data_2UX2
# 
_entry.id   2UX2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2UX2         
PDBE  EBI-32055    
WWPDB D_1290032055 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1CDQ unspecified 'CD59 (NMR, 20 STRUCTURES)'                                                                
PDB 1CDR unspecified 'CD59 COMPLEXED WITH GLCNAC-BETA-1,4-GLCNAC -BETA-1 (NMR, 10 STRUCTURES)'                  
PDB 1CDS unspecified 'CD59 COMPLEXED WITH GLCNAC-BETA-1,4-(FUC- ALPHA-1,6)- GLCNAC-BETA-1 (NMR, 10 STRUCTURES)' 
PDB 1ERG unspecified .                                                                                          
PDB 1ERH unspecified .                                                                                          
PDB 2J8B unspecified 'HIGH RESOLUTION STRUCTURE OF HUMAN CD59'                                                  
PDB 2UWR unspecified 'HIGH RESOLUTION STRUCTURE OF HUMAN CD59'                                                  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2UX2 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Leath, K.J.'   1 
'Johnson, S.'   2 
'Roversi, P.'   3 
'Morgan, B.P.'  4 
'Smith, R.A.G.' 5 
'Lea, S.M.'     6 
# 
_citation.id                        primary 
_citation.title                     'High-Resolution Structures of Bacterially Expressed Soluble Human Cd59.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            63 
_citation.page_first                648 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17671359 
_citation.pdbx_database_id_DOI      10.1107/S1744309107033477 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Leath, K.J.'   1 
primary 'Johnson, S.'   2 
primary 'Roversi, P.'   3 
primary 'Hughes, T.R.'  4 
primary 'Smith, R.A.G.' 5 
primary 'Mackenzie, L.' 6 
primary 'Morgan, B.P.'  7 
primary 'Lea, S.M.'     8 
# 
_cell.entry_id           2UX2 
_cell.length_a           60.840 
_cell.length_b           60.840 
_cell.length_c           107.530 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2UX2 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CD59 GLYCOPROTEIN' 9101.303 3   ? ? 'RESIDUES 26-102' ? 
2 water   nat water               18.015   212 ? ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;MEMBRANE ATTACK COMPLEX INHIBITION FACTOR, MACIF, MAC-INHIBITORY PROTEIN, MAC-IP, PROTECTIN, MEM43 ANTIGEN, MEMBRANE INHIBITOR OF REACTIVE LYSIS, MIRL, 20 KDA HOMOLOGOUS RESTRICTION FACTOR, HRF-20,HRF20,1F5 ANTIGEN
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN 
_entity_poly.pdbx_seq_one_letter_code_can   MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN 
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LEU n 
1 3  GLN n 
1 4  CYS n 
1 5  TYR n 
1 6  ASN n 
1 7  CYS n 
1 8  PRO n 
1 9  ASN n 
1 10 PRO n 
1 11 THR n 
1 12 ALA n 
1 13 ASP n 
1 14 CYS n 
1 15 LYS n 
1 16 THR n 
1 17 ALA n 
1 18 VAL n 
1 19 ASN n 
1 20 CYS n 
1 21 SER n 
1 22 SER n 
1 23 ASP n 
1 24 PHE n 
1 25 ASP n 
1 26 ALA n 
1 27 CYS n 
1 28 LEU n 
1 29 ILE n 
1 30 THR n 
1 31 LYS n 
1 32 ALA n 
1 33 GLY n 
1 34 LEU n 
1 35 GLN n 
1 36 VAL n 
1 37 TYR n 
1 38 ASN n 
1 39 LYS n 
1 40 CYS n 
1 41 TRP n 
1 42 LYS n 
1 43 PHE n 
1 44 GLU n 
1 45 HIS n 
1 46 CYS n 
1 47 ASN n 
1 48 PHE n 
1 49 ASN n 
1 50 ASP n 
1 51 VAL n 
1 52 THR n 
1 53 THR n 
1 54 ARG n 
1 55 LEU n 
1 56 ARG n 
1 57 GLU n 
1 58 ASN n 
1 59 GLU n 
1 60 LEU n 
1 61 THR n 
1 62 TYR n 
1 63 TYR n 
1 64 CYS n 
1 65 CYS n 
1 66 LYS n 
1 67 LYS n 
1 68 ASP n 
1 69 LEU n 
1 70 CYS n 
1 71 ASN n 
1 72 PHE n 
1 73 ASN n 
1 74 GLU n 
1 75 GLN n 
1 76 LEU n 
1 77 GLU n 
1 78 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'UT5600 DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET59-06 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2UX2       1 ? ? 2UX2   ? 
