33 ? -0.683  -18.069 5.296   1.00 0.00 ? 36 HIS A NE2  4  
ATOM 2306  H H    . HIS A 1 33 ? 2.615   -18.431 -0.021  1.00 0.00 ? 36 HIS A H    4  
ATOM 2307  H HA   . HIS A 1 33 ? 2.503   -19.114 2.843   1.00 0.00 ? 36 HIS A HA   4  
ATOM 2308  H HB2  . HIS A 1 33 ? 0.808   -17.452 1.613   1.00 0.00 ? 36 HIS A HB2  4  
ATOM 2309  H HB3  . HIS A 1 33 ? 0.005   -18.969 1.226   1.00 0.00 ? 36 HIS A HB3  4  
ATOM 2310  H HD1  . HIS A 1 33 ? -0.909  -20.366 3.250   1.00 0.00 ? 36 HIS A HD1  4  
ATOM 2311  H HD2  . HIS A 1 33 ? 0.561   -16.607 4.229   1.00 0.00 ? 36 HIS A HD2  4  
ATOM 2312  H HE1  . HIS A 1 33 ? -1.753  -19.902 5.575   1.00 0.00 ? 36 HIS A HE1  4  
ATOM 2313  H HE2  . HIS A 1 33 ? -0.756  -17.670 6.188   1.00 0.00 ? 36 HIS A HE2  4  
ATOM 2314  N N    . LEU A 1 34 ? 1.381   -20.940 0.314   1.00 0.00 ? 37 LEU A N    4  
ATOM 2315  C CA   . LEU A 1 34 ? 1.149   -22.316 -0.135  1.00 0.00 ? 37 LEU A CA   4  
ATOM 2316  C C    . LEU A 1 34 ? 2.134   -22.741 -1.224  1.00 0.00 ? 37 LEU A C    4  
ATOM 2317  O O    . LEU A 1 34 ? 2.532   -23.906 -1.292  1.00 0.00 ? 37 LEU A O    4  
ATOM 2318  C CB   . LEU A 1 34 ? -0.294  -22.479 -0.629  1.00 0.00 ? 37 LEU A CB   4  
ATOM 2319  C CG   . LEU A 1 34 ? -0.763  -21.438 -1.652  1.00 0.00 ? 37 LEU A CG   4  
ATOM 2320  C CD1  . LEU A 1 34 ? -1.732  -22.063 -2.639  1.00 0.00 ? 37 LEU A CD1  4  
ATOM 2321  C CD2  . LEU A 1 34 ? -1.411  -20.253 -0.952  1.00 0.00 ? 37 LEU A CD2  4  
ATOM 2322  H H    . LEU A 1 34 ? 1.177   -20.199 -0.292  1.00 0.00 ? 37 LEU A H    4  
ATOM 2323  H HA   . LEU A 1 34 ? 1.299   -22.954 0.706   1.00 0.00 ? 37 LEU A HA   4  
ATOM 2324  H HB2  . LEU A 1 34 ? -0.387  -23.460 -1.077  1.00 0.00 ? 37 LEU A HB2  4  
ATOM 2325  H HB3  . LEU A 1 34 ? -0.951  -22.432 0.225   1.00 0.00 ? 37 LEU A HB3  4  
ATOM 2326  H HG   . LEU A 1 34 ? 0.090   -21.076 -2.207  1.00 0.00 ? 37 LEU A HG   4  
ATOM 2327  H HD11 . LEU A 1 34 ? -2.523  -22.563 -2.101  1.00 0.00 ? 37 LEU A HD11 4  
ATOM 2328  H HD12 . LEU A 1 34 ? -1.208  -22.780 -3.255  1.00 0.00 ? 37 LEU A HD12 4  
ATOM 2329  H HD13 . LEU A 1 34 ? -2.154  -21.291 -3.266  1.00 0.00 ? 37 LEU A HD13 4  
ATOM 2330  H HD21 . LEU A 1 34 ? -0.885  -19.347 -1.217  1.00 0.00 ? 37 LEU A HD21 4  
ATOM 2331  H HD22 . LEU A 1 34 ? -1.365  -20.396 0.117   1.00 0.00 ? 37 LEU A HD22 4  
ATOM 2332  H HD23 . LEU A 1 34 ? -2.442  -20.174 -1.260  1.00 0.00 ? 37 LEU A HD23 4  
ATOM 2333  N N    . MET A 1 35 ? 2.519   -21.789 -2.063  1.00 0.00 ? 38 MET A N    4  
ATOM 2334  C CA   . MET A 1 35 ? 3.460   -22.042 -3.166  1.00 0.00 ? 38 MET A CA   4  
ATOM 2335  C C    . MET A 1 35 ? 4.748   -22.707 -2.682  1.00 0.00 ? 38 MET A C    4  
ATOM 2336  O O    . MET A 1 35 ? 5.364   -23.493 -3.401  1.00 0.00 ? 38 MET A O    4  
ATOM 2337  C CB   . MET A 1 35 ? 3.783   -20.734 -3.898  1.00 0.00 ? 38 MET A CB   4  
ATOM 2338  C CG   . MET A 1 35 ? 4.542   -20.933 -5.202  1.00 0.00 ? 38 MET A CG   4  
ATOM 2339  S SD   . MET A 1 35 ? 5.962   -19.832 -5.351  1.00 0.00 ? 38 MET A SD   4  
ATOM 2340  C CE   . MET A 1 35 ? 7.112   -20.602 -4.215  1.00 0.00 ? 38 MET A CE   4  
ATOM 2341  H H    . MET A 1 35 ? 2.162   -20.893 -1.938  1.00 0.00 ? 38 MET A H    4  
ATOM 2342  H HA   . MET A 1 35 ? 2.981   -22.711 -3.845  1.00 0.00 ? 38 MET A HA   4  
ATOM 2343  H HB2  . MET A 1 35 ? 2.858   -20.222 -4.121  1.00 0.00 ? 38 MET A HB2  4  
ATOM 2344  H HB3  . MET A 1 35 ? 4.381   -20.110 -3.251  1.00 0.00 ? 38 MET A HB3  4  
ATOM 2345  H HG2  . MET A 1 35 ? 4.892   -21.954 -5.249  1.00 0.00 ? 38 MET A HG2  4  
ATOM 2346  H HG3  . MET A 1 35 ? 3.871   -20.746 -6.027  1.00 0.00 ? 38 MET A HG3  4  
ATOM 2347  H HE1  . MET A 1 35 ? 7.190   -20.003 -3.321  1.00 0.00 ? 38 MET A HE1  4  
ATOM 2348  H HE2  . MET A 1 35 ? 8.082   -20.679 -4.682  1.00 0.00 ? 38 MET A HE2  4  
ATOM 2349  H HE3  . MET A 1 35 ? 6.758   -21.589 -3.958  1.00 0.00 ? 38 MET A HE3  4  
ATOM 2350  N N    . ALA A 1 36 ? 5.135   -22.389 -1.459  1.00 0.00 ? 39 ALA A N    4  
ATOM 2351  C CA   . ALA A 1 36 ? 6.339   -22.954 -0.853  1.00 0.00 ? 39 ALA A CA   4  
ATOM 2352  C C    . ALA A 1 36 ? 5.988   -23.968 0.245   1.00 0.00 ? 39 ALA A C    4  
ATOM 2353  O O    . ALA A 1 36 ? 6.780   -24.205 1.159   1.00 0.00 ? 39 ALA A O    4  
ATOM 2354  C CB   . ALA A 1 36 ? 7.215   -21.837 -0.298  1.00 0.00 ? 39 ALA A CB   4  
ATOM 2355  H H    . ALA A 1 36 ? 4.589   -21.765 -0.948  1.00 0.00 ? 39 ALA A H    4  
ATOM 2356  H HA   . ALA A 1 36 ? 6.895   -23.462 -1.628  1.00 0.00 ? 39 ALA A HA   4  
ATOM 2357  H HB1  . ALA A 1 36 ? 8.157   -22.249 0.032   1.00 0.00 ? 39 ALA A HB1  4  
ATOM 2358  H HB2  . ALA A 1 36 ? 6.715   -21.368 0.536   1.00 0.00 ? 39 ALA A HB2  4  
ATOM 2359  H HB3  . ALA A 1 36 ? 7.393   -21.102 -1.069  1.00 0.00 ? 39 ALA A HB3  4  
ATOM 2360  N N    . GLN A 1 37 ? 4.796   -24.561 0.149   1.00 0.00 ? 40 GLN A N    4  
ATOM 2361  C CA   . GLN A 1 37 ? 4.337   -25.540 1.128   1.00 0.00 ? 40 GLN A CA   4  
ATOM 2362  C C    . GLN A 1 37 ? 3.953   -26.863 0.457   1.00 0.00 ? 40 GLN A C    4  
ATOM 2363  O O    . GLN A 1 37 ? 4.434   -27.927 0.851   1.00 0.00 ? 40 GLN A O    4  
ATOM 2364  C CB   . GLN A 1 37 ? 3.144   -24.977 1.905   1.00 0.00 ? 40 GLN A CB   4  
ATOM 2365  C CG   . GLN A 1 37 ? 3.358   -24.936 3.412   1.00 0.00 ? 40 GLN A CG   4  
ATOM 2366  C CD   . GLN A 1 37 ? 2.078   -24.672 4.181   1.00 0.00 ? 40 GLN A CD   4  
ATOM 2367  O OE1  . GLN A 1 37 ? 1.609   -25.521 4.933   1.00 0.00 ? 40 GLN A OE1  4  
ATOM 2368  N NE2  . GLN A 1 37 ? 1.503   -23.492 3.999   1.00 0.00 ? 40 GLN A NE2  4  
ATOM 2369  H H    . GLN A 1 37 ? 4.206   -24.333 -0.600  1.00 0.00 ? 40 GLN A H    4  
ATOM 2370  H HA   . GLN A 1 37 ? 5.147   -25.724 1.814   1.00 0.00 ? 40 GLN A HA   4  
ATOM 2371  H HB2  . GLN A 1 37 ? 2.953   -23.969 1.565   1.00 0.00 ? 40 GLN A HB2  4  
ATOM 2372  H HB3  . GLN A 1 37 ? 2.276   -25.585 1.702   1.00 0.00 ? 40 GLN A HB3  4  
ATOM 2373  H HG2  . GLN A 1 37 ? 3.758   -25.887 3.731   1.00 0.00 ? 40 GLN A HG2  4  
ATOM 2374  H HG3  . GLN A 1 37 ? 4.066   -24.154 3.642   1.00 0.00 ? 40 GLN A HG3  4  
ATOM 2375  H HE21 . GLN A 1 37 ? 1.929   -22.853 3.380   1.00 0.00 ? 40 GLN A HE21 4  
ATOM 2376  H HE22 . GLN A 1 37 ? 0.677   -23.305 4.486   1.00 0.00 ? 40 GLN A HE22 4  
ATOM 2377  N N    . ILE A 1 38 ? 3.085   -26.786 -0.552  1.00 0.00 ? 41 ILE A N    4  
ATOM 2378  C CA   . ILE A 1 38 ? 2.635   -27.974 -1.277  1.00 0.00 ? 41 ILE A CA   4  
ATOM 2379  C C    . ILE A 1 38 ? 2.630   -27.728 -2.787  1.00 0.00 ? 41 ILE A C    4  
ATOM 2380  O O    . ILE A 1 38 ? 2.123   -26.668 -3.216  1.00 0.00 ? 41 ILE A O    4  
ATOM 2381  C CB   . ILE A 1 38 ? 1.220   -28.412 -0.830  1.00 0.00 ? 41 ILE A CB   4  
ATOM 2382  C CG1  . ILE A 1 38 ? 1.141   -28.513 0.696   1.00 0.00 ? 41 ILE A CG1  4  
ATOM 2383  C CG2  . ILE A 1 38 ? 0.847   -29.743 -1.467  1.00 0.00 ? 41 ILE A CG2  4  
ATOM 2384  C CD1  . ILE A 1 38 ? 0.375   -27.377 1.339   1.00 0.00 ? 41 ILE A CD1  4  
ATOM 2385  O OXT  . ILE A 1 38 ? 3.132   -28.600 -3.528  1.00 0.00 ? 41 ILE A OXT  4  
ATOM 2386  H H    . ILE A 1 38 ? 2.736   -25.908 -0.820  1.00 0.00 ? 41 ILE A H    4  
ATOM 2387  H HA   . ILE A 1 38 ? 3.321   -28.778 -1.060  1.00 0.00 ? 41 ILE A HA   4  
ATOM 2388  H HB   . ILE A 1 38 ? 0.518   -27.669 -1.173  1.00 0.00 ? 41 ILE A HB   4  
ATOM 2389  H HG12 . ILE A 1 38 ? 0.647   -29.436 0.962   1.00 0.00 ? 41 ILE A HG12 4  
ATOM 2390  H HG13 . ILE A 1 38 ? 2.141   -28.514 1.104   1.00 0.00 ? 41 ILE A HG13 4  
ATOM 2391  H HG21 . ILE A 1 38 ? 1.054   -29.706 -2.526  1.00 0.00 ? 41 ILE A HG21 4  
ATOM 2392  H HG22 . ILE A 1 38 ? -0.204  -29.934 -1.311  1.00 0.00 ? 41 ILE A HG22 4  
ATOM 2393  H HG23 . ILE A 1 38 ? 1.428   -30.534 -1.014  1.00 0.00 ? 41 ILE A HG23 4  
ATOM 2394  H HD11 . ILE A 1 38 ? 0.739   -27.221 2.344   1.00 0.00 ? 41 ILE A HD11 4  
ATOM 2395  H HD12 . ILE A 1 38 ? -0.676  -27.624 1.370   1.00 0.00 ? 41 ILE A HD12 4  
ATOM 2396  H HD13 . ILE A 1 38 ? 0.516   -26.476 0.761   1.00 0.00 ? 41 ILE A HD13 4  
ATOM 2397  N N    . PHE A 1 1  ? -4.989  20.467  8.220   1.00 0.00 ? 4  PHE A N    5  
ATOM 2398  C CA   . PHE A 1 1  ? -4.366  20.196  6.889   1.00 0.00 ? 4  PHE A CA   5  
ATOM 2399  C C    . PHE A 1 1  ? -5.199  19.196  6.083   1.00 0.00 ? 4  PHE A C    5  
ATOM 2400  O O    . PHE A 1 1  ? -5.898  18.366  6.662   1.00 0.00 ? 4  PHE A O    5  
ATOM 2401  C CB   . PHE A 1 1  ? -2.940  19.656  7.098   1.00 0.00 ? 4  PHE A CB   5  
ATOM 2402  C CG   . PHE A 1 1  ? -2.783  18.786  8.316   1.00 0.00 ? 4  PHE A CG   5  
ATOM 2403  C CD1  . PHE A 1 1  ? -3.349  17.521  8.359   1.00 0.00 ? 4  PHE A CD1  5  
ATOM 2404  C CD2  . PHE A 1 1  ? -2.074  19.235  9.418   1.00 0.00 ? 4  PHE A CD2  5  
ATOM 2405  C CE1  . PHE A 1 1  ? -3.210  16.723  9.478   1.00 0.00 ? 4  PHE A CE1  5  
ATOM 2406  C CE2  . PHE A 1 1  ? -1.932  18.442  10.540  1.00 0.00 ? 4  PHE A CE2  5  
ATOM 2407  C CZ   . PHE A 1 1  ? -2.500  17.184  10.570  1.00 0.00 ? 4  PHE A CZ   5  
ATOM 2408  H H1   . PHE A 1 1  ? -4.282  20.946  8.814   1.00 0.00 ? 4  PHE A H1   5  
ATOM 2409  H H2   . PHE A 1 1  ? -5.268  19.551  8.634   1.00 0.00 ? 4  PHE A H2   5  
ATOM 2410  H H3   . PHE A 1 1  ? -5.819  21.074  8.065   1.00 0.00 ? 4  PHE A H3   5  
ATOM 2411  H HA   . PHE A 1 1  ? -4.315  21.126  6.341   1.00 0.00 ? 4  PHE A HA   5  
ATOM 2412  H HB2  . PHE A 1 1  ? -2.656  19.069  6.238   1.00 0.00 ? 4  PHE A HB2  5  
ATOM 2413  H HB3  . PHE A 1 1  ? -2.259  20.490  7.196   1.00 0.00 ? 4  PHE A HB3  5  
ATOM 2414  H HD1  . PHE A 1 1  ? -3.903  17.159  7.505   1.00 0.00 ? 4  PHE A HD1  5  
ATOM 2415  H HD2  . PHE A 1 1  ? -1.628  20.219  9.396   1.00 0.00 ? 4  PHE A HD2  5  
ATOM 2416  H HE1  . PHE A 1 1  ? -3.655  15.738  9.499   1.00 0.00 ? 4  PHE A HE1  5  
ATOM 2417  H HE2  . PHE A 1 1  ? -1.375  18.804  11.392  1.00 0.00 ? 4  PHE A HE2  5  
ATOM 2418  H HZ   . PHE A 1 1  ? -2.390  16.562  11.446  1.00 0.00 ? 4  PHE A HZ   5  
ATOM 2419  N N    . THR A 1 2  ? -5.114  19.291  4.750   1.00 0.00 ? 5  THR A N    5  
ATOM 2420  C CA   . THR A 1 2  ? -5.857  18.401  3.843   1.00 0.00 ? 5  THR A CA   5  
ATOM 2421  C C    . THR A 1 2  ? -7.349  18.746  3.816   1.00 0.00 ? 5  THR A C    5  
ATOM 2422  O O    . THR A 1 2  ? -7.984  18.892  4.861   1.00 0.00 ? 5  THR A O    5  
ATOM 2423  C CB   . THR A 1 2  ? -5.661  16.929  4.235   1.00 0.00 ? 5  THR A CB   5  
ATOM 2424  O OG1  . THR A 1 2  ? -4.296  16.566  4.140   1.00 0.00 ? 5  THR A OG1  5  
ATOM 2425  C CG2  . THR A 1 2  ? -6.444  15.965  3.370   1.00 0.00 ? 5  THR A CG2  5  
ATOM 2426  H H    . THR A 1 2  ? -4.534  19.979  4.361   1.00 0.00 ? 5  THR A H    5  
ATOM 2427  H HA   . THR A 1 2  ? -5.457  18.547  2.850   1.00 0.00 ? 5  THR A HA   5  
ATOM 2428  H HB   . THR A 1 2  ? -5.983  16.792  5.258   1.00 0.00 ? 5  THR A HB   5  
ATOM 2429  H HG1  . THR A 1 2  ? -4.131  15.786  4.681   1.00 0.00 ? 5  THR A HG1  5  
ATOM 2430  H HG21 . THR A 1 2  ? -7.465  15.916  3.719   1.00 0.00 ? 5  THR A HG21 5  
ATOM 2431  H HG22 . THR A 1 2  ? -5.997  14.984  3.430   1.00 0.00 ? 5  THR A HG22 5  
ATOM 2432  H HG23 . THR A 1 2  ? -6.430  16.306  2.346   1.00 0.00 ? 5  THR A HG23 5  
ATOM 2433  N N    . LEU A 1 3  ? -7.902  18.877  2.610   1.00 0.00 ? 6  LEU A N    5  
ATOM 2434  C CA   . LEU A 1 3  ? -9.318  19.203  2.442   1.00 0.00 ? 6  LEU A CA   5  
ATOM 2435  C C    . LEU A 1 3  ? -9.998  18.234  1.471   1.00 0.00 ? 6  LEU A C    5  
ATOM 2436  O O    . LEU A 1 3  ? -9.451  17.917  0.412   1.00 0.00 ? 6  LEU A O    5  
ATOM 2437  C CB   . LEU A 1 3  ? -9.476  20.648  1.948   1.00 0.00 ? 6  LEU A CB   5  
ATOM 2438  C CG   . LEU A 1 3  ? -9.123  20.886  0.475   1.00 0.00 ? 6  LEU A CG   5  
ATOM 2439  C CD1  . LEU A 1 3  ? -10.384 21.005  -0.365  1.00 0.00 ? 6  LEU A CD1  5  
ATOM 2440  C CD2  . LEU A 1 3  ? -8.267  22.132  0.326   1.00 0.00 ? 6  LEU A CD2  5  
ATOM 2441  H H    . LEU A 1 3  ? -7.348  18.749  1.813   1.00 0.00 ? 6  LEU A H    5  
ATOM 2442  H HA   . LEU A 1 3  ? -9.793  19.112  3.407   1.00 0.00 ? 6  LEU A HA   5  
ATOM 2443  H HB2  . LEU A 1 3  ? -10.503 20.948  2.103   1.00 0.00 ? 6  LEU A HB2  5  
ATOM 2444  H HB3  . LEU A 1 3  ? -8.843  21.282  2.552   1.00 0.00 ? 6  LEU A HB3  5  
ATOM 2445  H HG   . LEU A 1 3  ? -8.556  20.043  0.106   1.00 0.00 ? 6  LEU A HG   5  
ATOM 2446  H HD11 . LEU A 1 3  ? -10.303 21.863  -1.016  1.00 0.00 ? 6  LEU A HD11 5  
ATOM 2447  H HD12 . LEU A 1 3  ? -11.241 21.123  0.282   1.00 0.00 ? 6  LEU A HD12 5  
ATOM 2448  H HD13 . LEU A 1 3  ? -10.504 20.112  -0.963  1.00 0.00 ? 6  LEU A HD13 5  
ATOM 2449  H HD21 . LEU A 1 3  ? -8.874  23.008  0.499   1.00 0.00 ? 6  LEU A HD21 5  
ATOM 2450  H HD22 . LEU A 1 3  ? -7.858  22.169  -0.673  1.00 0.00 ? 6  LEU A HD22 5  
ATOM 2451  H HD23 . LEU A 1 3  ? -7.461  22.104  1.044   1.00 0.00 ? 6  LEU A HD23 5  
ATOM 2452  N N    . SER A 1 4  ? -11.188 17.756  1.850   1.00 0.00 ? 7  SER A N    5  
ATOM 2453  C CA   . SER A 1 4  ? -11.961 16.812  1.026   1.00 0.00 ? 7  SER A CA   5  
ATOM 2454  C C    . SER A 1 4  ? -11.117 15.610  0.582   1.00 0.00 ? 7  SER A C    5  
ATOM 2455  O O    . SER A 1 4  ? -11.449 14.944  -0.397  1.00 0.00 ? 7  SER A O    5  
ATOM 2456  C CB   . SER A 1 4  ? -12.530 17.528  -0.203  1.00 0.00 ? 7  SER A CB   5  
ATOM 2457  O OG   . SER A 1 4  ? -13.928 17.732  -0.069  1.00 0.00 ? 7  SER A OG   5  
ATOM 2458  H H    . SER A 1 4  ? -11.558 18.040  2.710   1.00 0.00 ? 7  SER A H    5  
ATOM 2459  H HA   . SER A 1 4  ? -12.782 16.451  1.625   1.00 0.00 ? 7  SER A HA   5  
ATOM 2460  H HB2  . SER A 1 4  ? -12.045 18.488  -0.315  1.00 0.00 ? 7  SER A HB2  5  
ATOM 2461  H HB3  . SER A 1 4  ? -12.347 16.929  -1.085  1.00 0.00 ? 7  SER A HB3  5  
ATOM 2462  H HG   . SER A 1 4  ? -14.316 17.879  -0.936  1.00 0.00 ? 7  SER A HG   5  
ATOM 2463  N N    . LEU A 1 5  ? -10.027 15.340  1.309   1.00 0.00 ? 8  LEU A N    5  
ATOM 2464  C CA   . LEU A 1 5  ? -9.132  14.224  0.986   1.00 0.00 ? 8  LEU A CA   5  
ATOM 2465  C C    . LEU A 1 5  ? -8.804  14.184  -0.515  1.00 0.00 ? 8  LEU A C    5  
ATOM 2466  O O    . LEU A 1 5  ? -8.718  13.111  -1.118  1.00 0.00 ? 8  LEU A O    5  
ATOM 2467  C CB   . LEU A 1 5  ? -9.762  12.900  1.439   1.00 0.00 ? 8  LEU A CB   5  
ATOM 2468  C CG   . LEU A 1 5  ? -9.072  12.229  2.627   1.00 0.00 ? 8  LEU A CG   5  
ATOM 2469  C CD1  . LEU A 1 5  ? -10.076 11.444  3.454   1.00 0.00 ? 8  LEU A CD1  5  
ATOM 2470  C CD2  . LEU A 1 5  ? -7.954  11.318  2.147   1.00 0.00 ? 8  LEU A CD2  5  
ATOM 2471  H H    . LEU A 1 5  ? -9.819  15.906  2.080   1.00 0.00 ? 8  LEU A H    5  
ATOM 2472  H HA   . LEU A 1 5  ? -8.213  14.377  1.528   1.00 0.00 ? 8  LEU A HA   5  
ATOM 2473  H HB2  . LEU A 1 5  ? -10.792 13.089  1.707   1.00 0.00 ? 8  LEU A HB2  5  
ATOM 2474  H HB3  . LEU A 1 5  ? -9.746  12.212  0.607   1.00 0.00 ? 8  LEU A HB3  5  
ATOM 2475  H HG   . LEU A 1 5  ? -8.638  12.988  3.262   1.00 0.00 ? 8  LEU A HG   5  
ATOM 2476  H HD11 . LEU A 1 5  ? -9.608  11.115  4.370   1.00 0.00 ? 8  LEU A HD11 5  
ATOM 2477  H HD12 . LEU A 1 5  ? -10.410 10.586  2.893   1.00 0.00 ? 8  LEU A HD12 5  
ATOM 2478  H HD13 . LEU A 1 5  ? -10.921 12.074  3.689   1.00 0.00 ? 8  LEU A HD13 5  
ATOM 2479  H HD21 . LEU A 1 5  ? -7.174  11.282  2.892   1.00 0.00 ? 8  LEU A HD21 5  
ATOM 2480  H HD22 . LEU A 1 5  ? -7.550  11.701  1.221   1.00 0.00 ? 8  LEU A HD22 5  
ATOM 2481  H HD23 . LEU A 1 5  ? -8.345  10.324  1.985   1.00 0.00 ? 8  LEU A HD23 5  
ATOM 2482  N N    . ASP A 1 6  ? -8.618  15.364  -1.108  1.00 0.00 ? 9  ASP A N    5  
ATOM 2483  C CA   . ASP A 1 6  ? -8.308  15.489  -2.532  1.00 0.00 ? 9  ASP A CA   5  
ATOM 2484  C C    . ASP A 1 6  ? -6.886  15.001  -2.851  1.00 0.00 ? 9  ASP A C    5  
ATOM 2485  O O    . ASP A 1 6  ? -6.076  15.737  -3.421  1.00 0.00 ? 9  ASP A O    5  
ATOM 2486  C CB   . ASP A 1 6  ? -8.494  16.947  -2.966  1.00 0.00 ? 9  ASP A CB   5  
ATOM 2487  C CG   . ASP A 1 6  ? -9.937  17.280  -3.282  1.00 0.00 ? 9  ASP A CG   5  
ATOM 2488  O OD1  . ASP A 1 6  ? -10.442 16.807  -4.320  1.00 0.00 ? 9  ASP A OD1  5  
ATOM 2489  O OD2  . ASP A 1 6  ? -10.562 18.016  -2.490  1.00 0.00 ? 9  ASP A OD2  5  
ATOM 2490  H H    . ASP A 1 6  ? -8.696  16.176  -0.576  1.00 0.00 ? 9  ASP A H    5  
ATOM 2491  H HA   . ASP A 1 6  ? -9.010  14.873  -3.075  1.00 0.00 ? 9  ASP A HA   5  
ATOM 2492  H HB2  . ASP A 1 6  ? -8.163  17.598  -2.172  1.00 0.00 ? 9  ASP A HB2  5  
ATOM 2493  H HB3  . ASP A 1 6  ? -7.902  17.132  -3.846  1.00 0.00 ? 9  ASP A HB3  5  
ATOM 2494  N N    . VAL A 1 7  ? -6.607  13.750  -2.479  1.00 0.00 ? 10 VAL A N    5  
ATOM 2495  C CA   . VAL A 1 7  ? -5.302  13.109  -2.708  1.00 0.00 ? 10 VAL A CA   5  
ATOM 2496  C C    . VAL A 1 7  ? -4.129  14.100  -2.595  1.00 0.00 ? 10 VAL A C    5  
ATOM 2497  O O    . VAL A 1 7  ? -3.361  14.299  -3.542  1.00 0.00 ? 10 VAL A O    5  
ATOM 2498  C CB   . VAL A 1 7  ? -5.271  12.384  -4.079  1.00 0.00 ? 10 VAL A CB   5  
ATOM 2499  C CG1  . VAL A 1 7  ? -5.456  13.364  -5.231  1.00 0.00 ? 10 VAL A CG1  5  
ATOM 2500  C CG2  . VAL A 1 7  ? -3.982  11.595  -4.248  1.00 0.00 ? 10 VAL A CG2  5  
ATOM 2501  H H    . VAL A 1 7  ? -7.313  13.232  -2.032  1.00 0.00 ? 10 VAL A H    5  
ATOM 2502  H HA   . VAL A 1 7  ? -5.177  12.361  -1.939  1.00 0.00 ? 10 VAL A HA   5  
ATOM 2503  H HB   . VAL A 1 7  ? -6.095  11.685  -4.104  1.00 0.00 ? 10 VAL A HB   5  
ATOM 2504  H HG11 . VAL A 1 7  ? -6.487  13.684  -5.269  1.00 0.00 ? 10 VAL A HG11 5  
ATOM 2505  H HG12 . VAL A 1 7  ? -5.196  12.880  -6.161  1.00 0.00 ? 10 VAL A HG12 5  
ATOM 2506  H HG13 . VAL A 1 7  ? -4.819  14.222  -5.082  1.00 0.00 ? 10 VAL A HG13 5  
ATOM 2507  H HG21 . VAL A 1 7  ? -3.732  11.107  -3.318  1.00 0.00 ? 10 VAL A HG21 5  
ATOM 2508  H HG22 . VAL A 1 7  ? -3.184  12.267  -4.527  1.00 0.00 ? 10 VAL A HG22 5  
ATOM 2509  H HG23 . VAL A 1 7  ? -4.114  10.852  -5.020  1.00 0.00 ? 10 VAL A HG23 5  
ATOM 2510  N N    . PRO A 1 8  ? -3.967  14.729  -1.414  1.00 0.00 ? 11 PRO A N    5  
ATOM 2511  C CA   . PRO A 1 8  ? -2.886  15.693  -1.175  1.00 0.00 ? 11 PRO A CA   5  
ATOM 2512  C C    . PRO A 1 8  ? -1.510  15.030  -1.107  1.00 0.00 ? 11 PRO A C    5  
ATOM 2513  O O    . PRO A 1 8  ? -1.397  13.805  -0.989  1.00 0.00 ? 11 PRO A O    5  
ATOM 2514  C CB   . PRO A 1 8  ? -3.258  16.309  0.176   1.00 0.00 ? 11 PRO A CB   5  
ATOM 2515  C CG   . PRO A 1 8  ? -4.051  15.253  0.861   1.00 0.00 ? 11 PRO A CG   5  
ATOM 2516  C CD   . PRO A 1 8  ? -4.819  14.547  -0.223  1.00 0.00 ? 11 PRO A CD   5  
ATOM 2517  H HA   . PRO A 1 8  ? -2.872  16.463  -1.933  1.00 0.00 ? 11 PRO A HA   5  
ATOM 2518  H HB2  . PRO A 1 8  ? -2.360  16.553  0.726   1.00 0.00 ? 11 PRO A HB2  5  
ATOM 2519  H HB3  . PRO A 1 8  ? -3.844  17.203  0.019   1.00 0.00 ? 11 PRO A HB3  5  
ATOM 2520  H HG2  . PRO A 1 8  ? -3.389  14.563  1.362   1.00 0.00 ? 11 PRO A HG2  5  
ATOM 2521  H HG3  . PRO A 1 8  ? -4.730  15.703  1.569   1.00 0.00 ? 11 PRO A HG3  5  
ATOM 2522  H HD2  . PRO A 1 8  ? -4.932  13.499  0.015   1.00 0.00 ? 11 PRO A HD2  5  
ATOM 2523  H HD3  . PRO A 1 8  ? -5.785  15.008  -0.368  1.00 0.00 ? 11 PRO A HD3  5  
ATOM 2524  N N    . THR A 1 9  ? -0.464  15.849  -1.170  1.00 0.00 ? 12 THR A N    5  
ATOM 2525  C CA   . THR A 1 9  ? 0.915   15.360  -1.111  1.00 0.00 ? 12 THR A CA   5  
ATOM 2526  C C    . THR A 1 9  ? 1.144   14.471  0.112   1.00 0.00 ? 12 THR A C    5  
ATOM 2527  O O    . THR A 1 9  ? 1.827   13.454  0.021   1.00 0.00 ? 12 THR A O    5  
ATOM 2528  C CB   . THR A 1 9  ? 1.892   16.539  -1.086  1.00 0.00 ? 12 THR A CB   5  
ATOM 2529  O OG1  . THR A 1 9  ? 1.193   17.773  -1.030  1.00 0.00 ? 12 THR A OG1  5  
ATOM 2530  C CG2  . THR A 1 9  ? 2.805   16.584  -2.290  1.00 0.00 ? 12 THR A CG2  5  
ATOM 2531  H H    . THR A 1 9  ? -0.615  16.814  -1.254  1.00 0.00 ? 12 THR A H    5  
ATOM 2532  H HA   . THR A 1 9  ? 1.095   14.774  -2.001  1.00 0.00 ? 12 THR A HA   5  
ATOM 2533  H HB   . THR A 1 9  ? 2.508   16.461  -0.204  1.00 0.00 ? 12 THR A HB   5  
ATOM 2534  H HG1  . THR A 1 9  ? 1.805   18.498  -1.186  1.00 0.00 ? 12 THR A HG1  5  
ATOM 2535  H HG21 . THR A 1 9  ? 3.126   15.582  -2.536  1.00 0.00 ? 12 THR A HG21 5  
ATOM 2536  H HG22 . THR A 1 9  ? 3.667   17.192  -2.065  1.00 0.00 ? 12 THR A HG22 5  
ATOM 2537  H HG23 . THR A 1 9  ? 2.273   17.009  -3.129  1.00 0.00 ? 12 THR A HG23 5  
ATOM 2538  N N    . ASN A 1 10 ? 0.563   14.864  1.251   1.00 0.00 ? 13 ASN A N    5  
ATOM 2539  C CA   . ASN A 1 10 ? 0.699   14.101  2.499   1.00 0.00 ? 13 ASN A CA   5  
ATOM 2540  C C    . ASN A 1 10 ? -0.092  12.791  2.462   1.00 0.00 ? 13 ASN A C    5  
ATOM 2541  O O    . ASN A 1 10 ? 0.079   11.928  3.323   1.00 0.00 ? 13 ASN A O    5  
ATOM 2542  C CB   . ASN A 1 10 ? 0.256   14.944  3.703   1.00 0.00 ? 13 ASN A CB   5  
ATOM 2543  C CG   . ASN A 1 10 ? 0.754   16.375  3.634   1.00 0.00 ? 13 ASN A CG   5  
ATOM 2544  O OD1  . ASN A 1 10 ? 1.928   16.648  3.864   1.00 0.00 ? 13 ASN A OD1  5  
ATOM 2545  N ND2  . ASN A 1 10 ? -0.141  17.300  3.320   1.00 0.00 ? 13 ASN A ND2  5  
ATOM 2546  H H    . ASN A 1 10 ? 0.029   15.685  1.251   1.00 0.00 ? 13 ASN A H    5  
ATOM 2547  H HA   . ASN A 1 10 ? 1.735   13.854  2.609   1.00 0.00 ? 13 ASN A HA   5  
ATOM 2548  H HB2  . ASN A 1 10 ? -0.822  14.962  3.744   1.00 0.00 ? 13 ASN A HB2  5  
ATOM 2549  H HB3  . ASN A 1 10 ? 0.638   14.495  4.607   1.00 0.00 ? 13 ASN A HB3  5  
ATOM 2550  H HD21 . ASN A 1 10 ? -1.063  17.017  3.149   1.00 0.00 ? 13 ASN A HD21 5  
ATOM 2551  H HD22 . ASN A 1 10 ? 0.160   18.231  3.272   1.00 0.00 ? 13 ASN A HD22 5  
ATOM 2552  N N    . ILE A 1 11 ? -0.947  12.650  1.460   1.00 0.00 ? 14 ILE A N    5  
ATOM 2553  C CA   . ILE A 1 11 ? -1.754  11.454  1.293   1.00 0.00 ? 14 ILE A CA   5  
ATOM 2554  C C    . ILE A 1 11 ? -1.204  10.604  0.152   1.00 0.00 ? 14 ILE A C    5  
ATOM 2555  O O    . ILE A 1 11 ? -1.029  9.394   0.301   1.00 0.00 ? 14 ILE A O    5  
ATOM 2556  C CB   . ILE A 1 11 ? -3.228  11.831  1.026   1.00 0.00 ? 14 ILE A CB   5  
ATOM 2557  C CG1  . ILE A 1 11 ? -4.023  11.843  2.333   1.00 0.00 ? 14 ILE A CG1  5  
ATOM 2558  C CG2  . ILE A 1 11 ? -3.880  10.881  0.025   1.00 0.00 ? 14 ILE A CG2  5  
ATOM 2559  C CD1  . ILE A 1 11 ? -3.647  12.973  3.268   1.00 0.00 ? 14 ILE A CD1  5  
ATOM 2560  H H    . ILE A 1 11 ? -1.033  13.369  0.806   1.00 0.00 ? 14 ILE A H    5  
ATOM 2561  H HA   . ILE A 1 11 ? -1.702  10.886  2.209   1.00 0.00 ? 14 ILE A HA   5  
ATOM 2562  H HB   . ILE A 1 11 ? -3.237  12.823  0.603   1.00 0.00 ? 14 ILE A HB   5  
ATOM 2563  H HG12 . ILE A 1 11 ? -5.072  11.941  2.104   1.00 0.00 ? 14 ILE A HG12 5  
ATOM 2564  H HG13 . ILE A 1 11 ? -3.860  10.912  2.855   1.00 0.00 ? 14 ILE A HG13 5  
ATOM 2565  H HG21 . ILE A 1 11 ? -3.501  11.085  -0.965  1.00 0.00 ? 14 ILE A HG21 5  
ATOM 2566  H HG22 . ILE A 1 11 ? -4.950  11.024  0.038   1.00 0.00 ? 14 ILE A HG22 5  
ATOM 2567  H HG23 . ILE A 1 11 ? -3.650  9.860   0.295   1.00 0.00 ? 14 ILE A HG23 5  
ATOM 2568  H HD11 . ILE A 1 11 ? -2.674  13.355  3.000   1.00 0.00 ? 14 ILE A HD11 5  
ATOM 2569  H HD12 . ILE A 1 11 ? -3.622  12.605  4.283   1.00 0.00 ? 14 ILE A HD12 5  
ATOM 2570  H HD13 . ILE A 1 11 ? -4.379  13.763  3.189   1.00 0.00 ? 14 ILE A HD13 5  
ATOM 2571  N N    . MET A 1 12 ? -0.919  11.248  -0.981  1.00 0.00 ? 15 MET A N    5  
ATOM 2572  C CA   . MET A 1 12 ? -0.373  10.560  -2.141  1.00 0.00 ? 15 MET A CA   5  
ATOM 2573  C C    . MET A 1 12 ? 0.859   9.745   -1.753  1.00 0.00 ? 15 MET A C    5  
ATOM 2574  O O    . MET A 1 12 ? 0.943   8.554   -2.058  1.00 0.00 ? 15 MET A O    5  
ATOM 2575  C CB   . MET A 1 12 ? -0.017  11.584  -3.223  1.00 0.00 ? 15 MET A CB   5  
ATOM 2576  C CG   . MET A 1 12 ? -0.662  11.300  -4.566  1.00 0.00 ? 15 MET A CG   5  
ATOM 2577  S SD   . MET A 1 12 ? 0.541   10.886  -5.844  1.00 0.00 ? 15 MET A SD   5  
ATOM 2578  C CE   . MET A 1 12 ? 0.007   11.962  -7.173  1.00 0.00 ? 15 MET A CE   5  
ATOM 2579  H H    . MET A 1 12 ? -1.071  12.219  -1.034  1.00 0.00 ? 15 MET A H    5  
ATOM 2580  H HA   . MET A 1 12 ? -1.129  9.889   -2.521  1.00 0.00 ? 15 MET A HA   5  
ATOM 2581  H HB2  . MET A 1 12 ? -0.340  12.561  -2.895  1.00 0.00 ? 15 MET A HB2  5  
ATOM 2582  H HB3  . MET A 1 12 ? 1.051   11.596  -3.352  1.00 0.00 ? 15 MET A HB3  5  
ATOM 2583  H HG2  . MET A 1 12 ? -1.345  10.473  -4.454  1.00 0.00 ? 15 MET A HG2  5  
ATOM 2584  H HG3  . MET A 1 12 ? -1.209  12.177  -4.877  1.00 0.00 ? 15 MET A HG3  5  
ATOM 2585  H HE1  . MET A 1 12 ? 0.869   12.314  -7.719  1.00 0.00 ? 15 MET A HE1  5  
ATOM 2586  H HE2  . MET A 1 12 ? -0.527  12.806  -6.761  1.00 0.00 ? 15 MET A HE2  5  
ATOM 2587  H HE3  . MET A 1 12 ? -0.644  11.415  -7.839  1.00 0.00 ? 15 MET A HE3  5  
ATOM 2588  N N    . ASN A 1 13 ? 1.805   10.387  -1.060  1.00 0.00 ? 16 ASN A N    5  
ATOM 2589  C CA   . ASN A 1 13 ? 3.021   9.710   -0.617  1.00 0.00 ? 16 ASN A CA   5  
ATOM 2590  C C    . ASN A 1 13 ? 2.691   8.555   0.330   1.00 0.00 ? 16 ASN A C    5  
ATOM 2591  O O    . ASN A 1 13 ? 3.184   7.440   0.156   1.00 0.00 ? 16 ASN A O    5  
ATOM 2592  C CB   . ASN A 1 13 ? 3.994   10.702  0.047   1.00 0.00 ? 16 ASN A CB   5  
ATOM 2593  C CG   . ASN A 1 13 ? 3.428   11.376  1.287   1.00 0.00 ? 16 ASN A CG   5  
ATOM 2594  O OD1  . ASN A 1 13 ? 2.236   11.293  1.570   1.00 0.00 ? 16 ASN A OD1  5  
ATOM 2595  N ND2  . ASN A 1 13 ? 4.286   12.050  2.036   1.00 0.00 ? 16 ASN A ND2  5  
ATOM 2596  H H    . ASN A 1 13 ? 1.675   11.332  -0.831  1.00 0.00 ? 16 ASN A H    5  
ATOM 2597  H HA   . ASN A 1 13 ? 3.492   9.298   -1.491  1.00 0.00 ? 16 ASN A HA   5  
ATOM 2598  H HB2  . ASN A 1 13 ? 4.891   10.175  0.332   1.00 0.00 ? 16 ASN A HB2  5  
ATOM 2599  H HB3  . ASN A 1 13 ? 4.250   11.470  -0.669  1.00 0.00 ? 16 ASN A HB3  5  
ATOM 2600  H HD21 . ASN A 1 13 ? 5.224   12.078  1.756   1.00 0.00 ? 16 ASN A HD21 5  
ATOM 2601  H HD22 . ASN A 1 13 ? 3.946   12.493  2.839   1.00 0.00 ? 16 ASN A HD22 5  
ATOM 2602  N N    . LEU A 1 14 ? 1.841   8.827   1.318   1.00 0.00 ? 17 LEU A N    5  
ATOM 2603  C CA   . LEU A 1 14 ? 1.432   7.809   2.280   1.00 0.00 ? 17 LEU A CA   5  
ATOM 2604  C C    . LEU A 1 14 ? 0.685   6.681   1.570   1.00 0.00 ? 17 LEU A C    5  
ATOM 2605  O O    . LEU A 1 14 ? 0.960   5.504   1.805   1.00 0.00 ? 17 LEU A O    5  
ATOM 2606  C CB   . LEU A 1 14 ? 0.586   8.437   3.404   1.00 0.00 ? 17 LEU A CB   5  
ATOM 2607  C CG   . LEU A 1 14 ? -0.902  8.075   3.408   1.00 0.00 ? 17 LEU A CG   5  
ATOM 2608  C CD1  . LEU A 1 14 ? -1.135  6.778   4.169   1.00 0.00 ? 17 LEU A CD1  5  
ATOM 2609  C CD2  . LEU A 1 14 ? -1.725  9.201   4.012   1.00 0.00 ? 17 LEU A CD2  5  
ATOM 2610  H H    . LEU A 1 14 ? 1.474   9.736   1.392   1.00 0.00 ? 17 LEU A H    5  
ATOM 2611  H HA   . LEU A 1 14 ? 2.327   7.394   2.712   1.00 0.00 ? 17 LEU A HA   5  
ATOM 2612  H HB2  . LEU A 1 14 ? 1.007   8.134   4.350   1.00 0.00 ? 17 LEU A HB2  5  
ATOM 2613  H HB3  . LEU A 1 14 ? 0.668   9.511   3.325   1.00 0.00 ? 17 LEU A HB3  5  
ATOM 2614  H HG   . LEU A 1 14 ? -1.228  7.928   2.393   1.00 0.00 ? 17 LEU A HG   5  
ATOM 2615  H HD11 . LEU A 1 14 ? -1.856  6.948   4.956   1.00 0.00 ? 17 LEU A HD11 5  
ATOM 2616  H HD12 . LEU A 1 14 ? -0.205  6.438   4.598   1.00 0.00 ? 17 LEU A HD12 5  
ATOM 2617  H HD13 . LEU A 1 14 ? -1.514  6.027   3.490   1.00 0.00 ? 17 LEU A HD13 5  
ATOM 2618  H HD21 . LEU A 1 14 ? -2.560  9.421   3.366   1.00 0.00 ? 17 LEU A HD21 5  
ATOM 2619  H HD22 . LEU A 1 14 ? -1.109  10.082  4.117   1.00 0.00 ? 17 LEU A HD22 5  
ATOM 2620  H HD23 . LEU A 1 14 ? -2.089  8.900   4.983   1.00 0.00 ? 17 LEU A HD23 5  
ATOM 2621  N N    . LEU A 1 15 ? -0.237  7.046   0.679   1.00 0.00 ? 18 LEU A N    5  
ATOM 2622  C CA   . LEU A 1 15 ? -0.993  6.057   -0.082  1.00 0.00 ? 18 LEU A CA   5  
ATOM 2623  C C    . LEU A 1 15 ? -0.048  5.225   -0.945  1.00 0.00 ? 18 LEU A C    5  
ATOM 2624  O O    . LEU A 1 15 ? -0.093  3.992   -0.920  1.00 0.00 ? 18 LEU A O    5  
ATOM 2625  C CB   . LEU A 1 15 ? -2.051  6.749   -0.951  1.00 0.00 ? 18 LEU A CB   5  
ATOM 2626  C CG   . LEU A 1 15 ? -2.632  5.891   -2.074  1.00 0.00 ? 18 LEU A CG   5  
ATOM 2627  C CD1  . LEU A 1 15 ? -3.416  4.722   -1.504  1.00 0.00 ? 18 LEU A CD1  5  
ATOM 2628  C CD2  . LEU A 1 15 ? -3.515  6.729   -2.983  1.00 0.00 ? 18 LEU A CD2  5  
ATOM 2629  H H    . LEU A 1 15 ? -0.400  8.007   0.516   1.00 0.00 ? 18 LEU A H    5  
ATOM 2630  H HA   . LEU A 1 15 ? -1.484  5.401   0.618   1.00 0.00 ? 18 LEU A HA   5  
ATOM 2631  H HB2  . LEU A 1 15 ? -2.862  7.064   -0.309  1.00 0.00 ? 18 LEU A HB2  5  
ATOM 2632  H HB3  . LEU A 1 15 ? -1.604  7.627   -1.393  1.00 0.00 ? 18 LEU A HB3  5  
ATOM 2633  H HG   . LEU A 1 15 ? -1.821  5.495   -2.666  1.00 0.00 ? 18 LEU A HG   5  
ATOM 2634  H HD11 . LEU A 1 15 ? -3.873  4.169   -2.310  1.00 0.00 ? 18 LEU A HD11 5  
ATOM 2635  H HD12 . LEU A 1 15 ? -4.184  5.092   -0.840  1.00 0.00 ? 18 LEU A HD12 5  
ATOM 2636  H HD13 . LEU A 1 15 ? -2.748  4.073   -0.956  1.00 0.00 ? 18 LEU A HD13 5  
ATOM 2637  H HD21 . LEU A 1 15 ? -4.405  7.023   -2.447  1.00 0.00 ? 18 LEU A HD21 5  
ATOM 2638  H HD22 . LEU A 1 15 ? -3.792  6.149   -3.849  1.00 0.00 ? 18 LEU A HD22 5  
ATOM 2639  H HD23 . LEU A 1 15 ? -2.974  7.610   -3.297  1.00 0.00 ? 18 LEU A HD23 5  
ATOM 2640  N N    . PHE A 1 16 ? 0.822   5.912   -1.689  1.00 0.00 ? 19 PHE A N    5  
ATOM 2641  C CA   . PHE A 1 16 ? 1.798   5.243   -2.546  1.00 0.00 ? 19 PHE A CA   5  
ATOM 2642  C C    . PHE A 1 16 ? 2.702   4.321   -1.729  1.00 0.00 ? 19 PHE A C    5  
ATOM 2643  O O    . PHE A 1 16 ? 3.024   3.216   -2.165  1.00 0.00 ? 19 PHE A O    5  
ATOM 2644  C CB   . PHE A 1 16 ? 2.645   6.276   -3.299  1.00 0.00 ? 19 PHE A CB   5  
ATOM 2645  C CG   . PHE A 1 16 ? 2.734   6.013   -4.774  1.00 0.00 ? 19 PHE A CG   5  
ATOM 2646  C CD1  . PHE A 1 16 ? 3.566   5.021   -5.266  1.00 0.00 ? 19 PHE A CD1  5  
ATOM 2647  C CD2  . PHE A 1 16 ? 1.985   6.759   -5.668  1.00 0.00 ? 19 PHE A CD2  5  
ATOM 2648  C CE1  . PHE A 1 16 ? 3.647   4.776   -6.624  1.00 0.00 ? 19 PHE A CE1  5  
ATOM 2649  C CE2  . PHE A 1 16 ? 2.062   6.520   -7.027  1.00 0.00 ? 19 PHE A CE2  5  
ATOM 2650  C CZ   . PHE A 1 16 ? 2.895   5.527   -7.505  1.00 0.00 ? 19 PHE A CZ   5  
ATOM 2651  H H    . PHE A 1 16 ? 0.814   6.896   -1.650  1.00 0.00 ? 19 PHE A H    5  
ATOM 2652  H HA   . PHE A 1 16 ? 1.254   4.646   -3.263  1.00 0.00 ? 19 PHE A HA   5  
ATOM 2653  H HB2  . PHE A 1 16 ? 2.212   7.255   -3.165  1.00 0.00 ? 19 PHE A HB2  5  
ATOM 2654  H HB3  . PHE A 1 16 ? 3.648   6.275   -2.898  1.00 0.00 ? 19 PHE A HB3  5  
ATOM 2655  H HD1  . PHE A 1 16 ? 4.154   4.433   -4.577  1.00 0.00 ? 19 PHE A HD1  5  
ATOM 2656  H HD2  . PHE A 1 16 ? 1.333   7.535   -5.295  1.00 0.00 ? 19 PHE A HD2  5  
ATOM 2657  H HE1  . PHE A 1 16 ? 4.301   3.999   -6.995  1.00 0.00 ? 19 PHE A HE1  5  
ATOM 2658  H HE2  . PHE A 1 16 ? 1.472   7.108   -7.714  1.00 0.00 ? 19 PHE A HE2  5  
ATOM 2659  H HZ   . PHE A 1 16 ? 2.957   5.337   -8.566  1.00 0.00 ? 19 PHE A HZ   5  
ATOM 2660  N N    . ASN A 1 17 ? 3.103   4.775   -0.537  1.00 0.00 ? 20 ASN A N    5  
ATOM 2661  C CA   . ASN A 1 17 ? 3.959   3.985   0.334   1.00 0.00 ? 20 ASN A CA   5  
ATOM 2662  C C    . ASN A 1 17 ? 3.181   2.827   0.954   1.00 0.00 ? 20 ASN A C    5  
ATOM 2663  O O    . ASN A 1 17 ? 3.657   1.689   0.962   1.00 0.00 ? 20 ASN A O    5  
ATOM 2664  C CB   . ASN A 1 17 ? 4.551   4.871   1.427   1.00 0.00 ? 20 ASN A CB   5  
ATOM 2665  C CG   . ASN A 1 17 ? 6.021   4.602   1.653   1.00 0.00 ? 20 ASN A CG   5  
ATOM 2666  O OD1  . ASN A 1 17 ? 6.816   5.527   1.788   1.00 0.00 ? 20 ASN A OD1  5  
ATOM 2667  N ND2  . ASN A 1 17 ? 6.396   3.334   1.696   1.00 0.00 ? 20 ASN A ND2  5  
ATOM 2668  H H    . ASN A 1 17 ? 2.811   5.662   -0.230  1.00 0.00 ? 20 ASN A H    5  
ATOM 2669  H HA   . ASN A 1 17 ? 4.761   3.579   -0.266  1.00 0.00 ? 20 ASN A HA   5  
ATOM 2670  H HB2  . ASN A 1 17 ? 4.436   5.907   1.145   1.00 0.00 ? 20 ASN A HB2  5  
ATOM 2671  H HB3  . ASN A 1 17 ? 4.024   4.693   2.346   1.00 0.00 ? 20 ASN A HB3  5  
ATOM 2672  H HD21 . ASN A 1 17 ? 5.713   2.640   1.583   1.00 0.00 ? 20 ASN A HD21 5  
ATOM 2673  H HD22 . ASN A 1 17 ? 7.341   3.144   1.830   1.00 0.00 ? 20 ASN A HD22 5  
ATOM 2674  N N    . ILE A 1 18 ? 1.978   3.117   1.458   1.00 0.00 ? 21 ILE A N    5  
ATOM 2675  C CA   . ILE A 1 18 ? 1.137   2.082   2.056   1.00 0.00 ? 21 ILE A CA   5  
ATOM 2676  C C    . ILE A 1 18 ? 0.895   0.969   1.046   1.00 0.00 ? 21 ILE A C    5  
ATOM 2677  O O    . ILE A 1 18 ? 1.247   -0.185  1.295   1.00 0.00 ? 21 ILE A O    5  
ATOM 2678  C CB   . ILE A 1 18 ? -0.214  2.655   2.554   1.00 0.00 ? 21 ILE A CB   5  
ATOM 2679  C CG1  . ILE A 1 18 ? -0.021  3.394   3.881   1.00 0.00 ? 21 ILE A CG1  5  
ATOM 2680  C CG2  . ILE A 1 18 ? -1.254  1.551   2.712   1.00 0.00 ? 21 ILE A CG2  5  
ATOM 2681  C CD1  . ILE A 1 18 ? 0.610   2.545   4.967   1.00 0.00 ? 21 ILE A CD1  5  
ATOM 2682  H H    . ILE A 1 18 ? 1.646   4.046   1.414   1.00 0.00 ? 21 ILE A H    5  
ATOM 2683  H HA   . ILE A 1 18 ? 1.665   1.666   2.901   1.00 0.00 ? 21 ILE A HA   5  
ATOM 2684  H HB   . ILE A 1 18 ? -0.577  3.354   1.814   1.00 0.00 ? 21 ILE A HB   5  
ATOM 2685  H HG12 . ILE A 1 18 ? 0.615   4.250   3.720   1.00 0.00 ? 21 ILE A HG12 5  
ATOM 2686  H HG13 . ILE A 1 18 ? -0.983  3.729   4.240   1.00 0.00 ? 21 ILE A HG13 5  
ATOM 2687  H HG21 . ILE A 1 18 ? -0.840  0.749   3.305   1.00 0.00 ? 21 ILE A HG21 5  
ATOM 2688  H HG22 . ILE A 1 18 ? -1.532  1.174   1.739   1.00 0.00 ? 21 ILE A HG22 5  
ATOM 2689  H HG23 . ILE A 1 18 ? -2.127  1.950   3.207   1.00 0.00 ? 21 ILE A HG23 5  
ATOM 2690  H HD11 . ILE A 1 18 ? 0.564   1.505   4.683   1.00 0.00 ? 21 ILE A HD11 5  
ATOM 2691  H HD12 . ILE A 1 18 ? 0.074   2.691   5.893   1.00 0.00 ? 21 ILE A HD12 5  
ATOM 2692  H HD13 . ILE A 1 18 ? 1.641   2.838   5.098   1.00 0.00 ? 21 ILE A HD13 5  
ATOM 2693  N N    . ALA A 1 19 ? 0.335   1.323   -0.113  1.00 0.00 ? 22 ALA A N    5  
ATOM 2694  C CA   . ALA A 1 19 ? 0.096   0.342   -1.168  1.00 0.00 ? 22 ALA A CA   5  
ATOM 2695  C C    . ALA A 1 19 ? 1.394   -0.396  -1.499  1.00 0.00 ? 22 ALA A C    5  
ATOM 2696  O O    . ALA A 1 19 ? 1.389   -1.600  -1.768  1.00 0.00 ? 22 ALA A O    5  
ATOM 2697  C CB   . ALA A 1 19 ? -0.474  1.020   -2.407  1.00 0.00 ? 22 ALA A CB   5  
ATOM 2698  H H    . ALA A 1 19 ? 0.105   2.269   -0.271  1.00 0.00 ? 22 ALA A H    5  
ATOM 2699  H HA   . ALA A 1 19 ? -0.629  -0.373  -0.802  1.00 0.00 ? 22 ALA A HA   5  
ATOM 2700  H HB1  . ALA A 1 19 ? -1.080  1.863   -2.109  1.00 0.00 ? 22 ALA A HB1  5  
ATOM 2701  H HB2  . ALA A 1 19 ? -1.082  0.316   -2.956  1.00 0.00 ? 22 ALA A HB2  5  
ATOM 2702  H HB3  . ALA A 1 19 ? 0.334   1.363   -3.036  1.00 0.00 ? 22 ALA A HB3  5  
ATOM 2703  N N    . LYS A 1 20 ? 2.508   0.337   -1.451  1.00 0.00 ? 23 LYS A N    5  
ATOM 2704  C CA   . LYS A 1 20 ? 3.825   -0.229  -1.719  1.00 0.00 ? 23 LYS A CA   5  
ATOM 2705  C C    . LYS A 1 20 ? 4.122   -1.394  -0.773  1.00 0.00 ? 23 LYS A C    5  
ATOM 2706  O O    . LYS A 1 20 ? 4.288   -2.532  -1.211  1.00 0.00 ? 23 LYS A O    5  
ATOM 2707  C CB   . LYS A 1 20 ? 4.903   0.856   -1.569  1.00 0.00 ? 23 LYS A CB   5  
ATOM 2708  C CG   . LYS A 1 20 ? 5.878   0.924   -2.730  1.00 0.00 ? 23 LYS A CG   5  
ATOM 2709  C CD   . LYS A 1 20 ? 6.646   -0.382  -2.897  1.00 0.00 ? 23 LYS A CD   5  
ATOM 2710  C CE   . LYS A 1 20 ? 6.807   -0.757  -4.361  1.00 0.00 ? 23 LYS A CE   5  
ATOM 2711  N NZ   . LYS A 1 20 ? 8.218   -1.109  -4.687  1.00 0.00 ? 23 LYS A NZ   5  
ATOM 2712  H H    . LYS A 1 20 ? 2.441   1.285   -1.215  1.00 0.00 ? 23 LYS A H    5  
ATOM 2713  H HA   . LYS A 1 20 ? 3.830   -0.597  -2.732  1.00 0.00 ? 23 LYS A HA   5  
ATOM 2714  H HB2  . LYS A 1 20 ? 4.418   1.815   -1.485  1.00 0.00 ? 23 LYS A HB2  5  
ATOM 2715  H HB3  . LYS A 1 20 ? 5.465   0.671   -0.666  1.00 0.00 ? 23 LYS A HB3  5  
ATOM 2716  H HG2  . LYS A 1 20 ? 5.326   1.129   -3.635  1.00 0.00 ? 23 LYS A HG2  5  
ATOM 2717  H HG3  . LYS A 1 20 ? 6.581   1.724   -2.549  1.00 0.00 ? 23 LYS A HG3  5  
ATOM 2718  H HD2  . LYS A 1 20 ? 7.624   -0.270  -2.455  1.00 0.00 ? 23 LYS A HD2  5  
ATOM 2719  H HD3  . LYS A 1 20 ? 6.109   -1.171  -2.390  1.00 0.00 ? 23 LYS A HD3  5  
ATOM 2720  H HE2  . LYS A 1 20 ? 6.171   -1.606  -4.573  1.00 0.00 ? 23 LYS A HE2  5  
ATOM 2721  H HE3  . LYS A 1 20 ? 6.499   0.083   -4.971  1.00 0.00 ? 23 LYS A HE3  5  
ATOM 2722  H HZ1  . LYS A 1 20 ? 8.845   -0.305  -4.478  1.00 0.00 ? 23 LYS A HZ1  5  
ATOM 2723  H HZ2  . LYS A 1 20 ? 8.302   -1.346  -5.697  1.00 0.00 ? 23 LYS A HZ2  5  
ATOM 2724  H HZ3  . LYS A 1 20 ? 8.524   -1.928  -4.124  1.00 0.00 ? 23 LYS A HZ3  5  
ATOM 2725  N N    . ALA A 1 21 ? 4.189   -1.105  0.524   1.00 0.00 ? 24 ALA A N    5  
ATOM 2726  C CA   . ALA A 1 21 ? 4.474   -2.135  1.521   1.00 0.00 ? 24 ALA A CA   5  
ATOM 2727  C C    . ALA A 1 21 ? 3.318   -3.128  1.668   1.00 0.00 ? 24 ALA A C    5  
ATOM 2728  O O    . ALA A 1 21 ? 3.548   -4.325  1.866   1.00 0.00 ? 24 ALA A O    5  
ATOM 2729  C CB   . ALA A 1 21 ? 4.803   -1.496  2.863   1.00 0.00 ? 24 ALA A CB   5  
ATOM 2730  H H    . ALA A 1 21 ? 4.047   -0.176  0.816   1.00 0.00 ? 24 ALA A H    5  
ATOM 2731  H HA   . ALA A 1 21 ? 5.347   -2.678  1.186   1.00 0.00 ? 24 ALA A HA   5  
ATOM 2732  H HB1  . ALA A 1 21 ? 5.453   -0.647  2.708   1.00 0.00 ? 24 ALA A HB1  5  
ATOM 2733  H HB2  . ALA A 1 21 ? 5.300   -2.218  3.495   1.00 0.00 ? 24 ALA A HB2  5  
ATOM 2734  H HB3  . ALA A 1 21 ? 3.891   -1.167  3.340   1.00 0.00 ? 24 ALA A HB3  5  
ATOM 2735  N N    . LYS A 1 22 ? 2.078   -2.639  1.570   1.00 0.00 ? 25 LYS A N    5  
ATOM 2736  C CA   . LYS A 1 22 ? 0.911   -3.507  1.696   1.00 0.00 ? 25 LYS A CA   5  
ATOM 2737  C C    . LYS A 1 22 ? 0.887   -4.550  0.583   1.00 0.00 ? 25 LYS A C    5  
ATOM 2738  O O    . LYS A 1 22 ? 0.580   -5.718  0.829   1.00 0.00 ? 25 LYS A O    5  
ATOM 2739  C CB   . LYS A 1 22 ? -0.381  -2.685  1.678   1.00 0.00 ? 25 LYS A CB   5  
ATOM 2740  C CG   . LYS A 1 22 ? -1.272  -2.927  2.886   1.00 0.00 ? 25 LYS A CG   5  
ATOM 2741  C CD   . LYS A 1 22 ? -2.562  -3.640  2.500   1.00 0.00 ? 25 LYS A CD   5  
ATOM 2742  C CE   . LYS A 1 22 ? -2.518  -5.118  2.860   1.00 0.00 ? 25 LYS A CE   5  
ATOM 2743  N NZ   . LYS A 1 22 ? -3.229  -5.395  4.143   1.00 0.00 ? 25 LYS A NZ   5  
ATOM 2744  H H    . LYS A 1 22 ? 1.945   -1.676  1.404   1.00 0.00 ? 25 LYS A H    5  
ATOM 2745  H HA   . LYS A 1 22 ? 0.986   -4.020  2.643   1.00 0.00 ? 25 LYS A HA   5  
ATOM 2746  H HB2  . LYS A 1 22 ? -0.127  -1.636  1.653   1.00 0.00 ? 25 LYS A HB2  5  
ATOM 2747  H HB3  . LYS A 1 22 ? -0.941  -2.931  0.788   1.00 0.00 ? 25 LYS A HB3  5  
ATOM 2748  H HG2  . LYS A 1 22 ? -0.736  -3.533  3.602   1.00 0.00 ? 25 LYS A HG2  5  
ATOM 2749  H HG3  . LYS A 1 22 ? -1.516  -1.974  3.332   1.00 0.00 ? 25 LYS A HG3  5  
ATOM 2750  H HD2  . LYS A 1 22 ? -3.387  -3.177  3.020   1.00 0.00 ? 25 LYS A HD2  5  
ATOM 2751  H HD3  . LYS A 1 22 ? -2.708  -3.543  1.433   1.00 0.00 ? 25 LYS A HD3  5  
ATOM 2752  H HE2  . LYS A 1 22 ? -2.987  -5.682  2.065   1.00 0.00 ? 25 LYS A HE2  5  
ATOM 2753  H HE3  . LYS A 1 22 ? -1.485  -5.423  2.954   1.00 0.00 ? 25 LYS A HE3  5  
ATOM 2754  H HZ1  . LYS A 1 22 ? -2.945  -6.323  4.519   1.00 0.00 ? 25 LYS A HZ1  5  
ATOM 2755  H HZ2  . LYS A 1 22 ? -4.260  -5.396  3.989   1.00 0.00 ? 25 LYS A HZ2  5  
ATOM 2756  H HZ3  . LYS A 1 22 ? -3.000  -4.664  4.847   1.00 0.00 ? 25 LYS A HZ3  5  
ATOM 2757  N N    . ASN A 1 23 ? 1.214   -4.130  -0.639  1.00 0.00 ? 26 ASN A N    5  
ATOM 2758  C CA   . ASN A 1 23 ? 1.223   -5.050  -1.774  1.00 0.00 ? 26 ASN A CA   5  
ATOM 2759  C C    . ASN A 1 23 ? 2.455   -5.959  -1.749  1.00 0.00 ? 26 ASN A C    5  
ATOM 2760  O O    . ASN A 1 23 ? 2.335   -7.167  -1.948  1.00 0.00 ? 26 ASN A O    5  
ATOM 2761  C CB   . ASN A 1 23 ? 1.119   -4.282  -3.105  1.00 0.00 ? 26 ASN A CB   5  
ATOM 2762  C CG   . ASN A 1 23 ? 2.458   -4.041  -3.780  1.00 0.00 ? 26 ASN A CG   5  
ATOM 2763  O OD1  . ASN A 1 23 ? 3.010   -4.925  -4.427  1.00 0.00 ? 26 ASN A OD1  5  
ATOM 2764  N ND2  . ASN A 1 23 ? 2.986   -2.839  -3.635  1.00 0.00 ? 26 ASN A ND2  5  
ATOM 2765  H H    . ASN A 1 23 ? 1.458   -3.182  -0.776  1.00 0.00 ? 26 ASN A H    5  
ATOM 2766  H HA   . ASN A 1 23 ? 0.349   -5.679  -1.676  1.00 0.00 ? 26 ASN A HA   5  
ATOM 2767  H HB2  . ASN A 1 23 ? 0.502   -4.848  -3.786  1.00 0.00 ? 26 ASN A HB2  5  
ATOM 2768  H HB3  . ASN A 1 23 ? 0.654   -3.325  -2.922  1.00 0.00 ? 26 ASN A HB3  5  
ATOM 2769  H HD21 . ASN A 1 23 ? 2.491   -2.176  -3.104  1.00 0.00 ? 26 ASN A HD21 5  
ATOM 2770  H HD22 . ASN A 1 23 ? 3.847   -2.661  -4.062  1.00 0.00 ? 26 ASN A HD22 5  
ATOM 2771  N N    . LEU A 1 24 ? 3.635   -5.382  -1.502  1.00 0.00 ? 27 LEU A N    5  
ATOM 2772  C CA   . LEU A 1 24 ? 4.877   -6.165  -1.464  1.00 0.00 ? 27 LEU A CA   5  
ATOM 2773  C C    . LEU A 1 24 ? 4.794   -7.321  -0.472  1.00 0.00 ? 27 LEU A C    5  
ATOM 2774  O O    . LEU A 1 24 ? 5.291   -8.414  -0.735  1.00 0.00 ? 27 LEU A O    5  
ATOM 2775  C CB   . LEU A 1 24 ? 6.075   -5.270  -1.127  1.00 0.00 ? 27 LEU A CB   5  
ATOM 2776  C CG   . LEU A 1 24 ? 6.493   -4.290  -2.225  1.00 0.00 ? 27 LEU A CG   5  
ATOM 2777  C CD1  . LEU A 1 24 ? 7.846   -3.675  -1.903  1.00 0.00 ? 27 LEU A CD1  5  
ATOM 2778  C CD2  . LEU A 1 24 ? 6.536   -4.977  -3.581  1.00 0.00 ? 27 LEU A CD2  5  
ATOM 2779  H H    . LEU A 1 24 ? 3.676   -4.411  -1.347  1.00 0.00 ? 27 LEU A H    5  
ATOM 2780  H HA   . LEU A 1 24 ? 5.017   -6.579  -2.435  1.00 0.00 ? 27 LEU A HA   5  
ATOM 2781  H HB2  . LEU A 1 24 ? 5.834   -4.702  -0.241  1.00 0.00 ? 27 LEU A HB2  5  
ATOM 2782  H HB3  . LEU A 1 24 ? 6.920   -5.907  -0.905  1.00 0.00 ? 27 LEU A HB3  5  
ATOM 2783  H HG   . LEU A 1 24 ? 5.769   -3.494  -2.276  1.00 0.00 ? 27 LEU A HG   5  
ATOM 2784  H HD11 . LEU A 1 24 ? 8.090   -3.865  -0.867  1.00 0.00 ? 27 LEU A HD11 5  
ATOM 2785  H HD12 . LEU A 1 24 ? 7.807   -2.611  -2.072  1.00 0.00 ? 27 LEU A HD12 5  
ATOM 2786  H HD13 . LEU A 1 24 ? 8.601   -4.115  -2.537  1.00 0.00 ? 27 LEU A HD13 5  
ATOM 2787  H HD21 . LEU A 1 24 ? 6.946   -4.302  -4.316  1.00 0.00 ? 27 LEU A HD21 5  
ATOM 2788  H HD22 . LEU A 1 24 ? 5.536   -5.262  -3.872  1.00 0.00 ? 27 LEU A HD22 5  
ATOM 2789  H HD23 . LEU A 1 24 ? 7.157   -5.860  -3.519  1.00 0.00 ? 27 LEU A HD23 5  
ATOM 2790  N N    . ARG A 1 25 ? 4.173   -7.063  0.663   1.00 0.00 ? 28 ARG A N    5  
ATOM 2791  C CA   . ARG A 1 25 ? 4.021   -8.065  1.713   1.00 0.00 ? 28 ARG A CA   5  
ATOM 2792  C C    . ARG A 1 25 ? 2.854   -9.009  1.439   1.00 0.00 ? 28 ARG A C    5  
ATOM 2793  O O    . ARG A 1 25 ? 3.000   -10.220 1.573   1.00 0.00 ? 28 ARG A O    5  
ATOM 2794  C CB   . ARG A 1 25 ? 3.836   -7.369  3.060   1.00 0.00 ? 28 ARG A CB   5  
ATOM 2795  C CG   . ARG A 1 25 ? 5.092   -6.672  3.567   1.00 0.00 ? 28 ARG A CG   5  
ATOM 2796  C CD   . ARG A 1 25 ? 5.142   -6.627  5.089   1.00 0.00 ? 28 ARG A CD   5  
ATOM 2797  N NE   . ARG A 1 25 ? 3.927   -6.036  5.663   1.00 0.00 ? 28 ARG A NE   5  
ATOM 2798  C CZ   . ARG A 1 25 ? 3.899   -5.276  6.755   1.00 0.00 ? 28 ARG A CZ   5  
ATOM 2799  N NH1  . ARG A 1 25 ? 5.006   -5.006  7.419   1.00 0.00 ? 28 ARG A NH1  5  
ATOM 2800  N NH2  . ARG A 1 25 ? 2.751   -4.793  7.187   1.00 0.00 ? 28 ARG A NH2  5  
ATOM 2801  H H    . ARG A 1 25 ? 3.810   -6.169  0.802   1.00 0.00 ? 28 ARG A H    5  
ATOM 2802  H HA   . ARG A 1 25 ? 4.923   -8.658  1.744   1.00 0.00 ? 28 ARG A HA   5  
ATOM 2803  H HB2  . ARG A 1 25 ? 3.056   -6.627  2.962   1.00 0.00 ? 28 ARG A HB2  5  
ATOM 2804  H HB3  . ARG A 1 25 ? 3.535   -8.099  3.785   1.00 0.00 ? 28 ARG A HB3  5  
ATOM 2805  H HG2  . ARG A 1 25 ? 5.958   -7.207  3.205   1.00 0.00 ? 28 ARG A HG2  5  
ATOM 2806  H HG3  . ARG A 1 25 ? 5.108   -5.662  3.185   1.00 0.00 ? 28 ARG A HG3  5  
ATOM 2807  H HD2  . ARG A 1 25 ? 5.254   -7.637  5.462   1.00 0.00 ? 28 ARG A HD2  5  
ATOM 2808  H HD3  . ARG A 1 25 ? 5.998   -6.039  5.384   1.00 0.00 ? 28 ARG A HD3  5  
ATOM 2809  H HE   . ARG A 1 25 ? 3.081   -6.221  5.206   1.00 0.00 ? 28 ARG A HE   5  
ATOM 2810  H HH11 . ARG A 1 25 ? 5.878   -5.374  7.109   1.00 0.00 ? 28 ARG A HH11 5  
ATOM 2811  H HH12 . ARG A 1 25 ? 4.972   -4.433  8.235   1.00 0.00 ? 28 ARG A HH12 5  
ATOM 2812  H HH21 . ARG A 1 25 ? 1.907   -5.000  6.697   1.00 0.00 ? 28 ARG A HH21 5  
ATOM 2813  H HH22 . ARG A 1 25 ? 2.725   -4.223  8.005   1.00 0.00 ? 28 ARG A HH22 5  
ATOM 2814  N N    . ALA A 1 26 ? 1.706   -8.465  1.039   1.00 0.00 ? 29 ALA A N    5  
ATOM 2815  C CA   . ALA A 1 26 ? 0.544   -9.296  0.743   1.00 0.00 ? 29 ALA A CA   5  
ATOM 2816  C C    . ALA A 1 26 ? 0.831   -10.201 -0.446  1.00 0.00 ? 29 ALA A C    5  
ATOM 2817  O O    . ALA A 1 26 ? 0.458   -11.373 -0.454  1.00 0.00 ? 29 ALA A O    5  
ATOM 2818  C CB   . ALA A 1 26 ? -0.679  -8.429  0.475   1.00 0.00 ? 29 ALA A CB   5  
ATOM 2819  H H    . ALA A 1 26 ? 1.644   -7.495  0.925   1.00 0.00 ? 29 ALA A H    5  
ATOM 2820  H HA   . ALA A 1 26 ? 0.342   -9.911  1.608   1.00 0.00 ? 29 ALA A HA   5  
ATOM 2821  H HB1  . ALA A 1 26 ? -0.398  -7.592  -0.148  1.00 0.00 ? 29 ALA A HB1  5  
ATOM 2822  H HB2  . ALA A 1 26 ? -1.074  -8.064  1.411   1.00 0.00 ? 29 ALA A HB2  5  
ATOM 2823  H HB3  . ALA A 1 26 ? -1.433  -9.016  -0.030  1.00 0.00 ? 29 ALA A HB3  5  
ATOM 2824  N N    . GLN A 1 27 ? 1.511   -9.645  -1.445  1.00 0.00 ? 30 GLN A N    5  
ATOM 2825  C CA   . GLN A 1 27 ? 1.863   -10.396 -2.648  1.00 0.00 ? 30 GLN A CA   5  
ATOM 2826  C C    . GLN A 1 27 ? 2.957   -11.421 -2.376  1.00 0.00 ? 30 GLN A C    5  
ATOM 2827  O O    . GLN A 1 27 ? 2.989   -12.483 -2.995  1.00 0.00 ? 30 GLN A O    5  
ATOM 2828  C CB   . GLN A 1 27 ? 2.278   -9.427  -3.763  1.00 0.00 ? 30 GLN A CB   5  
ATOM 2829  C CG   . GLN A 1 27 ? 2.939   -10.092 -4.963  1.00 0.00 ? 30 GLN A CG   5  
ATOM 2830  C CD   . GLN A 1 27 ? 2.194   -9.835  -6.258  1.00 0.00 ? 30 GLN A CD   5  
ATOM 2831  O OE1  . GLN A 1 27 ? 2.036   -8.692  -6.678  1.00 0.00 ? 30 GLN A OE1  5  
ATOM 2832  N NE2  . GLN A 1 27 ? 1.728   -10.895 -6.899  1.00 0.00 ? 30 GLN A NE2  5  
ATOM 2833  H H    . GLN A 1 27 ? 1.787   -8.700  -1.368  1.00 0.00 ? 30 GLN A H    5  
ATOM 2834  H HA   . GLN A 1 27 ? 0.992   -10.932 -2.950  1.00 0.00 ? 30 GLN A HA   5  
ATOM 2835  H HB2  . GLN A 1 27 ? 1.399   -8.903  -4.112  1.00 0.00 ? 30 GLN A HB2  5  
ATOM 2836  H HB3  . GLN A 1 27 ? 2.971   -8.707  -3.354  1.00 0.00 ? 30 GLN A HB3  5  
ATOM 2837  H HG2  . GLN A 1 27 ? 3.941   -9.705  -5.063  1.00 0.00 ? 30 GLN A HG2  5  
ATOM 2838  H HG3  . GLN A 1 27 ? 2.982   -11.155 -4.792  1.00 0.00 ? 30 GLN A HG3  5  
ATOM 2839  H HE21 . GLN A 1 27 ? 1.885   -11.780 -6.512  1.00 0.00 ? 30 GLN A HE21 5  
ATOM 2840  H HE22 . GLN A 1 27 ? 1.246   -10.747 -7.739  1.00 0.00 ? 30 GLN A HE22 5  
ATOM 2841  N N    . ALA A 1 28 ? 3.829   -11.106 -1.438  1.00 0.00 ? 31 ALA A N    5  
ATOM 2842  C CA   . ALA A 1 28 ? 4.915   -12.010 -1.066  1.00 0.00 ? 31 ALA A CA   5  
ATOM 2843  C C    . ALA A 1 28 ? 4.435   -13.031 -0.036  1.00 0.00 ? 31 ALA A C    5  
ATOM 2844  O O    . ALA A 1 28 ? 4.626   -14.237 -0.202  1.00 0.00 ? 31 ALA A O    5  
ATOM 2845  C CB   . ALA A 1 28 ? 6.103   -11.223 -0.533  1.00 0.00 ? 31 ALA A CB   5  
ATOM 2846  H H    . ALA A 1 28 ? 3.729   -10.254 -0.976  1.00 0.00 ? 31 ALA A H    5  
ATOM 2847  H HA   . ALA A 1 28 ? 5.229   -12.537 -1.956  1.00 0.00 ? 31 ALA A HA   5  
ATOM 2848  H HB1  . ALA A 1 28 ? 6.297   -10.380 -1.181  1.00 0.00 ? 31 ALA A HB1  5  
ATOM 2849  H HB2  . ALA A 1 28 ? 6.975   -11.861 -0.505  1.00 0.00 ? 31 ALA A HB2  5  
ATOM 2850  H HB3  . ALA A 1 28 ? 5.884   -10.868 0.463   1.00 0.00 ? 31 ALA A HB3  5  
ATOM 2851  N N    . ALA A 1 29 ? 3.802   -12.538 1.028   1.00 0.00 ? 32 ALA A N    5  
ATOM 2852  C CA   . ALA A 1 29 ? 3.290   -13.403 2.088   1.00 0.00 ? 32 ALA A CA   5  
ATOM 2853  C C    . ALA A 1 29 ? 2.192   -14.356 1.591   1.00 0.00 ? 32 ALA A C    5  
ATOM 2854  O O    . ALA A 1 29 ? 2.086   -15.481 2.085   1.00 0.00 ? 32 ALA A O    5  
ATOM 2855  C CB   . ALA A 1 29 ? 2.773   -12.562 3.247   1.00 0.00 ? 32 ALA A CB   5  
ATOM 2856  H H    . ALA A 1 29 ? 3.679   -11.554 1.106   1.00 0.00 ? 32 ALA A H    5  
ATOM 2857  H HA   . ALA A 1 29 ? 4.115   -13.997 2.454   1.00 0.00 ? 32 ALA A HA   5  
ATOM 2858  H HB1  . ALA A 1 29 ? 3.580   -11.967 3.648   1.00 0.00 ? 32 ALA A HB1  5  
ATOM 2859  H HB2  . ALA A 1 29 ? 2.386   -13.210 4.019   1.00 0.00 ? 32 ALA A HB2  5  
ATOM 2860  H HB3  . ALA A 1 29 ? 1.986   -11.910 2.896   1.00 0.00 ? 32 ALA A HB3  5  
ATOM 2861  N N    . ALA A 1 30 ? 1.368   -13.912 0.634   1.00 0.00 ? 33 ALA A N    5  
ATOM 2862  C CA   . ALA A 1 30 ? 0.281   -14.750 0.115   1.00 0.00 ? 33 ALA A CA   5  
ATOM 2863  C C    . ALA A 1 30 ? 0.772   -15.795 -0.876  1.00 0.00 ? 33 ALA A C    5  
ATOM 2864  O O    . ALA A 1 30 ? 0.507   -16.993 -0.726  1.00 0.00 ? 33 ALA A O    5  
ATOM 2865  C CB   . ALA A 1 30 ? -0.806  -13.885 -0.511  1.00 0.00 ? 33 ALA A CB   5  
ATOM 2866  H H    . ALA A 1 30 ? 1.483   -13.000 0.275   1.00 0.00 ? 33 ALA A H    5  
ATOM 2867  H HA   . ALA A 1 30 ? -0.148  -15.263 0.942   1.00 0.00 ? 33 ALA A HA   5  
ATOM 2868  H HB1  . ALA A 1 30 ? -0.406  -13.375 -1.376  1.00 0.00 ? 33 ALA A HB1  5  
ATOM 2869  H HB2  . ALA A 1 30 ? -1.146  -13.156 0.210   1.00 0.00 ? 33 ALA A HB2  5  
ATOM 2870  H HB3  . ALA A 1 30 ? -1.635  -14.509 -0.812  1.00 0.00 ? 33 ALA A HB3  5  
ATOM 2871  N N    . ASN A 1 31 ? 1.480   -15.328 -1.885  1.00 0.00 ? 34 ASN A N    5  
ATOM 2872  C CA   . ASN A 1 31 ? 2.016   -16.202 -2.932  1.00 0.00 ? 34 ASN A CA   5  
ATOM 2873  C C    . ASN A 1 31 ? 2.963   -17.259 -2.353  1.00 0.00 ? 34 ASN A C    5  
ATOM 2874  O O    . ASN A 1 31 ? 3.038   -18.376 -2.863  1.00 0.00 ? 34 ASN A O    5  
ATOM 2875  C CB   . ASN A 1 31 ? 2.714   -15.368 -4.024  1.00 0.00 ? 34 ASN A CB   5  
ATOM 2876  C CG   . ASN A 1 31 ? 4.230   -15.468 -3.993  1.00 0.00 ? 34 ASN A CG   5  
ATOM 2877  O OD1  . ASN A 1 31 ? 4.875   -15.024 -3.050  1.00 0.00 ? 34 ASN A OD1  5  
ATOM 2878  N ND2  . ASN A 1 31 ? 4.807   -16.052 -5.033  1.00 0.00 ? 34 ASN A ND2  5  
ATOM 2879  H H    . ASN A 1 31 ? 1.641   -14.367 -1.925  1.00 0.00 ? 34 ASN A H    5  
ATOM 2880  H HA   . ASN A 1 31 ? 1.178   -16.716 -3.380  1.00 0.00 ? 34 ASN A HA   5  
ATOM 2881  H HB2  . ASN A 1 31 ? 2.375   -15.705 -4.991  1.00 0.00 ? 34 ASN A HB2  5  
ATOM 2882  H HB3  . ASN A 1 31 ? 2.441   -14.331 -3.899  1.00 0.00 ? 34 ASN A HB3  5  
ATOM 2883  H HD21 . ASN A 1 31 ? 4.235   -16.385 -5.754  1.00 0.00 ? 34 ASN A HD21 5  
ATOM 2884  H HD22 . ASN A 1 31 ? 5.782   -16.128 -5.034  1.00 0.00 ? 34 ASN A HD22 5  
ATOM 2885  N N    . ALA A 1 32 ? 3.683   -16.901 -1.289  1.00 0.00 ? 35 ALA A N    5  
ATOM 2886  C CA   . ALA A 1 32 ? 4.624   -17.825 -0.651  1.00 0.00 ? 35 ALA A CA   5  
ATOM 2887  C C    . ALA A 1 32 ? 3.929   -18.849 0.261   1.00 0.00 ? 35 ALA A C    5  
ATOM 2888  O O    . ALA A 1 32 ? 4.594   -19.686 0.873   1.00 0.00 ? 35 ALA A O    5  
ATOM 2889  C CB   . ALA A 1 32 ? 5.669   -17.040 0.130   1.00 0.00 ? 35 ALA A CB   5  
ATOM 2890  H H    . ALA A 1 32 ? 3.585   -15.992 -0.928  1.00 0.00 ? 35 ALA A H    5  
ATOM 2891  H HA   . ALA A 1 32 ? 5.131   -18.363 -1.436  1.00 0.00 ? 35 ALA A HA   5  
ATOM 2892  H HB1  . ALA A 1 32 ? 5.184   -16.459 0.900   1.00 0.00 ? 35 ALA A HB1  5  
ATOM 2893  H HB2  . ALA A 1 32 ? 6.197   -16.377 -0.541  1.00 0.00 ? 35 ALA A HB2  5  
ATOM 2894  H HB3  . ALA A 1 32 ? 6.371   -17.726 0.583   1.00 0.00 ? 35 ALA A HB3  5  
ATOM 2895  N N    . HIS A 1 33 ? 2.598   -18.786 0.354   1.00 0.00 ? 36 HIS A N    5  
ATOM 2896  C CA   . HIS A 1 33 ? 1.849   -19.719 1.201   1.00 0.00 ? 36 HIS A CA   5  
ATOM 2897  C C    . HIS A 1 33 ? 0.694   -20.376 0.441   1.00 0.00 ? 36 HIS A C    5  
ATOM 2898  O O    . HIS A 1 33 ? 0.622   -21.602 0.351   1.00 0.00 ? 36 HIS A O    5  
ATOM 2899  C CB   . HIS A 1 33 ? 1.317   -18.997 2.443   1.00 0.00 ? 36 HIS A CB   5  
ATOM 2900  C CG   . HIS A 1 33 ? 2.390   -18.588 3.400   1.00 0.00 ? 36 HIS A CG   5  
ATOM 2901  N ND1  . HIS A 1 33 ? 2.883   -17.305 3.466   1.00 0.00 ? 36 HIS A ND1  5  
ATOM 2902  C CD2  . HIS A 1 33 ? 3.068   -19.299 4.333   1.00 0.00 ? 36 HIS A CD2  5  
ATOM 2903  C CE1  . HIS A 1 33 ? 3.820   -17.240 4.396   1.00 0.00 ? 36 HIS A CE1  5  
ATOM 2904  N NE2  . HIS A 1 33 ? 3.953   -18.437 4.938   1.00 0.00 ? 36 HIS A NE2  5  
ATOM 2905  H H    . HIS A 1 33 ? 2.114   -18.102 -0.151  1.00 0.00 ? 36 HIS A H    5  
ATOM 2906  H HA   . HIS A 1 33 ? 2.531   -20.493 1.517   1.00 0.00 ? 36 HIS A HA   5  
ATOM 2907  H HB2  . HIS A 1 33 ? 0.791   -18.105 2.136   1.00 0.00 ? 36 HIS A HB2  5  
ATOM 2908  H HB3  . HIS A 1 33 ? 0.634   -19.650 2.966   1.00 0.00 ? 36 HIS A HB3  5  
ATOM 2909  H HD1  . HIS A 1 33 ? 2.584   -16.542 2.902   1.00 0.00 ? 36 HIS A HD1  5  
ATOM 2910  H HD2  . HIS A 1 33 ? 2.938   -20.348 4.555   1.00 0.00 ? 36 HIS A HD2  5  
ATOM 2911  H HE1  . HIS A 1 33 ? 4.382   -16.358 4.667   1.00 0.00 ? 36 HIS A HE1  5  
ATOM 2912  H HE2  . HIS A 1 33 ? 4.669   -18.700 5.553   1.00 0.00 ? 36 HIS A HE2  5  
ATOM 2913  N N    . LEU A 1 34 ? -0.212  -19.558 -0.099  1.00 0.00 ? 37 LEU A N    5  
ATOM 2914  C CA   . LEU A 1 34 ? -1.366  -20.070 -0.842  1.00 0.00 ? 37 LEU A CA   5  
ATOM 2915  C C    . LEU A 1 34 ? -0.942  -20.797 -2.110  1.00 0.00 ? 37 LEU A C    5  
ATOM 2916  O O    . LEU A 1 34 ? -1.417  -21.896 -2.406  1.00 0.00 ? 37 LEU A O    5  
ATOM 2917  C CB   . LEU A 1 34 ? -2.332  -18.927 -1.179  1.00 0.00 ? 37 LEU A CB   5  
ATOM 2918  C CG   . LEU A 1 34 ? -3.033  -18.298 0.027   1.00 0.00 ? 37 LEU A CG   5  
ATOM 2919  C CD1  . LEU A 1 34 ? -3.189  -16.799 -0.168  1.00 0.00 ? 37 LEU A CD1  5  
ATOM 2920  C CD2  . LEU A 1 34 ? -4.387  -18.948 0.254   1.00 0.00 ? 37 LEU A CD2  5  
ATOM 2921  H H    . LEU A 1 34 ? -0.103  -18.586 0.007   1.00 0.00 ? 37 LEU A H    5  
ATOM 2922  H HA   . LEU A 1 34 ? -1.866  -20.770 -0.213  1.00 0.00 ? 37 LEU A HA   5  
ATOM 2923  H HB2  . LEU A 1 34 ? -1.777  -18.154 -1.692  1.00 0.00 ? 37 LEU A HB2  5  
ATOM 2924  H HB3  . LEU A 1 34 ? -3.089  -19.310 -1.848  1.00 0.00 ? 37 LEU A HB3  5  
ATOM 2925  H HG   . LEU A 1 34 ? -2.431  -18.458 0.910   1.00 0.00 ? 37 LEU A HG   5  
ATOM 2926  H HD11 . LEU A 1 34 ? -3.858  -16.408 0.584   1.00 0.00 ? 37 LEU A HD11 5  
ATOM 2927  H HD12 . LEU A 1 34 ? -3.598  -16.606 -1.149  1.00 0.00 ? 37 LEU A HD12 5  
ATOM 2928  H HD13 . LEU A 1 34 ? -2.226  -16.323 -0.077  1.00 0.00 ? 37 LEU A HD13 5  
ATOM 2929  H HD21 . LEU A 1 34 ? -4.821  -18.567 1.166   1.00 0.00 ? 37 LEU A HD21 5  
ATOM 2930  H HD22 . LEU A 1 34 ? -4.265  -20.019 0.334   1.00 0.00 ? 37 LEU A HD22 5  
ATOM 2931  H HD23 . LEU A 1 34 ? -5.039  -18.722 -0.577  1.00 0.00 ? 37 LEU A HD23 5  
ATOM 2932  N N    . MET A 1 35 ? -0.036  -20.176 -2.840  1.00 0.00 ? 38 MET A N    5  
ATOM 2933  C CA   . MET A 1 35 ? 0.486   -20.742 -4.087  1.00 0.00 ? 38 MET A CA   5  
ATOM 2934  C C    . MET A 1 35 ? 1.342   -21.984 -3.832  1.00 0.00 ? 38 MET A C    5  
ATOM 2935  O O    . MET A 1 35 ? 1.509   -22.828 -4.714  1.00 0.00 ? 38 MET A O    5  
ATOM 2936  C CB   . MET A 1 35 ? 1.293   -19.685 -4.848  1.00 0.00 ? 38 MET A CB   5  
ATOM 2937  C CG   . MET A 1 35 ? 0.851   -19.497 -6.291  1.00 0.00 ? 38 MET A CG   5  
ATOM 2938  S SD   . MET A 1 35 ? 1.137   -17.819 -6.887  1.00 0.00 ? 38 MET A SD   5  
ATOM 2939  C CE   . MET A 1 35 ? -0.302  -16.976 -6.232  1.00 0.00 ? 38 MET A CE   5  
ATOM 2940  H H    . MET A 1 35 ? 0.294   -19.314 -2.527  1.00 0.00 ? 38 MET A H    5  
ATOM 2941  H HA   . MET A 1 35 ? -0.354  -21.035 -4.682  1.00 0.00 ? 38 MET A HA   5  
ATOM 2942  H HB2  . MET A 1 35 ? 1.193   -18.738 -4.340  1.00 0.00 ? 38 MET A HB2  5  
ATOM 2943  H HB3  . MET A 1 35 ? 2.334   -19.973 -4.846  1.00 0.00 ? 38 MET A HB3  5  
ATOM 2944  H HG2  . MET A 1 35 ? 1.403   -20.184 -6.915  1.00 0.00 ? 38 MET A HG2  5  
ATOM 2945  H HG3  . MET A 1 35 ? -0.204  -19.715 -6.363  1.00 0.00 ? 38 MET A HG3  5  
ATOM 2946  H HE1  . MET A 1 35 ? -1.195  -17.514 -6.513  1.00 0.00 ? 38 MET A HE1  5  
ATOM 2947  H HE2  . MET A 1 35 ? -0.345  -15.974 -6.633  1.00 0.00 ? 38 MET A HE2  5  
ATOM 2948  H HE3  . MET A 1 35 ? -0.233  -16.929 -5.155  1.00 0.00 ? 38 MET A HE3  5  
ATOM 2949  N N    . ALA A 1 36 ? 1.870   -22.088 -2.620  1.00 0.00 ? 39 ALA A N    5  
ATOM 2950  C CA   . ALA A 1 36 ? 2.704   -23.224 -2.228  1.00 0.00 ? 39 ALA A CA   5  
ATOM 2951  C C    . ALA A 1 36 ? 1.909   -24.273 -1.435  1.00 0.00 ? 39 ALA A C    5  
ATOM 2952  O O    . ALA A 1 36 ? 2.458   -25.301 -1.032  1.00 0.00 ? 39 ALA A O    5  
ATOM 2953  C CB   . ALA A 1 36 ? 3.898   -22.733 -1.421  1.00 0.00 ? 39 ALA A CB   5  
ATOM 2954  H H    . ALA A 1 36 ? 1.689   -21.383 -1.970  1.00 0.00 ? 39 ALA A H    5  
ATOM 2955  H HA   . ALA A 1 36 ? 3.075   -23.686 -3.129  1.00 0.00 ? 39 ALA A HA   5  
ATOM 2956  H HB1  . ALA A 1 36 ? 3.550   -22.241 -0.525  1.00 0.00 ? 39 ALA A HB1  5  
ATOM 2957  H HB2  . ALA A 1 36 ? 4.471   -22.037 -2.014  1.00 0.00 ? 39 ALA A HB2  5  
ATOM 2958  H HB3  . ALA A 1 36 ? 4.521   -23.574 -1.151  1.00 0.00 ? 39 ALA A HB3  5  
ATOM 2959  N N    . GLN A 1 37 ? 0.620   -24.011 -1.216  1.00 0.00 ? 40 GLN A N    5  
ATOM 2960  C CA   . GLN A 1 37 ? -0.244  -24.927 -0.475  1.00 0.00 ? 40 GLN A CA   5  
ATOM 2961  C C    . GLN A 1 37 ? -1.005  -25.858 -1.422  1.00 0.00 ? 40 GLN A C    5  
ATOM 2962  O O    . GLN A 1 37 ? -1.030  -27.073 -1.212  1.00 0.00 ? 40 GLN A O    5  
ATOM 2963  C CB   . GLN A 1 37 ? -1.232  -24.134 0.389   1.00 0.00 ? 40 GLN A CB   5  
ATOM 2964  C CG   . GLN A 1 37 ? -2.246  -25.003 1.122   1.00 0.00 ? 40 GLN A CG   5  
ATOM 2965  C CD   . GLN A 1 37 ? -3.649  -24.428 1.079   1.00 0.00 ? 40 GLN A CD   5  
ATOM 2966  O OE1  . GLN A 1 37 ? -4.011  -23.585 1.894   1.00 0.00 ? 40 GLN A OE1  5  
ATOM 2967  N NE2  . GLN A 1 37 ? -4.450  -24.882 0.126   1.00 0.00 ? 40 GLN A NE2  5  
ATOM 2968  H H    . GLN A 1 37 ? 0.239   -23.179 -1.560  1.00 0.00 ? 40 GLN A H    5  
ATOM 2969  H HA   . GLN A 1 37 ? 0.382   -25.527 0.167   1.00 0.00 ? 40 GLN A HA   5  
ATOM 2970  H HB2  . GLN A 1 37 ? -0.675  -23.571 1.124   1.00 0.00 ? 40 GLN A HB2  5  
ATOM 2971  H HB3  . GLN A 1 37 ? -1.771  -23.445 -0.244  1.00 0.00 ? 40 GLN A HB3  5  
ATOM 2972  H HG2  . GLN A 1 37 ? -2.263  -25.982 0.668   1.00 0.00 ? 40 GLN A HG2  5  
ATOM 2973  H HG3  . GLN A 1 37 ? -1.945  -25.094 2.155   1.00 0.00 ? 40 GLN A HG3  5  
ATOM 2974  H HE21 . GLN A 1 37 ? -4.101  -25.562 -0.498  1.00 0.00 ? 40 GLN A HE21 5  
ATOM 2975  H HE22 . GLN A 1 37 ? -5.358  -24.522 0.081   1.00 0.00 ? 40 GLN A HE22 5  
ATOM 2976  N N    . ILE A 1 38 ? -1.628  -25.272 -2.453  1.00 0.00 ? 41 ILE A N    5  
ATOM 2977  C CA   . ILE A 1 38 ? -2.408  -26.024 -3.445  1.00 0.00 ? 41 ILE A CA   5  
ATOM 2978  C C    . ILE A 1 38 ? -3.816  -26.330 -2.926  1.00 0.00 ? 41 ILE A C    5  
ATOM 2979  O O    . ILE A 1 38 ? -4.781  -26.126 -3.692  1.00 0.00 ? 41 ILE A O    5  
ATOM 2980  C CB   . ILE A 1 38 ? -1.715  -27.344 -3.862  1.00 0.00 ? 41 ILE A CB   5  
ATOM 2981  C CG1  . ILE A 1 38 ? -0.271  -27.084 -4.301  1.00 0.00 ? 41 ILE A CG1  5  
ATOM 2982  C CG2  . ILE A 1 38 ? -2.491  -28.023 -4.982  1.00 0.00 ? 41 ILE A CG2  5  
ATOM 2983  C CD1  . ILE A 1 38 ? 0.707   -28.125 -3.804  1.00 0.00 ? 41 ILE A CD1  5  
ATOM 2984  O OXT  . ILE A 1 38 ? -3.945  -26.762 -1.759  1.00 0.00 ? 41 ILE A OXT  5  
ATOM 2985  H H    . ILE A 1 38 ? -1.568  -24.298 -2.546  1.00 0.00 ? 41 ILE A H    5  
ATOM 2986  H HA   . ILE A 1 38 ? -2.499  -25.405 -4.324  1.00 0.00 ? 41 ILE A HA   5  
ATOM 2987  H HB   . ILE A 1 38 ? -1.713  -28.005 -3.009  1.00 0.00 ? 41 ILE A HB   5  
ATOM 2988  H HG12 . ILE A 1 38 ? -0.226  -27.075 -5.379  1.00 0.00 ? 41 ILE A HG12 5  
ATOM 2989  H HG13 . ILE A 1 38 ? 0.046   -26.122 -3.924  1.00 0.00 ? 41 ILE A HG13 5  
ATOM 2990  H HG21 . ILE A 1 38 ? -2.080  -29.006 -5.157  1.00 0.00 ? 41 ILE A HG21 5  
ATOM 2991  H HG22 . ILE A 1 38 ? -2.411  -27.434 -5.883  1.00 0.00 ? 41 ILE A HG22 5  
ATOM 2992  H HG23 . ILE A 1 38 ? -3.529  -28.112 -4.699  1.00 0.00 ? 41 ILE A HG23 5  
ATOM 2993  H HD11 . ILE A 1 38 ? 0.440   -29.091 -4.207  1.00 0.00 ? 41 ILE A HD11 5  
ATOM 2994  H HD12 . ILE A 1 38 ? 0.675   -28.163 -2.725  1.00 0.00 ? 41 ILE A HD12 5  
ATOM 2995  H HD13 . ILE A 1 38 ? 1.705   -27.864 -4.125  1.00 0.00 ? 41 ILE A HD13 5  
ATOM 2996  N N    . PHE A 1 1  ? -14.718 20.597  10.589  1.00 0.00 ? 4  PHE A N    6  
ATOM 2997  C CA   . PHE A 1 1  ? -14.666 20.341  9.120   1.00 0.00 ? 4  PHE A CA   6  
ATOM 2998  C C    . PHE A 1 1  ? -13.497 21.082  8.470   1.00 0.00 ? 4  PHE A C    6  
ATOM 2999  O O    . PHE A 1 1  ? -13.045 22.107  8.983   1.00 0.00 ? 4  PHE A O    6  
ATOM 3000  C CB   . PHE A 1 1  ? -15.991 20.792  8.491   1.00 0.00 ? 4  PHE A CB   6  
ATOM 3001  C CG   . PHE A 1 1  ? -17.190 20.055  9.016   1.00 0.00 ? 4  PHE A CG   6  
ATOM 3002  C CD1  . PHE A 1 1  ? -17.420 18.736  8.659   1.00 0.00 ? 4  PHE A CD1  6  
ATOM 3003  C CD2  . PHE A 1 1  ? -18.087 20.681  9.867   1.00 0.00 ? 4  PHE A CD2  6  
ATOM 3004  C CE1  . PHE A 1 1  ? -18.522 18.055  9.143   1.00 0.00 ? 4  PHE A CE1  6  
ATOM 3005  C CE2  . PHE A 1 1  ? -19.190 20.005  10.353  1.00 0.00 ? 4  PHE A CE2  6  
ATOM 3006  C CZ   . PHE A 1 1  ? -19.407 18.691  9.990   1.00 0.00 ? 4  PHE A CZ   6  
ATOM 3007  H H1   . PHE A 1 1  ? -13.797 20.329  10.993  1.00 0.00 ? 4  PHE A H1   6  
ATOM 3008  H H2   . PHE A 1 1  ? -15.485 20.017  10.988  1.00 0.00 ? 4  PHE A H2   6  
ATOM 3009  H H3   . PHE A 1 1  ? -14.903 21.612  10.729  1.00 0.00 ? 4  PHE A H3   6  
ATOM 3010  H HA   . PHE A 1 1  ? -14.540 19.280  8.960   1.00 0.00 ? 4  PHE A HA   6  
ATOM 3011  H HB2  . PHE A 1 1  ? -16.136 21.844  8.687   1.00 0.00 ? 4  PHE A HB2  6  
ATOM 3012  H HB3  . PHE A 1 1  ? -15.946 20.636  7.422   1.00 0.00 ? 4  PHE A HB3  6  
ATOM 3013  H HD1  . PHE A 1 1  ? -16.729 18.238  7.996   1.00 0.00 ? 4  PHE A HD1  6  
ATOM 3014  H HD2  . PHE A 1 1  ? -17.920 21.710  10.150  1.00 0.00 ? 4  PHE A HD2  6  
ATOM 3015  H HE1  . PHE A 1 1  ? -18.690 17.026  8.857   1.00 0.00 ? 4  PHE A HE1  6  
ATOM 3016  H HE2  . PHE A 1 1  ? -19.881 20.504  11.016  1.00 0.00 ? 4  PHE A HE2  6  
ATOM 3017  H HZ   . PHE A 1 1  ? -20.269 18.161  10.369  1.00 0.00 ? 4  PHE A HZ   6  
ATOM 3018  N N    . THR A 1 2  ? -13.011 20.556  7.346   1.00 0.00 ? 5  THR A N    6  
ATOM 3019  C CA   . THR A 1 2  ? -11.889 21.171  6.631   1.00 0.00 ? 5  THR A CA   6  
ATOM 3020  C C    . THR A 1 2  ? -11.916 20.805  5.150   1.00 0.00 ? 5  THR A C    6  
ATOM 3021  O O    . THR A 1 2  ? -11.754 19.639  4.787   1.00 0.00 ? 5  THR A O    6  
ATOM 3022  C CB   . THR A 1 2  ? -10.553 20.736  7.248   1.00 0.00 ? 5  THR A CB   6  
ATOM 3023  O OG1  . THR A 1 2  ? -10.619 20.747  8.663   1.00 0.00 ? 5  THR A OG1  6  
ATOM 3024  C CG2  . THR A 1 2  ? -9.391  21.617  6.845   1.00 0.00 ? 5  THR A CG2  6  
ATOM 3025  H H    . THR A 1 2  ? -13.410 19.734  6.988   1.00 0.00 ? 5  THR A H    6  
ATOM 3026  H HA   . THR A 1 2  ? -11.985 22.244  6.726   1.00 0.00 ? 5  THR A HA   6  
ATOM 3027  H HB   . THR A 1 2  ? -10.331 19.728  6.925   1.00 0.00 ? 5  THR A HB   6  
ATOM 3028  H HG1  . THR A 1 2  ? -10.928 21.607  8.966   1.00 0.00 ? 5  THR A HG1  6  
ATOM 3029  H HG21 . THR A 1 2  ? -9.741  22.624  6.679   1.00 0.00 ? 5  THR A HG21 6  
ATOM 3030  H HG22 . THR A 1 2  ? -8.948  21.234  5.936   1.00 0.00 ? 5  THR A HG22 6  
ATOM 3031  H HG23 . THR A 1 2  ? -8.651  21.617  7.632   1.00 0.00 ? 5  THR A HG23 6  
ATOM 3032  N N    . LEU A 1 3  ? -12.114 21.806  4.294   1.00 0.00 ? 6  LEU A N    6  
ATOM 3033  C CA   . LEU A 1 3  ? -12.155 21.584  2.847   1.00 0.00 ? 6  LEU A CA   6  
ATOM 3034  C C    . LEU A 1 3  ? -10.745 21.349  2.290   1.00 0.00 ? 6  LEU A C    6  
ATOM 3035  O O    . LEU A 1 3  ? -10.244 22.123  1.473   1.00 0.00 ? 6  LEU A O    6  
ATOM 3036  C CB   . LEU A 1 3  ? -12.825 22.775  2.142   1.00 0.00 ? 6  LEU A CB   6  
ATOM 3037  C CG   . LEU A 1 3  ? -12.236 24.152  2.467   1.00 0.00 ? 6  LEU A CG   6  
ATOM 3038  C CD1  . LEU A 1 3  ? -11.897 24.902  1.190   1.00 0.00 ? 6  LEU A CD1  6  
ATOM 3039  C CD2  . LEU A 1 3  ? -13.203 24.962  3.315   1.00 0.00 ? 6  LEU A CD2  6  
ATOM 3040  H H    . LEU A 1 3  ? -12.233 22.714  4.640   1.00 0.00 ? 6  LEU A H    6  
ATOM 3041  H HA   . LEU A 1 3  ? -12.745 20.697  2.668   1.00 0.00 ? 6  LEU A HA   6  
ATOM 3042  H HB2  . LEU A 1 3  ? -12.753 22.619  1.075   1.00 0.00 ? 6  LEU A HB2  6  
ATOM 3043  H HB3  . LEU A 1 3  ? -13.870 22.783  2.414   1.00 0.00 ? 6  LEU A HB3  6  
ATOM 3044  H HG   . LEU A 1 3  ? -11.322 24.023  3.029   1.00 0.00 ? 6  LEU A HG   6  
ATOM 3045  H HD11 . LEU A 1 3  ? -11.248 24.295  0.578   1.00 0.00 ? 6  LEU A HD11 6  
ATOM 3046  H HD12 . LEU A 1 3  ? -11.400 25.827  1.437   1.00 0.00 ? 6  LEU A HD12 6  
ATOM 3047  H HD13 . LEU A 1 3  ? -12.807 25.117  0.647   1.00 0.00 ? 6  LEU A HD13 6  
ATOM 3048  H HD21 . LEU A 1 3  ? -13.025 26.016  3.155   1.00 0.00 ? 6  LEU A HD21 6  
ATOM 3049  H HD22 . LEU A 1 3  ? -13.052 24.727  4.358   1.00 0.00 ? 6  LEU A HD22 6  
ATOM 3050  H HD23 . LEU A 1 3  ? -14.217 24.722  3.034   1.00 0.00 ? 6  LEU A HD23 6  
ATOM 3051  N N    . SER A 1 4  ? -10.104 20.274  2.750   1.00 0.00 ? 7  SER A N    6  
ATOM 3052  C CA   . SER A 1 4  ? -8.751  19.937  2.310   1.00 0.00 ? 7  SER A CA   6  
ATOM 3053  C C    . SER A 1 4  ? -8.557  18.420  2.211   1.00 0.00 ? 7  SER A C    6  
ATOM 3054  O O    . SER A 1 4  ? -7.609  17.867  2.775   1.00 0.00 ? 7  SER A O    6  
ATOM 3055  C CB   . SER A 1 4  ? -7.720  20.544  3.273   1.00 0.00 ? 7  SER A CB   6  
ATOM 3056  O OG   . SER A 1 4  ? -7.698  19.848  4.512   1.00 0.00 ? 7  SER A OG   6  
ATOM 3057  H H    . SER A 1 4  ? -10.553 19.696  3.408   1.00 0.00 ? 7  SER A H    6  
ATOM 3058  H HA   . SER A 1 4  ? -8.606  20.367  1.330   1.00 0.00 ? 7  SER A HA   6  
ATOM 3059  H HB2  . SER A 1 4  ? -6.738  20.489  2.825   1.00 0.00 ? 7  SER A HB2  6  
ATOM 3060  H HB3  . SER A 1 4  ? -7.972  21.578  3.459   1.00 0.00 ? 7  SER A HB3  6  
ATOM 3061  H HG   . SER A 1 4  ? -7.394  18.942  4.364   1.00 0.00 ? 7  SER A HG   6  
ATOM 3062  N N    . LEU A 1 5  ? -9.457  17.751  1.491   1.00 0.00 ? 8  LEU A N    6  
ATOM 3063  C CA   . LEU A 1 5  ? -9.374  16.299  1.321   1.00 0.00 ? 8  LEU A CA   6  
ATOM 3064  C C    . LEU A 1 5  ? -9.198  15.912  -0.150  1.00 0.00 ? 8  LEU A C    6  
ATOM 3065  O O    . LEU A 1 5  ? -9.697  14.878  -0.599  1.00 0.00 ? 8  LEU A O    6  
ATOM 3066  C CB   . LEU A 1 5  ? -10.617 15.623  1.911   1.00 0.00 ? 8  LEU A CB   6  
ATOM 3067  C CG   . LEU A 1 5  ? -10.510 15.251  3.389   1.00 0.00 ? 8  LEU A CG   6  
ATOM 3068  C CD1  . LEU A 1 5  ? -11.890 15.164  4.018   1.00 0.00 ? 8  LEU A CD1  6  
ATOM 3069  C CD2  . LEU A 1 5  ? -9.769  13.934  3.556   1.00 0.00 ? 8  LEU A CD2  6  
ATOM 3070  H H    . LEU A 1 5  ? -10.190 18.241  1.066   1.00 0.00 ? 8  LEU A H    6  
ATOM 3071  H HA   . LEU A 1 5  ? -8.504  15.961  1.861   1.00 0.00 ? 8  LEU A HA   6  
ATOM 3072  H HB2  . LEU A 1 5  ? -11.457 16.291  1.787   1.00 0.00 ? 8  LEU A HB2  6  
ATOM 3073  H HB3  . LEU A 1 5  ? -10.813 14.722  1.349   1.00 0.00 ? 8  LEU A HB3  6  
ATOM 3074  H HG   . LEU A 1 5  ? -9.953  16.018  3.909   1.00 0.00 ? 8  LEU A HG   6  
ATOM 3075  H HD11 . LEU A 1 5  ? -11.795 14.874  5.054   1.00 0.00 ? 8  LEU A HD11 6  
ATOM 3076  H HD12 . LEU A 1 5  ? -12.480 14.429  3.491   1.00 0.00 ? 8  LEU A HD12 6  
ATOM 3077  H HD13 . LEU A 1 5  ? -12.375 16.127  3.957   1.00 0.00 ? 8  LEU A HD13 6  
ATOM 3078  H HD21 . LEU A 1 5  ? -10.204 13.192  2.904   1.00 0.00 ? 8  LEU A HD21 6  
ATOM 3079  H HD22 . LEU A 1 5  ? -9.849  13.604  4.581   1.00 0.00 ? 8  LEU A HD22 6  
ATOM 3080  H HD23 . LEU A 1 5  ? -8.729  14.071  3.301   1.00 0.00 ? 8  LEU A HD23 6  
ATOM 3081  N N    . ASP A 1 6  ? -8.464  16.737  -0.887  1.00 0.00 ? 9  ASP A N    6  
ATOM 3082  C CA   . ASP A 1 6  ? -8.201  16.482  -2.301  1.00 0.00 ? 9  ASP A CA   6  
ATOM 3083  C C    . ASP A 1 6  ? -6.885  15.711  -2.468  1.00 0.00 ? 9  ASP A C    6  
ATOM 3084  O O    . ASP A 1 6  ? -5.934  16.200  -3.078  1.00 0.00 ? 9  ASP A O    6  
ATOM 3085  C CB   . ASP A 1 6  ? -8.171  17.805  -3.080  1.00 0.00 ? 9  ASP A CB   6  
ATOM 3086  C CG   . ASP A 1 6  ? -8.612  17.641  -4.520  1.00 0.00 ? 9  ASP A CG   6  
ATOM 3087  O OD1  . ASP A 1 6  ? -9.750  17.179  -4.747  1.00 0.00 ? 9  ASP A OD1  6  
ATOM 3088  O OD2  . ASP A 1 6  ? -7.819  17.978  -5.424  1.00 0.00 ? 9  ASP A OD2  6  
ATOM 3089  H H    . ASP A 1 6  ? -8.078  17.530  -0.466  1.00 0.00 ? 9  ASP A H    6  
ATOM 3090  H HA   . ASP A 1 6  ? -9.008  15.870  -2.680  1.00 0.00 ? 9  ASP A HA   6  
ATOM 3091  H HB2  . ASP A 1 6  ? -8.831  18.512  -2.603  1.00 0.00 ? 9  ASP A HB2  6  
ATOM 3092  H HB3  . ASP A 1 6  ? -7.165  18.197  -3.075  1.00 0.00 ? 9  ASP A HB3  6  
ATOM 3093  N N    . VAL A 1 7  ? -6.863  14.493  -1.912  1.00 0.00 ? 10 VAL A N    6  
ATOM 3094  C CA   . VAL A 1 7  ? -5.703  13.592  -1.961  1.00 0.00 ? 10 VAL A CA   6  
ATOM 3095  C C    . VAL A 1 7  ? -4.370  14.347  -2.123  1.00 0.00 ? 10 VAL A C    6  
ATOM 3096  O O    . VAL A 1 7  ? -3.739  14.316  -3.183  1.00 0.00 ? 10 VAL A O    6  
ATOM 3097  C CB   . VAL A 1 7  ? -5.890  12.558  -3.090  1.00 0.00 ? 10 VAL A CB   6  
ATOM 3098  C CG1  . VAL A 1 7  ? -4.611  11.775  -3.356  1.00 0.00 ? 10 VAL A CG1  6  
ATOM 3099  C CG2  . VAL A 1 7  ? -7.030  11.607  -2.756  1.00 0.00 ? 10 VAL A CG2  6  
ATOM 3100  H H    . VAL A 1 7  ? -7.666  14.182  -1.456  1.00 0.00 ? 10 VAL A H    6  
ATOM 3101  H HA   . VAL A 1 7  ? -5.673  13.053  -1.025  1.00 0.00 ? 10 VAL A HA   6  
ATOM 3102  H HB   . VAL A 1 7  ? -6.157  13.096  -3.985  1.00 0.00 ? 10 VAL A HB   6  
ATOM 3103  H HG11 . VAL A 1 7  ? -4.859  10.757  -3.617  1.00 0.00 ? 10 VAL A HG11 6  
ATOM 3104  H HG12 . VAL A 1 7  ? -3.995  11.779  -2.469  1.00 0.00 ? 10 VAL A HG12 6  
ATOM 3105  H HG13 . VAL A 1 7  ? -4.070  12.233  -4.171  1.00 0.00 ? 10 VAL A HG13 6  
ATOM 3106  H HG21 . VAL A 1 7  ? -7.547  11.333  -3.664  1.00 0.00 ? 10 VAL A HG21 6  
ATOM 3107  H HG22 . VAL A 1 7  ? -7.719  12.092  -2.081  1.00 0.00 ? 10 VAL A HG22 6  
ATOM 3108  H HG23 . VAL A 1 7  ? -6.632  10.719  -2.287  1.00 0.00 ? 10 VAL A HG23 6  
ATOM 3109  N N    . PRO A 1 8  ? -3.927  15.045  -1.056  1.00 0.00 ? 11 PRO A N    6  
ATOM 3110  C CA   . PRO A 1 8  ? -2.673  15.813  -1.074  1.00 0.00 ? 11 PRO A CA   6  
ATOM 3111  C C    . PRO A 1 8  ? -1.425  14.929  -0.965  1.00 0.00 ? 11 PRO A C    6  
ATOM 3112  O O    . PRO A 1 8  ? -1.519  13.715  -0.762  1.00 0.00 ? 11 PRO A O    6  
ATOM 3113  C CB   . PRO A 1 8  ? -2.808  16.712  0.156   1.00 0.00 ? 11 PRO A CB   6  
ATOM 3114  C CG   . PRO A 1 8  ? -3.658  15.933  1.099   1.00 0.00 ? 11 PRO A CG   6  
ATOM 3115  C CD   . PRO A 1 8  ? -4.616  15.145  0.247   1.00 0.00 ? 11 PRO A CD   6  
ATOM 3116  H HA   . PRO A 1 8  ? -2.601  16.423  -1.962  1.00 0.00 ? 11 PRO A HA   6  
ATOM 3117  H HB2  . PRO A 1 8  ? -1.830  16.911  0.572   1.00 0.00 ? 11 PRO A HB2  6  
ATOM 3118  H HB3  . PRO A 1 8  ? -3.282  17.642  -0.125  1.00 0.00 ? 11 PRO A HB3  6  
ATOM 3119  H HG2  . PRO A 1 8  ? -3.042  15.267  1.683   1.00 0.00 ? 11 PRO A HG2  6  
ATOM 3120  H HG3  . PRO A 1 8  ? -4.201  16.607  1.747   1.00 0.00 ? 11 PRO A HG3  6  
ATOM 3121  H HD2  . PRO A 1 8  ? -4.782  14.166  0.671   1.00 0.00 ? 11 PRO A HD2  6  
ATOM 3122  H HD3  . PRO A 1 8  ? -5.552  15.675  0.145   1.00 0.00 ? 11 PRO A HD3  6  
ATOM 3123  N N    . THR A 1 9  ? -0.253  15.553  -1.100  1.00 0.00 ? 12 THR A N    6  
ATOM 3124  C CA   . THR A 1 9  ? 1.029   14.841  -1.022  1.00 0.00 ? 12 THR A CA   6  
ATOM 3125  C C    . THR A 1 9  ? 1.105   13.949  0.218   1.00 0.00 ? 12 THR A C    6  
ATOM 3126  O O    . THR A 1 9  ? 1.513   12.790  0.126   1.00 0.00 ? 12 THR A O    6  
ATOM 3127  C CB   . THR A 1 9  ? 2.200   15.833  -1.018  1.00 0.00 ? 12 THR A CB   6  
ATOM 3128  O OG1  . THR A 1 9  ? 1.742   17.157  -1.231  1.00 0.00 ? 12 THR A OG1  6  
ATOM 3129  C CG2  . THR A 1 9  ? 3.235   15.535  -2.078  1.00 0.00 ? 12 THR A CG2  6  
ATOM 3130  H H    . THR A 1 9  ? -0.245  16.521  -1.259  1.00 0.00 ? 12 THR A H    6  
ATOM 3131  H HA   . THR A 1 9  ? 1.109   14.215  -1.898  1.00 0.00 ? 12 THR A HA   6  
ATOM 3132  H HB   . THR A 1 9  ? 2.691   15.793  -0.054  1.00 0.00 ? 12 THR A HB   6  
ATOM 3133  H HG1  . THR A 1 9  ? 2.486   17.766  -1.198  1.00 0.00 ? 12 THR A HG1  6  
ATOM 3134  H HG21 . THR A 1 9  ? 3.627   14.540  -1.930  1.00 0.00 ? 12 THR A HG21 6  
ATOM 3135  H HG22 . THR A 1 9  ? 4.039   16.252  -2.008  1.00 0.00 ? 12 THR A HG22 6  
ATOM 3136  H HG23 . THR A 1 9  ? 2.779   15.600  -3.055  1.00 0.00 ? 12 THR A HG23 6  
ATOM 3137  N N    . ASN A 1 10 ? 0.708   14.491  1.373   1.00 0.00 ? 13 ASN A N    6  
ATOM 3138  C CA   . ASN A 1 10 ? 0.732   13.733  2.629   1.00 0.00 ? 13 ASN A CA   6  
ATOM 3139  C C    . ASN A 1 10 ? -0.011  12.413  2.492   1.00 0.00 ? 13 ASN A C    6  
ATOM 3140  O O    . ASN A 1 10 ? 0.377   11.393  3.065   1.00 0.00 ? 13 ASN A O    6  
ATOM 3141  C CB   . ASN A 1 10 ? 0.141   14.564  3.774   1.00 0.00 ? 13 ASN A CB   6  
ATOM 3142  C CG   . ASN A 1 10 ? 1.030   15.726  4.176   1.00 0.00 ? 13 ASN A CG   6  
ATOM 3143  O OD1  . ASN A 1 10 ? 1.929   16.122  3.439   1.00 0.00 ? 13 ASN A OD1  6  
ATOM 3144  N ND2  . ASN A 1 10 ? 0.783   16.282  5.353   1.00 0.00 ? 13 ASN A ND2  6  
ATOM 3145  H H    . ASN A 1 10 ? 0.394   15.420  1.381   1.00 0.00 ? 13 ASN A H    6  
ATOM 3146  H HA   . ASN A 1 10 ? 1.746   13.511  2.846   1.00 0.00 ? 13 ASN A HA   6  
ATOM 3147  H HB2  . ASN A 1 10 ? -0.815  14.960  3.466   1.00 0.00 ? 13 ASN A HB2  6  
ATOM 3148  H HB3  . ASN A 1 10 ? 0.000   13.929  4.636   1.00 0.00 ? 13 ASN A HB3  6  
ATOM 3149  H HD21 . ASN A 1 10 ? 0.052   15.920  5.893   1.00 0.00 ? 13 ASN A HD21 6  
ATOM 3150  H HD22 . ASN A 1 10 ? 1.344   17.034  5.633   1.00 0.00 ? 13 ASN A HD22 6  
ATOM 3151  N N    . ILE A 1 11 ? -1.062  12.451  1.705   1.00 0.00 ? 14 ILE A N    6  
ATOM 3152  C CA   . ILE A 1 11 ? -1.879  11.281  1.434   1.00 0.00 ? 14 ILE A CA   6  
ATOM 3153  C C    . ILE A 1 11 ? -1.260  10.460  0.307   1.00 0.00 ? 14 ILE A C    6  
ATOM 3154  O O    . ILE A 1 11 ? -1.069  9.252   0.442   1.00 0.00 ? 14 ILE A O    6  
ATOM 3155  C CB   . ILE A 1 11 ? -3.316  11.714  1.071   1.00 0.00 ? 14 ILE A CB   6  
ATOM 3156  C CG1  . ILE A 1 11 ? -4.192  11.762  2.323   1.00 0.00 ? 14 ILE A CG1  6  
ATOM 3157  C CG2  . ILE A 1 11 ? -3.937  10.792  0.030   1.00 0.00 ? 14 ILE A CG2  6  
ATOM 3158  C CD1  . ILE A 1 11 ? -4.042  13.038  3.123   1.00 0.00 ? 14 ILE A CD1  6  
ATOM 3159  H H    . ILE A 1 11 ? -1.287  13.296  1.273   1.00 0.00 ? 14 ILE A H    6  
ATOM 3160  H HA   . ILE A 1 11 ? -1.914  10.676  2.328   1.00 0.00 ? 14 ILE A HA   6  
ATOM 3161  H HB   . ILE A 1 11 ? -3.253  12.708  0.652   1.00 0.00 ? 14 ILE A HB   6  
ATOM 3162  H HG12 . ILE A 1 11 ? -5.228  11.675  2.032   1.00 0.00 ? 14 ILE A HG12 6  
ATOM 3163  H HG13 . ILE A 1 11 ? -3.933  10.933  2.967   1.00 0.00 ? 14 ILE A HG13 6  
ATOM 3164  H HG21 . ILE A 1 11 ? -3.879  9.770   0.374   1.00 0.00 ? 14 ILE A HG21 6  
ATOM 3165  H HG22 . ILE A 1 11 ? -3.403  10.889  -0.904  1.00 0.00 ? 14 ILE A HG22 6  
ATOM 3166  H HG23 . ILE A 1 11 ? -4.973  11.062  -0.118  1.00 0.00 ? 14 ILE A HG23 6  
ATOM 3167  H HD11 . ILE A 1 11 ? -3.000  13.317  3.164   1.00 0.00 ? 14 ILE A HD11 6  
ATOM 3168  H HD12 . ILE A 1 11 ? -4.413  12.880  4.125   1.00 0.00 ? 14 ILE A HD12 6  
ATOM 3169  H HD13 . ILE A 1 11 ? -4.609  13.827  2.650   1.00 0.00 ? 14 ILE A HD13 6  
ATOM 3170  N N    . MET A 1 12 ? -0.920  11.129  -0.797  1.00 0.00 ? 15 MET A N    6  
ATOM 3171  C CA   . MET A 1 12 ? -0.298  10.468  -1.935  1.00 0.00 ? 15 MET A CA   6  
ATOM 3172  C C    . MET A 1 12 ? 0.947   9.696   -1.491  1.00 0.00 ? 15 MET A C    6  
ATOM 3173  O O    . MET A 1 12 ? 1.126   8.529   -1.850  1.00 0.00 ? 15 MET A O    6  
ATOM 3174  C CB   . MET A 1 12 ? 0.065   11.505  -2.997  1.00 0.00 ? 15 MET A CB   6  
ATOM 3175  C CG   . MET A 1 12 ? -0.525  11.207  -4.364  1.00 0.00 ? 15 MET A CG   6  
ATOM 3176  S SD   . MET A 1 12 ? 0.736   10.830  -5.597  1.00 0.00 ? 15 MET A SD   6  
ATOM 3177  C CE   . MET A 1 12 ? 1.081   12.467  -6.241  1.00 0.00 ? 15 MET A CE   6  
ATOM 3178  H H    . MET A 1 12 ? -1.079  12.099  -0.841  1.00 0.00 ? 15 MET A H    6  
ATOM 3179  H HA   . MET A 1 12 ? -1.011  9.770   -2.348  1.00 0.00 ? 15 MET A HA   6  
ATOM 3180  H HB2  . MET A 1 12 ? -0.298  12.471  -2.678  1.00 0.00 ? 15 MET A HB2  6  
ATOM 3181  H HB3  . MET A 1 12 ? 1.136   11.549  -3.090  1.00 0.00 ? 15 MET A HB3  6  
ATOM 3182  H HG2  . MET A 1 12 ? -1.188  10.359  -4.278  1.00 0.00 ? 15 MET A HG2  6  
ATOM 3183  H HG3  . MET A 1 12 ? -1.086  12.069  -4.693  1.00 0.00 ? 15 MET A HG3  6  
ATOM 3184  H HE1  . MET A 1 12 ? 0.334   13.160  -5.883  1.00 0.00 ? 15 MET A HE1  6  
ATOM 3185  H HE2  . MET A 1 12 ? 1.060   12.441  -7.320  1.00 0.00 ? 15 MET A HE2  6  
ATOM 3186  H HE3  . MET A 1 12 ? 2.057   12.786  -5.907  1.00 0.00 ? 15 MET A HE3  6  
ATOM 3187  N N    . ASN A 1 13 ? 1.794   10.350  -0.690  1.00 0.00 ? 16 ASN A N    6  
ATOM 3188  C CA   . ASN A 1 13 ? 3.008   9.725   -0.178  1.00 0.00 ? 16 ASN A CA   6  
ATOM 3189  C C    . ASN A 1 13 ? 2.672   8.455   0.603   1.00 0.00 ? 16 ASN A C    6  
ATOM 3190  O O    . ASN A 1 13 ? 3.268   7.399   0.377   1.00 0.00 ? 16 ASN A O    6  
ATOM 3191  C CB   . ASN A 1 13 ? 3.779   10.719  0.703   1.00 0.00 ? 16 ASN A CB   6  
ATOM 3192  C CG   . ASN A 1 13 ? 4.759   10.041  1.640   1.00 0.00 ? 16 ASN A CG   6  
ATOM 3193  O OD1  . ASN A 1 13 ? 5.855   9.661   1.239   1.00 0.00 ? 16 ASN A OD1  6  
ATOM 3194  N ND2  . ASN A 1 13 ? 4.368   9.882   2.895   1.00 0.00 ? 16 ASN A ND2  6  
ATOM 3195  H H    . ASN A 1 13 ? 1.586   11.277  -0.426  1.00 0.00 ? 16 ASN A H    6  
ATOM 3196  H HA   . ASN A 1 13 ? 3.618   9.455   -1.020  1.00 0.00 ? 16 ASN A HA   6  
ATOM 3197  H HB2  . ASN A 1 13 ? 4.333   11.395  0.071   1.00 0.00 ? 16 ASN A HB2  6  
ATOM 3198  H HB3  . ASN A 1 13 ? 3.076   11.285  1.297   1.00 0.00 ? 16 ASN A HB3  6  
ATOM 3199  H HD21 . ASN A 1 13 ? 3.479   10.205  3.150   1.00 0.00 ? 16 ASN A HD21 6  
ATOM 3200  H HD22 . ASN A 1 13 ? 4.984   9.448   3.517   1.00 0.00 ? 16 ASN A HD22 6  
ATOM 3201  N N    . LEU A 1 14 ? 1.701   8.560   1.508   1.00 0.00 ? 17 LEU A N    6  
ATOM 3202  C CA   . LEU A 1 14 ? 1.279   7.410   2.302   1.00 0.00 ? 17 LEU A CA   6  
ATOM 3203  C C    . LEU A 1 14 ? 0.608   6.366   1.410   1.00 0.00 ? 17 LEU A C    6  
ATOM 3204  O O    . LEU A 1 14 ? 0.875   5.170   1.538   1.00 0.00 ? 17 LEU A O    6  
ATOM 3205  C CB   . LEU A 1 14 ? 0.361   7.848   3.456   1.00 0.00 ? 17 LEU A CB   6  
ATOM 3206  C CG   . LEU A 1 14 ? -1.141  7.727   3.195   1.00 0.00 ? 17 LEU A CG   6  
ATOM 3207  C CD1  . LEU A 1 14 ? -1.656  6.368   3.639   1.00 0.00 ? 17 LEU A CD1  6  
ATOM 3208  C CD2  . LEU A 1 14 ? -1.897  8.839   3.903   1.00 0.00 ? 17 LEU A CD2  6  
ATOM 3209  H H    . LEU A 1 14 ? 1.253   9.423   1.630   1.00 0.00 ? 17 LEU A H    6  
ATOM 3210  H HA   . LEU A 1 14 ? 2.166   6.965   2.717   1.00 0.00 ? 17 LEU A HA   6  
ATOM 3211  H HB2  . LEU A 1 14 ? 0.601   7.250   4.322   1.00 0.00 ? 17 LEU A HB2  6  
ATOM 3212  H HB3  . LEU A 1 14 ? 0.579   8.881   3.685   1.00 0.00 ? 17 LEU A HB3  6  
ATOM 3213  H HG   . LEU A 1 14 ? -1.318  7.822   2.137   1.00 0.00 ? 17 LEU A HG   6  
ATOM 3214  H HD11 . LEU A 1 14 ? -2.574  6.494   4.193   1.00 0.00 ? 17 LEU A HD11 6  
ATOM 3215  H HD12 . LEU A 1 14 ? -0.920  5.889   4.267   1.00 0.00 ? 17 LEU A HD12 6  
ATOM 3216  H HD13 . LEU A 1 14 ? -1.841  5.753   2.770   1.00 0.00 ? 17 LEU A HD13 6  
ATOM 3217  H HD21 . LEU A 1 14 ? -1.261  9.707   3.994   1.00 0.00 ? 17 LEU A HD21 6  
ATOM 3218  H HD22 . LEU A 1 14 ? -2.192  8.503   4.886   1.00 0.00 ? 17 LEU A HD22 6  
ATOM 3219  H HD23 . LEU A 1 14 ? -2.777  9.095   3.332   1.00 0.00 ? 17 LEU A HD23 6  
ATOM 3220  N N    . LEU A 1 15 ? -0.240  6.823   0.485   1.00 0.00 ? 18 LEU A N    6  
ATOM 3221  C CA   . LEU A 1 15 ? -0.919  5.918   -0.440  1.00 0.00 ? 18 LEU A CA   6  
ATOM 3222  C C    . LEU A 1 15 ? 0.102   5.162   -1.287  1.00 0.00 ? 18 LEU A C    6  
ATOM 3223  O O    . LEU A 1 15 ? 0.018   3.939   -1.431  1.00 0.00 ? 18 LEU A O    6  
ATOM 3224  C CB   . LEU A 1 15 ? -1.887  6.692   -1.342  1.00 0.00 ? 18 LEU A CB   6  
ATOM 3225  C CG   . LEU A 1 15 ? -3.134  7.242   -0.646  1.00 0.00 ? 18 LEU A CG   6  
ATOM 3226  C CD1  . LEU A 1 15 ? -4.046  7.926   -1.652  1.00 0.00 ? 18 LEU A CD1  6  
ATOM 3227  C CD2  . LEU A 1 15 ? -3.880  6.133   0.076   1.00 0.00 ? 18 LEU A CD2  6  
ATOM 3228  H H    . LEU A 1 15 ? -0.401  7.795   0.414   1.00 0.00 ? 18 LEU A H    6  
ATOM 3229  H HA   . LEU A 1 15 ? -1.472  5.203   0.146   1.00 0.00 ? 18 LEU A HA   6  
ATOM 3230  H HB2  . LEU A 1 15 ? -1.351  7.521   -1.781  1.00 0.00 ? 18 LEU A HB2  6  
ATOM 3231  H HB3  . LEU A 1 15 ? -2.208  6.034   -2.137  1.00 0.00 ? 18 LEU A HB3  6  
ATOM 3232  H HG   . LEU A 1 15 ? -2.835  7.978   0.086   1.00 0.00 ? 18 LEU A HG   6  
ATOM 3233  H HD11 . LEU A 1 15 ? -4.305  7.227   -2.435  1.00 0.00 ? 18 LEU A HD11 6  
ATOM 3234  H HD12 . LEU A 1 15 ? -3.536  8.776   -2.081  1.00 0.00 ? 18 LEU A HD12 6  
ATOM 3235  H HD13 . LEU A 1 15 ? -4.945  8.258   -1.155  1.00 0.00 ? 18 LEU A HD13 6  
ATOM 3236  H HD21 . LEU A 1 15 ? -4.783  6.533   0.514   1.00 0.00 ? 18 LEU A HD21 6  
ATOM 3237  H HD22 . LEU A 1 15 ? -3.253  5.725   0.855   1.00 0.00 ? 18 LEU A HD22 6  
ATOM 3238  H HD23 . LEU A 1 15 ? -4.135  5.354   -0.626  1.00 0.00 ? 18 LEU A HD23 6  
ATOM 3239  N N    . PHE A 1 16 ? 1.076   5.896   -1.826  1.00 0.00 ? 19 PHE A N    6  
ATOM 3240  C CA   . PHE A 1 16 ? 2.131   5.304   -2.645  1.00 0.00 ? 19 PHE A CA   6  
ATOM 3241  C C    . PHE A 1 16 ? 2.855   4.195   -1.887  1.00 0.00 ? 19 PHE A C    6  
ATOM 3242  O O    . PHE A 1 16 ? 3.127   3.130   -2.442  1.00 0.00 ? 19 PHE A O    6  
ATOM 3243  C CB   . PHE A 1 16 ? 3.139   6.375   -3.062  1.00 0.00 ? 19 PHE A CB   6  
ATOM 3244  C CG   . PHE A 1 16 ? 3.733   6.146   -4.424  1.00 0.00 ? 19 PHE A CG   6  
ATOM 3245  C CD1  . PHE A 1 16 ? 2.959   6.281   -5.566  1.00 0.00 ? 19 PHE A CD1  6  
ATOM 3246  C CD2  . PHE A 1 16 ? 5.066   5.793   -4.563  1.00 0.00 ? 19 PHE A CD2  6  
ATOM 3247  C CE1  . PHE A 1 16 ? 3.503   6.069   -6.819  1.00 0.00 ? 19 PHE A CE1  6  
ATOM 3248  C CE2  . PHE A 1 16 ? 5.616   5.580   -5.813  1.00 0.00 ? 19 PHE A CE2  6  
ATOM 3249  C CZ   . PHE A 1 16 ? 4.833   5.718   -6.942  1.00 0.00 ? 19 PHE A CZ   6  
ATOM 3250  H H    . PHE A 1 16 ? 1.090   6.868   -1.660  1.00 0.00 ? 19 PHE A H    6  
ATOM 3251  H HA   . PHE A 1 16 ? 1.675   4.882   -3.529  1.00 0.00 ? 19 PHE A HA   6  
ATOM 3252  H HB2  . PHE A 1 16 ? 2.648   7.334   -3.065  1.00 0.00 ? 19 PHE A HB2  6  
ATOM 3253  H HB3  . PHE A 1 16 ? 3.948   6.398   -2.345  1.00 0.00 ? 19 PHE A HB3  6  
ATOM 3254  H HD1  . PHE A 1 16 ? 1.919   6.557   -5.469  1.00 0.00 ? 19 PHE A HD1  6  
ATOM 3255  H HD2  . PHE A 1 16 ? 5.679   5.685   -3.680  1.00 0.00 ? 19 PHE A HD2  6  
ATOM 3256  H HE1  . PHE A 1 16 ? 2.887   6.176   -7.701  1.00 0.00 ? 19 PHE A HE1  6  
ATOM 3257  H HE2  . PHE A 1 16 ? 6.657   5.306   -5.907  1.00 0.00 ? 19 PHE A HE2  6  
ATOM 3258  H HZ   . PHE A 1 16 ? 5.259   5.552   -7.921  1.00 0.00 ? 19 PHE A HZ   6  
ATOM 3259  N N    . ASN A 1 17 ? 3.163   4.457   -0.618  1.00 0.00 ? 20 ASN A N    6  
ATOM 3260  C CA   . ASN A 1 17 ? 3.859   3.480   0.217   1.00 0.00 ? 20 ASN A CA   6  
ATOM 3261  C C    . ASN A 1 17 ? 2.916   2.365   0.660   1.00 0.00 ? 20 ASN A C    6  
ATOM 3262  O O    . ASN A 1 17 ? 3.262   1.186   0.575   1.00 0.00 ? 20 ASN A O    6  
ATOM 3263  C CB   . ASN A 1 17 ? 4.483   4.161   1.430   1.00 0.00 ? 20 ASN A CB   6  
ATOM 3264  C CG   . ASN A 1 17 ? 5.866   3.625   1.747   1.00 0.00 ? 20 ASN A CG   6  
ATOM 3265  O OD1  . ASN A 1 17 ? 6.092   3.052   2.809   1.00 0.00 ? 20 ASN A OD1  6  
ATOM 3266  N ND2  . ASN A 1 17 ? 6.799   3.806   0.825   1.00 0.00 ? 20 ASN A ND2  6  
ATOM 3267  H H    . ASN A 1 17 ? 2.912   5.331   -0.234  1.00 0.00 ? 20 ASN A H    6  
ATOM 3268  H HA   . ASN A 1 17 ? 4.646   3.042   -0.381  1.00 0.00 ? 20 ASN A HA   6  
ATOM 3269  H HB2  . ASN A 1 17 ? 4.561   5.218   1.239   1.00 0.00 ? 20 ASN A HB2  6  
ATOM 3270  H HB3  . ASN A 1 17 ? 3.851   3.999   2.285   1.00 0.00 ? 20 ASN A HB3  6  
ATOM 3271  H HD21 . ASN A 1 17 ? 6.552   4.268   -0.002  1.00 0.00 ? 20 ASN A HD21 6  
ATOM 3272  H HD22 . ASN A 1 17 ? 7.699   3.467   1.010   1.00 0.00 ? 20 ASN A HD22 6  
ATOM 3273  N N    . ILE A 1 18 ? 1.719   2.738   1.119   1.00 0.00 ? 21 ILE A N    6  
ATOM 3274  C CA   . ILE A 1 18 ? 0.731   1.750   1.551   1.00 0.00 ? 21 ILE A CA   6  
ATOM 3275  C C    . ILE A 1 18 ? 0.544   0.697   0.465   1.00 0.00 ? 21 ILE A C    6  
ATOM 3276  O O    . ILE A 1 18 ? 0.802   -0.486  0.694   1.00 0.00 ? 21 ILE A O    6  
ATOM 3277  C CB   . ILE A 1 18 ? -0.629  2.407   1.894   1.00 0.00 ? 21 ILE A CB   6  
ATOM 3278  C CG1  . ILE A 1 18 ? -0.567  3.060   3.277   1.00 0.00 ? 21 ILE A CG1  6  
ATOM 3279  C CG2  . ILE A 1 18 ? -1.759  1.383   1.845   1.00 0.00 ? 21 ILE A CG2  6  
ATOM 3280  C CD1  . ILE A 1 18 ? -0.273  2.086   4.400   1.00 0.00 ? 21 ILE A CD1  6  
ATOM 3281  H H    . ILE A 1 18 ? 1.495   3.698   1.156   1.00 0.00 ? 21 ILE A H    6  
ATOM 3282  H HA   . ILE A 1 18 ? 1.110   1.264   2.439   1.00 0.00 ? 21 ILE A HA   6  
ATOM 3283  H HB   . ILE A 1 18 ? -0.833  3.168   1.155   1.00 0.00 ? 21 ILE A HB   6  
ATOM 3284  H HG12 . ILE A 1 18 ? 0.210   3.810   3.279   1.00 0.00 ? 21 ILE A HG12 6  
ATOM 3285  H HG13 . ILE A 1 18 ? -1.516  3.532   3.486   1.00 0.00 ? 21 ILE A HG13 6  
ATOM 3286  H HG21 . ILE A 1 18 ? -1.482  0.513   2.422   1.00 0.00 ? 21 ILE A HG21 6  
ATOM 3287  H HG22 . ILE A 1 18 ? -1.941  1.094   0.820   1.00 0.00 ? 21 ILE A HG22 6  
ATOM 3288  H HG23 . ILE A 1 18 ? -2.655  1.820   2.261   1.00 0.00 ? 21 ILE A HG23 6  
ATOM 3289  H HD11 . ILE A 1 18 ? 0.658   2.356   4.875   1.00 0.00 ? 21 ILE A HD11 6  
ATOM 3290  H HD12 . ILE A 1 18 ? -0.198  1.086   4.000   1.00 0.00 ? 21 ILE A HD12 6  
ATOM 3291  H HD13 . ILE A 1 18 ? -1.072  2.124   5.126   1.00 0.00 ? 21 ILE A HD13 6  
ATOM 3292  N N    . ALA A 1 19 ? 0.139   1.136   -0.730  1.00 0.00 ? 22 ALA A N    6  
ATOM 3293  C CA   . ALA A 1 19 ? -0.034  0.221   -1.857  1.00 0.00 ? 22 ALA A CA   6  
ATOM 3294  C C    . ALA A 1 19 ? 1.261   -0.557  -2.101  1.00 0.00 ? 22 ALA A C    6  
ATOM 3295  O O    . ALA A 1 19 ? 1.239   -1.750  -2.415  1.00 0.00 ? 22 ALA A O    6  
ATOM 3296  C CB   . ALA A 1 19 ? -0.446  0.993   -3.106  1.00 0.00 ? 22 ALA A CB   6  
ATOM 3297  H H    . ALA A 1 19 ? -0.018  2.099   -0.862  1.00 0.00 ? 22 ALA A H    6  
ATOM 3298  H HA   . ALA A 1 19 ? -0.822  -0.476  -1.609  1.00 0.00 ? 22 ALA A HA   6  
ATOM 3299  H HB1  . ALA A 1 19 ? 0.397   1.558   -3.475  1.00 0.00 ? 22 ALA A HB1  6  
ATOM 3300  H HB2  . ALA A 1 19 ? -1.253  1.668   -2.862  1.00 0.00 ? 22 ALA A HB2  6  
ATOM 3301  H HB3  . ALA A 1 19 ? -0.775  0.299   -3.866  1.00 0.00 ? 22 ALA A HB3  6  
ATOM 3302  N N    . LYS A 1 20 ? 2.389   0.133   -1.921  1.00 0.00 ? 23 LYS A N    6  
ATOM 3303  C CA   . LYS A 1 20 ? 3.708   -0.467  -2.088  1.00 0.00 ? 23 LYS A CA   6  
ATOM 3304  C C    . LYS A 1 20 ? 3.882   -1.665  -1.155  1.00 0.00 ? 23 LYS A C    6  
ATOM 3305  O O    . LYS A 1 20 ? 4.071   -2.790  -1.612  1.00 0.00 ? 23 LYS A O    6  
ATOM 3306  C CB   . LYS A 1 20 ? 4.794   0.583   -1.810  1.00 0.00 ? 23 LYS A CB   6  
ATOM 3307  C CG   . LYS A 1 20 ? 5.969   0.544   -2.774  1.00 0.00 ? 23 LYS A CG   6  
ATOM 3308  C CD   . LYS A 1 20 ? 5.521   0.633   -4.229  1.00 0.00 ? 23 LYS A CD   6  
ATOM 3309  C CE   . LYS A 1 20 ? 4.756   1.919   -4.505  1.00 0.00 ? 23 LYS A CE   6  
ATOM 3310  N NZ   . LYS A 1 20 ? 4.667   2.210   -5.966  1.00 0.00 ? 23 LYS A NZ   6  
ATOM 3311  H H    . LYS A 1 20 ? 2.330   1.074   -1.654  1.00 0.00 ? 23 LYS A H    6  
ATOM 3312  H HA   . LYS A 1 20 ? 3.793   -0.807  -3.106  1.00 0.00 ? 23 LYS A HA   6  
ATOM 3313  H HB2  . LYS A 1 20 ? 4.350   1.563   -1.863  1.00 0.00 ? 23 LYS A HB2  6  
ATOM 3314  H HB3  . LYS A 1 20 ? 5.176   0.430   -0.810  1.00 0.00 ? 23 LYS A HB3  6  
ATOM 3315  H HG2  . LYS A 1 20 ? 6.621   1.378   -2.560  1.00 0.00 ? 23 LYS A HG2  6  
ATOM 3316  H HG3  . LYS A 1 20 ? 6.506   -0.377  -2.623  1.00 0.00 ? 23 LYS A HG3  6  
ATOM 3317  H HD2  . LYS A 1 20 ? 6.392   0.601   -4.865  1.00 0.00 ? 23 LYS A HD2  6  
ATOM 3318  H HD3  . LYS A 1 20 ? 4.882   -0.210  -4.451  1.00 0.00 ? 23 LYS A HD3  6  
ATOM 3319  H HE2  . LYS A 1 20 ? 3.757   1.822   -4.103  1.00 0.00 ? 23 LYS A HE2  6  
ATOM 3320  H HE3  . LYS A 1 20 ? 5.263   2.737   -4.011  1.00 0.00 ? 23 LYS A HE3  6  
ATOM 3321  H HZ1  . LYS A 1 20 ? 5.619   2.251   -6.383  1.00 0.00 ? 23 LYS A HZ1  6  
ATOM 3322  H HZ2  . LYS A 1 20 ? 4.193   3.126   -6.119  1.00 0.00 ? 23 LYS A HZ2  6  
ATOM 3323  H HZ3  . LYS A 1 20 ? 4.122   1.465   -6.446  1.00 0.00 ? 23 LYS A HZ3  6  
ATOM 3324  N N    . ALA A 1 21 ? 3.809   -1.418  0.150   1.00 0.00 ? 24 ALA A N    6  
ATOM 3325  C CA   . ALA A 1 21 ? 3.958   -2.484  1.140   1.00 0.00 ? 24 ALA A CA   6  
ATOM 3326  C C    . ALA A 1 21 ? 2.773   -3.453  1.118   1.00 0.00 ? 24 ALA A C    6  
ATOM 3327  O O    . ALA A 1 21 ? 2.959   -4.661  1.283   1.00 0.00 ? 24 ALA A O    6  
ATOM 3328  C CB   . ALA A 1 21 ? 4.134   -1.888  2.530   1.00 0.00 ? 24 ALA A CB   6  
ATOM 3329  H H    . ALA A 1 21 ? 3.648   -0.494  0.455   1.00 0.00 ? 24 ALA A H    6  
ATOM 3330  H HA   . ALA A 1 21 ? 4.856   -3.042  0.900   1.00 0.00 ? 24 ALA A HA   6  
ATOM 3331  H HB1  . ALA A 1 21 ? 4.851   -1.081  2.487   1.00 0.00 ? 24 ALA A HB1  6  
ATOM 3332  H HB2  . ALA A 1 21 ? 4.489   -2.650  3.208   1.00 0.00 ? 24 ALA A HB2  6  
ATOM 3333  H HB3  . ALA A 1 21 ? 3.186   -1.506  2.882   1.00 0.00 ? 24 ALA A HB3  6  
ATOM 3334  N N    . LYS A 1 22 ? 1.559   -2.933  0.907   1.00 0.00 ? 25 LYS A N    6  
ATOM 3335  C CA   . LYS A 1 22 ? 0.371   -3.777  0.865   1.00 0.00 ? 25 LYS A CA   6  
ATOM 3336  C C    . LYS A 1 22 ? 0.475   -4.794  -0.259  1.00 0.00 ? 25 LYS A C    6  
ATOM 3337  O O    . LYS A 1 22 ? 0.212   -5.980  -0.055  1.00 0.00 ? 25 LYS A O    6  
ATOM 3338  C CB   . LYS A 1 22 ? -0.892  -2.931  0.699   1.00 0.00 ? 25 LYS A CB   6  
ATOM 3339  C CG   . LYS A 1 22 ? -1.954  -3.225  1.742   1.00 0.00 ? 25 LYS A CG   6  
ATOM 3340  C CD   . LYS A 1 22 ? -3.177  -3.892  1.124   1.00 0.00 ? 25 LYS A CD   6  
ATOM 3341  C CE   . LYS A 1 22 ? -4.462  -3.174  1.501   1.00 0.00 ? 25 LYS A CE   6  
ATOM 3342  N NZ   . LYS A 1 22 ? -4.790  -3.344  2.947   1.00 0.00 ? 25 LYS A NZ   6  
ATOM 3343  H H    . LYS A 1 22 ? 1.461   -1.963  0.767   1.00 0.00 ? 25 LYS A H    6  
ATOM 3344  H HA   . LYS A 1 22 ? 0.315   -4.310  1.803   1.00 0.00 ? 25 LYS A HA   6  
ATOM 3345  H HB2  . LYS A 1 22 ? -0.627  -1.889  0.775   1.00 0.00 ? 25 LYS A HB2  6  
ATOM 3346  H HB3  . LYS A 1 22 ? -1.313  -3.117  -0.278  1.00 0.00 ? 25 LYS A HB3  6  
ATOM 3347  H HG2  . LYS A 1 22 ? -1.536  -3.884  2.491   1.00 0.00 ? 25 LYS A HG2  6  
ATOM 3348  H HG3  . LYS A 1 22 ? -2.250  -2.296  2.203   1.00 0.00 ? 25 LYS A HG3  6  
ATOM 3349  H HD2  . LYS A 1 22 ? -3.076  -3.881  0.049   1.00 0.00 ? 25 LYS A HD2  6  
ATOM 3350  H HD3  . LYS A 1 22 ? -3.230  -4.914  1.470   1.00 0.00 ? 25 LYS A HD3  6  
ATOM 3351  H HE2  . LYS A 1 22 ? -4.348  -2.120  1.285   1.00 0.00 ? 25 LYS A HE2  6  
ATOM 3352  H HE3  . LYS A 1 22 ? -5.271  -3.576  0.905   1.00 0.00 ? 25 LYS A HE3  6  
ATOM 3353  H HZ1  . LYS A 1 22 ? -5.722  -2.929  3.156   1.00 0.00 ? 25 LYS A HZ1  6  
ATOM 3354  H HZ2  . LYS A 1 22 ? -4.073  -2.870  3.535   1.00 0.00 ? 25 LYS A HZ2  6  
ATOM 3355  H HZ3  . LYS A 1 22 ? -4.808  -4.355  3.194   1.00 0.00 ? 25 LYS A HZ3  6  
ATOM 3356  N N    . ASN A 1 23 ? 0.881   -4.338  -1.441  1.00 0.00 ? 26 ASN A N    6  
ATOM 3357  C CA   . ASN A 1 23 ? 1.031   -5.243  -2.578  1.00 0.00 ? 26 ASN A CA   6  
ATOM 3358  C C    . ASN A 1 23 ? 2.252   -6.143  -2.375  1.00 0.00 ? 26 ASN A C    6  
ATOM 3359  O O    . ASN A 1 23 ? 2.191   -7.346  -2.617  1.00 0.00 ? 26 ASN A O    6  
ATOM 3360  C CB   . ASN A 1 23 ? 1.114   -4.457  -3.901  1.00 0.00 ? 26 ASN A CB   6  
ATOM 3361  C CG   . ASN A 1 23 ? 2.513   -4.394  -4.484  1.00 0.00 ? 26 ASN A CG   6  
ATOM 3362  O OD1  . ASN A 1 23 ? 2.906   -5.246  -5.273  1.00 0.00 ? 26 ASN A OD1  6  
ATOM 3363  N ND2  . ASN A 1 23 ? 3.271   -3.384  -4.095  1.00 0.00 ? 26 ASN A ND2  6  
ATOM 3364  H H    . ASN A 1 23 ? 1.099   -3.377  -1.543  1.00 0.00 ? 26 ASN A H    6  
ATOM 3365  H HA   . ASN A 1 23 ? 0.151   -5.872  -2.605  1.00 0.00 ? 26 ASN A HA   6  
ATOM 3366  H HB2  . ASN A 1 23 ? 0.472   -4.927  -4.628  1.00 0.00 ? 26 ASN A HB2  6  
ATOM 3367  H HB3  . ASN A 1 23 ? 0.771   -3.447  -3.731  1.00 0.00 ? 26 ASN A HB3  6  
ATOM 3368  H HD21 . ASN A 1 23 ? 2.895   -2.740  -3.460  1.00 0.00 ? 26 ASN A HD21 6  
ATOM 3369  H HD22 . ASN A 1 23 ? 4.177   -3.325  -4.456  1.00 0.00 ? 26 ASN A HD22 6  
ATOM 3370  N N    . LEU A 1 24 ? 3.352   -5.551  -1.907  1.00 0.00 ? 27 LEU A N    6  
ATOM 3371  C CA   . LEU A 1 24 ? 4.588   -6.290  -1.651  1.00 0.00 ? 27 LEU A CA   6  
ATOM 3372  C C    . LEU A 1 24 ? 4.380   -7.403  -0.627  1.00 0.00 ? 27 LEU A C    6  
ATOM 3373  O O    . LEU A 1 24 ? 4.699   -8.564  -0.879  1.00 0.00 ? 27 LEU A O    6  
ATOM 3374  C CB   . LEU A 1 24 ? 5.694   -5.314  -1.214  1.00 0.00 ? 27 LEU A CB   6  
ATOM 3375  C CG   . LEU A 1 24 ? 6.547   -5.765  -0.036  1.00 0.00 ? 27 LEU A CG   6  
ATOM 3376  C CD1  . LEU A 1 24 ? 7.814   -6.448  -0.521  1.00 0.00 ? 27 LEU A CD1  6  
ATOM 3377  C CD2  . LEU A 1 24 ? 6.884   -4.588  0.865   1.00 0.00 ? 27 LEU A CD2  6  
ATOM 3378  H H    . LEU A 1 24 ? 3.330   -4.586  -1.720  1.00 0.00 ? 27 LEU A H    6  
ATOM 3379  H HA   . LEU A 1 24 ? 4.883   -6.750  -2.556  1.00 0.00 ? 27 LEU A HA   6  
ATOM 3380  H HB2  . LEU A 1 24 ? 6.346   -5.144  -2.058  1.00 0.00 ? 27 LEU A HB2  6  
ATOM 3381  H HB3  . LEU A 1 24 ? 5.230   -4.377  -0.951  1.00 0.00 ? 27 LEU A HB3  6  
ATOM 3382  H HG   . LEU A 1 24 ? 5.984   -6.475  0.538   1.00 0.00 ? 27 LEU A HG   6  
ATOM 3383  H HD11 . LEU A 1 24 ? 7.605   -7.487  -0.728  1.00 0.00 ? 27 LEU A HD11 6  
ATOM 3384  H HD12 . LEU A 1 24 ? 8.575   -6.378  0.243   1.00 0.00 ? 27 LEU A HD12 6  
ATOM 3385  H HD13 . LEU A 1 24 ? 8.163   -5.964  -1.421  1.00 0.00 ? 27 LEU A HD13 6  
ATOM 3386  H HD21 . LEU A 1 24 ? 6.948   -3.687  0.273   1.00 0.00 ? 27 LEU A HD21 6  
ATOM 3387  H HD22 . LEU A 1 24 ? 7.830   -4.767  1.351   1.00 0.00 ? 27 LEU A HD22 6  
ATOM 3388  H HD23 . LEU A 1 24 ? 6.111   -4.476  1.611   1.00 0.00 ? 27 LEU A HD23 6  
ATOM 3389  N N    . ARG A 1 25 ? 3.844   -7.038  0.521   1.00 0.00 ? 28 ARG A N    6  
ATOM 3390  C CA   . ARG A 1 25 ? 3.589   -8.000  1.599   1.00 0.00 ? 28 ARG A CA   6  
ATOM 3391  C C    . ARG A 1 25 ? 2.492   -8.992  1.223   1.00 0.00 ? 28 ARG A C    6  
ATOM 3392  O O    . ARG A 1 25 ? 2.623   -10.184 1.494   1.00 0.00 ? 28 ARG A O    6  
ATOM 3393  C CB   . ARG A 1 25 ? 3.225   -7.275  2.899   1.00 0.00 ? 28 ARG A CB   6  
ATOM 3394  C CG   . ARG A 1 25 ? 4.230   -7.499  4.019   1.00 0.00 ? 28 ARG A CG   6  
ATOM 3395  C CD   . ARG A 1 25 ? 3.542   -7.853  5.328   1.00 0.00 ? 28 ARG A CD   6  
ATOM 3396  N NE   . ARG A 1 25 ? 4.499   -8.299  6.345   1.00 0.00 ? 28 ARG A NE   6  
ATOM 3397  C CZ   . ARG A 1 25 ? 4.276   -8.264  7.656   1.00 0.00 ? 28 ARG A CZ   6  
ATOM 3398  N NH1  . ARG A 1 25 ? 3.124   -7.829  8.129   1.00 0.00 ? 28 ARG A NH1  6  
ATOM 3399  N NH2  . ARG A 1 25 ? 5.209   -8.678  8.492   1.00 0.00 ? 28 ARG A NH2  6  
ATOM 3400  H H    . ARG A 1 25 ? 3.614   -6.095  0.645   1.00 0.00 ? 28 ARG A H    6  
ATOM 3401  H HA   . ARG A 1 25 ? 4.498   -8.562  1.756   1.00 0.00 ? 28 ARG A HA   6  
ATOM 3402  H HB2  . ARG A 1 25 ? 3.167   -6.215  2.704   1.00 0.00 ? 28 ARG A HB2  6  
ATOM 3403  H HB3  . ARG A 1 25 ? 2.259   -7.623  3.235   1.00 0.00 ? 28 ARG A HB3  6  
ATOM 3404  H HG2  . ARG A 1 25 ? 4.890   -8.307  3.742   1.00 0.00 ? 28 ARG A HG2  6  
ATOM 3405  H HG3  . ARG A 1 25 ? 4.806   -6.595  4.159   1.00 0.00 ? 28 ARG A HG3  6  
ATOM 3406  H HD2  . ARG A 1 25 ? 3.020   -6.979  5.690   1.00 0.00 ? 28 ARG A HD2  6  
ATOM 3407  H HD3  . ARG A 1 25 ? 2.829   -8.647  5.141   1.00 0.00 ? 28 ARG A HD3  6  
ATOM 3408  H HE   . ARG A 1 25 ? 5.362   -8.640  6.030   1.00 0.00 ? 28 ARG A HE   6  
ATOM 3409  H HH11 . ARG A 1 25 ? 2.411   -7.524  7.504   1.00 0.00 ? 28 ARG A HH11 6  
ATOM 3410  H HH12 . ARG A 1 25 ? 2.966   -7.806  9.115   1.00 0.00 ? 28 ARG A HH12 6  
ATOM 3411  H HH21 . ARG A 1 25 ? 6.080   -9.017  8.140   1.00 0.00 ? 28 ARG A HH21 6  
ATOM 3412  H HH22 . ARG A 1 25 ? 5.045   -8.652  9.477   1.00 0.00 ? 28 ARG A HH22 6  
ATOM 3413  N N    . ALA A 1 26 ? 1.427   -8.513  0.583   1.00 0.00 ? 29 ALA A N    6  
ATOM 3414  C CA   . ALA A 1 26 ? 0.341   -9.395  0.171   1.00 0.00 ? 29 ALA A CA   6  
ATOM 3415  C C    . ALA A 1 26 ? 0.835   -10.373 -0.885  1.00 0.00 ? 29 ALA A C    6  
ATOM 3416  O O    . ALA A 1 26 ? 0.512   -11.557 -0.846  1.00 0.00 ? 29 ALA A O    6  
ATOM 3417  C CB   . ALA A 1 26 ? -0.838  -8.586  -0.352  1.00 0.00 ? 29 ALA A CB   6  
ATOM 3418  H H    . ALA A 1 26 ? 1.378   -7.558  0.367   1.00 0.00 ? 29 ALA A H    6  
ATOM 3419  H HA   . ALA A 1 26 ? 0.014   -9.952  1.037   1.00 0.00 ? 29 ALA A HA   6  
ATOM 3420  H HB1  . ALA A 1 26 ? -0.522  -7.995  -1.201  1.00 0.00 ? 29 ALA A HB1  6  
ATOM 3421  H HB2  . ALA A 1 26 ? -1.200  -7.931  0.427   1.00 0.00 ? 29 ALA A HB2  6  
ATOM 3422  H HB3  . ALA A 1 26 ? -1.630  -9.257  -0.655  1.00 0.00 ? 29 ALA A HB3  6  
ATOM 3423  N N    . GLN A 1 27 ? 1.635   -9.864  -1.818  1.00 0.00 ? 30 GLN A N    6  
ATOM 3424  C CA   . GLN A 1 27 ? 2.190   -10.692 -2.889  1.00 0.00 ? 30 GLN A CA   6  
ATOM 3425  C C    . GLN A 1 27 ? 3.269   -11.633 -2.372  1.00 0.00 ? 30 GLN A C    6  
ATOM 3426  O O    . GLN A 1 27 ? 3.385   -12.770 -2.830  1.00 0.00 ? 30 GLN A O    6  
ATOM 3427  C CB   . GLN A 1 27 ? 2.739   -9.800  -4.008  1.00 0.00 ? 30 GLN A CB   6  
ATOM 3428  C CG   . GLN A 1 27 ? 3.569   -10.541 -5.045  1.00 0.00 ? 30 GLN A CG   6  
ATOM 3429  C CD   . GLN A 1 27 ? 3.090   -10.298 -6.464  1.00 0.00 ? 30 GLN A CD   6  
ATOM 3430  O OE1  . GLN A 1 27 ? 2.686   -11.224 -7.161  1.00 0.00 ? 30 GLN A OE1  6  
ATOM 3431  N NE2  . GLN A 1 27 ? 3.134   -9.049  -6.902  1.00 0.00 ? 30 GLN A NE2  6  
ATOM 3432  H H    . GLN A 1 27 ? 1.862   -8.905  -1.785  1.00 0.00 ? 30 GLN A H    6  
ATOM 3433  H HA   . GLN A 1 27 ? 1.397   -11.290 -3.272  1.00 0.00 ? 30 GLN A HA   6  
ATOM 3434  H HB2  . GLN A 1 27 ? 1.908   -9.328  -4.513  1.00 0.00 ? 30 GLN A HB2  6  
ATOM 3435  H HB3  . GLN A 1 27 ? 3.358   -9.031  -3.567  1.00 0.00 ? 30 GLN A HB3  6  
ATOM 3436  H HG2  . GLN A 1 27 ? 4.593   -10.213 -4.969  1.00 0.00 ? 30 GLN A HG2  6  
ATOM 3437  H HG3  . GLN A 1 27 ? 3.514   -11.598 -4.839  1.00 0.00 ? 30 GLN A HG3  6  
ATOM 3438  H HE21 . GLN A 1 27 ? 3.467   -8.355  -6.297  1.00 0.00 ? 30 GLN A HE21 6  
ATOM 3439  H HE22 . GLN A 1 27 ? 2.829   -8.872  -7.815  1.00 0.00 ? 30 GLN A HE22 6  
ATOM 3440  N N    . ALA A 1 28 ? 4.036   -11.162 -1.410  1.00 0.00 ? 31 ALA A N    6  
ATOM 3441  C CA   . ALA A 1 28 ? 5.096   -11.963 -0.812  1.00 0.00 ? 31 ALA A CA   6  
ATOM 3442  C C    . ALA A 1 28 ? 4.503   -12.977 0.159   1.00 0.00 ? 31 ALA A C    6  
ATOM 3443  O O    . ALA A 1 28 ? 4.765   -14.177 0.058   1.00 0.00 ? 31 ALA A O    6  
ATOM 3444  C CB   . ALA A 1 28 ? 6.109   -11.067 -0.107  1.00 0.00 ? 31 ALA A CB   6  
ATOM 3445  H H    . ALA A 1 28 ? 3.871   -10.257 -1.085  1.00 0.00 ? 31 ALA A H    6  
ATOM 3446  H HA   . ALA A 1 28 ? 5.604   -12.494 -1.604  1.00 0.00 ? 31 ALA A HA   6  
ATOM 3447  H HB1  . ALA A 1 28 ? 6.331   -10.215 -0.733  1.00 0.00 ? 31 ALA A HB1  6  
ATOM 3448  H HB2  . ALA A 1 28 ? 7.016   -11.624 0.077   1.00 0.00 ? 31 ALA A HB2  6  
ATOM 3449  H HB3  . ALA A 1 28 ? 5.698   -10.726 0.831   1.00 0.00 ? 31 ALA A HB3  6  
ATOM 3450  N N    . ALA A 1 29 ? 3.688   -12.483 1.090   1.00 0.00 ? 32 ALA A N    6  
ATOM 3451  C CA   . ALA A 1 29 ? 3.041   -13.343 2.080   1.00 0.00 ? 32 ALA A CA   6  
ATOM 3452  C C    . ALA A 1 29 ? 2.124   -14.378 1.423   1.00 0.00 ? 32 ALA A C    6  
ATOM 3453  O O    . ALA A 1 29 ? 2.130   -15.543 1.813   1.00 0.00 ? 32 ALA A O    6  
ATOM 3454  C CB   . ALA A 1 29 ? 2.263   -12.503 3.083   1.00 0.00 ? 32 ALA A CB   6  
ATOM 3455  H H    . ALA A 1 29 ? 3.511   -11.506 1.107   1.00 0.00 ? 32 ALA A H    6  
ATOM 3456  H HA   . ALA A 1 29 ? 3.817   -13.870 2.616   1.00 0.00 ? 32 ALA A HA   6  
ATOM 3457  H HB1  . ALA A 1 29 ? 2.918   -11.764 3.520   1.00 0.00 ? 32 ALA A HB1  6  
ATOM 3458  H HB2  . ALA A 1 29 ? 1.872   -13.142 3.863   1.00 0.00 ? 32 ALA A HB2  6  
ATOM 3459  H HB3  . ALA A 1 29 ? 1.445   -12.007 2.581   1.00 0.00 ? 32 ALA A HB3  6  
ATOM 3460  N N    . ALA A 1 30 ? 1.334   -13.959 0.431   1.00 0.00 ? 33 ALA A N    6  
ATOM 3461  C CA   . ALA A 1 30 ? 0.422   -14.879 -0.251  1.00 0.00 ? 33 ALA A CA   6  
ATOM 3462  C C    . ALA A 1 30 ? 1.178   -15.962 -1.007  1.00 0.00 ? 33 ALA A C    6  
ATOM 3463  O O    . ALA A 1 30 ? 0.931   -17.158 -0.829  1.00 0.00 ? 33 ALA A O    6  
ATOM 3464  C CB   . ALA A 1 30 ? -0.507  -14.117 -1.187  1.00 0.00 ? 33 ALA A CB   6  
ATOM 3465  H H    . ALA A 1 30 ? 1.362   -13.014 0.152   1.00 0.00 ? 33 ALA A H    6  
ATOM 3466  H HA   . ALA A 1 30 ? -0.173  -15.352 0.492   1.00 0.00 ? 33 ALA A HA   6  
ATOM 3467  H HB1  . ALA A 1 30 ? -1.039  -13.360 -0.628  1.00 0.00 ? 33 ALA A HB1  6  
ATOM 3468  H HB2  . ALA A 1 30 ? -1.215  -14.800 -1.629  1.00 0.00 ? 33 ALA A HB2  6  
ATOM 3469  H HB3  . ALA A 1 30 ? 0.074   -13.645 -1.966  1.00 0.00 ? 33 ALA A HB3  6  
ATOM 3470  N N    . ASN A 1 31 ? 2.103   -15.522 -1.837  1.00 0.00 ? 34 ASN A N    6  
ATOM 3471  C CA   . ASN A 1 31 ? 2.925   -16.421 -2.638  1.00 0.00 ? 34 ASN A CA   6  
ATOM 3472  C C    . ASN A 1 31 ? 3.746   -17.350 -1.745  1.00 0.00 ? 34 ASN A C    6  
ATOM 3473  O O    . ASN A 1 31 ? 3.812   -18.554 -1.984  1.00 0.00 ? 34 ASN A O    6  
ATOM 3474  C CB   . ASN A 1 31 ? 3.840   -15.607 -3.562  1.00 0.00 ? 34 ASN A CB   6  
ATOM 3475  C CG   . ASN A 1 31 ? 4.946   -16.435 -4.178  1.00 0.00 ? 34 ASN A CG   6  
ATOM 3476  O OD1  . ASN A 1 31 ? 4.780   -17.023 -5.242  1.00 0.00 ? 34 ASN A OD1  6  
ATOM 3477  N ND2  . ASN A 1 31 ? 6.086   -16.484 -3.510  1.00 0.00 ? 34 ASN A ND2  6  
ATOM 3478  H H    . ASN A 1 31 ? 2.240   -14.560 -1.903  1.00 0.00 ? 34 ASN A H    6  
ATOM 3479  H HA   . ASN A 1 31 ? 2.262   -17.024 -3.244  1.00 0.00 ? 34 ASN A HA   6  
ATOM 3480  H HB2  . ASN A 1 31 ? 3.249   -15.185 -4.361  1.00 0.00 ? 34 ASN A HB2  6  
ATOM 3481  H HB3  . ASN A 1 31 ? 4.289   -14.805 -2.995  1.00 0.00 ? 34 ASN A HB3  6  
ATOM 3482  H HD21 . ASN A 1 31 ? 6.154   -15.990 -2.667  1.00 0.00 ? 34 ASN A HD21 6  
ATOM 3483  H HD22 . ASN A 1 31 ? 6.813   -17.015 -3.886  1.00 0.00 ? 34 ASN A HD22 6  
ATOM 3484  N N    . ALA A 1 32 ? 4.363   -16.786 -0.709  1.00 0.00 ? 35 ALA A N    6  
ATOM 3485  C CA   . ALA A 1 32 ? 5.176   -17.572 0.217   1.00 0.00 ? 35 ALA A CA   6  
ATOM 3486  C C    . ALA A 1 32 ? 4.346   -18.120 1.390   1.00 0.00 ? 35 ALA A C    6  
ATOM 3487  O O    . ALA A 1 32 ? 4.801   -18.119 2.536   1.00 0.00 ? 35 ALA A O    6  
ATOM 3488  C CB   . ALA A 1 32 ? 6.342   -16.733 0.724   1.00 0.00 ? 35 ALA A CB   6  
ATOM 3489  H H    . ALA A 1 32 ? 4.267   -15.815 -0.563  1.00 0.00 ? 35 ALA A H    6  
ATOM 3490  H HA   . ALA A 1 32 ? 5.584   -18.409 -0.333  1.00 0.00 ? 35 ALA A HA   6  
ATOM 3491  H HB1  . ALA A 1 32 ? 6.941   -17.322 1.404   1.00 0.00 ? 35 ALA A HB1  6  
ATOM 3492  H HB2  . ALA A 1 32 ? 5.962   -15.863 1.240   1.00 0.00 ? 35 ALA A HB2  6  
ATOM 3493  H HB3  . ALA A 1 32 ? 6.948   -16.418 -0.112  1.00 0.00 ? 35 ALA A HB3  6  
ATOM 3494  N N    . HIS A 1 33 ? 3.132   -18.596 1.099   1.00 0.00 ? 36 HIS A N    6  
ATOM 3495  C CA   . HIS A 1 33 ? 2.260   -19.149 2.139   1.00 0.00 ? 36 HIS A CA   6  
ATOM 3496  C C    . HIS A 1 33 ? 1.148   -20.030 1.557   1.00 0.00 ? 36 HIS A C    6  
ATOM 3497  O O    . HIS A 1 33 ? 0.984   -21.179 1.971   1.00 0.00 ? 36 HIS A O    6  
ATOM 3498  C CB   . HIS A 1 33 ? 1.649   -18.022 2.975   1.00 0.00 ? 36 HIS A CB   6  
ATOM 3499  C CG   . HIS A 1 33 ? 1.190   -18.461 4.329   1.00 0.00 ? 36 HIS A CG   6  
ATOM 3500  N ND1  . HIS A 1 33 ? -0.137  -18.639 4.653   1.00 0.00 ? 36 HIS A ND1  6  
ATOM 3501  C CD2  . HIS A 1 33 ? 1.893   -18.760 5.445   1.00 0.00 ? 36 HIS A CD2  6  
ATOM 3502  C CE1  . HIS A 1 33 ? -0.232  -19.029 5.912   1.00 0.00 ? 36 HIS A CE1  6  
ATOM 3503  N NE2  . HIS A 1 33 ? 0.985   -19.110 6.415   1.00 0.00 ? 36 HIS A NE2  6  
ATOM 3504  H H    . HIS A 1 33 ? 2.821   -18.578 0.171   1.00 0.00 ? 36 HIS A H    6  