2 UNP CD59_HUMAN 1 ? ? P13987 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2UX2 A 1 ? 1  ? 2UX2   0  ? 0   ? 0 0  
2 2 2UX2 A 2 ? 78 ? P13987 26 ? 102 ? 1 77 
3 1 2UX2 B 1 ? 1  ? 2UX2   0  ? 0   ? 0 0  
4 2 2UX2 B 2 ? 78 ? P13987 26 ? 102 ? 1 77 
5 1 2UX2 C 1 ? 1  ? 2UX2   0  ? 0   ? 0 0  
6 2 2UX2 C 2 ? 78 ? P13987 26 ? 102 ? 1 77 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2UX2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_percent_sol   42 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '25% PEG8000, 0.03M POTASSIUM PHOSPHATE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           77 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-05-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.24 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             1.24 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2UX2 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.00 
_reflns.d_resolution_high            1.80 
_reflns.number_obs                   20934 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        29.00 
_reflns.B_iso_Wilson_estimate        0.650 
_reflns.pdbx_redundancy              14.3 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.90 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.32 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.00 
_reflns_shell.pdbx_redundancy        14.1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2UX2 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     20772 
_refine.ls_number_reflns_all                     20772 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.187 
_refine.ls_R_factor_all                          0.187 
_refine.ls_R_factor_R_work                       0.185 
_refine.ls_R_factor_R_free                       0.223 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1038 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'BABINET SCALING' 
_refine.solvent_model_param_ksol                 0.49 
_refine.solvent_model_param_bsol                 107 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2J8C' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             'TNT BCORREL' 
_refine.pdbx_stereochemistry_target_values       'TNT PROTEGO' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1887 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             212 
_refine_hist.number_atoms_total               2099 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.004 ? 5  1969 'X-RAY DIFFRACTION' ? 
t_angle_deg               0.827 ? 5  2670 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d        12.7  ? 1  414  'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct        ?     ? ?  0    'X-RAY DIFFRACTION' ? 
t_pseud_angle             ?     ? ?  ?    'X-RAY DIFFRACTION' ? 
t_trig_c_planes           0.01  ? 2  69   'X-RAY DIFFRACTION' ? 
t_gen_planes              0.025 ? 5  274  'X-RAY DIFFRACTION' ? 
t_it                      1.256 ? 20 1969 'X-RAY DIFFRACTION' ? 
t_nbd                     0.193 ? 5  18   'X-RAY DIFFRACTION' ? 
t_omega_torsion           ?     ? ?  ?    'X-RAY DIFFRACTION' ? 
t_other_torsion           ?     ? ?  ?    'X-RAY DIFFRACTION' ? 
t_improper_torsion        ?     ? ?  ?    'X-RAY DIFFRACTION' ? 
t_chiral_improper_torsion ?     ? ?  ?    'X-RAY DIFFRACTION' ? 
t_sum_occupancies         ?     ? ?  ?    'X-RAY DIFFRACTION' ? 
t_utility_distance        ?     ? ?  ?    'X-RAY DIFFRACTION' ? 
t_utility_angle           ?     ? ?  ?    'X-RAY DIFFRACTION' ? 
t_utility_torsion         ?     ? ?  ?    'X-RAY DIFFRACTION' ? 
t_ideal_dist_contact      ?     ? ?  ?    'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    2UX2 
_pdbx_refine.R_factor_all_no_cutoff                      0.187 
_pdbx_refine.R_factor_obs_no_cutoff                      0.185 
_pdbx_refine.free_R_factor_no_cutoff                     0.223 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1038 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.658000  -0.753000 -0.026000 0.750000 0.658000  -0.066000 0.067000 0.024000 0.997000 -1.30690 1.55132  -18.74823 
2 given ? -0.984000 -0.180000 0.012000  0.181000 -0.983000 0.030000  0.006000 0.031000 0.999000 39.78791 45.91266 -21.25480 
# 
_struct.entry_id                  2UX2 
_struct.title                     'High resolution structure of human CD59' 
_struct.pdbx_descriptor           'CD59 GLYCOPROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2UX2 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
'MAC, MIRL, CD59, MEMBRANE, GPI-ANCHOR, LIPOPROTEIN, GLYCOPROTEIN, COMPLEMENT REGULATOR, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 42 ? CYS A 46 ? LYS A 41 CYS A 45 5 ? 5  
HELX_P HELX_P2 2 ASN A 47 ? ARG A 56 ? ASN A 46 ARG A 55 1 ? 10 
HELX_P HELX_P3 3 PHE A 72 ? LEU A 76 ? PHE A 71 LEU A 75 5 ? 5  
HELX_P HELX_P4 4 LYS B 42 ? CYS B 46 ? LYS B 41 CYS B 45 5 ? 5  
HELX_P HELX_P5 5 ASN B 47 ? ARG B 56 ? ASN B 46 ARG B 55 1 ? 10 
HELX_P HELX_P6 6 PHE B 72 ? GLU B 77 ? PHE B 71 GLU B 76 5 ? 6  
HELX_P HELX_P7 7 LYS C 42 ? CYS C 46 ? LYS C 41 CYS C 45 5 ? 5  
HELX_P HELX_P8 8 ASN C 47 ? ARG C 56 ? ASN C 46 ARG C 55 1 ? 10 
HELX_P HELX_P9 9 PHE C 72 ? LEU C 76 ? PHE C 71 LEU C 75 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 4  SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 3  A CYS 26 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2  disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 14 SG ? ? A CYS 6  A CYS 13 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3  disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 19 A CYS 39 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf4  disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 64 SG ? ? A CYS 45 A CYS 63 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf5  disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 70 SG ? ? A CYS 64 A CYS 69 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf6  disulf ? ? B CYS 4  SG ? ? ? 1_555 B CYS 27 SG ? ? B CYS 3  B CYS 26 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf7  disulf ? ? B CYS 7  SG ? ? ? 1_555 B CYS 14 SG ? ? B CYS 6  B CYS 13 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf8  disulf ? ? B CYS 20 SG ? ? ? 1_555 B CYS 40 SG ? ? B CYS 19 B CYS 39 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf9  disulf ? ? B CYS 46 SG ? ? ? 1_555 B CYS 64 SG ? ? B CYS 45 B CYS 63 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf10 disulf ? ? B CYS 65 SG ? ? ? 1_555 B CYS 70 SG ? ? B CYS 64 B CYS 69 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf11 disulf ? ? C CYS 4  SG ? ? ? 1_555 C CYS 27 SG ? ? C CYS 3  C CYS 26 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf12 disulf ? ? C CYS 7  SG ? ? ? 1_555 C CYS 14 SG ? ? C CYS 6  C CYS 13 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf13 disulf ? ? C CYS 20 SG ? ? ? 1_555 C CYS 40 SG ? ? C CYS 19 C CYS 39 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf14 disulf ? ? C CYS 46 SG ? ? ? 1_555 C CYS 64 SG ? ? C CYS 45 C CYS 63 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf15 disulf ? ? C CYS 65 SG ? ? ? 1_555 C CYS 70 SG ? ? C CYS 64 C CYS 69 1_555 ? ? ? ? ? ? ? 2.026 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 3 ? 
BA ? 2 ? 
BB ? 3 ? 
CA ? 2 ? 