ATOM 3505  H HA   . HIS A 1 33 ? 2.873   -19.761 2.784   1.00 0.00 ? 36 HIS A HA   6  
ATOM 3506  H HB2  . HIS A 1 33 ? 2.389   -17.247 3.112   1.00 0.00 ? 36 HIS A HB2  6  
ATOM 3507  H HB3  . HIS A 1 33 ? 0.800   -17.610 2.451   1.00 0.00 ? 36 HIS A HB3  6  
ATOM 3508  H HD1  . HIS A 1 33 ? -0.897  -18.501 4.049   1.00 0.00 ? 36 HIS A HD1  6  
ATOM 3509  H HD2  . HIS A 1 33 ? 2.968   -18.727 5.554   1.00 0.00 ? 36 HIS A HD2  6  
ATOM 3510  H HE1  . HIS A 1 33 ? -1.151  -19.243 6.440   1.00 0.00 ? 36 HIS A HE1  6  
ATOM 3511  H HE2  . HIS A 1 33 ? 1.209   -19.498 7.288   1.00 0.00 ? 36 HIS A HE2  6  
ATOM 3512  N N    . LEU A 1 34 ? 0.374   -19.491 0.610   1.00 0.00 ? 37 LEU A N    6  
ATOM 3513  C CA   . LEU A 1 34 ? -0.729  -20.246 0.003   1.00 0.00 ? 37 LEU A CA   6  
ATOM 3514  C C    . LEU A 1 34 ? -0.266  -21.153 -1.148  1.00 0.00 ? 37 LEU A C    6  
ATOM 3515  O O    . LEU A 1 34 ? -1.059  -21.931 -1.681  1.00 0.00 ? 37 LEU A O    6  
ATOM 3516  C CB   . LEU A 1 34 ? -1.827  -19.289 -0.481  1.00 0.00 ? 37 LEU A CB   6  
ATOM 3517  C CG   . LEU A 1 34 ? -1.545  -18.574 -1.806  1.00 0.00 ? 37 LEU A CG   6  
ATOM 3518  C CD1  . LEU A 1 34 ? -2.233  -19.288 -2.957  1.00 0.00 ? 37 LEU A CD1  6  
ATOM 3519  C CD2  . LEU A 1 34 ? -2.002  -17.127 -1.736  1.00 0.00 ? 37 LEU A CD2  6  
ATOM 3520  H H    . LEU A 1 34 ? 0.541   -18.565 0.320   1.00 0.00 ? 37 LEU A H    6  
ATOM 3521  H HA   . LEU A 1 34 ? -1.142  -20.876 0.773   1.00 0.00 ? 37 LEU A HA   6  
ATOM 3522  H HB2  . LEU A 1 34 ? -2.741  -19.855 -0.591  1.00 0.00 ? 37 LEU A HB2  6  
ATOM 3523  H HB3  . LEU A 1 34 ? -1.980  -18.538 0.281   1.00 0.00 ? 37 LEU A HB3  6  
ATOM 3524  H HG   . LEU A 1 34 ? -0.481  -18.581 -1.996  1.00 0.00 ? 37 LEU A HG   6  
ATOM 3525  H HD11 . LEU A 1 34 ? -2.177  -18.676 -3.844  1.00 0.00 ? 37 LEU A HD11 6  
ATOM 3526  H HD12 . LEU A 1 34 ? -3.268  -19.463 -2.704  1.00 0.00 ? 37 LEU A HD12 6  
ATOM 3527  H HD13 . LEU A 1 34 ? -1.742  -20.233 -3.140  1.00 0.00 ? 37 LEU A HD13 6  
ATOM 3528  H HD21 . LEU A 1 34 ? -1.711  -16.702 -0.787  1.00 0.00 ? 37 LEU A HD21 6  
ATOM 3529  H HD22 . LEU A 1 34 ? -3.077  -17.084 -1.836  1.00 0.00 ? 37 LEU A HD22 6  
ATOM 3530  H HD23 . LEU A 1 34 ? -1.543  -16.567 -2.537  1.00 0.00 ? 37 LEU A HD23 6  
ATOM 3531  N N    . MET A 1 35 ? 1.011   -21.061 -1.521  1.00 0.00 ? 38 MET A N    6  
ATOM 3532  C CA   . MET A 1 35 ? 1.560   -21.883 -2.606  1.00 0.00 ? 38 MET A CA   6  
ATOM 3533  C C    . MET A 1 35 ? 1.452   -23.382 -2.312  1.00 0.00 ? 38 MET A C    6  
ATOM 3534  O O    . MET A 1 35 ? 1.495   -24.207 -3.227  1.00 0.00 ? 38 MET A O    6  
ATOM 3535  C CB   . MET A 1 35 ? 3.021   -21.504 -2.872  1.00 0.00 ? 38 MET A CB   6  
ATOM 3536  C CG   . MET A 1 35 ? 3.325   -21.237 -4.337  1.00 0.00 ? 38 MET A CG   6  
ATOM 3537  S SD   . MET A 1 35 ? 5.091   -21.081 -4.659  1.00 0.00 ? 38 MET A SD   6  
ATOM 3538  C CE   . MET A 1 35 ? 5.088   -19.908 -6.014  1.00 0.00 ? 38 MET A CE   6  
ATOM 3539  H H    . MET A 1 35 ? 1.598   -20.432 -1.058  1.00 0.00 ? 38 MET A H    6  
ATOM 3540  H HA   . MET A 1 35 ? 0.983   -21.677 -3.485  1.00 0.00 ? 38 MET A HA   6  
ATOM 3541  H HB2  . MET A 1 35 ? 3.258   -20.613 -2.311  1.00 0.00 ? 38 MET A HB2  6  
ATOM 3542  H HB3  . MET A 1 35 ? 3.656   -22.309 -2.536  1.00 0.00 ? 38 MET A HB3  6  
ATOM 3543  H HG2  . MET A 1 35 ? 2.937   -22.054 -4.928  1.00 0.00 ? 38 MET A HG2  6  
ATOM 3544  H HG3  . MET A 1 35 ? 2.837   -20.319 -4.631  1.00 0.00 ? 38 MET A HG3  6  
ATOM 3545  H HE1  . MET A 1 35 ? 6.036   -19.391 -6.043  1.00 0.00 ? 38 MET A HE1  6  
ATOM 3546  H HE2  . MET A 1 35 ? 4.292   -19.193 -5.869  1.00 0.00 ? 38 MET A HE2  6  
ATOM 3547  H HE3  . MET A 1 35 ? 4.937   -20.434 -6.944  1.00 0.00 ? 38 MET A HE3  6  
ATOM 3548  N N    . ALA A 1 36 ? 1.308   -23.724 -1.038  1.00 0.00 ? 39 ALA A N    6  
ATOM 3549  C CA   . ALA A 1 36 ? 1.188   -25.118 -0.617  1.00 0.00 ? 39 ALA A CA   6  
ATOM 3550  C C    . ALA A 1 36 ? 0.239   -25.259 0.580   1.00 0.00 ? 39 ALA A C    6  
ATOM 3551  O O    . ALA A 1 36 ? 0.589   -25.856 1.599   1.00 0.00 ? 39 ALA A O    6  
ATOM 3552  C CB   . ALA A 1 36 ? 2.567   -25.679 -0.288  1.00 0.00 ? 39 ALA A CB   6  
ATOM 3553  H H    . ALA A 1 36 ? 1.278   -23.019 -0.366  1.00 0.00 ? 39 ALA A H    6  
ATOM 3554  H HA   . ALA A 1 36 ? 0.786   -25.682 -1.446  1.00 0.00 ? 39 ALA A HA   6  
ATOM 3555  H HB1  . ALA A 1 36 ? 3.084   -24.999 0.373   1.00 0.00 ? 39 ALA A HB1  6  
ATOM 3556  H HB2  . ALA A 1 36 ? 3.134   -25.796 -1.199  1.00 0.00 ? 39 ALA A HB2  6  
ATOM 3557  H HB3  . ALA A 1 36 ? 2.459   -26.639 0.196   1.00 0.00 ? 39 ALA A HB3  6  
ATOM 3558  N N    . GLN A 1 37 ? -0.965  -24.701 0.448   1.00 0.00 ? 40 GLN A N    6  
ATOM 3559  C CA   . GLN A 1 37 ? -1.962  -24.761 1.517   1.00 0.00 ? 40 GLN A CA   6  
ATOM 3560  C C    . GLN A 1 37 ? -2.935  -25.928 1.322   1.00 0.00 ? 40 GLN A C    6  
ATOM 3561  O O    . GLN A 1 37 ? -3.346  -26.564 2.296   1.00 0.00 ? 40 GLN A O    6  
ATOM 3562  C CB   . GLN A 1 37 ? -2.736  -23.442 1.600   1.00 0.00 ? 40 GLN A CB   6  
ATOM 3563  C CG   . GLN A 1 37 ? -3.128  -23.054 3.021   1.00 0.00 ? 40 GLN A CG   6  
ATOM 3564  C CD   . GLN A 1 37 ? -4.586  -23.338 3.330   1.00 0.00 ? 40 GLN A CD   6  
ATOM 3565  O OE1  . GLN A 1 37 ? -5.401  -22.424 3.421   1.00 0.00 ? 40 GLN A OE1  6  
ATOM 3566  N NE2  . GLN A 1 37 ? -4.925  -24.609 3.496   1.00 0.00 ? 40 GLN A NE2  6  
ATOM 3567  H H    . GLN A 1 37 ? -1.185  -24.235 -0.386  1.00 0.00 ? 40 GLN A H    6  
ATOM 3568  H HA   . GLN A 1 37 ? -1.433  -24.911 2.446   1.00 0.00 ? 40 GLN A HA   6  
ATOM 3569  H HB2  . GLN A 1 37 ? -2.121  -22.653 1.192   1.00 0.00 ? 40 GLN A HB2  6  
ATOM 3570  H HB3  . GLN A 1 37 ? -3.636  -23.526 1.010   1.00 0.00 ? 40 GLN A HB3  6  
ATOM 3571  H HG2  . GLN A 1 37 ? -2.517  -23.610 3.715   1.00 0.00 ? 40 GLN A HG2  6  
ATOM 3572  H HG3  . GLN A 1 37 ? -2.949  -21.998 3.153   1.00 0.00 ? 40 GLN A HG3  6  
ATOM 3573  H HE21 . GLN A 1 37 ? -4.228  -25.294 3.409   1.00 0.00 ? 40 GLN A HE21 6  
ATOM 3574  H HE22 . GLN A 1 37 ? -5.862  -24.811 3.695   1.00 0.00 ? 40 GLN A HE22 6  
ATOM 3575  N N    . ILE A 1 38 ? -3.304  -26.199 0.069   1.00 0.00 ? 41 ILE A N    6  
ATOM 3576  C CA   . ILE A 1 38 ? -4.231  -27.287 -0.249  1.00 0.00 ? 41 ILE A CA   6  
ATOM 3577  C C    . ILE A 1 38 ? -3.765  -28.062 -1.483  1.00 0.00 ? 41 ILE A C    6  
ATOM 3578  O O    . ILE A 1 38 ? -3.329  -27.414 -2.460  1.00 0.00 ? 41 ILE A O    6  
ATOM 3579  C CB   . ILE A 1 38 ? -5.665  -26.762 -0.493  1.00 0.00 ? 41 ILE A CB   6  
ATOM 3580  C CG1  . ILE A 1 38 ? -6.115  -25.854 0.655   1.00 0.00 ? 41 ILE A CG1  6  
ATOM 3581  C CG2  . ILE A 1 38 ? -6.637  -27.921 -0.658  1.00 0.00 ? 41 ILE A CG2  6  
ATOM 3582  C CD1  . ILE A 1 38 ? -6.182  -24.390 0.278   1.00 0.00 ? 41 ILE A CD1  6  
ATOM 3583  O OXT  . ILE A 1 38 ? -3.841  -29.309 -1.461  1.00 0.00 ? 41 ILE A OXT  6  
ATOM 3584  H H    . ILE A 1 38 ? -2.947  -25.655 -0.662  1.00 0.00 ? 41 ILE A H    6  
ATOM 3585  H HA   . ILE A 1 38 ? -4.257  -27.961 0.594   1.00 0.00 ? 41 ILE A HA   6  
ATOM 3586  H HB   . ILE A 1 38 ? -5.660  -26.196 -1.411  1.00 0.00 ? 41 ILE A HB   6  
ATOM 3587  H HG12 . ILE A 1 38 ? -7.100  -26.156 0.978   1.00 0.00 ? 41 ILE A HG12 6  
ATOM 3588  H HG13 . ILE A 1 38 ? -5.425  -25.954 1.479   1.00 0.00 ? 41 ILE A HG13 6  
ATOM 3589  H HG21 . ILE A 1 38 ? -6.272  -28.591 -1.423  1.00 0.00 ? 41 ILE A HG21 6  
ATOM 3590  H HG22 . ILE A 1 38 ? -7.606  -27.541 -0.945  1.00 0.00 ? 41 ILE A HG22 6  
ATOM 3591  H HG23 . ILE A 1 38 ? -6.723  -28.456 0.277   1.00 0.00 ? 41 ILE A HG23 6  
ATOM 3592  H HD11 . ILE A 1 38 ? -7.118  -24.189 -0.223  1.00 0.00 ? 41 ILE A HD11 6  
ATOM 3593  H HD12 . ILE A 1 38 ? -5.363  -24.151 -0.383  1.00 0.00 ? 41 ILE A HD12 6  
ATOM 3594  H HD13 . ILE A 1 38 ? -6.114  -23.785 1.170   1.00 0.00 ? 41 ILE A HD13 6  
ATOM 3595  N N    . PHE A 1 1  ? -12.119 14.134  7.276   1.00 0.00 ? 4  PHE A N    7  
ATOM 3596  C CA   . PHE A 1 1  ? -11.232 14.626  8.373   1.00 0.00 ? 4  PHE A CA   7  
ATOM 3597  C C    . PHE A 1 1  ? -9.848  14.995  7.839   1.00 0.00 ? 4  PHE A C    7  
ATOM 3598  O O    . PHE A 1 1  ? -9.503  14.643  6.710   1.00 0.00 ? 4  PHE A O    7  
ATOM 3599  C CB   . PHE A 1 1  ? -11.116 13.536  9.452   1.00 0.00 ? 4  PHE A CB   7  
ATOM 3600  C CG   . PHE A 1 1  ? -10.903 12.151  8.903   1.00 0.00 ? 4  PHE A CG   7  
ATOM 3601  C CD1  . PHE A 1 1  ? -9.696  11.799  8.319   1.00 0.00 ? 4  PHE A CD1  7  
ATOM 3602  C CD2  . PHE A 1 1  ? -11.911 11.203  8.971   1.00 0.00 ? 4  PHE A CD2  7  
ATOM 3603  C CE1  . PHE A 1 1  ? -9.500  10.529  7.814   1.00 0.00 ? 4  PHE A CE1  7  
ATOM 3604  C CE2  . PHE A 1 1  ? -11.720 9.931   8.467   1.00 0.00 ? 4  PHE A CE2  7  
ATOM 3605  C CZ   . PHE A 1 1  ? -10.513 9.593   7.888   1.00 0.00 ? 4  PHE A CZ   7  
ATOM 3606  H H1   . PHE A 1 1  ? -12.337 14.941  6.657   1.00 0.00 ? 4  PHE A H1   7  
ATOM 3607  H H2   . PHE A 1 1  ? -12.983 13.750  7.711   1.00 0.00 ? 4  PHE A H2   7  
ATOM 3608  H H3   . PHE A 1 1  ? -11.601 13.396  6.755   1.00 0.00 ? 4  PHE A H3   7  
ATOM 3609  H HA   . PHE A 1 1  ? -11.684 15.506  8.807   1.00 0.00 ? 4  PHE A HA   7  
ATOM 3610  H HB2  . PHE A 1 1  ? -10.282 13.766  10.096  1.00 0.00 ? 4  PHE A HB2  7  
ATOM 3611  H HB3  . PHE A 1 1  ? -12.023 13.525  10.040  1.00 0.00 ? 4  PHE A HB3  7  
ATOM 3612  H HD1  . PHE A 1 1  ? -8.901  12.530  8.261   1.00 0.00 ? 4  PHE A HD1  7  
ATOM 3613  H HD2  . PHE A 1 1  ? -12.855 11.465  9.425   1.00 0.00 ? 4  PHE A HD2  7  
ATOM 3614  H HE1  . PHE A 1 1  ? -8.554  10.268  7.360   1.00 0.00 ? 4  PHE A HE1  7  
ATOM 3615  H HE2  . PHE A 1 1  ? -12.514 9.200   8.526   1.00 0.00 ? 4  PHE A HE2  7  
ATOM 3616  H HZ   . PHE A 1 1  ? -10.362 8.599   7.492   1.00 0.00 ? 4  PHE A HZ   7  
ATOM 3617  N N    . THR A 1 2  ? -9.062  15.704  8.659   1.00 0.00 ? 5  THR A N    7  
ATOM 3618  C CA   . THR A 1 2  ? -7.706  16.130  8.277   1.00 0.00 ? 5  THR A CA   7  
ATOM 3619  C C    . THR A 1 2  ? -7.698  16.809  6.905   1.00 0.00 ? 5  THR A C    7  
ATOM 3620  O O    . THR A 1 2  ? -7.147  16.277  5.940   1.00 0.00 ? 5  THR A O    7  
ATOM 3621  C CB   . THR A 1 2  ? -6.732  14.938  8.289   1.00 0.00 ? 5  THR A CB   7  
ATOM 3622  O OG1  . THR A 1 2  ? -7.256  13.832  7.574   1.00 0.00 ? 5  THR A OG1  7  
ATOM 3623  C CG2  . THR A 1 2  ? -6.399  14.452  9.680   1.00 0.00 ? 5  THR A CG2  7  
ATOM 3624  H H    . THR A 1 2  ? -9.401  15.950  9.545   1.00 0.00 ? 5  THR A H    7  
ATOM 3625  H HA   . THR A 1 2  ? -7.375  16.849  9.011   1.00 0.00 ? 5  THR A HA   7  
ATOM 3626  H HB   . THR A 1 2  ? -5.808  15.239  7.816   1.00 0.00 ? 5  THR A HB   7  
ATOM 3627  H HG1  . THR A 1 2  ? -7.639  14.136  6.739   1.00 0.00 ? 5  THR A HG1  7  
ATOM 3628  H HG21 . THR A 1 2  ? -5.620  13.707  9.623   1.00 0.00 ? 5  THR A HG21 7  
ATOM 3629  H HG22 . THR A 1 2  ? -7.280  14.019  10.130  1.00 0.00 ? 5  THR A HG22 7  
ATOM 3630  H HG23 . THR A 1 2  ? -6.059  15.283  10.280  1.00 0.00 ? 5  THR A HG23 7  
ATOM 3631  N N    . LEU A 1 3  ? -8.320  17.990  6.835   1.00 0.00 ? 6  LEU A N    7  
ATOM 3632  C CA   . LEU A 1 3  ? -8.399  18.761  5.590   1.00 0.00 ? 6  LEU A CA   7  
ATOM 3633  C C    . LEU A 1 3  ? -9.243  18.031  4.536   1.00 0.00 ? 6  LEU A C    7  
ATOM 3634  O O    . LEU A 1 3  ? -9.772  16.948  4.789   1.00 0.00 ? 6  LEU A O    7  
ATOM 3635  C CB   . LEU A 1 3  ? -6.994  19.046  5.046   1.00 0.00 ? 6  LEU A CB   7  
ATOM 3636  C CG   . LEU A 1 3  ? -6.157  20.013  5.887   1.00 0.00 ? 6  LEU A CG   7  
ATOM 3637  C CD1  . LEU A 1 3  ? -4.786  19.423  6.170   1.00 0.00 ? 6  LEU A CD1  7  
ATOM 3638  C CD2  . LEU A 1 3  ? -6.021  21.352  5.181   1.00 0.00 ? 6  LEU A CD2  7  
ATOM 3639  H H    . LEU A 1 3  ? -8.737  18.353  7.641   1.00 0.00 ? 6  LEU A H    7  
ATOM 3640  H HA   . LEU A 1 3  ? -8.880  19.701  5.819   1.00 0.00 ? 6  LEU A HA   7  
ATOM 3641  H HB2  . LEU A 1 3  ? -6.461  18.109  4.976   1.00 0.00 ? 6  LEU A HB2  7  
ATOM 3642  H HB3  . LEU A 1 3  ? -7.089  19.459  4.055   1.00 0.00 ? 6  LEU A HB3  7  
ATOM 3643  H HG   . LEU A 1 3  ? -6.651  20.181  6.833   1.00 0.00 ? 6  LEU A HG   7  
ATOM 3644  H HD11 . LEU A 1 3  ? -4.253  19.290  5.240   1.00 0.00 ? 6  LEU A HD11 7  
ATOM 3645  H HD12 . LEU A 1 3  ? -4.900  18.467  6.660   1.00 0.00 ? 6  LEU A HD12 7  
ATOM 3646  H HD13 . LEU A 1 3  ? -4.231  20.092  6.811   1.00 0.00 ? 6  LEU A HD13 7  
ATOM 3647  H HD21 . LEU A 1 3  ? -6.912  21.939  5.347   1.00 0.00 ? 6  LEU A HD21 7  
ATOM 3648  H HD22 . LEU A 1 3  ? -5.889  21.189  4.122   1.00 0.00 ? 6  LEU A HD22 7  
ATOM 3649  H HD23 . LEU A 1 3  ? -5.164  21.880  5.573   1.00 0.00 ? 6  LEU A HD23 7  
ATOM 3650  N N    . SER A 1 4  ? -9.370  18.636  3.355   1.00 0.00 ? 7  SER A N    7  
ATOM 3651  C CA   . SER A 1 4  ? -10.152 18.043  2.266   1.00 0.00 ? 7  SER A CA   7  
ATOM 3652  C C    . SER A 1 4  ? -9.673  18.553  0.903   1.00 0.00 ? 7  SER A C    7  
ATOM 3653  O O    . SER A 1 4  ? -10.455 19.085  0.115   1.00 0.00 ? 7  SER A O    7  
ATOM 3654  C CB   . SER A 1 4  ? -11.643 18.350  2.456   1.00 0.00 ? 7  SER A CB   7  
ATOM 3655  O OG   . SER A 1 4  ? -12.351 17.195  2.880   1.00 0.00 ? 7  SER A OG   7  
ATOM 3656  H H    . SER A 1 4  ? -8.932  19.501  3.211   1.00 0.00 ? 7  SER A H    7  
ATOM 3657  H HA   . SER A 1 4  ? -10.009 16.974  2.302   1.00 0.00 ? 7  SER A HA   7  
ATOM 3658  H HB2  . SER A 1 4  ? -11.756 19.121  3.205   1.00 0.00 ? 7  SER A HB2  7  
ATOM 3659  H HB3  . SER A 1 4  ? -12.062 18.694  1.521   1.00 0.00 ? 7  SER A HB3  7  
ATOM 3660  H HG   . SER A 1 4  ? -13.115 17.058  2.313   1.00 0.00 ? 7  SER A HG   7  
ATOM 3661  N N    . LEU A 1 5  ? -8.377  18.390  0.632   1.00 0.00 ? 8  LEU A N    7  
ATOM 3662  C CA   . LEU A 1 5  ? -7.789  18.837  -0.634  1.00 0.00 ? 8  LEU A CA   7  
ATOM 3663  C C    . LEU A 1 5  ? -7.475  17.654  -1.561  1.00 0.00 ? 8  LEU A C    7  
ATOM 3664  O O    . LEU A 1 5  ? -6.382  17.569  -2.121  1.00 0.00 ? 8  LEU A O    7  
ATOM 3665  C CB   . LEU A 1 5  ? -6.523  19.662  -0.365  1.00 0.00 ? 8  LEU A CB   7  
ATOM 3666  C CG   . LEU A 1 5  ? -5.393  18.918  0.354   1.00 0.00 ? 8  LEU A CG   7  
ATOM 3667  C CD1  . LEU A 1 5  ? -4.045  19.319  -0.220  1.00 0.00 ? 8  LEU A CD1  7  
ATOM 3668  C CD2  . LEU A 1 5  ? -5.437  19.195  1.850   1.00 0.00 ? 8  LEU A CD2  7  
ATOM 3669  H H    . LEU A 1 5  ? -7.803  17.961  1.298   1.00 0.00 ? 8  LEU A H    7  
ATOM 3670  H HA   . LEU A 1 5  ? -8.516  19.468  -1.124  1.00 0.00 ? 8  LEU A HA   7  
ATOM 3671  H HB2  . LEU A 1 5  ? -6.144  20.015  -1.314  1.00 0.00 ? 8  LEU A HB2  7  
ATOM 3672  H HB3  . LEU A 1 5  ? -6.798  20.519  0.232   1.00 0.00 ? 8  LEU A HB3  7  
ATOM 3673  H HG   . LEU A 1 5  ? -5.515  17.856  0.205   1.00 0.00 ? 8  LEU A HG   7  
ATOM 3674  H HD11 . LEU A 1 5  ? -3.947  18.920  -1.219  1.00 0.00 ? 8  LEU A HD11 7  
ATOM 3675  H HD12 . LEU A 1 5  ? -3.256  18.925  0.405   1.00 0.00 ? 8  LEU A HD12 7  
ATOM 3676  H HD13 . LEU A 1 5  ? -3.974  20.396  -0.254  1.00 0.00 ? 8  LEU A HD13 7  
ATOM 3677  H HD21 . LEU A 1 5  ? -4.566  19.767  2.135   1.00 0.00 ? 8  LEU A HD21 7  
ATOM 3678  H HD22 . LEU A 1 5  ? -5.445  18.259  2.389   1.00 0.00 ? 8  LEU A HD22 7  
ATOM 3679  H HD23 . LEU A 1 5  ? -6.329  19.755  2.087   1.00 0.00 ? 8  LEU A HD23 7  
ATOM 3680  N N    . ASP A 1 6  ? -8.456  16.758  -1.720  1.00 0.00 ? 9  ASP A N    7  
ATOM 3681  C CA   . ASP A 1 6  ? -8.332  15.580  -2.579  1.00 0.00 ? 9  ASP A CA   7  
ATOM 3682  C C    . ASP A 1 6  ? -7.000  14.844  -2.373  1.00 0.00 ? 9  ASP A C    7  
ATOM 3683  O O    . ASP A 1 6  ? -6.010  15.122  -3.050  1.00 0.00 ? 9  ASP A O    7  
ATOM 3684  C CB   . ASP A 1 6  ? -8.504  15.993  -4.042  1.00 0.00 ? 9  ASP A CB   7  
ATOM 3685  C CG   . ASP A 1 6  ? -8.688  14.806  -4.965  1.00 0.00 ? 9  ASP A CG   7  
ATOM 3686  O OD1  . ASP A 1 6  ? -7.673  14.223  -5.397  1.00 0.00 ? 9  ASP A OD1  7  
ATOM 3687  O OD2  . ASP A 1 6  ? -9.852  14.460  -5.254  1.00 0.00 ? 9  ASP A OD2  7  
ATOM 3688  H H    . ASP A 1 6  ? -9.298  16.901  -1.255  1.00 0.00 ? 9  ASP A H    7  
ATOM 3689  H HA   . ASP A 1 6  ? -9.133  14.905  -2.319  1.00 0.00 ? 9  ASP A HA   7  
ATOM 3690  H HB2  . ASP A 1 6  ? -9.372  16.628  -4.130  1.00 0.00 ? 9  ASP A HB2  7  
ATOM 3691  H HB3  . ASP A 1 6  ? -7.632  16.540  -4.353  1.00 0.00 ? 9  ASP A HB3  7  
ATOM 3692  N N    . VAL A 1 7  ? -6.999  13.894  -1.433  1.00 0.00 ? 10 VAL A N    7  
ATOM 3693  C CA   . VAL A 1 7  ? -5.810  13.087  -1.122  1.00 0.00 ? 10 VAL A CA   7  
ATOM 3694  C C    . VAL A 1 7  ? -4.519  13.930  -1.142  1.00 0.00 ? 10 VAL A C    7  
ATOM 3695  O O    . VAL A 1 7  ? -3.729  13.873  -2.090  1.00 0.00 ? 10 VAL A O    7  
ATOM 3696  C CB   . VAL A 1 7  ? -5.693  11.871  -2.085  1.00 0.00 ? 10 VAL A CB   7  
ATOM 3697  C CG1  . VAL A 1 7  ? -5.605  12.311  -3.540  1.00 0.00 ? 10 VAL A CG1  7  
ATOM 3698  C CG2  . VAL A 1 7  ? -4.507  10.994  -1.718  1.00 0.00 ? 10 VAL A CG2  7  
ATOM 3699  H H    . VAL A 1 7  ? -7.827  13.723  -0.940  1.00 0.00 ? 10 VAL A H    7  
ATOM 3700  H HA   . VAL A 1 7  ? -5.940  12.700  -0.121  1.00 0.00 ? 10 VAL A HA   7  
ATOM 3701  H HB   . VAL A 1 7  ? -6.590  11.277  -1.976  1.00 0.00 ? 10 VAL A HB   7  
ATOM 3702  H HG11 . VAL A 1 7  ? -4.986  13.193  -3.616  1.00 0.00 ? 10 VAL A HG11 7  
ATOM 3703  H HG12 . VAL A 1 7  ? -6.595  12.537  -3.910  1.00 0.00 ? 10 VAL A HG12 7  
ATOM 3704  H HG13 . VAL A 1 7  ? -5.174  11.517  -4.131  1.00 0.00 ? 10 VAL A HG13 7  
ATOM 3705  H HG21 . VAL A 1 7  ? -4.260  10.357  -2.554  1.00 0.00 ? 10 VAL A HG21 7  
ATOM 3706  H HG22 . VAL A 1 7  ? -4.761  10.383  -0.864  1.00 0.00 ? 10 VAL A HG22 7  
ATOM 3707  H HG23 . VAL A 1 7  ? -3.659  11.616  -1.476  1.00 0.00 ? 10 VAL A HG23 7  
ATOM 3708  N N    . PRO A 1 8  ? -4.290  14.732  -0.078  1.00 0.00 ? 11 PRO A N    7  
ATOM 3709  C CA   . PRO A 1 8  ? -3.104  15.596  0.039   1.00 0.00 ? 11 PRO A CA   7  
ATOM 3710  C C    . PRO A 1 8  ? -1.794  14.846  -0.204  1.00 0.00 ? 11 PRO A C    7  
ATOM 3711  O O    . PRO A 1 8  ? -1.718  13.630  -0.024  1.00 0.00 ? 11 PRO A O    7  
ATOM 3712  C CB   . PRO A 1 8  ? -3.170  16.122  1.484   1.00 0.00 ? 11 PRO A CB   7  
ATOM 3713  C CG   . PRO A 1 8  ? -4.198  15.282  2.165   1.00 0.00 ? 11 PRO A CG   7  
ATOM 3714  C CD   . PRO A 1 8  ? -5.163  14.865  1.096   1.00 0.00 ? 11 PRO A CD   7  
ATOM 3715  H HA   . PRO A 1 8  ? -3.164  16.429  -0.648  1.00 0.00 ? 11 PRO A HA   7  
ATOM 3716  H HB2  . PRO A 1 8  ? -2.203  16.016  1.951   1.00 0.00 ? 11 PRO A HB2  7  
ATOM 3717  H HB3  . PRO A 1 8  ? -3.457  17.163  1.475   1.00 0.00 ? 11 PRO A HB3  7  
ATOM 3718  H HG2  . PRO A 1 8  ? -3.729  14.416  2.606   1.00 0.00 ? 11 PRO A HG2  7  
ATOM 3719  H HG3  . PRO A 1 8  ? -4.704  15.862  2.922   1.00 0.00 ? 11 PRO A HG3  7  
ATOM 3720  H HD2  . PRO A 1 8  ? -5.626  13.922  1.349   1.00 0.00 ? 11 PRO A HD2  7  
ATOM 3721  H HD3  . PRO A 1 8  ? -5.911  15.628  0.939   1.00 0.00 ? 11 PRO A HD3  7  
ATOM 3722  N N    . THR A 1 9  ? -0.761  15.585  -0.609  1.00 0.00 ? 12 THR A N    7  
ATOM 3723  C CA   . THR A 1 9  ? 0.558   15.004  -0.888  1.00 0.00 ? 12 THR A CA   7  
ATOM 3724  C C    . THR A 1 9  ? 1.015   14.076  0.235   1.00 0.00 ? 12 THR A C    7  
ATOM 3725  O O    . THR A 1 9  ? 1.424   12.942  -0.018  1.00 0.00 ? 12 THR A O    7  
ATOM 3726  C CB   . THR A 1 9  ? 1.601   16.110  -1.105  1.00 0.00 ? 12 THR A CB   7  
ATOM 3727  O OG1  . THR A 1 9  ? 0.998   17.396  -1.071  1.00 0.00 ? 12 THR A OG1  7  
ATOM 3728  C CG2  . THR A 1 9  ? 2.340   15.981  -2.420  1.00 0.00 ? 12 THR A CG2  7  
ATOM 3729  H H    . THR A 1 9  ? -0.885  16.549  -0.725  1.00 0.00 ? 12 THR A H    7  
ATOM 3730  H HA   . THR A 1 9  ? 0.474   14.425  -1.795  1.00 0.00 ? 12 THR A HA   7  
ATOM 3731  H HB   . THR A 1 9  ? 2.332   16.059  -0.310  1.00 0.00 ? 12 THR A HB   7  
ATOM 3732  H HG1  . THR A 1 9  ? 0.842   17.710  -1.967  1.00 0.00 ? 12 THR A HG1  7  
ATOM 3733  H HG21 . THR A 1 9  ? 1.630   15.842  -3.222  1.00 0.00 ? 12 THR A HG21 7  
ATOM 3734  H HG22 . THR A 1 9  ? 3.005   15.132  -2.378  1.00 0.00 ? 12 THR A HG22 7  
ATOM 3735  H HG23 . THR A 1 9  ? 2.914   16.878  -2.599  1.00 0.00 ? 12 THR A HG23 7  
ATOM 3736  N N    . ASN A 1 10 ? 0.940   14.564  1.475   1.00 0.00 ? 13 ASN A N    7  
ATOM 3737  C CA   . ASN A 1 10 ? 1.346   13.772  2.642   1.00 0.00 ? 13 ASN A CA   7  
ATOM 3738  C C    . ASN A 1 10 ? 0.574   12.461  2.732   1.00 0.00 ? 13 ASN A C    7  
ATOM 3739  O O    . ASN A 1 10 ? 1.080   11.458  3.230   1.00 0.00 ? 13 ASN A O    7  
ATOM 3740  C CB   . ASN A 1 10 ? 1.179   14.584  3.934   1.00 0.00 ? 13 ASN A CB   7  
ATOM 3741  C CG   . ASN A 1 10 ? 2.328   14.379  4.903   1.00 0.00 ? 13 ASN A CG   7  
ATOM 3742  O OD1  . ASN A 1 10 ? 2.806   13.263  5.090   1.00 0.00 ? 13 ASN A OD1  7  
ATOM 3743  N ND2  . ASN A 1 10 ? 2.782   15.456  5.528   1.00 0.00 ? 13 ASN A ND2  7  
ATOM 3744  H H    . ASN A 1 10 ? 0.601   15.474  1.607   1.00 0.00 ? 13 ASN A H    7  
ATOM 3745  H HA   . ASN A 1 10 ? 2.372   13.530  2.515   1.00 0.00 ? 13 ASN A HA   7  
ATOM 3746  H HB2  . ASN A 1 10 ? 1.126   15.633  3.689   1.00 0.00 ? 13 ASN A HB2  7  
ATOM 3747  H HB3  . ASN A 1 10 ? 0.264   14.286  4.424   1.00 0.00 ? 13 ASN A HB3  7  
ATOM 3748  H HD21 . ASN A 1 10 ? 2.359   16.317  5.336   1.00 0.00 ? 13 ASN A HD21 7  
ATOM 3749  H HD22 . ASN A 1 10 ? 3.524   15.343  6.158   1.00 0.00 ? 13 ASN A HD22 7  
ATOM 3750  N N    . ILE A 1 11 ? -0.641  12.484  2.229   1.00 0.00 ? 14 ILE A N    7  
ATOM 3751  C CA   . ILE A 1 11 ? -1.503  11.312  2.221   1.00 0.00 ? 14 ILE A CA   7  
ATOM 3752  C C    . ILE A 1 11 ? -1.286  10.501  0.940   1.00 0.00 ? 14 ILE A C    7  
ATOM 3753  O O    . ILE A 1 11 ? -1.085  9.286   0.994   1.00 0.00 ? 14 ILE A O    7  
ATOM 3754  C CB   . ILE A 1 11 ? -2.978  11.745  2.356   1.00 0.00 ? 14 ILE A CB   7  
ATOM 3755  C CG1  . ILE A 1 11 ? -3.400  11.751  3.825   1.00 0.00 ? 14 ILE A CG1  7  
ATOM 3756  C CG2  . ILE A 1 11 ? -3.904  10.846  1.547   1.00 0.00 ? 14 ILE A CG2  7  
ATOM 3757  C CD1  . ILE A 1 11 ? -2.843  12.918  4.613   1.00 0.00 ? 14 ILE A CD1  7  
ATOM 3758  H H    . ILE A 1 11 ? -0.967  13.314  1.835   1.00 0.00 ? 14 ILE A H    7  
ATOM 3759  H HA   . ILE A 1 11 ? -1.244  10.699  3.072   1.00 0.00 ? 14 ILE A HA   7  
ATOM 3760  H HB   . ILE A 1 11 ? -3.053  12.748  1.966   1.00 0.00 ? 14 ILE A HB   7  
ATOM 3761  H HG12 . ILE A 1 11 ? -4.477  11.797  3.883   1.00 0.00 ? 14 ILE A HG12 7  
ATOM 3762  H HG13 . ILE A 1 11 ? -3.058  10.840  4.295   1.00 0.00 ? 14 ILE A HG13 7  
ATOM 3763  H HG21 . ILE A 1 11 ? -3.692  9.812   1.775   1.00 0.00 ? 14 ILE A HG21 7  
ATOM 3764  H HG22 . ILE A 1 11 ? -3.745  11.022  0.494   1.00 0.00 ? 14 ILE A HG22 7  
ATOM 3765  H HG23 . ILE A 1 11 ? -4.931  11.067  1.797   1.00 0.00 ? 14 ILE A HG23 7  
ATOM 3766  H HD11 . ILE A 1 11 ? -1.824  13.104  4.311   1.00 0.00 ? 14 ILE A HD11 7  
ATOM 3767  H HD12 . ILE A 1 11 ? -2.869  12.684  5.668   1.00 0.00 ? 14 ILE A HD12 7  
ATOM 3768  H HD13 . ILE A 1 11 ? -3.442  13.797  4.426   1.00 0.00 ? 14 ILE A HD13 7  
ATOM 3769  N N    . MET A 1 12 ? -1.305  11.187  -0.207  1.00 0.00 ? 15 MET A N    7  
ATOM 3770  C CA   . MET A 1 12 ? -1.088  10.548  -1.498  1.00 0.00 ? 15 MET A CA   7  
ATOM 3771  C C    . MET A 1 12 ? 0.225   9.768   -1.491  1.00 0.00 ? 15 MET A C    7  
ATOM 3772  O O    . MET A 1 12 ? 0.261   8.590   -1.855  1.00 0.00 ? 15 MET A O    7  
ATOM 3773  C CB   . MET A 1 12 ? -1.072  11.609  -2.599  1.00 0.00 ? 15 MET A CB   7  
ATOM 3774  C CG   . MET A 1 12 ? -2.050  11.330  -3.723  1.00 0.00 ? 15 MET A CG   7  
ATOM 3775  S SD   . MET A 1 12 ? -1.230  11.008  -5.296  1.00 0.00 ? 15 MET A SD   7  
ATOM 3776  C CE   . MET A 1 12 ? -2.248  11.973  -6.411  1.00 0.00 ? 15 MET A CE   7  
ATOM 3777  H H    . MET A 1 12 ? -1.457  12.161  -0.183  1.00 0.00 ? 15 MET A H    7  
ATOM 3778  H HA   . MET A 1 12 ? -1.903  9.863   -1.675  1.00 0.00 ? 15 MET A HA   7  
ATOM 3779  H HB2  . MET A 1 12 ? -1.324  12.567  -2.165  1.00 0.00 ? 15 MET A HB2  7  
ATOM 3780  H HB3  . MET A 1 12 ? -0.079  11.666  -3.016  1.00 0.00 ? 15 MET A HB3  7  
ATOM 3781  H HG2  . MET A 1 12 ? -2.640  10.467  -3.458  1.00 0.00 ? 15 MET A HG2  7  
ATOM 3782  H HG3  . MET A 1 12 ? -2.697  12.187  -3.836  1.00 0.00 ? 15 MET A HG3  7  
ATOM 3783  H HE1  . MET A 1 12 ? -2.437  12.943  -5.977  1.00 0.00 ? 15 MET A HE1  7  
ATOM 3784  H HE2  . MET A 1 12 ? -3.185  11.461  -6.575  1.00 0.00 ? 15 MET A HE2  7  
ATOM 3785  H HE3  . MET A 1 12 ? -1.734  12.094  -7.353  1.00 0.00 ? 15 MET A HE3  7  
ATOM 3786  N N    . ASN A 1 13 ? 1.300   10.429  -1.046  1.00 0.00 ? 16 ASN A N    7  
ATOM 3787  C CA   . ASN A 1 13 ? 2.611   9.794   -0.962  1.00 0.00 ? 16 ASN A CA   7  
ATOM 3788  C C    . ASN A 1 13 ? 2.532   8.550   -0.080  1.00 0.00 ? 16 ASN A C    7  
ATOM 3789  O O    . ASN A 1 13 ? 3.029   7.482   -0.447  1.00 0.00 ? 16 ASN A O    7  
ATOM 3790  C CB   . ASN A 1 13 ? 3.645   10.788  -0.414  1.00 0.00 ? 16 ASN A CB   7  
ATOM 3791  C CG   . ASN A 1 13 ? 4.882   10.110  0.141   1.00 0.00 ? 16 ASN A CG   7  
ATOM 3792  O OD1  . ASN A 1 13 ? 5.754   9.677   -0.606  1.00 0.00 ? 16 ASN A OD1  7  
ATOM 3793  N ND2  . ASN A 1 13 ? 4.964   10.012  1.458   1.00 0.00 ? 16 ASN A ND2  7  
ATOM 3794  H H    . ASN A 1 13 ? 1.203   11.362  -0.751  1.00 0.00 ? 16 ASN A H    7  
ATOM 3795  H HA   . ASN A 1 13 ? 2.897   9.496   -1.955  1.00 0.00 ? 16 ASN A HA   7  
ATOM 3796  H HB2  . ASN A 1 13 ? 3.953   11.451  -1.208  1.00 0.00 ? 16 ASN A HB2  7  
ATOM 3797  H HB3  . ASN A 1 13 ? 3.192   11.370  0.375   1.00 0.00 ? 16 ASN A HB3  7  
ATOM 3798  H HD21 . ASN A 1 13 ? 4.234   10.378  1.999   1.00 0.00 ? 16 ASN A HD21 7  
ATOM 3799  H HD22 . ASN A 1 13 ? 5.754   9.580   1.837   1.00 0.00 ? 16 ASN A HD22 7  
ATOM 3800  N N    . LEU A 1 14 ? 1.880   8.695   1.070   1.00 0.00 ? 17 LEU A N    7  
ATOM 3801  C CA   . LEU A 1 14 ? 1.705   7.582   1.997   1.00 0.00 ? 17 LEU A CA   7  
ATOM 3802  C C    . LEU A 1 14 ? 0.921   6.463   1.323   1.00 0.00 ? 17 LEU A C    7  
ATOM 3803  O O    . LEU A 1 14 ? 1.385   5.326   1.259   1.00 0.00 ? 17 LEU A O    7  
ATOM 3804  C CB   . LEU A 1 14 ? 0.980   8.041   3.268   1.00 0.00 ? 17 LEU A CB   7  
ATOM 3805  C CG   . LEU A 1 14 ? 1.846   8.803   4.272   1.00 0.00 ? 17 LEU A CG   7  
ATOM 3806  C CD1  . LEU A 1 14 ? 1.017   9.229   5.472   1.00 0.00 ? 17 LEU A CD1  7  
ATOM 3807  C CD2  . LEU A 1 14 ? 3.026   7.954   4.716   1.00 0.00 ? 17 LEU A CD2  7  
ATOM 3808  H H    . LEU A 1 14 ? 1.490   9.566   1.289   1.00 0.00 ? 17 LEU A H    7  
ATOM 3809  H HA   . LEU A 1 14 ? 2.683   7.207   2.258   1.00 0.00 ? 17 LEU A HA   7  
ATOM 3810  H HB2  . LEU A 1 14 ? 0.159   8.679   2.977   1.00 0.00 ? 17 LEU A HB2  7  
ATOM 3811  H HB3  . LEU A 1 14 ? 0.579   7.170   3.763   1.00 0.00 ? 17 LEU A HB3  7  
ATOM 3812  H HG   . LEU A 1 14 ? 2.232   9.695   3.802   1.00 0.00 ? 17 LEU A HG   7  
ATOM 3813  H HD11 . LEU A 1 14 ? 0.349   8.427   5.752   1.00 0.00 ? 17 LEU A HD11 7  
ATOM 3814  H HD12 . LEU A 1 14 ? 0.441   10.107  5.217   1.00 0.00 ? 17 LEU A HD12 7  
ATOM 3815  H HD13 . LEU A 1 14 ? 1.672   9.456   6.300   1.00 0.00 ? 17 LEU A HD13 7  
ATOM 3816  H HD21 . LEU A 1 14 ? 3.730   7.862   3.903   1.00 0.00 ? 17 LEU A HD21 7  
ATOM 3817  H HD22 . LEU A 1 14 ? 2.676   6.972   5.001   1.00 0.00 ? 17 LEU A HD22 7  
ATOM 3818  H HD23 . LEU A 1 14 ? 3.509   8.423   5.560   1.00 0.00 ? 17 LEU A HD23 7  
ATOM 3819  N N    . LEU A 1 15 ? -0.258  6.801   0.795   1.00 0.00 ? 18 LEU A N    7  
ATOM 3820  C CA   . LEU A 1 15 ? -1.096  5.825   0.099   1.00 0.00 ? 18 LEU A CA   7  
ATOM 3821  C C    . LEU A 1 15 ? -0.290  5.106   -0.981  1.00 0.00 ? 18 LEU A C    7  
ATOM 3822  O O    . LEU A 1 15 ? -0.318  3.875   -1.074  1.00 0.00 ? 18 LEU A O    7  
ATOM 3823  C CB   . LEU A 1 15 ? -2.316  6.515   -0.521  1.00 0.00 ? 18 LEU A CB   7  
ATOM 3824  C CG   . LEU A 1 15 ? -3.463  6.798   0.449   1.00 0.00 ? 18 LEU A CG   7  
ATOM 3825  C CD1  . LEU A 1 15 ? -4.482  7.725   -0.189  1.00 0.00 ? 18 LEU A CD1  7  
ATOM 3826  C CD2  . LEU A 1 15 ? -4.125  5.501   0.885   1.00 0.00 ? 18 LEU A CD2  7  
ATOM 3827  H H    . LEU A 1 15 ? -0.566  7.737   0.863   1.00 0.00 ? 18 LEU A H    7  
ATOM 3828  H HA   . LEU A 1 15 ? -1.429  5.098   0.822   1.00 0.00 ? 18 LEU A HA   7  
ATOM 3829  H HB2  . LEU A 1 15 ? -1.992  7.453   -0.949  1.00 0.00 ? 18 LEU A HB2  7  
ATOM 3830  H HB3  . LEU A 1 15 ? -2.693  5.887   -1.315  1.00 0.00 ? 18 LEU A HB3  7  
ATOM 3831  H HG   . LEU A 1 15 ? -3.071  7.287   1.330   1.00 0.00 ? 18 LEU A HG   7  
ATOM 3832  H HD11 . LEU A 1 15 ? -5.120  7.158   -0.851  1.00 0.00 ? 18 LEU A HD11 7  
ATOM 3833  H HD12 . LEU A 1 15 ? -3.968  8.490   -0.752  1.00 0.00 ? 18 LEU A HD12 7  
ATOM 3834  H HD13 . LEU A 1 15 ? -5.082  8.186   0.581   1.00 0.00 ? 18 LEU A HD13 7  
ATOM 3835  H HD21 . LEU A 1 15 ? -5.111  5.712   1.269   1.00 0.00 ? 18 LEU A HD21 7  
ATOM 3836  H HD22 . LEU A 1 15 ? -3.530  5.034   1.655   1.00 0.00 ? 18 LEU A HD22 7  
ATOM 3837  H HD23 . LEU A 1 15 ? -4.205  4.836   0.037   1.00 0.00 ? 18 LEU A HD23 7  
ATOM 3838  N N    . PHE A 1 16 ? 0.447   5.886   -1.776  1.00 0.00 ? 19 PHE A N    7  
ATOM 3839  C CA   . PHE A 1 16 ? 1.287   5.337   -2.837  1.00 0.00 ? 19 PHE A CA   7  
ATOM 3840  C C    . PHE A 1 16 ? 2.222   4.266   -2.279  1.00 0.00 ? 19 PHE A C    7  
ATOM 3841  O O    . PHE A 1 16 ? 2.368   3.191   -2.864  1.00 0.00 ? 19 PHE A O    7  
ATOM 3842  C CB   . PHE A 1 16 ? 2.105   6.451   -3.500  1.00 0.00 ? 19 PHE A CB   7  
ATOM 3843  C CG   . PHE A 1 16 ? 2.195   6.323   -4.994  1.00 0.00 ? 19 PHE A CG   7  
ATOM 3844  C CD1  . PHE A 1 16 ? 2.602   5.132   -5.579  1.00 0.00 ? 19 PHE A CD1  7  
ATOM 3845  C CD2  . PHE A 1 16 ? 1.873   7.390   -5.815  1.00 0.00 ? 19 PHE A CD2  7  
ATOM 3846  C CE1  . PHE A 1 16 ? 2.686   5.012   -6.952  1.00 0.00 ? 19 PHE A CE1  7  
ATOM 3847  C CE2  . PHE A 1 16 ? 1.954   7.275   -7.190  1.00 0.00 ? 19 PHE A CE2  7  
ATOM 3848  C CZ   . PHE A 1 16 ? 2.361   6.084   -7.760  1.00 0.00 ? 19 PHE A CZ   7  
ATOM 3849  H H    . PHE A 1 16 ? 0.433   6.861   -1.635  1.00 0.00 ? 19 PHE A H    7  
ATOM 3850  H HA   . PHE A 1 16 ? 0.642   4.884   -3.575  1.00 0.00 ? 19 PHE A HA   7  
ATOM 3851  H HB2  . PHE A 1 16 ? 1.650   7.403   -3.276  1.00 0.00 ? 19 PHE A HB2  7  
ATOM 3852  H HB3  . PHE A 1 16 ? 3.109   6.437   -3.103  1.00 0.00 ? 19 PHE A HB3  7  
ATOM 3853  H HD1  . PHE A 1 16 ? 2.856   4.293   -4.948  1.00 0.00 ? 19 PHE A HD1  7  
ATOM 3854  H HD2  . PHE A 1 16 ? 1.555   8.322   -5.372  1.00 0.00 ? 19 PHE A HD2  7  
ATOM 3855  H HE1  . PHE A 1 16 ? 3.004   4.079   -7.395  1.00 0.00 ? 19 PHE A HE1  7  
ATOM 3856  H HE2  . PHE A 1 16 ? 1.699   8.116   -7.819  1.00 0.00 ? 19 PHE A HE2  7  
ATOM 3857  H HZ   . PHE A 1 16 ? 2.426   5.991   -8.834  1.00 0.00 ? 19 PHE A HZ   7  
ATOM 3858  N N    . ASN A 1 17 ? 2.838   4.555   -1.129  1.00 0.00 ? 20 ASN A N    7  
ATOM 3859  C CA   . ASN A 1 17 ? 3.738   3.602   -0.488  1.00 0.00 ? 20 ASN A CA   7  
ATOM 3860  C C    . ASN A 1 17 ? 2.937   2.481   0.168   1.00 0.00 ? 20 ASN A C    7  
ATOM 3861  O O    . ASN A 1 17 ? 3.280   1.306   0.030   1.00 0.00 ? 20 ASN A O    7  
ATOM 3862  C CB   . ASN A 1 17 ? 4.617   4.301   0.543   1.00 0.00 ? 20 ASN A CB   7  
ATOM 3863  C CG   . ASN A 1 17 ? 6.046   3.794   0.516   1.00 0.00 ? 20 ASN A CG   7  
ATOM 3864  O OD1  . ASN A 1 17 ? 6.511   3.171   1.464   1.00 0.00 ? 20 ASN A OD1  7  
ATOM 3865  N ND2  . ASN A 1 17 ? 6.747   4.053   -0.577  1.00 0.00 ? 20 ASN A ND2  7  
ATOM 3866  H H    . ASN A 1 17 ? 2.669   5.424   -0.695  1.00 0.00 ? 20 ASN A H    7  
ATOM 3867  H HA   . ASN A 1 17 ? 4.366   3.170   -1.255  1.00 0.00 ? 20 ASN A HA   7  
ATOM 3868  H HB2  . ASN A 1 17 ? 4.623   5.361   0.345   1.00 0.00 ? 20 ASN A HB2  7  
ATOM 3869  H HB3  . ASN A 1 17 ? 4.211   4.126   1.524   1.00 0.00 ? 20 ASN A HB3  7  
ATOM 3870  H HD21 . ASN A 1 17 ? 6.314   4.551   -1.300  1.00 0.00 ? 20 ASN A HD21 7  
ATOM 3871  H HD22 . ASN A 1 17 ? 7.672   3.733   -0.615  1.00 0.00 ? 20 ASN A HD22 7  
ATOM 3872  N N    . ILE A 1 18 ? 1.855   2.849   0.860   1.00 0.00 ? 21 ILE A N    7  
ATOM 3873  C CA   . ILE A 1 18 ? 0.989   1.862   1.506   1.00 0.00 ? 21 ILE A CA   7  
ATOM 3874  C C    . ILE A 1 18 ? 0.647   0.761   0.515   1.00 0.00 ? 21 ILE A C    7  
ATOM 3875  O O    . ILE A 1 18 ? 0.989   -0.399  0.735   1.00 0.00 ? 21 ILE A O    7  
ATOM 3876  C CB   . ILE A 1 18 ? -0.310  2.500   2.051   1.00 0.00 ? 21 ILE A CB   7  
ATOM 3877  C CG1  . ILE A 1 18 ? -0.002  3.387   3.261   1.00 0.00 ? 21 ILE A CG1  7  
ATOM 3878  C CG2  . ILE A 1 18 ? -1.328  1.427   2.424   1.00 0.00 ? 21 ILE A CG2  7  
ATOM 3879  C CD1  . ILE A 1 18 ? 0.444   2.617   4.488   1.00 0.00 ? 21 ILE A CD1  7  
ATOM 3880  H H    . ILE A 1 18 ? 1.625   3.807   0.919   1.00 0.00 ? 21 ILE A H    7  
ATOM 3881  H HA   . ILE A 1 18 ? 1.530   1.420   2.330   1.00 0.00 ? 21 ILE A HA   7  
ATOM 3882  H HB   . ILE A 1 18 ? -0.739  3.109   1.269   1.00 0.00 ? 21 ILE A HB   7  
ATOM 3883  H HG12 . ILE A 1 18 ? 0.787   4.077   3.002   1.00 0.00 ? 21 ILE A HG12 7  
ATOM 3884  H HG13 . ILE A 1 18 ? -0.888  3.945   3.524   1.00 0.00 ? 21 ILE A HG13 7  
ATOM 3885  H HG21 . ILE A 1 18 ? -2.075  1.854   3.077   1.00 0.00 ? 21 ILE A HG21 7  
ATOM 3886  H HG22 . ILE A 1 18 ? -0.826  0.617   2.934   1.00 0.00 ? 21 ILE A HG22 7  
ATOM 3887  H HG23 . ILE A 1 18 ? -1.802  1.053   1.530   1.00 0.00 ? 21 ILE A HG23 7  
ATOM 3888  H HD11 . ILE A 1 18 ? 0.727   1.615   4.202   1.00 0.00 ? 21 ILE A HD11 7  
ATOM 3889  H HD12 . ILE A 1 18 ? -0.369  2.572   5.198   1.00 0.00 ? 21 ILE A HD12 7  
ATOM 3890  H HD13 . ILE A 1 18 ? 1.288   3.116   4.938   1.00 0.00 ? 21 ILE A HD13 7  
ATOM 3891  N N    . ALA A 1 19 ? 0.019   1.134   -0.601  1.00 0.00 ? 22 ALA A N    7  
ATOM 3892  C CA   . ALA A 1 19 ? -0.312  0.165   -1.641  1.00 0.00 ? 22 ALA A CA   7  
ATOM 3893  C C    . ALA A 1 19 ? 0.949   -0.594  -2.052  1.00 0.00 ? 22 ALA A C    7  
ATOM 3894  O O    . ALA A 1 19 ? 0.956   -1.827  -2.106  1.00 0.00 ? 22 ALA A O    7  
ATOM 3895  C CB   . ALA A 1 19 ? -0.941  0.866   -2.839  1.00 0.00 ? 22 ALA A CB   7  
ATOM 3896  H H    . ALA A 1 19 ? -0.194  2.086   -0.741  1.00 0.00 ? 22 ALA A H    7  
ATOM 3897  H HA   . ALA A 1 19 ? -1.029  -0.535  -1.237  1.00 0.00 ? 22 ALA A HA   7  
ATOM 3898  H HB1  . ALA A 1 19 ? -0.168  1.342   -3.426  1.00 0.00 ? 22 ALA A HB1  7  
ATOM 3899  H HB2  . ALA A 1 19 ? -1.641  1.612   -2.495  1.00 0.00 ? 22 ALA A HB2  7  
ATOM 3900  H HB3  . ALA A 1 19 ? -1.459  0.141   -3.450  1.00 0.00 ? 22 ALA A HB3  7  
ATOM 3901  N N    . LYS A 1 20 ? 2.021   0.166   -2.302  1.00 0.00 ? 23 LYS A N    7  
ATOM 3902  C CA   . LYS A 1 20 ? 3.322   -0.390  -2.679  1.00 0.00 ? 23 LYS A CA   7  
ATOM 3903  C C    . LYS A 1 20 ? 3.751   -1.501  -1.717  1.00 0.00 ? 23 LYS A C    7  
ATOM 3904  O O    . LYS A 1 20 ? 4.111   -2.600  -2.139  1.00 0.00 ? 23 LYS A O    7  
ATOM 3905  C CB   . LYS A 1 20 ? 4.375   0.727   -2.691  1.00 0.00 ? 23 LYS A CB   7  
ATOM 3906  C CG   . LYS A 1 20 ? 4.857   1.107   -4.080  1.00 0.00 ? 23 LYS A CG   7  
ATOM 3907  C CD   . LYS A 1 20 ? 5.308   2.560   -4.140  1.00 0.00 ? 23 LYS A CD   7  
ATOM 3908  C CE   . LYS A 1 20 ? 6.824   2.682   -4.102  1.00 0.00 ? 23 LYS A CE   7  
ATOM 3909  N NZ   . LYS A 1 20 ? 7.413   2.693   -5.473  1.00 0.00 ? 23 LYS A NZ   7  
ATOM 3910  H H    . LYS A 1 20 ? 1.937   1.141   -2.212  1.00 0.00 ? 23 LYS A H    7  
ATOM 3911  H HA   . LYS A 1 20 ? 3.233   -0.805  -3.669  1.00 0.00 ? 23 LYS A HA   7  
ATOM 3912  H HB2  . LYS A 1 20 ? 3.950   1.607   -2.233  1.00 0.00 ? 23 LYS A HB2  7  
ATOM 3913  H HB3  . LYS A 1 20 ? 5.229   0.410   -2.110  1.00 0.00 ? 23 LYS A HB3  7  
ATOM 3914  H HG2  . LYS A 1 20 ? 5.686   0.470   -4.347  1.00 0.00 ? 23 LYS A HG2  7  
ATOM 3915  H HG3  . LYS A 1 20 ? 4.048   0.960   -4.782  1.00 0.00 ? 23 LYS A HG3  7  
ATOM 3916  H HD2  . LYS A 1 20 ? 4.946   3.001   -5.058  1.00 0.00 ? 23 LYS A HD2  7  
ATOM 3917  H HD3  . LYS A 1 20 ? 4.890   3.092   -3.297  1.00 0.00 ? 23 LYS A HD3  7  
ATOM 3918  H HE2  . LYS A 1 20 ? 7.085   3.602   -3.597  1.00 0.00 ? 23 LYS A HE2  7  
ATOM 3919  H HE3  . LYS A 1 20 ? 7.226   1.844   -3.549  1.00 0.00 ? 23 LYS A HE3  7  
ATOM 3920  H HZ1  . LYS A 1 20 ? 8.434   2.495   -5.429  1.00 0.00 ? 23 LYS A HZ1  7  
ATOM 3921  H HZ2  . LYS A 1 20 ? 7.271   3.624   -5.917  1.00 0.00 ? 23 LYS A HZ2  7  
ATOM 3922  H HZ3  . LYS A 1 20 ? 6.957   1.967   -6.063  1.00 0.00 ? 23 LYS A HZ3  7  
ATOM 3923  N N    . ALA A 1 21 ? 3.713   -1.206  -0.421  1.00 0.00 ? 24 ALA A N    7  
ATOM 3924  C CA   . ALA A 1 21 ? 4.098   -2.182  0.597   1.00 0.00 ? 24 ALA A CA   7  
ATOM 3925  C C    . ALA A 1 21 ? 2.992   -3.212  0.831   1.00 0.00 ? 24 ALA A C    7  
ATOM 3926  O O    . ALA A 1 21 ? 3.272   -4.398  1.030   1.00 0.00 ? 24 ALA A O    7  
ATOM 3927  C CB   . ALA A 1 21 ? 4.457   -1.473  1.895   1.00 0.00 ? 24 ALA A CB   7  
ATOM 3928  H H    . ALA A 1 21 ? 3.420   -0.307  -0.141  1.00 0.00 ? 24 ALA A H    7  
ATOM 3929  H HA   . ALA A 1 21 ? 4.977   -2.700  0.238   1.00 0.00 ? 24 ALA A HA   7  
ATOM 3930  H HB1  . ALA A 1 21 ? 4.859   -2.188  2.598   1.00 0.00 ? 24 ALA A HB1  7  
ATOM 3931  H HB2  . ALA A 1 21 ? 3.572   -1.015  2.313   1.00 0.00 ? 24 ALA A HB2  7  
ATOM 3932  H HB3  . ALA A 1 21 ? 5.196   -0.710  1.697   1.00 0.00 ? 24 ALA A HB3  7  
ATOM 3933  N N    . LYS A 1 22 ? 1.737   -2.760  0.791   1.00 0.00 ? 25 LYS A N    7  
ATOM 3934  C CA   . LYS A 1 22 ? 0.594   -3.637  0.983   1.00 0.00 ? 25 LYS A CA   7  
ATOM 3935  C C    . LYS A 1 22 ? 0.594   -4.746  -0.060  1.00 0.00 ? 25 LYS A C    7  
ATOM 3936  O O    . LYS A 1 22 ? 0.366   -5.914  0.266   1.00 0.00 ? 25 LYS A O    7  
ATOM 3937  C CB   . LYS A 1 22 ? -0.706  -2.830  0.908   1.00 0.00 ? 25 LYS A CB   7  
ATOM 3938  C CG   . LYS A 1 22 ? -1.655  -3.110  2.056   1.00 0.00 ? 25 LYS A CG   7  
ATOM 3939  C CD   . LYS A 1 22 ? -2.934  -3.782  1.574   1.00 0.00 ? 25 LYS A CD   7  
ATOM 3940  C CE   . LYS A 1 22 ? -3.945  -3.938  2.697   1.00 0.00 ? 25 LYS A CE   7  
ATOM 3941  N NZ   . LYS A 1 22 ? -4.877  -2.773  2.770   1.00 0.00 ? 25 LYS A NZ   7  
ATOM 3942  H H    . LYS A 1 22 ? 1.573   -1.806  0.614   1.00 0.00 ? 25 LYS A H    7  
ATOM 3943  H HA   . LYS A 1 22 ? 0.677   -4.082  1.963   1.00 0.00 ? 25 LYS A HA   7  
ATOM 3944  H HB2  . LYS A 1 22 ? -0.463  -1.776  0.923   1.00 0.00 ? 25 LYS A HB2  7  
ATOM 3945  H HB3  . LYS A 1 22 ? -1.211  -3.063  -0.019  1.00 0.00 ? 25 LYS A HB3  7  
ATOM 3946  H HG2  . LYS A 1 22 ? -1.161  -3.758  2.765   1.00 0.00 ? 25 LYS A HG2  7  
ATOM 3947  H HG3  . LYS A 1 22 ? -1.904  -2.174  2.534   1.00 0.00 ? 25 LYS A HG3  7  
ATOM 3948  H HD2  . LYS A 1 22 ? -3.371  -3.180  0.790   1.00 0.00 ? 25 LYS A HD2  7  
ATOM 3949  H HD3  . LYS A 1 22 ? -2.689  -4.759  1.183   1.00 0.00 ? 25 LYS A HD3  7  
ATOM 3950  H HE2  . LYS A 1 22 ? -4.517  -4.839  2.526   1.00 0.00 ? 25 LYS A HE2  7  
ATOM 3951  H HE3  . LYS A 1 22 ? -3.412  -4.024  3.634   1.00 0.00 ? 25 LYS A HE3  7  
ATOM 3952  H HZ1  . LYS A 1 22 ? -4.388  -1.902  2.477   1.00 0.00 ? 25 LYS A HZ1  7  
ATOM 3953  H HZ2  . LYS A 1 22 ? -5.225  -2.650  3.743   1.00 0.00 ? 25 LYS A HZ2  7  
ATOM 3954  H HZ3  . LYS A 1 22 ? -5.693  -2.926  2.141   1.00 0.00 ? 25 LYS A HZ3  7  
ATOM 3955  N N    . ASN A 1 23 ? 0.875   -4.384  -1.314  1.00 0.00 ? 26 ASN A N    7  
ATOM 3956  C CA   . ASN A 1 23 ? 0.921   -5.379  -2.383  1.00 0.00 ? 26 ASN A CA   7  
ATOM 3957  C C    . ASN A 1 23 ? 2.103   -6.328  -2.178  1.00 0.00 ? 26 ASN A C    7  
ATOM 3958  O O    . ASN A 1 23 ? 1.991   -7.525  -2.433  1.00 0.00 ? 26 ASN A O    7  
ATOM 3959  C CB   . ASN A 1 23 ? 0.964   -4.721  -3.779  1.00 0.00 ? 26 ASN A CB   7  
ATOM 3960  C CG   . ASN A 1 23 ? 2.263   -3.991  -4.098  1.00 0.00 ? 26 ASN A CG   7  
ATOM 3961  O OD1  . ASN A 1 23 ? 2.273   -2.775  -4.256  1.00 0.00 ? 26 ASN A OD1  7  
ATOM 3962  N ND2  . ASN A 1 23 ? 3.359   -4.726  -4.233  1.00 0.00 ? 26 ASN A ND2  7  
ATOM 3963  H H    . ASN A 1 23 ? 1.070   -3.431  -1.516  1.00 0.00 ? 26 ASN A H    7  
ATOM 3964  H HA   . ASN A 1 23 ? 0.015   -5.965  -2.308  1.00 0.00 ? 26 ASN A HA   7  
ATOM 3965  H HB2  . ASN A 1 23 ? 0.822   -5.485  -4.527  1.00 0.00 ? 26 ASN A HB2  7  
ATOM 3966  H HB3  . ASN A 1 23 ? 0.155   -4.010  -3.850  1.00 0.00 ? 26 ASN A HB3  7  
ATOM 3967  H HD21 . ASN A 1 23 ? 3.290   -5.695  -4.125  1.00 0.00 ? 26 ASN A HD21 7  
ATOM 3968  H HD22 . ASN A 1 23 ? 4.196   -4.262  -4.434  1.00 0.00 ? 26 ASN A HD22 7  
ATOM 3969  N N    . LEU A 1 24 ? 3.230   -5.790  -1.707  1.00 0.00 ? 27 LEU A N    7  
ATOM 3970  C CA   . LEU A 1 24 ? 4.425   -6.594  -1.463  1.00 0.00 ? 27 LEU A CA   7  
ATOM 3971  C C    . LEU A 1 24 ? 4.149   -7.693  -0.450  1.00 0.00 ? 27 LEU A C    7  
ATOM 3972  O O    . LEU A 1 24 ? 4.282   -8.881  -0.744  1.00 0.00 ? 27 LEU A O    7  
ATOM 3973  C CB   . LEU A 1 24 ? 5.577   -5.706  -0.978  1.00 0.00 ? 27 LEU A CB   7  
ATOM 3974  C CG   . LEU A 1 24 ? 6.294   -4.917  -2.074  1.00 0.00 ? 27 LEU A CG   7  
ATOM 3975  C CD1  . LEU A 1 24 ? 7.061   -3.749  -1.476  1.00 0.00 ? 27 LEU A CD1  7  
ATOM 3976  C CD2  . LEU A 1 24 ? 7.230   -5.825  -2.855  1.00 0.00 ? 27 LEU A CD2  7  
ATOM 3977  H H    . LEU A 1 24 ? 3.255   -4.828  -1.516  1.00 0.00 ? 27 LEU A H    7  
ATOM 3978  H HA   . LEU A 1 24 ? 4.702   -7.053  -2.382  1.00 0.00 ? 27 LEU A HA   7  
ATOM 3979  H HB2  . LEU A 1 24 ? 5.183   -5.004  -0.257  1.00 0.00 ? 27 LEU A HB2  7  
ATOM 3980  H HB3  . LEU A 1 24 ? 6.304   -6.332  -0.483  1.00 0.00 ? 27 LEU A HB3  7  
ATOM 3981  H HG   . LEU A 1 24 ? 5.561   -4.518  -2.761  1.00 0.00 ? 27 LEU A HG   7  
ATOM 3982  H HD11 . LEU A 1 24 ? 6.411   -2.889  -1.408  1.00 0.00 ? 27 LEU A HD11 7  
ATOM 3983  H HD12 . LEU A 1 24 ? 7.904   -3.513  -2.109  1.00 0.00 ? 27 LEU A HD12 7  
ATOM 3984  H HD13 . LEU A 1 24 ? 7.414   -4.015  -0.491  1.00 0.00 ? 27 LEU A HD13 7  
ATOM 3985  H HD21 . LEU A 1 24 ? 7.299   -5.478  -3.875  1.00 0.00 ? 27 LEU A HD21 7  
ATOM 3986  H HD22 . LEU A 1 24 ? 6.846   -6.835  -2.844  1.00 0.00 ? 27 LEU A HD22 7  
ATOM 3987  H HD23 . LEU A 1 24 ? 8.209   -5.808  -2.402  1.00 0.00 ? 27 LEU A HD23 7  
ATOM 3988  N N    . ARG A 1 25 ? 3.761   -7.277  0.737   1.00 0.00 ? 28 ARG A N    7  
ATOM 3989  C CA   . ARG A 1 25 ? 3.455   -8.208  1.825   1.00 0.00 ? 28 ARG A CA   7  
ATOM 3990  C C    . ARG A 1 25 ? 2.321   -9.162  1.449   1.00 0.00 ? 28 ARG A C    7  
ATOM 3991  O O    . ARG A 1 25 ? 2.400   -10.351 1.741   1.00 0.00 ? 28 ARG A O    7  
ATOM 3992  C CB   . ARG A 1 25 ? 3.107   -7.440  3.105   1.00 0.00 ? 28 ARG A CB   7  
ATOM 3993  C CG   . ARG A 1 25 ? 4.175   -7.550  4.187   1.00 0.00 ? 28 ARG A CG   7  
ATOM 3994  C CD   . ARG A 1 25 ? 3.736   -8.472  5.317   1.00 0.00 ? 28 ARG A CD   7  
ATOM 3995  N NE   . ARG A 1 25 ? 4.758   -9.478  5.639   1.00 0.00 ? 28 ARG A NE   7  
ATOM 3996  C CZ   . ARG A 1 25 ? 5.873   -9.231  6.322   1.00 0.00 ? 28 ARG A CZ   7  
ATOM 3997  N NH1  . ARG A 1 25 ? 6.148   -8.010  6.741   1.00 0.00 ? 28 ARG A NH1  7  
ATOM 3998  N NH2  . ARG A 1 25 ? 6.717   -10.212 6.580   1.00 0.00 ? 28 ARG A NH2  7  
ATOM 3999  H H    . ARG A 1 25 ? 3.678   -6.314  0.882   1.00 0.00 ? 28 ARG A H    7  
ATOM 4000  H HA   . ARG A 1 25 ? 4.339   -8.802  2.004   1.00 0.00 ? 28 ARG A HA   7  
ATOM 4001  H HB2  . ARG A 1 25 ? 2.979   -6.395  2.861   1.00 0.00 ? 28 ARG A HB2  7  
ATOM 4002  H HB3  . ARG A 1 25 ? 2.179   -7.824  3.503   1.00 0.00 ? 28 ARG A HB3  7  
ATOM 4003  H HG2  . ARG A 1 25 ? 5.080   -7.941  3.748   1.00 0.00 ? 28 ARG A HG2  7  
ATOM 4004  H HG3  . ARG A 1 25 ? 4.365   -6.566  4.591   1.00 0.00 ? 28 ARG A HG3  7  
ATOM 4005  H HD2  . ARG A 1 25 ? 3.537   -7.877  6.196   1.00 0.00 ? 28 ARG A HD2  7  
ATOM 4006  H HD3  . ARG A 1 25 ? 2.829   -8.978  5.016   1.00 0.00 ? 28 ARG A HD3  7  
ATOM 4007  H HE   . ARG A 1 25 ? 4.595   -10.393 5.332   1.00 0.00 ? 28 ARG A HE   7  
ATOM 4008  H HH11 . ARG A 1 25 ? 5.518   -7.264  6.547   1.00 0.00 ? 28 ARG A HH11 7  
ATOM 4009  H HH12 . ARG A 1 25 ? 6.986   -7.835  7.252   1.00 0.00 ? 28 ARG A HH12 7  
ATOM 4010  H HH21 . ARG A 1 25 ? 6.518   -11.137 6.263   1.00 0.00 ? 28 ARG A HH21 7  
ATOM 4011  H HH22 . ARG A 1 25 ? 7.553   -10.031 7.093   1.00 0.00 ? 28 ARG A HH22 7  
ATOM 4012  N N    . ALA A 1 26 ? 1.282   -8.653  0.786   1.00 0.00 ? 29 ALA A N    7  
ATOM 4013  C CA   . ALA A 1 26 ? 0.163   -9.496  0.371   1.00 0.00 ? 29 ALA A CA   7  
ATOM 4014  C C    . ALA A 1 26 ? 0.606   -10.485 -0.699  1.00 0.00 ? 29 ALA A C    7  
ATOM 4015  O O    . ALA A 1 26 ? 0.211   -11.651 -0.682  1.00 0.00 ? 29 ALA A O    7  
ATOM 4016  C CB   . ALA A 1 26 ? -0.994  -8.639  -0.129  1.00 0.00 ? 29 ALA A CB   7  
ATOM 4017  H H    . ALA A 1 26 ? 1.276   -7.700  0.556   1.00 0.00 ? 29 ALA A H    7  
ATOM 4018  H HA   . ALA A 1 26 ? -0.174  -10.054 1.234   1.00 0.00 ? 29 ALA A HA   7  
ATOM 4019  H HB1  . ALA A 1 26 ? -0.650  -8.000  -0.928  1.00 0.00 ? 29 ALA A HB1  7  
ATOM 4020  H HB2  . ALA A 1 26 ? -1.368  -8.031  0.683   1.00 0.00 ? 29 ALA A HB2  7  
ATOM 4021  H HB3  . ALA A 1 26 ? -1.785  -9.278  -0.492  1.00 0.00 ? 29 ALA A HB3  7  
ATOM 4022  N N    . GLN A 1 27 ? 1.443   -10.015 -1.618  1.00 0.00 ? 30 GLN A N    7  
ATOM 4023  C CA   . GLN A 1 27 ? 1.958   -10.861 -2.688  1.00 0.00 ? 30 GLN A CA   7  
ATOM 4024  C C    . GLN A 1 27 ? 2.966   -11.872 -2.150  1.00 0.00 ? 30 GLN A C    7  
ATOM 4025  O O    . GLN A 1 27 ? 2.977   -13.037 -2.553  1.00 0.00 ? 30 GLN A O    7  
ATOM 4026  C CB   . GLN A 1 27 ? 2.586   -9.992  -3.780  1.00 0.00 ? 30 GLN A CB   7  
ATOM 4027  C CG   . GLN A 1 27 ? 3.310   -10.780 -4.860  1.00 0.00 ? 30 GLN A CG   7  
ATOM 4028  C CD   . GLN A 1 27 ? 2.813   -10.456 -6.256  1.00 0.00 ? 30 GLN A CD   7  
ATOM 4029  O OE1  . GLN A 1 27 ? 2.875   -9.312  -6.698  1.00 0.00 ? 30 GLN A OE1  7  
ATOM 4030  N NE2  . GLN A 1 27 ? 2.315   -11.462 -6.958  1.00 0.00 ? 30 GLN A NE2  7  
ATOM 4031  H H    . GLN A 1 27 ? 1.731   -9.073  -1.571  1.00 0.00 ? 30 GLN A H    7  
ATOM 4032  H HA   . GLN A 1 27 ? 1.136   -11.399 -3.096  1.00 0.00 ? 30 GLN A HA   7  
ATOM 4033  H HB2  . GLN A 1 27 ? 1.807   -9.410  -4.252  1.00 0.00 ? 30 GLN A HB2  7  
ATOM 4034  H HB3  . GLN A 1 27 ? 3.295   -9.316  -3.322  1.00 0.00 ? 30 GLN A HB3  7  
ATOM 4035  H HG2  . GLN A 1 27 ? 4.361   -10.545 -4.807  1.00 0.00 ? 30 GLN A HG2  7  
ATOM 4036  H HG3  . GLN A 1 27 ? 3.168   -11.833 -4.675  1.00 0.00 ? 30 GLN A HG3  7  
ATOM 4037  H HE21 . GLN A 1 27 ? 2.292   -12.350 -6.548  1.00 0.00 ? 30 GLN A HE21 7  
ATOM 4038  H HE22 . GLN A 1 27 ? 1.990   -11.273 -7.863  1.00 0.00 ? 30 GLN A HE22 7  
ATOM 4039  N N    . ALA A 1 28 ? 3.794   -11.416 -1.229  1.00 0.00 ? 31 ALA A N    7  
ATOM 4040  C CA   . ALA A 1 28 ? 4.812   -12.260 -0.610  1.00 0.00 ? 31 ALA A CA   7  
ATOM 4041  C C    . ALA A 1 28 ? 4.194   -13.194 0.426   1.00 0.00 ? 31 ALA A C    7  
ATOM 4042  O O    . ALA A 1 28 ? 4.446   -14.399 0.412   1.00 0.00 ? 31 ALA A O    7  
ATOM 4043  C CB   . ALA A 1 28 ? 5.898   -11.399 0.022   1.00 0.00 ? 31 ALA A CB   7  
ATOM 4044  H H    . ALA A 1 28 ? 3.709   -10.482 -0.953  1.00 0.00 ? 31 ALA A H    7  
ATOM 4045  H HA   . ALA A 1 28 ? 5.268   -12.858 -1.388  1.00 0.00 ? 31 ALA A HA   7  
ATOM 4046  H HB1  . ALA A 1 28 ? 6.757   -12.014 0.253   1.00 0.00 ? 31 ALA A HB1  7  
ATOM 4047  H HB2  . ALA A 1 28 ? 5.521   -10.950 0.929   1.00 0.00 ? 31 ALA A HB2  7  
ATOM 4048  H HB3  . ALA A 1 28 ? 6.189   -10.622 -0.669  1.00 0.00 ? 31 ALA A HB3  7  
ATOM 4049  N N    . ALA A 1 29 ? 3.376   -12.631 1.317   1.00 0.00 ? 32 ALA A N    7  
ATOM 4050  C CA   . ALA A 1 29 ? 2.712   -13.417 2.363   1.00 0.00 ? 32 ALA A CA   7  
ATOM 4051  C C    . ALA A 1 29 ? 1.703   -14.419 1.789   1.00 0.00 ? 32 ALA A C    7  
ATOM 4052  O O    . ALA A 1 29 ? 1.262   -15.323 2.497   1.00 0.00 ? 32 ALA A O    7  
ATOM 4053  C CB   . ALA A 1 29 ? 2.032   -12.500 3.370   1.00 0.00 ? 32 ALA A CB   7  
ATOM 4054  H H    . ALA A 1 29 ? 3.210   -11.653 1.270   1.00 0.00 ? 32 ALA A H    7  
ATOM 4055  H HA   . ALA A 1 29 ? 3.477   -13.973 2.887   1.00 0.00 ? 32 ALA A HA   7  
ATOM 4056  H HB1  . ALA A 1 29 ? 2.750   -11.792 3.755   1.00 0.00 ? 32 ALA A HB1  7  
ATOM 4057  H HB2  . ALA A 1 29 ? 1.635   -13.089 4.184   1.00 0.00 ? 32 ALA A HB2  7  
ATOM 4058  H HB3  . ALA A 1 29 ? 1.226   -11.968 2.884   1.00 0.00 ? 32 ALA A HB3  7  
ATOM 4059  N N    . ALA A 1 30 ? 1.333   -14.257 0.515   1.00 0.00 ? 33 ALA A N    7  
ATOM 4060  C CA   . ALA A 1 30 ? 0.379   -15.165 -0.122  1.00 0.00 ? 33 ALA A CA   7  
ATOM 4061  C C    . ALA A 1 30 ? 1.082   -16.193 -0.998  1.00 0.00 ? 33 ALA A C    7  
ATOM 4062  O O    . ALA A 1 30 ? 0.896   -17.401 -0.832  1.00 0.00 ? 33 ALA A O    7  
ATOM 4063  C CB   . ALA A 1 30 ? -0.648  -14.380 -0.930  1.00 0.00 ? 33 ALA A CB   7  
ATOM 4064  H H    . ALA A 1 30 ? 1.702   -13.510 -0.003  1.00 0.00 ? 33 ALA A H    7  
ATOM 4065  H HA   . ALA A 1 30 ? -0.132  -15.688 0.647   1.00 0.00 ? 33 ALA A HA   7  
ATOM 4066  H HB1  . ALA A 1 30 ? -1.248  -13.779 -0.262  1.00 0.00 ? 33 ALA A HB1  7  
ATOM 4067  H HB2  . ALA A 1 30 ? -1.287  -15.067 -1.466  1.00 0.00 ? 33 ALA A HB2  7  
ATOM 4068  H HB3  . ALA A 1 30 ? -0.140  -13.738 -1.633  1.00 0.00 ? 33 ALA A HB3  7  
ATOM 4069  N N    . ASN A 1 31 ? 1.887   -15.700 -1.918  1.00 0.00 ? 34 ASN A N    7  
ATOM 4070  C CA   . ASN A 1 31 ? 2.636   -16.553 -2.840  1.00 0.00 ? 34 ASN A CA   7  
ATOM 4071  C C    . ASN A 1 31 ? 3.687   -17.377 -2.094  1.00 0.00 ? 34 ASN A C    7  
ATOM 4072  O O    . ASN A 1 31 ? 3.755   -18.596 -2.252  1.00 0.00 ? 34 ASN A O    7  
ATOM 4073  C CB   . ASN A 1 31 ? 3.294   -15.697 -3.932  1.00 0.00 ? 34 ASN A CB   7  
ATOM 4074  C CG   . ASN A 1 31 ? 4.353   -16.447 -4.716  1.00 0.00 ? 34 ASN A CG   7  
ATOM 4075  O OD1  . ASN A 1 31 ? 4.062   -17.076 -5.730  1.00 0.00 ? 34 ASN A OD1  7  
ATOM 4076  N ND2  . ASN A 1 31 ? 5.590   -16.379 -4.252  1.00 0.00 ? 34 ASN A ND2  7  
ATOM 4077  H H    . ASN A 1 31 ? 1.984   -14.731 -1.974  1.00 0.00 ? 34 ASN A H    7  
ATOM 4078  H HA   . ASN A 1 31 ? 1.935   -17.231 -3.305  1.00 0.00 ? 34 ASN A HA   7  
ATOM 4079  H HB2  . ASN A 1 31 ? 2.537   -15.365 -4.624  1.00 0.00 ? 34 ASN A HB2  7  
ATOM 4080  H HB3  . ASN A 1 31 ? 3.757   -14.836 -3.474  1.00 0.00 ? 34 ASN A HB3  7  
ATOM 4081  H HD21 . ASN A 1 31 ? 5.755   -15.857 -3.441  1.00 0.00 ? 34 ASN A HD21 7  
ATOM 4082  H HD22 . ASN A 1 31 ? 6.288   -16.858 -4.739  1.00 0.00 ? 34 ASN A HD22 7  
ATOM 4083  N N    . ALA A 1 32 ? 4.492   -16.709 -1.271  1.00 0.00 ? 35 ALA A N    7  
ATOM 4084  C CA   . ALA A 1 32 ? 5.531   -17.388 -0.496  1.00 0.00 ? 35 ALA A CA   7  
ATOM 4085  C C    . ALA A 1 32 ? 4.991   -17.875 0.854   1.00 0.00 ? 35 ALA A C    7  
ATOM 4086  O O    . ALA A 1 32 ? 5.646   -17.733 1.890   1.00 0.00 ? 35 ALA A O    7  
ATOM 4087  C CB   . ALA A 1 32 ? 6.725   -16.459 -0.300  1.00 0.00 ? 35 ALA A CB   7  
ATOM 4088  H H    . ALA A 1 32 ? 4.379   -15.737 -1.175  1.00 0.00 ? 35 ALA A H    7  
ATOM 4089  H HA   . ALA A 1 32 ? 5.863   -18.245 -1.064  1.00 0.00 ? 35 ALA A HA   7  
ATOM 4090  H HB1  . ALA A 1 32 ? 7.554   -17.020 0.109   1.00 0.00 ? 35 ALA A HB1  7  
ATOM 4091  H HB2  . ALA A 1 32 ? 6.456   -15.666 0.382   1.00 0.00 ? 35 ALA A HB2  7  
ATOM 4092  H HB3  . ALA A 1 32 ? 7.012   -16.034 -1.251  1.00 0.00 ? 35 ALA A HB3  7  
ATOM 4093  N N    . HIS A 1 33 ? 3.785   -18.447 0.835   1.00 0.00 ? 36 HIS A N    7  
ATOM 4094  C CA   . HIS A 1 33 ? 3.152   -18.948 2.051   1.00 0.00 ? 36 HIS A CA   7  
ATOM 4095  C C    . HIS A 1 33 ? 2.256   -20.156 1.763   1.00 0.00 ? 36 HIS A C    7  
ATOM 4096  O O    . HIS A 1 33 ? 2.484   -21.246 2.289   1.00 0.00 ? 36 HIS A O    7  
ATOM 4097  C CB   . HIS A 1 33 ? 2.334   -17.828 2.695   1.00 0.00 ? 36 HIS A CB   7  
ATOM 4098  C CG   . HIS A 1 33 ? 2.215   -17.925 4.182   1.00 0.00 ? 36 HIS A CG   7  
ATOM 4099  N ND1  . HIS A 1 33 ? 1.568   -16.973 4.937   1.00 0.00 ? 36 HIS A ND1  7  
ATOM 4100  C CD2  . HIS A 1 33 ? 2.661   -18.858 5.056   1.00 0.00 ? 36 HIS A CD2  7  
ATOM 4101  C CE1  . HIS A 1 33 ? 1.620   -17.313 6.212   1.00 0.00 ? 36 HIS A CE1  7  
ATOM 4102  N NE2  . HIS A 1 33 ? 2.277   -18.454 6.313   1.00 0.00 ? 36 HIS A NE2  7  
ATOM 4103  H H    . HIS A 1 33 ? 3.309   -18.525 -0.016  1.00 0.00 ? 36 HIS A H    7  
ATOM 4104  H HA   . HIS A 1 33 ? 3.933   -19.249 2.734   1.00 0.00 ? 36 HIS A HA   7  
ATOM 4105  H HB2  . HIS A 1 33 ? 2.801   -16.883 2.467   1.00 0.00 ? 36 HIS A HB2  7  
ATOM 4106  H HB3  . HIS A 1 33 ? 1.336   -17.836 2.281   1.00 0.00 ? 36 HIS A HB3  7  
ATOM 4107  H HD1  . HIS A 1 33 ? 1.138   -16.162 4.585   1.00 0.00 ? 36 HIS A HD1  7  
ATOM 4108  H HD2  . HIS A 1 33 ? 3.214   -19.753 4.808   1.00 0.00 ? 36 HIS A HD2  7  
ATOM 4109  H HE1  . HIS A 1 33 ? 1.194   -16.753 7.032   1.00 0.00 ? 36 HIS A HE1  7  
ATOM 4110  H HE2  . HIS A 1 33 ? 2.578   -18.858 7.154   1.00 0.00 ? 36 HIS A HE2  7  
ATOM 4111  N N    . LEU A 1 34 ? 1.232   -19.954 0.930   1.00 0.00 ? 37 LEU A N    7  
ATOM 4112  C CA   . LEU A 1 34 ? 0.296   -21.028 0.585   1.00 0.00 ? 37 LEU A CA   7  
ATOM 4113  C C    . LEU A 1 34 ? 0.876   -21.994 -0.447  1.00 0.00 ? 37 LEU A C    7  
ATOM 4114  O O    . LEU A 1 34 ? 0.480   -23.160 -0.507  1.00 0.00 ? 37 LEU A O    7  
ATOM 4115  C CB   . LEU A 1 34 ? -1.023  -20.441 0.075   1.00 0.00 ? 37 LEU A CB   7  
ATOM 4116  C CG   . LEU A 1 34 ? -2.093  -20.232 1.147   1.00 0.00 ? 37 LEU A CG   7  
ATOM 4117  C CD1  . LEU A 1 34 ? -3.122  -19.216 0.682   1.00 0.00 ? 37 LEU A CD1  7  
ATOM 4118  C CD2  . LEU A 1 34 ? -2.768  -21.550 1.490   1.00 0.00 ? 37 LEU A CD2  7  
ATOM 4119  H H    . LEU A 1 34 ? 1.097   -19.059 0.546   1.00 0.00 ? 37 LEU A H    7  
ATOM 4120  H HA   . LEU A 1 34 ? 0.105   -21.581 1.480   1.00 0.00 ? 37 LEU A HA   7  
ATOM 4121  H HB2  . LEU A 1 34 ? -0.814  -19.487 -0.388  1.00 0.00 ? 37 LEU A HB2  7  
ATOM 4122  H HB3  . LEU A 1 34 ? -1.424  -21.107 -0.676  1.00 0.00 ? 37 LEU A HB3  7  
ATOM 4123  H HG   . LEU A 1 34 ? -1.629  -19.849 2.044   1.00 0.00 ? 37 LEU A HG   7  
ATOM 4124  H HD11 . LEU A 1 34 ? -3.889  -19.110 1.435   1.00 0.00 ? 37 LEU A HD11 7  
ATOM 4125  H HD12 . LEU A 1 34 ? -3.570  -19.554 -0.241  1.00 0.00 ? 37 LEU A HD12 7  
ATOM 4126  H HD13 . LEU A 1 34 ? -2.641  -18.263 0.522   1.00 0.00 ? 37 LEU A HD13 7  
ATOM 4127  H HD21 . LEU A 1 34 ? -3.168  -21.500 2.492   1.00 0.00 ? 37 LEU A HD21 7  
ATOM 4128  H HD22 . LEU A 1 34 ? -2.046  -22.350 1.429   1.00 0.00 ? 37 LEU A HD22 7  
ATOM 4129  H HD23 . LEU A 1 34 ? -3.571  -21.736 0.791   1.00 0.00 ? 37 LEU A HD23 7  
ATOM 4130  N N    . MET A 1 35 ? 1.817   -21.505 -1.245  1.00 0.00 ? 38 MET A N    7  
ATOM 4131  C CA   . MET A 1 35 ? 2.466   -22.315 -2.286  1.00 0.00 ? 38 MET A CA   7  
ATOM 4132  C C    . MET A 1 35 ? 3.027   -23.628 -1.737  1.00 0.00 ? 38 MET A C    7  
ATOM 4133  O O    . MET A 1 35 ? 3.158   -24.610 -2.466  1.00 0.00 ? 38 MET A O    7  
ATOM 4134  C CB   . MET A 1 35 ? 3.577   -21.512 -2.969  1.00 0.00 ? 38 MET A CB   7  
ATOM 4135  C CG   . MET A 1 35 ? 4.071   -22.135 -4.266  1.00 0.00 ? 38 MET A CG   7  
ATOM 4136  S SD   . MET A 1 35 ? 5.107   -21.013 -5.222  1.00 0.00 ? 38 MET A SD   7  
ATOM 4137  C CE   . MET A 1 35 ? 3.862   -20.056 -6.082  1.00 0.00 ? 38 MET A CE   7  
ATOM 4138  H H    . MET A 1 35 ? 2.083   -20.574 -1.131  1.00 0.00 ? 38 MET A H    7  
ATOM 4139  H HA   . MET A 1 35 ? 1.718   -22.557 -3.011  1.00 0.00 ? 38 MET A HA   7  
ATOM 4140  H HB2  . MET A 1 35 ? 3.206   -20.522 -3.189  1.00 0.00 ? 38 MET A HB2  7  
ATOM 4141  H HB3  . MET A 1 35 ? 4.415   -21.429 -2.293  1.00 0.00 ? 38 MET A HB3  7  
ATOM 4142  H HG2  . MET A 1 35 ? 4.644   -23.019 -4.029  1.00 0.00 ? 38 MET A HG2  7  
ATOM 4143  H HG3  . MET A 1 35 ? 3.215   -22.411 -4.865  1.00 0.00 ? 38 MET A HG3  7  
ATOM 4144  H HE1  . MET A 1 35 ? 3.334   -19.435 -5.375  1.00 0.00 ? 38 MET A HE1  7  
ATOM 4145  H HE2  . MET A 1 35 ? 3.165   -20.724 -6.566  1.00 0.00 ? 38 MET A HE2  7  
ATOM 4146  H HE3  . MET A 1 35 ? 4.337   -19.432 -6.825  1.00 0.00 ? 38 MET A HE3  7  
ATOM 4147  N N    . ALA A 1 36 ? 3.346   -23.636 -0.451  1.00 0.00 ? 39 ALA A N    7  
ATOM 4148  C CA   . ALA A 1 36 ? 3.881   -24.828 0.208   1.00 0.00 ? 39 ALA A CA   7  
ATOM 4149  C C    . ALA A 1 36 ? 2.774   -25.657 0.880   1.00 0.00 ? 39 ALA A C    7  
ATOM 4150  O O    . ALA A 1 36 ? 3.062   -26.614 1.600   1.00 0.00 ? 39 ALA A O    7  
ATOM 4151  C CB   . ALA A 1 36 ? 4.939   -24.423 1.228   1.00 0.00 ? 39 ALA A CB   7  
ATOM 4152  H H    . ALA A 1 36 ? 3.208   -22.821 0.067   1.00 0.00 ? 39 ALA A H    7  
ATOM 4153  H HA   . ALA A 1 36 ? 4.360   -25.437 -0.546  1.00 0.00 ? 39 ALA A HA   7  
ATOM 4154  H HB1  . ALA A 1 36 ? 4.501   -23.758 1.957   1.00 0.00 ? 39 ALA A HB1  7  
ATOM 4155  H HB2  . ALA A 1 36 ? 5.752   -23.921 0.725   1.00 0.00 ? 39 ALA A HB2  7  
ATOM 4156  H HB3  . ALA A 1 36 ? 5.314   -25.306 1.726   1.00 0.00 ? 39 ALA A HB3  7  
ATOM 4157  N N    . GLN A 1 37 ? 1.511   -25.288 0.641   1.00 0.00 ? 40 GLN A N    7  
ATOM 4158  C CA   . GLN A 1 37 ? 0.377   -25.999 1.227   1.00 0.00 ? 40 GLN A CA   7  
ATOM 4159  C C    . GLN A 1 37 ? -0.681  -26.348 0.173   1.00 0.00 ? 40 GLN A C    7  
ATOM 4160  O O    . GLN A 1 37 ? -1.171  -27.477 0.133   1.00 0.00 ? 40 GLN A O    7  
ATOM 4161  C CB   . GLN A 1 37 ? -0.248  -25.158 2.345   1.00 0.00 ? 40 GLN A CB   7  
ATOM 4162  C CG   . GLN A 1 37 ? -1.234  -25.929 3.212   1.00 0.00 ? 40 GLN A CG   7  
ATOM 4163  C CD   . GLN A 1 37 ? -2.474  -25.126 3.554   1.00 0.00 ? 40 GLN A CD   7  
ATOM 4164  O OE1  . GLN A 1 37 ? -2.734  -24.832 4.717   1.00 0.00 ? 40 GLN A OE1  7  
ATOM 4165  N NE2  . GLN A 1 37 ? -3.250  -24.769 2.542   1.00 0.00 ? 40 GLN A NE2  7  
ATOM 4166  H H    . GLN A 1 37 ? 1.336   -24.519 0.061   1.00 0.00 ? 40 GLN A H    7  
ATOM 4167  H HA   . GLN A 1 37 ? 0.751   -26.917 1.650   1.00 0.00 ? 40 GLN A HA   7  
ATOM 4168  H HB2  . GLN A 1 37 ? 0.542   -24.784 2.980   1.00 0.00 ? 40 GLN A HB2  7  
ATOM 4169  H HB3  . GLN A 1 37 ? -0.767  -24.321 1.901   1.00 0.00 ? 40 GLN A HB3  7  
ATOM 4170  H HG2  . GLN A 1 37 ? -1.540  -26.821 2.685   1.00 0.00 ? 40 GLN A HG2  7  
ATOM 4171  H HG3  . GLN A 1 37 ? -0.742  -26.210 4.133   1.00 0.00 ? 40 GLN A HG3  7  
ATOM 4172  H HE21 . GLN A 1 37 ? -2.987  -25.038 1.637   1.00 0.00 ? 40 GLN A HE21 7  
ATOM 4173  H HE22 . GLN A 1 37 ? -4.055  -24.250 2.741   1.00 0.00 ? 40 GLN A HE22 7  
ATOM 4174  N N    . ILE A 1 38 ? -1.032  -25.376 -0.676  1.00 0.00 ? 41 ILE A N    7  
ATOM 4175  C CA   . ILE A 1 38 ? -2.033  -25.596 -1.722  1.00 0.00 ? 41 ILE A CA   7  
ATOM 4176  C C    . ILE A 1 38 ? -1.900  -24.570 -2.854  1.00 0.00 ? 41 ILE A C    7  
ATOM 4177  O O    . ILE A 1 38 ? -1.640  -23.383 -2.560  1.00 0.00 ? 41 ILE A O    7  
ATOM 4178  C CB   . ILE A 1 38 ? -3.470  -25.557 -1.147  1.00 0.00 ? 41 ILE A CB   7  
ATOM 4179  C CG1  . ILE A 1 38 ? -4.470  -26.102 -2.169  1.00 0.00 ? 41 ILE A CG1  7  
ATOM 4180  C CG2  . ILE A 1 38 ? -3.855  -24.143 -0.731  1.00 0.00 ? 41 ILE A CG2  7  
ATOM 4181  C CD1  . ILE A 1 38 ? -4.692  -27.595 -2.062  1.00 0.00 ? 41 ILE A CD1  7  
ATOM 4182  O OXT  . ILE A 1 38 ? -2.058  -24.969 -4.028  1.00 0.00 ? 41 ILE A OXT  7  
ATOM 4183  H H    . ILE A 1 38 ? -0.609  -24.490 -0.598  1.00 0.00 ? 41 ILE A H    7  
ATOM 4184  H HA   . ILE A 1 38 ? -1.864  -26.581 -2.134  1.00 0.00 ? 41 ILE A HA   7  
ATOM 4185  H HB   . ILE A 1 38 ? -3.495  -26.181 -0.267  1.00 0.00 ? 41 ILE A HB   7  
ATOM 4186  H HG12 . ILE A 1 38 ? -5.423  -25.615 -2.027  1.00 0.00 ? 41 ILE A HG12 7  
ATOM 4187  H HG13 . ILE A 1 38 ? -4.108  -25.889 -3.165  1.00 0.00 ? 41 ILE A HG13 7  
ATOM 4188  H HG21 . ILE A 1 38 ? -3.008  -23.663 -0.264  1.00 0.00 ? 41 ILE A HG21 7  
ATOM 4189  H HG22 . ILE A 1 38 ? -4.677  -24.183 -0.034  1.00 0.00 ? 41 ILE A HG22 7  
ATOM 4190  H HG23 . ILE A 1 38 ? -4.150  -23.580 -1.605  1.00 0.00 ? 41 ILE A HG23 7  
ATOM 4191  H HD11 . ILE A 1 38 ? -5.471  -27.792 -1.342  1.00 0.00 ? 41 ILE A HD11 7  
ATOM 4192  H HD12 . ILE A 1 38 ? -3.776  -28.072 -1.742  1.00 0.00 ? 41 ILE A HD12 7  
ATOM 4193  H HD13 . ILE A 1 38 ? -4.983  -27.985 -3.026  1.00 0.00 ? 41 ILE A HD13 7  
ATOM 4194  N N    . PHE A 1 1  ? -18.196 9.704   5.383   1.00 0.00 ? 4  PHE A N    8  
ATOM 4195  C CA   . PHE A 1 1  ? -16.764 9.306   5.243   1.00 0.00 ? 4  PHE A CA   8  
ATOM 4196  C C    . PHE A 1 1  ? -15.975 10.338  4.432   1.00 0.00 ? 4  PHE A C    8  
ATOM 4197  O O    . PHE A 1 1  ? -16.558 11.183  3.754   1.00 0.00 ? 4  PHE A O    8  
ATOM 4198  C CB   . PHE A 1 1  ? -16.697 7.933   4.560   1.00 0.00 ? 4  PHE A CB   8  
ATOM 4199  C CG   . PHE A 1 1  ? -17.375 6.839   5.336   1.00 0.00 ? 4  PHE A CG   8  
ATOM 4200  C CD1  . PHE A 1 1  ? -16.798 6.328   6.487   1.00 0.00 ? 4  PHE A CD1  8  
ATOM 4201  C CD2  . PHE A 1 1  ? -18.590 6.324   4.915   1.00 0.00 ? 4  PHE A CD2  8  
ATOM 4202  C CE1  . PHE A 1 1  ? -17.419 5.323   7.203   1.00 0.00 ? 4  PHE A CE1  8  
ATOM 4203  C CE2  . PHE A 1 1  ? -19.217 5.319   5.627   1.00 0.00 ? 4  PHE A CE2  8  
ATOM 4204  C CZ   . PHE A 1 1  ? -18.630 4.818   6.772   1.00 0.00 ? 4  PHE A CZ   8  
ATOM 4205  H H1   . PHE A 1 1  ? -18.639 9.064   6.073   1.00 0.00 ? 4  PHE A H1   8  
ATOM 4206  H H2   . PHE A 1 1  ? -18.645 9.614   4.448   1.00 0.00 ? 4  PHE A H2   8  
ATOM 4207  H H3   . PHE A 1 1  ? -18.223 10.688  5.717   1.00 0.00 ? 4  PHE A H3   8  
ATOM 4208  H HA   . PHE A 1 1  ? -16.331 9.232   6.229   1.00 0.00 ? 4  PHE A HA   8  
ATOM 4209  H HB2  . PHE A 1 1  ? -17.172 7.995   3.593   1.00 0.00 ? 4  PHE A HB2  8  
ATOM 4210  H HB3  . PHE A 1 1  ? -15.661 7.655   4.428   1.00 0.00 ? 4  PHE A HB3  8  
ATOM 4211  H HD1  . PHE A 1 1  ? -15.850 6.721   6.824   1.00 0.00 ? 4  PHE A HD1  8  
ATOM 4212  H HD2  . PHE A 1 1  ? -19.049 6.714   4.019   1.00 0.00 ? 4  PHE A HD2  8  
ATOM 4213  H HE1  . PHE A 1 1  ? -16.958 4.932   8.099   1.00 0.00 ? 4  PHE A HE1  8  
ATOM 4214  H HE2  . PHE A 1 1  ? -20.164 4.926   5.288   1.00 0.00 ? 4  PHE A HE2  8  
ATOM 4215  H HZ   . PHE A 1 1  ? -19.118 4.032   7.330   1.00 0.00 ? 4  PHE A HZ   8  
ATOM 4216  N N    . THR A 1 2  ? -14.647 10.263  4.509   1.00 0.00 ? 5  THR A N    8  
ATOM 4217  C CA   . THR A 1 2  ? -13.773 11.189  3.785   1.00 0.00 ? 5  THR A CA   8  
ATOM 4218  C C    . THR A 1 2  ? -13.553 10.726  2.345   1.00 0.00 ? 5  THR A C    8  
ATOM 4219  O O    . THR A 1 2  ? -12.606 9.995   2.053   1.00 0.00 ? 5  THR A O    8  
ATOM 4220  C CB   . THR A 1 2  ? -12.427 11.319  4.504   1.00 0.00 ? 5  THR A CB   8  
ATOM 4221  O OG1  . THR A 1 2  ? -11.980 10.054  4.959   1.00 0.00 ? 5  THR A OG1  8  
ATOM 4222  C CG2  . THR A 1 2  ? -12.473 12.240  5.703   1.00 0.00 ? 5  THR A CG2  8  
ATOM 4223  H H    . THR A 1 2  ? -14.238 9.567   5.066   1.00 0.00 ? 5  THR A H    8  
ATOM 4224  H HA   . THR A 1 2  ? -14.255 12.155  3.768   1.00 0.00 ? 5  THR A HA   8  
ATOM 4225  H HB   . THR A 1 2  ? -11.694 11.712  3.811   1.00 0.00 ? 5  THR A HB   8  
ATOM 4226  H HG1  . THR A 1 2  ? -11.483 9.621   4.257   1.00 0.00 ? 5  THR A HG1  8  
ATOM 4227  H HG21 . THR A 1 2  ? -11.933 13.148  5.480   1.00 0.00 ? 5  THR A HG21 8  
ATOM 4228  H HG22 . THR A 1 2  ? -12.016 11.749  6.550   1.00 0.00 ? 5  THR A HG22 8  
ATOM 4229  H HG23 . THR A 1 2  ? -13.499 12.479  5.935   1.00 0.00 ? 5  THR A HG23 8  
ATOM 4230  N N    . LEU A 1 3  ? -14.444 11.152  1.451   1.00 0.00 ? 6  LEU A N    8  
ATOM 4231  C CA   . LEU A 1 3  ? -14.356 10.782  0.037   1.00 0.00 ? 6  LEU A CA   8  
ATOM 4232  C C    . LEU A 1 3  ? -14.826 11.932  -0.866  1.00 0.00 ? 6  LEU A C    8  
ATOM 4233  O O    . LEU A 1 3  ? -15.780 11.790  -1.635  1.00 0.00 ? 6  LEU A O    8  
ATOM 4234  C CB   . LEU A 1 3  ? -15.176 9.512   -0.231  1.00 0.00 ? 6  LEU A CB   8  
ATOM 4235  C CG   . LEU A 1 3  ? -16.678 9.628   0.045   1.00 0.00 ? 6  LEU A CG   8  
ATOM 4236  C CD1  . LEU A 1 3  ? -17.478 8.983   -1.074  1.00 0.00 ? 6  LEU A CD1  8  
ATOM 4237  C CD2  . LEU A 1 3  ? -17.025 8.992   1.379   1.00 0.00 ? 6  LEU A CD2  8  
ATOM 4238  H H    . LEU A 1 3  ? -15.180 11.724  1.752   1.00 0.00 ? 6  LEU A H    8  
ATOM 4239  H HA   . LEU A 1 3  ? -13.318 10.579  -0.183  1.00 0.00 ? 6  LEU A HA   8  
ATOM 4240  H HB2  . LEU A 1 3  ? -15.043 9.237   -1.267  1.00 0.00 ? 6  LEU A HB2  8  
ATOM 4241  H HB3  . LEU A 1 3  ? -14.781 8.719   0.386   1.00 0.00 ? 6  LEU A HB3  8  
ATOM 4242  H HG   . LEU A 1 3  ? -16.951 10.673  0.090   1.00 0.00 ? 6  LEU A HG   8  
ATOM 4243  H HD11 . LEU A 1 3  ? -17.274 9.495   -2.002  1.00 0.00 ? 6  LEU A HD11 8  
ATOM 4244  H HD12 . LEU A 1 3  ? -18.531 9.052   -0.848  1.00 0.00 ? 6  LEU A HD12 8  
ATOM 4245  H HD13 . LEU A 1 3  ? -17.196 7.945   -1.165  1.00 0.00 ? 6  LEU A HD13 8  
ATOM 4246  H HD21 . LEU A 1 3  ? -17.096 7.922   1.259   1.00 0.00 ? 6  LEU A HD21 8  
ATOM 4247  H HD22 . LEU A 1 3  ? -17.972 9.380   1.725   1.00 0.00 ? 6  LEU A HD22 8  
ATOM 4248  H HD23 . LEU A 1 3  ? -16.255 9.224   2.100   1.00 0.00 ? 6  LEU A HD23 8  
ATOM 4249  N N    . SER A 1 4  ? -14.143 13.070  -0.771  1.00 0.00 ? 7  SER A N    8  
ATOM 4250  C CA   . SER A 1 4  ? -14.480 14.246  -1.576  1.00 0.00 ? 7  SER A CA   8  
ATOM 4251  C C    . SER A 1 4  ? -13.227 14.826  -2.242  1.00 0.00 ? 7  SER A C    8  
ATOM 4252  O O    . SER A 1 4  ? -12.999 16.039  -2.212  1.00 0.00 ? 7  SER A O    8  
ATOM 4253  C CB   . SER A 1 4  ? -15.155 15.307  -0.699  1.00 0.00 ? 7  SER A CB   8  
ATOM 4254  O OG   . SER A 1 4  ? -15.471 16.469  -1.450  1.00 0.00 ? 7  SER A OG   8  
ATOM 4255  H H    . SER A 1 4  ? -13.382 13.124  -0.140  1.00 0.00 ? 7  SER A H    8  
ATOM 4256  H HA   . SER A 1 4  ? -15.169 13.937  -2.347  1.00 0.00 ? 7  SER A HA   8  
ATOM 4257  H HB2  . SER A 1 4  ? -16.067 14.901  -0.286  1.00 0.00 ? 7  SER A HB2  8  
ATOM 4258  H HB3  . SER A 1 4  ? -14.488 15.583  0.106   1.00 0.00 ? 7  SER A HB3  8  
ATOM 4259  H HG   . SER A 1 4  ? -14.661 16.849  -1.812  1.00 0.00 ? 7  SER A HG   8  
ATOM 4260  N N    . LEU A 1 5  ? -12.419 13.945  -2.837  1.00 0.00 ? 8  LEU A N    8  
ATOM 4261  C CA   . LEU A 1 5  ? -11.180 14.349  -3.509  1.00 0.00 ? 8  LEU A CA   8  
ATOM 4262  C C    . LEU A 1 5  ? -10.190 14.972  -2.516  1.00 0.00 ? 8  LEU A C    8  
ATOM 4263  O O    . LEU A 1 5  ? -9.455  15.905  -2.848  1.00 0.00 ? 8  LEU A O    8  
ATOM 4264  C CB   . LEU A 1 5  ? -11.486 15.322  -4.655  1.00 0.00 ? 8  LEU A CB   8  
ATOM 4265  C CG   . LEU A 1 5  ? -11.136 14.810  -6.053  1.00 0.00 ? 8  LEU A CG   8  
ATOM 4266  C CD1  . LEU A 1 5  ? -11.928 15.562  -7.110  1.00 0.00 ? 8  LEU A CD1  8  
ATOM 4267  C CD2  . LEU A 1 5  ? -9.644  14.944  -6.314  1.00 0.00 ? 8  LEU A CD2  8  
ATOM 4268  H H    . LEU A 1 5  ? -12.660 12.997  -2.820  1.00 0.00 ? 8  LEU A H    8  
ATOM 4269  H HA   . LEU A 1 5  ? -10.729 13.458  -3.916  1.00 0.00 ? 8  LEU A HA   8  
ATOM 4270  H HB2  . LEU A 1 5  ? -12.543 15.551  -4.632  1.00 0.00 ? 8  LEU A HB2  8  
ATOM 4271  H HB3  . LEU A 1 5  ? -10.936 16.236  -4.483  1.00 0.00 ? 8  LEU A HB3  8  
ATOM 4272  H HG   . LEU A 1 5  ? -11.396 13.763  -6.123  1.00 0.00 ? 8  LEU A HG   8  
ATOM 4273  H HD11 . LEU A 1 5  ? -12.965 15.266  -7.060  1.00 0.00 ? 8  LEU A HD11 8  
ATOM 4274  H HD12 . LEU A 1 5  ? -11.533 15.330  -8.087  1.00 0.00 ? 8  LEU A HD12 8  
ATOM 4275  H HD13 . LEU A 1 5  ? -11.848 16.624  -6.930  1.00 0.00 ? 8  LEU A HD13 8  
ATOM 4276  H HD21 . LEU A 1 5  ? -9.486  15.374  -7.291  1.00 0.00 ? 8  LEU A HD21 8  
ATOM 4277  H HD22 . LEU A 1 5  ? -9.182  13.969  -6.270  1.00 0.00 ? 8  LEU A HD22 8  
ATOM 4278  H HD23 . LEU A 1 5  ? -9.204  15.584  -5.563  1.00 0.00 ? 8  LEU A HD23 8  
ATOM 4279  N N    . ASP A 1 6  ? -10.174 14.434  -1.300  1.00 0.00 ? 9  ASP A N    8  
ATOM 4280  C CA   . ASP A 1 6  ? -9.288  14.909  -0.248  1.00 0.00 ? 9  ASP A CA   8  
ATOM 4281  C C    . ASP A 1 6  ? -8.010  14.073  -0.201  1.00 0.00 ? 9  ASP A C    8  
ATOM 4282  O O    . ASP A 1 6  ? -7.738  13.362  0.768   1.00 0.00 ? 9  ASP A O    8  
ATOM 4283  C CB   . ASP A 1 6  ? -10.016 14.890  1.107   1.00 0.00 ? 9  ASP A CB   8  
ATOM 4284  C CG   . ASP A 1 6  ? -10.932 13.690  1.295   1.00 0.00 ? 9  ASP A CG   8  
ATOM 4285  O OD1  . ASP A 1 6  ? -11.970 13.611  0.599   1.00 0.00 ? 9  ASP A OD1  8  
ATOM 4286  O OD2  . ASP A 1 6  ? -10.616 12.833  2.143   1.00 0.00 ? 9  ASP A OD2  8  
ATOM 4287  H H    . ASP A 1 6  ? -10.773 13.691  -1.102  1.00 0.00 ? 9  ASP A H    8  
ATOM 4288  H HA   . ASP A 1 6  ? -9.014  15.920  -0.489  1.00 0.00 ? 9  ASP A HA   8  
ATOM 4289  H HB2  . ASP A 1 6  ? -9.284  14.869  1.891   1.00 0.00 ? 9  ASP A HB2  8  
ATOM 4290  H HB3  . ASP A 1 6  ? -10.610 15.788  1.201   1.00 0.00 ? 9  ASP A HB3  8  
ATOM 4291  N N    . VAL A 1 7  ? -7.241  14.158  -1.278  1.00 0.00 ? 10 VAL A N    8  
ATOM 4292  C CA   . VAL A 1 7  ? -6.002  13.401  -1.396  1.00 0.00 ? 10 VAL A CA   8  
ATOM 4293  C C    . VAL A 1 7  ? -4.766  14.310  -1.531  1.00 0.00 ? 10 VAL A C    8  
ATOM 4294  O O    . VAL A 1 7  ? -4.300  14.606  -2.633  1.00 0.00 ? 10 VAL A O    8  
ATOM 4295  C CB   . VAL A 1 7  ? -6.103  12.417  -2.581  1.00 0.00 ? 10 VAL A CB   8  
ATOM 4296  C CG1  . VAL A 1 7  ? -6.075  13.139  -3.921  1.00 0.00 ? 10 VAL A CG1  8  
ATOM 4297  C CG2  . VAL A 1 7  ? -5.007  11.365  -2.508  1.00 0.00 ? 10 VAL A CG2  8  
ATOM 4298  H H    . VAL A 1 7  ? -7.526  14.731  -2.021  1.00 0.00 ? 10 VAL A H    8  
ATOM 4299  H HA   . VAL A 1 7  ? -5.894  12.817  -0.494  1.00 0.00 ? 10 VAL A HA   8  
ATOM 4300  H HB   . VAL A 1 7  ? -7.057  11.918  -2.498  1.00 0.00 ? 10 VAL A HB   8  
ATOM 4301  H HG11 . VAL A 1 7  ? -5.056  13.204  -4.275  1.00 0.00 ? 10 VAL A HG11 8  
ATOM 4302  H HG12 . VAL A 1 7  ? -6.478  14.134  -3.805  1.00 0.00 ? 10 VAL A HG12 8  
ATOM 4303  H HG13 . VAL A 1 7  ? -6.670  12.592  -4.638  1.00 0.00 ? 10 VAL A HG13 8  
ATOM 4304  H HG21 . VAL A 1 7  ? -4.950  10.842  -3.452  1.00 0.00 ? 10 VAL A HG21 8  
ATOM 4305  H HG22 . VAL A 1 7  ? -5.233  10.663  -1.721  1.00 0.00 ? 10 VAL A HG22 8  
ATOM 4306  H HG23 . VAL A 1 7  ? -4.062  11.844  -2.305  1.00 0.00 ? 10 VAL A HG23 8  
ATOM 4307  N N    . PRO A 1 8  ? -4.212  14.765  -0.389  1.00 0.00 ? 11 PRO A N    8  
ATOM 4308  C CA   . PRO A 1 8  ? -3.032  15.635  -0.377  1.00 0.00 ? 11 PRO A CA   8  
ATOM 4309  C C    . PRO A 1 8  ? -1.729  14.863  -0.599  1.00 0.00 ? 11 PRO A C    8  
ATOM 4310  O O    . PRO A 1 8  ? -1.650  13.662  -0.326  1.00 0.00 ? 11 PRO A O    8  
ATOM 4311  C CB   . PRO A 1 8  ? -3.071  16.236  1.028   1.00 0.00 ? 11 PRO A CB   8  
ATOM 4312  C CG   . PRO A 1 8  ? -3.705  15.179  1.867   1.00 0.00 ? 11 PRO A CG   8  
ATOM 4313  C CD   . PRO A 1 8  ? -4.695  14.471  0.977   1.00 0.00 ? 11 PRO A CD   8  
ATOM 4314  H HA   . PRO A 1 8  ? -3.113  16.422  -1.112  1.00 0.00 ? 11 PRO A HA   8  
ATOM 4315  H HB2  . PRO A 1 8  ? -2.066  16.457  1.359   1.00 0.00 ? 11 PRO A HB2  8  
ATOM 4316  H HB3  . PRO A 1 8  ? -3.662  17.139  1.021   1.00 0.00 ? 11 PRO A HB3  8  
ATOM 4317  H HG2  . PRO A 1 8  ? -2.952  14.487  2.215   1.00 0.00 ? 11 PRO A HG2  8  
ATOM 4318  H HG3  . PRO A 1 8  ? -4.214  15.632  2.705   1.00 0.00 ? 11 PRO A HG3  8  
ATOM 4319  H HD2  . PRO A 1 8  ? -4.681  13.407  1.169   1.00 0.00 ? 11 PRO A HD2  8  
ATOM 4320  H HD3  . PRO A 1 8  ? -5.688  14.867  1.128   1.00 0.00 ? 11 PRO A HD3  8  
ATOM 4321  N N    . THR A 1 9  ? -0.704  15.561  -1.087  1.00 0.00 ? 12 THR A N    8  
ATOM 4322  C CA   . THR A 1 9  ? 0.606   14.949  -1.341  1.00 0.00 ? 12 THR A CA   8  
ATOM 4323  C C    . THR A 1 9  ? 1.088   14.151  -0.128  1.00 0.00 ? 12 THR A C    8  
ATOM 4324  O O    . THR A 1 9  ? 1.592   13.034  -0.271  1.00 0.00 ? 12 THR A O    8  
ATOM 4325  C CB   . THR A 1 9  ? 1.641   16.022  -1.703  1.00 0.00 ? 12 THR A CB   8  
ATOM 4326  O OG1  . THR A 1 9  ? 1.025   17.293  -1.827  1.00 0.00 ? 12 THR A OG1  8  
ATOM 4327  C CG2  . THR A 1 9  ? 2.366   15.742  -2.999  1.00 0.00 ? 12 THR A CG2  8  
ATOM 4328  H H    . THR A 1 9  ? -0.824  16.517  -1.278  1.00 0.00 ? 12 THR A H    8  
ATOM 4329  H HA   . THR A 1 9  ? 0.498   14.273  -2.176  1.00 0.00 ? 12 THR A HA   8  
ATOM 4330  H HB   . THR A 1 9  ? 2.380   16.078  -0.914  1.00 0.00 ? 12 THR A HB   8  
ATOM 4331  H HG1  . THR A 1 9  ? 1.695   17.963  -2.000  1.00 0.00 ? 12 THR A HG1  8  
ATOM 4332  H HG21 . THR A 1 9  ? 2.699   14.715  -3.010  1.00 0.00 ? 12 THR A HG21 8  
ATOM 4333  H HG22 . THR A 1 9  ? 3.219   16.397  -3.084  1.00 0.00 ? 12 THR A HG22 8  
ATOM 4334  H HG23 . THR A 1 9  ? 1.696   15.913  -3.829  1.00 0.00 ? 12 THR A HG23 8  
ATOM 4335  N N    . ASN A 1 10 ? 0.917   14.730  1.064   1.00 0.00 ? 13 ASN A N    8  
ATOM 4336  C CA   . ASN A 1 10 ? 1.319   14.077  2.314   1.00 0.00 ? 13 ASN A CA   8  
ATOM 4337  C C    . ASN A 1 10 ? 0.658   12.714  2.464   1.00 0.00 ? 13 ASN A C    8  
ATOM 4338  O O    . ASN A 1 10 ? 1.235   11.782  3.018   1.00 0.00 ? 13 ASN A O    8  
ATOM 4339  C CB   . ASN A 1 10 ? 0.982   14.962  3.522   1.00 0.00 ? 13 ASN A CB   8  
ATOM 4340  C CG   . ASN A 1 10 ? 1.556   16.363  3.410   1.00 0.00 ? 13 ASN A CG   8  
ATOM 4341  O OD1  . ASN A 1 10 ? 2.366   16.650  2.534   1.00 0.00 ? 13 ASN A OD1  8  
ATOM 4342  N ND2  . ASN A 1 10 ? 1.136   17.247  4.302   1.00 0.00 ? 13 ASN A ND2  8  
ATOM 4343  H H    . ASN A 1 10 ? 0.503   15.618  1.104   1.00 0.00 ? 13 ASN A H    8  
ATOM 4344  H HA   . ASN A 1 10 ? 2.370   13.927  2.272   1.00 0.00 ? 13 ASN A HA   8  
ATOM 4345  H HB2  . ASN A 1 10 ? -0.090  15.042  3.610   1.00 0.00 ? 13 ASN A HB2  8  
ATOM 4346  H HB3  . ASN A 1 10 ? 1.377   14.503  4.416   1.00 0.00 ? 13 ASN A HB3  8  
ATOM 4347  H HD21 . ASN A 1 10 ? 0.487   16.956  4.976   1.00 0.00 ? 13 ASN A HD21 8  
ATOM 4348  H HD22 . ASN A 1 10 ? 1.493   18.156  4.249   1.00 0.00 ? 13 ASN A HD22 8  
ATOM 4349  N N    . ILE A 1 11 ? -0.546  12.617  1.944   1.00 0.00 ? 14 ILE A N    8  
ATOM 4350  C CA   . ILE A 1 11 ? -1.318  11.384  1.978   1.00 0.00 ? 14 ILE A CA   8  
ATOM 4351  C C    . ILE A 1 11 ? -0.953  10.509  0.780   1.00 0.00 ? 14 ILE A C    8  
ATOM 4352  O O    . ILE A 1 11 ? -0.753  9.301   0.922   1.00 0.00 ? 14 ILE A O    8  
ATOM 4353  C CB   . ILE A 1 11 ? -2.830  11.703  1.992   1.00 0.00 ? 14 ILE A CB   8  
ATOM 4354  C CG1  . ILE A 1 11 ? -3.378  11.616  3.416   1.00 0.00 ? 14 ILE A CG1  8  
ATOM 4355  C CG2  . ILE A 1 11 ? -3.618  10.783  1.065   1.00 0.00 ? 14 ILE A CG2  8  
ATOM 4356  C CD1  . ILE A 1 11 ? -2.832  12.681  4.344   1.00 0.00 ? 14 ILE A CD1  8  
ATOM 4357  H H    . ILE A 1 11 ? -0.926  13.402  1.505   1.00 0.00 ? 14 ILE A H    8  
ATOM 4358  H HA   . ILE A 1 11 ? -1.068  10.855  2.887   1.00 0.00 ? 14 ILE A HA   8  
ATOM 4359  H HB   . ILE A 1 11 ? -2.945  12.716  1.636   1.00 0.00 ? 14 ILE A HB   8  
ATOM 4360  H HG12 . ILE A 1 11 ? -4.453  11.722  3.388   1.00 0.00 ? 14 ILE A HG12 8  
ATOM 4361  H HG13 . ILE A 1 11 ? -3.128  10.652  3.833   1.00 0.00 ? 14 ILE A HG13 8  
ATOM 4362  H HG21 . ILE A 1 11 ? -3.311  9.761   1.228   1.00 0.00 ? 14 ILE A HG21 8  
ATOM 4363  H HG22 . ILE A 1 11 ? -3.431  11.059  0.038   1.00 0.00 ? 14 ILE A HG22 8  
ATOM 4364  H HG23 . ILE A 1 11 ? -4.673  10.879  1.276   1.00 0.00 ? 14 ILE A HG23 8  
ATOM 4365  H HD11 . ILE A 1 11 ? -1.789  12.852  4.124   1.00 0.00 ? 14 ILE A HD11 8  
ATOM 4366  H HD12 . ILE A 1 11 ? -2.935  12.352  5.368   1.00 0.00 ? 14 ILE A HD12 8  
ATOM 4367  H HD13 . ILE A 1 11 ? -3.385  13.598  4.205   1.00 0.00 ? 14 ILE A HD13 8  
ATOM 4368  N N    . MET A 1 12 ? -0.844  11.135  -0.394  1.00 0.00 ? 15 MET A N    8  
ATOM 4369  C CA   . MET A 1 12 ? -0.477  10.432  -1.615  1.00 0.00 ? 15 MET A CA   8  
ATOM 4370  C C    . MET A 1 12 ? 0.853   9.703   -1.431  1.00 0.00 ? 15 MET A C    8  
ATOM 4371  O O    . MET A 1 12 ? 0.954   8.504   -1.695  1.00 0.00 ? 15 MET A O    8  
ATOM 4372  C CB   . MET A 1 12 ? -0.386  11.426  -2.773  1.00 0.00 ? 15 MET A CB   8  
ATOM 4373  C CG   . MET A 1 12 ? -1.266  11.065  -3.954  1.00 0.00 ? 15 MET A CG   8  
ATOM 4374  S SD   . MET A 1 12 ? -0.313  10.662  -5.430  1.00 0.00 ? 15 MET A SD   8  
ATOM 4375  C CE   . MET A 1 12 ? -1.300  9.337   -6.121  1.00 0.00 ? 15 MET A CE   8  
ATOM 4376  H H    . MET A 1 12 ? -1.001  12.104  -0.438  1.00 0.00 ? 15 MET A H    8  
ATOM 4377  H HA   . MET A 1 12 ? -1.247  9.706   -1.828  1.00 0.00 ? 15 MET A HA   8  
ATOM 4378  H HB2  . MET A 1 12 ? -0.683  12.403  -2.418  1.00 0.00 ? 15 MET A HB2  8  
ATOM 4379  H HB3  . MET A 1 12 ? 0.636   11.476  -3.110  1.00 0.00 ? 15 MET A HB3  8  
ATOM 4380  H HG2  . MET A 1 12 ? -1.870  10.211  -3.686  1.00 0.00 ? 15 MET A HG2  8  
ATOM 4381  H HG3  . MET A 1 12 ? -1.910  11.904  -4.175  1.00 0.00 ? 15 MET A HG3  8  
ATOM 4382  H HE1  . MET A 1 12 ? -1.312  9.422   -7.198  1.00 0.00 ? 15 MET A HE1  8  
ATOM 4383  H HE2  . MET A 1 12 ? -2.310  9.406   -5.744  1.00 0.00 ? 15 MET A HE2  8  
ATOM 4384  H HE3  . MET A 1 12 ? -0.873  8.386   -5.840  1.00 0.00 ? 15 MET A HE3  8  
ATOM 4385  N N    . ASN A 1 13 ? 1.867   10.432  -0.953  1.00 0.00 ? 16 ASN A N    8  
ATOM 4386  C CA   . ASN A 1 13 ? 3.183   9.845   -0.711  1.00 0.00 ? 16 ASN A CA   8  
ATOM 4387  C C    . ASN A 1 13 ? 3.068   8.658   0.243   1.00 0.00 ? 16 ASN A C    8  
ATOM 4388  O O    . ASN A 1 13 ? 3.641   7.592   0.004   1.00 0.00 ? 16 ASN A O    8  
ATOM 4389  C CB   . ASN A 1 13 ? 4.148   10.893  -0.144  1.00 0.00 ? 16 ASN A CB   8  
ATOM 4390  C CG   . ASN A 1 13 ? 5.450   10.959  -0.918  1.00 0.00 ? 16 ASN A CG   8  
ATOM 4391  O OD1  . ASN A 1 13 ? 6.124   9.951   -1.106  1.00 0.00 ? 16 ASN A OD1  8  
ATOM 4392  N ND2  . ASN A 1 13 ? 5.811   12.150  -1.373  1.00 0.00 ? 16 ASN A ND2  8  
ATOM 4393  H H    . ASN A 1 13 ? 1.720   11.383  -0.743  1.00 0.00 ? 16 ASN A H    8  
ATOM 4394  H HA   . ASN A 1 13 ? 3.562   9.490   -1.652  1.00 0.00 ? 16 ASN A HA   8  
ATOM 4395  H HB2  . ASN A 1 13 ? 3.679   11.864  -0.183  1.00 0.00 ? 16 ASN A HB2  8  
ATOM 4396  H HB3  . ASN A 1 13 ? 4.374   10.649  0.884   1.00 0.00 ? 16 ASN A HB3  8  
ATOM 4397  H HD21 . ASN A 1 13 ? 5.228   12.913  -1.190  1.00 0.00 ? 16 ASN A HD21 8  
ATOM 4398  H HD22 . ASN A 1 13 ? 6.650   12.214  -1.874  1.00 0.00 ? 16 ASN A HD22 8  
ATOM 4399  N N    . LEU A 1 14 ? 2.296   8.844   1.313   1.00 0.00 ? 17 LEU A N    8  
ATOM 4400  C CA   . LEU A 1 14 ? 2.073   7.784   2.293   1.00 0.00 ? 17 LEU A CA   8  
ATOM 4401  C C    . LEU A 1 14 ? 1.344   6.613   1.640   1.00 0.00 ? 17 LEU A C    8  
ATOM 4402  O O    . LEU A 1 14 ? 1.820   5.477   1.679   1.00 0.00 ? 17 LEU A O    8  
ATOM 4403  C CB   . LEU A 1 14 ? 1.265   8.310   3.485   1.00 0.00 ? 17 LEU A CB   8  
ATOM 4404  C CG   . LEU A 1 14 ? 2.020   9.257   4.420   1.00 0.00 ? 17 LEU A CG   8  
ATOM 4405  C CD1  . LEU A 1 14 ? 1.084   9.812   5.482   1.00 0.00 ? 17 LEU A CD1  8  
ATOM 4406  C CD2  . LEU A 1 14 ? 3.195   8.545   5.069   1.00 0.00 ? 17 LEU A CD2  8  
ATOM 4407  H H    . LEU A 1 14 ? 1.850   9.708   1.432   1.00 0.00 ? 17 LEU A H    8  
ATOM 4408  H HA   . LEU A 1 14 ? 3.037   7.441   2.638   1.00 0.00 ? 17 LEU A HA   8  
ATOM 4409  H HB2  . LEU A 1 14 ? 0.399   8.832   3.103   1.00 0.00 ? 17 LEU A HB2  8  
ATOM 4410  H HB3  . LEU A 1 14 ? 0.927   7.465   4.065   1.00 0.00 ? 17 LEU A HB3  8  
ATOM 4411  H HG   . LEU A 1 14 ? 2.403   10.089  3.848   1.00 0.00 ? 17 LEU A HG   8  
ATOM 4412  H HD11 . LEU A 1 14 ? 0.410   9.034   5.809   1.00 0.00 ? 17 LEU A HD11 8  
ATOM 4413  H HD12 . LEU A 1 14 ? 0.515   10.631  5.067   1.00 0.00 ? 17 LEU A HD12 8  
ATOM 4414  H HD13 . LEU A 1 14 ? 1.663   10.165  6.323   1.00 0.00 ? 17 LEU A HD13 8  
ATOM 4415  H HD21 . LEU A 1 14 ? 3.783   9.259   5.627   1.00 0.00 ? 17 LEU A HD21 8  
ATOM 4416  H HD22 . LEU A 1 14 ? 3.809   8.092   4.306   1.00 0.00 ? 17 LEU A HD22 8  
ATOM 4417  H HD23 . LEU A 1 14 ? 2.828   7.781   5.738   1.00 0.00 ? 17 LEU A HD23 8  
ATOM 4418  N N    . LEU A 1 15 ? 0.200   6.904   1.019   1.00 0.00 ? 18 LEU A N    8  
ATOM 4419  C CA   . LEU A 1 15 ? -0.585  5.879   0.334   1.00 0.00 ? 18 LEU A CA   8  
ATOM 4420  C C    . LEU A 1 15 ? 0.289   5.123   -0.665  1.00 0.00 ? 18 LEU A C    8  
ATOM 4421  O O    . LEU A 1 15 ? 0.294   3.888   -0.692  1.00 0.00 ? 18 LEU A O    8  
ATOM 4422  C CB   . LEU A 1 15 ? -1.780  6.513   -0.387  1.00 0.00 ? 18 LEU A CB   8  
ATOM 4423  C CG   . LEU A 1 15 ? -2.987  6.817   0.499   1.00 0.00 ? 18 LEU A CG   8  
ATOM 4424  C CD1  . LEU A 1 15 ? -3.962  7.731   -0.226  1.00 0.00 ? 18 LEU A CD1  8  
ATOM 4425  C CD2  . LEU A 1 15 ? -3.680  5.530   0.918   1.00 0.00 ? 18 LEU A CD2  8  
ATOM 4426  H H    . LEU A 1 15 ? -0.118  7.840   1.009   1.00 0.00 ? 18 LEU A H    8  
ATOM 4427  H HA   . LEU A 1 15 ? -0.942  5.183   1.075   1.00 0.00 ? 18 LEU A HA   8  
ATOM 4428  H HB2  . LEU A 1 15 ? -1.450  7.437   -0.839  1.00 0.00 ? 18 LEU A HB2  8  
ATOM 4429  H HB3  . LEU A 1 15 ? -2.098  5.842   -1.172  1.00 0.00 ? 18 LEU A HB3  8  
ATOM 4430  H HG   . LEU A 1 15 ? -2.654  7.326   1.393   1.00 0.00 ? 18 LEU A HG   8  
ATOM 4431  H HD11 . LEU A 1 15 ? -3.427  8.578   -0.631  1.00 0.00 ? 18 LEU A HD11 8  
ATOM 4432  H HD12 . LEU A 1 15 ? -4.714  8.076   0.466   1.00 0.00 ? 18 LEU A HD12 8  
ATOM 4433  H HD13 . LEU A 1 15 ? -4.434  7.186   -1.029  1.00 0.00 ? 18 LEU A HD13 8  
ATOM 4434  H HD21 . LEU A 1 15 ? -4.522  5.347   0.268   1.00 0.00 ? 18 LEU A HD21 8  
ATOM 4435  H HD22 . LEU A 1 15 ? -4.027  5.623   1.937   1.00 0.00 ? 18 LEU A HD22 8  
ATOM 4436  H HD23 . LEU A 1 15 ? -2.985  4.706   0.848   1.00 0.00 ? 18 LEU A HD23 8  
ATOM 4437  N N    . PHE A 1 16 ? 1.041   5.879   -1.467  1.00 0.00 ? 19 PHE A N    8  
ATOM 4438  C CA   . PHE A 1 16 ? 1.942   5.300   -2.458  1.00 0.00 ? 19 PHE A CA   8  
ATOM 4439  C C    . PHE A 1 16 ? 2.920   4.325   -1.801  1.00 0.00 ? 19 PHE A C    8  
ATOM 4440  O O    . PHE A 1 16 ? 3.170   3.243   -2.327  1.00 0.00 ? 19 PHE A O    8  
ATOM 4441  C CB   . PHE A 1 16 ? 2.719   6.407   -3.179  1.00 0.00 ? 19 PHE A CB   8  
ATOM 4442  C CG   . PHE A 1 16 ? 2.824   6.209   -4.664  1.00 0.00 ? 19 PHE A CG   8  
ATOM 4443  C CD1  . PHE A 1 16 ? 3.229   4.992   -5.189  1.00 0.00 ? 19 PHE A CD1  8  
ATOM 4444  C CD2  . PHE A 1 16 ? 2.520   7.242   -5.535  1.00 0.00 ? 19 PHE A CD2  8  
ATOM 4445  C CE1  . PHE A 1 16 ? 3.327   4.810   -6.556  1.00 0.00 ? 19 PHE A CE1  8  
ATOM 4446  C CE2  . PHE A 1 16 ? 2.616   7.067   -6.902  1.00 0.00 ? 19 PHE A CE2  8  
ATOM 4447  C CZ   . PHE A 1 16 ? 3.020   5.849   -7.413  1.00 0.00 ? 19 PHE A CZ   8  
ATOM 4448  H H    . PHE A 1 16 ? 0.995   6.860   -1.380  1.00 0.00 ? 19 PHE A H    8  
ATOM 4449  H HA   . PHE A 1 16 ? 1.344   4.761   -3.178  1.00 0.00 ? 19 PHE A HA   8  
ATOM 4450  H HB2  . PHE A 1 16 ? 2.228   7.352   -3.006  1.00 0.00 ? 19 PHE A HB2  8  
ATOM 4451  H HB3  . PHE A 1 16 ? 3.721   6.454   -2.778  1.00 0.00 ? 19 PHE A HB3  8  
ATOM 4452  H HD1  . PHE A 1 16 ? 3.467   4.179   -4.520  1.00 0.00 ? 19 PHE A HD1  8  
ATOM 4453  H HD2  . PHE A 1 16 ? 2.204   8.196   -5.136  1.00 0.00 ? 19 PHE A HD2  8  
ATOM 4454  H HE1  . PHE A 1 16 ? 3.643   3.857   -6.953  1.00 0.00 ? 19 PHE A HE1  8  
ATOM 4455  H HE2  . PHE A 1 16 ? 2.375   7.881   -7.570  1.00 0.00 ? 19 PHE A HE2  8  
ATOM 4456  H HZ   . PHE A 1 16 ? 3.097   5.710   -8.481  1.00 0.00 ? 19 PHE A HZ   8  
ATOM 4457  N N    . ASN A 1 17 ? 3.461   4.715   -0.643  1.00 0.00 ? 20 ASN A N    8  
ATOM 4458  C CA   . ASN A 1 17 ? 4.404   3.870   0.085   1.00 0.00 ? 20 ASN A CA   8  
ATOM 4459  C C    . ASN A 1 17 ? 3.682   2.715   0.772   1.00 0.00 ? 20 ASN A C    8  
ATOM 4460  O O    . ASN A 1 17 ? 4.112   1.564   0.671   1.00 0.00 ? 20 ASN A O    8  
ATOM 4461  C CB   . ASN A 1 17 ? 5.177   4.700   1.110   1.00 0.00 ? 20 ASN A CB   8  
ATOM 4462  C CG   . ASN A 1 17 ? 6.647   4.338   1.158   1.00 0.00 ? 20 ASN A CG   8  
ATOM 4463  O OD1  . ASN A 1 17 ? 7.160   3.922   2.191   1.00 0.00 ? 20 ASN A OD1  8  
ATOM 4464  N ND2  . ASN A 1 17 ? 7.334   4.494   0.037   1.00 0.00 ? 20 ASN A ND2  8  
ATOM 4465  H H    . ASN A 1 17 ? 3.212   5.590   -0.265  1.00 0.00 ? 20 ASN A H    8  
ATOM 4466  H HA   . ASN A 1 17 ? 5.101   3.457   -0.630  1.00 0.00 ? 20 ASN A HA   8  
ATOM 4467  H HB2  . ASN A 1 17 ? 5.089   5.746   0.858   1.00 0.00 ? 20 ASN A HB2  8  
ATOM 4468  H HB3  . ASN A 1 17 ? 4.751   4.533   2.083   1.00 0.00 ? 20 ASN A HB3  8  
ATOM 4469  H HD21 . ASN A 1 17 ? 6.863   4.829   -0.752  1.00 0.00 ? 20 ASN A HD21 8  
ATOM 4470  H HD22 . ASN A 1 17 ? 8.287   4.267   0.047   1.00 0.00 ? 20 ASN A HD22 8  
ATOM 4471  N N    . ILE A 1 18 ? 2.569   3.017   1.450   1.00 0.00 ? 21 ILE A N    8  
ATOM 4472  C CA   . ILE A 1 18 ? 1.782   1.982   2.119   1.00 0.00 ? 21 ILE A CA   8  
ATOM 4473  C C    . ILE A 1 18 ? 1.434   0.894   1.122   1.00 0.00 ? 21 ILE A C    8  
ATOM 4474  O O    . ILE A 1 18 ? 1.821   -0.260  1.307   1.00 0.00 ? 21 ILE A O    8  
ATOM 4475  C CB   . ILE A 1 18 ? 0.494   2.548   2.759   1.00 0.00 ? 21 ILE A CB   8  
ATOM 4476  C CG1  . ILE A 1 18 ? 0.842   3.497   3.910   1.00 0.00 ? 21 ILE A CG1  8  
ATOM 4477  C CG2  . ILE A 1 18 ? -0.401  1.421   3.258   1.00 0.00 ? 21 ILE A CG2  8  
ATOM 4478  C CD1  . ILE A 1 18 ? 1.742   2.879   4.959   1.00 0.00 ? 21 ILE A CD1  8  
ATOM 4479  H H    . ILE A 1 18 ? 2.264   3.956   1.481   1.00 0.00 ? 21 ILE A H    8  
ATOM 4480  H HA   . ILE A 1 18 ? 2.389   1.540   2.896   1.00 0.00 ? 21 ILE A HA   8  
ATOM 4481  H HB   . ILE A 1 18 ? -0.046  3.097   2.002   1.00 0.00 ? 21 ILE A HB   8  
ATOM 4482  H HG12 . ILE A 1 18 ? 1.346   4.365   3.513   1.00 0.00 ? 21 ILE A HG12 8  
ATOM 4483  H HG13 . ILE A 1 18 ? -0.070  3.809   4.398   1.00 0.00 ? 21 ILE A HG13 8  
ATOM 4484  H HG21 . ILE A 1 18 ? 0.186   0.725   3.838   1.00 0.00 ? 21 ILE A HG21 8  
ATOM 4485  H HG22 . ILE A 1 18 ? -0.840  0.908   2.415   1.00 0.00 ? 21 ILE A HG22 8  
ATOM 4486  H HG23 . ILE A 1 18 ? -1.186  1.833   3.876   1.00 0.00 ? 21 ILE A HG23 8  
ATOM 4487  H HD11 . ILE A 1 18 ? 2.744   2.784   4.565   1.00 0.00 ? 21 ILE A HD11 8  
ATOM 4488  H HD12 . ILE A 1 18 ? 1.366   1.901   5.225   1.00 0.00 ? 21 ILE A HD12 8  
ATOM 4489  H HD13 . ILE A 1 18 ? 1.758   3.509   5.836   1.00 0.00 ? 21 ILE A HD13 8  
ATOM 4490  N N    . ALA A 1 19 ? 0.754   1.268   0.037   1.00 0.00 ? 22 ALA A N    8  
ATOM 4491  C CA   . ALA A 1 19 ? 0.423   0.307   -1.003  1.00 0.00 ? 22 ALA A CA   8  
ATOM 4492  C C    . ALA A 1 19 ? 1.699   -0.418  -1.422  1.00 0.00 ? 22 ALA A C    8  
ATOM 4493  O O    . ALA A 1 19 ? 1.755   -1.646  -1.419  1.00 0.00 ? 22 ALA A O    8  
ATOM 4494  C CB   . ALA A 1 19 ? -0.228  1.003   -2.191  1.00 0.00 ? 22 ALA A CB   8  
ATOM 4495  H H    . ALA A 1 19 ? 0.508   2.215   -0.080  1.00 0.00 ? 22 ALA A H    8  
ATOM 4496  H HA   . ALA A 1 19 ? -0.275  -0.412  -0.594  1.00 0.00 ? 22 ALA A HA   8  
ATOM 4497  H HB1  . ALA A 1 19 ? -1.140  1.486   -1.871  1.00 0.00 ? 22 ALA A HB1  8  
ATOM 4498  H HB2  . ALA A 1 19 ? -0.456  0.276   -2.956  1.00 0.00 ? 22 ALA A HB2  8  
ATOM 4499  H HB3  . ALA A 1 19 ? 0.449   1.745   -2.590  1.00 0.00 ? 22 ALA A HB3  8  
ATOM 4500  N N    . LYS A 1 20 ? 2.733   0.376   -1.733  1.00 0.00 ? 23 LYS A N    8  
ATOM 4501  C CA   . LYS A 1 20 ? 4.047   -0.142  -2.118  1.00 0.00 ? 23 LYS A CA   8  
ATOM 4502  C C    . LYS A 1 20 ? 4.486   -1.276  -1.189  1.00 0.00 ? 23 LYS A C    8  
ATOM 4503  O O    . LYS A 1 20 ? 4.682   -2.410  -1.626  1.00 0.00 ? 23 LYS A O    8  
ATOM 4504  C CB   . LYS A 1 20 ? 5.078   0.995   -2.082  1.00 0.00 ? 23 LYS A CB   8  
ATOM 4505  C CG   . LYS A 1 20 ? 5.548   1.438   -3.457  1.00 0.00 ? 23 LYS A CG   8  
ATOM 4506  C CD   . LYS A 1 20 ? 5.866   2.925   -3.489  1.00 0.00 ? 23 LYS A CD   8  
ATOM 4507  C CE   . LYS A 1 20 ? 7.361   3.183   -3.445  1.00 0.00 ? 23 LYS A CE   8  
ATOM 4508  N NZ   . LYS A 1 20 ? 7.687   4.589   -3.816  1.00 0.00 ? 23 LYS A NZ   8  
ATOM 4509  H H    . LYS A 1 20 ? 2.612   1.347   -1.675  1.00 0.00 ? 23 LYS A H    8  
ATOM 4510  H HA   . LYS A 1 20 ? 3.976   -0.521  -3.124  1.00 0.00 ? 23 LYS A HA   8  
ATOM 4511  H HB2  . LYS A 1 20 ? 4.635   1.846   -1.589  1.00 0.00 ? 23 LYS A HB2  8  
ATOM 4512  H HB3  . LYS A 1 20 ? 5.939   0.675   -1.515  1.00 0.00 ? 23 LYS A HB3  8  
ATOM 4513  H HG2  . LYS A 1 20 ? 6.435   0.882   -3.718  1.00 0.00 ? 23 LYS A HG2  8  
ATOM 4514  H HG3  . LYS A 1 20 ? 4.766   1.231   -4.172  1.00 0.00 ? 23 LYS A HG3  8  
ATOM 4515  H HD2  . LYS A 1 20 ? 5.466   3.347   -4.399  1.00 0.00 ? 23 LYS A HD2  8  
ATOM 4516  H HD3  . LYS A 1 20 ? 5.402   3.401   -2.637  1.00 0.00 ? 23 LYS A HD3  8  
ATOM 4517  H HE2  . LYS A 1 20 ? 7.718   2.988   -2.443  1.00 0.00 ? 23 LYS A HE2  8  
ATOM 4518  H HE3  . LYS A 1 20 ? 7.850   2.511   -4.136  1.00 0.00 ? 23 LYS A HE3  8  
ATOM 4519  H HZ1  . LYS A 1 20 ? 8.658   4.822   -3.523  1.00 0.00 ? 23 LYS A HZ1  8  
ATOM 4520  H HZ2  . LYS A 1 20 ? 7.027   5.248   -3.351  1.00 0.00 ? 23 LYS A HZ2  8  
ATOM 4521  H HZ3  . LYS A 1 20 ? 7.611   4.713   -4.848  1.00 0.00 ? 23 LYS A HZ3  8  
ATOM 4522  N N    . ALA A 1 21 ? 4.631   -0.965  0.097   1.00 0.00 ? 24 ALA A N    8  
ATOM 4523  C CA   . ALA A 1 21 ? 5.041   -1.961  1.085   1.00 0.00 ? 24 ALA A CA   8  
ATOM 4524  C C    . ALA A 1 21 ? 3.977   -3.048  1.257   1.00 0.00 ? 24 ALA A C    8  
ATOM 4525  O O    . ALA A 1 21 ? 4.303   -4.231  1.393   1.00 0.00 ? 24 ALA A O    8  
ATOM 4526  C CB   . ALA A 1 21 ? 5.339   -1.288  2.420   1.00 0.00 ? 24 ALA A CB   8  
ATOM 4527  H H    . ALA A 1 21 ? 4.452   -0.039  0.391   1.00 0.00 ? 24 ALA A H    8  
ATOM 4528  H HA   . ALA A 1 21 ? 5.951   -2.423  0.730   1.00 0.00 ? 24 ALA A HA   8  
ATOM 4529  H HB1  . ALA A 1 21 ? 5.846   -0.350  2.244   1.00 0.00 ? 24 ALA A HB1  8  
ATOM 4530  H HB2  . ALA A 1 21 ? 5.971   -1.932  3.014   1.00 0.00 ? 24 ALA A HB2  8  
ATOM 4531  H HB3  . ALA A 1 21 ? 4.414   -1.104  2.946   1.00 0.00 ? 24 ALA A HB3  8  
ATOM 4532  N N    . LYS A 1 22 ? 2.706   -2.644  1.240   1.00 0.00 ? 25 LYS A N    8  
ATOM 4533  C CA   . LYS A 1 22 ? 1.599   -3.575  1.388   1.00 0.00 ? 25 LYS A CA   8  
ATOM 4534  C C    . LYS A 1 22 ? 1.574   -4.582  0.240   1.00 0.00 ? 25 LYS A C    8  
ATOM 4535  O O    . LYS A 1 22 ? 1.454   -5.786  0.468   1.00 0.00 ? 25 LYS A O    8  
ATOM 4536  C CB   . LYS A 1 22 ? 0.277   -2.804  1.454   1.00 0.00 ? 25 LYS A CB   8  
ATOM 4537  C CG   . LYS A 1 22 ? -0.597  -3.203  2.627   1.00 0.00 ? 25 LYS A CG   8  
ATOM 4538  C CD   . LYS A 1 22 ? -1.892  -3.853  2.161   1.00 0.00 ? 25 LYS A CD   8  
ATOM 4539  C CE   . LYS A 1 22 ? -2.941  -3.876  3.263   1.00 0.00 ? 25 LYS A CE   8  
ATOM 4540  N NZ   . LYS A 1 22 ? -2.692  -4.972  4.246   1.00 0.00 ? 25 LYS A NZ   8  
ATOM 4541  H H    . LYS A 1 22 ? 2.504   -1.688  1.118   1.00 0.00 ? 25 LYS A H    8  
ATOM 4542  H HA   . LYS A 1 22 ? 1.740   -4.111  2.314   1.00 0.00 ? 25 LYS A HA   8  
ATOM 4543  H HB2  . LYS A 1 22 ? 0.494   -1.747  1.543   1.00 0.00 ? 25 LYS A HB2  8  
ATOM 4544  H HB3  . LYS A 1 22 ? -0.277  -2.974  0.542   1.00 0.00 ? 25 LYS A HB3  8  
ATOM 4545  H HG2  . LYS A 1 22 ? -0.051  -3.903  3.242   1.00 0.00 ? 25 LYS A HG2  8  
ATOM 4546  H HG3  . LYS A 1 22 ? -0.829  -2.320  3.202   1.00 0.00 ? 25 LYS A HG3  8  
ATOM 4547  H HD2  . LYS A 1 22 ? -2.281  -3.292  1.323   1.00 0.00 ? 25 LYS A HD2  8  
ATOM 4548  H HD3  . LYS A 1 22 ? -1.684  -4.867  1.851   1.00 0.00 ? 25 LYS A HD3  8  
ATOM 4549  H HE2  . LYS A 1 22 ? -2.922  -2.926  3.779   1.00 0.00 ? 25 LYS A HE2  8  
ATOM 4550  H HE3  . LYS A 1 22 ? -3.914  -4.018  2.812   1.00 0.00 ? 25 LYS A HE3  8  
ATOM 4551  H HZ1  . LYS A 1 22 ? -3.577  -5.483  4.445   1.00 0.00 ? 25 LYS A HZ1  8  
ATOM 4552  H HZ2  . LYS A 1 22 ? -2.325  -4.578  5.137   1.00 0.00 ? 25 LYS A HZ2  8  
ATOM 4553  H HZ3  . LYS A 1 22 ? -1.995  -5.644  3.866   1.00 0.00 ? 25 LYS A HZ3  8  
ATOM 4554  N N    . ASN A 1 23 ? 1.701   -4.088  -0.993  1.00 0.00 ? 26 ASN A N    8  
ATOM 4555  C CA   . ASN A 1 23 ? 1.697   -4.973  -2.163  1.00 0.00 ? 26 ASN A CA   8  
ATOM 4556  C C    . ASN A 1 23 ? 2.919   -5.893  -2.167  1.00 0.00 ? 26 ASN A C    8  
ATOM 4557  O O    . ASN A 1 23 ? 2.833   -7.036  -2.617  1.00 0.00 ? 26 ASN A O    8  
ATOM 4558  C CB   . ASN A 1 23 ? 1.581   -4.186  -3.490  1.00 0.00 ? 26 ASN A CB   8  
ATOM 4559  C CG   . ASN A 1 23 ? 2.720   -3.212  -3.763  1.00 0.00 ? 26 ASN A CG   8  
ATOM 4560  O OD1  . ASN A 1 23 ? 2.506   -2.006  -3.850  1.00 0.00 ? 26 ASN A OD1  8  
ATOM 4561  N ND2  . ASN A 1 23 ? 3.927   -3.722  -3.954  1.00 0.00 ? 26 ASN A ND2  8  
ATOM 4562  H H    . ASN A 1 23 ? 1.806   -3.107  -1.115  1.00 0.00 ? 26 ASN A H    8  
ATOM 4563  H HA   . ASN A 1 23 ? 0.822   -5.602  -2.070  1.00 0.00 ? 26 ASN A HA   8  
ATOM 4564  H HB2  . ASN A 1 23 ? 1.548   -4.888  -4.308  1.00 0.00 ? 26 ASN A HB2  8  
ATOM 4565  H HB3  . ASN A 1 23 ? 0.658   -3.625  -3.478  1.00 0.00 ? 26 ASN A HB3  8  
ATOM 4566  H HD21 . ASN A 1 23 ? 4.037   -4.689  -3.919  1.00 0.00 ? 26 ASN A HD21 8  
ATOM 4567  H HD22 . ASN A 1 23 ? 4.664   -3.099  -4.118  1.00 0.00 ? 26 ASN A HD22 8  
ATOM 4568  N N    . LEU A 1 24 ? 4.052   -5.403  -1.654  1.00 0.00 ? 27 LEU A N    8  
ATOM 4569  C CA   . LEU A 1 24 ? 5.276   -6.206  -1.599  1.00 0.00 ? 27 LEU A CA   8  
ATOM 4570  C C    . LEU A 1 24 ? 5.102   -7.402  -0.673  1.00 0.00 ? 27 LEU A C    8  
ATOM 4571  O O    . LEU A 1 24 ? 5.495   -8.520  -0.997  1.00 0.00 ? 27 LEU A O    8  
ATOM 4572  C CB   . LEU A 1 24 ? 6.466   -5.354  -1.139  1.00 0.00 ? 27 LEU A CB   8  
ATOM 4573  C CG   . LEU A 1 24 ? 6.906   -4.259  -2.113  1.00 0.00 ? 27 LEU A CG   8  
ATOM 4574  C CD1  . LEU A 1 24 ? 7.681   -3.176  -1.380  1.00 0.00 ? 27 LEU A CD1  8  
ATOM 4575  C CD2  . LEU A 1 24 ? 7.747   -4.845  -3.235  1.00 0.00 ? 27 LEU A CD2  8  
ATOM 4576  H H    . LEU A 1 24 ? 4.064   -4.485  -1.302  1.00 0.00 ? 27 LEU A H    8  
ATOM 4577  H HA   . LEU A 1 24 ? 5.466   -6.572  -2.583  1.00 0.00 ? 27 LEU A HA   8  
ATOM 4578  H HB2  . LEU A 1 24 ? 6.203   -4.887  -0.201  1.00 0.00 ? 27 LEU A HB2  8  
ATOM 4579  H HB3  . LEU A 1 24 ? 7.306   -6.010  -0.970  1.00 0.00 ? 27 LEU A HB3  8  
ATOM 4580  H HG   . LEU A 1 24 ? 6.031   -3.803  -2.551  1.00 0.00 ? 27 LEU A HG   8  
ATOM 4581  H HD11 . LEU A 1 24 ? 8.634   -3.025  -1.864  1.00 0.00 ? 27 LEU A HD11 8  
ATOM 4582  H HD12 . LEU A 1 24 ? 7.840   -3.477  -0.356  1.00 0.00 ? 27 LEU A HD12 8  
ATOM 4583  H HD13 . LEU A 1 24 ? 7.117   -2.254  -1.401  1.00 0.00 ? 27 LEU A HD13 8  
ATOM 4584  H HD21 . LEU A 1 24 ? 8.355   -4.067  -3.673  1.00 0.00 ? 27 LEU A HD21 8  
ATOM 4585  H HD22 . LEU A 1 24 ? 7.099   -5.264  -3.991  1.00 0.00 ? 27 LEU A HD22 8  
ATOM 4586  H HD23 . LEU A 1 24 ? 8.386   -5.621  -2.839  1.00 0.00 ? 27 LEU A HD23 8  
ATOM 4587  N N    . ARG A 1 25 ? 4.502   -7.145  0.474   1.00 0.00 ? 28 ARG A N    8  
ATOM 4588  C CA   . ARG A 1 25 ? 4.246   -8.184  1.480   1.00 0.00 ? 28 ARG A CA   8  
ATOM 4589  C C    . ARG A 1 25 ? 2.999   -8.997  1.132   1.00 0.00 ? 28 ARG A C    8  
ATOM 4590  O O    . ARG A 1 25 ? 2.988   -10.222 1.293   1.00 0.00 ? 28 ARG A O    8  
ATOM 4591  C CB   . ARG A 1 25 ? 4.095   -7.551  2.867   1.00 0.00 ? 28 ARG A CB   8  
ATOM 4592  C CG   . ARG A 1 25 ? 5.359   -7.620  3.712   1.00 0.00 ? 28 ARG A CG   8  
ATOM 4593  C CD   . ARG A 1 25 ? 5.188   -8.557  4.898   1.00 0.00 ? 28 ARG A CD   8  
ATOM 4594  N NE   . ARG A 1 25 ? 4.274   -8.008  5.905   1.00 0.00 ? 28 ARG A NE   8  
ATOM 4595  C CZ   . ARG A 1 25 ? 4.604   -7.078  6.796   1.00 0.00 ? 28 ARG A CZ   8  
ATOM 4596  N NH1  . ARG A 1 25 ? 5.820   -6.564  6.814   1.00 0.00 ? 28 ARG A NH1  8  
ATOM 4597  N NH2  . ARG A 1 25 ? 3.710   -6.657  7.667   1.00 0.00 ? 28 ARG A NH2  8  
ATOM 4598  H H    . ARG A 1 25 ? 4.216   -6.226  0.647   1.00 0.00 ? 28 ARG A H    8  
ATOM 4599  H HA   . ARG A 1 25 ? 5.093   -8.856  1.489   1.00 0.00 ? 28 ARG A HA   8  
ATOM 4600  H HB2  . ARG A 1 25 ? 3.823   -6.512  2.749   1.00 0.00 ? 28 ARG A HB2  8  
ATOM 4601  H HB3  . ARG A 1 25 ? 3.304   -8.061  3.398   1.00 0.00 ? 28 ARG A HB3  8  
ATOM 4602  H HG2  . ARG A 1 25 ? 6.173   -7.977  3.098   1.00 0.00 ? 28 ARG A HG2  8  
ATOM 4603  H HG3  . ARG A 1 25 ? 5.588   -6.629  4.076   1.00 0.00 ? 28 ARG A HG3  8  
ATOM 4604  H HD2  . ARG A 1 25 ? 4.793   -9.499  4.540   1.00 0.00 ? 28 ARG A HD2  8  
ATOM 4605  H HD3  . ARG A 1 25 ? 6.155   -8.726  5.352   1.00 0.00 ? 28 ARG A HD3  8  
ATOM 4606  H HE   . ARG A 1 25 ? 3.359   -8.357  5.916   1.00 0.00 ? 28 ARG A HE   8  
ATOM 4607  H HH11 . ARG A 1 25 ? 6.500   -6.871  6.153   1.00 0.00 ? 28 ARG A HH11 8  
ATOM 4608  H HH12 . ARG A 1 25 ? 6.060   -5.870  7.491   1.00 0.00 ? 28 ARG A HH12 8  
ATOM 4609  H HH21 . ARG A 1 25 ? 2.787   -7.036  7.656   1.00 0.00 ? 28 ARG A HH21 8  
ATOM 4610  H HH22 . ARG A 1 25 ? 3.955   -5.961  8.337   1.00 0.00 ? 28 ARG A HH22 8  
ATOM 4611  N N    . ALA A 1 26 ? 1.961   -8.320  0.636   1.00 0.00 ? 29 ALA A N    8  
ATOM 4612  C CA   . ALA A 1 26 ? 0.723   -8.989  0.250   1.00 0.00 ? 29 ALA A CA   8  
ATOM 4613  C C    . ALA A 1 26 ? 0.998   -10.001 -0.852  1.00 0.00 ? 29 ALA A C    8  
ATOM 4614  O O    . ALA A 1 26 ? 0.370   -11.058 -0.913  1.00 0.00 ? 29 ALA A O    8  
ATOM 4615  C CB   . ALA A 1 26 ? -0.316  -7.971  -0.200  1.00 0.00 ? 29 ALA A CB   8  
ATOM 4616  H H    . ALA A 1 26 ? 2.036   -7.350  0.508   1.00 0.00 ? 29 ALA A H    8  
ATOM 4617  H HA   . ALA A 1 26 ? 0.337   -9.510  1.115   1.00 0.00 ? 29 ALA A HA   8  
ATOM 4618  H HB1  . ALA A 1 26 ? 0.027   -7.480  -1.099  1.00 0.00 ? 29 ALA A HB1  8  
ATOM 4619  H HB2  . ALA A 1 26 ? -0.460  -7.235  0.577   1.00 0.00 ? 29 ALA A HB2  8  
ATOM 4620  H HB3  . ALA A 1 26 ? -1.251  -8.472  -0.399  1.00 0.00 ? 29 ALA A HB3  8  
ATOM 4621  N N    . GLN A 1 27 ? 1.959   -9.674  -1.714  1.00 0.00 ? 30 GLN A N    8  
ATOM 4622  C CA   . GLN A 1 27 ? 2.337   -10.564 -2.807  1.00 0.00 ? 30 GLN A CA   8  
ATOM 4623  C C    . GLN A 1 27 ? 3.663   -11.274 -2.516  1.00 0.00 ? 30 GLN A C    8  
ATOM 4624  O O    . GLN A 1 27 ? 4.407   -11.634 -3.432  1.00 0.00 ? 30 GLN A O    8  
ATOM 4625  C CB   . GLN A 1 27 ? 2.417   -9.787  -4.123  1.00 0.00 ? 30 GLN A CB   8  
ATOM 4626  C CG   . GLN A 1 27 ? 1.065   -9.300  -4.623  1.00 0.00 ? 30 GLN A CG   8  
ATOM 4627  C CD   . GLN A 1 27 ? 0.161   -10.435 -5.066  1.00 0.00 ? 30 GLN A CD   8  
ATOM 4628  O OE1  . GLN A 1 27 ? 0.091   -10.762 -6.247  1.00 0.00 ? 30 GLN A OE1  8  
ATOM 4629  N NE2  . GLN A 1 27 ? -0.539  -11.046 -4.120  1.00 0.00 ? 30 GLN A NE2  8  
ATOM 4630  H H    . GLN A 1 27 ? 2.429   -8.817  -1.603  1.00 0.00 ? 30 GLN A H    8  
ATOM 4631  H HA   . GLN A 1 27 ? 1.569   -11.316 -2.885  1.00 0.00 ? 30 GLN A HA   8  
ATOM 4632  H HB2  . GLN A 1 27 ? 3.056   -8.927  -3.982  1.00 0.00 ? 30 GLN A HB2  8  
ATOM 4633  H HB3  . GLN A 1 27 ? 2.849   -10.425 -4.880  1.00 0.00 ? 30 GLN A HB3  8  
ATOM 4634  H HG2  . GLN A 1 27 ? 0.575   -8.759  -3.829  1.00 0.00 ? 30 GLN A HG2  8  
ATOM 4635  H HG3  . GLN A 1 27 ? 1.225   -8.638  -5.461  1.00 0.00 ? 30 GLN A HG3  8  
ATOM 4636  H HE21 . GLN A 1 27 ? -0.439  -10.738 -3.195  1.00 0.00 ? 30 GLN A HE21 8  
ATOM 4637  H HE22 . GLN A 1 27 ? -1.128  -11.781 -4.387  1.00 0.00 ? 30 GLN A HE22 8  
ATOM 4638  N N    . ALA A 1 28 ? 3.931   -11.492 -1.233  1.00 0.00 ? 31 ALA A N    8  
ATOM 4639  C CA   . ALA A 1 28 ? 5.137   -12.180 -0.792  1.00 0.00 ? 31 ALA A CA   8  
ATOM 4640  C C    . ALA A 1 28 ? 4.799   -13.161 0.325   1.00 0.00 ? 31 ALA A C    8  
ATOM 4641  O O    . ALA A 1 28 ? 5.178   -14.332 0.276   1.00 0.00 ? 31 ALA A O    8  
ATOM 4642  C CB   . ALA A 1 28 ? 6.194   -11.181 -0.342  1.00 0.00 ? 31 ALA A CB   8  
ATOM 4643  H H    . ALA A 1 28 ? 3.287   -11.194 -0.561  1.00 0.00 ? 31 ALA A H    8  
ATOM 4644  H HA   . ALA A 1 28 ? 5.524   -12.736 -1.633  1.00 0.00 ? 31 ALA A HA   8  
ATOM 4645  H HB1  . ALA A 1 28 ? 7.048   -11.712 0.052   1.00 0.00 ? 31 ALA A HB1  8  
ATOM 4646  H HB2  . ALA A 1 28 ? 5.783   -10.541 0.424   1.00 0.00 ? 31 ALA A HB2  8  
ATOM 4647  H HB3  . ALA A 1 28 ? 6.501   -10.580 -1.185  1.00 0.00 ? 31 ALA A HB3  8  
ATOM 4648  N N    . ALA A 1 29 ? 4.066   -12.678 1.327   1.00 0.00 ? 32 ALA A N    8  
ATOM 4649  C CA   . ALA A 1 29 ? 3.655   -13.518 2.444   1.00 0.00 ? 32 ALA A CA   8  
ATOM 4650  C C    . ALA A 1 29 ? 2.325   -14.240 2.162   1.00 0.00 ? 32 ALA A C    8  
ATOM 4651  O O    . ALA A 1 29 ? 1.976   -15.194 2.863   1.00 0.00 ? 32 ALA A O    8  
ATOM 4652  C CB   . ALA A 1 29 ? 3.549   -12.679 3.711   1.00 0.00 ? 32 ALA A CB   8  
ATOM 4653  H H    . ALA A 1 29 ? 3.785   -11.729 1.308   1.00 0.00 ? 32 ALA A H    8  
ATOM 4654  H HA   . ALA A 1 29 ? 4.424   -14.262 2.601   1.00 0.00 ? 32 ALA A HA   8  
ATOM 4655  H HB1  . ALA A 1 29 ? 4.461   -12.118 3.850   1.00 0.00 ? 32 ALA A HB1  8  
ATOM 4656  H HB2  . ALA A 1 29 ? 3.393   -13.328 4.561   1.00 0.00 ? 32 ALA A HB2  8  
ATOM 4657  H HB3  . ALA A 1 29 ? 2.717   -11.997 3.622   1.00 0.00 ? 32 ALA A HB3  8  
ATOM 4658  N N    . ALA A 1 30 ? 1.573   -13.783 1.146   1.00 0.00 ? 33 ALA A N    8  
ATOM 4659  C CA   . ALA A 1 30 ? 0.283   -14.400 0.821   1.00 0.00 ? 33 ALA A CA   8  
ATOM 4660  C C    . ALA A 1 30 ? 0.373   -15.388 -0.336  1.00 0.00 ? 33 ALA A C    8  
ATOM 4661  O O    . ALA A 1 30 ? -0.231  -16.464 -0.297  1.00 0.00 ? 33 ALA A O    8  
ATOM 4662  C CB   . ALA A 1 30 ? -0.754  -13.323 0.531   1.00 0.00 ? 33 ALA A CB   8  
ATOM 4663  H H    . ALA A 1 30 ? 1.883   -13.013 0.614   1.00 0.00 ? 33 ALA A H    8  
ATOM 4664  H HA   . ALA A 1 30 ? -0.036  -14.938 1.682   1.00 0.00 ? 33 ALA A HA   8  
ATOM 4665  H HB1  . ALA A 1 30 ? -0.506  -12.427 1.079   1.00 0.00 ? 33 ALA A HB1  8  
ATOM 4666  H HB2  . ALA A 1 30 ? -1.730  -13.673 0.833   1.00 0.00 ? 33 ALA A HB2  8  
ATOM 4667  H HB3  . ALA A 1 30 ? -0.763  -13.106 -0.528  1.00 0.00 ? 33 ALA A HB3  8  
ATOM 4668  N N    . ASN A 1 31 ? 1.129   -15.023 -1.351  1.00 0.00 ? 34 ASN A N    8  
ATOM 4669  C CA   . ASN A 1 31 ? 1.306   -15.875 -2.531  1.00 0.00 ? 34 ASN A CA   8  
ATOM 4670  C C    . ASN A 1 31 ? 1.996   -17.187 -2.160  1.00 0.00 ? 34 ASN A C    8  
ATOM 4671  O O    . ASN A 1 31 ? 1.593   -18.257 -2.616  1.00 0.00 ? 34 ASN A O    8  
ATOM 4672  C CB   . ASN A 1 31 ? 2.099   -15.143 -3.622  1.00 0.00 ? 34 ASN A CB   8  
ATOM 4673  C CG   . ASN A 1 31 ? 3.419   -14.594 -3.120  1.00 0.00 ? 34 ASN A CG   8  
ATOM 4674  O OD1  . ASN A 1 31 ? 3.533   -14.199 -1.965  1.00 0.00 ? 34 ASN A OD1  8  
ATOM 4675  N ND2  . ASN A 1 31 ? 4.421   -14.563 -3.983  1.00 0.00 ? 34 ASN A ND2  8  
ATOM 4676  H H    . ASN A 1 31 ? 1.587   -14.161 -1.301  1.00 0.00 ? 34 ASN A H    8  
ATOM 4677  H HA   . ASN A 1 31 ? 0.322   -16.107 -2.914  1.00 0.00 ? 34 ASN A HA   8  
ATOM 4678  H HB2  . ASN A 1 31 ? 2.303   -15.829 -4.431  1.00 0.00 ? 34 ASN A HB2  8  
ATOM 4679  H HB3  . ASN A 1 31 ? 1.508   -14.320 -3.996  1.00 0.00 ? 34 ASN A HB3  8  
ATOM 4680  H HD21 . ASN A 1 31 ? 4.262   -14.893 -4.892  1.00 0.00 ? 34 ASN A HD21 8  
ATOM 4681  H HD22 . ASN A 1 31 ? 5.280   -14.208 -3.677  1.00 0.00 ? 34 ASN A HD22 8  
ATOM 4682  N N    . ALA A 1 32 ? 3.029   -17.099 -1.320  1.00 0.00 ? 35 ALA A N    8  
ATOM 4683  C CA   . ALA A 1 32 ? 3.764   -18.285 -0.881  1.00 0.00 ? 35 ALA A CA   8  
ATOM 4684  C C    . ALA A 1 32 ? 2.901   -19.215 -0.020  1.00 0.00 ? 35 ALA A C    8  
ATOM 4685  O O    . ALA A 1 32 ? 3.237   -20.384 0.176   1.00 0.00 ? 35 ALA A O    8  
ATOM 4686  C CB   . ALA A 1 32 ? 5.024   -17.875 -0.128  1.00 0.00 ? 35 ALA A CB   8  
ATOM 4687  H H    . ALA A 1 32 ? 3.298   -16.216 -0.984  1.00 0.00 ? 35 ALA A H    8  
ATOM 4688  H HA   . ALA A 1 32 ? 4.061   -18.822 -1.759  1.00 0.00 ? 35 ALA A HA   8  
ATOM 4689  H HB1  . ALA A 1 32 ? 5.630   -18.748 0.062   1.00 0.00 ? 35 ALA A HB1  8  
ATOM 4690  H HB2  . ALA A 1 32 ? 4.750   -17.416 0.811   1.00 0.00 ? 35 ALA A HB2  8  
ATOM 4691  H HB3  . ALA A 1 32 ? 5.585   -17.169 -0.723  1.00 0.00 ? 35 ALA A HB3  8  
ATOM 4692  N N    . HIS A 1 33 ? 1.788   -18.689 0.479   1.00 0.00 ? 36 HIS A N    8  
ATOM 4693  C CA   . HIS A 1 33 ? 0.868   -19.463 1.312   1.00 0.00 ? 36 HIS A CA   8  
ATOM 4694  C C    . HIS A 1 33 ? -0.327  -19.963 0.499   1.00 0.00 ? 36 HIS A C    8  
ATOM 4695  O O    . HIS A 1 33 ? -0.625  -21.158 0.492   1.00 0.00 ? 36 HIS A O    8  
ATOM 4696  C CB   . HIS A 1 33 ? 0.379   -18.619 2.495   1.00 0.00 ? 36 HIS A CB   8  
ATOM 4697  C CG   . HIS A 1 33 ? 0.456   -19.332 3.809   1.00 0.00 ? 36 HIS A CG   8  
ATOM 4698  N ND1  . HIS A 1 33 ? -0.650  -19.837 4.462   1.00 0.00 ? 36 HIS A ND1  8  
ATOM 4699  C CD2  . HIS A 1 33 ? 1.519   -19.625 4.592   1.00 0.00 ? 36 HIS A CD2  8  
ATOM 4700  C CE1  . HIS A 1 33 ? -0.267  -20.411 5.590   1.00 0.00 ? 36 HIS A CE1  8  
ATOM 4701  N NE2  . HIS A 1 33 ? 1.045   -20.296 5.691   1.00 0.00 ? 36 HIS A NE2  8  
ATOM 4702  H H    . HIS A 1 33 ? 1.579   -17.757 0.279   1.00 0.00 ? 36 HIS A H    8  
ATOM 4703  H HA   . HIS A 1 33 ? 1.407   -20.319 1.692   1.00 0.00 ? 36 HIS A HA   8  
ATOM 4704  H HB2  . HIS A 1 33 ? 0.984   -17.727 2.567   1.00 0.00 ? 36 HIS A HB2  8  
ATOM 4705  H HB3  . HIS A 1 33 ? -0.650  -18.337 2.328   1.00 0.00 ? 36 HIS A HB3  8  
ATOM 4706  H HD1  . HIS A 1 33 ? -1.588  -19.785 4.147   1.00 0.00 ? 36 HIS A HD1  8  
ATOM 4707  H HD2  . HIS A 1 33 ? 2.552   -19.375 4.388   1.00 0.00 ? 36 HIS A HD2  8  
ATOM 4708  H HE1  . HIS A 1 33 ? -0.917  -20.891 6.307   1.00 0.00 ? 36 HIS A HE1  8  
ATOM 4709  H HE2  . HIS A 1 33 ? 1.598   -20.757 6.357   1.00 0.00 ? 36 HIS A HE2  8  
ATOM 4710  N N    . LEU A 1 34 ? -1.008  -19.043 -0.188  1.00 0.00 ? 37 LEU A N    8  
ATOM 4711  C CA   . LEU A 1 34 ? -2.176  -19.390 -1.004  1.00 0.00 ? 37 LEU A CA   8  
ATOM 4712  C C    . LEU A 1 34 ? -1.878  -20.497 -2.018  1.00 0.00 ? 37 LEU A C    8  
ATOM 4713  O O    . LEU A 1 34 ? -2.787  -21.191 -2.471  1.00 0.00 ? 37 LEU A O    8  
ATOM 4714  C CB   . LEU A 1 34 ? -2.710  -18.147 -1.725  1.00 0.00 ? 37 LEU A CB   8  
ATOM 4715  C CG   . LEU A 1 34 ? -3.354  -17.095 -0.819  1.00 0.00 ? 37 LEU A CG   8  
ATOM 4716  C CD1  . LEU A 1 34 ? -3.365  -15.737 -1.502  1.00 0.00 ? 37 LEU A CD1  8  
ATOM 4717  C CD2  . LEU A 1 34 ? -4.767  -17.510 -0.441  1.00 0.00 ? 37 LEU A CD2  8  
ATOM 4718  H H    . LEU A 1 34 ? -0.718  -18.101 -0.144  1.00 0.00 ? 37 LEU A H    8  
ATOM 4719  H HA   . LEU A 1 34 ? -2.931  -19.751 -0.338  1.00 0.00 ? 37 LEU A HA   8  
ATOM 4720  H HB2  . LEU A 1 34 ? -1.889  -17.684 -2.253  1.00 0.00 ? 37 LEU A HB2  8  
ATOM 4721  H HB3  . LEU A 1 34 ? -3.445  -18.465 -2.449  1.00 0.00 ? 37 LEU A HB3  8  
ATOM 4722  H HG   . LEU A 1 34 ? -2.775  -17.007 0.089   1.00 0.00 ? 37 LEU A HG   8  
ATOM 4723  H HD11 . LEU A 1 34 ? -4.053  -15.083 -0.987  1.00 0.00 ? 37 LEU A HD11 8  
ATOM 4724  H HD12 . LEU A 1 34 ? -3.680  -15.853 -2.528  1.00 0.00 ? 37 LEU A HD12 8  
ATOM 4725  H HD13 . LEU A 1 34 ? -2.374  -15.312 -1.474  1.00 0.00 ? 37 LEU A HD13 8  
ATOM 4726  H HD21 . LEU A 1 34 ? -5.243  -17.982 -1.288  1.00 0.00 ? 37 LEU A HD21 8  
ATOM 4727  H HD22 . LEU A 1 34 ? -5.332  -16.637 -0.150  1.00 0.00 ? 37 LEU A HD22 8  
ATOM 4728  H HD23 . LEU A 1 34 ? -4.729  -18.205 0.385   1.00 0.00 ? 37 LEU A HD23 8  
ATOM 4729  N N    . MET A 1 35 ? -0.609  -20.655 -2.366  1.00 0.00 ? 38 MET A N    8  
ATOM 4730  C CA   . MET A 1 35 ? -0.189  -21.676 -3.328  1.00 0.00 ? 38 MET A CA   8  
ATOM 4731  C C    . MET A 1 35 ? 0.296   -22.966 -2.646  1.00 0.00 ? 38 MET A C    8  
ATOM 4732  O O    . MET A 1 35 ? 0.688   -23.915 -3.326  1.00 0.00 ? 38 MET A O    8  
ATOM 4733  C CB   . MET A 1 35 ? 0.913   -21.118 -4.232  1.00 0.00 ? 38 MET A CB   8  
ATOM 4734  C CG   . MET A 1 35 ? 0.603   -21.237 -5.717  1.00 0.00 ? 38 MET A CG   8  
ATOM 4735  S SD   . MET A 1 35 ? 2.084   -21.176 -6.743  1.00 0.00 ? 38 MET A SD   8  
ATOM 4736  C CE   . MET A 1 35 ? 1.552   -22.127 -8.164  1.00 0.00 ? 38 MET A CE   8  
ATOM 4737  H H    . MET A 1 35 ? 0.062   -20.069 -1.967  1.00 0.00 ? 38 MET A H    8  
ATOM 4738  H HA   . MET A 1 35 ? -1.045  -21.919 -3.937  1.00 0.00 ? 38 MET A HA   8  
ATOM 4739  H HB2  . MET A 1 35 ? 1.059   -20.074 -3.998  1.00 0.00 ? 38 MET A HB2  8  
ATOM 4740  H HB3  . MET A 1 35 ? 1.831   -21.653 -4.035  1.00 0.00 ? 38 MET A HB3  8  
ATOM 4741  H HG2  . MET A 1 35 ? 0.101   -22.177 -5.893  1.00 0.00 ? 38 MET A HG2  8  
ATOM 4742  H HG3  . MET A 1 35 ? -0.048  -20.424 -6.001  1.00 0.00 ? 38 MET A HG3  8  
ATOM 4743  H HE1  . MET A 1 35 ? 1.491   -23.171 -7.896  1.00 0.00 ? 38 MET A HE1  8  
ATOM 4744  H HE2  . MET A 1 35 ? 2.263   -22.003 -8.968  1.00 0.00 ? 38 MET A HE2  8  
ATOM 4745  H HE3  . MET A 1 35 ? 0.581   -21.781 -8.486  1.00 0.00 ? 38 MET A HE3  8  
ATOM 4746  N N    . ALA A 1 36 ? 0.274   -23.005 -1.311  1.00 0.00 ? 39 ALA A N    8  
ATOM 4747  C CA   . ALA A 1 36 ? 0.720   -24.191 -0.575  1.00 0.00 ? 39 ALA A CA   8  
ATOM 4748  C C    . ALA A 1 36 ? 0.028   -24.317 0.790   1.00 0.00 ? 39 ALA A C    8  
ATOM 4749  O O    . ALA A 1 36 ? 0.638   -24.750 1.769   1.00 0.00 ? 39 ALA A O    8  
ATOM 4750  C CB   . ALA A 1 36 ? 2.235   -24.151 -0.407  1.00 0.00 ? 39 ALA A CB   8  
ATOM 4751  H H    . ALA A 1 36 ? -0.045  -22.222 -0.812  1.00 0.00 ? 39 ALA A H    8  
ATOM 4752  H HA   . ALA A 1 36 ? 0.474   -25.061 -1.167  1.00 0.00 ? 39 ALA A HA   8  
ATOM 4753  H HB1  . ALA A 1 36 ? 2.515   -23.256 0.128   1.00 0.00 ? 39 ALA A HB1  8  
ATOM 4754  H HB2  . ALA A 1 36 ? 2.705   -24.150 -1.380  1.00 0.00 ? 39 ALA A HB2  8  
ATOM 4755  H HB3  . ALA A 1 36 ? 2.560   -25.020 0.148   1.00 0.00 ? 39 ALA A HB3  8  
ATOM 4756  N N    . GLN A 1 37 ? -1.246  -23.928 0.850   1.00 0.00 ? 40 GLN A N    8  
ATOM 4757  C CA   . GLN A 1 37 ? -2.010  -23.988 2.091   1.00 0.00 ? 40 GLN A CA   8  
ATOM 4758  C C    . GLN A 1 37 ? -3.464  -24.405 1.843   1.00 0.00 ? 40 GLN A C    8  
ATOM 4759  O O    . GLN A 1 37 ? -3.881  -25.480 2.275   1.00 0.00 ? 40 GLN A O    8  
ATOM 4760  C CB   . GLN A 1 37 ? -1.956  -22.624 2.776   1.00 0.00 ? 40 GLN A CB   8  
ATOM 4761  C CG   . GLN A 1 37 ? -2.840  -22.510 4.010   1.00 0.00 ? 40 GLN A CG   8  
ATOM 4762  C CD   . GLN A 1 37 ? -3.670  -21.244 4.006   1.00 0.00 ? 40 GLN A CD   8  
ATOM 4763  O OE1  . GLN A 1 37 ? -3.142  -20.144 4.170   1.00 0.00 ? 40 GLN A OE1  8  
ATOM 4764  N NE2  . GLN A 1 37 ? -4.971  -21.386 3.804   1.00 0.00 ? 40 GLN A NE2  8  
ATOM 4765  H H    . GLN A 1 37 ? -1.677  -23.583 0.047   1.00 0.00 ? 40 GLN A H    8  
ATOM 4766  H HA   . GLN A 1 37 ? -1.545  -24.720 2.731   1.00 0.00 ? 40 GLN A HA   8  
ATOM 4767  H HB2  . GLN A 1 37 ? -0.936  -22.429 3.065   1.00 0.00 ? 40 GLN A HB2  8  
ATOM 4768  H HB3  . GLN A 1 37 ? -2.265  -21.869 2.068   1.00 0.00 ? 40 GLN A HB3  8  
ATOM 4769  H HG2  . GLN A 1 37 ? -3.505  -23.360 4.046   1.00 0.00 ? 40 GLN A HG2  8  
ATOM 4770  H HG3  . GLN A 1 37 ? -2.212  -22.508 4.889   1.00 0.00 ? 40 GLN A HG3  8  
ATOM 4771  H HE21 . GLN A 1 37 ? -5.328  -22.297 3.667   1.00 0.00 ? 40 GLN A HE21 8  
ATOM 4772  H HE22 . GLN A 1 37 ? -5.525  -20.581 3.798   1.00 0.00 ? 40 GLN A HE22 8  
ATOM 4773  N N    . ILE A 1 38 ? -4.215  -23.538 1.151   1.00 0.00 ? 41 ILE A N    8  
ATOM 4774  C CA   . ILE A 1 38 ? -5.623  -23.775 0.828   1.00 0.00 ? 41 ILE A CA   8  
ATOM 4775  C C    . ILE A 1 38 ? -6.466  -24.122 2.070   1.00 0.00 ? 41 ILE A C    8  
ATOM 4776  O O    . ILE A 1 38 ? -6.036  -23.786 3.198   1.00 0.00 ? 41 ILE A O    8  
ATOM 4777  C CB   . ILE A 1 38 ? -5.777  -24.862 -0.265  1.00 0.00 ? 41 ILE A CB   8  
ATOM 4778  C CG1  . ILE A 1 38 ? -5.569  -26.270 0.303   1.00 0.00 ? 41 ILE A CG1  8  
ATOM 4779  C CG2  . ILE A 1 38 ? -4.807  -24.607 -1.412  1.00 0.00 ? 41 ILE A CG2  8  
ATOM 4780  C CD1  . ILE A 1 38 ? -6.271  -27.350 -0.491  1.00 0.00 ? 41 ILE A CD1  8  
ATOM 4781  O OXT  . ILE A 1 38 ? -7.565  -24.695 1.904   1.00 0.00 ? 41 ILE A OXT  8  
ATOM 4782  H H    . ILE A 1 38 ? -3.811  -22.709 0.842   1.00 0.00 ? 41 ILE A H    8  
ATOM 4783  H HA   . ILE A 1 38 ? -6.010  -22.852 0.420   1.00 0.00 ? 41 ILE A HA   8  
ATOM 4784  H HB   . ILE A 1 38 ? -6.773  -24.784 -0.655  1.00 0.00 ? 41 ILE A HB   8  
ATOM 4785  H HG12 . ILE A 1 38 ? -4.513  -26.496 0.308   1.00 0.00 ? 41 ILE A HG12 8  
ATOM 4786  H HG13 . ILE A 1 38 ? -5.943  -26.303 1.315   1.00 0.00 ? 41 ILE A HG13 8  
ATOM 4787  H HG21 . ILE A 1 38 ? -4.621  -23.547 -1.499  1.00 0.00 ? 41 ILE A HG21 8  
ATOM 4788  H HG22 . ILE A 1 38 ? -5.235  -24.975 -2.332  1.00 0.00 ? 41 ILE A HG22 8  
ATOM 4789  H HG23 . ILE A 1 38 ? -3.878  -25.122 -1.217  1.00 0.00 ? 41 ILE A HG23 8  
ATOM 4790  H HD11 . ILE A 1 38 ? -7.339  -27.223 -0.403  1.00 0.00 ? 41 ILE A HD11 8  
ATOM 4791  H HD12 . ILE A 1 38 ? -5.991  -28.320 -0.105  1.00 0.00 ? 41 ILE A HD12 8  
ATOM 4792  H HD13 . ILE A 1 38 ? -5.983  -27.278 -1.529  1.00 0.00 ? 41 ILE A HD13 8  
ATOM 4793  N N    . PHE A 1 1  ? -20.196 14.647  3.712   1.00 0.00 ? 4  PHE A N    9  
ATOM 4794  C CA   . PHE A 1 1  ? -20.319 15.327  2.390   1.00 0.00 ? 4  PHE A CA   9  
ATOM 4795  C C    . PHE A 1 1  ? -19.711 16.730  2.433   1.00 0.00 ? 4  PHE A C    9  
ATOM 4796  O O    . PHE A 1 1  ? -19.796 17.409  3.455   1.00 0.00 ? 4  PHE A O    9  
ATOM 4797  C CB   . PHE A 1 1  ? -21.804 15.408  2.009   1.00 0.00 ? 4  PHE A CB   9  
ATOM 4798  C CG   . PHE A 1 1  ? -22.454 14.066  1.829   1.00 0.00 ? 4  PHE A CG   9  
ATOM 4799  C CD1  . PHE A 1 1  ? -22.121 13.258  0.753   1.00 0.00 ? 4  PHE A CD1  9  
ATOM 4800  C CD2  . PHE A 1 1  ? -23.396 13.611  2.737   1.00 0.00 ? 4  PHE A CD2  9  
ATOM 4801  C CE1  . PHE A 1 1  ? -22.714 12.023  0.586   1.00 0.00 ? 4  PHE A CE1  9  
ATOM 4802  C CE2  . PHE A 1 1  ? -23.993 12.375  2.575   1.00 0.00 ? 4  PHE A CE2  9  
ATOM 4803  C CZ   . PHE A 1 1  ? -23.652 11.580  1.499   1.00 0.00 ? 4  PHE A CZ   9  
ATOM 4804  H H1   . PHE A 1 1  ? -19.182 14.544  3.925   1.00 0.00 ? 4  PHE A H1   9  
ATOM 4805  H H2   . PHE A 1 1  ? -20.659 13.718  3.639   1.00 0.00 ? 4  PHE A H2   9  
ATOM 4806  H H3   . PHE A 1 1  ? -20.666 15.246  4.422   1.00 0.00 ? 4  PHE A H3   9  
ATOM 4807  H HA   . PHE A 1 1  ? -19.792 14.740  1.650   1.00 0.00 ? 4  PHE A HA   9  
ATOM 4808  H HB2  . PHE A 1 1  ? -22.339 15.933  2.784   1.00 0.00 ? 4  PHE A HB2  9  
ATOM 4809  H HB3  . PHE A 1 1  ? -21.901 15.952  1.080   1.00 0.00 ? 4  PHE A HB3  9  
ATOM 4810  H HD1  . PHE A 1 1  ? -21.387 13.603  0.038   1.00 0.00 ? 4  PHE A HD1  9  
ATOM 4811  H HD2  . PHE A 1 1  ? -23.666 14.232  3.577   1.00 0.00 ? 4  PHE A HD2  9  
ATOM 4812  H HE1  . PHE A 1 1  ? -22.446 11.403  -0.257  1.00 0.00 ? 4  PHE A HE1  9  
ATOM 4813  H HE2  . PHE A 1 1  ? -24.726 12.032  3.290   1.00 0.00 ? 4  PHE A HE2  9  
ATOM 4814  H HZ   . PHE A 1 1  ? -24.117 10.614  1.371   1.00 0.00 ? 4  PHE A HZ   9  
ATOM 4815  N N    . THR A 1 2  ? -19.101 17.150  1.319   1.00 0.00 ? 5  THR A N    9  
ATOM 4816  C CA   . THR A 1 2  ? -18.472 18.472  1.215   1.00 0.00 ? 5  THR A CA   9  
ATOM 4817  C C    . THR A 1 2  ? -17.135 18.510  1.963   1.00 0.00 ? 5  THR A C    9  
ATOM 4818  O O    . THR A 1 2  ? -17.017 17.988  3.073   1.00 0.00 ? 5  THR A O    9  
ATOM 4819  C CB   . THR A 1 2  ? -19.420 19.572  1.727   1.00 0.00 ? 5  THR A CB   9  
ATOM 4820  O OG1  . THR A 1 2  ? -19.649 20.536  0.715   1.00 0.00 ? 5  THR A OG1  9  
ATOM 4821  C CG2  . THR A 1 2  ? -18.921 20.309  2.955   1.00 0.00 ? 5  THR A CG2  9  
ATOM 4822  H H    . THR A 1 2  ? -19.072 16.554  0.542   1.00 0.00 ? 5  THR A H    9  
ATOM 4823  H HA   . THR A 1 2  ? -18.275 18.652  0.168   1.00 0.00 ? 5  THR A HA   9  
ATOM 4824  H HB   . THR A 1 2  ? -20.369 19.119  1.979   1.00 0.00 ? 5  THR A HB   9  
ATOM 4825  H HG1  . THR A 1 2  ? -18.973 21.217  0.754   1.00 0.00 ? 5  THR A HG1  9  
ATOM 4826  H HG21 . THR A 1 2  ? -17.988 20.804  2.726   1.00 0.00 ? 5  THR A HG21 9  
ATOM 4827  H HG22 . THR A 1 2  ? -18.768 19.606  3.760   1.00 0.00 ? 5  THR A HG22 9  
ATOM 4828  H HG23 . THR A 1 2  ? -19.653 21.045  3.255   1.00 0.00 ? 5  THR A HG23 9  
ATOM 4829  N N    . LEU A 1 3  ? -16.133 19.131  1.336   1.00 0.00 ? 6  LEU A N    9  
ATOM 4830  C CA   . LEU A 1 3  ? -14.791 19.251  1.920   1.00 0.00 ? 6  LEU A CA   9  
ATOM 4831  C C    . LEU A 1 3  ? -14.096 17.888  2.032   1.00 0.00 ? 6  LEU A C    9  
ATOM 4832  O O    . LEU A 1 3  ? -14.708 16.842  1.805   1.00 0.00 ? 6  LEU A O    9  
ATOM 4833  C CB   . LEU A 1 3  ? -14.861 19.923  3.297   1.00 0.00 ? 6  LEU A CB   9  
ATOM 4834  C CG   . LEU A 1 3  ? -15.231 21.408  3.277   1.00 0.00 ? 6  LEU A CG   9  
ATOM 4835  C CD1  . LEU A 1 3  ? -15.833 21.824  4.608   1.00 0.00 ? 6  LEU A CD1  9  
ATOM 4836  C CD2  . LEU A 1 3  ? -14.012 22.258  2.958   1.00 0.00 ? 6  LEU A CD2  9  
ATOM 4837  H H    . LEU A 1 3  ? -16.300 19.521  0.453   1.00 0.00 ? 6  LEU A H    9  
ATOM 4838  H HA   . LEU A 1 3  ? -14.206 19.875  1.261   1.00 0.00 ? 6  LEU A HA   9  
ATOM 4839  H HB2  . LEU A 1 3  ? -15.593 19.400  3.893   1.00 0.00 ? 6  LEU A HB2  9  
ATOM 4840  H HB3  . LEU A 1 3  ? -13.897 19.823  3.774   1.00 0.00 ? 6  LEU A HB3  9  
ATOM 4841  H HG   . LEU A 1 3  ? -15.970 21.579  2.507   1.00 0.00 ? 6  LEU A HG   9  
ATOM 4842  H HD11 . LEU A 1 3  ? -15.086 21.739  5.382   1.00 0.00 ? 6  LEU A HD11 9  
ATOM 4843  H HD12 . LEU A 1 3  ? -16.670 21.183  4.841   1.00 0.00 ? 6  LEU A HD12 9  
ATOM 4844  H HD13 . LEU A 1 3  ? -16.170 22.847  4.545   1.00 0.00 ? 6  LEU A HD13 9  
ATOM 4845  H HD21 . LEU A 1 3  ? -14.239 23.296  3.148   1.00 0.00 ? 6  LEU A HD21 9  
ATOM 4846  H HD22 . LEU A 1 3  ? -13.747 22.132  1.919   1.00 0.00 ? 6  LEU A HD22 9  
ATOM 4847  H HD23 . LEU A 1 3  ? -13.185 21.950  3.582   1.00 0.00 ? 6  LEU A HD23 9  
ATOM 4848  N N    . SER A 1 4  ? -12.806 17.912  2.382   1.00 0.00 ? 7  SER A N    9  
ATOM 4849  C CA   . SER A 1 4  ? -12.010 16.687  2.525   1.00 0.00 ? 7  SER A CA   9  
ATOM 4850  C C    . SER A 1 4  ? -11.932 15.904  1.207   1.00 0.00 ? 7  SER A C    9  
ATOM 4851  O O    . SER A 1 4  ? -11.891 14.673  1.209   1.00 0.00 ? 7  SER A O    9  
ATOM 4852  C CB   . SER A 1 4  ? -12.593 15.800  3.634   1.00 0.00 ? 7  SER A CB   9  
ATOM 4853  O OG   . SER A 1 4  ? -11.921 16.020  4.866   1.00 0.00 ? 7  SER A OG   9  
ATOM 4854  H H    . SER A 1 4  ? -12.376 18.778  2.545   1.00 0.00 ? 7  SER A H    9  
ATOM 4855  H HA   . SER A 1 4  ? -11.010 16.979  2.809   1.00 0.00 ? 7  SER A HA   9  
ATOM 4856  H HB2  . SER A 1 4  ? -13.641 16.029  3.762   1.00 0.00 ? 7  SER A HB2  9  
ATOM 4857  H HB3  . SER A 1 4  ? -12.481 14.761  3.357   1.00 0.00 ? 7  SER A HB3  9  
ATOM 4858  H HG   . SER A 1 4  ? -12.347 15.512  5.562   1.00 0.00 ? 7  SER A HG   9  
ATOM 4859  N N    . LEU A 1 5  ? -11.904 16.625  0.084   1.00 0.00 ? 8  LEU A N    9  
ATOM 4860  C CA   . LEU A 1 5  ? -11.827 15.995  -1.235  1.00 0.00 ? 8  LEU A CA   9  
ATOM 4861  C C    . LEU A 1 5  ? -10.651 16.553  -2.049  1.00 0.00 ? 8  LEU A C    9  
ATOM 4862  O O    . LEU A 1 5  ? -10.812 16.959  -3.201  1.00 0.00 ? 8  LEU A O    9  
ATOM 4863  C CB   . LEU A 1 5  ? -13.149 16.189  -1.991  1.00 0.00 ? 8  LEU A CB   9  
ATOM 4864  C CG   . LEU A 1 5  ? -13.624 17.639  -2.124  1.00 0.00 ? 8  LEU A CG   9  
ATOM 4865  C CD1  . LEU A 1 5  ? -13.712 18.041  -3.587  1.00 0.00 ? 8  LEU A CD1  9  
ATOM 4866  C CD2  . LEU A 1 5  ? -14.970 17.824  -1.444  1.00 0.00 ? 8  LEU A CD2  9  
ATOM 4867  H H    . LEU A 1 5  ? -11.933 17.601  0.143   1.00 0.00 ? 8  LEU A H    9  
ATOM 4868  H HA   . LEU A 1 5  ? -11.666 14.938  -1.083  1.00 0.00 ? 8  LEU A HA   9  
ATOM 4869  H HB2  . LEU A 1 5  ? -13.033 15.779  -2.984  1.00 0.00 ? 8  LEU A HB2  9  
ATOM 4870  H HB3  . LEU A 1 5  ? -13.916 15.630  -1.477  1.00 0.00 ? 8  LEU A HB3  9  
ATOM 4871  H HG   . LEU A 1 5  ? -12.912 18.294  -1.642  1.00 0.00 ? 8  LEU A HG   9  
ATOM 4872  H HD11 . LEU A 1 5  ? -14.473 17.452  -4.076  1.00 0.00 ? 8  LEU A HD11 9  
ATOM 4873  H HD12 . LEU A 1 5  ? -12.759 17.867  -4.065  1.00 0.00 ? 8  LEU A HD12 9  
ATOM 4874  H HD13 . LEU A 1 5  ? -13.964 19.088  -3.659  1.00 0.00 ? 8  LEU A HD13 9  
ATOM 4875  H HD21 . LEU A 1 5  ? -15.197 18.877  -1.376  1.00 0.00 ? 8  LEU A HD21 9  
ATOM 4876  H HD22 . LEU A 1 5  ? -14.935 17.396  -0.454  1.00 0.00 ? 8  LEU A HD22 9  
ATOM 4877  H HD23 . LEU A 1 5  ? -15.735 17.328  -2.023  1.00 0.00 ? 8  LEU A HD23 9  
ATOM 4878  N N    . ASP A 1 6  ? -9.466  16.559  -1.441  1.00 0.00 ? 9  ASP A N    9  
ATOM 4879  C CA   . ASP A 1 6  ? -8.262  17.056  -2.096  1.00 0.00 ? 9  ASP A CA   9  
ATOM 4880  C C    . ASP A 1 6  ? -7.054  16.199  -1.713  1.00 0.00 ? 9  ASP A C    9  
ATOM 4881  O O    . ASP A 1 6  ? -6.336  16.502  -0.760  1.00 0.00 ? 9  ASP A O    9  
ATOM 4882  C CB   . ASP A 1 6  ? -8.026  18.526  -1.721  1.00 0.00 ? 9  ASP A CB   9  
ATOM 4883  C CG   . ASP A 1 6  ? -7.788  19.402  -2.934  1.00 0.00 ? 9  ASP A CG   9  
ATOM 4884  O OD1  . ASP A 1 6  ? -6.693  19.306  -3.528  1.00 0.00 ? 9  ASP A OD1  9  
ATOM 4885  O OD2  . ASP A 1 6  ? -8.695  20.182  -3.287  1.00 0.00 ? 9  ASP A OD2  9  
ATOM 4886  H H    . ASP A 1 6  ? -9.399  16.215  -0.528  1.00 0.00 ? 9  ASP A H    9  
ATOM 4887  H HA   . ASP A 1 6  ? -8.412  16.986  -3.164  1.00 0.00 ? 9  ASP A HA   9  
ATOM 4888  H HB2  . ASP A 1 6  ? -8.892  18.901  -1.199  1.00 0.00 ? 9  ASP A HB2  9  
ATOM 4889  H HB3  . ASP A 1 6  ? -7.164  18.595  -1.076  1.00 0.00 ? 9  ASP A HB3  9  
ATOM 4890  N N    . VAL A 1 7  ? -6.851  15.114  -2.461  1.00 0.00 ? 10 VAL A N    9  
ATOM 4891  C CA   . VAL A 1 7  ? -5.740  14.187  -2.210  1.00 0.00 ? 10 VAL A CA   9  
ATOM 4892  C C    . VAL A 1 7  ? -4.388  14.910  -2.235  1.00 0.00 ? 10 VAL A C    9  
ATOM 4893  O O    . VAL A 1 7  ? -3.899  15.293  -3.300  1.00 0.00 ? 10 VAL A O    9  
ATOM 4894  C CB   . VAL A 1 7  ? -5.713  13.036  -3.243  1.00 0.00 ? 10 VAL A CB   9  
ATOM 4895  C CG1  . VAL A 1 7  ? -4.631  12.025  -2.895  1.00 0.00 ? 10 VAL A CG1  9  
ATOM 4896  C CG2  . VAL A 1 7  ? -7.068  12.350  -3.331  1.00 0.00 ? 10 VAL A CG2  9  
ATOM 4897  H H    . VAL A 1 7  ? -7.471  14.928  -3.194  1.00 0.00 ? 10 VAL A H    9  
ATOM 4898  H HA   . VAL A 1 7  ? -5.885  13.756  -1.230  1.00 0.00 ? 10 VAL A HA   9  
ATOM 4899  H HB   . VAL A 1 7  ? -5.482  13.457  -4.212  1.00 0.00 ? 10 VAL A HB   9  
ATOM 4900  H HG11 . VAL A 1 7  ? -4.452  11.384  -3.745  1.00 0.00 ? 10 VAL A HG11 9  
ATOM 4901  H HG12 . VAL A 1 7  ? -4.956  11.427  -2.056  1.00 0.00 ? 10 VAL A HG12 9  
ATOM 4902  H HG13 . VAL A 1 7  ? -3.720  12.543  -2.636  1.00 0.00 ? 10 VAL A HG13 9  
ATOM 4903  H HG21 . VAL A 1 7  ? -6.949  11.379  -3.789  1.00 0.00 ? 10 VAL A HG21 9  
ATOM 4904  H HG22 . VAL A 1 7  ? -7.738  12.949  -3.929  1.00 0.00 ? 10 VAL A HG22 9  
ATOM 4905  H HG23 . VAL A 1 7  ? -7.477  12.232  -2.339  1.00 0.00 ? 10 VAL A HG23 9  
ATOM 4906  N N    . PRO A 1 8  ? -3.765  15.109  -1.053  1.00 0.00 ? 11 PRO A N    9  
ATOM 4907  C CA   . PRO A 1 8  ? -2.475  15.790  -0.940  1.00 0.00 ? 11 PRO A CA   9  
ATOM 4908  C C    . PRO A 1 8  ? -1.277  14.850  -1.106  1.00 0.00 ? 11 PRO A C    9  
ATOM 4909  O O    . PRO A 1 8  ? -1.384  13.636  -0.893  1.00 0.00 ? 11 PRO A O    9  
ATOM 4910  C CB   . PRO A 1 8  ? -2.531  16.354  0.476   1.00 0.00 ? 11 PRO A CB   9  
ATOM 4911  C CG   . PRO A 1 8  ? -3.327  15.354  1.249   1.00 0.00 ? 11 PRO A CG   9  
ATOM 4912  C CD   . PRO A 1 8  ? -4.274  14.696  0.270   1.00 0.00 ? 11 PRO A CD   9  
ATOM 4913  H HA   . PRO A 1 8  ? -2.393  16.602  -1.650  1.00 0.00 ? 11 PRO A HA   9  
ATOM 4914  H HB2  . PRO A 1 8  ? -1.529  16.453  0.868   1.00 0.00 ? 11 PRO A HB2  9  
ATOM 4915  H HB3  . PRO A 1 8  ? -3.017  17.318  0.464   1.00 0.00 ? 11 PRO A HB3  9  
ATOM 4916  H HG2  . PRO A 1 8  ? -2.667  14.619  1.680   1.00 0.00 ? 11 PRO A HG2  9  
ATOM 4917  H HG3  . PRO A 1 8  ? -3.885  15.856  2.026   1.00 0.00 ? 11 PRO A HG3  9  
ATOM 4918  H HD2  . PRO A 1 8  ? -4.238  13.621  0.376   1.00 0.00 ? 11 PRO A HD2  9  
ATOM 4919  H HD3  . PRO A 1 8  ? -5.281  15.055  0.424   1.00 0.00 ? 11 PRO A HD3  9  
ATOM 4920  N N    . THR A 1 9  ? -0.132  15.425  -1.478  1.00 0.00 ? 12 THR A N    9  
ATOM 4921  C CA   . THR A 1 9  ? 1.102   14.658  -1.673  1.00 0.00 ? 12 THR A CA   9  
ATOM 4922  C C    . THR A 1 9  ? 1.434   13.813  -0.443  1.00 0.00 ? 12 THR A C    9  
ATOM 4923  O O    . THR A 1 9  ? 1.773   12.634  -0.568  1.00 0.00 ? 12 THR A O    9  
ATOM 4924  C CB   . THR A 1 9  ? 2.272   15.598  -1.993  1.00 0.00 ? 12 THR A CB   9  
ATOM 4925  O OG1  . THR A 1 9  ? 1.841   16.948  -2.030  1.00 0.00 ? 12 THR A OG1  9  
ATOM 4926  C CG2  . THR A 1 9  ? 2.935   15.300  -3.320  1.00 0.00 ? 12 THR A CG2  9  
ATOM 4927  H H    . THR A 1 9  ? -0.111  16.394  -1.624  1.00 0.00 ? 12 THR A H    9  
ATOM 4928  H HA   . THR A 1 9  ? 0.947   13.995  -2.511  1.00 0.00 ? 12 THR A HA   9  
ATOM 4929  H HB   . THR A 1 9  ? 3.020   15.500  -1.219  1.00 0.00 ? 12 THR A HB   9  
ATOM 4930  H HG1  . THR A 1 9  ? 2.596   17.525  -2.177  1.00 0.00 ? 12 THR A HG1  9  
ATOM 4931  H HG21 . THR A 1 9  ? 2.884   14.240  -3.519  1.00 0.00 ? 12 THR A HG21 9  
ATOM 4932  H HG22 . THR A 1 9  ? 3.968   15.612  -3.282  1.00 0.00 ? 12 THR A HG22 9  
ATOM 4933  H HG23 . THR A 1 9  ? 2.425   15.839  -4.104  1.00 0.00 ? 12 THR A HG23 9  
ATOM 4934  N N    . ASN A 1 10 ? 1.331   14.421  0.744   1.00 0.00 ? 13 ASN A N    9  
ATOM 4935  C CA   . ASN A 1 10 ? 1.619   13.721  2.001   1.00 0.00 ? 13 ASN A CA   9  
ATOM 4936  C C    . ASN A 1 10 ? 0.818   12.434  2.112   1.00 0.00 ? 13 ASN A C    9  
ATOM 4937  O O    . ASN A 1 10 ? 1.336   11.386  2.498   1.00 0.00 ? 13 ASN A O    9  
ATOM 4938  C CB   . ASN A 1 10 ? 1.332   14.628  3.207   1.00 0.00 ? 13 ASN A CB   9  
ATOM 4939  C CG   . ASN A 1 10 ? 2.001   15.985  3.093   1.00 0.00 ? 13 ASN A CG   9  
ATOM 4940  O OD1  . ASN A 1 10 ? 1.700   16.759  2.188   1.00 0.00 ? 13 ASN A OD1  9  
ATOM 4941  N ND2  . ASN A 1 10 ? 2.908   16.282  4.011   1.00 0.00 ? 13 ASN A ND2  9  
ATOM 4942  H H    . ASN A 1 10 ? 1.055   15.363  0.774   1.00 0.00 ? 13 ASN A H    9  
ATOM 4943  H HA   . ASN A 1 10 ? 2.645   13.463  1.995   1.00 0.00 ? 13 ASN A HA   9  
ATOM 4944  H HB2  . ASN A 1 10 ? 0.267   14.782  3.288   1.00 0.00 ? 13 ASN A HB2  9  
ATOM 4945  H HB3  . ASN A 1 10 ? 1.689   14.145  4.104   1.00 0.00 ? 13 ASN A HB3  9  
ATOM 4946  H HD21 . ASN A 1 10 ? 3.100   15.621  4.707   1.00 0.00 ? 13 ASN A HD21 9  
ATOM 4947  H HD22 . ASN A 1 10 ? 3.350   17.155  3.955   1.00 0.00 ? 13 ASN A HD22 9  
ATOM 4948  N N    . ILE A 1 11 ? -0.440  12.531  1.746   1.00 0.00 ? 14 ILE A N    9  
ATOM 4949  C CA   . ILE A 1 11 ? -1.349  11.395  1.767   1.00 0.00 ? 14 ILE A CA   9  
ATOM 4950  C C    . ILE A 1 11 ? -1.032  10.441  0.618   1.00 0.00 ? 14 ILE A C    9  
ATOM 4951  O O    . ILE A 1 11 ? -0.932  9.231   0.819   1.00 0.00 ? 14 ILE A O    9  
ATOM 4952  C CB   . ILE A 1 11 ? -2.811  11.885  1.682   1.00 0.00 ? 14 ILE A CB   9  
ATOM 4953  C CG1  . ILE A 1 11 ? -3.426  11.970  3.079   1.00 0.00 ? 14 ILE A CG1  9  
ATOM 4954  C CG2  . ILE A 1 11 ? -3.659  10.989  0.788   1.00 0.00 ? 14 ILE A CG2  9  
ATOM 4955  C CD1  . ILE A 1 11 ? -3.050  13.227  3.834   1.00 0.00 ? 14 ILE A CD1  9  
ATOM 4956  H H    . ILE A 1 11 ? -0.762  13.398  1.434   1.00 0.00 ? 14 ILE A H    9  
ATOM 4957  H HA   . ILE A 1 11 ? -1.213  10.872  2.704   1.00 0.00 ? 14 ILE A HA   9  
ATOM 4958  H HB   . ILE A 1 11 ? -2.789  12.872  1.250   1.00 0.00 ? 14 ILE A HB   9  
ATOM 4959  H HG12 . ILE A 1 11 ? -4.502  11.947  2.993   1.00 0.00 ? 14 ILE A HG12 9  
ATOM 4960  H HG13 . ILE A 1 11 ? -3.100  11.121  3.662   1.00 0.00 ? 14 ILE A HG13 9  
ATOM 4961  H HG21 . ILE A 1 11 ? -3.474  9.953   1.034   1.00 0.00 ? 14 ILE A HG21 9  
ATOM 4962  H HG22 . ILE A 1 11 ? -3.403  11.163  -0.247  1.00 0.00 ? 14 ILE A HG22 9  
ATOM 4963  H HG23 . ILE A 1 11 ? -4.705  11.213  0.942   1.00 0.00 ? 14 ILE A HG23 9  
ATOM 4964  H HD11 . ILE A 1 11 ? -2.085  13.574  3.497   1.00 0.00 ? 14 ILE A HD11 9  
ATOM 4965  H HD12 . ILE A 1 11 ? -3.005  13.011  4.891   1.00 0.00 ? 14 ILE A HD12 9  
ATOM 4966  H HD13 . ILE A 1 11 ? -3.791  13.990  3.654   1.00 0.00 ? 14 ILE A HD13 9  
ATOM 4967  N N    . MET A 1 12 ? -0.851  11.000  -0.585  1.00 0.00 ? 15 MET A N    9  
ATOM 4968  C CA   . MET A 1 12 ? -0.519  10.206  -1.759  1.00 0.00 ? 15 MET A CA   9  
ATOM 4969  C C    . MET A 1 12 ? 0.726   9.361   -1.493  1.00 0.00 ? 15 MET A C    9  
ATOM 4970  O O    . MET A 1 12 ? 0.719   8.145   -1.703  1.00 0.00 ? 15 MET A O    9  
ATOM 4971  C CB   . MET A 1 12 ? -0.294  11.129  -2.957  1.00 0.00 ? 15 MET A CB   9  
ATOM 4972  C CG   . MET A 1 12 ? -1.160  10.791  -4.156  1.00 0.00 ? 15 MET A CG   9  
ATOM 4973  S SD   . MET A 1 12 ? -0.198  10.213  -5.567  1.00 0.00 ? 15 MET A SD   9  
ATOM 4974  C CE   . MET A 1 12 ? -0.417  11.577  -6.707  1.00 0.00 ? 15 MET A CE   9  
ATOM 4975  H H    . MET A 1 12 ? -0.931  11.975  -0.680  1.00 0.00 ? 15 MET A H    9  
ATOM 4976  H HA   . MET A 1 12 ? -1.350  9.549   -1.967  1.00 0.00 ? 15 MET A HA   9  
ATOM 4977  H HB2  . MET A 1 12 ? -0.513  12.144  -2.658  1.00 0.00 ? 15 MET A HB2  9  
ATOM 4978  H HB3  . MET A 1 12 ? 0.740   11.069  -3.253  1.00 0.00 ? 15 MET A HB3  9  
ATOM 4979  H HG2  . MET A 1 12 ? -1.857  10.017  -3.871  1.00 0.00 ? 15 MET A HG2  9  
ATOM 4980  H HG3  . MET A 1 12 ? -1.707  11.675  -4.446  1.00 0.00 ? 15 MET A HG3  9  
ATOM 4981  H HE1  . MET A 1 12 ? 0.042   12.465  -6.299  1.00 0.00 ? 15 MET A HE1  9  
ATOM 4982  H HE2  . MET A 1 12 ? -1.470  11.753  -6.860  1.00 0.00 ? 15 MET A HE2  9  
ATOM 4983  H HE3  . MET A 1 12 ? 0.048   11.333  -7.652  1.00 0.00 ? 15 MET A HE3  9  
ATOM 4984  N N    . ASN A 1 13 ? 1.787   10.009  -1.000  1.00 0.00 ? 16 ASN A N    9  
ATOM 4985  C CA   . ASN A 1 13 ? 3.031   9.312   -0.675  1.00 0.00 ? 16 ASN A CA   9  
ATOM 4986  C C    . ASN A 1 13 ? 2.755   8.181   0.314   1.00 0.00 ? 16 ASN A C    9  
ATOM 4987  O O    . ASN A 1 13 ? 3.199   7.044   0.119   1.00 0.00 ? 16 ASN A O    9  
ATOM 4988  C CB   . ASN A 1 13 ? 4.058   10.289  -0.090  1.00 0.00 ? 16 ASN A CB   9  
ATOM 4989  C CG   . ASN A 1 13 ? 5.386   10.240  -0.818  1.00 0.00 ? 16 ASN A CG   9  
ATOM 4990  O OD1  . ASN A 1 13 ? 6.166   9.309   -0.643  1.00 0.00 ? 16 ASN A OD1  9  
ATOM 4991  N ND2  . ASN A 1 13 ? 5.651   11.241  -1.642  1.00 0.00 ? 16 ASN A ND2  9  
ATOM 4992  H H    . ASN A 1 13 ? 1.724   10.979  -0.835  1.00 0.00 ? 16 ASN A H    9  
ATOM 4993  H HA   . ASN A 1 13 ? 3.419   8.890   -1.584  1.00 0.00 ? 16 ASN A HA   9  
ATOM 4994  H HB2  . ASN A 1 13 ? 3.670   11.295  -0.158  1.00 0.00 ? 16 ASN A HB2  9  
ATOM 4995  H HB3  . ASN A 1 13 ? 4.229   10.045  0.948   1.00 0.00 ? 16 ASN A HB3  9  
ATOM 4996  H HD21 . ASN A 1 13 ? 4.986   11.953  -1.739  1.00 0.00 ? 16 ASN A HD21 9  
ATOM 4997  H HD22 . ASN A 1 13 ? 6.504   11.228  -2.122  1.00 0.00 ? 16 ASN A HD22 9  
ATOM 4998  N N    . LEU A 1 14 ? 1.997   8.500   1.361   1.00 0.00 ? 17 LEU A N    9  
ATOM 4999  C CA   . LEU A 1 14 ? 1.630   7.517   2.376   1.00 0.00 ? 17 LEU A CA   9  
ATOM 5000  C C    . LEU A 1 14 ? 0.860   6.365   1.741   1.00 0.00 ? 17 LEU A C    9  
ATOM 5001  O O    . LEU A 1 14 ? 1.248   5.205   1.874   1.00 0.00 ? 17 LEU A O    9  
ATOM 5002  C CB   . LEU A 1 14 ? 0.790   8.171   3.479   1.00 0.00 ? 17 LEU A CB   9  
ATOM 5003  C CG   . LEU A 1 14 ? 1.574   9.033   4.469   1.00 0.00 ? 17 LEU A CG   9  
ATOM 5004  C CD1  . LEU A 1 14 ? 0.629   9.707   5.450   1.00 0.00 ? 17 LEU A CD1  9  
ATOM 5005  C CD2  . LEU A 1 14 ? 2.603   8.195   5.211   1.00 0.00 ? 17 LEU A CD2  9  
ATOM 5006  H H    . LEU A 1 14 ? 1.662   9.418   1.442   1.00 0.00 ? 17 LEU A H    9  
ATOM 5007  H HA   . LEU A 1 14 ? 2.541   7.127   2.806   1.00 0.00 ? 17 LEU A HA   9  
ATOM 5008  H HB2  . LEU A 1 14 ? 0.040   8.791   3.009   1.00 0.00 ? 17 LEU A HB2  9  
ATOM 5009  H HB3  . LEU A 1 14 ? 0.291   7.390   4.033   1.00 0.00 ? 17 LEU A HB3  9  
ATOM 5010  H HG   . LEU A 1 14 ? 2.098   9.808   3.926   1.00 0.00 ? 17 LEU A HG   9  
ATOM 5011  H HD11 . LEU A 1 14 ? -0.226  9.071   5.620   1.00 0.00 ? 17 LEU A HD11 9  
ATOM 5012  H HD12 . LEU A 1 14 ? 0.302   10.651  5.044   1.00 0.00 ? 17 LEU A HD12 9  
ATOM 5013  H HD13 . LEU A 1 14 ? 1.143   9.875   6.385   1.00 0.00 ? 17 LEU A HD13 9  
ATOM 5014  H HD21 . LEU A 1 14 ? 3.351   7.844   4.516   1.00 0.00 ? 17 LEU A HD21 9  
ATOM 5015  H HD22 . LEU A 1 14 ? 2.113   7.349   5.670   1.00 0.00 ? 17 LEU A HD22 9  
ATOM 5016  H HD23 . LEU A 1 14 ? 3.073   8.796   5.975   1.00 0.00 ? 17 LEU A HD23 9  
ATOM 5017  N N    . LEU A 1 15 ? -0.220  6.692   1.026   1.00 0.00 ? 18 LEU A N    9  
ATOM 5018  C CA   . LEU A 1 15 ? -1.025  5.675   0.349   1.00 0.00 ? 18 LEU A CA   9  
ATOM 5019  C C    . LEU A 1 15 ? -0.144  4.825   -0.559  1.00 0.00 ? 18 LEU A C    9  
ATOM 5020  O O    . LEU A 1 15 ? -0.203  3.591   -0.519  1.00 0.00 ? 18 LEU A O    9  
ATOM 5021  C CB   . LEU A 1 15 ? -2.150  6.329   -0.459  1.00 0.00 ? 18 LEU A CB   9  
ATOM 5022  C CG   . LEU A 1 15 ? -3.226  7.031   0.372   1.00 0.00 ? 18 LEU A CG   9  
ATOM 5023  C CD1  . LEU A 1 15 ? -4.102  7.897   -0.516  1.00 0.00 ? 18 LEU A CD1  9  
ATOM 5024  C CD2  . LEU A 1 15 ? -4.069  6.013   1.121   1.00 0.00 ? 18 LEU A CD2  9  
ATOM 5025  H H    . LEU A 1 15 ? -0.471  7.644   0.941   1.00 0.00 ? 18 LEU A H    9  
ATOM 5026  H HA   . LEU A 1 15 ? -1.452  5.033   1.102   1.00 0.00 ? 18 LEU A HA   9  
ATOM 5027  H HB2  . LEU A 1 15 ? -1.710  7.057   -1.126  1.00 0.00 ? 18 LEU A HB2  9  
ATOM 5028  H HB3  . LEU A 1 15 ? -2.629  5.566   -1.054  1.00 0.00 ? 18 LEU A HB3  9  
ATOM 5029  H HG   . LEU A 1 15 ? -2.749  7.673   1.100   1.00 0.00 ? 18 LEU A HG   9  
ATOM 5030  H HD11 . LEU A 1 15 ? -3.520  8.717   -0.907  1.00 0.00 ? 18 LEU A HD11 9  
ATOM 5031  H HD12 . LEU A 1 15 ? -4.928  8.285   0.063   1.00 0.00 ? 18 LEU A HD12 9  
ATOM 5032  H HD13 . LEU A 1 15 ? -4.485  7.303   -1.332  1.00 0.00 ? 18 LEU A HD13 9  
ATOM 5033  H HD21 . LEU A 1 15 ? -4.638  5.427   0.414   1.00 0.00 ? 18 LEU A HD21 9  
ATOM 5034  H HD22 . LEU A 1 15 ? -4.745  6.527   1.788   1.00 0.00 ? 18 LEU A HD22 9  
ATOM 5035  H HD23 . LEU A 1 15 ? -3.425  5.361   1.693   1.00 0.00 ? 18 LEU A HD23 9  
ATOM 5036  N N    . PHE A 1 16 ? 0.695   5.491   -1.354  1.00 0.00 ? 19 PHE A N    9  
ATOM 5037  C CA   . PHE A 1 16 ? 1.616   4.798   -2.249  1.00 0.00 ? 19 PHE A CA   9  
ATOM 5038  C C    . PHE A 1 16 ? 2.473   3.811   -1.461  1.00 0.00 ? 19 PHE A C    9  
ATOM 5039  O O    . PHE A 1 16 ? 2.660   2.665   -1.877  1.00 0.00 ? 19 PHE A O    9  
ATOM 5040  C CB   . PHE A 1 16 ? 2.513   5.805   -2.976  1.00 0.00 ? 19 PHE A CB   9  
ATOM 5041  C CG   . PHE A 1 16 ? 2.737   5.478   -4.425  1.00 0.00 ? 19 PHE A CG   9  
ATOM 5042  C CD1  . PHE A 1 16 ? 3.258   4.249   -4.801  1.00 0.00 ? 19 PHE A CD1  9  
ATOM 5043  C CD2  . PHE A 1 16 ? 2.424   6.398   -5.412  1.00 0.00 ? 19 PHE A CD2  9  
ATOM 5044  C CE1  . PHE A 1 16 ? 3.463   3.946   -6.134  1.00 0.00 ? 19 PHE A CE1  9  
ATOM 5045  C CE2  . PHE A 1 16 ? 2.627   6.100   -6.746  1.00 0.00 ? 19 PHE A CE2  9  
ATOM 5046  C CZ   . PHE A 1 16 ? 3.147   4.873   -7.107  1.00 0.00 ? 19 PHE A CZ   9  
ATOM 5047  H H    . PHE A 1 16 ? 0.708   6.476   -1.321  1.00 0.00 ? 19 PHE A H    9  
ATOM 5048  H HA   . PHE A 1 16 ? 1.031   4.253   -2.975  1.00 0.00 ? 19 PHE A HA   9  
ATOM 5049  H HB2  . PHE A 1 16 ? 2.060   6.784   -2.923  1.00 0.00 ? 19 PHE A HB2  9  
ATOM 5050  H HB3  . PHE A 1 16 ? 3.477   5.837   -2.489  1.00 0.00 ? 19 PHE A HB3  9  
ATOM 5051  H HD1  . PHE A 1 16 ? 3.505   3.524   -4.040  1.00 0.00 ? 19 PHE A HD1  9  
ATOM 5052  H HD2  . PHE A 1 16 ? 2.017   7.359   -5.131  1.00 0.00 ? 19 PHE A HD2  9  
ATOM 5053  H HE1  . PHE A 1 16 ? 3.869   2.985   -6.413  1.00 0.00 ? 19 PHE A HE1  9  
ATOM 5054  H HE2  . PHE A 1 16 ? 2.378   6.828   -7.506  1.00 0.00 ? 19 PHE A HE2  9  
ATOM 5055  H HZ   . PHE A 1 16 ? 3.306   4.639   -8.149  1.00 0.00 ? 19 PHE A HZ   9  
ATOM 5056  N N    . ASN A 1 17 ? 2.981   4.256   -0.308  1.00 0.00 ? 20 ASN A N    9  
ATOM 5057  C CA   . ASN A 1 17 ? 3.797   3.417   0.538   1.00 0.00 ? 20 ASN A CA   9  
ATOM 5058  C C    . ASN A 1 17 ? 2.955   2.335   1.207   1.00 0.00 ? 20 ASN A C    9  
ATOM 5059  O O    . ASN A 1 17 ? 3.368   1.174   1.269   1.00 0.00 ? 20 ASN A O    9  
ATOM 5060  C CB   . ASN A 1 17 ? 4.507   4.276   1.569   1.00 0.00 ? 20 ASN A CB   9  
ATOM 5061  C CG   . ASN A 1 17 ? 5.965   3.926   1.646   1.00 0.00 ? 20 ASN A CG   9  
ATOM 5062  O OD1  . ASN A 1 17 ? 6.801   4.535   0.975   1.00 0.00 ? 20 ASN A OD1  9  
ATOM 5063  N ND2  . ASN A 1 17 ? 6.279   2.911   2.422   1.00 0.00 ? 20 ASN A ND2  9  
ATOM 5064  H H    . ASN A 1 17 ? 2.794   5.172   -0.014  1.00 0.00 ? 20 ASN A H    9  
ATOM 5065  H HA   . ASN A 1 17 ? 4.537   2.938   -0.087  1.00 0.00 ? 20 ASN A HA   9  
ATOM 5066  H HB2  . ASN A 1 17 ? 4.417   5.316   1.292   1.00 0.00 ? 20 ASN A HB2  9  
ATOM 5067  H HB3  . ASN A 1 17 ? 4.059   4.123   2.535   1.00 0.00 ? 20 ASN A HB3  9  
ATOM 5068  H HD21 . ASN A 1 17 ? 5.560   2.450   2.901   1.00 0.00 ? 20 ASN A HD21 9  
ATOM 5069  H HD22 . ASN A 1 17 ? 7.213   2.661   2.477   1.00 0.00 ? 20 ASN A HD22 9  
ATOM 5070  N N    . ILE A 1 18 ? 1.760   2.706   1.675   1.00 0.00 ? 21 ILE A N    9  
ATOM 5071  C CA   . ILE A 1 18 ? 0.857   1.737   2.292   1.00 0.00 ? 21 ILE A CA   9  
ATOM 5072  C C    . ILE A 1 18 ? 0.640   0.585   1.324   1.00 0.00 ? 21 ILE A C    9  
ATOM 5073  O O    . ILE A 1 18 ? 0.981   -0.558  1.629   1.00 0.00 ? 21 ILE A O    9  
ATOM 5074  C CB   . ILE A 1 18 ? -0.504  2.367   2.671   1.00 0.00 ? 21 ILE A CB   9  
ATOM 5075  C CG1  . ILE A 1 18 ? -0.327  3.395   3.790   1.00 0.00 ? 21 ILE A CG1  9  
ATOM 5076  C CG2  . ILE A 1 18 ? -1.495  1.289   3.095   1.00 0.00 ? 21 ILE A CG2  9  
ATOM 5077  C CD1  . ILE A 1 18 ? -1.473  4.378   3.893   1.00 0.00 ? 21 ILE A CD1  9  
ATOM 5078  H H    . ILE A 1 18 ? 1.473   3.645   1.577   1.00 0.00 ? 21 ILE A H    9  
ATOM 5079  H HA   . ILE A 1 18 ? 1.328   1.353   3.187   1.00 0.00 ? 21 ILE A HA   9  
ATOM 5080  H HB   . ILE A 1 18 ? -0.901  2.862   1.797   1.00 0.00 ? 21 ILE A HB   9  
ATOM 5081  H HG12 . ILE A 1 18 ? -0.250  2.879   4.735   1.00 0.00 ? 21 ILE A HG12 9  
ATOM 5082  H HG13 . ILE A 1 18 ? 0.579   3.957   3.617   1.00 0.00 ? 21 ILE A HG13 9  
ATOM 5083  H HG21 . ILE A 1 18 ? -1.978  1.588   4.014   1.00 0.00 ? 21 ILE A HG21 9  
ATOM 5084  H HG22 . ILE A 1 18 ? -0.972  0.356   3.251   1.00 0.00 ? 21 ILE A HG22 9  
ATOM 5085  H HG23 . ILE A 1 18 ? -2.239  1.161   2.324   1.00 0.00 ? 21 ILE A HG23 9  
ATOM 5086  H HD11 . ILE A 1 18 ? -2.378  3.916   3.525   1.00 0.00 ? 21 ILE A HD11 9  
ATOM 5087  H HD12 . ILE A 1 18 ? -1.251  5.254   3.303   1.00 0.00 ? 21 ILE A HD12 9  
ATOM 5088  H HD13 . ILE A 1 18 ? -1.610  4.665   4.925   1.00 0.00 ? 21 ILE A HD13 9  
ATOM 5089  N N    . ALA A 1 19 ? 0.122   0.901   0.133   1.00 0.00 ? 22 ALA A N    9  
ATOM 5090  C CA   . ALA A 1 19 ? -0.080  -0.115  -0.897  1.00 0.00 ? 22 ALA A CA   9  
ATOM 5091  C C    . ALA A 1 19 ? 1.233   -0.857  -1.151  1.00 0.00 ? 22 ALA A C    9  
ATOM 5092  O O    . ALA A 1 19 ? 1.259   -2.086  -1.264  1.00 0.00 ? 22 ALA A O    9  
ATOM 5093  C CB   . ALA A 1 19 ? -0.599  0.522   -2.181  1.00 0.00 ? 22 ALA A CB   9  
ATOM 5094  H H    . ALA A 1 19 ? -0.093  1.846   -0.066  1.00 0.00 ? 22 ALA A H    9  
ATOM 5095  H HA   . ALA A 1 19 ? -0.818  -0.819  -0.539  1.00 0.00 ? 22 ALA A HA   9  
ATOM 5096  H HB1  . ALA A 1 19 ? -1.552  0.994   -1.988  1.00 0.00 ? 22 ALA A HB1  9  
ATOM 5097  H HB2  . ALA A 1 19 ? -0.720  -0.239  -2.938  1.00 0.00 ? 22 ALA A HB2  9  
ATOM 5098  H HB3  . ALA A 1 19 ? 0.106   1.264   -2.525  1.00 0.00 ? 22 ALA A HB3  9  
ATOM 5099  N N    . LYS A 1 20 ? 2.328   -0.092  -1.206  1.00 0.00 ? 23 LYS A N    9  
ATOM 5100  C CA   . LYS A 1 20 ? 3.662   -0.650  -1.410  1.00 0.00 ? 23 LYS A CA   9  
ATOM 5101  C C    . LYS A 1 20 ? 3.907   -1.809  -0.441  1.00 0.00 ? 23 LYS A C    9  
ATOM 5102  O O    . LYS A 1 20 ? 4.064   -2.955  -0.858  1.00 0.00 ? 23 LYS A O    9  
ATOM 5103  C CB   . LYS A 1 20 ? 4.725   0.444   -1.209  1.00 0.00 ? 23 LYS A CB   9  
ATOM 5104  C CG   . LYS A 1 20 ? 5.461   0.842   -2.481  1.00 0.00 ? 23 LYS A CG   9  
ATOM 5105  C CD   . LYS A 1 20 ? 5.854   2.317   -2.465  1.00 0.00 ? 23 LYS A CD   9  
ATOM 5106  C CE   . LYS A 1 20 ? 7.066   2.574   -1.577  1.00 0.00 ? 23 LYS A CE   9  
ATOM 5107  N NZ   . LYS A 1 20 ? 7.320   4.035   -1.379  1.00 0.00 ? 23 LYS A NZ   9  
ATOM 5108  H H    . LYS A 1 20 ? 2.235   0.878   -1.088  1.00 0.00 ? 23 LYS A H    9  
ATOM 5109  H HA   . LYS A 1 20 ? 3.721   -1.020  -2.419  1.00 0.00 ? 23 LYS A HA   9  
ATOM 5110  H HB2  . LYS A 1 20 ? 4.242   1.322   -0.814  1.00 0.00 ? 23 LYS A HB2  9  
ATOM 5111  H HB3  . LYS A 1 20 ? 5.453   0.095   -0.492  1.00 0.00 ? 23 LYS A HB3  9  
ATOM 5112  H HG2  . LYS A 1 20 ? 6.354   0.243   -2.572  1.00 0.00 ? 23 LYS A HG2  9  
ATOM 5113  H HG3  . LYS A 1 20 ? 4.816   0.661   -3.330  1.00 0.00 ? 23 LYS A HG3  9  
ATOM 5114  H HD2  . LYS A 1 20 ? 6.089   2.627   -3.472  1.00 0.00 ? 23 LYS A HD2  9  
ATOM 5115  H HD3  . LYS A 1 20 ? 5.018   2.897   -2.096  1.00 0.00 ? 23 LYS A HD3  9  
ATOM 5116  H HE2  . LYS A 1 20 ? 6.893   2.112   -0.614  1.00 0.00 ? 23 LYS A HE2  9  
ATOM 5117  H HE3  . LYS A 1 20 ? 7.933   2.124   -2.039  1.00 0.00 ? 23 LYS A HE3  9  
ATOM 5118  H HZ1  . LYS A 1 20 ? 6.681   4.600   -1.975  1.00 0.00 ? 23 LYS A HZ1  9  
ATOM 5119  H HZ2  . LYS A 1 20 ? 8.305   4.266   -1.628  1.00 0.00 ? 23 LYS A HZ2  9  
ATOM 5120  H HZ3  . LYS A 1 20 ? 7.159   4.302   -0.370  1.00 0.00 ? 23 LYS A HZ3  9  
ATOM 5121  N N    . ALA A 1 21 ? 3.924   -1.508  0.854   1.00 0.00 ? 24 ALA A N    9  
ATOM 5122  C CA   . ALA A 1 21 ? 4.144   -2.535  1.871   1.00 0.00 ? 24 ALA A CA   9  
ATOM 5123  C C    . ALA A 1 21 ? 2.968   -3.516  1.962   1.00 0.00 ? 24 ALA A C    9  
ATOM 5124  O O    . ALA A 1 21 ? 3.174   -4.724  2.109   1.00 0.00 ? 24 ALA A O    9  
ATOM 5125  C CB   . ALA A 1 21 ? 4.411   -1.892  3.224   1.00 0.00 ? 24 ALA A CB   9  
ATOM 5126  H H    . ALA A 1 21 ? 3.779   -0.574  1.133   1.00 0.00 ? 24 ALA A H    9  
ATOM 5127  H HA   . ALA A 1 21 ? 5.029   -3.090  1.584   1.00 0.00 ? 24 ALA A HA   9  
ATOM 5128  H HB1  . ALA A 1 21 ? 5.229   -1.191  3.135   1.00 0.00 ? 24 ALA A HB1  9  
ATOM 5129  H HB2  . ALA A 1 21 ? 4.670   -2.657  3.943   1.00 0.00 ? 24 ALA A HB2  9  
ATOM 5130  H HB3  . ALA A 1 21 ? 3.526   -1.370  3.557   1.00 0.00 ? 24 ALA A HB3  9  
ATOM 5131  N N    . LYS A 1 22 ? 1.738   -2.998  1.873   1.00 0.00 ? 25 LYS A N    9  
ATOM 5132  C CA   . LYS A 1 22 ? 0.546   -3.841  1.947   1.00 0.00 ? 25 LYS A CA   9  
ATOM 5133  C C    . LYS A 1 22 ? 0.541   -4.893  0.847   1.00 0.00 ? 25 LYS A C    9  
ATOM 5134  O O    . LYS A 1 22 ? 0.053   -6.009  1.053   1.00 0.00 ? 25 LYS A O    9  
ATOM 5135  C CB   . LYS A 1 22 ? -0.719  -2.991  1.849   1.00 0.00 ? 25 LYS A CB   9  
ATOM 5136  C CG   . LYS A 1 22 ? -1.704  -3.242  2.975   1.00 0.00 ? 25 LYS A CG   9  
ATOM 5137  C CD   . LYS A 1 22 ? -2.918  -4.025  2.490   1.00 0.00 ? 25 LYS A CD   9  
ATOM 5138  C CE   . LYS A 1 22 ? -2.744  -5.524  2.694   1.00 0.00 ? 25 LYS A CE   9  
ATOM 5139  N NZ   . LYS A 1 22 ? -2.364  -6.225  1.431   1.00 0.00 ? 25 LYS A NZ   9  
ATOM 5140  H H    . LYS A 1 22 ? 1.627   -2.026  1.750   1.00 0.00 ? 25 LYS A H    9  
ATOM 5141  H HA   . LYS A 1 22 ? 0.556   -4.343  2.903   1.00 0.00 ? 25 LYS A HA   9  
ATOM 5142  H HB2  . LYS A 1 22 ? -0.440  -1.949  1.869   1.00 0.00 ? 25 LYS A HB2  9  
ATOM 5143  H HB3  . LYS A 1 22 ? -1.212  -3.202  0.911   1.00 0.00 ? 25 LYS A HB3  9  
ATOM 5144  H HG2  . LYS A 1 22 ? -1.211  -3.803  3.755   1.00 0.00 ? 25 LYS A HG2  9  
ATOM 5145  H HG3  . LYS A 1 22 ? -2.030  -2.290  3.365   1.00 0.00 ? 25 LYS A HG3  9  
ATOM 5146  H HD2  . LYS A 1 22 ? -3.788  -3.697  3.039   1.00 0.00 ? 25 LYS A HD2  9  
ATOM 5147  H HD3  . LYS A 1 22 ? -3.063  -3.828  1.438   1.00 0.00 ? 25 LYS A HD3  9  
ATOM 5148  H HE2  . LYS A 1 22 ? -1.973  -5.686  3.434   1.00 0.00 ? 25 LYS A HE2  9  
ATOM 5149  H HE3  . LYS A 1 22 ? -3.678  -5.933  3.058   1.00 0.00 ? 25 LYS A HE3  9  
ATOM 5150  H HZ1  . LYS A 1 22 ? -2.756  -5.722  0.609   1.00 0.00 ? 25 LYS A HZ1  9  
ATOM 5151  H HZ2  . LYS A 1 22 ? -2.728  -7.199  1.435   1.00 0.00 ? 25 LYS A HZ2  9  
ATOM 5152  H HZ3  . LYS A 1 22 ? -1.316  -6.257  1.333   1.00 0.00 ? 25 LYS A HZ3  9  
ATOM 5153  N N    . ASN A 1 23 ? 1.065   -4.534  -0.322  1.00 0.00 ? 26 ASN A N    9  
ATOM 5154  C CA   . ASN A 1 23 ? 1.110   -5.456  -1.455  1.00 0.00 ? 26 ASN A CA   9  
ATOM 5155  C C    . ASN A 1 23 ? 2.426   -6.239  -1.489  1.00 0.00 ? 26 ASN A C    9  
ATOM 5156  O O    . ASN A 1 23 ? 2.416   -7.444  -1.724  1.00 0.00 ? 26 ASN A O    9  
ATOM 5157  C CB   . ASN A 1 23 ? 0.866   -4.708  -2.778  1.00 0.00 ? 26 ASN A CB   9  
ATOM 5158  C CG   . ASN A 1 23 ? 2.137   -4.398  -3.546  1.00 0.00 ? 26 ASN A CG   9  
ATOM 5159  O OD1  . ASN A 1 23 ? 2.559   -5.166  -4.405  1.00 0.00 ? 26 ASN A OD1  9  
ATOM 5160  N ND2  . ASN A 1 23 ? 2.750   -3.270  -3.241  1.00 0.00 ? 26 ASN A ND2  9  
ATOM 5161  H H    . ASN A 1 23 ? 1.422   -3.620  -0.428  1.00 0.00 ? 26 ASN A H    9  
ATOM 5162  H HA   . ASN A 1 23 ? 0.312   -6.167  -1.314  1.00 0.00 ? 26 ASN A HA   9  
ATOM 5163  H HB2  . ASN A 1 23 ? 0.234   -5.312  -3.411  1.00 0.00 ? 26 ASN A HB2  9  
ATOM 5164  H HB3  . ASN A 1 23 ? 0.362   -3.776  -2.566  1.00 0.00 ? 26 ASN A HB3  9  
ATOM 5165  H HD21 . ASN A 1 23 ? 2.356   -2.704  -2.543  1.00 0.00 ? 26 ASN A HD21 9  
ATOM 5166  H HD22 . ASN A 1 23 ? 3.573   -3.049  -3.722  1.00 0.00 ? 26 ASN A HD22 9  
ATOM 5167  N N    . LEU A 1 24 ? 3.553   -5.562  -1.239  1.00 0.00 ? 27 LEU A N    9  
ATOM 5168  C CA   . LEU A 1 24 ? 4.862   -6.225  -1.238  1.00 0.00 ? 27 LEU A CA   9  
ATOM 5169  C C    . LEU A 1 24 ? 4.806   -7.535  -0.468  1.00 0.00 ? 27 LEU A C    9  
ATOM 5170  O O    . LEU A 1 24 ? 5.150   -8.598  -0.983  1.00 0.00 ? 27 LEU A O    9  
ATOM 5171  C CB   . LEU A 1 24 ? 5.935   -5.312  -0.627  1.00 0.00 ? 27 LEU A CB   9  
ATOM 5172  C CG   . LEU A 1 24 ? 6.514   -4.251  -1.565  1.00 0.00 ? 27 LEU A CG   9  
ATOM 5173  C CD1  . LEU A 1 24 ? 7.520   -3.382  -0.829  1.00 0.00 ? 27 LEU A CD1  9  
ATOM 5174  C CD2  . LEU A 1 24 ? 7.163   -4.902  -2.776  1.00 0.00 ? 27 LEU A CD2  9  
ATOM 5175  H H    . LEU A 1 24 ? 3.505   -4.599  -1.044  1.00 0.00 ? 27 LEU A H    9  
ATOM 5176  H HA   . LEU A 1 24 ? 5.119   -6.444  -2.248  1.00 0.00 ? 27 LEU A HA   9  
ATOM 5177  H HB2  . LEU A 1 24 ? 5.503   -4.809  0.225   1.00 0.00 ? 27 LEU A HB2  9  
ATOM 5178  H HB3  . LEU A 1 24 ? 6.748   -5.933  -0.279  1.00 0.00 ? 27 LEU A HB3  9  
ATOM 5179  H HG   . LEU A 1 24 ? 5.715   -3.614  -1.911  1.00 0.00 ? 27 LEU A HG   9  
ATOM 5180  H HD11 . LEU A 1 24 ? 8.018   -2.734  -1.535  1.00 0.00 ? 27 LEU A HD11 9  
ATOM 5181  H HD12 . LEU A 1 24 ? 8.248   -4.010  -0.339  1.00 0.00 ? 27 LEU A HD12 9  
ATOM 5182  H HD13 . LEU A 1 24 ? 7.006   -2.782  -0.092  1.00 0.00 ? 27 LEU A HD13 9  
ATOM 5183  H HD21 . LEU A 1 24 ? 6.404   -5.374  -3.382  1.00 0.00 ? 27 LEU A HD21 9  
ATOM 5184  H HD22 . LEU A 1 24 ? 7.874   -5.646  -2.448  1.00 0.00 ? 27 LEU A HD22 9  
ATOM 5185  H HD23 . LEU A 1 24 ? 7.672   -4.149  -3.358  1.00 0.00 ? 27 LEU A HD23 9  
ATOM 5186  N N    . ARG A 1 25 ? 4.357   -7.436  0.764   1.00 0.00 ? 28 ARG A N    9  
ATOM 5187  C CA   . ARG A 1 25 ? 4.232   -8.595  1.643   1.00 0.00 ? 28 ARG A CA   9  
ATOM 5188  C C    . ARG A 1 25 ? 3.062   -9.495  1.234   1.00 0.00 ? 28 ARG A C    9  
ATOM 5189  O O    . ARG A 1 25 ? 3.177   -10.719 1.258   1.00 0.00 ? 28 ARG A O    9  
ATOM 5190  C CB   . ARG A 1 25 ? 4.054   -8.138  3.091   1.00 0.00 ? 28 ARG A CB   9  
ATOM 5191  C CG   . ARG A 1 25 ? 5.116   -8.689  4.025   1.00 0.00 ? 28 ARG A CG   9  
ATOM 5192  C CD   . ARG A 1 25 ? 4.501   -9.425  5.205   1.00 0.00 ? 28 ARG A CD   9  
ATOM 5193  N NE   . ARG A 1 25 ? 4.416   -8.569  6.393   1.00 0.00 ? 28 ARG A NE   9  
ATOM 5194  C CZ   . ARG A 1 25 ? 3.399   -7.755  6.667   1.00 0.00 ? 28 ARG A CZ   9  
ATOM 5195  N NH1  . ARG A 1 25 ? 2.331   -7.724  5.892   1.00 0.00 ? 28 ARG A NH1  9  
ATOM 5196  N NH2  . ARG A 1 25 ? 3.448   -6.981  7.737   1.00 0.00 ? 28 ARG A NH2  9  
ATOM 5197  H H    . ARG A 1 25 ? 4.098   -6.552  1.088   1.00 0.00 ? 28 ARG A H    9  
ATOM 5198  H HA   . ARG A 1 25 ? 5.145   -9.165  1.567   1.00 0.00 ? 28 ARG A HA   9  
ATOM 5199  H HB2  . ARG A 1 25 ? 4.097   -7.059  3.126   1.00 0.00 ? 28 ARG A HB2  9  
ATOM 5200  H HB3  . ARG A 1 25 ? 3.089   -8.464  3.442   1.00 0.00 ? 28 ARG A HB3  9  
ATOM 5201  H HG2  . ARG A 1 25 ? 5.745   -9.372  3.474   1.00 0.00 ? 28 ARG A HG2  9  
ATOM 5202  H HG3  . ARG A 1 25 ? 5.714   -7.868  4.397   1.00 0.00 ? 28 ARG A HG3  9  
ATOM 5203  H HD2  . ARG A 1 25 ? 3.509   -9.760  4.934   1.00 0.00 ? 28 ARG A HD2  9  
ATOM 5204  H HD3  . ARG A 1 25 ? 5.115   -10.285 5.437   1.00 0.00 ? 28 ARG A HD3  9  
ATOM 5205  H HE   . ARG A 1 25 ? 5.175   -8.587  7.011   1.00 0.00 ? 28 ARG A HE   9  
ATOM 5206  H HH11 . ARG A 1 25 ? 2.277   -8.315  5.093   1.00 0.00 ? 28 ARG A HH11 9  
ATOM 5207  H HH12 . ARG A 1 25 ? 1.576   -7.107  6.106   1.00 0.00 ? 28 ARG A HH12 9  
ATOM 5208  H HH21 . ARG A 1 25 ? 4.246   -7.008  8.337   1.00 0.00 ? 28 ARG A HH21 9  
ATOM 5209  H HH22 . ARG A 1 25 ? 2.689   -6.367  7.944   1.00 0.00 ? 28 ARG A HH22 9  
ATOM 5210  N N    . ALA A 1 26 ? 1.942   -8.887  0.850   1.00 0.00 ? 29 ALA A N    9  
ATOM 5211  C CA   . ALA A 1 26 ? 0.765   -9.646  0.435   1.00 0.00 ? 29 ALA A CA   9  
ATOM 5212  C C    . ALA A 1 26 ? 1.011   -10.384 -0.882  1.00 0.00 ? 29 ALA A C    9  
ATOM 5213  O O    . ALA A 1 26 ? 0.322   -11.352 -1.197  1.00 0.00 ? 29 ALA A O    9  
ATOM 5214  C CB   . ALA A 1 26 ? -0.441  -8.725  0.312   1.00 0.00 ? 29 ALA A CB   9  
ATOM 5215  H H    . ALA A 1 26 ? 1.909   -7.910  0.837   1.00 0.00 ? 29 ALA A H    9  
ATOM 5216  H HA   . ALA A 1 26 ? 0.552   -10.375 1.204   1.00 0.00 ? 29 ALA A HA   9  
ATOM 5217  H HB1  . ALA A 1 26 ? -0.182  -7.874  -0.301  1.00 0.00 ? 29 ALA A HB1  9  
ATOM 5218  H HB2  . ALA A 1 26 ? -0.736  -8.388  1.293   1.00 0.00 ? 29 ALA A HB2  9  
ATOM 5219  H HB3  . ALA A 1 26 ? -1.259  -9.262  -0.147  1.00 0.00 ? 29 ALA A HB3  9  
ATOM 5220  N N    . GLN A 1 27 ? 1.974   -9.906  -1.660  1.00 0.00 ? 30 GLN A N    9  
ATOM 5221  C CA   . GLN A 1 27 ? 2.282   -10.513 -2.952  1.00 0.00 ? 30 GLN A CA   9  
ATOM 5222  C C    . GLN A 1 27 ? 3.564   -11.345 -2.932  1.00 0.00 ? 30 GLN A C    9  
ATOM 5223  O O    . GLN A 1 27 ? 3.662   -12.354 -3.629  1.00 0.00 ? 30 GLN A O    9  
ATOM 5224  C CB   . GLN A 1 27 ? 2.347   -9.416  -4.028  1.00 0.00 ? 30 GLN A CB   9  
ATOM 5225  C CG   . GLN A 1 27 ? 3.025   -9.837  -5.324  1.00 0.00 ? 30 GLN A CG   9  
ATOM 5226  C CD   . GLN A 1 27 ? 2.066   -9.880  -6.495  1.00 0.00 ? 30 GLN A CD   9  
ATOM 5227  O OE1  . GLN A 1 27 ? 1.467   -10.913 -6.781  1.00 0.00 ? 30 GLN A OE1  9  
ATOM 5228  N NE2  . GLN A 1 27 ? 1.910   -8.756  -7.181  1.00 0.00 ? 30 GLN A NE2  9  
ATOM 5229  H H    . GLN A 1 27 ? 2.472   -9.106  -1.373  1.00 0.00 ? 30 GLN A H    9  
ATOM 5230  H HA   . GLN A 1 27 ? 1.483   -11.175 -3.177  1.00 0.00 ? 30 GLN A HA   9  
ATOM 5231  H HB2  . GLN A 1 27 ? 1.339   -9.105  -4.262  1.00 0.00 ? 30 GLN A HB2  9  
ATOM 5232  H HB3  . GLN A 1 27 ? 2.886   -8.570  -3.624  1.00 0.00 ? 30 GLN A HB3  9  
ATOM 5233  H HG2  . GLN A 1 27 ? 3.809   -9.131  -5.550  1.00 0.00 ? 30 GLN A HG2  9  
ATOM 5234  H HG3  . GLN A 1 27 ? 3.454   -10.816 -5.193  1.00 0.00 ? 30 GLN A HG3  9  
ATOM 5235  H HE21 . GLN A 1 27 ? 2.414   -7.965  -6.898  1.00 0.00 ? 30 GLN A HE21 9  
ATOM 5236  H HE22 . GLN A 1 27 ? 1.296   -8.766  -7.944  1.00 0.00 ? 30 GLN A HE22 9  
ATOM 5237  N N    . ALA A 1 28 ? 4.532   -10.922 -2.147  1.00 0.00 ? 31 ALA A N    9  
ATOM 5238  C CA   . ALA A 1 28 ? 5.809   -11.634 -2.050  1.00 0.00 ? 31 ALA A CA   9  
ATOM 5239  C C    . ALA A 1 28 ? 5.832   -12.631 -0.889  1.00 0.00 ? 31 ALA A C    9  
ATOM 5240  O O    . ALA A 1 28 ? 6.617   -13.582 -0.898  1.00 0.00 ? 31 ALA A O    9  
ATOM 5241  C CB   . ALA A 1 28 ? 6.958   -10.644 -1.929  1.00 0.00 ? 31 ALA A CB   9  
ATOM 5242  H H    . ALA A 1 28 ? 4.389   -10.111 -1.624  1.00 0.00 ? 31 ALA A H    9  
ATOM 5243  H HA   . ALA A 1 28 ? 5.939   -12.186 -2.968  1.00 0.00 ? 31 ALA A HA   9  
ATOM 5244  H HB1  . ALA A 1 28 ? 7.896   -11.165 -2.055  1.00 0.00 ? 31 ALA A HB1  9  
ATOM 5245  H HB2  . ALA A 1 28 ? 6.933   -10.178 -0.955  1.00 0.00 ? 31 ALA A HB2  9  
ATOM 5246  H HB3  . ALA A 1 28 ? 6.862   -9.886  -2.693  1.00 0.00 ? 31 ALA A HB3  9  
ATOM 5247  N N    . ALA A 1 29 ? 4.976   -12.411 0.110   1.00 0.00 ? 32 ALA A N    9  
ATOM 5248  C CA   . ALA A 1 29 ? 4.908   -13.297 1.266   1.00 0.00 ? 32 ALA A CA   9  
ATOM 5249  C C    . ALA A 1 29 ? 3.605   -14.105 1.289   1.00 0.00 ? 32 ALA A C    9  
ATOM 5250  O O    . ALA A 1 29 ? 3.564   -15.197 1.857   1.00 0.00 ? 32 ALA A O    9  
ATOM 5251  C CB   . ALA A 1 29 ? 5.070   -12.498 2.553   1.00 0.00 ? 32 ALA A CB   9  
ATOM 5252  H H    . ALA A 1 29 ? 4.378   -11.634 0.068   1.00 0.00 ? 32 ALA A H    9  
ATOM 5253  H HA   . ALA A 1 29 ? 5.737   -13.988 1.200   1.00 0.00 ? 32 ALA A HA   9  
ATOM 5254  H HB1  . ALA A 1 29 ? 5.773   -11.694 2.392   1.00 0.00 ? 32 ALA A HB1  9  
ATOM 5255  H HB2  . ALA A 1 29 ? 5.438   -13.147 3.335   1.00 0.00 ? 32 ALA A HB2  9  
ATOM 5256  H HB3  . ALA A 1 29 ? 4.114   -12.088 2.845   1.00 0.00 ? 32 ALA A HB3  9  
ATOM 5257  N N    . ALA A 1 30 ? 2.539   -13.578 0.672   1.00 0.00 ? 33 ALA A N    9  
ATOM 5258  C CA   . ALA A 1 30 ? 1.263   -14.291 0.651   1.00 0.00 ? 33 ALA A CA   9  
ATOM 5259  C C    . ALA A 1 30 ? 1.148   -15.230 -0.547  1.00 0.00 ? 33 ALA A C    9  
ATOM 5260  O O    . ALA A 1 30 ? 0.360   -16.177 -0.528  1.00 0.00 ? 33 ALA A O    9  
ATOM 5261  C CB   . ALA A 1 30 ? 0.099   -13.311 0.689   1.00 0.00 ? 33 ALA A CB   9  
ATOM 5262  H H    . ALA A 1 30 ? 2.612   -12.704 0.223   1.00 0.00 ? 33 ALA A H    9  
ATOM 5263  H HA   . ALA A 1 30 ? 1.221   -14.888 1.539   1.00 0.00 ? 33 ALA A HA   9  
ATOM 5264  H HB1  . ALA A 1 30 ? 0.466   -12.326 0.936   1.00 0.00 ? 33 ALA A HB1  9  
ATOM 5265  H HB2  . ALA A 1 30 ? -0.614  -13.627 1.437   1.00 0.00 ? 33 ALA A HB2  9  
ATOM 5266  H HB3  . ALA A 1 30 ? -0.383  -13.284 -0.278  1.00 0.00 ? 33 ALA A HB3  9  
ATOM 5267  N N    . ASN A 1 31 ? 1.954   -14.981 -1.573  1.00 0.00 ? 34 ASN A N    9  
ATOM 5268  C CA   . ASN A 1 31 ? 1.958   -15.819 -2.774  1.00 0.00 ? 34 ASN A CA   9  
ATOM 5269  C C    . ASN A 1 31 ? 2.403   -17.241 -2.438  1.00 0.00 ? 34 ASN A C    9  
ATOM 5270  O O    . ASN A 1 31 ? 1.743   -18.210 -2.810  1.00 0.00 ? 34 ASN A O    9  
ATOM 5271  C CB   . ASN A 1 31 ? 2.875   -15.218 -3.848  1.00 0.00 ? 34 ASN A CB   9  
ATOM 5272  C CG   . ASN A 1 31 ? 4.314   -15.081 -3.383  1.00 0.00 ? 34 ASN A CG   9  
ATOM 5273  O OD1  . ASN A 1 31 ? 4.579   -14.925 -2.193  1.00 0.00 ? 34 ASN A OD1  9  
ATOM 5274  N ND2  . ASN A 1 31 ? 5.251   -15.152 -4.313  1.00 0.00 ? 34 ASN A ND2  9  
ATOM 5275  H H    . ASN A 1 31 ? 2.575   -14.225 -1.513  1.00 0.00 ? 34 ASN A H    9  
ATOM 5276  H HA   . ASN A 1 31 ? 0.947   -15.855 -3.155  1.00 0.00 ? 34 ASN A HA   9  
ATOM 5277  H HB2  . ASN A 1 31 ? 2.860   -15.852 -4.721  1.00 0.00 ? 34 ASN A HB2  9  
ATOM 5278  H HB3  . ASN A 1 31 ? 2.509   -14.238 -4.117  1.00 0.00 ? 34 ASN A HB3  9  
ATOM 5279  H HD21 . ASN A 1 31 ? 4.974   -15.288 -5.242  1.00 0.00 ? 34 ASN A HD21 9  
ATOM 5280  H HD22 . ASN A 1 31 ? 6.185   -15.063 -4.033  1.00 0.00 ? 34 ASN A HD22 9  
ATOM 5281  N N    . ALA A 1 32 ? 3.522   -17.355 -1.721  1.00 0.00 ? 35 ALA A N    9  
ATOM 5282  C CA   . ALA A 1 32 ? 4.053   -18.658 -1.323  1.00 0.00 ? 35 ALA A CA   9  
ATOM 5283  C C    . ALA A 1 32 ? 3.234   -19.285 -0.190  1.00 0.00 ? 35 ALA A C    9  
ATOM 5284  O O    . ALA A 1 32 ? 3.382   -20.470 0.115   1.00 0.00 ? 35 ALA A O    9  
ATOM 5285  C CB   . ALA A 1 32 ? 5.517   -18.529 -0.921  1.00 0.00 ? 35 ALA A CB   9  
ATOM 5286  H H    . ALA A 1 32 ? 3.997   -16.538 -1.448  1.00 0.00 ? 35 ALA A H    9  
ATOM 5287  H HA   . ALA A 1 32 ? 3.995   -19.305 -2.179  1.00 0.00 ? 35 ALA A HA   9  
ATOM 5288  H HB1  . ALA A 1 32 ? 5.850   -19.454 -0.472  1.00 0.00 ? 35 ALA A HB1  9  
ATOM 5289  H HB2  . ALA A 1 32 ? 5.627   -17.723 -0.211  1.00 0.00 ? 35 ALA A HB2  9  
ATOM 5290  H HB3  . ALA A 1 32 ? 6.114   -18.320 -1.798  1.00 0.00 ? 35 ALA A HB3  9  
ATOM 5291  N N    . HIS A 1 33 ? 2.366   -18.483 0.418   1.00 0.00 ? 36 HIS A N    9  
ATOM 5292  C CA   . HIS A 1 33 ? 1.512   -18.943 1.509   1.00 0.00 ? 36 HIS A CA   9  
ATOM 5293  C C    . HIS A 1 33 ? 0.148   -19.395 0.983   1.00 0.00 ? 36 HIS A C    9  
ATOM 5294  O O    . HIS A 1 33 ? -0.298  -20.506 1.271   1.00 0.00 ? 36 HIS A O    9  
ATOM 5295  C CB   . HIS A 1 33 ? 1.335   -17.829 2.548   1.00 0.00 ? 36 HIS A CB   9  
ATOM 5296  C CG   . HIS A 1 33 ? 1.679   -18.251 3.939   1.00 0.00 ? 36 HIS A CG   9  
ATOM 5297  N ND1  . HIS A 1 33 ? 0.819   -18.970 4.742   1.00 0.00 ? 36 HIS A ND1  9  
ATOM 5298  C CD2  . HIS A 1 33 ? 2.798   -18.054 4.673   1.00 0.00 ? 36 HIS A CD2  9  
ATOM 5299  C CE1  . HIS A 1 33 ? 1.394   -19.197 5.909   1.00 0.00 ? 36 HIS A CE1  9  
ATOM 5300  N NE2  . HIS A 1 33 ? 2.597   -18.654 5.893   1.00 0.00 ? 36 HIS A NE2  9  
ATOM 5301  H H    . HIS A 1 33 ? 2.296   -17.558 0.120   1.00 0.00 ? 36 HIS A H    9  
ATOM 5302  H HA   . HIS A 1 33 ? 1.998   -19.786 1.978   1.00 0.00 ? 36 HIS A HA   9  
ATOM 5303  H HB2  . HIS A 1 33 ? 1.973   -16.997 2.287   1.00 0.00 ? 36 HIS A HB2  9  
ATOM 5304  H HB3  . HIS A 1 33 ? 0.306   -17.501 2.543   1.00 0.00 ? 36 HIS A HB3  9  
ATOM 5305  H HD1  . HIS A 1 33 ? -0.080  -19.271 4.491   1.00 0.00 ? 36 HIS A HD1  9  
ATOM 5306  H HD2  . HIS A 1 33 ? 3.686   -17.524 4.356   1.00 0.00 ? 36 HIS A HD2  9  
ATOM 5307  H HE1  . HIS A 1 33 ? 0.955   -19.738 6.738   1.00 0.00 ? 36 HIS A HE1  9  
ATOM 5308  H HE2  . HIS A 1 33 ? 3.282   -18.777 6.584   1.00 0.00 ? 36 HIS A HE2  9  
ATOM 5309  N N    . LEU A 1 34 ? -0.512  -18.529 0.207   1.00 0.00 ? 37 LEU A N    9  
ATOM 5310  C CA   . LEU A 1 34 ? -1.825  -18.848 -0.358  1.00 0.00 ? 37 LEU A CA   9  
ATOM 5311  C C    . LEU A 1 34 ? -1.727  -19.867 -1.496  1.00 0.00 ? 37 LEU A C    9  
ATOM 5312  O O    . LEU A 1 34 ? -2.734  -20.451 -1.902  1.00 0.00 ? 37 LEU A O    9  
ATOM 5313  C CB   . LEU A 1 34 ? -2.517  -17.573 -0.849  1.00 0.00 ? 37 LEU A CB   9  
ATOM 5314  C CG   . LEU A 1 34 ? -3.253  -16.771 0.228   1.00 0.00 ? 37 LEU A CG   9  
ATOM 5315  C CD1  . LEU A 1 34 ? -4.409  -17.575 0.799   1.00 0.00 ? 37 LEU A CD1  9  
ATOM 5316  C CD2  . LEU A 1 34 ? -2.297  -16.353 1.335   1.00 0.00 ? 37 LEU A CD2  9  
ATOM 5317  H H    . LEU A 1 34 ? -0.106  -17.653 0.008   1.00 0.00 ? 37 LEU A H    9  
ATOM 5318  H HA   . LEU A 1 34 ? -2.414  -19.283 0.427   1.00 0.00 ? 37 LEU A HA   9  
ATOM 5319  H HB2  . LEU A 1 34 ? -1.768  -16.933 -1.297  1.00 0.00 ? 37 LEU A HB2  9  
ATOM 5320  H HB3  . LEU A 1 34 ? -3.231  -17.847 -1.612  1.00 0.00 ? 37 LEU A HB3  9  
ATOM 5321  H HG   . LEU A 1 34 ? -3.658  -15.875 -0.218  1.00 0.00 ? 37 LEU A HG   9  
ATOM 5322  H HD11 . LEU A 1 34 ? -5.176  -16.901 1.152   1.00 0.00 ? 37 LEU A HD11 9  
ATOM 5323  H HD12 . LEU A 1 34 ? -4.056  -18.180 1.621   1.00 0.00 ? 37 LEU A HD12 9  
ATOM 5324  H HD13 . LEU A 1 34 ? -4.819  -18.215 0.030   1.00 0.00 ? 37 LEU A HD13 9  
ATOM 5325  H HD21 . LEU A 1 34 ? -2.816  -15.717 2.036   1.00 0.00 ? 37 LEU A HD21 9  
ATOM 5326  H HD22 . LEU A 1 34 ? -1.464  -15.815 0.908   1.00 0.00 ? 37 LEU A HD22 9  
ATOM 5327  H HD23 . LEU A 1 34 ? -1.935  -17.233 1.846   1.00 0.00 ? 37 LEU A HD23 9  
ATOM 5328  N N    . MET A 1 35 ? -0.511  -20.085 -1.998  1.00 0.00 ? 38 MET A N    9  
ATOM 5329  C CA   . MET A 1 35 ? -0.273  -21.039 -3.081  1.00 0.00 ? 38 MET A CA   9  
ATOM 5330  C C    . MET A 1 35 ? -0.758  -22.446 -2.720  1.00 0.00 ? 38 MET A C    9  
ATOM 5331  O O    . MET A 1 35 ? -1.028  -23.265 -3.599  1.00 0.00 ? 38 MET A O    9  
ATOM 5332  C CB   . MET A 1 35 ? 1.218   -21.066 -3.430  1.00 0.00 ? 38 MET A CB   9  
ATOM 5333  C CG   . MET A 1 35 ? 1.514   -20.766 -4.890  1.00 0.00 ? 38 MET A CG   9  
ATOM 5334  S SD   . MET A 1 35 ? 1.559   -22.251 -5.912  1.00 0.00 ? 38 MET A SD   9  
ATOM 5335  C CE   . MET A 1 35 ? 0.184   -21.941 -7.016  1.00 0.00 ? 38 MET A CE   9  
ATOM 5336  H H    . MET A 1 35 ? 0.247   -19.597 -1.626  1.00 0.00 ? 38 MET A H    9  
ATOM 5337  H HA   . MET A 1 35 ? -0.826  -20.704 -3.933  1.00 0.00 ? 38 MET A HA   9  
ATOM 5338  H HB2  . MET A 1 35 ? 1.730   -20.333 -2.825  1.00 0.00 ? 38 MET A HB2  9  
ATOM 5339  H HB3  . MET A 1 35 ? 1.610   -22.041 -3.196  1.00 0.00 ? 38 MET A HB3  9  
ATOM 5340  H HG2  . MET A 1 35 ? 0.747   -20.108 -5.272  1.00 0.00 ? 38 MET A HG2  9  
ATOM 5341  H HG3  . MET A 1 35 ? 2.473   -20.272 -4.955  1.00 0.00 ? 38 MET A HG3  9  
ATOM 5342  H HE1  . MET A 1 35 ? -0.744  -22.073 -6.480  1.00 0.00 ? 38 MET A HE1  9  
ATOM 5343  H HE2  . MET A 1 35 ? 0.224   -22.634 -7.843  1.00 0.00 ? 38 MET A HE2  9  
ATOM 5344  H HE3  . MET A 1 35 ? 0.244   -20.929 -7.390  1.00 0.00 ? 38 MET A HE3  9  
ATOM 5345  N N    . ALA A 1 36 ? -0.871  -22.710 -1.425  1.00 0.00 ? 39 ALA A N    9  
ATOM 5346  C CA   . ALA A 1 36 ? -1.329  -24.005 -0.929  1.00 0.00 ? 39 ALA A CA   9  
ATOM 5347  C C    . ALA A 1 36 ? -2.535  -23.845 0.007   1.00 0.00 ? 39 ALA A C    9  
ATOM 5348  O O    . ALA A 1 36 ? -2.620  -24.497 1.049   1.00 0.00 ? 39 ALA A O    9  
ATOM 5349  C CB   . ALA A 1 36 ? -0.183  -24.720 -0.223  1.00 0.00 ? 39 ALA A CB   9  
ATOM 5350  H H    . ALA A 1 36 ? -0.647  -22.010 -0.785  1.00 0.00 ? 39 ALA A H    9  
ATOM 5351  H HA   . ALA A 1 36 ? -1.626  -24.603 -1.780  1.00 0.00 ? 39 ALA A HA   9  
ATOM 5352  H HB1  . ALA A 1 36 ? 0.336   -24.021 0.417   1.00 0.00 ? 39 ALA A HB1  9  
ATOM 5353  H HB2  . ALA A 1 36 ? 0.503   -25.114 -0.958  1.00 0.00 ? 39 ALA A HB2  9  
ATOM 5354  H HB3  . ALA A 1 36 ? -0.576  -25.530 0.373   1.00 0.00 ? 39 ALA A HB3  9  
ATOM 5355  N N    . GLN A 1 37 ? -3.462  -22.963 -0.372  1.00 0.00 ? 40 GLN A N    9  
ATOM 5356  C CA   . GLN A 1 37 ? -4.661  -22.708 0.433   1.00 0.00 ? 40 GLN A CA   9  
ATOM 5357  C C    . GLN A 1 37 ? -5.664  -23.864 0.344   1.00 0.00 ? 40 GLN A C    9  
ATOM 5358  O O    . GLN A 1 37 ? -6.281  -24.233 1.346   1.00 0.00 ? 40 GLN A O    9  
ATOM 5359  C CB   . GLN A 1 37 ? -5.331  -21.403 -0.008  1.00 0.00 ? 40 GLN A CB   9  
ATOM 5360  C CG   . GLN A 1 37 ? -6.304  -20.839 1.021   1.00 0.00 ? 40 GLN A CG   9  
ATOM 5361  C CD   . GLN A 1 37 ? -7.757  -21.096 0.664   1.00 0.00 ? 40 GLN A CD   9  
ATOM 5362  O OE1  . GLN A 1 37 ? -8.414  -20.257 0.054   1.00 0.00 ? 40 GLN A OE1  9  
ATOM 5363  N NE2  . GLN A 1 37 ? -8.268  -22.259 1.043   1.00 0.00 ? 40 GLN A NE2  9  
ATOM 5364  H H    . GLN A 1 37 ? -3.335  -22.466 -1.209  1.00 0.00 ? 40 GLN A H    9  
ATOM 5365  H HA   . GLN A 1 37 ? -4.348  -22.608 1.462   1.00 0.00 ? 40 GLN A HA   9  
ATOM 5366  H HB2  . GLN A 1 37 ? -4.564  -20.663 -0.190  1.00 0.00 ? 40 GLN A HB2  9  
ATOM 5367  H HB3  . GLN A 1 37 ? -5.872  -21.581 -0.926  1.00 0.00 ? 40 GLN A HB3  9  
ATOM 5368  H HG2  . GLN A 1 37 ? -6.102  -21.294 1.978   1.00 0.00 ? 40 GLN A HG2  9  
ATOM 5369  H HG3  . GLN A 1 37 ? -6.152  -19.772 1.094   1.00 0.00 ? 40 GLN A HG3  9  
ATOM 5370  H HE21 . GLN A 1 37 ? -7.689  -22.887 1.528   1.00 0.00 ? 40 GLN A HE21 9  
ATOM 5371  H HE22 . GLN A 1 37 ? -9.203  -22.443 0.821   1.00 0.00 ? 40 GLN A HE22 9  
ATOM 5372  N N    . ILE A 1 38 ? -5.831  -24.422 -0.856  1.00 0.00 ? 41 ILE A N    9  
ATOM 5373  C CA   . ILE A 1 38 ? -6.764  -25.527 -1.075  1.00 0.00 ? 41 ILE A CA   9  
ATOM 5374  C C    . ILE A 1 38 ? -6.564  -26.160 -2.457  1.00 0.00 ? 41 ILE A C    9  
ATOM 5375  O O    . ILE A 1 38 ? -6.107  -25.445 -3.378  1.00 0.00 ? 41 ILE A O    9  
ATOM 5376  C CB   . ILE A 1 38 ? -8.234  -25.063 -0.921  1.00 0.00 ? 41 ILE A CB   9  
ATOM 5377  C CG1  . ILE A 1 38 ? -9.189  -26.255 -1.009  1.00 0.00 ? 41 ILE A CG1  9  
ATOM 5378  C CG2  . ILE A 1 38 ? -8.586  -24.018 -1.973  1.00 0.00 ? 41 ILE A CG2  9  
ATOM 5379  C CD1  . ILE A 1 38 ? -10.548 -25.990 -0.398  1.00 0.00 ? 41 ILE A CD1  9  
ATOM 5380  O OXT  . ILE A 1 38 ? -6.860  -27.365 -2.605  1.00 0.00 ? 41 ILE A OXT  9  
ATOM 5381  H H    . ILE A 1 38 ? -5.320  -24.079 -1.618  1.00 0.00 ? 41 ILE A H    9  
ATOM 5382  H HA   . ILE A 1 38 ? -6.569  -26.277 -0.322  1.00 0.00 ? 41 ILE A HA   9  
ATOM 5383  H HB   . ILE A 1 38 ? -8.338  -24.603 0.051   1.00 0.00 ? 41 ILE A HB   9  
ATOM 5384  H HG12 . ILE A 1 38 ? -9.339  -26.511 -2.048  1.00 0.00 ? 41 ILE A HG12 9  
ATOM 5385  H HG13 . ILE A 1 38 ? -8.751  -27.099 -0.497  1.00 0.00 ? 41 ILE A HG13 9  
ATOM 5386  H HG21 . ILE A 1 38 ? -8.122  -23.078 -1.716  1.00 0.00 ? 41 ILE A HG21 9  
ATOM 5387  H HG22 . ILE A 1 38 ? -9.658  -23.893 -2.010  1.00 0.00 ? 41 ILE A HG22 9  
ATOM 5388  H HG23 . ILE A 1 38 ? -8.228  -24.346 -2.938  1.00 0.00 ? 41 ILE A HG23 9  
ATOM 5389  H HD11 . ILE A 1 38 ? -10.439 -25.829 0.664   1.00 0.00 ? 41 ILE A HD11 9  
ATOM 5390  H HD12 . ILE A 1 38 ? -11.193 -26.838 -0.569  1.00 0.00 ? 41 ILE A HD12 9  
ATOM 5391  H HD13 . ILE A 1 38 ? -10.981 -25.111 -0.852  1.00 0.00 ? 41 ILE A HD13 9  
ATOM 5392  N N    . PHE A 1 1  ? -20.944 10.074  -4.232  1.00 0.00 ? 4  PHE A N    10 
ATOM 5393  C CA   . PHE A 1 1  ? -20.092 9.011   -4.843  1.00 0.00 ? 4  PHE A CA   10 
ATOM 5394  C C    . PHE A 1 1  ? -18.863 9.614   -5.528  1.00 0.00 ? 4  PHE A C    10 
ATOM 5395  O O    . PHE A 1 1  ? -18.856 10.802  -5.859  1.00 0.00 ? 4  PHE A O    10 
ATOM 5396  C CB   . PHE A 1 1  ? -20.934 8.228   -5.860  1.00 0.00 ? 4  PHE A CB   10 
ATOM 5397  C CG   . PHE A 1 1  ? -20.305 6.933   -6.294  1.00 0.00 ? 4  PHE A CG   10 
ATOM 5398  C CD1  . PHE A 1 1  ? -20.389 5.804   -5.496  1.00 0.00 ? 4  PHE A CD1  10 
ATOM 5399  C CD2  . PHE A 1 1  ? -19.629 6.848   -7.501  1.00 0.00 ? 4  PHE A CD2  10 
ATOM 5400  C CE1  . PHE A 1 1  ? -19.810 4.614   -5.891  1.00 0.00 ? 4  PHE A CE1  10 
ATOM 5401  C CE2  . PHE A 1 1  ? -19.048 5.660   -7.902  1.00 0.00 ? 4  PHE A CE2  10 
ATOM 5402  C CZ   . PHE A 1 1  ? -19.138 4.541   -7.097  1.00 0.00 ? 4  PHE A CZ   10 
ATOM 5403  H H1   . PHE A 1 1  ? -20.536 10.315  -3.306  1.00 0.00 ? 4  PHE A H1   10 
ATOM 5404  H H2   . PHE A 1 1  ? -21.908 9.693   -4.128  1.00 0.00 ? 4  PHE A H2   10 
ATOM 5405  H H3   . PHE A 1 1  ? -20.931 10.898  -4.869  1.00 0.00 ? 4  PHE A H3   10 
ATOM 5406  H HA   . PHE A 1 1  ? -19.763 8.341   -4.062  1.00 0.00 ? 4  PHE A HA   10 
ATOM 5407  H HB2  . PHE A 1 1  ? -21.895 7.996   -5.423  1.00 0.00 ? 4  PHE A HB2  10 
ATOM 5408  H HB3  . PHE A 1 1  ? -21.083 8.837   -6.740  1.00 0.00 ? 4  PHE A HB3  10 
ATOM 5409  H HD1  . PHE A 1 1  ? -20.915 5.859   -4.554  1.00 0.00 ? 4  PHE A HD1  10 
ATOM 5410  H HD2  . PHE A 1 1  ? -19.557 7.722   -8.131  1.00 0.00 ? 4  PHE A HD2  10 
ATOM 5411  H HE1  . PHE A 1 1  ? -19.882 3.740   -5.260  1.00 0.00 ? 4  PHE A HE1  10 
ATOM 5412  H HE2  . PHE A 1 1  ? -18.523 5.606   -8.845  1.00 0.00 ? 4  PHE A HE2  10 
ATOM 5413  H HZ   . PHE A 1 1  ? -18.685 3.612   -7.408  1.00 0.00 ? 4  PHE A HZ   10 
ATOM 5414  N N    . THR A 1 2  ? -17.832 8.789   -5.741  1.00 0.00 ? 5  THR A N    10 
ATOM 5415  C CA   . THR A 1 2  ? -16.588 9.229   -6.395  1.00 0.00 ? 5  THR A CA   10 
ATOM 5416  C C    . THR A 1 2  ? -16.044 10.523  -5.782  1.00 0.00 ? 5  THR A C    10 
ATOM 5417  O O    . THR A 1 2  ? -16.129 11.594  -6.386  1.00 0.00 ? 5  THR A O    10 
ATOM 5418  C CB   . THR A 1 2  ? -16.796 9.411   -7.909  1.00 0.00 ? 5  THR A CB   10 
ATOM 5419  O OG1  . THR A 1 2  ? -18.105 9.868   -8.200  1.00 0.00 ? 5  THR A OG1  10 
ATOM 5420  C CG2  . THR A 1 2  ? -16.577 8.142   -8.698  1.00 0.00 ? 5  THR A CG2  10 
ATOM 5421  H H    . THR A 1 2  ? -17.908 7.853   -5.457  1.00 0.00 ? 5  THR A H    10 
ATOM 5422  H HA   . THR A 1 2  ? -15.854 8.452   -6.244  1.00 0.00 ? 5  THR A HA   10 
ATOM 5423  H HB   . THR A 1 2  ? -16.092 10.149  -8.270  1.00 0.00 ? 5  THR A HB   10 
ATOM 5424  H HG1  . THR A 1 2  ? -18.285 10.675  -7.700  1.00 0.00 ? 5  THR A HG1  10 
ATOM 5425  H HG21 . THR A 1 2  ? -16.993 7.305   -8.158  1.00 0.00 ? 5  THR A HG21 10 
ATOM 5426  H HG22 . THR A 1 2  ? -15.518 7.986   -8.844  1.00 0.00 ? 5  THR A HG22 10 
ATOM 5427  H HG23 . THR A 1 2  ? -17.064 8.228   -9.658  1.00 0.00 ? 5  THR A HG23 10 
ATOM 5428  N N    . LEU A 1 3  ? -15.474 10.412  -4.583  1.00 0.00 ? 6  LEU A N    10 
ATOM 5429  C CA   . LEU A 1 3  ? -14.905 11.566  -3.888  1.00 0.00 ? 6  LEU A CA   10 
ATOM 5430  C C    . LEU A 1 3  ? -13.563 11.206  -3.245  1.00 0.00 ? 6  LEU A C    10 
ATOM 5431  O O    . LEU A 1 3  ? -13.497 10.356  -2.357  1.00 0.00 ? 6  LEU A O    10 
ATOM 5432  C CB   . LEU A 1 3  ? -15.882 12.088  -2.825  1.00 0.00 ? 6  LEU A CB   10 
ATOM 5433  C CG   . LEU A 1 3  ? -16.460 11.026  -1.886  1.00 0.00 ? 6  LEU A CG   10 
ATOM 5434  C CD1  . LEU A 1 3  ? -16.202 11.398  -0.436  1.00 0.00 ? 6  LEU A CD1  10 
ATOM 5435  C CD2  . LEU A 1 3  ? -17.949 10.851  -2.133  1.00 0.00 ? 6  LEU A CD2  10 
ATOM 5436  H H    . LEU A 1 3  ? -15.430 9.531   -4.157  1.00 0.00 ? 6  LEU A H    10 
ATOM 5437  H HA   . LEU A 1 3  ? -14.739 12.343  -4.620  1.00 0.00 ? 6  LEU A HA   10 
ATOM 5438  H HB2  . LEU A 1 3  ? -15.366 12.826  -2.226  1.00 0.00 ? 6  LEU A HB2  10 
ATOM 5439  H HB3  . LEU A 1 3  ? -16.703 12.574  -3.331  1.00 0.00 ? 6  LEU A HB3  10 
ATOM 5440  H HG   . LEU A 1 3  ? -15.973 10.079  -2.078  1.00 0.00 ? 6  LEU A HG   10 
ATOM 5441  H HD11 . LEU A 1 3  ? -15.141 11.362  -0.238  1.00 0.00 ? 6  LEU A HD11 10 
ATOM 5442  H HD12 . LEU A 1 3  ? -16.713 10.702  0.211   1.00 0.00 ? 6  LEU A HD12 10 
ATOM 5443  H HD13 . LEU A 1 3  ? -16.569 12.397  -0.250  1.00 0.00 ? 6  LEU A HD13 10 
ATOM 5444  H HD21 . LEU A 1 3  ? -18.254 9.867   -1.812  1.00 0.00 ? 6  LEU A HD21 10 
ATOM 5445  H HD22 . LEU A 1 3  ? -18.154 10.967  -3.186  1.00 0.00 ? 6  LEU A HD22 10 
ATOM 5446  H HD23 . LEU A 1 3  ? -18.495 11.598  -1.575  1.00 0.00 ? 6  LEU A HD23 10 
ATOM 5447  N N    . SER A 1 4  ? -12.492 11.850  -3.708  1.00 0.00 ? 7  SER A N    10 
ATOM 5448  C CA   . SER A 1 4  ? -11.148 11.586  -3.180  1.00 0.00 ? 7  SER A CA   10 
ATOM 5449  C C    . SER A 1 4  ? -10.766 12.536  -2.041  1.00 0.00 ? 7  SER A C    10 
ATOM 5450  O O    . SER A 1 4  ? -9.706  12.378  -1.435  1.00 0.00 ? 7  SER A O    10 
ATOM 5451  C CB   . SER A 1 4  ? -10.109 11.686  -4.300  1.00 0.00 ? 7  SER A CB   10 
ATOM 5452  O OG   . SER A 1 4  ? -10.057 13.002  -4.831  1.00 0.00 ? 7  SER A OG   10 
ATOM 5453  H H    . SER A 1 4  ? -12.600 12.512  -4.424  1.00 0.00 ? 7  SER A H    10 
ATOM 5454  H HA   . SER A 1 4  ? -11.144 10.581  -2.795  1.00 0.00 ? 7  SER A HA   10 
ATOM 5455  H HB2  . SER A 1 4  ? -9.136  11.427  -3.908  1.00 0.00 ? 7  SER A HB2  10 
ATOM 5456  H HB3  . SER A 1 4  ? -10.372 10.999  -5.094  1.00 0.00 ? 7  SER A HB3  10 
ATOM 5457  H HG   . SER A 1 4  ? -9.272  13.099  -5.378  1.00 0.00 ? 7  SER A HG   10 
ATOM 5458  N N    . LEU A 1 5  ? -11.624 13.517  -1.751  1.00 0.00 ? 8  LEU A N    10 
ATOM 5459  C CA   . LEU A 1 5  ? -11.363 14.488  -0.682  1.00 0.00 ? 8  LEU A CA   10 
ATOM 5460  C C    . LEU A 1 5  ? -10.019 15.202  -0.890  1.00 0.00 ? 8  LEU A C    10 
ATOM 5461  O O    . LEU A 1 5  ? -9.267  15.419  0.064   1.00 0.00 ? 8  LEU A O    10 
ATOM 5462  C CB   . LEU A 1 5  ? -11.390 13.787  0.685   1.00 0.00 ? 8  LEU A CB   10 
ATOM 5463  C CG   . LEU A 1 5  ? -12.486 14.261  1.642   1.00 0.00 ? 8  LEU A CG   10 
ATOM 5464  C CD1  . LEU A 1 5  ? -12.513 13.394  2.889   1.00 0.00 ? 8  LEU A CD1  10 
ATOM 5465  C CD2  . LEU A 1 5  ? -12.277 15.719  2.015   1.00 0.00 ? 8  LEU A CD2  10 
ATOM 5466  H H    . LEU A 1 5  ? -12.450 13.591  -2.266  1.00 0.00 ? 8  LEU A H    10 
ATOM 5467  H HA   . LEU A 1 5  ? -12.149 15.226  -0.711  1.00 0.00 ? 8  LEU A HA   10 
ATOM 5468  H HB2  . LEU A 1 5  ? -11.518 12.728  0.519   1.00 0.00 ? 8  LEU A HB2  10 
ATOM 5469  H HB3  . LEU A 1 5  ? -10.435 13.942  1.165   1.00 0.00 ? 8  LEU A HB3  10 
ATOM 5470  H HG   . LEU A 1 5  ? -13.446 14.172  1.153   1.00 0.00 ? 8  LEU A HG   10 
ATOM 5471  H HD11 . LEU A 1 5  ? -13.014 13.924  3.685   1.00 0.00 ? 8  LEU A HD11 10 
ATOM 5472  H HD12 . LEU A 1 5  ? -11.500 13.167  3.191   1.00 0.00 ? 8  LEU A HD12 10 
ATOM 5473  H HD13 . LEU A 1 5  ? -13.040 12.476  2.679   1.00 0.00 ? 8  LEU A HD13 10 
ATOM 5474  H HD21 . LEU A 1 5  ? -11.224 15.904  2.169   1.00 0.00 ? 8  LEU A HD21 10 
ATOM 5475  H HD22 . LEU A 1 5  ? -12.818 15.940  2.924   1.00 0.00 ? 8  LEU A HD22 10 
ATOM 5476  H HD23 . LEU A 1 5  ? -12.641 16.351  1.218   1.00 0.00 ? 8  LEU A HD23 10 
ATOM 5477  N N    . ASP A 1 6  ? -9.735  15.569  -2.145  1.00 0.00 ? 9  ASP A N    10 
ATOM 5478  C CA   . ASP A 1 6  ? -8.497  16.263  -2.504  1.00 0.00 ? 9  ASP A CA   10 
ATOM 5479  C C    . ASP A 1 6  ? -7.271  15.607  -1.848  1.00 0.00 ? 9  ASP A C    10 
ATOM 5480  O O    . ASP A 1 6  ? -6.761  16.081  -0.831  1.00 0.00 ? 9  ASP A O    10 
ATOM 5481  C CB   . ASP A 1 6  ? -8.608  17.739  -2.116  1.00 0.00 ? 9  ASP A CB   10 
ATOM 5482  C CG   . ASP A 1 6  ? -7.498  18.592  -2.698  1.00 0.00 ? 9  ASP A CG   10 
ATOM 5483  O OD1  . ASP A 1 6  ? -7.107  18.351  -3.861  1.00 0.00 ? 9  ASP A OD1  10 
ATOM 5484  O OD2  . ASP A 1 6  ? -7.024  19.505  -1.994  1.00 0.00 ? 9  ASP A OD2  10 
ATOM 5485  H H    . ASP A 1 6  ? -10.381 15.375  -2.848  1.00 0.00 ? 9  ASP A H    10 
ATOM 5486  H HA   . ASP A 1 6  ? -8.384  16.195  -3.577  1.00 0.00 ? 9  ASP A HA   10 
ATOM 5487  H HB2  . ASP A 1 6  ? -9.551  18.125  -2.471  1.00 0.00 ? 9  ASP A HB2  10 
ATOM 5488  H HB3  . ASP A 1 6  ? -8.578  17.818  -1.043  1.00 0.00 ? 9  ASP A HB3  10 
ATOM 5489  N N    . VAL A 1 7  ? -6.812  14.504  -2.442  1.00 0.00 ? 10 VAL A N    10 
ATOM 5490  C CA   . VAL A 1 7  ? -5.656  13.763  -1.925  1.00 0.00 ? 10 VAL A CA   10 
ATOM 5491  C C    . VAL A 1 7  ? -4.369  14.598  -1.991  1.00 0.00 ? 10 VAL A C    10 
ATOM 5492  O O    . VAL A 1 7  ? -3.831  14.841  -3.074  1.00 0.00 ? 10 VAL A O    10 
ATOM 5493  C CB   . VAL A 1 7  ? -5.440  12.441  -2.696  1.00 0.00 ? 10 VAL A CB   10 
ATOM 5494  C CG1  . VAL A 1 7  ? -4.298  11.638  -2.091  1.00 0.00 ? 10 VAL A CG1  10 
ATOM 5495  C CG2  . VAL A 1 7  ? -6.719  11.614  -2.716  1.00 0.00 ? 10 VAL A CG2  10 
ATOM 5496  H H    . VAL A 1 7  ? -7.265  14.176  -3.245  1.00 0.00 ? 10 VAL A H    10 
ATOM 5497  H HA   . VAL A 1 7  ? -5.858  13.520  -0.892  1.00 0.00 ? 10 VAL A HA   10 
ATOM 5498  H HB   . VAL A 1 7  ? -5.179  12.683  -3.717  1.00 0.00 ? 10 VAL A HB   10 
ATOM 5499  H HG11 . VAL A 1 7  ? -3.774  11.111  -2.874  1.00 0.00 ? 10 VAL A HG11 10 
ATOM 5500  H HG12 . VAL A 1 7  ? -4.697  10.925  -1.384  1.00 0.00 ? 10 VAL A HG12 10 
ATOM 5501  H HG13 . VAL A 1 7  ? -3.615  12.304  -1.585  1.00 0.00 ? 10 VAL A HG13 10 
ATOM 5502  H HG21 . VAL A 1 7  ? -7.473  12.099  -2.114  1.00 0.00 ? 10 VAL A HG21 10 
ATOM 5503  H HG22 . VAL A 1 7  ? -6.518  10.630  -2.316  1.00 0.00 ? 10 VAL A HG22 10 
ATOM 5504  H HG23 . VAL A 1 7  ? -7.073  11.523  -3.732  1.00 0.00 ? 10 VAL A HG23 10 
ATOM 5505  N N    . PRO A 1 8  ? -3.856  15.046  -0.825  1.00 0.00 ? 11 PRO A N    10 
ATOM 5506  C CA   . PRO A 1 8  ? -2.632  15.852  -0.751  1.00 0.00 ? 11 PRO A CA   10 
ATOM 5507  C C    . PRO A 1 8  ? -1.354  15.011  -0.841  1.00 0.00 ? 11 PRO A C    10 
ATOM 5508  O O    . PRO A 1 8  ? -1.364  13.809  -0.557  1.00 0.00 ? 11 PRO A O    10 
ATOM 5509  C CB   . PRO A 1 8  ? -2.749  16.507  0.623   1.00 0.00 ? 11 PRO A CB   10 
ATOM 5510  C CG   . PRO A 1 8  ? -3.476  15.501  1.448   1.00 0.00 ? 11 PRO A CG   10 
ATOM 5511  C CD   . PRO A 1 8  ? -4.434  14.804  0.515   1.00 0.00 ? 11 PRO A CD   10 
ATOM 5512  H HA   . PRO A 1 8  ? -2.615  16.615  -1.516  1.00 0.00 ? 11 PRO A HA   10 
ATOM 5513  H HB2  . PRO A 1 8  ? -1.763  16.709  1.017   1.00 0.00 ? 11 PRO A HB2  10 
ATOM 5514  H HB3  . PRO A 1 8  ? -3.308  17.427  0.540   1.00 0.00 ? 11 PRO A HB3  10 
ATOM 5515  H HG2  . PRO A 1 8  ? -2.776  14.792  1.864   1.00 0.00 ? 11 PRO A HG2  10 
ATOM 5516  H HG3  . PRO A 1 8  ? -4.019  15.999  2.237   1.00 0.00 ? 11 PRO A HG3  10 
ATOM 5517  H HD2  . PRO A 1 8  ? -4.471  13.746  0.733   1.00 0.00 ? 11 PRO A HD2  10 
ATOM 5518  H HD3  . PRO A 1 8  ? -5.419  15.241  0.593   1.00 0.00 ? 11 PRO A HD3  10 
ATOM 5519  N N    . THR A 1 9  ? -0.253  15.654  -1.230  1.00 0.00 ? 12 THR A N    10 
ATOM 5520  C CA   . THR A 1 9  ? 1.044   14.977  -1.358  1.00 0.00 ? 12 THR A CA   10 
ATOM 5521  C C    . THR A 1 9  ? 1.391   14.182  -0.098  1.00 0.00 ? 12 THR A C    10 
ATOM 5522  O O    . THR A 1 9  ? 1.823   13.030  -0.186  1.00 0.00 ? 12 THR A O    10 
ATOM 5523  C CB   . THR A 1 9  ? 2.155   15.993  -1.652  1.00 0.00 ? 12 THR A CB   10 
ATOM 5524  O OG1  . THR A 1 9  ? 1.623   17.298  -1.795  1.00 0.00 ? 12 THR A OG1  10 
ATOM 5525  C CG2  . THR A 1 9  ? 2.934   15.682  -2.911  1.00 0.00 ? 12 THR A CG2  10 
ATOM 5526  H H    . THR A 1 9  ? -0.307  16.612  -1.436  1.00 0.00 ? 12 THR A H    10 
ATOM 5527  H HA   . THR A 1 9  ? 0.974   14.289  -2.188  1.00 0.00 ? 12 THR A HA   10 
ATOM 5528  H HB   . THR A 1 9  ? 2.852   15.999  -0.826  1.00 0.00 ? 12 THR A HB   10 
ATOM 5529  H HG1  . THR A 1 9  ? 2.341   17.932  -1.884  1.00 0.00 ? 12 THR A HG1  10 
ATOM 5530  H HG21 . THR A 1 9  ? 2.979   14.613  -3.054  1.00 0.00 ? 12 THR A HG21 10 
ATOM 5531  H HG22 . THR A 1 9  ? 3.936   16.076  -2.822  1.00 0.00 ? 12 THR A HG22 10 
ATOM 5532  H HG23 . THR A 1 9  ? 2.443   16.138  -3.759  1.00 0.00 ? 12 THR A HG23 10 
ATOM 5533  N N    . ASN A 1 10 ? 1.198   14.801  1.073   1.00 0.00 ? 13 ASN A N    10 
ATOM 5534  C CA   . ASN A 1 10 ? 1.490   14.147  2.355   1.00 0.00 ? 13 ASN A CA   10 
ATOM 5535  C C    . ASN A 1 10 ? 0.754   12.822  2.490   1.00 0.00 ? 13 ASN A C    10 
ATOM 5536  O O    . ASN A 1 10 ? 1.255   11.872  3.091   1.00 0.00 ? 13 ASN A O    10 
ATOM 5537  C CB   . ASN A 1 10 ? 1.136   15.071  3.528   1.00 0.00 ? 13 ASN A CB   10 
ATOM 5538  C CG   . ASN A 1 10 ? 1.838   16.412  3.446   1.00 0.00 ? 13 ASN A CG   10 
ATOM 5539  O OD1  . ASN A 1 10 ? 1.573   17.204  2.547   1.00 0.00 ? 13 ASN A OD1  10 
ATOM 5540  N ND2  . ASN A 1 10 ? 2.739   16.672  4.380   1.00 0.00 ? 13 ASN A ND2  10 
ATOM 5541  H H    . ASN A 1 10 ? 0.851   15.719  1.074   1.00 0.00 ? 13 ASN A H    10 
ATOM 5542  H HA   . ASN A 1 10 ? 2.529   13.940  2.376   1.00 0.00 ? 13 ASN A HA   10 
ATOM 5543  H HB2  . ASN A 1 10 ? 0.071   15.246  3.532   1.00 0.00 ? 13 ASN A HB2  10 
ATOM 5544  H HB3  . ASN A 1 10 ? 1.420   14.592  4.454   1.00 0.00 ? 13 ASN A HB3  10 
ATOM 5545  H HD21 . ASN A 1 10 ? 2.905   15.995  5.069   1.00 0.00 ? 13 ASN A HD21 10 
ATOM 5546  H HD22 . ASN A 1 10 ? 3.201   17.534  4.344   1.00 0.00 ? 13 ASN A HD22 10 
ATOM 5547  N N    . ILE A 1 11 ? -0.423  12.774  1.904   1.00 0.00 ? 14 ILE A N    10 
ATOM 5548  C CA   . ILE A 1 11 ? -1.254  11.582  1.913   1.00 0.00 ? 14 ILE A CA   10 
ATOM 5549  C C    . ILE A 1 11 ? -0.895  10.685  0.728   1.00 0.00 ? 14 ILE A C    10 
ATOM 5550  O O    . ILE A 1 11 ? -0.710  9.477   0.889   1.00 0.00 ? 14 ILE A O    10 
ATOM 5551  C CB   . ILE A 1 11 ? -2.741  11.980  1.869   1.00 0.00 ? 14 ILE A CB   10 
ATOM 5552  C CG1  . ILE A 1 11 ? -3.277  12.186  3.287   1.00 0.00 ? 14 ILE A CG1  10 
ATOM 5553  C CG2  . ILE A 1 11 ? -3.579  10.942  1.131   1.00 0.00 ? 14 ILE A CG2  10 
ATOM 5554  C CD1  . ILE A 1 11 ? -4.652  12.819  3.330   1.00 0.00 ? 14 ILE A CD1  10 
ATOM 5555  H H    . ILE A 1 11 ? -0.737  13.569  1.432   1.00 0.00 ? 14 ILE A H    10 
ATOM 5556  H HA   . ILE A 1 11 ? -1.066  11.044  2.831   1.00 0.00 ? 14 ILE A HA   10 
ATOM 5557  H HB   . ILE A 1 11 ? -2.804  12.915  1.334   1.00 0.00 ? 14 ILE A HB   10 
ATOM 5558  H HG12 . ILE A 1 11 ? -3.341  11.229  3.783   1.00 0.00 ? 14 ILE A HG12 10 
ATOM 5559  H HG13 . ILE A 1 11 ? -2.600  12.825  3.833   1.00 0.00 ? 14 ILE A HG13 10 
ATOM 5560  H HG21 . ILE A 1 11 ? -3.371  9.961   1.530   1.00 0.00 ? 14 ILE A HG21 10 
ATOM 5561  H HG22 . ILE A 1 11 ? -3.334  10.963  0.080   1.00 0.00 ? 14 ILE A HG22 10 
ATOM 5562  H HG23 . ILE A 1 11 ? -4.627  11.170  1.262   1.00 0.00 ? 14 ILE A HG23 10 
ATOM 5563  H HD11 . ILE A 1 11 ? -5.124  12.592  4.274   1.00 0.00 ? 14 ILE A HD11 10 
ATOM 5564  H HD12 . ILE A 1 11 ? -5.254  12.427  2.523   1.00 0.00 ? 14 ILE A HD12 10 
ATOM 5565  H HD13 . ILE A 1 11 ? -4.559  13.889  3.223   1.00 0.00 ? 14 ILE A HD13 10 
ATOM 5566  N N    . MET A 1 12 ? -0.772  11.295  -0.457  1.00 0.00 ? 15 MET A N    10 
ATOM 5567  C CA   . MET A 1 12 ? -0.406  10.571  -1.667  1.00 0.00 ? 15 MET A CA   10 
ATOM 5568  C C    . MET A 1 12 ? 0.841   9.722   -1.425  1.00 0.00 ? 15 MET A C    10 
ATOM 5569  O O    . MET A 1 12 ? 0.842   8.518   -1.691  1.00 0.00 ? 15 MET A O    10 
ATOM 5570  C CB   . MET A 1 12 ? -0.160  11.565  -2.804  1.00 0.00 ? 15 MET A CB   10 
ATOM 5571  C CG   . MET A 1 12 ? -0.949  11.257  -4.061  1.00 0.00 ? 15 MET A CG   10 
ATOM 5572  S SD   . MET A 1 12 ? 0.106   10.759  -5.436  1.00 0.00 ? 15 MET A SD   10 
ATOM 5573  C CE   . MET A 1 12 ? -1.114  10.454  -6.711  1.00 0.00 ? 15 MET A CE   10 
ATOM 5574  H H    . MET A 1 12 ? -0.916  12.267  -0.516  1.00 0.00 ? 15 MET A H    10 
ATOM 5575  H HA   . MET A 1 12 ? -1.227  9.922   -1.932  1.00 0.00 ? 15 MET A HA   10 
ATOM 5576  H HB2  . MET A 1 12 ? -0.436  12.554  -2.467  1.00 0.00 ? 15 MET A HB2  10 
ATOM 5577  H HB3  . MET A 1 12 ? 0.890   11.561  -3.049  1.00 0.00 ? 15 MET A HB3  10 
ATOM 5578  H HG2  . MET A 1 12 ? -1.641  10.457  -3.846  1.00 0.00 ? 15 MET A HG2  10 
ATOM 5579  H HG3  . MET A 1 12 ? -1.498  12.141  -4.345  1.00 0.00 ? 15 MET A HG3  10 
ATOM 5580  H HE1  . MET A 1 12 ? -1.576  11.388  -6.998  1.00 0.00 ? 15 MET A HE1  10 
ATOM 5581  H HE2  . MET A 1 12 ? -1.868  9.780   -6.334  1.00 0.00 ? 15 MET A HE2  10 
ATOM 5582  H HE3  . MET A 1 12 ? -0.633  10.011  -7.570  1.00 0.00 ? 15 MET A HE3  10 
ATOM 5583  N N    . ASN A 1 13 ? 1.893   10.354  -0.892  1.00 0.00 ? 16 ASN A N    10 
ATOM 5584  C CA   . ASN A 1 13 ? 3.138   9.650   -0.588  1.00 0.00 ? 16 ASN A CA   10 
ATOM 5585  C C    . ASN A 1 13 ? 2.862   8.470   0.344   1.00 0.00 ? 16 ASN A C    10 
ATOM 5586  O O    . ASN A 1 13 ? 3.327   7.353   0.109   1.00 0.00 ? 16 ASN A O    10 
ATOM 5587  C CB   . ASN A 1 13 ? 4.156   10.606  0.047   1.00 0.00 ? 16 ASN A CB   10 
ATOM 5588  C CG   . ASN A 1 13 ? 5.338   10.886  -0.861  1.00 0.00 ? 16 ASN A CG   10 
ATOM 5589  O OD1  . ASN A 1 13 ? 5.687   10.076  -1.716  1.00 0.00 ? 16 ASN A OD1  10 
ATOM 5590  N ND2  . ASN A 1 13 ? 5.966   12.039  -0.682  1.00 0.00 ? 16 ASN A ND2  10 
ATOM 5591  H H    . ASN A 1 13 ? 1.823   11.314  -0.686  1.00 0.00 ? 16 ASN A H    10 
ATOM 5592  H HA   . ASN A 1 13 ? 3.536   9.271   -1.512  1.00 0.00 ? 16 ASN A HA   10 
ATOM 5593  H HB2  . ASN A 1 13 ? 3.671   11.542  0.272   1.00 0.00 ? 16 ASN A HB2  10 
ATOM 5594  H HB3  . ASN A 1 13 ? 4.528   10.170  0.964   1.00 0.00 ? 16 ASN A HB3  10 
ATOM 5595  H HD21 . ASN A 1 13 ? 5.640   12.641  0.017   1.00 0.00 ? 16 ASN A HD21 10 
ATOM 5596  H HD22 . ASN A 1 13 ? 6.733   12.238  -1.258  1.00 0.00 ? 16 ASN A HD22 10 
ATOM 5597  N N    . LEU A 1 14 ? 2.075   8.729   1.387   1.00 0.00 ? 17 LEU A N    10 
ATOM 5598  C CA   . LEU A 1 14 ? 1.701   7.693   2.347   1.00 0.00 ? 17 LEU A CA   10 
ATOM 5599  C C    . LEU A 1 14 ? 0.943   6.573   1.641   1.00 0.00 ? 17 LEU A C    10 
ATOM 5600  O O    . LEU A 1 14 ? 1.328   5.407   1.725   1.00 0.00 ? 17 LEU A O    10 
ATOM 5601  C CB   . LEU A 1 14 ? 0.844   8.287   3.472   1.00 0.00 ? 17 LEU A CB   10 
ATOM 5602  C CG   . LEU A 1 14 ? 1.608   9.104   4.513   1.00 0.00 ? 17 LEU A CG   10 
ATOM 5603  C CD1  . LEU A 1 14 ? 0.640   9.821   5.439   1.00 0.00 ? 17 LEU A CD1  10 
ATOM 5604  C CD2  . LEU A 1 14 ? 2.542   8.210   5.314   1.00 0.00 ? 17 LEU A CD2  10 
ATOM 5605  H H    . LEU A 1 14 ? 1.722   9.634   1.499   1.00 0.00 ? 17 LEU A H    10 
ATOM 5606  H HA   . LEU A 1 14 ? 2.608   7.286   2.768   1.00 0.00 ? 17 LEU A HA   10 
ATOM 5607  H HB2  . LEU A 1 14 ? 0.095   8.924   3.024   1.00 0.00 ? 17 LEU A HB2  10 
ATOM 5608  H HB3  . LEU A 1 14 ? 0.343   7.476   3.980   1.00 0.00 ? 17 LEU A HB3  10 
ATOM 5609  H HG   . LEU A 1 14 ? 2.205   9.851   4.011   1.00 0.00 ? 17 LEU A HG   10 
ATOM 5610  H HD11 . LEU A 1 14 ? -0.136  9.138   5.748   1.00 0.00 ? 17 LEU A HD11 10 
ATOM 5611  H HD12 . LEU A 1 14 ? 0.198   10.657  4.917   1.00 0.00 ? 17 LEU A HD12 10 
ATOM 5612  H HD13 . LEU A 1 14 ? 1.172   10.179  6.308   1.00 0.00 ? 17 LEU A HD13 10 
ATOM 5613  H HD21 . LEU A 1 14 ? 2.927   8.759   6.159   1.00 0.00 ? 17 LEU A HD21 10 
ATOM 5614  H HD22 . LEU A 1 14 ? 3.361   7.892   4.687   1.00 0.00 ? 17 LEU A HD22 10 
ATOM 5615  H HD23 . LEU A 1 14 ? 2.000   7.344   5.664   1.00 0.00 ? 17 LEU A HD23 10 
ATOM 5616  N N    . LEU A 1 15 ? -0.121  6.939   0.921   1.00 0.00 ? 18 LEU A N    10 
ATOM 5617  C CA   . LEU A 1 15 ? -0.914  5.960   0.174   1.00 0.00 ? 18 LEU A CA   10 
ATOM 5618  C C    . LEU A 1 15 ? -0.016  5.161   -0.768  1.00 0.00 ? 18 LEU A C    10 
ATOM 5619  O O    . LEU A 1 15 ? -0.068  3.927   -0.794  1.00 0.00 ? 18 LEU A O    10 
ATOM 5620  C CB   . LEU A 1 15 ? -2.024  6.658   -0.621  1.00 0.00 ? 18 LEU A CB   10 
ATOM 5621  C CG   . LEU A 1 15 ? -3.079  7.380   0.220   1.00 0.00 ? 18 LEU A CG   10 
ATOM 5622  C CD1  . LEU A 1 15 ? -3.910  8.304   -0.652  1.00 0.00 ? 18 LEU A CD1  10 
ATOM 5623  C CD2  . LEU A 1 15 ? -3.973  6.377   0.930   1.00 0.00 ? 18 LEU A CD2  10 
ATOM 5624  H H    . LEU A 1 15 ? -0.365  7.895   0.877   1.00 0.00 ? 18 LEU A H    10 
ATOM 5625  H HA   . LEU A 1 15 ? -1.357  5.278   0.883   1.00 0.00 ? 18 LEU A HA   10 
ATOM 5626  H HB2  . LEU A 1 15 ? -1.564  7.381   -1.279  1.00 0.00 ? 18 LEU A HB2  10 
ATOM 5627  H HB3  . LEU A 1 15 ? -2.525  5.917   -1.225  1.00 0.00 ? 18 LEU A HB3  10 
ATOM 5628  H HG   . LEU A 1 15 ? -2.584  7.981   0.970   1.00 0.00 ? 18 LEU A HG   10 
ATOM 5629  H HD11 . LEU A 1 15 ? -3.300  9.131   -0.984  1.00 0.00 ? 18 LEU A HD11 10 
ATOM 5630  H HD12 . LEU A 1 15 ? -4.746  8.681   -0.082  1.00 0.00 ? 18 LEU A HD12 10 
ATOM 5631  H HD13 . LEU A 1 15 ? -4.275  7.758   -1.509  1.00 0.00 ? 18 LEU A HD13 10 
ATOM 5632  H HD21 . LEU A 1 15 ? -3.390  5.814   1.642   1.00 0.00 ? 18 LEU A HD21 10 
ATOM 5633  H HD22 . LEU A 1 15 ? -4.406  5.704   0.205   1.00 0.00 ? 18 LEU A HD22 10 
ATOM 5634  H HD23 . LEU A 1 15 ? -4.762  6.904   1.448   1.00 0.00 ? 18 LEU A HD23 10 
ATOM 5635  N N    . PHE A 1 16 ? 0.822   5.876   -1.523  1.00 0.00 ? 19 PHE A N    10 
ATOM 5636  C CA   . PHE A 1 16 ? 1.755   5.244   -2.451  1.00 0.00 ? 19 PHE A CA   10 
ATOM 5637  C C    . PHE A 1 16 ? 2.655   4.255   -1.712  1.00 0.00 ? 19 PHE A C    10 
ATOM 5638  O O    . PHE A 1 16 ? 2.898   3.151   -2.195  1.00 0.00 ? 19 PHE A O    10 
ATOM 5639  C CB   . PHE A 1 16 ? 2.606   6.307   -3.157  1.00 0.00 ? 19 PHE A CB   10 
ATOM 5640  C CG   . PHE A 1 16 ? 2.661   6.137   -4.649  1.00 0.00 ? 19 PHE A CG   10 
ATOM 5641  C CD1  . PHE A 1 16 ? 3.518   5.212   -5.222  1.00 0.00 ? 19 PHE A CD1  10 
ATOM 5642  C CD2  . PHE A 1 16 ? 1.854   6.901   -5.476  1.00 0.00 ? 19 PHE A CD2  10 
ATOM 5643  C CE1  . PHE A 1 16 ? 3.571   5.053   -6.594  1.00 0.00 ? 19 PHE A CE1  10 
ATOM 5644  C CE2  . PHE A 1 16 ? 1.901   6.746   -6.848  1.00 0.00 ? 19 PHE A CE2  10 
ATOM 5645  C CZ   . PHE A 1 16 ? 2.761   5.820   -7.408  1.00 0.00 ? 19 PHE A CZ   10 
ATOM 5646  H H    . PHE A 1 16 ? 0.822   6.858   -1.439  1.00 0.00 ? 19 PHE A H    10 
ATOM 5647  H HA   . PHE A 1 16 ? 1.178   4.705   -3.188  1.00 0.00 ? 19 PHE A HA   10 
ATOM 5648  H HB2  . PHE A 1 16 ? 2.195   7.284   -2.951  1.00 0.00 ? 19 PHE A HB2  10 
ATOM 5649  H HB3  . PHE A 1 16 ? 3.617   6.262   -2.779  1.00 0.00 ? 19 PHE A HB3  10 
ATOM 5650  H HD1  . PHE A 1 16 ? 4.151   4.611   -4.586  1.00 0.00 ? 19 PHE A HD1  10 
ATOM 5651  H HD2  . PHE A 1 16 ? 1.181   7.625   -5.040  1.00 0.00 ? 19 PHE A HD2  10 
ATOM 5652  H HE1  . PHE A 1 16 ? 4.244   4.328   -7.029  1.00 0.00 ? 19 PHE A HE1  10 
ATOM 5653  H HE2  . PHE A 1 16 ? 1.267   7.348   -7.484  1.00 0.00 ? 19 PHE A HE2  10 
ATOM 5654  H HZ   . PHE A 1 16 ? 2.800   5.697   -8.481  1.00 0.00 ? 19 PHE A HZ   10 
ATOM 5655  N N    . ASN A 1 17 ? 3.129   4.655   -0.527  1.00 0.00 ? 20 ASN A N    10 
ATOM 5656  C CA   . ASN A 1 17 ? 3.985   3.807   0.291   1.00 0.00 ? 20 ASN A CA   10 
ATOM 5657  C C    . ASN A 1 17 ? 3.186   2.646   0.878   1.00 0.00 ? 20 ASN A C    10 
ATOM 5658  O O    . ASN A 1 17 ? 3.626   1.497   0.826   1.00 0.00 ? 20 ASN A O    10 
ATOM 5659  C CB   . ASN A 1 17 ? 4.615   4.640   1.409   1.00 0.00 ? 20 ASN A CB   10 
ATOM 5660  C CG   . ASN A 1 17 ? 6.083   4.340   1.606   1.00 0.00 ? 20 ASN A CG   10 
ATOM 5661  O OD1  . ASN A 1 17 ? 6.896   5.248   1.743   1.00 0.00 ? 20 ASN A OD1  10 
ATOM 5662  N ND2  . ASN A 1 17 ? 6.434   3.065   1.623   1.00 0.00 ? 20 ASN A ND2  10 
ATOM 5663  H H    . ASN A 1 17 ? 2.886   5.542   -0.184  1.00 0.00 ? 20 ASN A H    10 
ATOM 5664  H HA   . ASN A 1 17 ? 4.768   3.404   -0.342  1.00 0.00 ? 20 ASN A HA   10 
ATOM 5665  H HB2  . ASN A 1 17 ? 4.515   5.687   1.165   1.00 0.00 ? 20 ASN A HB2  10 
ATOM 5666  H HB3  . ASN A 1 17 ? 4.097   4.442   2.333   1.00 0.00 ? 20 ASN A HB3  10 
ATOM 5667  H HD21 . ASN A 1 17 ? 5.737   2.386   1.511   1.00 0.00 ? 20 ASN A HD21 10 
ATOM 5668  H HD22 . ASN A 1 17 ? 7.379   2.858   1.743   1.00 0.00 ? 20 ASN A HD22 10 
ATOM 5669  N N    . ILE A 1 18 ? 2.003   2.951   1.420   1.00 0.00 ? 21 ILE A N    10 
ATOM 5670  C CA   . ILE A 1 18 ? 1.136   1.919   1.992   1.00 0.00 ? 21 ILE A CA   10 
ATOM 5671  C C    . ILE A 1 18 ? 0.893   0.826   0.962   1.00 0.00 ? 21 ILE A C    10 
ATOM 5672  O O    . ILE A 1 18 ? 1.251   -0.334  1.179   1.00 0.00 ? 21 ILE A O    10 
ATOM 5673  C CB   . ILE A 1 18 ? -0.221  2.499   2.461   1.00 0.00 ? 21 ILE A CB   10 
ATOM 5674  C CG1  . ILE A 1 18 ? -0.018  3.473   3.624   1.00 0.00 ? 21 ILE A CG1  10 
ATOM 5675  C CG2  . ILE A 1 18 ? -1.169  1.381   2.871   1.00 0.00 ? 21 ILE A CG2  10 
ATOM 5676  C CD1  . ILE A 1 18 ? -1.194  4.399   3.845   1.00 0.00 ? 21 ILE A CD1  10 
ATOM 5677  H H    . ILE A 1 18 ? 1.701   3.891   1.418   1.00 0.00 ? 21 ILE A H    10 
ATOM 5678  H HA   . ILE A 1 18 ? 1.640   1.487   2.845   1.00 0.00 ? 21 ILE A HA   10 
ATOM 5679  H HB   . ILE A 1 18 ? -0.666  3.029   1.632   1.00 0.00 ? 21 ILE A HB   10 
ATOM 5680  H HG12 . ILE A 1 18 ? 0.136   2.911   4.533   1.00 0.00 ? 21 ILE A HG12 10 
ATOM 5681  H HG13 . ILE A 1 18 ? 0.853   4.081   3.431   1.00 0.00 ? 21 ILE A HG13 10 
ATOM 5682  H HG21 . ILE A 1 18 ? -0.650  0.685   3.515   1.00 0.00 ? 21 ILE A HG21 10 
ATOM 5683  H HG22 . ILE A 1 18 ? -1.519  0.862   1.990   1.00 0.00 ? 21 ILE A HG22 10 
ATOM 5684  H HG23 . ILE A 1 18 ? -2.011  1.800   3.400   1.00 0.00 ? 21 ILE A HG23 10 
ATOM 5685  H HD11 . ILE A 1 18 ? -2.084  3.814   4.029   1.00 0.00 ? 21 ILE A HD11 10 
ATOM 5686  H HD12 . ILE A 1 18 ? -1.341  5.011   2.967   1.00 0.00 ? 21 ILE A HD12 10 
ATOM 5687  H HD13 . ILE A 1 18 ? -0.998  5.034   4.697   1.00 0.00 ? 21 ILE A HD13 10 
ATOM 5688  N N    . ALA A 1 19 ? 0.319   1.208   -0.181  1.00 0.00 ? 22 ALA A N    10 
ATOM 5689  C CA   . ALA A 1 19 ? 0.066   0.261   -1.263  1.00 0.00 ? 22 ALA A CA   10 
ATOM 5690  C C    . ALA A 1 19 ? 1.373   -0.412  -1.699  1.00 0.00 ? 22 ALA A C    10 
ATOM 5691  O O    . ALA A 1 19 ? 1.390   -1.591  -2.063  1.00 0.00 ? 22 ALA A O    10 
ATOM 5692  C CB   . ALA A 1 19 ? -0.594  0.971   -2.438  1.00 0.00 ? 22 ALA A CB   10 
ATOM 5693  H H    . ALA A 1 19 ? 0.082   2.158   -0.306  1.00 0.00 ? 22 ALA A H    10 
ATOM 5694  H HA   . ALA A 1 19 ? -0.612  -0.497  -0.897  1.00 0.00 ? 22 ALA A HA   10 
ATOM 5695  H HB1  . ALA A 1 19 ? -1.411  1.579   -2.078  1.00 0.00 ? 22 ALA A HB1  10 
ATOM 5696  H HB2  . ALA A 1 19 ? -0.973  0.238   -3.136  1.00 0.00 ? 22 ALA A HB2  10 
ATOM 5697  H HB3  . ALA A 1 19 ? 0.131   1.600   -2.933  1.00 0.00 ? 22 ALA A HB3  10 
ATOM 5698  N N    . LYS A 1 20 ? 2.466   0.349   -1.648  1.00 0.00 ? 23 LYS A N    10 
ATOM 5699  C CA   . LYS A 1 20 ? 3.786   -0.153  -2.022  1.00 0.00 ? 23 LYS A CA   10 
ATOM 5700  C C    . LYS A 1 20 ? 4.251   -1.264  -1.079  1.00 0.00 ? 23 LYS A C    10 
ATOM 5701  O O    . LYS A 1 20 ? 4.728   -2.303  -1.529  1.00 0.00 ? 23 LYS A O    10 
ATOM 5702  C CB   . LYS A 1 20 ? 4.802   1.000   -2.029  1.00 0.00 ? 23 LYS A CB   10 
ATOM 5703  C CG   . LYS A 1 20 ? 5.219   1.453   -3.422  1.00 0.00 ? 23 LYS A CG   10 
ATOM 5704  C CD   . LYS A 1 20 ? 5.641   0.282   -4.298  1.00 0.00 ? 23 LYS A CD   10 
ATOM 5705  C CE   . LYS A 1 20 ? 4.684   0.087   -5.465  1.00 0.00 ? 23 LYS A CE   10 
ATOM 5706  N NZ   . LYS A 1 20 ? 5.307   -0.705  -6.565  1.00 0.00 ? 23 LYS A NZ   10 
ATOM 5707  H H    . LYS A 1 20 ? 2.384   1.279   -1.345  1.00 0.00 ? 23 LYS A H    10 
ATOM 5708  H HA   . LYS A 1 20 ? 3.707   -0.563  -3.014  1.00 0.00 ? 23 LYS A HA   10 
ATOM 5709  H HB2  . LYS A 1 20 ? 4.364   1.845   -1.521  1.00 0.00 ? 23 LYS A HB2  10 
ATOM 5710  H HB3  . LYS A 1 20 ? 5.686   0.698   -1.490  1.00 0.00 ? 23 LYS A HB3  10 
ATOM 5711  H HG2  . LYS A 1 20 ? 4.386   1.959   -3.887  1.00 0.00 ? 23 LYS A HG2  10 
ATOM 5712  H HG3  . LYS A 1 20 ? 6.050   2.139   -3.329  1.00 0.00 ? 23 LYS A HG3  10 
ATOM 5713  H HD2  . LYS A 1 20 ? 6.630   0.473   -4.684  1.00 0.00 ? 23 LYS A HD2  10 
ATOM 5714  H HD3  . LYS A 1 20 ? 5.655   -0.618  -3.700  1.00 0.00 ? 23 LYS A HD3  10 
ATOM 5715  H HE2  . LYS A 1 20 ? 3.804   -0.432  -5.109  1.00 0.00 ? 23 LYS A HE2  10 
ATOM 5716  H HE3  . LYS A 1 20 ? 4.398   1.057   -5.845  1.00 0.00 ? 23 LYS A HE3  10 
ATOM 5717  H HZ1  . LYS A 1 20 ? 5.584   -0.077  -7.348  1.00 0.00 ? 23 LYS A HZ1  10 
ATOM 5718  H HZ2  . LYS A 1 20 ? 4.632   -1.412  -6.926  1.00 0.00 ? 23 LYS A HZ2  10 
ATOM 5719  H HZ3  . LYS A 1 20 ? 6.154   -1.201  -6.219  1.00 0.00 ? 23 LYS A HZ3  10 
ATOM 5720  N N    . ALA A 1 21 ? 4.113   -1.041  0.224   1.00 0.00 ? 24 ALA A N    10 
ATOM 5721  C CA   . ALA A 1 21 ? 4.525   -2.031  1.213   1.00 0.00 ? 24 ALA A CA   10 
ATOM 5722  C C    . ALA A 1 21 ? 3.468   -3.124  1.398   1.00 0.00 ? 24 ALA A C    10 
ATOM 5723  O O    . ALA A 1 21 ? 3.804   -4.304  1.544   1.00 0.00 ? 24 ALA A O    10 
ATOM 5724  C CB   . ALA A 1 21 ? 4.827   -1.351  2.542   1.00 0.00 ? 24 ALA A CB   10 
ATOM 5725  H H    . ALA A 1 21 ? 3.729   -0.186  0.527   1.00 0.00 ? 24 ALA A H    10 
ATOM 5726  H HA   . ALA A 1 21 ? 5.435   -2.491  0.859   1.00 0.00 ? 24 ALA A HA   10 
ATOM 5727  H HB1  . ALA A 1 21 ? 5.357   -0.427  2.362   1.00 0.00 ? 24 ALA A HB1  10 
ATOM 5728  H HB2  . ALA A 1 21 ? 5.438   -2.003  3.150   1.00 0.00 ? 24 ALA A HB2  10 
ATOM 5729  H HB3  . ALA A 1 21 ? 3.903   -1.140  3.059   1.00 0.00 ? 24 ALA A HB3  10 
ATOM 5730  N N    . LYS A 1 22 ? 2.191   -2.733  1.386   1.00 0.00 ? 25 LYS A N    10 
ATOM 5731  C CA   . LYS A 1 22 ? 1.098   -3.686  1.556   1.00 0.00 ? 25 LYS A CA   10 
ATOM 5732  C C    . LYS A 1 22 ? 1.074   -4.711  0.431   1.00 0.00 ? 25 LYS A C    10 
ATOM 5733  O O    . LYS A 1 22 ? 0.850   -5.900  0.677   1.00 0.00 ? 25 LYS A O    10 
ATOM 5734  C CB   . LYS A 1 22 ? -0.244  -2.953  1.634   1.00 0.00 ? 25 LYS A CB   10 
ATOM 5735  C CG   . LYS A 1 22 ? -1.046  -3.290  2.880   1.00 0.00 ? 25 LYS A CG   10 
ATOM 5736  C CD   . LYS A 1 22 ? -2.248  -4.170  2.557   1.00 0.00 ? 25 LYS A CD   10 
ATOM 5737  C CE   . LYS A 1 22 ? -2.044  -5.603  3.028   1.00 0.00 ? 25 LYS A CE   10 
ATOM 5738  N NZ   . LYS A 1 22 ? -2.773  -5.878  4.302   1.00 0.00 ? 25 LYS A NZ   10 
ATOM 5739  H H    . LYS A 1 22 ? 1.975   -1.781  1.257   1.00 0.00 ? 25 LYS A H    10 
ATOM 5740  H HA   . LYS A 1 22 ? 1.263   -4.207  2.488   1.00 0.00 ? 25 LYS A HA   10 
ATOM 5741  H HB2  . LYS A 1 22 ? -0.061  -1.889  1.629   1.00 0.00 ? 25 LYS A HB2  10 
ATOM 5742  H HB3  . LYS A 1 22 ? -0.836  -3.211  0.768   1.00 0.00 ? 25 LYS A HB3  10 
ATOM 5743  H HG2  . LYS A 1 22 ? -0.407  -3.810  3.579   1.00 0.00 ? 25 LYS A HG2  10 
ATOM 5744  H HG3  . LYS A 1 22 ? -1.391  -2.369  3.325   1.00 0.00 ? 25 LYS A HG3  10 
ATOM 5745  H HD2  . LYS A 1 22 ? -3.121  -3.762  3.045   1.00 0.00 ? 25 LYS A HD2  10 
ATOM 5746  H HD3  . LYS A 1 22 ? -2.402  -4.172  1.487   1.00 0.00 ? 25 LYS A HD3  10 
ATOM 5747  H HE2  . LYS A 1 22 ? -2.404  -6.275  2.262   1.00 0.00 ? 25 LYS A HE2  10 
ATOM 5748  H HE3  . LYS A 1 22 ? -0.986  -5.770  3.182   1.00 0.00 ? 25 LYS A HE3  10 
ATOM 5749  H HZ1  . LYS A 1 22 ? -2.386  -6.726  4.765   1.00 0.00 ? 25 LYS A HZ1  10 
ATOM 5750  H HZ2  . LYS A 1 22 ? -3.786  -6.032  4.110   1.00 0.00 ? 25 LYS A HZ2  10 
ATOM 5751  H HZ3  . LYS A 1 22 ? -2.678  -5.069  4.951   1.00 0.00 ? 25 LYS A HZ3  10 
ATOM 5752  N N    . ASN A 1 23 ? 1.316   -4.260  -0.804  1.00 0.00 ? 26 ASN A N    10 
ATOM 5753  C CA   . ASN A 1 23 ? 1.318   -5.180  -1.944  1.00 0.00 ? 26 ASN A CA   10 
ATOM 5754  C C    . ASN A 1 23 ? 2.498   -6.147  -1.848  1.00 0.00 ? 26 ASN A C    10 
ATOM 5755  O O    . ASN A 1 23 ? 2.339   -7.341  -2.083  1.00 0.00 ? 26 ASN A O    10 
ATOM 5756  C CB   . ASN A 1 23 ? 1.321   -4.417  -3.281  1.00 0.00 ? 26 ASN A CB   10 
ATOM 5757  C CG   . ASN A 1 23 ? 2.710   -4.118  -3.806  1.00 0.00 ? 26 ASN A CG   10 
ATOM 5758  O OD1  . ASN A 1 23 ? 3.363   -4.973  -4.399  1.00 0.00 ? 26 ASN A OD1  10 
ATOM 5759  N ND2  . ASN A 1 23 ? 3.167   -2.899  -3.594  1.00 0.00 ? 26 ASN A ND2  10 
ATOM 5760  H H    . ASN A 1 23 ? 1.502   -3.297  -0.946  1.00 0.00 ? 26 ASN A H    10 
ATOM 5761  H HA   . ASN A 1 23 ? 0.411   -5.763  -1.883  1.00 0.00 ? 26 ASN A HA   10 
ATOM 5762  H HB2  . ASN A 1 23 ? 0.805   -5.010  -4.022  1.00 0.00 ? 26 ASN A HB2  10 
ATOM 5763  H HB3  . ASN A 1 23 ? 0.797   -3.482  -3.152  1.00 0.00 ? 26 ASN A HB3  10 
ATOM 5764  H HD21 . ASN A 1 23 ? 2.587   -2.264  -3.118  1.00 0.00 ? 26 ASN A HD21 10 
ATOM 5765  H HD22 . ASN A 1 23 ? 4.067   -2.683  -3.910  1.00 0.00 ? 26 ASN A HD22 10 
ATOM 5766  N N    . LEU A 1 24 ? 3.671   -5.633  -1.473  1.00 0.00 ? 27 LEU A N    10 
ATOM 5767  C CA   . LEU A 1 24 ? 4.856   -6.476  -1.326  1.00 0.00 ? 27 LEU A CA   10 
ATOM 5768  C C    . LEU A 1 24 ? 4.596   -7.591  -0.324  1.00 0.00 ? 27 LEU A C    10 
ATOM 5769  O O    . LEU A 1 24 ? 4.800   -8.772  -0.607  1.00 0.00 ? 27 LEU A O    10 
ATOM 5770  C CB   . LEU A 1 24 ? 6.063   -5.640  -0.882  1.00 0.00 ? 27 LEU A CB   10 
ATOM 5771  C CG   . LEU A 1 24 ? 6.575   -4.631  -1.911  1.00 0.00 ? 27 LEU A CG   10 
ATOM 5772  C CD1  . LEU A 1 24 ? 7.529   -3.643  -1.256  1.00 0.00 ? 27 LEU A CD1  10 
ATOM 5773  C CD2  . LEU A 1 24 ? 7.259   -5.347  -3.063  1.00 0.00 ? 27 LEU A CD2  10 
ATOM 5774  H H    . LEU A 1 24 ? 3.737   -4.674  -1.276  1.00 0.00 ? 27 LEU A H    10 
ATOM 5775  H HA   . LEU A 1 24 ? 5.063   -6.917  -2.273  1.00 0.00 ? 27 LEU A HA   10 
ATOM 5776  H HB2  . LEU A 1 24 ? 5.789   -5.100  0.013   1.00 0.00 ? 27 LEU A HB2  10 
ATOM 5777  H HB3  . LEU A 1 24 ? 6.871   -6.314  -0.640  1.00 0.00 ? 27 LEU A HB3  10 
ATOM 5778  H HG   . LEU A 1 24 ? 5.740   -4.074  -2.309  1.00 0.00 ? 27 LEU A HG   10 
ATOM 5779  H HD11 . LEU A 1 24 ? 8.319   -3.392  -1.948  1.00 0.00 ? 27 LEU A HD11 10 
ATOM 5780  H HD12 . LEU A 1 24 ? 7.956   -4.088  -0.369  1.00 0.00 ? 27 LEU A HD12 10 
ATOM 5781  H HD13 . LEU A 1 24 ? 6.989   -2.747  -0.985  1.00 0.00 ? 27 LEU A HD13 10 
ATOM 5782  H HD21 . LEU A 1 24 ? 8.106   -4.766  -3.396  1.00 0.00 ? 27 LEU A HD21 10 
ATOM 5783  H HD22 . LEU A 1 24 ? 6.561   -5.464  -3.880  1.00 0.00 ? 27 LEU A HD22 10 
ATOM 5784  H HD23 . LEU A 1 24 ? 7.596   -6.319  -2.736  1.00 0.00 ? 27 LEU A HD23 10 
ATOM 5785  N N    . ARG A 1 25 ? 4.133   -7.193  0.842   1.00 0.00 ? 28 ARG A N    10 
ATOM 5786  C CA   . ARG A 1 25 ? 3.822   -8.127  1.922   1.00 0.00 ? 28 ARG A CA   10 
ATOM 5787  C C    . ARG A 1 25 ? 2.680   -9.071  1.547   1.00 0.00 ? 28 ARG A C    10 
ATOM 5788  O O    . ARG A 1 25 ? 2.774   -10.276 1.773   1.00 0.00 ? 28 ARG A O    10 
ATOM 5789  C CB   . ARG A 1 25 ? 3.472   -7.354  3.193   1.00 0.00 ? 28 ARG A CB   10 
ATOM 5790  C CG   . ARG A 1 25 ? 4.665   -7.128  4.105   1.00 0.00 ? 28 ARG A CG   10 
ATOM 5791  C CD   . ARG A 1 25 ? 4.698   -8.135  5.242   1.00 0.00 ? 28 ARG A CD   10 
ATOM 5792  N NE   . ARG A 1 25 ? 5.313   -9.400  4.831   1.00 0.00 ? 28 ARG A NE   10 
ATOM 5793  C CZ   . ARG A 1 25 ? 5.418   -10.470 5.609   1.00 0.00 ? 28 ARG A CZ   10 
ATOM 5794  N NH1  . ARG A 1 25 ? 4.943   -10.455 6.841   1.00 0.00 ? 28 ARG A NH1  10 
ATOM 5795  N NH2  . ARG A 1 25 ? 6.000   -11.558 5.149   1.00 0.00 ? 28 ARG A NH2  10 
ATOM 5796  H H    . ARG A 1 25 ? 3.993   -6.235  0.978   1.00 0.00 ? 28 ARG A H    10 
ATOM 5797  H HA   . ARG A 1 25 ? 4.702   -8.722  2.108   1.00 0.00 ? 28 ARG A HA   10 
ATOM 5798  H HB2  . ARG A 1 25 ? 3.071   -6.389  2.914   1.00 0.00 ? 28 ARG A HB2  10 
ATOM 5799  H HB3  . ARG A 1 25 ? 2.722   -7.902  3.741   1.00 0.00 ? 28 ARG A HB3  10 
ATOM 5800  H HG2  . ARG A 1 25 ? 5.572   -7.225  3.527   1.00 0.00 ? 28 ARG A HG2  10 
ATOM 5801  H HG3  . ARG A 1 25 ? 4.605   -6.135  4.516   1.00 0.00 ? 28 ARG A HG3  10 
ATOM 5802  H HD2  . ARG A 1 25 ? 5.265   -7.716  6.061   1.00 0.00 ? 28 ARG A HD2  10 
ATOM 5803  H HD3  . ARG A 1 25 ? 3.683   -8.325  5.567   1.00 0.00 ? 28 ARG A HD3  10 
ATOM 5804  H HE   . ARG A 1 25 ? 5.675   -9.450  3.922   1.00 0.00 ? 28 ARG A HE   10 
ATOM 5805  H HH11 . ARG A 1 25 ? 4.502   -9.634  7.195   1.00 0.00 ? 28 ARG A HH11 10 
ATOM 5806  H HH12 . ARG A 1 25 ? 5.027   -11.264 7.420   1.00 0.00 ? 28 ARG A HH12 10 
ATOM 5807  H HH21 . ARG A 1 25 ? 6.361   -11.578 4.219   1.00 0.00 ? 28 ARG A HH21 10 
ATOM 5808  H HH22 . ARG A 1 25 ? 6.084   -12.363 5.732   1.00 0.00 ? 28 ARG A HH22 10 
ATOM 5809  N N    . ALA A 1 26 ? 1.611   -8.526  0.969   1.00 0.00 ? 29 ALA A N    10 
ATOM 5810  C CA   . ALA A 1 26 ? 0.465   -9.336  0.567   1.00 0.00 ? 29 ALA A CA   10 
ATOM 5811  C C    . ALA A 1 26 ? 0.815   -10.251 -0.604  1.00 0.00 ? 29 ALA A C    10 
ATOM 5812  O O    . ALA A 1 26 ? 0.262   -11.340 -0.734  1.00 0.00 ? 29 ALA A O    10 
ATOM 5813  C CB   . ALA A 1 26 ? -0.717  -8.443  0.213   1.00 0.00 ? 29 ALA A CB   10 
ATOM 5814  H H    . ALA A 1 26 ? 1.595   -7.559  0.801   1.00 0.00 ? 29 ALA A H    10 
ATOM 5815  H HA   . ALA A 1 26 ? 0.180   -9.950  1.410   1.00 0.00 ? 29 ALA A HA   10 
ATOM 5816  H HB1  . ALA A 1 26 ? -0.389  -7.661  -0.456  1.00 0.00 ? 29 ALA A HB1  10 
ATOM 5817  H HB2  . ALA A 1 26 ? -1.116  -8.001  1.114   1.00 0.00 ? 29 ALA A HB2  10 
ATOM 5818  H HB3  . ALA A 1 26 ? -1.483  -9.032  -0.270  1.00 0.00 ? 29 ALA A HB3  10 
ATOM 5819  N N    . GLN A 1 27 ? 1.729   -9.800  -1.459  1.00 0.00 ? 30 GLN A N    10 
ATOM 5820  C CA   . GLN A 1 27 ? 2.138   -10.585 -2.620  1.00 0.00 ? 30 GLN A CA   10 
ATOM 5821  C C    . GLN A 1 27 ? 3.225   -11.599 -2.280  1.00 0.00 ? 30 GLN A C    10 
ATOM 5822  O O    . GLN A 1 27 ? 3.214   -12.720 -2.780  1.00 0.00 ? 30 GLN A O    10 
ATOM 5823  C CB   . GLN A 1 27 ? 2.603   -9.653  -3.745  1.00 0.00 ? 30 GLN A CB   10 
ATOM 5824  C CG   . GLN A 1 27 ? 3.252   -10.375 -4.915  1.00 0.00 ? 30 GLN A CG   10 
ATOM 5825  C CD   . GLN A 1 27 ? 2.624   -10.017 -6.248  1.00 0.00 ? 30 GLN A CD   10 
ATOM 5826  O OE1  . GLN A 1 27 ? 1.957   -10.838 -6.868  1.00 0.00 ? 30 GLN A OE1  10 
ATOM 5827  N NE2  . GLN A 1 27 ? 2.833   -8.787  -6.696  1.00 0.00 ? 30 GLN A NE2  10 
ATOM 5828  H H    . GLN A 1 27 ? 2.130   -8.912  -1.312  1.00 0.00 ? 30 GLN A H    10 
ATOM 5829  H HA   . GLN A 1 27 ? 1.287   -11.129 -2.950  1.00 0.00 ? 30 GLN A HA   10 
ATOM 5830  H HB2  . GLN A 1 27 ? 1.749   -9.105  -4.116  1.00 0.00 ? 30 GLN A HB2  10 
ATOM 5831  H HB3  . GLN A 1 27 ? 3.319   -8.952  -3.340  1.00 0.00 ? 30 GLN A HB3  10 
ATOM 5832  H HG2  . GLN A 1 27 ? 4.299   -10.112 -4.947  1.00 0.00 ? 30 GLN A HG2  10 
ATOM 5833  H HG3  . GLN A 1 27 ? 3.154   -11.439 -4.763  1.00 0.00 ? 30 GLN A HG3  10 
ATOM 5834  H HE21 . GLN A 1 27 ? 3.375   -8.179  -6.152  1.00 0.00 ? 30 GLN A HE21 10 
ATOM 5835  H HE22 . GLN A 1 27 ? 2.436   -8.539  -7.555  1.00 0.00 ? 30 GLN A HE22 10 
ATOM 5836  N N    . ALA A 1 28 ? 4.154   -11.192 -1.437  1.00 0.00 ? 31 ALA A N    10 
ATOM 5837  C CA   . ALA A 1 28 ? 5.264   -12.055 -1.025  1.00 0.00 ? 31 ALA A CA   10 
ATOM 5838  C C    . ALA A 1 28 ? 4.862   -13.016 0.096   1.00 0.00 ? 31 ALA A C    10 
ATOM 5839  O O    . ALA A 1 28 ? 5.244   -14.187 0.087   1.00 0.00 ? 31 ALA A O    10 
ATOM 5840  C CB   . ALA A 1 28 ? 6.455   -11.205 -0.598  1.00 0.00 ? 31 ALA A CB   10 
ATOM 5841  H H    . ALA A 1 28 ? 4.092   -10.282 -1.085  1.00 0.00 ? 31 ALA A H    10 
ATOM 5842  H HA   . ALA A 1 28 ? 5.564   -12.638 -1.885  1.00 0.00 ? 31 ALA A HA   10 
ATOM 5843  H HB1  . ALA A 1 28 ? 6.494   -10.311 -1.203  1.00 0.00 ? 31 ALA A HB1  10 
ATOM 5844  H HB2  . ALA A 1 28 ? 7.366   -11.769 -0.733  1.00 0.00 ? 31 ALA A HB2  10 
ATOM 5845  H HB3  . ALA A 1 28 ? 6.350   -10.933 0.441   1.00 0.00 ? 31 ALA A HB3  10 
ATOM 5846  N N    . ALA A 1 29 ? 4.101   -12.520 1.071   1.00 0.00 ? 32 ALA A N    10 
ATOM 5847  C CA   . ALA A 1 29 ? 3.672   -13.355 2.195   1.00 0.00 ? 32 ALA A CA   10 
ATOM 5848  C C    . ALA A 1 29 ? 2.470   -14.249 1.850   1.00 0.00 ? 32 ALA A C    10 
ATOM 5849  O O    . ALA A 1 29 ? 2.131   -15.145 2.624   1.00 0.00 ? 32 ALA A O    10 
ATOM 5850  C CB   . ALA A 1 29 ? 3.351   -12.483 3.402   1.00 0.00 ? 32 ALA A CB   10 
ATOM 5851  H H    . ALA A 1 29 ? 3.832   -11.569 1.043   1.00 0.00 ? 32 ALA A H    10 
ATOM 5852  H HA   . ALA A 1 29 ? 4.501   -13.993 2.462   1.00 0.00 ? 32 ALA A HA   10 
ATOM 5853  H HB1  . ALA A 1 29 ? 4.021   -11.638 3.424   1.00 0.00 ? 32 ALA A HB1  10 
ATOM 5854  H HB2  . ALA A 1 29 ? 3.468   -13.062 4.306   1.00 0.00 ? 32 ALA A HB2  10 
ATOM 5855  H HB3  . ALA A 1 29 ? 2.332   -12.131 3.330   1.00 0.00 ? 32 ALA A HB3  10 
ATOM 5856  N N    . ALA A 1 30 ? 1.814   -14.008 0.709   1.00 0.00 ? 33 ALA A N    10 
ATOM 5857  C CA   . ALA A 1 30 ? 0.648   -14.809 0.329   1.00 0.00 ? 33 ALA A CA   10 
ATOM 5858  C C    . ALA A 1 30 ? 0.935   -15.796 -0.797  1.00 0.00 ? 33 ALA A C    10 
ATOM 5859  O O    . ALA A 1 30 ? 0.453   -16.931 -0.774  1.00 0.00 ? 33 ALA A O    10 
ATOM 5860  C CB   . ALA A 1 30 ? -0.516  -13.901 -0.037  1.00 0.00 ? 33 ALA A CB   10 
ATOM 5861  H H    . ALA A 1 30 ? 2.105   -13.274 0.125   1.00 0.00 ? 33 ALA A H    10 
ATOM 5862  H HA   . ALA A 1 30 ? 0.362   -15.373 1.185   1.00 0.00 ? 33 ALA A HA   10 
ATOM 5863  H HB1  . ALA A 1 30 ? -0.582  -13.091 0.676   1.00 0.00 ? 33 ALA A HB1  10 
ATOM 5864  H HB2  . ALA A 1 30 ? -1.435  -14.468 -0.023  1.00 0.00 ? 33 ALA A HB2  10 
ATOM 5865  H HB3  . ALA A 1 30 ? -0.360  -13.494 -1.027  1.00 0.00 ? 33 ALA A HB3  10 
ATOM 5866  N N    . ASN A 1 31 ? 1.711   -15.360 -1.773  1.00 0.00 ? 34 ASN A N    10 
ATOM 5867  C CA   . ASN A 1 31 ? 2.055   -16.201 -2.925  1.00 0.00 ? 34 ASN A CA   10 
ATOM 5868  C C    . ASN A 1 31 ? 2.786   -17.471 -2.490  1.00 0.00 ? 34 ASN A C    10 
ATOM 5869  O O    . ASN A 1 31 ? 2.528   -18.552 -3.017  1.00 0.00 ? 34 ASN A O    10 
ATOM 5870  C CB   . ASN A 1 31 ? 2.891   -15.413 -3.948  1.00 0.00 ? 34 ASN A CB   10 
ATOM 5871  C CG   . ASN A 1 31 ? 4.348   -15.254 -3.551  1.00 0.00 ? 34 ASN A CG   10 
ATOM 5872  O OD1  . ASN A 1 31 ? 4.669   -15.072 -2.382  1.00 0.00 ? 34 ASN A OD1  10 
ATOM 5873  N ND2  . ASN A 1 31 ? 5.240   -15.322 -4.526  1.00 0.00 ? 34 ASN A ND2  10 
ATOM 5874  H H    . ASN A 1 31 ? 2.057   -14.452 -1.718  1.00 0.00 ? 34 ASN A H    10 
ATOM 5875  H HA   . ASN A 1 31 ? 1.128   -16.496 -3.395  1.00 0.00 ? 34 ASN A HA   10 
ATOM 5876  H HB2  . ASN A 1 31 ? 2.855   -15.924 -4.898  1.00 0.00 ? 34 ASN A HB2  10 
ATOM 5877  H HB3  . ASN A 1 31 ? 2.462   -14.427 -4.064  1.00 0.00 ? 34 ASN A HB3  10 
ATOM 5878  H HD21 . ASN A 1 31 ? 4.920   -15.469 -5.440  1.00 0.00 ? 34 ASN A HD21 10 
ATOM 5879  H HD22 . ASN A 1 31 ? 6.185   -15.219 -4.292  1.00 0.00 ? 34 ASN A HD22 10 
ATOM 5880  N N    . ALA A 1 32 ? 3.691   -17.337 -1.523  1.00 0.00 ? 35 ALA A N    10 
ATOM 5881  C CA   . ALA A 1 32 ? 4.449   -18.481 -1.018  1.00 0.00 ? 35 ALA A CA   10 
ATOM 5882  C C    . ALA A 1 32 ? 3.661   -19.281 0.031   1.00 0.00 ? 35 ALA A C    10 
ATOM 5883  O O    . ALA A 1 32 ? 4.161   -20.274 0.562   1.00 0.00 ? 35 ALA A O    10 
ATOM 5884  C CB   . ALA A 1 32 ? 5.782   -18.014 -0.448  1.00 0.00 ? 35 ALA A CB   10 
ATOM 5885  H H    . ALA A 1 32 ? 3.850   -16.443 -1.141  1.00 0.00 ? 35 ALA A H    10 
ATOM 5886  H HA   . ALA A 1 32 ? 4.655   -19.131 -1.854  1.00 0.00 ? 35 ALA A HA   10 
ATOM 5887  H HB1  . ALA A 1 32 ? 6.155   -18.752 0.248   1.00 0.00 ? 35 ALA A HB1  10 
ATOM 5888  H HB2  . ALA A 1 32 ? 5.645   -17.073 0.064   1.00 0.00 ? 35 ALA A HB2  10 
ATOM 5889  H HB3  . ALA A 1 32 ? 6.492   -17.886 -1.252  1.00 0.00 ? 35 ALA A HB3  10 
ATOM 5890  N N    . HIS A 1 33 ? 2.434   -18.848 0.326   1.00 0.00 ? 36 HIS A N    10 
ATOM 5891  C CA   . HIS A 1 33 ? 1.592   -19.531 1.310   1.00 0.00 ? 36 HIS A CA   10 
ATOM 5892  C C    . HIS A 1 33 ? 0.342   -20.132 0.664   1.00 0.00 ? 36 HIS A C    10 
ATOM 5893  O O    . HIS A 1 33 ? 0.056   -21.319 0.840   1.00 0.00 ? 36 HIS A O    10 
ATOM 5894  C CB   . HIS A 1 33 ? 1.192   -18.562 2.426   1.00 0.00 ? 36 HIS A CB   10 
ATOM 5895  C CG   . HIS A 1 33 ? 1.775   -18.911 3.759   1.00 0.00 ? 36 HIS A CG   10 
ATOM 5896  N ND1  . HIS A 1 33 ? 1.633   -20.153 4.342   1.00 0.00 ? 36 HIS A ND1  10 
ATOM 5897  C CD2  . HIS A 1 33 ? 2.512   -18.175 4.622   1.00 0.00 ? 36 HIS A CD2  10 
ATOM 5898  C CE1  . HIS A 1 33 ? 2.255   -20.165 5.507   1.00 0.00 ? 36 HIS A CE1  10 
ATOM 5899  N NE2  . HIS A 1 33 ? 2.797   -18.977 5.700   1.00 0.00 ? 36 HIS A NE2  10 
ATOM 5900  H H    . HIS A 1 33 ? 2.085   -18.055 -0.127  1.00 0.00 ? 36 HIS A H    10 
ATOM 5901  H HA   . HIS A 1 33 ? 2.176   -20.333 1.738   1.00 0.00 ? 36 HIS A HA   10 
ATOM 5902  H HB2  . HIS A 1 33 ? 1.527   -17.567 2.169   1.00 0.00 ? 36 HIS A HB2  10 
ATOM 5903  H HB3  . HIS A 1 33 ? 0.116   -18.559 2.525   1.00 0.00 ? 36 HIS A HB3  10 
ATOM 5904  H HD1  . HIS A 1 33 ? 1.143   -20.913 3.959   1.00 0.00 ? 36 HIS A HD1  10 