CB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLN A 3  ? TYR A 5  ? GLN A 2  TYR A 4  
AA 2 ALA A 17 ? ASN A 19 ? ALA A 16 ASN A 18 
AB 1 GLN A 35 ? TRP A 41 ? GLN A 34 TRP A 40 
AB 2 ALA A 26 ? ALA A 32 ? ALA A 25 ALA A 31 
AB 3 THR A 61 ? CYS A 65 ? THR A 60 CYS A 64 
BA 1 GLN B 3  ? TYR B 5  ? GLN B 2  TYR B 4  
BA 2 ALA B 17 ? ASN B 19 ? ALA B 16 ASN B 18 
BB 1 GLN B 35 ? TRP B 41 ? GLN B 34 TRP B 40 
BB 2 ALA B 26 ? ALA B 32 ? ALA B 25 ALA B 31 
BB 3 THR B 61 ? CYS B 65 ? THR B 60 CYS B 64 
CA 1 GLN C 3  ? TYR C 5  ? GLN C 2  TYR C 4  
CA 2 ALA C 17 ? ASN C 19 ? ALA C 16 ASN C 18 
CB 1 GLN C 35 ? TRP C 41 ? GLN C 34 TRP C 40 
CB 2 ALA C 26 ? ALA C 32 ? ALA C 25 ALA C 31 
CB 3 THR C 61 ? CYS C 65 ? THR C 60 CYS C 64 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N CYS A 4  ? N CYS A 3  O VAL A 18 ? O VAL A 17 
AB 1 2 N TRP A 41 ? N TRP A 40 O ALA A 26 ? O ALA A 25 
AB 2 3 N LYS A 31 ? N LYS A 30 O THR A 61 ? O THR A 60 
BA 1 2 N CYS B 4  ? N CYS B 3  O VAL B 18 ? O VAL B 17 
BB 1 2 N TRP B 41 ? N TRP B 40 O ALA B 26 ? O ALA B 25 
BB 2 3 N LYS B 31 ? N LYS B 30 O THR B 61 ? O THR B 60 
CA 1 2 N CYS C 4  ? N CYS C 3  O VAL C 18 ? O VAL C 17 
CB 1 2 N TRP C 41 ? N TRP C 40 O ALA C 26 ? O ALA C 25 
CB 2 3 N LYS C 31 ? N LYS C 30 O THR C 61 ? O THR C 60 
# 
_database_PDB_matrix.entry_id          2UX2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2UX2 
_atom_sites.fract_transf_matrix[1][1]   0.016437 
_atom_sites.fract_transf_matrix[1][2]   0.009490 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018979 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009300 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1  ? 19.082  30.290  -7.931  1.00 32.96 ? 0    MET A N   1 
ATOM   2    C CA  . MET A 1 1  ? 17.849  29.607  -8.284  1.00 32.35 ? 0    MET A CA  1 
ATOM   3    C C   . MET A 1 1  ? 17.980  28.107  -8.151  1.00 28.64 ? 0    MET A C   1 
ATOM   4    O O   . MET A 1 1  ? 19.044  27.533  -8.397  1.00 28.39 ? 0    MET A O   1 
ATOM   5    C CB  . MET A 1 1  ? 17.453  29.932  -9.713  1.00 36.02 ? 0    MET A CB  1 
ATOM   6    C CG  . MET A 1 1  ? 16.130  29.348  -10.110 1.00 42.15 ? 0    MET A CG  1 
ATOM   7    S SD  . MET A 1 1  ? 15.922  29.750  -11.797 1.00 49.19 ? 0    MET A SD  1 
ATOM   8    C CE  . MET A 1 1  ? 15.242  31.369  -11.726 1.00 45.89 ? 0    MET A CE  1 
ATOM   9    N N   . LEU A 1 2  ? 16.869  27.473  -7.813  1.00 19.49 ? 1    LEU A N   1 
ATOM   10   C CA  . LEU A 1 2  ? 16.801  26.029  -7.791  1.00 16.59 ? 1    LEU A CA  1 
ATOM   11   C C   . LEU A 1 2  ? 15.812  25.698  -8.893  1.00 15.93 ? 1    LEU A C   1 
ATOM   12   O O   . LEU A 1 2  ? 14.880  26.461  -9.125  1.00 15.95 ? 1    LEU A O   1 