ATOM 5905  H HD2  . HIS A 1 33 ? 2.816   -17.146 4.487   1.00 0.00 ? 36 HIS A HD2  10 
ATOM 5906  H HE1  . HIS A 1 33 ? 2.312   -21.004 6.186   1.00 0.00 ? 36 HIS A HE1  10 
ATOM 5907  H HE2  . HIS A 1 33 ? 3.276   -18.698 6.507   1.00 0.00 ? 36 HIS A HE2  10 
ATOM 5908  N N    . LEU A 1 34 ? -0.404  -19.313 -0.083  1.00 0.00 ? 37 LEU A N    10 
ATOM 5909  C CA   . LEU A 1 34 ? -1.628  -19.774 -0.746  1.00 0.00 ? 37 LEU A CA   10 
ATOM 5910  C C    . LEU A 1 34 ? -1.342  -20.791 -1.853  1.00 0.00 ? 37 LEU A C    10 
ATOM 5911  O O    . LEU A 1 34 ? -2.245  -21.502 -2.299  1.00 0.00 ? 37 LEU A O    10 
ATOM 5912  C CB   . LEU A 1 34 ? -2.411  -18.584 -1.311  1.00 0.00 ? 37 LEU A CB   10 
ATOM 5913  C CG   . LEU A 1 34 ? -3.359  -17.906 -0.321  1.00 0.00 ? 37 LEU A CG   10 
ATOM 5914  C CD1  . LEU A 1 34 ? -2.584  -17.028 0.646   1.00 0.00 ? 37 LEU A CD1  10 
ATOM 5915  C CD2  . LEU A 1 34 ? -4.404  -17.086 -1.060  1.00 0.00 ? 37 LEU A CD2  10 
ATOM 5916  H H    . LEU A 1 34 ? -0.126  -18.372 -0.188  1.00 0.00 ? 37 LEU A H    10 
ATOM 5917  H HA   . LEU A 1 34 ? -2.229  -20.258 -0.001  1.00 0.00 ? 37 LEU A HA   10 
ATOM 5918  H HB2  . LEU A 1 34 ? -1.701  -17.848 -1.661  1.00 0.00 ? 37 LEU A HB2  10 
ATOM 5919  H HB3  . LEU A 1 34 ? -2.993  -18.928 -2.153  1.00 0.00 ? 37 LEU A HB3  10 
ATOM 5920  H HG   . LEU A 1 34 ? -3.872  -18.663 0.254   1.00 0.00 ? 37 LEU A HG   10 
ATOM 5921  H HD11 . LEU A 1 34 ? -2.056  -17.651 1.352   1.00 0.00 ? 37 LEU A HD11 10 
ATOM 5922  H HD12 . LEU A 1 34 ? -3.269  -16.384 1.175   1.00 0.00 ? 37 LEU A HD12 10 
ATOM 5923  H HD13 . LEU A 1 34 ? -1.874  -16.427 0.096   1.00 0.00 ? 37 LEU A HD13 10 
ATOM 5924  H HD21 . LEU A 1 34 ? -3.912  -16.383 -1.715  1.00 0.00 ? 37 LEU A HD21 10 
ATOM 5925  H HD22 . LEU A 1 34 ? -5.011  -16.549 -0.346  1.00 0.00 ? 37 LEU A HD22 10 
ATOM 5926  H HD23 . LEU A 1 34 ? -5.031  -17.744 -1.643  1.00 0.00 ? 37 LEU A HD23 10 
ATOM 5927  N N    . MET A 1 35 ? -0.085  -20.865 -2.281  1.00 0.00 ? 38 MET A N    10 
ATOM 5928  C CA   . MET A 1 35 ? 0.325   -21.803 -3.328  1.00 0.00 ? 38 MET A CA   10 
ATOM 5929  C C    . MET A 1 35 ? 0.126   -23.262 -2.905  1.00 0.00 ? 38 MET A C    10 
ATOM 5930  O O    . MET A 1 35 ? 0.142   -24.164 -3.743  1.00 0.00 ? 38 MET A O    10 
ATOM 5931  C CB   . MET A 1 35 ? 1.789   -21.561 -3.715  1.00 0.00 ? 38 MET A CB   10 
ATOM 5932  C CG   . MET A 1 35 ? 2.008   -21.416 -5.213  1.00 0.00 ? 38 MET A CG   10 
ATOM 5933  S SD   . MET A 1 35 ? 3.672   -20.850 -5.616  1.00 0.00 ? 38 MET A SD   10 
ATOM 5934  C CE   . MET A 1 35 ? 3.335   -19.768 -7.003  1.00 0.00 ? 38 MET A CE   10 
ATOM 5935  H H    . MET A 1 35 ? 0.583   -20.280 -1.878  1.00 0.00 ? 38 MET A H    10 
ATOM 5936  H HA   . MET A 1 35 ? -0.296  -21.618 -4.184  1.00 0.00 ? 38 MET A HA   10 
ATOM 5937  H HB2  . MET A 1 35 ? 2.132   -20.656 -3.236  1.00 0.00 ? 38 MET A HB2  10 
ATOM 5938  H HB3  . MET A 1 35 ? 2.384   -22.390 -3.365  1.00 0.00 ? 38 MET A HB3  10 
ATOM 5939  H HG2  . MET A 1 35 ? 1.846   -22.376 -5.682  1.00 0.00 ? 38 MET A HG2  10 
ATOM 5940  H HG3  . MET A 1 35 ? 1.295   -20.703 -5.600  1.00 0.00 ? 38 MET A HG3  10 
ATOM 5941  H HE1  . MET A 1 35 ? 2.455   -20.113 -7.525  1.00 0.00 ? 38 MET A HE1  10 
ATOM 5942  H HE2  . MET A 1 35 ? 4.179   -19.774 -7.678  1.00 0.00 ? 38 MET A HE2  10 
ATOM 5943  H HE3  . MET A 1 35 ? 3.168   -18.763 -6.644  1.00 0.00 ? 38 MET A HE3  10 
ATOM 5944  N N    . ALA A 1 36 ? -0.063  -23.486 -1.609  1.00 0.00 ? 39 ALA A N    10 
ATOM 5945  C CA   . ALA A 1 36 ? -0.270  -24.832 -1.078  1.00 0.00 ? 39 ALA A CA   10 
ATOM 5946  C C    . ALA A 1 36 ? -1.470  -24.877 -0.122  1.00 0.00 ? 39 ALA A C    10 
ATOM 5947  O O    . ALA A 1 36 ? -1.394  -25.457 0.963   1.00 0.00 ? 39 ALA A O    10 
ATOM 5948  C CB   . ALA A 1 36 ? 0.997   -25.314 -0.381  1.00 0.00 ? 39 ALA A CB   10 
ATOM 5949  H H    . ALA A 1 36 ? -0.068  -22.727 -0.995  1.00 0.00 ? 39 ALA A H    10 
ATOM 5950  H HA   . ALA A 1 36 ? -0.466  -25.492 -1.911  1.00 0.00 ? 39 ALA A HA   10 
ATOM 5951  H HB1  . ALA A 1 36 ? 1.299   -24.588 0.361   1.00 0.00 ? 39 ALA A HB1  10 
ATOM 5952  H HB2  . ALA A 1 36 ? 1.786   -25.431 -1.109  1.00 0.00 ? 39 ALA A HB2  10 
ATOM 5953  H HB3  . ALA A 1 36 ? 0.806   -26.262 0.100   1.00 0.00 ? 39 ALA A HB3  10 
ATOM 5954  N N    . GLN A 1 37 ? -2.576  -24.253 -0.531  1.00 0.00 ? 40 GLN A N    10 
ATOM 5955  C CA   . GLN A 1 37 ? -3.786  -24.218 0.290   1.00 0.00 ? 40 GLN A CA   10 
ATOM 5956  C C    . GLN A 1 37 ? -4.877  -25.147 -0.257  1.00 0.00 ? 40 GLN A C    10 
ATOM 5957  O O    . GLN A 1 37 ? -5.493  -25.897 0.504   1.00 0.00 ? 40 GLN A O    10 
ATOM 5958  C CB   . GLN A 1 37 ? -4.320  -22.785 0.392   1.00 0.00 ? 40 GLN A CB   10 
ATOM 5959  C CG   . GLN A 1 37 ? -5.624  -22.666 1.175   1.00 0.00 ? 40 GLN A CG   10 
ATOM 5960  C CD   . GLN A 1 37 ? -5.503  -23.152 2.609   1.00 0.00 ? 40 GLN A CD   10 
ATOM 5961  O OE1  . GLN A 1 37 ? -5.216  -22.375 3.515   1.00 0.00 ? 40 GLN A OE1  10 
ATOM 5962  N NE2  . GLN A 1 37 ? -5.720  -24.443 2.823   1.00 0.00 ? 40 GLN A NE2  10 
ATOM 5963  H H    . GLN A 1 37 ? -2.575  -23.802 -1.399  1.00 0.00 ? 40 GLN A H    10 
ATOM 5964  H HA   . GLN A 1 37 ? -3.517  -24.557 1.278   1.00 0.00 ? 40 GLN A HA   10 
ATOM 5965  H HB2  . GLN A 1 37 ? -3.576  -22.172 0.880   1.00 0.00 ? 40 GLN A HB2  10 
ATOM 5966  H HB3  . GLN A 1 37 ? -4.488  -22.404 -0.605  1.00 0.00 ? 40 GLN A HB3  10 
ATOM 5967  H HG2  . GLN A 1 37 ? -5.923  -21.629 1.193   1.00 0.00 ? 40 GLN A HG2  10 
ATOM 5968  H HG3  . GLN A 1 37 ? -6.383  -23.250 0.677   1.00 0.00 ? 40 GLN A HG3  10 
ATOM 5969  H HE21 . GLN A 1 37 ? -5.943  -25.012 2.053   1.00 0.00 ? 40 GLN A HE21 10 
ATOM 5970  H HE22 . GLN A 1 37 ? -5.648  -24.774 3.740   1.00 0.00 ? 40 GLN A HE22 10 
ATOM 5971  N N    . ILE A 1 38 ? -5.122  -25.084 -1.566  1.00 0.00 ? 41 ILE A N    10 
ATOM 5972  C CA   . ILE A 1 38 ? -6.148  -25.913 -2.201  1.00 0.00 ? 41 ILE A CA   10 
ATOM 5973  C C    . ILE A 1 38 ? -5.989  -25.929 -3.725  1.00 0.00 ? 41 ILE A C    10 
ATOM 5974  O O    . ILE A 1 38 ? -5.564  -24.898 -4.292  1.00 0.00 ? 41 ILE A O    10 
ATOM 5975  C CB   . ILE A 1 38 ? -7.569  -25.424 -1.829  1.00 0.00 ? 41 ILE A CB   10 
ATOM 5976  C CG1  . ILE A 1 38 ? -8.629  -26.386 -2.370  1.00 0.00 ? 41 ILE A CG1  10 
ATOM 5977  C CG2  . ILE A 1 38 ? -7.812  -24.015 -2.354  1.00 0.00 ? 41 ILE A CG2  10 
ATOM 5978  C CD1  . ILE A 1 38 ? -10.011 -26.146 -1.800  1.00 0.00 ? 41 ILE A CD1  10 
ATOM 5979  O OXT  . ILE A 1 38 ? -6.291  -26.976 -4.338  1.00 0.00 ? 41 ILE A OXT  10 
ATOM 5980  H H    . ILE A 1 38 ? -4.609  -24.460 -2.119  1.00 0.00 ? 41 ILE A H    10 
ATOM 5981  H HA   . ILE A 1 38 ? -6.031  -26.921 -1.832  1.00 0.00 ? 41 ILE A HA   10 
ATOM 5982  H HB   . ILE A 1 38 ? -7.641  -25.394 -0.752  1.00 0.00 ? 41 ILE A HB   10 
ATOM 5983  H HG12 . ILE A 1 38 ? -8.690  -26.276 -3.442  1.00 0.00 ? 41 ILE A HG12 10 
ATOM 5984  H HG13 . ILE A 1 38 ? -8.341  -27.400 -2.133  1.00 0.00 ? 41 ILE A HG13 10 
ATOM 5985  H HG21 . ILE A 1 38 ? -7.785  -24.025 -3.435  1.00 0.00 ? 41 ILE A HG21 10 
ATOM 5986  H HG22 . ILE A 1 38 ? -7.045  -23.353 -1.981  1.00 0.00 ? 41 ILE A HG22 10 
ATOM 5987  H HG23 . ILE A 1 38 ? -8.781  -23.670 -2.023  1.00 0.00 ? 41 ILE A HG23 10 
ATOM 5988  H HD11 . ILE A 1 38 ? -10.172 -25.085 -1.682  1.00 0.00 ? 41 ILE A HD11 10 
ATOM 5989  H HD12 . ILE A 1 38 ? -10.093 -26.632 -0.839  1.00 0.00 ? 41 ILE A HD12 10 
ATOM 5990  H HD13 . ILE A 1 38 ? -10.752 -26.551 -2.472  1.00 0.00 ? 41 ILE A HD13 10 
ATOM 5991  N N    . PHE A 1 1  ? -9.111  29.194  -2.296  1.00 0.00 ? 4  PHE A N    11 
ATOM 5992  C CA   . PHE A 1 1  ? -8.745  27.747  -2.288  1.00 0.00 ? 4  PHE A CA   11 
ATOM 5993  C C    . PHE A 1 1  ? -9.589  26.968  -1.276  1.00 0.00 ? 4  PHE A C    11 
ATOM 5994  O O    . PHE A 1 1  ? -10.314 27.563  -0.479  1.00 0.00 ? 4  PHE A O    11 
ATOM 5995  C CB   . PHE A 1 1  ? -7.254  27.619  -1.949  1.00 0.00 ? 4  PHE A CB   11 
ATOM 5996  C CG   . PHE A 1 1  ? -6.550  26.552  -2.738  1.00 0.00 ? 4  PHE A CG   11 
ATOM 5997  C CD1  . PHE A 1 1  ? -6.141  26.790  -4.041  1.00 0.00 ? 4  PHE A CD1  11 
ATOM 5998  C CD2  . PHE A 1 1  ? -6.300  25.310  -2.177  1.00 0.00 ? 4  PHE A CD2  11 
ATOM 5999  C CE1  . PHE A 1 1  ? -5.496  25.808  -4.769  1.00 0.00 ? 4  PHE A CE1  11 
ATOM 6000  C CE2  . PHE A 1 1  ? -5.655  24.325  -2.900  1.00 0.00 ? 4  PHE A CE2  11 
ATOM 6001  C CZ   . PHE A 1 1  ? -5.253  24.575  -4.197  1.00 0.00 ? 4  PHE A CZ   11 
ATOM 6002  H H1   . PHE A 1 1  ? -8.934  29.574  -1.343  1.00 0.00 ? 4  PHE A H1   11 
ATOM 6003  H H2   . PHE A 1 1  ? -10.120 29.266  -2.545  1.00 0.00 ? 4  PHE A H2   11 
ATOM 6004  H H3   . PHE A 1 1  ? -8.516  29.671  -3.004  1.00 0.00 ? 4  PHE A H3   11 
ATOM 6005  H HA   . PHE A 1 1  ? -8.922  27.342  -3.275  1.00 0.00 ? 4  PHE A HA   11 
ATOM 6006  H HB2  . PHE A 1 1  ? -6.762  28.558  -2.151  1.00 0.00 ? 4  PHE A HB2  11 
ATOM 6007  H HB3  . PHE A 1 1  ? -7.148  27.382  -0.900  1.00 0.00 ? 4  PHE A HB3  11 
ATOM 6008  H HD1  . PHE A 1 1  ? -6.329  27.754  -4.489  1.00 0.00 ? 4  PHE A HD1  11 
ATOM 6009  H HD2  . PHE A 1 1  ? -6.613  25.114  -1.162  1.00 0.00 ? 4  PHE A HD2  11 
ATOM 6010  H HE1  . PHE A 1 1  ? -5.182  26.004  -5.783  1.00 0.00 ? 4  PHE A HE1  11 
ATOM 6011  H HE2  . PHE A 1 1  ? -5.466  23.361  -2.452  1.00 0.00 ? 4  PHE A HE2  11 
ATOM 6012  H HZ   . PHE A 1 1  ? -4.748  23.805  -4.765  1.00 0.00 ? 4  PHE A HZ   11 
ATOM 6013  N N    . THR A 1 2  ? -9.488  25.638  -1.312  1.00 0.00 ? 5  THR A N    11 
ATOM 6014  C CA   . THR A 1 2  ? -10.236 24.778  -0.400  1.00 0.00 ? 5  THR A CA   11 
ATOM 6015  C C    . THR A 1 2  ? -9.680  23.355  -0.417  1.00 0.00 ? 5  THR A C    11 
ATOM 6016  O O    . THR A 1 2  ? -9.410  22.797  -1.482  1.00 0.00 ? 5  THR A O    11 
ATOM 6017  C CB   . THR A 1 2  ? -11.726 24.760  -0.762  1.00 0.00 ? 5  THR A CB   11 
ATOM 6018  O OG1  . THR A 1 2  ? -12.460 24.034  0.207   1.00 0.00 ? 5  THR A OG1  11 
ATOM 6019  C CG2  . THR A 1 2  ? -12.016 24.138  -2.111  1.00 0.00 ? 5  THR A CG2  11 
ATOM 6020  H H    . THR A 1 2  ? -8.893  25.221  -1.967  1.00 0.00 ? 5  THR A H    11 
ATOM 6021  H HA   . THR A 1 2  ? -10.125 25.179  0.597   1.00 0.00 ? 5  THR A HA   11 
ATOM 6022  H HB   . THR A 1 2  ? -12.094 25.777  -0.777  1.00 0.00 ? 5  THR A HB   11 
ATOM 6023  H HG1  . THR A 1 2  ? -13.399 24.093  0.012   1.00 0.00 ? 5  THR A HG1  11 
ATOM 6024  H HG21 . THR A 1 2  ? -11.930 23.064  -2.036  1.00 0.00 ? 5  THR A HG21 11 
ATOM 6025  H HG22 . THR A 1 2  ? -11.307 24.504  -2.837  1.00 0.00 ? 5  THR A HG22 11 
ATOM 6026  H HG23 . THR A 1 2  ? -13.017 24.399  -2.420  1.00 0.00 ? 5  THR A HG23 11 
ATOM 6027  N N    . LEU A 1 3  ? -9.510  22.783  0.767   1.00 0.00 ? 6  LEU A N    11 
ATOM 6028  C CA   . LEU A 1 3  ? -8.986  21.425  0.899   1.00 0.00 ? 6  LEU A CA   11 
ATOM 6029  C C    . LEU A 1 3  ? -9.937  20.543  1.712   1.00 0.00 ? 6  LEU A C    11 
ATOM 6030  O O    . LEU A 1 3  ? -10.610 21.014  2.635   1.00 0.00 ? 6  LEU A O    11 
ATOM 6031  C CB   . LEU A 1 3  ? -7.596  21.447  1.546   1.00 0.00 ? 6  LEU A CB   11 
ATOM 6032  C CG   . LEU A 1 3  ? -7.568  21.812  3.032   1.00 0.00 ? 6  LEU A CG   11 
ATOM 6033  C CD1  . LEU A 1 3  ? -7.417  20.564  3.886   1.00 0.00 ? 6  LEU A CD1  11 
ATOM 6034  C CD2  . LEU A 1 3  ? -6.438  22.788  3.319   1.00 0.00 ? 6  LEU A CD2  11 
ATOM 6035  H H    . LEU A 1 3  ? -9.741  23.284  1.570   1.00 0.00 ? 6  LEU A H    11 
ATOM 6036  H HA   . LEU A 1 3  ? -8.901  21.009  -0.095  1.00 0.00 ? 6  LEU A HA   11 
ATOM 6037  H HB2  . LEU A 1 3  ? -7.154  20.468  1.429   1.00 0.00 ? 6  LEU A HB2  11 
ATOM 6038  H HB3  . LEU A 1 3  ? -6.987  22.161  1.011   1.00 0.00 ? 6  LEU A HB3  11 
ATOM 6039  H HG   . LEU A 1 3  ? -8.500  22.289  3.300   1.00 0.00 ? 6  LEU A HG   11 
ATOM 6040  H HD11 . LEU A 1 3  ? -7.875  19.726  3.384   1.00 0.00 ? 6  LEU A HD11 11 
ATOM 6041  H HD12 . LEU A 1 3  ? -7.901  20.721  4.840   1.00 0.00 ? 6  LEU A HD12 11 
ATOM 6042  H HD13 . LEU A 1 3  ? -6.368  20.361  4.045   1.00 0.00 ? 6  LEU A HD13 11 
ATOM 6043  H HD21 . LEU A 1 3  ? -5.499  22.350  3.018   1.00 0.00 ? 6  LEU A HD21 11 
ATOM 6044  H HD22 . LEU A 1 3  ? -6.411  23.005  4.377   1.00 0.00 ? 6  LEU A HD22 11 
ATOM 6045  H HD23 . LEU A 1 3  ? -6.603  23.702  2.768   1.00 0.00 ? 6  LEU A HD23 11 
ATOM 6046  N N    . SER A 1 4  ? -9.992  19.265  1.357   1.00 0.00 ? 7  SER A N    11 
ATOM 6047  C CA   . SER A 1 4  ? -10.859 18.305  2.041   1.00 0.00 ? 7  SER A CA   11 
ATOM 6048  C C    . SER A 1 4  ? -10.541 16.876  1.599   1.00 0.00 ? 7  SER A C    11 
ATOM 6049  O O    . SER A 1 4  ? -11.378 16.194  1.004   1.00 0.00 ? 7  SER A O    11 
ATOM 6050  C CB   . SER A 1 4  ? -12.333 18.635  1.775   1.00 0.00 ? 7  SER A CB   11 
ATOM 6051  O OG   . SER A 1 4  ? -12.800 19.633  2.673   1.00 0.00 ? 7  SER A OG   11 
ATOM 6052  H H    . SER A 1 4  ? -9.432  18.956  0.601   1.00 0.00 ? 7  SER A H    11 
ATOM 6053  H HA   . SER A 1 4  ? -10.669 18.387  3.101   1.00 0.00 ? 7  SER A HA   11 
ATOM 6054  H HB2  . SER A 1 4  ? -12.441 18.997  0.763   1.00 0.00 ? 7  SER A HB2  11 
ATOM 6055  H HB3  . SER A 1 4  ? -12.929 17.743  1.904   1.00 0.00 ? 7  SER A HB3  11 
ATOM 6056  H HG   . SER A 1 4  ? -12.130 20.328  2.763   1.00 0.00 ? 7  SER A HG   11 
ATOM 6057  N N    . LEU A 1 5  ? -9.314  16.438  1.892   1.00 0.00 ? 8  LEU A N    11 
ATOM 6058  C CA   . LEU A 1 5  ? -8.851  15.095  1.531   1.00 0.00 ? 8  LEU A CA   11 
ATOM 6059  C C    . LEU A 1 5  ? -8.823  14.901  0.010   1.00 0.00 ? 8  LEU A C    11 
ATOM 6060  O O    . LEU A 1 5  ? -9.104  13.814  -0.500  1.00 0.00 ? 8  LEU A O    11 
ATOM 6061  C CB   . LEU A 1 5  ? -9.731  14.030  2.197   1.00 0.00 ? 8  LEU A CB   11 
ATOM 6062  C CG   . LEU A 1 5  ? -9.303  13.629  3.609   1.00 0.00 ? 8  LEU A CG   11 
ATOM 6063  C CD1  . LEU A 1 5  ? -10.473 13.033  4.372   1.00 0.00 ? 8  LEU A CD1  11 
ATOM 6064  C CD2  . LEU A 1 5  ? -8.147  12.643  3.555   1.00 0.00 ? 8  LEU A CD2  11 
ATOM 6065  H H    . LEU A 1 5  ? -8.700  17.039  2.363   1.00 0.00 ? 8  LEU A H    11 
ATOM 6066  H HA   . LEU A 1 5  ? -7.843  14.993  1.898   1.00 0.00 ? 8  LEU A HA   11 
ATOM 6067  H HB2  . LEU A 1 5  ? -10.744 14.406  2.242   1.00 0.00 ? 8  LEU A HB2  11 
ATOM 6068  H HB3  . LEU A 1 5  ? -9.722  13.145  1.578   1.00 0.00 ? 8  LEU A HB3  11 
ATOM 6069  H HG   . LEU A 1 5  ? -8.970  14.508  4.142   1.00 0.00 ? 8  LEU A HG   11 
ATOM 6070  H HD11 . LEU A 1 5  ? -10.902 12.225  3.798   1.00 0.00 ? 8  LEU A HD11 11 
ATOM 6071  H HD12 . LEU A 1 5  ? -11.221 13.794  4.537   1.00 0.00 ? 8  LEU A HD12 11 
ATOM 6072  H HD13 . LEU A 1 5  ? -10.129 12.655  5.322   1.00 0.00 ? 8  LEU A HD13 11 
ATOM 6073  H HD21 . LEU A 1 5  ? -8.383  11.851  2.861   1.00 0.00 ? 8  LEU A HD21 11 
ATOM 6074  H HD22 . LEU A 1 5  ? -7.986  12.225  4.537   1.00 0.00 ? 8  LEU A HD22 11 
ATOM 6075  H HD23 . LEU A 1 5  ? -7.254  13.155  3.229   1.00 0.00 ? 8  LEU A HD23 11 
ATOM 6076  N N    . ASP A 1 6  ? -8.461  15.961  -0.705  1.00 0.00 ? 9  ASP A N    11 
ATOM 6077  C CA   . ASP A 1 6  ? -8.378  15.931  -2.162  1.00 0.00 ? 9  ASP A CA   11 
ATOM 6078  C C    . ASP A 1 6  ? -7.043  15.321  -2.616  1.00 0.00 ? 9  ASP A C    11 
ATOM 6079  O O    . ASP A 1 6  ? -6.273  15.949  -3.345  1.00 0.00 ? 9  ASP A O    11 
ATOM 6080  C CB   . ASP A 1 6  ? -8.553  17.351  -2.734  1.00 0.00 ? 9  ASP A CB   11 
ATOM 6081  C CG   . ASP A 1 6  ? -9.202  18.322  -1.762  1.00 0.00 ? 9  ASP A CG   11 
ATOM 6082  O OD1  . ASP A 1 6  ? -8.568  18.651  -0.735  1.00 0.00 ? 9  ASP A OD1  11 
ATOM 6083  O OD2  . ASP A 1 6  ? -10.342 18.751  -2.024  1.00 0.00 ? 9  ASP A OD2  11 
ATOM 6084  H H    . ASP A 1 6  ? -8.236  16.791  -0.242  1.00 0.00 ? 9  ASP A H    11 
ATOM 6085  H HA   . ASP A 1 6  ? -9.182  15.306  -2.524  1.00 0.00 ? 9  ASP A HA   11 
ATOM 6086  H HB2  . ASP A 1 6  ? -7.587  17.745  -3.005  1.00 0.00 ? 9  ASP A HB2  11 
ATOM 6087  H HB3  . ASP A 1 6  ? -9.168  17.295  -3.612  1.00 0.00 ? 9  ASP A HB3  11 
ATOM 6088  N N    . VAL A 1 7  ? -6.786  14.087  -2.166  1.00 0.00 ? 10 VAL A N    11 
ATOM 6089  C CA   . VAL A 1 7  ? -5.555  13.353  -2.498  1.00 0.00 ? 10 VAL A CA   11 
ATOM 6090  C C    . VAL A 1 7  ? -4.304  14.254  -2.474  1.00 0.00 ? 10 VAL A C    11 
ATOM 6091  O O    . VAL A 1 7  ? -3.584  14.376  -3.467  1.00 0.00 ? 10 VAL A O    11 
ATOM 6092  C CB   . VAL A 1 7  ? -5.680  12.632  -3.866  1.00 0.00 ? 10 VAL A CB   11 
ATOM 6093  C CG1  . VAL A 1 7  ? -5.854  13.623  -5.009  1.00 0.00 ? 10 VAL A CG1  11 
ATOM 6094  C CG2  . VAL A 1 7  ? -4.477  11.734  -4.112  1.00 0.00 ? 10 VAL A CG2  11 
ATOM 6095  H H    . VAL A 1 7  ? -7.449  13.654  -1.588  1.00 0.00 ? 10 VAL A H    11 
ATOM 6096  H HA   . VAL A 1 7  ? -5.428  12.593  -1.740  1.00 0.00 ? 10 VAL A HA   11 
ATOM 6097  H HB   . VAL A 1 7  ? -6.561  12.006  -3.833  1.00 0.00 ? 10 VAL A HB   11 
ATOM 6098  H HG11 . VAL A 1 7  ? -6.880  13.957  -5.042  1.00 0.00 ? 10 VAL A HG11 11 
ATOM 6099  H HG12 . VAL A 1 7  ? -5.600  13.144  -5.942  1.00 0.00 ? 10 VAL A HG12 11 
ATOM 6100  H HG13 . VAL A 1 7  ? -5.205  14.472  -4.853  1.00 0.00 ? 10 VAL A HG13 11 
ATOM 6101  H HG21 . VAL A 1 7  ? -4.125  11.334  -3.174  1.00 0.00 ? 10 VAL A HG21 11 
ATOM 6102  H HG22 . VAL A 1 7  ? -3.689  12.309  -4.577  1.00 0.00 ? 10 VAL A HG22 11 
ATOM 6103  H HG23 . VAL A 1 7  ? -4.761  10.922  -4.766  1.00 0.00 ? 10 VAL A HG23 11 
ATOM 6104  N N    . PRO A 1 8  ? -4.024  14.892  -1.319  1.00 0.00 ? 11 PRO A N    11 
ATOM 6105  C CA   . PRO A 1 8  ? -2.856  15.772  -1.166  1.00 0.00 ? 11 PRO A CA   11 
ATOM 6106  C C    . PRO A 1 8  ? -1.540  14.994  -1.071  1.00 0.00 ? 11 PRO A C    11 
ATOM 6107  O O    . PRO A 1 8  ? -1.538  13.777  -0.858  1.00 0.00 ? 11 PRO A O    11 
ATOM 6108  C CB   . PRO A 1 8  ? -3.149  16.503  0.146   1.00 0.00 ? 11 PRO A CB   11 
ATOM 6109  C CG   . PRO A 1 8  ? -3.969  15.539  0.931   1.00 0.00 ? 11 PRO A CG   11 
ATOM 6110  C CD   . PRO A 1 8  ? -4.813  14.800  -0.073  1.00 0.00 ? 11 PRO A CD   11 
ATOM 6111  H HA   . PRO A 1 8  ? -2.792  16.486  -1.973  1.00 0.00 ? 11 PRO A HA   11 
ATOM 6112  H HB2  . PRO A 1 8  ? -2.222  16.738  0.648   1.00 0.00 ? 11 PRO A HB2  11 
ATOM 6113  H HB3  . PRO A 1 8  ? -3.697  17.410  -0.058  1.00 0.00 ? 11 PRO A HB3  11 
ATOM 6114  H HG2  . PRO A 1 8  ? -3.323  14.850  1.457   1.00 0.00 ? 11 PRO A HG2  11 
ATOM 6115  H HG3  . PRO A 1 8  ? -4.597  16.072  1.628   1.00 0.00 ? 11 PRO A HG3  11 
ATOM 6116  H HD2  . PRO A 1 8  ? -4.942  13.771  0.227   1.00 0.00 ? 11 PRO A HD2  11 
ATOM 6117  H HD3  . PRO A 1 8  ? -5.771  15.283  -0.190  1.00 0.00 ? 11 PRO A HD3  11 
ATOM 6118  N N    . THR A 1 9  ? -0.419  15.699  -1.230  1.00 0.00 ? 12 THR A N    11 
ATOM 6119  C CA   . THR A 1 9  ? 0.911   15.077  -1.165  1.00 0.00 ? 12 THR A CA   11 
ATOM 6120  C C    . THR A 1 9  ? 1.063   14.197  0.077   1.00 0.00 ? 12 THR A C    11 
ATOM 6121  O O    . THR A 1 9  ? 1.531   13.061  -0.015  1.00 0.00 ? 12 THR A O    11 
ATOM 6122  C CB   . THR A 1 9  ? 2.013   16.143  -1.180  1.00 0.00 ? 12 THR A CB   11 
ATOM 6123  O OG1  . THR A 1 9  ? 1.493   17.405  -1.566  1.00 0.00 ? 12 THR A OG1  11 
ATOM 6124  C CG2  . THR A 1 9  ? 3.149   15.811  -2.121  1.00 0.00 ? 12 THR A CG2  11 
ATOM 6125  H H    . THR A 1 9  ? -0.482  16.665  -1.396  1.00 0.00 ? 12 THR A H    11 
ATOM 6126  H HA   . THR A 1 9  ? 1.024   14.454  -2.038  1.00 0.00 ? 12 THR A HA   11 
ATOM 6127  H HB   . THR A 1 9  ? 2.424   16.234  -0.185  1.00 0.00 ? 12 THR A HB   11 
ATOM 6128  H HG1  . THR A 1 9  ? 2.212   18.038  -1.652  1.00 0.00 ? 12 THR A HG1  11 
ATOM 6129  H HG21 . THR A 1 9  ? 3.330   14.745  -2.107  1.00 0.00 ? 12 THR A HG21 11 
ATOM 6130  H HG22 . THR A 1 9  ? 4.042   16.331  -1.807  1.00 0.00 ? 12 THR A HG22 11 
ATOM 6131  H HG23 . THR A 1 9  ? 2.887   16.118  -3.123  1.00 0.00 ? 12 THR A HG23 11 
ATOM 6132  N N    . ASN A 1 10 ? 0.653   14.723  1.234   1.00 0.00 ? 13 ASN A N    11 
ATOM 6133  C CA   . ASN A 1 10 ? 0.737   13.976  2.496   1.00 0.00 ? 13 ASN A CA   11 
ATOM 6134  C C    . ASN A 1 10 ? -0.066  12.678  2.445   1.00 0.00 ? 13 ASN A C    11 
ATOM 6135  O O    . ASN A 1 10 ? 0.195   11.745  3.201   1.00 0.00 ? 13 ASN A O    11 
ATOM 6136  C CB   . ASN A 1 10 ? 0.275   14.846  3.676   1.00 0.00 ? 13 ASN A CB   11 
ATOM 6137  C CG   . ASN A 1 10 ? -1.003  15.610  3.382   1.00 0.00 ? 13 ASN A CG   11 
ATOM 6138  O OD1  . ASN A 1 10 ? -1.057  16.417  2.458   1.00 0.00 ? 13 ASN A OD1  11 
ATOM 6139  N ND2  . ASN A 1 10 ? -2.041  15.359  4.166   1.00 0.00 ? 13 ASN A ND2  11 
ATOM 6140  H H    . ASN A 1 10 ? 0.278   15.631  1.240   1.00 0.00 ? 13 ASN A H    11 
ATOM 6141  H HA   . ASN A 1 10 ? 1.760   13.717  2.639   1.00 0.00 ? 13 ASN A HA   11 
ATOM 6142  H HB2  . ASN A 1 10 ? 0.103   14.215  4.534   1.00 0.00 ? 13 ASN A HB2  11 
ATOM 6143  H HB3  . ASN A 1 10 ? 1.050   15.559  3.912   1.00 0.00 ? 13 ASN A HB3  11 
ATOM 6144  H HD21 . ASN A 1 10 ? -1.935  14.703  4.884   1.00 0.00 ? 13 ASN A HD21 11 
ATOM 6145  H HD22 . ASN A 1 10 ? -2.875  15.845  3.992   1.00 0.00 ? 13 ASN A HD22 11 
ATOM 6146  N N    . ILE A 1 11 ? -1.024  12.625  1.538   1.00 0.00 ? 14 ILE A N    11 
ATOM 6147  C CA   . ILE A 1 11 ? -1.861  11.449  1.355   1.00 0.00 ? 14 ILE A CA   11 
ATOM 6148  C C    . ILE A 1 11 ? -1.330  10.597  0.200   1.00 0.00 ? 14 ILE A C    11 
ATOM 6149  O O    . ILE A 1 11 ? -1.160  9.384   0.340   1.00 0.00 ? 14 ILE A O    11 
ATOM 6150  C CB   . ILE A 1 11 ? -3.324  11.872  1.099   1.00 0.00 ? 14 ILE A CB   11 
ATOM 6151  C CG1  . ILE A 1 11 ? -4.132  11.798  2.394   1.00 0.00 ? 14 ILE A CG1  11 
ATOM 6152  C CG2  . ILE A 1 11 ? -3.983  11.017  0.020   1.00 0.00 ? 14 ILE A CG2  11 
ATOM 6153  C CD1  . ILE A 1 11 ? -3.836  12.924  3.360   1.00 0.00 ? 14 ILE A CD1  11 
ATOM 6154  H H    . ILE A 1 11 ? -1.166  13.397  0.962   1.00 0.00 ? 14 ILE A H    11 
ATOM 6155  H HA   . ILE A 1 11 ? -1.824  10.867  2.265   1.00 0.00 ? 14 ILE A HA   11 
ATOM 6156  H HB   . ILE A 1 11 ? -3.309  12.895  0.755   1.00 0.00 ? 14 ILE A HB   11 
ATOM 6157  H HG12 . ILE A 1 11 ? -5.183  11.835  2.155   1.00 0.00 ? 14 ILE A HG12 11 
ATOM 6158  H HG13 . ILE A 1 11 ? -3.914  10.865  2.894   1.00 0.00 ? 14 ILE A HG13 11 
ATOM 6159  H HG21 . ILE A 1 11 ? -3.748  9.977   0.191   1.00 0.00 ? 14 ILE A HG21 11 
ATOM 6160  H HG22 . ILE A 1 11 ? -3.617  11.316  -0.951  1.00 0.00 ? 14 ILE A HG22 11 
ATOM 6161  H HG23 . ILE A 1 11 ? -5.054  11.154  0.058   1.00 0.00 ? 14 ILE A HG23 11 
ATOM 6162  H HD11 . ILE A 1 11 ? -2.823  13.268  3.213   1.00 0.00 ? 14 ILE A HD11 11 
ATOM 6163  H HD12 . ILE A 1 11 ? -3.952  12.569  4.373   1.00 0.00 ? 14 ILE A HD12 11 
ATOM 6164  H HD13 . ILE A 1 11 ? -4.523  13.739  3.183   1.00 0.00 ? 14 ILE A HD13 11 
ATOM 6165  N N    . MET A 1 12 ? -1.053  11.247  -0.935  1.00 0.00 ? 15 MET A N    11 
ATOM 6166  C CA   . MET A 1 12 ? -0.524  10.566  -2.110  1.00 0.00 ? 15 MET A CA   11 
ATOM 6167  C C    . MET A 1 12 ? 0.730   9.772   -1.750  1.00 0.00 ? 15 MET A C    11 
ATOM 6168  O O    . MET A 1 12 ? 0.816   8.572   -2.026  1.00 0.00 ? 15 MET A O    11 
ATOM 6169  C CB   . MET A 1 12 ? -0.215  11.590  -3.202  1.00 0.00 ? 15 MET A CB   11 
ATOM 6170  C CG   . MET A 1 12 ? -0.896  11.290  -4.526  1.00 0.00 ? 15 MET A CG   11 
ATOM 6171  S SD   . MET A 1 12 ? 0.273   10.861  -5.829  1.00 0.00 ? 15 MET A SD   11 
ATOM 6172  C CE   . MET A 1 12 ? -0.140  12.081  -7.074  1.00 0.00 ? 15 MET A CE   11 
ATOM 6173  H H    . MET A 1 12 ? -1.198  12.221  -0.980  1.00 0.00 ? 15 MET A H    11 
ATOM 6174  H HA   . MET A 1 12 ? -1.278  9.882   -2.468  1.00 0.00 ? 15 MET A HA   11 
ATOM 6175  H HB2  . MET A 1 12 ? -0.541  12.564  -2.869  1.00 0.00 ? 15 MET A HB2  11 
ATOM 6176  H HB3  . MET A 1 12 ? 0.849   11.617  -3.365  1.00 0.00 ? 15 MET A HB3  11 
ATOM 6177  H HG2  . MET A 1 12 ? -1.577  10.464  -4.385  1.00 0.00 ? 15 MET A HG2  11 
ATOM 6178  H HG3  . MET A 1 12 ? -1.452  12.164  -4.831  1.00 0.00 ? 15 MET A HG3  11 
ATOM 6179  H HE1  . MET A 1 12 ? -0.343  13.028  -6.598  1.00 0.00 ? 15 MET A HE1  11 
ATOM 6180  H HE2  . MET A 1 12 ? -1.016  11.756  -7.619  1.00 0.00 ? 15 MET A HE2  11 
ATOM 6181  H HE3  . MET A 1 12 ? 0.688   12.192  -7.759  1.00 0.00 ? 15 MET A HE3  11 
ATOM 6182  N N    . ASN A 1 13 ? 1.692   10.443  -1.107  1.00 0.00 ? 16 ASN A N    11 
ATOM 6183  C CA   . ASN A 1 13 ? 2.929   9.791   -0.685  1.00 0.00 ? 16 ASN A CA   11 
ATOM 6184  C C    . ASN A 1 13 ? 2.614   8.595   0.216   1.00 0.00 ? 16 ASN A C    11 
ATOM 6185  O O    . ASN A 1 13 ? 3.214   7.526   0.082   1.00 0.00 ? 16 ASN A O    11 
ATOM 6186  C CB   . ASN A 1 13 ? 3.838   10.787  0.046   1.00 0.00 ? 16 ASN A CB   11 
ATOM 6187  C CG   . ASN A 1 13 ? 4.600   11.687  -0.908  1.00 0.00 ? 16 ASN A CG   11 
ATOM 6188  O OD1  . ASN A 1 13 ? 4.012   12.505  -1.611  1.00 0.00 ? 16 ASN A OD1  11 
ATOM 6189  N ND2  . ASN A 1 13 ? 5.917   11.542  -0.940  1.00 0.00 ? 16 ASN A ND2  11 
ATOM 6190  H H    . ASN A 1 13 ? 1.557   11.394  -0.898  1.00 0.00 ? 16 ASN A H    11 
ATOM 6191  H HA   . ASN A 1 13 ? 3.431   9.435   -1.567  1.00 0.00 ? 16 ASN A HA   11 
ATOM 6192  H HB2  . ASN A 1 13 ? 3.235   11.410  0.689   1.00 0.00 ? 16 ASN A HB2  11 
ATOM 6193  H HB3  . ASN A 1 13 ? 4.551   10.242  0.646   1.00 0.00 ? 16 ASN A HB3  11 
ATOM 6194  H HD21 . ASN A 1 13 ? 6.326   10.872  -0.355  1.00 0.00 ? 16 ASN A HD21 11 
ATOM 6195  H HD22 . ASN A 1 13 ? 6.428   12.114  -1.549  1.00 0.00 ? 16 ASN A HD22 11 
ATOM 6196  N N    . LEU A 1 14 ? 1.646   8.782   1.115   1.00 0.00 ? 17 LEU A N    11 
ATOM 6197  C CA   . LEU A 1 14 ? 1.222   7.720   2.022   1.00 0.00 ? 17 LEU A CA   11 
ATOM 6198  C C    . LEU A 1 14 ? 0.589   6.574   1.236   1.00 0.00 ? 17 LEU A C    11 
ATOM 6199  O O    . LEU A 1 14 ? 1.018   5.426   1.352   1.00 0.00 ? 17 LEU A O    11 
ATOM 6200  C CB   . LEU A 1 14 ? 0.226   8.257   3.059   1.00 0.00 ? 17 LEU A CB   11 
ATOM 6201  C CG   . LEU A 1 14 ? 0.849   9.023   4.229   1.00 0.00 ? 17 LEU A CG   11 
ATOM 6202  C CD1  . LEU A 1 14 ? -0.231  9.486   5.192   1.00 0.00 ? 17 LEU A CD1  11 
ATOM 6203  C CD2  . LEU A 1 14 ? 1.870   8.161   4.952   1.00 0.00 ? 17 LEU A CD2  11 
ATOM 6204  H H    . LEU A 1 14 ? 1.196   9.651   1.152   1.00 0.00 ? 17 LEU A H    11 
ATOM 6205  H HA   . LEU A 1 14 ? 2.098   7.347   2.532   1.00 0.00 ? 17 LEU A HA   11 
ATOM 6206  H HB2  . LEU A 1 14 ? -0.466  8.915   2.553   1.00 0.00 ? 17 LEU A HB2  11 
ATOM 6207  H HB3  . LEU A 1 14 ? -0.327  7.421   3.461   1.00 0.00 ? 17 LEU A HB3  11 
ATOM 6208  H HG   . LEU A 1 14 ? 1.354   9.900   3.849   1.00 0.00 ? 17 LEU A HG   11 
ATOM 6209  H HD11 . LEU A 1 14 ? -0.924  8.678   5.372   1.00 0.00 ? 17 LEU A HD11 11 
ATOM 6210  H HD12 . LEU A 1 14 ? -0.760  10.325  4.765   1.00 0.00 ? 17 LEU A HD12 11 
ATOM 6211  H HD13 . LEU A 1 14 ? 0.224   9.785   6.125   1.00 0.00 ? 17 LEU A HD13 11 
ATOM 6212  H HD21 . LEU A 1 14 ? 2.774   8.103   4.364   1.00 0.00 ? 17 LEU A HD21 11 
ATOM 6213  H HD22 . LEU A 1 14 ? 1.469   7.170   5.096   1.00 0.00 ? 17 LEU A HD22 11 
ATOM 6214  H HD23 . LEU A 1 14 ? 2.095   8.601   5.912   1.00 0.00 ? 17 LEU A HD23 11 
ATOM 6215  N N    . LEU A 1 15 ? -0.419  6.895   0.419   1.00 0.00 ? 18 LEU A N    11 
ATOM 6216  C CA   . LEU A 1 15 ? -1.096  5.889   -0.402  1.00 0.00 ? 18 LEU A CA   11 
ATOM 6217  C C    . LEU A 1 15 ? -0.080  5.075   -1.199  1.00 0.00 ? 18 LEU A C    11 
ATOM 6218  O O    . LEU A 1 15 ? -0.098  3.839   -1.169  1.00 0.00 ? 18 LEU A O    11 
ATOM 6219  C CB   . LEU A 1 15 ? -2.098  6.558   -1.352  1.00 0.00 ? 18 LEU A CB   11 
ATOM 6220  C CG   . LEU A 1 15 ? -3.282  7.251   -0.676  1.00 0.00 ? 18 LEU A CG   11 
ATOM 6221  C CD1  . LEU A 1 15 ? -4.012  8.143   -1.665  1.00 0.00 ? 18 LEU A CD1  11 
ATOM 6222  C CD2  . LEU A 1 15 ? -4.235  6.225   -0.086  1.00 0.00 ? 18 LEU A CD2  11 
ATOM 6223  H H    . LEU A 1 15 ? -0.706  7.839   0.360   1.00 0.00 ? 18 LEU A H    11 
ATOM 6224  H HA   . LEU A 1 15 ? -1.625  5.221   0.258   1.00 0.00 ? 18 LEU A HA   11 
ATOM 6225  H HB2  . LEU A 1 15 ? -1.566  7.294   -1.939  1.00 0.00 ? 18 LEU A HB2  11 
ATOM 6226  H HB3  . LEU A 1 15 ? -2.485  5.804   -2.021  1.00 0.00 ? 18 LEU A HB3  11 
ATOM 6227  H HG   . LEU A 1 15 ? -2.918  7.872   0.129   1.00 0.00 ? 18 LEU A HG   11 
ATOM 6228  H HD11 . LEU A 1 15 ? -4.241  7.578   -2.558  1.00 0.00 ? 18 LEU A HD11 11 
ATOM 6229  H HD12 . LEU A 1 15 ? -3.387  8.985   -1.922  1.00 0.00 ? 18 LEU A HD12 11 
ATOM 6230  H HD13 . LEU A 1 15 ? -4.931  8.498   -1.221  1.00 0.00 ? 18 LEU A HD13 11 
ATOM 6231  H HD21 . LEU A 1 15 ? -5.140  6.718   0.236   1.00 0.00 ? 18 LEU A HD21 11 
ATOM 6232  H HD22 . LEU A 1 15 ? -3.767  5.743   0.761   1.00 0.00 ? 18 LEU A HD22 11 
ATOM 6233  H HD23 . LEU A 1 15 ? -4.476  5.484   -0.834  1.00 0.00 ? 18 LEU A HD23 11 
ATOM 6234  N N    . PHE A 1 16 ? 0.819   5.780   -1.890  1.00 0.00 ? 19 PHE A N    11 
ATOM 6235  C CA   . PHE A 1 16 ? 1.867   5.134   -2.676  1.00 0.00 ? 19 PHE A CA   11 
ATOM 6236  C C    . PHE A 1 16 ? 2.701   4.208   -1.794  1.00 0.00 ? 19 PHE A C    11 
ATOM 6237  O O    . PHE A 1 16 ? 3.027   3.088   -2.185  1.00 0.00 ? 19 PHE A O    11 
ATOM 6238  C CB   . PHE A 1 16 ? 2.772   6.189   -3.317  1.00 0.00 ? 19 PHE A CB   11 
ATOM 6239  C CG   . PHE A 1 16 ? 3.236   5.825   -4.700  1.00 0.00 ? 19 PHE A CG   11 
ATOM 6240  C CD1  . PHE A 1 16 ? 2.489   6.176   -5.812  1.00 0.00 ? 19 PHE A CD1  11 
ATOM 6241  C CD2  . PHE A 1 16 ? 4.419   5.129   -4.884  1.00 0.00 ? 19 PHE A CD2  11 
ATOM 6242  C CE1  . PHE A 1 16 ? 2.916   5.841   -7.083  1.00 0.00 ? 19 PHE A CE1  11 
ATOM 6243  C CE2  . PHE A 1 16 ? 4.851   4.790   -6.152  1.00 0.00 ? 19 PHE A CE2  11 
ATOM 6244  C CZ   . PHE A 1 16 ? 4.097   5.147   -7.254  1.00 0.00 ? 19 PHE A CZ   11 
ATOM 6245  H H    . PHE A 1 16 ? 0.785   6.764   -1.854  1.00 0.00 ? 19 PHE A H    11 
ATOM 6246  H HA   . PHE A 1 16 ? 1.395   4.549   -3.452  1.00 0.00 ? 19 PHE A HA   11 
ATOM 6247  H HB2  . PHE A 1 16 ? 2.235   7.121   -3.379  1.00 0.00 ? 19 PHE A HB2  11 
ATOM 6248  H HB3  . PHE A 1 16 ? 3.646   6.326   -2.699  1.00 0.00 ? 19 PHE A HB3  11 
ATOM 6249  H HD1  . PHE A 1 16 ? 1.565   6.719   -5.680  1.00 0.00 ? 19 PHE A HD1  11 
ATOM 6250  H HD2  . PHE A 1 16 ? 5.008   4.849   -4.023  1.00 0.00 ? 19 PHE A HD2  11 
ATOM 6251  H HE1  . PHE A 1 16 ? 2.325   6.121   -7.943  1.00 0.00 ? 19 PHE A HE1  11 
ATOM 6252  H HE2  . PHE A 1 16 ? 5.776   4.248   -6.283  1.00 0.00 ? 19 PHE A HE2  11 
ATOM 6253  H HZ   . PHE A 1 16 ? 4.432   4.885   -8.246  1.00 0.00 ? 19 PHE A HZ   11 
ATOM 6254  N N    . ASN A 1 17 ? 3.020   4.685   -0.591  1.00 0.00 ? 20 ASN A N    11 
ATOM 6255  C CA   . ASN A 1 17 ? 3.800   3.906   0.368   1.00 0.00 ? 20 ASN A CA   11 
ATOM 6256  C C    . ASN A 1 17 ? 2.981   2.729   0.884   1.00 0.00 ? 20 ASN A C    11 
ATOM 6257  O O    . ASN A 1 17 ? 3.451   1.589   0.879   1.00 0.00 ? 20 ASN A O    11 
ATOM 6258  C CB   . ASN A 1 17 ? 4.251   4.794   1.531   1.00 0.00 ? 20 ASN A CB   11 
ATOM 6259  C CG   . ASN A 1 17 ? 5.646   4.453   2.012   1.00 0.00 ? 20 ASN A CG   11 
ATOM 6260  O OD1  . ASN A 1 17 ? 5.852   4.155   3.183   1.00 0.00 ? 20 ASN A OD1  11 
ATOM 6261  N ND2  . ASN A 1 17 ? 6.614   4.495   1.108   1.00 0.00 ? 20 ASN A ND2  11 
ATOM 6262  H H    . ASN A 1 17 ? 2.707   5.581   -0.335  1.00 0.00 ? 20 ASN A H    11 
ATOM 6263  H HA   . ASN A 1 17 ? 4.670   3.521   -0.145  1.00 0.00 ? 20 ASN A HA   11 
ATOM 6264  H HB2  . ASN A 1 17 ? 4.243   5.826   1.214   1.00 0.00 ? 20 ASN A HB2  11 
ATOM 6265  H HB3  . ASN A 1 17 ? 3.567   4.670   2.355   1.00 0.00 ? 20 ASN A HB3  11 
ATOM 6266  H HD21 . ASN A 1 17 ? 6.383   4.741   0.189   1.00 0.00 ? 20 ASN A HD21 11 
ATOM 6267  H HD22 . ASN A 1 17 ? 7.524   4.279   1.400   1.00 0.00 ? 20 ASN A HD22 11 
ATOM 6268  N N    . ILE A 1 18 ? 1.743   3.008   1.297   1.00 0.00 ? 21 ILE A N    11 
ATOM 6269  C CA   . ILE A 1 18 ? 0.843   1.961   1.781   1.00 0.00 ? 21 ILE A CA   11 
ATOM 6270  C C    . ILE A 1 18 ? 0.746   0.864   0.733   1.00 0.00 ? 21 ILE A C    11 
ATOM 6271  O O    . ILE A 1 18 ? 1.051   -0.296  1.015   1.00 0.00 ? 21 ILE A O    11 
ATOM 6272  C CB   . ILE A 1 18 ? -0.567  2.509   2.102   1.00 0.00 ? 21 ILE A CB   11 
ATOM 6273  C CG1  . ILE A 1 18 ? -0.506  3.497   3.272   1.00 0.00 ? 21 ILE A CG1  11 
ATOM 6274  C CG2  . ILE A 1 18 ? -1.527  1.371   2.424   1.00 0.00 ? 21 ILE A CG2  11 
ATOM 6275  C CD1  . ILE A 1 18 ? 0.137   2.931   4.522   1.00 0.00 ? 21 ILE A CD1  11 
ATOM 6276  H H    . ILE A 1 18 ? 1.422   3.942   1.251   1.00 0.00 ? 21 ILE A H    11 
ATOM 6277  H HA   . ILE A 1 18 ? 1.265   1.536   2.680   1.00 0.00 ? 21 ILE A HA   11 
ATOM 6278  H HB   . ILE A 1 18 ? -0.937  3.022   1.227   1.00 0.00 ? 21 ILE A HB   11 
ATOM 6279  H HG12 . ILE A 1 18 ? 0.062   4.365   2.974   1.00 0.00 ? 21 ILE A HG12 11 
ATOM 6280  H HG13 . ILE A 1 18 ? -1.512  3.803   3.526   1.00 0.00 ? 21 ILE A HG13 11 
ATOM 6281  H HG21 . ILE A 1 18 ? -1.077  0.716   3.156   1.00 0.00 ? 21 ILE A HG21 11 
ATOM 6282  H HG22 . ILE A 1 18 ? -1.741  0.812   1.524   1.00 0.00 ? 21 ILE A HG22 11 
ATOM 6283  H HG23 . ILE A 1 18 ? -2.445  1.778   2.822   1.00 0.00 ? 21 ILE A HG23 11 
ATOM 6284  H HD11 . ILE A 1 18 ? 1.148   2.626   4.300   1.00 0.00 ? 21 ILE A HD11 11 
ATOM 6285  H HD12 . ILE A 1 18 ? -0.430  2.078   4.863   1.00 0.00 ? 21 ILE A HD12 11 
ATOM 6286  H HD13 . ILE A 1 18 ? 0.150   3.687   5.292   1.00 0.00 ? 21 ILE A HD13 11 
ATOM 6287  N N    . ALA A 1 19 ? 0.373   1.244   -0.489  1.00 0.00 ? 22 ALA A N    11 
ATOM 6288  C CA   . ALA A 1 19 ? 0.297   0.287   -1.586  1.00 0.00 ? 22 ALA A CA   11 
ATOM 6289  C C    . ALA A 1 19 ? 1.642   -0.425  -1.734  1.00 0.00 ? 22 ALA A C    11 
ATOM 6290  O O    . ALA A 1 19 ? 1.701   -1.652  -1.819  1.00 0.00 ? 22 ALA A O    11 
ATOM 6291  C CB   . ALA A 1 19 ? -0.093  0.989   -2.881  1.00 0.00 ? 22 ALA A CB   11 
ATOM 6292  H H    . ALA A 1 19 ? 0.180   2.198   -0.664  1.00 0.00 ? 22 ALA A H    11 
ATOM 6293  H HA   . ALA A 1 19 ? -0.464  -0.443  -1.346  1.00 0.00 ? 22 ALA A HA   11 
ATOM 6294  H HB1  . ALA A 1 19 ? 0.797   1.318   -3.395  1.00 0.00 ? 22 ALA A HB1  11 
ATOM 6295  H HB2  . ALA A 1 19 ? -0.714  1.843   -2.655  1.00 0.00 ? 22 ALA A HB2  11 
ATOM 6296  H HB3  . ALA A 1 19 ? -0.640  0.303   -3.512  1.00 0.00 ? 22 ALA A HB3  11 
ATOM 6297  N N    . LYS A 1 20 ? 2.722   0.363   -1.732  1.00 0.00 ? 23 LYS A N    11 
ATOM 6298  C CA   . LYS A 1 20 ? 4.081   -0.169  -1.837  1.00 0.00 ? 23 LYS A CA   11 
ATOM 6299  C C    . LYS A 1 20 ? 4.313   -1.283  -0.815  1.00 0.00 ? 23 LYS A C    11 
ATOM 6300  O O    . LYS A 1 20 ? 4.675   -2.403  -1.180  1.00 0.00 ? 23 LYS A O    11 
ATOM 6301  C CB   . LYS A 1 20 ? 5.106   0.955   -1.628  1.00 0.00 ? 23 LYS A CB   11 
ATOM 6302  C CG   . LYS A 1 20 ? 6.060   1.147   -2.797  1.00 0.00 ? 23 LYS A CG   11 
ATOM 6303  C CD   . LYS A 1 20 ? 6.765   -0.149  -3.176  1.00 0.00 ? 23 LYS A CD   11 
ATOM 6304  C CE   . LYS A 1 20 ? 7.905   -0.469  -2.220  1.00 0.00 ? 23 LYS A CE   11 
ATOM 6305  N NZ   . LYS A 1 20 ? 8.707   -1.637  -2.688  1.00 0.00 ? 23 LYS A NZ   11 
ATOM 6306  H H    . LYS A 1 20 ? 2.600   1.335   -1.640  1.00 0.00 ? 23 LYS A H    11 
ATOM 6307  H HA   . LYS A 1 20 ? 4.201   -0.574  -2.829  1.00 0.00 ? 23 LYS A HA   11 
ATOM 6308  H HB2  . LYS A 1 20 ? 4.576   1.882   -1.472  1.00 0.00 ? 23 LYS A HB2  11 
ATOM 6309  H HB3  . LYS A 1 20 ? 5.690   0.739   -0.745  1.00 0.00 ? 23 LYS A HB3  11 
ATOM 6310  H HG2  . LYS A 1 20 ? 5.497   1.502   -3.649  1.00 0.00 ? 23 LYS A HG2  11 
ATOM 6311  H HG3  . LYS A 1 20 ? 6.801   1.886   -2.525  1.00 0.00 ? 23 LYS A HG3  11 
ATOM 6312  H HD2  . LYS A 1 20 ? 6.052   -0.958  -3.150  1.00 0.00 ? 23 LYS A HD2  11 
ATOM 6313  H HD3  . LYS A 1 20 ? 7.164   -0.051  -4.176  1.00 0.00 ? 23 LYS A HD3  11 
ATOM 6314  H HE2  . LYS A 1 20 ? 8.549   0.396   -2.146  1.00 0.00 ? 23 LYS A HE2  11 
ATOM 6315  H HE3  . LYS A 1 20 ? 7.489   -0.692  -1.247  1.00 0.00 ? 23 LYS A HE3  11 
ATOM 6316  H HZ1  . LYS A 1 20 ? 8.961   -1.520  -3.691  1.00 0.00 ? 23 LYS A HZ1  11 
ATOM 6317  H HZ2  . LYS A 1 20 ? 8.160   -2.515  -2.581  1.00 0.00 ? 23 LYS A HZ2  11 
ATOM 6318  H HZ3  . LYS A 1 20 ? 9.582   -1.718  -2.131  1.00 0.00 ? 23 LYS A HZ3  11 
ATOM 6319  N N    . ALA A 1 21 ? 4.098   -0.968  0.464   1.00 0.00 ? 24 ALA A N    11 
ATOM 6320  C CA   . ALA A 1 21 ? 4.281   -1.940  1.542   1.00 0.00 ? 24 ALA A CA   11 
ATOM 6321  C C    . ALA A 1 21 ? 3.229   -3.052  1.486   1.00 0.00 ? 24 ALA A C    11 
ATOM 6322  O O    . ALA A 1 21 ? 3.555   -4.232  1.645   1.00 0.00 ? 24 ALA A O    11 
ATOM 6323  C CB   . ALA A 1 21 ? 4.246   -1.236  2.892   1.00 0.00 ? 24 ALA A CB   11 
ATOM 6324  H H    . ALA A 1 21 ? 3.806   -0.052  0.687   1.00 0.00 ? 24 ALA A H    11 
ATOM 6325  H HA   . ALA A 1 21 ? 5.259   -2.385  1.422   1.00 0.00 ? 24 ALA A HA   11 
ATOM 6326  H HB1  . ALA A 1 21 ? 4.353   -1.966  3.682   1.00 0.00 ? 24 ALA A HB1  11 
ATOM 6327  H HB2  . ALA A 1 21 ? 3.305   -0.719  3.005   1.00 0.00 ? 24 ALA A HB2  11 
ATOM 6328  H HB3  . ALA A 1 21 ? 5.057   -0.524  2.949   1.00 0.00 ? 24 ALA A HB3  11 
ATOM 6329  N N    . LYS A 1 22 ? 1.971   -2.673  1.246   1.00 0.00 ? 25 LYS A N    11 
ATOM 6330  C CA   . LYS A 1 22 ? 0.881   -3.631  1.157   1.00 0.00 ? 25 LYS A CA   11 
ATOM 6331  C C    . LYS A 1 22 ? 1.144   -4.639  0.044   1.00 0.00 ? 25 LYS A C    11 
ATOM 6332  O O    . LYS A 1 22 ? 1.015   -5.847  0.244   1.00 0.00 ? 25 LYS A O    11 
ATOM 6333  C CB   . LYS A 1 22 ? -0.430  -2.888  0.905   1.00 0.00 ? 25 LYS A CB   11 
ATOM 6334  C CG   . LYS A 1 22 ? -1.570  -3.367  1.775   1.00 0.00 ? 25 LYS A CG   11 
ATOM 6335  C CD   . LYS A 1 22 ? -2.635  -4.079  0.951   1.00 0.00 ? 25 LYS A CD   11 
ATOM 6336  C CE   . LYS A 1 22 ? -3.497  -4.993  1.807   1.00 0.00 ? 25 LYS A CE   11 
ATOM 6337  N NZ   . LYS A 1 22 ? -4.645  -5.549  1.031   1.00 0.00 ? 25 LYS A NZ   11 
ATOM 6338  H H    . LYS A 1 22 ? 1.768   -1.722  1.114   1.00 0.00 ? 25 LYS A H    11 
ATOM 6339  H HA   . LYS A 1 22 ? 0.818   -4.156  2.098   1.00 0.00 ? 25 LYS A HA   11 
ATOM 6340  H HB2  . LYS A 1 22 ? -0.277  -1.834  1.104   1.00 0.00 ? 25 LYS A HB2  11 
ATOM 6341  H HB3  . LYS A 1 22 ? -0.714  -3.012  -0.129  1.00 0.00 ? 25 LYS A HB3  11 
ATOM 6342  H HG2  . LYS A 1 22 ? -1.178  -4.048  2.515   1.00 0.00 ? 25 LYS A HG2  11 
ATOM 6343  H HG3  . LYS A 1 22 ? -2.009  -2.513  2.264   1.00 0.00 ? 25 LYS A HG3  11 
ATOM 6344  H HD2  . LYS A 1 22 ? -3.267  -3.338  0.486   1.00 0.00 ? 25 LYS A HD2  11 
ATOM 6345  H HD3  . LYS A 1 22 ? -2.148  -4.670  0.188   1.00 0.00 ? 25 LYS A HD3  11 
ATOM 6346  H HE2  . LYS A 1 22 ? -2.885  -5.807  2.170   1.00 0.00 ? 25 LYS A HE2  11 
ATOM 6347  H HE3  . LYS A 1 22 ? -3.877  -4.426  2.646   1.00 0.00 ? 25 LYS A HE3  11 
ATOM 6348  H HZ1  . LYS A 1 22 ? -4.296  -6.098  0.218   1.00 0.00 ? 25 LYS A HZ1  11 
ATOM 6349  H HZ2  . LYS A 1 22 ? -5.246  -4.776  0.679   1.00 0.00 ? 25 LYS A HZ2  11 
ATOM 6350  H HZ3  . LYS A 1 22 ? -5.221  -6.172  1.635   1.00 0.00 ? 25 LYS A HZ3  11 
ATOM 6351  N N    . ASN A 1 23 ? 1.533   -4.130  -1.123  1.00 0.00 ? 26 ASN A N    11 
ATOM 6352  C CA   . ASN A 1 23 ? 1.833   -4.990  -2.270  1.00 0.00 ? 26 ASN A CA   11 
ATOM 6353  C C    . ASN A 1 23 ? 2.967   -5.961  -1.929  1.00 0.00 ? 26 ASN A C    11 
ATOM 6354  O O    . ASN A 1 23 ? 2.906   -7.141  -2.283  1.00 0.00 ? 26 ASN A O    11 
ATOM 6355  C CB   . ASN A 1 23 ? 2.172   -4.138  -3.509  1.00 0.00 ? 26 ASN A CB   11 
ATOM 6356  C CG   . ASN A 1 23 ? 3.576   -4.359  -4.041  1.00 0.00 ? 26 ASN A CG   11 
ATOM 6357  O OD1  . ASN A 1 23 ? 3.785   -5.149  -4.953  1.00 0.00 ? 26 ASN A OD1  11 
ATOM 6358  N ND2  . ASN A 1 23 ? 4.548   -3.664  -3.471  1.00 0.00 ? 26 ASN A ND2  11 
ATOM 6359  H H    . ASN A 1 23 ? 1.631   -3.148  -1.210  1.00 0.00 ? 26 ASN A H    11 
ATOM 6360  H HA   . ASN A 1 23 ? 0.947   -5.572  -2.480  1.00 0.00 ? 26 ASN A HA   11 
ATOM 6361  H HB2  . ASN A 1 23 ? 1.477   -4.379  -4.299  1.00 0.00 ? 26 ASN A HB2  11 
ATOM 6362  H HB3  . ASN A 1 23 ? 2.066   -3.094  -3.259  1.00 0.00 ? 26 ASN A HB3  11 
ATOM 6363  H HD21 . ASN A 1 23 ? 4.317   -3.049  -2.739  1.00 0.00 ? 26 ASN A HD21 11 
ATOM 6364  H HD22 . ASN A 1 23 ? 5.458   -3.793  -3.803  1.00 0.00 ? 26 ASN A HD22 11 
ATOM 6365  N N    . LEU A 1 24 ? 3.986   -5.465  -1.224  1.00 0.00 ? 27 LEU A N    11 
ATOM 6366  C CA   . LEU A 1 24 ? 5.120   -6.297  -0.823  1.00 0.00 ? 27 LEU A CA   11 
ATOM 6367  C C    . LEU A 1 24 ? 4.651   -7.491  -0.004  1.00 0.00 ? 27 LEU A C    11 
ATOM 6368  O O    . LEU A 1 24 ? 5.041   -8.626  -0.255  1.00 0.00 ? 27 LEU A O    11 
ATOM 6369  C CB   . LEU A 1 24 ? 6.135   -5.474  -0.021  1.00 0.00 ? 27 LEU A CB   11 
ATOM 6370  C CG   . LEU A 1 24 ? 6.930   -4.444  -0.828  1.00 0.00 ? 27 LEU A CG   11 
ATOM 6371  C CD1  . LEU A 1 24 ? 7.425   -3.327  0.076   1.00 0.00 ? 27 LEU A CD1  11 
ATOM 6372  C CD2  . LEU A 1 24 ? 8.098   -5.110  -1.538  1.00 0.00 ? 27 LEU A CD2  11 
ATOM 6373  H H    . LEU A 1 24 ? 3.970   -4.521  -0.959  1.00 0.00 ? 27 LEU A H    11 
ATOM 6374  H HA   . LEU A 1 24 ? 5.583   -6.662  -1.710  1.00 0.00 ? 27 LEU A HA   11 
ATOM 6375  H HB2  . LEU A 1 24 ? 5.603   -4.953  0.762   1.00 0.00 ? 27 LEU A HB2  11 
ATOM 6376  H HB3  . LEU A 1 24 ? 6.835   -6.155  0.438   1.00 0.00 ? 27 LEU A HB3  11 
ATOM 6377  H HG   . LEU A 1 24 ? 6.285   -4.008  -1.576  1.00 0.00 ? 27 LEU A HG   11 
ATOM 6378  H HD11 . LEU A 1 24 ? 6.849   -2.433  -0.108  1.00 0.00 ? 27 LEU A HD11 11 
ATOM 6379  H HD12 . LEU A 1 24 ? 8.468   -3.134  -0.129  1.00 0.00 ? 27 LEU A HD12 11 
ATOM 6380  H HD13 . LEU A 1 24 ? 7.311   -3.622  1.109   1.00 0.00 ? 27 LEU A HD13 11 
ATOM 6381  H HD21 . LEU A 1 24 ? 7.808   -5.368  -2.545  1.00 0.00 ? 27 LEU A HD21 11 
ATOM 6382  H HD22 . LEU A 1 24 ? 8.379   -6.007  -1.006  1.00 0.00 ? 27 LEU A HD22 11 
ATOM 6383  H HD23 . LEU A 1 24 ? 8.937   -4.432  -1.567  1.00 0.00 ? 27 LEU A HD23 11 
ATOM 6384  N N    . ARG A 1 25 ? 3.807   -7.208  0.971   1.00 0.00 ? 28 ARG A N    11 
ATOM 6385  C CA   . ARG A 1 25 ? 3.252   -8.235  1.854   1.00 0.00 ? 28 ARG A CA   11 
ATOM 6386  C C    . ARG A 1 25 ? 2.164   -9.055  1.156   1.00 0.00 ? 28 ARG A C    11 
ATOM 6387  O O    . ARG A 1 25 ? 2.116   -10.281 1.302   1.00 0.00 ? 28 ARG A O    11 
ATOM 6388  C CB   . ARG A 1 25 ? 2.683   -7.584  3.120   1.00 0.00 ? 28 ARG A CB   11 
ATOM 6389  C CG   . ARG A 1 25 ? 3.391   -8.017  4.392   1.00 0.00 ? 28 ARG A CG   11 
ATOM 6390  C CD   . ARG A 1 25 ? 2.400   -8.358  5.496   1.00 0.00 ? 28 ARG A CD   11 
ATOM 6391  N NE   . ARG A 1 25 ? 2.487   -9.764  5.903   1.00 0.00 ? 28 ARG A NE   11 
ATOM 6392  C CZ   . ARG A 1 25 ? 1.553   -10.402 6.600   1.00 0.00 ? 28 ARG A CZ   11 
ATOM 6393  N NH1  . ARG A 1 25 ? 0.463   -9.774  7.000   1.00 0.00 ? 28 ARG A NH1  11 
ATOM 6394  N NH2  . ARG A 1 25 ? 1.719   -11.671 6.911   1.00 0.00 ? 28 ARG A NH2  11 
ATOM 6395  H H    . ARG A 1 25 ? 3.549   -6.276  1.096   1.00 0.00 ? 28 ARG A H    11 
ATOM 6396  H HA   . ARG A 1 25 ? 4.054   -8.902  2.133   1.00 0.00 ? 28 ARG A HA   11 
ATOM 6397  H HB2  . ARG A 1 25 ? 2.772   -6.510  3.032   1.00 0.00 ? 28 ARG A HB2  11 
ATOM 6398  H HB3  . ARG A 1 25 ? 1.638   -7.843  3.207   1.00 0.00 ? 28 ARG A HB3  11 
ATOM 6399  H HG2  . ARG A 1 25 ? 3.991   -8.886  4.175   1.00 0.00 ? 28 ARG A HG2  11 
ATOM 6400  H HG3  . ARG A 1 25 ? 4.030   -7.213  4.728   1.00 0.00 ? 28 ARG A HG3  11 
ATOM 6401  H HD2  . ARG A 1 25 ? 2.607   -7.731  6.353   1.00 0.00 ? 28 ARG A HD2  11 
ATOM 6402  H HD3  . ARG A 1 25 ? 1.401   -8.155  5.138   1.00 0.00 ? 28 ARG A HD3  11 
ATOM 6403  H HE   . ARG A 1 25 ? 3.289   -10.260 5.639   1.00 0.00 ? 28 ARG A HE   11 
ATOM 6404  H HH11 . ARG A 1 25 ? 0.333   -8.809  6.781   1.00 0.00 ? 28 ARG A HH11 11 
ATOM 6405  H HH12 . ARG A 1 25 ? -0.231  -10.262 7.526   1.00 0.00 ? 28 ARG A HH12 11 
ATOM 6406  H HH21 . ARG A 1 25 ? 2.546   -12.152 6.623   1.00 0.00 ? 28 ARG A HH21 11 
ATOM 6407  H HH22 . ARG A 1 25 ? 1.021   -12.153 7.436   1.00 0.00 ? 28 ARG A HH22 11 
ATOM 6408  N N    . ALA A 1 26 ? 1.305   -8.380  0.388   1.00 0.00 ? 29 ALA A N    11 
ATOM 6409  C CA   . ALA A 1 26 ? 0.231   -9.052  -0.337  1.00 0.00 ? 29 ALA A CA   11 
ATOM 6410  C C    . ALA A 1 26 ? 0.806   -10.050 -1.330  1.00 0.00 ? 29 ALA A C    11 
ATOM 6411  O O    . ALA A 1 26 ? 0.235   -11.116 -1.561  1.00 0.00 ? 29 ALA A O    11 
ATOM 6412  C CB   . ALA A 1 26 ? -0.647  -8.029  -1.048  1.00 0.00 ? 29 ALA A CB   11 
ATOM 6413  H H    . ALA A 1 26 ? 1.406   -7.407  0.295   1.00 0.00 ? 29 ALA A H    11 
ATOM 6414  H HA   . ALA A 1 26 ? -0.377  -9.584  0.379   1.00 0.00 ? 29 ALA A HA   11 
ATOM 6415  H HB1  . ALA A 1 26 ? -0.076  -7.543  -1.825  1.00 0.00 ? 29 ALA A HB1  11 
ATOM 6416  H HB2  . ALA A 1 26 ? -0.987  -7.292  -0.336  1.00 0.00 ? 29 ALA A HB2  11 
ATOM 6417  H HB3  . ALA A 1 26 ? -1.500  -8.528  -1.485  1.00 0.00 ? 29 ALA A HB3  11 
ATOM 6418  N N    . GLN A 1 27 ? 1.950   -9.698  -1.909  1.00 0.00 ? 30 GLN A N    11 
ATOM 6419  C CA   . GLN A 1 27 ? 2.614   -10.569 -2.872  1.00 0.00 ? 30 GLN A CA   11 
ATOM 6420  C C    . GLN A 1 27 ? 3.842   -11.249 -2.262  1.00 0.00 ? 30 GLN A C    11 
ATOM 6421  O O    . GLN A 1 27 ? 4.817   -11.548 -2.956  1.00 0.00 ? 30 GLN A O    11 
ATOM 6422  C CB   . GLN A 1 27 ? 2.992   -9.781  -4.128  1.00 0.00 ? 30 GLN A CB   11 
ATOM 6423  C CG   . GLN A 1 27 ? 1.790   -9.206  -4.864  1.00 0.00 ? 30 GLN A CG   11 
ATOM 6424  C CD   . GLN A 1 27 ? 0.950   -10.272 -5.542  1.00 0.00 ? 30 GLN A CD   11 
ATOM 6425  O OE1  . GLN A 1 27 ? 1.071   -10.502 -6.740  1.00 0.00 ? 30 GLN A OE1  11 
ATOM 6426  N NE2  . GLN A 1 27 ? 0.090   -10.934 -4.778  1.00 0.00 ? 30 GLN A NE2  11 
ATOM 6427  H H    . GLN A 1 27 ? 2.356   -8.829  -1.679  1.00 0.00 ? 30 GLN A H    11 
ATOM 6428  H HA   . GLN A 1 27 ? 1.909   -11.341 -3.139  1.00 0.00 ? 30 GLN A HA   11 
ATOM 6429  H HB2  . GLN A 1 27 ? 3.641   -8.965  -3.846  1.00 0.00 ? 30 GLN A HB2  11 
ATOM 6430  H HB3  . GLN A 1 27 ? 3.524   -10.436 -4.805  1.00 0.00 ? 30 GLN A HB3  11 
ATOM 6431  H HG2  . GLN A 1 27 ? 1.169   -8.678  -4.155  1.00 0.00 ? 30 GLN A HG2  11 
ATOM 6432  H HG3  . GLN A 1 27 ? 2.144   -8.515  -5.615  1.00 0.00 ? 30 GLN A HG3  11 
ATOM 6433  H HE21 . GLN A 1 27 ? 0.040   -10.704 -3.827  1.00 0.00 ? 30 GLN A HE21 11 
ATOM 6434  H HE22 . GLN A 1 27 ? -0.459  -11.626 -5.199  1.00 0.00 ? 30 GLN A HE22 11 
ATOM 6435  N N    . ALA A 1 28 ? 3.767   -11.513 -0.963  1.00 0.00 ? 31 ALA A N    11 
ATOM 6436  C CA   . ALA A 1 28 ? 4.837   -12.189 -0.240  1.00 0.00 ? 31 ALA A CA   11 
ATOM 6437  C C    . ALA A 1 28 ? 4.250   -13.162 0.778   1.00 0.00 ? 31 ALA A C    11 
ATOM 6438  O O    . ALA A 1 28 ? 4.657   -14.322 0.849   1.00 0.00 ? 31 ALA A O    11 
ATOM 6439  C CB   . ALA A 1 28 ? 5.751   -11.180 0.441   1.00 0.00 ? 31 ALA A CB   11 
ATOM 6440  H H    . ALA A 1 28 ? 2.955   -11.266 -0.478  1.00 0.00 ? 31 ALA A H    11 
ATOM 6441  H HA   . ALA A 1 28 ? 5.420   -12.749 -0.957  1.00 0.00 ? 31 ALA A HA   11 
ATOM 6442  H HB1  . ALA A 1 28 ? 6.457   -11.700 1.071   1.00 0.00 ? 31 ALA A HB1  11 
ATOM 6443  H HB2  . ALA A 1 28 ? 5.159   -10.506 1.042   1.00 0.00 ? 31 ALA A HB2  11 
ATOM 6444  H HB3  . ALA A 1 28 ? 6.284   -10.615 -0.310  1.00 0.00 ? 31 ALA A HB3  11 
ATOM 6445  N N    . ALA A 1 29 ? 3.279   -12.683 1.556   1.00 0.00 ? 32 ALA A N    11 
ATOM 6446  C CA   . ALA A 1 29 ? 2.626   -13.512 2.560   1.00 0.00 ? 32 ALA A CA   11 
ATOM 6447  C C    . ALA A 1 29 ? 1.372   -14.213 2.012   1.00 0.00 ? 32 ALA A C    11 
ATOM 6448  O O    . ALA A 1 29 ? 0.770   -15.026 2.713   1.00 0.00 ? 32 ALA A O    11 
ATOM 6449  C CB   . ALA A 1 29 ? 2.274   -12.667 3.776   1.00 0.00 ? 32 ALA A CB   11 
ATOM 6450  H H    . ALA A 1 29 ? 2.992   -11.745 1.449   1.00 0.00 ? 32 ALA A H    11 
ATOM 6451  H HA   . ALA A 1 29 ? 3.332   -14.266 2.874   1.00 0.00 ? 32 ALA A HA   11 
ATOM 6452  H HB1  . ALA A 1 29 ? 3.177   -12.261 4.205   1.00 0.00 ? 32 ALA A HB1  11 
ATOM 6453  H HB2  . ALA A 1 29 ? 1.772   -13.282 4.508   1.00 0.00 ? 32 ALA A HB2  11 
ATOM 6454  H HB3  . ALA A 1 29 ? 1.622   -11.859 3.476   1.00 0.00 ? 32 ALA A HB3  11 
ATOM 6455  N N    . ALA A 1 30 ? 0.965   -13.896 0.771   1.00 0.00 ? 33 ALA A N    11 
ATOM 6456  C CA   . ALA A 1 30 ? -0.232  -14.515 0.191   1.00 0.00 ? 33 ALA A CA   11 
ATOM 6457  C C    . ALA A 1 30 ? 0.087   -15.518 -0.917  1.00 0.00 ? 33 ALA A C    11 
ATOM 6458  O O    . ALA A 1 30 ? -0.614  -16.517 -1.082  1.00 0.00 ? 33 ALA A O    11 
ATOM 6459  C CB   . ALA A 1 30 ? -1.181  -13.440 -0.319  1.00 0.00 ? 33 ALA A CB   11 
ATOM 6460  H H    . ALA A 1 30 ? 1.466   -13.230 0.244   1.00 0.00 ? 33 ALA A H    11 
ATOM 6461  H HA   . ALA A 1 30 ? -0.726  -15.043 0.973   1.00 0.00 ? 33 ALA A HA   11 
ATOM 6462  H HB1  . ALA A 1 30 ? -1.162  -12.594 0.351   1.00 0.00 ? 33 ALA A HB1  11 
ATOM 6463  H HB2  . ALA A 1 30 ? -2.184  -13.838 -0.368  1.00 0.00 ? 33 ALA A HB2  11 
ATOM 6464  H HB3  . ALA A 1 30 ? -0.872  -13.125 -1.306  1.00 0.00 ? 33 ALA A HB3  11 
ATOM 6465  N N    . ASN A 1 31 ? 1.133   -15.241 -1.669  1.00 0.00 ? 34 ASN A N    11 
ATOM 6466  C CA   . ASN A 1 31 ? 1.548   -16.106 -2.776  1.00 0.00 ? 34 ASN A CA   11 
ATOM 6467  C C    . ASN A 1 31 ? 2.473   -17.230 -2.302  1.00 0.00 ? 34 ASN A C    11 
ATOM 6468  O O    . ASN A 1 31 ? 2.212   -18.407 -2.560  1.00 0.00 ? 34 ASN A O    11 
ATOM 6469  C CB   . ASN A 1 31 ? 2.235   -15.279 -3.873  1.00 0.00 ? 34 ASN A CB   11 
ATOM 6470  C CG   . ASN A 1 31 ? 3.407   -14.472 -3.349  1.00 0.00 ? 34 ASN A CG   11 
ATOM 6471  O OD1  . ASN A 1 31 ? 3.426   -14.070 -2.187  1.00 0.00 ? 34 ASN A OD1  11 
ATOM 6472  N ND2  . ASN A 1 31 ? 4.394   -14.236 -4.196  1.00 0.00 ? 34 ASN A ND2  11 
ATOM 6473  H H    . ASN A 1 31 ? 1.640   -14.429 -1.479  1.00 0.00 ? 34 ASN A H    11 
ATOM 6474  H HA   . ASN A 1 31 ? 0.656   -16.553 -3.188  1.00 0.00 ? 34 ASN A HA   11 
ATOM 6475  H HB2  . ASN A 1 31 ? 2.596   -15.943 -4.643  1.00 0.00 ? 34 ASN A HB2  11 
ATOM 6476  H HB3  . ASN A 1 31 ? 1.516   -14.597 -4.301  1.00 0.00 ? 34 ASN A HB3  11 
ATOM 6477  H HD21 . ASN A 1 31 ? 4.322   -14.589 -5.106  1.00 0.00 ? 34 ASN A HD21 11 
ATOM 6478  H HD22 . ASN A 1 31 ? 5.160   -13.719 -3.873  1.00 0.00 ? 34 ASN A HD22 11 
ATOM 6479  N N    . ALA A 1 32 ? 3.554   -16.867 -1.609  1.00 0.00 ? 35 ALA A N    11 
ATOM 6480  C CA   . ALA A 1 32 ? 4.510   -17.853 -1.108  1.00 0.00 ? 35 ALA A CA   11 
ATOM 6481  C C    . ALA A 1 32 ? 3.916   -18.718 0.006   1.00 0.00 ? 35 ALA A C    11 
ATOM 6482  O O    . ALA A 1 32 ? 4.413   -19.808 0.292   1.00 0.00 ? 35 ALA A O    11 
ATOM 6483  C CB   . ALA A 1 32 ? 5.782   -17.162 -0.634  1.00 0.00 ? 35 ALA A CB   11 
ATOM 6484  H H    . ALA A 1 32 ? 3.712   -15.914 -1.431  1.00 0.00 ? 35 ALA A H    11 
ATOM 6485  H HA   . ALA A 1 32 ? 4.765   -18.492 -1.929  1.00 0.00 ? 35 ALA A HA   11 
ATOM 6486  H HB1  . ALA A 1 32 ? 6.496   -17.904 -0.309  1.00 0.00 ? 35 ALA A HB1  11 
ATOM 6487  H HB2  . ALA A 1 32 ? 5.547   -16.502 0.189   1.00 0.00 ? 35 ALA A HB2  11 
ATOM 6488  H HB3  . ALA A 1 32 ? 6.204   -16.587 -1.445  1.00 0.00 ? 35 ALA A HB3  11 
ATOM 6489  N N    . HIS A 1 33 ? 2.850   -18.223 0.622   1.00 0.00 ? 36 HIS A N    11 
ATOM 6490  C CA   . HIS A 1 33 ? 2.171   -18.936 1.707   1.00 0.00 ? 36 HIS A CA   11 
ATOM 6491  C C    . HIS A 1 33 ? 1.597   -20.273 1.238   1.00 0.00 ? 36 HIS A C    11 
ATOM 6492  O O    . HIS A 1 33 ? 1.686   -21.272 1.953   1.00 0.00 ? 36 HIS A O    11 
ATOM 6493  C CB   . HIS A 1 33 ? 1.056   -18.069 2.296   1.00 0.00 ? 36 HIS A CB   11 
ATOM 6494  C CG   . HIS A 1 33 ? 0.648   -18.470 3.680   1.00 0.00 ? 36 HIS A CG   11 
ATOM 6495  N ND1  . HIS A 1 33 ? 0.650   -19.778 4.123   1.00 0.00 ? 36 HIS A ND1  11 
ATOM 6496  C CD2  . HIS A 1 33 ? 0.224   -17.723 4.724   1.00 0.00 ? 36 HIS A CD2  11 
ATOM 6497  C CE1  . HIS A 1 33 ? 0.242   -19.816 5.380   1.00 0.00 ? 36 HIS A CE1  11 
ATOM 6498  N NE2  . HIS A 1 33 ? -0.021  -18.581 5.767   1.00 0.00 ? 36 HIS A NE2  11 
ATOM 6499  H H    . HIS A 1 33 ? 2.510   -17.355 0.337   1.00 0.00 ? 36 HIS A H    11 
ATOM 6500  H HA   . HIS A 1 33 ? 2.903   -19.130 2.478   1.00 0.00 ? 36 HIS A HA   11 
ATOM 6501  H HB2  . HIS A 1 33 ? 1.389   -17.045 2.334   1.00 0.00 ? 36 HIS A HB2  11 
ATOM 6502  H HB3  . HIS A 1 33 ? 0.184   -18.135 1.660   1.00 0.00 ? 36 HIS A HB3  11 
ATOM 6503  H HD1  . HIS A 1 33 ? 0.911   -20.565 3.592   1.00 0.00 ? 36 HIS A HD1  11 
ATOM 6504  H HD2  . HIS A 1 33 ? 0.101   -16.648 4.733   1.00 0.00 ? 36 HIS A HD2  11 
ATOM 6505  H HE1  . HIS A 1 33 ? 0.142   -20.705 5.986   1.00 0.00 ? 36 HIS A HE1  11 
ATOM 6506  H HE2  . HIS A 1 33 ? -0.260  -18.314 6.679   1.00 0.00 ? 36 HIS A HE2  11 
ATOM 6507  N N    . LEU A 1 34 ? 1.002   -20.288 0.044   1.00 0.00 ? 37 LEU A N    11 
ATOM 6508  C CA   . LEU A 1 34 ? 0.416   -21.515 -0.500  1.00 0.00 ? 37 LEU A CA   11 
ATOM 6509  C C    . LEU A 1 34 ? 1.456   -22.332 -1.261  1.00 0.00 ? 37 LEU A C    11 
ATOM 6510  O O    . LEU A 1 34 ? 1.456   -23.564 -1.211  1.00 0.00 ? 37 LEU A O    11 
ATOM 6511  C CB   . LEU A 1 34 ? -0.782  -21.189 -1.403  1.00 0.00 ? 37 LEU A CB   11 
ATOM 6512  C CG   . LEU A 1 34 ? -0.465  -20.366 -2.655  1.00 0.00 ? 37 LEU A CG   11 
ATOM 6513  C CD1  . LEU A 1 34 ? -0.413  -21.261 -3.883  1.00 0.00 ? 37 LEU A CD1  11 
ATOM 6514  C CD2  . LEU A 1 34 ? -1.495  -19.267 -2.845  1.00 0.00 ? 37 LEU A CD2  11 
ATOM 6515  H H    . LEU A 1 34 ? 0.954   -19.459 -0.478  1.00 0.00 ? 37 LEU A H    11 
ATOM 6516  H HA   . LEU A 1 34 ? 0.080   -22.100 0.326   1.00 0.00 ? 37 LEU A HA   11 
ATOM 6517  H HB2  . LEU A 1 34 ? -1.231  -22.121 -1.715  1.00 0.00 ? 37 LEU A HB2  11 
ATOM 6518  H HB3  . LEU A 1 34 ? -1.506  -20.643 -0.816  1.00 0.00 ? 37 LEU A HB3  11 
ATOM 6519  H HG   . LEU A 1 34 ? 0.504   -19.901 -2.541  1.00 0.00 ? 37 LEU A HG   11 
ATOM 6520  H HD11 . LEU A 1 34 ? 0.349   -22.014 -3.748  1.00 0.00 ? 37 LEU A HD11 11 
ATOM 6521  H HD12 . LEU A 1 34 ? -0.181  -20.665 -4.753  1.00 0.00 ? 37 LEU A HD12 11 
ATOM 6522  H HD13 . LEU A 1 34 ? -1.372  -21.740 -4.019  1.00 0.00 ? 37 LEU A HD13 11 
ATOM 6523  H HD21 . LEU A 1 34 ? -1.432  -18.567 -2.025  1.00 0.00 ? 37 LEU A HD21 11 
ATOM 6524  H HD22 . LEU A 1 34 ? -2.483  -19.701 -2.872  1.00 0.00 ? 37 LEU A HD22 11 
ATOM 6525  H HD23 . LEU A 1 34 ? -1.303  -18.750 -3.774  1.00 0.00 ? 37 LEU A HD23 11 
ATOM 6526  N N    . MET A 1 35 ? 2.342   -21.628 -1.947  1.00 0.00 ? 38 MET A N    11 
ATOM 6527  C CA   . MET A 1 35 ? 3.411   -22.260 -2.723  1.00 0.00 ? 38 MET A CA   11 
ATOM 6528  C C    . MET A 1 35 ? 4.346   -23.069 -1.830  1.00 0.00 ? 38 MET A C    11 
ATOM 6529  O O    . MET A 1 35 ? 4.862   -24.112 -2.231  1.00 0.00 ? 38 MET A O    11 
ATOM 6530  C CB   . MET A 1 35 ? 4.201   -21.204 -3.504  1.00 0.00 ? 38 MET A CB   11 
ATOM 6531  C CG   . MET A 1 35 ? 4.418   -21.561 -4.967  1.00 0.00 ? 38 MET A CG   11 
ATOM 6532  S SD   . MET A 1 35 ? 2.900   -21.472 -5.938  1.00 0.00 ? 38 MET A SD   11 
ATOM 6533  C CE   . MET A 1 35 ? 2.503   -19.731 -5.797  1.00 0.00 ? 38 MET A CE   11 
ATOM 6534  H H    . MET A 1 35 ? 2.277   -20.655 -1.922  1.00 0.00 ? 38 MET A H    11 
ATOM 6535  H HA   . MET A 1 35 ? 2.951   -22.932 -3.413  1.00 0.00 ? 38 MET A HA   11 
ATOM 6536  H HB2  . MET A 1 35 ? 3.666   -20.266 -3.462  1.00 0.00 ? 38 MET A HB2  11 
ATOM 6537  H HB3  . MET A 1 35 ? 5.169   -21.077 -3.040  1.00 0.00 ? 38 MET A HB3  11 
ATOM 6538  H HG2  . MET A 1 35 ? 5.139   -20.877 -5.389  1.00 0.00 ? 38 MET A HG2  11 
ATOM 6539  H HG3  . MET A 1 35 ? 4.804   -22.569 -5.023  1.00 0.00 ? 38 MET A HG3  11 
ATOM 6540  H HE1  . MET A 1 35 ? 3.415   -19.155 -5.757  1.00 0.00 ? 38 MET A HE1  11 
ATOM 6541  H HE2  . MET A 1 35 ? 1.932   -19.564 -4.895  1.00 0.00 ? 38 MET A HE2  11 
ATOM 6542  H HE3  . MET A 1 35 ? 1.921   -19.423 -6.653  1.00 0.00 ? 38 MET A HE3  11 
ATOM 6543  N N    . ALA A 1 36 ? 4.543   -22.581 -0.616  1.00 0.00 ? 39 ALA A N    11 
ATOM 6544  C CA   . ALA A 1 36 ? 5.402   -23.249 0.361   1.00 0.00 ? 39 ALA A CA   11 
ATOM 6545  C C    . ALA A 1 36 ? 4.594   -24.151 1.308   1.00 0.00 ? 39 ALA A C    11 
ATOM 6546  O O    . ALA A 1 36 ? 5.096   -24.570 2.353   1.00 0.00 ? 39 ALA A O    11 
ATOM 6547  C CB   . ALA A 1 36 ? 6.192   -22.214 1.151   1.00 0.00 ? 39 ALA A CB   11 
ATOM 6548  H H    . ALA A 1 36 ? 4.090   -21.751 -0.370  1.00 0.00 ? 39 ALA A H    11 
ATOM 6549  H HA   . ALA A 1 36 ? 6.106   -23.863 -0.183  1.00 0.00 ? 39 ALA A HA   11 
ATOM 6550  H HB1  . ALA A 1 36 ? 5.511   -21.508 1.603   1.00 0.00 ? 39 ALA A HB1  11 
ATOM 6551  H HB2  . ALA A 1 36 ? 6.864   -21.691 0.486   1.00 0.00 ? 39 ALA A HB2  11 
ATOM 6552  H HB3  . ALA A 1 36 ? 6.763   -22.709 1.923   1.00 0.00 ? 39 ALA A HB3  11 
ATOM 6553  N N    . GLN A 1 37 ? 3.346   -24.451 0.936   1.00 0.00 ? 40 GLN A N    11 
ATOM 6554  C CA   . GLN A 1 37 ? 2.480   -25.302 1.748   1.00 0.00 ? 40 GLN A CA   11 
ATOM 6555  C C    . GLN A 1 37 ? 2.193   -26.628 1.042   1.00 0.00 ? 40 GLN A C    11 
ATOM 6556  O O    . GLN A 1 37 ? 2.442   -27.698 1.603   1.00 0.00 ? 40 GLN A O    11 
ATOM 6557  C CB   . GLN A 1 37 ? 1.169   -24.573 2.062   1.00 0.00 ? 40 GLN A CB   11 
ATOM 6558  C CG   . GLN A 1 37 ? 0.172   -25.413 2.853   1.00 0.00 ? 40 GLN A CG   11 
ATOM 6559  C CD   . GLN A 1 37 ? -1.225  -25.369 2.265   1.00 0.00 ? 40 GLN A CD   11 
ATOM 6560  O OE1  . GLN A 1 37 ? -1.972  -24.419 2.484   1.00 0.00 ? 40 GLN A OE1  11 
ATOM 6561  N NE2  . GLN A 1 37 ? -1.589  -26.398 1.516   1.00 0.00 ? 40 GLN A NE2  11 
ATOM 6562  H H    . GLN A 1 37 ? 2.999   -24.095 0.095   1.00 0.00 ? 40 GLN A H    11 
ATOM 6563  H HA   . GLN A 1 37 ? 2.996   -25.508 2.672   1.00 0.00 ? 40 GLN A HA   11 
ATOM 6564  H HB2  . GLN A 1 37 ? 1.393   -23.684 2.634   1.00 0.00 ? 40 GLN A HB2  11 
ATOM 6565  H HB3  . GLN A 1 37 ? 0.704   -24.281 1.131   1.00 0.00 ? 40 GLN A HB3  11 
ATOM 6566  H HG2  . GLN A 1 37 ? 0.508   -26.438 2.862   1.00 0.00 ? 40 GLN A HG2  11 
ATOM 6567  H HG3  . GLN A 1 37 ? 0.130   -25.039 3.865   1.00 0.00 ? 40 GLN A HG3  11 
ATOM 6568  H HE21 . GLN A 1 37 ? -0.945  -27.131 1.379   1.00 0.00 ? 40 GLN A HE21 11 
ATOM 6569  H HE22 . GLN A 1 37 ? -2.485  -26.386 1.125   1.00 0.00 ? 40 GLN A HE22 11 
ATOM 6570  N N    . ILE A 1 38 ? 1.667   -26.539 -0.186  1.00 0.00 ? 41 ILE A N    11 
ATOM 6571  C CA   . ILE A 1 38 ? 1.331   -27.719 -0.994  1.00 0.00 ? 41 ILE A CA   11 
ATOM 6572  C C    . ILE A 1 38 ? -0.010  -28.325 -0.568  1.00 0.00 ? 41 ILE A C    11 
ATOM 6573  O O    . ILE A 1 38 ? -0.189  -28.594 0.641   1.00 0.00 ? 41 ILE A O    11 
ATOM 6574  C CB   . ILE A 1 38 ? 2.429   -28.809 -0.934  1.00 0.00 ? 41 ILE A CB   11 
ATOM 6575  C CG1  . ILE A 1 38 ? 3.818   -28.202 -1.178  1.00 0.00 ? 41 ILE A CG1  11 
ATOM 6576  C CG2  . ILE A 1 38 ? 2.148   -29.904 -1.952  1.00 0.00 ? 41 ILE A CG2  11 
ATOM 6577  C CD1  . ILE A 1 38 ? 3.922   -27.407 -2.462  1.00 0.00 ? 41 ILE A CD1  11 
ATOM 6578  O OXT  . ILE A 1 38 ? -0.873  -28.517 -1.449  1.00 0.00 ? 41 ILE A OXT  11 
ATOM 6579  H H    . ILE A 1 38 ? 1.496   -25.651 -0.562  1.00 0.00 ? 41 ILE A H    11 
ATOM 6580  H HA   . ILE A 1 38 ? 1.242   -27.394 -2.020  1.00 0.00 ? 41 ILE A HA   11 
ATOM 6581  H HB   . ILE A 1 38 ? 2.405   -29.252 0.048   1.00 0.00 ? 41 ILE A HB   11 
ATOM 6582  H HG12 . ILE A 1 38 ? 4.063   -27.543 -0.360  1.00 0.00 ? 41 ILE A HG12 11 
ATOM 6583  H HG13 . ILE A 1 38 ? 4.546   -28.999 -1.220  1.00 0.00 ? 41 ILE A HG13 11 
ATOM 6584  H HG21 . ILE A 1 38 ? 2.758   -30.767 -1.730  1.00 0.00 ? 41 ILE A HG21 11 
ATOM 6585  H HG22 . ILE A 1 38 ? 2.379   -29.544 -2.943  1.00 0.00 ? 41 ILE A HG22 11 
ATOM 6586  H HG23 . ILE A 1 38 ? 1.103   -30.180 -1.904  1.00 0.00 ? 41 ILE A HG23 11 
ATOM 6587  H HD11 . ILE A 1 38 ? 3.686   -26.372 -2.265  1.00 0.00 ? 41 ILE A HD11 11 
ATOM 6588  H HD12 . ILE A 1 38 ? 3.229   -27.804 -3.189  1.00 0.00 ? 41 ILE A HD12 11 
ATOM 6589  H HD13 . ILE A 1 38 ? 4.929   -27.479 -2.849  1.00 0.00 ? 41 ILE A HD13 11 
ATOM 6590  N N    . PHE A 1 1  ? -6.261  26.184  -3.542  1.00 0.00 ? 4  PHE A N    12 
ATOM 6591  C CA   . PHE A 1 1  ? -6.524  24.819  -2.998  1.00 0.00 ? 4  PHE A CA   12 
ATOM 6592  C C    . PHE A 1 1  ? -6.562  23.776  -4.118  1.00 0.00 ? 4  PHE A C    12 
ATOM 6593  O O    . PHE A 1 1  ? -6.536  24.128  -5.297  1.00 0.00 ? 4  PHE A O    12 
ATOM 6594  C CB   . PHE A 1 1  ? -7.860  24.835  -2.237  1.00 0.00 ? 4  PHE A CB   12 
ATOM 6595  C CG   . PHE A 1 1  ? -8.984  25.498  -2.987  1.00 0.00 ? 4  PHE A CG   12 
ATOM 6596  C CD1  . PHE A 1 1  ? -9.585  24.864  -4.064  1.00 0.00 ? 4  PHE A CD1  12 
ATOM 6597  C CD2  . PHE A 1 1  ? -9.433  26.755  -2.618  1.00 0.00 ? 4  PHE A CD2  12 
ATOM 6598  C CE1  . PHE A 1 1  ? -10.614 25.473  -4.756  1.00 0.00 ? 4  PHE A CE1  12 
ATOM 6599  C CE2  . PHE A 1 1  ? -10.461 27.368  -3.308  1.00 0.00 ? 4  PHE A CE2  12 
ATOM 6600  C CZ   . PHE A 1 1  ? -11.053 26.727  -4.377  1.00 0.00 ? 4  PHE A CZ   12 
ATOM 6601  H H1   . PHE A 1 1  ? -5.258  26.231  -3.814  1.00 0.00 ? 4  PHE A H1   12 
ATOM 6602  H H2   . PHE A 1 1  ? -6.479  26.875  -2.794  1.00 0.00 ? 4  PHE A H2   12 
ATOM 6603  H H3   . PHE A 1 1  ? -6.878  26.321  -4.370  1.00 0.00 ? 4  PHE A H3   12 
ATOM 6604  H HA   . PHE A 1 1  ? -5.729  24.564  -2.312  1.00 0.00 ? 4  PHE A HA   12 
ATOM 6605  H HB2  . PHE A 1 1  ? -8.160  23.819  -2.026  1.00 0.00 ? 4  PHE A HB2  12 
ATOM 6606  H HB3  . PHE A 1 1  ? -7.727  25.363  -1.303  1.00 0.00 ? 4  PHE A HB3  12 
ATOM 6607  H HD1  . PHE A 1 1  ? -9.245  23.883  -4.360  1.00 0.00 ? 4  PHE A HD1  12 
ATOM 6608  H HD2  . PHE A 1 1  ? -8.973  27.258  -1.781  1.00 0.00 ? 4  PHE A HD2  12 
ATOM 6609  H HE1  . PHE A 1 1  ? -11.075 24.969  -5.592  1.00 0.00 ? 4  PHE A HE1  12 
ATOM 6610  H HE2  . PHE A 1 1  ? -10.804 28.349  -3.009  1.00 0.00 ? 4  PHE A HE2  12 
ATOM 6611  H HZ   . PHE A 1 1  ? -11.857 27.205  -4.918  1.00 0.00 ? 4  PHE A HZ   12 
ATOM 6612  N N    . THR A 1 2  ? -6.622  22.498  -3.744  1.00 0.00 ? 5  THR A N    12 
ATOM 6613  C CA   . THR A 1 2  ? -6.664  21.412  -4.710  1.00 0.00 ? 5  THR A CA   12 
ATOM 6614  C C    . THR A 1 2  ? -8.109  20.960  -4.935  1.00 0.00 ? 5  THR A C    12 
ATOM 6615  O O    . THR A 1 2  ? -9.049  21.730  -4.722  1.00 0.00 ? 5  THR A O    12 
ATOM 6616  C CB   . THR A 1 2  ? -5.794  20.240  -4.219  1.00 0.00 ? 5  THR A CB   12 
ATOM 6617  O OG1  . THR A 1 2  ? -5.041  20.609  -3.076  1.00 0.00 ? 5  THR A OG1  12 
ATOM 6618  C CG2  . THR A 1 2  ? -4.818  19.740  -5.261  1.00 0.00 ? 5  THR A CG2  12 
ATOM 6619  H H    . THR A 1 2  ? -6.641  22.272  -2.796  1.00 0.00 ? 5  THR A H    12 
ATOM 6620  H HA   . THR A 1 2  ? -6.265  21.781  -5.643  1.00 0.00 ? 5  THR A HA   12 
ATOM 6621  H HB   . THR A 1 2  ? -6.437  19.415  -3.944  1.00 0.00 ? 5  THR A HB   12 
ATOM 6622  H HG1  . THR A 1 2  ? -4.546  19.850  -2.754  1.00 0.00 ? 5  THR A HG1  12 
ATOM 6623  H HG21 . THR A 1 2  ? -5.338  19.572  -6.192  1.00 0.00 ? 5  THR A HG21 12 
ATOM 6624  H HG22 . THR A 1 2  ? -4.374  18.815  -4.924  1.00 0.00 ? 5  THR A HG22 12 
ATOM 6625  H HG23 . THR A 1 2  ? -4.043  20.478  -5.409  1.00 0.00 ? 5  THR A HG23 12 
ATOM 6626  N N    . LEU A 1 3  ? -8.275  19.713  -5.361  1.00 0.00 ? 6  LEU A N    12 
ATOM 6627  C CA   . LEU A 1 3  ? -9.601  19.140  -5.619  1.00 0.00 ? 6  LEU A CA   12 
ATOM 6628  C C    . LEU A 1 3  ? -9.484  17.730  -6.210  1.00 0.00 ? 6  LEU A C    12 
ATOM 6629  O O    . LEU A 1 3  ? -9.440  17.556  -7.428  1.00 0.00 ? 6  LEU A O    12 
ATOM 6630  C CB   . LEU A 1 3  ? -10.412 20.045  -6.564  1.00 0.00 ? 6  LEU A CB   12 
ATOM 6631  C CG   . LEU A 1 3  ? -9.686  20.483  -7.840  1.00 0.00 ? 6  LEU A CG   12 
ATOM 6632  C CD1  . LEU A 1 3  ? -10.415 19.970  -9.071  1.00 0.00 ? 6  LEU A CD1  12 
ATOM 6633  C CD2  . LEU A 1 3  ? -9.562  21.997  -7.893  1.00 0.00 ? 6  LEU A CD2  12 
ATOM 6634  H H    . LEU A 1 3  ? -7.484  19.162  -5.504  1.00 0.00 ? 6  LEU A H    12 
ATOM 6635  H HA   . LEU A 1 3  ? -10.118 19.073  -4.673  1.00 0.00 ? 6  LEU A HA   12 
ATOM 6636  H HB2  . LEU A 1 3  ? -11.310 19.516  -6.849  1.00 0.00 ? 6  LEU A HB2  12 
ATOM 6637  H HB3  . LEU A 1 3  ? -10.697 20.932  -6.018  1.00 0.00 ? 6  LEU A HB3  12 
ATOM 6638  H HG   . LEU A 1 3  ? -8.690  20.064  -7.844  1.00 0.00 ? 6  LEU A HG   12 
ATOM 6639  H HD11 . LEU A 1 3  ? -11.410 20.386  -9.099  1.00 0.00 ? 6  LEU A HD11 12 
ATOM 6640  H HD12 . LEU A 1 3  ? -10.476 18.892  -9.029  1.00 0.00 ? 6  LEU A HD12 12 
ATOM 6641  H HD13 . LEU A 1 3  ? -9.874  20.265  -9.957  1.00 0.00 ? 6  LEU A HD13 12 
ATOM 6642  H HD21 . LEU A 1 3  ? -8.968  22.279  -8.748  1.00 0.00 ? 6  LEU A HD21 12 
ATOM 6643  H HD22 . LEU A 1 3  ? -9.087  22.351  -6.991  1.00 0.00 ? 6  LEU A HD22 12 
ATOM 6644  H HD23 . LEU A 1 3  ? -10.546 22.435  -7.978  1.00 0.00 ? 6  LEU A HD23 12 
ATOM 6645  N N    . SER A 1 4  ? -9.428  16.722  -5.339  1.00 0.00 ? 7  SER A N    12 
ATOM 6646  C CA   . SER A 1 4  ? -9.311  15.330  -5.783  1.00 0.00 ? 7  SER A CA   12 
ATOM 6647  C C    . SER A 1 4  ? -9.463  14.355  -4.614  1.00 0.00 ? 7  SER A C    12 
ATOM 6648  O O    . SER A 1 4  ? -8.516  13.653  -4.250  1.00 0.00 ? 7  SER A O    12 
ATOM 6649  C CB   . SER A 1 4  ? -7.967  15.105  -6.487  1.00 0.00 ? 7  SER A CB   12 
ATOM 6650  O OG   . SER A 1 4  ? -7.823  13.753  -6.892  1.00 0.00 ? 7  SER A OG   12 
ATOM 6651  H H    . SER A 1 4  ? -9.461  16.918  -4.379  1.00 0.00 ? 7  SER A H    12 
ATOM 6652  H HA   . SER A 1 4  ? -10.106 15.144  -6.490  1.00 0.00 ? 7  SER A HA   12 
ATOM 6653  H HB2  . SER A 1 4  ? -7.911  15.736  -7.362  1.00 0.00 ? 7  SER A HB2  12 
ATOM 6654  H HB3  . SER A 1 4  ? -7.162  15.355  -5.811  1.00 0.00 ? 7  SER A HB3  12 
ATOM 6655  H HG   . SER A 1 4  ? -7.747  13.189  -6.112  1.00 0.00 ? 7  SER A HG   12 
ATOM 6656  N N    . LEU A 1 5  ? -10.666 14.312  -4.036  1.00 0.00 ? 8  LEU A N    12 
ATOM 6657  C CA   . LEU A 1 5  ? -10.965 13.417  -2.911  1.00 0.00 ? 8  LEU A CA   12 
ATOM 6658  C C    . LEU A 1 5  ? -9.968  13.595  -1.755  1.00 0.00 ? 8  LEU A C    12 
ATOM 6659  O O    . LEU A 1 5  ? -9.543  12.617  -1.141  1.00 0.00 ? 8  LEU A O    12 
ATOM 6660  C CB   . LEU A 1 5  ? -10.967 11.958  -3.388  1.00 0.00 ? 8  LEU A CB   12 
ATOM 6661  C CG   . LEU A 1 5  ? -11.997 11.628  -4.474  1.00 0.00 ? 8  LEU A CG   12 
ATOM 6662  C CD1  . LEU A 1 5  ? -11.387 11.787  -5.858  1.00 0.00 ? 8  LEU A CD1  12 
ATOM 6663  C CD2  . LEU A 1 5  ? -12.528 10.216  -4.288  1.00 0.00 ? 8  LEU A CD2  12 
ATOM 6664  H H    . LEU A 1 5  ? -11.376 14.892  -4.381  1.00 0.00 ? 8  LEU A H    12 
ATOM 6665  H HA   . LEU A 1 5  ? -11.951 13.665  -2.550  1.00 0.00 ? 8  LEU A HA   12 
ATOM 6666  H HB2  . LEU A 1 5  ? -9.983  11.727  -3.771  1.00 0.00 ? 8  LEU A HB2  12 
ATOM 6667  H HB3  . LEU A 1 5  ? -11.160 11.324  -2.536  1.00 0.00 ? 8  LEU A HB3  12 
ATOM 6668  H HG   . LEU A 1 5  ? -12.828 12.312  -4.394  1.00 0.00 ? 8  LEU A HG   12 
ATOM 6669  H HD11 . LEU A 1 5  ? -11.910 12.566  -6.393  1.00 0.00 ? 8  LEU A HD11 12 
ATOM 6670  H HD12 . LEU A 1 5  ? -11.476 10.857  -6.399  1.00 0.00 ? 8  LEU A HD12 12 
ATOM 6671  H HD13 . LEU A 1 5  ? -10.344 12.051  -5.766  1.00 0.00 ? 8  LEU A HD13 12 
ATOM 6672  H HD21 . LEU A 1 5  ? -13.232 10.202  -3.470  1.00 0.00 ? 8  LEU A HD21 12 
ATOM 6673  H HD22 . LEU A 1 5  ? -11.707 9.549   -4.069  1.00 0.00 ? 8  LEU A HD22 12 
ATOM 6674  H HD23 . LEU A 1 5  ? -13.021 9.895   -5.193  1.00 0.00 ? 8  LEU A HD23 12 
ATOM 6675  N N    . ASP A 1 6  ? -9.620  14.854  -1.467  1.00 0.00 ? 9  ASP A N    12 
ATOM 6676  C CA   . ASP A 1 6  ? -8.685  15.200  -0.388  1.00 0.00 ? 9  ASP A CA   12 
ATOM 6677  C C    . ASP A 1 6  ? -7.496  14.235  -0.313  1.00 0.00 ? 9  ASP A C    12 
ATOM 6678  O O    . ASP A 1 6  ? -7.471  13.299  0.490   1.00 0.00 ? 9  ASP A O    12 
ATOM 6679  C CB   . ASP A 1 6  ? -9.426  15.259  0.951   1.00 0.00 ? 9  ASP A CB   12 
ATOM 6680  C CG   . ASP A 1 6  ? -8.578  15.833  2.071   1.00 0.00 ? 9  ASP A CG   12 
ATOM 6681  O OD1  . ASP A 1 6  ? -7.791  16.767  1.804   1.00 0.00 ? 9  ASP A OD1  12 
ATOM 6682  O OD2  . ASP A 1 6  ? -8.704  15.351  3.215   1.00 0.00 ? 9  ASP A OD2  12 
ATOM 6683  H H    . ASP A 1 6  ? -10.011 15.578  -1.991  1.00 0.00 ? 9  ASP A H    12 
ATOM 6684  H HA   . ASP A 1 6  ? -8.293  16.181  -0.608  1.00 0.00 ? 9  ASP A HA   12 
ATOM 6685  H HB2  . ASP A 1 6  ? -10.304 15.876  0.842   1.00 0.00 ? 9  ASP A HB2  12 
ATOM 6686  H HB3  . ASP A 1 6  ? -9.727  14.262  1.228   1.00 0.00 ? 9  ASP A HB3  12 
ATOM 6687  N N    . VAL A 1 7  ? -6.508  14.487  -1.165  1.00 0.00 ? 10 VAL A N    12 
ATOM 6688  C CA   . VAL A 1 7  ? -5.307  13.666  -1.224  1.00 0.00 ? 10 VAL A CA   12 
ATOM 6689  C C    . VAL A 1 7  ? -4.053  14.548  -1.287  1.00 0.00 ? 10 VAL A C    12 
ATOM 6690  O O    . VAL A 1 7  ? -3.449  14.721  -2.348  1.00 0.00 ? 10 VAL A O    12 
ATOM 6691  C CB   . VAL A 1 7  ? -5.360  12.728  -2.449  1.00 0.00 ? 10 VAL A CB   12 
ATOM 6692  C CG1  . VAL A 1 7  ? -4.088  11.900  -2.572  1.00 0.00 ? 10 VAL A CG1  12 
ATOM 6693  C CG2  . VAL A 1 7  ? -6.577  11.818  -2.371  1.00 0.00 ? 10 VAL A CG2  12 
ATOM 6694  H H    . VAL A 1 7  ? -6.591  15.249  -1.774  1.00 0.00 ? 10 VAL A H    12 
ATOM 6695  H HA   . VAL A 1 7  ? -5.267  13.060  -0.330  1.00 0.00 ? 10 VAL A HA   12 
ATOM 6696  H HB   . VAL A 1 7  ? -5.458  13.343  -3.331  1.00 0.00 ? 10 VAL A HB   12 
ATOM 6697  H HG11 . VAL A 1 7  ? -4.124  11.080  -1.871  1.00 0.00 ? 10 VAL A HG11 12 
ATOM 6698  H HG12 . VAL A 1 7  ? -3.230  12.519  -2.358  1.00 0.00 ? 10 VAL A HG12 12 
ATOM 6699  H HG13 . VAL A 1 7  ? -4.010  11.509  -3.576  1.00 0.00 ? 10 VAL A HG13 12 
ATOM 6700  H HG21 . VAL A 1 7  ? -7.441  12.339  -2.757  1.00 0.00 ? 10 VAL A HG21 12 
ATOM 6701  H HG22 . VAL A 1 7  ? -6.755  11.539  -1.342  1.00 0.00 ? 10 VAL A HG22 12 
ATOM 6702  H HG23 . VAL A 1 7  ? -6.400  10.930  -2.959  1.00 0.00 ? 10 VAL A HG23 12 
ATOM 6703  N N    . PRO A 1 8  ? -3.652  15.137  -0.141  1.00 0.00 ? 11 PRO A N    12 
ATOM 6704  C CA   . PRO A 1 8  ? -2.474  16.015  -0.071  1.00 0.00 ? 11 PRO A CA   12 
ATOM 6705  C C    . PRO A 1 8  ? -1.164  15.274  -0.345  1.00 0.00 ? 11 PRO A C    12 
ATOM 6706  O O    . PRO A 1 8  ? -1.104  14.042  -0.275  1.00 0.00 ? 11 PRO A O    12 
ATOM 6707  C CB   . PRO A 1 8  ? -2.504  16.542  1.369   1.00 0.00 ? 11 PRO A CB   12 
ATOM 6708  C CG   . PRO A 1 8  ? -3.292  15.532  2.130   1.00 0.00 ? 11 PRO A CG   12 
ATOM 6709  C CD   . PRO A 1 8  ? -4.320  15.006  1.167   1.00 0.00 ? 11 PRO A CD   12 
ATOM 6710  H HA   . PRO A 1 8  ? -2.562  16.843  -0.759  1.00 0.00 ? 11 PRO A HA   12 
ATOM 6711  H HB2  . PRO A 1 8  ? -1.496  16.624  1.749   1.00 0.00 ? 11 PRO A HB2  12 
ATOM 6712  H HB3  . PRO A 1 8  ? -2.981  17.511  1.391   1.00 0.00 ? 11 PRO A HB3  12 
ATOM 6713  H HG2  . PRO A 1 8  ? -2.645  14.734  2.462   1.00 0.00 ? 11 PRO A HG2  12 
ATOM 6714  H HG3  . PRO A 1 8  ? -3.776  16.002  2.974   1.00 0.00 ? 11 PRO A HG3  12 
ATOM 6715  H HD2  . PRO A 1 8  ? -4.547  13.972  1.385   1.00 0.00 ? 11 PRO A HD2  12 
ATOM 6716  H HD3  . PRO A 1 8  ? -5.218  15.607  1.204   1.00 0.00 ? 11 PRO A HD3  12 
ATOM 6717  N N    . THR A 1 9  ? -0.112  16.033  -0.648  1.00 0.00 ? 12 THR A N    12 
ATOM 6718  C CA   . THR A 1 9  ? 1.206   15.458  -0.929  1.00 0.00 ? 12 THR A CA   12 
ATOM 6719  C C    . THR A 1 9  ? 1.642   14.503  0.182   1.00 0.00 ? 12 THR A C    12 
ATOM 6720  O O    . THR A 1 9  ? 2.170   13.428  -0.096  1.00 0.00 ? 12 THR A O    12 
ATOM 6721  C CB   . THR A 1 9  ? 2.253   16.565  -1.104  1.00 0.00 ? 12 THR A CB   12 
ATOM 6722  O OG1  . THR A 1 9  ? 1.660   17.846  -0.990  1.00 0.00 ? 12 THR A OG1  12 
ATOM 6723  C CG2  . THR A 1 9  ? 2.962   16.511  -2.440  1.00 0.00 ? 12 THR A CG2  12 
ATOM 6724  H H    . THR A 1 9  ? -0.217  17.007  -0.681  1.00 0.00 ? 12 THR A H    12 
ATOM 6725  H HA   . THR A 1 9  ? 1.131   14.899  -1.851  1.00 0.00 ? 12 THR A HA   12 
ATOM 6726  H HB   . THR A 1 9  ? 3.001   16.466  -0.330  1.00 0.00 ? 12 THR A HB   12 
ATOM 6727  H HG1  . THR A 1 9  ? 2.333   18.525  -1.092  1.00 0.00 ? 12 THR A HG1  12 
ATOM 6728  H HG21 . THR A 1 9  ? 3.119   15.481  -2.724  1.00 0.00 ? 12 THR A HG21 12 
ATOM 6729  H HG22 . THR A 1 9  ? 3.914   17.014  -2.363  1.00 0.00 ? 12 THR A HG22 12 
ATOM 6730  H HG23 . THR A 1 9  ? 2.355   17.001  -3.187  1.00 0.00 ? 12 THR A HG23 12 
ATOM 6731  N N    . ASN A 1 10 ? 1.404   14.899  1.439   1.00 0.00 ? 13 ASN A N    12 
ATOM 6732  C CA   . ASN A 1 10 ? 1.766   14.069  2.592   1.00 0.00 ? 13 ASN A CA   12 
ATOM 6733  C C    . ASN A 1 10 ? 0.872   12.830  2.715   1.00 0.00 ? 13 ASN A C    12 
ATOM 6734  O O    . ASN A 1 10 ? 1.127   11.952  3.538   1.00 0.00 ? 13 ASN A O    12 
ATOM 6735  C CB   . ASN A 1 10 ? 1.718   14.891  3.886   1.00 0.00 ? 13 ASN A CB   12 
ATOM 6736  C CG   . ASN A 1 10 ? 3.022   14.832  4.659   1.00 0.00 ? 13 ASN A CG   12 
ATOM 6737  O OD1  . ASN A 1 10 ? 3.927   14.073  4.319   1.00 0.00 ? 13 ASN A OD1  12 
ATOM 6738  N ND2  . ASN A 1 10 ? 3.128   15.638  5.704   1.00 0.00 ? 13 ASN A ND2  12 
ATOM 6739  H H    . ASN A 1 10 ? 0.971   15.764  1.592   1.00 0.00 ? 13 ASN A H    12 
ATOM 6740  H HA   . ASN A 1 10 ? 2.772   13.730  2.436   1.00 0.00 ? 13 ASN A HA   12 
ATOM 6741  H HB2  . ASN A 1 10 ? 1.512   15.922  3.645   1.00 0.00 ? 13 ASN A HB2  12 
ATOM 6742  H HB3  . ASN A 1 10 ? 0.930   14.509  4.520   1.00 0.00 ? 13 ASN A HB3  12 
ATOM 6743  H HD21 . ASN A 1 10 ? 2.372   16.220  5.922   1.00 0.00 ? 13 ASN A HD21 12 
ATOM 6744  H HD22 . ASN A 1 10 ? 3.961   15.617  6.216   1.00 0.00 ? 13 ASN A HD22 12 
ATOM 6745  N N    . ILE A 1 11 ? -0.157  12.754  1.880   1.00 0.00 ? 14 ILE A N    12 
ATOM 6746  C CA   . ILE A 1 11 ? -1.062  11.619  1.871   1.00 0.00 ? 14 ILE A CA   12 
ATOM 6747  C C    . ILE A 1 11 ? -0.762  10.742  0.657   1.00 0.00 ? 14 ILE A C    12 
ATOM 6748  O O    . ILE A 1 11 ? -0.631  9.521   0.778   1.00 0.00 ? 14 ILE A O    12 
ATOM 6749  C CB   . ILE A 1 11 ? -2.539  12.087  1.863   1.00 0.00 ? 14 ILE A CB   12 
ATOM 6750  C CG1  . ILE A 1 11 ? -3.117  12.031  3.280   1.00 0.00 ? 14 ILE A CG1  12 
ATOM 6751  C CG2  . ILE A 1 11 ? -3.392  11.255  0.910   1.00 0.00 ? 14 ILE A CG2  12 
ATOM 6752  C CD1  . ILE A 1 11 ? -4.548  12.521  3.377   1.00 0.00 ? 14 ILE A CD1  12 
ATOM 6753  H H    . ILE A 1 11 ? -0.302  13.475  1.236   1.00 0.00 ? 14 ILE A H    12 
ATOM 6754  H HA   . ILE A 1 11 ? -0.886  11.044  2.767   1.00 0.00 ? 14 ILE A HA   12 
ATOM 6755  H HB   . ILE A 1 11 ? -2.556  13.111  1.520   1.00 0.00 ? 14 ILE A HB   12 
ATOM 6756  H HG12 . ILE A 1 11 ? -3.095  11.010  3.629   1.00 0.00 ? 14 ILE A HG12 12 
ATOM 6757  H HG13 . ILE A 1 11 ? -2.512  12.642  3.932   1.00 0.00 ? 14 ILE A HG13 12 
ATOM 6758  H HG21 . ILE A 1 11 ? -3.128  11.493  -0.110  1.00 0.00 ? 14 ILE A HG21 12 
ATOM 6759  H HG22 . ILE A 1 11 ? -4.436  11.479  1.073   1.00 0.00 ? 14 ILE A HG22 12 
ATOM 6760  H HG23 . ILE A 1 11 ? -3.217  10.205  1.093   1.00 0.00 ? 14 ILE A HG23 12 
ATOM 6761  H HD11 . ILE A 1 11 ? -5.071  11.956  4.136   1.00 0.00 ? 14 ILE A HD11 12 
ATOM 6762  H HD12 . ILE A 1 11 ? -5.041  12.385  2.425   1.00 0.00 ? 14 ILE A HD12 12 
ATOM 6763  H HD13 . ILE A 1 11 ? -4.553  13.568  3.641   1.00 0.00 ? 14 ILE A HD13 12 
ATOM 6764  N N    . MET A 1 12 ? -0.628  11.381  -0.510  1.00 0.00 ? 15 MET A N    12 
ATOM 6765  C CA   . MET A 1 12 ? -0.318  10.679  -1.747  1.00 0.00 ? 15 MET A CA   12 
ATOM 6766  C C    . MET A 1 12 ? 0.953   9.843   -1.588  1.00 0.00 ? 15 MET A C    12 
ATOM 6767  O O    . MET A 1 12 ? 0.958   8.648   -1.893  1.00 0.00 ? 15 MET A O    12 
ATOM 6768  C CB   . MET A 1 12 ? -0.154  11.687  -2.884  1.00 0.00 ? 15 MET A CB   12 
ATOM 6769  C CG   . MET A 1 12 ? -1.055  11.416  -4.074  1.00 0.00 ? 15 MET A CG   12 
ATOM 6770  S SD   . MET A 1 12 ? -0.137  10.922  -5.544  1.00 0.00 ? 15 MET A SD   12 
ATOM 6771  C CE   . MET A 1 12 ? -0.949  11.906  -6.800  1.00 0.00 ? 15 MET A CE   12 
ATOM 6772  H H    . MET A 1 12 ? -0.728  12.358  -0.536  1.00 0.00 ? 15 MET A H    12 
ATOM 6773  H HA   . MET A 1 12 ? -1.143  10.020  -1.974  1.00 0.00 ? 15 MET A HA   12 
ATOM 6774  H HB2  . MET A 1 12 ? -0.380  12.675  -2.508  1.00 0.00 ? 15 MET A HB2  12 
ATOM 6775  H HB3  . MET A 1 12 ? 0.869   11.669  -3.220  1.00 0.00 ? 15 MET A HB3  12 
ATOM 6776  H HG2  . MET A 1 12 ? -1.743  10.626  -3.813  1.00 0.00 ? 15 MET A HG2  12 
ATOM 6777  H HG3  . MET A 1 12 ? -1.611  12.314  -4.295  1.00 0.00 ? 15 MET A HG3  12 
ATOM 6778  H HE1  . MET A 1 12 ? -0.258  12.101  -7.607  1.00 0.00 ? 15 MET A HE1  12 
ATOM 6779  H HE2  . MET A 1 12 ? -1.274  12.843  -6.371  1.00 0.00 ? 15 MET A HE2  12 
ATOM 6780  H HE3  . MET A 1 12 ? -1.805  11.369  -7.182  1.00 0.00 ? 15 MET A HE3  12 
ATOM 6781  N N    . ASN A 1 13 ? 2.020   10.473  -1.086  1.00 0.00 ? 16 ASN A N    12 
ATOM 6782  C CA   . ASN A 1 13 ? 3.288   9.777   -0.867  1.00 0.00 ? 16 ASN A CA   12 
ATOM 6783  C C    . ASN A 1 13 ? 3.087   8.576   0.060   1.00 0.00 ? 16 ASN A C    12 
ATOM 6784  O O    . ASN A 1 13 ? 3.597   7.484   -0.201  1.00 0.00 ? 16 ASN A O    12 
ATOM 6785  C CB   . ASN A 1 13 ? 4.349   10.736  -0.293  1.00 0.00 ? 16 ASN A CB   12 
ATOM 6786  C CG   . ASN A 1 13 ? 3.937   11.380  1.022   1.00 0.00 ? 16 ASN A CG   12 
ATOM 6787  O OD1  . ASN A 1 13 ? 2.804   11.241  1.469   1.00 0.00 ? 16 ASN A OD1  12 
ATOM 6788  N ND2  . ASN A 1 13 ? 4.858   12.096  1.648   1.00 0.00 ? 16 ASN A ND2  12 
ATOM 6789  H H    . ASN A 1 13 ? 1.948   11.422  -0.846  1.00 0.00 ? 16 ASN A H    12 
ATOM 6790  H HA   . ASN A 1 13 ? 3.626   9.413   -1.821  1.00 0.00 ? 16 ASN A HA   12 
ATOM 6791  H HB2  . ASN A 1 13 ? 5.263   10.189  -0.125  1.00 0.00 ? 16 ASN A HB2  12 
ATOM 6792  H HB3  . ASN A 1 13 ? 4.534   11.521  -1.012  1.00 0.00 ? 16 ASN A HB3  12 
ATOM 6793  H HD21 . ASN A 1 13 ? 5.744   12.173  1.240   1.00 0.00 ? 16 ASN A HD21 12 
ATOM 6794  H HD22 . ASN A 1 13 ? 4.613   12.520  2.498   1.00 0.00 ? 16 ASN A HD22 12 
ATOM 6795  N N    . LEU A 1 14 ? 2.323   8.787   1.130   1.00 0.00 ? 17 LEU A N    12 
ATOM 6796  C CA   . LEU A 1 14 ? 2.030   7.731   2.092   1.00 0.00 ? 17 LEU A CA   12 
ATOM 6797  C C    . LEU A 1 14 ? 1.185   6.643   1.440   1.00 0.00 ? 17 LEU A C    12 
ATOM 6798  O O    . LEU A 1 14 ? 1.545   5.467   1.479   1.00 0.00 ? 17 LEU A O    12 
ATOM 6799  C CB   . LEU A 1 14 ? 1.308   8.302   3.319   1.00 0.00 ? 17 LEU A CB   12 
ATOM 6800  C CG   . LEU A 1 14 ? 2.178   9.142   4.256   1.00 0.00 ? 17 LEU A CG   12 
ATOM 6801  C CD1  . LEU A 1 14 ? 1.375   9.589   5.467   1.00 0.00 ? 17 LEU A CD1  12 
ATOM 6802  C CD2  . LEU A 1 14 ? 3.405   8.359   4.695   1.00 0.00 ? 17 LEU A CD2  12 
ATOM 6803  H H    . LEU A 1 14 ? 1.939   9.682   1.269   1.00 0.00 ? 17 LEU A H    12 
ATOM 6804  H HA   . LEU A 1 14 ? 2.968   7.296   2.404   1.00 0.00 ? 17 LEU A HA   12 
ATOM 6805  H HB2  . LEU A 1 14 ? 0.490   8.918   2.973   1.00 0.00 ? 17 LEU A HB2  12 
ATOM 6806  H HB3  . LEU A 1 14 ? 0.899   7.479   3.886   1.00 0.00 ? 17 LEU A HB3  12 
ATOM 6807  H HG   . LEU A 1 14 ? 2.511   10.026  3.733   1.00 0.00 ? 17 LEU A HG   12 
ATOM 6808  H HD11 . LEU A 1 14 ? 0.737   8.782   5.794   1.00 0.00 ? 17 LEU A HD11 12 
ATOM 6809  H HD12 . LEU A 1 14 ? 0.770   10.443  5.201   1.00 0.00 ? 17 LEU A HD12 12 
ATOM 6810  H HD13 . LEU A 1 14 ? 2.050   9.861   6.265   1.00 0.00 ? 17 LEU A HD13 12 
ATOM 6811  H HD21 . LEU A 1 14 ? 4.064   8.219   3.851   1.00 0.00 ? 17 LEU A HD21 12 
ATOM 6812  H HD22 . LEU A 1 14 ? 3.101   7.397   5.079   1.00 0.00 ? 17 LEU A HD22 12 
ATOM 6813  H HD23 . LEU A 1 14 ? 3.923   8.907   5.469   1.00 0.00 ? 17 LEU A HD23 12 
ATOM 6814  N N    . LEU A 1 15 ? 0.070   7.041   0.823   1.00 0.00 ? 18 LEU A N    12 
ATOM 6815  C CA   . LEU A 1 15 ? -0.813  6.090   0.143   1.00 0.00 ? 18 LEU A CA   12 
ATOM 6816  C C    . LEU A 1 15 ? -0.022  5.257   -0.862  1.00 0.00 ? 18 LEU A C    12 
ATOM 6817  O O    . LEU A 1 15 ? -0.098  4.023   -0.862  1.00 0.00 ? 18 LEU A O    12 
ATOM 6818  C CB   . LEU A 1 15 ? -1.952  6.831   -0.566  1.00 0.00 ? 18 LEU A CB   12 
ATOM 6819  C CG   . LEU A 1 15 ? -3.007  7.447   0.356   1.00 0.00 ? 18 LEU A CG   12 
ATOM 6820  C CD1  . LEU A 1 15 ? -3.982  8.294   -0.443  1.00 0.00 ? 18 LEU A CD1  12 
ATOM 6821  C CD2  . LEU A 1 15 ? -3.750  6.363   1.119   1.00 0.00 ? 18 LEU A CD2  12 
ATOM 6822  H H    . LEU A 1 15 ? -0.158  8.002   0.813   1.00 0.00 ? 18 LEU A H    12 
ATOM 6823  H HA   . LEU A 1 15 ? -1.226  5.429   0.888   1.00 0.00 ? 18 LEU A HA   12 
ATOM 6824  H HB2  . LEU A 1 15 ? -1.522  7.622   -1.163  1.00 0.00 ? 18 LEU A HB2  12 
ATOM 6825  H HB3  . LEU A 1 15 ? -2.448  6.136   -1.227  1.00 0.00 ? 18 LEU A HB3  12 
ATOM 6826  H HG   . LEU A 1 15 ? -2.517  8.090   1.075   1.00 0.00 ? 18 LEU A HG   12 
ATOM 6827  H HD11 . LEU A 1 15 ? -4.479  7.675   -1.176  1.00 0.00 ? 18 LEU A HD11 12 
ATOM 6828  H HD12 . LEU A 1 15 ? -3.446  9.085   -0.945  1.00 0.00 ? 18 LEU A HD12 12 
ATOM 6829  H HD13 . LEU A 1 15 ? -4.717  8.722   0.222   1.00 0.00 ? 18 LEU A HD13 12 
ATOM 6830  H HD21 . LEU A 1 15 ? -3.106  5.958   1.887   1.00 0.00 ? 18 LEU A HD21 12 
ATOM 6831  H HD22 . LEU A 1 15 ? -4.037  5.576   0.438   1.00 0.00 ? 18 LEU A HD22 12 
ATOM 6832  H HD23 . LEU A 1 15 ? -4.633  6.786   1.574   1.00 0.00 ? 18 LEU A HD23 12 
ATOM 6833  N N    . PHE A 1 16 ? 0.755   5.943   -1.702  1.00 0.00 ? 19 PHE A N    12 
ATOM 6834  C CA   . PHE A 1 16 ? 1.586   5.277   -2.703  1.00 0.00 ? 19 PHE A CA   12 
ATOM 6835  C C    . PHE A 1 16 ? 2.514   4.260   -2.042  1.00 0.00 ? 19 PHE A C    12 
ATOM 6836  O O    . PHE A 1 16 ? 2.686   3.147   -2.540  1.00 0.00 ? 19 PHE A O    12 
ATOM 6837  C CB   . PHE A 1 16 ? 2.413   6.306   -3.478  1.00 0.00 ? 19 PHE A CB   12 
ATOM 6838  C CG   . PHE A 1 16 ? 2.510   6.019   -4.951  1.00 0.00 ? 19 PHE A CG   12 
ATOM 6839  C CD1  . PHE A 1 16 ? 2.901   4.768   -5.403  1.00 0.00 ? 19 PHE A CD1  12 
ATOM 6840  C CD2  . PHE A 1 16 ? 2.209   6.999   -5.882  1.00 0.00 ? 19 PHE A CD2  12 
ATOM 6841  C CE1  . PHE A 1 16 ? 2.990   4.500   -6.755  1.00 0.00 ? 19 PHE A CE1  12 
ATOM 6842  C CE2  . PHE A 1 16 ? 2.297   6.738   -7.236  1.00 0.00 ? 19 PHE A CE2  12 
ATOM 6843  C CZ   . PHE A 1 16 ? 2.688   5.488   -7.673  1.00 0.00 ? 19 PHE A CZ   12 
ATOM 6844  H H    . PHE A 1 16 ? 0.781   6.926   -1.636  1.00 0.00 ? 19 PHE A H    12 
ATOM 6845  H HA   . PHE A 1 16 ? 0.933   4.758   -3.388  1.00 0.00 ? 19 PHE A HA   12 
ATOM 6846  H HB2  . PHE A 1 16 ? 1.965   7.279   -3.358  1.00 0.00 ? 19 PHE A HB2  12 
ATOM 6847  H HB3  . PHE A 1 16 ? 3.417   6.328   -3.077  1.00 0.00 ? 19 PHE A HB3  12 
ATOM 6848  H HD1  . PHE A 1 16 ? 3.138   3.995   -4.686  1.00 0.00 ? 19 PHE A HD1  12 
ATOM 6849  H HD2  . PHE A 1 16 ? 1.904   7.977   -5.541  1.00 0.00 ? 19 PHE A HD2  12 
ATOM 6850  H HE1  . PHE A 1 16 ? 3.295   3.522   -7.094  1.00 0.00 ? 19 PHE A HE1  12 
ATOM 6851  H HE2  . PHE A 1 16 ? 2.060   7.511   -7.952  1.00 0.00 ? 19 PHE A HE2  12 
ATOM 6852  H HZ   . PHE A 1 16 ? 2.756   5.281   -8.732  1.00 0.00 ? 19 PHE A HZ   12 
ATOM 6853  N N    . ASN A 1 17 ? 3.099   4.649   -0.908  1.00 0.00 ? 20 ASN A N    12 
ATOM 6854  C CA   . ASN A 1 17 ? 4.000   3.771   -0.172  1.00 0.00 ? 20 ASN A CA   12 
ATOM 6855  C C    . ASN A 1 17 ? 3.217   2.662   0.528   1.00 0.00 ? 20 ASN A C    12 
ATOM 6856  O O    . ASN A 1 17 ? 3.581   1.489   0.434   1.00 0.00 ? 20 ASN A O    12 
ATOM 6857  C CB   . ASN A 1 17 ? 4.809   4.573   0.839   1.00 0.00 ? 20 ASN A CB   12 
ATOM 6858  C CG   . ASN A 1 17 ? 6.270   4.177   0.857   1.00 0.00 ? 20 ASN A CG   12 
ATOM 6859  O OD1  . ASN A 1 17 ? 6.782   3.703   1.865   1.00 0.00 ? 20 ASN A OD1  12 
ATOM 6860  N ND2  . ASN A 1 17 ? 6.949   4.368   -0.264  1.00 0.00 ? 20 ASN A ND2  12 
ATOM 6861  H H    . ASN A 1 17 ? 2.912   5.546   -0.551  1.00 0.00 ? 20 ASN A H    12 
ATOM 6862  H HA   . ASN A 1 17 ? 4.674   3.319   -0.884  1.00 0.00 ? 20 ASN A HA   12 
ATOM 6863  H HB2  . ASN A 1 17 ? 4.744   5.623   0.596   1.00 0.00 ? 20 ASN A HB2  12 
ATOM 6864  H HB3  . ASN A 1 17 ? 4.400   4.409   1.818   1.00 0.00 ? 20 ASN A HB3  12 
ATOM 6865  H HD21 . ASN A 1 17 ? 6.477   4.750   -1.033  1.00 0.00 ? 20 ASN A HD21 12 
ATOM 6866  H HD22 . ASN A 1 17 ? 7.894   4.119   -0.275  1.00 0.00 ? 20 ASN A HD22 12 
ATOM 6867  N N    . ILE A 1 18 ? 2.123   3.032   1.204   1.00 0.00 ? 21 ILE A N    12 
ATOM 6868  C CA   . ILE A 1 18 ? 1.278   2.046   1.881   1.00 0.00 ? 21 ILE A CA   12 
ATOM 6869  C C    . ILE A 1 18 ? 0.907   0.951   0.897   1.00 0.00 ? 21 ILE A C    12 
ATOM 6870  O O    . ILE A 1 18 ? 1.213   -0.220  1.125   1.00 0.00 ? 21 ILE A O    12 
ATOM 6871  C CB   . ILE A 1 18 ? -0.004  2.680   2.470   1.00 0.00 ? 21 ILE A CB   12 
ATOM 6872  C CG1  . ILE A 1 18 ? 0.342   3.564   3.673   1.00 0.00 ? 21 ILE A CG1  12 
ATOM 6873  C CG2  . ILE A 1 18 ? -1.001  1.601   2.877   1.00 0.00 ? 21 ILE A CG2  12 
ATOM 6874  C CD1  . ILE A 1 18 ? 1.002   2.814   4.811   1.00 0.00 ? 21 ILE A CD1  12 
ATOM 6875  H H    . ILE A 1 18 ? 1.869   3.988   1.227   1.00 0.00 ? 21 ILE A H    12 
ATOM 6876  H HA   . ILE A 1 18 ? 1.848   1.604   2.685   1.00 0.00 ? 21 ILE A HA   12 
ATOM 6877  H HB   . ILE A 1 18 ? -0.461  3.290   1.705   1.00 0.00 ? 21 ILE A HB   12 
ATOM 6878  H HG12 . ILE A 1 18 ? 1.016   4.345   3.357   1.00 0.00 ? 21 ILE A HG12 12 
ATOM 6879  H HG13 . ILE A 1 18 ? -0.567  4.011   4.052   1.00 0.00 ? 21 ILE A HG13 12 
ATOM 6880  H HG21 . ILE A 1 18 ? -0.498  0.853   3.472   1.00 0.00 ? 21 ILE A HG21 12 
ATOM 6881  H HG22 . ILE A 1 18 ? -1.415  1.140   1.993   1.00 0.00 ? 21 ILE A HG22 12 
ATOM 6882  H HG23 . ILE A 1 18 ? -1.795  2.047   3.458   1.00 0.00 ? 21 ILE A HG23 12 
ATOM 6883  H HD11 . ILE A 1 18 ? 1.109   1.773   4.545   1.00 0.00 ? 21 ILE A HD11 12 
ATOM 6884  H HD12 . ILE A 1 18 ? 0.391   2.897   5.698   1.00 0.00 ? 21 ILE A HD12 12 
ATOM 6885  H HD13 . ILE A 1 18 ? 1.976   3.238   5.004   1.00 0.00 ? 21 ILE A HD13 12 
ATOM 6886  N N    . ALA A 1 19 ? 0.296   1.342   -0.223  1.00 0.00 ? 22 ALA A N    12 
ATOM 6887  C CA   . ALA A 1 19 ? -0.056  0.382   -1.261  1.00 0.00 ? 22 ALA A CA   12 
ATOM 6888  C C    . ALA A 1 19 ? 1.192   -0.400  -1.661  1.00 0.00 ? 22 ALA A C    12 
ATOM 6889  O O    . ALA A 1 19 ? 1.174   -1.630  -1.737  1.00 0.00 ? 22 ALA A O    12 
ATOM 6890  C CB   . ALA A 1 19 ? -0.664  1.093   -2.464  1.00 0.00 ? 22 ALA A CB   12 
ATOM 6891  H H    . ALA A 1 19 ? 0.113   2.300   -0.366  1.00 0.00 ? 22 ALA A H    12 
ATOM 6892  H HA   . ALA A 1 19 ? -0.789  -0.303  -0.857  1.00 0.00 ? 22 ALA A HA   12 
ATOM 6893  H HB1  . ALA A 1 19 ? 0.124   1.517   -3.068  1.00 0.00 ? 22 ALA A HB1  12 
ATOM 6894  H HB2  . ALA A 1 19 ? -1.318  1.882   -2.123  1.00 0.00 ? 22 ALA A HB2  12 
ATOM 6895  H HB3  . ALA A 1 19 ? -1.229  0.386   -3.053  1.00 0.00 ? 22 ALA A HB3  12 
ATOM 6896  N N    . LYS A 1 20 ? 2.290   0.334   -1.876  1.00 0.00 ? 23 LYS A N    12 
ATOM 6897  C CA   . LYS A 1 20 ? 3.576   -0.260  -2.233  1.00 0.00 ? 23 LYS A CA   12 
ATOM 6898  C C    . LYS A 1 20 ? 3.938   -1.396  -1.273  1.00 0.00 ? 23 LYS A C    12 
ATOM 6899  O O    . LYS A 1 20 ? 4.125   -2.539  -1.692  1.00 0.00 ? 23 LYS A O    12 
ATOM 6900  C CB   . LYS A 1 20 ? 4.673   0.815   -2.205  1.00 0.00 ? 23 LYS A CB   12 
ATOM 6901  C CG   . LYS A 1 20 ? 5.397   0.994   -3.525  1.00 0.00 ? 23 LYS A CG   12 
ATOM 6902  C CD   . LYS A 1 20 ? 6.110   2.337   -3.600  1.00 0.00 ? 23 LYS A CD   12 
ATOM 6903  C CE   . LYS A 1 20 ? 6.619   2.628   -5.005  1.00 0.00 ? 23 LYS A CE   12 
ATOM 6904  N NZ   . LYS A 1 20 ? 7.738   1.717   -5.395  1.00 0.00 ? 23 LYS A NZ   12 
ATOM 6905  H H    . LYS A 1 20 ? 2.233   1.309   -1.771  1.00 0.00 ? 23 LYS A H    12 
ATOM 6906  H HA   . LYS A 1 20 ? 3.496   -0.659  -3.230  1.00 0.00 ? 23 LYS A HA   12 
ATOM 6907  H HB2  . LYS A 1 20 ? 4.227   1.759   -1.934  1.00 0.00 ? 23 LYS A HB2  12 
ATOM 6908  H HB3  . LYS A 1 20 ? 5.403   0.548   -1.453  1.00 0.00 ? 23 LYS A HB3  12 
ATOM 6909  H HG2  . LYS A 1 20 ? 6.124   0.207   -3.629  1.00 0.00 ? 23 LYS A HG2  12 
ATOM 6910  H HG3  . LYS A 1 20 ? 4.676   0.933   -4.328  1.00 0.00 ? 23 LYS A HG3  12 
ATOM 6911  H HD2  . LYS A 1 20 ? 5.419   3.117   -3.312  1.00 0.00 ? 23 LYS A HD2  12 
ATOM 6912  H HD3  . LYS A 1 20 ? 6.947   2.327   -2.917  1.00 0.00 ? 23 LYS A HD3  12 
ATOM 6913  H HE2  . LYS A 1 20 ? 5.802   2.505   -5.703  1.00 0.00 ? 23 LYS A HE2  12 
ATOM 6914  H HE3  . LYS A 1 20 ? 6.968   3.652   -5.042  1.00 0.00 ? 23 LYS A HE3  12 
ATOM 6915  H HZ1  . LYS A 1 20 ? 7.361   0.794   -5.695  1.00 0.00 ? 23 LYS A HZ1  12 
ATOM 6916  H HZ2  . LYS A 1 20 ? 8.382   1.572   -4.590  1.00 0.00 ? 23 LYS A HZ2  12 
ATOM 6917  H HZ3  . LYS A 1 20 ? 8.277   2.128   -6.185  1.00 0.00 ? 23 LYS A HZ3  12 
ATOM 6918  N N    . ALA A 1 21 ? 4.033   -1.068  0.016   1.00 0.00 ? 24 ALA A N    12 
ATOM 6919  C CA   . ALA A 1 21 ? 4.375   -2.053  1.044   1.00 0.00 ? 24 ALA A CA   12 
ATOM 6920  C C    . ALA A 1 21 ? 3.265   -3.091  1.237   1.00 0.00 ? 24 ALA A C    12 
ATOM 6921  O O    . ALA A 1 21 ? 3.544   -4.289  1.360   1.00 0.00 ? 24 ALA A O    12 
ATOM 6922  C CB   . ALA A 1 21 ? 4.678   -1.348  2.359   1.00 0.00 ? 24 ALA A CB   12 
ATOM 6923  H H    . ALA A 1 21 ? 3.867   -0.132  0.284   1.00 0.00 ? 24 ALA A H    12 
ATOM 6924  H HA   . ALA A 1 21 ? 5.272   -2.564  0.725   1.00 0.00 ? 24 ALA A HA   12 
ATOM 6925  H HB1  . ALA A 1 21 ? 5.083   -2.058  3.064   1.00 0.00 ? 24 ALA A HB1  12 
ATOM 6926  H HB2  . ALA A 1 21 ? 3.769   -0.922  2.759   1.00 0.00 ? 24 ALA A HB2  12 
ATOM 6927  H HB3  . ALA A 1 21 ? 5.398   -0.561  2.189   1.00 0.00 ? 24 ALA A HB3  12 
ATOM 6928  N N    . LYS A 1 22 ? 2.010   -2.634  1.254   1.00 0.00 ? 25 LYS A N    12 
ATOM 6929  C CA   . LYS A 1 22 ? 0.870   -3.525  1.427   1.00 0.00 ? 25 LYS A CA   12 
ATOM 6930  C C    . LYS A 1 22 ? 0.814   -4.550  0.300   1.00 0.00 ? 25 LYS A C    12 
ATOM 6931  O O    . LYS A 1 22 ? 0.626   -5.745  0.542   1.00 0.00 ? 25 LYS A O    12 
ATOM 6932  C CB   . LYS A 1 22 ? -0.425  -2.711  1.476   1.00 0.00 ? 25 LYS A CB   12 
ATOM 6933  C CG   . LYS A 1 22 ? -1.265  -2.982  2.710   1.00 0.00 ? 25 LYS A CG   12 
ATOM 6934  C CD   . LYS A 1 22 ? -2.405  -3.948  2.414   1.00 0.00 ? 25 LYS A CD   12 
ATOM 6935  C CE   . LYS A 1 22 ? -3.583  -3.248  1.753   1.00 0.00 ? 25 LYS A CE   12 
ATOM 6936  N NZ   . LYS A 1 22 ? -4.515  -2.658  2.759   1.00 0.00 ? 25 LYS A NZ   12 
ATOM 6937  H H    . LYS A 1 22 ? 1.844   -1.670  1.141   1.00 0.00 ? 25 LYS A H    12 
ATOM 6938  H HA   . LYS A 1 22 ? 0.995   -4.047  2.364   1.00 0.00 ? 25 LYS A HA   12 
ATOM 6939  H HB2  . LYS A 1 22 ? -0.174  -1.659  1.467   1.00 0.00 ? 25 LYS A HB2  12 
ATOM 6940  H HB3  . LYS A 1 22 ? -1.017  -2.939  0.602   1.00 0.00 ? 25 LYS A HB3  12 
ATOM 6941  H HG2  . LYS A 1 22 ? -0.634  -3.410  3.476   1.00 0.00 ? 25 LYS A HG2  12 
ATOM 6942  H HG3  . LYS A 1 22 ? -1.672  -2.047  3.059   1.00 0.00 ? 25 LYS A HG3  12 
ATOM 6943  H HD2  . LYS A 1 22 ? -2.044  -4.722  1.750   1.00 0.00 ? 25 LYS A HD2  12 
ATOM 6944  H HD3  . LYS A 1 22 ? -2.735  -4.395  3.340   1.00 0.00 ? 25 LYS A HD3  12 
ATOM 6945  H HE2  . LYS A 1 22 ? -3.206  -2.461  1.114   1.00 0.00 ? 25 LYS A HE2  12 
ATOM 6946  H HE3  . LYS A 1 22 ? -4.122  -3.970  1.152   1.00 0.00 ? 25 LYS A HE3  12 
ATOM 6947  H HZ1  . LYS A 1 22 ? -5.500  -2.731  2.426   1.00 0.00 ? 25 LYS A HZ1  12 
ATOM 6948  H HZ2  . LYS A 1 22 ? -4.288  -1.654  2.914   1.00 0.00 ? 25 LYS A HZ2  12 
ATOM 6949  H HZ3  . LYS A 1 22 ? -4.432  -3.164  3.666   1.00 0.00 ? 25 LYS A HZ3  12 
ATOM 6950  N N    . ASN A 1 23 ? 1.003   -4.076  -0.933  1.00 0.00 ? 26 ASN A N    12 
ATOM 6951  C CA   . ASN A 1 23 ? 0.996   -4.961  -2.097  1.00 0.00 ? 26 ASN A CA   12 
ATOM 6952  C C    . ASN A 1 23 ? 2.116   -5.997  -1.975  1.00 0.00 ? 26 ASN A C    12 
ATOM 6953  O O    . ASN A 1 23 ? 1.913   -7.176  -2.263  1.00 0.00 ? 26 ASN A O    12 
ATOM 6954  C CB   . ASN A 1 23 ? 1.115   -4.140  -3.400  1.00 0.00 ? 26 ASN A CB   12 
ATOM 6955  C CG   . ASN A 1 23 ? 2.359   -4.446  -4.217  1.00 0.00 ? 26 ASN A CG   12 
ATOM 6956  O OD1  . ASN A 1 23 ? 2.309   -5.210  -5.173  1.00 0.00 ? 26 ASN A OD1  12 
ATOM 6957  N ND2  . ASN A 1 23 ? 3.480   -3.845  -3.850  1.00 0.00 ? 26 ASN A ND2  12 
ATOM 6958  H H    . ASN A 1 23 ? 1.170   -3.108  -1.057  1.00 0.00 ? 26 ASN A H    12 
ATOM 6959  H HA   . ASN A 1 23 ? 0.051   -5.487  -2.101  1.00 0.00 ? 26 ASN A HA   12 
ATOM 6960  H HB2  . ASN A 1 23 ? 0.255   -4.345  -4.020  1.00 0.00 ? 26 ASN A HB2  12 
ATOM 6961  H HB3  . ASN A 1 23 ? 1.122   -3.090  -3.154  1.00 0.00 ? 26 ASN A HB3  12 
ATOM 6962  H HD21 . ASN A 1 23 ? 3.457   -3.239  -3.075  1.00 0.00 ? 26 ASN A HD21 12 
ATOM 6963  H HD22 . ASN A 1 23 ? 4.289   -4.032  -4.368  1.00 0.00 ? 26 ASN A HD22 12 
ATOM 6964  N N    . LEU A 1 24 ? 3.287   -5.547  -1.519  1.00 0.00 ? 27 LEU A N    12 
ATOM 6965  C CA   . LEU A 1 24 ? 4.437   -6.430  -1.334  1.00 0.00 ? 27 LEU A CA   12 
ATOM 6966  C C    . LEU A 1 24 ? 4.110   -7.555  -0.365  1.00 0.00 ? 27 LEU A C    12 
ATOM 6967  O O    . LEU A 1 24 ? 4.063   -8.723  -0.738  1.00 0.00 ? 27 LEU A O    12 
ATOM 6968  C CB   . LEU A 1 24 ? 5.645   -5.630  -0.833  1.00 0.00 ? 27 LEU A CB   12 
ATOM 6969  C CG   . LEU A 1 24 ? 6.318   -4.747  -1.884  1.00 0.00 ? 27 LEU A CG   12 
ATOM 6970  C CD1  . LEU A 1 24 ? 7.237   -3.735  -1.221  1.00 0.00 ? 27 LEU A CD1  12 
ATOM 6971  C CD2  . LEU A 1 24 ? 7.090   -5.598  -2.880  1.00 0.00 ? 27 LEU A CD2  12 
ATOM 6972  H H    . LEU A 1 24 ? 3.376   -4.597  -1.289  1.00 0.00 ? 27 LEU A H    12 
ATOM 6973  H HA   . LEU A 1 24 ? 4.672   -6.863  -2.277  1.00 0.00 ? 27 LEU A HA   12 
ATOM 6974  H HB2  . LEU A 1 24 ? 5.320   -4.999  -0.018  1.00 0.00 ? 27 LEU A HB2  12 
ATOM 6975  H HB3  . LEU A 1 24 ? 6.381   -6.325  -0.457  1.00 0.00 ? 27 LEU A HB3  12 
ATOM 6976  H HG   . LEU A 1 24 ? 5.560   -4.201  -2.425  1.00 0.00 ? 27 LEU A HG   12 
ATOM 6977  H HD11 . LEU A 1 24 ? 7.953   -3.371  -1.943  1.00 0.00 ? 27 LEU A HD11 12 
ATOM 6978  H HD12 . LEU A 1 24 ? 7.761   -4.208  -0.402  1.00 0.00 ? 27 LEU A HD12 12 
ATOM 6979  H HD13 . LEU A 1 24 ? 6.652   -2.909  -0.845  1.00 0.00 ? 27 LEU A HD13 12 
ATOM 6980  H HD21 . LEU A 1 24 ? 6.698   -5.435  -3.872  1.00 0.00 ? 27 LEU A HD21 12 
ATOM 6981  H HD22 . LEU A 1 24 ? 6.988   -6.640  -2.619  1.00 0.00 ? 27 LEU A HD22 12 
ATOM 6982  H HD23 . LEU A 1 24 ? 8.134   -5.322  -2.855  1.00 0.00 ? 27 LEU A HD23 12 
ATOM 6983  N N    . ARG A 1 25 ? 3.879   -7.181  0.877   1.00 0.00 ? 28 ARG A N    12 
ATOM 6984  C CA   . ARG A 1 25 ? 3.546   -8.134  1.940   1.00 0.00 ? 28 ARG A CA   12 
ATOM 6985  C C    . ARG A 1 25 ? 2.358   -9.018  1.566   1.00 0.00 ? 28 ARG A C    12 
ATOM 6986  O O    . ARG A 1 25 ? 2.325   -10.191 1.933   1.00 0.00 ? 28 ARG A O    12 
ATOM 6987  C CB   . ARG A 1 25 ? 3.250   -7.380  3.242   1.00 0.00 ? 28 ARG A CB   12 
ATOM 6988  C CG   . ARG A 1 25 ? 4.214   -7.706  4.370   1.00 0.00 ? 28 ARG A CG   12 
ATOM 6989  C CD   . ARG A 1 25 ? 3.532   -7.624  5.729   1.00 0.00 ? 28 ARG A CD   12 
ATOM 6990  N NE   . ARG A 1 25 ? 3.796   -8.809  6.551   1.00 0.00 ? 28 ARG A NE   12 
ATOM 6991  C CZ   . ARG A 1 25 ? 3.229   -9.995  6.364   1.00 0.00 ? 28 ARG A CZ   12 
ATOM 6992  N NH1  . ARG A 1 25 ? 2.375   -10.183 5.376   1.00 0.00 ? 28 ARG A NH1  12 
ATOM 6993  N NH2  . ARG A 1 25 ? 3.525   -10.999 7.168   1.00 0.00 ? 28 ARG A NH2  12 
ATOM 6994  H H    . ARG A 1 25 ? 3.931   -6.229  1.085   1.00 0.00 ? 28 ARG A H    12 
ATOM 6995  H HA   . ARG A 1 25 ? 4.399   -8.780  2.089   1.00 0.00 ? 28 ARG A HA   12 
ATOM 6996  H HB2  . ARG A 1 25 ? 3.305   -6.318  3.047   1.00 0.00 ? 28 ARG A HB2  12 
ATOM 6997  H HB3  . ARG A 1 25 ? 2.250   -7.624  3.566   1.00 0.00 ? 28 ARG A HB3  12 
ATOM 6998  H HG2  . ARG A 1 25 ? 4.595   -8.704  4.226   1.00 0.00 ? 28 ARG A HG2  12 
ATOM 6999  H HG3  . ARG A 1 25 ? 5.033   -7.000  4.345   1.00 0.00 ? 28 ARG A HG3  12 
ATOM 7000  H HD2  . ARG A 1 25 ? 3.897   -6.747  6.246   1.00 0.00 ? 28 ARG A HD2  12 
ATOM 7001  H HD3  . ARG A 1 25 ? 2.466   -7.529  5.578   1.00 0.00 ? 28 ARG A HD3  12 
ATOM 7002  H HE   . ARG A 1 25 ? 4.434   -8.708  7.289   1.00 0.00 ? 28 ARG A HE   12 
ATOM 7003  H HH11 . ARG A 1 25 ? 2.150   -9.430  4.760   1.00 0.00 ? 28 ARG A HH11 12 
ATOM 7004  H HH12 . ARG A 1 25 ? 1.956   -11.079 5.241   1.00 0.00 ? 28 ARG A HH12 12 
ATOM 7005  H HH21 . ARG A 1 25 ? 4.174   -10.866 7.915   1.00 0.00 ? 28 ARG A HH21 12 
ATOM 7006  H HH22 . ARG A 1 25 ? 3.100   -11.892 7.031   1.00 0.00 ? 28 ARG A HH22 12 
ATOM 7007  N N    . ALA A 1 26 ? 1.395   -8.466  0.831   1.00 0.00 ? 29 ALA A N    12 
ATOM 7008  C CA   . ALA A 1 26 ? 0.232   -9.237  0.416   1.00 0.00 ? 29 ALA A CA   12 
ATOM 7009  C C    . ALA A 1 26 ? 0.616   -10.231 -0.672  1.00 0.00 ? 29 ALA A C    12 
ATOM 7010  O O    . ALA A 1 26 ? 0.301   -11.417 -0.582  1.00 0.00 ? 29 ALA A O    12 
ATOM 7011  C CB   . ALA A 1 26 ? -0.876  -8.312  -0.065  1.00 0.00 ? 29 ALA A CB   12 
ATOM 7012  H H    . ALA A 1 26 ? 1.473   -7.529  0.550   1.00 0.00 ? 29 ALA A H    12 
ATOM 7013  H HA   . ALA A 1 26 ? -0.131  -9.784  1.275   1.00 0.00 ? 29 ALA A HA   12 
ATOM 7014  H HB1  . ALA A 1 26 ? -0.455  -7.545  -0.700  1.00 0.00 ? 29 ALA A HB1  12 
ATOM 7015  H HB2  . ALA A 1 26 ? -1.355  -7.850  0.786   1.00 0.00 ? 29 ALA A HB2  12 
ATOM 7016  H HB3  . ALA A 1 26 ? -1.605  -8.881  -0.624  1.00 0.00 ? 29 ALA A HB3  12 
ATOM 7017  N N    . GLN A 1 27 ? 1.309   -9.736  -1.697  1.00 0.00 ? 30 GLN A N    12 
ATOM 7018  C CA   . GLN A 1 27 ? 1.741   -10.580 -2.808  1.00 0.00 ? 30 GLN A CA   12 
ATOM 7019  C C    . GLN A 1 27 ? 2.879   -11.507 -2.414  1.00 0.00 ? 30 GLN A C    12 
ATOM 7020  O O    . GLN A 1 27 ? 2.935   -12.647 -2.857  1.00 0.00 ? 30 GLN A O    12 
ATOM 7021  C CB   . GLN A 1 27 ? 2.145   -9.715  -4.003  1.00 0.00 ? 30 GLN A CB   12 
ATOM 7022  C CG   . GLN A 1 27 ? 2.849   -10.488 -5.108  1.00 0.00 ? 30 GLN A CG   12 
ATOM 7023  C CD   . GLN A 1 27 ? 2.032   -10.568 -6.382  1.00 0.00 ? 30 GLN A CD   12 
ATOM 7024  O OE1  . GLN A 1 27 ? 1.010   -11.246 -6.432  1.00 0.00 ? 30 GLN A OE1  12 
ATOM 7025  N NE2  . GLN A 1 27 ? 2.478   -9.879  -7.421  1.00 0.00 ? 30 GLN A NE2  12 
ATOM 7026  H H    . GLN A 1 27 ? 1.538   -8.774  -1.706  1.00 0.00 ? 30 GLN A H    12 
ATOM 7027  H HA   . GLN A 1 27 ? 0.914   -11.190 -3.084  1.00 0.00 ? 30 GLN A HA   12 
ATOM 7028  H HB2  . GLN A 1 27 ? 1.257   -9.261  -4.419  1.00 0.00 ? 30 GLN A HB2  12 
ATOM 7029  H HB3  . GLN A 1 27 ? 2.809   -8.935  -3.661  1.00 0.00 ? 30 GLN A HB3  12 
ATOM 7030  H HG2  . GLN A 1 27 ? 3.784   -10.002 -5.327  1.00 0.00 ? 30 GLN A HG2  12 
ATOM 7031  H HG3  . GLN A 1 27 ? 3.042   -11.493 -4.763  1.00 0.00 ? 30 GLN A HG3  12 
ATOM 7032  H HE21 . GLN A 1 27 ? 3.301   -9.360  -7.317  1.00 0.00 ? 30 GLN A HE21 12 
ATOM 7033  H HE22 . GLN A 1 27 ? 1.964   -9.920  -8.253  1.00 0.00 ? 30 GLN A HE22 12 
ATOM 7034  N N    . ALA A 1 28 ? 3.767   -11.023 -1.574  1.00 0.00 ? 31 ALA A N    12 
ATOM 7035  C CA   . ALA A 1 28 ? 4.896   -11.820 -1.113  1.00 0.00 ? 31 ALA A CA   12 
ATOM 7036  C C    . ALA A 1 28 ? 4.400   -12.933 -0.204  1.00 0.00 ? 31 ALA A C    12 
ATOM 7037  O O    . ALA A 1 28 ? 4.728   -14.103 -0.400  1.00 0.00 ? 31 ALA A O    12 
ATOM 7038  C CB   . ALA A 1 28 ? 5.915   -10.942 -0.395  1.00 0.00 ? 31 ALA A CB   12 
ATOM 7039  H H    . ALA A 1 28 ? 3.650   -10.111 -1.242  1.00 0.00 ? 31 ALA A H    12 
ATOM 7040  H HA   . ALA A 1 28 ? 5.374   -12.260 -1.978  1.00 0.00 ? 31 ALA A HA   12 
ATOM 7041  H HB1  . ALA A 1 28 ? 6.700   -11.562 0.015   1.00 0.00 ? 31 ALA A HB1  12 
ATOM 7042  H HB2  . ALA A 1 28 ? 5.427   -10.404 0.405   1.00 0.00 ? 31 ALA A HB2  12 
ATOM 7043  H HB3  . ALA A 1 28 ? 6.340   -10.238 -1.095  1.00 0.00 ? 31 ALA A HB3  12 
ATOM 7044  N N    . ALA A 1 29 ? 3.594   -12.553 0.782   1.00 0.00 ? 32 ALA A N    12 
ATOM 7045  C CA   . ALA A 1 29 ? 3.032   -13.521 1.725   1.00 0.00 ? 32 ALA A CA   12 
ATOM 7046  C C    . ALA A 1 29 ? 2.012   -14.461 1.058   1.00 0.00 ? 32 ALA A C    12 
ATOM 7047  O O    . ALA A 1 29 ? 2.025   -15.669 1.305   1.00 0.00 ? 32 ALA A O    12 
ATOM 7048  C CB   . ALA A 1 29 ? 2.397   -12.799 2.904   1.00 0.00 ? 32 ALA A CB   12 
ATOM 7049  H H    . ALA A 1 29 ? 3.367   -11.589 0.875   1.00 0.00 ? 32 ALA A H    12 
ATOM 7050  H HA   . ALA A 1 29 ? 3.849   -14.118 2.105   1.00 0.00 ? 32 ALA A HA   12 
ATOM 7051  H HB1  . ALA A 1 29 ? 1.548   -12.226 2.559   1.00 0.00 ? 32 ALA A HB1  12 
ATOM 7052  H HB2  . ALA A 1 29 ? 3.122   -12.134 3.351   1.00 0.00 ? 32 ALA A HB2  12 
ATOM 7053  H HB3  . ALA A 1 29 ? 2.070   -13.522 3.637   1.00 0.00 ? 32 ALA A HB3  12 
ATOM 7054  N N    . ALA A 1 30 ? 1.114   -13.905 0.235   1.00 0.00 ? 33 ALA A N    12 
ATOM 7055  C CA   . ALA A 1 30 ? 0.078   -14.708 -0.428  1.00 0.00 ? 33 ALA A CA   12 
ATOM 7056  C C    . ALA A 1 30 ? 0.541   -15.377 -1.727  1.00 0.00 ? 33 ALA A C    12 
ATOM 7057  O O    . ALA A 1 30 ? -0.166  -16.229 -2.263  1.00 0.00 ? 33 ALA A O    12 
ATOM 7058  C CB   . ALA A 1 30 ? -1.162  -13.861 -0.683  1.00 0.00 ? 33 ALA A CB   12 
ATOM 7059  H H    . ALA A 1 30 ? 1.135   -12.933 0.085   1.00 0.00 ? 33 ALA A H    12 
ATOM 7060  H HA   . ALA A 1 30 ? -0.198  -15.487 0.257   1.00 0.00 ? 33 ALA A HA   12 
ATOM 7061  H HB1  . ALA A 1 30 ? -1.501  -13.427 0.246   1.00 0.00 ? 33 ALA A HB1  12 
ATOM 7062  H HB2  . ALA A 1 30 ? -1.944  -14.482 -1.096  1.00 0.00 ? 33 ALA A HB2  12 
ATOM 7063  H HB3  . ALA A 1 30 ? -0.923  -13.074 -1.382  1.00 0.00 ? 33 ALA A HB3  12 
ATOM 7064  N N    . ASN A 1 31 ? 1.718   -15.013 -2.226  1.00 0.00 ? 34 ASN A N    12 
ATOM 7065  C CA   . ASN A 1 31 ? 2.245   -15.611 -3.461  1.00 0.00 ? 34 ASN A CA   12 
ATOM 7066  C C    . ASN A 1 31 ? 2.361   -17.123 -3.304  1.00 0.00 ? 34 ASN A C    12 
ATOM 7067  O O    . ASN A 1 31 ? 1.860   -17.891 -4.128  1.00 0.00 ? 34 ASN A O    12 
ATOM 7068  C CB   . ASN A 1 31 ? 3.607   -14.992 -3.818  1.00 0.00 ? 34 ASN A CB   12 
ATOM 7069  C CG   . ASN A 1 31 ? 4.505   -15.917 -4.615  1.00 0.00 ? 34 ASN A CG   12 
ATOM 7070  O OD1  . ASN A 1 31 ? 4.143   -16.381 -5.692  1.00 0.00 ? 34 ASN A OD1  12 
ATOM 7071  N ND2  . ASN A 1 31 ? 5.691   -16.184 -4.092  1.00 0.00 ? 34 ASN A ND2  12 
ATOM 7072  H H    . ASN A 1 31 ? 2.246   -14.341 -1.753  1.00 0.00 ? 34 ASN A H    12 
ATOM 7073  H HA   . ASN A 1 31 ? 1.542   -15.402 -4.252  1.00 0.00 ? 34 ASN A HA   12 
ATOM 7074  H HB2  . ASN A 1 31 ? 3.442   -14.101 -4.404  1.00 0.00 ? 34 ASN A HB2  12 
ATOM 7075  H HB3  . ASN A 1 31 ? 4.119   -14.722 -2.906  1.00 0.00 ? 34 ASN A HB3  12 
ATOM 7076  H HD21 . ASN A 1 31 ? 5.921   -15.779 -3.231  1.00 0.00 ? 34 ASN A HD21 12 
ATOM 7077  H HD22 . ASN A 1 31 ? 6.289   -16.773 -4.590  1.00 0.00 ? 34 ASN A HD22 12 
ATOM 7078  N N    . ALA A 1 32 ? 3.006   -17.538 -2.221  1.00 0.00 ? 35 ALA A N    12 
ATOM 7079  C CA   . ALA A 1 32 ? 3.174   -18.958 -1.922  1.00 0.00 ? 35 ALA A CA   12 
ATOM 7080  C C    . ALA A 1 32 ? 2.158   -19.434 -0.876  1.00 0.00 ? 35 ALA A C    12 
ATOM 7081  O O    . ALA A 1 32 ? 2.142   -20.609 -0.507  1.00 0.00 ? 35 ALA A O    12 
ATOM 7082  C CB   . ALA A 1 32 ? 4.597   -19.231 -1.454  1.00 0.00 ? 35 ALA A CB   12 
ATOM 7083  H H    . ALA A 1 32 ? 3.362   -16.867 -1.597  1.00 0.00 ? 35 ALA A H    12 
ATOM 7084  H HA   . ALA A 1 32 ? 3.009   -19.508 -2.835  1.00 0.00 ? 35 ALA A HA   12 
ATOM 7085  H HB1  . ALA A 1 32 ? 4.677   -20.259 -1.127  1.00 0.00 ? 35 ALA A HB1  12 
ATOM 7086  H HB2  . ALA A 1 32 ? 4.840   -18.573 -0.633  1.00 0.00 ? 35 ALA A HB2  12 
ATOM 7087  H HB3  . ALA A 1 32 ? 5.283   -19.059 -2.269  1.00 0.00 ? 35 ALA A HB3  12 
ATOM 7088  N N    . HIS A 1 33 ? 1.325   -18.508 -0.388  1.00 0.00 ? 36 HIS A N    12 
ATOM 7089  C CA   . HIS A 1 33 ? 0.304   -18.798 0.627   1.00 0.00 ? 36 HIS A CA   12 
ATOM 7090  C C    . HIS A 1 33 ? 0.935   -19.045 1.997   1.00 0.00 ? 36 HIS A C    12 
ATOM 7091  O O    . HIS A 1 33 ? 0.498   -18.487 3.004   1.00 0.00 ? 36 HIS A O    12 
ATOM 7092  C CB   . HIS A 1 33 ? -0.553  -19.999 0.210   1.00 0.00 ? 36 HIS A CB   12 
ATOM 7093  C CG   . HIS A 1 33 ? -1.817  -20.127 0.998   1.00 0.00 ? 36 HIS A CG   12 
ATOM 7094  N ND1  . HIS A 1 33 ? -2.706  -19.087 1.165   1.00 0.00 ? 36 HIS A ND1  12 
ATOM 7095  C CD2  . HIS A 1 33 ? -2.337  -21.176 1.675   1.00 0.00 ? 36 HIS A CD2  12 
ATOM 7096  C CE1  . HIS A 1 33 ? -3.719  -19.490 1.912   1.00 0.00 ? 36 HIS A CE1  12 
ATOM 7097  N NE2  . HIS A 1 33 ? -3.519  -20.755 2.236   1.00 0.00 ? 36 HIS A NE2  12 
ATOM 7098  H H    . HIS A 1 33 ? 1.404   -17.599 -0.712  1.00 0.00 ? 36 HIS A H    12 
ATOM 7099  H HA   . HIS A 1 33 ? -0.333  -17.930 0.701   1.00 0.00 ? 36 HIS A HA   12 
ATOM 7100  H HB2  . HIS A 1 33 ? -0.819  -19.898 -0.832  1.00 0.00 ? 36 HIS A HB2  12 
ATOM 7101  H HB3  . HIS A 1 33 ? 0.018   -20.906 0.344   1.00 0.00 ? 36 HIS A HB3  12 
ATOM 7102  H HD1  . HIS A 1 33 ? -2.607  -18.185 0.791   1.00 0.00 ? 36 HIS A HD1  12 
ATOM 7103  H HD2  . HIS A 1 33 ? -1.903  -22.163 1.759   1.00 0.00 ? 36 HIS A HD2  12 
ATOM 7104  H HE1  . HIS A 1 33 ? -4.566  -18.887 2.208   1.00 0.00 ? 36 HIS A HE1  12 