ATOM   13   C CB  . LEU A 1 2  ? 16.265  25.571  -6.436  1.00 16.40 ? 1    LEU A CB  1 
ATOM   14   C CG  . LEU A 1 2  ? 15.755  24.139  -6.332  1.00 19.03 ? 1    LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 2  ? 16.916  23.158  -6.456  1.00 18.18 ? 1    LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 2  ? 15.039  23.971  -4.999  1.00 20.55 ? 1    LEU A CD2 1 
ATOM   17   N N   . GLN A 1 3  ? 16.094  24.653  -9.665  1.00 10.40 ? 2    GLN A N   1 
ATOM   18   C CA  . GLN A 1 3  ? 15.166  24.218  -10.700 1.00 9.17  ? 2    GLN A CA  1 
ATOM   19   C C   . GLN A 1 3  ? 14.320  23.096  -10.122 1.00 10.02 ? 2    GLN A C   1 
ATOM   20   O O   . GLN A 1 3  ? 14.842  22.195  -9.469  1.00 9.07  ? 2    GLN A O   1 
ATOM   21   C CB  . GLN A 1 3  ? 15.914  23.687  -11.926 1.00 10.48 ? 2    GLN A CB  1 
ATOM   22   C CG  . GLN A 1 3  ? 16.739  24.720  -12.669 1.00 20.18 ? 2    GLN A CG  1 
ATOM   23   C CD  . GLN A 1 3  ? 17.256  24.192  -13.993 1.00 33.25 ? 2    GLN A CD  1 
ATOM   24   O OE1 . GLN A 1 3  ? 16.504  24.070  -14.961 1.00 28.69 ? 2    GLN A OE1 1 
ATOM   25   N NE2 . GLN A 1 3  ? 18.519  23.787  -14.014 1.00 23.79 ? 2    GLN A NE2 1 
ATOM   26   N N   . CYS A 1 4  ? 13.021  23.146  -10.379 1.00 7.84  ? 3    CYS A N   1 
ATOM   27   C CA  . CYS A 1 4  ? 12.113  22.094  -9.934  1.00 8.33  ? 3    CYS A CA  1 
ATOM   28   C C   . CYS A 1 4  ? 11.132  21.794  -11.056 1.00 10.80 ? 3    CYS A C   1 
ATOM   29   O O   . CYS A 1 4  ? 10.780  22.676  -11.839 1.00 11.61 ? 3    CYS A O   1 
ATOM   30   C CB  . CYS A 1 4  ? 11.294  22.552  -8.718  1.00 9.42  ? 3    CYS A CB  1 
ATOM   31   S SG  . CYS A 1 4  ? 12.213  23.071  -7.253  1.00 13.57 ? 3    CYS A SG  1 
ATOM   32   N N   . TYR A 1 5  ? 10.569  20.595  -11.029 1.00 8.14  ? 4    TYR A N   1 
ATOM   33   C CA  . TYR A 1 5  ? 9.418   20.304  -11.868 1.00 8.39  ? 4    TYR A CA  1 
ATOM   34   C C   . TYR A 1 5  ? 8.264   21.045  -11.202 1.00 11.41 ? 4    TYR A C   1 
ATOM   35   O O   . TYR A 1 5  ? 8.079   20.949  -9.991  1.00 9.83  ? 4    TYR A O   1 
ATOM   36   C CB  . TYR A 1 5  ? 9.128   18.803  -11.879 1.00 8.92  ? 4    TYR A CB  1 
ATOM   37   C CG  . TYR A 1 5  ? 10.162  17.990  -12.625 1.00 9.97  ? 4    TYR A CG  1 
ATOM   38   C CD1 . TYR A 1 5  ? 10.490  18.289  -13.943 1.00 11.86 ? 4    TYR A CD1 1 
ATOM   39   C CD2 . TYR A 1 5  ? 10.894  17.001  -11.977 1.00 11.18 ? 4    TYR A CD2 1 
ATOM   40   C CE1 . TYR A 1 5  ? 11.469  17.577  -14.617 1.00 12.04 ? 4    TYR A CE1 1 
ATOM   41   C CE2 . TYR A 1 5  ? 11.867  16.275  -12.647 1.00 12.04 ? 4    TYR A CE2 1 
ATOM   42   C CZ  . TYR A 1 5  ? 12.149  16.566  -13.967 1.00 15.86 ? 4    TYR A CZ  1 