ATOM 7105  H HE2  . HIS A 1 33 ? -4.044  -21.256 2.894   1.00 0.00 ? 36 HIS A HE2  12 
ATOM 7106  N N    . LEU A 1 34 ? 1.971   -19.877 2.023   1.00 0.00 ? 37 LEU A N    12 
ATOM 7107  C CA   . LEU A 1 34 ? 2.679   -20.201 3.259   1.00 0.00 ? 37 LEU A CA   12 
ATOM 7108  C C    . LEU A 1 34 ? 3.982   -19.401 3.389   1.00 0.00 ? 37 LEU A C    12 
ATOM 7109  O O    . LEU A 1 34 ? 4.841   -19.731 4.210   1.00 0.00 ? 37 LEU A O    12 
ATOM 7110  C CB   . LEU A 1 34 ? 2.977   -21.704 3.313   1.00 0.00 ? 37 LEU A CB   12 
ATOM 7111  C CG   . LEU A 1 34 ? 1.789   -22.585 3.706   1.00 0.00 ? 37 LEU A CG   12 
ATOM 7112  C CD1  . LEU A 1 34 ? 1.021   -23.026 2.472   1.00 0.00 ? 37 LEU A CD1  12 
ATOM 7113  C CD2  . LEU A 1 34 ? 2.262   -23.793 4.497   1.00 0.00 ? 37 LEU A CD2  12 
ATOM 7114  H H    . LEU A 1 34 ? 2.271   -20.279 1.180   1.00 0.00 ? 37 LEU A H    12 
ATOM 7115  H HA   . LEU A 1 34 ? 2.034   -19.945 4.086   1.00 0.00 ? 37 LEU A HA   12 
ATOM 7116  H HB2  . LEU A 1 34 ? 3.324   -22.016 2.340   1.00 0.00 ? 37 LEU A HB2  12 
ATOM 7117  H HB3  . LEU A 1 34 ? 3.769   -21.867 4.029   1.00 0.00 ? 37 LEU A HB3  12 
ATOM 7118  H HG   . LEU A 1 34 ? 1.117   -22.016 4.332   1.00 0.00 ? 37 LEU A HG   12 
ATOM 7119  H HD11 . LEU A 1 34 ? 0.922   -22.194 1.792   1.00 0.00 ? 37 LEU A HD11 12 
ATOM 7120  H HD12 . LEU A 1 34 ? 0.041   -23.372 2.764   1.00 0.00 ? 37 LEU A HD12 12 
ATOM 7121  H HD13 . LEU A 1 34 ? 1.555   -23.829 1.984   1.00 0.00 ? 37 LEU A HD13 12 
ATOM 7122  H HD21 . LEU A 1 34 ? 2.527   -23.486 5.497   1.00 0.00 ? 37 LEU A HD21 12 
ATOM 7123  H HD22 . LEU A 1 34 ? 3.124   -24.226 4.012   1.00 0.00 ? 37 LEU A HD22 12 
ATOM 7124  H HD23 . LEU A 1 34 ? 1.469   -24.524 4.543   1.00 0.00 ? 37 LEU A HD23 12 
ATOM 7125  N N    . MET A 1 35 ? 4.121   -18.337 2.588   1.00 0.00 ? 38 MET A N    12 
ATOM 7126  C CA   . MET A 1 35 ? 5.312   -17.490 2.626   1.00 0.00 ? 38 MET A CA   12 
ATOM 7127  C C    . MET A 1 35 ? 5.387   -16.684 3.924   1.00 0.00 ? 38 MET A C    12 
ATOM 7128  O O    . MET A 1 35 ? 6.454   -16.208 4.312   1.00 0.00 ? 38 MET A O    12 
ATOM 7129  C CB   . MET A 1 35 ? 5.329   -16.554 1.413   1.00 0.00 ? 38 MET A CB   12 
ATOM 7130  C CG   . MET A 1 35 ? 6.576   -16.687 0.551   1.00 0.00 ? 38 MET A CG   12 
ATOM 7131  S SD   . MET A 1 35 ? 7.721   -15.311 0.769   1.00 0.00 ? 38 MET A SD   12 
ATOM 7132  C CE   . MET A 1 35 ? 8.772   -15.950 2.071   1.00 0.00 ? 38 MET A CE   12 
ATOM 7133  H H    . MET A 1 35 ? 3.403   -18.110 1.964   1.00 0.00 ? 38 MET A H    12 
ATOM 7134  H HA   . MET A 1 35 ? 6.168   -18.135 2.583   1.00 0.00 ? 38 MET A HA   12 
ATOM 7135  H HB2  . MET A 1 35 ? 4.468   -16.766 0.796   1.00 0.00 ? 38 MET A HB2  12 
ATOM 7136  H HB3  . MET A 1 35 ? 5.264   -15.535 1.760   1.00 0.00 ? 38 MET A HB3  12 
ATOM 7137  H HG2  . MET A 1 35 ? 7.084   -17.603 0.814   1.00 0.00 ? 38 MET A HG2  12 
ATOM 7138  H HG3  . MET A 1 35 ? 6.277   -16.727 -0.486  1.00 0.00 ? 38 MET A HG3  12 
ATOM 7139  H HE1  . MET A 1 35 ? 9.747   -15.489 2.007   1.00 0.00 ? 38 MET A HE1  12 
ATOM 7140  H HE2  . MET A 1 35 ? 8.871   -17.020 1.962   1.00 0.00 ? 38 MET A HE2  12 
ATOM 7141  H HE3  . MET A 1 35 ? 8.330   -15.725 3.031   1.00 0.00 ? 38 MET A HE3  12 
ATOM 7142  N N    . ALA A 1 36 ? 4.249   -16.549 4.593   1.00 0.00 ? 39 ALA A N    12 
ATOM 7143  C CA   . ALA A 1 36 ? 4.168   -15.818 5.854   1.00 0.00 ? 39 ALA A CA   12 
ATOM 7144  C C    . ALA A 1 36 ? 3.708   -16.737 6.992   1.00 0.00 ? 39 ALA A C    12 
ATOM 7145  O O    . ALA A 1 36 ? 2.937   -16.330 7.863   1.00 0.00 ? 39 ALA A O    12 
ATOM 7146  C CB   . ALA A 1 36 ? 3.229   -14.627 5.703   1.00 0.00 ? 39 ALA A CB   12 
ATOM 7147  H H    . ALA A 1 36 ? 3.443   -16.961 4.231   1.00 0.00 ? 39 ALA A H    12 
ATOM 7148  H HA   . ALA A 1 36 ? 5.156   -15.442 6.088   1.00 0.00 ? 39 ALA A HA   12 
ATOM 7149  H HB1  . ALA A 1 36 ? 2.888   -14.312 6.678   1.00 0.00 ? 39 ALA A HB1  12 
ATOM 7150  H HB2  . ALA A 1 36 ? 2.380   -14.913 5.100   1.00 0.00 ? 39 ALA A HB2  12 
ATOM 7151  H HB3  . ALA A 1 36 ? 3.754   -13.814 5.224   1.00 0.00 ? 39 ALA A HB3  12 
ATOM 7152  N N    . GLN A 1 37 ? 4.184   -17.984 6.972   1.00 0.00 ? 40 GLN A N    12 
ATOM 7153  C CA   . GLN A 1 37 ? 3.820   -18.967 7.995   1.00 0.00 ? 40 GLN A CA   12 
ATOM 7154  C C    . GLN A 1 37 ? 4.749   -18.893 9.211   1.00 0.00 ? 40 GLN A C    12 
ATOM 7155  O O    . GLN A 1 37 ? 4.290   -18.978 10.351  1.00 0.00 ? 40 GLN A O    12 
ATOM 7156  C CB   . GLN A 1 37 ? 3.843   -20.381 7.401   1.00 0.00 ? 40 GLN A CB   12 
ATOM 7157  C CG   . GLN A 1 37 ? 2.705   -21.268 7.889   1.00 0.00 ? 40 GLN A CG   12 
ATOM 7158  C CD   . GLN A 1 37 ? 1.342   -20.765 7.453   1.00 0.00 ? 40 GLN A CD   12 
ATOM 7159  O OE1  . GLN A 1 37 ? 0.930   -20.963 6.313   1.00 0.00 ? 40 GLN A OE1  12 
ATOM 7160  N NE2  . GLN A 1 37 ? 0.634   -20.108 8.359   1.00 0.00 ? 40 GLN A NE2  12 
ATOM 7161  H H    . GLN A 1 37 ? 4.792   -18.251 6.250   1.00 0.00 ? 40 GLN A H    12 
ATOM 7162  H HA   . GLN A 1 37 ? 2.815   -18.744 8.319   1.00 0.00 ? 40 GLN A HA   12 
ATOM 7163  H HB2  . GLN A 1 37 ? 3.780   -20.310 6.326   1.00 0.00 ? 40 GLN A HB2  12 
ATOM 7164  H HB3  . GLN A 1 37 ? 4.777   -20.856 7.666   1.00 0.00 ? 40 GLN A HB3  12 
ATOM 7165  H HG2  . GLN A 1 37 ? 2.845   -22.262 7.492   1.00 0.00 ? 40 GLN A HG2  12 
ATOM 7166  H HG3  . GLN A 1 37 ? 2.730   -21.306 8.967   1.00 0.00 ? 40 GLN A HG3  12 
ATOM 7167  H HE21 . GLN A 1 37 ? 1.019   -19.984 9.250   1.00 0.00 ? 40 GLN A HE21 12 
ATOM 7168  H HE22 . GLN A 1 37 ? -0.247  -19.772 8.097   1.00 0.00 ? 40 GLN A HE22 12 
ATOM 7169  N N    . ILE A 1 38 ? 6.051   -18.738 8.964   1.00 0.00 ? 41 ILE A N    12 
ATOM 7170  C CA   . ILE A 1 38 ? 7.037   -18.656 10.042  1.00 0.00 ? 41 ILE A CA   12 
ATOM 7171  C C    . ILE A 1 38 ? 8.068   -17.559 9.771   1.00 0.00 ? 41 ILE A C    12 
ATOM 7172  O O    . ILE A 1 38 ? 8.296   -16.731 10.678  1.00 0.00 ? 41 ILE A O    12 
ATOM 7173  C CB   . ILE A 1 38 ? 7.774   -19.999 10.259  1.00 0.00 ? 41 ILE A CB   12 
ATOM 7174  C CG1  . ILE A 1 38 ? 8.186   -20.626 8.916   1.00 0.00 ? 41 ILE A CG1  12 
ATOM 7175  C CG2  . ILE A 1 38 ? 6.908   -20.957 11.066  1.00 0.00 ? 41 ILE A CG2  12 
ATOM 7176  C CD1  . ILE A 1 38 ? 7.152   -21.564 8.325   1.00 0.00 ? 41 ILE A CD1  12 
ATOM 7177  O OXT  . ILE A 1 38 ? 8.640   -17.537 8.660   1.00 0.00 ? 41 ILE A OXT  12 
ATOM 7178  H H    . ILE A 1 38 ? 6.357   -18.679 8.035   1.00 0.00 ? 41 ILE A H    12 
ATOM 7179  H HA   . ILE A 1 38 ? 6.509   -18.411 10.952  1.00 0.00 ? 41 ILE A HA   12 
ATOM 7180  H HB   . ILE A 1 38 ? 8.665   -19.796 10.835  1.00 0.00 ? 41 ILE A HB   12 
ATOM 7181  H HG12 . ILE A 1 38 ? 8.361   -19.838 8.200   1.00 0.00 ? 41 ILE A HG12 12 
ATOM 7182  H HG13 . ILE A 1 38 ? 9.099   -21.184 9.056   1.00 0.00 ? 41 ILE A HG13 12 
ATOM 7183  H HG21 . ILE A 1 38 ? 5.892   -20.919 10.701  1.00 0.00 ? 41 ILE A HG21 12 
ATOM 7184  H HG22 . ILE A 1 38 ? 6.928   -20.671 12.107  1.00 0.00 ? 41 ILE A HG22 12 
ATOM 7185  H HG23 . ILE A 1 38 ? 7.289   -21.962 10.961  1.00 0.00 ? 41 ILE A HG23 12 
ATOM 7186  H HD11 . ILE A 1 38 ? 7.467   -22.585 8.476   1.00 0.00 ? 41 ILE A HD11 12 
ATOM 7187  H HD12 . ILE A 1 38 ? 7.053   -21.370 7.268   1.00 0.00 ? 41 ILE A HD12 12 
ATOM 7188  H HD13 . ILE A 1 38 ? 6.201   -21.405 8.812   1.00 0.00 ? 41 ILE A HD13 12 
ATOM 7189  N N    . PHE A 1 1  ? -8.639  15.176  9.857   1.00 0.00 ? 4  PHE A N    13 
ATOM 7190  C CA   . PHE A 1 1  ? -9.919  14.524  9.459   1.00 0.00 ? 4  PHE A CA   13 
ATOM 7191  C C    . PHE A 1 1  ? -11.019 15.561  9.230   1.00 0.00 ? 4  PHE A C    13 
ATOM 7192  O O    . PHE A 1 1  ? -10.939 16.676  9.745   1.00 0.00 ? 4  PHE A O    13 
ATOM 7193  C CB   . PHE A 1 1  ? -10.336 13.545  10.564  1.00 0.00 ? 4  PHE A CB   13 
ATOM 7194  C CG   . PHE A 1 1  ? -11.334 12.514  10.112  1.00 0.00 ? 4  PHE A CG   13 
ATOM 7195  C CD1  . PHE A 1 1  ? -10.911 11.319  9.553   1.00 0.00 ? 4  PHE A CD1  13 
ATOM 7196  C CD2  . PHE A 1 1  ? -12.695 12.742  10.247  1.00 0.00 ? 4  PHE A CD2  13 
ATOM 7197  C CE1  . PHE A 1 1  ? -11.825 10.371  9.136   1.00 0.00 ? 4  PHE A CE1  13 
ATOM 7198  C CE2  . PHE A 1 1  ? -13.614 11.797  9.831   1.00 0.00 ? 4  PHE A CE2  13 
ATOM 7199  C CZ   . PHE A 1 1  ? -13.179 10.610  9.276   1.00 0.00 ? 4  PHE A CZ   13 
ATOM 7200  H H1   . PHE A 1 1  ? -7.914  14.435  9.939   1.00 0.00 ? 4  PHE A H1   13 
ATOM 7201  H H2   . PHE A 1 1  ? -8.795  15.652  10.772  1.00 0.00 ? 4  PHE A H2   13 
ATOM 7202  H H3   . PHE A 1 1  ? -8.388  15.865  9.117   1.00 0.00 ? 4  PHE A H3   13 
ATOM 7203  H HA   . PHE A 1 1  ? -9.757  13.978  8.542   1.00 0.00 ? 4  PHE A HA   13 
ATOM 7204  H HB2  . PHE A 1 1  ? -9.464  13.022  10.921  1.00 0.00 ? 4  PHE A HB2  13 
ATOM 7205  H HB3  . PHE A 1 1  ? -10.777 14.098  11.381  1.00 0.00 ? 4  PHE A HB3  13 
ATOM 7206  H HD1  . PHE A 1 1  ? -9.853  11.130  9.444   1.00 0.00 ? 4  PHE A HD1  13 
ATOM 7207  H HD2  . PHE A 1 1  ? -13.038 13.669  10.682  1.00 0.00 ? 4  PHE A HD2  13 
ATOM 7208  H HE1  . PHE A 1 1  ? -11.483 9.443   8.700   1.00 0.00 ? 4  PHE A HE1  13 
ATOM 7209  H HE2  . PHE A 1 1  ? -14.671 11.987  9.942   1.00 0.00 ? 4  PHE A HE2  13 
ATOM 7210  H HZ   . PHE A 1 1  ? -13.896 9.870   8.950   1.00 0.00 ? 4  PHE A HZ   13 
ATOM 7211  N N    . THR A 1 2  ? -12.039 15.179  8.456   1.00 0.00 ? 5  THR A N    13 
ATOM 7212  C CA   . THR A 1 2  ? -13.169 16.065  8.147   1.00 0.00 ? 5  THR A CA   13 
ATOM 7213  C C    . THR A 1 2  ? -12.749 17.177  7.183   1.00 0.00 ? 5  THR A C    13 
ATOM 7214  O O    . THR A 1 2  ? -12.193 18.196  7.599   1.00 0.00 ? 5  THR A O    13 
ATOM 7215  C CB   . THR A 1 2  ? -13.758 16.668  9.430   1.00 0.00 ? 5  THR A CB   13 
ATOM 7216  O OG1  . THR A 1 2  ? -14.132 15.646  10.338  1.00 0.00 ? 5  THR A OG1  13 
ATOM 7217  C CG2  . THR A 1 2  ? -14.983 17.523  9.184   1.00 0.00 ? 5  THR A CG2  13 
ATOM 7218  H H    . THR A 1 2  ? -12.037 14.272  8.083   1.00 0.00 ? 5  THR A H    13 
ATOM 7219  H HA   . THR A 1 2  ? -13.928 15.468  7.667   1.00 0.00 ? 5  THR A HA   13 
ATOM 7220  H HB   . THR A 1 2  ? -13.009 17.290  9.902   1.00 0.00 ? 5  THR A HB   13 
ATOM 7221  H HG1  . THR A 1 2  ? -14.419 16.039  11.167  1.00 0.00 ? 5  THR A HG1  13 
ATOM 7222  H HG21 . THR A 1 2  ? -15.461 17.745  10.126  1.00 0.00 ? 5  THR A HG21 13 
ATOM 7223  H HG22 . THR A 1 2  ? -15.673 16.989  8.547   1.00 0.00 ? 5  THR A HG22 13 
ATOM 7224  H HG23 . THR A 1 2  ? -14.688 18.444  8.704   1.00 0.00 ? 5  THR A HG23 13 
ATOM 7225  N N    . LEU A 1 3  ? -13.023 16.967  5.891   1.00 0.00 ? 6  LEU A N    13 
ATOM 7226  C CA   . LEU A 1 3  ? -12.685 17.936  4.841   1.00 0.00 ? 6  LEU A CA   13 
ATOM 7227  C C    . LEU A 1 3  ? -11.168 18.038  4.627   1.00 0.00 ? 6  LEU A C    13 
ATOM 7228  O O    . LEU A 1 3  ? -10.377 17.496  5.402   1.00 0.00 ? 6  LEU A O    13 
ATOM 7229  C CB   . LEU A 1 3  ? -13.268 19.318  5.172   1.00 0.00 ? 6  LEU A CB   13 
ATOM 7230  C CG   . LEU A 1 3  ? -14.765 19.477  4.888   1.00 0.00 ? 6  LEU A CG   13 
ATOM 7231  C CD1  . LEU A 1 3  ? -15.574 19.270  6.158   1.00 0.00 ? 6  LEU A CD1  13 
ATOM 7232  C CD2  . LEU A 1 3  ? -15.050 20.845  4.293   1.00 0.00 ? 6  LEU A CD2  13 
ATOM 7233  H H    . LEU A 1 3  ? -13.469 16.133  5.634   1.00 0.00 ? 6  LEU A H    13 
ATOM 7234  H HA   . LEU A 1 3  ? -13.132 17.587  3.923   1.00 0.00 ? 6  LEU A HA   13 
ATOM 7235  H HB2  . LEU A 1 3  ? -13.099 19.517  6.220   1.00 0.00 ? 6  LEU A HB2  13 
ATOM 7236  H HB3  . LEU A 1 3  ? -12.736 20.059  4.594   1.00 0.00 ? 6  LEU A HB3  13 
ATOM 7237  H HG   . LEU A 1 3  ? -15.072 18.729  4.172   1.00 0.00 ? 6  LEU A HG   13 
ATOM 7238  H HD11 . LEU A 1 3  ? -15.334 20.049  6.868   1.00 0.00 ? 6  LEU A HD11 13 
ATOM 7239  H HD12 . LEU A 1 3  ? -15.335 18.308  6.584   1.00 0.00 ? 6  LEU A HD12 13 
ATOM 7240  H HD13 . LEU A 1 3  ? -16.627 19.311  5.923   1.00 0.00 ? 6  LEU A HD13 13 
ATOM 7241  H HD21 . LEU A 1 3  ? -14.607 20.912  3.311   1.00 0.00 ? 6  LEU A HD21 13 
ATOM 7242  H HD22 . LEU A 1 3  ? -14.631 21.609  4.931   1.00 0.00 ? 6  LEU A HD22 13 
ATOM 7243  H HD23 . LEU A 1 3  ? -16.118 20.988  4.217   1.00 0.00 ? 6  LEU A HD23 13 
ATOM 7244  N N    . SER A 1 4  ? -10.774 18.737  3.558   1.00 0.00 ? 7  SER A N    13 
ATOM 7245  C CA   . SER A 1 4  ? -9.356  18.924  3.218   1.00 0.00 ? 7  SER A CA   13 
ATOM 7246  C C    . SER A 1 4  ? -8.657  17.599  2.877   1.00 0.00 ? 7  SER A C    13 
ATOM 7247  O O    . SER A 1 4  ? -7.429  17.504  2.944   1.00 0.00 ? 7  SER A O    13 
ATOM 7248  C CB   . SER A 1 4  ? -8.621  19.621  4.368   1.00 0.00 ? 7  SER A CB   13 
ATOM 7249  O OG   . SER A 1 4  ? -7.848  20.712  3.892   1.00 0.00 ? 7  SER A OG   13 
ATOM 7250  H H    . SER A 1 4  ? -11.455 19.141  2.979   1.00 0.00 ? 7  SER A H    13 
ATOM 7251  H HA   . SER A 1 4  ? -9.313  19.562  2.348   1.00 0.00 ? 7  SER A HA   13 
ATOM 7252  H HB2  . SER A 1 4  ? -9.343  19.993  5.081   1.00 0.00 ? 7  SER A HB2  13 
ATOM 7253  H HB3  . SER A 1 4  ? -7.965  18.915  4.856   1.00 0.00 ? 7  SER A HB3  13 
ATOM 7254  H HG   . SER A 1 4  ? -7.147  20.384  3.319   1.00 0.00 ? 7  SER A HG   13 
ATOM 7255  N N    . LEU A 1 5  ? -9.436  16.583  2.494   1.00 0.00 ? 8  LEU A N    13 
ATOM 7256  C CA   . LEU A 1 5  ? -8.879  15.278  2.130   1.00 0.00 ? 8  LEU A CA   13 
ATOM 7257  C C    . LEU A 1 5  ? -8.943  15.066  0.614   1.00 0.00 ? 8  LEU A C    13 
ATOM 7258  O O    . LEU A 1 5  ? -9.181  13.956  0.129   1.00 0.00 ? 8  LEU A O    13 
ATOM 7259  C CB   . LEU A 1 5  ? -9.627  14.157  2.863   1.00 0.00 ? 8  LEU A CB   13 
ATOM 7260  C CG   . LEU A 1 5  ? -9.731  14.326  4.381   1.00 0.00 ? 8  LEU A CG   13 
ATOM 7261  C CD1  . LEU A 1 5  ? -11.181 14.475  4.805   1.00 0.00 ? 8  LEU A CD1  13 
ATOM 7262  C CD2  . LEU A 1 5  ? -9.089  13.148  5.095   1.00 0.00 ? 8  LEU A CD2  13 
ATOM 7263  H H    . LEU A 1 5  ? -10.403 16.716  2.443   1.00 0.00 ? 8  LEU A H    13 
ATOM 7264  H HA   . LEU A 1 5  ? -7.843  15.269  2.432   1.00 0.00 ? 8  LEU A HA   13 
ATOM 7265  H HB2  . LEU A 1 5  ? -10.627 14.098  2.458   1.00 0.00 ? 8  LEU A HB2  13 
ATOM 7266  H HB3  . LEU A 1 5  ? -9.121  13.225  2.660   1.00 0.00 ? 8  LEU A HB3  13 
ATOM 7267  H HG   . LEU A 1 5  ? -9.204  15.224  4.675   1.00 0.00 ? 8  LEU A HG   13 
ATOM 7268  H HD11 . LEU A 1 5  ? -11.569 13.513  5.104   1.00 0.00 ? 8  LEU A HD11 13 
ATOM 7269  H HD12 . LEU A 1 5  ? -11.761 14.855  3.977   1.00 0.00 ? 8  LEU A HD12 13 
ATOM 7270  H HD13 . LEU A 1 5  ? -11.244 15.163  5.634   1.00 0.00 ? 8  LEU A HD13 13 
ATOM 7271  H HD21 . LEU A 1 5  ? -9.418  13.128  6.122   1.00 0.00 ? 8  LEU A HD21 13 
ATOM 7272  H HD22 . LEU A 1 5  ? -8.014  13.251  5.064   1.00 0.00 ? 8  LEU A HD22 13 
ATOM 7273  H HD23 . LEU A 1 5  ? -9.378  12.230  4.606   1.00 0.00 ? 8  LEU A HD23 13 
ATOM 7274  N N    . ASP A 1 6  ? -8.724  16.147  -0.126  1.00 0.00 ? 9  ASP A N    13 
ATOM 7275  C CA   . ASP A 1 6  ? -8.753  16.131  -1.581  1.00 0.00 ? 9  ASP A CA   13 
ATOM 7276  C C    . ASP A 1 6  ? -7.469  15.519  -2.152  1.00 0.00 ? 9  ASP A C    13 
ATOM 7277  O O    . ASP A 1 6  ? -6.738  16.161  -2.910  1.00 0.00 ? 9  ASP A O    13 
ATOM 7278  C CB   . ASP A 1 6  ? -8.956  17.564  -2.102  1.00 0.00 ? 9  ASP A CB   13 
ATOM 7279  C CG   . ASP A 1 6  ? -9.772  18.428  -1.156  1.00 0.00 ? 9  ASP A CG   13 
ATOM 7280  O OD1  . ASP A 1 6  ? -9.242  18.804  -0.085  1.00 0.00 ? 9  ASP A OD1  13 
ATOM 7281  O OD2  . ASP A 1 6  ? -10.939 18.721  -1.480  1.00 0.00 ? 9  ASP A OD2  13 
ATOM 7282  H H    . ASP A 1 6  ? -8.538  16.992  0.321   1.00 0.00 ? 9  ASP A H    13 
ATOM 7283  H HA   . ASP A 1 6  ? -9.592  15.526  -1.890  1.00 0.00 ? 9  ASP A HA   13 
ATOM 7284  H HB2  . ASP A 1 6  ? -7.994  18.031  -2.241  1.00 0.00 ? 9  ASP A HB2  13 
ATOM 7285  H HB3  . ASP A 1 6  ? -9.468  17.522  -3.044  1.00 0.00 ? 9  ASP A HB3  13 
ATOM 7286  N N    . VAL A 1 7  ? -7.210  14.266  -1.769  1.00 0.00 ? 10 VAL A N    13 
ATOM 7287  C CA   . VAL A 1 7  ? -6.022  13.522  -2.215  1.00 0.00 ? 10 VAL A CA   13 
ATOM 7288  C C    . VAL A 1 7  ? -4.752  14.395  -2.202  1.00 0.00 ? 10 VAL A C    13 
ATOM 7289  O O    . VAL A 1 7  ? -4.086  14.579  -3.225  1.00 0.00 ? 10 VAL A O    13 
ATOM 7290  C CB   . VAL A 1 7  ? -6.244  12.894  -3.618  1.00 0.00 ? 10 VAL A CB   13 
ATOM 7291  C CG1  . VAL A 1 7  ? -6.457  13.960  -4.684  1.00 0.00 ? 10 VAL A CG1  13 
ATOM 7292  C CG2  . VAL A 1 7  ? -5.085  11.984  -3.994  1.00 0.00 ? 10 VAL A CG2  13 
ATOM 7293  H H    . VAL A 1 7  ? -7.841  13.827  -1.160  1.00 0.00 ? 10 VAL A H    13 
ATOM 7294  H HA   . VAL A 1 7  ? -5.874  12.713  -1.514  1.00 0.00 ? 10 VAL A HA   13 
ATOM 7295  H HB   . VAL A 1 7  ? -7.139  12.291  -3.573  1.00 0.00 ? 10 VAL A HB   13 
ATOM 7296  H HG11 . VAL A 1 7  ? -5.750  14.764  -4.540  1.00 0.00 ? 10 VAL A HG11 13 
ATOM 7297  H HG12 . VAL A 1 7  ? -7.462  14.348  -4.611  1.00 0.00 ? 10 VAL A HG12 13 
ATOM 7298  H HG13 . VAL A 1 7  ? -6.310  13.525  -5.661  1.00 0.00 ? 10 VAL A HG13 13 
ATOM 7299  H HG21 . VAL A 1 7  ? -5.348  11.411  -4.871  1.00 0.00 ? 10 VAL A HG21 13 
ATOM 7300  H HG22 . VAL A 1 7  ? -4.873  11.312  -3.175  1.00 0.00 ? 10 VAL A HG22 13 
ATOM 7301  H HG23 . VAL A 1 7  ? -4.211  12.582  -4.205  1.00 0.00 ? 10 VAL A HG23 13 
ATOM 7302  N N    . PRO A 1 8  ? -4.402  14.949  -1.021  1.00 0.00 ? 11 PRO A N    13 
ATOM 7303  C CA   . PRO A 1 8  ? -3.219  15.806  -0.866  1.00 0.00 ? 11 PRO A CA   13 
ATOM 7304  C C    . PRO A 1 8  ? -1.900  15.034  -0.942  1.00 0.00 ? 11 PRO A C    13 
ATOM 7305  O O    . PRO A 1 8  ? -1.875  13.801  -0.860  1.00 0.00 ? 11 PRO A O    13 
ATOM 7306  C CB   . PRO A 1 8  ? -3.409  16.413  0.527   1.00 0.00 ? 11 PRO A CB   13 
ATOM 7307  C CG   . PRO A 1 8  ? -4.227  15.412  1.268   1.00 0.00 ? 11 PRO A CG   13 
ATOM 7308  C CD   . PRO A 1 8  ? -5.136  14.783  0.249   1.00 0.00 ? 11 PRO A CD   13 
ATOM 7309  H HA   . PRO A 1 8  ? -3.210  16.595  -1.603  1.00 0.00 ? 11 PRO A HA   13 
ATOM 7310  H HB2  . PRO A 1 8  ? -2.447  16.564  0.994   1.00 0.00 ? 11 PRO A HB2  13 
ATOM 7311  H HB3  . PRO A 1 8  ? -3.926  17.358  0.442   1.00 0.00 ? 11 PRO A HB3  13 
ATOM 7312  H HG2  . PRO A 1 8  ? -3.582  14.665  1.708   1.00 0.00 ? 11 PRO A HG2  13 
ATOM 7313  H HG3  . PRO A 1 8  ? -4.807  15.906  2.034   1.00 0.00 ? 11 PRO A HG3  13 
ATOM 7314  H HD2  . PRO A 1 8  ? -5.286  13.738  0.473   1.00 0.00 ? 11 PRO A HD2  13 
ATOM 7315  H HD3  . PRO A 1 8  ? -6.083  15.302  0.216   1.00 0.00 ? 11 PRO A HD3  13 
ATOM 7316  N N    . THR A 1 9  ? -0.801  15.776  -1.093  1.00 0.00 ? 12 THR A N    13 
ATOM 7317  C CA   . THR A 1 9  ? 0.541   15.187  -1.181  1.00 0.00 ? 12 THR A CA   13 
ATOM 7318  C C    . THR A 1 9  ? 0.788   14.188  -0.051  1.00 0.00 ? 12 THR A C    13 
ATOM 7319  O O    . THR A 1 9  ? 1.268   13.080  -0.293  1.00 0.00 ? 12 THR A O    13 
ATOM 7320  C CB   . THR A 1 9  ? 1.614   16.284  -1.149  1.00 0.00 ? 12 THR A CB   13 
ATOM 7321  O OG1  . THR A 1 9  ? 1.024   17.574  -1.182  1.00 0.00 ? 12 THR A OG1  13 
ATOM 7322  C CG2  . THR A 1 9  ? 2.593   16.196  -2.300  1.00 0.00 ? 12 THR A CG2  13 
ATOM 7323  H H    . THR A 1 9  ? -0.891  16.752  -1.146  1.00 0.00 ? 12 THR A H    13 
ATOM 7324  H HA   . THR A 1 9  ? 0.608   14.662  -2.122  1.00 0.00 ? 12 THR A HA   13 
ATOM 7325  H HB   . THR A 1 9  ? 2.177   16.194  -0.230  1.00 0.00 ? 12 THR A HB   13 
ATOM 7326  H HG1  . THR A 1 9  ? 0.958   17.881  -2.092  1.00 0.00 ? 12 THR A HG1  13 
ATOM 7327  H HG21 . THR A 1 9  ? 3.292   15.392  -2.118  1.00 0.00 ? 12 THR A HG21 13 
ATOM 7328  H HG22 . THR A 1 9  ? 3.133   17.128  -2.385  1.00 0.00 ? 12 THR A HG22 13 
ATOM 7329  H HG23 . THR A 1 9  ? 2.056   16.005  -3.217  1.00 0.00 ? 12 THR A HG23 13 
ATOM 7330  N N    . ASN A 1 10 ? 0.448   14.582  1.181   1.00 0.00 ? 13 ASN A N    13 
ATOM 7331  C CA   . ASN A 1 10 ? 0.628   13.707  2.343   1.00 0.00 ? 13 ASN A CA   13 
ATOM 7332  C C    . ASN A 1 10 ? -0.028  12.360  2.103   1.00 0.00 ? 13 ASN A C    13 
ATOM 7333  O O    . ASN A 1 10 ? 0.599   11.305  2.227   1.00 0.00 ? 13 ASN A O    13 
ATOM 7334  C CB   . ASN A 1 10 ? 0.061   14.364  3.611   1.00 0.00 ? 13 ASN A CB   13 
ATOM 7335  C CG   . ASN A 1 10 ? 1.118   14.600  4.674   1.00 0.00 ? 13 ASN A CG   13 
ATOM 7336  O OD1  . ASN A 1 10 ? 2.150   13.936  4.698   1.00 0.00 ? 13 ASN A OD1  13 
ATOM 7337  N ND2  . ASN A 1 10 ? 0.865   15.549  5.564   1.00 0.00 ? 13 ASN A ND2  13 
ATOM 7338  H H    . ASN A 1 10 ? 0.063   15.475  1.308   1.00 0.00 ? 13 ASN A H    13 
ATOM 7339  H HA   . ASN A 1 10 ? 1.666   13.546  2.467   1.00 0.00 ? 13 ASN A HA   13 
ATOM 7340  H HB2  . ASN A 1 10 ? -0.375  15.316  3.352   1.00 0.00 ? 13 ASN A HB2  13 
ATOM 7341  H HB3  . ASN A 1 10 ? -0.705  13.726  4.028   1.00 0.00 ? 13 ASN A HB3  13 
ATOM 7342  H HD21 . ASN A 1 10 ? 0.021   16.041  5.491   1.00 0.00 ? 13 ASN A HD21 13 
ATOM 7343  H HD22 . ASN A 1 10 ? 1.534   15.718  6.259   1.00 0.00 ? 13 ASN A HD22 13 
ATOM 7344  N N    . ILE A 1 11 ? -1.285  12.425  1.729   1.00 0.00 ? 14 ILE A N    13 
ATOM 7345  C CA   . ILE A 1 11 ? -2.075  11.240  1.425   1.00 0.00 ? 14 ILE A CA   13 
ATOM 7346  C C    . ILE A 1 11 ? -1.472  10.490  0.237   1.00 0.00 ? 14 ILE A C    13 
ATOM 7347  O O    . ILE A 1 11 ? -1.255  9.278   0.305   1.00 0.00 ? 14 ILE A O    13 
ATOM 7348  C CB   . ILE A 1 11 ? -3.539  11.642  1.137   1.00 0.00 ? 14 ILE A CB   13 
ATOM 7349  C CG1  . ILE A 1 11 ? -4.397  11.453  2.390   1.00 0.00 ? 14 ILE A CG1  13 
ATOM 7350  C CG2  . ILE A 1 11 ? -4.128  10.856  -0.031  1.00 0.00 ? 14 ILE A CG2  13 
ATOM 7351  C CD1  . ILE A 1 11 ? -5.755  12.116  2.304   1.00 0.00 ? 14 ILE A CD1  13 
ATOM 7352  H H    . ILE A 1 11 ? -1.688  13.306  1.634   1.00 0.00 ? 14 ILE A H    13 
ATOM 7353  H HA   . ILE A 1 11 ? -2.058  10.593  2.290   1.00 0.00 ? 14 ILE A HA   13 
ATOM 7354  H HB   . ILE A 1 11 ? -3.536  12.689  0.871   1.00 0.00 ? 14 ILE A HB   13 
ATOM 7355  H HG12 . ILE A 1 11 ? -4.554  10.398  2.554   1.00 0.00 ? 14 ILE A HG12 13 
ATOM 7356  H HG13 . ILE A 1 11 ? -3.876  11.871  3.240   1.00 0.00 ? 14 ILE A HG13 13 
ATOM 7357  H HG21 . ILE A 1 11 ? -3.878  9.811   0.076   1.00 0.00 ? 14 ILE A HG21 13 
ATOM 7358  H HG22 . ILE A 1 11 ? -3.721  11.230  -0.959  1.00 0.00 ? 14 ILE A HG22 13 
ATOM 7359  H HG23 . ILE A 1 11 ? -5.202  10.971  -0.037  1.00 0.00 ? 14 ILE A HG23 13 
ATOM 7360  H HD11 . ILE A 1 11 ? -6.420  11.670  3.030   1.00 0.00 ? 14 ILE A HD11 13 
ATOM 7361  H HD12 . ILE A 1 11 ? -6.161  11.976  1.312   1.00 0.00 ? 14 ILE A HD12 13 
ATOM 7362  H HD13 . ILE A 1 11 ? -5.655  13.171  2.508   1.00 0.00 ? 14 ILE A HD13 13 
ATOM 7363  N N    . MET A 1 12 ? -1.181  11.222  -0.843  1.00 0.00 ? 15 MET A N    13 
ATOM 7364  C CA   . MET A 1 12 ? -0.581  10.634  -2.034  1.00 0.00 ? 15 MET A CA   13 
ATOM 7365  C C    . MET A 1 12 ? 0.707   9.893   -1.672  1.00 0.00 ? 15 MET A C    13 
ATOM 7366  O O    . MET A 1 12 ? 0.885   8.725   -2.028  1.00 0.00 ? 15 MET A O    13 
ATOM 7367  C CB   . MET A 1 12 ? -0.297  11.731  -3.060  1.00 0.00 ? 15 MET A CB   13 
ATOM 7368  C CG   . MET A 1 12 ? -0.927  11.472  -4.415  1.00 0.00 ? 15 MET A CG   13 
ATOM 7369  S SD   . MET A 1 12 ? 0.298   11.158  -5.700  1.00 0.00 ? 15 MET A SD   13 
ATOM 7370  C CE   . MET A 1 12 ? -0.546  11.807  -7.139  1.00 0.00 ? 15 MET A CE   13 
ATOM 7371  H H    . MET A 1 12 ? -1.363  12.189  -0.834  1.00 0.00 ? 15 MET A H    13 
ATOM 7372  H HA   . MET A 1 12 ? -1.284  9.929   -2.451  1.00 0.00 ? 15 MET A HA   13 
ATOM 7373  H HB2  . MET A 1 12 ? -0.683  12.667  -2.684  1.00 0.00 ? 15 MET A HB2  13 
ATOM 7374  H HB3  . MET A 1 12 ? 0.768   11.820  -3.189  1.00 0.00 ? 15 MET A HB3  13 
ATOM 7375  H HG2  . MET A 1 12 ? -1.575  10.611  -4.337  1.00 0.00 ? 15 MET A HG2  13 
ATOM 7376  H HG3  . MET A 1 12 ? -1.510  12.336  -4.694  1.00 0.00 ? 15 MET A HG3  13 
ATOM 7377  H HE1  . MET A 1 12 ? -1.557  12.079  -6.874  1.00 0.00 ? 15 MET A HE1  13 
ATOM 7378  H HE2  . MET A 1 12 ? -0.567  11.053  -7.913  1.00 0.00 ? 15 MET A HE2  13 
ATOM 7379  H HE3  . MET A 1 12 ? -0.021  12.679  -7.501  1.00 0.00 ? 15 MET A HE3  13 
ATOM 7380  N N    . ASN A 1 13 ? 1.589   10.575  -0.935  1.00 0.00 ? 16 ASN A N    13 
ATOM 7381  C CA   . ASN A 1 13 ? 2.846   9.984   -0.494  1.00 0.00 ? 16 ASN A CA   13 
ATOM 7382  C C    . ASN A 1 13 ? 2.572   8.726   0.330   1.00 0.00 ? 16 ASN A C    13 
ATOM 7383  O O    . ASN A 1 13 ? 3.183   7.676   0.109   1.00 0.00 ? 16 ASN A O    13 
ATOM 7384  C CB   . ASN A 1 13 ? 3.645   11.012  0.319   1.00 0.00 ? 16 ASN A CB   13 
ATOM 7385  C CG   . ASN A 1 13 ? 4.742   10.385  1.153   1.00 0.00 ? 16 ASN A CG   13 
ATOM 7386  O OD1  . ASN A 1 13 ? 5.790   10.010  0.636   1.00 0.00 ? 16 ASN A OD1  13 
ATOM 7387  N ND2  . ASN A 1 13 ? 4.509   10.274  2.450   1.00 0.00 ? 16 ASN A ND2  13 
ATOM 7388  H H    . ASN A 1 13 ? 1.379   11.498  -0.664  1.00 0.00 ? 16 ASN A H    13 
ATOM 7389  H HA   . ASN A 1 13 ? 3.408   9.710   -1.368  1.00 0.00 ? 16 ASN A HA   13 
ATOM 7390  H HB2  . ASN A 1 13 ? 4.099   11.719  -0.357  1.00 0.00 ? 16 ASN A HB2  13 
ATOM 7391  H HB3  . ASN A 1 13 ? 2.972   11.538  0.980   1.00 0.00 ? 16 ASN A HB3  13 
ATOM 7392  H HD21 . ASN A 1 13 ? 3.654   10.597  2.799   1.00 0.00 ? 16 ASN A HD21 13 
ATOM 7393  H HD22 . ASN A 1 13 ? 5.204   9.873   3.005   1.00 0.00 ? 16 ASN A HD22 13 
ATOM 7394  N N    . LEU A 1 14 ? 1.626   8.837   1.262   1.00 0.00 ? 17 LEU A N    13 
ATOM 7395  C CA   . LEU A 1 14 ? 1.240   7.709   2.104   1.00 0.00 ? 17 LEU A CA   13 
ATOM 7396  C C    . LEU A 1 14 ? 0.689   6.575   1.245   1.00 0.00 ? 17 LEU A C    13 
ATOM 7397  O O    . LEU A 1 14 ? 1.131   5.431   1.359   1.00 0.00 ? 17 LEU A O    13 
ATOM 7398  C CB   . LEU A 1 14 ? 0.198   8.140   3.142   1.00 0.00 ? 17 LEU A CB   13 
ATOM 7399  C CG   . LEU A 1 14 ? 0.727   9.032   4.267   1.00 0.00 ? 17 LEU A CG   13 
ATOM 7400  C CD1  . LEU A 1 14 ? -0.416  9.517   5.140   1.00 0.00 ? 17 LEU A CD1  13 
ATOM 7401  C CD2  . LEU A 1 14 ? 1.755   8.286   5.103   1.00 0.00 ? 17 LEU A CD2  13 
ATOM 7402  H H    . LEU A 1 14 ? 1.164   9.698   1.370   1.00 0.00 ? 17 LEU A H    13 
ATOM 7403  H HA   . LEU A 1 14 ? 2.125   7.356   2.612   1.00 0.00 ? 17 LEU A HA   13 
ATOM 7404  H HB2  . LEU A 1 14 ? -0.589  8.674   2.629   1.00 0.00 ? 17 LEU A HB2  13 
ATOM 7405  H HB3  . LEU A 1 14 ? -0.224  7.252   3.587   1.00 0.00 ? 17 LEU A HB3  13 
ATOM 7406  H HG   . LEU A 1 14 ? 1.208   9.898   3.836   1.00 0.00 ? 17 LEU A HG   13 
ATOM 7407  H HD11 . LEU A 1 14 ? -1.074  8.690   5.366   1.00 0.00 ? 17 LEU A HD11 13 
ATOM 7408  H HD12 . LEU A 1 14 ? -0.968  10.285  4.619   1.00 0.00 ? 17 LEU A HD12 13 
ATOM 7409  H HD13 . LEU A 1 14 ? -0.020  9.921   6.061   1.00 0.00 ? 17 LEU A HD13 13 
ATOM 7410  H HD21 . LEU A 1 14 ? 2.604   8.032   4.488   1.00 0.00 ? 17 LEU A HD21 13 
ATOM 7411  H HD22 . LEU A 1 14 ? 1.311   7.382   5.494   1.00 0.00 ? 17 LEU A HD22 13 
ATOM 7412  H HD23 . LEU A 1 14 ? 2.075   8.913   5.921   1.00 0.00 ? 17 LEU A HD23 13 
ATOM 7413  N N    . LEU A 1 15 ? -0.265  6.902   0.369   1.00 0.00 ? 18 LEU A N    13 
ATOM 7414  C CA   . LEU A 1 15 ? -0.858  5.908   -0.524  1.00 0.00 ? 18 LEU A CA   13 
ATOM 7415  C C    . LEU A 1 15 ? 0.226   5.206   -1.335  1.00 0.00 ? 18 LEU A C    13 
ATOM 7416  O O    . LEU A 1 15 ? 0.254   3.974   -1.414  1.00 0.00 ? 18 LEU A O    13 
ATOM 7417  C CB   . LEU A 1 15 ? -1.879  6.567   -1.459  1.00 0.00 ? 18 LEU A CB   13 
ATOM 7418  C CG   . LEU A 1 15 ? -3.201  6.969   -0.801  1.00 0.00 ? 18 LEU A CG   13 
ATOM 7419  C CD1  . LEU A 1 15 ? -4.087  7.703   -1.794  1.00 0.00 ? 18 LEU A CD1  13 
ATOM 7420  C CD2  . LEU A 1 15 ? -3.918  5.745   -0.254  1.00 0.00 ? 18 LEU A CD2  13 
ATOM 7421  H H    . LEU A 1 15 ? -0.567  7.839   0.315   1.00 0.00 ? 18 LEU A H    13 
ATOM 7422  H HA   . LEU A 1 15 ? -1.356  5.172   0.086   1.00 0.00 ? 18 LEU A HA   13 
ATOM 7423  H HB2  . LEU A 1 15 ? -1.428  7.454   -1.881  1.00 0.00 ? 18 LEU A HB2  13 
ATOM 7424  H HB3  . LEU A 1 15 ? -2.097  5.879   -2.262  1.00 0.00 ? 18 LEU A HB3  13 
ATOM 7425  H HG   . LEU A 1 15 ? -2.998  7.637   0.024   1.00 0.00 ? 18 LEU A HG   13 
ATOM 7426  H HD11 . LEU A 1 15 ? -4.086  7.173   -2.735  1.00 0.00 ? 18 LEU A HD11 13 
ATOM 7427  H HD12 . LEU A 1 15 ? -3.708  8.703   -1.943  1.00 0.00 ? 18 LEU A HD12 13 
ATOM 7428  H HD13 . LEU A 1 15 ? -5.094  7.752   -1.409  1.00 0.00 ? 18 LEU A HD13 13 
ATOM 7429  H HD21 . LEU A 1 15 ? -4.786  6.057   0.307   1.00 0.00 ? 18 LEU A HD21 13 
ATOM 7430  H HD22 . LEU A 1 15 ? -3.250  5.194   0.392   1.00 0.00 ? 18 LEU A HD22 13 
ATOM 7431  H HD23 . LEU A 1 15 ? -4.227  5.114   -1.074  1.00 0.00 ? 18 LEU A HD23 13 
ATOM 7432  N N    . PHE A 1 16 ? 1.132   5.999   -1.914  1.00 0.00 ? 19 PHE A N    13 
ATOM 7433  C CA   . PHE A 1 16 ? 2.240   5.458   -2.698  1.00 0.00 ? 19 PHE A CA   13 
ATOM 7434  C C    . PHE A 1 16 ? 3.038   4.455   -1.867  1.00 0.00 ? 19 PHE A C    13 
ATOM 7435  O O    . PHE A 1 16 ? 3.382   3.371   -2.345  1.00 0.00 ? 19 PHE A O    13 
ATOM 7436  C CB   . PHE A 1 16 ? 3.155   6.589   -3.177  1.00 0.00 ? 19 PHE A CB   13 
ATOM 7437  C CG   . PHE A 1 16 ? 3.650   6.403   -4.584  1.00 0.00 ? 19 PHE A CG   13 
ATOM 7438  C CD1  . PHE A 1 16 ? 4.649   5.484   -4.863  1.00 0.00 ? 19 PHE A CD1  13 
ATOM 7439  C CD2  . PHE A 1 16 ? 3.116   7.143   -5.625  1.00 0.00 ? 19 PHE A CD2  13 
ATOM 7440  C CE1  . PHE A 1 16 ? 5.106   5.308   -6.156  1.00 0.00 ? 19 PHE A CE1  13 
ATOM 7441  C CE2  . PHE A 1 16 ? 3.569   6.972   -6.919  1.00 0.00 ? 19 PHE A CE2  13 
ATOM 7442  C CZ   . PHE A 1 16 ? 4.565   6.052   -7.185  1.00 0.00 ? 19 PHE A CZ   13 
ATOM 7443  H H    . PHE A 1 16 ? 1.060   6.974   -1.796  1.00 0.00 ? 19 PHE A H    13 
ATOM 7444  H HA   . PHE A 1 16 ? 1.825   4.949   -3.555  1.00 0.00 ? 19 PHE A HA   13 
ATOM 7445  H HB2  . PHE A 1 16 ? 2.616   7.522   -3.134  1.00 0.00 ? 19 PHE A HB2  13 
ATOM 7446  H HB3  . PHE A 1 16 ? 4.016   6.647   -2.526  1.00 0.00 ? 19 PHE A HB3  13 
ATOM 7447  H HD1  . PHE A 1 16 ? 5.072   4.900   -4.059  1.00 0.00 ? 19 PHE A HD1  13 
ATOM 7448  H HD2  . PHE A 1 16 ? 2.337   7.863   -5.419  1.00 0.00 ? 19 PHE A HD2  13 
ATOM 7449  H HE1  . PHE A 1 16 ? 5.885   4.587   -6.361  1.00 0.00 ? 19 PHE A HE1  13 
ATOM 7450  H HE2  . PHE A 1 16 ? 3.144   7.555   -7.723  1.00 0.00 ? 19 PHE A HE2  13 
ATOM 7451  H HZ   . PHE A 1 16 ? 4.920   5.917   -8.196  1.00 0.00 ? 19 PHE A HZ   13 
ATOM 7452  N N    . ASN A 1 17 ? 3.312   4.816   -0.610  1.00 0.00 ? 20 ASN A N    13 
ATOM 7453  C CA   . ASN A 1 17 ? 4.047   3.947   0.291   1.00 0.00 ? 20 ASN A CA   13 
ATOM 7454  C C    . ASN A 1 17 ? 3.200   2.738   0.674   1.00 0.00 ? 20 ASN A C    13 
ATOM 7455  O O    . ASN A 1 17 ? 3.685   1.605   0.666   1.00 0.00 ? 20 ASN A O    13 
ATOM 7456  C CB   . ASN A 1 17 ? 4.464   4.723   1.537   1.00 0.00 ? 20 ASN A CB   13 
ATOM 7457  C CG   . ASN A 1 17 ? 5.878   4.405   1.960   1.00 0.00 ? 20 ASN A CG   13 
ATOM 7458  O OD1  . ASN A 1 17 ? 6.692   5.298   2.165   1.00 0.00 ? 20 ASN A OD1  13 
ATOM 7459  N ND2  . ASN A 1 17 ? 6.183   3.126   2.089   1.00 0.00 ? 20 ASN A ND2  13 
ATOM 7460  H H    . ASN A 1 17 ? 2.998   5.684   -0.278  1.00 0.00 ? 20 ASN A H    13 
ATOM 7461  H HA   . ASN A 1 17 ? 4.932   3.603   -0.225  1.00 0.00 ? 20 ASN A HA   13 
ATOM 7462  H HB2  . ASN A 1 17 ? 4.399   5.781   1.335   1.00 0.00 ? 20 ASN A HB2  13 
ATOM 7463  H HB3  . ASN A 1 17 ? 3.799   4.474   2.345   1.00 0.00 ? 20 ASN A HB3  13 
ATOM 7464  H HD21 . ASN A 1 17 ? 5.487   2.459   1.911   1.00 0.00 ? 20 ASN A HD21 13 
ATOM 7465  H HD22 . ASN A 1 17 ? 7.092   2.903   2.351   1.00 0.00 ? 20 ASN A HD22 13 
ATOM 7466  N N    . ILE A 1 18 ? 1.923   2.983   0.987   1.00 0.00 ? 21 ILE A N    13 
ATOM 7467  C CA   . ILE A 1 18 ? 1.006   1.904   1.340   1.00 0.00 ? 21 ILE A CA   13 
ATOM 7468  C C    . ILE A 1 18 ? 0.986   0.869   0.223   1.00 0.00 ? 21 ILE A C    13 
ATOM 7469  O O    . ILE A 1 18 ? 1.305   -0.297  0.449   1.00 0.00 ? 21 ILE A O    13 
ATOM 7470  C CB   . ILE A 1 18 ? -0.427  2.428   1.604   1.00 0.00 ? 21 ILE A CB   13 
ATOM 7471  C CG1  . ILE A 1 18 ? -0.481  3.182   2.935   1.00 0.00 ? 21 ILE A CG1  13 
ATOM 7472  C CG2  . ILE A 1 18 ? -1.433  1.282   1.605   1.00 0.00 ? 21 ILE A CG2  13 
ATOM 7473  C CD1  . ILE A 1 18 ? -0.038  2.352   4.123   1.00 0.00 ? 21 ILE A CD1  13 
ATOM 7474  H H    . ILE A 1 18 ? 1.592   3.912   0.959   1.00 0.00 ? 21 ILE A H    13 
ATOM 7475  H HA   . ILE A 1 18 ? 1.370   1.432   2.241   1.00 0.00 ? 21 ILE A HA   13 
ATOM 7476  H HB   . ILE A 1 18 ? -0.692  3.105   0.805   1.00 0.00 ? 21 ILE A HB   13 
ATOM 7477  H HG12 . ILE A 1 18 ? 0.163   4.047   2.878   1.00 0.00 ? 21 ILE A HG12 13 
ATOM 7478  H HG13 . ILE A 1 18 ? -1.496  3.506   3.116   1.00 0.00 ? 21 ILE A HG13 13 
ATOM 7479  H HG21 . ILE A 1 18 ? -2.383  1.640   1.974   1.00 0.00 ? 21 ILE A HG21 13 
ATOM 7480  H HG22 . ILE A 1 18 ? -1.074  0.489   2.245   1.00 0.00 ? 21 ILE A HG22 13 
ATOM 7481  H HG23 . ILE A 1 18 ? -1.555  0.908   0.600   1.00 0.00 ? 21 ILE A HG23 13 
ATOM 7482  H HD11 . ILE A 1 18 ? 1.018   2.504   4.295   1.00 0.00 ? 21 ILE A HD11 13 
ATOM 7483  H HD12 . ILE A 1 18 ? -0.224  1.307   3.922   1.00 0.00 ? 21 ILE A HD12 13 
ATOM 7484  H HD13 . ILE A 1 18 ? -0.592  2.654   5.000   1.00 0.00 ? 21 ILE A HD13 13 
ATOM 7485  N N    . ALA A 1 19 ? 0.659   1.312   -0.994  1.00 0.00 ? 22 ALA A N    13 
ATOM 7486  C CA   . ALA A 1 19 ? 0.651   0.419   -2.152  1.00 0.00 ? 22 ALA A CA   13 
ATOM 7487  C C    . ALA A 1 19 ? 1.997   -0.301  -2.265  1.00 0.00 ? 22 ALA A C    13 
ATOM 7488  O O    . ALA A 1 19 ? 2.059   -1.483  -2.614  1.00 0.00 ? 22 ALA A O    13 
ATOM 7489  C CB   . ALA A 1 19 ? 0.351   1.204   -3.422  1.00 0.00 ? 22 ALA A CB   13 
ATOM 7490  H H    . ALA A 1 19 ? 0.448   2.269   -1.119  1.00 0.00 ? 22 ALA A H    13 
ATOM 7491  H HA   . ALA A 1 19 ? -0.130  -0.314  -2.008  1.00 0.00 ? 22 ALA A HA   13 
ATOM 7492  H HB1  . ALA A 1 19 ? -0.454  1.899   -3.235  1.00 0.00 ? 22 ALA A HB1  13 
ATOM 7493  H HB2  . ALA A 1 19 ? 0.061   0.522   -4.208  1.00 0.00 ? 22 ALA A HB2  13 
ATOM 7494  H HB3  . ALA A 1 19 ? 1.233   1.749   -3.726  1.00 0.00 ? 22 ALA A HB3  13 
ATOM 7495  N N    . LYS A 1 20 ? 3.069   0.426   -1.944  1.00 0.00 ? 23 LYS A N    13 
ATOM 7496  C CA   . LYS A 1 20 ? 4.423   -0.116  -1.978  1.00 0.00 ? 23 LYS A CA   13 
ATOM 7497  C C    . LYS A 1 20 ? 4.571   -1.285  -1.003  1.00 0.00 ? 23 LYS A C    13 
ATOM 7498  O O    . LYS A 1 20 ? 4.966   -2.384  -1.392  1.00 0.00 ? 23 LYS A O    13 
ATOM 7499  C CB   . LYS A 1 20 ? 5.433   0.987   -1.630  1.00 0.00 ? 23 LYS A CB   13 
ATOM 7500  C CG   . LYS A 1 20 ? 6.571   1.119   -2.626  1.00 0.00 ? 23 LYS A CG   13 
ATOM 7501  C CD   . LYS A 1 20 ? 7.335   -0.189  -2.772  1.00 0.00 ? 23 LYS A CD   13 
ATOM 7502  C CE   . LYS A 1 20 ? 8.421   -0.086  -3.829  1.00 0.00 ? 23 LYS A CE   13 
ATOM 7503  N NZ   . LYS A 1 20 ? 9.523   -1.061  -3.582  1.00 0.00 ? 23 LYS A NZ   13 
ATOM 7504  H H    . LYS A 1 20 ? 2.942   1.357   -1.663  1.00 0.00 ? 23 LYS A H    13 
ATOM 7505  H HA   . LYS A 1 20 ? 4.615   -0.471  -2.978  1.00 0.00 ? 23 LYS A HA   13 
ATOM 7506  H HB2  . LYS A 1 20 ? 4.912   1.933   -1.590  1.00 0.00 ? 23 LYS A HB2  13 
ATOM 7507  H HB3  . LYS A 1 20 ? 5.856   0.781   -0.658  1.00 0.00 ? 23 LYS A HB3  13 
ATOM 7508  H HG2  . LYS A 1 20 ? 6.162   1.401   -3.583  1.00 0.00 ? 23 LYS A HG2  13 
ATOM 7509  H HG3  . LYS A 1 20 ? 7.249   1.887   -2.281  1.00 0.00 ? 23 LYS A HG3  13 
ATOM 7510  H HD2  . LYS A 1 20 ? 7.791   -0.434  -1.825  1.00 0.00 ? 23 LYS A HD2  13 
ATOM 7511  H HD3  . LYS A 1 20 ? 6.643   -0.969  -3.054  1.00 0.00 ? 23 LYS A HD3  13 
ATOM 7512  H HE2  . LYS A 1 20 ? 7.984   -0.284  -4.798  1.00 0.00 ? 23 LYS A HE2  13 
ATOM 7513  H HE3  . LYS A 1 20 ? 8.827   0.917   -3.816  1.00 0.00 ? 23 LYS A HE3  13 
ATOM 7514  H HZ1  . LYS A 1 20 ? 9.135   -1.962  -3.234  1.00 0.00 ? 23 LYS A HZ1  13 
ATOM 7515  H HZ2  . LYS A 1 20 ? 10.183  -0.684  -2.871  1.00 0.00 ? 23 LYS A HZ2  13 
ATOM 7516  H HZ3  . LYS A 1 20 ? 10.046  -1.240  -4.461  1.00 0.00 ? 23 LYS A HZ3  13 
ATOM 7517  N N    . ALA A 1 21 ? 4.251   -1.042  0.266   1.00 0.00 ? 24 ALA A N    13 
ATOM 7518  C CA   . ALA A 1 21 ? 4.351   -2.078  1.293   1.00 0.00 ? 24 ALA A CA   13 
ATOM 7519  C C    . ALA A 1 21 ? 3.239   -3.122  1.155   1.00 0.00 ? 24 ALA A C    13 
ATOM 7520  O O    . ALA A 1 21 ? 3.467   -4.314  1.383   1.00 0.00 ? 24 ALA A O    13 
ATOM 7521  C CB   . ALA A 1 21 ? 4.322   -1.447  2.678   1.00 0.00 ? 24 ALA A CB   13 
ATOM 7522  H H    . ALA A 1 21 ? 3.941   -0.141  0.518   1.00 0.00 ? 24 ALA A H    13 
ATOM 7523  H HA   . ALA A 1 21 ? 5.305   -2.573  1.171   1.00 0.00 ? 24 ALA A HA   13 
ATOM 7524  H HB1  . ALA A 1 21 ? 4.360   -2.224  3.430   1.00 0.00 ? 24 ALA A HB1  13 
ATOM 7525  H HB2  . ALA A 1 21 ? 3.412   -0.877  2.797   1.00 0.00 ? 24 ALA A HB2  13 
ATOM 7526  H HB3  . ALA A 1 21 ? 5.174   -0.792  2.795   1.00 0.00 ? 24 ALA A HB3  13 
ATOM 7527  N N    . LYS A 1 22 ? 2.039   -2.675  0.776   1.00 0.00 ? 25 LYS A N    13 
ATOM 7528  C CA   . LYS A 1 22 ? 0.902   -3.571  0.608   1.00 0.00 ? 25 LYS A CA   13 
ATOM 7529  C C    . LYS A 1 22 ? 1.183   -4.603  -0.475  1.00 0.00 ? 25 LYS A C    13 
ATOM 7530  O O    . LYS A 1 22 ? 0.906   -5.789  -0.295  1.00 0.00 ? 25 LYS A O    13 
ATOM 7531  C CB   . LYS A 1 22 ? -0.364  -2.774  0.266   1.00 0.00 ? 25 LYS A CB   13 
ATOM 7532  C CG   . LYS A 1 22 ? -1.542  -3.087  1.175   1.00 0.00 ? 25 LYS A CG   13 
ATOM 7533  C CD   . LYS A 1 22 ? -2.694  -3.724  0.404   1.00 0.00 ? 25 LYS A CD   13 
ATOM 7534  C CE   . LYS A 1 22 ? -3.799  -2.718  0.108   1.00 0.00 ? 25 LYS A CE   13 
ATOM 7535  N NZ   . LYS A 1 22 ? -4.981  -2.902  1.007   1.00 0.00 ? 25 LYS A NZ   13 
ATOM 7536  H H    . LYS A 1 22 ? 1.915   -1.715  0.598   1.00 0.00 ? 25 LYS A H    13 
ATOM 7537  H HA   . LYS A 1 22 ? 0.748   -4.088  1.544   1.00 0.00 ? 25 LYS A HA   13 
ATOM 7538  H HB2  . LYS A 1 22 ? -0.146  -1.719  0.352   1.00 0.00 ? 25 LYS A HB2  13 
ATOM 7539  H HB3  . LYS A 1 22 ? -0.651  -2.991  -0.752  1.00 0.00 ? 25 LYS A HB3  13 
ATOM 7540  H HG2  . LYS A 1 22 ? -1.214  -3.770  1.945   1.00 0.00 ? 25 LYS A HG2  13 
ATOM 7541  H HG3  . LYS A 1 22 ? -1.885  -2.169  1.629   1.00 0.00 ? 25 LYS A HG3  13 
ATOM 7542  H HD2  . LYS A 1 22 ? -2.316  -4.112  -0.530  1.00 0.00 ? 25 LYS A HD2  13 
ATOM 7543  H HD3  . LYS A 1 22 ? -3.101  -4.534  0.991   1.00 0.00 ? 25 LYS A HD3  13 
ATOM 7544  H HE2  . LYS A 1 22 ? -3.405  -1.720  0.243   1.00 0.00 ? 25 LYS A HE2  13 
ATOM 7545  H HE3  . LYS A 1 22 ? -4.113  -2.842  -0.919  1.00 0.00 ? 25 LYS A HE3  13 
ATOM 7546  H HZ1  . LYS A 1 22 ? -5.826  -3.138  0.445   1.00 0.00 ? 25 LYS A HZ1  13 
ATOM 7547  H HZ2  . LYS A 1 22 ? -5.168  -2.026  1.539   1.00 0.00 ? 25 LYS A HZ2  13 
ATOM 7548  H HZ3  . LYS A 1 22 ? -4.804  -3.673  1.683   1.00 0.00 ? 25 LYS A HZ3  13 
ATOM 7549  N N    . ASN A 1 23 ? 1.747   -4.153  -1.596  1.00 0.00 ? 26 ASN A N    13 
ATOM 7550  C CA   . ASN A 1 23 ? 2.066   -5.064  -2.697  1.00 0.00 ? 26 ASN A CA   13 
ATOM 7551  C C    . ASN A 1 23 ? 3.213   -6.007  -2.313  1.00 0.00 ? 26 ASN A C    13 
ATOM 7552  O O    . ASN A 1 23 ? 3.147   -7.207  -2.583  1.00 0.00 ? 26 ASN A O    13 
ATOM 7553  C CB   . ASN A 1 23 ? 2.380   -4.284  -3.987  1.00 0.00 ? 26 ASN A CB   13 
ATOM 7554  C CG   . ASN A 1 23 ? 3.845   -3.921  -4.142  1.00 0.00 ? 26 ASN A CG   13 
ATOM 7555  O OD1  . ASN A 1 23 ? 4.682   -4.774  -4.420  1.00 0.00 ? 26 ASN A OD1  13 
ATOM 7556  N ND2  . ASN A 1 23 ? 4.158   -2.650  -3.969  1.00 0.00 ? 26 ASN A ND2  13 
ATOM 7557  H H    . ASN A 1 23 ? 1.957   -3.190  -1.680  1.00 0.00 ? 26 ASN A H    13 
ATOM 7558  H HA   . ASN A 1 23 ? 1.186   -5.670  -2.871  1.00 0.00 ? 26 ASN A HA   13 
ATOM 7559  H HB2  . ASN A 1 23 ? 2.096   -4.885  -4.837  1.00 0.00 ? 26 ASN A HB2  13 
ATOM 7560  H HB3  . ASN A 1 23 ? 1.802   -3.371  -3.993  1.00 0.00 ? 26 ASN A HB3  13 
ATOM 7561  H HD21 . ASN A 1 23 ? 3.438   -2.018  -3.752  1.00 0.00 ? 26 ASN A HD21 13 
ATOM 7562  H HD22 . ASN A 1 23 ? 5.097   -2.392  -4.061  1.00 0.00 ? 26 ASN A HD22 13 
ATOM 7563  N N    . LEU A 1 24 ? 4.248   -5.464  -1.664  1.00 0.00 ? 27 LEU A N    13 
ATOM 7564  C CA   . LEU A 1 24 ? 5.394   -6.271  -1.230  1.00 0.00 ? 27 LEU A CA   13 
ATOM 7565  C C    . LEU A 1 24 ? 4.944   -7.413  -0.328  1.00 0.00 ? 27 LEU A C    13 
ATOM 7566  O O    . LEU A 1 24 ? 5.309   -8.572  -0.528  1.00 0.00 ? 27 LEU A O    13 
ATOM 7567  C CB   . LEU A 1 24 ? 6.423   -5.399  -0.499  1.00 0.00 ? 27 LEU A CB   13 
ATOM 7568  C CG   . LEU A 1 24 ? 7.154   -4.377  -1.373  1.00 0.00 ? 27 LEU A CG   13 
ATOM 7569  C CD1  . LEU A 1 24 ? 7.884   -3.366  -0.505  1.00 0.00 ? 27 LEU A CD1  13 
ATOM 7570  C CD2  . LEU A 1 24 ? 8.126   -5.075  -2.312  1.00 0.00 ? 27 LEU A CD2  13 
ATOM 7571  H H    . LEU A 1 24 ? 4.238   -4.504  -1.463  1.00 0.00 ? 27 LEU A H    13 
ATOM 7572  H HA   . LEU A 1 24 ? 5.843   -6.691  -2.100  1.00 0.00 ? 27 LEU A HA   13 
ATOM 7573  H HB2  . LEU A 1 24 ? 5.914   -4.866  0.290   1.00 0.00 ? 27 LEU A HB2  13 
ATOM 7574  H HB3  . LEU A 1 24 ? 7.160   -6.049  -0.053  1.00 0.00 ? 27 LEU A HB3  13 
ATOM 7575  H HG   . LEU A 1 24 ? 6.432   -3.843  -1.971  1.00 0.00 ? 27 LEU A HG   13 
ATOM 7576  H HD11 . LEU A 1 24 ? 7.335   -2.435  -0.498  1.00 0.00 ? 27 LEU A HD11 13 
ATOM 7577  H HD12 . LEU A 1 24 ? 8.873   -3.198  -0.904  1.00 0.00 ? 27 LEU A HD12 13 
ATOM 7578  H HD13 . LEU A 1 24 ? 7.963   -3.745  0.503   1.00 0.00 ? 27 LEU A HD13 13 
ATOM 7579  H HD21 . LEU A 1 24 ? 7.622   -5.311  -3.239  1.00 0.00 ? 27 LEU A HD21 13 
ATOM 7580  H HD22 . LEU A 1 24 ? 8.480   -5.985  -1.853  1.00 0.00 ? 27 LEU A HD22 13 
ATOM 7581  H HD23 . LEU A 1 24 ? 8.962   -4.424  -2.513  1.00 0.00 ? 27 LEU A HD23 13 
ATOM 7582  N N    . ARG A 1 25 ? 4.143   -7.061  0.659   1.00 0.00 ? 28 ARG A N    13 
ATOM 7583  C CA   . ARG A 1 25 ? 3.608   -8.031  1.620   1.00 0.00 ? 28 ARG A CA   13 
ATOM 7584  C C    . ARG A 1 25 ? 2.511   -8.894  0.999   1.00 0.00 ? 28 ARG A C    13 
ATOM 7585  O O    . ARG A 1 25 ? 2.372   -10.061 1.355   1.00 0.00 ? 28 ARG A O    13 
ATOM 7586  C CB   . ARG A 1 25 ? 3.075   -7.307  2.862   1.00 0.00 ? 28 ARG A CB   13 
ATOM 7587  C CG   . ARG A 1 25 ? 4.052   -7.306  4.029   1.00 0.00 ? 28 ARG A CG   13 
ATOM 7588  C CD   . ARG A 1 25 ? 3.348   -7.063  5.355   1.00 0.00 ? 28 ARG A CD   13 
ATOM 7589  N NE   . ARG A 1 25 ? 3.667   -8.101  6.341   1.00 0.00 ? 28 ARG A NE   13 
ATOM 7590  C CZ   . ARG A 1 25 ? 2.996   -9.242  6.478   1.00 0.00 ? 28 ARG A CZ   13 
ATOM 7591  N NH1  . ARG A 1 25 ? 1.968   -9.515  5.699   1.00 0.00 ? 28 ARG A NH1  13 
ATOM 7592  N NH2  . ARG A 1 25 ? 3.363   -10.117 7.395   1.00 0.00 ? 28 ARG A NH2  13 
ATOM 7593  H H    . ARG A 1 25 ? 3.900   -6.117  0.739   1.00 0.00 ? 28 ARG A H    13 
ATOM 7594  H HA   . ARG A 1 25 ? 4.415   -8.686  1.916   1.00 0.00 ? 28 ARG A HA   13 
ATOM 7595  H HB2  . ARG A 1 25 ? 2.857   -6.281  2.601   1.00 0.00 ? 28 ARG A HB2  13 
ATOM 7596  H HB3  . ARG A 1 25 ? 2.164   -7.789  3.182   1.00 0.00 ? 28 ARG A HB3  13 
ATOM 7597  H HG2  . ARG A 1 25 ? 4.550   -8.264  4.069   1.00 0.00 ? 28 ARG A HG2  13 
ATOM 7598  H HG3  . ARG A 1 25 ? 4.783   -6.526  3.870   1.00 0.00 ? 28 ARG A HG3  13 
ATOM 7599  H HD2  . ARG A 1 25 ? 3.663   -6.102  5.742   1.00 0.00 ? 28 ARG A HD2  13 
ATOM 7600  H HD3  . ARG A 1 25 ? 2.281   -7.046  5.187   1.00 0.00 ? 28 ARG A HD3  13 
ATOM 7601  H HE   . ARG A 1 25 ? 4.428   -7.936  6.935   1.00 0.00 ? 28 ARG A HE   13 
ATOM 7602  H HH11 . ARG A 1 25 ? 1.686   -8.867  4.997   1.00 0.00 ? 28 ARG A HH11 13 
ATOM 7603  H HH12 . ARG A 1 25 ? 1.471   -10.373 5.812   1.00 0.00 ? 28 ARG A HH12 13 
ATOM 7604  H HH21 . ARG A 1 25 ? 4.144   -9.922  7.985   1.00 0.00 ? 28 ARG A HH21 13 
ATOM 7605  H HH22 . ARG A 1 25 ? 2.861   -10.973 7.501   1.00 0.00 ? 28 ARG A HH22 13 
ATOM 7606  N N    . ALA A 1 26 ? 1.749   -8.332  0.060   1.00 0.00 ? 29 ALA A N    13 
ATOM 7607  C CA   . ALA A 1 26 ? 0.690   -9.081  -0.603  1.00 0.00 ? 29 ALA A CA   13 
ATOM 7608  C C    . ALA A 1 26 ? 1.296   -10.167 -1.476  1.00 0.00 ? 29 ALA A C    13 
ATOM 7609  O O    . ALA A 1 26 ? 0.905   -11.330 -1.398  1.00 0.00 ? 29 ALA A O    13 
ATOM 7610  C CB   . ALA A 1 26 ? -0.189  -8.153  -1.430  1.00 0.00 ? 29 ALA A CB   13 
ATOM 7611  H H    . ALA A 1 26 ? 1.914   -7.403  -0.207  1.00 0.00 ? 29 ALA A H    13 
ATOM 7612  H HA   . ALA A 1 26 ? 0.078   -9.545  0.157   1.00 0.00 ? 29 ALA A HA   13 
ATOM 7613  H HB1  . ALA A 1 26 ? 0.430   -7.566  -2.093  1.00 0.00 ? 29 ALA A HB1  13 
ATOM 7614  H HB2  . ALA A 1 26 ? -0.734  -7.492  -0.771  1.00 0.00 ? 29 ALA A HB2  13 
ATOM 7615  H HB3  . ALA A 1 26 ? -0.887  -8.737  -2.011  1.00 0.00 ? 29 ALA A HB3  13 
ATOM 7616  N N    . GLN A 1 27 ? 2.278   -9.781  -2.288  1.00 0.00 ? 30 GLN A N    13 
ATOM 7617  C CA   . GLN A 1 27 ? 2.962   -10.733 -3.166  1.00 0.00 ? 30 GLN A CA   13 
ATOM 7618  C C    . GLN A 1 27 ? 3.782   -11.740 -2.363  1.00 0.00 ? 30 GLN A C    13 
ATOM 7619  O O    . GLN A 1 27 ? 4.015   -12.867 -2.805  1.00 0.00 ? 30 GLN A O    13 
ATOM 7620  C CB   . GLN A 1 27 ? 3.848   -9.999  -4.182  1.00 0.00 ? 30 GLN A CB   13 
ATOM 7621  C CG   . GLN A 1 27 ? 5.074   -9.332  -3.570  1.00 0.00 ? 30 GLN A CG   13 
ATOM 7622  C CD   . GLN A 1 27 ? 6.378   -9.903  -4.092  1.00 0.00 ? 30 GLN A CD   13 
ATOM 7623  O OE1  . GLN A 1 27 ? 6.873   -9.491  -5.136  1.00 0.00 ? 30 GLN A OE1  13 
ATOM 7624  N NE2  . GLN A 1 27 ? 6.943   -10.856 -3.367  1.00 0.00 ? 30 GLN A NE2  13 
ATOM 7625  H H    . GLN A 1 27 ? 2.559   -8.832  -2.283  1.00 0.00 ? 30 GLN A H    13 
ATOM 7626  H HA   . GLN A 1 27 ? 2.205   -11.278 -3.690  1.00 0.00 ? 30 GLN A HA   13 
ATOM 7627  H HB2  . GLN A 1 27 ? 4.184   -10.708 -4.926  1.00 0.00 ? 30 GLN A HB2  13 
ATOM 7628  H HB3  . GLN A 1 27 ? 3.257   -9.238  -4.670  1.00 0.00 ? 30 GLN A HB3  13 
ATOM 7629  H HG2  . GLN A 1 27 ? 5.045   -8.278  -3.801  1.00 0.00 ? 30 GLN A HG2  13 
ATOM 7630  H HG3  . GLN A 1 27 ? 5.044   -9.463  -2.499  1.00 0.00 ? 30 GLN A HG3  13 
ATOM 7631  H HE21 . GLN A 1 27 ? 6.498   -11.139 -2.543  1.00 0.00 ? 30 GLN A HE21 13 
ATOM 7632  H HE22 . GLN A 1 27 ? 7.786   -11.236 -3.688  1.00 0.00 ? 30 GLN A HE22 13 
ATOM 7633  N N    . ALA A 1 28 ? 4.193   -11.333 -1.173  1.00 0.00 ? 31 ALA A N    13 
ATOM 7634  C CA   . ALA A 1 28 ? 4.964   -12.193 -0.285  1.00 0.00 ? 31 ALA A CA   13 
ATOM 7635  C C    . ALA A 1 28 ? 4.033   -13.096 0.518   1.00 0.00 ? 31 ALA A C    13 
ATOM 7636  O O    . ALA A 1 28 ? 4.143   -14.322 0.467   1.00 0.00 ? 31 ALA A O    13 
ATOM 7637  C CB   . ALA A 1 28 ? 5.837   -11.354 0.641   1.00 0.00 ? 31 ALA A CB   13 
ATOM 7638  H H    . ALA A 1 28 ? 3.952   -10.434 -0.879  1.00 0.00 ? 31 ALA A H    13 
ATOM 7639  H HA   . ALA A 1 28 ? 5.611   -12.809 -0.893  1.00 0.00 ? 31 ALA A HA   13 
ATOM 7640  H HB1  . ALA A 1 28 ? 6.582   -11.984 1.103   1.00 0.00 ? 31 ALA A HB1  13 
ATOM 7641  H HB2  . ALA A 1 28 ? 5.222   -10.903 1.406   1.00 0.00 ? 31 ALA A HB2  13 
ATOM 7642  H HB3  . ALA A 1 28 ? 6.325   -10.577 0.069   1.00 0.00 ? 31 ALA A HB3  13 
ATOM 7643  N N    . ALA A 1 29 ? 3.104   -12.478 1.247   1.00 0.00 ? 32 ALA A N    13 
ATOM 7644  C CA   . ALA A 1 29 ? 2.140   -13.222 2.061   1.00 0.00 ? 32 ALA A CA   13 
ATOM 7645  C C    . ALA A 1 29 ? 1.225   -14.114 1.212   1.00 0.00 ? 32 ALA A C    13 
ATOM 7646  O O    . ALA A 1 29 ? 0.777   -15.160 1.684   1.00 0.00 ? 32 ALA A O    13 
ATOM 7647  C CB   . ALA A 1 29 ? 1.312   -12.263 2.905   1.00 0.00 ? 32 ALA A CB   13 
ATOM 7648  H H    . ALA A 1 29 ? 3.063   -11.485 1.236   1.00 0.00 ? 32 ALA A H    13 
ATOM 7649  H HA   . ALA A 1 29 ? 2.700   -13.856 2.733   1.00 0.00 ? 32 ALA A HA   13 
ATOM 7650  H HB1  . ALA A 1 29 ? 1.970   -11.662 3.514   1.00 0.00 ? 32 ALA A HB1  13 
ATOM 7651  H HB2  . ALA A 1 29 ? 0.645   -12.826 3.543   1.00 0.00 ? 32 ALA A HB2  13 
ATOM 7652  H HB3  . ALA A 1 29 ? 0.733   -11.621 2.258   1.00 0.00 ? 32 ALA A HB3  13 
ATOM 7653  N N    . ALA A 1 30 ? 0.936   -13.704 -0.028  1.00 0.00 ? 33 ALA A N    13 
ATOM 7654  C CA   . ALA A 1 30 ? 0.065   -14.489 -0.907  1.00 0.00 ? 33 ALA A CA   13 
ATOM 7655  C C    . ALA A 1 30 ? 0.772   -15.719 -1.451  1.00 0.00 ? 33 ALA A C    13 
ATOM 7656  O O    . ALA A 1 30 ? 0.296   -16.844 -1.304  1.00 0.00 ? 33 ALA A O    13 
ATOM 7657  C CB   . ALA A 1 30 ? -0.470  -13.629 -2.044  1.00 0.00 ? 33 ALA A CB   13 
ATOM 7658  H H    . ALA A 1 30 ? 1.308   -12.855 -0.355  1.00 0.00 ? 33 ALA A H    13 
ATOM 7659  H HA   . ALA A 1 30 ? -0.762  -14.819 -0.326  1.00 0.00 ? 33 ALA A HA   13 
ATOM 7660  H HB1  . ALA A 1 30 ? -0.977  -12.767 -1.634  1.00 0.00 ? 33 ALA A HB1  13 
ATOM 7661  H HB2  . ALA A 1 30 ? -1.165  -14.207 -2.637  1.00 0.00 ? 33 ALA A HB2  13 
ATOM 7662  H HB3  . ALA A 1 30 ? 0.349   -13.303 -2.665  1.00 0.00 ? 33 ALA A HB3  13 
ATOM 7663  N N    . ASN A 1 31 ? 1.911   -15.492 -2.074  1.00 0.00 ? 34 ASN A N    13 
ATOM 7664  C CA   . ASN A 1 31 ? 2.705   -16.580 -2.647  1.00 0.00 ? 34 ASN A CA   13 
ATOM 7665  C C    . ASN A 1 31 ? 3.209   -17.525 -1.551  1.00 0.00 ? 34 ASN A C    13 
ATOM 7666  O O    . ASN A 1 31 ? 3.206   -18.742 -1.726  1.00 0.00 ? 34 ASN A O    13 
ATOM 7667  C CB   . ASN A 1 31 ? 3.875   -16.023 -3.481  1.00 0.00 ? 34 ASN A CB   13 
ATOM 7668  C CG   . ASN A 1 31 ? 5.201   -16.035 -2.744  1.00 0.00 ? 34 ASN A CG   13 
ATOM 7669  O OD1  . ASN A 1 31 ? 5.916   -17.032 -2.742  1.00 0.00 ? 34 ASN A OD1  13 
ATOM 7670  N ND2  . ASN A 1 31 ? 5.537   -14.922 -2.118  1.00 0.00 ? 34 ASN A ND2  13 
ATOM 7671  H H    . ASN A 1 31 ? 2.220   -14.571 -2.145  1.00 0.00 ? 34 ASN A H    13 
ATOM 7672  H HA   . ASN A 1 31 ? 2.054   -17.142 -3.302  1.00 0.00 ? 34 ASN A HA   13 
ATOM 7673  H HB2  . ASN A 1 31 ? 3.984   -16.619 -4.373  1.00 0.00 ? 34 ASN A HB2  13 
ATOM 7674  H HB3  . ASN A 1 31 ? 3.652   -15.004 -3.763  1.00 0.00 ? 34 ASN A HB3  13 
ATOM 7675  H HD21 . ASN A 1 31 ? 4.920   -14.160 -2.165  1.00 0.00 ? 34 ASN A HD21 13 
ATOM 7676  H HD22 . ASN A 1 31 ? 6.388   -14.904 -1.636  1.00 0.00 ? 34 ASN A HD22 13 
ATOM 7677  N N    . ALA A 1 32 ? 3.627   -16.959 -0.415  1.00 0.00 ? 35 ALA A N    13 
ATOM 7678  C CA   . ALA A 1 32 ? 4.120   -17.762 0.702   1.00 0.00 ? 35 ALA A CA   13 
ATOM 7679  C C    . ALA A 1 32 ? 2.992   -18.128 1.680   1.00 0.00 ? 35 ALA A C    13 
ATOM 7680  O O    . ALA A 1 32 ? 3.174   -18.083 2.899   1.00 0.00 ? 35 ALA A O    13 
ATOM 7681  C CB   . ALA A 1 32 ? 5.242   -17.020 1.419   1.00 0.00 ? 35 ALA A CB   13 
ATOM 7682  H H    . ALA A 1 32 ? 3.600   -15.981 -0.325  1.00 0.00 ? 35 ALA A H    13 
ATOM 7683  H HA   . ALA A 1 32 ? 4.533   -18.673 0.294   1.00 0.00 ? 35 ALA A HA   13 
ATOM 7684  H HB1  . ALA A 1 32 ? 5.609   -17.623 2.237   1.00 0.00 ? 35 ALA A HB1  13 
ATOM 7685  H HB2  . ALA A 1 32 ? 4.865   -16.083 1.804   1.00 0.00 ? 35 ALA A HB2  13 
ATOM 7686  H HB3  . ALA A 1 32 ? 6.046   -16.825 0.724   1.00 0.00 ? 35 ALA A HB3  13 
ATOM 7687  N N    . HIS A 1 33 ? 1.827   -18.495 1.138   1.00 0.00 ? 36 HIS A N    13 
ATOM 7688  C CA   . HIS A 1 33 ? 0.676   -18.870 1.963   1.00 0.00 ? 36 HIS A CA   13 
ATOM 7689  C C    . HIS A 1 33 ? 0.467   -20.386 1.975   1.00 0.00 ? 36 HIS A C    13 
ATOM 7690  O O    . HIS A 1 33 ? 0.697   -21.043 2.990   1.00 0.00 ? 36 HIS A O    13 
ATOM 7691  C CB   . HIS A 1 33 ? -0.591  -18.171 1.462   1.00 0.00 ? 36 HIS A CB   13 
ATOM 7692  C CG   . HIS A 1 33 ? -1.350  -17.471 2.542   1.00 0.00 ? 36 HIS A CG   13 
ATOM 7693  N ND1  . HIS A 1 33 ? -1.049  -16.197 2.954   1.00 0.00 ? 36 HIS A ND1  13 
ATOM 7694  C CD2  . HIS A 1 33 ? -2.397  -17.875 3.297   1.00 0.00 ? 36 HIS A CD2  13 
ATOM 7695  C CE1  . HIS A 1 33 ? -1.876  -15.839 3.921   1.00 0.00 ? 36 HIS A CE1  13 
ATOM 7696  N NE2  . HIS A 1 33 ? -2.707  -16.841 4.149   1.00 0.00 ? 36 HIS A NE2  13 
ATOM 7697  H H    . HIS A 1 33 ? 1.739   -18.512 0.162   1.00 0.00 ? 36 HIS A H    13 
ATOM 7698  H HA   . HIS A 1 33 ? 0.877   -18.546 2.974   1.00 0.00 ? 36 HIS A HA   13 
ATOM 7699  H HB2  . HIS A 1 33 ? -0.320  -17.434 0.721   1.00 0.00 ? 36 HIS A HB2  13 
ATOM 7700  H HB3  . HIS A 1 33 ? -1.248  -18.901 1.013   1.00 0.00 ? 36 HIS A HB3  13 
ATOM 7701  H HD1  . HIS A 1 33 ? -0.322  -15.631 2.584   1.00 0.00 ? 36 HIS A HD1  13 
ATOM 7702  H HD2  . HIS A 1 33 ? -2.897  -18.832 3.239   1.00 0.00 ? 36 HIS A HD2  13 
ATOM 7703  H HE1  . HIS A 1 33 ? -1.876  -14.889 4.436   1.00 0.00 ? 36 HIS A HE1  13 
ATOM 7704  H HE2  . HIS A 1 33 ? -3.324  -16.899 4.907   1.00 0.00 ? 36 HIS A HE2  13 
ATOM 7705  N N    . LEU A 1 34 ? 0.024   -20.935 0.843   1.00 0.00 ? 37 LEU A N    13 
ATOM 7706  C CA   . LEU A 1 34 ? -0.225  -22.374 0.728   1.00 0.00 ? 37 LEU A CA   13 
ATOM 7707  C C    . LEU A 1 34 ? 0.885   -23.093 -0.054  1.00 0.00 ? 37 LEU A C    13 
ATOM 7708  O O    . LEU A 1 34 ? 0.802   -24.298 -0.278  1.00 0.00 ? 37 LEU A O    13 
ATOM 7709  C CB   . LEU A 1 34 ? -1.580  -22.615 0.054   1.00 0.00 ? 37 LEU A CB   13 
ATOM 7710  C CG   . LEU A 1 34 ? -2.800  -22.380 0.947   1.00 0.00 ? 37 LEU A CG   13 
ATOM 7711  C CD1  . LEU A 1 34 ? -3.901  -21.674 0.172   1.00 0.00 ? 37 LEU A CD1  13 
ATOM 7712  C CD2  . LEU A 1 34 ? -3.309  -23.696 1.512   1.00 0.00 ? 37 LEU A CD2  13 
ATOM 7713  H H    . LEU A 1 34 ? -0.148  -20.359 0.069   1.00 0.00 ? 37 LEU A H    13 
ATOM 7714  H HA   . LEU A 1 34 ? -0.259  -22.781 1.727   1.00 0.00 ? 37 LEU A HA   13 
ATOM 7715  H HB2  . LEU A 1 34 ? -1.654  -21.961 -0.802  1.00 0.00 ? 37 LEU A HB2  13 
ATOM 7716  H HB3  . LEU A 1 34 ? -1.609  -23.638 -0.293  1.00 0.00 ? 37 LEU A HB3  13 
ATOM 7717  H HG   . LEU A 1 34 ? -2.517  -21.746 1.776   1.00 0.00 ? 37 LEU A HG   13 
ATOM 7718  H HD11 . LEU A 1 34 ? -4.746  -21.507 0.823   1.00 0.00 ? 37 LEU A HD11 13 
ATOM 7719  H HD12 . LEU A 1 34 ? -4.204  -22.289 -0.661  1.00 0.00 ? 37 LEU A HD12 13 
ATOM 7720  H HD13 . LEU A 1 34 ? -3.534  -20.727 -0.193  1.00 0.00 ? 37 LEU A HD13 13 
ATOM 7721  H HD21 . LEU A 1 34 ? -3.883  -23.505 2.407   1.00 0.00 ? 37 LEU A HD21 13 
ATOM 7722  H HD22 . LEU A 1 34 ? -2.472  -24.334 1.750   1.00 0.00 ? 37 LEU A HD22 13 
ATOM 7723  H HD23 . LEU A 1 34 ? -3.937  -24.182 0.779   1.00 0.00 ? 37 LEU A HD23 13 
ATOM 7724  N N    . MET A 1 35 ? 1.921   -22.355 -0.462  1.00 0.00 ? 38 MET A N    13 
ATOM 7725  C CA   . MET A 1 35 ? 3.033   -22.943 -1.215  1.00 0.00 ? 38 MET A CA   13 
ATOM 7726  C C    . MET A 1 35 ? 4.103   -23.547 -0.293  1.00 0.00 ? 38 MET A C    13 
ATOM 7727  O O    . MET A 1 35 ? 5.077   -24.130 -0.769  1.00 0.00 ? 38 MET A O    13 
ATOM 7728  C CB   . MET A 1 35 ? 3.661   -21.886 -2.129  1.00 0.00 ? 38 MET A CB   13 
ATOM 7729  C CG   . MET A 1 35 ? 3.714   -22.297 -3.594  1.00 0.00 ? 38 MET A CG   13 
ATOM 7730  S SD   . MET A 1 35 ? 3.080   -21.019 -4.697  1.00 0.00 ? 38 MET A SD   13 
ATOM 7731  C CE   . MET A 1 35 ? 1.393   -21.575 -4.928  1.00 0.00 ? 38 MET A CE   13 
ATOM 7732  H H    . MET A 1 35 ? 1.942   -21.400 -0.256  1.00 0.00 ? 38 MET A H    13 
ATOM 7733  H HA   . MET A 1 35 ? 2.629   -23.733 -1.825  1.00 0.00 ? 38 MET A HA   13 
ATOM 7734  H HB2  . MET A 1 35 ? 3.087   -20.973 -2.057  1.00 0.00 ? 38 MET A HB2  13 
ATOM 7735  H HB3  . MET A 1 35 ? 4.670   -21.691 -1.797  1.00 0.00 ? 38 MET A HB3  13 
ATOM 7736  H HG2  . MET A 1 35 ? 4.740   -22.503 -3.859  1.00 0.00 ? 38 MET A HG2  13 
ATOM 7737  H HG3  . MET A 1 35 ? 3.124   -23.191 -3.725  1.00 0.00 ? 38 MET A HG3  13 
ATOM 7738  H HE1  . MET A 1 35 ? 1.391   -22.630 -5.162  1.00 0.00 ? 38 MET A HE1  13 
ATOM 7739  H HE2  . MET A 1 35 ? 0.940   -21.026 -5.741  1.00 0.00 ? 38 MET A HE2  13 
ATOM 7740  H HE3  . MET A 1 35 ? 0.831   -21.407 -4.022  1.00 0.00 ? 38 MET A HE3  13 
ATOM 7741  N N    . ALA A 1 36 ? 3.920   -23.406 1.023   1.00 0.00 ? 39 ALA A N    13 
ATOM 7742  C CA   . ALA A 1 36 ? 4.875   -23.939 1.995   1.00 0.00 ? 39 ALA A CA   13 
ATOM 7743  C C    . ALA A 1 36 ? 4.167   -24.487 3.243   1.00 0.00 ? 39 ALA A C    13 
ATOM 7744  O O    . ALA A 1 36 ? 4.602   -24.254 4.373   1.00 0.00 ? 39 ALA A O    13 
ATOM 7745  C CB   . ALA A 1 36 ? 5.882   -22.857 2.370   1.00 0.00 ? 39 ALA A CB   13 
ATOM 7746  H H    . ALA A 1 36 ? 3.129   -22.933 1.346   1.00 0.00 ? 39 ALA A H    13 
ATOM 7747  H HA   . ALA A 1 36 ? 5.414   -24.747 1.520   1.00 0.00 ? 39 ALA A HA   13 
ATOM 7748  H HB1  . ALA A 1 36 ? 6.175   -22.979 3.402   1.00 0.00 ? 39 ALA A HB1  13 
ATOM 7749  H HB2  . ALA A 1 36 ? 5.433   -21.884 2.237   1.00 0.00 ? 39 ALA A HB2  13 
ATOM 7750  H HB3  . ALA A 1 36 ? 6.752   -22.941 1.737   1.00 0.00 ? 39 ALA A HB3  13 
ATOM 7751  N N    . GLN A 1 37 ? 3.072   -25.222 3.030   1.00 0.00 ? 40 GLN A N    13 
ATOM 7752  C CA   . GLN A 1 37 ? 2.308   -25.801 4.135   1.00 0.00 ? 40 GLN A CA   13 
ATOM 7753  C C    . GLN A 1 37 ? 2.497   -27.319 4.220   1.00 0.00 ? 40 GLN A C    13 
ATOM 7754  O O    . GLN A 1 37 ? 2.804   -27.851 5.287   1.00 0.00 ? 40 GLN A O    13 
ATOM 7755  C CB   . GLN A 1 37 ? 0.821   -25.461 3.987   1.00 0.00 ? 40 GLN A CB   13 
ATOM 7756  C CG   . GLN A 1 37 ? 0.110   -25.239 5.317   1.00 0.00 ? 40 GLN A CG   13 
ATOM 7757  C CD   . GLN A 1 37 ? -1.354  -25.630 5.277   1.00 0.00 ? 40 GLN A CD   13 
ATOM 7758  O OE1  . GLN A 1 37 ? -1.769  -26.594 5.915   1.00 0.00 ? 40 GLN A OE1  13 
ATOM 7759  N NE2  . GLN A 1 37 ? -2.150  -24.882 4.528   1.00 0.00 ? 40 GLN A NE2  13 
ATOM 7760  H H    . GLN A 1 37 ? 2.774   -25.376 2.112   1.00 0.00 ? 40 GLN A H    13 
ATOM 7761  H HA   . GLN A 1 37 ? 2.674   -25.361 5.048   1.00 0.00 ? 40 GLN A HA   13 
ATOM 7762  H HB2  . GLN A 1 37 ? 0.726   -24.560 3.399   1.00 0.00 ? 40 GLN A HB2  13 
ATOM 7763  H HB3  . GLN A 1 37 ? 0.327   -26.271 3.469   1.00 0.00 ? 40 GLN A HB3  13 
ATOM 7764  H HG2  . GLN A 1 37 ? 0.601   -25.832 6.076   1.00 0.00 ? 40 GLN A HG2  13 
ATOM 7765  H HG3  . GLN A 1 37 ? 0.181   -24.193 5.578   1.00 0.00 ? 40 GLN A HG3  13 
ATOM 7766  H HE21 . GLN A 1 37 ? -1.759  -24.126 4.046   1.00 0.00 ? 40 GLN A HE21 13 
ATOM 7767  H HE22 . GLN A 1 37 ? -3.098  -25.119 4.489   1.00 0.00 ? 40 GLN A HE22 13 
ATOM 7768  N N    . ILE A 1 38 ? 2.309   -28.007 3.094   1.00 0.00 ? 41 ILE A N    13 
ATOM 7769  C CA   . ILE A 1 38 ? 2.457   -29.462 3.044   1.00 0.00 ? 41 ILE A CA   13 
ATOM 7770  C C    . ILE A 1 38 ? 3.328   -29.887 1.862   1.00 0.00 ? 41 ILE A C    13 
ATOM 7771  O O    . ILE A 1 38 ? 4.246   -30.710 2.070   1.00 0.00 ? 41 ILE A O    13 
ATOM 7772  C CB   . ILE A 1 38 ? 1.089   -30.175 2.942   1.00 0.00 ? 41 ILE A CB   13 
ATOM 7773  C CG1  . ILE A 1 38 ? 0.067   -29.536 3.889   1.00 0.00 ? 41 ILE A CG1  13 
ATOM 7774  C CG2  . ILE A 1 38 ? 1.238   -31.658 3.252   1.00 0.00 ? 41 ILE A CG2  13 
ATOM 7775  C CD1  . ILE A 1 38 ? -0.906  -28.608 3.192   1.00 0.00 ? 41 ILE A CD1  13 
ATOM 7776  O OXT  . ILE A 1 38 ? 3.085   -29.395 0.737   1.00 0.00 ? 41 ILE A OXT  13 
ATOM 7777  H H    . ILE A 1 38 ? 2.064   -27.529 2.275   1.00 0.00 ? 41 ILE A H    13 
ATOM 7778  H HA   . ILE A 1 38 ? 2.936   -29.780 3.958   1.00 0.00 ? 41 ILE A HA   13 
ATOM 7779  H HB   . ILE A 1 38 ? 0.737   -30.079 1.926   1.00 0.00 ? 41 ILE A HB   13 
ATOM 7780  H HG12 . ILE A 1 38 ? -0.505  -30.315 4.367   1.00 0.00 ? 41 ILE A HG12 13 
ATOM 7781  H HG13 . ILE A 1 38 ? 0.590   -28.966 4.642   1.00 0.00 ? 41 ILE A HG13 13 
ATOM 7782  H HG21 . ILE A 1 38 ? 2.069   -32.059 2.689   1.00 0.00 ? 41 ILE A HG21 13 
ATOM 7783  H HG22 . ILE A 1 38 ? 0.332   -32.176 2.976   1.00 0.00 ? 41 ILE A HG22 13 
ATOM 7784  H HG23 . ILE A 1 38 ? 1.420   -31.788 4.307   1.00 0.00 ? 41 ILE A HG23 13 
ATOM 7785  H HD11 . ILE A 1 38 ? -1.657  -29.193 2.682   1.00 0.00 ? 41 ILE A HD11 13 
ATOM 7786  H HD12 . ILE A 1 38 ? -0.373  -28.002 2.476   1.00 0.00 ? 41 ILE A HD12 13 
ATOM 7787  H HD13 . ILE A 1 38 ? -1.381  -27.971 3.923   1.00 0.00 ? 41 ILE A HD13 13 
ATOM 7788  N N    . PHE A 1 1  ? -19.047 10.455  4.135   1.00 0.00 ? 4  PHE A N    14 
ATOM 7789  C CA   . PHE A 1 1  ? -18.034 9.431   4.528   1.00 0.00 ? 4  PHE A CA   14 
ATOM 7790  C C    . PHE A 1 1  ? -17.370 8.814   3.296   1.00 0.00 ? 4  PHE A C    14 
ATOM 7791  O O    . PHE A 1 1  ? -17.864 8.975   2.181   1.00 0.00 ? 4  PHE A O    14 
ATOM 7792  C CB   . PHE A 1 1  ? -18.724 8.343   5.365   1.00 0.00 ? 4  PHE A CB   14 
ATOM 7793  C CG   . PHE A 1 1  ? -19.962 7.776   4.725   1.00 0.00 ? 4  PHE A CG   14 
ATOM 7794  C CD1  . PHE A 1 1  ? -19.867 6.873   3.679   1.00 0.00 ? 4  PHE A CD1  14 
ATOM 7795  C CD2  . PHE A 1 1  ? -21.220 8.151   5.169   1.00 0.00 ? 4  PHE A CD2  14 
ATOM 7796  C CE1  . PHE A 1 1  ? -21.002 6.354   3.088   1.00 0.00 ? 4  PHE A CE1  14 
ATOM 7797  C CE2  . PHE A 1 1  ? -22.358 7.635   4.581   1.00 0.00 ? 4  PHE A CE2  14 
ATOM 7798  C CZ   . PHE A 1 1  ? -22.250 6.735   3.540   1.00 0.00 ? 4  PHE A CZ   14 
ATOM 7799  H H1   . PHE A 1 1  ? -19.628 10.668  4.970   1.00 0.00 ? 4  PHE A H1   14 
ATOM 7800  H H2   . PHE A 1 1  ? -19.625 10.051  3.368   1.00 0.00 ? 4  PHE A H2   14 
ATOM 7801  H H3   . PHE A 1 1  ? -18.536 11.301  3.812   1.00 0.00 ? 4  PHE A H3   14 
ATOM 7802  H HA   . PHE A 1 1  ? -17.274 9.912   5.128   1.00 0.00 ? 4  PHE A HA   14 
ATOM 7803  H HB2  . PHE A 1 1  ? -18.034 7.527   5.522   1.00 0.00 ? 4  PHE A HB2  14 
ATOM 7804  H HB3  . PHE A 1 1  ? -19.004 8.758   6.322   1.00 0.00 ? 4  PHE A HB3  14 
ATOM 7805  H HD1  . PHE A 1 1  ? -18.891 6.573   3.325   1.00 0.00 ? 4  PHE A HD1  14 
ATOM 7806  H HD2  . PHE A 1 1  ? -21.307 8.854   5.984   1.00 0.00 ? 4  PHE A HD2  14 
ATOM 7807  H HE1  . PHE A 1 1  ? -20.914 5.651   2.273   1.00 0.00 ? 4  PHE A HE1  14 
ATOM 7808  H HE2  . PHE A 1 1  ? -23.334 7.935   4.937   1.00 0.00 ? 4  PHE A HE2  14 
ATOM 7809  H HZ   . PHE A 1 1  ? -23.139 6.330   3.080   1.00 0.00 ? 4  PHE A HZ   14 
ATOM 7810  N N    . THR A 1 2  ? -16.253 8.110   3.506   1.00 0.00 ? 5  THR A N    14 
ATOM 7811  C CA   . THR A 1 2  ? -15.523 7.467   2.407   1.00 0.00 ? 5  THR A CA   14 
ATOM 7812  C C    . THR A 1 2  ? -15.015 8.505   1.402   1.00 0.00 ? 5  THR A C    14 
ATOM 7813  O O    . THR A 1 2  ? -15.586 8.667   0.322   1.00 0.00 ? 5  THR A O    14 
ATOM 7814  C CB   . THR A 1 2  ? -16.412 6.432   1.702   1.00 0.00 ? 5  THR A CB   14 
ATOM 7815  O OG1  . THR A 1 2  ? -17.054 5.593   2.648   1.00 0.00 ? 5  THR A OG1  14 
ATOM 7816  C CG2  . THR A 1 2  ? -15.656 5.539   0.743   1.00 0.00 ? 5  THR A CG2  14 
ATOM 7817  H H    . THR A 1 2  ? -15.913 8.019   4.420   1.00 0.00 ? 5  THR A H    14 
ATOM 7818  H HA   . THR A 1 2  ? -14.671 6.958   2.833   1.00 0.00 ? 5  THR A HA   14 
ATOM 7819  H HB   . THR A 1 2  ? -17.175 6.954   1.138   1.00 0.00 ? 5  THR A HB   14 
ATOM 7820  H HG1  . THR A 1 2  ? -16.433 4.938   2.977   1.00 0.00 ? 5  THR A HG1  14 
ATOM 7821  H HG21 . THR A 1 2  ? -16.269 4.687   0.486   1.00 0.00 ? 5  THR A HG21 14 
ATOM 7822  H HG22 . THR A 1 2  ? -14.744 5.198   1.210   1.00 0.00 ? 5  THR A HG22 14 
ATOM 7823  H HG23 . THR A 1 2  ? -15.416 6.094   -0.153  1.00 0.00 ? 5  THR A HG23 14 
ATOM 7824  N N    . LEU A 1 3  ? -13.935 9.200   1.777   1.00 0.00 ? 6  LEU A N    14 
ATOM 7825  C CA   . LEU A 1 3  ? -13.323 10.234  0.933   1.00 0.00 ? 6  LEU A CA   14 
ATOM 7826  C C    . LEU A 1 3  ? -14.124 11.542  0.970   1.00 0.00 ? 6  LEU A C    14 
ATOM 7827  O O    . LEU A 1 3  ? -15.355 11.532  0.967   1.00 0.00 ? 6  LEU A O    14 
ATOM 7828  C CB   . LEU A 1 3  ? -13.175 9.745   -0.513  1.00 0.00 ? 6  LEU A CB   14 
ATOM 7829  C CG   . LEU A 1 3  ? -11.740 9.711   -1.038  1.00 0.00 ? 6  LEU A CG   14 
ATOM 7830  C CD1  . LEU A 1 3  ? -11.611 8.706   -2.169  1.00 0.00 ? 6  LEU A CD1  14 
ATOM 7831  C CD2  . LEU A 1 3  ? -11.307 11.091  -1.504  1.00 0.00 ? 6  LEU A CD2  14 
ATOM 7832  H H    . LEU A 1 3  ? -13.536 9.014   2.650   1.00 0.00 ? 6  LEU A H    14 
ATOM 7833  H HA   . LEU A 1 3  ? -12.338 10.432  1.331   1.00 0.00 ? 6  LEU A HA   14 
ATOM 7834  H HB2  . LEU A 1 3  ? -13.584 8.746   -0.579  1.00 0.00 ? 6  LEU A HB2  14 
ATOM 7835  H HB3  . LEU A 1 3  ? -13.753 10.394  -1.154  1.00 0.00 ? 6  LEU A HB3  14 
ATOM 7836  H HG   . LEU A 1 3  ? -11.080 9.402   -0.240  1.00 0.00 ? 6  LEU A HG   14 
ATOM 7837  H HD11 . LEU A 1 3  ? -12.448 8.815   -2.844  1.00 0.00 ? 6  LEU A HD11 14 
ATOM 7838  H HD12 . LEU A 1 3  ? -11.603 7.706   -1.763  1.00 0.00 ? 6  LEU A HD12 14 
ATOM 7839  H HD13 . LEU A 1 3  ? -10.691 8.885   -2.706  1.00 0.00 ? 6  LEU A HD13 14 
ATOM 7840  H HD21 . LEU A 1 3  ? -12.093 11.534  -2.097  1.00 0.00 ? 6  LEU A HD21 14 
ATOM 7841  H HD22 . LEU A 1 3  ? -10.412 11.004  -2.103  1.00 0.00 ? 6  LEU A HD22 14 
ATOM 7842  H HD23 . LEU A 1 3  ? -11.107 11.715  -0.646  1.00 0.00 ? 6  LEU A HD23 14 
ATOM 7843  N N    . SER A 1 4  ? -13.408 12.667  1.010   1.00 0.00 ? 7  SER A N    14 
ATOM 7844  C CA   . SER A 1 4  ? -14.044 13.987  1.050   1.00 0.00 ? 7  SER A CA   14 
ATOM 7845  C C    . SER A 1 4  ? -13.271 15.010  0.209   1.00 0.00 ? 7  SER A C    14 
ATOM 7846  O O    . SER A 1 4  ? -13.088 16.155  0.626   1.00 0.00 ? 7  SER A O    14 
ATOM 7847  C CB   . SER A 1 4  ? -14.158 14.476  2.500   1.00 0.00 ? 7  SER A CB   14 
ATOM 7848  O OG   . SER A 1 4  ? -12.905 14.934  2.992   1.00 0.00 ? 7  SER A OG   14 
ATOM 7849  H H    . SER A 1 4  ? -12.429 12.610  1.015   1.00 0.00 ? 7  SER A H    14 
ATOM 7850  H HA   . SER A 1 4  ? -15.037 13.886  0.639   1.00 0.00 ? 7  SER A HA   14 
ATOM 7851  H HB2  . SER A 1 4  ? -14.868 15.288  2.549   1.00 0.00 ? 7  SER A HB2  14 
ATOM 7852  H HB3  . SER A 1 4  ? -14.500 13.663  3.125   1.00 0.00 ? 7  SER A HB3  14 
ATOM 7853  H HG   . SER A 1 4  ? -12.631 15.720  2.501   1.00 0.00 ? 7  SER A HG   14 
ATOM 7854  N N    . LEU A 1 5  ? -12.823 14.588  -0.978  1.00 0.00 ? 8  LEU A N    14 
ATOM 7855  C CA   . LEU A 1 5  ? -12.071 15.460  -1.889  1.00 0.00 ? 8  LEU A CA   14 
ATOM 7856  C C    . LEU A 1 5  ? -10.892 16.149  -1.182  1.00 0.00 ? 8  LEU A C    14 
ATOM 7857  O O    . LEU A 1 5  ? -10.794 17.377  -1.163  1.00 0.00 ? 8  LEU A O    14 
ATOM 7858  C CB   . LEU A 1 5  ? -13.008 16.504  -2.513  1.00 0.00 ? 8  LEU A CB   14 
ATOM 7859  C CG   . LEU A 1 5  ? -13.072 16.483  -4.042  1.00 0.00 ? 8  LEU A CG   14 
ATOM 7860  C CD1  . LEU A 1 5  ? -14.185 17.389  -4.541  1.00 0.00 ? 8  LEU A CD1  14 
ATOM 7861  C CD2  . LEU A 1 5  ? -11.738 16.904  -4.639  1.00 0.00 ? 8  LEU A CD2  14 
ATOM 7862  H H    . LEU A 1 5  ? -13.007 13.667  -1.252  1.00 0.00 ? 8  LEU A H    14 
ATOM 7863  H HA   . LEU A 1 5  ? -11.675 14.839  -2.678  1.00 0.00 ? 8  LEU A HA   14 
ATOM 7864  H HB2  . LEU A 1 5  ? -14.003 16.339  -2.130  1.00 0.00 ? 8  LEU A HB2  14 
ATOM 7865  H HB3  . LEU A 1 5  ? -12.680 17.486  -2.205  1.00 0.00 ? 8  LEU A HB3  14 
ATOM 7866  H HG   . LEU A 1 5  ? -13.286 15.477  -4.373  1.00 0.00 ? 8  LEU A HG   14 
ATOM 7867  H HD11 . LEU A 1 5  ? -14.022 18.393  -4.177  1.00 0.00 ? 8  LEU A HD11 14 
ATOM 7868  H HD12 . LEU A 1 5  ? -15.135 17.025  -4.181  1.00 0.00 ? 8  LEU A HD12 14 
ATOM 7869  H HD13 . LEU A 1 5  ? -14.187 17.394  -5.621  1.00 0.00 ? 8  LEU A HD13 14 
ATOM 7870  H HD21 . LEU A 1 5  ? -11.901 17.341  -5.613  1.00 0.00 ? 8  LEU A HD21 14 
ATOM 7871  H HD22 . LEU A 1 5  ? -11.099 16.040  -4.735  1.00 0.00 ? 8  LEU A HD22 14 
ATOM 7872  H HD23 . LEU A 1 5  ? -11.268 17.629  -3.992  1.00 0.00 ? 8  LEU A HD23 14 
ATOM 7873  N N    . ASP A 1 6  ? -9.992  15.344  -0.616  1.00 0.00 ? 9  ASP A N    14 
ATOM 7874  C CA   . ASP A 1 6  ? -8.820  15.868  0.079   1.00 0.00 ? 9  ASP A CA   14 
ATOM 7875  C C    . ASP A 1 6  ? -7.622  14.934  -0.091  1.00 0.00 ? 9  ASP A C    14 
ATOM 7876  O O    . ASP A 1 6  ? -7.391  14.028  0.715   1.00 0.00 ? 9  ASP A O    14 
ATOM 7877  C CB   . ASP A 1 6  ? -9.128  16.084  1.565   1.00 0.00 ? 9  ASP A CB   14 
ATOM 7878  C CG   . ASP A 1 6  ? -8.280  17.180  2.178   1.00 0.00 ? 9  ASP A CG   14 
ATOM 7879  O OD1  . ASP A 1 6  ? -7.052  16.983  2.300   1.00 0.00 ? 9  ASP A OD1  14 
ATOM 7880  O OD2  . ASP A 1 6  ? -8.842  18.234  2.534   1.00 0.00 ? 9  ASP A OD2  14 
ATOM 7881  H H    . ASP A 1 6  ? -10.115 14.377  -0.674  1.00 0.00 ? 9  ASP A H    14 
ATOM 7882  H HA   . ASP A 1 6  ? -8.572  16.820  -0.369  1.00 0.00 ? 9  ASP A HA   14 
ATOM 7883  H HB2  . ASP A 1 6  ? -10.166 16.356  1.676   1.00 0.00 ? 9  ASP A HB2  14 
ATOM 7884  H HB3  . ASP A 1 6  ? -8.940  15.166  2.103   1.00 0.00 ? 9  ASP A HB3  14 
ATOM 7885  N N    . VAL A 1 7  ? -6.867  15.162  -1.156  1.00 0.00 ? 10 VAL A N    14 
ATOM 7886  C CA   . VAL A 1 7  ? -5.689  14.355  -1.460  1.00 0.00 ? 10 VAL A CA   14 
ATOM 7887  C C    . VAL A 1 7  ? -4.406  15.184  -1.302  1.00 0.00 ? 10 VAL A C    14 
ATOM 7888  O O    . VAL A 1 7  ? -3.869  15.709  -2.280  1.00 0.00 ? 10 VAL A O    14 
ATOM 7889  C CB   . VAL A 1 7  ? -5.763  13.784  -2.892  1.00 0.00 ? 10 VAL A CB   14 
ATOM 7890  C CG1  . VAL A 1 7  ? -4.554  12.911  -3.190  1.00 0.00 ? 10 VAL A CG1  14 
ATOM 7891  C CG2  . VAL A 1 7  ? -7.051  12.998  -3.094  1.00 0.00 ? 10 VAL A CG2  14 
ATOM 7892  H H    . VAL A 1 7  ? -7.113  15.892  -1.760  1.00 0.00 ? 10 VAL A H    14 
ATOM 7893  H HA   . VAL A 1 7  ? -5.660  13.529  -0.765  1.00 0.00 ? 10 VAL A HA   14 
ATOM 7894  H HB   . VAL A 1 7  ? -5.763  14.615  -3.584  1.00 0.00 ? 10 VAL A HB   14 
ATOM 7895  H HG11 . VAL A 1 7  ? -4.358  12.266  -2.347  1.00 0.00 ? 10 VAL A HG11 14 
ATOM 7896  H HG12 . VAL A 1 7  ? -3.693  13.538  -3.372  1.00 0.00 ? 10 VAL A HG12 14 
ATOM 7897  H HG13 . VAL A 1 7  ? -4.751  12.309  -4.065  1.00 0.00 ? 10 VAL A HG13 14 
ATOM 7898  H HG21 . VAL A 1 7  ? -7.864  13.682  -3.293  1.00 0.00 ? 10 VAL A HG21 14 
ATOM 7899  H HG22 . VAL A 1 7  ? -7.269  12.430  -2.201  1.00 0.00 ? 10 VAL A HG22 14 
ATOM 7900  H HG23 . VAL A 1 7  ? -6.935  12.325  -3.929  1.00 0.00 ? 10 VAL A HG23 14 
ATOM 7901  N N    . PRO A 1 8  ? -3.910  15.329  -0.057  1.00 0.00 ? 11 PRO A N    14 
ATOM 7902  C CA   . PRO A 1 8  ? -2.701  16.112  0.230   1.00 0.00 ? 11 PRO A CA   14 
ATOM 7903  C C    . PRO A 1 8  ? -1.399  15.354  -0.054  1.00 0.00 ? 11 PRO A C    14 
ATOM 7904  O O    . PRO A 1 8  ? -1.382  14.122  -0.147  1.00 0.00 ? 11 PRO A O    14 
ATOM 7905  C CB   . PRO A 1 8  ? -2.840  16.400  1.722   1.00 0.00 ? 11 PRO A CB   14 
ATOM 7906  C CG   . PRO A 1 8  ? -3.549  15.205  2.259   1.00 0.00 ? 11 PRO A CG   14 
ATOM 7907  C CD   . PRO A 1 8  ? -4.501  14.765  1.176   1.00 0.00 ? 11 PRO A CD   14 
ATOM 7908  H HA   . PRO A 1 8  ? -2.697  17.044  -0.318  1.00 0.00 ? 11 PRO A HA   14 
ATOM 7909  H HB2  . PRO A 1 8  ? -1.863  16.517  2.165   1.00 0.00 ? 11 PRO A HB2  14 
ATOM 7910  H HB3  . PRO A 1 8  ? -3.420  17.300  1.867   1.00 0.00 ? 11 PRO A HB3  14 
ATOM 7911  H HG2  . PRO A 1 8  ? -2.838  14.422  2.474   1.00 0.00 ? 11 PRO A HG2  14 
ATOM 7912  H HG3  . PRO A 1 8  ? -4.098  15.473  3.151   1.00 0.00 ? 11 PRO A HG3  14 
ATOM 7913  H HD2  . PRO A 1 8  ? -4.544  13.686  1.126   1.00 0.00 ? 11 PRO A HD2  14 
ATOM 7914  H HD3  . PRO A 1 8  ? -5.486  15.174  1.352   1.00 0.00 ? 11 PRO A HD3  14 
ATOM 7915  N N    . THR A 1 9  ? -0.302  16.106  -0.178  1.00 0.00 ? 12 THR A N    14 
ATOM 7916  C CA   . THR A 1 9  ? 1.021   15.528  -0.441  1.00 0.00 ? 12 THR A CA   14 
ATOM 7917  C C    . THR A 1 9  ? 1.379   14.454  0.586   1.00 0.00 ? 12 THR A C    14 
ATOM 7918  O O    . THR A 1 9  ? 1.963   13.429  0.237   1.00 0.00 ? 12 THR A O    14 
ATOM 7919  C CB   . THR A 1 9  ? 2.096   16.620  -0.441  1.00 0.00 ? 12 THR A CB   14 
ATOM 7920  O OG1  . THR A 1 9  ? 1.518   17.899  -0.639  1.00 0.00 ? 12 THR A OG1  14 
ATOM 7921  C CG2  . THR A 1 9  ? 3.152   16.422  -1.507  1.00 0.00 ? 12 THR A CG2  14 
ATOM 7922  H H    . THR A 1 9  ? -0.381  17.080  -0.084  1.00 0.00 ? 12 THR A H    14 
ATOM 7923  H HA   . THR A 1 9  ? 0.994   15.070  -1.416  1.00 0.00 ? 12 THR A HA   14 
ATOM 7924  H HB   . THR A 1 9  ? 2.591   16.616  0.518   1.00 0.00 ? 12 THR A HB   14 
ATOM 7925  H HG1  . THR A 1 9  ? 1.409   18.067  -1.579  1.00 0.00 ? 12 THR A HG1  14 
ATOM 7926  H HG21 . THR A 1 9  ? 3.821   15.627  -1.208  1.00 0.00 ? 12 THR A HG21 14 
ATOM 7927  H HG22 . THR A 1 9  ? 3.712   17.336  -1.632  1.00 0.00 ? 12 THR A HG22 14 
ATOM 7928  H HG23 . THR A 1 9  ? 2.677   16.158  -2.442  1.00 0.00 ? 12 THR A HG23 14 
ATOM 7929  N N    . ASN A 1 10 ? 1.014   14.691  1.852   1.00 0.00 ? 13 ASN A N    14 
ATOM 7930  C CA   . ASN A 1 10 ? 1.289   13.732  2.929   1.00 0.00 ? 13 ASN A CA   14 
ATOM 7931  C C    . ASN A 1 10 ? 0.472   12.447  2.774   1.00 0.00 ? 13 ASN A C    14 
ATOM 7932  O O    . ASN A 1 10 ? 0.716   11.462  3.469   1.00 0.00 ? 13 ASN A O    14 
ATOM 7933  C CB   . ASN A 1 10 ? 1.026   14.365  4.302   1.00 0.00 ? 13 ASN A CB   14 
ATOM 7934  C CG   . ASN A 1 10 ? -0.292  15.109  4.364   1.00 0.00 ? 13 ASN A CG   14 
ATOM 7935  O OD1  . ASN A 1 10 ? -0.459  16.141  3.720   1.00 0.00 ? 13 ASN A OD1  14 
ATOM 7936  N ND2  . ASN A 1 10 ? -1.236  14.593  5.135   1.00 0.00 ? 13 ASN A ND2  14 
ATOM 7937  H H    . ASN A 1 10 ? 0.543   15.526  2.064   1.00 0.00 ? 13 ASN A H    14 
ATOM 7938  H HA   . ASN A 1 10 ? 2.326   13.470  2.863   1.00 0.00 ? 13 ASN A HA   14 
ATOM 7939  H HB2  . ASN A 1 10 ? 1.012   13.588  5.052   1.00 0.00 ? 13 ASN A HB2  14 
ATOM 7940  H HB3  . ASN A 1 10 ? 1.821   15.060  4.528   1.00 0.00 ? 13 ASN A HB3  14 
ATOM 7941  H HD21 . ASN A 1 10 ? -1.038  13.765  5.621   1.00 0.00 ? 13 ASN A HD21 14 
ATOM 7942  H HD22 . ASN A 1 10 ? -2.094  15.062  5.188   1.00 0.00 ? 13 ASN A HD22 14 
ATOM 7943  N N    . ILE A 1 11 ? -0.486  12.461  1.857   1.00 0.00 ? 14 ILE A N    14 
ATOM 7944  C CA   . ILE A 1 11 ? -1.322  11.302  1.594   1.00 0.00 ? 14 ILE A CA   14 
ATOM 7945  C C    . ILE A 1 11 ? -0.834  10.575  0.340   1.00 0.00 ? 14 ILE A C    14 
ATOM 7946  O O    . ILE A 1 11 ? -0.717  9.349   0.331   1.00 0.00 ? 14 ILE A O    14 
ATOM 7947  C CB   . ILE A 1 11 ? -2.804  11.725  1.442   1.00 0.00 ? 14 ILE A CB   14 
ATOM 7948  C CG1  . ILE A 1 11 ? -3.570  11.455  2.737   1.00 0.00 ? 14 ILE A CG1  14 
ATOM 7949  C CG2  . ILE A 1 11 ? -3.479  11.015  0.274   1.00 0.00 ? 14 ILE A CG2  14 
ATOM 7950  C CD1  . ILE A 1 11 ? -3.095  12.282  3.912   1.00 0.00 ? 14 ILE A CD1  14 
ATOM 7951  H H    . ILE A 1 11 ? -0.630  13.271  1.331   1.00 0.00 ? 14 ILE A H    14 
ATOM 7952  H HA   . ILE A 1 11 ? -1.239  10.633  2.438   1.00 0.00 ? 14 ILE A HA   14 
ATOM 7953  H HB   . ILE A 1 11 ? -2.821  12.786  1.243   1.00 0.00 ? 14 ILE A HB   14 
ATOM 7954  H HG12 . ILE A 1 11 ? -4.613  11.676  2.580   1.00 0.00 ? 14 ILE A HG12 14 
ATOM 7955  H HG13 . ILE A 1 11 ? -3.464  10.412  2.999   1.00 0.00 ? 14 ILE A HG13 14 
ATOM 7956  H HG21 . ILE A 1 11 ? -3.102  11.410  -0.657  1.00 0.00 ? 14 ILE A HG21 14 
ATOM 7957  H HG22 . ILE A 1 11 ? -4.547  11.175  0.326   1.00 0.00 ? 14 ILE A HG22 14 
ATOM 7958  H HG23 . ILE A 1 11 ? -3.273  9.956   0.327   1.00 0.00 ? 14 ILE A HG23 14 
ATOM 7959  H HD11 . ILE A 1 11 ? -2.853  11.629  4.737   1.00 0.00 ? 14 ILE A HD11 14 
ATOM 7960  H HD12 . ILE A 1 11 ? -3.877  12.965  4.210   1.00 0.00 ? 14 ILE A HD12 14 
ATOM 7961  H HD13 . ILE A 1 11 ? -2.217  12.842  3.627   1.00 0.00 ? 14 ILE A HD13 14 
ATOM 7962  N N    . MET A 1 12 ? -0.534  11.345  -0.712  1.00 0.00 ? 15 MET A N    14 
ATOM 7963  C CA   . MET A 1 12 ? -0.042  10.786  -1.965  1.00 0.00 ? 15 MET A CA   14 
ATOM 7964  C C    . MET A 1 12 ? 1.169   9.883   -1.722  1.00 0.00 ? 15 MET A C    14 
ATOM 7965  O O    . MET A 1 12 ? 1.174   8.715   -2.121  1.00 0.00 ? 15 MET A O    14 
ATOM 7966  C CB   . MET A 1 12 ? 0.322   11.919  -2.926  1.00 0.00 ? 15 MET A CB   14 
ATOM 7967  C CG   . MET A 1 12 ? -0.361  11.813  -4.275  1.00 0.00 ? 15 MET A CG   14 
ATOM 7968  S SD   . MET A 1 12 ? 0.795   11.468  -5.615  1.00 0.00 ? 15 MET A SD   14 
ATOM 7969  C CE   . MET A 1 12 ? 0.751   13.017  -6.514  1.00 0.00 ? 15 MET A CE   14 
ATOM 7970  H H    . MET A 1 12 ? -0.639  12.318  -0.641  1.00 0.00 ? 15 MET A H    14 
ATOM 7971  H HA   . MET A 1 12 ? -0.833  10.194  -2.401  1.00 0.00 ? 15 MET A HA   14 
ATOM 7972  H HB2  . MET A 1 12 ? 0.038   12.859  -2.477  1.00 0.00 ? 15 MET A HB2  14 
ATOM 7973  H HB3  . MET A 1 12 ? 1.388   11.915  -3.081  1.00 0.00 ? 15 MET A HB3  14 
ATOM 7974  H HG2  . MET A 1 12 ? -1.090  11.018  -4.234  1.00 0.00 ? 15 MET A HG2  14 
ATOM 7975  H HG3  . MET A 1 12 ? -0.863  12.747  -4.480  1.00 0.00 ? 15 MET A HG3  14 
ATOM 7976  H HE1  . MET A 1 12 ? 0.955   13.833  -5.836  1.00 0.00 ? 15 MET A HE1  14 
ATOM 7977  H HE2  . MET A 1 12 ? -0.226  13.149  -6.954  1.00 0.00 ? 15 MET A HE2  14 
ATOM 7978  H HE3  . MET A 1 12 ? 1.498   13.002  -7.294  1.00 0.00 ? 15 MET A HE3  14 
ATOM 7979  N N    . ASN A 1 13 ? 2.188   10.424  -1.045  1.00 0.00 ? 16 ASN A N    14 
ATOM 7980  C CA   . ASN A 1 13 ? 3.389   9.652   -0.735  1.00 0.00 ? 16 ASN A CA   14 
ATOM 7981  C C    . ASN A 1 13 ? 3.028   8.424   0.103   1.00 0.00 ? 16 ASN A C    14 
ATOM 7982  O O    . ASN A 1 13 ? 3.488   7.314   -0.175  1.00 0.00 ? 16 ASN A O    14 
ATOM 7983  C CB   . ASN A 1 13 ? 4.440   10.519  -0.017  1.00 0.00 ? 16 ASN A CB   14 
ATOM 7984  C CG   . ASN A 1 13 ? 3.897   11.266  1.190   1.00 0.00 ? 16 ASN A CG   14 
ATOM 7985  O OD1  . ASN A 1 13 ? 2.751   11.084  1.590   1.00 0.00 ? 16 ASN A OD1  14 
ATOM 7986  N ND2  . ASN A 1 13 ? 4.724   12.117  1.779   1.00 0.00 ? 16 ASN A ND2  14 
ATOM 7987  H H    . ASN A 1 13 ? 2.121   11.353  -0.738  1.00 0.00 ? 16 ASN A H    14 
ATOM 7988  H HA   . ASN A 1 13 ? 3.800   9.312   -1.669  1.00 0.00 ? 16 ASN A HA   14 
ATOM 7989  H HB2  . ASN A 1 13 ? 5.247   9.886   0.318   1.00 0.00 ? 16 ASN A HB2  14 
ATOM 7990  H HB3  . ASN A 1 13 ? 4.829   11.244  -0.716  1.00 0.00 ? 16 ASN A HB3  14 
ATOM 7991  H HD21 . ASN A 1 13 ? 5.626   12.218  1.412   1.00 0.00 ? 16 ASN A HD21 14 
ATOM 7992  H HD22 . ASN A 1 13 ? 4.397   12.608  2.559   1.00 0.00 ? 16 ASN A HD22 14 
ATOM 7993  N N    . LEU A 1 14 ? 2.177   8.631   1.107   1.00 0.00 ? 17 LEU A N    14 
ATOM 7994  C CA   . LEU A 1 14 ? 1.723   7.543   1.968   1.00 0.00 ? 17 LEU A CA   14 
ATOM 7995  C C    . LEU A 1 14 ? 1.012   6.481   1.137   1.00 0.00 ? 17 LEU A C    14 
ATOM 7996  O O    . LEU A 1 14 ? 1.343   5.298   1.217   1.00 0.00 ? 17 LEU A O    14 
ATOM 7997  C CB   . LEU A 1 14 ? 0.787   8.071   3.062   1.00 0.00 ? 17 LEU A CB   14 
ATOM 7998  C CG   . LEU A 1 14 ? 1.481   8.725   4.259   1.00 0.00 ? 17 LEU A CG   14 
ATOM 7999  C CD1  . LEU A 1 14 ? 0.462   9.099   5.323   1.00 0.00 ? 17 LEU A CD1  14 
ATOM 8000  C CD2  . LEU A 1 14 ? 2.537   7.799   4.842   1.00 0.00 ? 17 LEU A CD2  14 
ATOM 8001  H H    . LEU A 1 14 ? 1.833   9.539   1.259   1.00 0.00 ? 17 LEU A H    14 
ATOM 8002  H HA   . LEU A 1 14 ? 2.593   7.097   2.428   1.00 0.00 ? 17 LEU A HA   14 
ATOM 8003  H HB2  . LEU A 1 14 ? 0.122   8.797   2.618   1.00 0.00 ? 17 LEU A HB2  14 
ATOM 8004  H HB3  . LEU A 1 14 ? 0.194   7.245   3.428   1.00 0.00 ? 17 LEU A HB3  14 
ATOM 8005  H HG   . LEU A 1 14 ? 1.971   9.631   3.932   1.00 0.00 ? 17 LEU A HG   14 
ATOM 8006  H HD11 . LEU A 1 14 ? -0.259  8.303   5.427   1.00 0.00 ? 17 LEU A HD11 14 
ATOM 8007  H HD12 . LEU A 1 14 ? -0.043  10.008  5.033   1.00 0.00 ? 17 LEU A HD12 14 
ATOM 8008  H HD13 . LEU A 1 14 ? 0.968   9.254   6.265   1.00 0.00 ? 17 LEU A HD13 14 
ATOM 8009  H HD21 . LEU A 1 14 ? 3.405   7.796   4.200   1.00 0.00 ? 17 LEU A HD21 14 
ATOM 8010  H HD22 . LEU A 1 14 ? 2.139   6.799   4.915   1.00 0.00 ? 17 LEU A HD22 14 
ATOM 8011  H HD23 . LEU A 1 14 ? 2.817   8.148   5.825   1.00 0.00 ? 17 LEU A HD23 14 
ATOM 8012  N N    . LEU A 1 15 ? 0.051   6.909   0.318   1.00 0.00 ? 18 LEU A N    14 
ATOM 8013  C CA   . LEU A 1 15 ? -0.684  5.989   -0.547  1.00 0.00 ? 18 LEU A CA   14 
ATOM 8014  C C    . LEU A 1 15 ? 0.281   5.228   -1.447  1.00 0.00 ? 18 LEU A C    14 
ATOM 8015  O O    . LEU A 1 15 ? 0.217   3.997   -1.540  1.00 0.00 ? 18 LEU A O    14 
ATOM 8016  C CB   . LEU A 1 15 ? -1.717  6.748   -1.388  1.00 0.00 ? 18 LEU A CB   14 
ATOM 8017  C CG   . LEU A 1 15 ? -2.958  7.215   -0.626  1.00 0.00 ? 18 LEU A CG   14 
ATOM 8018  C CD1  . LEU A 1 15 ? -3.915  7.936   -1.560  1.00 0.00 ? 18 LEU A CD1  14 
ATOM 8019  C CD2  . LEU A 1 15 ? -3.651  6.037   0.040   1.00 0.00 ? 18 LEU A CD2  14 
ATOM 8020  H H    . LEU A 1 15 ? -0.159  7.875   0.285   1.00 0.00 ? 18 LEU A H    14 
ATOM 8021  H HA   . LEU A 1 15 ? -1.192  5.277   0.083   1.00 0.00 ? 18 LEU A HA   14 
ATOM 8022  H HB2  . LEU A 1 15 ? -1.234  7.616   -1.815  1.00 0.00 ? 18 LEU A HB2  14 
ATOM 8023  H HB3  . LEU A 1 15 ? -2.038  6.104   -2.193  1.00 0.00 ? 18 LEU A HB3  14 
ATOM 8024  H HG   . LEU A 1 15 ? -2.659  7.910   0.146   1.00 0.00 ? 18 LEU A HG   14 
ATOM 8025  H HD11 . LEU A 1 15 ? -3.917  7.445   -2.522  1.00 0.00 ? 18 LEU A HD11 14 
ATOM 8026  H HD12 . LEU A 1 15 ? -3.597  8.961   -1.681  1.00 0.00 ? 18 LEU A HD12 14 
ATOM 8027  H HD13 . LEU A 1 15 ? -4.911  7.914   -1.143  1.00 0.00 ? 18 LEU A HD13 14 
ATOM 8028  H HD21 . LEU A 1 15 ? -4.591  6.364   0.461   1.00 0.00 ? 18 LEU A HD21 14 
ATOM 8029  H HD22 . LEU A 1 15 ? -3.022  5.645   0.825   1.00 0.00 ? 18 LEU A HD22 14 
ATOM 8030  H HD23 . LEU A 1 15 ? -3.834  5.266   -0.693  1.00 0.00 ? 18 LEU A HD23 14 
ATOM 8031  N N    . PHE A 1 16 ? 1.198   5.962   -2.081  1.00 0.00 ? 19 PHE A N    14 
ATOM 8032  C CA   . PHE A 1 16 ? 2.205   5.353   -2.946  1.00 0.00 ? 19 PHE A CA   14 
ATOM 8033  C C    . PHE A 1 16 ? 3.005   4.315   -2.164  1.00 0.00 ? 19 PHE A C    14 
ATOM 8034  O O    . PHE A 1 16 ? 3.256   3.210   -2.648  1.00 0.00 ? 19 PHE A O    14 
ATOM 8035  C CB   . PHE A 1 16 ? 3.150   6.423   -3.500  1.00 0.00 ? 19 PHE A CB   14 
ATOM 8036  C CG   . PHE A 1 16 ? 3.613   6.149   -4.903  1.00 0.00 ? 19 PHE A CG   14 
ATOM 8037  C CD1  . PHE A 1 16 ? 4.653   5.265   -5.142  1.00 0.00 ? 19 PHE A CD1  14 
ATOM 8038  C CD2  . PHE A 1 16 ? 3.008   6.774   -5.982  1.00 0.00 ? 19 PHE A CD2  14 
ATOM 8039  C CE1  . PHE A 1 16 ? 5.082   5.010   -6.431  1.00 0.00 ? 19 PHE A CE1  14 
ATOM 8040  C CE2  . PHE A 1 16 ? 3.433   6.521   -7.273  1.00 0.00 ? 19 PHE A CE2  14 
ATOM 8041  C CZ   . PHE A 1 16 ? 4.471   5.639   -7.497  1.00 0.00 ? 19 PHE A CZ   14 
ATOM 8042  H H    . PHE A 1 16 ? 1.208   6.938   -1.944  1.00 0.00 ? 19 PHE A H    14 
ATOM 8043  H HA   . PHE A 1 16 ? 1.698   4.864   -3.765  1.00 0.00 ? 19 PHE A HA   14 
ATOM 8044  H HB2  . PHE A 1 16 ? 2.646   7.374   -3.493  1.00 0.00 ? 19 PHE A HB2  14 
ATOM 8045  H HB3  . PHE A 1 16 ? 4.024   6.483   -2.867  1.00 0.00 ? 19 PHE A HB3  14 
ATOM 8046  H HD1  . PHE A 1 16 ? 5.131   4.772   -4.308  1.00 0.00 ? 19 PHE A HD1  14 
ATOM 8047  H HD2  . PHE A 1 16 ? 2.197   7.465   -5.807  1.00 0.00 ? 19 PHE A HD2  14 
ATOM 8048  H HE1  . PHE A 1 16 ? 5.895   4.319   -6.604  1.00 0.00 ? 19 PHE A HE1  14 
ATOM 8049  H HE2  . PHE A 1 16 ? 2.954   7.015   -8.106  1.00 0.00 ? 19 PHE A HE2  14 
ATOM 8050  H HZ   . PHE A 1 16 ? 4.804   5.441   -8.505  1.00 0.00 ? 19 PHE A HZ   14 
ATOM 8051  N N    . ASN A 1 17 ? 3.387   4.679   -0.939  1.00 0.00 ? 20 ASN A N    14 
ATOM 8052  C CA   . ASN A 1 17 ? 4.141   3.792   -0.072  1.00 0.00 ? 20 ASN A CA   14 
ATOM 8053  C C    . ASN A 1 17 ? 3.270   2.626   0.387   1.00 0.00 ? 20 ASN A C    14 
ATOM 8054  O O    . ASN A 1 17 ? 3.699   1.471   0.349   1.00 0.00 ? 20 ASN A O    14 
ATOM 8055  C CB   . ASN A 1 17 ? 4.668   4.568   1.129   1.00 0.00 ? 20 ASN A CB   14 
ATOM 8056  C CG   . ASN A 1 17 ? 6.109   4.241   1.438   1.00 0.00 ? 20 ASN A CG   14 
ATOM 8057  O OD1  . ASN A 1 17 ? 6.947   5.128   1.553   1.00 0.00 ? 20 ASN A OD1  14 
ATOM 8058  N ND2  . ASN A 1 17 ? 6.409   2.960   1.568   1.00 0.00 ? 20 ASN A ND2  14 
ATOM 8059  H H    . ASN A 1 17 ? 3.142   5.570   -0.602  1.00 0.00 ? 20 ASN A H    14 
ATOM 8060  H HA   . ASN A 1 17 ? 4.975   3.402   -0.637  1.00 0.00 ? 20 ASN A HA   14 
ATOM 8061  H HB2  . ASN A 1 17 ? 4.597   5.626   0.929   1.00 0.00 ? 20 ASN A HB2  14 
ATOM 8062  H HB3  . ASN A 1 17 ? 4.069   4.329   1.989   1.00 0.00 ? 20 ASN A HB3  14 
ATOM 8063  H HD21 . ASN A 1 17 ? 5.694   2.299   1.463   1.00 0.00 ? 20 ASN A HD21 14 
ATOM 8064  H HD22 . ASN A 1 17 ? 7.334   2.730   1.759   1.00 0.00 ? 20 ASN A HD22 14 
ATOM 8065  N N    . ILE A 1 18 ? 2.037   2.933   0.798   1.00 0.00 ? 21 ILE A N    14 
ATOM 8066  C CA   . ILE A 1 18 ? 1.095   1.902   1.237   1.00 0.00 ? 21 ILE A CA   14 
ATOM 8067  C C    . ILE A 1 18 ? 0.962   0.845   0.151   1.00 0.00 ? 21 ILE A C    14 
ATOM 8068  O O    . ILE A 1 18 ? 1.270   -0.326  0.378   1.00 0.00 ? 21 ILE A O    14 
ATOM 8069  C CB   . ILE A 1 18 ? -0.299  2.491   1.567   1.00 0.00 ? 21 ILE A CB   14 
ATOM 8070  C CG1  . ILE A 1 18 ? -0.234  3.338   2.840   1.00 0.00 ? 21 ILE A CG1  14 
ATOM 8071  C CG2  . ILE A 1 18 ? -1.329  1.380   1.728   1.00 0.00 ? 21 ILE A CG2  14 
ATOM 8072  C CD1  . ILE A 1 18 ? -1.363  4.340   2.958   1.00 0.00 ? 21 ILE A CD1  14 
ATOM 8073  H H    . ILE A 1 18 ? 1.749   3.879   0.790   1.00 0.00 ? 21 ILE A H    14 
ATOM 8074  H HA   . ILE A 1 18 ? 1.493   1.435   2.126   1.00 0.00 ? 21 ILE A HA   14 
ATOM 8075  H HB   . ILE A 1 18 ? -0.605  3.117   0.742   1.00 0.00 ? 21 ILE A HB   14 
ATOM 8076  H HG12 . ILE A 1 18 ? -0.279  2.687   3.700   1.00 0.00 ? 21 ILE A HG12 14 
ATOM 8077  H HG13 . ILE A 1 18 ? 0.698   3.884   2.856   1.00 0.00 ? 21 ILE A HG13 14 
ATOM 8078  H HG21 . ILE A 1 18 ? -2.232  1.789   2.157   1.00 0.00 ? 21 ILE A HG21 14 
ATOM 8079  H HG22 . ILE A 1 18 ? -0.935  0.615   2.381   1.00 0.00 ? 21 ILE A HG22 14 
ATOM 8080  H HG23 . ILE A 1 18 ? -1.550  0.950   0.762   1.00 0.00 ? 21 ILE A HG23 14 
ATOM 8081  H HD11 . ILE A 1 18 ? -2.309  3.828   2.865   1.00 0.00 ? 21 ILE A HD11 14 
ATOM 8082  H HD12 . ILE A 1 18 ? -1.273  5.077   2.175   1.00 0.00 ? 21 ILE A HD12 14 
ATOM 8083  H HD13 . ILE A 1 18 ? -1.312  4.828   3.921   1.00 0.00 ? 21 ILE A HD13 14 
ATOM 8084  N N    . ALA A 1 19 ? 0.544   1.270   -1.044  1.00 0.00 ? 22 ALA A N    14 
ATOM 8085  C CA   . ALA A 1 19 ? 0.413   0.356   -2.177  1.00 0.00 ? 22 ALA A CA   14 
ATOM 8086  C C    . ALA A 1 19 ? 1.721   -0.411  -2.395  1.00 0.00 ? 22 ALA A C    14 
ATOM 8087  O O    . ALA A 1 19 ? 1.713   -1.595  -2.742  1.00 0.00 ? 22 ALA A O    14 
ATOM 8088  C CB   . ALA A 1 19 ? 0.024   1.126   -3.433  1.00 0.00 ? 22 ALA A CB   14 
ATOM 8089  H H    . ALA A 1 19 ? 0.343   2.228   -1.170  1.00 0.00 ? 22 ALA A H    14 
ATOM 8090  H HA   . ALA A 1 19 ? -0.373  -0.350  -1.951  1.00 0.00 ? 22 ALA A HA   14 
ATOM 8091  H HB1  . ALA A 1 19 ? -0.499  2.030   -3.155  1.00 0.00 ? 22 ALA A HB1  14 
ATOM 8092  H HB2  . ALA A 1 19 ? -0.620  0.513   -4.046  1.00 0.00 ? 22 ALA A HB2  14 
ATOM 8093  H HB3  . ALA A 1 19 ? 0.914   1.383   -3.990  1.00 0.00 ? 22 ALA A HB3  14 
ATOM 8094  N N    . LYS A 1 20 ? 2.844   0.277   -2.171  1.00 0.00 ? 23 LYS A N    14 
ATOM 8095  C CA   . LYS A 1 20 ? 4.171   -0.316  -2.321  1.00 0.00 ? 23 LYS A CA   14 
ATOM 8096  C C    . LYS A 1 20 ? 4.375   -1.480  -1.351  1.00 0.00 ? 23 LYS A C    14 
ATOM 8097  O O    . LYS A 1 20 ? 4.721   -2.585  -1.761  1.00 0.00 ? 23 LYS A O    14 
ATOM 8098  C CB   . LYS A 1 20 ? 5.250   0.750   -2.087  1.00 0.00 ? 23 LYS A CB   14 
ATOM 8099  C CG   . LYS A 1 20 ? 6.309   0.810   -3.175  1.00 0.00 ? 23 LYS A CG   14 
ATOM 8100  C CD   . LYS A 1 20 ? 6.960   -0.548  -3.405  1.00 0.00 ? 23 LYS A CD   14 
ATOM 8101  C CE   . LYS A 1 20 ? 7.321   -0.757  -4.866  1.00 0.00 ? 23 LYS A CE   14 
ATOM 8102  N NZ   . LYS A 1 20 ? 8.712   -0.306  -5.159  1.00 0.00 ? 23 LYS A NZ   14 
ATOM 8103  H H    . LYS A 1 20 ? 2.776   1.215   -1.890  1.00 0.00 ? 23 LYS A H    14 
ATOM 8104  H HA   . LYS A 1 20 ? 4.254   -0.689  -3.329  1.00 0.00 ? 23 LYS A HA   14 
ATOM 8105  H HB2  . LYS A 1 20 ? 4.775   1.717   -2.030  1.00 0.00 ? 23 LYS A HB2  14 
ATOM 8106  H HB3  . LYS A 1 20 ? 5.743   0.548   -1.147  1.00 0.00 ? 23 LYS A HB3  14 
ATOM 8107  H HG2  . LYS A 1 20 ? 5.844   1.141   -4.091  1.00 0.00 ? 23 LYS A HG2  14 
ATOM 8108  H HG3  . LYS A 1 20 ? 7.070   1.519   -2.881  1.00 0.00 ? 23 LYS A HG3  14 
ATOM 8109  H HD2  . LYS A 1 20 ? 7.858   -0.610  -2.810  1.00 0.00 ? 23 LYS A HD2  14 
ATOM 8110  H HD3  . LYS A 1 20 ? 6.272   -1.324  -3.099  1.00 0.00 ? 23 LYS A HD3  14 
ATOM 8111  H HE2  . LYS A 1 20 ? 7.234   -1.810  -5.098  1.00 0.00 ? 23 LYS A HE2  14 
ATOM 8112  H HE3  . LYS A 1 20 ? 6.628   -0.197  -5.479  1.00 0.00 ? 23 LYS A HE3  14 
ATOM 8113  H HZ1  . LYS A 1 20 ? 8.828   0.693   -4.888  1.00 0.00 ? 23 LYS A HZ1  14 
ATOM 8114  H HZ2  . LYS A 1 20 ? 8.913   -0.404  -6.174  1.00 0.00 ? 23 LYS A HZ2  14 
ATOM 8115  H HZ3  . LYS A 1 20 ? 9.395   -0.880  -4.625  1.00 0.00 ? 23 LYS A HZ3  14 
ATOM 8116  N N    . ALA A 1 21 ? 4.163   -1.224  -0.064  1.00 0.00 ? 24 ALA A N    14 
ATOM 8117  C CA   . ALA A 1 21 ? 4.332   -2.257  0.955   1.00 0.00 ? 24 ALA A CA   14 
ATOM 8118  C C    . ALA A 1 21 ? 3.168   -3.252  0.950   1.00 0.00 ? 24 ALA A C    14 
ATOM 8119  O O    . ALA A 1 21 ? 3.366   -4.448  1.184   1.00 0.00 ? 24 ALA A O    14 
ATOM 8120  C CB   . ALA A 1 21 ? 4.485   -1.619  2.329   1.00 0.00 ? 24 ALA A CB   14 
ATOM 8121  H H    . ALA A 1 21 ? 3.890   -0.317  0.208   1.00 0.00 ? 24 ALA A H    14 
ATOM 8122  H HA   . ALA A 1 21 ? 5.243   -2.794  0.730   1.00 0.00 ? 24 ALA A HA   14 
ATOM 8123  H HB1  . ALA A 1 21 ? 4.699   -2.385  3.061   1.00 0.00 ? 24 ALA A HB1  14 
ATOM 8124  H HB2  . ALA A 1 21 ? 3.569   -1.112  2.596   1.00 0.00 ? 24 ALA A HB2  14 
ATOM 8125  H HB3  . ALA A 1 21 ? 5.297   -0.907  2.307   1.00 0.00 ? 24 ALA A HB3  14 
ATOM 8126  N N    . LYS A 1 22 ? 1.959   -2.758  0.675   1.00 0.00 ? 25 LYS A N    14 
ATOM 8127  C CA   . LYS A 1 22 ? 0.774   -3.606  0.642   1.00 0.00 ? 25 LYS A CA   14 
ATOM 8128  C C    . LYS A 1 22 ? 0.886   -4.658  -0.457  1.00 0.00 ? 25 LYS A C    14 
ATOM 8129  O O    . LYS A 1 22 ? 0.555   -5.823  -0.240  1.00 0.00 ? 25 LYS A O    14 
ATOM 8130  C CB   . LYS A 1 22 ? -0.489  -2.757  0.447   1.00 0.00 ? 25 LYS A CB   14 
ATOM 8131  C CG   . LYS A 1 22 ? -1.485  -2.880  1.590   1.00 0.00 ? 25 LYS A CG   14 
ATOM 8132  C CD   . LYS A 1 22 ? -2.883  -3.202  1.081   1.00 0.00 ? 25 LYS A CD   14 
ATOM 8133  C CE   . LYS A 1 22 ? -3.885  -3.314  2.223   1.00 0.00 ? 25 LYS A CE   14 
ATOM 8134  N NZ   . LYS A 1 22 ? -4.448  -1.983  2.603   1.00 0.00 ? 25 LYS A NZ   14 
ATOM 8135  H H    . LYS A 1 22 ? 1.862   -1.798  0.486   1.00 0.00 ? 25 LYS A H    14 
ATOM 8136  H HA   . LYS A 1 22 ? 0.708   -4.114  1.593   1.00 0.00 ? 25 LYS A HA   14 
ATOM 8137  H HB2  . LYS A 1 22 ? -0.201  -1.719  0.364   1.00 0.00 ? 25 LYS A HB2  14 
ATOM 8138  H HB3  . LYS A 1 22 ? -0.978  -3.060  -0.466  1.00 0.00 ? 25 LYS A HB3  14 
ATOM 8139  H HG2  . LYS A 1 22 ? -1.161  -3.671  2.251   1.00 0.00 ? 25 LYS A HG2  14 
ATOM 8140  H HG3  . LYS A 1 22 ? -1.514  -1.946  2.131   1.00 0.00 ? 25 LYS A HG3  14 
ATOM 8141  H HD2  . LYS A 1 22 ? -3.203  -2.419  0.411   1.00 0.00 ? 25 LYS A HD2  14 
ATOM 8142  H HD3  . LYS A 1 22 ? -2.854  -4.143  0.549   1.00 0.00 ? 25 LYS A HD3  14 
ATOM 8143  H HE2  . LYS A 1 22 ? -4.692  -3.963  1.914   1.00 0.00 ? 25 LYS A HE2  14 
ATOM 8144  H HE3  . LYS A 1 22 ? -3.386  -3.744  3.080   1.00 0.00 ? 25 LYS A HE3  14 
ATOM 8145  H HZ1  . LYS A 1 22 ? -3.757  -1.230  2.401   1.00 0.00 ? 25 LYS A HZ1  14 
ATOM 8146  H HZ2  . LYS A 1 22 ? -4.676  -1.966  3.619   1.00 0.00 ? 25 LYS A HZ2  14 
ATOM 8147  H HZ3  . LYS A 1 22 ? -5.316  -1.791  2.062   1.00 0.00 ? 25 LYS A HZ3  14 
ATOM 8148  N N    . ASN A 1 23 ? 1.367   -4.253  -1.633  1.00 0.00 ? 26 ASN A N    14 
ATOM 8149  C CA   . ASN A 1 23 ? 1.521   -5.198  -2.742  1.00 0.00 ? 26 ASN A CA   14 
ATOM 8150  C C    . ASN A 1 23 ? 2.672   -6.171  -2.475  1.00 0.00 ? 26 ASN A C    14 
ATOM 8151  O O    . ASN A 1 23 ? 2.585   -7.350  -2.823  1.00 0.00 ? 26 ASN A O    14 
ATOM 8152  C CB   . ASN A 1 23 ? 1.715   -4.459  -4.078  1.00 0.00 ? 26 ASN A CB   14 
ATOM 8153  C CG   . ASN A 1 23 ? 3.161   -4.111  -4.376  1.00 0.00 ? 26 ASN A CG   14 
ATOM 8154  O OD1  . ASN A 1 23 ? 3.934   -4.950  -4.827  1.00 0.00 ? 26 ASN A OD1  14 
ATOM 8155  N ND2  . ASN A 1 23 ? 3.528   -2.869  -4.125  1.00 0.00 ? 26 ASN A ND2  14 
ATOM 8156  H H    . ASN A 1 23 ? 1.631   -3.308  -1.752  1.00 0.00 ? 26 ASN A H    14 
ATOM 8157  H HA   . ASN A 1 23 ? 0.609   -5.775  -2.798  1.00 0.00 ? 26 ASN A HA   14 
ATOM 8158  H HB2  . ASN A 1 23 ? 1.350   -5.082  -4.879  1.00 0.00 ? 26 ASN A HB2  14 
ATOM 8159  H HB3  . ASN A 1 23 ? 1.143   -3.542  -4.058  1.00 0.00 ? 26 ASN A HB3  14 
ATOM 8160  H HD21 . ASN A 1 23 ? 2.855   -2.249  -3.765  1.00 0.00 ? 26 ASN A HD21 14 
ATOM 8161  H HD22 . ASN A 1 23 ? 4.456   -2.620  -4.301  1.00 0.00 ? 26 ASN A HD22 14 
ATOM 8162  N N    . LEU A 1 24 ? 3.743   -5.681  -1.844  1.00 0.00 ? 27 LEU A N    14 
ATOM 8163  C CA   . LEU A 1 24 ? 4.898   -6.521  -1.524  1.00 0.00 ? 27 LEU A CA   14 
ATOM 8164  C C    . LEU A 1 24 ? 4.525   -7.603  -0.517  1.00 0.00 ? 27 LEU A C    14 
ATOM 8165  O O    . LEU A 1 24 ? 4.821   -8.783  -0.705  1.00 0.00 ? 27 LEU A O    14 
ATOM 8166  C CB   . LEU A 1 24 ? 6.050   -5.665  -0.980  1.00 0.00 ? 27 LEU A CB   14 
ATOM 8167  C CG   . LEU A 1 24 ? 6.704   -4.733  -2.001  1.00 0.00 ? 27 LEU A CG   14 
ATOM 8168  C CD1  . LEU A 1 24 ? 7.635   -3.750  -1.309  1.00 0.00 ? 27 LEU A CD1  14 
ATOM 8169  C CD2  . LEU A 1 24 ? 7.462   -5.532  -3.048  1.00 0.00 ? 27 LEU A CD2  14 
ATOM 8170  H H    . LEU A 1 24 ? 3.753   -4.736  -1.583  1.00 0.00 ? 27 LEU A H    14 
ATOM 8171  H HA   . LEU A 1 24 ? 5.211   -6.998  -2.422  1.00 0.00 ? 27 LEU A HA   14 
ATOM 8172  H HB2  . LEU A 1 24 ? 5.670   -5.064  -0.166  1.00 0.00 ? 27 LEU A HB2  14 
ATOM 8173  H HB3  . LEU A 1 24 ? 6.811   -6.326  -0.592  1.00 0.00 ? 27 LEU A HB3  14 
ATOM 8174  H HG   . LEU A 1 24 ? 5.935   -4.164  -2.503  1.00 0.00 ? 27 LEU A HG   14 
ATOM 8175  H HD11 . LEU A 1 24 ? 7.061   -2.916  -0.932  1.00 0.00 ? 27 LEU A HD11 14 
ATOM 8176  H HD12 . LEU A 1 24 ? 8.369   -3.392  -2.014  1.00 0.00 ? 27 LEU A HD12 14 
ATOM 8177  H HD13 . LEU A 1 24 ? 8.134   -4.242  -0.488  1.00 0.00 ? 27 LEU A HD13 14 
ATOM 8178  H HD21 . LEU A 1 24 ? 6.762   -5.947  -3.759  1.00 0.00 ? 27 LEU A HD21 14 
ATOM 8179  H HD22 . LEU A 1 24 ? 8.003   -6.334  -2.567  1.00 0.00 ? 27 LEU A HD22 14 
ATOM 8180  H HD23 . LEU A 1 24 ? 8.157   -4.887  -3.562  1.00 0.00 ? 27 LEU A HD23 14 
ATOM 8181  N N    . ARG A 1 25 ? 3.869   -7.181  0.547   1.00 0.00 ? 28 ARG A N    14 
ATOM 8182  C CA   . ARG A 1 25 ? 3.433   -8.091  1.610   1.00 0.00 ? 28 ARG A CA   14 
ATOM 8183  C C    . ARG A 1 25 ? 2.290   -8.997  1.154   1.00 0.00 ? 28 ARG A C    14 
ATOM 8184  O O    . ARG A 1 25 ? 2.244   -10.166 1.531   1.00 0.00 ? 28 ARG A O    14 
ATOM 8185  C CB   . ARG A 1 25 ? 3.009   -7.298  2.852   1.00 0.00 ? 28 ARG A CB   14 
ATOM 8186  C CG   . ARG A 1 25 ? 3.950   -7.467  4.036   1.00 0.00 ? 28 ARG A CG   14 
ATOM 8187  C CD   . ARG A 1 25 ? 3.189   -7.547  5.351   1.00 0.00 ? 28 ARG A CD   14 
ATOM 8188  N NE   . ARG A 1 25 ? 4.028   -8.066  6.438   1.00 0.00 ? 28 ARG A NE   14 
ATOM 8189  C CZ   . ARG A 1 25 ? 3.729   -7.971  7.730   1.00 0.00 ? 28 ARG A CZ   14 
ATOM 8190  N NH1  . ARG A 1 25 ? 2.602   -7.401  8.117   1.00 0.00 ? 28 ARG A NH1  14 
ATOM 8191  N NH2  . ARG A 1 25 ? 4.557   -8.456  8.635   1.00 0.00 ? 28 ARG A NH2  14 
ATOM 8192  H H    . ARG A 1 25 ? 3.671   -6.226  0.616   1.00 0.00 ? 28 ARG A H    14 
ATOM 8193  H HA   . ARG A 1 25 ? 4.271   -8.724  1.869   1.00 0.00 ? 28 ARG A HA   14 
ATOM 8194  H HB2  . ARG A 1 25 ? 2.970   -6.248  2.599   1.00 0.00 ? 28 ARG A HB2  14 
ATOM 8195  H HB3  . ARG A 1 25 ? 2.024   -7.621  3.154   1.00 0.00 ? 28 ARG A HB3  14 
ATOM 8196  H HG2  . ARG A 1 25 ? 4.518   -8.376  3.904   1.00 0.00 ? 28 ARG A HG2  14 
ATOM 8197  H HG3  . ARG A 1 25 ? 4.625   -6.623  4.070   1.00 0.00 ? 28 ARG A HG3  14 
ATOM 8198  H HD2  . ARG A 1 25 ? 2.846   -6.556  5.612   1.00 0.00 ? 28 ARG A HD2  14 
ATOM 8199  H HD3  . ARG A 1 25 ? 2.338   -8.201  5.221   1.00 0.00 ? 28 ARG A HD3  14 
ATOM 8200  H HE   . ARG A 1 25 ? 4.867   -8.507  6.186   1.00 0.00 ? 28 ARG A HE   14 
ATOM 8201  H HH11 . ARG A 1 25 ? 1.967   -7.041  7.438   1.00 0.00 ? 28 ARG A HH11 14 
ATOM 8202  H HH12 . ARG A 1 25 ? 2.386   -7.331  9.089   1.00 0.00 ? 28 ARG A HH12 14 
ATOM 8203  H HH21 . ARG A 1 25 ? 5.407   -8.895  8.349   1.00 0.00 ? 28 ARG A HH21 14 
ATOM 8204  H HH22 . ARG A 1 25 ? 4.335   -8.384  9.607   1.00 0.00 ? 28 ARG A HH22 14 
ATOM 8205  N N    . ALA A 1 26 ? 1.381   -8.471  0.332   1.00 0.00 ? 29 ALA A N    14 
ATOM 8206  C CA   . ALA A 1 26 ? 0.261   -9.264  -0.164  1.00 0.00 ? 29 ALA A CA   14 
ATOM 8207  C C    . ALA A 1 26 ? 0.764   -10.369 -1.076  1.00 0.00 ? 29 ALA A C    14 
ATOM 8208  O O    . ALA A 1 26 ? 0.360   -11.525 -0.950  1.00 0.00 ? 29 ALA A O    14 
ATOM 8209  C CB   . ALA A 1 26 ? -0.741  -8.377  -0.892  1.00 0.00 ? 29 ALA A CB   14 
ATOM 8210  H H    . ALA A 1 26 ? 1.471   -7.541  0.041   1.00 0.00 ? 29 ALA A H    14 
ATOM 8211  H HA   . ALA A 1 26 ? -0.235  -9.715  0.684   1.00 0.00 ? 29 ALA A HA   14 
ATOM 8212  H HB1  . ALA A 1 26 ? -0.225  -7.784  -1.633  1.00 0.00 ? 29 ALA A HB1  14 
ATOM 8213  H HB2  . ALA A 1 26 ? -1.223  -7.723  -0.181  1.00 0.00 ? 29 ALA A HB2  14 
ATOM 8214  H HB3  . ALA A 1 26 ? -1.484  -8.993  -1.376  1.00 0.00 ? 29 ALA A HB3  14 
ATOM 8215  N N    . GLN A 1 27 ? 1.664   -10.007 -1.986  1.00 0.00 ? 30 GLN A N    14 
ATOM 8216  C CA   . GLN A 1 27 ? 2.239   -10.980 -2.917  1.00 0.00 ? 30 GLN A CA   14 
ATOM 8217  C C    . GLN A 1 27 ? 3.155   -11.967 -2.196  1.00 0.00 ? 30 GLN A C    14 
ATOM 8218  O O    . GLN A 1 27 ? 3.246   -13.139 -2.572  1.00 0.00 ? 30 GLN A O    14 
ATOM 8219  C CB   . GLN A 1 27 ? 2.993   -10.271 -4.047  1.00 0.00 ? 30 GLN A CB   14 
ATOM 8220  C CG   . GLN A 1 27 ? 4.416   -9.866  -3.681  1.00 0.00 ? 30 GLN A CG   14 
ATOM 8221  C CD   . GLN A 1 27 ? 5.020   -8.888  -4.666  1.00 0.00 ? 30 GLN A CD   14 
ATOM 8222  O OE1  . GLN A 1 27 ? 6.016   -9.184  -5.318  1.00 0.00 ? 30 GLN A OE1  14 
ATOM 8223  N NE2  . GLN A 1 27 ? 4.421   -7.716  -4.776  1.00 0.00 ? 30 GLN A NE2  14 
ATOM 8224  H H    . GLN A 1 27 ? 1.954   -9.063  -2.023  1.00 0.00 ? 30 GLN A H    14 
ATOM 8225  H HA   . GLN A 1 27 ? 1.428   -11.532 -3.334  1.00 0.00 ? 30 GLN A HA   14 
ATOM 8226  H HB2  . GLN A 1 27 ? 3.039   -10.931 -4.901  1.00 0.00 ? 30 GLN A HB2  14 
ATOM 8227  H HB3  . GLN A 1 27 ? 2.447   -9.380  -4.323  1.00 0.00 ? 30 GLN A HB3  14 
ATOM 8228  H HG2  . GLN A 1 27 ? 4.406   -9.405  -2.707  1.00 0.00 ? 30 GLN A HG2  14 
ATOM 8229  H HG3  . GLN A 1 27 ? 5.034   -10.751 -3.653  1.00 0.00 ? 30 GLN A HG3  14 
ATOM 8230  H HE21 . GLN A 1 27 ? 3.630   -7.545  -4.223  1.00 0.00 ? 30 GLN A HE21 14 
ATOM 8231  H HE22 . GLN A 1 27 ? 4.794   -7.063  -5.404  1.00 0.00 ? 30 GLN A HE22 14 
ATOM 8232  N N    . ALA A 1 28 ? 3.814   -11.487 -1.155  1.00 0.00 ? 31 ALA A N    14 
ATOM 8233  C CA   . ALA A 1 28 ? 4.716   -12.313 -0.361  1.00 0.00 ? 31 ALA A CA   14 
ATOM 8234  C C    . ALA A 1 28 ? 3.924   -13.198 0.592   1.00 0.00 ? 31 ALA A C    14 
ATOM 8235  O O    . ALA A 1 28 ? 4.072   -14.421 0.587   1.00 0.00 ? 31 ALA A O    14 
ATOM 8236  C CB   . ALA A 1 28 ? 5.703   -11.440 0.404   1.00 0.00 ? 31 ALA A CB   14 
ATOM 8237  H H    . ALA A 1 28 ? 3.675   -10.555 -0.906  1.00 0.00 ? 31 ALA A H    14 
ATOM 8238  H HA   . ALA A 1 28 ? 5.276   -12.944 -1.037  1.00 0.00 ? 31 ALA A HA   14 
ATOM 8239  H HB1  . ALA A 1 28 ? 6.517   -12.050 0.769   1.00 0.00 ? 31 ALA A HB1  14 
ATOM 8240  H HB2  . ALA A 1 28 ? 5.201   -10.976 1.240   1.00 0.00 ? 31 ALA A HB2  14 
ATOM 8241  H HB3  . ALA A 1 28 ? 6.092   -10.676 -0.252  1.00 0.00 ? 31 ALA A HB3  14 
ATOM 8242  N N    . ALA A 1 29 ? 3.064   -12.568 1.393   1.00 0.00 ? 32 ALA A N    14 
ATOM 8243  C CA   . ALA A 1 29 ? 2.228   -13.299 2.347   1.00 0.00 ? 32 ALA A CA   14 
ATOM 8244  C C    . ALA A 1 29 ? 1.278   -14.279 1.646   1.00 0.00 ? 32 ALA A C    14 
ATOM 8245  O O    . ALA A 1 29 ? 0.753   -15.191 2.281   1.00 0.00 ? 32 ALA A O    14 
ATOM 8246  C CB   . ALA A 1 29 ? 1.442   -12.328 3.217   1.00 0.00 ? 32 ALA A CB   14 
ATOM 8247  H H    . ALA A 1 29 ? 2.985   -11.579 1.334   1.00 0.00 ? 32 ALA A H    14 
ATOM 8248  H HA   . ALA A 1 29 ? 2.884   -13.867 2.991   1.00 0.00 ? 32 ALA A HA   14 
ATOM 8249  H HB1  . ALA A 1 29 ? 2.121   -11.625 3.676   1.00 0.00 ? 32 ALA A HB1  14 
ATOM 8250  H HB2  . ALA A 1 29 ? 0.917   -12.877 3.985   1.00 0.00 ? 32 ALA A HB2  14 
ATOM 8251  H HB3  . ALA A 1 29 ? 0.730   -11.794 2.606   1.00 0.00 ? 32 ALA A HB3  14 
ATOM 8252  N N    . ALA A 1 30 ? 1.053   -14.091 0.342   1.00 0.00 ? 33 ALA A N    14 
ATOM 8253  C CA   . ALA A 1 30 ? 0.167   -14.973 -0.414  1.00 0.00 ? 33 ALA A CA   14 
ATOM 8254  C C    . ALA A 1 30 ? 0.926   -16.133 -1.044  1.00 0.00 ? 33 ALA A C    14 
ATOM 8255  O O    . ALA A 1 30 ? 0.656   -17.303 -0.762  1.00 0.00 ? 33 ALA A O    14 
ATOM 8256  C CB   . ALA A 1 30 ? -0.588  -14.184 -1.477  1.00 0.00 ? 33 ALA A CB   14 
ATOM 8257  H H    . ALA A 1 30 ? 1.486   -13.343 -0.118  1.00 0.00 ? 33 ALA A H    14 
ATOM 8258  H HA   . ALA A 1 30 ? -0.547  -15.376 0.263   1.00 0.00 ? 33 ALA A HA   14 
ATOM 8259  H HB1  . ALA A 1 30 ? -1.277  -13.504 -1.000  1.00 0.00 ? 33 ALA A HB1  14 
ATOM 8260  H HB2  . ALA A 1 30 ? -1.136  -14.864 -2.113  1.00 0.00 ? 33 ALA A HB2  14 
ATOM 8261  H HB3  . ALA A 1 30 ? 0.115   -13.621 -2.076  1.00 0.00 ? 33 ALA A HB3  14 
ATOM 8262  N N    . ASN A 1 31 ? 1.869   -15.793 -1.902  1.00 0.00 ? 34 ASN A N    14 
ATOM 8263  C CA   . ASN A 1 31 ? 2.684   -16.787 -2.605  1.00 0.00 ? 34 ASN A CA   14 
ATOM 8264  C C    . ASN A 1 31 ? 3.551   -17.598 -1.637  1.00 0.00 ? 34 ASN A C    14 
ATOM 8265  O O    . ASN A 1 31 ? 3.709   -18.807 -1.805  1.00 0.00 ? 34 ASN A O    14 
ATOM 8266  C CB   . ASN A 1 31 ? 3.547   -16.112 -3.687  1.00 0.00 ? 34 ASN A CB   14 
ATOM 8267  C CG   . ASN A 1 31 ? 4.987   -15.886 -3.263  1.00 0.00 ? 34 ASN A CG   14 
ATOM 8268  O OD1  . ASN A 1 31 ? 5.836   -16.759 -3.416  1.00 0.00 ? 34 ASN A OD1  14 
ATOM 8269  N ND2  . ASN A 1 31 ? 5.270   -14.710 -2.728  1.00 0.00 ? 34 ASN A ND2  14 
ATOM 8270  H H    . ASN A 1 31 ? 2.015   -14.843 -2.066  1.00 0.00 ? 34 ASN A H    14 
ATOM 8271  H HA   . ASN A 1 31 ? 2.002   -17.471 -3.090  1.00 0.00 ? 34 ASN A HA   14 
ATOM 8272  H HB2  . ASN A 1 31 ? 3.554   -16.734 -4.569  1.00 0.00 ? 34 ASN A HB2  14 
ATOM 8273  H HB3  . ASN A 1 31 ? 3.112   -15.155 -3.937  1.00 0.00 ? 34 ASN A HB3  14 
ATOM 8274  H HD21 . ASN A 1 31 ? 4.543   -14.054 -2.637  1.00 0.00 ? 34 ASN A HD21 14 
ATOM 8275  H HD22 . ASN A 1 31 ? 6.192   -14.543 -2.448  1.00 0.00 ? 34 ASN A HD22 14 
ATOM 8276  N N    . ALA A 1 32 ? 4.105   -16.936 -0.620  1.00 0.00 ? 35 ALA A N    14 
ATOM 8277  C CA   . ALA A 1 32 ? 4.950   -17.614 0.364   1.00 0.00 ? 35 ALA A CA   14 
ATOM 8278  C C    . ALA A 1 32 ? 4.133   -18.150 1.549   1.00 0.00 ? 35 ALA A C    14 
ATOM 8279  O O    . ALA A 1 32 ? 4.608   -18.161 2.687   1.00 0.00 ? 35 ALA A O    14 
ATOM 8280  C CB   . ALA A 1 32 ? 6.046   -16.673 0.846   1.00 0.00 ? 35 ALA A CB   14 
ATOM 8281  H H    . ALA A 1 32 ? 3.941   -15.971 -0.527  1.00 0.00 ? 35 ALA A H    14 
ATOM 8282  H HA   . ALA A 1 32 ? 5.425   -18.450 -0.130  1.00 0.00 ? 35 ALA A HA   14 
ATOM 8283  H HB1  . ALA A 1 32 ? 6.741   -17.218 1.468   1.00 0.00 ? 35 ALA A HB1  14 
ATOM 8284  H HB2  . ALA A 1 32 ? 5.605   -15.870 1.419   1.00 0.00 ? 35 ALA A HB2  14 
ATOM 8285  H HB3  . ALA A 1 32 ? 6.568   -16.262 -0.006  1.00 0.00 ? 35 ALA A HB3  14 
ATOM 8286  N N    . HIS A 1 33 ? 2.906   -18.598 1.273   1.00 0.00 ? 36 HIS A N    14 
ATOM 8287  C CA   . HIS A 1 33 ? 2.030   -19.136 2.314   1.00 0.00 ? 36 HIS A CA   14 
ATOM 8288  C C    . HIS A 1 33 ? 1.173   -20.286 1.781   1.00 0.00 ? 36 HIS A C    14 
ATOM 8289  O O    . HIS A 1 33 ? 1.396   -21.444 2.130   1.00 0.00 ? 36 HIS A O    14 
ATOM 8290  C CB   . HIS A 1 33 ? 1.135   -18.028 2.873   1.00 0.00 ? 36 HIS A CB   14 
ATOM 8291  C CG   . HIS A 1 33 ? 1.439   -17.667 4.291   1.00 0.00 ? 36 HIS A CG   14 
ATOM 8292  N ND1  . HIS A 1 33 ? 0.486   -17.659 5.284   1.00 0.00 ? 36 HIS A ND1  14 
ATOM 8293  C CD2  . HIS A 1 33 ? 2.599   -17.303 4.885   1.00 0.00 ? 36 HIS A CD2  14 
ATOM 8294  C CE1  . HIS A 1 33 ? 1.044   -17.306 6.427   1.00 0.00 ? 36 HIS A CE1  14 
ATOM 8295  N NE2  . HIS A 1 33 ? 2.328   -17.085 6.213   1.00 0.00 ? 36 HIS A NE2  14 
ATOM 8296  H H    . HIS A 1 33 ? 2.582   -18.566 0.351   1.00 0.00 ? 36 HIS A H    14 
ATOM 8297  H HA   . HIS A 1 33 ? 2.655   -19.515 3.109   1.00 0.00 ? 36 HIS A HA   14 
ATOM 8298  H HB2  . HIS A 1 33 ? 1.262   -17.143 2.273   1.00 0.00 ? 36 HIS A HB2  14 
ATOM 8299  H HB3  . HIS A 1 33 ? 0.104   -18.345 2.824   1.00 0.00 ? 36 HIS A HB3  14 
ATOM 8300  H HD1  . HIS A 1 33 ? -0.461  -17.886 5.167   1.00 0.00 ? 36 HIS A HD1  14 
ATOM 8301  H HD2  . HIS A 1 33 ? 3.560   -17.201 4.400   1.00 0.00 ? 36 HIS A HD2  14 
ATOM 8302  H HE1  . HIS A 1 33 ? 0.536   -17.214 7.377   1.00 0.00 ? 36 HIS A HE1  14 
ATOM 8303  H HE2  . HIS A 1 33 ? 3.003   -16.983 6.916   1.00 0.00 ? 36 HIS A HE2  14 
ATOM 8304  N N    . LEU A 1 34 ? 0.192   -19.961 0.934   1.00 0.00 ? 37 LEU A N    14 
ATOM 8305  C CA   . LEU A 1 34 ? -0.697  -20.977 0.363   1.00 0.00 ? 37 LEU A CA   14 
ATOM 8306  C C    . LEU A 1 34 ? 0.068   -21.975 -0.498  1.00 0.00 ? 37 LEU A C    14 
ATOM 8307  O O    . LEU A 1 34 ? -0.191  -23.179 -0.456  1.00 0.00 ? 37 LEU A O    14 
ATOM 8308  C CB   . LEU A 1 34 ? -1.823  -20.320 -0.448  1.00 0.00 ? 37 LEU A CB   14 
ATOM 8309  C CG   . LEU A 1 34 ? -1.371  -19.451 -1.625  1.00 0.00 ? 37 LEU A CG   14 
ATOM 8310  C CD1  . LEU A 1 34 ? -1.487  -20.217 -2.932  1.00 0.00 ? 37 LEU A CD1  14 
ATOM 8311  C CD2  . LEU A 1 34 ? -2.192  -18.174 -1.688  1.00 0.00 ? 37 LEU A CD2  14 
ATOM 8312  H H    . LEU A 1 34 ? 0.062   -19.019 0.691   1.00 0.00 ? 37 LEU A H    14 
ATOM 8313  H HA   . LEU A 1 34 ? -1.127  -21.513 1.178   1.00 0.00 ? 37 LEU A HA   14 
ATOM 8314  H HB2  . LEU A 1 34 ? -2.463  -21.102 -0.831  1.00 0.00 ? 37 LEU A HB2  14 
ATOM 8315  H HB3  . LEU A 1 34 ? -2.404  -19.703 0.223   1.00 0.00 ? 37 LEU A HB3  14 
ATOM 8316  H HG   . LEU A 1 34 ? -0.336  -19.177 -1.490  1.00 0.00 ? 37 LEU A HG   14 
ATOM 8317  H HD11 . LEU A 1 34 ? -0.824  -19.780 -3.664  1.00 0.00 ? 37 LEU A HD11 14 
ATOM 8318  H HD12 . LEU A 1 34 ? -2.504  -20.167 -3.291  1.00 0.00 ? 37 LEU A HD12 14 
ATOM 8319  H HD13 . LEU A 1 34 ? -1.212  -21.250 -2.770  1.00 0.00 ? 37 LEU A HD13 14 
ATOM 8320  H HD21 . LEU A 1 34 ? -1.887  -17.592 -2.545  1.00 0.00 ? 37 LEU A HD21 14 
ATOM 8321  H HD22 . LEU A 1 34 ? -2.033  -17.599 -0.788  1.00 0.00 ? 37 LEU A HD22 14 
ATOM 8322  H HD23 . LEU A 1 34 ? -3.239  -18.423 -1.776  1.00 0.00 ? 37 LEU A HD23 14 
ATOM 8323  N N    . MET A 1 35 ? 1.016   -21.458 -1.262  1.00 0.00 ? 38 MET A N    14 
ATOM 8324  C CA   . MET A 1 35 ? 1.850   -22.280 -2.143  1.00 0.00 ? 38 MET A CA   14 
ATOM 8325  C C    . MET A 1 35 ? 2.702   -23.271 -1.351  1.00 0.00 ? 38 MET A C    14 
ATOM 8326  O O    . MET A 1 35 ? 3.086   -24.325 -1.862  1.00 0.00 ? 38 MET A O    14 
ATOM 8327  C CB   . MET A 1 35 ? 2.742   -21.388 -3.013  1.00 0.00 ? 38 MET A CB   14 
ATOM 8328  C CG   . MET A 1 35 ? 3.116   -22.013 -4.347  1.00 0.00 ? 38 MET A CG   14 
ATOM 8329  S SD   . MET A 1 35 ? 3.634   -20.788 -5.565  1.00 0.00 ? 38 MET A SD   14 
ATOM 8330  C CE   . MET A 1 35 ? 3.706   -21.793 -7.047  1.00 0.00 ? 38 MET A CE   14 
ATOM 8331  H H    . MET A 1 35 ? 1.162   -20.495 -1.223  1.00 0.00 ? 38 MET A H    14 
ATOM 8332  H HA   . MET A 1 35 ? 1.192   -22.839 -2.776  1.00 0.00 ? 38 MET A HA   14 
ATOM 8333  H HB2  . MET A 1 35 ? 2.223   -20.461 -3.208  1.00 0.00 ? 38 MET A HB2  14 
ATOM 8334  H HB3  . MET A 1 35 ? 3.652   -21.172 -2.472  1.00 0.00 ? 38 MET A HB3  14 
ATOM 8335  H HG2  . MET A 1 35 ? 3.927   -22.708 -4.190  1.00 0.00 ? 38 MET A HG2  14 
ATOM 8336  H HG3  . MET A 1 35 ? 2.259   -22.544 -4.734  1.00 0.00 ? 38 MET A HG3  14 
ATOM 8337  H HE1  . MET A 1 35 ? 4.302   -21.291 -7.794  1.00 0.00 ? 38 MET A HE1  14 
ATOM 8338  H HE2  . MET A 1 35 ? 2.705   -21.946 -7.426  1.00 0.00 ? 38 MET A HE2  14 
ATOM 8339  H HE3  . MET A 1 35 ? 4.151   -22.748 -6.814  1.00 0.00 ? 38 MET A HE3  14 
ATOM 8340  N N    . ALA A 1 36 ? 2.975   -22.928 -0.102  1.00 0.00 ? 39 ALA A N    14 
ATOM 8341  C CA   . ALA A 1 36 ? 3.764   -23.776 0.787   1.00 0.00 ? 39 ALA A CA   14 
ATOM 8342  C C    . ALA A 1 36 ? 2.889   -24.401 1.885   1.00 0.00 ? 39 ALA A C    14 
ATOM 8343  O O    . ALA A 1 36 ? 3.394   -24.825 2.926   1.00 0.00 ? 39 ALA A O    14 
ATOM 8344  C CB   . ALA A 1 36 ? 4.901   -22.967 1.399   1.00 0.00 ? 39 ALA A CB   14 
ATOM 8345  H H    . ALA A 1 36 ? 2.624   -22.082 0.237   1.00 0.00 ? 39 ALA A H    14 
ATOM 8346  H HA   . ALA A 1 36 ? 4.198   -24.570 0.195   1.00 0.00 ? 39 ALA A HA   14 
ATOM 8347  H HB1  . ALA A 1 36 ? 5.308   -23.500 2.246   1.00 0.00 ? 39 ALA A HB1  14 
ATOM 8348  H HB2  . ALA A 1 36 ? 4.525   -22.007 1.726   1.00 0.00 ? 39 ALA A HB2  14 
ATOM 8349  H HB3  . ALA A 1 36 ? 5.675   -22.818 0.662   1.00 0.00 ? 39 ALA A HB3  14 
ATOM 8350  N N    . GLN A 1 37 ? 1.576   -24.453 1.642   1.00 0.00 ? 40 GLN A N    14 
ATOM 8351  C CA   . GLN A 1 37 ? 0.636   -25.019 2.605   1.00 0.00 ? 40 GLN A CA   14 
ATOM 8352  C C    . GLN A 1 37 ? -0.290  -26.042 1.944   1.00 0.00 ? 40 GLN A C    14 
ATOM 8353  O O    . GLN A 1 37 ? -0.334  -27.197 2.367   1.00 0.00 ? 40 GLN A O    14 
ATOM 8354  C CB   . GLN A 1 37 ? -0.187  -23.900 3.252   1.00 0.00 ? 40 GLN A CB   14 
ATOM 8355  C CG   . GLN A 1 37 ? -1.215  -24.396 4.263   1.00 0.00 ? 40 GLN A CG   14 
ATOM 8356  C CD   . GLN A 1 37 ? -2.526  -23.641 4.186   1.00 0.00 ? 40 GLN A CD   14 
ATOM 8357  O OE1  . GLN A 1 37 ? -2.676  -22.575 4.777   1.00 0.00 ? 40 GLN A OE1  14 
ATOM 8358  N NE2  . GLN A 1 37 ? -3.487  -24.187 3.456   1.00 0.00 ? 40 GLN A NE2  14 
ATOM 8359  H H    . GLN A 1 37 ? 1.231   -24.101 0.798   1.00 0.00 ? 40 GLN A H    14 
ATOM 8360  H HA   . GLN A 1 37 ? 1.209   -25.518 3.370   1.00 0.00 ? 40 GLN A HA   14 
ATOM 8361  H HB2  . GLN A 1 37 ? 0.486   -23.223 3.759   1.00 0.00 ? 40 GLN A HB2  14 
ATOM 8362  H HB3  . GLN A 1 37 ? -0.708  -23.359 2.477   1.00 0.00 ? 40 GLN A HB3  14 
ATOM 8363  H HG2  . GLN A 1 37 ? -1.409  -25.442 4.077   1.00 0.00 ? 40 GLN A HG2  14 
ATOM 8364  H HG3  . GLN A 1 37 ? -0.808  -24.279 5.257   1.00 0.00 ? 40 GLN A HG3  14 
ATOM 8365  H HE21 . GLN A 1 37 ? -3.302  -25.048 3.004   1.00 0.00 ? 40 GLN A HE21 14 
ATOM 8366  H HE22 . GLN A 1 37 ? -4.341  -23.717 3.394   1.00 0.00 ? 40 GLN A HE22 14 
ATOM 8367  N N    . ILE A 1 38 ? -1.022  -25.599 0.911   1.00 0.00 ? 41 ILE A N    14 
ATOM 8368  C CA   . ILE A 1 38 ? -1.963  -26.454 0.172   1.00 0.00 ? 41 ILE A CA   14 
ATOM 8369  C C    . ILE A 1 38 ? -3.193  -26.834 1.015   1.00 0.00 ? 41 ILE A C    14 
ATOM 8370  O O    . ILE A 1 38 ? -3.200  -26.550 2.234   1.00 0.00 ? 41 ILE A O    14 
ATOM 8371  C CB   . ILE A 1 38 ? -1.267  -27.729 -0.388  1.00 0.00 ? 41 ILE A CB   14 
ATOM 8372  C CG1  . ILE A 1 38 ? -1.865  -28.105 -1.745  1.00 0.00 ? 41 ILE A CG1  14 
ATOM 8373  C CG2  . ILE A 1 38 ? -1.365  -28.908 0.575   1.00 0.00 ? 41 ILE A CG2  14 
ATOM 8374  C CD1  . ILE A 1 38 ? -0.909  -28.869 -2.636  1.00 0.00 ? 41 ILE A CD1  14 
ATOM 8375  O OXT  . ILE A 1 38 ? -4.148  -27.400 0.442   1.00 0.00 ? 41 ILE A OXT  14 
ATOM 8376  H H    . ILE A 1 38 ? -0.929  -24.662 0.637   1.00 0.00 ? 41 ILE A H    14 
ATOM 8377  H HA   . ILE A 1 38 ? -2.313  -25.879 -0.673  1.00 0.00 ? 41 ILE A HA   14 
ATOM 8378  H HB   . ILE A 1 38 ? -0.220  -27.500 -0.523  1.00 0.00 ? 41 ILE A HB   14 
ATOM 8379  H HG12 . ILE A 1 38 ? -2.736  -28.724 -1.585  1.00 0.00 ? 41 ILE A HG12 14 
ATOM 8380  H HG13 . ILE A 1 38 ? -2.159  -27.206 -2.265  1.00 0.00 ? 41 ILE A HG13 14 
ATOM 8381  H HG21 . ILE A 1 38 ? -2.083  -28.688 1.350   1.00 0.00 ? 41 ILE A HG21 14 
ATOM 8382  H HG22 . ILE A 1 38 ? -0.400  -29.089 1.023   1.00 0.00 ? 41 ILE A HG22 14 
ATOM 8383  H HG23 . ILE A 1 38 ? -1.680  -29.788 0.034   1.00 0.00 ? 41 ILE A HG23 14 
ATOM 8384  H HD11 . ILE A 1 38 ? -0.009  -29.098 -2.084  1.00 0.00 ? 41 ILE A HD11 14 
ATOM 8385  H HD12 . ILE A 1 38 ? -0.660  -28.267 -3.497  1.00 0.00 ? 41 ILE A HD12 14 
ATOM 8386  H HD13 . ILE A 1 38 ? -1.376  -29.787 -2.959  1.00 0.00 ? 41 ILE A HD13 14 
ATOM 8387  N N    . PHE A 1 1  ? -19.827 4.335   4.921   1.00 0.00 ? 4  PHE A N    15 
ATOM 8388  C CA   . PHE A 1 1  ? -19.361 5.650   4.390   1.00 0.00 ? 4  PHE A CA   15 
ATOM 8389  C C    . PHE A 1 1  ? -18.874 5.522   2.944   1.00 0.00 ? 4  PHE A C    15 
ATOM 8390  O O    . PHE A 1 1  ? -18.776 4.416   2.415   1.00 0.00 ? 4  PHE A O    15 
ATOM 8391  C CB   . PHE A 1 1  ? -18.231 6.174   5.291   1.00 0.00 ? 4  PHE A CB   15 
ATOM 8392  C CG   . PHE A 1 1  ? -17.019 5.284   5.331   1.00 0.00 ? 4  PHE A CG   15 
ATOM 8393  C CD1  . PHE A 1 1  ? -16.057 5.356   4.336   1.00 0.00 ? 4  PHE A CD1  15 
ATOM 8394  C CD2  . PHE A 1 1  ? -16.845 4.373   6.361   1.00 0.00 ? 4  PHE A CD2  15 
ATOM 8395  C CE1  . PHE A 1 1  ? -14.944 4.537   4.368   1.00 0.00 ? 4  PHE A CE1  15 
ATOM 8396  C CE2  . PHE A 1 1  ? -15.735 3.553   6.399   1.00 0.00 ? 4  PHE A CE2  15 
ATOM 8397  C CZ   . PHE A 1 1  ? -14.783 3.634   5.401   1.00 0.00 ? 4  PHE A CZ   15 
ATOM 8398  H H1   . PHE A 1 1  ? -20.715 4.093   4.436   1.00 0.00 ? 4  PHE A H1   15 
ATOM 8399  H H2   . PHE A 1 1  ? -19.976 4.438   5.946   1.00 0.00 ? 4  PHE A H2   15 
ATOM 8400  H H3   . PHE A 1 1  ? -19.089 3.630   4.717   1.00 0.00 ? 4  PHE A H3   15 
ATOM 8401  H HA   . PHE A 1 1  ? -20.189 6.344   4.419   1.00 0.00 ? 4  PHE A HA   15 
ATOM 8402  H HB2  . PHE A 1 1  ? -17.916 7.144   4.934   1.00 0.00 ? 4  PHE A HB2  15 
ATOM 8403  H HB3  . PHE A 1 1  ? -18.603 6.275   6.301   1.00 0.00 ? 4  PHE A HB3  15 
ATOM 8404  H HD1  . PHE A 1 1  ? -16.180 6.063   3.528   1.00 0.00 ? 4  PHE A HD1  15 
ATOM 8405  H HD2  . PHE A 1 1  ? -17.588 4.309   7.143   1.00 0.00 ? 4  PHE A HD2  15 
ATOM 8406  H HE1  . PHE A 1 1  ? -14.201 4.603   3.587   1.00 0.00 ? 4  PHE A HE1  15 
ATOM 8407  H HE2  . PHE A 1 1  ? -15.611 2.847   7.207   1.00 0.00 ? 4  PHE A HE2  15 
ATOM 8408  H HZ   . PHE A 1 1  ? -13.914 2.994   5.428   1.00 0.00 ? 4  PHE A HZ   15 
ATOM 8409  N N    . THR A 1 2  ? -18.571 6.656   2.313   1.00 0.00 ? 5  THR A N    15 
ATOM 8410  C CA   . THR A 1 2  ? -18.091 6.666   0.928   1.00 0.00 ? 5  THR A CA   15 
ATOM 8411  C C    . THR A 1 2  ? -17.476 8.018   0.566   1.00 0.00 ? 5  THR A C    15 
ATOM 8412  O O    . THR A 1 2  ? -18.104 9.064   0.745   1.00 0.00 ? 5  THR A O    15 
ATOM 8413  C CB   . THR A 1 2  ? -19.231 6.328   -0.041  1.00 0.00 ? 5  THR A CB   15 
ATOM 8414  O OG1  . THR A 1 2  ? -18.777 6.384   -1.381  1.00 0.00 ? 5  THR A OG1  15 
ATOM 8415  C CG2  . THR A 1 2  ? -20.424 7.255   0.074   1.00 0.00 ? 5  THR A CG2  15 
ATOM 8416  H H    . THR A 1 2  ? -18.668 7.510   2.786   1.00 0.00 ? 5  THR A H    15 
ATOM 8417  H HA   . THR A 1 2  ? -17.328 5.907   0.841   1.00 0.00 ? 5  THR A HA   15 
ATOM 8418  H HB   . THR A 1 2  ? -19.573 5.322   0.161   1.00 0.00 ? 5  THR A HB   15 
ATOM 8419  H HG1  . THR A 1 2  ? -19.475 6.085   -1.971  1.00 0.00 ? 5  THR A HG1  15 
ATOM 8420  H HG21 . THR A 1 2  ? -20.740 7.310   1.104   1.00 0.00 ? 5  THR A HG21 15 
ATOM 8421  H HG22 . THR A 1 2  ? -21.234 6.876   -0.533  1.00 0.00 ? 5  THR A HG22 15 
ATOM 8422  H HG23 . THR A 1 2  ? -20.147 8.240   -0.271  1.00 0.00 ? 5  THR A HG23 15 
ATOM 8423  N N    . LEU A 1 3  ? -16.241 7.988   0.063   1.00 0.00 ? 6  LEU A N    15 
ATOM 8424  C CA   . LEU A 1 3  ? -15.528 9.209   -0.323  1.00 0.00 ? 6  LEU A CA   15 
ATOM 8425  C C    . LEU A 1 3  ? -14.266 8.881   -1.126  1.00 0.00 ? 6  LEU A C    15 
ATOM 8426  O O    . LEU A 1 3  ? -13.612 7.866   -0.883  1.00 0.00 ? 6  LEU A O    15 
ATOM 8427  C CB   . LEU A 1 3  ? -15.162 10.028  0.921   1.00 0.00 ? 6  LEU A CB   15 
ATOM 8428  C CG   . LEU A 1 3  ? -14.194 9.344   1.893   1.00 0.00 ? 6  LEU A CG   15 
ATOM 8429  C CD1  . LEU A 1 3  ? -12.863 10.074  1.925   1.00 0.00 ? 6  LEU A CD1  15 
ATOM 8430  C CD2  . LEU A 1 3  ? -14.797 9.280   3.287   1.00 0.00 ? 6  LEU A CD2  15 
ATOM 8431  H H    . LEU A 1 3  ? -15.795 7.122   -0.048  1.00 0.00 ? 6  LEU A H    15 
ATOM 8432  H HA   . LEU A 1 3  ? -16.190 9.794   -0.944  1.00 0.00 ? 6  LEU A HA   15 
ATOM 8433  H HB2  . LEU A 1 3  ? -14.715 10.956  0.596   1.00 0.00 ? 6  LEU A HB2  15 
ATOM 8434  H HB3  . LEU A 1 3  ? -16.072 10.256  1.456   1.00 0.00 ? 6  LEU A HB3  15 
ATOM 8435  H HG   . LEU A 1 3  ? -14.012 8.332   1.560   1.00 0.00 ? 6  LEU A HG   15 
ATOM 8436  H HD11 . LEU A 1 3  ? -12.365 9.959   0.974   1.00 0.00 ? 6  LEU A HD11 15 
ATOM 8437  H HD12 . LEU A 1 3  ? -12.244 9.660   2.707   1.00 0.00 ? 6  LEU A HD12 15 
ATOM 8438  H HD13 . LEU A 1 3  ? -13.031 11.124  2.118   1.00 0.00 ? 6  LEU A HD13 15 
ATOM 8439  H HD21 . LEU A 1 3  ? -14.712 10.247  3.761   1.00 0.00 ? 6  LEU A HD21 15 
ATOM 8440  H HD22 . LEU A 1 3  ? -14.269 8.544   3.874   1.00 0.00 ? 6  LEU A HD22 15 
ATOM 8441  H HD23 . LEU A 1 3  ? -15.839 9.004   3.217   1.00 0.00 ? 6  LEU A HD23 15 
ATOM 8442  N N    . SER A 1 4  ? -13.930 9.746   -2.083  1.00 0.00 ? 7  SER A N    15 
ATOM 8443  C CA   . SER A 1 4  ? -12.744 9.548   -2.922  1.00 0.00 ? 7  SER A CA   15 
ATOM 8444  C C    . SER A 1 4  ? -12.266 10.869  -3.535  1.00 0.00 ? 7  SER A C    15 
ATOM 8445  O O    . SER A 1 4  ? -12.171 11.001  -4.758  1.00 0.00 ? 7  SER A O    15 
ATOM 8446  C CB   . SER A 1 4  ? -13.041 8.525   -4.028  1.00 0.00 ? 7  SER A CB   15 
ATOM 8447  O OG   . SER A 1 4  ? -11.960 8.429   -4.944  1.00 0.00 ? 7  SER A OG   15 
ATOM 8448  H H    . SER A 1 4  ? -14.492 10.537  -2.230  1.00 0.00 ? 7  SER A H    15 
ATOM 8449  H HA   . SER A 1 4  ? -11.957 9.157   -2.292  1.00 0.00 ? 7  SER A HA   15 
ATOM 8450  H HB2  . SER A 1 4  ? -13.205 7.555   -3.583  1.00 0.00 ? 7  SER A HB2  15 
ATOM 8451  H HB3  . SER A 1 4  ? -13.929 8.828   -4.565  1.00 0.00 ? 7  SER A HB3  15 
ATOM 8452  H HG   . SER A 1 4  ? -11.792 9.295   -5.338  1.00 0.00 ? 7  SER A HG   15 
ATOM 8453  N N    . LEU A 1 5  ? -11.966 11.843  -2.677  1.00 0.00 ? 8  LEU A N    15 
ATOM 8454  C CA   . LEU A 1 5  ? -11.498 13.154  -3.132  1.00 0.00 ? 8  LEU A CA   15 
ATOM 8455  C C    . LEU A 1 5  ? -10.542 13.790  -2.116  1.00 0.00 ? 8  LEU A C    15 
ATOM 8456  O O    . LEU A 1 5  ? -10.632 14.983  -1.823  1.00 0.00 ? 8  LEU A O    15 
ATOM 8457  C CB   . LEU A 1 5  ? -12.693 14.080  -3.394  1.00 0.00 ? 8  LEU A CB   15 
ATOM 8458  C CG   . LEU A 1 5  ? -13.729 14.147  -2.267  1.00 0.00 ? 8  LEU A CG   15 
ATOM 8459  C CD1  . LEU A 1 5  ? -13.770 15.539  -1.661  1.00 0.00 ? 8  LEU A CD1  15 
ATOM 8460  C CD2  . LEU A 1 5  ? -15.102 13.754  -2.784  1.00 0.00 ? 8  LEU A CD2  15 
ATOM 8461  H H    . LEU A 1 5  ? -12.061 11.678  -1.715  1.00 0.00 ? 8  LEU A H    15 
ATOM 8462  H HA   . LEU A 1 5  ? -10.963 13.007  -4.060  1.00 0.00 ? 8  LEU A HA   15 
ATOM 8463  H HB2  . LEU A 1 5  ? -12.315 15.078  -3.566  1.00 0.00 ? 8  LEU A HB2  15 
ATOM 8464  H HB3  . LEU A 1 5  ? -13.192 13.744  -4.290  1.00 0.00 ? 8  LEU A HB3  15 
ATOM 8465  H HG   . LEU A 1 5  ? -13.451 13.453  -1.487  1.00 0.00 ? 8  LEU A HG   15 
ATOM 8466  H HD11 . LEU A 1 5  ? -14.138 16.241  -2.394  1.00 0.00 ? 8  LEU A HD11 15 
ATOM 8467  H HD12 . LEU A 1 5  ? -12.775 15.828  -1.354  1.00 0.00 ? 8  LEU A HD12 15 
ATOM 8468  H HD13 . LEU A 1 5  ? -14.425 15.538  -0.803  1.00 0.00 ? 8  LEU A HD13 15 
ATOM 8469  H HD21 . LEU A 1 5  ? -15.773 13.612  -1.949  1.00 0.00 ? 8  LEU A HD21 15 
ATOM 8470  H HD22 . LEU A 1 5  ? -15.026 12.835  -3.345  1.00 0.00 ? 8  LEU A HD22 15 
ATOM 8471  H HD23 . LEU A 1 5  ? -15.483 14.536  -3.422  1.00 0.00 ? 8  LEU A HD23 15 
ATOM 8472  N N    . ASP A 1 6  ? -9.620  12.985  -1.589  1.00 0.00 ? 9  ASP A N    15 
ATOM 8473  C CA   . ASP A 1 6  ? -8.646  13.463  -0.617  1.00 0.00 ? 9  ASP A CA   15 
ATOM 8474  C C    . ASP A 1 6  ? -7.342  12.681  -0.727  1.00 0.00 ? 9  ASP A C    15 
ATOM 8475  O O    . ASP A 1 6  ? -7.162  11.636  -0.098  1.00 0.00 ? 9  ASP A O    15 
ATOM 8476  C CB   . ASP A 1 6  ? -9.213  13.372  0.804   1.00 0.00 ? 9  ASP A CB   15 
ATOM 8477  C CG   . ASP A 1 6  ? -8.466  14.251  1.784   1.00 0.00 ? 9  ASP A CG   15 
ATOM 8478  O OD1  . ASP A 1 6  ? -7.275  13.976  2.042   1.00 0.00 ? 9  ASP A OD1  15 
ATOM 8479  O OD2  . ASP A 1 6  ? -9.070  15.217  2.291   1.00 0.00 ? 9  ASP A OD2  15 
ATOM 8480  H H    . ASP A 1 6  ? -9.588  12.047  -1.868  1.00 0.00 ? 9  ASP A H    15 
ATOM 8481  H HA   . ASP A 1 6  ? -8.436  14.497  -0.847  1.00 0.00 ? 9  ASP A HA   15 
ATOM 8482  H HB2  . ASP A 1 6  ? -10.247 13.679  0.793   1.00 0.00 ? 9  ASP A HB2  15 
ATOM 8483  H HB3  . ASP A 1 6  ? -9.149  12.349  1.146   1.00 0.00 ? 9  ASP A HB3  15 
ATOM 8484  N N    . VAL A 1 7  ? -6.445  13.199  -1.549  1.00 0.00 ? 10 VAL A N    15 
ATOM 8485  C CA   . VAL A 1 7  ? -5.152  12.569  -1.774  1.00 0.00 ? 10 VAL A CA   15 
ATOM 8486  C C    . VAL A 1 7  ? -4.036  13.620  -1.855  1.00 0.00 ? 10 VAL A C    15 
ATOM 8487  O O    . VAL A 1 7  ? -3.376  13.768  -2.886  1.00 0.00 ? 10 VAL A O    15 
ATOM 8488  C CB   . VAL A 1 7  ? -5.182  11.726  -3.066  1.00 0.00 ? 10 VAL A CB   15 
ATOM 8489  C CG1  . VAL A 1 7  ? -3.887  10.946  -3.240  1.00 0.00 ? 10 VAL A CG1  15 
ATOM 8490  C CG2  . VAL A 1 7  ? -6.372  10.776  -3.066  1.00 0.00 ? 10 VAL A CG2  15 
ATOM 8491  H H    . VAL A 1 7  ? -6.663  14.025  -2.026  1.00 0.00 ? 10 VAL A H    15 
ATOM 8492  H HA   . VAL A 1 7  ? -4.951  11.910  -0.942  1.00 0.00 ? 10 VAL A HA   15 
ATOM 8493  H HB   . VAL A 1 7  ? -5.294  12.402  -3.901  1.00 0.00 ? 10 VAL A HB   15 
ATOM 8494  H HG11 . VAL A 1 7  ? -3.894  10.087  -2.586  1.00 0.00 ? 10 VAL A HG11 15 
ATOM 8495  H HG12 . VAL A 1 7  ? -3.049  11.580  -2.993  1.00 0.00 ? 10 VAL A HG12 15 
ATOM 8496  H HG13 . VAL A 1 7  ? -3.800  10.617  -4.265  1.00 0.00 ? 10 VAL A HG13 15 
ATOM 8497  H HG21 . VAL A 1 7  ? -7.279  11.334  -3.240  1.00 0.00 ? 10 VAL A HG21 15 
ATOM 8498  H HG22 . VAL A 1 7  ? -6.433  10.277  -2.110  1.00 0.00 ? 10 VAL A HG22 15 
ATOM 8499  H HG23 . VAL A 1 7  ? -6.247  10.041  -3.848  1.00 0.00 ? 10 VAL A HG23 15 
ATOM 8500  N N    . PRO A 1 8  ? -3.819  14.376  -0.759  1.00 0.00 ? 11 PRO A N    15 
ATOM 8501  C CA   . PRO A 1 8  ? -2.784  15.422  -0.708  1.00 0.00 ? 11 PRO A CA   15 
ATOM 8502  C C    . PRO A 1 8  ? -1.365  14.848  -0.685  1.00 0.00 ? 11 PRO A C    15 
ATOM 8503  O O    . PRO A 1 8  ? -1.174  13.650  -0.466  1.00 0.00 ? 11 PRO A O    15 
ATOM 8504  C CB   . PRO A 1 8  ? -3.093  16.156  0.601   1.00 0.00 ? 11 PRO A CB   15 
ATOM 8505  C CG   . PRO A 1 8  ? -3.773  15.139  1.452   1.00 0.00 ? 11 PRO A CG   15 
ATOM 8506  C CD   . PRO A 1 8  ? -4.568  14.278  0.510   1.00 0.00 ? 11 PRO A CD   15 
ATOM 8507  H HA   . PRO A 1 8  ? -2.877  16.107  -1.538  1.00 0.00 ? 11 PRO A HA   15 
ATOM 8508  H HB2  . PRO A 1 8  ? -2.172  16.500  1.052   1.00 0.00 ? 11 PRO A HB2  15 
ATOM 8509  H HB3  . PRO A 1 8  ? -3.738  16.998  0.401   1.00 0.00 ? 11 PRO A HB3  15 
ATOM 8510  H HG2  . PRO A 1 8  ? -3.038  14.546  1.973   1.00 0.00 ? 11 PRO A HG2  15 
ATOM 8511  H HG3  . PRO A 1 8  ? -4.430  15.629  2.156   1.00 0.00 ? 11 PRO A HG3  15 
ATOM 8512  H HD2  . PRO A 1 8  ? -4.597  13.258  0.865   1.00 0.00 ? 11 PRO A HD2  15 
ATOM 8513  H HD3  . PRO A 1 8  ? -5.569  14.666  0.398   1.00 0.00 ? 11 PRO A HD3  15 
ATOM 8514  N N    . THR A 1 9  ? -0.372  15.708  -0.907  1.00 0.00 ? 12 THR A N    15 
ATOM 8515  C CA   . THR A 1 9  ? 1.038   15.292  -0.914  1.00 0.00 ? 12 THR A CA   15 
ATOM 8516  C C    . THR A 1 9  ? 1.386   14.447  0.315   1.00 0.00 ? 12 THR A C    15 
ATOM 8517  O O    . THR A 1 9  ? 2.039   13.408  0.196   1.00 0.00 ? 12 THR A O    15 
ATOM 8518  C CB   . THR A 1 9  ? 1.960   16.516  -0.979  1.00 0.00 ? 12 THR A CB   15 
ATOM 8519  O OG1  . THR A 1 9  ? 1.207   17.707  -1.148  1.00 0.00 ? 12 THR A OG1  15 
ATOM 8520  C CG2  . THR A 1 9  ? 2.962   16.448  -2.111  1.00 0.00 ? 12 THR A CG2  15 
ATOM 8521  H H    . THR A 1 9  ? -0.586  16.652  -1.073  1.00 0.00 ? 12 THR A H    15 
ATOM 8522  H HA   . THR A 1 9  ? 1.197   14.691  -1.796  1.00 0.00 ? 12 THR A HA   15 
ATOM 8523  H HB   . THR A 1 9  ? 2.512   16.591  -0.052  1.00 0.00 ? 12 THR A HB   15 
ATOM 8524  H HG1  . THR A 1 9  ? 1.803   18.449  -1.287  1.00 0.00 ? 12 THR A HG1  15 
ATOM 8525  H HG21 . THR A 1 9  ? 3.344   15.441  -2.194  1.00 0.00 ? 12 THR A HG21 15 
ATOM 8526  H HG22 . THR A 1 9  ? 3.777   17.127  -1.913  1.00 0.00 ? 12 THR A HG22 15 
ATOM 8527  H HG23 . THR A 1 9  ? 2.478   16.725  -3.036  1.00 0.00 ? 12 THR A HG23 15 
ATOM 8528  N N    . ASN A 1 10 ? 0.939   14.895  1.492   1.00 0.00 ? 13 ASN A N    15 
ATOM 8529  C CA   . ASN A 1 10 ? 1.200   14.178  2.744   1.00 0.00 ? 13 ASN A CA   15 
ATOM 8530  C C    . ASN A 1 10 ? 0.471   12.835  2.802   1.00 0.00 ? 13 ASN A C    15 
ATOM 8531  O O    . ASN A 1 10 ? 0.813   11.965  3.600   1.00 0.00 ? 13 ASN A O    15 
ATOM 8532  C CB   . ASN A 1 10 ? 0.812   15.043  3.950   1.00 0.00 ? 13 ASN A CB   15 
ATOM 8533  C CG   . ASN A 1 10 ? 1.893   15.087  5.012   1.00 0.00 ? 13 ASN A CG   15 
ATOM 8534  O OD1  . ASN A 1 10 ? 2.801   14.260  5.027   1.00 0.00 ? 13 ASN A OD1  15 
ATOM 8535  N ND2  . ASN A 1 10 ? 1.804   16.056  5.912   1.00 0.00 ? 13 ASN A ND2  15 
ATOM 8536  H H    . ASN A 1 10 ? 0.421   15.727  1.518   1.00 0.00 ? 13 ASN A H    15 
ATOM 8537  H HA   . ASN A 1 10 ? 2.248   13.977  2.781   1.00 0.00 ? 13 ASN A HA   15 
ATOM 8538  H HB2  . ASN A 1 10 ? 0.625   16.052  3.617   1.00 0.00 ? 13 ASN A HB2  15 
ATOM 8539  H HB3  . ASN A 1 10 ? -0.087  14.645  4.397   1.00 0.00 ? 13 ASN A HB3  15 
ATOM 8540  H HD21 . ASN A 1 10 ? 1.056   16.685  5.846   1.00 0.00 ? 13 ASN A HD21 15 
ATOM 8541  H HD22 . ASN A 1 10 ? 2.493   16.102  6.605   1.00 0.00 ? 13 ASN A HD22 15 
ATOM 8542  N N    . ILE A 1 11 ? -0.519  12.671  1.944   1.00 0.00 ? 14 ILE A N    15 
ATOM 8543  C CA   . ILE A 1 11 ? -1.289  11.439  1.877   1.00 0.00 ? 14 ILE A CA   15 
ATOM 8544  C C    . ILE A 1 11 ? -0.823  10.592  0.695   1.00 0.00 ? 14 ILE A C    15 
ATOM 8545  O O    . ILE A 1 11 ? -0.563  9.399   0.846   1.00 0.00 ? 14 ILE A O    15 
ATOM 8546  C CB   . ILE A 1 11 ? -2.797  11.756  1.766   1.00 0.00 ? 14 ILE A CB   15 
ATOM 8547  C CG1  . ILE A 1 11 ? -3.446  11.742  3.151   1.00 0.00 ? 14 ILE A CG1  15 
ATOM 8548  C CG2  . ILE A 1 11 ? -3.515  10.783  0.838   1.00 0.00 ? 14 ILE A CG2  15 
ATOM 8549  C CD1  . ILE A 1 11 ? -3.035  12.904  4.029   1.00 0.00 ? 14 ILE A CD1  15 
ATOM 8550  H H    . ILE A 1 11 ? -0.734  13.395  1.328   1.00 0.00 ? 14 ILE A H    15 
ATOM 8551  H HA   . ILE A 1 11 ? -1.118  10.889  2.790   1.00 0.00 ? 14 ILE A HA   15 
ATOM 8552  H HB   . ILE A 1 11 ? -2.887  12.747  1.351   1.00 0.00 ? 14 ILE A HB   15 
ATOM 8553  H HG12 . ILE A 1 11 ? -4.520  11.779  3.037   1.00 0.00 ? 14 ILE A HG12 15 
ATOM 8554  H HG13 . ILE A 1 11 ? -3.176  10.829  3.659   1.00 0.00 ? 14 ILE A HG13 15 
ATOM 8555  H HG21 . ILE A 1 11 ? -3.219  10.972  -0.183  1.00 0.00 ? 14 ILE A HG21 15 
ATOM 8556  H HG22 . ILE A 1 11 ? -4.584  10.916  0.934   1.00 0.00 ? 14 ILE A HG22 15 
ATOM 8557  H HG23 . ILE A 1 11 ? -3.255  9.770   1.107   1.00 0.00 ? 14 ILE A HG23 15 
ATOM 8558  H HD11 . ILE A 1 11 ? -3.807  13.660  4.011   1.00 0.00 ? 14 ILE A HD11 15 
ATOM 8559  H HD12 . ILE A 1 11 ? -2.111  13.325  3.663   1.00 0.00 ? 14 ILE A HD12 15 
ATOM 8560  H HD13 . ILE A 1 11 ? -2.896  12.558  5.043   1.00 0.00 ? 14 ILE A HD13 15 
ATOM 8561  N N    . MET A 1 12 ? -0.700  11.225  -0.474  1.00 0.00 ? 15 MET A N    15 
ATOM 8562  C CA   . MET A 1 12 ? -0.245  10.548  -1.679  1.00 0.00 ? 15 MET A CA   15 
ATOM 8563  C C    . MET A 1 12 ? 1.067   9.811   -1.419  1.00 0.00 ? 15 MET A C    15 
ATOM 8564  O O    . MET A 1 12 ? 1.170   8.612   -1.682  1.00 0.00 ? 15 MET A O    15 
ATOM 8565  C CB   . MET A 1 12 ? -0.067  11.568  -2.806  1.00 0.00 ? 15 MET A CB   15 
ATOM 8566  C CG   . MET A 1 12 ? -0.819  11.211  -4.074  1.00 0.00 ? 15 MET A CG   15 
ATOM 8567  S SD   . MET A 1 12 ? 0.279   10.889  -5.467  1.00 0.00 ? 15 MET A SD   15 
ATOM 8568  C CE   . MET A 1 12 ? -0.187  12.215  -6.580  1.00 0.00 ? 15 MET A CE   15 
ATOM 8569  H H    . MET A 1 12 ? -0.910  12.187  -0.525  1.00 0.00 ? 15 MET A H    15 
ATOM 8570  H HA   . MET A 1 12 ? -0.998  9.829   -1.964  1.00 0.00 ? 15 MET A HA   15 
ATOM 8571  H HB2  . MET A 1 12 ? -0.422  12.530  -2.464  1.00 0.00 ? 15 MET A HB2  15 
ATOM 8572  H HB3  . MET A 1 12 ? 0.981   11.648  -3.041  1.00 0.00 ? 15 MET A HB3  15 
ATOM 8573  H HG2  . MET A 1 12 ? -1.409  10.328  -3.885  1.00 0.00 ? 15 MET A HG2  15 
ATOM 8574  H HG3  . MET A 1 12 ? -1.474  12.031  -4.329  1.00 0.00 ? 15 MET A HG3  15 
ATOM 8575  H HE1  . MET A 1 12 ? -0.133  13.159  -6.058  1.00 0.00 ? 15 MET A HE1  15 
ATOM 8576  H HE2  . MET A 1 12 ? -1.196  12.054  -6.930  1.00 0.00 ? 15 MET A HE2  15 
ATOM 8577  H HE3  . MET A 1 12 ? 0.488   12.230  -7.423  1.00 0.00 ? 15 MET A HE3  15 
ATOM 8578  N N    . ASN A 1 13 ? 2.057   10.527  -0.879  1.00 0.00 ? 16 ASN A N    15 
ATOM 8579  C CA   . ASN A 1 13 ? 3.354   9.927   -0.565  1.00 0.00 ? 16 ASN A CA   15 
ATOM 8580  C C    . ASN A 1 13 ? 3.178   8.733   0.372   1.00 0.00 ? 16 ASN A C    15 
ATOM 8581  O O    . ASN A 1 13 ? 3.767   7.671   0.162   1.00 0.00 ? 16 ASN A O    15 
ATOM 8582  C CB   . ASN A 1 13 ? 4.293   10.967  0.065   1.00 0.00 ? 16 ASN A CB   15 
ATOM 8583  C CG   . ASN A 1 13 ? 5.644   11.037  -0.625  1.00 0.00 ? 16 ASN A CG   15 
ATOM 8584  O OD1  . ASN A 1 13 ? 6.133   10.046  -1.163  1.00 0.00 ? 16 ASN A OD1  15 
ATOM 8585  N ND2  . ASN A 1 13 ? 6.259   12.211  -0.611  1.00 0.00 ? 16 ASN A ND2  15 
ATOM 8586  H H    . ASN A 1 13 ? 1.907   11.477  -0.674  1.00 0.00 ? 16 ASN A H    15 
ATOM 8587  H HA   . ASN A 1 13 ? 3.784   9.576   -1.489  1.00 0.00 ? 16 ASN A HA   15 
ATOM 8588  H HB2  . ASN A 1 13 ? 3.832   11.941  0.004   1.00 0.00 ? 16 ASN A HB2  15 
ATOM 8589  H HB3  . ASN A 1 13 ? 4.454   10.716  1.102   1.00 0.00 ? 16 ASN A HB3  15 
ATOM 8590  H HD21 . ASN A 1 13 ? 5.818   12.962  -0.163  1.00 0.00 ? 16 ASN A HD21 15 
ATOM 8591  H HD22 . ASN A 1 13 ? 7.132   12.278  -1.050  1.00 0.00 ? 16 ASN A HD22 15 
ATOM 8592  N N    . LEU A 1 14 ? 2.345   8.911   1.394   1.00 0.00 ? 17 LEU A N    15 
ATOM 8593  C CA   . LEU A 1 14 ? 2.069   7.849   2.357   1.00 0.00 ? 17 LEU A CA   15 
ATOM 8594  C C    . LEU A 1 14 ? 1.295   6.710   1.696   1.00 0.00 ? 17 LEU A C    15 
ATOM 8595  O O    . LEU A 1 14 ? 1.726   5.557   1.734   1.00 0.00 ? 17 LEU A O    15 
ATOM 8596  C CB   . LEU A 1 14 ? 1.285   8.396   3.556   1.00 0.00 ? 17 LEU A CB   15 
ATOM 8597  C CG   . LEU A 1 14 ? 2.071   9.329   4.479   1.00 0.00 ? 17 LEU A CG   15 
ATOM 8598  C CD1  . LEU A 1 14 ? 1.229   9.721   5.681   1.00 0.00 ? 17 LEU A CD1  15 
ATOM 8599  C CD2  . LEU A 1 14 ? 3.367   8.673   4.930   1.00 0.00 ? 17 LEU A CD2  15 
ATOM 8600  H H    . LEU A 1 14 ? 1.896   9.775   1.494   1.00 0.00 ? 17 LEU A H    15 
ATOM 8601  H HA   . LEU A 1 14 ? 3.016   7.462   2.704   1.00 0.00 ? 17 LEU A HA   15 
ATOM 8602  H HB2  . LEU A 1 14 ? 0.427   8.936   3.180   1.00 0.00 ? 17 LEU A HB2  15 
ATOM 8603  H HB3  . LEU A 1 14 ? 0.934   7.560   4.141   1.00 0.00 ? 17 LEU A HB3  15 
ATOM 8604  H HG   . LEU A 1 14 ? 2.321   10.232  3.940   1.00 0.00 ? 17 LEU A HG   15 
ATOM 8605  H HD11 . LEU A 1 14 ? 0.575   8.904   5.945   1.00 0.00 ? 17 LEU A HD11 15 
ATOM 8606  H HD12 . LEU A 1 14 ? 0.639   10.592  5.437   1.00 0.00 ? 17 LEU A HD12 15 
ATOM 8607  H HD13 . LEU A 1 14 ? 1.877   9.948   6.516   1.00 0.00 ? 17 LEU A HD13 15 
ATOM 8608  H HD21 . LEU A 1 14 ? 3.806   9.256   5.726   1.00 0.00 ? 17 LEU A HD21 15 
ATOM 8609  H HD22 . LEU A 1 14 ? 4.053   8.623   4.098   1.00 0.00 ? 17 LEU A HD22 15 
ATOM 8610  H HD23 . LEU A 1 14 ? 3.159   7.676   5.287   1.00 0.00 ? 17 LEU A HD23 15 
ATOM 8611  N N    . LEU A 1 15 ? 0.161   7.039   1.072   1.00 0.00 ? 18 LEU A N    15 
ATOM 8612  C CA   . LEU A 1 15 ? -0.658  6.042   0.390   1.00 0.00 ? 18 LEU A CA   15 
ATOM 8613  C C    . LEU A 1 15 ? 0.187   5.247   -0.605  1.00 0.00 ? 18 LEU A C    15 
ATOM 8614  O O    . LEU A 1 15 ? 0.158   4.011   -0.613  1.00 0.00 ? 18 LEU A O    15 
ATOM 8615  C CB   . LEU A 1 15 ? -1.833  6.723   -0.320  1.00 0.00 ? 18 LEU A CB   15 
ATOM 8616  C CG   . LEU A 1 15 ? -2.548  5.870   -1.363  1.00 0.00 ? 18 LEU A CG   15 
ATOM 8617  C CD1  . LEU A 1 15 ? -3.255  4.699   -0.702  1.00 0.00 ? 18 LEU A CD1  15 
ATOM 8618  C CD2  . LEU A 1 15 ? -3.535  6.709   -2.155  1.00 0.00 ? 18 LEU A CD2  15 
ATOM 8619  H H    . LEU A 1 15 ? -0.125  7.983   1.058   1.00 0.00 ? 18 LEU A H    15 
ATOM 8620  H HA   . LEU A 1 15 ? -1.041  5.362   1.134   1.00 0.00 ? 18 LEU A HA   15 
ATOM 8621  H HB2  . LEU A 1 15 ? -2.554  7.018   0.429   1.00 0.00 ? 18 LEU A HB2  15 
ATOM 8622  H HB3  . LEU A 1 15 ? -1.464  7.614   -0.807  1.00 0.00 ? 18 LEU A HB3  15 
ATOM 8623  H HG   . LEU A 1 15 ? -1.816  5.474   -2.051  1.00 0.00 ? 18 LEU A HG   15 
ATOM 8624  H HD11 . LEU A 1 15 ? -3.728  4.091   -1.459  1.00 0.00 ? 18 LEU A HD11 15 
ATOM 8625  H HD12 . LEU A 1 15 ? -4.005  5.071   -0.020  1.00 0.00 ? 18 LEU A HD12 15 
ATOM 8626  H HD13 . LEU A 1 15 ? -2.536  4.103   -0.159  1.00 0.00 ? 18 LEU A HD13 15 
ATOM 8627  H HD21 . LEU A 1 15 ? -3.000  7.311   -2.874  1.00 0.00 ? 18 LEU A HD21 15 
ATOM 8628  H HD22 . LEU A 1 15 ? -4.083  7.351   -1.483  1.00 0.00 ? 18 LEU A HD22 15 
ATOM 8629  H HD23 . LEU A 1 15 ? -4.225  6.058   -2.673  1.00 0.00 ? 18 LEU A HD23 15 
ATOM 8630  N N    . PHE A 1 16 ? 0.959   5.967   -1.423  1.00 0.00 ? 19 PHE A N    15 
ATOM 8631  C CA   . PHE A 1 16 ? 1.839   5.338   -2.406  1.00 0.00 ? 19 PHE A CA   15 
ATOM 8632  C C    . PHE A 1 16 ? 2.815   4.387   -1.717  1.00 0.00 ? 19 PHE A C    15 
ATOM 8633  O O    . PHE A 1 16 ? 3.066   3.283   -2.200  1.00 0.00 ? 19 PHE A O    15 
ATOM 8634  C CB   . PHE A 1 16 ? 2.616   6.406   -3.184  1.00 0.00 ? 19 PHE A CB   15 
ATOM 8635  C CG   . PHE A 1 16 ? 2.736   6.113   -4.652  1.00 0.00 ? 19 PHE A CG   15 
ATOM 8636  C CD1  . PHE A 1 16 ? 3.452   5.014   -5.097  1.00 0.00 ? 19 PHE A CD1  15 
ATOM 8637  C CD2  . PHE A 1 16 ? 2.133   6.941   -5.585  1.00 0.00 ? 19 PHE A CD2  15 
ATOM 8638  C CE1  . PHE A 1 16 ? 3.563   4.744   -6.448  1.00 0.00 ? 19 PHE A CE1  15 
ATOM 8639  C CE2  . PHE A 1 16 ? 2.242   6.676   -6.937  1.00 0.00 ? 19 PHE A CE2  15 
ATOM 8640  C CZ   . PHE A 1 16 ? 2.957   5.576   -7.368  1.00 0.00 ? 19 PHE A CZ   15 
ATOM 8641  H H    . PHE A 1 16 ? 0.950   6.950   -1.351  1.00 0.00 ? 19 PHE A H    15 
ATOM 8642  H HA   . PHE A 1 16 ? 1.226   4.773   -3.093  1.00 0.00 ? 19 PHE A HA   15 
ATOM 8643  H HB2  . PHE A 1 16 ? 2.114   7.352   -3.074  1.00 0.00 ? 19 PHE A HB2  15 
ATOM 8644  H HB3  . PHE A 1 16 ? 3.613   6.487   -2.776  1.00 0.00 ? 19 PHE A HB3  15 
ATOM 8645  H HD1  . PHE A 1 16 ? 3.925   4.363   -4.377  1.00 0.00 ? 19 PHE A HD1  15 
ATOM 8646  H HD2  . PHE A 1 16 ? 1.574   7.801   -5.248  1.00 0.00 ? 19 PHE A HD2  15 
ATOM 8647  H HE1  . PHE A 1 16 ? 4.124   3.884   -6.783  1.00 0.00 ? 19 PHE A HE1  15 
ATOM 8648  H HE2  . PHE A 1 16 ? 1.767   7.329   -7.655  1.00 0.00 ? 19 PHE A HE2  15 
ATOM 8649  H HZ   . PHE A 1 16 ? 3.043   5.367   -8.425  1.00 0.00 ? 19 PHE A HZ   15 
ATOM 8650  N N    . ASN A 1 17 ? 3.349   4.822   -0.575  1.00 0.00 ? 20 ASN A N    15 
ATOM 8651  C CA   . ASN A 1 17 ? 4.284   4.013   0.197   1.00 0.00 ? 20 ASN A CA   15 
ATOM 8652  C C    . ASN A 1 17 ? 3.561   2.835   0.840   1.00 0.00 ? 20 ASN A C    15 
ATOM 8653  O O    . ASN A 1 17 ? 4.014   1.692   0.738   1.00 0.00 ? 20 ASN A O    15 
ATOM 8654  C CB   . ASN A 1 17 ? 4.971   4.870   1.261   1.00 0.00 ? 20 ASN A CB   15 
ATOM 8655  C CG   . ASN A 1 17 ? 6.445   4.554   1.393   1.00 0.00 ? 20 ASN A CG   15 
ATOM 8656  O OD1  . ASN A 1 17 ? 6.922   4.211   2.468   1.00 0.00 ? 20 ASN A OD1  15 
ATOM 8657  N ND2  . ASN A 1 17 ? 7.175   4.666   0.293   1.00 0.00 ? 20 ASN A ND2  15 
ATOM 8658  H H    . ASN A 1 17 ? 3.095   5.708   -0.234  1.00 0.00 ? 20 ASN A H    15 
ATOM 8659  H HA   . ASN A 1 17 ? 5.030   3.629   -0.484  1.00 0.00 ? 20 ASN A HA   15 
ATOM 8660  H HB2  . ASN A 1 17 ? 4.869   5.912   0.997   1.00 0.00 ? 20 ASN A HB2  15 
ATOM 8661  H HB3  . ASN A 1 17 ? 4.496   4.696   2.212   1.00 0.00 ? 20 ASN A HB3  15 
ATOM 8662  H HD21 . ASN A 1 17 ? 6.731   4.944   -0.535  1.00 0.00 ? 20 ASN A HD21 15 
ATOM 8663  H HD22 . ASN A 1 17 ? 8.131   4.467   0.356   1.00 0.00 ? 20 ASN A HD22 15 
ATOM 8664  N N    . ILE A 1 18 ? 2.419   3.112   1.475   1.00 0.00 ? 21 ILE A N    15 
ATOM 8665  C CA   . ILE A 1 18 ? 1.619   2.058   2.100   1.00 0.00 ? 21 ILE A CA   15 
ATOM 8666  C C    . ILE A 1 18 ? 1.308   0.988   1.066   1.00 0.00 ? 21 ILE A C    15 
ATOM 8667  O O    . ILE A 1 18 ? 1.655   -0.179  1.253   1.00 0.00 ? 21 ILE A O    15 
ATOM 8668  C CB   . ILE A 1 18 ? 0.302   2.604   2.704   1.00 0.00 ? 21 ILE A CB   15 
ATOM 8669  C CG1  . ILE A 1 18 ? 0.594   3.598   3.834   1.00 0.00 ? 21 ILE A CG1  15 
ATOM 8670  C CG2  . ILE A 1 18 ? -0.566  1.463   3.219   1.00 0.00 ? 21 ILE A CG2  15 
ATOM 8671  C CD1  . ILE A 1 18 ? 1.491   3.045   4.922   1.00 0.00 ? 21 ILE A CD1  15 
ATOM 8672  H H    . ILE A 1 18 ? 2.098   4.047   1.501   1.00 0.00 ? 21 ILE A H    15 
ATOM 8673  H HA   . ILE A 1 18 ? 2.203   1.608   2.889   1.00 0.00 ? 21 ILE A HA   15 
ATOM 8674  H HB   . ILE A 1 18 ? -0.242  3.112   1.920   1.00 0.00 ? 21 ILE A HB   15 
ATOM 8675  H HG12 . ILE A 1 18 ? 1.076   4.471   3.423   1.00 0.00 ? 21 ILE A HG12 15 
ATOM 8676  H HG13 . ILE A 1 18 ? -0.340  3.892   4.292   1.00 0.00 ? 21 ILE A HG13 15 
ATOM 8677  H HG21 . ILE A 1 18 ? 0.037   0.794   3.815   1.00 0.00 ? 21 ILE A HG21 15 
ATOM 8678  H HG22 . ILE A 1 18 ? -0.983  0.921   2.383   1.00 0.00 ? 21 ILE A HG22 15 
ATOM 8679  H HG23 . ILE A 1 18 ? -1.365  1.864   3.824   1.00 0.00 ? 21 ILE A HG23 15 
ATOM 8680  H HD11 . ILE A 1 18 ? 2.413   2.693   4.485   1.00 0.00 ? 21 ILE A HD11 15 
ATOM 8681  H HD12 . ILE A 1 18 ? 0.991   2.227   5.419   1.00 0.00 ? 21 ILE A HD12 15 
ATOM 8682  H HD13 . ILE A 1 18 ? 1.707   3.823   5.639   1.00 0.00 ? 21 ILE A HD13 15 
ATOM 8683  N N    . ALA A 1 19 ? 0.702   1.399   -0.050  1.00 0.00 ? 22 ALA A N    15 
ATOM 8684  C CA   . ALA A 1 19 ? 0.402   0.471   -1.132  1.00 0.00 ? 22 ALA A CA   15 
ATOM 8685  C C    . ALA A 1 19 ? 1.680   -0.258  -1.540  1.00 0.00 ? 22 ALA A C    15 
ATOM 8686  O O    . ALA A 1 19 ? 1.690   -1.479  -1.688  1.00 0.00 ? 22 ALA A O    15 
ATOM 8687  C CB   . ALA A 1 19 ? -0.205  1.210   -2.316  1.00 0.00 ? 22 ALA A CB   15 
ATOM 8688  H H    . ALA A 1 19 ? 0.485   2.354   -0.159  1.00 0.00 ? 22 ALA A H    15 
ATOM 8689  H HA   . ALA A 1 19 ? -0.316  -0.252  -0.770  1.00 0.00 ? 22 ALA A HA   15 
ATOM 8690  H HB1  . ALA A 1 19 ? -1.047  1.798   -1.981  1.00 0.00 ? 22 ALA A HB1  15 
ATOM 8691  H HB2  . ALA A 1 19 ? -0.537  0.497   -3.057  1.00 0.00 ? 22 ALA A HB2  15 
ATOM 8692  H HB3  . ALA A 1 19 ? 0.537   1.864   -2.752  1.00 0.00 ? 22 ALA A HB3  15 
ATOM 8693  N N    . LYS A 1 20 ? 2.765   0.509   -1.687  1.00 0.00 ? 23 LYS A N    15 
ATOM 8694  C CA   . LYS A 1 20 ? 4.070   -0.042  -2.047  1.00 0.00 ? 23 LYS A CA   15 
ATOM 8695  C C    . LYS A 1 20 ? 4.442   -1.214  -1.136  1.00 0.00 ? 23 LYS A C    15 
ATOM 8696  O O    . LYS A 1 20 ? 4.608   -2.342  -1.600  1.00 0.00 ? 23 LYS A O    15 
ATOM 8697  C CB   . LYS A 1 20 ? 5.148   1.049   -1.955  1.00 0.00 ? 23 LYS A CB   15 
ATOM 8698  C CG   . LYS A 1 20 ? 5.968   1.213   -3.222  1.00 0.00 ? 23 LYS A CG   15 
ATOM 8699  C CD   . LYS A 1 20 ? 6.702   -0.071  -3.582  1.00 0.00 ? 23 LYS A CD   15 
ATOM 8700  C CE   . LYS A 1 20 ? 7.560   0.103   -4.825  1.00 0.00 ? 23 LYS A CE   15 
ATOM 8701  N NZ   . LYS A 1 20 ? 8.987   0.379   -4.481  1.00 0.00 ? 23 LYS A NZ   15 
ATOM 8702  H H    . LYS A 1 20 ? 2.687   1.475   -1.532  1.00 0.00 ? 23 LYS A H    15 
ATOM 8703  H HA   . LYS A 1 20 ? 4.014   -0.395  -3.064  1.00 0.00 ? 23 LYS A HA   15 
ATOM 8704  H HB2  . LYS A 1 20 ? 4.670   1.992   -1.738  1.00 0.00 ? 23 LYS A HB2  15 
ATOM 8705  H HB3  . LYS A 1 20 ? 5.820   0.807   -1.144  1.00 0.00 ? 23 LYS A HB3  15 
ATOM 8706  H HG2  . LYS A 1 20 ? 5.306   1.482   -4.031  1.00 0.00 ? 23 LYS A HG2  15 
ATOM 8707  H HG3  . LYS A 1 20 ? 6.691   2.002   -3.070  1.00 0.00 ? 23 LYS A HG3  15 
ATOM 8708  H HD2  . LYS A 1 20 ? 7.336   -0.356  -2.757  1.00 0.00 ? 23 LYS A HD2  15 
ATOM 8709  H HD3  . LYS A 1 20 ? 5.975   -0.850  -3.765  1.00 0.00 ? 23 LYS A HD3  15 
ATOM 8710  H HE2  . LYS A 1 20 ? 7.507   -0.803  -5.414  1.00 0.00 ? 23 LYS A HE2  15 
ATOM 8711  H HE3  . LYS A 1 20 ? 7.170   0.930   -5.404  1.00 0.00 ? 23 LYS A HE3  15 
ATOM 8712  H HZ1  . LYS A 1 20 ? 9.404   -0.442  -3.994  1.00 0.00 ? 23 LYS A HZ1  15 
ATOM 8713  H HZ2  . LYS A 1 20 ? 9.051   1.209   -3.856  1.00 0.00 ? 23 LYS A HZ2  15 
ATOM 8714  H HZ3  . LYS A 1 20 ? 9.533   0.568   -5.345  1.00 0.00 ? 23 LYS A HZ3  15 
ATOM 8715  N N    . ALA A 1 21 ? 4.564   -0.937  0.163   1.00 0.00 ? 24 ALA A N    15 
ATOM 8716  C CA   . ALA A 1 21 ? 4.917   -1.964  1.141   1.00 0.00 ? 24 ALA A CA   15 
ATOM 8717  C C    . ALA A 1 21 ? 3.827   -3.029  1.265   1.00 0.00 ? 24 ALA A C    15 
ATOM 8718  O O    . ALA A 1 21 ? 4.127   -4.223  1.350   1.00 0.00 ? 24 ALA A O    15 
ATOM 8719  C CB   . ALA A 1 21 ? 5.194   -1.325  2.497   1.00 0.00 ? 24 ALA A CB   15 
ATOM 8720  H H    . ALA A 1 21 ? 4.411   -0.013  0.472   1.00 0.00 ? 24 ALA A H    15 
ATOM 8721  H HA   . ALA A 1 21 ? 5.825   -2.442  0.805   1.00 0.00 ? 24 ALA A HA   15 
ATOM 8722  H HB1  . ALA A 1 21 ? 5.892   -0.509  2.374   1.00 0.00 ? 24 ALA A HB1  15 
ATOM 8723  H HB2  . ALA A 1 21 ? 5.617   -2.062  3.163   1.00 0.00 ? 24 ALA A HB2  15 
ATOM 8724  H HB3  . ALA A 1 21 ? 4.271   -0.948  2.913   1.00 0.00 ? 24 ALA A HB3  15 
ATOM 8725  N N    . LYS A 1 22 ? 2.564   -2.597  1.265   1.00 0.00 ? 25 LYS A N    15 
ATOM 8726  C CA   . LYS A 1 22 ? 1.443   -3.518  1.371   1.00 0.00 ? 25 LYS A CA   15 
ATOM 8727  C C    . LYS A 1 22 ? 1.432   -4.488  0.196   1.00 0.00 ? 25 LYS A C    15 
ATOM 8728  O O    . LYS A 1 22 ? 1.302   -5.697  0.382   1.00 0.00 ? 25 LYS A O    15 
ATOM 8729  C CB   . LYS A 1 22 ? 0.126   -2.741  1.436   1.00 0.00 ? 25 LYS A CB   15 
ATOM 8730  C CG   . LYS A 1 22 ? -0.769  -3.166  2.584   1.00 0.00 ? 25 LYS A CG   15 
ATOM 8731  C CD   . LYS A 1 22 ? -2.018  -3.880  2.084   1.00 0.00 ? 25 LYS A CD   15 
ATOM 8732  C CE   . LYS A 1 22 ? -2.659  -4.724  3.176   1.00 0.00 ? 25 LYS A CE   15 
ATOM 8733  N NZ   . LYS A 1 22 ? -2.896  -6.128  2.727   1.00 0.00 ? 25 LYS A NZ   15 
ATOM 8734  H H    . LYS A 1 22 ? 2.379   -1.634  1.184   1.00 0.00 ? 25 LYS A H    15 
ATOM 8735  H HA   . LYS A 1 22 ? 1.563   -4.084  2.283   1.00 0.00 ? 25 LYS A HA   15 
ATOM 8736  H HB2  . LYS A 1 22 ? 0.348   -1.689  1.556   1.00 0.00 ? 25 LYS A HB2  15 
ATOM 8737  H HB3  . LYS A 1 22 ? -0.413  -2.884  0.511   1.00 0.00 ? 25 LYS A HB3  15 
ATOM 8738  H HG2  . LYS A 1 22 ? -0.216  -3.832  3.230   1.00 0.00 ? 25 LYS A HG2  15 
ATOM 8739  H HG3  . LYS A 1 22 ? -1.060  -2.286  3.136   1.00 0.00 ? 25 LYS A HG3  15 
ATOM 8740  H HD2  . LYS A 1 22 ? -2.732  -3.141  1.750   1.00 0.00 ? 25 LYS A HD2  15 
ATOM 8741  H HD3  . LYS A 1 22 ? -1.747  -4.520  1.257   1.00 0.00 ? 25 LYS A HD3  15 
ATOM 8742  H HE2  . LYS A 1 22 ? -2.003  -4.735  4.036   1.00 0.00 ? 25 LYS A HE2  15 
ATOM 8743  H HE3  . LYS A 1 22 ? -3.604  -4.274  3.451   1.00 0.00 ? 25 LYS A HE3  15 
ATOM 8744  H HZ1  . LYS A 1 22 ? -3.550  -6.608  3.381   1.00 0.00 ? 25 LYS A HZ1  15 
ATOM 8745  H HZ2  . LYS A 1 22 ? -1.999  -6.655  2.700   1.00 0.00 ? 25 LYS A HZ2  15 
ATOM 8746  H HZ3  . LYS A 1 22 ? -3.316  -6.134  1.774   1.00 0.00 ? 25 LYS A HZ3  15 
ATOM 8747  N N    . ASN A 1 23 ? 1.588   -3.951  -1.013  1.00 0.00 ? 26 ASN A N    15 
ATOM 8748  C CA   . ASN A 1 23 ? 1.608   -4.779  -2.221  1.00 0.00 ? 26 ASN A CA   15 
ATOM 8749  C C    . ASN A 1 23 ? 2.739   -5.811  -2.149  1.00 0.00 ? 26 ASN A C    15 
ATOM 8750  O O    . ASN A 1 23 ? 2.544   -6.979  -2.485  1.00 0.00 ? 26 ASN A O    15 
ATOM 8751  C CB   . ASN A 1 23 ? 1.728   -3.897  -3.482  1.00 0.00 ? 26 ASN A CB   15 
ATOM 8752  C CG   . ASN A 1 23 ? 2.994   -4.136  -4.286  1.00 0.00 ? 26 ASN A CG   15 
ATOM 8753  O OD1  . ASN A 1 23 ? 2.996   -4.907  -5.240  1.00 0.00 ? 26 ASN A OD1  15 
ATOM 8754  N ND2  . ASN A 1 23 ? 4.079   -3.478  -3.908  1.00 0.00 ? 26 ASN A ND2  15 
ATOM 8755  H H    . ASN A 1 23 ? 1.703   -2.970  -1.092  1.00 0.00 ? 26 ASN A H    15 
ATOM 8756  H HA   . ASN A 1 23 ? 0.670   -5.315  -2.261  1.00 0.00 ? 26 ASN A HA   15 
ATOM 8757  H HB2  . ASN A 1 23 ? 0.885   -4.093  -4.125  1.00 0.00 ? 26 ASN A HB2  15 
ATOM 8758  H HB3  . ASN A 1 23 ? 1.707   -2.860  -3.187  1.00 0.00 ? 26 ASN A HB3  15 
ATOM 8759  H HD21 . ASN A 1 23 ? 4.014   -2.876  -3.133  1.00 0.00 ? 26 ASN A HD21 15 
ATOM 8760  H HD22 . ASN A 1 23 ? 4.902   -3.619  -4.417  1.00 0.00 ? 26 ASN A HD22 15 
ATOM 8761  N N    . LEU A 1 24 ? 3.916   -5.368  -1.694  1.00 0.00 ? 27 LEU A N    15 
ATOM 8762  C CA   . LEU A 1 24 ? 5.076   -6.251  -1.568  1.00 0.00 ? 27 LEU A CA   15 
ATOM 8763  C C    . LEU A 1 24 ? 4.771   -7.431  -0.658  1.00 0.00 ? 27 LEU A C    15 
ATOM 8764  O O    . LEU A 1 24 ? 4.942   -8.585  -1.037  1.00 0.00 ? 27 LEU A O    15 
ATOM 8765  C CB   . LEU A 1 24 ? 6.289   -5.476  -1.037  1.00 0.00 ? 27 LEU A CB   15 
ATOM 8766  C CG   . LEU A 1 24 ? 6.824   -4.379  -1.962  1.00 0.00 ? 27 LEU A CG   15 
ATOM 8767  C CD1  . LEU A 1 24 ? 7.588   -3.334  -1.165  1.00 0.00 ? 27 LEU A CD1  15 
ATOM 8768  C CD2  . LEU A 1 24 ? 7.712   -4.975  -3.042  1.00 0.00 ? 27 LEU A CD2  15 
ATOM 8769  H H    . LEU A 1 24 ? 4.005   -4.426  -1.432  1.00 0.00 ? 27 LEU A H    15 
ATOM 8770  H HA   . LEU A 1 24 ? 5.302   -6.628  -2.535  1.00 0.00 ? 27 LEU A HA   15 
ATOM 8771  H HB2  . LEU A 1 24 ? 6.015   -5.021  -0.096  1.00 0.00 ? 27 LEU A HB2  15 
ATOM 8772  H HB3  . LEU A 1 24 ? 7.088   -6.180  -0.856  1.00 0.00 ? 27 LEU A HB3  15 
ATOM 8773  H HG   . LEU A 1 24 ? 5.993   -3.886  -2.444  1.00 0.00 ? 27 LEU A HG   15 
ATOM 8774  H HD11 . LEU A 1 24 ? 6.949   -2.485  -0.979  1.00 0.00 ? 27 LEU A HD11 15 
ATOM 8775  H HD12 . LEU A 1 24 ? 8.455   -3.018  -1.725  1.00 0.00 ? 27 LEU A HD12 15 
ATOM 8776  H HD13 . LEU A 1 24 ? 7.906   -3.760  -0.224  1.00 0.00 ? 27 LEU A HD13 15 
ATOM 8777  H HD21 . LEU A 1 24 ? 7.098   -5.478  -3.775  1.00 0.00 ? 27 LEU A HD21 15 
ATOM 8778  H HD22 . LEU A 1 24 ? 8.395   -5.682  -2.596  1.00 0.00 ? 27 LEU A HD22 15 
ATOM 8779  H HD23 . LEU A 1 24 ? 8.272   -4.186  -3.523  1.00 0.00 ? 27 LEU A HD23 15 
ATOM 8780  N N    . ARG A 1 25 ? 4.318   -7.119  0.538   1.00 0.00 ? 28 ARG A N    15 
ATOM 8781  C CA   . ARG A 1 25 ? 3.977   -8.137  1.537   1.00 0.00 ? 28 ARG A CA   15 
ATOM 8782  C C    . ARG A 1 25 ? 2.706   -8.903  1.158   1.00 0.00 ? 28 ARG A C    15 
ATOM 8783  O O    . ARG A 1 25 ? 2.628   -10.119 1.359   1.00 0.00 ? 28 ARG A O    15 
ATOM 8784  C CB   . ARG A 1 25 ? 3.809   -7.487  2.915   1.00 0.00 ? 28 ARG A CB   15 
ATOM 8785  C CG   . ARG A 1 25 ? 5.059   -7.561  3.781   1.00 0.00 ? 28 ARG A CG   15 
ATOM 8786  C CD   . ARG A 1 25 ? 4.890   -8.548  4.927   1.00 0.00 ? 28 ARG A CD   15 
ATOM 8787  N NE   . ARG A 1 25 ? 3.927   -8.071  5.926   1.00 0.00 ? 28 ARG A NE   15 
ATOM 8788  C CZ   . ARG A 1 25 ? 4.178   -7.119  6.820   1.00 0.00 ? 28 ARG A CZ   15 
ATOM 8789  N NH1  . ARG A 1 25 ? 5.355   -6.524  6.855   1.00 0.00 ? 28 ARG A NH1  15 
ATOM 8790  N NH2  . ARG A 1 25 ? 3.245   -6.761  7.679   1.00 0.00 ? 28 ARG A NH2  15 
ATOM 8791  H H    . ARG A 1 25 ? 4.210   -6.172  0.755   1.00 0.00 ? 28 ARG A H    15 
ATOM 8792  H HA   . ARG A 1 25 ? 4.794   -8.843  1.581   1.00 0.00 ? 28 ARG A HA   15 
ATOM 8793  H HB2  . ARG A 1 25 ? 3.553   -6.446  2.779   1.00 0.00 ? 28 ARG A HB2  15 
ATOM 8794  H HB3  . ARG A 1 25 ? 3.004   -7.981  3.438   1.00 0.00 ? 28 ARG A HB3  15 
ATOM 8795  H HG2  . ARG A 1 25 ? 5.892   -7.875  3.169   1.00 0.00 ? 28 ARG A HG2  15 
ATOM 8796  H HG3  . ARG A 1 25 ? 5.258   -6.580  4.187   1.00 0.00 ? 28 ARG A HG3  15 
ATOM 8797  H HD2  . ARG A 1 25 ? 4.541   -9.490  4.524   1.00 0.00 ? 28 ARG A HD2  15 
ATOM 8798  H HD3  . ARG A 1 25 ? 5.849   -8.698  5.403   1.00 0.00 ? 28 ARG A HD3  15 
ATOM 8799  H HE   . ARG A 1 25 ? 3.040   -8.488  5.928   1.00 0.00 ? 28 ARG A HE   15 
ATOM 8800  H HH11 . ARG A 1 25 ? 6.066   -6.787  6.207   1.00 0.00 ? 28 ARG A HH11 15 
ATOM 8801  H HH12 . ARG A 1 25 ? 5.535   -5.811  7.530   1.00 0.00 ? 28 ARG A HH12 15 
ATOM 8802  H HH21 . ARG A 1 25 ? 2.351   -7.205  7.658   1.00 0.00 ? 28 ARG A HH21 15 
ATOM 8803  H HH22 . ARG A 1 25 ? 3.431   -6.046  8.351   1.00 0.00 ? 28 ARG A HH22 15 
ATOM 8804  N N    . ALA A 1 26 ? 1.721   -8.199  0.598   1.00 0.00 ? 29 ALA A N    15 
ATOM 8805  C CA   . ALA A 1 26 ? 0.469   -8.823  0.187   1.00 0.00 ? 29 ALA A CA   15 
ATOM 8806  C C    . ALA A 1 26 ? 0.716   -9.823  -0.934  1.00 0.00 ? 29 ALA A C    15 
ATOM 8807  O O    . ALA A 1 26 ? 0.139   -10.909 -0.951  1.00 0.00 ? 29 ALA A O    15 
ATOM 8808  C CB   . ALA A 1 26 ? -0.535  -7.763  -0.250  1.00 0.00 ? 29 ALA A CB   15 
ATOM 8809  H H    . ALA A 1 26 ? 1.845   -7.236  0.441   1.00 0.00 ? 29 ALA A H    15 
ATOM 8810  H HA   . ALA A 1 26 ? 0.059   -9.347  1.039   1.00 0.00 ? 29 ALA A HA   15 
ATOM 8811  H HB1  . ALA A 1 26 ? -0.192  -7.297  -1.162  1.00 0.00 ? 29 ALA A HB1  15 
ATOM 8812  H HB2  . ALA A 1 26 ? -0.626  -7.014  0.523   1.00 0.00 ? 29 ALA A HB2  15 
ATOM 8813  H HB3  . ALA A 1 26 ? -1.496  -8.225  -0.420  1.00 0.00 ? 29 ALA A HB3  15 
ATOM 8814  N N    . GLN A 1 27 ? 1.590   -9.454  -1.861  1.00 0.00 ? 30 GLN A N    15 
ATOM 8815  C CA   . GLN A 1 27 ? 1.920   -10.335 -2.978  1.00 0.00 ? 30 GLN A CA   15 
ATOM 8816  C C    . GLN A 1 27 ? 3.163   -11.184 -2.684  1.00 0.00 ? 30 GLN A C    15 
ATOM 8817  O O    . GLN A 1 27 ? 3.706   -11.832 -3.577  1.00 0.00 ? 30 GLN A O    15 
ATOM 8818  C CB   . GLN A 1 27 ? 2.107   -9.526  -4.264  1.00 0.00 ? 30 GLN A CB   15 
ATOM 8819  C CG   . GLN A 1 27 ? 0.825   -8.877  -4.770  1.00 0.00 ? 30 GLN A CG   15 
ATOM 8820  C CD   . GLN A 1 27 ? -0.130  -9.870  -5.405  1.00 0.00 ? 30 GLN A CD   15 
ATOM 8821  O OE1  . GLN A 1 27 ? -0.188  -9.997  -6.624  1.00 0.00 ? 30 GLN A OE1  15 
ATOM 8822  N NE2  . GLN A 1 27 ? -0.888  -10.580 -4.582  1.00 0.00 ? 30 GLN A NE2  15 
ATOM 8823  H H    . GLN A 1 27 ? 2.030   -8.573  -1.788  1.00 0.00 ? 30 GLN A H    15 
ATOM 8824  H HA   . GLN A 1 27 ? 1.084   -11.007 -3.103  1.00 0.00 ? 30 GLN A HA   15 
ATOM 8825  H HB2  . GLN A 1 27 ? 2.833   -8.746  -4.082  1.00 0.00 ? 30 GLN A HB2  15 
ATOM 8826  H HB3  . GLN A 1 27 ? 2.483   -10.181 -5.036  1.00 0.00 ? 30 GLN A HB3  15 
ATOM 8827  H HG2  . GLN A 1 27 ? 0.325   -8.402  -3.941  1.00 0.00 ? 30 GLN A HG2  15 
ATOM 8828  H HG3  . GLN A 1 27 ? 1.083   -8.129  -5.507  1.00 0.00 ? 30 GLN A HG3  15 
ATOM 8829  H HE21 . GLN A 1 27 ? -0.796  -10.430 -3.618  1.00 0.00 ? 30 GLN A HE21 15 
ATOM 8830  H HE22 . GLN A 1 27 ? -1.510  -11.228 -4.973  1.00 0.00 ? 30 GLN A HE22 15 
ATOM 8831  N N    . ALA A 1 28 ? 3.584   -11.201 -1.421  1.00 0.00 ? 31 ALA A N    15 
ATOM 8832  C CA   . ALA A 1 28 ? 4.727   -11.995 -0.993  1.00 0.00 ? 31 ALA A CA   15 
ATOM 8833  C C    . ALA A 1 28 ? 4.267   -13.037 0.020   1.00 0.00 ? 31 ALA A C    15 
ATOM 8834  O O    . ALA A 1 28 ? 4.516   -14.230 -0.142  1.00 0.00 ? 31 ALA A O    15 
ATOM 8835  C CB   . ALA A 1 28 ? 5.814   -11.106 -0.403  1.00 0.00 ? 31 ALA A CB   15 
ATOM 8836  H H    . ALA A 1 28 ? 3.099   -10.685 -0.753  1.00 0.00 ? 31 ALA A H    15 
ATOM 8837  H HA   . ALA A 1 28 ? 5.127   -12.499 -1.860  1.00 0.00 ? 31 ALA A HA   15 
ATOM 8838  H HB1  . ALA A 1 28 ? 6.565   -11.721 0.071   1.00 0.00 ? 31 ALA A HB1  15 
ATOM 8839  H HB2  . ALA A 1 28 ? 5.379   -10.442 0.328   1.00 0.00 ? 31 ALA A HB2  15 
ATOM 8840  H HB3  . ALA A 1 28 ? 6.270   -10.525 -1.191  1.00 0.00 ? 31 ALA A HB3  15 
ATOM 8841  N N    . ALA A 1 29 ? 3.569   -12.572 1.057   1.00 0.00 ? 32 ALA A N    15 
ATOM 8842  C CA   . ALA A 1 29 ? 3.047   -13.458 2.092   1.00 0.00 ? 32 ALA A CA   15 
ATOM 8843  C C    . ALA A 1 29 ? 1.663   -14.012 1.722   1.00 0.00 ? 32 ALA A C    15 
ATOM 8844  O O    . ALA A 1 29 ? 1.267   -15.069 2.217   1.00 0.00 ? 32 ALA A O    15 
ATOM 8845  C CB   . ALA A 1 29 ? 2.985   -12.720 3.423   1.00 0.00 ? 32 ALA A CB   15 
ATOM 8846  H H    . ALA A 1 29 ? 3.390   -11.603 1.123   1.00 0.00 ? 32 ALA A H    15 
ATOM 8847  H HA   . ALA A 1 29 ? 3.734   -14.285 2.200   1.00 0.00 ? 32 ALA A HA   15 
ATOM 8848  H HB1  . ALA A 1 29 ? 2.516   -11.758 3.280   1.00 0.00 ? 32 ALA A HB1  15 
ATOM 8849  H HB2  . ALA A 1 29 ? 3.986   -12.581 3.802   1.00 0.00 ? 32 ALA A HB2  15 
ATOM 8850  H HB3  . ALA A 1 29 ? 2.410   -13.300 4.130   1.00 0.00 ? 32 ALA A HB3  15 
ATOM 8851  N N    . ALA A 1 30 ? 0.927   -13.301 0.855   1.00 0.00 ? 33 ALA A N    15 
ATOM 8852  C CA   . ALA A 1 30 ? -0.408  -13.744 0.446   1.00 0.00 ? 33 ALA A CA   15 
ATOM 8853  C C    . ALA A 1 30 ? -0.445  -14.229 -1.010  1.00 0.00 ? 33 ALA A C    15 
ATOM 8854  O O    . ALA A 1 30 ? -1.518  -14.533 -1.537  1.00 0.00 ? 33 ALA A O    15 
ATOM 8855  C CB   . ALA A 1 30 ? -1.416  -12.621 0.656   1.00 0.00 ? 33 ALA A CB   15 
ATOM 8856  H H    . ALA A 1 30 ? 1.285   -12.462 0.486   1.00 0.00 ? 33 ALA A H    15 
ATOM 8857  H HA   . ALA A 1 30 ? -0.693  -14.567 1.086   1.00 0.00 ? 33 ALA A HA   15 
ATOM 8858  H HB1  . ALA A 1 30 ? -1.065  -11.965 1.439   1.00 0.00 ? 33 ALA A HB1  15 
ATOM 8859  H HB2  . ALA A 1 30 ? -2.370  -13.041 0.937   1.00 0.00 ? 33 ALA A HB2  15 
ATOM 8860  H HB3  . ALA A 1 30 ? -1.525  -12.060 -0.262  1.00 0.00 ? 33 ALA A HB3  15 
ATOM 8861  N N    . ASN A 1 31 ? 0.719   -14.306 -1.660  1.00 0.00 ? 34 ASN A N    15 
ATOM 8862  C CA   . ASN A 1 31 ? 0.793   -14.760 -3.035  1.00 0.00 ? 34 ASN A CA   15 
ATOM 8863  C C    . ASN A 1 31 ? 0.706   -16.283 -3.108  1.00 0.00 ? 34 ASN A C    15 
ATOM 8864  O O    . ASN A 1 31 ? -0.240  -16.834 -3.672  1.00 0.00 ? 34 ASN A O    15 
ATOM 8865  C CB   . ASN A 1 31 ? 2.088   -14.252 -3.675  1.00 0.00 ? 34 ASN A CB   15 
ATOM 8866  C CG   . ASN A 1 31 ? 2.270   -14.755 -5.083  1.00 0.00 ? 34 ASN A CG   15 
ATOM 8867  O OD1  . ASN A 1 31 ? 3.324   -15.270 -5.441  1.00 0.00 ? 34 ASN A OD1  15 
ATOM 8868  N ND2  . ASN A 1 31 ? 1.240   -14.606 -5.890  1.00 0.00 ? 34 ASN A ND2  15 
ATOM 8869  H H    . ASN A 1 31 ? 1.543   -14.058 -1.207  1.00 0.00 ? 34 ASN A H    15 
ATOM 8870  H HA   . ASN A 1 31 ? -0.048  -14.344 -3.563  1.00 0.00 ? 34 ASN A HA   15 
ATOM 8871  H HB2  . ASN A 1 31 ? 2.070   -13.175 -3.702  1.00 0.00 ? 34 ASN A HB2  15 
ATOM 8872  H HB3  . ASN A 1 31 ? 2.931   -14.578 -3.083  1.00 0.00 ? 34 ASN A HB3  15 
ATOM 8873  H HD21 . ASN A 1 31 ? 0.431   -14.180 -5.543  1.00 0.00 ? 34 ASN A HD21 15 
ATOM 8874  H HD22 . ASN A 1 31 ? 1.326   -14.939 -6.794  1.00 0.00 ? 34 ASN A HD22 15 
ATOM 8875  N N    . ALA A 1 32 ? 1.688   -16.956 -2.517  1.00 0.00 ? 35 ALA A N    15 
ATOM 8876  C CA   . ALA A 1 32 ? 1.706   -18.414 -2.498  1.00 0.00 ? 35 ALA A CA   15 
ATOM 8877  C C    . ALA A 1 32 ? 1.048   -18.964 -1.225  1.00 0.00 ? 35 ALA A C    15 
ATOM 8878  O O    . ALA A 1 32 ? 0.916   -20.177 -1.060  1.00 0.00 ? 35 ALA A O    15 
ATOM 8879  C CB   . ALA A 1 32 ? 3.136   -18.923 -2.631  1.00 0.00 ? 35 ALA A CB   15 
ATOM 8880  H H    . ALA A 1 32 ? 2.407   -16.462 -2.072  1.00 0.00 ? 35 ALA A H    15 
ATOM 8881  H HA   . ALA A 1 32 ? 1.144   -18.761 -3.351  1.00 0.00 ? 35 ALA A HA   15 
ATOM 8882  H HB1  . ALA A 1 32 ? 3.125   -19.992 -2.784  1.00 0.00 ? 35 ALA A HB1  15 
ATOM 8883  H HB2  . ALA A 1 32 ? 3.686   -18.695 -1.730  1.00 0.00 ? 35 ALA A HB2  15 
ATOM 8884  H HB3  . ALA A 1 32 ? 3.611   -18.443 -3.474  1.00 0.00 ? 35 ALA A HB3  15 
ATOM 8885  N N    . HIS A 1 33 ? 0.648   -18.059 -0.322  1.00 0.00 ? 36 HIS A N    15 
ATOM 8886  C CA   . HIS A 1 33 ? 0.004   -18.419 0.950   1.00 0.00 ? 36 HIS A CA   15 
ATOM 8887  C C    . HIS A 1 33 ? 0.985   -19.080 1.924   1.00 0.00 ? 36 HIS A C    15 
ATOM 8888  O O    . HIS A 1 33 ? 1.007   -18.753 3.111   1.00 0.00 ? 36 HIS A O    15 
ATOM 8889  C CB   . HIS A 1 33 ? -1.202  -19.335 0.706   1.00 0.00 ? 36 HIS A CB   15 
ATOM 8890  C CG   . HIS A 1 33 ? -2.470  -18.824 1.316   1.00 0.00 ? 36 HIS A CG   15 
ATOM 8891  N ND1  . HIS A 1 33 ? -2.610  -18.582 2.665   1.00 0.00 ? 36 HIS A ND1  15 
ATOM 8892  C CD2  . HIS A 1 33 ? -3.658  -18.502 0.753   1.00 0.00 ? 36 HIS A CD2  15 
ATOM 8893  C CE1  . HIS A 1 33 ? -3.830  -18.134 2.907   1.00 0.00 ? 36 HIS A CE1  15 
ATOM 8894  N NE2  . HIS A 1 33 ? -4.486  -18.077 1.763   1.00 0.00 ? 36 HIS A NE2  15 
ATOM 8895  H H    . HIS A 1 33 ? 0.792   -17.119 -0.517  1.00 0.00 ? 36 HIS A H    15 
ATOM 8896  H HA   . HIS A 1 33 ? -0.347  -17.503 1.404   1.00 0.00 ? 36 HIS A HA   15 
ATOM 8897  H HB2  . HIS A 1 33 ? -1.362  -19.433 -0.357  1.00 0.00 ? 36 HIS A HB2  15 
ATOM 8898  H HB3  . HIS A 1 33 ? -0.999  -20.309 1.126   1.00 0.00 ? 36 HIS A HB3  15 
ATOM 8899  H HD1  . HIS A 1 33 ? -1.918  -18.722 3.347   1.00 0.00 ? 36 HIS A HD1  15 
ATOM 8900  H HD2  . HIS A 1 33 ? -3.907  -18.569 -0.298  1.00 0.00 ? 36 HIS A HD2  15 
ATOM 8901  H HE1  . HIS A 1 33 ? -4.222  -17.860 3.877   1.00 0.00 ? 36 HIS A HE1  15 
ATOM 8902  H HE2  . HIS A 1 33 ? -5.448  -17.905 1.674   1.00 0.00 ? 36 HIS A HE2  15 
ATOM 8903  N N    . LEU A 1 34 ? 1.788   -20.008 1.414   1.00 0.00 ? 37 LEU A N    15 
ATOM 8904  C CA   . LEU A 1 34 ? 2.771   -20.724 2.228   1.00 0.00 ? 37 LEU A CA   15 
ATOM 8905  C C    . LEU A 1 34 ? 4.192   -20.167 2.041   1.00 0.00 ? 37 LEU A C    15 
ATOM 8906  O O    . LEU A 1 34 ? 5.170   -20.804 2.438   1.00 0.00 ? 37 LEU A O    15 
ATOM 8907  C CB   . LEU A 1 34 ? 2.742   -22.220 1.886   1.00 0.00 ? 37 LEU A CB   15 
ATOM 8908  C CG   . LEU A 1 34 ? 3.008   -22.562 0.417   1.00 0.00 ? 37 LEU A CG   15 
ATOM 8909  C CD1  . LEU A 1 34 ? 4.387   -23.173 0.252   1.00 0.00 ? 37 LEU A CD1  15 
ATOM 8910  C CD2  . LEU A 1 34 ? 1.942   -23.508 -0.111  1.00 0.00 ? 37 LEU A CD2  15 
ATOM 8911  H H    . LEU A 1 34 ? 1.714   -20.221 0.461   1.00 0.00 ? 37 LEU A H    15 
ATOM 8912  H HA   . LEU A 1 34 ? 2.490   -20.602 3.263   1.00 0.00 ? 37 LEU A HA   15 
ATOM 8913  H HB2  . LEU A 1 34 ? 3.486   -22.718 2.491   1.00 0.00 ? 37 LEU A HB2  15 
ATOM 8914  H HB3  . LEU A 1 34 ? 1.770   -22.607 2.154   1.00 0.00 ? 37 LEU A HB3  15 
ATOM 8915  H HG   . LEU A 1 34 ? 2.972   -21.656 -0.172  1.00 0.00 ? 37 LEU A HG   15 
ATOM 8916  H HD11 . LEU A 1 34 ? 4.543   -23.434 -0.785  1.00 0.00 ? 37 LEU A HD11 15 
ATOM 8917  H HD12 . LEU A 1 34 ? 4.461   -24.062 0.861   1.00 0.00 ? 37 LEU A HD12 15 
ATOM 8918  H HD13 . LEU A 1 34 ? 5.136   -22.461 0.562   1.00 0.00 ? 37 LEU A HD13 15 
ATOM 8919  H HD21 . LEU A 1 34 ? 1.802   -24.318 0.588   1.00 0.00 ? 37 LEU A HD21 15 
ATOM 8920  H HD22 . LEU A 1 34 ? 2.253   -23.904 -1.065  1.00 0.00 ? 37 LEU A HD22 15 
ATOM 8921  H HD23 . LEU A 1 34 ? 1.011   -22.971 -0.230  1.00 0.00 ? 37 LEU A HD23 15 
ATOM 8922  N N    . MET A 1 35 ? 4.306   -18.972 1.450   1.00 0.00 ? 38 MET A N    15 
ATOM 8923  C CA   . MET A 1 35 ? 5.613   -18.342 1.230   1.00 0.00 ? 38 MET A CA   15 
ATOM 8924  C C    . MET A 1 35 ? 6.259   -17.885 2.545   1.00 0.00 ? 38 MET A C    15 
ATOM 8925  O O    . MET A 1 35 ? 7.435   -17.519 2.572   1.00 0.00 ? 38 MET A O    15 
ATOM 8926  C CB   . MET A 1 35 ? 5.471   -17.156 0.269   1.00 0.00 ? 38 MET A CB   15 
ATOM 8927  C CG   . MET A 1 35 ? 6.398   -17.226 -0.935  1.00 0.00 ? 38 MET A CG   15 
ATOM 8928  S SD   . MET A 1 35 ? 8.054   -16.605 -0.580  1.00 0.00 ? 38 MET A SD   15 
ATOM 8929  C CE   . MET A 1 35 ? 8.921   -18.131 -0.216  1.00 0.00 ? 38 MET A CE   15 
ATOM 8930  H H    . MET A 1 35 ? 3.498   -18.500 1.163   1.00 0.00 ? 38 MET A H    15 
ATOM 8931  H HA   . MET A 1 35 ? 6.253   -19.079 0.780   1.00 0.00 ? 38 MET A HA   15 
ATOM 8932  H HB2  . MET A 1 35 ? 4.454   -17.118 -0.090  1.00 0.00 ? 38 MET A HB2  15 
ATOM 8933  H HB3  . MET A 1 35 ? 5.685   -16.245 0.808   1.00 0.00 ? 38 MET A HB3  15 
ATOM 8934  H HG2  . MET A 1 35 ? 6.477   -18.255 -1.254  1.00 0.00 ? 38 MET A HG2  15 
ATOM 8935  H HG3  . MET A 1 35 ? 5.972   -16.635 -1.733  1.00 0.00 ? 38 MET A HG3  15 
ATOM 8936  H HE1  . MET A 1 35 ? 9.983   -17.943 -0.189  1.00 0.00 ? 38 MET A HE1  15 
ATOM 8937  H HE2  . MET A 1 35 ? 8.703   -18.861 -0.983  1.00 0.00 ? 38 MET A HE2  15 
ATOM 8938  H HE3  . MET A 1 35 ? 8.598   -18.509 0.743   1.00 0.00 ? 38 MET A HE3  15 
ATOM 8939  N N    . ALA A 1 36 ? 5.490   -17.920 3.630   1.00 0.00 ? 39 ALA A N    15 
ATOM 8940  C CA   . ALA A 1 36 ? 5.981   -17.521 4.945   1.00 0.00 ? 39 ALA A CA   15 
ATOM 8941  C C    . ALA A 1 36 ? 5.748   -18.633 5.973   1.00 0.00 ? 39 ALA A C    15 
ATOM 8942  O O    . ALA A 1 36 ? 5.307   -18.379 7.095   1.00 0.00 ? 39 ALA A O    15 
ATOM 8943  C CB   . ALA A 1 36 ? 5.304   -16.226 5.378   1.00 0.00 ? 39 ALA A CB   15 
ATOM 8944  H H    . ALA A 1 36 ? 4.570   -18.231 3.545   1.00 0.00 ? 39 ALA A H    15 
ATOM 8945  H HA   . ALA A 1 36 ? 7.043   -17.337 4.865   1.00 0.00 ? 39 ALA A HA   15 
ATOM 8946  H HB1  . ALA A 1 36 ? 5.231   -16.199 6.456   1.00 0.00 ? 39 ALA A HB1  15 
ATOM 8947  H HB2  . ALA A 1 36 ? 4.314   -16.175 4.949   1.00 0.00 ? 39 ALA A HB2  15 
ATOM 8948  H HB3  . ALA A 1 36 ? 5.888   -15.385 5.037   1.00 0.00 ? 39 ALA A HB3  15 
ATOM 8949  N N    . GLN A 1 37 ? 6.038   -19.871 5.574   1.00 0.00 ? 40 GLN A N    15 
ATOM 8950  C CA   . GLN A 1 37 ? 5.856   -21.027 6.446   1.00 0.00 ? 40 GLN A CA   15 
ATOM 8951  C C    . GLN A 1 37 ? 7.201   -21.603 6.913   1.00 0.00 ? 40 GLN A C    15 
ATOM 8952  O O    . GLN A 1 37 ? 7.341   -22.816 7.089   1.00 0.00 ? 40 GLN A O    15 
ATOM 8953  C CB   . GLN A 1 37 ? 5.045   -22.096 5.710   1.00 0.00 ? 40 GLN A CB   15 
ATOM 8954  C CG   . GLN A 1 37 ? 3.670   -22.346 6.314   1.00 0.00 ? 40 GLN A CG   15 
ATOM 8955  C CD   . GLN A 1 37 ? 2.588   -21.494 5.679   1.00 0.00 ? 40 GLN A CD   15 
ATOM 8956  O OE1  . GLN A 1 37 ? 1.708   -22.004 4.988   1.00 0.00 ? 40 GLN A OE1  15 
ATOM 8957  N NE2  . GLN A 1 37 ? 2.643   -20.190 5.907   1.00 0.00 ? 40 GLN A NE2  15 
ATOM 8958  H H    . GLN A 1 37 ? 6.374   -20.013 4.667   1.00 0.00 ? 40 GLN A H    15 
ATOM 8959  H HA   . GLN A 1 37 ? 5.302   -20.703 7.311   1.00 0.00 ? 40 GLN A HA   15 
ATOM 8960  H HB2  . GLN A 1 37 ? 4.914   -21.784 4.684   1.00 0.00 ? 40 GLN A HB2  15 
ATOM 8961  H HB3  . GLN A 1 37 ? 5.597   -23.023 5.724   1.00 0.00 ? 40 GLN A HB3  15 
ATOM 8962  H HG2  . GLN A 1 37 ? 3.413   -23.385 6.174   1.00 0.00 ? 40 GLN A HG2  15 
ATOM 8963  H HG3  . GLN A 1 37 ? 3.708   -22.125 7.370   1.00 0.00 ? 40 GLN A HG3  15 
ATOM 8964  H HE21 . GLN A 1 37 ? 3.369   -19.847 6.469   1.00 0.00 ? 40 GLN A HE21 15 
ATOM 8965  H HE22 . GLN A 1 37 ? 1.954   -19.623 5.503   1.00 0.00 ? 40 GLN A HE22 15 
ATOM 8966  N N    . ILE A 1 38 ? 8.183   -20.726 7.119   1.00 0.00 ? 41 ILE A N    15 
ATOM 8967  C CA   . ILE A 1 38 ? 9.512   -21.141 7.569   1.00 0.00 ? 41 ILE A CA   15 
ATOM 8968  C C    . ILE A 1 38 ? 10.296  -19.958 8.146   1.00 0.00 ? 41 ILE A C    15 
ATOM 8969  O O    . ILE A 1 38 ? 11.000  -20.158 9.158   1.00 0.00 ? 41 ILE A O    15 
ATOM 8970  C CB   . ILE A 1 38 ? 10.320  -21.796 6.421   1.00 0.00 ? 41 ILE A CB   15 
ATOM 8971  C CG1  . ILE A 1 38 ? 11.719  -22.189 6.903   1.00 0.00 ? 41 ILE A CG1  15 
ATOM 8972  C CG2  . ILE A 1 38 ? 10.413  -20.862 5.221   1.00 0.00 ? 41 ILE A CG2  15 
ATOM 8973  C CD1  . ILE A 1 38 ? 12.332  -23.330 6.120   1.00 0.00 ? 41 ILE A CD1  15 
ATOM 8974  O OXT  . ILE A 1 38 ? 10.196  -18.844 7.586   1.00 0.00 ? 41 ILE A OXT  15 
ATOM 8975  H H    . ILE A 1 38 ? 8.011   -19.774 6.968   1.00 0.00 ? 41 ILE A H    15 
ATOM 8976  H HA   . ILE A 1 38 ? 9.379   -21.878 8.349   1.00 0.00 ? 41 ILE A HA   15 
ATOM 8977  H HB   . ILE A 1 38 ? 9.793   -22.686 6.109   1.00 0.00 ? 41 ILE A HB   15 
ATOM 8978  H HG12 . ILE A 1 38 ? 12.375  -21.336 6.813   1.00 0.00 ? 41 ILE A HG12 15 
ATOM 8979  H HG13 . ILE A 1 38 ? 11.665  -22.488 7.941   1.00 0.00 ? 41 ILE A HG13 15 
ATOM 8980  H HG21 . ILE A 1 38 ? 10.746  -19.888 5.549   1.00 0.00 ? 41 ILE A HG21 15 
ATOM 8981  H HG22 . ILE A 1 38 ? 9.442   -20.774 4.757   1.00 0.00 ? 41 ILE A HG22 15 
ATOM 8982  H HG23 . ILE A 1 38 ? 11.118  -21.262 4.509   1.00 0.00 ? 41 ILE A HG23 15 
ATOM 8983  H HD11 . ILE A 1 38 ? 11.674  -23.603 5.307   1.00 0.00 ? 41 ILE A HD11 15 
ATOM 8984  H HD12 . ILE A 1 38 ? 12.472  -24.180 6.771   1.00 0.00 ? 41 ILE A HD12 15 
ATOM 8985  H HD13 . ILE A 1 38 ? 13.287  -23.020 5.722   1.00 0.00 ? 41 ILE A HD13 15 
ATOM 8986  N N    . PHE A 1 1  ? -18.799 5.381   3.420   1.00 0.00 ? 4  PHE A N    16 
ATOM 8987  C CA   . PHE A 1 1  ? -17.568 4.563   3.208   1.00 0.00 ? 4  PHE A CA   16 
ATOM 8988  C C    . PHE A 1 1  ? -17.038 4.725   1.782   1.00 0.00 ? 4  PHE A C    16 
ATOM 8989  O O    . PHE A 1 1  ? -17.781 5.124   0.887   1.00 0.00 ? 4  PHE A O    16 
ATOM 8990  C CB   . PHE A 1 1  ? -17.901 3.092   3.487   1.00 0.00 ? 4  PHE A CB   16 
ATOM 8991  C CG   . PHE A 1 1  ? -16.693 2.241   3.753   1.00 0.00 ? 4  PHE A CG   16 
ATOM 8992  C CD1  . PHE A 1 1  ? -16.110 2.215   5.010   1.00 0.00 ? 4  PHE A CD1  16 
ATOM 8993  C CD2  . PHE A 1 1  ? -16.138 1.469   2.745   1.00 0.00 ? 4  PHE A CD2  16 
ATOM 8994  C CE1  . PHE A 1 1  ? -14.997 1.435   5.256   1.00 0.00 ? 4  PHE A CE1  16 
ATOM 8995  C CE2  . PHE A 1 1  ? -15.025 0.687   2.986   1.00 0.00 ? 4  PHE A CE2  16 
ATOM 8996  C CZ   . PHE A 1 1  ? -14.454 0.670   4.242   1.00 0.00 ? 4  PHE A CZ   16 
ATOM 8997  H H1   . PHE A 1 1  ? -19.518 5.053   2.742   1.00 0.00 ? 4  PHE A H1   16 
ATOM 8998  H H2   . PHE A 1 1  ? -18.550 6.378   3.251   1.00 0.00 ? 4  PHE A H2   16 
ATOM 8999  H H3   . PHE A 1 1  ? -19.116 5.233   4.399   1.00 0.00 ? 4  PHE A H3   16 
ATOM 9000  H HA   . PHE A 1 1  ? -16.810 4.895   3.903   1.00 0.00 ? 4  PHE A HA   16 
ATOM 9001  H HB2  . PHE A 1 1  ? -18.542 3.033   4.353   1.00 0.00 ? 4  PHE A HB2  16 
ATOM 9002  H HB3  . PHE A 1 1  ? -18.418 2.678   2.634   1.00 0.00 ? 4  PHE A HB3  16 
ATOM 9003  H HD1  . PHE A 1 1  ? -16.534 2.811   5.803   1.00 0.00 ? 4  PHE A HD1  16 
ATOM 9004  H HD2  . PHE A 1 1  ? -16.584 1.483   1.760   1.00 0.00 ? 4  PHE A HD2  16 
ATOM 9005  H HE1  . PHE A 1 1  ? -14.551 1.422   6.240   1.00 0.00 ? 4  PHE A HE1  16 
ATOM 9006  H HE2  . PHE A 1 1  ? -14.603 0.088   2.191   1.00 0.00 ? 4  PHE A HE2  16 
ATOM 9007  H HZ   . PHE A 1 1  ? -13.584 0.058   4.432   1.00 0.00 ? 4  PHE A HZ   16 
ATOM 9008  N N    . THR A 1 2  ? -15.755 4.412   1.583   1.00 0.00 ? 5  THR A N    16 
ATOM 9009  C CA   . THR A 1 2  ? -15.118 4.520   0.264   1.00 0.00 ? 5  THR A CA   16 
ATOM 9010  C C    . THR A 1 2  ? -15.131 5.963   -0.247  1.00 0.00 ? 5  THR A C    16 
ATOM 9011  O O    . THR A 1 2  ? -16.007 6.351   -1.022  1.00 0.00 ? 5  THR A O    16 
ATOM 9012  C CB   . THR A 1 2  ? -15.814 3.601   -0.747  1.00 0.00 ? 5  THR A CB   16 
ATOM 9013  O OG1  . THR A 1 2  ? -15.947 2.290   -0.228  1.00 0.00 ? 5  THR A OG1  16 
ATOM 9014  C CG2  . THR A 1 2  ? -15.084 3.499   -2.070  1.00 0.00 ? 5  THR A CG2  16 
ATOM 9015  H H    . THR A 1 2  ? -15.220 4.098   2.342   1.00 0.00 ? 5  THR A H    16 
ATOM 9016  H HA   . THR A 1 2  ? -14.091 4.204   0.369   1.00 0.00 ? 5  THR A HA   16 
ATOM 9017  H HB   . THR A 1 2  ? -16.804 3.991   -0.946  1.00 0.00 ? 5  THR A HB   16 
ATOM 9018  H HG1  . THR A 1 2  ? -15.141 1.791   -0.389  1.00 0.00 ? 5  THR A HG1  16 
ATOM 9019  H HG21 . THR A 1 2  ? -15.534 2.721   -2.668  1.00 0.00 ? 5  THR A HG21 16 
ATOM 9020  H HG22 . THR A 1 2  ? -14.046 3.263   -1.892  1.00 0.00 ? 5  THR A HG22 16 
ATOM 9021  H HG23 . THR A 1 2  ? -15.155 4.441   -2.593  1.00 0.00 ? 5  THR A HG23 16 
ATOM 9022  N N    . LEU A 1 3  ? -14.151 6.752   0.186   1.00 0.00 ? 6  LEU A N    16 
ATOM 9023  C CA   . LEU A 1 3  ? -14.051 8.149   -0.232  1.00 0.00 ? 6  LEU A CA   16 
ATOM 9024  C C    . LEU A 1 3  ? -12.707 8.426   -0.906  1.00 0.00 ? 6  LEU A C    16 
ATOM 9025  O O    . LEU A 1 3  ? -11.654 8.036   -0.402  1.00 0.00 ? 6  LEU A O    16 
ATOM 9026  C CB   . LEU A 1 3  ? -14.259 9.113   0.956   1.00 0.00 ? 6  LEU A CB   16 
ATOM 9027  C CG   . LEU A 1 3  ? -13.966 8.565   2.365   1.00 0.00 ? 6  LEU A CG   16 
ATOM 9028  C CD1  . LEU A 1 3  ? -14.957 7.478   2.749   1.00 0.00 ? 6  LEU A CD1  16 
ATOM 9029  C CD2  . LEU A 1 3  ? -12.536 8.054   2.471   1.00 0.00 ? 6  LEU A CD2  16 
ATOM 9030  H H    . LEU A 1 3  ? -13.478 6.388   0.795   1.00 0.00 ? 6  LEU A H    16 
ATOM 9031  H HA   . LEU A 1 3  ? -14.833 8.323   -0.956  1.00 0.00 ? 6  LEU A HA   16 
ATOM 9032  H HB2  . LEU A 1 3  ? -13.627 9.974   0.800   1.00 0.00 ? 6  LEU A HB2  16 
ATOM 9033  H HB3  . LEU A 1 3  ? -15.287 9.444   0.936   1.00 0.00 ? 6  LEU A HB3  16 
ATOM 9034  H HG   . LEU A 1 3  ? -14.078 9.371   3.077   1.00 0.00 ? 6  LEU A HG   16 
ATOM 9035  H HD11 . LEU A 1 3  ? -15.426 7.735   3.687   1.00 0.00 ? 6  LEU A HD11 16 
ATOM 9036  H HD12 . LEU A 1 3  ? -14.434 6.538   2.856   1.00 0.00 ? 6  LEU A HD12 16 
ATOM 9037  H HD13 . LEU A 1 3  ? -15.710 7.387   1.981   1.00 0.00 ? 6  LEU A HD13 16 
ATOM 9038  H HD21 . LEU A 1 3  ? -12.531 6.978   2.406   1.00 0.00 ? 6  LEU A HD21 16 
ATOM 9039  H HD22 . LEU A 1 3  ? -12.115 8.358   3.418   1.00 0.00 ? 6  LEU A HD22 16 
ATOM 9040  H HD23 . LEU A 1 3  ? -11.945 8.467   1.668   1.00 0.00 ? 6  LEU A HD23 16 
ATOM 9041  N N    . SER A 1 4  ? -12.753 9.102   -2.052  1.00 0.00 ? 7  SER A N    16 
ATOM 9042  C CA   . SER A 1 4  ? -11.538 9.436   -2.797  1.00 0.00 ? 7  SER A CA   16 
ATOM 9043  C C    . SER A 1 4  ? -11.487 10.930  -3.137  1.00 0.00 ? 7  SER A C    16 
ATOM 9044  O O    . SER A 1 4  ? -11.003 11.319  -4.202  1.00 0.00 ? 7  SER A O    16 
ATOM 9045  C CB   . SER A 1 4  ? -11.454 8.595   -4.080  1.00 0.00 ? 7  SER A CB   16 
ATOM 9046  O OG   . SER A 1 4  ? -12.229 9.164   -5.123  1.00 0.00 ? 7  SER A OG   16 
ATOM 9047  H H    . SER A 1 4  ? -13.622 9.385   -2.407  1.00 0.00 ? 7  SER A H    16 
ATOM 9048  H HA   . SER A 1 4  ? -10.691 9.197   -2.170  1.00 0.00 ? 7  SER A HA   16 
ATOM 9049  H HB2  . SER A 1 4  ? -10.424 8.539   -4.404  1.00 0.00 ? 7  SER A HB2  16 
ATOM 9050  H HB3  . SER A 1 4  ? -11.820 7.598   -3.877  1.00 0.00 ? 7  SER A HB3  16 
ATOM 9051  H HG   . SER A 1 4  ? -11.863 10.024  -5.365  1.00 0.00 ? 7  SER A HG   16 
ATOM 9052  N N    . LEU A 1 5  ? -11.986 11.763  -2.222  1.00 0.00 ? 8  LEU A N    16 
ATOM 9053  C CA   . LEU A 1 5  ? -11.992 13.212  -2.425  1.00 0.00 ? 8  LEU A CA   16 
ATOM 9054  C C    . LEU A 1 5  ? -10.975 13.899  -1.509  1.00 0.00 ? 8  LEU A C    16 
ATOM 9055  O O    . LEU A 1 5  ? -11.229 14.981  -0.977  1.00 0.00 ? 8  LEU A O    16 
ATOM 9056  C CB   . LEU A 1 5  ? -13.401 13.773  -2.186  1.00 0.00 ? 8  LEU A CB   16 
ATOM 9057  C CG   . LEU A 1 5  ? -14.003 13.470  -0.809  1.00 0.00 ? 8  LEU A CG   16 
ATOM 9058  C CD1  . LEU A 1 5  ? -14.323 14.760  -0.072  1.00 0.00 ? 8  LEU A CD1  16 
ATOM 9059  C CD2  . LEU A 1 5  ? -15.252 12.618  -0.949  1.00 0.00 ? 8  LEU A CD2  16 
ATOM 9060  H H    . LEU A 1 5  ? -12.354 11.398  -1.393  1.00 0.00 ? 8  LEU A H    16 
ATOM 9061  H HA   . LEU A 1 5  ? -11.709 13.400  -3.450  1.00 0.00 ? 8  LEU A HA   16 
ATOM 9062  H HB2  . LEU A 1 5  ? -13.361 14.846  -2.309  1.00 0.00 ? 8  LEU A HB2  16 
ATOM 9063  H HB3  . LEU A 1 5  ? -14.060 13.367  -2.939  1.00 0.00 ? 8  LEU A HB3  16 
ATOM 9064  H HG   . LEU A 1 5  ? -13.284 12.920  -0.220  1.00 0.00 ? 8  LEU A HG   16 
ATOM 9065  H HD11 . LEU A 1 5  ? -13.411 15.311  0.101   1.00 0.00 ? 8  LEU A HD11 16 
ATOM 9066  H HD12 . LEU A 1 5  ? -14.788 14.525  0.875   1.00 0.00 ? 8  LEU A HD12 16 
ATOM 9067  H HD13 . LEU A 1 5  ? -14.997 15.357  -0.667  1.00 0.00 ? 8  LEU A HD13 16 
ATOM 9068  H HD21 . LEU A 1 5  ? -16.070 13.233  -1.294  1.00 0.00 ? 8  LEU A HD21 16 
ATOM 9069  H HD22 . LEU A 1 5  ? -15.504 12.188  0.010   1.00 0.00 ? 8  LEU A HD22 16 
ATOM 9070  H HD23 . LEU A 1 5  ? -15.073 11.827  -1.662  1.00 0.00 ? 8  LEU A HD23 16 
ATOM 9071  N N    . ASP A 1 6  ? -9.820  13.258  -1.340  1.00 0.00 ? 9  ASP A N    16 
ATOM 9072  C CA   . ASP A 1 6  ? -8.750  13.788  -0.501  1.00 0.00 ? 9  ASP A CA   16 
ATOM 9073  C C    . ASP A 1 6  ? -7.464  12.991  -0.697  1.00 0.00 ? 9  ASP A C    16 
ATOM 9074  O O    . ASP A 1 6  ? -7.291  11.902  -0.141  1.00 0.00 ? 9  ASP A O    16 
ATOM 9075  C CB   . ASP A 1 6  ? -9.164  13.776  0.975   1.00 0.00 ? 9  ASP A CB   16 
ATOM 9076  C CG   . ASP A 1 6  ? -8.242  14.614  1.834   1.00 0.00 ? 9  ASP A CG   16 
ATOM 9077  O OD1  . ASP A 1 6  ? -7.196  14.090  2.269   1.00 0.00 ? 9  ASP A OD1  16 
ATOM 9078  O OD2  . ASP A 1 6  ? -8.563  15.796  2.065   1.00 0.00 ? 9  ASP A OD2  16 
ATOM 9079  H H    . ASP A 1 6  ? -9.678  12.407  -1.800  1.00 0.00 ? 9  ASP A H    16 
ATOM 9080  H HA   . ASP A 1 6  ? -8.568  14.806  -0.806  1.00 0.00 ? 9  ASP A HA   16 
ATOM 9081  H HB2  . ASP A 1 6  ? -10.166 14.169  1.066   1.00 0.00 ? 9  ASP A HB2  16 
ATOM 9082  H HB3  . ASP A 1 6  ? -9.144  12.761  1.342   1.00 0.00 ? 9  ASP A HB3  16 
ATOM 9083  N N    . VAL A 1 7  ? -6.572  13.542  -1.505  1.00 0.00 ? 10 VAL A N    16 
ATOM 9084  C CA   . VAL A 1 7  ? -5.297  12.900  -1.800  1.00 0.00 ? 10 VAL A CA   16 
ATOM 9085  C C    . VAL A 1 7  ? -4.162  13.934  -1.839  1.00 0.00 ? 10 VAL A C    16 
ATOM 9086  O O    . VAL A 1 7  ? -3.502  14.116  -2.865  1.00 0.00 ? 10 VAL A O    16 
ATOM 9087  C CB   . VAL A 1 7  ? -5.367  12.140  -3.142  1.00 0.00 ? 10 VAL A CB   16 
ATOM 9088  C CG1  . VAL A 1 7  ? -4.109  11.314  -3.366  1.00 0.00 ? 10 VAL A CG1  16 
ATOM 9089  C CG2  . VAL A 1 7  ? -6.599  11.248  -3.196  1.00 0.00 ? 10 VAL A CG2  16 
ATOM 9090  H H    . VAL A 1 7  ? -6.780  14.403  -1.923  1.00 0.00 ? 10 VAL A H    16 
ATOM 9091  H HA   . VAL A 1 7  ? -5.093  12.187  -1.014  1.00 0.00 ? 10 VAL A HA   16 
ATOM 9092  H HB   . VAL A 1 7  ? -5.444  12.869  -3.935  1.00 0.00 ? 10 VAL A HB   16 
ATOM 9093  H HG11 . VAL A 1 7  ? -4.212  10.359  -2.872  1.00 0.00 ? 10 VAL A HG11 16 
ATOM 9094  H HG12 . VAL A 1 7  ? -3.255  11.839  -2.962  1.00 0.00 ? 10 VAL A HG12 16 
ATOM 9095  H HG13 . VAL A 1 7  ? -3.965  11.157  -4.425  1.00 0.00 ? 10 VAL A HG13 16 
ATOM 9096  H HG21 . VAL A 1 7  ? -7.468  11.847  -3.423  1.00 0.00 ? 10 VAL A HG21 16 
ATOM 9097  H HG22 . VAL A 1 7  ? -6.735  10.764  -2.241  1.00 0.00 ? 10 VAL A HG22 16 
ATOM 9098  H HG23 . VAL A 1 7  ? -6.468  10.499  -3.963  1.00 0.00 ? 10 VAL A HG23 16 
ATOM 9099  N N    . PRO A 1 8  ? -3.923  14.631  -0.708  1.00 0.00 ? 11 PRO A N    16 
ATOM 9100  C CA   . PRO A 1 8  ? -2.867  15.650  -0.613  1.00 0.00 ? 11 PRO A CA   16 
ATOM 9101  C C    . PRO A 1 8  ? -1.465  15.039  -0.617  1.00 0.00 ? 11 PRO A C    16 
ATOM 9102  O O    . PRO A 1 8  ? -1.300  13.845  -0.368  1.00 0.00 ? 11 PRO A O    16 
ATOM 9103  C CB   . PRO A 1 8  ? -3.159  16.337  0.724   1.00 0.00 ? 11 PRO A CB   16 
ATOM 9104  C CG   . PRO A 1 8  ? -3.865  15.307  1.535   1.00 0.00 ? 11 PRO A CG   16 
ATOM 9105  C CD   . PRO A 1 8  ? -4.663  14.484  0.561   1.00 0.00 ? 11 PRO A CD   16 
ATOM 9106  H HA   . PRO A 1 8  ? -2.943  16.371  -1.416  1.00 0.00 ? 11 PRO A HA   16 
ATOM 9107  H HB2  . PRO A 1 8  ? -2.230  16.640  1.189   1.00 0.00 ? 11 PRO A HB2  16 
ATOM 9108  H HB3  . PRO A 1 8  ? -3.783  17.204  0.559   1.00 0.00 ? 11 PRO A HB3  16 
ATOM 9109  H HG2  . PRO A 1 8  ? -3.145  14.687  2.048   1.00 0.00 ? 11 PRO A HG2  16 
ATOM 9110  H HG3  . PRO A 1 8  ? -4.523  15.785  2.245   1.00 0.00 ? 11 PRO A HG3  16 
ATOM 9111  H HD2  . PRO A 1 8  ? -4.689  13.449  0.875   1.00 0.00 ? 11 PRO A HD2  16 
ATOM 9112  H HD3  . PRO A 1 8  ? -5.666  14.874  0.469   1.00 0.00 ? 11 PRO A HD3  16 
ATOM 9113  N N    . THR A 1 9  ? -0.456  15.862  -0.897  1.00 0.00 ? 12 THR A N    16 
ATOM 9114  C CA   . THR A 1 9  ? 0.939   15.406  -0.939  1.00 0.00 ? 12 THR A CA   16 
ATOM 9115  C C    . THR A 1 9  ? 1.295   14.559  0.284   1.00 0.00 ? 12 THR A C    16 
ATOM 9116  O O    . THR A 1 9  ? 1.885   13.480  0.152   1.00 0.00 ? 12 THR A O    16 
ATOM 9117  C CB   . THR A 1 9  ? 1.889   16.607  -1.033  1.00 0.00 ? 12 THR A CB   16 
ATOM 9118  O OG1  . THR A 1 9  ? 1.165   17.808  -1.232  1.00 0.00 ? 12 THR A OG1  16 
ATOM 9119  C CG2  . THR A 1 9  ? 2.891   16.492  -2.161  1.00 0.00 ? 12 THR A CG2  16 
ATOM 9120  H H    . THR A 1 9  ? -0.649  16.805  -1.083  1.00 0.00 ? 12 THR A H    16 
ATOM 9121  H HA   . THR A 1 9  ? 1.059   14.800  -1.824  1.00 0.00 ? 12 THR A HA   16 
ATOM 9122  H HB   . THR A 1 9  ? 2.442   16.690  -0.107  1.00 0.00 ? 12 THR A HB   16 
ATOM 9123  H HG1  . THR A 1 9  ? 1.751   18.561  -1.118  1.00 0.00 ? 12 THR A HG1  16 
ATOM 9124  H HG21 . THR A 1 9  ? 3.168   15.457  -2.295  1.00 0.00 ? 12 THR A HG21 16 
ATOM 9125  H HG22 . THR A 1 9  ? 3.770   17.072  -1.922  1.00 0.00 ? 12 THR A HG22 16 
ATOM 9126  H HG23 . THR A 1 9  ? 2.450   16.867  -3.073  1.00 0.00 ? 12 THR A HG23 16 
ATOM 9127  N N    . ASN A 1 10 ? 0.935   15.049  1.471   1.00 0.00 ? 13 ASN A N    16 
ATOM 9128  C CA   . ASN A 1 10 ? 1.221   14.337  2.723   1.00 0.00 ? 13 ASN A CA   16 
ATOM 9129  C C    . ASN A 1 10 ? 0.517   12.984  2.794   1.00 0.00 ? 13 ASN A C    16 
ATOM 9130  O O    . ASN A 1 10 ? 0.935   12.095  3.535   1.00 0.00 ? 13 ASN A O    16 
ATOM 9131  C CB   . ASN A 1 10 ? 0.839   15.198  3.932   1.00 0.00 ? 13 ASN A CB   16 
ATOM 9132  C CG   . ASN A 1 10 ? 1.540   16.541  3.935   1.00 0.00 ? 13 ASN A CG   16 
ATOM 9133  O OD1  . ASN A 1 10 ? 1.289   17.385  3.080   1.00 0.00 ? 13 ASN A OD1  16 
ATOM 9134  N ND2  . ASN A 1 10 ? 2.430   16.749  4.895   1.00 0.00 ? 13 ASN A ND2  16 
ATOM 9135  H H    . ASN A 1 10 ? 0.470   15.913  1.506   1.00 0.00 ? 13 ASN A H    16 
ATOM 9136  H HA   . ASN A 1 10 ? 2.271   14.154  2.745   1.00 0.00 ? 13 ASN A HA   16 
ATOM 9137  H HB2  . ASN A 1 10 ? -0.226  15.372  3.920   1.00 0.00 ? 13 ASN A HB2  16 
ATOM 9138  H HB3  . ASN A 1 10 ? 1.101   14.672  4.837   1.00 0.00 ? 13 ASN A HB3  16 
ATOM 9139  H HD21 . ASN A 1 10 ? 2.588   16.034  5.546   1.00 0.00 ? 13 ASN A HD21 16 
ATOM 9140  H HD22 . ASN A 1 10 ? 2.892   17.612  4.916   1.00 0.00 ? 13 ASN A HD22 16 
ATOM 9141  N N    . ILE A 1 11 ? -0.534  12.834  2.010   1.00 0.00 ? 14 ILE A N    16 
ATOM 9142  C CA   . ILE A 1 11 ? -1.294  11.595  1.959   1.00 0.00 ? 14 ILE A CA   16 
ATOM 9143  C C    . ILE A 1 11 ? -0.880  10.771  0.737   1.00 0.00 ? 14 ILE A C    16 
ATOM 9144  O O    . ILE A 1 11 ? -0.645  9.565   0.842   1.00 0.00 ? 14 ILE A O    16 
ATOM 9145  C CB   . ILE A 1 11 ? -2.809  11.902  1.930   1.00 0.00 ? 14 ILE A CB   16 
ATOM 9146  C CG1  . ILE A 1 11 ? -3.386  11.840  3.344   1.00 0.00 ? 14 ILE A CG1  16 
ATOM 9147  C CG2  . ILE A 1 11 ? -3.564  10.951  1.008   1.00 0.00 ? 14 ILE A CG2  16 
ATOM 9148  C CD1  . ILE A 1 11 ? -4.761  12.460  3.466   1.00 0.00 ? 14 ILE A CD1  16 
ATOM 9149  H H    . ILE A 1 11 ? -0.800  13.576  1.437   1.00 0.00 ? 14 ILE A H    16 
ATOM 9150  H HA   . ILE A 1 11 ? -1.074  11.030  2.852   1.00 0.00 ? 14 ILE A HA   16 
ATOM 9151  H HB   . ILE A 1 11 ? -2.926  12.904  1.550   1.00 0.00 ? 14 ILE A HB   16 
ATOM 9152  H HG12 . ILE A 1 11 ? -3.462  10.808  3.649   1.00 0.00 ? 14 ILE A HG12 16 
ATOM 9153  H HG13 . ILE A 1 11 ? -2.725  12.363  4.020   1.00 0.00 ? 14 ILE A HG13 16 
ATOM 9154  H HG21 . ILE A 1 11 ? -4.627  11.125  1.109   1.00 0.00 ? 14 ILE A HG21 16 
ATOM 9155  H HG22 . ILE A 1 11 ? -3.340  9.931   1.282   1.00 0.00 ? 14 ILE A HG22 16 
ATOM 9156  H HG23 . ILE A 1 11 ? -3.266  11.126  -0.014  1.00 0.00 ? 14 ILE A HG23 16 
ATOM 9157  H HD11 . ILE A 1 11 ? -5.191  12.201  4.422   1.00 0.00 ? 14 ILE A HD11 16 
ATOM 9158  H HD12 . ILE A 1 11 ? -5.396  12.088  2.675   1.00 0.00 ? 14 ILE A HD12 16 
ATOM 9159  H HD13 . ILE A 1 11 ? -4.683  13.534  3.386   1.00 0.00 ? 14 ILE A HD13 16 
ATOM 9160  N N    . MET A 1 12 ? -0.777  11.438  -0.413  1.00 0.00 ? 15 MET A N    16 
ATOM 9161  C CA   . MET A 1 12 ? -0.376  10.798  -1.658  1.00 0.00 ? 15 MET A CA   16 
ATOM 9162  C C    . MET A 1 12 ? 0.916   10.003  -1.475  1.00 0.00 ? 15 MET A C    16 
ATOM 9163  O O    . MET A 1 12 ? 0.975   8.817   -1.810  1.00 0.00 ? 15 MET A O    16 
ATOM 9164  C CB   . MET A 1 12 ? -0.195  11.861  -2.744  1.00 0.00 ? 15 MET A CB   16 
ATOM 9165  C CG   . MET A 1 12 ? -0.980  11.575  -4.009  1.00 0.00 ? 15 MET A CG   16 
ATOM 9166  S SD   . MET A 1 12 ? 0.081   11.298  -5.439  1.00 0.00 ? 15 MET A SD   16 
ATOM 9167  C CE   . MET A 1 12 ? -0.340  12.716  -6.450  1.00 0.00 ? 15 MET A CE   16 
ATOM 9168  H H    . MET A 1 12 ? -0.968  12.405  -0.425  1.00 0.00 ? 15 MET A H    16 
ATOM 9169  H HA   . MET A 1 12 ? -1.163  10.121  -1.953  1.00 0.00 ? 15 MET A HA   16 
ATOM 9170  H HB2  . MET A 1 12 ? -0.521  12.815  -2.355  1.00 0.00 ? 15 MET A HB2  16 
ATOM 9171  H HB3  . MET A 1 12 ? 0.850   11.926  -2.998  1.00 0.00 ? 15 MET A HB3  16 
ATOM 9172  H HG2  . MET A 1 12 ? -1.581  10.694  -3.848  1.00 0.00 ? 15 MET A HG2  16 
ATOM 9173  H HG3  . MET A 1 12 ? -1.626  12.416  -4.213  1.00 0.00 ? 15 MET A HG3  16 
ATOM 9174  H HE1  . MET A 1 12 ? -0.080  13.623  -5.924  1.00 0.00 ? 15 MET A HE1  16 
ATOM 9175  H HE2  . MET A 1 12 ? -1.402  12.710  -6.654  1.00 0.00 ? 15 MET A HE2  16 
ATOM 9176  H HE3  . MET A 1 12 ? 0.206   12.671  -7.381  1.00 0.00 ? 15 MET A HE3  16 
ATOM 9177  N N    . ASN A 1 13 ? 1.948   10.657  -0.930  1.00 0.00 ? 16 ASN A N    16 
ATOM 9178  C CA   . ASN A 1 13 ? 3.230   9.994   -0.697  1.00 0.00 ? 16 ASN A CA   16 
ATOM 9179  C C    . ASN A 1 13 ? 3.051   8.785   0.224   1.00 0.00 ? 16 ASN A C    16 
ATOM 9180  O O    . ASN A 1 13 ? 3.599   7.712   -0.031  1.00 0.00 ? 16 ASN A O    16 
ATOM 9181  C CB   . ASN A 1 13 ? 4.260   10.980  -0.117  1.00 0.00 ? 16 ASN A CB   16 
ATOM 9182  C CG   . ASN A 1 13 ? 4.151   11.140  1.388   1.00 0.00 ? 16 ASN A CG   16 
ATOM 9183  O OD1  . ASN A 1 13 ? 4.836   10.461  2.146   1.00 0.00 ? 16 ASN A OD1  16 
ATOM 9184  N ND2  . ASN A 1 13 ? 3.284   12.038  1.828   1.00 0.00 ? 16 ASN A ND2  16 
ATOM 9185  H H    . ASN A 1 13 ? 1.839   11.598  -0.673  1.00 0.00 ? 16 ASN A H    16 
ATOM 9186  H HA   . ASN A 1 13 ? 3.587   9.641   -1.648  1.00 0.00 ? 16 ASN A HA   16 
ATOM 9187  H HB2  . ASN A 1 13 ? 5.253   10.626  -0.345  1.00 0.00 ? 16 ASN A HB2  16 
ATOM 9188  H HB3  . ASN A 1 13 ? 4.115   11.948  -0.573  1.00 0.00 ? 16 ASN A HB3  16 
ATOM 9189  H HD21 . ASN A 1 13 ? 2.764   12.548  1.165   1.00 0.00 ? 16 ASN A HD21 16 
ATOM 9190  H HD22 . ASN A 1 13 ? 3.193   12.152  2.796   1.00 0.00 ? 16 ASN A HD22 16 
ATOM 9191  N N    . LEU A 1 14 ? 2.259   8.965   1.280   1.00 0.00 ? 17 LEU A N    16 
ATOM 9192  C CA   . LEU A 1 14 ? 1.983   7.888   2.226   1.00 0.00 ? 17 LEU A CA   16 
ATOM 9193  C C    . LEU A 1 14 ? 1.210   6.766   1.542   1.00 0.00 ? 17 LEU A C    16 
ATOM 9194  O O    . LEU A 1 14 ? 1.577   5.596   1.652   1.00 0.00 ? 17 LEU A O    16 
ATOM 9195  C CB   . LEU A 1 14 ? 1.200   8.418   3.433   1.00 0.00 ? 17 LEU A CB   16 
ATOM 9196  C CG   . LEU A 1 14 ? 2.001   9.300   4.393   1.00 0.00 ? 17 LEU A CG   16 
ATOM 9197  C CD1  . LEU A 1 14 ? 1.129   9.756   5.549   1.00 0.00 ? 17 LEU A CD1  16 
ATOM 9198  C CD2  . LEU A 1 14 ? 3.224   8.556   4.911   1.00 0.00 ? 17 LEU A CD2  16 
ATOM 9199  H H    . LEU A 1 14 ? 1.836   9.838   1.413   1.00 0.00 ? 17 LEU A H    16 
ATOM 9200  H HA   . LEU A 1 14 ? 2.932   7.497   2.566   1.00 0.00 ? 17 LEU A HA   16 
ATOM 9201  H HB2  . LEU A 1 14 ? 0.362   8.991   3.065   1.00 0.00 ? 17 LEU A HB2  16 
ATOM 9202  H HB3  . LEU A 1 14 ? 0.822   7.573   3.988   1.00 0.00 ? 17 LEU A HB3  16 
ATOM 9203  H HG   . LEU A 1 14 ? 2.343   10.179  3.866   1.00 0.00 ? 17 LEU A HG   16 
ATOM 9204  H HD11 . LEU A 1 14 ? 0.454   8.961   5.827   1.00 0.00 ? 17 LEU A HD11 16 
ATOM 9205  H HD12 . LEU A 1 14 ? 0.559   10.623  5.249   1.00 0.00 ? 17 LEU A HD12 16 
ATOM 9206  H HD13 . LEU A 1 14 ? 1.753   10.009  6.393   1.00 0.00 ? 17 LEU A HD13 16 
ATOM 9207  H HD21 . LEU A 1 14 ? 3.988   8.544   4.149   1.00 0.00 ? 17 LEU A HD21 16 
ATOM 9208  H HD22 . LEU A 1 14 ? 2.949   7.544   5.163   1.00 0.00 ? 17 LEU A HD22 16 
ATOM 9209  H HD23 . LEU A 1 14 ? 3.602   9.056   5.791   1.00 0.00 ? 17 LEU A HD23 16 
ATOM 9210  N N    . LEU A 1 15 ? 0.153   7.129   0.815   1.00 0.00 ? 18 LEU A N    16 
ATOM 9211  C CA   . LEU A 1 15 ? -0.651  6.143   0.093   1.00 0.00 ? 18 LEU A CA   16 
ATOM 9212  C C    . LEU A 1 15 ? 0.224   5.347   -0.867  1.00 0.00 ? 18 LEU A C    16 
ATOM 9213  O O    . LEU A 1 15 ? 0.205   4.112   -0.860  1.00 0.00 ? 18 LEU A O    16 
ATOM 9214  C CB   . LEU A 1 15 ? -1.788  6.832   -0.672  1.00 0.00 ? 18 LEU A CB   16 
ATOM 9215  C CG   . LEU A 1 15 ? -2.925  7.376   0.195   1.00 0.00 ? 18 LEU A CG   16 
ATOM 9216  C CD1  . LEU A 1 15 ? -3.853  8.248   -0.633  1.00 0.00 ? 18 LEU A CD1  16 
ATOM 9217  C CD2  . LEU A 1 15 ? -3.703  6.237   0.835   1.00 0.00 ? 18 LEU A CD2  16 
ATOM 9218  H H    . LEU A 1 15 ? -0.083  8.086   0.751   1.00 0.00 ? 18 LEU A H    16 
ATOM 9219  H HA   . LEU A 1 15 ? -1.068  5.462   0.817   1.00 0.00 ? 18 LEU A HA   16 
ATOM 9220  H HB2  . LEU A 1 15 ? -1.369  7.654   -1.233  1.00 0.00 ? 18 LEU A HB2  16 
ATOM 9221  H HB3  . LEU A 1 15 ? -2.207  6.121   -1.368  1.00 0.00 ? 18 LEU A HB3  16 
ATOM 9222  H HG   . LEU A 1 15 ? -2.509  7.984   0.985   1.00 0.00 ? 18 LEU A HG   16 
ATOM 9223  H HD11 . LEU A 1 15 ? -3.299  9.085   -1.032  1.00 0.00 ? 18 LEU A HD11 16 
ATOM 9224  H HD12 . LEU A 1 15 ? -4.656  8.613   -0.009  1.00 0.00 ? 18 LEU A HD12 16 
ATOM 9225  H HD13 . LEU A 1 15 ? -4.264  7.668   -1.445  1.00 0.00 ? 18 LEU A HD13 16 
ATOM 9226  H HD21 . LEU A 1 15 ? -4.209  5.671   0.065   1.00 0.00 ? 18 LEU A HD21 16 
ATOM 9227  H HD22 . LEU A 1 15 ? -4.433  6.641   1.521   1.00 0.00 ? 18 LEU A HD22 16 
ATOM 9228  H HD23 . LEU A 1 15 ? -3.023  5.592   1.370   1.00 0.00 ? 18 LEU A HD23 16 
ATOM 9229  N N    . PHE A 1 16 ? 1.010   6.061   -1.674  1.00 0.00 ? 19 PHE A N    16 
ATOM 9230  C CA   . PHE A 1 16 ? 1.917   5.426   -2.627  1.00 0.00 ? 19 PHE A CA   16 
ATOM 9231  C C    . PHE A 1 16 ? 2.904   4.514   -1.905  1.00 0.00 ? 19 PHE A C    16 
ATOM 9232  O O    . PHE A 1 16 ? 3.188   3.411   -2.365  1.00 0.00 ? 19 PHE A O    16 
ATOM 9233  C CB   . PHE A 1 16 ? 2.682   6.488   -3.424  1.00 0.00 ? 19 PHE A CB   16 
ATOM 9234  C CG   . PHE A 1 16 ? 2.829   6.160   -4.886  1.00 0.00 ? 19 PHE A CG   16 
ATOM 9235  C CD1  . PHE A 1 16 ? 1.719   6.108   -5.714  1.00 0.00 ? 19 PHE A CD1  16 
ATOM 9236  C CD2  . PHE A 1 16 ? 4.077   5.902   -5.428  1.00 0.00 ? 19 PHE A CD2  16 
ATOM 9237  C CE1  . PHE A 1 16 ? 1.851   5.808   -7.056  1.00 0.00 ? 19 PHE A CE1  16 
ATOM 9238  C CE2  . PHE A 1 16 ? 4.217   5.601   -6.770  1.00 0.00 ? 19 PHE A CE2  16 
ATOM 9239  C CZ   . PHE A 1 16 ? 3.102   5.553   -7.585  1.00 0.00 ? 19 PHE A CZ   16 
ATOM 9240  H H    . PHE A 1 16 ? 0.989   7.044   -1.615  1.00 0.00 ? 19 PHE A H    16 
ATOM 9241  H HA   . PHE A 1 16 ? 1.325   4.831   -3.307  1.00 0.00 ? 19 PHE A HA   16 
ATOM 9242  H HB2  . PHE A 1 16 ? 2.162   7.429   -3.343  1.00 0.00 ? 19 PHE A HB2  16 
ATOM 9243  H HB3  . PHE A 1 16 ? 3.672   6.597   -3.006  1.00 0.00 ? 19 PHE A HB3  16 
ATOM 9244  H HD1  . PHE A 1 16 ? 0.741   6.308   -5.302  1.00 0.00 ? 19 PHE A HD1  16 
ATOM 9245  H HD2  . PHE A 1 16 ? 4.949   5.939   -4.792  1.00 0.00 ? 19 PHE A HD2  16 
ATOM 9246  H HE1  . PHE A 1 16 ? 0.978   5.772   -7.692  1.00 0.00 ? 19 PHE A HE1  16 
ATOM 9247  H HE2  . PHE A 1 16 ? 5.195   5.403   -7.183  1.00 0.00 ? 19 PHE A HE2  16 
ATOM 9248  H HZ   . PHE A 1 16 ? 3.208   5.318   -8.634  1.00 0.00 ? 19 PHE A HZ   16 
ATOM 9249  N N    . ASN A 1 17 ? 3.411   4.980   -0.761  1.00 0.00 ? 20 ASN A N    16 
ATOM 9250  C CA   . ASN A 1 17 ? 4.358   4.213   0.039   1.00 0.00 ? 20 ASN A CA   16 
ATOM 9251  C C    . ASN A 1 17 ? 3.668   3.015   0.682   1.00 0.00 ? 20 ASN A C    16 
ATOM 9252  O O    . ASN A 1 17 ? 4.163   1.887   0.596   1.00 0.00 ? 20 ASN A O    16 
ATOM 9253  C CB   . ASN A 1 17 ? 4.968   5.113   1.116   1.00 0.00 ? 20 ASN A CB   16 
ATOM 9254  C CG   . ASN A 1 17 ? 6.460   4.923   1.269   1.00 0.00 ? 20 ASN A CG   16 
ATOM 9255  O OD1  . ASN A 1 17 ? 7.207   5.888   1.382   1.00 0.00 ? 20 ASN A OD1  16 
ATOM 9256  N ND2  . ASN A 1 17 ? 6.905   3.677   1.273   1.00 0.00 ? 20 ASN A ND2  16 
ATOM 9257  H H    . ASN A 1 17 ? 3.133   5.864   -0.438  1.00 0.00 ? 20 ASN A H    16 
ATOM 9258  H HA   . ASN A 1 17 ? 5.142   3.851   -0.614  1.00 0.00 ? 20 ASN A HA   16 
ATOM 9259  H HB2  . ASN A 1 17 ? 4.786   6.144   0.857   1.00 0.00 ? 20 ASN A HB2  16 
ATOM 9260  H HB3  . ASN A 1 17 ? 4.496   4.899   2.060   1.00 0.00 ? 20 ASN A HB3  16 
ATOM 9261  H HD21 . ASN A 1 17 ? 6.258   2.948   1.183   1.00 0.00 ? 20 ASN A HD21 16 
ATOM 9262  H HD22 . ASN A 1 17 ? 7.865   3.539   1.362   1.00 0.00 ? 20 ASN A HD22 16 
ATOM 9263  N N    . ILE A 1 18 ? 2.516   3.259   1.308   1.00 0.00 ? 21 ILE A N    16 
ATOM 9264  C CA   . ILE A 1 18 ? 1.754   2.184   1.941   1.00 0.00 ? 21 ILE A CA   16 
ATOM 9265  C C    . ILE A 1 18 ? 1.484   1.086   0.924   1.00 0.00 ? 21 ILE A C    16 
ATOM 9266  O O    . ILE A 1 18 ? 1.890   -0.061  1.119   1.00 0.00 ? 21 ILE A O    16 
ATOM 9267  C CB   . ILE A 1 18 ? 0.419   2.692   2.539   1.00 0.00 ? 21 ILE A CB   16 
ATOM 9268  C CG1  . ILE A 1 18 ? 0.680   3.483   3.824   1.00 0.00 ? 21 ILE A CG1  16 
ATOM 9269  C CG2  . ILE A 1 18 ? -0.529  1.530   2.816   1.00 0.00 ? 21 ILE A CG2  16 
ATOM 9270  C CD1  . ILE A 1 18 ? 1.257   2.647   4.949   1.00 0.00 ? 21 ILE A CD1  16 
ATOM 9271  H H    . ILE A 1 18 ? 2.165   4.184   1.328   1.00 0.00 ? 21 ILE A H    16 
ATOM 9272  H HA   . ILE A 1 18 ? 2.355   1.774   2.741   1.00 0.00 ? 21 ILE A HA   16 
ATOM 9273  H HB   . ILE A 1 18 ? -0.049  3.342   1.815   1.00 0.00 ? 21 ILE A HB   16 
ATOM 9274  H HG12 . ILE A 1 18 ? 1.378   4.279   3.614   1.00 0.00 ? 21 ILE A HG12 16 
ATOM 9275  H HG13 . ILE A 1 18 ? -0.250  3.908   4.171   1.00 0.00 ? 21 ILE A HG13 16 
ATOM 9276  H HG21 . ILE A 1 18 ? -1.318  1.861   3.475   1.00 0.00 ? 21 ILE A HG21 16 
ATOM 9277  H HG22 . ILE A 1 18 ? 0.017   0.724   3.284   1.00 0.00 ? 21 ILE A HG22 16 
ATOM 9278  H HG23 . ILE A 1 18 ? -0.957  1.183   1.886   1.00 0.00 ? 21 ILE A HG23 16 
ATOM 9279  H HD11 . ILE A 1 18 ? 1.325   1.615   4.633   1.00 0.00 ? 21 ILE A HD11 16 
ATOM 9280  H HD12 . ILE A 1 18 ? 0.615   2.716   5.814   1.00 0.00 ? 21 ILE A HD12 16 
ATOM 9281  H HD13 . ILE A 1 18 ? 2.242   3.011   5.200   1.00 0.00 ? 21 ILE A HD13 16 
ATOM 9282  N N    . ALA A 1 19 ? 0.832   1.450   -0.183  1.00 0.00 ? 22 ALA A N    16 
ATOM 9283  C CA   . ALA A 1 19 ? 0.549   0.492   -1.248  1.00 0.00 ? 22 ALA A CA   16 
ATOM 9284  C C    . ALA A 1 19 ? 1.845   -0.173  -1.724  1.00 0.00 ? 22 ALA A C    16 
ATOM 9285  O O    . ALA A 1 19 ? 1.865   -1.366  -2.039  1.00 0.00 ? 22 ALA A O    16 
ATOM 9286  C CB   . ALA A 1 19 ? -0.158  1.182   -2.408  1.00 0.00 ? 22 ALA A CB   16 
ATOM 9287  H H    . ALA A 1 19 ? 0.559   2.393   -0.295  1.00 0.00 ? 22 ALA A H    16 
ATOM 9288  H HA   . ALA A 1 19 ? -0.108  -0.268  -0.851  1.00 0.00 ? 22 ALA A HA   16 
ATOM 9289  H HB1  . ALA A 1 19 ? -0.905  1.861   -2.020  1.00 0.00 ? 22 ALA A HB1  16 
ATOM 9290  H HB2  . ALA A 1 19 ? -0.636  0.440   -3.031  1.00 0.00 ? 22 ALA A HB2  16 
ATOM 9291  H HB3  . ALA A 1 19 ? 0.562   1.735   -2.993  1.00 0.00 ? 22 ALA A HB3  16 
ATOM 9292  N N    . LYS A 1 20 ? 2.928   0.609   -1.758  1.00 0.00 ? 23 LYS A N    16 
ATOM 9293  C CA   . LYS A 1 20 ? 4.239   0.117   -2.180  1.00 0.00 ? 23 LYS A CA   16 
ATOM 9294  C C    . LYS A 1 20 ? 4.762   -0.976  -1.241  1.00 0.00 ? 23 LYS A C    16 
ATOM 9295  O O    . LYS A 1 20 ? 5.228   -2.021  -1.695  1.00 0.00 ? 23 LYS A O    16 
ATOM 9296  C CB   . LYS A 1 20 ? 5.240   1.282   -2.245  1.00 0.00 ? 23 LYS A CB   16 
ATOM 9297  C CG   . LYS A 1 20 ? 5.803   1.541   -3.635  1.00 0.00 ? 23 LYS A CG   16 
ATOM 9298  C CD   . LYS A 1 20 ? 6.480   0.306   -4.214  1.00 0.00 ? 23 LYS A CD   16 
ATOM 9299  C CE   . LYS A 1 20 ? 6.996   0.557   -5.623  1.00 0.00 ? 23 LYS A CE   16 
ATOM 9300  N NZ   . LYS A 1 20 ? 7.156   -0.714  -6.390  1.00 0.00 ? 23 LYS A NZ   16 
ATOM 9301  H H    . LYS A 1 20 ? 2.841   1.549   -1.488  1.00 0.00 ? 23 LYS A H    16 
ATOM 9302  H HA   . LYS A 1 20 ? 4.126   -0.308  -3.163  1.00 0.00 ? 23 LYS A HA   16 
ATOM 9303  H HB2  . LYS A 1 20 ? 4.742   2.179   -1.915  1.00 0.00 ? 23 LYS A HB2  16 
ATOM 9304  H HB3  . LYS A 1 20 ? 6.062   1.082   -1.576  1.00 0.00 ? 23 LYS A HB3  16 
ATOM 9305  H HG2  . LYS A 1 20 ? 4.994   1.838   -4.287  1.00 0.00 ? 23 LYS A HG2  16 
ATOM 9306  H HG3  . LYS A 1 20 ? 6.526   2.343   -3.573  1.00 0.00 ? 23 LYS A HG3  16 
ATOM 9307  H HD2  . LYS A 1 20 ? 7.313   0.034   -3.581  1.00 0.00 ? 23 LYS A HD2  16 
ATOM 9308  H HD3  . LYS A 1 20 ? 5.768   -0.506  -4.240  1.00 0.00 ? 23 LYS A HD3  16 
ATOM 9309  H HE2  . LYS A 1 20 ? 6.294   1.197   -6.140  1.00 0.00 ? 23 LYS A HE2  16 
ATOM 9310  H HE3  . LYS A 1 20 ? 7.954   1.054   -5.558  1.00 0.00 ? 23 LYS A HE3  16 
ATOM 9311  H HZ1  . LYS A 1 20 ? 6.225   -1.148  -6.563  1.00 0.00 ? 23 LYS A HZ1  16 
ATOM 9312  H HZ2  . LYS A 1 20 ? 7.744   -1.385  -5.854  1.00 0.00 ? 23 LYS A HZ2  16 
ATOM 9313  H HZ3  . LYS A 1 20 ? 7.612   -0.528  -7.307  1.00 0.00 ? 23 LYS A HZ3  16 
ATOM 9314  N N    . ALA A 1 21 ? 4.688   -0.729  0.063   1.00 0.00 ? 24 ALA A N    16 
ATOM 9315  C CA   . ALA A 1 21 ? 5.160   -1.700  1.049   1.00 0.00 ? 24 ALA A CA   16 
ATOM 9316  C C    . ALA A 1 21 ? 4.117   -2.787  1.323   1.00 0.00 ? 24 ALA A C    16 
ATOM 9317  O O    . ALA A 1 21 ? 4.468   -3.946  1.553   1.00 0.00 ? 24 ALA A O    16 
ATOM 9318  C CB   . ALA A 1 21 ? 5.554   -0.990  2.337   1.00 0.00 ? 24 ALA A CB   16 
ATOM 9319  H H    . ALA A 1 21 ? 4.311   0.126   0.371   1.00 0.00 ? 24 ALA A H    16 
ATOM 9320  H HA   . ALA A 1 21 ? 6.043   -2.172  0.644   1.00 0.00 ? 24 ALA A HA   16 
ATOM 9321  H HB1  . ALA A 1 21 ? 6.014   -0.042  2.100   1.00 0.00 ? 24 ALA A HB1  16 
ATOM 9322  H HB2  . ALA A 1 21 ? 6.253   -1.602  2.887   1.00 0.00 ? 24 ALA A HB2  16 
ATOM 9323  H HB3  . ALA A 1 21 ? 4.672   -0.820  2.939   1.00 0.00 ? 24 ALA A HB3  16 
ATOM 9324  N N    . LYS A 1 22 ? 2.837   -2.412  1.293   1.00 0.00 ? 25 LYS A N    16 
ATOM 9325  C CA   . LYS A 1 22 ? 1.757   -3.359  1.537   1.00 0.00 ? 25 LYS A CA   16 
ATOM 9326  C C    . LYS A 1 22 ? 1.691   -4.416  0.438   1.00 0.00 ? 25 LYS A C    16 
ATOM 9327  O O    . LYS A 1 22 ? 1.483   -5.596  0.725   1.00 0.00 ? 25 LYS A O    16 
ATOM 9328  C CB   . LYS A 1 22 ? 0.413   -2.627  1.647   1.00 0.00 ? 25 LYS A CB   16 
ATOM 9329  C CG   . LYS A 1 22 ? -0.319  -2.896  2.952   1.00 0.00 ? 25 LYS A CG   16 
ATOM 9330  C CD   . LYS A 1 22 ? -1.685  -3.527  2.708   1.00 0.00 ? 25 LYS A CD   16 
ATOM 9331  C CE   . LYS A 1 22 ? -2.630  -3.300  3.880   1.00 0.00 ? 25 LYS A CE   16 
ATOM 9332  N NZ   . LYS A 1 22 ? -3.131  -1.895  3.928   1.00 0.00 ? 25 LYS A NZ   16 
ATOM 9333  H H    . LYS A 1 22 ? 2.613   -1.473  1.099   1.00 0.00 ? 25 LYS A H    16 
ATOM 9334  H HA   . LYS A 1 22 ? 1.962   -3.854  2.474   1.00 0.00 ? 25 LYS A HA   16 
ATOM 9335  H HB2  . LYS A 1 22 ? 0.586   -1.565  1.572   1.00 0.00 ? 25 LYS A HB2  16 
ATOM 9336  H HB3  . LYS A 1 22 ? -0.223  -2.938  0.831   1.00 0.00 ? 25 LYS A HB3  16 
ATOM 9337  H HG2  . LYS A 1 22 ? 0.276   -3.567  3.552   1.00 0.00 ? 25 LYS A HG2  16 
ATOM 9338  H HG3  . LYS A 1 22 ? -0.449  -1.962  3.478   1.00 0.00 ? 25 LYS A HG3  16 
ATOM 9339  H HD2  . LYS A 1 22 ? -2.119  -3.090  1.821   1.00 0.00 ? 25 LYS A HD2  16 
ATOM 9340  H HD3  . LYS A 1 22 ? -1.557  -4.589  2.562   1.00 0.00 ? 25 LYS A HD3  16 
ATOM 9341  H HE2  . LYS A 1 22 ? -3.472  -3.972  3.782   1.00 0.00 ? 25 LYS A HE2  16 
ATOM 9342  H HE3  . LYS A 1 22 ? -2.102  -3.518  4.799   1.00 0.00 ? 25 LYS A HE3  16 
ATOM 9343  H HZ1  . LYS A 1 22 ? -2.364  -1.250  4.209   1.00 0.00 ? 25 LYS A HZ1  16 
ATOM 9344  H HZ2  . LYS A 1 22 ? -3.908  -1.814  4.615   1.00 0.00 ? 25 LYS A HZ2  16 
ATOM 9345  H HZ3  . LYS A 1 22 ? -3.482  -1.607  2.991   1.00 0.00 ? 25 LYS A HZ3  16 
ATOM 9346  N N    . ASN A 1 23 ? 1.870   -4.000  -0.820  1.00 0.00 ? 26 ASN A N    16 
ATOM 9347  C CA   . ASN A 1 23 ? 1.819   -4.948  -1.936  1.00 0.00 ? 26 ASN A CA   16 
ATOM 9348  C C    . ASN A 1 23 ? 2.963   -5.965  -1.863  1.00 0.00 ? 26 ASN A C    16 
ATOM 9349  O O    . ASN A 1 23 ? 2.760   -7.145  -2.149  1.00 0.00 ? 26 ASN A O    16 
ATOM 9350  C CB   . ASN A 1 23 ? 1.819   -4.215  -3.290  1.00 0.00 ? 26 ASN A CB   16 
ATOM 9351  C CG   . ASN A 1 23 ? 3.204   -3.817  -3.768  1.00 0.00 ? 26 ASN A CG   16 
ATOM 9352  O OD1  . ASN A 1 23 ? 3.978   -4.646  -4.237  1.00 0.00 ? 26 ASN A OD1  16 
ATOM 9353  N ND2  . ASN A 1 23 ? 3.516   -2.541  -3.658  1.00 0.00 ? 26 ASN A ND2  16 
ATOM 9354  H H    . ASN A 1 23 ? 2.039   -3.040  -0.999  1.00 0.00 ? 26 ASN A H    16 
ATOM 9355  H HA   . ASN A 1 23 ? 0.888   -5.491  -1.846  1.00 0.00 ? 26 ASN A HA   16 
ATOM 9356  H HB2  . ASN A 1 23 ? 1.380   -4.859  -4.035  1.00 0.00 ? 26 ASN A HB2  16 
ATOM 9357  H HB3  . ASN A 1 23 ? 1.220   -3.320  -3.203  1.00 0.00 ? 26 ASN A HB3  16 
ATOM 9358  H HD21 . ASN A 1 23 ? 2.847   -1.929  -3.279  1.00 0.00 ? 26 ASN A HD21 16 
ATOM 9359  H HD22 . ASN A 1 23 ? 4.406   -2.262  -3.947  1.00 0.00 ? 26 ASN A HD22 16 
ATOM 9360  N N    . LEU A 1 24 ? 4.156   -5.509  -1.471  1.00 0.00 ? 27 LEU A N    16 
ATOM 9361  C CA   . LEU A 1 24 ? 5.322   -6.390  -1.368  1.00 0.00 ? 27 LEU A CA   16 
ATOM 9362  C C    . LEU A 1 24 ? 5.027   -7.630  -0.533  1.00 0.00 ? 27 LEU A C    16 
ATOM 9363  O O    . LEU A 1 24 ? 5.175   -8.763  -0.994  1.00 0.00 ? 27 LEU A O    16 
ATOM 9364  C CB   . LEU A 1 24 ? 6.515   -5.627  -0.782  1.00 0.00 ? 27 LEU A CB   16 
ATOM 9365  C CG   . LEU A 1 24 ? 7.164   -4.613  -1.729  1.00 0.00 ? 27 LEU A CG   16 
ATOM 9366  C CD1  . LEU A 1 24 ? 7.952   -3.578  -0.943  1.00 0.00 ? 27 LEU A CD1  16 
ATOM 9367  C CD2  . LEU A 1 24 ? 8.066   -5.319  -2.729  1.00 0.00 ? 27 LEU A CD2  16 
ATOM 9368  H H    . LEU A 1 24 ? 4.257   -4.557  -1.247  1.00 0.00 ? 27 LEU A H    16 
ATOM 9369  H HA   . LEU A 1 24 ? 5.568   -6.710  -2.350  1.00 0.00 ? 27 LEU A HA   16 
ATOM 9370  H HB2  . LEU A 1 24 ? 6.181   -5.101  0.101   1.00 0.00 ? 27 LEU A HB2  16 
ATOM 9371  H HB3  . LEU A 1 24 ? 7.267   -6.344  -0.489  1.00 0.00 ? 27 LEU A HB3  16 
ATOM 9372  H HG   . LEU A 1 24 ? 6.391   -4.097  -2.280  1.00 0.00 ? 27 LEU A HG   16 
ATOM 9373  H HD11 . LEU A 1 24 ? 7.359   -2.682  -0.833  1.00 0.00 ? 27 LEU A HD11 16 
ATOM 9374  H HD12 . LEU A 1 24 ? 8.863   -3.343  -1.472  1.00 0.00 ? 27 LEU A HD12 16 
ATOM 9375  H HD13 . LEU A 1 24 ? 8.194   -3.972  0.032   1.00 0.00 ? 27 LEU A HD13 16 
ATOM 9376  H HD21 . LEU A 1 24 ? 7.480   -5.645  -3.575  1.00 0.00 ? 27 LEU A HD21 16 
ATOM 9377  H HD22 . LEU A 1 24 ? 8.525   -6.176  -2.258  1.00 0.00 ? 27 LEU A HD22 16 
ATOM 9378  H HD23 . LEU A 1 24 ? 8.835   -4.638  -3.063  1.00 0.00 ? 27 LEU A HD23 16 
ATOM 9379  N N    . ARG A 1 25 ? 4.612   -7.397  0.693   1.00 0.00 ? 28 ARG A N    16 
ATOM 9380  C CA   . ARG A 1 25 ? 4.290   -8.474  1.624   1.00 0.00 ? 28 ARG A CA   16 
ATOM 9381  C C    . ARG A 1 25 ? 2.958   -9.145  1.284   1.00 0.00 ? 28 ARG A C    16 
ATOM 9382  O O    . ARG A 1 25 ? 2.788   -10.342 1.520   1.00 0.00 ? 28 ARG A O    16 
ATOM 9383  C CB   . ARG A 1 25 ? 4.260   -7.934  3.053   1.00 0.00 ? 28 ARG A CB   16 
ATOM 9384  C CG   . ARG A 1 25 ? 5.630   -7.893  3.711   1.00 0.00 ? 28 ARG A CG   16 
ATOM 9385  C CD   . ARG A 1 25 ? 5.534   -7.982  5.225   1.00 0.00 ? 28 ARG A CD   16 
ATOM 9386  N NE   . ARG A 1 25 ? 5.672   -6.666  5.856   1.00 0.00 ? 28 ARG A NE   16 
ATOM 9387  C CZ   . ARG A 1 25 ? 4.654   -5.889  6.215   1.00 0.00 ? 28 ARG A CZ   16 
ATOM 9388  N NH1  . ARG A 1 25 ? 3.407   -6.268  6.001   1.00 0.00 ? 28 ARG A NH1  16 
ATOM 9389  N NH2  . ARG A 1 25 ? 4.888   -4.722  6.781   1.00 0.00 ? 28 ARG A NH2  16 
ATOM 9390  H H    . ARG A 1 25 ? 4.522   -6.469  0.978   1.00 0.00 ? 28 ARG A H    16 
ATOM 9391  H HA   . ARG A 1 25 ? 5.070   -9.218  1.552   1.00 0.00 ? 28 ARG A HA   16 
ATOM 9392  H HB2  . ARG A 1 25 ? 3.859   -6.931  3.039   1.00 0.00 ? 28 ARG A HB2  16 
ATOM 9393  H HB3  . ARG A 1 25 ? 3.616   -8.561  3.646   1.00 0.00 ? 28 ARG A HB3  16 
ATOM 9394  H HG2  . ARG A 1 25 ? 6.216   -8.725  3.350   1.00 0.00 ? 28 ARG A HG2  16 
ATOM 9395  H HG3  . ARG A 1 25 ? 6.118   -6.967  3.444   1.00 0.00 ? 28 ARG A HG3  16 
ATOM 9396  H HD2  . ARG A 1 25 ? 4.579   -8.409  5.490   1.00 0.00 ? 28 ARG A HD2  16 
ATOM 9397  H HD3  . ARG A 1 25 ? 6.324   -8.628  5.584   1.00 0.00 ? 28 ARG A HD3  16 
ATOM 9398  H HE   . ARG A 1 25 ? 6.583   -6.344  6.019   1.00 0.00 ? 28 ARG A HE   16 
ATOM 9399  H HH11 . ARG A 1 25 ? 3.220   -7.143  5.564   1.00 0.00 ? 28 ARG A HH11 16 
ATOM 9400  H HH12 . ARG A 1 25 ? 2.653   -5.677  6.279   1.00 0.00 ? 28 ARG A HH12 16 
ATOM 9401  H HH21 . ARG A 1 25 ? 5.828   -4.423  6.936   1.00 0.00 ? 28 ARG A HH21 16 
ATOM 9402  H HH22 . ARG A 1 25 ? 4.128   -4.138  7.057   1.00 0.00 ? 28 ARG A HH22 16 
ATOM 9403  N N    . ALA A 1 26 ? 2.021   -8.383  0.714   1.00 0.00 ? 29 ALA A N    16 
ATOM 9404  C CA   . ALA A 1 26 ? 0.722   -8.926  0.341   1.00 0.00 ? 29 ALA A CA   16 
ATOM 9405  C C    . ALA A 1 26 ? 0.869   -9.941  -0.782  1.00 0.00 ? 29 ALA A C    16 
ATOM 9406  O O    . ALA A 1 26 ? 0.269   -11.014 -0.742  1.00 0.00 ? 29 ALA A O    16 
ATOM 9407  C CB   . ALA A 1 26 ? -0.225  -7.804  -0.070  1.00 0.00 ? 29 ALA A CB   16 
ATOM 9408  H H    . ALA A 1 26 ? 2.214   -7.441  0.528   1.00 0.00 ? 29 ALA A H    16 
ATOM 9409  H HA   . ALA A 1 26 ? 0.304   -9.421  1.206   1.00 0.00 ? 29 ALA A HA   16 
ATOM 9410  H HB1  . ALA A 1 26 ? 0.135   -7.345  -0.979  1.00 0.00 ? 29 ALA A HB1  16 
ATOM 9411  H HB2  . ALA A 1 26 ? -0.267  -7.064  0.715   1.00 0.00 ? 29 ALA A HB2  16 
ATOM 9412  H HB3  . ALA A 1 26 ? -1.213  -8.208  -0.237  1.00 0.00 ? 29 ALA A HB3  16 
ATOM 9413  N N    . GLN A 1 27 ? 1.682   -9.600  -1.778  1.00 0.00 ? 30 GLN A N    16 
ATOM 9414  C CA   . GLN A 1 27 ? 1.910   -10.499 -2.912  1.00 0.00 ? 30 GLN A CA   16 
ATOM 9415  C C    . GLN A 1 27 ? 2.922   -11.594 -2.578  1.00 0.00 ? 30 GLN A C    16 
ATOM 9416  O O    . GLN A 1 27 ? 2.904   -12.674 -3.173  1.00 0.00 ? 30 GLN A O    16 
ATOM 9417  C CB   . GLN A 1 27 ? 2.342   -9.714  -4.154  1.00 0.00 ? 30 GLN A CB   16 
ATOM 9418  C CG   . GLN A 1 27 ? 3.781   -9.211  -4.111  1.00 0.00 ? 30 GLN A CG   16 
ATOM 9419  C CD   . GLN A 1 27 ? 3.939   -7.835  -4.729  1.00 0.00 ? 30 GLN A CD   16 
ATOM 9420  O OE1  . GLN A 1 27 ? 3.032   -7.326  -5.384  1.00 0.00 ? 30 GLN A OE1  16 
ATOM 9421  N NE2  . GLN A 1 27 ? 5.098   -7.229  -4.533  1.00 0.00 ? 30 GLN A NE2  16 
ATOM 9422  H H    . GLN A 1 27 ? 2.143   -8.723  -1.745  1.00 0.00 ? 30 GLN A H    16 
ATOM 9423  H HA   . GLN A 1 27 ? 0.977   -10.979 -3.115  1.00 0.00 ? 30 GLN A HA   16 
ATOM 9424  H HB2  . GLN A 1 27 ? 2.234   -10.349 -5.021  1.00 0.00 ? 30 GLN A HB2  16 
ATOM 9425  H HB3  . GLN A 1 27 ? 1.691   -8.858  -4.267  1.00 0.00 ? 30 GLN A HB3  16 
ATOM 9426  H HG2  . GLN A 1 27 ? 4.101   -9.163  -3.082  1.00 0.00 ? 30 GLN A HG2  16 
ATOM 9427  H HG3  . GLN A 1 27 ? 4.407   -9.905  -4.651  1.00 0.00 ? 30 GLN A HG3  16 
ATOM 9428  H HE21 . GLN A 1 27 ? 5.783   -7.694  -4.014  1.00 0.00 ? 30 GLN A HE21 16 
ATOM 9429  H HE22 . GLN A 1 27 ? 5.213   -6.330  -4.907  1.00 0.00 ? 30 GLN A HE22 16 
ATOM 9430  N N    . ALA A 1 28 ? 3.783   -11.323 -1.612  1.00 0.00 ? 31 ALA A N    16 
ATOM 9431  C CA   . ALA A 1 28 ? 4.785   -12.294 -1.187  1.00 0.00 ? 31 ALA A CA   16 
ATOM 9432  C C    . ALA A 1 28 ? 4.172   -13.310 -0.226  1.00 0.00 ? 31 ALA A C    16 
ATOM 9433  O O    . ALA A 1 28 ? 4.285   -14.519 -0.431  1.00 0.00 ? 31 ALA A O    16 
ATOM 9434  C CB   . ALA A 1 28 ? 5.974   -11.593 -0.543  1.00 0.00 ? 31 ALA A CB   16 
ATOM 9435  H H    . ALA A 1 28 ? 3.732   -10.456 -1.167  1.00 0.00 ? 31 ALA A H    16 
ATOM 9436  H HA   . ALA A 1 28 ? 5.137   -12.816 -2.065  1.00 0.00 ? 31 ALA A HA   16 
ATOM 9437  H HB1  . ALA A 1 28 ? 6.748   -12.316 -0.331  1.00 0.00 ? 31 ALA A HB1  16 
ATOM 9438  H HB2  . ALA A 1 28 ? 5.660   -11.122 0.377   1.00 0.00 ? 31 ALA A HB2  16 
ATOM 9439  H HB3  . ALA A 1 28 ? 6.358   -10.842 -1.218  1.00 0.00 ? 31 ALA A HB3  16 
ATOM 9440  N N    . ALA A 1 29 ? 3.516   -12.806 0.819   1.00 0.00 ? 32 ALA A N    16 
ATOM 9441  C CA   . ALA A 1 29 ? 2.880   -13.668 1.815   1.00 0.00 ? 32 ALA A CA   16 
ATOM 9442  C C    . ALA A 1 29 ? 1.712   -14.465 1.223   1.00 0.00 ? 32 ALA A C    16 
ATOM 9443  O O    . ALA A 1 29 ? 1.551   -15.644 1.527   1.00 0.00 ? 32 ALA A O    16 
ATOM 9444  C CB   . ALA A 1 29 ? 2.414   -12.842 3.007   1.00 0.00 ? 32 ALA A CB   16 
ATOM 9445  H H    . ALA A 1 29 ? 3.457   -11.826 0.924   1.00 0.00 ? 32 ALA A H    16 
ATOM 9446  H HA   . ALA A 1 29 ? 3.626   -14.366 2.168   1.00 0.00 ? 32 ALA A HA   16 
ATOM 9447  H HB1  . ALA A 1 29 ? 1.574   -12.229 2.714   1.00 0.00 ? 32 ALA A HB1  16 
ATOM 9448  H HB2  . ALA A 1 29 ? 3.220   -12.208 3.343   1.00 0.00 ? 32 ALA A HB2  16 
ATOM 9449  H HB3  . ALA A 1 29 ? 2.116   -13.502 3.808   1.00 0.00 ? 32 ALA A HB3  16 
ATOM 9450  N N    . ALA A 1 30 ? 0.893   -13.820 0.388   1.00 0.00 ? 33 ALA A N    16 
ATOM 9451  C CA   . ALA A 1 30 ? -0.259  -14.490 -0.221  1.00 0.00 ? 33 ALA A CA   16 
ATOM 9452  C C    . ALA A 1 30 ? 0.156   -15.659 -1.099  1.00 0.00 ? 33 ALA A C    16 
ATOM 9453  O O    . ALA A 1 30 ? -0.295  -16.794 -0.909  1.00 0.00 ? 33 ALA A O    16 
ATOM 9454  C CB   . ALA A 1 30 ? -1.096  -13.494 -1.013  1.00 0.00 ? 33 ALA A CB   16 
ATOM 9455  H H    . ALA A 1 30 ? 1.061   -12.875 0.183   1.00 0.00 ? 33 ALA A H    16 
ATOM 9456  H HA   . ALA A 1 30 ? -0.862  -14.871 0.567   1.00 0.00 ? 33 ALA A HA   16 
ATOM 9457  H HB1  . ALA A 1 30 ? -1.464  -12.724 -0.351  1.00 0.00 ? 33 ALA A HB1  16 
ATOM 9458  H HB2  . ALA A 1 30 ? -1.931  -14.005 -1.469  1.00 0.00 ? 33 ALA A HB2  16 
ATOM 9459  H HB3  . ALA A 1 30 ? -0.487  -13.042 -1.783  1.00 0.00 ? 33 ALA A HB3  16 
ATOM 9460  N N    . ASN A 1 31 ? 1.013   -15.370 -2.054  1.00 0.00 ? 34 ASN A N    16 
ATOM 9461  C CA   . ASN A 1 31 ? 1.506   -16.386 -2.981  1.00 0.00 ? 34 ASN A CA   16 
ATOM 9462  C C    . ASN A 1 31 ? 2.298   -17.465 -2.239  1.00 0.00 ? 34 ASN A C    16 
ATOM 9463  O O    . ASN A 1 31 ? 2.129   -18.655 -2.500  1.00 0.00 ? 34 ASN A O    16 
ATOM 9464  C CB   . ASN A 1 31 ? 2.350   -15.743 -4.096  1.00 0.00 ? 34 ASN A CB   16 
ATOM 9465  C CG   . ASN A 1 31 ? 3.844   -15.892 -3.883  1.00 0.00 ? 34 ASN A CG   16 
ATOM 9466  O OD1  . ASN A 1 31 ? 4.426   -16.929 -4.189  1.00 0.00 ? 34 ASN A OD1  16 
ATOM 9467  N ND2  . ASN A 1 31 ? 4.469   -14.856 -3.353  1.00 0.00 ? 34 ASN A ND2  16 
ATOM 9468  H H    . ASN A 1 31 ? 1.322   -14.449 -2.130  1.00 0.00 ? 34 ASN A H    16 
ATOM 9469  H HA   . ASN A 1 31 ? 0.643   -16.854 -3.430  1.00 0.00 ? 34 ASN A HA   16 
ATOM 9470  H HB2  . ASN A 1 31 ? 2.099   -16.207 -5.038  1.00 0.00 ? 34 ASN A HB2  16 
ATOM 9471  H HB3  . ASN A 1 31 ? 2.117   -14.690 -4.151  1.00 0.00 ? 34 ASN A HB3  16 
ATOM 9472  H HD21 . ASN A 1 31 ? 3.940   -14.060 -3.130  1.00 0.00 ? 34 ASN A HD21 16 
ATOM 9473  H HD22 . ASN A 1 31 ? 5.433   -14.928 -3.202  1.00 0.00 ? 34 ASN A HD22 16 
ATOM 9474  N N    . ALA A 1 32 ? 3.154   -17.041 -1.309  1.00 0.00 ? 35 ALA A N    16 
ATOM 9475  C CA   . ALA A 1 32 ? 3.965   -17.974 -0.532  1.00 0.00 ? 35 ALA A CA   16 
ATOM 9476  C C    . ALA A 1 32 ? 3.237   -18.456 0.733   1.00 0.00 ? 35 ALA A C    16 
ATOM 9477  O O    . ALA A 1 32 ? 3.847   -18.596 1.797   1.00 0.00 ? 35 ALA A O    16 
ATOM 9478  C CB   . ALA A 1 32 ? 5.299   -17.328 -0.177  1.00 0.00 ? 35 ALA A CB   16 
ATOM 9479  H H    . ALA A 1 32 ? 3.240   -16.076 -1.140  1.00 0.00 ? 35 ALA A H    16 
ATOM 9480  H HA   . ALA A 1 32 ? 4.169   -18.829 -1.160  1.00 0.00 ? 35 ALA A HA   16 
ATOM 9481  H HB1  . ALA A 1 32 ? 6.047   -18.096 -0.051  1.00 0.00 ? 35 ALA A HB1  16 
ATOM 9482  H HB2  . ALA A 1 32 ? 5.195   -16.771 0.742   1.00 0.00 ? 35 ALA A HB2  16 
ATOM 9483  H HB3  . ALA A 1 32 ? 5.598   -16.661 -0.972  1.00 0.00 ? 35 ALA A HB3  16 
ATOM 9484  N N    . HIS A 1 33 ? 1.934   -18.718 0.611   1.00 0.00 ? 36 HIS A N    16 
ATOM 9485  C CA   . HIS A 1 33 ? 1.135   -19.190 1.744   1.00 0.00 ? 36 HIS A CA   16 
ATOM 9486  C C    . HIS A 1 33 ? -0.201  -19.779 1.286   1.00 0.00 ? 36 HIS A C    16 
ATOM 9487  O O    . HIS A 1 33 ? -0.503  -20.937 1.575   1.00 0.00 ? 36 HIS A O    16 
ATOM 9488  C CB   . HIS A 1 33 ? 0.896   -18.052 2.740   1.00 0.00 ? 36 HIS A CB   16 
ATOM 9489  C CG   . HIS A 1 33 ? 0.495   -18.524 4.101   1.00 0.00 ? 36 HIS A CG   16 
ATOM 9490  N ND1  . HIS A 1 33 ? -0.766  -18.995 4.392   1.00 0.00 ? 36 HIS A ND1  16 
ATOM 9491  C CD2  . HIS A 1 33 ? 1.198   -18.600 5.254   1.00 0.00 ? 36 HIS A CD2  16 
ATOM 9492  C CE1  . HIS A 1 33 ? -0.825  -19.340 5.665   1.00 0.00 ? 36 HIS A CE1  16 
ATOM 9493  N NE2  . HIS A 1 33 ? 0.356   -19.110 6.211   1.00 0.00 ? 36 HIS A NE2  16 
ATOM 9494  H H    . HIS A 1 33 ? 1.501   -18.596 -0.259  1.00 0.00 ? 36 HIS A H    16 
ATOM 9495  H HA   . HIS A 1 33 ? 1.699   -19.968 2.237   1.00 0.00 ? 36 HIS A HA   16 
ATOM 9496  H HB2  . HIS A 1 33 ? 1.805   -17.478 2.844   1.00 0.00 ? 36 HIS A HB2  16 
ATOM 9497  H HB3  . HIS A 1 33 ? 0.112   -17.411 2.365   1.00 0.00 ? 36 HIS A HB3  16 
ATOM 9498  H HD1  . HIS A 1 33 ? -1.509  -19.071 3.755   1.00 0.00 ? 36 HIS A HD1  16 
ATOM 9499  H HD2  . HIS A 1 33 ? 2.231   -18.314 5.393   1.00 0.00 ? 36 HIS A HD2  16 
ATOM 9500  H HE1  . HIS A 1 33 ? -1.690  -19.740 6.175   1.00 0.00 ? 36 HIS A HE1  16 
ATOM 9501  H HE2  . HIS A 1 33 ? 0.627   -19.403 7.107   1.00 0.00 ? 36 HIS A HE2  16 
ATOM 9502  N N    . LEU A 1 34 ? -1.000  -18.982 0.572   1.00 0.00 ? 37 LEU A N    16 
ATOM 9503  C CA   . LEU A 1 34 ? -2.301  -19.447 0.082   1.00 0.00 ? 37 LEU A CA   16 
ATOM 9504  C C    . LEU A 1 34 ? -2.199  -19.986 -1.341  1.00 0.00 ? 37 LEU A C    16 