ATOM   43   O OH  . TYR A 1 5  ? 13.156  15.876  -14.620 1.00 15.54 ? 4    TYR A OH  1 
ATOM   44   N N   . ASN A 1 6  ? 7.552   21.867  -11.962 1.00 8.84  ? 5    ASN A N   1 
ATOM   45   C CA  . ASN A 1 6  ? 6.464   22.638  -11.375 1.00 8.75  ? 5    ASN A CA  1 
ATOM   46   C C   . ASN A 1 6  ? 5.292   22.751  -12.335 1.00 14.91 ? 5    ASN A C   1 
ATOM   47   O O   . ASN A 1 6  ? 5.440   23.254  -13.451 1.00 14.54 ? 5    ASN A O   1 
ATOM   48   C CB  . ASN A 1 6  ? 6.961   24.027  -10.956 1.00 9.96  ? 5    ASN A CB  1 
ATOM   49   C CG  . ASN A 1 6  ? 5.879   24.866  -10.299 1.00 24.97 ? 5    ASN A CG  1 
ATOM   50   O OD1 . ASN A 1 6  ? 5.745   24.880  -9.078  1.00 19.85 ? 5    ASN A OD1 1 
ATOM   51   N ND2 . ASN A 1 6  ? 5.142   25.621  -11.108 1.00 23.08 ? 5    ASN A ND2 1 
ATOM   52   N N   . CYS A 1 7  ? 4.138   22.252  -11.898 1.00 13.81 ? 6    CYS A N   1 
ATOM   53   C CA  . CYS A 1 7  ? 2.905   22.313  -12.677 1.00 14.37 ? 6    CYS A CA  1 
ATOM   54   C C   . CYS A 1 7  ? 1.818   22.905  -11.768 1.00 17.50 ? 6    CYS A C   1 
ATOM   55   O O   . CYS A 1 7  ? 1.730   22.544  -10.596 1.00 15.01 ? 6    CYS A O   1 
ATOM   56   C CB  . CYS A 1 7  ? 2.520   20.901  -13.151 1.00 15.17 ? 6    CYS A CB  1 
ATOM   57   S SG  . CYS A 1 7  ? 3.579   20.230  -14.497 1.00 19.71 ? 6    CYS A SG  1 
ATOM   58   N N   . PRO A 1 8  ? 1.073   23.890  -12.265 1.00 16.64 ? 7    PRO A N   1 
ATOM   59   C CA  . PRO A 1 8  ? 0.091   24.570  -11.421 1.00 16.69 ? 7    PRO A CA  1 
ATOM   60   C C   . PRO A 1 8  ? -1.050  23.666  -10.958 1.00 20.32 ? 7    PRO A C   1 
ATOM   61   O O   . PRO A 1 8  ? -1.615  23.876  -9.888  1.00 21.01 ? 7    PRO A O   1 
ATOM   62   C CB  . PRO A 1 8  ? -0.424  25.709  -12.310 1.00 18.81 ? 7    PRO A CB  1 
ATOM   63   C CG  . PRO A 1 8  ? -0.198  25.249  -13.696 1.00 23.20 ? 7    PRO A CG  1 
ATOM   64   C CD  . PRO A 1 8  ? 0.985   24.310  -13.676 1.00 17.52 ? 7    PRO A CD  1 
ATOM   65   N N   . ASN A 1 9  ? -1.346  22.632  -11.739 1.00 16.81 ? 8    ASN A N   1 
ATOM   66   C CA  . ASN A 1 9  ? -2.373  21.658  -11.376 1.00 16.49 ? 8    ASN A CA  1 
ATOM   67   C C   . ASN A 1 9  ? -1.765  20.256  -11.319 1.00 20.20 ? 8    ASN A C   1 
ATOM   68   O O   . ASN A 1 9  ? -0.819  19.960  -12.048 1.00 19.73 ? 8    ASN A O   1 
ATOM   69   C CB  . ASN A 1 9  ? -3.511  21.688  -12.401 1.00 18.02 ? 8    ASN A CB  1 
ATOM   70   C CG  . ASN A 1 9  ? -4.156  23.057  -12.517 1.00 35.98 ? 8    ASN A CG  1 
ATOM   71   O OD1 . ASN A 1 9  ? -4.259  23.618  -13.608 1.00 35.11 ? 8    ASN A OD1 1 
ATOM   72   N ND2 . ASN A 1 9  ? -4.596  23.601  -11.388 1.00 24.17 ? 8    ASN A ND2 1 
ATOM   73   N N   . PRO A 1 10 ? -2.326  19.381  -10.486 1.00 17.60 ? 9    PRO A N   1 