ATOM 9505  O O    . LEU A 1 34 ? -2.864  -20.957 -1.701  1.00 0.00 ? 37 LEU A O    16 
ATOM 9506  C CB   . LEU A 1 34 ? -3.347  -18.326 0.167   1.00 0.00 ? 37 LEU A CB   16 
ATOM 9507  C CG   . LEU A 1 34 ? -3.336  -17.312 -0.983  1.00 0.00 ? 37 LEU A CG   16 
ATOM 9508  C CD1  . LEU A 1 34 ? -4.339  -17.707 -2.054  1.00 0.00 ? 37 LEU A CD1  16 
ATOM 9509  C CD2  . LEU A 1 34 ? -3.639  -15.917 -0.464  1.00 0.00 ? 37 LEU A CD2  16 
ATOM 9510  H H    . LEU A 1 34 ? -0.709  -18.064 0.368   1.00 0.00 ? 37 LEU A H    16 
ATOM 9511  H HA   . LEU A 1 34 ? -2.606  -20.252 0.712   1.00 0.00 ? 37 LEU A HA   16 
ATOM 9512  H HB2  . LEU A 1 34 ? -4.326  -18.782 0.203   1.00 0.00 ? 37 LEU A HB2  16 
ATOM 9513  H HB3  . LEU A 1 34 ? -3.190  -17.788 1.091   1.00 0.00 ? 37 LEU A HB3  16 
ATOM 9514  H HG   . LEU A 1 34 ? -2.355  -17.297 -1.433  1.00 0.00 ? 37 LEU A HG   16 
ATOM 9515  H HD11 . LEU A 1 34 ? -4.188  -18.741 -2.327  1.00 0.00 ? 37 LEU A HD11 16 
ATOM 9516  H HD12 . LEU A 1 34 ? -4.200  -17.081 -2.923  1.00 0.00 ? 37 LEU A HD12 16 
ATOM 9517  H HD13 . LEU A 1 34 ? -5.340  -17.578 -1.674  1.00 0.00 ? 37 LEU A HD13 16 
ATOM 9518  H HD21 . LEU A 1 34 ? -2.843  -15.597 0.193   1.00 0.00 ? 37 LEU A HD21 16 
ATOM 9519  H HD22 . LEU A 1 34 ? -4.570  -15.930 0.080   1.00 0.00 ? 37 LEU A HD22 16 
ATOM 9520  H HD23 . LEU A 1 34 ? -3.716  -15.233 -1.297  1.00 0.00 ? 37 LEU A HD23 16 
ATOM 9521  N N    . MET A 1 35 ? -1.351  -19.352 -2.134  1.00 0.00 ? 38 MET A N    16 
ATOM 9522  C CA   . MET A 1 35 ? -1.133  -19.758 -3.523  1.00 0.00 ? 38 MET A CA   16 
ATOM 9523  C C    . MET A 1 35 ? -0.130  -20.911 -3.621  1.00 0.00 ? 38 MET A C    16 
ATOM 9524  O O    . MET A 1 35 ? -0.029  -21.569 -4.656  1.00 0.00 ? 38 MET A O    16 
ATOM 9525  C CB   . MET A 1 35 ? -0.654  -18.566 -4.355  1.00 0.00 ? 38 MET A CB   16 
ATOM 9526  C CG   . MET A 1 35 ? -1.261  -18.508 -5.747  1.00 0.00 ? 38 MET A CG   16 
ATOM 9527  S SD   . MET A 1 35 ? -0.955  -16.933 -6.568  1.00 0.00 ? 38 MET A SD   16 
ATOM 9528  C CE   . MET A 1 35 ? -2.067  -15.855 -5.666  1.00 0.00 ? 38 MET A CE   16 
ATOM 9529  H H    . MET A 1 35 ? -0.852  -18.597 -1.768  1.00 0.00 ? 38 MET A H    16 
ATOM 9530  H HA   . MET A 1 35 ? -2.075  -20.099 -3.911  1.00 0.00 ? 38 MET A HA   16 
ATOM 9531  H HB2  . MET A 1 35 ? -0.912  -17.655 -3.837  1.00 0.00 ? 38 MET A HB2  16 
ATOM 9532  H HB3  . MET A 1 35 ? 0.420   -18.621 -4.455  1.00 0.00 ? 38 MET A HB3  16 
ATOM 9533  H HG2  . MET A 1 35 ? -0.833  -19.299 -6.346  1.00 0.00 ? 38 MET A HG2  16 
ATOM 9534  H HG3  . MET A 1 35 ? -2.328  -18.655 -5.668  1.00 0.00 ? 38 MET A HG3  16 
ATOM 9535  H HE1  . MET A 1 35 ? -3.080  -16.016 -6.009  1.00 0.00 ? 38 MET A HE1  16 
ATOM 9536  H HE2  . MET A 1 35 ? -1.789  -14.825 -5.836  1.00 0.00 ? 38 MET A HE2  16 
ATOM 9537  H HE3  . MET A 1 35 ? -2.004  -16.074 -4.611  1.00 0.00 ? 38 MET A HE3  16 
ATOM 9538  N N    . ALA A 1 36 ? 0.596   -21.153 -2.534  1.00 0.00 ? 39 ALA A N    16 
ATOM 9539  C CA   . ALA A 1 36 ? 1.583   -22.229 -2.483  1.00 0.00 ? 39 ALA A CA   16 
ATOM 9540  C C    . ALA A 1 36 ? 1.014   -23.483 -1.800  1.00 0.00 ? 39 ALA A C    16 
ATOM 9541  O O    . ALA A 1 36 ? 1.763   -24.313 -1.284  1.00 0.00 ? 39 ALA A O    16 
ATOM 9542  C CB   . ALA A 1 36 ? 2.838   -21.747 -1.765  1.00 0.00 ? 39 ALA A CB   16 
ATOM 9543  H H    . ALA A 1 36 ? 0.460   -20.598 -1.744  1.00 0.00 ? 39 ALA A H    16 
ATOM 9544  H HA   . ALA A 1 36 ? 1.855   -22.481 -3.498  1.00 0.00 ? 39 ALA A HA   16 
ATOM 9545  H HB1  . ALA A 1 36 ? 2.668   -21.751 -0.698  1.00 0.00 ? 39 ALA A HB1  16 
ATOM 9546  H HB2  . ALA A 1 36 ? 3.074   -20.744 -2.088  1.00 0.00 ? 39 ALA A HB2  16 
ATOM 9547  H HB3  . ALA A 1 36 ? 3.663   -22.404 -2.000  1.00 0.00 ? 39 ALA A HB3  16 
ATOM 9548  N N    . GLN A 1 37 ? -0.316  -23.613 -1.806  1.00 0.00 ? 40 GLN A N    16 
ATOM 9549  C CA   . GLN A 1 37 ? -0.982  -24.763 -1.196  1.00 0.00 ? 40 GLN A CA   16 
ATOM 9550  C C    . GLN A 1 37 ? -0.993  -25.960 -2.149  1.00 0.00 ? 40 GLN A C    16 
ATOM 9551  O O    . GLN A 1 37 ? -0.651  -27.074 -1.750  1.00 0.00 ? 40 GLN A O    16 
ATOM 9552  C CB   . GLN A 1 37 ? -2.416  -24.389 -0.793  1.00 0.00 ? 40 GLN A CB   16 
ATOM 9553  C CG   . GLN A 1 37 ? -3.298  -25.590 -0.469  1.00 0.00 ? 40 GLN A CG   16 
ATOM 9554  C CD   . GLN A 1 37 ? -4.516  -25.220 0.354   1.00 0.00 ? 40 GLN A CD   16 
ATOM 9555  O OE1  . GLN A 1 37 ? -5.633  -25.171 -0.154  1.00 0.00 ? 40 GLN A OE1  16 
ATOM 9556  N NE2  . GLN A 1 37 ? -4.310  -24.956 1.636   1.00 0.00 ? 40 GLN A NE2  16 
ATOM 9557  H H    . GLN A 1 37 ? -0.861  -22.923 -2.235  1.00 0.00 ? 40 GLN A H    16 
ATOM 9558  H HA   . GLN A 1 37 ? -0.429  -25.033 -0.309  1.00 0.00 ? 40 GLN A HA   16 
ATOM 9559  H HB2  . GLN A 1 37 ? -2.377  -23.752 0.078   1.00 0.00 ? 40 GLN A HB2  16 
ATOM 9560  H HB3  . GLN A 1 37 ? -2.874  -23.842 -1.606  1.00 0.00 ? 40 GLN A HB3  16 
ATOM 9561  H HG2  . GLN A 1 37 ? -3.634  -26.035 -1.395  1.00 0.00 ? 40 GLN A HG2  16 
ATOM 9562  H HG3  . GLN A 1 37 ? -2.715  -26.311 0.083   1.00 0.00 ? 40 GLN A HG3  16 
ATOM 9563  H HE21 . GLN A 1 37 ? -3.395  -25.012 1.981   1.00 0.00 ? 40 GLN A HE21 16 
ATOM 9564  H HE22 . GLN A 1 37 ? -5.083  -24.714 2.185   1.00 0.00 ? 40 GLN A HE22 16 
ATOM 9565  N N    . ILE A 1 38 ? -1.393  -25.710 -3.402  1.00 0.00 ? 41 ILE A N    16 
ATOM 9566  C CA   . ILE A 1 38 ? -1.464  -26.749 -4.437  1.00 0.00 ? 41 ILE A CA   16 
ATOM 9567  C C    . ILE A 1 38 ? -2.738  -27.589 -4.300  1.00 0.00 ? 41 ILE A C    16 
ATOM 9568  O O    . ILE A 1 38 ? -3.025  -28.065 -3.180  1.00 0.00 ? 41 ILE A O    16 
ATOM 9569  C CB   . ILE A 1 38 ? -0.227  -27.679 -4.418  1.00 0.00 ? 41 ILE A CB   16 
ATOM 9570  C CG1  . ILE A 1 38 ? 1.066   -26.858 -4.478  1.00 0.00 ? 41 ILE A CG1  16 
ATOM 9571  C CG2  . ILE A 1 38 ? -0.279  -28.664 -5.578  1.00 0.00 ? 41 ILE A CG2  16 
ATOM 9572  C CD1  . ILE A 1 38 ? 2.058   -27.209 -3.392  1.00 0.00 ? 41 ILE A CD1  16 
ATOM 9573  O OXT  . ILE A 1 38 ? -3.441  -27.757 -5.319  1.00 0.00 ? 41 ILE A OXT  16 
ATOM 9574  H H    . ILE A 1 38 ? -1.652  -24.797 -3.639  1.00 0.00 ? 41 ILE A H    16 
ATOM 9575  H HA   . ILE A 1 38 ? -1.490  -26.253 -5.395  1.00 0.00 ? 41 ILE A HA   16 
ATOM 9576  H HB   . ILE A 1 38 ? -0.246  -28.243 -3.499  1.00 0.00 ? 41 ILE A HB   16 
ATOM 9577  H HG12 . ILE A 1 38 ? 1.546   -27.025 -5.431  1.00 0.00 ? 41 ILE A HG12 16 
ATOM 9578  H HG13 . ILE A 1 38 ? 0.823   -25.809 -4.381  1.00 0.00 ? 41 ILE A HG13 16 
ATOM 9579  H HG21 . ILE A 1 38 ? -0.166  -28.129 -6.509  1.00 0.00 ? 41 ILE A HG21 16 
ATOM 9580  H HG22 . ILE A 1 38 ? -1.229  -29.178 -5.571  1.00 0.00 ? 41 ILE A HG22 16 
ATOM 9581  H HG23 . ILE A 1 38 ? 0.521   -29.382 -5.476  1.00 0.00 ? 41 ILE A HG23 16 
ATOM 9582  H HD11 . ILE A 1 38 ? 2.775   -27.921 -3.775  1.00 0.00 ? 41 ILE A HD11 16 
ATOM 9583  H HD12 . ILE A 1 38 ? 1.535   -27.641 -2.552  1.00 0.00 ? 41 ILE A HD12 16 
ATOM 9584  H HD13 . ILE A 1 38 ? 2.574   -26.314 -3.072  1.00 0.00 ? 41 ILE A HD13 16 
ATOM 9585  N N    . PHE A 1 1  ? -11.646 8.054   -10.502 1.00 0.00 ? 4  PHE A N    17 
ATOM 9586  C CA   . PHE A 1 1  ? -12.748 9.037   -10.717 1.00 0.00 ? 4  PHE A CA   17 
ATOM 9587  C C    . PHE A 1 1  ? -13.055 9.816   -9.436  1.00 0.00 ? 4  PHE A C    17 
ATOM 9588  O O    . PHE A 1 1  ? -12.498 9.517   -8.377  1.00 0.00 ? 4  PHE A O    17 
ATOM 9589  C CB   . PHE A 1 1  ? -13.996 8.281   -11.192 1.00 0.00 ? 4  PHE A CB   17 
ATOM 9590  C CG   . PHE A 1 1  ? -13.793 7.526   -12.476 1.00 0.00 ? 4  PHE A CG   17 
ATOM 9591  C CD1  . PHE A 1 1  ? -13.659 8.201   -13.679 1.00 0.00 ? 4  PHE A CD1  17 
ATOM 9592  C CD2  . PHE A 1 1  ? -13.733 6.142   -12.479 1.00 0.00 ? 4  PHE A CD2  17 
ATOM 9593  C CE1  . PHE A 1 1  ? -13.470 7.508   -14.860 1.00 0.00 ? 4  PHE A CE1  17 
ATOM 9594  C CE2  . PHE A 1 1  ? -13.544 5.445   -13.657 1.00 0.00 ? 4  PHE A CE2  17 
ATOM 9595  C CZ   . PHE A 1 1  ? -13.413 6.129   -14.849 1.00 0.00 ? 4  PHE A CZ   17 
ATOM 9596  H H1   . PHE A 1 1  ? -11.327 7.721   -11.435 1.00 0.00 ? 4  PHE A H1   17 
ATOM 9597  H H2   . PHE A 1 1  ? -12.026 7.267   -9.934  1.00 0.00 ? 4  PHE A H2   17 
ATOM 9598  H H3   . PHE A 1 1  ? -10.878 8.541   -9.996  1.00 0.00 ? 4  PHE A H3   17 
ATOM 9599  H HA   . PHE A 1 1  ? -12.441 9.734   -11.483 1.00 0.00 ? 4  PHE A HA   17 
ATOM 9600  H HB2  . PHE A 1 1  ? -14.292 7.571   -10.433 1.00 0.00 ? 4  PHE A HB2  17 
ATOM 9601  H HB3  . PHE A 1 1  ? -14.800 8.986   -11.346 1.00 0.00 ? 4  PHE A HB3  17 
ATOM 9602  H HD1  . PHE A 1 1  ? -13.705 9.279   -13.689 1.00 0.00 ? 4  PHE A HD1  17 
ATOM 9603  H HD2  . PHE A 1 1  ? -13.838 5.603   -11.548 1.00 0.00 ? 4  PHE A HD2  17 
ATOM 9604  H HE1  . PHE A 1 1  ? -13.367 8.046   -15.792 1.00 0.00 ? 4  PHE A HE1  17 
ATOM 9605  H HE2  . PHE A 1 1  ? -13.500 4.365   -13.646 1.00 0.00 ? 4  PHE A HE2  17 
ATOM 9606  H HZ   . PHE A 1 1  ? -13.265 5.586   -15.772 1.00 0.00 ? 4  PHE A HZ   17 
ATOM 9607  N N    . THR A 1 2  ? -13.942 10.812  -9.539  1.00 0.00 ? 5  THR A N    17 
ATOM 9608  C CA   . THR A 1 2  ? -14.334 11.641  -8.387  1.00 0.00 ? 5  THR A CA   17 
ATOM 9609  C C    . THR A 1 2  ? -13.116 12.139  -7.601  1.00 0.00 ? 5  THR A C    17 
ATOM 9610  O O    . THR A 1 2  ? -13.035 11.968  -6.382  1.00 0.00 ? 5  THR A O    17 
ATOM 9611  C CB   . THR A 1 2  ? -15.282 10.866  -7.457  1.00 0.00 ? 5  THR A CB   17 
ATOM 9612  O OG1  . THR A 1 2  ? -14.828 9.540   -7.243  1.00 0.00 ? 5  THR A OG1  17 
ATOM 9613  C CG2  . THR A 1 2  ? -16.695 10.775  -7.985  1.00 0.00 ? 5  THR A CG2  17 
ATOM 9614  H H    . THR A 1 2  ? -14.350 10.995  -10.412 1.00 0.00 ? 5  THR A H    17 
ATOM 9615  H HA   . THR A 1 2  ? -14.860 12.502  -8.773  1.00 0.00 ? 5  THR A HA   17 
ATOM 9616  H HB   . THR A 1 2  ? -15.321 11.370  -6.500  1.00 0.00 ? 5  THR A HB   17 
ATOM 9617  H HG1  . THR A 1 2  ? -13.876 9.545   -7.084  1.00 0.00 ? 5  THR A HG1  17 
ATOM 9618  H HG21 . THR A 1 2  ? -17.301 10.210  -7.293  1.00 0.00 ? 5  THR A HG21 17 
ATOM 9619  H HG22 . THR A 1 2  ? -16.689 10.279  -8.944  1.00 0.00 ? 5  THR A HG22 17 
ATOM 9620  H HG23 . THR A 1 2  ? -17.105 11.768  -8.095  1.00 0.00 ? 5  THR A HG23 17 
ATOM 9621  N N    . LEU A 1 3  ? -12.171 12.764  -8.303  1.00 0.00 ? 6  LEU A N    17 
ATOM 9622  C CA   . LEU A 1 3  ? -10.963 13.290  -7.664  1.00 0.00 ? 6  LEU A CA   17 
ATOM 9623  C C    . LEU A 1 3  ? -11.272 14.551  -6.848  1.00 0.00 ? 6  LEU A C    17 
ATOM 9624  O O    . LEU A 1 3  ? -10.791 15.643  -7.154  1.00 0.00 ? 6  LEU A O    17 
ATOM 9625  C CB   . LEU A 1 3  ? -9.891  13.583  -8.722  1.00 0.00 ? 6  LEU A CB   17 
ATOM 9626  C CG   . LEU A 1 3  ? -8.569  12.843  -8.521  1.00 0.00 ? 6  LEU A CG   17 
ATOM 9627  C CD1  . LEU A 1 3  ? -7.731  12.897  -9.785  1.00 0.00 ? 6  LEU A CD1  17 
ATOM 9628  C CD2  . LEU A 1 3  ? -7.800  13.433  -7.350  1.00 0.00 ? 6  LEU A CD2  17 
ATOM 9629  H H    . LEU A 1 3  ? -12.289 12.879  -9.268  1.00 0.00 ? 6  LEU A H    17 
ATOM 9630  H HA   . LEU A 1 3  ? -10.591 12.531  -6.992  1.00 0.00 ? 6  LEU A HA   17 
ATOM 9631  H HB2  . LEU A 1 3  ? -10.286 13.314  -9.691  1.00 0.00 ? 6  LEU A HB2  17 
ATOM 9632  H HB3  . LEU A 1 3  ? -9.686  14.643  -8.717  1.00 0.00 ? 6  LEU A HB3  17 
ATOM 9633  H HG   . LEU A 1 3  ? -8.774  11.806  -8.300  1.00 0.00 ? 6  LEU A HG   17 
ATOM 9634  H HD11 . LEU A 1 3  ? -8.145  12.224  -10.522 1.00 0.00 ? 6  LEU A HD11 17 
ATOM 9635  H HD12 . LEU A 1 3  ? -6.717  12.602  -9.557  1.00 0.00 ? 6  LEU A HD12 17 
ATOM 9636  H HD13 . LEU A 1 3  ? -7.733  13.903  -10.177 1.00 0.00 ? 6  LEU A HD13 17 
ATOM 9637  H HD21 . LEU A 1 3  ? -6.770  13.112  -7.397  1.00 0.00 ? 6  LEU A HD21 17 
ATOM 9638  H HD22 . LEU A 1 3  ? -8.239  13.096  -6.423  1.00 0.00 ? 6  LEU A HD22 17 
ATOM 9639  H HD23 . LEU A 1 3  ? -7.843  14.511  -7.398  1.00 0.00 ? 6  LEU A HD23 17 
ATOM 9640  N N    . SER A 1 4  ? -12.087 14.390  -5.805  1.00 0.00 ? 7  SER A N    17 
ATOM 9641  C CA   . SER A 1 4  ? -12.468 15.510  -4.944  1.00 0.00 ? 7  SER A CA   17 
ATOM 9642  C C    . SER A 1 4  ? -12.727 15.044  -3.507  1.00 0.00 ? 7  SER A C    17 
ATOM 9643  O O    . SER A 1 4  ? -13.796 15.295  -2.943  1.00 0.00 ? 7  SER A O    17 
ATOM 9644  C CB   . SER A 1 4  ? -13.711 16.207  -5.513  1.00 0.00 ? 7  SER A CB   17 
ATOM 9645  O OG   . SER A 1 4  ? -14.181 17.219  -4.638  1.00 0.00 ? 7  SER A OG   17 
ATOM 9646  H H    . SER A 1 4  ? -12.442 13.493  -5.612  1.00 0.00 ? 7  SER A H    17 
ATOM 9647  H HA   . SER A 1 4  ? -11.650 16.214  -4.936  1.00 0.00 ? 7  SER A HA   17 
ATOM 9648  H HB2  . SER A 1 4  ? -13.463 16.657  -6.463  1.00 0.00 ? 7  SER A HB2  17 
ATOM 9649  H HB3  . SER A 1 4  ? -14.496 15.477  -5.656  1.00 0.00 ? 7  SER A HB3  17 
ATOM 9650  H HG   . SER A 1 4  ? -14.424 16.826  -3.789  1.00 0.00 ? 7  SER A HG   17 
ATOM 9651  N N    . LEU A 1 5  ? -11.740 14.366  -2.919  1.00 0.00 ? 8  LEU A N    17 
ATOM 9652  C CA   . LEU A 1 5  ? -11.856 13.867  -1.547  1.00 0.00 ? 8  LEU A CA   17 
ATOM 9653  C C    . LEU A 1 5  ? -10.583 14.154  -0.740  1.00 0.00 ? 8  LEU A C    17 
ATOM 9654  O O    . LEU A 1 5  ? -10.133 13.317  0.042   1.00 0.00 ? 8  LEU A O    17 
ATOM 9655  C CB   . LEU A 1 5  ? -12.147 12.360  -1.557  1.00 0.00 ? 8  LEU A CB   17 
ATOM 9656  C CG   . LEU A 1 5  ? -13.410 11.941  -2.315  1.00 0.00 ? 8  LEU A CG   17 
ATOM 9657  C CD1  . LEU A 1 5  ? -13.064 10.971  -3.433  1.00 0.00 ? 8  LEU A CD1  17 
ATOM 9658  C CD2  . LEU A 1 5  ? -14.419 11.316  -1.365  1.00 0.00 ? 8  LEU A CD2  17 
ATOM 9659  H H    . LEU A 1 5  ? -10.914 14.200  -3.418  1.00 0.00 ? 8  LEU A H    17 
ATOM 9660  H HA   . LEU A 1 5  ? -12.681 14.379  -1.078  1.00 0.00 ? 8  LEU A HA   17 
ATOM 9661  H HB2  . LEU A 1 5  ? -11.301 11.856  -2.003  1.00 0.00 ? 8  LEU A HB2  17 
ATOM 9662  H HB3  . LEU A 1 5  ? -12.241 12.027  -0.534  1.00 0.00 ? 8  LEU A HB3  17 
ATOM 9663  H HG   . LEU A 1 5  ? -13.866 12.814  -2.758  1.00 0.00 ? 8  LEU A HG   17 
ATOM 9664  H HD11 . LEU A 1 5  ? -12.448 11.471  -4.164  1.00 0.00 ? 8  LEU A HD11 17 
ATOM 9665  H HD12 . LEU A 1 5  ? -13.974 10.626  -3.903  1.00 0.00 ? 8  LEU A HD12 17 
ATOM 9666  H HD13 . LEU A 1 5  ? -12.527 10.128  -3.024  1.00 0.00 ? 8  LEU A HD13 17 
ATOM 9667  H HD21 . LEU A 1 5  ? -14.929 12.094  -0.818  1.00 0.00 ? 8  LEU A HD21 17 
ATOM 9668  H HD22 . LEU A 1 5  ? -13.905 10.665  -0.672  1.00 0.00 ? 8  LEU A HD22 17 
ATOM 9669  H HD23 . LEU A 1 5  ? -15.138 10.741  -1.931  1.00 0.00 ? 8  LEU A HD23 17 
ATOM 9670  N N    . ASP A 1 6  ? -10.018 15.350  -0.941  1.00 0.00 ? 9  ASP A N    17 
ATOM 9671  C CA   . ASP A 1 6  ? -8.800  15.785  -0.250  1.00 0.00 ? 9  ASP A CA   17 
ATOM 9672  C C    . ASP A 1 6  ? -7.670  14.752  -0.363  1.00 0.00 ? 9  ASP A C    17 
ATOM 9673  O O    . ASP A 1 6  ? -7.536  13.852  0.469   1.00 0.00 ? 9  ASP A O    17 
ATOM 9674  C CB   . ASP A 1 6  ? -9.108  16.094  1.218   1.00 0.00 ? 9  ASP A CB   17 
ATOM 9675  C CG   . ASP A 1 6  ? -7.903  16.633  1.966   1.00 0.00 ? 9  ASP A CG   17 
ATOM 9676  O OD1  . ASP A 1 6  ? -7.193  17.497  1.407   1.00 0.00 ? 9  ASP A OD1  17 
ATOM 9677  O OD2  . ASP A 1 6  ? -7.668  16.193  3.109   1.00 0.00 ? 9  ASP A OD2  17 
ATOM 9678  H H    . ASP A 1 6  ? -10.439 15.964  -1.571  1.00 0.00 ? 9  ASP A H    17 
ATOM 9679  H HA   . ASP A 1 6  ? -8.469  16.694  -0.729  1.00 0.00 ? 9  ASP A HA   17 
ATOM 9680  H HB2  . ASP A 1 6  ? -9.895  16.830  1.266   1.00 0.00 ? 9  ASP A HB2  17 
ATOM 9681  H HB3  . ASP A 1 6  ? -9.437  15.190  1.702   1.00 0.00 ? 9  ASP A HB3  17 
ATOM 9682  N N    . VAL A 1 7  ? -6.851  14.899  -1.402  1.00 0.00 ? 10 VAL A N    17 
ATOM 9683  C CA   . VAL A 1 7  ? -5.727  13.994  -1.629  1.00 0.00 ? 10 VAL A CA   17 
ATOM 9684  C C    . VAL A 1 7  ? -4.386  14.747  -1.604  1.00 0.00 ? 10 VAL A C    17 
ATOM 9685  O O    . VAL A 1 7  ? -3.711  14.895  -2.626  1.00 0.00 ? 10 VAL A O    17 
ATOM 9686  C CB   . VAL A 1 7  ? -5.899  13.228  -2.964  1.00 0.00 ? 10 VAL A CB   17 
ATOM 9687  C CG1  . VAL A 1 7  ? -5.850  14.172  -4.158  1.00 0.00 ? 10 VAL A CG1  17 
ATOM 9688  C CG2  . VAL A 1 7  ? -4.851  12.133  -3.098  1.00 0.00 ? 10 VAL A CG2  17 
ATOM 9689  H H    . VAL A 1 7  ? -7.002  15.638  -2.026  1.00 0.00 ? 10 VAL A H    17 
ATOM 9690  H HA   . VAL A 1 7  ? -5.725  13.269  -0.828  1.00 0.00 ? 10 VAL A HA   17 
ATOM 9691  H HB   . VAL A 1 7  ? -6.873  12.760  -2.952  1.00 0.00 ? 10 VAL A HB   17 
ATOM 9692  H HG11 . VAL A 1 7  ? -6.651  13.932  -4.840  1.00 0.00 ? 10 VAL A HG11 17 
ATOM 9693  H HG12 . VAL A 1 7  ? -4.902  14.061  -4.664  1.00 0.00 ? 10 VAL A HG12 17 
ATOM 9694  H HG13 . VAL A 1 7  ? -5.959  15.190  -3.819  1.00 0.00 ? 10 VAL A HG13 17 
ATOM 9695  H HG21 . VAL A 1 7  ? -4.984  11.408  -2.308  1.00 0.00 ? 10 VAL A HG21 17 
ATOM 9696  H HG22 . VAL A 1 7  ? -3.865  12.569  -3.026  1.00 0.00 ? 10 VAL A HG22 17 
ATOM 9697  H HG23 . VAL A 1 7  ? -4.960  11.646  -4.056  1.00 0.00 ? 10 VAL A HG23 17 
ATOM 9698  N N    . PRO A 1 8  ? -3.983  15.244  -0.416  1.00 0.00 ? 11 PRO A N    17 
ATOM 9699  C CA   . PRO A 1 8  ? -2.727  15.993  -0.248  1.00 0.00 ? 11 PRO A CA   17 
ATOM 9700  C C    . PRO A 1 8  ? -1.482  15.161  -0.567  1.00 0.00 ? 11 PRO A C    17 
ATOM 9701  O O    . PRO A 1 8  ? -1.498  13.928  -0.482  1.00 0.00 ? 11 PRO A O    17 
ATOM 9702  C CB   . PRO A 1 8  ? -2.739  16.393  1.234   1.00 0.00 ? 11 PRO A CB   17 
ATOM 9703  C CG   . PRO A 1 8  ? -3.674  15.432  1.883   1.00 0.00 ? 11 PRO A CG   17 
ATOM 9704  C CD   . PRO A 1 8  ? -4.723  15.127  0.855   1.00 0.00 ? 11 PRO A CD   17 
ATOM 9705  H HA   . PRO A 1 8  ? -2.721  16.883  -0.859  1.00 0.00 ? 11 PRO A HA   17 
ATOM 9706  H HB2  . PRO A 1 8  ? -1.742  16.312  1.640   1.00 0.00 ? 11 PRO A HB2  17 
ATOM 9707  H HB3  . PRO A 1 8  ? -3.092  17.409  1.330   1.00 0.00 ? 11 PRO A HB3  17 
ATOM 9708  H HG2  . PRO A 1 8  ? -3.145  14.531  2.159   1.00 0.00 ? 11 PRO A HG2  17 
ATOM 9709  H HG3  . PRO A 1 8  ? -4.124  15.886  2.754   1.00 0.00 ? 11 PRO A HG3  17 
ATOM 9710  H HD2  . PRO A 1 8  ? -5.108  14.126  0.991   1.00 0.00 ? 11 PRO A HD2  17 
ATOM 9711  H HD3  . PRO A 1 8  ? -5.523  15.850  0.904   1.00 0.00 ? 11 PRO A HD3  17 
ATOM 9712  N N    . THR A 1 9  ? -0.399  15.853  -0.925  1.00 0.00 ? 12 THR A N    17 
ATOM 9713  C CA   . THR A 1 9  ? 0.874   15.204  -1.254  1.00 0.00 ? 12 THR A CA   17 
ATOM 9714  C C    . THR A 1 9  ? 1.288   14.215  -0.166  1.00 0.00 ? 12 THR A C    17 
ATOM 9715  O O    . THR A 1 9  ? 1.727   13.102  -0.464  1.00 0.00 ? 12 THR A O    17 
ATOM 9716  C CB   . THR A 1 9  ? 1.972   16.257  -1.449  1.00 0.00 ? 12 THR A CB   17 
ATOM 9717  O OG1  . THR A 1 9  ? 1.450   17.566  -1.294  1.00 0.00 ? 12 THR A OG1  17 
ATOM 9718  C CG2  . THR A 1 9  ? 2.631   16.191  -2.808  1.00 0.00 ? 12 THR A CG2  17 
ATOM 9719  H H    . THR A 1 9  ? -0.451  16.832  -0.965  1.00 0.00 ? 12 THR A H    17 
ATOM 9720  H HA   . THR A 1 9  ? 0.740   14.663  -2.178  1.00 0.00 ? 12 THR A HA   17 
ATOM 9721  H HB   . THR A 1 9  ? 2.739   16.106  -0.701  1.00 0.00 ? 12 THR A HB   17 
ATOM 9722  H HG1  . THR A 1 9  ? 2.172   18.201  -1.272  1.00 0.00 ? 12 THR A HG1  17 
ATOM 9723  H HG21 . THR A 1 9  ? 2.726   15.160  -3.114  1.00 0.00 ? 12 THR A HG21 17 
ATOM 9724  H HG22 . THR A 1 9  ? 3.610   16.643  -2.756  1.00 0.00 ? 12 THR A HG22 17 
ATOM 9725  H HG23 . THR A 1 9  ? 2.026   16.726  -3.526  1.00 0.00 ? 12 THR A HG23 17 
ATOM 9726  N N    . ASN A 1 10 ? 1.136   14.625  1.097   1.00 0.00 ? 13 ASN A N    17 
ATOM 9727  C CA   . ASN A 1 10 ? 1.486   13.767  2.232   1.00 0.00 ? 13 ASN A CA   17 
ATOM 9728  C C    . ASN A 1 10 ? 0.765   12.437  2.143   1.00 0.00 ? 13 ASN A C    17 
ATOM 9729  O O    . ASN A 1 10 ? 1.368   11.367  2.244   1.00 0.00 ? 13 ASN A O    17 
ATOM 9730  C CB   . ASN A 1 10 ? 1.159   14.466  3.560   1.00 0.00 ? 13 ASN A CB   17 
ATOM 9731  C CG   . ASN A 1 10 ? 1.888   15.788  3.723   1.00 0.00 ? 13 ASN A CG   17 
ATOM 9732  O OD1  . ASN A 1 10 ? 2.895   16.042  3.068   1.00 0.00 ? 13 ASN A OD1  17 
ATOM 9733  N ND2  . ASN A 1 10 ? 1.382   16.639  4.602   1.00 0.00 ? 13 ASN A ND2  17 
ATOM 9734  H H    . ASN A 1 10 ? 0.777   15.520  1.267   1.00 0.00 ? 13 ASN A H    17 
ATOM 9735  H HA   . ASN A 1 10 ? 2.524   13.577  2.182   1.00 0.00 ? 13 ASN A HA   17 
ATOM 9736  H HB2  . ASN A 1 10 ? 0.098   14.657  3.607   1.00 0.00 ? 13 ASN A HB2  17 
ATOM 9737  H HB3  . ASN A 1 10 ? 1.440   13.819  4.377   1.00 0.00 ? 13 ASN A HB3  17 
ATOM 9738  H HD21 . ASN A 1 10 ? 0.577   16.377  5.093   1.00 0.00 ? 13 ASN A HD21 17 
ATOM 9739  H HD22 . ASN A 1 10 ? 1.835   17.499  4.724   1.00 0.00 ? 13 ASN A HD22 17 
ATOM 9740  N N    . ILE A 1 11 ? -0.526  12.528  1.920   1.00 0.00 ? 14 ILE A N    17 
ATOM 9741  C CA   . ILE A 1 11 ? -1.380  11.358  1.775   1.00 0.00 ? 14 ILE A CA   17 
ATOM 9742  C C    . ILE A 1 11 ? -0.936  10.529  0.570   1.00 0.00 ? 14 ILE A C    17 
ATOM 9743  O O    . ILE A 1 11 ? -0.745  9.316   0.679   1.00 0.00 ? 14 ILE A O    17 
ATOM 9744  C CB   . ILE A 1 11 ? -2.854  11.794  1.624   1.00 0.00 ? 14 ILE A CB   17 
ATOM 9745  C CG1  . ILE A 1 11 ? -3.539  11.821  2.992   1.00 0.00 ? 14 ILE A CG1  17 
ATOM 9746  C CG2  . ILE A 1 11 ? -3.618  10.887  0.665   1.00 0.00 ? 14 ILE A CG2  17 
ATOM 9747  C CD1  . ILE A 1 11 ? -4.913  12.455  2.971   1.00 0.00 ? 14 ILE A CD1  17 
ATOM 9748  H H    . ILE A 1 11 ? -0.913  13.417  1.828   1.00 0.00 ? 14 ILE A H    17 
ATOM 9749  H HA   . ILE A 1 11 ? -1.283  10.757  2.667   1.00 0.00 ? 14 ILE A HA   17 
ATOM 9750  H HB   . ILE A 1 11 ? -2.849  12.794  1.216   1.00 0.00 ? 14 ILE A HB   17 
ATOM 9751  H HG12 . ILE A 1 11 ? -3.650  10.808  3.352   1.00 0.00 ? 14 ILE A HG12 17 
ATOM 9752  H HG13 . ILE A 1 11 ? -2.926  12.378  3.685   1.00 0.00 ? 14 ILE A HG13 17 
ATOM 9753  H HG21 . ILE A 1 11 ? -3.352  9.857   0.851   1.00 0.00 ? 14 ILE A HG21 17 
ATOM 9754  H HG22 . ILE A 1 11 ? -3.366  11.145  -0.354  1.00 0.00 ? 14 ILE A HG22 17 
ATOM 9755  H HG23 . ILE A 1 11 ? -4.680  11.018  0.816   1.00 0.00 ? 14 ILE A HG23 17 
ATOM 9756  H HD11 . ILE A 1 11 ? -5.540  11.983  3.713   1.00 0.00 ? 14 ILE A HD11 17 
ATOM 9757  H HD12 . ILE A 1 11 ? -5.355  12.325  1.994   1.00 0.00 ? 14 ILE A HD12 17 
ATOM 9758  H HD13 . ILE A 1 11 ? -4.828  13.509  3.190   1.00 0.00 ? 14 ILE A HD13 17 
ATOM 9759  N N    . MET A 1 12 ? -0.748  11.198  -0.571  1.00 0.00 ? 15 MET A N    17 
ATOM 9760  C CA   . MET A 1 12 ? -0.297  10.531  -1.784  1.00 0.00 ? 15 MET A CA   17 
ATOM 9761  C C    . MET A 1 12 ? 1.022   9.804   -1.524  1.00 0.00 ? 15 MET A C    17 
ATOM 9762  O O    . MET A 1 12 ? 1.167   8.623   -1.851  1.00 0.00 ? 15 MET A O    17 
ATOM 9763  C CB   . MET A 1 12 ? -0.138  11.556  -2.907  1.00 0.00 ? 15 MET A CB   17 
ATOM 9764  C CG   . MET A 1 12 ? -0.952  11.232  -4.146  1.00 0.00 ? 15 MET A CG   17 
ATOM 9765  S SD   . MET A 1 12 ? 0.077   10.846  -5.574  1.00 0.00 ? 15 MET A SD   17 
ATOM 9766  C CE   . MET A 1 12 ? -0.301  12.231  -6.645  1.00 0.00 ? 15 MET A CE   17 
ATOM 9767  H H    . MET A 1 12 ? -0.898  12.168  -0.592  1.00 0.00 ? 15 MET A H    17 
ATOM 9768  H HA   . MET A 1 12 ? -1.046  9.805   -2.067  1.00 0.00 ? 15 MET A HA   17 
ATOM 9769  H HB2  . MET A 1 12 ? -0.452  12.524  -2.542  1.00 0.00 ? 15 MET A HB2  17 
ATOM 9770  H HB3  . MET A 1 12 ? 0.901   11.610  -3.186  1.00 0.00 ? 15 MET A HB3  17 
ATOM 9771  H HG2  . MET A 1 12 ? -1.582  10.381  -3.933  1.00 0.00 ? 15 MET A HG2  17 
ATOM 9772  H HG3  . MET A 1 12 ? -1.572  12.084  -4.383  1.00 0.00 ? 15 MET A HG3  17 
ATOM 9773  H HE1  . MET A 1 12 ? -0.334  13.140  -6.061  1.00 0.00 ? 15 MET A HE1  17 
ATOM 9774  H HE2  . MET A 1 12 ? -1.260  12.070  -7.116  1.00 0.00 ? 15 MET A HE2  17 
ATOM 9775  H HE3  . MET A 1 12 ? 0.463   12.318  -7.403  1.00 0.00 ? 15 MET A HE3  17 
ATOM 9776  N N    . ASN A 1 13 ? 1.969   10.512  -0.901  1.00 0.00 ? 16 ASN A N    17 
ATOM 9777  C CA   . ASN A 1 13 ? 3.265   9.934   -0.559  1.00 0.00 ? 16 ASN A CA   17 
ATOM 9778  C C    . ASN A 1 13 ? 3.071   8.693   0.310   1.00 0.00 ? 16 ASN A C    17 
ATOM 9779  O O    . ASN A 1 13 ? 3.630   7.628   0.034   1.00 0.00 ? 16 ASN A O    17 
ATOM 9780  C CB   . ASN A 1 13 ? 4.131   10.965  0.172   1.00 0.00 ? 16 ASN A CB   17 
ATOM 9781  C CG   . ASN A 1 13 ? 5.600   10.843  -0.175  1.00 0.00 ? 16 ASN A CG   17 
ATOM 9782  O OD1  . ASN A 1 13 ? 6.356   10.171  0.518   1.00 0.00 ? 16 ASN A OD1  17 
ATOM 9783  N ND2  . ASN A 1 13 ? 6.012   11.493  -1.253  1.00 0.00 ? 16 ASN A ND2  17 
ATOM 9784  H H    . ASN A 1 13 ? 1.782   11.445  -0.648  1.00 0.00 ? 16 ASN A H    17 
ATOM 9785  H HA   . ASN A 1 13 ? 3.751   9.643   -1.473  1.00 0.00 ? 16 ASN A HA   17 
ATOM 9786  H HB2  . ASN A 1 13 ? 3.801   11.957  -0.094  1.00 0.00 ? 16 ASN A HB2  17 
ATOM 9787  H HB3  . ASN A 1 13 ? 4.021   10.829  1.238   1.00 0.00 ? 16 ASN A HB3  17 
ATOM 9788  H HD21 . ASN A 1 13 ? 5.355   12.011  -1.762  1.00 0.00 ? 16 ASN A HD21 17 
ATOM 9789  H HD22 . ASN A 1 13 ? 6.958   11.427  -1.494  1.00 0.00 ? 16 ASN A HD22 17 
ATOM 9790  N N    . LEU A 1 14 ? 2.249   8.839   1.348   1.00 0.00 ? 17 LEU A N    17 
ATOM 9791  C CA   . LEU A 1 14 ? 1.946   7.733   2.252   1.00 0.00 ? 17 LEU A CA   17 
ATOM 9792  C C    . LEU A 1 14 ? 1.270   6.600   1.488   1.00 0.00 ? 17 LEU A C    17 
ATOM 9793  O O    . LEU A 1 14 ? 1.698   5.447   1.567   1.00 0.00 ? 17 LEU A O    17 
ATOM 9794  C CB   . LEU A 1 14 ? 1.045   8.204   3.401   1.00 0.00 ? 17 LEU A CB   17 
ATOM 9795  C CG   . LEU A 1 14 ? 1.701   9.166   4.394   1.00 0.00 ? 17 LEU A CG   17 
ATOM 9796  C CD1  . LEU A 1 14 ? 0.667   9.710   5.365   1.00 0.00 ? 17 LEU A CD1  17 
ATOM 9797  C CD2  . LEU A 1 14 ? 2.824   8.473   5.148   1.00 0.00 ? 17 LEU A CD2  17 
ATOM 9798  H H    . LEU A 1 14 ? 1.820   9.712   1.497   1.00 0.00 ? 17 LEU A H    17 
ATOM 9799  H HA   . LEU A 1 14 ? 2.879   7.368   2.655   1.00 0.00 ? 17 LEU A HA   17 
ATOM 9800  H HB2  . LEU A 1 14 ? 0.183   8.695   2.974   1.00 0.00 ? 17 LEU A HB2  17 
ATOM 9801  H HB3  . LEU A 1 14 ? 0.710   7.334   3.946   1.00 0.00 ? 17 LEU A HB3  17 
ATOM 9802  H HG   . LEU A 1 14 ? 2.123   10.001  3.853   1.00 0.00 ? 17 LEU A HG   17 
ATOM 9803  H HD11 . LEU A 1 14 ? 0.008   8.913   5.673   1.00 0.00 ? 17 LEU A HD11 17 
ATOM 9804  H HD12 . LEU A 1 14 ? 0.094   10.487  4.882   1.00 0.00 ? 17 LEU A HD12 17 
ATOM 9805  H HD13 . LEU A 1 14 ? 1.168   10.118  6.231   1.00 0.00 ? 17 LEU A HD13 17 
ATOM 9806  H HD21 . LEU A 1 14 ? 3.502   8.013   4.444   1.00 0.00 ? 17 LEU A HD21 17 
ATOM 9807  H HD22 . LEU A 1 14 ? 2.409   7.715   5.795   1.00 0.00 ? 17 LEU A HD22 17 
ATOM 9808  H HD23 . LEU A 1 14 ? 3.360   9.199   5.742   1.00 0.00 ? 17 LEU A HD23 17 
ATOM 9809  N N    . LEU A 1 15 ? 0.226   6.937   0.728   1.00 0.00 ? 18 LEU A N    17 
ATOM 9810  C CA   . LEU A 1 15 ? -0.492  5.948   -0.069  1.00 0.00 ? 18 LEU A CA   17 
ATOM 9811  C C    . LEU A 1 15 ? 0.479   5.207   -0.983  1.00 0.00 ? 18 LEU A C    17 
ATOM 9812  O O    . LEU A 1 15 ? 0.471   3.974   -1.040  1.00 0.00 ? 18 LEU A O    17 
ATOM 9813  C CB   . LEU A 1 15 ? -1.595  6.627   -0.890  1.00 0.00 ? 18 LEU A CB   17 
ATOM 9814  C CG   . LEU A 1 15 ? -2.144  5.799   -2.052  1.00 0.00 ? 18 LEU A CG   17 
ATOM 9815  C CD1  . LEU A 1 15 ? -2.940  4.613   -1.535  1.00 0.00 ? 18 LEU A CD1  17 
ATOM 9816  C CD2  . LEU A 1 15 ? -3.003  6.659   -2.960  1.00 0.00 ? 18 LEU A CD2  17 
ATOM 9817  H H    . LEU A 1 15 ? -0.060  7.881   0.692   1.00 0.00 ? 18 LEU A H    17 
ATOM 9818  H HA   . LEU A 1 15 ? -0.936  5.238   0.608   1.00 0.00 ? 18 LEU A HA   17 
ATOM 9819  H HB2  . LEU A 1 15 ? -2.413  6.864   -0.225  1.00 0.00 ? 18 LEU A HB2  17 
ATOM 9820  H HB3  . LEU A 1 15 ? -1.201  7.548   -1.290  1.00 0.00 ? 18 LEU A HB3  17 
ATOM 9821  H HG   . LEU A 1 15 ? -1.318  5.419   -2.634  1.00 0.00 ? 18 LEU A HG   17 
ATOM 9822  H HD11 . LEU A 1 15 ? -3.411  4.107   -2.364  1.00 0.00 ? 18 LEU A HD11 17 
ATOM 9823  H HD12 . LEU A 1 15 ? -3.698  4.961   -0.848  1.00 0.00 ? 18 LEU A HD12 17 
ATOM 9824  H HD13 . LEU A 1 15 ? -2.278  3.929   -1.024  1.00 0.00 ? 18 LEU A HD13 17 
ATOM 9825  H HD21 . LEU A 1 15 ? -2.406  7.460   -3.369  1.00 0.00 ? 18 LEU A HD21 17 
ATOM 9826  H HD22 . LEU A 1 15 ? -3.823  7.074   -2.392  1.00 0.00 ? 18 LEU A HD22 17 
ATOM 9827  H HD23 . LEU A 1 15 ? -3.394  6.053   -3.765  1.00 0.00 ? 18 LEU A HD23 17 
ATOM 9828  N N    . PHE A 1 16 ? 1.329   5.967   -1.677  1.00 0.00 ? 19 PHE A N    17 
ATOM 9829  C CA   . PHE A 1 16 ? 2.330   5.388   -2.569  1.00 0.00 ? 19 PHE A CA   17 
ATOM 9830  C C    . PHE A 1 16 ? 3.154   4.337   -1.832  1.00 0.00 ? 19 PHE A C    17 
ATOM 9831  O O    . PHE A 1 16 ? 3.373   3.237   -2.340  1.00 0.00 ? 19 PHE A O    17 
ATOM 9832  C CB   . PHE A 1 16 ? 3.253   6.481   -3.114  1.00 0.00 ? 19 PHE A CB   17 
ATOM 9833  C CG   . PHE A 1 16 ? 3.693   6.242   -4.531  1.00 0.00 ? 19 PHE A CG   17 
ATOM 9834  C CD1  . PHE A 1 16 ? 4.620   5.255   -4.822  1.00 0.00 ? 19 PHE A CD1  17 
ATOM 9835  C CD2  . PHE A 1 16 ? 3.179   7.001   -5.569  1.00 0.00 ? 19 PHE A CD2  17 
ATOM 9836  C CE1  . PHE A 1 16 ? 5.028   5.029   -6.124  1.00 0.00 ? 19 PHE A CE1  17 
ATOM 9837  C CE2  . PHE A 1 16 ? 3.584   6.780   -6.873  1.00 0.00 ? 19 PHE A CE2  17 
ATOM 9838  C CZ   . PHE A 1 16 ? 4.509   5.793   -7.150  1.00 0.00 ? 19 PHE A CZ   17 
ATOM 9839  H H    . PHE A 1 16 ? 1.292   6.946   -1.571  1.00 0.00 ? 19 PHE A H    17 
ATOM 9840  H HA   . PHE A 1 16 ? 1.813   4.915   -3.392  1.00 0.00 ? 19 PHE A HA   17 
ATOM 9841  H HB2  . PHE A 1 16 ? 2.737   7.427   -3.078  1.00 0.00 ? 19 PHE A HB2  17 
ATOM 9842  H HB3  . PHE A 1 16 ? 4.138   6.538   -2.497  1.00 0.00 ? 19 PHE A HB3  17 
ATOM 9843  H HD1  . PHE A 1 16 ? 5.026   4.656   -4.020  1.00 0.00 ? 19 PHE A HD1  17 
ATOM 9844  H HD2  . PHE A 1 16 ? 2.457   7.774   -5.354  1.00 0.00 ? 19 PHE A HD2  17 
ATOM 9845  H HE1  . PHE A 1 16 ? 5.752   4.257   -6.338  1.00 0.00 ? 19 PHE A HE1  17 
ATOM 9846  H HE2  . PHE A 1 16 ? 3.175   7.380   -7.674  1.00 0.00 ? 19 PHE A HE2  17 
ATOM 9847  H HZ   . PHE A 1 16 ? 4.825   5.618   -8.167  1.00 0.00 ? 19 PHE A HZ   17 
ATOM 9848  N N    . ASN A 1 17 ? 3.590   4.679   -0.619  1.00 0.00 ? 20 ASN A N    17 
ATOM 9849  C CA   . ASN A 1 17 ? 4.370   3.767   0.202   1.00 0.00 ? 20 ASN A CA   17 
ATOM 9850  C C    . ASN A 1 17 ? 3.496   2.617   0.693   1.00 0.00 ? 20 ASN A C    17 
ATOM 9851  O O    . ASN A 1 17 ? 3.895   1.453   0.620   1.00 0.00 ? 20 ASN A O    17 
ATOM 9852  C CB   . ASN A 1 17 ? 4.976   4.523   1.382   1.00 0.00 ? 20 ASN A CB   17 
ATOM 9853  C CG   . ASN A 1 17 ? 6.417   4.145   1.626   1.00 0.00 ? 20 ASN A CG   17 
ATOM 9854  O OD1  . ASN A 1 17 ? 7.283   5.004   1.744   1.00 0.00 ? 20 ASN A OD1  17 
ATOM 9855  N ND2  . ASN A 1 17 ? 6.686   2.853   1.701   1.00 0.00 ? 20 ASN A ND2  17 
ATOM 9856  H H    . ASN A 1 17 ? 3.367   5.567   -0.258  1.00 0.00 ? 20 ASN A H    17 
ATOM 9857  H HA   . ASN A 1 17 ? 5.165   3.362   -0.410  1.00 0.00 ? 20 ASN A HA   17 
ATOM 9858  H HB2  . ASN A 1 17 ? 4.935   5.585   1.182   1.00 0.00 ? 20 ASN A HB2  17 
ATOM 9859  H HB3  . ASN A 1 17 ? 4.406   4.307   2.269   1.00 0.00 ? 20 ASN A HB3  17 
ATOM 9860  H HD21 . ASN A 1 17 ? 5.950   2.216   1.599   1.00 0.00 ? 20 ASN A HD21 17 
ATOM 9861  H HD22 . ASN A 1 17 ? 7.611   2.591   1.847   1.00 0.00 ? 20 ASN A HD22 17 
ATOM 9862  N N    . ILE A 1 18 ? 2.294   2.948   1.168   1.00 0.00 ? 21 ILE A N    17 
ATOM 9863  C CA   . ILE A 1 18 ? 1.354   1.936   1.641   1.00 0.00 ? 21 ILE A CA   17 
ATOM 9864  C C    . ILE A 1 18 ? 1.121   0.901   0.546   1.00 0.00 ? 21 ILE A C    17 
ATOM 9865  O O    . ILE A 1 18 ? 1.375   -0.285  0.746   1.00 0.00 ? 21 ILE A O    17 
ATOM 9866  C CB   . ILE A 1 18 ? 0.004   2.559   2.072   1.00 0.00 ? 21 ILE A CB   17 
ATOM 9867  C CG1  . ILE A 1 18 ? 0.166   3.309   3.397   1.00 0.00 ? 21 ILE A CG1  17 
ATOM 9868  C CG2  . ILE A 1 18 ? -1.074  1.489   2.199   1.00 0.00 ? 21 ILE A CG2  17 
ATOM 9869  C CD1  . ILE A 1 18 ? 0.611   2.427   4.545   1.00 0.00 ? 21 ILE A CD1  17 
ATOM 9870  H H    . ILE A 1 18 ? 2.028   3.899   1.183   1.00 0.00 ? 21 ILE A H    17 
ATOM 9871  H HA   . ILE A 1 18 ? 1.793   1.441   2.496   1.00 0.00 ? 21 ILE A HA   17 
ATOM 9872  H HB   . ILE A 1 18 ? -0.304  3.258   1.308   1.00 0.00 ? 21 ILE A HB   17 
ATOM 9873  H HG12 . ILE A 1 18 ? 0.903   4.089   3.274   1.00 0.00 ? 21 ILE A HG12 17 
ATOM 9874  H HG13 . ILE A 1 18 ? -0.780  3.754   3.667   1.00 0.00 ? 21 ILE A HG13 17 
ATOM 9875  H HG21 . ILE A 1 18 ? -0.689  0.655   2.767   1.00 0.00 ? 21 ILE A HG21 17 
ATOM 9876  H HG22 . ILE A 1 18 ? -1.367  1.151   1.216   1.00 0.00 ? 21 ILE A HG22 17 
ATOM 9877  H HG23 . ILE A 1 18 ? -1.933  1.904   2.707   1.00 0.00 ? 21 ILE A HG23 17 
ATOM 9878  H HD11 . ILE A 1 18 ? 0.255   1.420   4.385   1.00 0.00 ? 21 ILE A HD11 17 
ATOM 9879  H HD12 . ILE A 1 18 ? 0.206   2.809   5.470   1.00 0.00 ? 21 ILE A HD12 17 
ATOM 9880  H HD13 . ILE A 1 18 ? 1.689   2.424   4.599   1.00 0.00 ? 21 ILE A HD13 17 
ATOM 9881  N N    . ALA A 1 19 ? 0.679   1.364   -0.624  1.00 0.00 ? 22 ALA A N    17 
ATOM 9882  C CA   . ALA A 1 19 ? 0.457   0.473   -1.761  1.00 0.00 ? 22 ALA A CA   17 
ATOM 9883  C C    . ALA A 1 19 ? 1.736   -0.304  -2.081  1.00 0.00 ? 22 ALA A C    17 
ATOM 9884  O O    . ALA A 1 19 ? 1.691   -1.487  -2.433  1.00 0.00 ? 22 ALA A O    17 
ATOM 9885  C CB   . ALA A 1 19 ? -0.007  1.271   -2.974  1.00 0.00 ? 22 ALA A CB   17 
ATOM 9886  H H    . ALA A 1 19 ? 0.524   2.333   -0.733  1.00 0.00 ? 22 ALA A H    17 
ATOM 9887  H HA   . ALA A 1 19 ? -0.323  -0.227  -1.494  1.00 0.00 ? 22 ALA A HA   17 
ATOM 9888  H HB1  . ALA A 1 19 ? 0.826   1.827   -3.378  1.00 0.00 ? 22 ALA A HB1  17 
ATOM 9889  H HB2  . ALA A 1 19 ? -0.787  1.956   -2.678  1.00 0.00 ? 22 ALA A HB2  17 
ATOM 9890  H HB3  . ALA A 1 19 ? -0.388  0.595   -3.726  1.00 0.00 ? 22 ALA A HB3  17 
ATOM 9891  N N    . LYS A 1 20 ? 2.877   0.372   -1.939  1.00 0.00 ? 23 LYS A N    17 
ATOM 9892  C CA   . LYS A 1 20 ? 4.181   -0.235  -2.192  1.00 0.00 ? 23 LYS A CA   17 
ATOM 9893  C C    . LYS A 1 20 ? 4.463   -1.373  -1.207  1.00 0.00 ? 23 LYS A C    17 
ATOM 9894  O O    . LYS A 1 20 ? 4.927   -2.440  -1.604  1.00 0.00 ? 23 LYS A O    17 
ATOM 9895  C CB   . LYS A 1 20 ? 5.284   0.831   -2.102  1.00 0.00 ? 23 LYS A CB   17 
ATOM 9896  C CG   . LYS A 1 20 ? 6.087   1.006   -3.382  1.00 0.00 ? 23 LYS A CG   17 
ATOM 9897  C CD   . LYS A 1 20 ? 6.568   -0.327  -3.945  1.00 0.00 ? 23 LYS A CD   17 
ATOM 9898  C CE   . LYS A 1 20 ? 7.587   -0.991  -3.033  1.00 0.00 ? 23 LYS A CE   17 
ATOM 9899  N NZ   . LYS A 1 20 ? 8.405   -2.002  -3.763  1.00 0.00 ? 23 LYS A NZ   17 
ATOM 9900  H H    . LYS A 1 20 ? 2.841   1.309   -1.647  1.00 0.00 ? 23 LYS A H    17 
ATOM 9901  H HA   . LYS A 1 20 ? 4.161   -0.644  -3.188  1.00 0.00 ? 23 LYS A HA   17 
ATOM 9902  H HB2  . LYS A 1 20 ? 4.826   1.779   -1.865  1.00 0.00 ? 23 LYS A HB2  17 
ATOM 9903  H HB3  . LYS A 1 20 ? 5.964   0.569   -1.305  1.00 0.00 ? 23 LYS A HB3  17 
ATOM 9904  H HG2  . LYS A 1 20 ? 5.464   1.492   -4.119  1.00 0.00 ? 23 LYS A HG2  17 
ATOM 9905  H HG3  . LYS A 1 20 ? 6.945   1.629   -3.174  1.00 0.00 ? 23 LYS A HG3  17 
ATOM 9906  H HD2  . LYS A 1 20 ? 5.721   -0.985  -4.060  1.00 0.00 ? 23 LYS A HD2  17 
ATOM 9907  H HD3  . LYS A 1 20 ? 7.022   -0.154  -4.911  1.00 0.00 ? 23 LYS A HD3  17 
ATOM 9908  H HE2  . LYS A 1 20 ? 8.240   -0.230  -2.630  1.00 0.00 ? 23 LYS A HE2  17 
ATOM 9909  H HE3  . LYS A 1 20 ? 7.061   -1.479  -2.223  1.00 0.00 ? 23 LYS A HE3  17 
ATOM 9910  H HZ1  . LYS A 1 20 ? 7.820   -2.827  -4.012  1.00 0.00 ? 23 LYS A HZ1  17 
ATOM 9911  H HZ2  . LYS A 1 20 ? 9.197   -2.321  -3.169  1.00 0.00 ? 23 LYS A HZ2  17 
ATOM 9912  H HZ3  . LYS A 1 20 ? 8.790   -1.590  -4.637  1.00 0.00 ? 23 LYS A HZ3  17 
ATOM 9913  N N    . ALA A 1 21 ? 4.184   -1.139  0.072   1.00 0.00 ? 24 ALA A N    17 
ATOM 9914  C CA   . ALA A 1 21 ? 4.408   -2.150  1.103   1.00 0.00 ? 24 ALA A CA   17 
ATOM 9915  C C    . ALA A 1 21 ? 3.261   -3.165  1.154   1.00 0.00 ? 24 ALA A C    17 
ATOM 9916  O O    . ALA A 1 21 ? 3.488   -4.361  1.359   1.00 0.00 ? 24 ALA A O    17 
ATOM 9917  C CB   . ALA A 1 21 ? 4.591   -1.482  2.460   1.00 0.00 ? 24 ALA A CB   17 
ATOM 9918  H H    . ALA A 1 21 ? 3.817   -0.262  0.331   1.00 0.00 ? 24 ALA A H    17 
ATOM 9919  H HA   . ALA A 1 21 ? 5.322   -2.673  0.859   1.00 0.00 ? 24 ALA A HA   17 
ATOM 9920  H HB1  . ALA A 1 21 ? 5.158   -2.134  3.109   1.00 0.00 ? 24 ALA A HB1  17 
ATOM 9921  H HB2  . ALA A 1 21 ? 3.625   -1.287  2.900   1.00 0.00 ? 24 ALA A HB2  17 
ATOM 9922  H HB3  . ALA A 1 21 ? 5.123   -0.550  2.334   1.00 0.00 ? 24 ALA A HB3  17 
ATOM 9923  N N    . LYS A 1 22 ? 2.032   -2.681  0.960   1.00 0.00 ? 25 LYS A N    17 
ATOM 9924  C CA   . LYS A 1 22 ? 0.851   -3.532  0.980   1.00 0.00 ? 25 LYS A CA   17 
ATOM 9925  C C    . LYS A 1 22 ? 0.914   -4.583  -0.118  1.00 0.00 ? 25 LYS A C    17 
ATOM 9926  O O    . LYS A 1 22 ? 0.619   -5.755  0.120   1.00 0.00 ? 25 LYS A O    17 
ATOM 9927  C CB   . LYS A 1 22 ? -0.411  -2.681  0.822   1.00 0.00 ? 25 LYS A CB   17 
ATOM 9928  C CG   . LYS A 1 22 ? -1.474  -2.974  1.863   1.00 0.00 ? 25 LYS A CG   17 
ATOM 9929  C CD   . LYS A 1 22 ? -2.729  -3.549  1.226   1.00 0.00 ? 25 LYS A CD   17 
ATOM 9930  C CE   . LYS A 1 22 ? -3.784  -3.887  2.266   1.00 0.00 ? 25 LYS A CE   17 
ATOM 9931  N NZ   . LYS A 1 22 ? -3.785  -5.339  2.597   1.00 0.00 ? 25 LYS A NZ   17 
ATOM 9932  H H    . LYS A 1 22 ? 1.913   -1.720  0.792   1.00 0.00 ? 25 LYS A H    17 
ATOM 9933  H HA   . LYS A 1 22 ? 0.819   -4.033  1.937   1.00 0.00 ? 25 LYS A HA   17 
ATOM 9934  H HB2  . LYS A 1 22 ? -0.142  -1.638  0.904   1.00 0.00 ? 25 LYS A HB2  17 
ATOM 9935  H HB3  . LYS A 1 22 ? -0.835  -2.859  -0.156  1.00 0.00 ? 25 LYS A HB3  17 
ATOM 9936  H HG2  . LYS A 1 22 ? -1.077  -3.685  2.572   1.00 0.00 ? 25 LYS A HG2  17 
ATOM 9937  H HG3  . LYS A 1 22 ? -1.723  -2.055  2.372   1.00 0.00 ? 25 LYS A HG3  17 
ATOM 9938  H HD2  . LYS A 1 22 ? -3.138  -2.822  0.539   1.00 0.00 ? 25 LYS A HD2  17 
ATOM 9939  H HD3  . LYS A 1 22 ? -2.468  -4.448  0.685   1.00 0.00 ? 25 LYS A HD3  17 
ATOM 9940  H HE2  . LYS A 1 22 ? -3.582  -3.319  3.164   1.00 0.00 ? 25 LYS A HE2  17 
ATOM 9941  H HE3  . LYS A 1 22 ? -4.756  -3.611  1.879   1.00 0.00 ? 25 LYS A HE3  17 
ATOM 9942  H HZ1  . LYS A 1 22 ? -3.957  -5.902  1.737   1.00 0.00 ? 25 LYS A HZ1  17 
ATOM 9943  H HZ2  . LYS A 1 22 ? -4.533  -5.550  3.291   1.00 0.00 ? 25 LYS A HZ2  17 
ATOM 9944  H HZ3  . LYS A 1 22 ? -2.866  -5.616  2.998   1.00 0.00 ? 25 LYS A HZ3  17 
ATOM 9945  N N    . ASN A 1 23 ? 1.311   -4.168  -1.321  1.00 0.00 ? 26 ASN A N    17 
ATOM 9946  C CA   . ASN A 1 23 ? 1.412   -5.111  -2.434  1.00 0.00 ? 26 ASN A CA   17 
ATOM 9947  C C    . ASN A 1 23 ? 2.545   -6.109  -2.188  1.00 0.00 ? 26 ASN A C    17 
ATOM 9948  O O    . ASN A 1 23 ? 2.383   -7.307  -2.414  1.00 0.00 ? 26 ASN A O    17 
ATOM 9949  C CB   . ASN A 1 23 ? 1.595   -4.373  -3.771  1.00 0.00 ? 26 ASN A CB   17 
ATOM 9950  C CG   . ASN A 1 23 ? 3.043   -4.083  -4.105  1.00 0.00 ? 26 ASN A CG   17 
ATOM 9951  O OD1  . ASN A 1 23 ? 3.771   -4.952  -4.574  1.00 0.00 ? 26 ASN A OD1  17 
ATOM 9952  N ND2  . ASN A 1 23 ? 3.467   -2.858  -3.861  1.00 0.00 ? 26 ASN A ND2  17 
ATOM 9953  H H    . ASN A 1 23 ? 1.550   -3.216  -1.456  1.00 0.00 ? 26 ASN A H    17 
ATOM 9954  H HA   . ASN A 1 23 ? 0.483   -5.665  -2.470  1.00 0.00 ? 26 ASN A HA   17 
ATOM 9955  H HB2  . ASN A 1 23 ? 1.184   -4.977  -4.565  1.00 0.00 ? 26 ASN A HB2  17 
ATOM 9956  H HB3  . ASN A 1 23 ? 1.060   -3.435  -3.730  1.00 0.00 ? 26 ASN A HB3  17 
ATOM 9957  H HD21 . ASN A 1 23 ? 2.830   -2.213  -3.481  1.00 0.00 ? 26 ASN A HD21 17 
ATOM 9958  H HD22 . ASN A 1 23 ? 4.400   -2.648  -4.063  1.00 0.00 ? 26 ASN A HD22 17 
ATOM 9959  N N    . LEU A 1 24 ? 3.685   -5.608  -1.703  1.00 0.00 ? 27 LEU A N    17 
ATOM 9960  C CA   . LEU A 1 24 ? 4.840   -6.457  -1.409  1.00 0.00 ? 27 LEU A CA   17 
ATOM 9961  C C    . LEU A 1 24 ? 4.469   -7.587  -0.461  1.00 0.00 ? 27 LEU A C    17 
ATOM 9962  O O    . LEU A 1 24 ? 4.644   -8.765  -0.771  1.00 0.00 ? 27 LEU A O    17 
ATOM 9963  C CB   . LEU A 1 24 ? 5.978   -5.621  -0.809  1.00 0.00 ? 27 LEU A CB   17 
ATOM 9964  C CG   . LEU A 1 24 ? 6.785   -4.798  -1.814  1.00 0.00 ? 27 LEU A CG   17 
ATOM 9965  C CD1  . LEU A 1 24 ? 7.857   -3.990  -1.099  1.00 0.00 ? 27 LEU A CD1  17 
ATOM 9966  C CD2  . LEU A 1 24 ? 7.410   -5.702  -2.865  1.00 0.00 ? 27 LEU A CD2  17 
ATOM 9967  H H    . LEU A 1 24 ? 3.746   -4.645  -1.529  1.00 0.00 ? 27 LEU A H    17 
ATOM 9968  H HA   . LEU A 1 24 ? 5.168   -6.888  -2.325  1.00 0.00 ? 27 LEU A HA   17 
ATOM 9969  H HB2  . LEU A 1 24 ? 5.554   -4.945  -0.082  1.00 0.00 ? 27 LEU A HB2  17 
ATOM 9970  H HB3  . LEU A 1 24 ? 6.656   -6.288  -0.299  1.00 0.00 ? 27 LEU A HB3  17 
ATOM 9971  H HG   . LEU A 1 24 ? 6.124   -4.105  -2.313  1.00 0.00 ? 27 LEU A HG   17 
ATOM 9972  H HD11 . LEU A 1 24 ? 7.481   -3.000  -0.888  1.00 0.00 ? 27 LEU A HD11 17 
ATOM 9973  H HD12 . LEU A 1 24 ? 8.732   -3.918  -1.727  1.00 0.00 ? 27 LEU A HD12 17 
ATOM 9974  H HD13 . LEU A 1 24 ? 8.119   -4.481  -0.173  1.00 0.00 ? 27 LEU A HD13 17 
ATOM 9975  H HD21 . LEU A 1 24 ? 7.458   -6.713  -2.488  1.00 0.00 ? 27 LEU A HD21 17 
ATOM 9976  H HD22 . LEU A 1 24 ? 8.406   -5.355  -3.092  1.00 0.00 ? 27 LEU A HD22 17 
ATOM 9977  H HD23 . LEU A 1 24 ? 6.808   -5.681  -3.761  1.00 0.00 ? 27 LEU A HD23 17 
ATOM 9978  N N    . ARG A 1 25 ? 3.954   -7.209  0.692   1.00 0.00 ? 28 ARG A N    17 
ATOM 9979  C CA   . ARG A 1 25 ? 3.545   -8.172  1.720   1.00 0.00 ? 28 ARG A CA   17 
ATOM 9980  C C    . ARG A 1 25 ? 2.413   -9.072  1.233   1.00 0.00 ? 28 ARG A C    17 
ATOM 9981  O O    . ARG A 1 25 ? 2.437   -10.278 1.476   1.00 0.00 ? 28 ARG A O    17 
ATOM 9982  C CB   . ARG A 1 25 ? 3.127   -7.439  3.000   1.00 0.00 ? 28 ARG A CB   17 
ATOM 9983  C CG   . ARG A 1 25 ? 3.972   -7.804  4.211   1.00 0.00 ? 28 ARG A CG   17 
ATOM 9984  C CD   . ARG A 1 25 ? 3.108   -8.138  5.417   1.00 0.00 ? 28 ARG A CD   17 
ATOM 9985  N NE   . ARG A 1 25 ? 3.894   -8.761  6.488   1.00 0.00 ? 28 ARG A NE   17 
ATOM 9986  C CZ   . ARG A 1 25 ? 3.584   -8.708  7.779   1.00 0.00 ? 28 ARG A CZ   17 
ATOM 9987  N NH1  . ARG A 1 25 ? 2.489   -8.094  8.184   1.00 0.00 ? 28 ARG A NH1  17 
ATOM 9988  N NH2  . ARG A 1 25 ? 4.371   -9.284  8.667   1.00 0.00 ? 28 ARG A NH2  17 
ATOM 9989  H H    . ARG A 1 25 ? 3.849   -6.251  0.854   1.00 0.00 ? 28 ARG A H    17 
ATOM 9990  H HA   . ARG A 1 25 ? 4.395   -8.803  1.940   1.00 0.00 ? 28 ARG A HA   17 
ATOM 9991  H HB2  . ARG A 1 25 ? 3.212   -6.374  2.836   1.00 0.00 ? 28 ARG A HB2  17 
ATOM 9992  H HB3  . ARG A 1 25 ? 2.097   -7.678  3.219   1.00 0.00 ? 28 ARG A HB3  17 
ATOM 9993  H HG2  . ARG A 1 25 ? 4.581   -8.662  3.969   1.00 0.00 ? 28 ARG A HG2  17 
ATOM 9994  H HG3  . ARG A 1 25 ? 4.610   -6.967  4.458   1.00 0.00 ? 28 ARG A HG3  17 
ATOM 9995  H HD2  . ARG A 1 25 ? 2.664   -7.224  5.785   1.00 0.00 ? 28 ARG A HD2  17 
ATOM 9996  H HD3  . ARG A 1 25 ? 2.328   -8.821  5.107   1.00 0.00 ? 28 ARG A HD3  17 
ATOM 9997  H HE   . ARG A 1 25 ? 4.707   -9.239  6.225   1.00 0.00 ? 28 ARG A HE   17 
ATOM 9998  H HH11 . ARG A 1 25 ? 1.884   -7.664  7.518   1.00 0.00 ? 28 ARG A HH11 17 
ATOM 9999  H HH12 . ARG A 1 25 ? 2.267   -8.056  9.156   1.00 0.00 ? 28 ARG A HH12 17 
ATOM 10000 H HH21 . ARG A 1 25 ? 5.196   -9.758  8.368   1.00 0.00 ? 28 ARG A HH21 17 
ATOM 10001 H HH22 . ARG A 1 25 ? 4.143   -9.244  9.639   1.00 0.00 ? 28 ARG A HH22 17 
ATOM 10002 N N    . ALA A 1 26 ? 1.439   -8.499  0.530   1.00 0.00 ? 29 ALA A N    17 
ATOM 10003 C CA   . ALA A 1 26 ? 0.328   -9.284  0.007   1.00 0.00 ? 29 ALA A CA   17 
ATOM 10004 C C    . ALA A 1 26 ? 0.837   -10.276 -1.031  1.00 0.00 ? 29 ALA A C    17 
ATOM 10005 O O    . ALA A 1 26 ? 0.432   -11.438 -1.048  1.00 0.00 ? 29 ALA A O    17 
ATOM 10006 C CB   . ALA A 1 26 ? -0.735  -8.374  -0.591  1.00 0.00 ? 29 ALA A CB   17 
ATOM 10007 H H    . ALA A 1 26 ? 1.478   -7.537  0.341   1.00 0.00 ? 29 ALA A H    17 
ATOM 10008 H HA   . ALA A 1 26 ? -0.113  -9.832  0.828   1.00 0.00 ? 29 ALA A HA   17 
ATOM 10009 H HB1  . ALA A 1 26 ? -0.382  -7.973  -1.529  1.00 0.00 ? 29 ALA A HB1  17 
ATOM 10010 H HB2  . ALA A 1 26 ? -0.940  -7.562  0.092   1.00 0.00 ? 29 ALA A HB2  17 
ATOM 10011 H HB3  . ALA A 1 26 ? -1.641  -8.940  -0.758  1.00 0.00 ? 29 ALA A HB3  17 
ATOM 10012 N N    . GLN A 1 27 ? 1.742   -9.805  -1.885  1.00 0.00 ? 30 GLN A N    17 
ATOM 10013 C CA   . GLN A 1 27 ? 2.327   -10.641 -2.931  1.00 0.00 ? 30 GLN A CA   17 
ATOM 10014 C C    . GLN A 1 27 ? 3.320   -11.646 -2.360  1.00 0.00 ? 30 GLN A C    17 
ATOM 10015 O O    . GLN A 1 27 ? 3.402   -12.783 -2.823  1.00 0.00 ? 30 GLN A O    17 
ATOM 10016 C CB   . GLN A 1 27 ? 2.996   -9.760  -3.991  1.00 0.00 ? 30 GLN A CB   17 
ATOM 10017 C CG   . GLN A 1 27 ? 3.889   -10.522 -4.958  1.00 0.00 ? 30 GLN A CG   17 
ATOM 10018 C CD   . GLN A 1 27 ? 3.640   -10.145 -6.405  1.00 0.00 ? 30 GLN A CD   17 
ATOM 10019 O OE1  . GLN A 1 27 ? 3.906   -9.020  -6.817  1.00 0.00 ? 30 GLN A OE1  17 
ATOM 10020 N NE2  . GLN A 1 27 ? 3.127   -11.084 -7.185  1.00 0.00 ? 30 GLN A NE2  17 
ATOM 10021 H H    . GLN A 1 27 ? 2.027   -8.862  -1.807  1.00 0.00 ? 30 GLN A H    17 
ATOM 10022 H HA   . GLN A 1 27 ? 1.535   -11.193 -3.379  1.00 0.00 ? 30 GLN A HA   17 
ATOM 10023 H HB2  . GLN A 1 27 ? 2.226   -9.261  -4.562  1.00 0.00 ? 30 GLN A HB2  17 
ATOM 10024 H HB3  . GLN A 1 27 ? 3.598   -9.013  -3.492  1.00 0.00 ? 30 GLN A HB3  17 
ATOM 10025 H HG2  . GLN A 1 27 ? 4.921   -10.307 -4.722  1.00 0.00 ? 30 GLN A HG2  17 
ATOM 10026 H HG3  . GLN A 1 27 ? 3.707   -11.577 -4.838  1.00 0.00 ? 30 GLN A HG3  17 
ATOM 10027 H HE21 . GLN A 1 27 ? 2.938   -11.961 -6.795  1.00 0.00 ? 30 GLN A HE21 17 
ATOM 10028 H HE22 . GLN A 1 27 ? 2.960   -10.860 -8.123  1.00 0.00 ? 30 GLN A HE22 17 
ATOM 10029 N N    . ALA A 1 28 ? 4.051   -11.224 -1.348  1.00 0.00 ? 31 ALA A N    17 
ATOM 10030 C CA   . ALA A 1 28 ? 5.027   -12.088 -0.695  1.00 0.00 ? 31 ALA A CA   17 
ATOM 10031 C C    . ALA A 1 28 ? 4.310   -13.114 0.173   1.00 0.00 ? 31 ALA A C    17 
ATOM 10032 O O    . ALA A 1 28 ? 4.555   -14.318 0.065   1.00 0.00 ? 31 ALA A O    17 
ATOM 10033 C CB   . ALA A 1 28 ? 6.001   -11.261 0.137   1.00 0.00 ? 31 ALA A CB   17 
ATOM 10034 H H    . ALA A 1 28 ? 3.916   -10.312 -1.024  1.00 0.00 ? 31 ALA A H    17 
ATOM 10035 H HA   . ALA A 1 28 ? 5.586   -12.606 -1.461  1.00 0.00 ? 31 ALA A HA   17 
ATOM 10036 H HB1  . ALA A 1 28 ? 6.910   -11.825 0.292   1.00 0.00 ? 31 ALA A HB1  17 
ATOM 10037 H HB2  . ALA A 1 28 ? 5.554   -11.030 1.094   1.00 0.00 ? 31 ALA A HB2  17 
ATOM 10038 H HB3  . ALA A 1 28 ? 6.232   -10.345 -0.384  1.00 0.00 ? 31 ALA A HB3  17 
ATOM 10039 N N    . ALA A 1 29 ? 3.408   -12.624 1.022   1.00 0.00 ? 32 ALA A N    17 
ATOM 10040 C CA   . ALA A 1 29 ? 2.634   -13.494 1.904   1.00 0.00 ? 32 ALA A CA   17 
ATOM 10041 C C    . ALA A 1 29 ? 1.769   -14.479 1.110   1.00 0.00 ? 32 ALA A C    17 
ATOM 10042 O O    . ALA A 1 29 ? 1.782   -15.676 1.384   1.00 0.00 ? 32 ALA A O    17 
ATOM 10043 C CB   . ALA A 1 29 ? 1.770   -12.665 2.843   1.00 0.00 ? 32 ALA A CB   17 
ATOM 10044 H H    . ALA A 1 29 ? 3.253   -11.642 1.049   1.00 0.00 ? 32 ALA A H    17 
ATOM 10045 H HA   . ALA A 1 29 ? 3.332   -14.059 2.505   1.00 0.00 ? 32 ALA A HA   17 
ATOM 10046 H HB1  . ALA A 1 29 ? 2.402   -12.041 3.458   1.00 0.00 ? 32 ALA A HB1  17 
ATOM 10047 H HB2  . ALA A 1 29 ? 1.189   -13.322 3.473   1.00 0.00 ? 32 ALA A HB2  17 
ATOM 10048 H HB3  . ALA A 1 29 ? 1.106   -12.040 2.263   1.00 0.00 ? 32 ALA A HB3  17 
ATOM 10049 N N    . ALA A 1 30 ? 1.012   -13.973 0.130   1.00 0.00 ? 33 ALA A N    17 
ATOM 10050 C CA   . ALA A 1 30 ? 0.140   -14.825 -0.682  1.00 0.00 ? 33 ALA A CA   17 
ATOM 10051 C C    . ALA A 1 30 ? 0.921   -15.900 -1.423  1.00 0.00 ? 33 ALA A C    17 
ATOM 10052 O O    . ALA A 1 30 ? 0.560   -17.081 -1.405  1.00 0.00 ? 33 ALA A O    17 
ATOM 10053 C CB   . ALA A 1 30 ? -0.670  -13.982 -1.659  1.00 0.00 ? 33 ALA A CB   17 
ATOM 10054 H H    . ALA A 1 30 ? 1.036   -13.005 -0.047  1.00 0.00 ? 33 ALA A H    17 
ATOM 10055 H HA   . ALA A 1 30 ? -0.539  -15.311 -0.023  1.00 0.00 ? 33 ALA A HA   17 
ATOM 10056 H HB1  . ALA A 1 30 ? -1.320  -13.319 -1.108  1.00 0.00 ? 33 ALA A HB1  17 
ATOM 10057 H HB2  . ALA A 1 30 ? -1.264  -14.628 -2.288  1.00 0.00 ? 33 ALA A HB2  17 
ATOM 10058 H HB3  . ALA A 1 30 ? 0.001   -13.399 -2.273  1.00 0.00 ? 33 ALA A HB3  17 
ATOM 10059 N N    . ASN A 1 31 ? 1.989   -15.473 -2.066  1.00 0.00 ? 34 ASN A N    17 
ATOM 10060 C CA   . ASN A 1 31 ? 2.854   -16.370 -2.829  1.00 0.00 ? 34 ASN A CA   17 
ATOM 10061 C C    . ASN A 1 31 ? 3.482   -17.435 -1.927  1.00 0.00 ? 34 ASN A C    17 
ATOM 10062 O O    . ASN A 1 31 ? 3.540   -18.609 -2.289  1.00 0.00 ? 34 ASN A O    17 
ATOM 10063 C CB   . ASN A 1 31 ? 3.944   -15.558 -3.542  1.00 0.00 ? 34 ASN A CB   17 
ATOM 10064 C CG   . ASN A 1 31 ? 5.078   -16.418 -4.062  1.00 0.00 ? 34 ASN A CG   17 
ATOM 10065 O OD1  . ASN A 1 31 ? 5.051   -16.883 -5.196  1.00 0.00 ? 34 ASN A OD1  17 
ATOM 10066 N ND2  . ASN A 1 31 ? 6.083   -16.633 -3.230  1.00 0.00 ? 34 ASN A ND2  17 
ATOM 10067 H H    . ASN A 1 31 ? 2.204   -14.522 -2.021  1.00 0.00 ? 34 ASN A H    17 
ATOM 10068 H HA   . ASN A 1 31 ? 2.245   -16.864 -3.571  1.00 0.00 ? 34 ASN A HA   17 
ATOM 10069 H HB2  . ASN A 1 31 ? 3.506   -15.038 -4.380  1.00 0.00 ? 34 ASN A HB2  17 
ATOM 10070 H HB3  . ASN A 1 31 ? 4.353   -14.834 -2.853  1.00 0.00 ? 34 ASN A HB3  17 
ATOM 10071 H HD21 . ASN A 1 31 ? 6.044   -16.232 -2.337  1.00 0.00 ? 34 ASN A HD21 17 
ATOM 10072 H HD22 . ASN A 1 31 ? 6.824   -17.186 -3.542  1.00 0.00 ? 34 ASN A HD22 17 
ATOM 10073 N N    . ALA A 1 32 ? 3.955   -17.016 -0.754  1.00 0.00 ? 35 ALA A N    17 
ATOM 10074 C CA   . ALA A 1 32 ? 4.588   -17.936 0.189   1.00 0.00 ? 35 ALA A CA   17 
ATOM 10075 C C    . ALA A 1 32 ? 3.658   -18.307 1.352   1.00 0.00 ? 35 ALA A C    17 
ATOM 10076 O O    . ALA A 1 32 ? 4.056   -18.256 2.519   1.00 0.00 ? 35 ALA A O    17 
ATOM 10077 C CB   . ALA A 1 32 ? 5.887   -17.327 0.704   1.00 0.00 ? 35 ALA A CB   17 
ATOM 10078 H H    . ALA A 1 32 ? 3.881   -16.065 -0.521  1.00 0.00 ? 35 ALA A H    17 
ATOM 10079 H HA   . ALA A 1 32 ? 4.837   -18.838 -0.351  1.00 0.00 ? 35 ALA A HA   17 
ATOM 10080 H HB1  . ALA A 1 32 ? 6.701   -17.610 0.051   1.00 0.00 ? 35 ALA A HB1  17 
ATOM 10081 H HB2  . ALA A 1 32 ? 6.084   -17.689 1.702   1.00 0.00 ? 35 ALA A HB2  17 
ATOM 10082 H HB3  . ALA A 1 32 ? 5.798   -16.251 0.721   1.00 0.00 ? 35 ALA A HB3  17 
ATOM 10083 N N    . HIS A 1 33 ? 2.420   -18.691 1.034   1.00 0.00 ? 36 HIS A N    17 
ATOM 10084 C CA   . HIS A 1 33 ? 1.455   -19.077 2.068   1.00 0.00 ? 36 HIS A CA   17 
ATOM 10085 C C    . HIS A 1 33 ? 0.283   -19.884 1.498   1.00 0.00 ? 36 HIS A C    17 
ATOM 10086 O O    . HIS A 1 33 ? 0.147   -21.072 1.789   1.00 0.00 ? 36 HIS A O    17 
ATOM 10087 C CB   . HIS A 1 33 ? 0.933   -17.834 2.798   1.00 0.00 ? 36 HIS A CB   17 
ATOM 10088 C CG   . HIS A 1 33 ? 0.080   -18.148 3.985   1.00 0.00 ? 36 HIS A CG   17 
ATOM 10089 N ND1  . HIS A 1 33 ? -1.192  -17.646 4.149   1.00 0.00 ? 36 HIS A ND1  17 
ATOM 10090 C CD2  . HIS A 1 33 ? 0.323   -18.918 5.069   1.00 0.00 ? 36 HIS A CD2  17 
ATOM 10091 C CE1  . HIS A 1 33 ? -1.697  -18.094 5.286   1.00 0.00 ? 36 HIS A CE1  17 
ATOM 10092 N NE2  . HIS A 1 33 ? -0.797  -18.869 5.862   1.00 0.00 ? 36 HIS A NE2  17 
ATOM 10093 H H    . HIS A 1 33 ? 2.154   -18.720 0.091   1.00 0.00 ? 36 HIS A H    17 
ATOM 10094 H HA   . HIS A 1 33 ? 1.976   -19.698 2.781   1.00 0.00 ? 36 HIS A HA   17 
ATOM 10095 H HB2  . HIS A 1 33 ? 1.773   -17.249 3.140   1.00 0.00 ? 36 HIS A HB2  17 
ATOM 10096 H HB3  . HIS A 1 33 ? 0.346   -17.241 2.112   1.00 0.00 ? 36 HIS A HB3  17 
ATOM 10097 H HD1  . HIS A 1 33 ? -1.657  -17.049 3.527   1.00 0.00 ? 36 HIS A HD1  17 
ATOM 10098 H HD2  . HIS A 1 33 ? 1.230   -19.470 5.271   1.00 0.00 ? 36 HIS A HD2  17 
ATOM 10099 H HE1  . HIS A 1 33 ? -2.680  -17.865 5.676   1.00 0.00 ? 36 HIS A HE1  17 
ATOM 10100 H HE2  . HIS A 1 33 ? -0.950  -19.415 6.661   1.00 0.00 ? 36 HIS A HE2  17 
ATOM 10101 N N    . LEU A 1 34 ? -0.569  -19.234 0.703   1.00 0.00 ? 37 LEU A N    17 
ATOM 10102 C CA   . LEU A 1 34 ? -1.737  -19.905 0.121   1.00 0.00 ? 37 LEU A CA   17 
ATOM 10103 C C    . LEU A 1 34 ? -1.514  -20.328 -1.334  1.00 0.00 ? 37 LEU A C    17 
ATOM 10104 O O    . LEU A 1 34 ? -2.255  -21.157 -1.865  1.00 0.00 ? 37 LEU A O    17 
ATOM 10105 C CB   . LEU A 1 34 ? -2.971  -19.004 0.225   1.00 0.00 ? 37 LEU A CB   17 
ATOM 10106 C CG   . LEU A 1 34 ? -3.509  -18.804 1.643   1.00 0.00 ? 37 LEU A CG   17 
ATOM 10107 C CD1  . LEU A 1 34 ? -4.211  -17.462 1.764   1.00 0.00 ? 37 LEU A CD1  17 
ATOM 10108 C CD2  . LEU A 1 34 ? -4.456  -19.932 2.019   1.00 0.00 ? 37 LEU A CD2  17 
ATOM 10109 H H    . LEU A 1 34 ? -0.420  -18.283 0.516   1.00 0.00 ? 37 LEU A H    17 
ATOM 10110 H HA   . LEU A 1 34 ? -1.911  -20.793 0.696   1.00 0.00 ? 37 LEU A HA   17 
ATOM 10111 H HB2  . LEU A 1 34 ? -2.718  -18.035 -0.183  1.00 0.00 ? 37 LEU A HB2  17 
ATOM 10112 H HB3  . LEU A 1 34 ? -3.757  -19.434 -0.376  1.00 0.00 ? 37 LEU A HB3  17 
ATOM 10113 H HG   . LEU A 1 34 ? -2.684  -18.813 2.341   1.00 0.00 ? 37 LEU A HG   17 
ATOM 10114 H HD11 . LEU A 1 34 ? -3.481  -16.667 1.709   1.00 0.00 ? 37 LEU A HD11 17 
ATOM 10115 H HD12 . LEU A 1 34 ? -4.729  -17.410 2.710   1.00 0.00 ? 37 LEU A HD12 17 
ATOM 10116 H HD13 . LEU A 1 34 ? -4.921  -17.355 0.958   1.00 0.00 ? 37 LEU A HD13 17 
ATOM 10117 H HD21 . LEU A 1 34 ? -4.868  -19.744 2.999   1.00 0.00 ? 37 LEU A HD21 17 
ATOM 10118 H HD22 . LEU A 1 34 ? -3.916  -20.867 2.027   1.00 0.00 ? 37 LEU A HD22 17 
ATOM 10119 H HD23 . LEU A 1 34 ? -5.256  -19.985 1.296   1.00 0.00 ? 37 LEU A HD23 17 
ATOM 10120 N N    . MET A 1 35 ? -0.491  -19.763 -1.969  1.00 0.00 ? 38 MET A N    17 
ATOM 10121 C CA   . MET A 1 35 ? -0.173  -20.087 -3.363  1.00 0.00 ? 38 MET A CA   17 
ATOM 10122 C C    . MET A 1 35 ? 0.201   -21.562 -3.545  1.00 0.00 ? 38 MET A C    17 
ATOM 10123 O O    . MET A 1 35 ? 0.176   -22.084 -4.660  1.00 0.00 ? 38 MET A O    17 
ATOM 10124 C CB   . MET A 1 35 ? 0.960   -19.187 -3.867  1.00 0.00 ? 38 MET A CB   17 
ATOM 10125 C CG   . MET A 1 35 ? 0.641   -18.475 -5.173  1.00 0.00 ? 38 MET A CG   17 
ATOM 10126 S SD   . MET A 1 35 ? 1.938   -18.675 -6.406  1.00 0.00 ? 38 MET A SD   17 
ATOM 10127 C CE   . MET A 1 35 ? 1.507   -20.270 -7.095  1.00 0.00 ? 38 MET A CE   17 
ATOM 10128 H H    . MET A 1 35 ? 0.062   -19.115 -1.491  1.00 0.00 ? 38 MET A H    17 
ATOM 10129 H HA   . MET A 1 35 ? -1.053  -19.894 -3.944  1.00 0.00 ? 38 MET A HA   17 
ATOM 10130 H HB2  . MET A 1 35 ? 1.170   -18.439 -3.117  1.00 0.00 ? 38 MET A HB2  17 
ATOM 10131 H HB3  . MET A 1 35 ? 1.844   -19.789 -4.016  1.00 0.00 ? 38 MET A HB3  17 
ATOM 10132 H HG2  . MET A 1 35 ? -0.279  -18.877 -5.571  1.00 0.00 ? 38 MET A HG2  17 
ATOM 10133 H HG3  . MET A 1 35 ? 0.513   -17.422 -4.970  1.00 0.00 ? 38 MET A HG3  17 
ATOM 10134 H HE1  . MET A 1 35 ? 1.717   -21.044 -6.370  1.00 0.00 ? 38 MET A HE1  17 
ATOM 10135 H HE2  . MET A 1 35 ? 2.088   -20.446 -7.988  1.00 0.00 ? 38 MET A HE2  17 
ATOM 10136 H HE3  . MET A 1 35 ? 0.456   -20.284 -7.341  1.00 0.00 ? 38 MET A HE3  17 
ATOM 10137 N N    . ALA A 1 36 ? 0.533   -22.228 -2.445  1.00 0.00 ? 39 ALA A N    17 
ATOM 10138 C CA   . ALA A 1 36 ? 0.900   -23.642 -2.472  1.00 0.00 ? 39 ALA A CA   17 
ATOM 10139 C C    . ALA A 1 36 ? -0.126  -24.495 -1.716  1.00 0.00 ? 39 ALA A C    17 
ATOM 10140 O O    . ALA A 1 36 ? 0.227   -25.466 -1.046  1.00 0.00 ? 39 ALA A O    17 
ATOM 10141 C CB   . ALA A 1 36 ? 2.295   -23.827 -1.886  1.00 0.00 ? 39 ALA A CB   17 
ATOM 10142 H H    . ALA A 1 36 ? 0.522   -21.757 -1.592  1.00 0.00 ? 39 ALA A H    17 
ATOM 10143 H HA   . ALA A 1 36 ? 0.924   -23.962 -3.505  1.00 0.00 ? 39 ALA A HA   17 
ATOM 10144 H HB1  . ALA A 1 36 ? 2.304   -23.482 -0.863  1.00 0.00 ? 39 ALA A HB1  17 
ATOM 10145 H HB2  . ALA A 1 36 ? 3.006   -23.257 -2.465  1.00 0.00 ? 39 ALA A HB2  17 
ATOM 10146 H HB3  . ALA A 1 36 ? 2.562   -24.873 -1.916  1.00 0.00 ? 39 ALA A HB3  17 
ATOM 10147 N N    . GLN A 1 37 ? -1.401  -24.116 -1.826  1.00 0.00 ? 40 GLN A N    17 
ATOM 10148 C CA   . GLN A 1 37 ? -2.482  -24.838 -1.152  1.00 0.00 ? 40 GLN A CA   17 
ATOM 10149 C C    . GLN A 1 37 ? -2.770  -26.182 -1.829  1.00 0.00 ? 40 GLN A C    17 
ATOM 10150 O O    . GLN A 1 37 ? -2.744  -27.227 -1.178  1.00 0.00 ? 40 GLN A O    17 
ATOM 10151 C CB   . GLN A 1 37 ? -3.753  -23.982 -1.122  1.00 0.00 ? 40 GLN A CB   17 
ATOM 10152 C CG   . GLN A 1 37 ? -4.329  -23.793 0.275   1.00 0.00 ? 40 GLN A CG   17 
ATOM 10153 C CD   . GLN A 1 37 ? -5.809  -23.458 0.262   1.00 0.00 ? 40 GLN A CD   17 
ATOM 10154 O OE1  . GLN A 1 37 ? -6.631  -24.221 0.760   1.00 0.00 ? 40 GLN A OE1  17 
ATOM 10155 N NE2  . GLN A 1 37 ? -6.156  -22.313 -0.306  1.00 0.00 ? 40 GLN A NE2  17 
ATOM 10156 H H    . GLN A 1 37 ? -1.618  -23.329 -2.369  1.00 0.00 ? 40 GLN A H    17 
ATOM 10157 H HA   . GLN A 1 37 ? -2.167  -25.028 -0.136  1.00 0.00 ? 40 GLN A HA   17 
ATOM 10158 H HB2  . GLN A 1 37 ? -3.527  -23.007 -1.529  1.00 0.00 ? 40 GLN A HB2  17 
ATOM 10159 H HB3  . GLN A 1 37 ? -4.507  -24.452 -1.737  1.00 0.00 ? 40 GLN A HB3  17 
ATOM 10160 H HG2  . GLN A 1 37 ? -4.191  -24.705 0.834   1.00 0.00 ? 40 GLN A HG2  17 
ATOM 10161 H HG3  . GLN A 1 37 ? -3.799  -22.988 0.764   1.00 0.00 ? 40 GLN A HG3  17 
ATOM 10162 H HE21 . GLN A 1 37 ? -5.451  -21.748 -0.683  1.00 0.00 ? 40 GLN A HE21 17 
ATOM 10163 H HE22 . GLN A 1 37 ? -7.107  -22.080 -0.325  1.00 0.00 ? 40 GLN A HE22 17 
ATOM 10164 N N    . ILE A 1 38 ? -3.049  -26.145 -3.132  1.00 0.00 ? 41 ILE A N    17 
ATOM 10165 C CA   . ILE A 1 38 ? -3.345  -27.358 -3.893  1.00 0.00 ? 41 ILE A CA   17 
ATOM 10166 C C    . ILE A 1 38 ? -3.080  -27.157 -5.389  1.00 0.00 ? 41 ILE A C    17 
ATOM 10167 O O    . ILE A 1 38 ? -2.526  -28.085 -6.017  1.00 0.00 ? 41 ILE A O    17 
ATOM 10168 C CB   . ILE A 1 38 ? -4.810  -27.816 -3.672  1.00 0.00 ? 41 ILE A CB   17 
ATOM 10169 C CG1  . ILE A 1 38 ? -5.072  -29.155 -4.376  1.00 0.00 ? 41 ILE A CG1  17 
ATOM 10170 C CG2  . ILE A 1 38 ? -5.793  -26.749 -4.142  1.00 0.00 ? 41 ILE A CG2  17 
ATOM 10171 C CD1  . ILE A 1 38 ? -5.659  -29.022 -5.767  1.00 0.00 ? 41 ILE A CD1  17 
ATOM 10172 O OXT  . ILE A 1 38 ? -3.420  -26.075 -5.918  1.00 0.00 ? 41 ILE A OXT  17 
ATOM 10173 H H    . ILE A 1 38 ? -3.058  -25.282 -3.596  1.00 0.00 ? 41 ILE A H    17 
ATOM 10174 H HA   . ILE A 1 38 ? -2.692  -28.139 -3.532  1.00 0.00 ? 41 ILE A HA   17 
ATOM 10175 H HB   . ILE A 1 38 ? -4.956  -27.948 -2.609  1.00 0.00 ? 41 ILE A HB   17 
ATOM 10176 H HG12 . ILE A 1 38 ? -4.141  -29.694 -4.466  1.00 0.00 ? 41 ILE A HG12 17 
ATOM 10177 H HG13 . ILE A 1 38 ? -5.760  -29.737 -3.780  1.00 0.00 ? 41 ILE A HG13 17 
ATOM 10178 H HG21 . ILE A 1 38 ? -5.653  -25.849 -3.564  1.00 0.00 ? 41 ILE A HG21 17 
ATOM 10179 H HG22 . ILE A 1 38 ? -6.802  -27.107 -4.013  1.00 0.00 ? 41 ILE A HG22 17 
ATOM 10180 H HG23 . ILE A 1 38 ? -5.618  -26.535 -5.187  1.00 0.00 ? 41 ILE A HG23 17 
ATOM 10181 H HD11 . ILE A 1 38 ? -5.679  -29.989 -6.244  1.00 0.00 ? 41 ILE A HD11 17 
ATOM 10182 H HD12 . ILE A 1 38 ? -5.051  -28.344 -6.350  1.00 0.00 ? 41 ILE A HD12 17 
ATOM 10183 H HD13 . ILE A 1 38 ? -6.665  -28.633 -5.696  1.00 0.00 ? 41 ILE A HD13 17 
ATOM 10184 N N    . PHE A 1 1  ? -13.505 15.555  9.448   1.00 0.00 ? 4  PHE A N    18 
ATOM 10185 C CA   . PHE A 1 1  ? -13.097 15.915  8.059   1.00 0.00 ? 4  PHE A CA   18 
ATOM 10186 C C    . PHE A 1 1  ? -14.314 16.204  7.180   1.00 0.00 ? 4  PHE A C    18 
ATOM 10187 O O    . PHE A 1 1  ? -15.428 15.794  7.501   1.00 0.00 ? 4  PHE A O    18 
ATOM 10188 C CB   . PHE A 1 1  ? -12.283 14.755  7.471   1.00 0.00 ? 4  PHE A CB   18 
ATOM 10189 C CG   . PHE A 1 1  ? -10.848 14.741  7.913   1.00 0.00 ? 4  PHE A CG   18 
ATOM 10190 C CD1  . PHE A 1 1  ? -9.997  15.784  7.584   1.00 0.00 ? 4  PHE A CD1  18 
ATOM 10191 C CD2  . PHE A 1 1  ? -10.350 13.686  8.658   1.00 0.00 ? 4  PHE A CD2  18 
ATOM 10192 C CE1  . PHE A 1 1  ? -8.677  15.775  7.989   1.00 0.00 ? 4  PHE A CE1  18 
ATOM 10193 C CE2  . PHE A 1 1  ? -9.030  13.670  9.068   1.00 0.00 ? 4  PHE A CE2  18 
ATOM 10194 C CZ   . PHE A 1 1  ? -8.193  14.716  8.732   1.00 0.00 ? 4  PHE A CZ   18 
ATOM 10195 H H1   . PHE A 1 1  ? -12.666 15.193  9.944   1.00 0.00 ? 4  PHE A H1   18 
ATOM 10196 H H2   . PHE A 1 1  ? -14.248 14.827  9.382   1.00 0.00 ? 4  PHE A H2   18 
ATOM 10197 H H3   . PHE A 1 1  ? -13.866 16.415  9.907   1.00 0.00 ? 4  PHE A H3   18 
ATOM 10198 H HA   . PHE A 1 1  ? -12.477 16.799  8.101   1.00 0.00 ? 4  PHE A HA   18 
ATOM 10199 H HB2  . PHE A 1 1  ? -12.732 13.820  7.769   1.00 0.00 ? 4  PHE A HB2  18 
ATOM 10200 H HB3  . PHE A 1 1  ? -12.298 14.825  6.392   1.00 0.00 ? 4  PHE A HB3  18 
ATOM 10201 H HD1  . PHE A 1 1  ? -10.374 16.613  7.002   1.00 0.00 ? 4  PHE A HD1  18 
ATOM 10202 H HD2  . PHE A 1 1  ? -11.002 12.866  8.920   1.00 0.00 ? 4  PHE A HD2  18 
ATOM 10203 H HE1  . PHE A 1 1  ? -8.025  16.594  7.725   1.00 0.00 ? 4  PHE A HE1  18 
ATOM 10204 H HE2  . PHE A 1 1  ? -8.652  12.841  9.648   1.00 0.00 ? 4  PHE A HE2  18 
ATOM 10205 H HZ   . PHE A 1 1  ? -7.160  14.707  9.051   1.00 0.00 ? 4  PHE A HZ   18 
ATOM 10206 N N    . THR A 1 2  ? -14.089 16.908  6.068   1.00 0.00 ? 5  THR A N    18 
ATOM 10207 C CA   . THR A 1 2  ? -15.164 17.251  5.134   1.00 0.00 ? 5  THR A CA   18 
ATOM 10208 C C    . THR A 1 2  ? -14.607 17.914  3.873   1.00 0.00 ? 5  THR A C    18 
ATOM 10209 O O    . THR A 1 2  ? -13.775 18.817  3.958   1.00 0.00 ? 5  THR A O    18 
ATOM 10210 C CB   . THR A 1 2  ? -16.190 18.174  5.803   1.00 0.00 ? 5  THR A CB   18 
ATOM 10211 O OG1  . THR A 1 2  ? -17.323 18.340  4.970   1.00 0.00 ? 5  THR A OG1  18 
ATOM 10212 C CG2  . THR A 1 2  ? -15.653 19.554  6.118   1.00 0.00 ? 5  THR A CG2  18 
ATOM 10213 H H    . THR A 1 2  ? -13.176 17.203  5.865   1.00 0.00 ? 5  THR A H    18 
ATOM 10214 H HA   . THR A 1 2  ? -15.656 16.333  4.851   1.00 0.00 ? 5  THR A HA   18 
ATOM 10215 H HB   . THR A 1 2  ? -16.513 17.723  6.731   1.00 0.00 ? 5  THR A HB   18 
ATOM 10216 H HG1  . THR A 1 2  ? -18.005 18.819  5.447   1.00 0.00 ? 5  THR A HG1  18 
ATOM 10217 H HG21 . THR A 1 2  ? -14.587 19.497  6.283   1.00 0.00 ? 5  THR A HG21 18 
ATOM 10218 H HG22 . THR A 1 2  ? -16.136 19.934  7.006   1.00 0.00 ? 5  THR A HG22 18 
ATOM 10219 H HG23 . THR A 1 2  ? -15.853 20.216  5.288   1.00 0.00 ? 5  THR A HG23 18 
ATOM 10220 N N    . LEU A 1 3  ? -15.077 17.447  2.712   1.00 0.00 ? 6  LEU A N    18 
ATOM 10221 C CA   . LEU A 1 3  ? -14.655 17.967  1.399   1.00 0.00 ? 6  LEU A CA   18 
ATOM 10222 C C    . LEU A 1 3  ? -13.187 18.431  1.384   1.00 0.00 ? 6  LEU A C    18 
ATOM 10223 O O    . LEU A 1 3  ? -12.902 19.628  1.312   1.00 0.00 ? 6  LEU A O    18 
ATOM 10224 C CB   . LEU A 1 3  ? -15.586 19.106  0.953   1.00 0.00 ? 6  LEU A CB   18 
ATOM 10225 C CG   . LEU A 1 3  ? -15.718 20.280  1.930   1.00 0.00 ? 6  LEU A CG   18 
ATOM 10226 C CD1  . LEU A 1 3  ? -15.355 21.587  1.244   1.00 0.00 ? 6  LEU A CD1  18 
ATOM 10227 C CD2  . LEU A 1 3  ? -17.128 20.352  2.491   1.00 0.00 ? 6  LEU A CD2  18 
ATOM 10228 H H    . LEU A 1 3  ? -15.737 16.724  2.737   1.00 0.00 ? 6  LEU A H    18 
ATOM 10229 H HA   . LEU A 1 3  ? -14.752 17.155  0.691   1.00 0.00 ? 6  LEU A HA   18 
ATOM 10230 H HB2  . LEU A 1 3  ? -15.218 19.491  0.012   1.00 0.00 ? 6  LEU A HB2  18 
ATOM 10231 H HB3  . LEU A 1 3  ? -16.569 18.692  0.790   1.00 0.00 ? 6  LEU A HB3  18 
ATOM 10232 H HG   . LEU A 1 3  ? -15.035 20.137  2.754   1.00 0.00 ? 6  LEU A HG   18 
ATOM 10233 H HD11 . LEU A 1 3  ? -14.354 21.518  0.845   1.00 0.00 ? 6  LEU A HD11 18 
ATOM 10234 H HD12 . LEU A 1 3  ? -15.402 22.393  1.960   1.00 0.00 ? 6  LEU A HD12 18 
ATOM 10235 H HD13 . LEU A 1 3  ? -16.052 21.777  0.440   1.00 0.00 ? 6  LEU A HD13 18 
ATOM 10236 H HD21 . LEU A 1 3  ? -17.367 19.422  2.985   1.00 0.00 ? 6  LEU A HD21 18 
ATOM 10237 H HD22 . LEU A 1 3  ? -17.828 20.520  1.685   1.00 0.00 ? 6  LEU A HD22 18 
ATOM 10238 H HD23 . LEU A 1 3  ? -17.193 21.163  3.200   1.00 0.00 ? 6  LEU A HD23 18 
ATOM 10239 N N    . SER A 1 4  ? -12.261 17.469  1.442   1.00 0.00 ? 7  SER A N    18 
ATOM 10240 C CA   . SER A 1 4  ? -10.825 17.776  1.427   1.00 0.00 ? 7  SER A CA   18 
ATOM 10241 C C    . SER A 1 4  ? -9.979  16.497  1.452   1.00 0.00 ? 7  SER A C    18 
ATOM 10242 O O    . SER A 1 4  ? -9.294  16.210  2.439   1.00 0.00 ? 7  SER A O    18 
ATOM 10243 C CB   . SER A 1 4  ? -10.461 18.676  2.619   1.00 0.00 ? 7  SER A CB   18 
ATOM 10244 O OG   . SER A 1 4  ? -9.054  18.761  2.798   1.00 0.00 ? 7  SER A OG   18 
ATOM 10245 H H    . SER A 1 4  ? -12.549 16.534  1.490   1.00 0.00 ? 7  SER A H    18 
ATOM 10246 H HA   . SER A 1 4  ? -10.611 18.310  0.512   1.00 0.00 ? 7  SER A HA   18 
ATOM 10247 H HB2  . SER A 1 4  ? -10.849 19.670  2.446   1.00 0.00 ? 7  SER A HB2  18 
ATOM 10248 H HB3  . SER A 1 4  ? -10.903 18.271  3.519   1.00 0.00 ? 7  SER A HB3  18 
ATOM 10249 H HG   . SER A 1 4  ? -8.691  17.877  2.937   1.00 0.00 ? 7  SER A HG   18 
ATOM 10250 N N    . LEU A 1 5  ? -10.029 15.728  0.362   1.00 0.00 ? 8  LEU A N    18 
ATOM 10251 C CA   . LEU A 1 5  ? -9.264  14.482  0.273   1.00 0.00 ? 8  LEU A CA   18 
ATOM 10252 C C    . LEU A 1 5  ? -8.693  14.256  -1.133  1.00 0.00 ? 8  LEU A C    18 
ATOM 10253 O O    . LEU A 1 5  ? -8.659  13.127  -1.630  1.00 0.00 ? 8  LEU A O    18 
ATOM 10254 C CB   . LEU A 1 5  ? -10.141 13.297  0.689   1.00 0.00 ? 8  LEU A CB   18 
ATOM 10255 C CG   . LEU A 1 5  ? -10.297 13.104  2.199   1.00 0.00 ? 8  LEU A CG   18 
ATOM 10256 C CD1  . LEU A 1 5  ? -11.423 12.129  2.498   1.00 0.00 ? 8  LEU A CD1  18 
ATOM 10257 C CD2  . LEU A 1 5  ? -8.994  12.616  2.810   1.00 0.00 ? 8  LEU A CD2  18 
ATOM 10258 H H    . LEU A 1 5  ? -10.588 16.004  -0.394  1.00 0.00 ? 8  LEU A H    18 
ATOM 10259 H HA   . LEU A 1 5  ? -8.437  14.559  0.962   1.00 0.00 ? 8  LEU A HA   18 
ATOM 10260 H HB2  . LEU A 1 5  ? -11.123 13.436  0.260   1.00 0.00 ? 8  LEU A HB2  18 
ATOM 10261 H HB3  . LEU A 1 5  ? -9.714  12.395  0.276   1.00 0.00 ? 8  LEU A HB3  18 
ATOM 10262 H HG   . LEU A 1 5  ? -10.546 14.053  2.652   1.00 0.00 ? 8  LEU A HG   18 
ATOM 10263 H HD11 . LEU A 1 5  ? -11.507 11.418  1.690   1.00 0.00 ? 8  LEU A HD11 18 
ATOM 10264 H HD12 . LEU A 1 5  ? -12.350 12.672  2.599   1.00 0.00 ? 8  LEU A HD12 18 
ATOM 10265 H HD13 . LEU A 1 5  ? -11.210 11.606  3.418   1.00 0.00 ? 8  LEU A HD13 18 
ATOM 10266 H HD21 . LEU A 1 5  ? -8.358  13.463  3.025   1.00 0.00 ? 8  LEU A HD21 18 
ATOM 10267 H HD22 . LEU A 1 5  ? -8.494  11.957  2.116   1.00 0.00 ? 8  LEU A HD22 18 
ATOM 10268 H HD23 . LEU A 1 5  ? -9.203  12.082  3.725   1.00 0.00 ? 8  LEU A HD23 18 
ATOM 10269 N N    . ASP A 1 6  ? -8.222  15.331  -1.762  1.00 0.00 ? 9  ASP A N    18 
ATOM 10270 C CA   . ASP A 1 6  ? -7.636  15.254  -3.100  1.00 0.00 ? 9  ASP A CA   18 
ATOM 10271 C C    . ASP A 1 6  ? -6.225  14.650  -3.046  1.00 0.00 ? 9  ASP A C    18 
ATOM 10272 O O    . ASP A 1 6  ? -5.261  15.248  -3.524  1.00 0.00 ? 9  ASP A O    18 
ATOM 10273 C CB   . ASP A 1 6  ? -7.605  16.651  -3.740  1.00 0.00 ? 9  ASP A CB   18 
ATOM 10274 C CG   . ASP A 1 6  ? -7.273  17.750  -2.751  1.00 0.00 ? 9  ASP A CG   18 
ATOM 10275 O OD1  . ASP A 1 6  ? -8.180  18.155  -1.993  1.00 0.00 ? 9  ASP A OD1  18 
ATOM 10276 O OD2  . ASP A 1 6  ? -6.108  18.194  -2.724  1.00 0.00 ? 9  ASP A OD2  18 
ATOM 10277 H H    . ASP A 1 6  ? -8.257  16.198  -1.312  1.00 0.00 ? 9  ASP A H    18 
ATOM 10278 H HA   . ASP A 1 6  ? -8.263  14.610  -3.698  1.00 0.00 ? 9  ASP A HA   18 
ATOM 10279 H HB2  . ASP A 1 6  ? -6.859  16.664  -4.514  1.00 0.00 ? 9  ASP A HB2  18 
ATOM 10280 H HB3  . ASP A 1 6  ? -8.570  16.863  -4.174  1.00 0.00 ? 9  ASP A HB3  18 
ATOM 10281 N N    . VAL A 1 7  ? -6.139  13.446  -2.463  1.00 0.00 ? 10 VAL A N    18 
ATOM 10282 C CA   . VAL A 1 7  ? -4.890  12.692  -2.310  1.00 0.00 ? 10 VAL A CA   18 
ATOM 10283 C C    . VAL A 1 7  ? -3.632  13.552  -2.530  1.00 0.00 ? 10 VAL A C    18 
ATOM 10284 O O    . VAL A 1 7  ? -2.888  13.363  -3.497  1.00 0.00 ? 10 VAL A O    18 
ATOM 10285 C CB   . VAL A 1 7  ? -4.891  11.475  -3.258  1.00 0.00 ? 10 VAL A CB   18 
ATOM 10286 C CG1  . VAL A 1 7  ? -3.594  10.682  -3.154  1.00 0.00 ? 10 VAL A CG1  18 
ATOM 10287 C CG2  . VAL A 1 7  ? -6.081  10.575  -2.964  1.00 0.00 ? 10 VAL A CG2  18 
ATOM 10288 H H    . VAL A 1 7  ? -6.960  13.040  -2.127  1.00 0.00 ? 10 VAL A H    18 
ATOM 10289 H HA   . VAL A 1 7  ? -4.864  12.316  -1.297  1.00 0.00 ? 10 VAL A HA   18 
ATOM 10290 H HB   . VAL A 1 7  ? -4.993  11.844  -4.264  1.00 0.00 ? 10 VAL A HB   18 
ATOM 10291 H HG11 . VAL A 1 7  ? -3.741  9.837   -2.498  1.00 0.00 ? 10 VAL A HG11 18 
ATOM 10292 H HG12 . VAL A 1 7  ? -2.813  11.312  -2.759  1.00 0.00 ? 10 VAL A HG12 18 
ATOM 10293 H HG13 . VAL A 1 7  ? -3.311  10.329  -4.135  1.00 0.00 ? 10 VAL A HG13 18 
ATOM 10294 H HG21 . VAL A 1 7  ? -5.970  9.645   -3.500  1.00 0.00 ? 10 VAL A HG21 18 
ATOM 10295 H HG22 . VAL A 1 7  ? -6.991  11.066  -3.279  1.00 0.00 ? 10 VAL A HG22 18 
ATOM 10296 H HG23 . VAL A 1 7  ? -6.130  10.376  -1.903  1.00 0.00 ? 10 VAL A HG23 18 
ATOM 10297 N N    . PRO A 1 8  ? -3.380  14.518  -1.619  1.00 0.00 ? 11 PRO A N    18 
ATOM 10298 C CA   . PRO A 1 8  ? -2.211  15.406  -1.706  1.00 0.00 ? 11 PRO A CA   18 
ATOM 10299 C C    . PRO A 1 8  ? -0.910  14.672  -1.375  1.00 0.00 ? 11 PRO A C    18 
ATOM 10300 O O    . PRO A 1 8  ? -0.940  13.545  -0.889  1.00 0.00 ? 11 PRO A O    18 
ATOM 10301 C CB   . PRO A 1 8  ? -2.512  16.477  -0.655  1.00 0.00 ? 11 PRO A CB   18 
ATOM 10302 C CG   . PRO A 1 8  ? -3.362  15.779  0.347   1.00 0.00 ? 11 PRO A CG   18 
ATOM 10303 C CD   . PRO A 1 8  ? -4.211  14.817  -0.436  1.00 0.00 ? 11 PRO A CD   18 
ATOM 10304 H HA   . PRO A 1 8  ? -2.130  15.862  -2.682  1.00 0.00 ? 11 PRO A HA   18 
ATOM 10305 H HB2  . PRO A 1 8  ? -1.589  16.831  -0.218  1.00 0.00 ? 11 PRO A HB2  18 
ATOM 10306 H HB3  . PRO A 1 8  ? -3.040  17.300  -1.115  1.00 0.00 ? 11 PRO A HB3  18 
ATOM 10307 H HG2  . PRO A 1 8  ? -2.740  15.244  1.050   1.00 0.00 ? 11 PRO A HG2  18 
ATOM 10308 H HG3  . PRO A 1 8  ? -3.986  16.494  0.864   1.00 0.00 ? 11 PRO A HG3  18 
ATOM 10309 H HD2  . PRO A 1 8  ? -4.402  13.924  0.139   1.00 0.00 ? 11 PRO A HD2  18 
ATOM 10310 H HD3  . PRO A 1 8  ? -5.140  15.285  -0.729  1.00 0.00 ? 11 PRO A HD3  18 
ATOM 10311 N N    . THR A 1 9  ? 0.229   15.313  -1.638  1.00 0.00 ? 12 THR A N    18 
ATOM 10312 C CA   . THR A 1 9  ? 1.545   14.712  -1.370  1.00 0.00 ? 12 THR A CA   18 
ATOM 10313 C C    . THR A 1 9  ? 1.607   14.056  0.011   1.00 0.00 ? 12 THR A C    18 
ATOM 10314 O O    . THR A 1 9  ? 2.143   12.957  0.156   1.00 0.00 ? 12 THR A O    18 
ATOM 10315 C CB   . THR A 1 9  ? 2.654   15.765  -1.492  1.00 0.00 ? 12 THR A CB   18 
ATOM 10316 O OG1  . THR A 1 9  ? 2.138   16.985  -1.992  1.00 0.00 ? 12 THR A OG1  18 
ATOM 10317 C CG2  . THR A 1 9  ? 3.780   15.341  -2.407  1.00 0.00 ? 12 THR A CG2  18 
ATOM 10318 H H    . THR A 1 9  ? 0.191   16.213  -2.023  1.00 0.00 ? 12 THR A H    18 
ATOM 10319 H HA   . THR A 1 9  ? 1.711   13.949  -2.117  1.00 0.00 ? 12 THR A HA   18 
ATOM 10320 H HB   . THR A 1 9  ? 3.073   15.947  -0.512  1.00 0.00 ? 12 THR A HB   18 
ATOM 10321 H HG1  . THR A 1 9  ? 2.824   17.658  -1.970  1.00 0.00 ? 12 THR A HG1  18 
ATOM 10322 H HG21 . THR A 1 9  ? 4.191   14.403  -2.063  1.00 0.00 ? 12 THR A HG21 18 
ATOM 10323 H HG22 . THR A 1 9  ? 4.553   16.095  -2.400  1.00 0.00 ? 12 THR A HG22 18 
ATOM 10324 H HG23 . THR A 1 9  ? 3.402   15.222  -3.412  1.00 0.00 ? 12 THR A HG23 18 
ATOM 10325 N N    . ASN A 1 10 ? 1.052   14.732  1.019   1.00 0.00 ? 13 ASN A N    18 
ATOM 10326 C CA   . ASN A 1 10 ? 1.045   14.208  2.391   1.00 0.00 ? 13 ASN A CA   18 
ATOM 10327 C C    . ASN A 1 10 ? 0.242   12.914  2.505   1.00 0.00 ? 13 ASN A C    18 
ATOM 10328 O O    . ASN A 1 10 ? 0.483   12.093  3.389   1.00 0.00 ? 13 ASN A O    18 
ATOM 10329 C CB   . ASN A 1 10 ? 0.504   15.258  3.370   1.00 0.00 ? 13 ASN A CB   18 
ATOM 10330 C CG   . ASN A 1 10 ? -0.800  15.876  2.903   1.00 0.00 ? 13 ASN A CG   18 
ATOM 10331 O OD1  . ASN A 1 10 ? -0.829  16.614  1.922   1.00 0.00 ? 13 ASN A OD1  18 
ATOM 10332 N ND2  . ASN A 1 10 ? -1.886  15.575  3.597   1.00 0.00 ? 13 ASN A ND2  18 
ATOM 10333 H H    . ASN A 1 10 ? 0.636   15.604  0.836   1.00 0.00 ? 13 ASN A H    18 
ATOM 10334 H HA   . ASN A 1 10 ? 2.053   13.983  2.647   1.00 0.00 ? 13 ASN A HA   18 
ATOM 10335 H HB2  . ASN A 1 10 ? 0.336   14.795  4.330   1.00 0.00 ? 13 ASN A HB2  18 
ATOM 10336 H HB3  . ASN A 1 10 ? 1.234   16.047  3.479   1.00 0.00 ? 13 ASN A HB3  18 
ATOM 10337 H HD21 . ASN A 1 10 ? -1.795  14.976  4.366   1.00 0.00 ? 13 ASN A HD21 18 
ATOM 10338 H HD22 . ASN A 1 10 ? -2.737  15.969  3.314   1.00 0.00 ? 13 ASN A HD22 18 
ATOM 10339 N N    . ILE A 1 11 ? -0.693  12.743  1.597   1.00 0.00 ? 14 ILE A N    18 
ATOM 10340 C CA   . ILE A 1 11 ? -1.533  11.557  1.555   1.00 0.00 ? 14 ILE A CA   18 
ATOM 10341 C C    . ILE A 1 11 ? -1.034  10.597  0.476   1.00 0.00 ? 14 ILE A C    18 
ATOM 10342 O O    . ILE A 1 11 ? -0.883  9.399   0.720   1.00 0.00 ? 14 ILE A O    18 
ATOM 10343 C CB   . ILE A 1 11 ? -3.000  11.960  1.293   1.00 0.00 ? 14 ILE A CB   18 
ATOM 10344 C CG1  . ILE A 1 11 ? -3.726  12.208  2.616   1.00 0.00 ? 14 ILE A CG1  18 
ATOM 10345 C CG2  . ILE A 1 11 ? -3.735  10.907  0.472   1.00 0.00 ? 14 ILE A CG2  18 
ATOM 10346 C CD1  . ILE A 1 11 ? -4.957  13.080  2.478   1.00 0.00 ? 14 ILE A CD1  18 
ATOM 10347 H H    . ILE A 1 11 ? -0.817  13.433  0.917   1.00 0.00 ? 14 ILE A H    18 
ATOM 10348 H HA   . ILE A 1 11 ? -1.474  11.069  2.516   1.00 0.00 ? 14 ILE A HA   18 
ATOM 10349 H HB   . ILE A 1 11 ? -2.981  12.880  0.729   1.00 0.00 ? 14 ILE A HB   18 
ATOM 10350 H HG12 . ILE A 1 11 ? -4.037  11.260  3.031   1.00 0.00 ? 14 ILE A HG12 18 
ATOM 10351 H HG13 . ILE A 1 11 ? -3.051  12.692  3.306   1.00 0.00 ? 14 ILE A HG13 18 
ATOM 10352 H HG21 . ILE A 1 11 ? -3.390  10.942  -0.551  1.00 0.00 ? 14 ILE A HG21 18 
ATOM 10353 H HG22 . ILE A 1 11 ? -4.796  11.105  0.501   1.00 0.00 ? 14 ILE A HG22 18 
ATOM 10354 H HG23 . ILE A 1 11 ? -3.541  9.928   0.885   1.00 0.00 ? 14 ILE A HG23 18 
ATOM 10355 H HD11 . ILE A 1 11 ? -5.547  13.016  3.381   1.00 0.00 ? 14 ILE A HD11 18 
ATOM 10356 H HD12 . ILE A 1 11 ? -5.547  12.740  1.640   1.00 0.00 ? 14 ILE A HD12 18 
ATOM 10357 H HD13 . ILE A 1 11 ? -4.658  14.104  2.316   1.00 0.00 ? 14 ILE A HD13 18 
ATOM 10358 N N    . MET A 1 12 ? -0.754  11.142  -0.710  1.00 0.00 ? 15 MET A N    18 
ATOM 10359 C CA   . MET A 1 12 ? -0.246  10.366  -1.829  1.00 0.00 ? 15 MET A CA   18 
ATOM 10360 C C    . MET A 1 12 ? 0.986   9.571   -1.411  1.00 0.00 ? 15 MET A C    18 
ATOM 10361 O O    . MET A 1 12 ? 1.058   8.365   -1.645  1.00 0.00 ? 15 MET A O    18 
ATOM 10362 C CB   . MET A 1 12 ? 0.089   11.303  -2.992  1.00 0.00 ? 15 MET A CB   18 
ATOM 10363 C CG   . MET A 1 12 ? -0.589  10.923  -4.296  1.00 0.00 ? 15 MET A CG   18 
ATOM 10364 S SD   . MET A 1 12 ? 0.587   10.442  -5.575  1.00 0.00 ? 15 MET A SD   18 
ATOM 10365 C CE   . MET A 1 12 ? -0.351  9.188   -6.443  1.00 0.00 ? 15 MET A CE   18 
ATOM 10366 H H    . MET A 1 12 ? -0.881  12.112  -0.831  1.00 0.00 ? 15 MET A H    18 
ATOM 10367 H HA   . MET A 1 12 ? -1.018  9.676   -2.138  1.00 0.00 ? 15 MET A HA   18 
ATOM 10368 H HB2  . MET A 1 12 ? -0.222  12.304  -2.733  1.00 0.00 ? 15 MET A HB2  18 
ATOM 10369 H HB3  . MET A 1 12 ? 1.154   11.298  -3.149  1.00 0.00 ? 15 MET A HB3  18 
ATOM 10370 H HG2  . MET A 1 12 ? -1.256  10.096  -4.109  1.00 0.00 ? 15 MET A HG2  18 
ATOM 10371 H HG3  . MET A 1 12 ? -1.159  11.771  -4.649  1.00 0.00 ? 15 MET A HG3  18 
ATOM 10372 H HE1  . MET A 1 12 ? 0.277   8.722   -7.189  1.00 0.00 ? 15 MET A HE1  18 
ATOM 10373 H HE2  . MET A 1 12 ? -1.204  9.643   -6.923  1.00 0.00 ? 15 MET A HE2  18 
ATOM 10374 H HE3  . MET A 1 12 ? -0.689  8.441   -5.740  1.00 0.00 ? 15 MET A HE3  18 
ATOM 10375 N N    . ASN A 1 13 ? 1.945   10.245  -0.764  1.00 0.00 ? 16 ASN A N    18 
ATOM 10376 C CA   . ASN A 1 13 ? 3.160   9.582   -0.291  1.00 0.00 ? 16 ASN A CA   18 
ATOM 10377 C C    . ASN A 1 13 ? 2.799   8.394   0.599   1.00 0.00 ? 16 ASN A C    18 
ATOM 10378 O O    . ASN A 1 13 ? 3.316   7.289   0.422   1.00 0.00 ? 16 ASN A O    18 
ATOM 10379 C CB   . ASN A 1 13 ? 4.052   10.571  0.475   1.00 0.00 ? 16 ASN A CB   18 
ATOM 10380 C CG   . ASN A 1 13 ? 5.531   10.349  0.223   1.00 0.00 ? 16 ASN A CG   18 
ATOM 10381 O OD1  . ASN A 1 13 ? 5.966   9.234   -0.057  1.00 0.00 ? 16 ASN A OD1  18 
ATOM 10382 N ND2  . ASN A 1 13 ? 6.316   11.411  0.323   1.00 0.00 ? 16 ASN A ND2  18 
ATOM 10383 H H    . ASN A 1 13 ? 1.822   11.206  -0.587  1.00 0.00 ? 16 ASN A H    18 
ATOM 10384 H HA   . ASN A 1 13 ? 3.693   9.216   -1.151  1.00 0.00 ? 16 ASN A HA   18 
ATOM 10385 H HB2  . ASN A 1 13 ? 3.806   11.577  0.170   1.00 0.00 ? 16 ASN A HB2  18 
ATOM 10386 H HB3  . ASN A 1 13 ? 3.868   10.467  1.534   1.00 0.00 ? 16 ASN A HB3  18 
ATOM 10387 H HD21 . ASN A 1 13 ? 5.908   12.272  0.551   1.00 0.00 ? 16 ASN A HD21 18 
ATOM 10388 H HD22 . ASN A 1 13 ? 7.274   11.290  0.163   1.00 0.00 ? 16 ASN A HD22 18 
ATOM 10389 N N    . LEU A 1 14 ? 1.885   8.630   1.537   1.00 0.00 ? 17 LEU A N    18 
ATOM 10390 C CA   . LEU A 1 14 ? 1.422   7.581   2.442   1.00 0.00 ? 17 LEU A CA   18 
ATOM 10391 C C    . LEU A 1 14 ? 0.660   6.511   1.663   1.00 0.00 ? 17 LEU A C    18 
ATOM 10392 O O    . LEU A 1 14 ? 0.959   5.322   1.775   1.00 0.00 ? 17 LEU A O    18 
ATOM 10393 C CB   . LEU A 1 14 ? 0.534   8.172   3.542   1.00 0.00 ? 17 LEU A CB   18 
ATOM 10394 C CG   . LEU A 1 14 ? 1.250   9.090   4.534   1.00 0.00 ? 17 LEU A CG   18 
ATOM 10395 C CD1  . LEU A 1 14 ? 0.264   9.655   5.542   1.00 0.00 ? 17 LEU A CD1  18 
ATOM 10396 C CD2  . LEU A 1 14 ? 2.367   8.343   5.244   1.00 0.00 ? 17 LEU A CD2  18 
ATOM 10397 H H    . LEU A 1 14 ? 1.497   9.526   1.607   1.00 0.00 ? 17 LEU A H    18 
ATOM 10398 H HA   . LEU A 1 14 ? 2.290   7.125   2.893   1.00 0.00 ? 17 LEU A HA   18 
ATOM 10399 H HB2  . LEU A 1 14 ? -0.260  8.735   3.071   1.00 0.00 ? 17 LEU A HB2  18 
ATOM 10400 H HB3  . LEU A 1 14 ? 0.092   7.357   4.096   1.00 0.00 ? 17 LEU A HB3  18 
ATOM 10401 H HG   . LEU A 1 14 ? 1.688   9.920   3.997   1.00 0.00 ? 17 LEU A HG   18 
ATOM 10402 H HD11 . LEU A 1 14 ? -0.516  8.931   5.728   1.00 0.00 ? 17 LEU A HD11 18 
ATOM 10403 H HD12 . LEU A 1 14 ? -0.171  10.562  5.150   1.00 0.00 ? 17 LEU A HD12 18 
ATOM 10404 H HD13 . LEU A 1 14 ? 0.779   9.874   6.466   1.00 0.00 ? 17 LEU A HD13 18 
ATOM 10405 H HD21 . LEU A 1 14 ? 2.745   8.947   6.055   1.00 0.00 ? 17 LEU A HD21 18 
ATOM 10406 H HD22 . LEU A 1 14 ? 3.165   8.139   4.545   1.00 0.00 ? 17 LEU A HD22 18 
ATOM 10407 H HD23 . LEU A 1 14 ? 1.985   7.412   5.636   1.00 0.00 ? 17 LEU A HD23 18 
ATOM 10408 N N    . LEU A 1 15 ? -0.310  6.945   0.855   1.00 0.00 ? 18 LEU A N    18 
ATOM 10409 C CA   . LEU A 1 15 ? -1.099  6.027   0.036   1.00 0.00 ? 18 LEU A CA   18 
ATOM 10410 C C    . LEU A 1 15 ? -0.182  5.180   -0.844  1.00 0.00 ? 18 LEU A C    18 
ATOM 10411 O O    . LEU A 1 15 ? -0.299  3.953   -0.876  1.00 0.00 ? 18 LEU A O    18 
ATOM 10412 C CB   . LEU A 1 15 ? -2.101  6.815   -0.824  1.00 0.00 ? 18 LEU A CB   18 
ATOM 10413 C CG   . LEU A 1 15 ? -2.538  6.137   -2.126  1.00 0.00 ? 18 LEU A CG   18 
ATOM 10414 C CD1  . LEU A 1 15 ? -3.933  5.554   -1.982  1.00 0.00 ? 18 LEU A CD1  18 
ATOM 10415 C CD2  . LEU A 1 15 ? -2.491  7.124   -3.280  1.00 0.00 ? 18 LEU A CD2  18 
ATOM 10416 H H    . LEU A 1 15 ? -0.490  7.915   0.797   1.00 0.00 ? 18 LEU A H    18 
ATOM 10417 H HA   . LEU A 1 15 ? -1.639  5.369   0.698   1.00 0.00 ? 18 LEU A HA   18 
ATOM 10418 H HB2  . LEU A 1 15 ? -2.982  7.001   -0.228  1.00 0.00 ? 18 LEU A HB2  18 
ATOM 10419 H HB3  . LEU A 1 15 ? -1.653  7.766   -1.074  1.00 0.00 ? 18 LEU A HB3  18 
ATOM 10420 H HG   . LEU A 1 15 ? -1.860  5.327   -2.351  1.00 0.00 ? 18 LEU A HG   18 
ATOM 10421 H HD11 . LEU A 1 15 ? -4.238  5.116   -2.921  1.00 0.00 ? 18 LEU A HD11 18 
ATOM 10422 H HD12 . LEU A 1 15 ? -4.624  6.337   -1.709  1.00 0.00 ? 18 LEU A HD12 18 
ATOM 10423 H HD13 . LEU A 1 15 ? -3.928  4.794   -1.216  1.00 0.00 ? 18 LEU A HD13 18 
ATOM 10424 H HD21 . LEU A 1 15 ? -1.481  7.485   -3.406  1.00 0.00 ? 18 LEU A HD21 18 
ATOM 10425 H HD22 . LEU A 1 15 ? -3.148  7.953   -3.070  1.00 0.00 ? 18 LEU A HD22 18 
ATOM 10426 H HD23 . LEU A 1 15 ? -2.812  6.631   -4.186  1.00 0.00 ? 18 LEU A HD23 18 
ATOM 10427 N N    . PHE A 1 16 ? 0.741   5.842   -1.540  1.00 0.00 ? 19 PHE A N    18 
ATOM 10428 C CA   . PHE A 1 16 ? 1.697   5.155   -2.405  1.00 0.00 ? 19 PHE A CA   18 
ATOM 10429 C C    . PHE A 1 16 ? 2.514   4.142   -1.608  1.00 0.00 ? 19 PHE A C    18 
ATOM 10430 O O    . PHE A 1 16 ? 2.766   3.034   -2.076  1.00 0.00 ? 19 PHE A O    18 
ATOM 10431 C CB   . PHE A 1 16 ? 2.629   6.169   -3.075  1.00 0.00 ? 19 PHE A CB   18 
ATOM 10432 C CG   . PHE A 1 16 ? 2.891   5.878   -4.525  1.00 0.00 ? 19 PHE A CG   18 
ATOM 10433 C CD1  . PHE A 1 16 ? 1.869   5.960   -5.457  1.00 0.00 ? 19 PHE A CD1  18 
ATOM 10434 C CD2  . PHE A 1 16 ? 4.157   5.519   -4.956  1.00 0.00 ? 19 PHE A CD2  18 
ATOM 10435 C CE1  . PHE A 1 16 ? 2.106   5.690   -6.792  1.00 0.00 ? 19 PHE A CE1  18 
ATOM 10436 C CE2  . PHE A 1 16 ? 4.400   5.248   -6.289  1.00 0.00 ? 19 PHE A CE2  18 
ATOM 10437 C CZ   . PHE A 1 16 ? 3.373   5.333   -7.208  1.00 0.00 ? 19 PHE A CZ   18 
ATOM 10438 H H    . PHE A 1 16 ? 0.791   6.825   -1.459  1.00 0.00 ? 19 PHE A H    18 
ATOM 10439 H HA   . PHE A 1 16 ? 1.140   4.630   -3.166  1.00 0.00 ? 19 PHE A HA   18 
ATOM 10440 H HB2  . PHE A 1 16 ? 2.187   7.149   -3.007  1.00 0.00 ? 19 PHE A HB2  18 
ATOM 10441 H HB3  . PHE A 1 16 ? 3.577   6.175   -2.558  1.00 0.00 ? 19 PHE A HB3  18 
ATOM 10442 H HD1  . PHE A 1 16 ? 0.878   6.240   -5.132  1.00 0.00 ? 19 PHE A HD1  18 
ATOM 10443 H HD2  . PHE A 1 16 ? 4.961   5.452   -4.239  1.00 0.00 ? 19 PHE A HD2  18 
ATOM 10444 H HE1  . PHE A 1 16 ? 1.299   5.758   -7.508  1.00 0.00 ? 19 PHE A HE1  18 
ATOM 10445 H HE2  . PHE A 1 16 ? 5.393   4.969   -6.614  1.00 0.00 ? 19 PHE A HE2  18 
ATOM 10446 H HZ   . PHE A 1 16 ? 3.559   5.122   -8.251  1.00 0.00 ? 19 PHE A HZ   18 
ATOM 10447 N N    . ASN A 1 17 ? 2.914   4.529   -0.396  1.00 0.00 ? 20 ASN A N    18 
ATOM 10448 C CA   . ASN A 1 17 ? 3.693   3.652   0.472   1.00 0.00 ? 20 ASN A CA   18 
ATOM 10449 C C    . ASN A 1 17 ? 2.824   2.530   1.034   1.00 0.00 ? 20 ASN A C    18 
ATOM 10450 O O    . ASN A 1 17 ? 3.219   1.362   1.008   1.00 0.00 ? 20 ASN A O    18 
ATOM 10451 C CB   . ASN A 1 17 ? 4.321   4.459   1.605   1.00 0.00 ? 20 ASN A CB   18 
ATOM 10452 C CG   . ASN A 1 17 ? 5.762   4.076   1.864   1.00 0.00 ? 20 ASN A CG   18 
ATOM 10453 O OD1  . ASN A 1 17 ? 6.125   3.694   2.972   1.00 0.00 ? 20 ASN A OD1  18 
ATOM 10454 N ND2  . ASN A 1 17 ? 6.594   4.176   0.839   1.00 0.00 ? 20 ASN A ND2  18 
ATOM 10455 H H    . ASN A 1 17 ? 2.669   5.426   -0.072  1.00 0.00 ? 20 ASN A H    18 
ATOM 10456 H HA   . ASN A 1 17 ? 4.480   3.209   -0.124  1.00 0.00 ? 20 ASN A HA   18 
ATOM 10457 H HB2  . ASN A 1 17 ? 4.287   5.508   1.355   1.00 0.00 ? 20 ASN A HB2  18 
ATOM 10458 H HB3  . ASN A 1 17 ? 3.756   4.291   2.503   1.00 0.00 ? 20 ASN A HB3  18 
ATOM 10459 H HD21 . ASN A 1 17 ? 6.240   4.488   -0.017  1.00 0.00 ? 20 ASN A HD21 18 
ATOM 10460 H HD22 . ASN A 1 17 ? 7.531   3.934   0.984   1.00 0.00 ? 20 ASN A HD22 18 
ATOM 10461 N N    . ILE A 1 18 ? 1.629   2.881   1.520   1.00 0.00 ? 21 ILE A N    18 
ATOM 10462 C CA   . ILE A 1 18 ? 0.704   1.883   2.059   1.00 0.00 ? 21 ILE A CA   18 
ATOM 10463 C C    . ILE A 1 18 ? 0.473   0.792   1.023   1.00 0.00 ? 21 ILE A C    18 
ATOM 10464 O O    . ILE A 1 18 ? 0.825   -0.366  1.249   1.00 0.00 ? 21 ILE A O    18 
ATOM 10465 C CB   . ILE A 1 18 ? -0.646  2.511   2.475   1.00 0.00 ? 21 ILE A CB   18 
ATOM 10466 C CG1  . ILE A 1 18 ? -0.477  3.324   3.763   1.00 0.00 ? 21 ILE A CG1  18 
ATOM 10467 C CG2  . ILE A 1 18 ? -1.713  1.438   2.661   1.00 0.00 ? 21 ILE A CG2  18 
ATOM 10468 C CD1  . ILE A 1 18 ? -0.187  2.476   4.985   1.00 0.00 ? 21 ILE A CD1  18 
ATOM 10469 H H    . ILE A 1 18 ? 1.360   3.832   1.499   1.00 0.00 ? 21 ILE A H    18 
ATOM 10470 H HA   . ILE A 1 18 ? 1.159   1.434   2.930   1.00 0.00 ? 21 ILE A HA   18 
ATOM 10471 H HB   . ILE A 1 18 ? -0.969  3.172   1.684   1.00 0.00 ? 21 ILE A HB   18 
ATOM 10472 H HG12 . ILE A 1 18 ? 0.341   4.015   3.639   1.00 0.00 ? 21 ILE A HG12 18 
ATOM 10473 H HG13 . ILE A 1 18 ? -1.385  3.878   3.951   1.00 0.00 ? 21 ILE A HG13 18 
ATOM 10474 H HG21 . ILE A 1 18 ? -1.305  0.623   3.240   1.00 0.00 ? 21 ILE A HG21 18 
ATOM 10475 H HG22 . ILE A 1 18 ? -2.028  1.070   1.694   1.00 0.00 ? 21 ILE A HG22 18 
ATOM 10476 H HG23 . ILE A 1 18 ? -2.561  1.859   3.180   1.00 0.00 ? 21 ILE A HG23 18 
ATOM 10477 H HD11 . ILE A 1 18 ? -0.078  1.442   4.691   1.00 0.00 ? 21 ILE A HD11 18 
ATOM 10478 H HD12 . ILE A 1 18 ? -1.003  2.567   5.687   1.00 0.00 ? 21 ILE A HD12 18 
ATOM 10479 H HD13 . ILE A 1 18 ? 0.726   2.816   5.450   1.00 0.00 ? 21 ILE A HD13 18 
ATOM 10480 N N    . ALA A 1 19 ? -0.077  1.173   -0.133  1.00 0.00 ? 22 ALA A N    18 
ATOM 10481 C CA   . ALA A 1 19 ? -0.302  0.219   -1.216  1.00 0.00 ? 22 ALA A CA   18 
ATOM 10482 C C    . ALA A 1 19 ? 0.996   -0.525  -1.535  1.00 0.00 ? 22 ALA A C    18 
ATOM 10483 O O    . ALA A 1 19 ? 0.987   -1.723  -1.828  1.00 0.00 ? 22 ALA A O    18 
ATOM 10484 C CB   . ALA A 1 19 ? -0.831  0.936   -2.452  1.00 0.00 ? 22 ALA A CB   18 
ATOM 10485 H H    . ALA A 1 19 ? -0.305  2.123   -0.270  1.00 0.00 ? 22 ALA A H    18 
ATOM 10486 H HA   . ALA A 1 19 ? -1.047  -0.494  -0.888  1.00 0.00 ? 22 ALA A HA   18 
ATOM 10487 H HB1  . ALA A 1 19 ? -1.678  1.549   -2.179  1.00 0.00 ? 22 ALA A HB1  18 
ATOM 10488 H HB2  . ALA A 1 19 ? -1.138  0.207   -3.188  1.00 0.00 ? 22 ALA A HB2  18 
ATOM 10489 H HB3  . ALA A 1 19 ? -0.054  1.560   -2.867  1.00 0.00 ? 22 ALA A HB3  18 
ATOM 10490 N N    . LYS A 1 20 ? 2.115   0.198   -1.451  1.00 0.00 ? 23 LYS A N    18 
ATOM 10491 C CA   . LYS A 1 20 ? 3.437   -0.367  -1.704  1.00 0.00 ? 23 LYS A CA   18 
ATOM 10492 C C    . LYS A 1 20 ? 3.731   -1.529  -0.754  1.00 0.00 ? 23 LYS A C    18 
ATOM 10493 O O    . LYS A 1 20 ? 3.989   -2.646  -1.193  1.00 0.00 ? 23 LYS A O    18 
ATOM 10494 C CB   . LYS A 1 20 ? 4.510   0.719   -1.552  1.00 0.00 ? 23 LYS A CB   18 
ATOM 10495 C CG   . LYS A 1 20 ? 5.195   1.088   -2.855  1.00 0.00 ? 23 LYS A CG   18 
ATOM 10496 C CD   . LYS A 1 20 ? 5.635   2.544   -2.866  1.00 0.00 ? 23 LYS A CD   18 
ATOM 10497 C CE   . LYS A 1 20 ? 7.110   2.685   -2.532  1.00 0.00 ? 23 LYS A CE   18 
ATOM 10498 N NZ   . LYS A 1 20 ? 7.635   4.026   -2.917  1.00 0.00 ? 23 LYS A NZ   18 
ATOM 10499 H H    . LYS A 1 20 ? 2.048   1.144   -1.199  1.00 0.00 ? 23 LYS A H    18 
ATOM 10500 H HA   . LYS A 1 20 ? 3.450   -0.738  -2.715  1.00 0.00 ? 23 LYS A HA   18 
ATOM 10501 H HB2  . LYS A 1 20 ? 4.047   1.608   -1.153  1.00 0.00 ? 23 LYS A HB2  18 
ATOM 10502 H HB3  . LYS A 1 20 ? 5.262   0.378   -0.857  1.00 0.00 ? 23 LYS A HB3  18 
ATOM 10503 H HG2  . LYS A 1 20 ? 6.061   0.459   -2.983  1.00 0.00 ? 23 LYS A HG2  18 
ATOM 10504 H HG3  . LYS A 1 20 ? 4.504   0.925   -3.670  1.00 0.00 ? 23 LYS A HG3  18 
ATOM 10505 H HD2  . LYS A 1 20 ? 5.458   2.955   -3.848  1.00 0.00 ? 23 LYS A HD2  18 
ATOM 10506 H HD3  . LYS A 1 20 ? 5.056   3.090   -2.136  1.00 0.00 ? 23 LYS A HD3  18 
ATOM 10507 H HE2  . LYS A 1 20 ? 7.241   2.544   -1.468  1.00 0.00 ? 23 LYS A HE2  18 
ATOM 10508 H HE3  . LYS A 1 20 ? 7.662   1.923   -3.065  1.00 0.00 ? 23 LYS A HE3  18 
ATOM 10509 H HZ1  . LYS A 1 20 ? 7.722   4.093   -3.953  1.00 0.00 ? 23 LYS A HZ1  18 
ATOM 10510 H HZ2  . LYS A 1 20 ? 8.574   4.178   -2.494  1.00 0.00 ? 23 LYS A HZ2  18 
ATOM 10511 H HZ3  . LYS A 1 20 ? 6.994   4.776   -2.586  1.00 0.00 ? 23 LYS A HZ3  18 
ATOM 10512 N N    . ALA A 1 21 ? 3.693   -1.260  0.547   1.00 0.00 ? 24 ALA A N    18 
ATOM 10513 C CA   . ALA A 1 21 ? 3.960   -2.293  1.545   1.00 0.00 ? 24 ALA A CA   18 
ATOM 10514 C C    . ALA A 1 21 ? 2.806   -3.293  1.657   1.00 0.00 ? 24 ALA A C    18 
ATOM 10515 O O    . ALA A 1 21 ? 3.032   -4.488  1.869   1.00 0.00 ? 24 ALA A O    18 
ATOM 10516 C CB   . ALA A 1 21 ? 4.251   -1.655  2.897   1.00 0.00 ? 24 ALA A CB   18 
ATOM 10517 H H    . ALA A 1 21 ? 3.480   -0.343  0.842   1.00 0.00 ? 24 ALA A H    18 
ATOM 10518 H HA   . ALA A 1 21 ? 4.846   -2.829  1.231   1.00 0.00 ? 24 ALA A HA   18 
ATOM 10519 H HB1  . ALA A 1 21 ? 4.975   -0.863  2.774   1.00 0.00 ? 24 ALA A HB1  18 
ATOM 10520 H HB2  . ALA A 1 21 ? 4.645   -2.402  3.571   1.00 0.00 ? 24 ALA A HB2  18 
ATOM 10521 H HB3  . ALA A 1 21 ? 3.337   -1.247  3.308   1.00 0.00 ? 24 ALA A HB3  18 
ATOM 10522 N N    . LYS A 1 22 ? 1.570   -2.806  1.514   1.00 0.00 ? 25 LYS A N    18 
ATOM 10523 C CA   . LYS A 1 22 ? 0.394   -3.660  1.605   1.00 0.00 ? 25 LYS A CA   18 
ATOM 10524 C C    . LYS A 1 22 ? 0.375   -4.694  0.483   1.00 0.00 ? 25 LYS A C    18 
ATOM 10525 O O    . LYS A 1 22 ? 0.080   -5.867  0.723   1.00 0.00 ? 25 LYS A O    18 
ATOM 10526 C CB   . LYS A 1 22 ? -0.882  -2.810  1.574   1.00 0.00 ? 25 LYS A CB   18 
ATOM 10527 C CG   . LYS A 1 22 ? -1.667  -2.856  2.875   1.00 0.00 ? 25 LYS A CG   18 
ATOM 10528 C CD   . LYS A 1 22 ? -3.170  -2.885  2.625   1.00 0.00 ? 25 LYS A CD   18 
ATOM 10529 C CE   . LYS A 1 22 ? -3.899  -3.725  3.662   1.00 0.00 ? 25 LYS A CE   18 
ATOM 10530 N NZ   . LYS A 1 22 ? -4.117  -2.972  4.934   1.00 0.00 ? 25 LYS A NZ   18 
ATOM 10531 H H    . LYS A 1 22 ? 1.445   -1.845  1.341   1.00 0.00 ? 25 LYS A H    18 
ATOM 10532 H HA   . LYS A 1 22 ? 0.442   -4.181  2.548   1.00 0.00 ? 25 LYS A HA   18 
ATOM 10533 H HB2  . LYS A 1 22 ? -0.614  -1.782  1.381   1.00 0.00 ? 25 LYS A HB2  18 
ATOM 10534 H HB3  . LYS A 1 22 ? -1.519  -3.163  0.779   1.00 0.00 ? 25 LYS A HB3  18 
ATOM 10535 H HG2  . LYS A 1 22 ? -1.382  -3.742  3.420   1.00 0.00 ? 25 LYS A HG2  18 
ATOM 10536 H HG3  . LYS A 1 22 ? -1.424  -1.980  3.459   1.00 0.00 ? 25 LYS A HG3  18 
ATOM 10537 H HD2  . LYS A 1 22 ? -3.550  -1.875  2.663   1.00 0.00 ? 25 LYS A HD2  18 
ATOM 10538 H HD3  . LYS A 1 22 ? -3.353  -3.301  1.644   1.00 0.00 ? 25 LYS A HD3  18 
ATOM 10539 H HE2  . LYS A 1 22 ? -4.858  -4.020  3.257   1.00 0.00 ? 25 LYS A HE2  18 
ATOM 10540 H HE3  . LYS A 1 22 ? -3.310  -4.607  3.870   1.00 0.00 ? 25 LYS A HE3  18 
ATOM 10541 H HZ1  . LYS A 1 22 ? -4.459  -3.616  5.677   1.00 0.00 ? 25 LYS A HZ1  18 
ATOM 10542 H HZ2  . LYS A 1 22 ? -4.823  -2.218  4.791   1.00 0.00 ? 25 LYS A HZ2  18 
ATOM 10543 H HZ3  . LYS A 1 22 ? -3.225  -2.541  5.251   1.00 0.00 ? 25 LYS A HZ3  18 
ATOM 10544 N N    . ASN A 1 23 ? 0.703   -4.267  -0.739  1.00 0.00 ? 26 ASN A N    18 
ATOM 10545 C CA   . ASN A 1 23 ? 0.722   -5.193  -1.874  1.00 0.00 ? 26 ASN A CA   18 
ATOM 10546 C C    . ASN A 1 23 ? 1.874   -6.193  -1.739  1.00 0.00 ? 26 ASN A C    18 
ATOM 10547 O O    . ASN A 1 23 ? 1.693   -7.388  -1.978  1.00 0.00 ? 26 ASN A O    18 
ATOM 10548 C CB   . ASN A 1 23 ? 0.783   -4.433  -3.213  1.00 0.00 ? 26 ASN A CB   18 
ATOM 10549 C CG   . ASN A 1 23 ? 2.193   -4.196  -3.716  1.00 0.00 ? 26 ASN A CG   18 
ATOM 10550 O OD1  . ASN A 1 23 ? 2.822   -5.085  -4.282  1.00 0.00 ? 26 ASN A OD1  18 
ATOM 10551 N ND2  . ASN A 1 23 ? 2.694   -2.992  -3.513  1.00 0.00 ? 26 ASN A ND2  18 
ATOM 10552 H H    . ASN A 1 23 ? 0.945   -3.317  -0.875  1.00 0.00 ? 26 ASN A H    18 
ATOM 10553 H HA   . ASN A 1 23 ? -0.204  -5.751  -1.842  1.00 0.00 ? 26 ASN A HA   18 
ATOM 10554 H HB2  . ASN A 1 23 ? 0.253   -5.002  -3.961  1.00 0.00 ? 26 ASN A HB2  18 
ATOM 10555 H HB3  . ASN A 1 23 ? 0.298   -3.474  -3.094  1.00 0.00 ? 26 ASN A HB3  18 
ATOM 10556 H HD21 . ASN A 1 23 ? 2.134   -2.328  -3.055  1.00 0.00 ? 26 ASN A HD21 18 
ATOM 10557 H HD22 . ASN A 1 23 ? 3.604   -2.815  -3.823  1.00 0.00 ? 26 ASN A HD22 18 
ATOM 10558 N N    . LEU A 1 24 ? 3.049   -5.706  -1.326  1.00 0.00 ? 27 LEU A N    18 
ATOM 10559 C CA   . LEU A 1 24 ? 4.213   -6.576  -1.137  1.00 0.00 ? 27 LEU A CA   18 
ATOM 10560 C C    . LEU A 1 24 ? 3.901   -7.673  -0.128  1.00 0.00 ? 27 LEU A C    18 
ATOM 10561 O O    . LEU A 1 24 ? 4.025   -8.863  -0.417  1.00 0.00 ? 27 LEU A O    18 
ATOM 10562 C CB   . LEU A 1 24 ? 5.430   -5.763  -0.674  1.00 0.00 ? 27 LEU A CB   18 
ATOM 10563 C CG   . LEU A 1 24 ? 5.958   -4.742  -1.684  1.00 0.00 ? 27 LEU A CG   18 
ATOM 10564 C CD1  . LEU A 1 24 ? 6.918   -3.776  -1.012  1.00 0.00 ? 27 LEU A CD1  18 
ATOM 10565 C CD2  . LEU A 1 24 ? 6.637   -5.441  -2.849  1.00 0.00 ? 27 LEU A CD2  18 
ATOM 10566 H H    . LEU A 1 24 ? 3.131   -4.746  -1.130  1.00 0.00 ? 27 LEU A H    18 
ATOM 10567 H HA   . LEU A 1 24 ? 4.432   -7.035  -2.072  1.00 0.00 ? 27 LEU A HA   18 
ATOM 10568 H HB2  . LEU A 1 24 ? 5.163   -5.237  0.230   1.00 0.00 ? 27 LEU A HB2  18 
ATOM 10569 H HB3  . LEU A 1 24 ? 6.230   -6.453  -0.446  1.00 0.00 ? 27 LEU A HB3  18 
ATOM 10570 H HG   . LEU A 1 24 ? 5.129   -4.169  -2.073  1.00 0.00 ? 27 LEU A HG   18 
ATOM 10571 H HD11 . LEU A 1 24 ? 7.574   -3.345  -1.754  1.00 0.00 ? 27 LEU A HD11 18 
ATOM 10572 H HD12 . LEU A 1 24 ? 7.505   -4.305  -0.277  1.00 0.00 ? 27 LEU A HD12 18 
ATOM 10573 H HD13 . LEU A 1 24 ? 6.357   -2.990  -0.528  1.00 0.00 ? 27 LEU A HD13 18 
ATOM 10574 H HD21 . LEU A 1 24 ? 7.200   -4.720  -3.422  1.00 0.00 ? 27 LEU A HD21 18 
ATOM 10575 H HD22 . LEU A 1 24 ? 5.890   -5.898  -3.480  1.00 0.00 ? 27 LEU A HD22 18 
ATOM 10576 H HD23 . LEU A 1 24 ? 7.306   -6.202  -2.472  1.00 0.00 ? 27 LEU A HD23 18 
ATOM 10577 N N    . ARG A 1 25 ? 3.480   -7.249  1.049   1.00 0.00 ? 28 ARG A N    18 
ATOM 10578 C CA   . ARG A 1 25 ? 3.124   -8.168  2.132   1.00 0.00 ? 28 ARG A CA   18 
ATOM 10579 C C    . ARG A 1 25 ? 1.974   -9.087  1.722   1.00 0.00 ? 28 ARG A C    18 
ATOM 10580 O O    . ARG A 1 25 ? 1.988   -10.275 2.039   1.00 0.00 ? 28 ARG A O    18 
ATOM 10581 C CB   . ARG A 1 25 ? 2.746   -7.384  3.396   1.00 0.00 ? 28 ARG A CB   18 
ATOM 10582 C CG   . ARG A 1 25 ? 3.551   -7.779  4.624   1.00 0.00 ? 28 ARG A CG   18 
ATOM 10583 C CD   . ARG A 1 25 ? 2.735   -8.638  5.584   1.00 0.00 ? 28 ARG A CD   18 
ATOM 10584 N NE   . ARG A 1 25 ? 3.400   -9.912  5.876   1.00 0.00 ? 28 ARG A NE   18 
ATOM 10585 C CZ   . ARG A 1 25 ? 3.135   -10.679 6.930   1.00 0.00 ? 28 ARG A CZ   18 
ATOM 10586 N NH1  . ARG A 1 25 ? 2.220   -10.323 7.811   1.00 0.00 ? 28 ARG A NH1  18 
ATOM 10587 N NH2  . ARG A 1 25 ? 3.790   -11.809 7.100   1.00 0.00 ? 28 ARG A NH2  18 
ATOM 10588 H H    . ARG A 1 25 ? 3.400   -6.284  1.187   1.00 0.00 ? 28 ARG A H    18 
ATOM 10589 H HA   . ARG A 1 25 ? 3.986   -8.783  2.343   1.00 0.00 ? 28 ARG A HA   18 
ATOM 10590 H HB2  . ARG A 1 25 ? 2.904   -6.331  3.213   1.00 0.00 ? 28 ARG A HB2  18 
ATOM 10591 H HB3  . ARG A 1 25 ? 1.699   -7.548  3.608   1.00 0.00 ? 28 ARG A HB3  18 
ATOM 10592 H HG2  . ARG A 1 25 ? 4.421   -8.335  4.311   1.00 0.00 ? 28 ARG A HG2  18 
ATOM 10593 H HG3  . ARG A 1 25 ? 3.865   -6.881  5.138   1.00 0.00 ? 28 ARG A HG3  18 
ATOM 10594 H HD2  . ARG A 1 25 ? 2.601   -8.090  6.507   1.00 0.00 ? 28 ARG A HD2  18 
ATOM 10595 H HD3  . ARG A 1 25 ? 1.770   -8.837  5.138   1.00 0.00 ? 28 ARG A HD3  18 
ATOM 10596 H HE   . ARG A 1 25 ? 4.087   -10.213 5.245   1.00 0.00 ? 28 ARG A HE   18 
ATOM 10597 H HH11 . ARG A 1 25 ? 1.716   -9.471  7.693   1.00 0.00 ? 28 ARG A HH11 18 
ATOM 10598 H HH12 . ARG A 1 25 ? 2.030   -10.908 8.599   1.00 0.00 ? 28 ARG A HH12 18 
ATOM 10599 H HH21 . ARG A 1 25 ? 4.482   -12.091 6.438   1.00 0.00 ? 28 ARG A HH21 18 
ATOM 10600 H HH22 . ARG A 1 25 ? 3.596   -12.384 7.892   1.00 0.00 ? 28 ARG A HH22 18 
ATOM 10601 N N    . ALA A 1 26 ? 0.994   -8.543  1.001   1.00 0.00 ? 29 ALA A N    18 
ATOM 10602 C CA   . ALA A 1 26 ? -0.142  -9.333  0.543   1.00 0.00 ? 29 ALA A CA   18 
ATOM 10603 C C    . ALA A 1 26 ? 0.310   -10.349 -0.498  1.00 0.00 ? 29 ALA A C    18 
ATOM 10604 O O    . ALA A 1 26 ? -0.076  -11.516 -0.451  1.00 0.00 ? 29 ALA A O    18 
ATOM 10605 C CB   . ALA A 1 26 ? -1.225  -8.425  -0.024  1.00 0.00 ? 29 ALA A CB   18 
ATOM 10606 H H    . ALA A 1 26 ? 1.044   -7.594  0.758   1.00 0.00 ? 29 ALA A H    18 
ATOM 10607 H HA   . ALA A 1 26 ? -0.550  -9.860  1.394   1.00 0.00 ? 29 ALA A HA   18 
ATOM 10608 H HB1  . ALA A 1 26 ? -0.819  -7.848  -0.842  1.00 0.00 ? 29 ALA A HB1  18 
ATOM 10609 H HB2  . ALA A 1 26 ? -1.576  -7.756  0.748   1.00 0.00 ? 29 ALA A HB2  18 
ATOM 10610 H HB3  . ALA A 1 26 ? -2.049  -9.026  -0.382  1.00 0.00 ? 29 ALA A HB3  18 
ATOM 10611 N N    . GLN A 1 27 ? 1.143   -9.899  -1.431  1.00 0.00 ? 30 GLN A N    18 
ATOM 10612 C CA   . GLN A 1 27 ? 1.654   -10.777 -2.483  1.00 0.00 ? 30 GLN A CA   18 
ATOM 10613 C C    . GLN A 1 27 ? 2.714   -11.741 -1.956  1.00 0.00 ? 30 GLN A C    18 
ATOM 10614 O O    . GLN A 1 27 ? 2.932   -12.811 -2.524  1.00 0.00 ? 30 GLN A O    18 
ATOM 10615 C CB   . GLN A 1 27 ? 2.213   -9.953  -3.648  1.00 0.00 ? 30 GLN A CB   18 
ATOM 10616 C CG   . GLN A 1 27 ? 1.146   -9.460  -4.615  1.00 0.00 ? 30 GLN A CG   18 
ATOM 10617 C CD   . GLN A 1 27 ? 0.678   -10.538 -5.574  1.00 0.00 ? 30 GLN A CD   18 
ATOM 10618 O OE1  . GLN A 1 27 ? -0.383  -11.126 -5.390  1.00 0.00 ? 30 GLN A OE1  18 
ATOM 10619 N NE2  . GLN A 1 27 ? 1.467   -10.802 -6.605  1.00 0.00 ? 30 GLN A NE2  18 
ATOM 10620 H H    . GLN A 1 27 ? 1.422   -8.950  -1.409  1.00 0.00 ? 30 GLN A H    18 
ATOM 10621 H HA   . GLN A 1 27 ? 0.828   -11.360 -2.831  1.00 0.00 ? 30 GLN A HA   18 
ATOM 10622 H HB2  . GLN A 1 27 ? 2.732   -9.093  -3.249  1.00 0.00 ? 30 GLN A HB2  18 
ATOM 10623 H HB3  . GLN A 1 27 ? 2.917   -10.561 -4.199  1.00 0.00 ? 30 GLN A HB3  18 
ATOM 10624 H HG2  . GLN A 1 27 ? 0.296   -9.114  -4.046  1.00 0.00 ? 30 GLN A HG2  18 
ATOM 10625 H HG3  . GLN A 1 27 ? 1.550   -8.639  -5.189  1.00 0.00 ? 30 GLN A HG3  18 
ATOM 10626 H HE21 . GLN A 1 27 ? 2.299   -10.294 -6.695  1.00 0.00 ? 30 GLN A HE21 18 
ATOM 10627 H HE22 . GLN A 1 27 ? 1.183   -11.496 -7.234  1.00 0.00 ? 30 GLN A HE22 18 
ATOM 10628 N N    . ALA A 1 28 ? 3.361   -11.366 -0.871  1.00 0.00 ? 31 ALA A N    18 
ATOM 10629 C CA   . ALA A 1 28 ? 4.389   -12.200 -0.260  1.00 0.00 ? 31 ALA A CA   18 
ATOM 10630 C C    . ALA A 1 28 ? 3.780   -13.156 0.766   1.00 0.00 ? 31 ALA A C    18 
ATOM 10631 O O    . ALA A 1 28 ? 4.035   -14.360 0.733   1.00 0.00 ? 31 ALA A O    18 
ATOM 10632 C CB   . ALA A 1 28 ? 5.459   -11.330 0.386   1.00 0.00 ? 31 ALA A CB   18 
ATOM 10633 H H    . ALA A 1 28 ? 3.136   -10.506 -0.467  1.00 0.00 ? 31 ALA A H    18 
ATOM 10634 H HA   . ALA A 1 28 ? 4.855   -12.781 -1.043  1.00 0.00 ? 31 ALA A HA   18 
ATOM 10635 H HB1  . ALA A 1 28 ? 6.054   -11.929 1.059   1.00 0.00 ? 31 ALA A HB1  18 
ATOM 10636 H HB2  . ALA A 1 28 ? 4.988   -10.529 0.937   1.00 0.00 ? 31 ALA A HB2  18 
ATOM 10637 H HB3  . ALA A 1 28 ? 6.095   -10.913 -0.382  1.00 0.00 ? 31 ALA A HB3  18 
ATOM 10638 N N    . ALA A 1 29 ? 2.979   -12.608 1.681   1.00 0.00 ? 32 ALA A N    18 
ATOM 10639 C CA   . ALA A 1 29 ? 2.343   -13.408 2.725   1.00 0.00 ? 32 ALA A CA   18 
ATOM 10640 C C    . ALA A 1 29 ? 1.105   -14.172 2.231   1.00 0.00 ? 32 ALA A C    18 
ATOM 10641 O O    . ALA A 1 29 ? 0.711   -15.159 2.852   1.00 0.00 ? 32 ALA A O    18 
ATOM 10642 C CB   . ALA A 1 29 ? 1.978   -12.522 3.908   1.00 0.00 ? 32 ALA A CB   18 
ATOM 10643 H H    . ALA A 1 29 ? 2.819   -11.631 1.659   1.00 0.00 ? 32 ALA A H    18 
ATOM 10644 H HA   . ALA A 1 29 ? 3.070   -14.129 3.070   1.00 0.00 ? 32 ALA A HA   18 
ATOM 10645 H HB1  . ALA A 1 29 ? 1.123   -11.914 3.651   1.00 0.00 ? 32 ALA A HB1  18 
ATOM 10646 H HB2  . ALA A 1 29 ? 2.813   -11.882 4.150   1.00 0.00 ? 32 ALA A HB2  18 
ATOM 10647 H HB3  . ALA A 1 29 ? 1.738   -13.139 4.761   1.00 0.00 ? 32 ALA A HB3  18 
ATOM 10648 N N    . ALA A 1 30 ? 0.472   -13.716 1.141   1.00 0.00 ? 33 ALA A N    18 
ATOM 10649 C CA   . ALA A 1 30 ? -0.732  -14.392 0.638   1.00 0.00 ? 33 ALA A CA   18 
ATOM 10650 C C    . ALA A 1 30 ? -0.545  -15.052 -0.729  1.00 0.00 ? 33 ALA A C    18 
ATOM 10651 O O    . ALA A 1 30 ? -1.346  -15.905 -1.122  1.00 0.00 ? 33 ALA A O    18 
ATOM 10652 C CB   . ALA A 1 30 ? -1.905  -13.421 0.603   1.00 0.00 ? 33 ALA A CB   18 
ATOM 10653 H H    . ALA A 1 30 ? 0.802   -12.911 0.682   1.00 0.00 ? 33 ALA A H    18 
ATOM 10654 H HA   . ALA A 1 30 ? -0.968  -15.167 1.338   1.00 0.00 ? 33 ALA A HA   18 
ATOM 10655 H HB1  . ALA A 1 30 ? -1.863  -12.775 1.468   1.00 0.00 ? 33 ALA A HB1  18 
ATOM 10656 H HB2  . ALA A 1 30 ? -2.831  -13.976 0.612   1.00 0.00 ? 33 ALA A HB2  18 
ATOM 10657 H HB3  . ALA A 1 30 ? -1.849  -12.823 -0.296  1.00 0.00 ? 33 ALA A HB3  18 
ATOM 10658 N N    . ASN A 1 31 ? 0.501   -14.674 -1.445  1.00 0.00 ? 34 ASN A N    18 
ATOM 10659 C CA   . ASN A 1 31 ? 0.770   -15.246 -2.763  1.00 0.00 ? 34 ASN A CA   18 
ATOM 10660 C C    . ASN A 1 31 ? 2.087   -16.035 -2.776  1.00 0.00 ? 34 ASN A C    18 
ATOM 10661 O O    . ASN A 1 31 ? 2.095   -17.228 -3.081  1.00 0.00 ? 34 ASN A O    18 
ATOM 10662 C CB   . ASN A 1 31 ? 0.759   -14.134 -3.829  1.00 0.00 ? 34 ASN A CB   18 
ATOM 10663 C CG   . ASN A 1 31 ? 1.686   -14.406 -4.999  1.00 0.00 ? 34 ASN A CG   18 
ATOM 10664 O OD1  . ASN A 1 31 ? 1.338   -15.131 -5.923  1.00 0.00 ? 34 ASN A OD1  18 
ATOM 10665 N ND2  . ASN A 1 31 ? 2.874   -13.820 -4.963  1.00 0.00 ? 34 ASN A ND2  18 
ATOM 10666 H H    . ASN A 1 31 ? 1.102   -14.004 -1.081  1.00 0.00 ? 34 ASN A H    18 
ATOM 10667 H HA   . ASN A 1 31 ? -0.031  -15.933 -2.978  1.00 0.00 ? 34 ASN A HA   18 
ATOM 10668 H HB2  . ASN A 1 31 ? -0.243  -14.033 -4.216  1.00 0.00 ? 34 ASN A HB2  18 
ATOM 10669 H HB3  . ASN A 1 31 ? 1.052   -13.203 -3.370  1.00 0.00 ? 34 ASN A HB3  18 
ATOM 10670 H HD21 . ASN A 1 31 ? 3.089   -13.251 -4.192  1.00 0.00 ? 34 ASN A HD21 18 
ATOM 10671 H HD22 . ASN A 1 31 ? 3.488   -13.983 -5.707  1.00 0.00 ? 34 ASN A HD22 18 
ATOM 10672 N N    . ALA A 1 32 ? 3.194   -15.370 -2.448  1.00 0.00 ? 35 ALA A N    18 
ATOM 10673 C CA   . ALA A 1 32 ? 4.506   -16.021 -2.436  1.00 0.00 ? 35 ALA A CA   18 
ATOM 10674 C C    . ALA A 1 32 ? 4.675   -17.005 -1.272  1.00 0.00 ? 35 ALA A C    18 
ATOM 10675 O O    . ALA A 1 32 ? 5.571   -17.851 -1.297  1.00 0.00 ? 35 ALA A O    18 
ATOM 10676 C CB   . ALA A 1 32 ? 5.615   -14.977 -2.420  1.00 0.00 ? 35 ALA A CB   18 
ATOM 10677 H H    . ALA A 1 32 ? 3.129   -14.415 -2.217  1.00 0.00 ? 35 ALA A H    18 
ATOM 10678 H HA   . ALA A 1 32 ? 4.591   -16.576 -3.348  1.00 0.00 ? 35 ALA A HA   18 
ATOM 10679 H HB1  . ALA A 1 32 ? 6.402   -15.276 -3.098  1.00 0.00 ? 35 ALA A HB1  18 
ATOM 10680 H HB2  . ALA A 1 32 ? 6.016   -14.891 -1.420  1.00 0.00 ? 35 ALA A HB2  18 
ATOM 10681 H HB3  . ALA A 1 32 ? 5.216   -14.023 -2.729  1.00 0.00 ? 35 ALA A HB3  18 
ATOM 10682 N N    . HIS A 1 33 ? 3.816   -16.899 -0.266  1.00 0.00 ? 36 HIS A N    18 
ATOM 10683 C CA   . HIS A 1 33 ? 3.875   -17.786 0.905   1.00 0.00 ? 36 HIS A CA   18 
ATOM 10684 C C    . HIS A 1 33 ? 3.829   -19.270 0.510   1.00 0.00 ? 36 HIS A C    18 
ATOM 10685 O O    . HIS A 1 33 ? 4.381   -20.120 1.211   1.00 0.00 ? 36 HIS A O    18 
ATOM 10686 C CB   . HIS A 1 33 ? 2.737   -17.463 1.881   1.00 0.00 ? 36 HIS A CB   18 
ATOM 10687 C CG   . HIS A 1 33 ? 1.366   -17.768 1.355   1.00 0.00 ? 36 HIS A CG   18 
ATOM 10688 N ND1  . HIS A 1 33 ? 0.383   -18.352 2.119   1.00 0.00 ? 36 HIS A ND1  18 
ATOM 10689 C CD2  . HIS A 1 33 ? 0.815   -17.548 0.142   1.00 0.00 ? 36 HIS A CD2  18 
ATOM 10690 C CE1  . HIS A 1 33 ? -0.717  -18.476 1.398   1.00 0.00 ? 36 HIS A CE1  18 
ATOM 10691 N NE2  . HIS A 1 33 ? -0.485  -17.991 0.190   1.00 0.00 ? 36 HIS A NE2  18 
ATOM 10692 H H    . HIS A 1 33 ? 3.126   -16.208 -0.309  1.00 0.00 ? 36 HIS A H    18 
ATOM 10693 H HA   . HIS A 1 33 ? 4.816   -17.601 1.402   1.00 0.00 ? 36 HIS A HA   18 
ATOM 10694 H HB2  . HIS A 1 33 ? 2.876   -18.036 2.785   1.00 0.00 ? 36 HIS A HB2  18 
ATOM 10695 H HB3  . HIS A 1 33 ? 2.771   -16.411 2.123   1.00 0.00 ? 36 HIS A HB3  18 
ATOM 10696 H HD1  . HIS A 1 33 ? 0.476   -18.631 3.053   1.00 0.00 ? 36 HIS A HD1  18 
ATOM 10697 H HD2  . HIS A 1 33 ? 1.306   -17.106 -0.711  1.00 0.00 ? 36 HIS A HD2  18 
ATOM 10698 H HE1  . HIS A 1 33 ? -1.651  -18.901 1.739   1.00 0.00 ? 36 HIS A HE1  18 
ATOM 10699 H HE2  . HIS A 1 33 ? -1.188  -17.716 -0.442  1.00 0.00 ? 36 HIS A HE2  18 
ATOM 10700 N N    . LEU A 1 34 ? 3.169   -19.577 -0.609  1.00 0.00 ? 37 LEU A N    18 
ATOM 10701 C CA   . LEU A 1 34 ? 3.057   -20.957 -1.085  1.00 0.00 ? 37 LEU A CA   18 
ATOM 10702 C C    . LEU A 1 34 ? 4.063   -21.265 -2.207  1.00 0.00 ? 37 LEU A C    18 
ATOM 10703 O O    . LEU A 1 34 ? 4.006   -22.333 -2.816  1.00 0.00 ? 37 LEU A O    18 
ATOM 10704 C CB   . LEU A 1 34 ? 1.628   -21.232 -1.570  1.00 0.00 ? 37 LEU A CB   18 
ATOM 10705 C CG   . LEU A 1 34 ? 1.141   -20.342 -2.719  1.00 0.00 ? 37 LEU A CG   18 
ATOM 10706 C CD1  . LEU A 1 34 ? 1.189   -21.097 -4.037  1.00 0.00 ? 37 LEU A CD1  18 
ATOM 10707 C CD2  . LEU A 1 34 ? -0.268  -19.843 -2.445  1.00 0.00 ? 37 LEU A CD2  18 
ATOM 10708 H H    . LEU A 1 34 ? 2.747   -18.861 -1.127  1.00 0.00 ? 37 LEU A H    18 
ATOM 10709 H HA   . LEU A 1 34 ? 3.270   -21.608 -0.251  1.00 0.00 ? 37 LEU A HA   18 
ATOM 10710 H HB2  . LEU A 1 34 ? 1.574   -22.263 -1.892  1.00 0.00 ? 37 LEU A HB2  18 
ATOM 10711 H HB3  . LEU A 1 34 ? 0.959   -21.101 -0.733  1.00 0.00 ? 37 LEU A HB3  18 
ATOM 10712 H HG   . LEU A 1 34 ? 1.790   -19.484 -2.804  1.00 0.00 ? 37 LEU A HG   18 
ATOM 10713 H HD11 . LEU A 1 34 ? 1.365   -20.400 -4.843  1.00 0.00 ? 37 LEU A HD11 18 
ATOM 10714 H HD12 . LEU A 1 34 ? 0.248   -21.603 -4.197  1.00 0.00 ? 37 LEU A HD12 18 
ATOM 10715 H HD13 . LEU A 1 34 ? 1.988   -21.824 -4.008  1.00 0.00 ? 37 LEU A HD13 18 
ATOM 10716 H HD21 . LEU A 1 34 ? -0.505  -19.984 -1.401  1.00 0.00 ? 37 LEU A HD21 18 
ATOM 10717 H HD22 . LEU A 1 34 ? -0.970  -20.396 -3.052  1.00 0.00 ? 37 LEU A HD22 18 
ATOM 10718 H HD23 . LEU A 1 34 ? -0.330  -18.794 -2.690  1.00 0.00 ? 37 LEU A HD23 18 
ATOM 10719 N N    . MET A 1 35 ? 4.984   -20.334 -2.478  1.00 0.00 ? 38 MET A N    18 
ATOM 10720 C CA   . MET A 1 35 ? 5.986   -20.530 -3.526  1.00 0.00 ? 38 MET A CA   18 
ATOM 10721 C C    . MET A 1 35 ? 7.362   -20.890 -2.949  1.00 0.00 ? 38 MET A C    18 
ATOM 10722 O O    . MET A 1 35 ? 8.298   -21.182 -3.698  1.00 0.00 ? 38 MET A O    18 
ATOM 10723 C CB   . MET A 1 35 ? 6.090   -19.268 -4.389  1.00 0.00 ? 38 MET A CB   18 
ATOM 10724 C CG   . MET A 1 35 ? 5.881   -19.525 -5.873  1.00 0.00 ? 38 MET A CG   18 
ATOM 10725 S SD   . MET A 1 35 ? 7.297   -19.025 -6.871  1.00 0.00 ? 38 MET A SD   18 
ATOM 10726 C CE   . MET A 1 35 ? 8.207   -20.565 -6.961  1.00 0.00 ? 38 MET A CE   18 
ATOM 10727 H H    . MET A 1 35 ? 4.992   -19.498 -1.964  1.00 0.00 ? 38 MET A H    18 
ATOM 10728 H HA   . MET A 1 35 ? 5.655   -21.347 -4.144  1.00 0.00 ? 38 MET A HA   18 
ATOM 10729 H HB2  . MET A 1 35 ? 5.344   -18.559 -4.059  1.00 0.00 ? 38 MET A HB2  18 
ATOM 10730 H HB3  . MET A 1 35 ? 7.068   -18.834 -4.253  1.00 0.00 ? 38 MET A HB3  18 
ATOM 10731 H HG2  . MET A 1 35 ? 5.709   -20.581 -6.023  1.00 0.00 ? 38 MET A HG2  18 
ATOM 10732 H HG3  . MET A 1 35 ? 5.012   -18.971 -6.202  1.00 0.00 ? 38 MET A HG3  18 
ATOM 10733 H HE1  . MET A 1 35 ? 8.312   -20.979 -5.969  1.00 0.00 ? 38 MET A HE1  18 
ATOM 10734 H HE2  . MET A 1 35 ? 9.186   -20.382 -7.379  1.00 0.00 ? 38 MET A HE2  18 
ATOM 10735 H HE3  . MET A 1 35 ? 7.673   -21.263 -7.588  1.00 0.00 ? 38 MET A HE3  18 
ATOM 10736 N N    . ALA A 1 36 ? 7.480   -20.871 -1.621  1.00 0.00 ? 39 ALA A N    18 
ATOM 10737 C CA   . ALA A 1 36 ? 8.740   -21.195 -0.952  1.00 0.00 ? 39 ALA A CA   18 
ATOM 10738 C C    . ALA A 1 36 ? 8.503   -21.656 0.491   1.00 0.00 ? 39 ALA A C    18 
ATOM 10739 O O    . ALA A 1 36 ? 9.108   -21.135 1.431   1.00 0.00 ? 39 ALA A O    18 
ATOM 10740 C CB   . ALA A 1 36 ? 9.671   -19.989 -0.990  1.00 0.00 ? 39 ALA A CB   18 
ATOM 10741 H H    . ALA A 1 36 ? 6.703   -20.632 -1.078  1.00 0.00 ? 39 ALA A H    18 
ATOM 10742 H HA   . ALA A 1 36 ? 9.210   -21.999 -1.500  1.00 0.00 ? 39 ALA A HA   18 
ATOM 10743 H HB1  . ALA A 1 36 ? 10.624  -20.256 -0.557  1.00 0.00 ? 39 ALA A HB1  18 
ATOM 10744 H HB2  . ALA A 1 36 ? 9.233   -19.178 -0.426  1.00 0.00 ? 39 ALA A HB2  18 
ATOM 10745 H HB3  . ALA A 1 36 ? 9.814   -19.678 -2.015  1.00 0.00 ? 39 ALA A HB3  18 
ATOM 10746 N N    . GLN A 1 37 ? 7.616   -22.637 0.660   1.00 0.00 ? 40 GLN A N    18 
ATOM 10747 C CA   . GLN A 1 37 ? 7.298   -23.168 1.983   1.00 0.00 ? 40 GLN A CA   18 
ATOM 10748 C C    . GLN A 1 37 ? 7.325   -24.700 1.987   1.00 0.00 ? 40 GLN A C    18 
ATOM 10749 O O    . GLN A 1 37 ? 8.205   -25.301 2.600   1.00 0.00 ? 40 GLN A O    18 
ATOM 10750 C CB   . GLN A 1 37 ? 5.930   -22.656 2.442   1.00 0.00 ? 40 GLN A CB   18 
ATOM 10751 C CG   . GLN A 1 37 ? 5.955   -21.999 3.815   1.00 0.00 ? 40 GLN A CG   18 
ATOM 10752 C CD   . GLN A 1 37 ? 4.569   -21.717 4.365   1.00 0.00 ? 40 GLN A CD   18 
ATOM 10753 O OE1  . GLN A 1 37 ? 4.249   -22.092 5.489   1.00 0.00 ? 40 GLN A OE1  18 
ATOM 10754 N NE2  . GLN A 1 37 ? 3.741   -21.043 3.580   1.00 0.00 ? 40 GLN A NE2  18 
ATOM 10755 H H    . GLN A 1 37 ? 7.166   -23.013 -0.121  1.00 0.00 ? 40 GLN A H    18 
ATOM 10756 H HA   . GLN A 1 37 ? 8.052   -22.812 2.667   1.00 0.00 ? 40 GLN A HA   18 
ATOM 10757 H HB2  . GLN A 1 37 ? 5.572   -21.931 1.726   1.00 0.00 ? 40 GLN A HB2  18 
ATOM 10758 H HB3  . GLN A 1 37 ? 5.240   -23.486 2.475   1.00 0.00 ? 40 GLN A HB3  18 
ATOM 10759 H HG2  . GLN A 1 37 ? 6.466   -22.654 4.504   1.00 0.00 ? 40 GLN A HG2  18 
ATOM 10760 H HG3  . GLN A 1 37 ? 6.494   -21.065 3.743   1.00 0.00 ? 40 GLN A HG3  18 
ATOM 10761 H HE21 . GLN A 1 37 ? 4.061   -20.764 2.691   1.00 0.00 ? 40 GLN A HE21 18 
ATOM 10762 H HE22 . GLN A 1 37 ? 2.842   -20.854 3.917   1.00 0.00 ? 40 GLN A HE22 18 
ATOM 10763 N N    . ILE A 1 38 ? 6.355   -25.312 1.293   1.00 0.00 ? 41 ILE A N    18 
ATOM 10764 C CA   . ILE A 1 38 ? 6.244   -26.774 1.197   1.00 0.00 ? 41 ILE A CA   18 
ATOM 10765 C C    . ILE A 1 38 ? 5.584   -27.381 2.444   1.00 0.00 ? 41 ILE A C    18 
ATOM 10766 O O    . ILE A 1 38 ? 5.727   -26.803 3.544   1.00 0.00 ? 41 ILE A O    18 
ATOM 10767 C CB   . ILE A 1 38 ? 7.622   -27.443 0.925   1.00 0.00 ? 41 ILE A CB   18 
ATOM 10768 C CG1  . ILE A 1 38 ? 7.526   -28.381 -0.280  1.00 0.00 ? 41 ILE A CG1  18 
ATOM 10769 C CG2  . ILE A 1 38 ? 8.132   -28.204 2.145   1.00 0.00 ? 41 ILE A CG2  18 
ATOM 10770 C CD1  . ILE A 1 38 ? 8.830   -28.534 -1.031  1.00 0.00 ? 41 ILE A CD1  18 
ATOM 10771 O OXT  . ILE A 1 38 ? 4.921   -28.431 2.304   1.00 0.00 ? 41 ILE A OXT  18 
ATOM 10772 H H    . ILE A 1 38 ? 5.692   -24.763 0.828   1.00 0.00 ? 41 ILE A H    18 
ATOM 10773 H HA   . ILE A 1 38 ? 5.605   -26.987 0.351   1.00 0.00 ? 41 ILE A HA   18 
ATOM 10774 H HB   . ILE A 1 38 ? 8.333   -26.662 0.703   1.00 0.00 ? 41 ILE A HB   18 
ATOM 10775 H HG12 . ILE A 1 38 ? 7.221   -29.359 0.059   1.00 0.00 ? 41 ILE A HG12 18 
ATOM 10776 H HG13 . ILE A 1 38 ? 6.788   -27.996 -0.969  1.00 0.00 ? 41 ILE A HG13 18 
ATOM 10777 H HG21 . ILE A 1 38 ? 7.504   -29.065 2.319   1.00 0.00 ? 41 ILE A HG21 18 
ATOM 10778 H HG22 . ILE A 1 38 ? 8.104   -27.558 3.010   1.00 0.00 ? 41 ILE A HG22 18 
ATOM 10779 H HG23 . ILE A 1 38 ? 9.147   -28.528 1.969   1.00 0.00 ? 41 ILE A HG23 18 
ATOM 10780 H HD11 . ILE A 1 38 ? 8.760   -29.376 -1.704  1.00 0.00 ? 41 ILE A HD11 18 
ATOM 10781 H HD12 . ILE A 1 38 ? 9.633   -28.702 -0.328  1.00 0.00 ? 41 ILE A HD12 18 
ATOM 10782 H HD13 . ILE A 1 38 ? 9.029   -27.636 -1.597  1.00 0.00 ? 41 ILE A HD13 18 
ATOM 10783 N N    . PHE A 1 1  ? -18.494 0.813   1.012   1.00 0.00 ? 4  PHE A N    19 
ATOM 10784 C CA   . PHE A 1 1  ? -17.456 1.718   1.591   1.00 0.00 ? 4  PHE A CA   19 
ATOM 10785 C C    . PHE A 1 1  ? -18.010 3.130   1.807   1.00 0.00 ? 4  PHE A C    19 
ATOM 10786 O O    . PHE A 1 1  ? -19.151 3.415   1.443   1.00 0.00 ? 4  PHE A O    19 
ATOM 10787 C CB   . PHE A 1 1  ? -16.245 1.757   0.645   1.00 0.00 ? 4  PHE A CB   19 
ATOM 10788 C CG   . PHE A 1 1  ? -16.601 2.010   -0.794  1.00 0.00 ? 4  PHE A CG   19 
ATOM 10789 C CD1  . PHE A 1 1  ? -16.952 3.280   -1.223  1.00 0.00 ? 4  PHE A CD1  19 
ATOM 10790 C CD2  . PHE A 1 1  ? -16.587 0.977   -1.717  1.00 0.00 ? 4  PHE A CD2  19 
ATOM 10791 C CE1  . PHE A 1 1  ? -17.282 3.514   -2.544  1.00 0.00 ? 4  PHE A CE1  19 
ATOM 10792 C CE2  . PHE A 1 1  ? -16.917 1.204   -3.039  1.00 0.00 ? 4  PHE A CE2  19 
ATOM 10793 C CZ   . PHE A 1 1  ? -17.264 2.476   -3.452  1.00 0.00 ? 4  PHE A CZ   19 
ATOM 10794 H H1   . PHE A 1 1  ? -18.024 -0.067  0.719   1.00 0.00 ? 4  PHE A H1   19 
ATOM 10795 H H2   . PHE A 1 1  ? -18.923 1.301   0.196   1.00 0.00 ? 4  PHE A H2   19 
ATOM 10796 H H3   . PHE A 1 1  ? -19.202 0.629   1.751   1.00 0.00 ? 4  PHE A H3   19 
ATOM 10797 H HA   . PHE A 1 1  ? -17.148 1.318   2.545   1.00 0.00 ? 4  PHE A HA   19 
ATOM 10798 H HB2  . PHE A 1 1  ? -15.575 2.543   0.960   1.00 0.00 ? 4  PHE A HB2  19 
ATOM 10799 H HB3  . PHE A 1 1  ? -15.726 0.810   0.697   1.00 0.00 ? 4  PHE A HB3  19 
ATOM 10800 H HD1  . PHE A 1 1  ? -16.965 4.094   -0.513  1.00 0.00 ? 4  PHE A HD1  19 
ATOM 10801 H HD2  . PHE A 1 1  ? -16.314 -0.018  -1.395  1.00 0.00 ? 4  PHE A HD2  19 
ATOM 10802 H HE1  . PHE A 1 1  ? -17.553 4.510   -2.864  1.00 0.00 ? 4  PHE A HE1  19 
ATOM 10803 H HE2  . PHE A 1 1  ? -16.901 0.391   -3.748  1.00 0.00 ? 4  PHE A HE2  19 
ATOM 10804 H HZ   . PHE A 1 1  ? -17.521 2.656   -4.486  1.00 0.00 ? 4  PHE A HZ   19 
ATOM 10805 N N    . THR A 1 2  ? -17.196 4.004   2.396   1.00 0.00 ? 5  THR A N    19 
ATOM 10806 C CA   . THR A 1 2  ? -17.597 5.383   2.658   1.00 0.00 ? 5  THR A CA   19 
ATOM 10807 C C    . THR A 1 2  ? -16.840 6.343   1.734   1.00 0.00 ? 5  THR A C    19 
ATOM 10808 O O    . THR A 1 2  ? -16.501 5.986   0.603   1.00 0.00 ? 5  THR A O    19 
ATOM 10809 C CB   . THR A 1 2  ? -17.351 5.723   4.136   1.00 0.00 ? 5  THR A CB   19 
ATOM 10810 O OG1  . THR A 1 2  ? -15.964 5.771   4.415   1.00 0.00 ? 5  THR A OG1  19 
ATOM 10811 C CG2  . THR A 1 2  ? -17.971 4.727   5.091   1.00 0.00 ? 5  THR A CG2  19 
ATOM 10812 H H    . THR A 1 2  ? -16.297 3.723   2.662   1.00 0.00 ? 5  THR A H    19 
ATOM 10813 H HA   . THR A 1 2  ? -18.650 5.473   2.450   1.00 0.00 ? 5  THR A HA   19 
ATOM 10814 H HB   . THR A 1 2  ? -17.777 6.694   4.349   1.00 0.00 ? 5  THR A HB   19 
ATOM 10815 H HG1  . THR A 1 2  ? -15.827 5.935   5.353   1.00 0.00 ? 5  THR A HG1  19 
ATOM 10816 H HG21 . THR A 1 2  ? -17.239 3.981   5.358   1.00 0.00 ? 5  THR A HG21 19 
ATOM 10817 H HG22 . THR A 1 2  ? -18.815 4.249   4.616   1.00 0.00 ? 5  THR A HG22 19 
ATOM 10818 H HG23 . THR A 1 2  ? -18.303 5.240   5.981   1.00 0.00 ? 5  THR A HG23 19 
ATOM 10819 N N    . LEU A 1 3  ? -16.585 7.555   2.212   1.00 0.00 ? 6  LEU A N    19 
ATOM 10820 C CA   . LEU A 1 3  ? -15.869 8.564   1.428   1.00 0.00 ? 6  LEU A CA   19 
ATOM 10821 C C    . LEU A 1 3  ? -14.446 8.103   1.091   1.00 0.00 ? 6  LEU A C    19 
ATOM 10822 O O    . LEU A 1 3  ? -13.839 7.324   1.829   1.00 0.00 ? 6  LEU A O    19 
ATOM 10823 C CB   . LEU A 1 3  ? -15.851 9.913   2.173   1.00 0.00 ? 6  LEU A CB   19 
ATOM 10824 C CG   . LEU A 1 3  ? -14.845 10.055  3.329   1.00 0.00 ? 6  LEU A CG   19 
ATOM 10825 C CD1  . LEU A 1 3  ? -14.913 8.866   4.276   1.00 0.00 ? 6  LEU A CD1  19 
ATOM 10826 C CD2  . LEU A 1 3  ? -13.431 10.233  2.799   1.00 0.00 ? 6  LEU A CD2  19 
ATOM 10827 H H    . LEU A 1 3  ? -16.883 7.775   3.112   1.00 0.00 ? 6  LEU A H    19 
ATOM 10828 H HA   . LEU A 1 3  ? -16.410 8.690   0.502   1.00 0.00 ? 6  LEU A HA   19 
ATOM 10829 H HB2  . LEU A 1 3  ? -15.638 10.688  1.452   1.00 0.00 ? 6  LEU A HB2  19 
ATOM 10830 H HB3  . LEU A 1 3  ? -16.841 10.087  2.569   1.00 0.00 ? 6  LEU A HB3  19 
ATOM 10831 H HG   . LEU A 1 3  ? -15.095 10.940  3.900   1.00 0.00 ? 6  LEU A HG   19 
ATOM 10832 H HD11 . LEU A 1 3  ? -14.767 7.953   3.719   1.00 0.00 ? 6  LEU A HD11 19 
ATOM 10833 H HD12 . LEU A 1 3  ? -15.878 8.845   4.758   1.00 0.00 ? 6  LEU A HD12 19 
ATOM 10834 H HD13 . LEU A 1 3  ? -14.139 8.959   5.023   1.00 0.00 ? 6  LEU A HD13 19 
ATOM 10835 H HD21 . LEU A 1 3  ? -13.469 10.665  1.810   1.00 0.00 ? 6  LEU A HD21 19 
ATOM 10836 H HD22 . LEU A 1 3  ? -12.940 9.273   2.755   1.00 0.00 ? 6  LEU A HD22 19 
ATOM 10837 H HD23 . LEU A 1 3  ? -12.881 10.889  3.456   1.00 0.00 ? 6  LEU A HD23 19 
ATOM 10838 N N    . SER A 1 4  ? -13.923 8.583   -0.037  1.00 0.00 ? 7  SER A N    19 
ATOM 10839 C CA   . SER A 1 4  ? -12.574 8.216   -0.480  1.00 0.00 ? 7  SER A CA   19 
ATOM 10840 C C    . SER A 1 4  ? -12.103 9.111   -1.632  1.00 0.00 ? 7  SER A C    19 
ATOM 10841 O O    . SER A 1 4  ? -11.686 8.619   -2.683  1.00 0.00 ? 7  SER A O    19 
ATOM 10842 C CB   . SER A 1 4  ? -12.546 6.740   -0.905  1.00 0.00 ? 7  SER A CB   19 
ATOM 10843 O OG   . SER A 1 4  ? -11.282 6.379   -1.444  1.00 0.00 ? 7  SER A OG   19 
ATOM 10844 H H    . SER A 1 4  ? -14.457 9.193   -0.589  1.00 0.00 ? 7  SER A H    19 
ATOM 10845 H HA   . SER A 1 4  ? -11.903 8.350   0.357   1.00 0.00 ? 7  SER A HA   19 
ATOM 10846 H HB2  . SER A 1 4  ? -12.745 6.117   -0.045  1.00 0.00 ? 7  SER A HB2  19 
ATOM 10847 H HB3  . SER A 1 4  ? -13.306 6.570   -1.654  1.00 0.00 ? 7  SER A HB3  19 
ATOM 10848 H HG   . SER A 1 4  ? -11.068 6.962   -2.185  1.00 0.00 ? 7  SER A HG   19 
ATOM 10849 N N    . LEU A 1 5  ? -12.171 10.426  -1.427  1.00 0.00 ? 8  LEU A N    19 
ATOM 10850 C CA   . LEU A 1 5  ? -11.754 11.384  -2.451  1.00 0.00 ? 8  LEU A CA   19 
ATOM 10851 C C    . LEU A 1 5  ? -10.861 12.486  -1.867  1.00 0.00 ? 8  LEU A C    19 
ATOM 10852 O O    . LEU A 1 5  ? -11.087 13.672  -2.104  1.00 0.00 ? 8  LEU A O    19 
ATOM 10853 C CB   . LEU A 1 5  ? -12.985 11.997  -3.127  1.00 0.00 ? 8  LEU A CB   19 
ATOM 10854 C CG   . LEU A 1 5  ? -13.671 11.102  -4.161  1.00 0.00 ? 8  LEU A CG   19 
ATOM 10855 C CD1  . LEU A 1 5  ? -15.139 11.469  -4.294  1.00 0.00 ? 8  LEU A CD1  19 
ATOM 10856 C CD2  . LEU A 1 5  ? -12.973 11.212  -5.506  1.00 0.00 ? 8  LEU A CD2  19 
ATOM 10857 H H    . LEU A 1 5  ? -12.511 10.760  -0.570  1.00 0.00 ? 8  LEU A H    19 
ATOM 10858 H HA   . LEU A 1 5  ? -11.186 10.842  -3.193  1.00 0.00 ? 8  LEU A HA   19 
ATOM 10859 H HB2  . LEU A 1 5  ? -13.705 12.244  -2.360  1.00 0.00 ? 8  LEU A HB2  19 
ATOM 10860 H HB3  . LEU A 1 5  ? -12.684 12.910  -3.619  1.00 0.00 ? 8  LEU A HB3  19 
ATOM 10861 H HG   . LEU A 1 5  ? -13.612 10.073  -3.835  1.00 0.00 ? 8  LEU A HG   19 
ATOM 10862 H HD11 . LEU A 1 5  ? -15.225 12.481  -4.663  1.00 0.00 ? 8  LEU A HD11 19 
ATOM 10863 H HD12 . LEU A 1 5  ? -15.617 11.395  -3.329  1.00 0.00 ? 8  LEU A HD12 19 
ATOM 10864 H HD13 . LEU A 1 5  ? -15.617 10.792  -4.987  1.00 0.00 ? 8  LEU A HD13 19 
ATOM 10865 H HD21 . LEU A 1 5  ? -13.634 10.860  -6.284  1.00 0.00 ? 8  LEU A HD21 19 
ATOM 10866 H HD22 . LEU A 1 5  ? -12.076 10.610  -5.496  1.00 0.00 ? 8  LEU A HD22 19 
ATOM 10867 H HD23 . LEU A 1 5  ? -12.713 12.242  -5.694  1.00 0.00 ? 8  LEU A HD23 19 
ATOM 10868 N N    . ASP A 1 6  ? -9.838  12.081  -1.113  1.00 0.00 ? 9  ASP A N    19 
ATOM 10869 C CA   . ASP A 1 6  ? -8.906  13.030  -0.506  1.00 0.00 ? 9  ASP A CA   19 
ATOM 10870 C C    . ASP A 1 6  ? -7.511  12.415  -0.370  1.00 0.00 ? 9  ASP A C    19 
ATOM 10871 O O    . ASP A 1 6  ? -7.171  11.817  0.655   1.00 0.00 ? 9  ASP A O    19 
ATOM 10872 C CB   . ASP A 1 6  ? -9.426  13.499  0.859   1.00 0.00 ? 9  ASP A CB   19 
ATOM 10873 C CG   . ASP A 1 6  ? -9.098  14.953  1.137   1.00 0.00 ? 9  ASP A CG   19 
ATOM 10874 O OD1  . ASP A 1 6  ? -7.902  15.313  1.093   1.00 0.00 ? 9  ASP A OD1  19 
ATOM 10875 O OD2  . ASP A 1 6  ? -10.037 15.732  1.397   1.00 0.00 ? 9  ASP A OD2  19 
ATOM 10876 H H    . ASP A 1 6  ? -9.702  11.123  -0.967  1.00 0.00 ? 9  ASP A H    19 
ATOM 10877 H HA   . ASP A 1 6  ? -8.835  13.883  -1.165  1.00 0.00 ? 9  ASP A HA   19 
ATOM 10878 H HB2  . ASP A 1 6  ? -10.499 13.383  0.889   1.00 0.00 ? 9  ASP A HB2  19 
ATOM 10879 H HB3  . ASP A 1 6  ? -8.980  12.896  1.636   1.00 0.00 ? 9  ASP A HB3  19 
ATOM 10880 N N    . VAL A 1 7  ? -6.714  12.565  -1.421  1.00 0.00 ? 10 VAL A N    19 
ATOM 10881 C CA   . VAL A 1 7  ? -5.356  12.032  -1.446  1.00 0.00 ? 10 VAL A CA   19 
ATOM 10882 C C    . VAL A 1 7  ? -4.330  13.164  -1.571  1.00 0.00 ? 10 VAL A C    19 
ATOM 10883 O O    . VAL A 1 7  ? -3.729  13.364  -2.631  1.00 0.00 ? 10 VAL A O    19 
ATOM 10884 C CB   . VAL A 1 7  ? -5.179  11.026  -2.605  1.00 0.00 ? 10 VAL A CB   19 
ATOM 10885 C CG1  . VAL A 1 7  ? -3.760  10.474  -2.641  1.00 0.00 ? 10 VAL A CG1  19 
ATOM 10886 C CG2  . VAL A 1 7  ? -6.185  9.889   -2.490  1.00 0.00 ? 10 VAL A CG2  19 
ATOM 10887 H H    . VAL A 1 7  ? -7.050  13.046  -2.205  1.00 0.00 ? 10 VAL A H    19 
ATOM 10888 H HA   . VAL A 1 7  ? -5.185  11.509  -0.514  1.00 0.00 ? 10 VAL A HA   19 
ATOM 10889 H HB   . VAL A 1 7  ? -5.365  11.548  -3.533  1.00 0.00 ? 10 VAL A HB   19 
ATOM 10890 H HG11 . VAL A 1 7  ? -3.571  9.912   -1.739  1.00 0.00 ? 10 VAL A HG11 19 
ATOM 10891 H HG12 . VAL A 1 7  ? -3.057  11.290  -2.713  1.00 0.00 ? 10 VAL A HG12 19 
ATOM 10892 H HG13 . VAL A 1 7  ? -3.649  9.826   -3.497  1.00 0.00 ? 10 VAL A HG13 19 
ATOM 10893 H HG21 . VAL A 1 7  ? -6.850  9.909   -3.341  1.00 0.00 ? 10 VAL A HG21 19 
ATOM 10894 H HG22 . VAL A 1 7  ? -6.759  10.006  -1.582  1.00 0.00 ? 10 VAL A HG22 19 
ATOM 10895 H HG23 . VAL A 1 7  ? -5.661  8.946   -2.465  1.00 0.00 ? 10 VAL A HG23 19 
ATOM 10896 N N    . PRO A 1 8  ? -4.122  13.932  -0.484  1.00 0.00 ? 11 PRO A N    19 
ATOM 10897 C CA   . PRO A 1 8  ? -3.168  15.053  -0.472  1.00 0.00 ? 11 PRO A CA   19 
ATOM 10898 C C    . PRO A 1 8  ? -1.715  14.588  -0.591  1.00 0.00 ? 11 PRO A C    19 
ATOM 10899 O O    . PRO A 1 8  ? -1.410  13.413  -0.378  1.00 0.00 ? 11 PRO A O    19 
ATOM 10900 C CB   . PRO A 1 8  ? -3.412  15.711  0.890   1.00 0.00 ? 11 PRO A CB   19 
ATOM 10901 C CG   . PRO A 1 8  ? -3.976  14.626  1.738   1.00 0.00 ? 11 PRO A CG   19 
ATOM 10902 C CD   . PRO A 1 8  ? -4.803  13.776  0.816   1.00 0.00 ? 11 PRO A CD   19 
ATOM 10903 H HA   . PRO A 1 8  ? -3.382  15.759  -1.261  1.00 0.00 ? 11 PRO A HA   19 
ATOM 10904 H HB2  . PRO A 1 8  ? -2.479  16.084  1.287   1.00 0.00 ? 11 PRO A HB2  19 
ATOM 10905 H HB3  . PRO A 1 8  ? -4.112  16.526  0.777   1.00 0.00 ? 11 PRO A HB3  19 
ATOM 10906 H HG2  . PRO A 1 8  ? -3.177  14.043  2.171   1.00 0.00 ? 11 PRO A HG2  19 
ATOM 10907 H HG3  . PRO A 1 8  ? -4.597  15.049  2.515   1.00 0.00 ? 11 PRO A HG3  19 
ATOM 10908 H HD2  . PRO A 1 8  ? -4.792  12.745  1.139   1.00 0.00 ? 11 PRO A HD2  19 
ATOM 10909 H HD3  . PRO A 1 8  ? -5.817  14.147  0.767   1.00 0.00 ? 11 PRO A HD3  19 
ATOM 10910 N N    . THR A 1 9  ? -0.821  15.520  -0.926  1.00 0.00 ? 12 THR A N    19 
ATOM 10911 C CA   . THR A 1 9  ? 0.610   15.220  -1.073  1.00 0.00 ? 12 THR A CA   19 
ATOM 10912 C C    . THR A 1 9  ? 1.125   14.361  0.084   1.00 0.00 ? 12 THR A C    19 
ATOM 10913 O O    . THR A 1 9  ? 1.843   13.382  -0.131  1.00 0.00 ? 12 THR A O    19 
ATOM 10914 C CB   . THR A 1 9  ? 1.425   16.515  -1.159  1.00 0.00 ? 12 THR A CB   19 
ATOM 10915 O OG1  . THR A 1 9  ? 0.587   17.622  -1.454  1.00 0.00 ? 12 THR A OG1  19 
ATOM 10916 C CG2  . THR A 1 9  ? 2.517   16.469  -2.208  1.00 0.00 ? 12 THR A CG2  19 
ATOM 10917 H H    . THR A 1 9  ? -1.126  16.440  -1.075  1.00 0.00 ? 12 THR A H    19 
ATOM 10918 H HA   . THR A 1 9  ? 0.739   14.668  -1.991  1.00 0.00 ? 12 THR A HA   19 
ATOM 10919 H HB   . THR A 1 9  ? 1.894   16.692  -0.203  1.00 0.00 ? 12 THR A HB   19 
ATOM 10920 H HG1  . THR A 1 9  ? 0.586   17.789  -2.401  1.00 0.00 ? 12 THR A HG1  19 
ATOM 10921 H HG21 . THR A 1 9  ? 3.332   15.857  -1.851  1.00 0.00 ? 12 THR A HG21 19 
ATOM 10922 H HG22 . THR A 1 9  ? 2.874   17.470  -2.398  1.00 0.00 ? 12 THR A HG22 19 
ATOM 10923 H HG23 . THR A 1 9  ? 2.122   16.047  -3.120  1.00 0.00 ? 12 THR A HG23 19 
ATOM 10924 N N    . ASN A 1 10 ? 0.741   14.730  1.309   1.00 0.00 ? 13 ASN A N    19 
ATOM 10925 C CA   . ASN A 1 10 ? 1.152   13.987  2.502   1.00 0.00 ? 13 ASN A CA   19 
ATOM 10926 C C    . ASN A 1 10 ? 0.733   12.535  2.399   1.00 0.00 ? 13 ASN A C    19 
ATOM 10927 O O    . ASN A 1 10 ? 1.546   11.615  2.518   1.00 0.00 ? 13 ASN A O    19 
ATOM 10928 C CB   . ASN A 1 10 ? 0.559   14.620  3.769   1.00 0.00 ? 13 ASN A CB   19 
ATOM 10929 C CG   . ASN A 1 10 ? 0.868   16.100  3.889   1.00 0.00 ? 13 ASN A CG   19 
ATOM 10930 O OD1  . ASN A 1 10 ? 1.982   16.536  3.616   1.00 0.00 ? 13 ASN A OD1  19 
ATOM 10931 N ND2  . ASN A 1 10 ? -0.121  16.882  4.298   1.00 0.00 ? 13 ASN A ND2  19 
ATOM 10932 H H    . ASN A 1 10 ? 0.161   15.514  1.409   1.00 0.00 ? 13 ASN A H    19 
ATOM 10933 H HA   . ASN A 1 10 ? 2.207   14.019  2.555   1.00 0.00 ? 13 ASN A HA   19 
ATOM 10934 H HB2  . ASN A 1 10 ? -0.513  14.498  3.757   1.00 0.00 ? 13 ASN A HB2  19 
ATOM 10935 H HB3  . ASN A 1 10 ? 0.962   14.118  4.636   1.00 0.00 ? 13 ASN A HB3  19 
ATOM 10936 H HD21 . ASN A 1 10 ? -0.987  16.471  4.500   1.00 0.00 ? 13 ASN A HD21 19 
ATOM 10937 H HD22 . ASN A 1 10 ? 0.058   17.840  4.385   1.00 0.00 ? 13 ASN A HD22 19 
ATOM 10938 N N    . ILE A 1 11 ? -0.542  12.359  2.148   1.00 0.00 ? 14 ILE A N    19 
ATOM 10939 C CA   . ILE A 1 11 ? -1.135  11.044  1.988   1.00 0.00 ? 14 ILE A CA   19 
ATOM 10940 C C    . ILE A 1 11 ? -0.589  10.364  0.735   1.00 0.00 ? 14 ILE A C    19 
ATOM 10941 O O    . ILE A 1 11 ? -0.230  9.191   0.771   1.00 0.00 ? 14 ILE A O    19 
ATOM 10942 C CB   . ILE A 1 11 ? -2.670  11.167  1.924   1.00 0.00 ? 14 ILE A CB   19 
ATOM 10943 C CG1  . ILE A 1 11 ? -3.267  11.060  3.328   1.00 0.00 ? 14 ILE A CG1  19 
ATOM 10944 C CG2  . ILE A 1 11 ? -3.284  10.115  1.006   1.00 0.00 ? 14 ILE A CG2  19 
ATOM 10945 C CD1  . ILE A 1 11 ? -4.640  11.685  3.455   1.00 0.00 ? 14 ILE A CD1  19 
ATOM 10946 H H    . ILE A 1 11 ? -1.101  13.151  2.049   1.00 0.00 ? 14 ILE A H    19 
ATOM 10947 H HA   . ILE A 1 11 ? -0.873  10.450  2.850   1.00 0.00 ? 14 ILE A HA   19 
ATOM 10948 H HB   . ILE A 1 11 ? -2.893  12.144  1.522   1.00 0.00 ? 14 ILE A HB   19 
ATOM 10949 H HG12 . ILE A 1 11 ? -3.353  10.018  3.597   1.00 0.00 ? 14 ILE A HG12 19 
ATOM 10950 H HG13 . ILE A 1 11 ? -2.611  11.555  4.030   1.00 0.00 ? 14 ILE A HG13 19 
ATOM 10951 H HG21 . ILE A 1 11 ? -2.847  9.150   1.219   1.00 0.00 ? 14 ILE A HG21 19 
ATOM 10952 H HG22 . ILE A 1 11 ? -3.090  10.378  -0.023  1.00 0.00 ? 14 ILE A HG22 19 
ATOM 10953 H HG23 . ILE A 1 11 ? -4.350  10.072  1.171   1.00 0.00 ? 14 ILE A HG23 19 
ATOM 10954 H HD11 . ILE A 1 11 ? -5.137  11.289  4.328   1.00 0.00 ? 14 ILE A HD11 19 
ATOM 10955 H HD12 . ILE A 1 11 ? -5.222  11.454  2.575   1.00 0.00 ? 14 ILE A HD12 19 
ATOM 10956 H HD13 . ILE A 1 11 ? -4.541  12.756  3.552   1.00 0.00 ? 14 ILE A HD13 19 
ATOM 10957 N N    . MET A 1 12 ? -0.502  11.113  -0.364  1.00 0.00 ? 15 MET A N    19 
ATOM 10958 C CA   . MET A 1 12 ? 0.030   10.587  -1.612  1.00 0.00 ? 15 MET A CA   19 
ATOM 10959 C C    . MET A 1 12 ? 1.416   9.980   -1.387  1.00 0.00 ? 15 MET A C    19 
ATOM 10960 O O    . MET A 1 12 ? 1.679   8.846   -1.792  1.00 0.00 ? 15 MET A O    19 
ATOM 10961 C CB   . MET A 1 12 ? 0.100   11.707  -2.652  1.00 0.00 ? 15 MET A CB   19 
ATOM 10962 C CG   . MET A 1 12 ? -0.625  11.384  -3.945  1.00 0.00 ? 15 MET A CG   19 
ATOM 10963 S SD   . MET A 1 12 ? 0.495   11.223  -5.349  1.00 0.00 ? 15 MET A SD   19 
ATOM 10964 C CE   . MET A 1 12 ? -0.443  10.123  -6.405  1.00 0.00 ? 15 MET A CE   19 
ATOM 10965 H H    . MET A 1 12 ? -0.789  12.055  -0.331  1.00 0.00 ? 15 MET A H    19 
ATOM 10966 H HA   . MET A 1 12 ? -0.638  9.815   -1.964  1.00 0.00 ? 15 MET A HA   19 
ATOM 10967 H HB2  . MET A 1 12 ? -0.341  12.599  -2.233  1.00 0.00 ? 15 MET A HB2  19 
ATOM 10968 H HB3  . MET A 1 12 ? 1.134   11.905  -2.881  1.00 0.00 ? 15 MET A HB3  19 
ATOM 10969 H HG2  . MET A 1 12 ? -1.159  10.455  -3.819  1.00 0.00 ? 15 MET A HG2  19 
ATOM 10970 H HG3  . MET A 1 12 ? -1.328  12.177  -4.151  1.00 0.00 ? 15 MET A HG3  19 
ATOM 10971 H HE1  . MET A 1 12 ? -0.053  10.170  -7.411  1.00 0.00 ? 15 MET A HE1  19 
ATOM 10972 H HE2  . MET A 1 12 ? -1.480  10.422  -6.407  1.00 0.00 ? 15 MET A HE2  19 
ATOM 10973 H HE3  . MET A 1 12 ? -0.361  9.111   -6.034  1.00 0.00 ? 15 MET A HE3  19 
ATOM 10974 N N    . ASN A 1 13 ? 2.293   10.740  -0.725  1.00 0.00 ? 16 ASN A N    19 
ATOM 10975 C CA   . ASN A 1 13 ? 3.650   10.278  -0.430  1.00 0.00 ? 16 ASN A CA   19 
ATOM 10976 C C    . ASN A 1 13 ? 3.626   8.989   0.388   1.00 0.00 ? 16 ASN A C    19 
ATOM 10977 O O    . ASN A 1 13 ? 4.268   8.002   0.019   1.00 0.00 ? 16 ASN A O    19 
ATOM 10978 C CB   . ASN A 1 13 ? 4.443   11.366  0.308   1.00 0.00 ? 16 ASN A CB   19 
ATOM 10979 C CG   . ASN A 1 13 ? 5.680   11.805  -0.453  1.00 0.00 ? 16 ASN A CG   19 
ATOM 10980 O OD1  . ASN A 1 13 ? 6.294   11.021  -1.172  1.00 0.00 ? 16 ASN A OD1  19 
ATOM 10981 N ND2  . ASN A 1 13 ? 6.060   13.066  -0.296  1.00 0.00 ? 16 ASN A ND2  19 
ATOM 10982 H H    . ASN A 1 13 ? 2.018   11.634  -0.420  1.00 0.00 ? 16 ASN A H    19 
ATOM 10983 H HA   . ASN A 1 13 ? 4.132   10.068  -1.367  1.00 0.00 ? 16 ASN A HA   19 
ATOM 10984 H HB2  . ASN A 1 13 ? 3.810   12.228  0.452   1.00 0.00 ? 16 ASN A HB2  19 
ATOM 10985 H HB3  . ASN A 1 13 ? 4.752   10.988  1.272   1.00 0.00 ? 16 ASN A HB3  19 
ATOM 10986 H HD21 . ASN A 1 13 ? 5.532   13.641  0.294   1.00 0.00 ? 16 ASN A HD21 19 
ATOM 10987 H HD22 . ASN A 1 13 ? 6.857   13.369  -0.779  1.00 0.00 ? 16 ASN A HD22 19 
ATOM 10988 N N    . LEU A 1 14 ? 2.871   8.988   1.486   1.00 0.00 ? 17 LEU A N    19 
ATOM 10989 C CA   . LEU A 1 14 ? 2.769   7.792   2.322   1.00 0.00 ? 17 LEU A CA   19 
ATOM 10990 C C    . LEU A 1 14 ? 2.036   6.685   1.565   1.00 0.00 ? 17 LEU A C    19 
ATOM 10991 O O    . LEU A 1 14 ? 2.473   5.536   1.568   1.00 0.00 ? 17 LEU A O    19 
ATOM 10992 C CB   . LEU A 1 14 ? 2.087   8.086   3.669   1.00 0.00 ? 17 LEU A CB   19 
ATOM 10993 C CG   . LEU A 1 14 ? 0.747   8.811   3.592   1.00 0.00 ? 17 LEU A CG   19 
ATOM 10994 C CD1  . LEU A 1 14 ? -0.402  7.817   3.532   1.00 0.00 ? 17 LEU A CD1  19 
ATOM 10995 C CD2  . LEU A 1 14 ? 0.579   9.744   4.781   1.00 0.00 ? 17 LEU A CD2  19 
ATOM 10996 H H    . LEU A 1 14 ? 2.367   9.798   1.723   1.00 0.00 ? 17 LEU A H    19 
ATOM 10997 H HA   . LEU A 1 14 ? 3.773   7.454   2.514   1.00 0.00 ? 17 LEU A HA   19 
ATOM 10998 H HB2  . LEU A 1 14 ? 1.933   7.147   4.180   1.00 0.00 ? 17 LEU A HB2  19 
ATOM 10999 H HB3  . LEU A 1 14 ? 2.761   8.688   4.261   1.00 0.00 ? 17 LEU A HB3  19 
ATOM 11000 H HG   . LEU A 1 14 ? 0.727   9.404   2.694   1.00 0.00 ? 17 LEU A HG   19 
ATOM 11001 H HD11 . LEU A 1 14 ? -0.050  6.881   3.127   1.00 0.00 ? 17 LEU A HD11 19 
ATOM 11002 H HD12 . LEU A 1 14 ? -1.184  8.212   2.899   1.00 0.00 ? 17 LEU A HD12 19 
ATOM 11003 H HD13 . LEU A 1 14 ? -0.791  7.656   4.526   1.00 0.00 ? 17 LEU A HD13 19 
ATOM 11004 H HD21 . LEU A 1 14 ? 1.326   10.523  4.736   1.00 0.00 ? 17 LEU A HD21 19 
ATOM 11005 H HD22 . LEU A 1 14 ? 0.699   9.183   5.697   1.00 0.00 ? 17 LEU A HD22 19 
ATOM 11006 H HD23 . LEU A 1 14 ? -0.406  10.186  4.755   1.00 0.00 ? 17 LEU A HD23 19 
ATOM 11007 N N    . LEU A 1 15 ? 0.940   7.043   0.889   1.00 0.00 ? 18 LEU A N    19 
ATOM 11008 C CA   . LEU A 1 15 ? 0.171   6.085   0.099   1.00 0.00 ? 18 LEU A CA   19 
ATOM 11009 C C    . LEU A 1 15 ? 1.077   5.407   -0.925  1.00 0.00 ? 18 LEU A C    19 
ATOM 11010 O O    . LEU A 1 15 ? 1.049   4.182   -1.074  1.00 0.00 ? 18 LEU A O    19 
ATOM 11011 C CB   . LEU A 1 15 ? -0.999  6.789   -0.598  1.00 0.00 ? 18 LEU A CB   19 
ATOM 11012 C CG   . LEU A 1 15 ? -1.623  6.025   -1.766  1.00 0.00 ? 18 LEU A CG   19 
ATOM 11013 C CD1  . LEU A 1 15 ? -2.377  4.806   -1.264  1.00 0.00 ? 18 LEU A CD1  19 
ATOM 11014 C CD2  . LEU A 1 15 ? -2.546  6.933   -2.561  1.00 0.00 ? 18 LEU A CD2  19 
ATOM 11015 H H    . LEU A 1 15 ? 0.652   7.987   0.903   1.00 0.00 ? 18 LEU A H    19 
ATOM 11016 H HA   . LEU A 1 15 ? -0.213  5.334   0.769   1.00 0.00 ? 18 LEU A HA   19 
ATOM 11017 H HB2  . LEU A 1 15 ? -1.769  6.971   0.137   1.00 0.00 ? 18 LEU A HB2  19 
ATOM 11018 H HB3  . LEU A 1 15 ? -0.647  7.740   -0.968  1.00 0.00 ? 18 LEU A HB3  19 
ATOM 11019 H HG   . LEU A 1 15 ? -0.838  5.685   -2.425  1.00 0.00 ? 18 LEU A HG   19 
ATOM 11020 H HD11 . LEU A 1 15 ? -2.814  4.284   -2.103  1.00 0.00 ? 18 LEU A HD11 19 
ATOM 11021 H HD12 . LEU A 1 15 ? -3.160  5.120   -0.589  1.00 0.00 ? 18 LEU A HD12 19 
ATOM 11022 H HD13 . LEU A 1 15 ? -1.695  4.149   -0.746  1.00 0.00 ? 18 LEU A HD13 19 
ATOM 11023 H HD21 . LEU A 1 15 ? -2.310  7.965   -2.346  1.00 0.00 ? 18 LEU A HD21 19 
ATOM 11024 H HD22 . LEU A 1 15 ? -3.571  6.733   -2.288  1.00 0.00 ? 18 LEU A HD22 19 
ATOM 11025 H HD23 . LEU A 1 15 ? -2.412  6.746   -3.616  1.00 0.00 ? 18 LEU A HD23 19 
ATOM 11026 N N    . PHE A 1 16 ? 1.895   6.215   -1.607  1.00 0.00 ? 19 PHE A N    19 
ATOM 11027 C CA   . PHE A 1 16 ? 2.845   5.708   -2.598  1.00 0.00 ? 19 PHE A CA   19 
ATOM 11028 C C    . PHE A 1 16 ? 3.633   4.542   -2.010  1.00 0.00 ? 19 PHE A C    19 
ATOM 11029 O O    . PHE A 1 16 ? 3.738   3.472   -2.615  1.00 0.00 ? 19 PHE A O    19 
ATOM 11030 C CB   . PHE A 1 16 ? 3.799   6.828   -3.024  1.00 0.00 ? 19 PHE A CB   19 
ATOM 11031 C CG   . PHE A 1 16 ? 4.361   6.654   -4.407  1.00 0.00 ? 19 PHE A CG   19 
ATOM 11032 C CD1  . PHE A 1 16 ? 3.617   7.007   -5.520  1.00 0.00 ? 19 PHE A CD1  19 
ATOM 11033 C CD2  . PHE A 1 16 ? 5.633   6.138   -4.592  1.00 0.00 ? 19 PHE A CD2  19 
ATOM 11034 C CE1  . PHE A 1 16 ? 4.130   6.848   -6.793  1.00 0.00 ? 19 PHE A CE1  19 
ATOM 11035 C CE2  . PHE A 1 16 ? 6.152   5.976   -5.863  1.00 0.00 ? 19 PHE A CE2  19 
ATOM 11036 C CZ   . PHE A 1 16 ? 5.400   6.332   -6.965  1.00 0.00 ? 19 PHE A CZ   19 
ATOM 11037 H H    . PHE A 1 16 ? 1.873   7.182   -1.422  1.00 0.00 ? 19 PHE A H    19 
ATOM 11038 H HA   . PHE A 1 16 ? 2.289   5.362   -3.458  1.00 0.00 ? 19 PHE A HA   19 
ATOM 11039 H HB2  . PHE A 1 16 ? 3.270   7.766   -2.995  1.00 0.00 ? 19 PHE A HB2  19 
ATOM 11040 H HB3  . PHE A 1 16 ? 4.626   6.875   -2.330  1.00 0.00 ? 19 PHE A HB3  19 
ATOM 11041 H HD1  . PHE A 1 16 ? 2.625   7.410   -5.387  1.00 0.00 ? 19 PHE A HD1  19 
ATOM 11042 H HD2  . PHE A 1 16 ? 6.222   5.859   -3.731  1.00 0.00 ? 19 PHE A HD2  19 
ATOM 11043 H HE1  . PHE A 1 16 ? 3.539   7.127   -7.653  1.00 0.00 ? 19 PHE A HE1  19 
ATOM 11044 H HE2  . PHE A 1 16 ? 7.146   5.573   -5.995  1.00 0.00 ? 19 PHE A HE2  19 
ATOM 11045 H HZ   . PHE A 1 16 ? 5.803   6.207   -7.959  1.00 0.00 ? 19 PHE A HZ   19 
ATOM 11046 N N    . ASN A 1 17 ? 4.159   4.757   -0.805  1.00 0.00 ? 20 ASN A N    19 
ATOM 11047 C CA   . ASN A 1 17 ? 4.912   3.725   -0.100  1.00 0.00 ? 20 ASN A CA   19 
ATOM 11048 C C    . ASN A 1 17 ? 3.961   2.657   0.429   1.00 0.00 ? 20 ASN A C    19 
ATOM 11049 O O    . ASN A 1 17 ? 4.219   1.463   0.285   1.00 0.00 ? 20 ASN A O    19 
ATOM 11050 C CB   . ASN A 1 17 ? 5.718   4.332   1.047   1.00 0.00 ? 20 ASN A CB   19 
ATOM 11051 C CG   . ASN A 1 17 ? 7.082   3.687   1.192   1.00 0.00 ? 20 ASN A CG   19 
ATOM 11052 O OD1  . ASN A 1 17 ? 7.363   3.023   2.185   1.00 0.00 ? 20 ASN A OD1  19 
ATOM 11053 N ND2  . ASN A 1 17 ? 7.935   3.870   0.195   1.00 0.00 ? 20 ASN A ND2  19 
ATOM 11054 H H    . ASN A 1 17 ? 4.012   5.628   -0.371  1.00 0.00 ? 20 ASN A H    19 
ATOM 11055 H HA   . ASN A 1 17 ? 5.589   3.264   -0.806  1.00 0.00 ? 20 ASN A HA   19 
ATOM 11056 H HB2  . ASN A 1 17 ? 5.852   5.385   0.865   1.00 0.00 ? 20 ASN A HB2  19 
ATOM 11057 H HB3  . ASN A 1 17 ? 5.175   4.197   1.968   1.00 0.00 ? 20 ASN A HB3  19 
ATOM 11058 H HD21 . ASN A 1 17 ? 7.645   4.404   -0.572  1.00 0.00 ? 20 ASN A HD21 19 
ATOM 11059 H HD22 . ASN A 1 17 ? 8.822   3.462   0.270   1.00 0.00 ? 20 ASN A HD22 19 
ATOM 11060 N N    . ILE A 1 18 ? 2.846   3.094   1.022   1.00 0.00 ? 21 ILE A N    19 
ATOM 11061 C CA   . ILE A 1 18 ? 1.842   2.166   1.542   1.00 0.00 ? 21 ILE A CA   19 
ATOM 11062 C C    . ILE A 1 18 ? 1.509   1.121   0.485   1.00 0.00 ? 21 ILE A C    19 
ATOM 11063 O O    . ILE A 1 18 ? 1.678   -0.072  0.718   1.00 0.00 ? 21 ILE A O    19 
ATOM 11064 C CB   . ILE A 1 18 ? 0.551   2.899   1.985   1.00 0.00 ? 21 ILE A CB   19 
ATOM 11065 C CG1  . ILE A 1 18 ? 0.771   3.599   3.329   1.00 0.00 ? 21 ILE A CG1  19 
ATOM 11066 C CG2  . ILE A 1 18 ? -0.621  1.930   2.081   1.00 0.00 ? 21 ILE A CG2  19 
ATOM 11067 C CD1  . ILE A 1 18 ? 1.192   2.663   4.442   1.00 0.00 ? 21 ILE A CD1  19 
ATOM 11068 H H    . ILE A 1 18 ? 2.691   4.068   1.094   1.00 0.00 ? 21 ILE A H    19 
ATOM 11069 H HA   . ILE A 1 18 ? 2.261   1.662   2.401   1.00 0.00 ? 21 ILE A HA   19 
ATOM 11070 H HB   . ILE A 1 18 ? 0.313   3.640   1.237   1.00 0.00 ? 21 ILE A HB   19 
ATOM 11071 H HG12 . ILE A 1 18 ? 1.544   4.346   3.217   1.00 0.00 ? 21 ILE A HG12 19 
ATOM 11072 H HG13 . ILE A 1 18 ? -0.148  4.082   3.629   1.00 0.00 ? 21 ILE A HG13 19 
ATOM 11073 H HG21 . ILE A 1 18 ? -1.429  2.395   2.626   1.00 0.00 ? 21 ILE A HG21 19 
ATOM 11074 H HG22 . ILE A 1 18 ? -0.306  1.035   2.597   1.00 0.00 ? 21 ILE A HG22 19 
ATOM 11075 H HG23 . ILE A 1 18 ? -0.958  1.672   1.087   1.00 0.00 ? 21 ILE A HG23 19 
ATOM 11076 H HD11 . ILE A 1 18 ? 2.265   2.541   4.424   1.00 0.00 ? 21 ILE A HD11 19 
ATOM 11077 H HD12 . ILE A 1 18 ? 0.718   1.703   4.305   1.00 0.00 ? 21 ILE A HD12 19 
ATOM 11078 H HD13 . ILE A 1 18 ? 0.893   3.078   5.394   1.00 0.00 ? 21 ILE A HD13 19 
ATOM 11079 N N    . ALA A 1 19 ? 1.079   1.575   -0.695  1.00 0.00 ? 22 ALA A N    19 
ATOM 11080 C CA   . ALA A 1 19 ? 0.773   0.660   -1.795  1.00 0.00 ? 22 ALA A CA   19 
ATOM 11081 C C    . ALA A 1 19 ? 2.000   -0.195  -2.122  1.00 0.00 ? 22 ALA A C    19 
ATOM 11082 O O    . ALA A 1 19 ? 1.886   -1.391  -2.409  1.00 0.00 ? 22 ALA A O    19 
ATOM 11083 C CB   . ALA A 1 19 ? 0.314   1.439   -3.021  1.00 0.00 ? 22 ALA A CB   19 
ATOM 11084 H H    . ALA A 1 19 ? 0.996   2.549   -0.837  1.00 0.00 ? 22 ALA A H    19 
ATOM 11085 H HA   . ALA A 1 19 ? -0.032  0.011   -1.479  1.00 0.00 ? 22 ALA A HA   19 
ATOM 11086 H HB1  . ALA A 1 19 ? 1.057   2.180   -3.276  1.00 0.00 ? 22 ALA A HB1  19 
ATOM 11087 H HB2  . ALA A 1 19 ? -0.624  1.930   -2.806  1.00 0.00 ? 22 ALA A HB2  19 
ATOM 11088 H HB3  . ALA A 1 19 ? 0.182   0.760   -3.851  1.00 0.00 ? 22 ALA A HB3  19 
ATOM 11089 N N    . LYS A 1 20 ? 3.177   0.433   -2.055  1.00 0.00 ? 23 LYS A N    19 
ATOM 11090 C CA   . LYS A 1 20 ? 4.443   -0.247  -2.317  1.00 0.00 ? 23 LYS A CA   19 
ATOM 11091 C C    . LYS A 1 20 ? 4.688   -1.362  -1.298  1.00 0.00 ? 23 LYS A C    19 
ATOM 11092 O O    . LYS A 1 20 ? 5.055   -2.477  -1.664  1.00 0.00 ? 23 LYS A O    19 
ATOM 11093 C CB   . LYS A 1 20 ? 5.597   0.766   -2.280  1.00 0.00 ? 23 LYS A CB   19 
ATOM 11094 C CG   . LYS A 1 20 ? 6.295   0.952   -3.617  1.00 0.00 ? 23 LYS A CG   19 
ATOM 11095 C CD   . LYS A 1 20 ? 7.126   -0.267  -3.990  1.00 0.00 ? 23 LYS A CD   19 
ATOM 11096 C CE   . LYS A 1 20 ? 7.871   -0.056  -5.298  1.00 0.00 ? 23 LYS A CE   19 
ATOM 11097 N NZ   . LYS A 1 20 ? 7.965   -1.316  -6.090  1.00 0.00 ? 23 LYS A NZ   19 
ATOM 11098 H H    . LYS A 1 20 ? 3.194   1.382   -1.808  1.00 0.00 ? 23 LYS A H    19 
ATOM 11099 H HA   . LYS A 1 20 ? 4.387   -0.684  -3.298  1.00 0.00 ? 23 LYS A HA   19 
ATOM 11100 H HB2  . LYS A 1 20 ? 5.206   1.723   -1.971  1.00 0.00 ? 23 LYS A HB2  19 
ATOM 11101 H HB3  . LYS A 1 20 ? 6.329   0.439   -1.557  1.00 0.00 ? 23 LYS A HB3  19 
ATOM 11102 H HG2  . LYS A 1 20 ? 5.549   1.117   -4.379  1.00 0.00 ? 23 LYS A HG2  19 
ATOM 11103 H HG3  . LYS A 1 20 ? 6.943   1.814   -3.554  1.00 0.00 ? 23 LYS A HG3  19 
ATOM 11104 H HD2  . LYS A 1 20 ? 7.845   -0.454  -3.205  1.00 0.00 ? 23 LYS A HD2  19 
ATOM 11105 H HD3  . LYS A 1 20 ? 6.472   -1.121  -4.091  1.00 0.00 ? 23 LYS A HD3  19 
ATOM 11106 H HE2  . LYS A 1 20 ? 7.347   0.691   -5.880  1.00 0.00 ? 23 LYS A HE2  19 
ATOM 11107 H HE3  . LYS A 1 20 ? 8.869   0.299   -5.077  1.00 0.00 ? 23 LYS A HE3  19 
ATOM 11108 H HZ1  . LYS A 1 20 ? 8.588   -1.998  -5.608  1.00 0.00 ? 23 LYS A HZ1  19 
ATOM 11109 H HZ2  . LYS A 1 20 ? 8.351   -1.118  -7.035  1.00 0.00 ? 23 LYS A HZ2  19 
ATOM 11110 H HZ3  . LYS A 1 20 ? 7.022   -1.743  -6.198  1.00 0.00 ? 23 LYS A HZ3  19 
ATOM 11111 N N    . ALA A 1 21 ? 4.484   -1.055  -0.022  1.00 0.00 ? 24 ALA A N    19 
ATOM 11112 C CA   . ALA A 1 21 ? 4.683   -2.035  1.044   1.00 0.00 ? 24 ALA A CA   19 
ATOM 11113 C C    . ALA A 1 21 ? 3.500   -3.002  1.152   1.00 0.00 ? 24 ALA A C    19 
ATOM 11114 O O    . ALA A 1 21 ? 3.689   -4.197  1.405   1.00 0.00 ? 24 ALA A O    19 
ATOM 11115 C CB   . ALA A 1 21 ? 4.914   -1.325  2.371   1.00 0.00 ? 24 ALA A CB   19 
ATOM 11116 H H    . ALA A 1 21 ? 4.194   -0.142  0.212   1.00 0.00 ? 24 ALA A H    19 
ATOM 11117 H HA   . ALA A 1 21 ? 5.572   -2.602  0.809   1.00 0.00 ? 24 ALA A HA   19 
ATOM 11118 H HB1  . ALA A 1 21 ? 5.487   -1.964  3.027   1.00 0.00 ? 24 ALA A HB1  19 
ATOM 11119 H HB2  . ALA A 1 21 ? 3.963   -1.099  2.830   1.00 0.00 ? 24 ALA A HB2  19 
ATOM 11120 H HB3  . ALA A 1 21 ? 5.456   -0.406  2.199   1.00 0.00 ? 24 ALA A HB3  19 
ATOM 11121 N N    . LYS A 1 22 ? 2.284   -2.487  0.957   1.00 0.00 ? 25 LYS A N    19 
ATOM 11122 C CA   . LYS A 1 22 ? 1.079   -3.300  1.034   1.00 0.00 ? 25 LYS A CA   19 
ATOM 11123 C C    . LYS A 1 22 ? 1.086   -4.400  -0.019  1.00 0.00 ? 25 LYS A C    19 
ATOM 11124 O O    . LYS A 1 22 ? 0.759   -5.551  0.277   1.00 0.00 ? 25 LYS A O    19 
ATOM 11125 C CB   . LYS A 1 22 ? -0.160  -2.417  0.867   1.00 0.00 ? 25 LYS A CB   19 
ATOM 11126 C CG   . LYS A 1 22 ? -1.213  -2.649  1.932   1.00 0.00 ? 25 LYS A CG   19 
ATOM 11127 C CD   . LYS A 1 22 ? -2.492  -3.224  1.335   1.00 0.00 ? 25 LYS A CD   19 
ATOM 11128 C CE   . LYS A 1 22 ? -3.615  -3.294  2.359   1.00 0.00 ? 25 LYS A CE   19 
ATOM 11129 N NZ   . LYS A 1 22 ? -3.999  -1.939  2.855   1.00 0.00 ? 25 LYS A NZ   19 
ATOM 11130 H H    . LYS A 1 22 ? 2.192   -1.529  0.753   1.00 0.00 ? 25 LYS A H    19 
ATOM 11131 H HA   . LYS A 1 22 ? 1.052   -3.759  2.012   1.00 0.00 ? 25 LYS A HA   19 
ATOM 11132 H HB2  . LYS A 1 22 ? 0.142   -1.381  0.915   1.00 0.00 ? 25 LYS A HB2  19 
ATOM 11133 H HB3  . LYS A 1 22 ? -0.603  -2.611  -0.098  1.00 0.00 ? 25 LYS A HB3  19 
ATOM 11134 H HG2  . LYS A 1 22 ? -0.821  -3.340  2.662   1.00 0.00 ? 25 LYS A HG2  19 
ATOM 11135 H HG3  . LYS A 1 22 ? -1.436  -1.706  2.407   1.00 0.00 ? 25 LYS A HG3  19 
ATOM 11136 H HD2  . LYS A 1 22 ? -2.808  -2.597  0.513   1.00 0.00 ? 25 LYS A HD2  19 
ATOM 11137 H HD3  . LYS A 1 22 ? -2.288  -4.220  0.969   1.00 0.00 ? 25 LYS A HD3  19 
ATOM 11138 H HE2  . LYS A 1 22 ? -4.476  -3.759  1.897   1.00 0.00 ? 25 LYS A HE2  19 
ATOM 11139 H HE3  . LYS A 1 22 ? -3.286  -3.898  3.193   1.00 0.00 ? 25 LYS A HE3  19 
ATOM 11140 H HZ1  . LYS A 1 22 ? -3.384  -1.662  3.647   1.00 0.00 ? 25 LYS A HZ1  19 
ATOM 11141 H HZ2  . LYS A 1 22 ? -4.988  -1.942  3.183   1.00 0.00 ? 25 LYS A HZ2  19 
ATOM 11142 H HZ3  . LYS A 1 22 ? -3.902  -1.237  2.093   1.00 0.00 ? 25 LYS A HZ3  19 
ATOM 11143 N N    . ASN A 1 23 ? 1.469   -4.049  -1.248  1.00 0.00 ? 26 ASN A N    19 
ATOM 11144 C CA   . ASN A 1 23 ? 1.514   -5.039  -2.324  1.00 0.00 ? 26 ASN A CA   19 
ATOM 11145 C C    . ASN A 1 23 ? 2.572   -6.108  -2.030  1.00 0.00 ? 26 ASN A C    19 
ATOM 11146 O O    . ASN A 1 23 ? 2.332   -7.296  -2.242  1.00 0.00 ? 26 ASN A O    19 
ATOM 11147 C CB   . ASN A 1 23 ? 1.754   -4.371  -3.688  1.00 0.00 ? 26 ASN A CB   19 
ATOM 11148 C CG   . ASN A 1 23 ? 3.218   -4.135  -3.994  1.00 0.00 ? 26 ASN A CG   19 
ATOM 11149 O OD1  . ASN A 1 23 ? 3.951   -5.057  -4.341  1.00 0.00 ? 26 ASN A OD1  19 
ATOM 11150 N ND2  . ASN A 1 23 ? 3.649   -2.895  -3.870  1.00 0.00 ? 26 ASN A ND2  19 
ATOM 11151 H H    . ASN A 1 23 ? 1.733   -3.110  -1.427  1.00 0.00 ? 26 ASN A H    19 
ATOM 11152 H HA   . ASN A 1 23 ? 0.548   -5.527  -2.347  1.00 0.00 ? 26 ASN A HA   19 
ATOM 11153 H HB2  . ASN A 1 23 ? 1.349   -5.003  -4.464  1.00 0.00 ? 26 ASN A HB2  19 
ATOM 11154 H HB3  . ASN A 1 23 ? 1.245   -3.419  -3.707  1.00 0.00 ? 26 ASN A HB3  19 
ATOM 11155 H HD21 . ASN A 1 23 ? 3.007   -2.207  -3.592  1.00 0.00 ? 26 ASN A HD21 19 
ATOM 11156 H HD22 . ASN A 1 23 ? 4.593   -2.718  -4.051  1.00 0.00 ? 26 ASN A HD22 19 
ATOM 11157 N N    . LEU A 1 24 ? 3.730   -5.683  -1.520  1.00 0.00 ? 27 LEU A N    19 
ATOM 11158 C CA   . LEU A 1 24 ? 4.807   -6.615  -1.180  1.00 0.00 ? 27 LEU A CA   19 
ATOM 11159 C C    . LEU A 1 24 ? 4.335   -7.632  -0.152  1.00 0.00 ? 27 LEU A C    19 
ATOM 11160 O O    . LEU A 1 24 ? 4.395   -8.843  -0.370  1.00 0.00 ? 27 LEU A O    19 
ATOM 11161 C CB   . LEU A 1 24 ? 6.028   -5.851  -0.654  1.00 0.00 ? 27 LEU A CB   19 
ATOM 11162 C CG   . LEU A 1 24 ? 6.762   -5.004  -1.695  1.00 0.00 ? 27 LEU A CG   19 
ATOM 11163 C CD1  . LEU A 1 24 ? 7.749   -4.067  -1.020  1.00 0.00 ? 27 LEU A CD1  19 
ATOM 11164 C CD2  . LEU A 1 24 ? 7.474   -5.894  -2.701  1.00 0.00 ? 27 LEU A CD2  19 
ATOM 11165 H H    . LEU A 1 24 ? 3.858   -4.725  -1.356  1.00 0.00 ? 27 LEU A H    19 
ATOM 11166 H HA   . LEU A 1 24 ? 5.078   -7.137  -2.066  1.00 0.00 ? 27 LEU A HA   19 
ATOM 11167 H HB2  . LEU A 1 24 ? 5.703   -5.200  0.145   1.00 0.00 ? 27 LEU A HB2  19 
ATOM 11168 H HB3  . LEU A 1 24 ? 6.728   -6.568  -0.249  1.00 0.00 ? 27 LEU A HB3  19 
ATOM 11169 H HG   . LEU A 1 24 ? 6.042   -4.400  -2.231  1.00 0.00 ? 27 LEU A HG   19 
ATOM 11170 H HD11 . LEU A 1 24 ? 7.266   -3.121  -0.819  1.00 0.00 ? 27 LEU A HD11 19 
ATOM 11171 H HD12 . LEU A 1 24 ? 8.596   -3.907  -1.671  1.00 0.00 ? 27 LEU A HD12 19 
ATOM 11172 H HD13 . LEU A 1 24 ? 8.086   -4.505  -0.092  1.00 0.00 ? 27 LEU A HD13 19 
ATOM 11173 H HD21 . LEU A 1 24 ? 6.808   -6.680  -3.024  1.00 0.00 ? 27 LEU A HD21 19 
ATOM 11174 H HD22 . LEU A 1 24 ? 8.348   -6.331  -2.239  1.00 0.00 ? 27 LEU A HD22 19 
ATOM 11175 H HD23 . LEU A 1 24 ? 7.775   -5.304  -3.554  1.00 0.00 ? 27 LEU A HD23 19 
ATOM 11176 N N    . ARG A 1 25 ? 3.851   -7.116  0.959   1.00 0.00 ? 28 ARG A N    19 
ATOM 11177 C CA   . ARG A 1 25 ? 3.340   -7.946  2.046   1.00 0.00 ? 28 ARG A CA   19 
ATOM 11178 C C    . ARG A 1 25 ? 2.195   -8.839  1.567   1.00 0.00 ? 28 ARG A C    19 
ATOM 11179 O O    . ARG A 1 25 ? 2.122   -10.008 1.939   1.00 0.00 ? 28 ARG A O    19 
ATOM 11180 C CB   . ARG A 1 25 ? 2.869   -7.063  3.209   1.00 0.00 ? 28 ARG A CB   19 
ATOM 11181 C CG   . ARG A 1 25 ? 3.399   -7.504  4.564   1.00 0.00 ? 28 ARG A CG   19 
ATOM 11182 C CD   . ARG A 1 25 ? 2.281   -7.999  5.465   1.00 0.00 ? 28 ARG A CD   19 
ATOM 11183 N NE   . ARG A 1 25 ? 2.765   -8.968  6.454   1.00 0.00 ? 28 ARG A NE   19 
ATOM 11184 C CZ   . ARG A 1 25 ? 3.208   -8.651  7.669   1.00 0.00 ? 28 ARG A CZ   19 
ATOM 11185 N NH1  . ARG A 1 25 ? 3.276   -7.391  8.054   1.00 0.00 ? 28 ARG A NH1  19 
ATOM 11186 N NH2  . ARG A 1 25 ? 3.598   -9.604  8.492   1.00 0.00 ? 28 ARG A NH2  19 
ATOM 11187 H H    . ARG A 1 25 ? 3.831   -6.143  1.043   1.00 0.00 ? 28 ARG A H    19 
ATOM 11188 H HA   . ARG A 1 25 ? 4.144   -8.582  2.389   1.00 0.00 ? 28 ARG A HA   19 
ATOM 11189 H HB2  . ARG A 1 25 ? 3.198   -6.050  3.032   1.00 0.00 ? 28 ARG A HB2  19 
ATOM 11190 H HB3  . ARG A 1 25 ? 1.790   -7.079  3.244   1.00 0.00 ? 28 ARG A HB3  19 
ATOM 11191 H HG2  . ARG A 1 25 ? 4.112   -8.303  4.418   1.00 0.00 ? 28 ARG A HG2  19 
ATOM 11192 H HG3  . ARG A 1 25 ? 3.888   -6.664  5.036   1.00 0.00 ? 28 ARG A HG3  19 
ATOM 11193 H HD2  . ARG A 1 25 ? 1.844   -7.154  5.976   1.00 0.00 ? 28 ARG A HD2  19 
ATOM 11194 H HD3  . ARG A 1 25 ? 1.526   -8.473  4.851   1.00 0.00 ? 28 ARG A HD3  19 
ATOM 11195 H HE   . ARG A 1 25 ? 2.752   -9.914  6.197   1.00 0.00 ? 28 ARG A HE   19 
ATOM 11196 H HH11 . ARG A 1 25 ? 2.996   -6.664  7.434   1.00 0.00 ? 28 ARG A HH11 19 
ATOM 11197 H HH12 . ARG A 1 25 ? 3.608   -7.164  8.969   1.00 0.00 ? 28 ARG A HH12 19 
ATOM 11198 H HH21 . ARG A 1 25 ? 3.559   -10.558 8.203   1.00 0.00 ? 28 ARG A HH21 19 
ATOM 11199 H HH22 . ARG A 1 25 ? 3.931   -9.373  9.403   1.00 0.00 ? 28 ARG A HH22 19 
ATOM 11200 N N    . ALA A 1 26 ? 1.317   -8.292  0.726   1.00 0.00 ? 29 ALA A N    19 
ATOM 11201 C CA   . ALA A 1 26 ? 0.195   -9.056  0.197   1.00 0.00 ? 29 ALA A CA   19 
ATOM 11202 C C    . ALA A 1 26 ? 0.679   -10.107 -0.797  1.00 0.00 ? 29 ALA A C    19 
ATOM 11203 O O    . ALA A 1 26 ? 0.253   -11.260 -0.758  1.00 0.00 ? 29 ALA A O    19 
ATOM 11204 C CB   . ALA A 1 26 ? -0.816  -8.123  -0.458  1.00 0.00 ? 29 ALA A CB   19 
ATOM 11205 H H    . ALA A 1 26 ? 1.434   -7.360  0.445   1.00 0.00 ? 29 ALA A H    19 
ATOM 11206 H HA   . ALA A 1 26 ? -0.291  -9.555  1.023   1.00 0.00 ? 29 ALA A HA   19 
ATOM 11207 H HB1  . ALA A 1 26 ? -0.299  -7.424  -1.098  1.00 0.00 ? 29 ALA A HB1  19 
ATOM 11208 H HB2  . ALA A 1 26 ? -1.352  -7.581  0.307   1.00 0.00 ? 29 ALA A HB2  19 
ATOM 11209 H HB3  . ALA A 1 26 ? -1.514  -8.702  -1.045  1.00 0.00 ? 29 ALA A HB3  19 
ATOM 11210 N N    . GLN A 1 27 ? 1.579   -9.707  -1.687  1.00 0.00 ? 30 GLN A N    19 
ATOM 11211 C CA   . GLN A 1 27 ? 2.109   -10.634 -2.687  1.00 0.00 ? 30 GLN A CA   19 
ATOM 11212 C C    . GLN A 1 27 ? 3.078   -11.647 -2.079  1.00 0.00 ? 30 GLN A C    19 
ATOM 11213 O O    . GLN A 1 27 ? 3.371   -12.680 -2.685  1.00 0.00 ? 30 GLN A O    19 
ATOM 11214 C CB   . GLN A 1 27 ? 2.776   -9.874  -3.840  1.00 0.00 ? 30 GLN A CB   19 
ATOM 11215 C CG   . GLN A 1 27 ? 4.185   -9.386  -3.523  1.00 0.00 ? 30 GLN A CG   19 
ATOM 11216 C CD   . GLN A 1 27 ? 4.913   -8.853  -4.740  1.00 0.00 ? 30 GLN A CD   19 
ATOM 11217 O OE1  . GLN A 1 27 ? 5.556   -9.603  -5.468  1.00 0.00 ? 30 GLN A OE1  19 
ATOM 11218 N NE2  . GLN A 1 27 ? 4.822   -7.551  -4.969  1.00 0.00 ? 30 GLN A NE2  19 
ATOM 11219 H H    . GLN A 1 27 ? 1.892   -8.769  -1.672  1.00 0.00 ? 30 GLN A H    19 
ATOM 11220 H HA   . GLN A 1 27 ? 1.271   -11.182 -3.064  1.00 0.00 ? 30 GLN A HA   19 
ATOM 11221 H HB2  . GLN A 1 27 ? 2.830   -10.526 -4.700  1.00 0.00 ? 30 GLN A HB2  19 
ATOM 11222 H HB3  . GLN A 1 27 ? 2.168   -9.016  -4.088  1.00 0.00 ? 30 GLN A HB3  19 
ATOM 11223 H HG2  . GLN A 1 27 ? 4.122   -8.598  -2.789  1.00 0.00 ? 30 GLN A HG2  19 
ATOM 11224 H HG3  . GLN A 1 27 ? 4.755   -10.208 -3.116  1.00 0.00 ? 30 GLN A HG3  19 
ATOM 11225 H HE21 . GLN A 1 27 ? 4.295   -7.002  -4.350  1.00 0.00 ? 30 GLN A HE21 19 
ATOM 11226 H HE22 . GLN A 1 27 ? 5.286   -7.190  -5.750  1.00 0.00 ? 30 GLN A HE22 19 
ATOM 11227 N N    . ALA A 1 28 ? 3.560   -11.361 -0.885  1.00 0.00 ? 31 ALA A N    19 
ATOM 11228 C CA   . ALA A 1 28 ? 4.478   -12.258 -0.204  1.00 0.00 ? 31 ALA A CA   19 
ATOM 11229 C C    . ALA A 1 28 ? 3.753   -13.065 0.869   1.00 0.00 ? 31 ALA A C    19 
ATOM 11230 O O    . ALA A 1 28 ? 3.861   -14.290 0.911   1.00 0.00 ? 31 ALA A O    19 
ATOM 11231 C CB   . ALA A 1 28 ? 5.645   -11.479 0.389   1.00 0.00 ? 31 ALA A CB   19 
ATOM 11232 H H    . ALA A 1 28 ? 3.288   -10.532 -0.451  1.00 0.00 ? 31 ALA A H    19 
ATOM 11233 H HA   . ALA A 1 28 ? 4.864   -12.943 -0.941  1.00 0.00 ? 31 ALA A HA   19 
ATOM 11234 H HB1  . ALA A 1 28 ? 6.425   -12.168 0.683   1.00 0.00 ? 31 ALA A HB1  19 
ATOM 11235 H HB2  . ALA A 1 28 ? 5.309   -10.926 1.253   1.00 0.00 ? 31 ALA A HB2  19 
ATOM 11236 H HB3  . ALA A 1 28 ? 6.031   -10.793 -0.351  1.00 0.00 ? 31 ALA A HB3  19 
ATOM 11237 N N    . ALA A 1 29 ? 3.004   -12.376 1.728   1.00 0.00 ? 32 ALA A N    19 
ATOM 11238 C CA   . ALA A 1 29 ? 2.259   -13.045 2.789   1.00 0.00 ? 32 ALA A CA   19 
ATOM 11239 C C    . ALA A 1 29 ? 0.962   -13.683 2.272   1.00 0.00 ? 32 ALA A C    19 
ATOM 11240 O O    . ALA A 1 29 ? 0.397   -14.549 2.942   1.00 0.00 ? 32 ALA A O    19 
ATOM 11241 C CB   . ALA A 1 29 ? 1.962   -12.071 3.919   1.00 0.00 ? 32 ALA A CB   19 
ATOM 11242 H H    . ALA A 1 29 ? 2.947   -11.392 1.646   1.00 0.00 ? 32 ALA A H    19 
ATOM 11243 H HA   . ALA A 1 29 ? 2.889   -13.831 3.184   1.00 0.00 ? 32 ALA A HA   19 
ATOM 11244 H HB1  . ALA A 1 29 ? 2.789   -11.384 4.028   1.00 0.00 ? 32 ALA A HB1  19 
ATOM 11245 H HB2  . ALA A 1 29 ? 1.827   -12.619 4.841   1.00 0.00 ? 32 ALA A HB2  19 
ATOM 11246 H HB3  . ALA A 1 29 ? 1.062   -11.518 3.692   1.00 0.00 ? 32 ALA A HB3  19 
ATOM 11247 N N    . ALA A 1 30 ? 0.480   -13.264 1.092   1.00 0.00 ? 33 ALA A N    19 
ATOM 11248 C CA   . ALA A 1 30 ? -0.755  -13.827 0.547   1.00 0.00 ? 33 ALA A CA   19 
ATOM 11249 C C    . ALA A 1 30 ? -0.517  -14.619 -0.730  1.00 0.00 ? 33 ALA A C    19 
ATOM 11250 O O    . ALA A 1 30 ? -1.035  -15.722 -0.895  1.00 0.00 ? 33 ALA A O    19 
ATOM 11251 C CB   . ALA A 1 30 ? -1.787  -12.729 0.319   1.00 0.00 ? 33 ALA A CB   19 
ATOM 11252 H H    . ALA A 1 30 ? 0.956   -12.564 0.584   1.00 0.00 ? 33 ALA A H    19 
ATOM 11253 H HA   . ALA A 1 30 ? -1.146  -14.498 1.273   1.00 0.00 ? 33 ALA A HA   19 
ATOM 11254 H HB1  . ALA A 1 30 ? -1.606  -11.917 1.008   1.00 0.00 ? 33 ALA A HB1  19 
ATOM 11255 H HB2  . ALA A 1 30 ? -2.779  -13.126 0.482   1.00 0.00 ? 33 ALA A HB2  19 
ATOM 11256 H HB3  . ALA A 1 30 ? -1.708  -12.364 -0.695  1.00 0.00 ? 33 ALA A HB3  19 
ATOM 11257 N N    . ASN A 1 31 ? 0.270   -14.054 -1.622  1.00 0.00 ? 34 ASN A N    19 
ATOM 11258 C CA   . ASN A 1 31 ? 0.581   -14.710 -2.892  1.00 0.00 ? 34 ASN A CA   19 
ATOM 11259 C C    . ASN A 1 31 ? 1.685   -15.752 -2.705  1.00 0.00 ? 34 ASN A C    19 
ATOM 11260 O O    . ASN A 1 31 ? 1.538   -16.902 -3.119  1.00 0.00 ? 34 ASN A O    19 
ATOM 11261 C CB   . ASN A 1 31 ? 0.963   -13.668 -3.955  1.00 0.00 ? 34 ASN A CB   19 
ATOM 11262 C CG   . ASN A 1 31 ? 1.879   -14.214 -5.034  1.00 0.00 ? 34 ASN A CG   19 
ATOM 11263 O OD1  . ASN A 1 31 ? 1.422   -14.768 -6.028  1.00 0.00 ? 34 ASN A OD1  19 
ATOM 11264 N ND2  . ASN A 1 31 ? 3.179   -14.055 -4.845  1.00 0.00 ? 34 ASN A ND2  19 
ATOM 11265 H H    . ASN A 1 31 ? 0.655   -13.181 -1.417  1.00 0.00 ? 34 ASN A H    19 
ATOM 11266 H HA   . ASN A 1 31 ? -0.313  -15.223 -3.217  1.00 0.00 ? 34 ASN A HA   19 
ATOM 11267 H HB2  . ASN A 1 31 ? 0.064   -13.309 -4.432  1.00 0.00 ? 34 ASN A HB2  19 
ATOM 11268 H HB3  . ASN A 1 31 ? 1.459   -12.843 -3.477  1.00 0.00 ? 34 ASN A HB3  19 
ATOM 11269 H HD21 . ASN A 1 31 ? 3.478   -13.597 -4.027  1.00 0.00 ? 34 ASN A HD21 19 
ATOM 11270 H HD22 . ASN A 1 31 ? 3.789   -14.401 -5.527  1.00 0.00 ? 34 ASN A HD22 19 
ATOM 11271 N N    . ALA A 1 32 ? 2.780   -15.352 -2.060  1.00 0.00 ? 35 ALA A N    19 
ATOM 11272 C CA   . ALA A 1 32 ? 3.894   -16.263 -1.806  1.00 0.00 ? 35 ALA A CA   19 
ATOM 11273 C C    . ALA A 1 32 ? 3.687   -17.061 -0.511  1.00 0.00 ? 35 ALA A C    19 
ATOM 11274 O O    . ALA A 1 32 ? 4.641   -17.340 0.216   1.00 0.00 ? 35 ALA A O    19 
ATOM 11275 C CB   . ALA A 1 32 ? 5.202   -15.483 -1.756  1.00 0.00 ? 35 ALA A CB   19 
ATOM 11276 H H    . ALA A 1 32 ? 2.836   -14.426 -1.740  1.00 0.00 ? 35 ALA A H    19 
ATOM 11277 H HA   . ALA A 1 32 ? 3.949   -16.955 -2.633  1.00 0.00 ? 35 ALA A HA   19 
ATOM 11278 H HB1  . ALA A 1 32 ? 6.032   -16.169 -1.840  1.00 0.00 ? 35 ALA A HB1  19 
ATOM 11279 H HB2  . ALA A 1 32 ? 5.268   -14.953 -0.818  1.00 0.00 ? 35 ALA A HB2  19 
ATOM 11280 H HB3  . ALA A 1 32 ? 5.232   -14.777 -2.573  1.00 0.00 ? 35 ALA A HB3  19 
ATOM 11281 N N    . HIS A 1 33 ? 2.437   -17.443 -0.236  1.00 0.00 ? 36 HIS A N    19 
ATOM 11282 C CA   . HIS A 1 33 ? 2.109   -18.219 0.960   1.00 0.00 ? 36 HIS A CA   19 
ATOM 11283 C C    . HIS A 1 33 ? 0.865   -19.075 0.730   1.00 0.00 ? 36 HIS A C    19 
ATOM 11284 O O    . HIS A 1 33 ? 0.933   -20.302 0.804   1.00 0.00 ? 36 HIS A O    19 
ATOM 11285 C CB   . HIS A 1 33 ? 1.918   -17.294 2.168   1.00 0.00 ? 36 HIS A CB   19 
ATOM 11286 C CG   . HIS A 1 33 ? 3.066   -17.348 3.124   1.00 0.00 ? 36 HIS A CG   19 
ATOM 11287 N ND1  . HIS A 1 33 ? 2.996   -17.952 4.357   1.00 0.00 ? 36 HIS A ND1  19 
ATOM 11288 C CD2  . HIS A 1 33 ? 4.335   -16.905 2.998   1.00 0.00 ? 36 HIS A CD2  19 
ATOM 11289 C CE1  . HIS A 1 33 ? 4.176   -17.880 4.947   1.00 0.00 ? 36 HIS A CE1  19 
ATOM 11290 N NE2  . HIS A 1 33 ? 5.015   -17.251 4.140   1.00 0.00 ? 36 HIS A NE2  19 
ATOM 11291 H H    . HIS A 1 33 ? 1.721   -17.209 -0.858  1.00 0.00 ? 36 HIS A H    19 
ATOM 11292 H HA   . HIS A 1 33 ? 2.940   -18.878 1.157   1.00 0.00 ? 36 HIS A HA   19 
ATOM 11293 H HB2  . HIS A 1 33 ? 1.817   -16.275 1.825   1.00 0.00 ? 36 HIS A HB2  19 
ATOM 11294 H HB3  . HIS A 1 33 ? 1.024   -17.582 2.701   1.00 0.00 ? 36 HIS A HB3  19 
ATOM 11295 H HD1  . HIS A 1 33 ? 2.200   -18.378 4.743   1.00 0.00 ? 36 HIS A HD1  19 
ATOM 11296 H HD2  . HIS A 1 33 ? 4.743   -16.373 2.149   1.00 0.00 ? 36 HIS A HD2  19 
ATOM 11297 H HE1  . HIS A 1 33 ? 4.417   -18.274 5.925   1.00 0.00 ? 36 HIS A HE1  19 
ATOM 11298 H HE2  . HIS A 1 33 ? 6.003   -17.364 4.177   1.00 0.00 ? 36 HIS A HE2  19 
ATOM 11299 N N    . LEU A 1 34 ? -0.268  -18.429 0.430   1.00 0.00 ? 37 LEU A N    19 
ATOM 11300 C CA   . LEU A 1 34 ? -1.516  -19.156 0.173   1.00 0.00 ? 37 LEU A CA   19 
ATOM 11301 C C    . LEU A 1 34 ? -1.357  -20.140 -0.986  1.00 0.00 ? 37 LEU A C    19 
ATOM 11302 O O    . LEU A 1 34 ? -2.046  -21.157 -1.050  1.00 0.00 ? 37 LEU A O    19 
ATOM 11303 C CB   . LEU A 1 34 ? -2.664  -18.180 -0.111  1.00 0.00 ? 37 LEU A CB   19 
ATOM 11304 C CG   . LEU A 1 34 ? -3.142  -17.368 1.095   1.00 0.00 ? 37 LEU A CG   19 
ATOM 11305 C CD1  . LEU A 1 34 ? -3.761  -16.056 0.642   1.00 0.00 ? 37 LEU A CD1  19 
ATOM 11306 C CD2  . LEU A 1 34 ? -4.140  -18.169 1.915   1.00 0.00 ? 37 LEU A CD2  19 
ATOM 11307 H H    . LEU A 1 34 ? -0.261  -17.450 0.368   1.00 0.00 ? 37 LEU A H    19 
ATOM 11308 H HA   . LEU A 1 34 ? -1.745  -19.717 1.054   1.00 0.00 ? 37 LEU A HA   19 
ATOM 11309 H HB2  . LEU A 1 34 ? -2.341  -17.492 -0.879  1.00 0.00 ? 37 LEU A HB2  19 
ATOM 11310 H HB3  . LEU A 1 34 ? -3.503  -18.746 -0.490  1.00 0.00 ? 37 LEU A HB3  19 
ATOM 11311 H HG   . LEU A 1 34 ? -2.296  -17.139 1.726   1.00 0.00 ? 37 LEU A HG   19 
ATOM 11312 H HD11 . LEU A 1 34 ? -3.129  -15.598 -0.103  1.00 0.00 ? 37 LEU A HD11 19 
ATOM 11313 H HD12 . LEU A 1 34 ? -3.858  -15.395 1.489   1.00 0.00 ? 37 LEU A HD12 19 
ATOM 11314 H HD13 . LEU A 1 34 ? -4.737  -16.246 0.220   1.00 0.00 ? 37 LEU A HD13 19 
ATOM 11315 H HD21 . LEU A 1 34 ? -4.092  -17.855 2.947   1.00 0.00 ? 37 LEU A HD21 19 
ATOM 11316 H HD22 . LEU A 1 34 ? -3.902  -19.220 1.848   1.00 0.00 ? 37 LEU A HD22 19 
ATOM 11317 H HD23 . LEU A 1 34 ? -5.136  -18.000 1.534   1.00 0.00 ? 37 LEU A HD23 19 
ATOM 11318 N N    . MET A 1 35 ? -0.431  -19.832 -1.884  1.00 0.00 ? 38 MET A N    19 
ATOM 11319 C CA   . MET A 1 35 ? -0.148  -20.686 -3.039  1.00 0.00 ? 38 MET A CA   19 
ATOM 11320 C C    . MET A 1 35 ? 0.790   -21.849 -2.671  1.00 0.00 ? 38 MET A C    19 
ATOM 11321 O O    . MET A 1 35 ? 1.123   -22.669 -3.528  1.00 0.00 ? 38 MET A O    19 
ATOM 11322 C CB   . MET A 1 35 ? 0.465   -19.856 -4.170  1.00 0.00 ? 38 MET A CB   19 
ATOM 11323 C CG   . MET A 1 35 ? -0.222  -20.054 -5.512  1.00 0.00 ? 38 MET A CG   19 
ATOM 11324 S SD   . MET A 1 35 ? 0.756   -19.433 -6.895  1.00 0.00 ? 38 MET A SD   19 
ATOM 11325 C CE   . MET A 1 35 ? 0.642   -17.666 -6.628  1.00 0.00 ? 38 MET A CE   19 
ATOM 11326 H H    . MET A 1 35 ? 0.086   -19.014 -1.757  1.00 0.00 ? 38 MET A H    19 
ATOM 11327 H HA   . MET A 1 35 ? -1.086  -21.100 -3.378  1.00 0.00 ? 38 MET A HA   19 
ATOM 11328 H HB2  . MET A 1 35 ? 0.403   -18.810 -3.909  1.00 0.00 ? 38 MET A HB2  19 
ATOM 11329 H HB3  . MET A 1 35 ? 1.506   -20.128 -4.280  1.00 0.00 ? 38 MET A HB3  19 
ATOM 11330 H HG2  . MET A 1 35 ? -0.395  -21.109 -5.660  1.00 0.00 ? 38 MET A HG2  19 
ATOM 11331 H HG3  . MET A 1 35 ? -1.169  -19.534 -5.498  1.00 0.00 ? 38 MET A HG3  19 
ATOM 11332 H HE1  . MET A 1 35 ? -0.348  -17.419 -6.270  1.00 0.00 ? 38 MET A HE1  19 
ATOM 11333 H HE2  . MET A 1 35 ? 0.827   -17.149 -7.557  1.00 0.00 ? 38 MET A HE2  19 
ATOM 11334 H HE3  . MET A 1 35 ? 1.375   -17.364 -5.894  1.00 0.00 ? 38 MET A HE3  19 
ATOM 11335 N N    . ALA A 1 36 ? 1.205   -21.909 -1.394  1.00 0.00 ? 39 ALA A N    19 
ATOM 11336 C CA   . ALA A 1 36 ? 2.097   -22.961 -0.893  1.00 0.00 ? 39 ALA A CA   19 
ATOM 11337 C C    . ALA A 1 36 ? 3.574   -22.613 -1.121  1.00 0.00 ? 39 ALA A C    19 
ATOM 11338 O O    . ALA A 1 36 ? 4.312   -23.364 -1.762  1.00 0.00 ? 39 ALA A O    19 
ATOM 11339 C CB   . ALA A 1 36 ? 1.749   -24.306 -1.517  1.00 0.00 ? 39 ALA A CB   19 
ATOM 11340 H H    . ALA A 1 36 ? 0.898   -21.224 -0.765  1.00 0.00 ? 39 ALA A H    19 
ATOM 11341 H HA   . ALA A 1 36 ? 1.932   -23.041 0.173   1.00 0.00 ? 39 ALA A HA   19 
ATOM 11342 H HB1  . ALA A 1 36 ? 2.207   -24.378 -2.492  1.00 0.00 ? 39 ALA A HB1  19 
ATOM 11343 H HB2  . ALA A 1 36 ? 0.678   -24.390 -1.615  1.00 0.00 ? 39 ALA A HB2  19 
ATOM 11344 H HB3  . ALA A 1 36 ? 2.117   -25.102 -0.887  1.00 0.00 ? 39 ALA A HB3  19 
ATOM 11345 N N    . GLN A 1 37 ? 3.999   -21.473 -0.575  1.00 0.00 ? 40 GLN A N    19 
ATOM 11346 C CA   . GLN A 1 37 ? 5.384   -21.024 -0.700  1.00 0.00 ? 40 GLN A CA   19 
ATOM 11347 C C    . GLN A 1 37 ? 6.072   -21.010 0.670   1.00 0.00 ? 40 GLN A C    19 
ATOM 11348 O O    . GLN A 1 37 ? 7.015   -21.768 0.900   1.00 0.00 ? 40 GLN A O    19 
ATOM 11349 C CB   . GLN A 1 37 ? 5.428   -19.635 -1.341  1.00 0.00 ? 40 GLN A CB   19 
ATOM 11350 C CG   . GLN A 1 37 ? 6.155   -19.596 -2.679  1.00 0.00 ? 40 GLN A CG   19 
ATOM 11351 C CD   . GLN A 1 37 ? 5.259   -19.150 -3.819  1.00 0.00 ? 40 GLN A CD   19 
ATOM 11352 O OE1  . GLN A 1 37 ? 4.470   -19.931 -4.344  1.00 0.00 ? 40 GLN A OE1  19 
ATOM 11353 N NE2  . GLN A 1 37 ? 5.377   -17.891 -4.213  1.00 0.00 ? 40 GLN A NE2  19 
ATOM 11354 H H    . GLN A 1 37 ? 3.370   -20.923 -0.071  1.00 0.00 ? 40 GLN A H    19 
ATOM 11355 H HA   . GLN A 1 37 ? 5.899   -21.723 -1.337  1.00 0.00 ? 40 GLN A HA   19 
ATOM 11356 H HB2  . GLN A 1 37 ? 4.415   -19.293 -1.497  1.00 0.00 ? 40 GLN A HB2  19 
ATOM 11357 H HB3  . GLN A 1 37 ? 5.924   -18.955 -0.665  1.00 0.00 ? 40 GLN A HB3  19 
ATOM 11358 H HG2  . GLN A 1 37 ? 6.984   -18.909 -2.604  1.00 0.00 ? 40 GLN A HG2  19 
ATOM 11359 H HG3  . GLN A 1 37 ? 6.527   -20.585 -2.901  1.00 0.00 ? 40 GLN A HG3  19 
ATOM 11360 H HE21 . GLN A 1 37 ? 6.028   -17.320 -3.756  1.00 0.00 ? 40 GLN A HE21 19 
ATOM 11361 H HE22 . GLN A 1 37 ? 4.807   -17.584 -4.947  1.00 0.00 ? 40 GLN A HE22 19 
ATOM 11362 N N    . ILE A 1 38 ? 5.575   -20.146 1.569   1.00 0.00 ? 41 ILE A N    19 
ATOM 11363 C CA   . ILE A 1 38 ? 6.105   -20.009 2.934   1.00 0.00 ? 41 ILE A CA   19 
ATOM 11364 C C    . ILE A 1 38 ? 7.384   -19.165 2.972   1.00 0.00 ? 41 ILE A C    19 
ATOM 11365 O O    . ILE A 1 38 ? 7.358   -18.092 3.618   1.00 0.00 ? 41 ILE A O    19 
ATOM 11366 C CB   . ILE A 1 38 ? 6.357   -21.383 3.607   1.00 0.00 ? 41 ILE A CB   19 
ATOM 11367 C CG1  . ILE A 1 38 ? 5.030   -22.100 3.871   1.00 0.00 ? 41 ILE A CG1  19 
ATOM 11368 C CG2  . ILE A 1 38 ? 7.126   -21.211 4.911   1.00 0.00 ? 41 ILE A CG2  19 
ATOM 11369 C CD1  . ILE A 1 38 ? 4.478   -22.827 2.663   1.00 0.00 ? 41 ILE A CD1  19 
ATOM 11370 O OXT  . ILE A 1 38 ? 8.397   -19.578 2.366   1.00 0.00 ? 41 ILE A OXT  19 
ATOM 11371 H H    . ILE A 1 38 ? 4.821   -19.582 1.306   1.00 0.00 ? 41 ILE A H    19 
ATOM 11372 H HA   . ILE A 1 38 ? 5.353   -19.498 3.514   1.00 0.00 ? 41 ILE A HA   19 
ATOM 11373 H HB   . ILE A 1 38 ? 6.957   -21.981 2.941   1.00 0.00 ? 41 ILE A HB   19 
ATOM 11374 H HG12 . ILE A 1 38 ? 5.172   -22.827 4.656   1.00 0.00 ? 41 ILE A HG12 19 
ATOM 11375 H HG13 . ILE A 1 38 ? 4.295   -21.375 4.187   1.00 0.00 ? 41 ILE A HG13 19 
ATOM 11376 H HG21 . ILE A 1 38 ? 8.137   -20.896 4.692   1.00 0.00 ? 41 ILE A HG21 19 
ATOM 11377 H HG22 . ILE A 1 38 ? 7.149   -22.150 5.442   1.00 0.00 ? 41 ILE A HG22 19 
ATOM 11378 H HG23 . ILE A 1 38 ? 6.640   -20.463 5.520   1.00 0.00 ? 41 ILE A HG23 19 
ATOM 11379 H HD11 . ILE A 1 38 ? 3.846   -23.639 2.991   1.00 0.00 ? 41 ILE A HD11 19 
ATOM 11380 H HD12 . ILE A 1 38 ? 5.294   -23.221 2.075   1.00 0.00 ? 41 ILE A HD12 19 
ATOM 11381 H HD13 . ILE A 1 38 ? 3.900   -22.140 2.063   1.00 0.00 ? 41 ILE A HD13 19 
ATOM 11382 N N    . PHE A 1 1  ? -17.740 18.120  2.204   1.00 0.00 ? 4  PHE A N    20 
ATOM 11383 C CA   . PHE A 1 1  ? -17.001 17.854  0.934   1.00 0.00 ? 4  PHE A CA   20 
ATOM 11384 C C    . PHE A 1 1  ? -15.652 18.574  0.920   1.00 0.00 ? 4  PHE A C    20 
ATOM 11385 O O    . PHE A 1 1  ? -15.488 19.600  1.582   1.00 0.00 ? 4  PHE A O    20 
ATOM 11386 C CB   . PHE A 1 1  ? -17.863 18.313  -0.253  1.00 0.00 ? 4  PHE A CB   20 
ATOM 11387 C CG   . PHE A 1 1  ? -18.501 19.662  -0.061  1.00 0.00 ? 4  PHE A CG   20 
ATOM 11388 C CD1  . PHE A 1 1  ? -17.771 20.823  -0.263  1.00 0.00 ? 4  PHE A CD1  20 
ATOM 11389 C CD2  . PHE A 1 1  ? -19.828 19.768  0.326   1.00 0.00 ? 4  PHE A CD2  20 
ATOM 11390 C CE1  . PHE A 1 1  ? -18.352 22.063  -0.083  1.00 0.00 ? 4  PHE A CE1  20 
ATOM 11391 C CE2  . PHE A 1 1  ? -20.413 21.006  0.509   1.00 0.00 ? 4  PHE A CE2  20 
ATOM 11392 C CZ   . PHE A 1 1  ? -19.674 22.155  0.305   1.00 0.00 ? 4  PHE A CZ   20 
ATOM 11393 H H1   . PHE A 1 1  ? -17.211 17.676  2.980   1.00 0.00 ? 4  PHE A H1   20 
ATOM 11394 H H2   . PHE A 1 1  ? -18.691 17.707  2.113   1.00 0.00 ? 4  PHE A H2   20 
ATOM 11395 H H3   . PHE A 1 1  ? -17.791 19.153  2.332   1.00 0.00 ? 4  PHE A H3   20 
ATOM 11396 H HA   . PHE A 1 1  ? -16.828 16.790  0.856   1.00 0.00 ? 4  PHE A HA   20 
ATOM 11397 H HB2  . PHE A 1 1  ? -17.246 18.365  -1.138  1.00 0.00 ? 4  PHE A HB2  20 
ATOM 11398 H HB3  . PHE A 1 1  ? -18.651 17.592  -0.416  1.00 0.00 ? 4  PHE A HB3  20 
ATOM 11399 H HD1  . PHE A 1 1  ? -16.737 20.753  -0.567  1.00 0.00 ? 4  PHE A HD1  20 
ATOM 11400 H HD2  . PHE A 1 1  ? -20.406 18.870  0.486   1.00 0.00 ? 4  PHE A HD2  20 
ATOM 11401 H HE1  . PHE A 1 1  ? -17.773 22.960  -0.244  1.00 0.00 ? 4  PHE A HE1  20 
ATOM 11402 H HE2  . PHE A 1 1  ? -21.449 21.075  0.811   1.00 0.00 ? 4  PHE A HE2  20 
ATOM 11403 H HZ   . PHE A 1 1  ? -20.131 23.123  0.446   1.00 0.00 ? 4  PHE A HZ   20 
ATOM 11404 N N    . THR A 1 2  ? -14.690 18.030  0.164   1.00 0.00 ? 5  THR A N    20 
ATOM 11405 C CA   . THR A 1 2  ? -13.343 18.619  0.059   1.00 0.00 ? 5  THR A CA   20 
ATOM 11406 C C    . THR A 1 2  ? -12.790 19.015  1.432   1.00 0.00 ? 5  THR A C    20 
ATOM 11407 O O    . THR A 1 2  ? -12.253 20.111  1.607   1.00 0.00 ? 5  THR A O    20 
ATOM 11408 C CB   . THR A 1 2  ? -13.360 19.841  -0.874  1.00 0.00 ? 5  THR A CB   20 
ATOM 11409 O OG1  . THR A 1 2  ? -14.496 20.656  -0.634  1.00 0.00 ? 5  THR A OG1  20 
ATOM 11410 C CG2  . THR A 1 2  ? -13.372 19.472  -2.339  1.00 0.00 ? 5  THR A CG2  20 
ATOM 11411 H H    . THR A 1 2  ? -14.887 17.211  -0.339  1.00 0.00 ? 5  THR A H    20 
ATOM 11412 H HA   . THR A 1 2  ? -12.692 17.870  -0.368  1.00 0.00 ? 5  THR A HA   20 
ATOM 11413 H HB   . THR A 1 2  ? -12.472 20.431  -0.691  1.00 0.00 ? 5  THR A HB   20 
ATOM 11414 H HG1  . THR A 1 2  ? -14.581 20.821  0.313   1.00 0.00 ? 5  THR A HG1  20 
ATOM 11415 H HG21 . THR A 1 2  ? -13.571 20.355  -2.929  1.00 0.00 ? 5  THR A HG21 20 
ATOM 11416 H HG22 . THR A 1 2  ? -14.142 18.737  -2.519  1.00 0.00 ? 5  THR A HG22 20 
ATOM 11417 H HG23 . THR A 1 2  ? -12.411 19.062  -2.616  1.00 0.00 ? 5  THR A HG23 20 
ATOM 11418 N N    . LEU A 1 3  ? -12.921 18.117  2.407   1.00 0.00 ? 6  LEU A N    20 
ATOM 11419 C CA   . LEU A 1 3  ? -12.436 18.379  3.763   1.00 0.00 ? 6  LEU A CA   20 
ATOM 11420 C C    . LEU A 1 3  ? -10.946 18.053  3.891   1.00 0.00 ? 6  LEU A C    20 
ATOM 11421 O O    . LEU A 1 3  ? -10.550 17.193  4.682   1.00 0.00 ? 6  LEU A O    20 
ATOM 11422 C CB   . LEU A 1 3  ? -13.253 17.570  4.778   1.00 0.00 ? 6  LEU A CB   20 
ATOM 11423 C CG   . LEU A 1 3  ? -14.718 17.989  4.914   1.00 0.00 ? 6  LEU A CG   20 
ATOM 11424 C CD1  . LEU A 1 3  ? -15.577 16.803  5.314   1.00 0.00 ? 6  LEU A CD1  20 
ATOM 11425 C CD2  . LEU A 1 3  ? -14.858 19.112  5.929   1.00 0.00 ? 6  LEU A CD2  20 
ATOM 11426 H H    . LEU A 1 3  ? -13.355 17.261  2.212   1.00 0.00 ? 6  LEU A H    20 
ATOM 11427 H HA   . LEU A 1 3  ? -12.576 19.430  3.963   1.00 0.00 ? 6  LEU A HA   20 
ATOM 11428 H HB2  . LEU A 1 3  ? -13.222 16.530  4.487   1.00 0.00 ? 6  LEU A HB2  20 
ATOM 11429 H HB3  . LEU A 1 3  ? -12.783 17.669  5.746   1.00 0.00 ? 6  LEU A HB3  20 
ATOM 11430 H HG   . LEU A 1 3  ? -15.072 18.353  3.961   1.00 0.00 ? 6  LEU A HG   20 
ATOM 11431 H HD11 . LEU A 1 3  ? -16.579 17.141  5.531   1.00 0.00 ? 6  LEU A HD11 20 
ATOM 11432 H HD12 . LEU A 1 3  ? -15.158 16.336  6.194   1.00 0.00 ? 6  LEU A HD12 20 
ATOM 11433 H HD13 . LEU A 1 3  ? -15.605 16.088  4.506   1.00 0.00 ? 6  LEU A HD13 20 
ATOM 11434 H HD21 . LEU A 1 3  ? -14.559 18.755  6.904   1.00 0.00 ? 6  LEU A HD21 20 
ATOM 11435 H HD22 . LEU A 1 3  ? -15.886 19.438  5.965   1.00 0.00 ? 6  LEU A HD22 20 
ATOM 11436 H HD23 . LEU A 1 3  ? -14.228 19.939  5.639   1.00 0.00 ? 6  LEU A HD23 20 
ATOM 11437 N N    . SER A 1 4  ? -10.121 18.749  3.106   1.00 0.00 ? 7  SER A N    20 
ATOM 11438 C CA   . SER A 1 4  ? -8.669  18.544  3.122   1.00 0.00 ? 7  SER A CA   20 
ATOM 11439 C C    . SER A 1 4  ? -8.300  17.087  2.817   1.00 0.00 ? 7  SER A C    20 
ATOM 11440 O O    . SER A 1 4  ? -7.387  16.526  3.422   1.00 0.00 ? 7  SER A O    20 
ATOM 11441 C CB   . SER A 1 4  ? -8.088  18.963  4.478   1.00 0.00 ? 7  SER A CB   20 
ATOM 11442 O OG   . SER A 1 4  ? -7.305  20.139  4.353   1.00 0.00 ? 7  SER A OG   20 
ATOM 11443 H H    . SER A 1 4  ? -10.498 19.421  2.498   1.00 0.00 ? 7  SER A H    20 
ATOM 11444 H HA   . SER A 1 4  ? -8.241  19.172  2.355   1.00 0.00 ? 7  SER A HA   20 
ATOM 11445 H HB2  . SER A 1 4  ? -8.896  19.155  5.169   1.00 0.00 ? 7  SER A HB2  20 
ATOM 11446 H HB3  . SER A 1 4  ? -7.467  18.168  4.865   1.00 0.00 ? 7  SER A HB3  20 
ATOM 11447 H HG   . SER A 1 4  ? -6.386  19.900  4.188   1.00 0.00 ? 7  SER A HG   20 
ATOM 11448 N N    . LEU A 1 5  ? -9.014  16.480  1.867   1.00 0.00 ? 8  LEU A N    20 
ATOM 11449 C CA   . LEU A 1 5  ? -8.755  15.090  1.481   1.00 0.00 ? 8  LEU A CA   20 
ATOM 11450 C C    . LEU A 1 5  ? -8.731  14.934  -0.041  1.00 0.00 ? 8  LEU A C    20 
ATOM 11451 O O    . LEU A 1 5  ? -9.209  13.936  -0.587  1.00 0.00 ? 8  LEU A O    20 
ATOM 11452 C CB   . LEU A 1 5  ? -9.810  14.166  2.098   1.00 0.00 ? 8  LEU A CB   20 
ATOM 11453 C CG   . LEU A 1 5  ? -9.631  13.884  3.590   1.00 0.00 ? 8  LEU A CG   20 
ATOM 11454 C CD1  . LEU A 1 5  ? -10.946 14.065  4.328   1.00 0.00 ? 8  LEU A CD1  20 
ATOM 11455 C CD2  . LEU A 1 5  ? -9.091  12.480  3.806   1.00 0.00 ? 8  LEU A CD2  20 
ATOM 11456 H H    . LEU A 1 5  ? -9.727  16.977  1.414   1.00 0.00 ? 8  LEU A H    20 
ATOM 11457 H HA   . LEU A 1 5  ? -7.784  14.821  1.865   1.00 0.00 ? 8  LEU A HA   20 
ATOM 11458 H HB2  . LEU A 1 5  ? -10.781 14.615  1.949   1.00 0.00 ? 8  LEU A HB2  20 
ATOM 11459 H HB3  . LEU A 1 5  ? -9.785  13.223  1.570   1.00 0.00 ? 8  LEU A HB3  20 
ATOM 11460 H HG   . LEU A 1 5  ? -8.918  14.585  4.000   1.00 0.00 ? 8  LEU A HG   20 
ATOM 11461 H HD11 . LEU A 1 5  ? -11.339 15.051  4.126   1.00 0.00 ? 8  LEU A HD11 20 
ATOM 11462 H HD12 . LEU A 1 5  ? -10.781 13.953  5.389   1.00 0.00 ? 8  LEU A HD12 20 
ATOM 11463 H HD13 . LEU A 1 5  ? -11.652 13.320  3.993   1.00 0.00 ? 8  LEU A HD13 20 
ATOM 11464 H HD21 . LEU A 1 5  ? -8.967  12.301  4.863   1.00 0.00 ? 8  LEU A HD21 20 
ATOM 11465 H HD22 . LEU A 1 5  ? -8.138  12.380  3.309   1.00 0.00 ? 8  LEU A HD22 20 
ATOM 11466 H HD23 . LEU A 1 5  ? -9.787  11.760  3.400   1.00 0.00 ? 8  LEU A HD23 20 
ATOM 11467 N N    . ASP A 1 6  ? -8.172  15.929  -0.719  1.00 0.00 ? 9  ASP A N    20 
ATOM 11468 C CA   . ASP A 1 6  ? -8.082  15.928  -2.167  1.00 0.00 ? 9  ASP A CA   20 
ATOM 11469 C C    . ASP A 1 6  ? -6.719  15.391  -2.635  1.00 0.00 ? 9  ASP A C    20 
ATOM 11470 O O    . ASP A 1 6  ? -5.946  16.096  -3.286  1.00 0.00 ? 9  ASP A O    20 
ATOM 11471 C CB   . ASP A 1 6  ? -8.326  17.350  -2.671  1.00 0.00 ? 9  ASP A CB   20 
ATOM 11472 C CG   . ASP A 1 6  ? -9.762  17.795  -2.470  1.00 0.00 ? 9  ASP A CG   20 
ATOM 11473 O OD1  . ASP A 1 6  ? -10.118 18.168  -1.329  1.00 0.00 ? 9  ASP A OD1  20 
ATOM 11474 O OD2  . ASP A 1 6  ? -10.531 17.766  -3.449  1.00 0.00 ? 9  ASP A OD2  20 
ATOM 11475 H H    . ASP A 1 6  ? -7.813  16.694  -0.232  1.00 0.00 ? 9  ASP A H    20 
ATOM 11476 H HA   . ASP A 1 6  ? -8.859  15.283  -2.549  1.00 0.00 ? 9  ASP A HA   20 
ATOM 11477 H HB2  . ASP A 1 6  ? -7.682  18.031  -2.135  1.00 0.00 ? 9  ASP A HB2  20 
ATOM 11478 H HB3  . ASP A 1 6  ? -8.096  17.397  -3.716  1.00 0.00 ? 9  ASP A HB3  20 
ATOM 11479 N N    . VAL A 1 7  ? -6.447  14.128  -2.285  1.00 0.00 ? 10 VAL A N    20 
ATOM 11480 C CA   . VAL A 1 7  ? -5.192  13.445  -2.642  1.00 0.00 ? 10 VAL A CA   20 
ATOM 11481 C C    . VAL A 1 7  ? -3.957  14.357  -2.500  1.00 0.00 ? 10 VAL A C    20 
ATOM 11482 O O    . VAL A 1 7  ? -3.200  14.564  -3.452  1.00 0.00 ? 10 VAL A O    20 
ATOM 11483 C CB   . VAL A 1 7  ? -5.263  12.843  -4.070  1.00 0.00 ? 10 VAL A CB   20 
ATOM 11484 C CG1  . VAL A 1 7  ? -5.389  13.930  -5.130  1.00 0.00 ? 10 VAL A CG1  20 
ATOM 11485 C CG2  . VAL A 1 7  ? -4.052  11.963  -4.345  1.00 0.00 ? 10 VAL A CG2  20 
ATOM 11486 H H    . VAL A 1 7  ? -7.116  13.635  -1.765  1.00 0.00 ? 10 VAL A H    20 
ATOM 11487 H HA   . VAL A 1 7  ? -5.073  12.623  -1.949  1.00 0.00 ? 10 VAL A HA   20 
ATOM 11488 H HB   . VAL A 1 7  ? -6.145  12.222  -4.126  1.00 0.00 ? 10 VAL A HB   20 
ATOM 11489 H HG11 . VAL A 1 7  ? -5.002  13.562  -6.069  1.00 0.00 ? 10 VAL A HG11 20 
ATOM 11490 H HG12 . VAL A 1 7  ? -4.826  14.800  -4.825  1.00 0.00 ? 10 VAL A HG12 20 
ATOM 11491 H HG13 . VAL A 1 7  ? -6.428  14.198  -5.249  1.00 0.00 ? 10 VAL A HG13 20 
ATOM 11492 H HG21 . VAL A 1 7  ? -3.798  11.409  -3.455  1.00 0.00 ? 10 VAL A HG21 20 
ATOM 11493 H HG22 . VAL A 1 7  ? -3.216  12.583  -4.636  1.00 0.00 ? 10 VAL A HG22 20 
ATOM 11494 H HG23 . VAL A 1 7  ? -4.282  11.274  -5.145  1.00 0.00 ? 10 VAL A HG23 20 
ATOM 11495 N N    . PRO A 1 8  ? -3.730  14.907  -1.292  1.00 0.00 ? 11 PRO A N    20 
ATOM 11496 C CA   . PRO A 1 8  ? -2.585  15.788  -1.026  1.00 0.00 ? 11 PRO A CA   20 
ATOM 11497 C C    . PRO A 1 8  ? -1.261  15.024  -0.921  1.00 0.00 ? 11 PRO A C    20 
ATOM 11498 O O    . PRO A 1 8  ? -1.242  13.795  -0.784  1.00 0.00 ? 11 PRO A O    20 
ATOM 11499 C CB   . PRO A 1 8  ? -2.949  16.424  0.317   1.00 0.00 ? 11 PRO A CB   20 
ATOM 11500 C CG   . PRO A 1 8  ? -3.784  15.396  0.998   1.00 0.00 ? 11 PRO A CG   20 
ATOM 11501 C CD   . PRO A 1 8  ? -4.567  14.712  -0.090  1.00 0.00 ? 11 PRO A CD   20 
ATOM 11502 H HA   . PRO A 1 8  ? -2.495  16.557  -1.780  1.00 0.00 ? 11 PRO A HA   20 
ATOM 11503 H HB2  . PRO A 1 8  ? -2.049  16.640  0.875   1.00 0.00 ? 11 PRO A HB2  20 
ATOM 11504 H HB3  . PRO A 1 8  ? -3.504  17.334  0.148   1.00 0.00 ? 11 PRO A HB3  20 
ATOM 11505 H HG2  . PRO A 1 8  ? -3.148  14.685  1.506   1.00 0.00 ? 11 PRO A HG2  20 
ATOM 11506 H HG3  . PRO A 1 8  ? -4.452  15.871  1.700   1.00 0.00 ? 11 PRO A HG3  20 
ATOM 11507 H HD2  . PRO A 1 8  ? -4.684  13.662  0.131   1.00 0.00 ? 11 PRO A HD2  20 
ATOM 11508 H HD3  . PRO A 1 8  ? -5.531  15.181  -0.214  1.00 0.00 ? 11 PRO A HD3  20 
ATOM 11509 N N    . THR A 1 9  ? -0.150  15.760  -0.979  1.00 0.00 ? 12 THR A N    20 
ATOM 11510 C CA   . THR A 1 9  ? 1.189   15.163  -0.887  1.00 0.00 ? 12 THR A CA   20 
ATOM 11511 C C    . THR A 1 9  ? 1.320   14.258  0.340   1.00 0.00 ? 12 THR A C    20 
ATOM 11512 O O    . THR A 1 9  ? 1.959   13.210  0.274   1.00 0.00 ? 12 THR A O    20 
ATOM 11513 C CB   . THR A 1 9  ? 2.264   16.252  -0.842  1.00 0.00 ? 12 THR A CB   20 
ATOM 11514 O OG1  . THR A 1 9  ? 1.711   17.518  -1.158  1.00 0.00 ? 12 THR A OG1  20 
ATOM 11515 C CG2  . THR A 1 9  ? 3.407   16.004  -1.801  1.00 0.00 ? 12 THR A CG2  20 
ATOM 11516 H H    . THR A 1 9  ? -0.226  16.732  -1.083  1.00 0.00 ? 12 THR A H    20 
ATOM 11517 H HA   . THR A 1 9  ? 1.341   14.563  -1.771  1.00 0.00 ? 12 THR A HA   20 
ATOM 11518 H HB   . THR A 1 9  ? 2.674   16.299  0.157   1.00 0.00 ? 12 THR A HB   20 
ATOM 11519 H HG1  . THR A 1 9  ? 2.400   18.186  -1.139  1.00 0.00 ? 12 THR A HG1  20 
ATOM 11520 H HG21 . THR A 1 9  ? 3.526   14.941  -1.952  1.00 0.00 ? 12 THR A HG21 20 
ATOM 11521 H HG22 . THR A 1 9  ? 4.318   16.413  -1.390  1.00 0.00 ? 12 THR A HG22 20 
ATOM 11522 H HG23 . THR A 1 9  ? 3.193   16.480  -2.746  1.00 0.00 ? 12 THR A HG23 20 
ATOM 11523 N N    . ASN A 1 10 ? 0.699   14.667  1.453   1.00 0.00 ? 13 ASN A N    20 
ATOM 11524 C CA   . ASN A 1 10 ? 0.737   13.885  2.694   1.00 0.00 ? 13 ASN A CA   20 
ATOM 11525 C C    . ASN A 1 10 ? -0.125  12.620  2.606   1.00 0.00 ? 13 ASN A C    20 
ATOM 11526 O O    . ASN A 1 10 ? -0.110  11.788  3.512   1.00 0.00 ? 13 ASN A O    20 
ATOM 11527 C CB   . ASN A 1 10 ? 0.293   14.747  3.883   1.00 0.00 ? 13 ASN A CB   20 
ATOM 11528 C CG   . ASN A 1 10 ? -1.116  15.282  3.720   1.00 0.00 ? 13 ASN A CG   20 
ATOM 11529 O OD1  . ASN A 1 10 ? -1.350  16.214  2.956   1.00 0.00 ? 13 ASN A OD1  20 
ATOM 11530 N ND2  . ASN A 1 10 ? -2.064  14.694  4.433   1.00 0.00 ? 13 ASN A ND2  20 
ATOM 11531 H H    . ASN A 1 10 ? 0.196   15.511  1.437   1.00 0.00 ? 13 ASN A H    20 
ATOM 11532 H HA   . ASN A 1 10 ? 1.754   13.580  2.848   1.00 0.00 ? 13 ASN A HA   20 
ATOM 11533 H HB2  . ASN A 1 10 ? 0.328   14.152  4.783   1.00 0.00 ? 13 ASN A HB2  20 
ATOM 11534 H HB3  . ASN A 1 10 ? 0.967   15.584  3.983   1.00 0.00 ? 13 ASN A HB3  20 
ATOM 11535 H HD21 . ASN A 1 10 ? -1.810  13.952  5.021   1.00 0.00 ? 13 ASN A HD21 20 
ATOM 11536 H HD22 . ASN A 1 10 ? -2.979  15.028  4.345   1.00 0.00 ? 13 ASN A HD22 20 
ATOM 11537 N N    . ILE A 1 11 ? -0.863  12.481  1.511   1.00 0.00 ? 14 ILE A N    20 
ATOM 11538 C CA   . ILE A 1 11 ? -1.714  11.324  1.287   1.00 0.00 ? 14 ILE A CA   20 
ATOM 11539 C C    . ILE A 1 11 ? -1.171  10.493  0.125   1.00 0.00 ? 14 ILE A C    20 
ATOM 11540 O O    . ILE A 1 11 ? -1.066  9.268   0.221   1.00 0.00 ? 14 ILE A O    20 
ATOM 11541 C CB   . ILE A 1 11 ? -3.168  11.766  1.013   1.00 0.00 ? 14 ILE A CB   20 
ATOM 11542 C CG1  . ILE A 1 11 ? -3.947  11.859  2.327   1.00 0.00 ? 14 ILE A CG1  20 
ATOM 11543 C CG2  . ILE A 1 11 ? -3.868  10.819  0.044   1.00 0.00 ? 14 ILE A CG2  20 
ATOM 11544 C CD1  . ILE A 1 11 ? -5.351  12.403  2.169   1.00 0.00 ? 14 ILE A CD1  20 
ATOM 11545 H H    . ILE A 1 11 ? -0.830  13.175  0.825   1.00 0.00 ? 14 ILE A H    20 
ATOM 11546 H HA   . ILE A 1 11 ? -1.701  10.720  2.182   1.00 0.00 ? 14 ILE A HA   20 
ATOM 11547 H HB   . ILE A 1 11 ? -3.128  12.745  0.560   1.00 0.00 ? 14 ILE A HB   20 
ATOM 11548 H HG12 . ILE A 1 11 ? -4.022  10.874  2.761   1.00 0.00 ? 14 ILE A HG12 20 
ATOM 11549 H HG13 . ILE A 1 11 ? -3.414  12.507  3.007   1.00 0.00 ? 14 ILE A HG13 20 
ATOM 11550 H HG21 . ILE A 1 11 ? -3.607  9.799   0.284   1.00 0.00 ? 14 ILE A HG21 20 
ATOM 11551 H HG22 . ILE A 1 11 ? -3.558  11.041  -0.966  1.00 0.00 ? 14 ILE A HG22 20 
ATOM 11552 H HG23 . ILE A 1 11 ? -4.938  10.945  0.129   1.00 0.00 ? 14 ILE A HG23 20 
ATOM 11553 H HD11 . ILE A 1 11 ? -5.992  11.963  2.917   1.00 0.00 ? 14 ILE A HD11 20 
ATOM 11554 H HD12 . ILE A 1 11 ? -5.723  12.157  1.185   1.00 0.00 ? 14 ILE A HD12 20 
ATOM 11555 H HD13 . ILE A 1 11 ? -5.338  13.476  2.292   1.00 0.00 ? 14 ILE A HD13 20 
ATOM 11556 N N    . MET A 1 12 ? -0.804  11.174  -0.967  1.00 0.00 ? 15 MET A N    20 
ATOM 11557 C CA   . MET A 1 12 ? -0.246  10.515  -2.140  1.00 0.00 ? 15 MET A CA   20 
ATOM 11558 C C    . MET A 1 12 ? 0.928   9.621   -1.740  1.00 0.00 ? 15 MET A C    20 
ATOM 11559 O O    . MET A 1 12 ? 0.996   8.455   -2.139  1.00 0.00 ? 15 MET A O    20 
ATOM 11560 C CB   . MET A 1 12 ? 0.202   11.568  -3.155  1.00 0.00 ? 15 MET A CB   20 
ATOM 11561 C CG   . MET A 1 12 ? -0.399  11.377  -4.535  1.00 0.00 ? 15 MET A CG   20 
ATOM 11562 S SD   . MET A 1 12 ? 0.841   10.989  -5.785  1.00 0.00 ? 15 MET A SD   20 
ATOM 11563 C CE   . MET A 1 12 ? 1.052   9.232   -5.519  1.00 0.00 ? 15 MET A CE   20 
ATOM 11564 H H    . MET A 1 12 ? -0.898  12.153  -0.977  1.00 0.00 ? 15 MET A H    20 
ATOM 11565 H HA   . MET A 1 12 ? -1.019  9.902   -2.580  1.00 0.00 ? 15 MET A HA   20 
ATOM 11566 H HB2  . MET A 1 12 ? -0.087  12.544  -2.794  1.00 0.00 ? 15 MET A HB2  20 
ATOM 11567 H HB3  . MET A 1 12 ? 1.275   11.533  -3.242  1.00 0.00 ? 15 MET A HB3  20 
ATOM 11568 H HG2  . MET A 1 12 ? -1.113  10.570  -4.493  1.00 0.00 ? 15 MET A HG2  20 
ATOM 11569 H HG3  . MET A 1 12 ? -0.905  12.288  -4.820  1.00 0.00 ? 15 MET A HG3  20 
ATOM 11570 H HE1  . MET A 1 12 ? 2.057   8.946   -5.791  1.00 0.00 ? 15 MET A HE1  20 
ATOM 11571 H HE2  . MET A 1 12 ? 0.345   8.688   -6.128  1.00 0.00 ? 15 MET A HE2  20 
ATOM 11572 H HE3  . MET A 1 12 ? 0.881   9.002   -4.478  1.00 0.00 ? 15 MET A HE3  20 
ATOM 11573 N N    . ASN A 1 13 ? 1.836   10.169  -0.926  1.00 0.00 ? 16 ASN A N    20 
ATOM 11574 C CA   . ASN A 1 13 ? 2.990   9.414   -0.445  1.00 0.00 ? 16 ASN A CA   20 
ATOM 11575 C C    . ASN A 1 13 ? 2.528   8.190   0.345   1.00 0.00 ? 16 ASN A C    20 
ATOM 11576 O O    . ASN A 1 13 ? 3.009   7.076   0.127   1.00 0.00 ? 16 ASN A O    20 
ATOM 11577 C CB   . ASN A 1 13 ? 3.901   10.304  0.419   1.00 0.00 ? 16 ASN A CB   20 
ATOM 11578 C CG   . ASN A 1 13 ? 3.185   10.929  1.607   1.00 0.00 ? 16 ASN A CG   20 
ATOM 11579 O OD1  . ASN A 1 13 ? 1.963   10.867  1.719   1.00 0.00 ? 16 ASN A OD1  20 
ATOM 11580 N ND2  . ASN A 1 13 ? 3.944   11.536  2.503   1.00 0.00 ? 16 ASN A ND2  20 
ATOM 11581 H H    . ASN A 1 13 ? 1.713   11.095  -0.625  1.00 0.00 ? 16 ASN A H    20 
ATOM 11582 H HA   . ASN A 1 13 ? 3.540   9.078   -1.305  1.00 0.00 ? 16 ASN A HA   20 
ATOM 11583 H HB2  . ASN A 1 13 ? 4.720   9.711   0.794   1.00 0.00 ? 16 ASN A HB2  20 
ATOM 11584 H HB3  . ASN A 1 13 ? 4.295   11.101  -0.195  1.00 0.00 ? 16 ASN A HB3  20 
ATOM 11585 H HD21 . ASN A 1 13 ? 4.912   11.552  2.357   1.00 0.00 ? 16 ASN A HD21 20 
ATOM 11586 H HD22 . ASN A 1 13 ? 3.505   11.944  3.277   1.00 0.00 ? 16 ASN A HD22 20 
ATOM 11587 N N    . LEU A 1 14 ? 1.573   8.410   1.246   1.00 0.00 ? 17 LEU A N    20 
ATOM 11588 C CA   . LEU A 1 14 ? 1.012   7.337   2.061   1.00 0.00 ? 17 LEU A CA   20 
ATOM 11589 C C    . LEU A 1 14 ? 0.382   6.275   1.167   1.00 0.00 ? 17 LEU A C    20 
ATOM 11590 O O    . LEU A 1 14 ? 0.692   5.094   1.291   1.00 0.00 ? 17 LEU A O    20 
ATOM 11591 C CB   . LEU A 1 14 ? -0.025  7.893   3.043   1.00 0.00 ? 17 LEU A CB   20 
ATOM 11592 C CG   . LEU A 1 14 ? 0.541   8.758   4.172   1.00 0.00 ? 17 LEU A CG   20 
ATOM 11593 C CD1  . LEU A 1 14 ? -0.568  9.195   5.113   1.00 0.00 ? 17 LEU A CD1  20 
ATOM 11594 C CD2  . LEU A 1 14 ? 1.619   8.005   4.935   1.00 0.00 ? 17 LEU A CD2  20 
ATOM 11595 H H    . LEU A 1 14 ? 1.228   9.323   1.353   1.00 0.00 ? 17 LEU A H    20 
ATOM 11596 H HA   . LEU A 1 14 ? 1.820   6.886   2.617   1.00 0.00 ? 17 LEU A HA   20 
ATOM 11597 H HB2  . LEU A 1 14 ? -0.736  8.486   2.485   1.00 0.00 ? 17 LEU A HB2  20 
ATOM 11598 H HB3  . LEU A 1 14 ? -0.550  7.060   3.488   1.00 0.00 ? 17 LEU A HB3  20 
ATOM 11599 H HG   . LEU A 1 14 ? 0.987   9.647   3.748   1.00 0.00 ? 17 LEU A HG   20 
ATOM 11600 H HD11 . LEU A 1 14 ? -1.300  8.406   5.198   1.00 0.00 ? 17 LEU A HD11 20 
ATOM 11601 H HD12 . LEU A 1 14 ? -1.039  10.086  4.725   1.00 0.00 ? 17 LEU A HD12 20 
ATOM 11602 H HD13 . LEU A 1 14 ? -0.150  9.404   6.087   1.00 0.00 ? 17 LEU A HD13 20 
ATOM 11603 H HD21 . LEU A 1 14 ? 2.493   7.896   4.312   1.00 0.00 ? 17 LEU A HD21 20 
ATOM 11604 H HD22 . LEU A 1 14 ? 1.249   7.030   5.212   1.00 0.00 ? 17 LEU A HD22 20 
ATOM 11605 H HD23 . LEU A 1 14 ? 1.879   8.557   5.827   1.00 0.00 ? 17 LEU A HD23 20 
ATOM 11606 N N    . LEU A 1 15 ? -0.487  6.706   0.249   1.00 0.00 ? 18 LEU A N    20 
ATOM 11607 C CA   . LEU A 1 15 ? -1.138  5.780   -0.685  1.00 0.00 ? 18 LEU A CA   20 
ATOM 11608 C C    . LEU A 1 15 ? -0.091  4.960   -1.432  1.00 0.00 ? 18 LEU A C    20 
ATOM 11609 O O    . LEU A 1 15 ? -0.158  3.727   -1.459  1.00 0.00 ? 18 LEU A O    20 
ATOM 11610 C CB   . LEU A 1 15 ? -2.018  6.548   -1.678  1.00 0.00 ? 18 LEU A CB   20 
ATOM 11611 C CG   . LEU A 1 15 ? -3.204  7.290   -1.062  1.00 0.00 ? 18 LEU A CG   20 
ATOM 11612 C CD1  . LEU A 1 15 ? -3.752  8.317   -2.037  1.00 0.00 ? 18 LEU A CD1  20 
ATOM 11613 C CD2  . LEU A 1 15 ? -4.293  6.310   -0.658  1.00 0.00 ? 18 LEU A CD2  20 
ATOM 11614 H H    . LEU A 1 15 ? -0.683  7.673   0.187   1.00 0.00 ? 18 LEU A H    20 
ATOM 11615 H HA   . LEU A 1 15 ? -1.753  5.104   -0.111  1.00 0.00 ? 18 LEU A HA   20 
ATOM 11616 H HB2  . LEU A 1 15 ? -1.397  7.268   -2.192  1.00 0.00 ? 18 LEU A HB2  20 
ATOM 11617 H HB3  . LEU A 1 15 ? -2.399  5.847   -2.405  1.00 0.00 ? 18 LEU A HB3  20 
ATOM 11618 H HG   . LEU A 1 15 ? -2.875  7.812   -0.175  1.00 0.00 ? 18 LEU A HG   20 
ATOM 11619 H HD11 . LEU A 1 15 ? -3.815  7.881   -3.023  1.00 0.00 ? 18 LEU A HD11 20 
ATOM 11620 H HD12 . LEU A 1 15 ? -3.094  9.174   -2.064  1.00 0.00 ? 18 LEU A HD12 20 
ATOM 11621 H HD13 . LEU A 1 15 ? -4.735  8.629   -1.718  1.00 0.00 ? 18 LEU A HD13 20 
ATOM 11622 H HD21 . LEU A 1 15 ? -5.174  6.857   -0.355  1.00 0.00 ? 18 LEU A HD21 20 
ATOM 11623 H HD22 . LEU A 1 15 ? -3.945  5.704   0.165   1.00 0.00 ? 18 LEU A HD22 20 
ATOM 11624 H HD23 . LEU A 1 15 ? -4.536  5.674   -1.497  1.00 0.00 ? 18 LEU A HD23 20 
ATOM 11625 N N    . PHE A 1 16 ? 0.891   5.653   -2.013  1.00 0.00 ? 19 PHE A N    20 
ATOM 11626 C CA   . PHE A 1 16 ? 1.976   4.990   -2.735  1.00 0.00 ? 19 PHE A CA   20 
ATOM 11627 C C    . PHE A 1 16 ? 2.680   3.990   -1.823  1.00 0.00 ? 19 PHE A C    20 
ATOM 11628 O O    . PHE A 1 16 ? 2.990   2.869   -2.230  1.00 0.00 ? 19 PHE A O    20 
ATOM 11629 C CB   . PHE A 1 16 ? 2.982   6.023   -3.245  1.00 0.00 ? 19 PHE A CB   20 
ATOM 11630 C CG   . PHE A 1 16 ? 3.552   5.691   -4.596  1.00 0.00 ? 19 PHE A CG   20 
ATOM 11631 C CD1  . PHE A 1 16 ? 4.675   4.887   -4.709  1.00 0.00 ? 19 PHE A CD1  20 
ATOM 11632 C CD2  . PHE A 1 16 ? 2.965   6.182   -5.750  1.00 0.00 ? 19 PHE A CD2  20 
ATOM 11633 C CE1  . PHE A 1 16 ? 5.201   4.578   -5.948  1.00 0.00 ? 19 PHE A CE1  20 
ATOM 11634 C CE2  . PHE A 1 16 ? 3.488   5.877   -6.993  1.00 0.00 ? 19 PHE A CE2  20 
ATOM 11635 C CZ   . PHE A 1 16 ? 4.607   5.075   -7.092  1.00 0.00 ? 19 PHE A CZ   20 
ATOM 11636 H H    . PHE A 1 16 ? 0.897   6.634   -1.935  1.00 0.00 ? 19 PHE A H    20 
ATOM 11637 H HA   . PHE A 1 16 ? 1.549   4.461   -3.574  1.00 0.00 ? 19 PHE A HA   20 
ATOM 11638 H HB2  . PHE A 1 16 ? 2.497   6.983   -3.313  1.00 0.00 ? 19 PHE A HB2  20 
ATOM 11639 H HB3  . PHE A 1 16 ? 3.803   6.092   -2.546  1.00 0.00 ? 19 PHE A HB3  20 
ATOM 11640 H HD1  . PHE A 1 16 ? 5.139   4.499   -3.815  1.00 0.00 ? 19 PHE A HD1  20 
ATOM 11641 H HD2  . PHE A 1 16 ? 2.090   6.810   -5.675  1.00 0.00 ? 19 PHE A HD2  20 
ATOM 11642 H HE1  . PHE A 1 16 ? 6.077   3.950   -6.024  1.00 0.00 ? 19 PHE A HE1  20 
ATOM 11643 H HE2  . PHE A 1 16 ? 3.020   6.266   -7.886  1.00 0.00 ? 19 PHE A HE2  20 
ATOM 11644 H HZ   . PHE A 1 16 ? 5.017   4.835   -8.063  1.00 0.00 ? 19 PHE A HZ   20 
ATOM 11645 N N    . ASN A 1 17 ? 2.909   4.403   -0.575  1.00 0.00 ? 20 ASN A N    20 
ATOM 11646 C CA   . ASN A 1 17 ? 3.558   3.548   0.411   1.00 0.00 ? 20 ASN A CA   20 
ATOM 11647 C C    . ASN A 1 17 ? 2.639   2.390   0.793   1.00 0.00 ? 20 ASN A C    20 
ATOM 11648 O O    . ASN A 1 17 ? 3.059   1.231   0.798   1.00 0.00 ? 20 ASN A O    20 
ATOM 11649 C CB   . ASN A 1 17 ? 3.937   4.360   1.649   1.00 0.00 ? 20 ASN A CB   20 
ATOM 11650 C CG   . ASN A 1 17 ? 5.281   3.954   2.219   1.00 0.00 ? 20 ASN A CG   20 
ATOM 11651 O OD1  . ASN A 1 17 ? 5.388   3.605   3.389   1.00 0.00 ? 20 ASN A OD1  20 
ATOM 11652 N ND2  . ASN A 1 17 ? 6.315   3.996   1.391   1.00 0.00 ? 20 ASN A ND2  20 
ATOM 11653 H H    . ASN A 1 17 ? 2.617   5.305   -0.309  1.00 0.00 ? 20 ASN A H    20 
ATOM 11654 H HA   . ASN A 1 17 ? 4.454   3.144   -0.037  1.00 0.00 ? 20 ASN A HA   20 
ATOM 11655 H HB2  . ASN A 1 17 ? 3.981   5.406   1.388   1.00 0.00 ? 20 ASN A HB2  20 
ATOM 11656 H HB3  . ASN A 1 17 ? 3.187   4.215   2.408   1.00 0.00 ? 20 ASN A HB3  20 
ATOM 11657 H HD21 . ASN A 1 17 ? 6.160   4.283   0.468   1.00 0.00 ? 20 ASN A HD21 20 
ATOM 11658 H HD22 . ASN A 1 17 ? 7.192   3.738   1.740   1.00 0.00 ? 20 ASN A HD22 20 
ATOM 11659 N N    . ILE A 1 18 ? 1.375   2.709   1.080   1.00 0.00 ? 21 ILE A N    20 
ATOM 11660 C CA   . ILE A 1 18 ? 0.389   1.686   1.426   1.00 0.00 ? 21 ILE A CA   20 
ATOM 11661 C C    . ILE A 1 18 ? 0.367   0.616   0.345   1.00 0.00 ? 21 ILE A C    20 
ATOM 11662 O O    . ILE A 1 18 ? 0.621   -0.556  0.621   1.00 0.00 ? 21 ILE A O    20 
ATOM 11663 C CB   . ILE A 1 18 ? -1.027  2.288   1.608   1.00 0.00 ? 21 ILE A CB   20 
ATOM 11664 C CG1  . ILE A 1 18 ? -1.104  3.076   2.920   1.00 0.00 ? 21 ILE A CG1  20 
ATOM 11665 C CG2  . ILE A 1 18 ? -2.092  1.199   1.586   1.00 0.00 ? 21 ILE A CG2  20 
ATOM 11666 C CD1  . ILE A 1 18 ? -0.687  2.276   4.137   1.00 0.00 ? 21 ILE A CD1  20 
ATOM 11667 H H    . ILE A 1 18 ? 1.097   3.657   1.035   1.00 0.00 ? 21 ILE A H    20 
ATOM 11668 H HA   . ILE A 1 18 ? 0.689   1.223   2.356   1.00 0.00 ? 21 ILE A HA   20 
ATOM 11669 H HB   . ILE A 1 18 ? -1.215  2.960   0.783   1.00 0.00 ? 21 ILE A HB   20 
ATOM 11670 H HG12 . ILE A 1 18 ? -0.457  3.938   2.853   1.00 0.00 ? 21 ILE A HG12 20 
ATOM 11671 H HG13 . ILE A 1 18 ? -2.120  3.407   3.071   1.00 0.00 ? 21 ILE A HG13 20 
ATOM 11672 H HG21 . ILE A 1 18 ? -1.820  0.417   2.281   1.00 0.00 ? 21 ILE A HG21 20 
ATOM 11673 H HG22 . ILE A 1 18 ? -2.165  0.785   0.591   1.00 0.00 ? 21 ILE A HG22 20 
ATOM 11674 H HG23 . ILE A 1 18 ? -3.043  1.620   1.872   1.00 0.00 ? 21 ILE A HG23 20 
ATOM 11675 H HD11 . ILE A 1 18 ? 0.363   2.438   4.331   1.00 0.00 ? 21 ILE A HD11 20 
ATOM 11676 H HD12 . ILE A 1 18 ? -0.862  1.226   3.954   1.00 0.00 ? 21 ILE A HD12 20 
ATOM 11677 H HD13 . ILE A 1 18 ? -1.265  2.594   4.991   1.00 0.00 ? 21 ILE A HD13 20 
ATOM 11678 N N    . ALA A 1 19 ? 0.109   1.030   -0.896  1.00 0.00 ? 22 ALA A N    20 
ATOM 11679 C CA   . ALA A 1 19 ? 0.108   0.096   -2.020  1.00 0.00 ? 22 ALA A CA   20 
ATOM 11680 C C    . ALA A 1 19 ? 1.439   -0.662  -2.078  1.00 0.00 ? 22 ALA A C    20 
ATOM 11681 O O    . ALA A 1 19 ? 1.479   -1.855  -2.398  1.00 0.00 ? 22 ALA A O    20 
ATOM 11682 C CB   . ALA A 1 19 ? -0.148  0.839   -3.325  1.00 0.00 ? 22 ALA A CB   20 
ATOM 11683 H H    . ALA A 1 19 ? -0.055  1.992   -1.062  1.00 0.00 ? 22 ALA A H    20 
ATOM 11684 H HA   . ALA A 1 19 ? -0.692  -0.614  -1.867  1.00 0.00 ? 22 ALA A HA   20 
ATOM 11685 H HB1  . ALA A 1 19 ? 0.675   1.509   -3.527  1.00 0.00 ? 22 ALA A HB1  20 
ATOM 11686 H HB2  . ALA A 1 19 ? -1.062  1.410   -3.242  1.00 0.00 ? 22 ALA A HB2  20 
ATOM 11687 H HB3  . ALA A 1 19 ? -0.240  0.128   -4.133  1.00 0.00 ? 22 ALA A HB3  20 
ATOM 11688 N N    . LYS A 1 20 ? 2.528   0.041   -1.752  1.00 0.00 ? 23 LYS A N    20 
ATOM 11689 C CA   . LYS A 1 20 ? 3.863   -0.552  -1.751  1.00 0.00 ? 23 LYS A CA   20 
ATOM 11690 C C    . LYS A 1 20 ? 3.984   -1.666  -0.715  1.00 0.00 ? 23 LYS A C    20 
ATOM 11691 O O    . LYS A 1 20 ? 4.559   -2.716  -1.003  1.00 0.00 ? 23 LYS A O    20 
ATOM 11692 C CB   . LYS A 1 20 ? 4.928   0.520   -1.481  1.00 0.00 ? 23 LYS A CB   20 
ATOM 11693 C CG   . LYS A 1 20 ? 6.045   0.565   -2.514  1.00 0.00 ? 23 LYS A CG   20 
ATOM 11694 C CD   . LYS A 1 20 ? 6.560   -0.827  -2.866  1.00 0.00 ? 23 LYS A CD   20 
ATOM 11695 C CE   . LYS A 1 20 ? 7.622   -1.305  -1.883  1.00 0.00 ? 23 LYS A CE   20 
ATOM 11696 N NZ   . LYS A 1 20 ? 7.068   -2.258  -0.872  1.00 0.00 ? 23 LYS A NZ   20 
ATOM 11697 H H    . LYS A 1 20 ? 2.428   0.984   -1.500  1.00 0.00 ? 23 LYS A H    20 
ATOM 11698 H HA   . LYS A 1 20 ? 4.030   -0.976  -2.726  1.00 0.00 ? 23 LYS A HA   20 
ATOM 11699 H HB2  . LYS A 1 20 ? 4.448   1.487   -1.463  1.00 0.00 ? 23 LYS A HB2  20 
ATOM 11700 H HB3  . LYS A 1 20 ? 5.371   0.335   -0.513  1.00 0.00 ? 23 LYS A HB3  20 
ATOM 11701 H HG2  . LYS A 1 20 ? 5.666   1.034   -3.410  1.00 0.00 ? 23 LYS A HG2  20 
ATOM 11702 H HG3  . LYS A 1 20 ? 6.860   1.153   -2.119  1.00 0.00 ? 23 LYS A HG3  20 
ATOM 11703 H HD2  . LYS A 1 20 ? 5.738   -1.522  -2.855  1.00 0.00 ? 23 LYS A HD2  20 
ATOM 11704 H HD3  . LYS A 1 20 ? 6.992   -0.797  -3.857  1.00 0.00 ? 23 LYS A HD3  20 
ATOM 11705 H HE2  . LYS A 1 20 ? 8.408   -1.798  -2.438  1.00 0.00 ? 23 LYS A HE2  20 
ATOM 11706 H HE3  . LYS A 1 20 ? 8.031   -0.445  -1.370  1.00 0.00 ? 23 LYS A HE3  20 
ATOM 11707 H HZ1  . LYS A 1 20 ? 7.014   -1.799  0.059   1.00 0.00 ? 23 LYS A HZ1  20 
ATOM 11708 H HZ2  . LYS A 1 20 ? 7.680   -3.098  -0.796  1.00 0.00 ? 23 LYS A HZ2  20 
ATOM 11709 H HZ3  . LYS A 1 20 ? 6.105   -2.569  -1.147  1.00 0.00 ? 23 LYS A HZ3  20 
ATOM 11710 N N    . ALA A 1 21 ? 3.462   -1.428  0.486   1.00 0.00 ? 24 ALA A N    20 
ATOM 11711 C CA   . ALA A 1 21 ? 3.522   -2.416  1.561   1.00 0.00 ? 24 ALA A CA   20 
ATOM 11712 C C    . ALA A 1 21 ? 2.379   -3.424  1.447   1.00 0.00 ? 24 ALA A C    20 
ATOM 11713 O O    . ALA A 1 21 ? 2.567   -4.613  1.701   1.00 0.00 ? 24 ALA A O    20 
ATOM 11714 C CB   . ALA A 1 21 ? 3.488   -1.719  2.915   1.00 0.00 ? 24 ALA A CB   20 
ATOM 11715 H H    . ALA A 1 21 ? 3.031   -0.561  0.657   1.00 0.00 ? 24 ALA A H    20 
ATOM 11716 H HA   . ALA A 1 21 ? 4.461   -2.948  1.479   1.00 0.00 ? 24 ALA A HA   20 
ATOM 11717 H HB1  . ALA A 1 21 ? 3.592   -2.452  3.702   1.00 0.00 ? 24 ALA A HB1  20 
ATOM 11718 H HB2  . ALA A 1 21 ? 2.549   -1.199  3.030   1.00 0.00 ? 24 ALA A HB2  20 
ATOM 11719 H HB3  . ALA A 1 21 ? 4.301   -1.009  2.975   1.00 0.00 ? 24 ALA A HB3  20 
ATOM 11720 N N    . LYS A 1 22 ? 1.200   -2.946  1.045   1.00 0.00 ? 25 LYS A N    20 
ATOM 11721 C CA   . LYS A 1 22 ? 0.038   -3.807  0.882   1.00 0.00 ? 25 LYS A CA   20 
ATOM 11722 C C    . LYS A 1 22 ? 0.350   -4.918  -0.111  1.00 0.00 ? 25 LYS A C    20 
ATOM 11723 O O    . LYS A 1 22 ? 0.053   -6.087  0.142   1.00 0.00 ? 25 LYS A O    20 
ATOM 11724 C CB   . LYS A 1 22 ? -1.174  -2.986  0.423   1.00 0.00 ? 25 LYS A CB   20 
ATOM 11725 C CG   . LYS A 1 22 ? -2.411  -3.209  1.276   1.00 0.00 ? 25 LYS A CG   20 
ATOM 11726 C CD   . LYS A 1 22 ? -3.559  -3.788  0.460   1.00 0.00 ? 25 LYS A CD   20 
ATOM 11727 C CE   . LYS A 1 22 ? -4.816  -3.961  1.300   1.00 0.00 ? 25 LYS A CE   20 
ATOM 11728 N NZ   . LYS A 1 22 ? -5.582  -2.684  1.433   1.00 0.00 ? 25 LYS A NZ   20 
ATOM 11729 H H    . LYS A 1 22 ? 1.112   -1.988  0.837   1.00 0.00 ? 25 LYS A H    20 
ATOM 11730 H HA   . LYS A 1 22 ? -0.181  -4.253  1.842   1.00 0.00 ? 25 LYS A HA   20 
ATOM 11731 H HB2  . LYS A 1 22 ? -0.920  -1.935  0.468   1.00 0.00 ? 25 LYS A HB2  20 
ATOM 11732 H HB3  . LYS A 1 22 ? -1.410  -3.248  -0.597  1.00 0.00 ? 25 LYS A HB3  20 
ATOM 11733 H HG2  . LYS A 1 22 ? -2.165  -3.895  2.072   1.00 0.00 ? 25 LYS A HG2  20 
ATOM 11734 H HG3  . LYS A 1 22 ? -2.719  -2.263  1.698   1.00 0.00 ? 25 LYS A HG3  20 
ATOM 11735 H HD2  . LYS A 1 22 ? -3.776  -3.121  -0.361  1.00 0.00 ? 25 LYS A HD2  20 
ATOM 11736 H HD3  . LYS A 1 22 ? -3.261  -4.752  0.073   1.00 0.00 ? 25 LYS A HD3  20 
ATOM 11737 H HE2  . LYS A 1 22 ? -5.447  -4.703  0.830   1.00 0.00 ? 25 LYS A HE2  20 
ATOM 11738 H HE3  . LYS A 1 22 ? -4.530  -4.306  2.284   1.00 0.00 ? 25 LYS A HE3  20 
ATOM 11739 H HZ1  . LYS A 1 22 ? -5.004  -1.881  1.104   1.00 0.00 ? 25 LYS A HZ1  20 
ATOM 11740 H HZ2  . LYS A 1 22 ? -5.842  -2.522  2.429   1.00 0.00 ? 25 LYS A HZ2  20 
ATOM 11741 H HZ3  . LYS A 1 22 ? -6.452  -2.724  0.865   1.00 0.00 ? 25 LYS A HZ3  20 
ATOM 11742 N N    . ASN A 1 23 ? 0.989   -4.556  -1.224  1.00 0.00 ? 26 ASN A N    20 
ATOM 11743 C CA   . ASN A 1 23 ? 1.370   -5.549  -2.227  1.00 0.00 ? 26 ASN A CA   20 
ATOM 11744 C C    . ASN A 1 23 ? 2.594   -6.333  -1.739  1.00 0.00 ? 26 ASN A C    20 
ATOM 11745 O O    . ASN A 1 23 ? 2.662   -7.553  -1.879  1.00 0.00 ? 26 ASN A O    20 
ATOM 11746 C CB   . ASN A 1 23 ? 1.632   -4.884  -3.590  1.00 0.00 ? 26 ASN A CB   20 
ATOM 11747 C CG   . ASN A 1 23 ? 3.088   -4.534  -3.821  1.00 0.00 ? 26 ASN A CG   20 
ATOM 11748 O OD1  . ASN A 1 23 ? 3.888   -5.380  -4.210  1.00 0.00 ? 26 ASN A OD1  20 
ATOM 11749 N ND2  . ASN A 1 23 ? 3.439   -3.284  -3.582  1.00 0.00 ? 26 ASN A ND2  20 
ATOM 11750 H H    . ASN A 1 23 ? 1.233   -3.604  -1.358  1.00 0.00 ? 26 ASN A H    20 
ATOM 11751 H HA   . ASN A 1 23 ? 0.545   -6.239  -2.327  1.00 0.00 ? 26 ASN A HA   20 
ATOM 11752 H HB2  . ASN A 1 23 ? 1.320   -5.556  -4.374  1.00 0.00 ? 26 ASN A HB2  20 
ATOM 11753 H HB3  . ASN A 1 23 ? 1.050   -3.975  -3.653  1.00 0.00 ? 26 ASN A HB3  20 
ATOM 11754 H HD21 . ASN A 1 23 ? 2.748   -2.659  -3.271  1.00 0.00 ? 26 ASN A HD21 20 
ATOM 11755 H HD22 . ASN A 1 23 ? 4.374   -3.035  -3.725  1.00 0.00 ? 26 ASN A HD22 20 
ATOM 11756 N N    . LEU A 1 24 ? 3.543   -5.618  -1.132  1.00 0.00 ? 27 LEU A N    20 
ATOM 11757 C CA   . LEU A 1 24 ? 4.754   -6.232  -0.590  1.00 0.00 ? 27 LEU A CA   20 
ATOM 11758 C C    . LEU A 1 24 ? 4.433   -7.245  0.517   1.00 0.00 ? 27 LEU A C    20 
ATOM 11759 O O    . LEU A 1 24 ? 5.262   -8.081  0.866   1.00 0.00 ? 27 LEU A O    20 
ATOM 11760 C CB   . LEU A 1 24 ? 5.705   -5.133  -0.093  1.00 0.00 ? 27 LEU A CB   20 
ATOM 11761 C CG   . LEU A 1 24 ? 6.603   -5.512  1.077   1.00 0.00 ? 27 LEU A CG   20 
ATOM 11762 C CD1  . LEU A 1 24 ? 7.855   -6.219  0.585   1.00 0.00 ? 27 LEU A CD1  20 
ATOM 11763 C CD2  . LEU A 1 24 ? 6.967   -4.283  1.893   1.00 0.00 ? 27 LEU A CD2  20 
ATOM 11764 H H    . LEU A 1 24 ? 3.416   -4.652  -1.031  1.00 0.00 ? 27 LEU A H    20 
ATOM 11765 H HA   . LEU A 1 24 ? 5.226   -6.765  -1.384  1.00 0.00 ? 27 LEU A HA   20 
ATOM 11766 H HB2  . LEU A 1 24 ? 6.332   -4.834  -0.919  1.00 0.00 ? 27 LEU A HB2  20 
ATOM 11767 H HB3  . LEU A 1 24 ? 5.108   -4.288  0.205   1.00 0.00 ? 27 LEU A HB3  20 
ATOM 11768 H HG   . LEU A 1 24 ? 6.064   -6.189  1.713   1.00 0.00 ? 27 LEU A HG   20 
ATOM 11769 H HD11 . LEU A 1 24 ? 7.644   -7.270  0.452   1.00 0.00 ? 27 LEU A HD11 20 
ATOM 11770 H HD12 . LEU A 1 24 ? 8.644   -6.100  1.314   1.00 0.00 ? 27 LEU A HD12 20 
ATOM 11771 H HD13 . LEU A 1 24 ? 8.166   -5.792  -0.356  1.00 0.00 ? 27 LEU A HD13 20 
ATOM 11772 H HD21 . LEU A 1 24 ? 6.355   -3.450  1.586   1.00 0.00 ? 27 LEU A HD21 20 
ATOM 11773 H HD22 . LEU A 1 24 ? 8.009   -4.042  1.735   1.00 0.00 ? 27 LEU A HD22 20 
ATOM 11774 H HD23 . LEU A 1 24 ? 6.799   -4.486  2.940   1.00 0.00 ? 27 LEU A HD23 20 
ATOM 11775 N N    . ARG A 1 25 ? 3.224   -7.177  1.052   1.00 0.00 ? 28 ARG A N    20 
ATOM 11776 C CA   . ARG A 1 25 ? 2.796   -8.100  2.096   1.00 0.00 ? 28 ARG A CA   20 
ATOM 11777 C C    . ARG A 1 25 ? 1.792   -9.113  1.544   1.00 0.00 ? 28 ARG A C    20 
ATOM 11778 O O    . ARG A 1 25 ? 1.915   -10.315 1.786   1.00 0.00 ? 28 ARG A O    20 
ATOM 11779 C CB   . ARG A 1 25 ? 2.187   -7.330  3.270   1.00 0.00 ? 28 ARG A CB   20 
ATOM 11780 C CG   . ARG A 1 25 ? 3.160   -7.097  4.417   1.00 0.00 ? 28 ARG A CG   20 
ATOM 11781 C CD   . ARG A 1 25 ? 2.587   -7.576  5.741   1.00 0.00 ? 28 ARG A CD   20 
ATOM 11782 N NE   . ARG A 1 25 ? 3.631   -7.764  6.751   1.00 0.00 ? 28 ARG A NE   20 
ATOM 11783 C CZ   . ARG A 1 25 ? 3.419   -8.264  7.963   1.00 0.00 ? 28 ARG A CZ   20 
ATOM 11784 N NH1  . ARG A 1 25 ? 2.207   -8.631  8.333   1.00 0.00 ? 28 ARG A NH1  20 
ATOM 11785 N NH2  . ARG A 1 25 ? 4.424   -8.395  8.807   1.00 0.00 ? 28 ARG A NH2  20 
ATOM 11786 H H    . ARG A 1 25 ? 2.603   -6.496  0.732   1.00 0.00 ? 28 ARG A H    20 
ATOM 11787 H HA   . ARG A 1 25 ? 3.669   -8.637  2.438   1.00 0.00 ? 28 ARG A HA   20 
ATOM 11788 H HB2  . ARG A 1 25 ? 1.847   -6.368  2.915   1.00 0.00 ? 28 ARG A HB2  20 
ATOM 11789 H HB3  . ARG A 1 25 ? 1.340   -7.883  3.648   1.00 0.00 ? 28 ARG A HB3  20 
ATOM 11790 H HG2  . ARG A 1 25 ? 4.074   -7.636  4.216   1.00 0.00 ? 28 ARG A HG2  20 
ATOM 11791 H HG3  . ARG A 1 25 ? 3.372   -6.039  4.487   1.00 0.00 ? 28 ARG A HG3  20 
ATOM 11792 H HD2  . ARG A 1 25 ? 1.878   -6.839  6.097   1.00 0.00 ? 28 ARG A HD2  20 
ATOM 11793 H HD3  . ARG A 1 25 ? 2.078   -8.517  5.578   1.00 0.00 ? 28 ARG A HD3  20 
ATOM 11794 H HE   . ARG A 1 25 ? 4.543   -7.500  6.511   1.00 0.00 ? 28 ARG A HE   20 
ATOM 11795 H HH11 . ARG A 1 25 ? 1.442   -8.533  7.701   1.00 0.00 ? 28 ARG A HH11 20 
ATOM 11796 H HH12 . ARG A 1 25 ? 2.054   -9.006  9.244   1.00 0.00 ? 28 ARG A HH12 20 
ATOM 11797 H HH21 . ARG A 1 25 ? 5.344   -8.119  8.533   1.00 0.00 ? 28 ARG A HH21 20 
ATOM 11798 H HH22 . ARG A 1 25 ? 4.267   -8.770  9.719   1.00 0.00 ? 28 ARG A HH22 20 
ATOM 11799 N N    . ALA A 1 26 ? 0.806   -8.625  0.793   1.00 0.00 ? 29 ALA A N    20 
ATOM 11800 C CA   . ALA A 1 26 ? -0.210  -9.490  0.206   1.00 0.00 ? 29 ALA A CA   20 
ATOM 11801 C C    . ALA A 1 26 ? 0.331   -10.272 -0.995  1.00 0.00 ? 29 ALA A C    20 
ATOM 11802 O O    . ALA A 1 26 ? -0.180  -11.344 -1.316  1.00 0.00 ? 29 ALA A O    20 
ATOM 11803 C CB   . ALA A 1 26 ? -1.428  -8.670  -0.197  1.00 0.00 ? 29 ALA A CB   20 
ATOM 11804 H H    . ALA A 1 26 ? 0.764   -7.658  0.624   1.00 0.00 ? 29 ALA A H    20 
ATOM 11805 H HA   . ALA A 1 26 ? -0.520  -10.196 0.963   1.00 0.00 ? 29 ALA A HA   20 
ATOM 11806 H HB1  . ALA A 1 26 ? -1.139  -7.931  -0.928  1.00 0.00 ? 29 ALA A HB1  20 
ATOM 11807 H HB2  . ALA A 1 26 ? -1.833  -8.176  0.674   1.00 0.00 ? 29 ALA A HB2  20 
ATOM 11808 H HB3  . ALA A 1 26 ? -2.178  -9.323  -0.621  1.00 0.00 ? 29 ALA A HB3  20 
ATOM 11809 N N    . GLN A 1 27 ? 1.352   -9.733  -1.669  1.00 0.00 ? 30 GLN A N    20 
ATOM 11810 C CA   . GLN A 1 27 ? 1.917   -10.405 -2.834  1.00 0.00 ? 30 GLN A CA   20 
ATOM 11811 C C    . GLN A 1 27 ? 3.342   -10.906 -2.599  1.00 0.00 ? 30 GLN A C    20 
ATOM 11812 O O    . GLN A 1 27 ? 3.790   -11.839 -3.263  1.00 0.00 ? 30 GLN A O    20 
ATOM 11813 C CB   . GLN A 1 27 ? 1.847   -9.474  -4.055  1.00 0.00 ? 30 GLN A CB   20 
ATOM 11814 C CG   . GLN A 1 27 ? 2.970   -9.663  -5.066  1.00 0.00 ? 30 GLN A CG   20 
ATOM 11815 C CD   . GLN A 1 27 ? 2.682   -10.768 -6.064  1.00 0.00 ? 30 GLN A CD   20 
ATOM 11816 O OE1  . GLN A 1 27 ? 2.095   -10.533 -7.116  1.00 0.00 ? 30 GLN A OE1  20 
ATOM 11817 N NE2  . GLN A 1 27 ? 3.090   -11.983 -5.739  1.00 0.00 ? 30 GLN A NE2  20 
ATOM 11818 H H    . GLN A 1 27 ? 1.725   -8.862  -1.389  1.00 0.00 ? 30 GLN A H    20 
ATOM 11819 H HA   . GLN A 1 27 ? 1.309   -11.260 -3.019  1.00 0.00 ? 30 GLN A HA   20 
ATOM 11820 H HB2  . GLN A 1 27 ? 0.909   -9.642  -4.563  1.00 0.00 ? 30 GLN A HB2  20 
ATOM 11821 H HB3  . GLN A 1 27 ? 1.875   -8.451  -3.710  1.00 0.00 ? 30 GLN A HB3  20 
ATOM 11822 H HG2  . GLN A 1 27 ? 3.105   -8.741  -5.603  1.00 0.00 ? 30 GLN A HG2  20 
ATOM 11823 H HG3  . GLN A 1 27 ? 3.881   -9.904  -4.540  1.00 0.00 ? 30 GLN A HG3  20 
ATOM 11824 H HE21 . GLN A 1 27 ? 3.551   -12.104 -4.877  1.00 0.00 ? 30 GLN A HE21 20 
ATOM 11825 H HE22 . GLN A 1 27 ? 2.915   -12.712 -6.367  1.00 0.00 ? 30 GLN A HE22 20 
ATOM 11826 N N    . ALA A 1 28 ? 4.049   -10.307 -1.663  1.00 0.00 ? 31 ALA A N    20 
ATOM 11827 C CA   . ALA A 1 28 ? 5.415   -10.734 -1.372  1.00 0.00 ? 31 ALA A CA   20 
ATOM 11828 C C    . ALA A 1 28 ? 5.459   -11.694 -0.185  1.00 0.00 ? 31 ALA A C    20 
ATOM 11829 O O    . ALA A 1 28 ? 6.333   -12.558 -0.112  1.00 0.00 ? 31 ALA A O    20 
ATOM 11830 C CB   . ALA A 1 28 ? 6.322   -9.534  -1.144  1.00 0.00 ? 31 ALA A CB   20 
ATOM 11831 H H    . ALA A 1 28 ? 3.647   -9.576  -1.158  1.00 0.00 ? 31 ALA A H    20 
ATOM 11832 H HA   . ALA A 1 28 ? 5.776   -11.262 -2.241  1.00 0.00 ? 31 ALA A HA   20 
ATOM 11833 H HB1  . ALA A 1 28 ? 7.201   -9.623  -1.766  1.00 0.00 ? 31 ALA A HB1  20 
ATOM 11834 H HB2  . ALA A 1 28 ? 6.618   -9.495  -0.106  1.00 0.00 ? 31 ALA A HB2  20 
ATOM 11835 H HB3  . ALA A 1 28 ? 5.792   -8.629  -1.400  1.00 0.00 ? 31 ALA A HB3  20 
ATOM 11836 N N    . ALA A 1 29 ? 4.507   -11.551 0.734   1.00 0.00 ? 32 ALA A N    20 
ATOM 11837 C CA   . ALA A 1 29 ? 4.438   -12.418 1.905   1.00 0.00 ? 32 ALA A CA   20 
ATOM 11838 C C    . ALA A 1 29 ? 3.288   -13.428 1.802   1.00 0.00 ? 32 ALA A C    20 
ATOM 11839 O O    . ALA A 1 29 ? 3.347   -14.500 2.407   1.00 0.00 ? 32 ALA A O    20 
ATOM 11840 C CB   . ALA A 1 29 ? 4.301   -11.578 3.168   1.00 0.00 ? 32 ALA A CB   20 
ATOM 11841 H H    . ALA A 1 29 ? 3.832   -10.850 0.621   1.00 0.00 ? 32 ALA A H    20 
ATOM 11842 H HA   . ALA A 1 29 ? 5.368   -12.964 1.968   1.00 0.00 ? 32 ALA A HA   20 
ATOM 11843 H HB1  . ALA A 1 29 ? 4.902   -10.685 3.073   1.00 0.00 ? 32 ALA A HB1  20 
ATOM 11844 H HB2  . ALA A 1 29 ? 4.641   -12.150 4.019   1.00 0.00 ? 32 ALA A HB2  20 
ATOM 11845 H HB3  . ALA A 1 29 ? 3.267   -11.303 3.309   1.00 0.00 ? 32 ALA A HB3  20 
ATOM 11846 N N    . ALA A 1 30 ? 2.234   -13.086 1.047   1.00 0.00 ? 33 ALA A N    20 
ATOM 11847 C CA   . ALA A 1 30 ? 1.084   -13.981 0.905   1.00 0.00 ? 33 ALA A CA   20 
ATOM 11848 C C    . ALA A 1 30 ? 1.148   -14.861 -0.349  1.00 0.00 ? 33 ALA A C    20 
ATOM 11849 O O    . ALA A 1 30 ? 0.312   -15.750 -0.523  1.00 0.00 ? 33 ALA A O    20 
ATOM 11850 C CB   . ALA A 1 30 ? -0.210  -13.178 0.930   1.00 0.00 ? 33 ALA A CB   20 
ATOM 11851 H H    . ALA A 1 30 ? 2.225   -12.216 0.590   1.00 0.00 ? 33 ALA A H    20 
ATOM 11852 H HA   . ALA A 1 30 ? 1.081   -14.630 1.761   1.00 0.00 ? 33 ALA A HA   20 
ATOM 11853 H HB1  . ALA A 1 30 ? -0.901  -13.632 1.625   1.00 0.00 ? 33 ALA A HB1  20 
ATOM 11854 H HB2  . ALA A 1 30 ? -0.648  -13.167 -0.057  1.00 0.00 ? 33 ALA A HB2  20 
ATOM 11855 H HB3  . ALA A 1 30 ? 0.001   -12.166 1.242   1.00 0.00 ? 33 ALA A HB3  20 
ATOM 11856 N N    . ASN A 1 31 ? 2.129   -14.632 -1.217  1.00 0.00 ? 34 ASN A N    20 
ATOM 11857 C CA   . ASN A 1 31 ? 2.261   -15.433 -2.440  1.00 0.00 ? 34 ASN A CA   20 
ATOM 11858 C C    . ASN A 1 31 ? 2.816   -16.832 -2.143  1.00 0.00 ? 34 ASN A C    20 
ATOM 11859 O O    . ASN A 1 31 ? 2.378   -17.817 -2.736  1.00 0.00 ? 34 ASN A O    20 
ATOM 11860 C CB   . ASN A 1 31 ? 3.138   -14.714 -3.477  1.00 0.00 ? 34 ASN A CB   20 
ATOM 11861 C CG   . ASN A 1 31 ? 4.627   -14.943 -3.275  1.00 0.00 ? 34 ASN A CG   20 
ATOM 11862 O OD1  . ASN A 1 31 ? 5.235   -15.761 -3.955  1.00 0.00 ? 34 ASN A OD1  20 
ATOM 11863 N ND2  . ASN A 1 31 ? 5.220   -14.224 -2.337  1.00 0.00 ? 34 ASN A ND2  20 
ATOM 11864 H H    . ASN A 1 31 ? 2.771   -13.917 -1.033  1.00 0.00 ? 34 ASN A H    20 
ATOM 11865 H HA   . ASN A 1 31 ? 1.270   -15.550 -2.854  1.00 0.00 ? 34 ASN A HA   20 
ATOM 11866 H HB2  . ASN A 1 31 ? 2.877   -15.068 -4.462  1.00 0.00 ? 34 ASN A HB2  20 
ATOM 11867 H HB3  . ASN A 1 31 ? 2.945   -13.656 -3.423  1.00 0.00 ? 34 ASN A HB3  20 
ATOM 11868 H HD21 . ASN A 1 31 ? 4.679   -13.593 -1.827  1.00 0.00 ? 34 ASN A HD21 20 
ATOM 11869 H HD22 . ASN A 1 31 ? 6.179   -14.352 -2.196  1.00 0.00 ? 34 ASN A HD22 20 
ATOM 11870 N N    . ALA A 1 32 ? 3.783   -16.913 -1.228  1.00 0.00 ? 35 ALA A N    20 
ATOM 11871 C CA   . ALA A 1 32 ? 4.390   -18.194 -0.870  1.00 0.00 ? 35 ALA A CA   20 
ATOM 11872 C C    . ALA A 1 32 ? 3.549   -18.978 0.144   1.00 0.00 ? 35 ALA A C    20 
ATOM 11873 O O    . ALA A 1 32 ? 3.741   -20.186 0.320   1.00 0.00 ? 35 ALA A O    20 
ATOM 11874 C CB   . ALA A 1 32 ? 5.800   -17.974 -0.341  1.00 0.00 ? 35 ALA A CB   20 
ATOM 11875 H H    . ALA A 1 32 ? 4.097   -16.096 -0.789  1.00 0.00 ? 35 ALA A H    20 
ATOM 11876 H HA   . ALA A 1 32 ? 4.458   -18.771 -1.768  1.00 0.00 ? 35 ALA A HA   20 
ATOM 11877 H HB1  . ALA A 1 32 ? 6.216   -18.918 -0.021  1.00 0.00 ? 35 ALA A HB1  20 
ATOM 11878 H HB2  . ALA A 1 32 ? 5.770   -17.291 0.497   1.00 0.00 ? 35 ALA A HB2  20 
ATOM 11879 H HB3  . ALA A 1 32 ? 6.417   -17.556 -1.123  1.00 0.00 ? 35 ALA A HB3  20 
ATOM 11880 N N    . HIS A 1 33 ? 2.623   -18.285 0.801   1.00 0.00 ? 36 HIS A N    20 
ATOM 11881 C CA   . HIS A 1 33 ? 1.747   -18.897 1.808   1.00 0.00 ? 36 HIS A CA   20 
ATOM 11882 C C    . HIS A 1 33 ? 1.095   -20.193 1.301   1.00 0.00 ? 36 HIS A C    20 
ATOM 11883 O O    . HIS A 1 33 ? 0.992   -21.169 2.043   1.00 0.00 ? 36 HIS A O    20 
ATOM 11884 C CB   . HIS A 1 33 ? 0.679   -17.886 2.271   1.00 0.00 ? 36 HIS A CB   20 
ATOM 11885 C CG   . HIS A 1 33 ? -0.676  -18.075 1.655   1.00 0.00 ? 36 HIS A CG   20 
ATOM 11886 N ND1  . HIS A 1 33 ? -1.092  -17.399 0.530   1.00 0.00 ? 36 HIS A ND1  20 
ATOM 11887 C CD2  . HIS A 1 33 ? -1.713  -18.867 2.021   1.00 0.00 ? 36 HIS A CD2  20 
ATOM 11888 C CE1  . HIS A 1 33 ? -2.327  -17.764 0.228   1.00 0.00 ? 36 HIS A CE1  20 
ATOM 11889 N NE2  . HIS A 1 33 ? -2.728  -18.655 1.118   1.00 0.00 ? 36 HIS A NE2  20 
ATOM 11890 H H    . HIS A 1 33 ? 2.530   -17.333 0.605   1.00 0.00 ? 36 HIS A H    20 
ATOM 11891 H HA   . HIS A 1 33 ? 2.365   -19.149 2.657   1.00 0.00 ? 36 HIS A HA   20 
ATOM 11892 H HB2  . HIS A 1 33 ? 0.563   -17.968 3.341   1.00 0.00 ? 36 HIS A HB2  20 
ATOM 11893 H HB3  . HIS A 1 33 ? 1.015   -16.888 2.031   1.00 0.00 ? 36 HIS A HB3  20 
ATOM 11894 H HD1  . HIS A 1 33 ? -0.554  -16.731 0.022   1.00 0.00 ? 36 HIS A HD1  20 
ATOM 11895 H HD2  . HIS A 1 33 ? -1.736  -19.542 2.865   1.00 0.00 ? 36 HIS A HD2  20 
ATOM 11896 H HE1  . HIS A 1 33 ? -2.909  -17.397 -0.606  1.00 0.00 ? 36 HIS A HE1  20 
ATOM 11897 H HE2  . HIS A 1 33 ? -3.652  -18.968 1.221   1.00 0.00 ? 36 HIS A HE2  20 
ATOM 11898 N N    . LEU A 1 34 ? 0.658   -20.198 0.040   1.00 0.00 ? 37 LEU A N    20 
ATOM 11899 C CA   . LEU A 1 34 ? 0.022   -21.382 -0.544  1.00 0.00 ? 37 LEU A CA   20 
ATOM 11900 C C    . LEU A 1 34 ? 0.989   -22.182 -1.433  1.00 0.00 ? 37 LEU A C    20 
ATOM 11901 O O    . LEU A 1 34 ? 0.572   -23.110 -2.130  1.00 0.00 ? 37 LEU A O    20 
ATOM 11902 C CB   . LEU A 1 34 ? -1.218  -20.975 -1.347  1.00 0.00 ? 37 LEU A CB   20 
ATOM 11903 C CG   . LEU A 1 34 ? -2.542  -21.528 -0.817  1.00 0.00 ? 37 LEU A CG   20 
ATOM 11904 C CD1  . LEU A 1 34 ? -3.709  -20.992 -1.630  1.00 0.00 ? 37 LEU A CD1  20 
ATOM 11905 C CD2  . LEU A 1 34 ?