ATOM   74   C CA  . PRO A 1 10 ? -1.812  18.016  -10.384 1.00 17.78 ? 9    PRO A CA  1 
ATOM   75   C C   . PRO A 1 10 ? -1.916  17.304  -11.728 1.00 21.72 ? 9    PRO A C   1 
ATOM   76   O O   . PRO A 1 10 ? -2.813  17.586  -12.523 1.00 21.62 ? 9    PRO A O   1 
ATOM   77   C CB  . PRO A 1 10 ? -2.742  17.354  -9.359  1.00 19.22 ? 9    PRO A CB  1 
ATOM   78   C CG  . PRO A 1 10 ? -3.959  18.209  -9.322  1.00 23.33 ? 9    PRO A CG  1 
ATOM   79   C CD  . PRO A 1 10 ? -3.488  19.600  -9.608  1.00 18.30 ? 9    PRO A CD  1 
ATOM   80   N N   . THR A 1 11 ? -0.972  16.406  -11.987 1.00 18.02 ? 10   THR A N   1 
ATOM   81   C CA  . THR A 1 11 ? -0.937  15.668  -13.245 1.00 17.53 ? 10   THR A CA  1 
ATOM   82   C C   . THR A 1 11 ? -0.001  14.468  -13.122 1.00 18.95 ? 10   THR A C   1 
ATOM   83   O O   . THR A 1 11 ? 0.889   14.456  -12.277 1.00 16.07 ? 10   THR A O   1 
ATOM   84   C CB  . THR A 1 11 ? -0.553  16.586  -14.425 1.00 28.09 ? 10   THR A CB  1 
ATOM   85   O OG1 . THR A 1 11 ? -0.871  15.939  -15.664 1.00 29.09 ? 10   THR A OG1 1 
ATOM   86   C CG2 . THR A 1 11 ? 0.934   16.923  -14.389 1.00 23.44 ? 10   THR A CG2 1 
ATOM   87   N N   . ALA A 1 12 ? -0.245  13.440  -13.928 1.00 16.30 ? 11   ALA A N   1 
ATOM   88   C CA  . ALA A 1 12 ? 0.503   12.191  -13.832 1.00 15.15 ? 11   ALA A CA  1 
ATOM   89   C C   . ALA A 1 12 ? 2.002   12.300  -14.116 1.00 16.19 ? 11   ALA A C   1 
ATOM   90   O O   . ALA A 1 12 ? 2.800   11.569  -13.538 1.00 14.59 ? 11   ALA A O   1 
ATOM   91   C CB  . ALA A 1 12 ? -0.131  11.121  -14.710 1.00 16.07 ? 11   ALA A CB  1 
ATOM   92   N N   . ASP A 1 13 ? 2.379   13.142  -15.070 1.00 12.69 ? 12   ASP A N   1 
ATOM   93   C CA  . ASP A 1 13 ? 3.780   13.231  -15.458 1.00 11.45 ? 12   ASP A CA  1 
ATOM   94   C C   . ASP A 1 13 ? 4.204   14.663  -15.749 1.00 15.36 ? 12   ASP A C   1 
ATOM   95   O O   . ASP A 1 13 ? 4.375   15.056  -16.904 1.00 14.27 ? 12   ASP A O   1 
ATOM   96   C CB  . ASP A 1 13 ? 4.054   12.334  -16.668 1.00 13.26 ? 12   ASP A CB  1 
ATOM   97   C CG  . ASP A 1 13 ? 5.527   12.269  -17.025 1.00 20.56 ? 12   ASP A CG  1 
ATOM   98   O OD1 . ASP A 1 13 ? 6.368   12.585  -16.158 1.00 20.40 ? 12   ASP A OD1 1 
ATOM   99   O OD2 . ASP A 1 13 ? 5.840   11.911  -18.181 1.00 23.91 ? 12   ASP A OD2 1 
ATOM   100  N N   . CYS A 1 14 ? 4.386   15.435  -14.686 1.00 13.16 ? 13   CYS A N   1 
ATOM   101  C CA  . CYS A 1 14 ? 4.836   16.810  -14.809 1.00 13.24 ? 13   CYS A CA  1 
ATOM   102  C C   . CYS A 1 14 ? 6.328   16.831  -15.119 1.00 16.28 ? 13   CYS A C   1 
ATOM   103  O O   . CYS A 1 14 ? 7.148   16.477  -14.275 1.00 16.00 ? 13   CYS A O   1 
ATOM   104  C CB  . CYS A 1 14 ? 4.574   17.566  -13.505 1.00 14.17 ? 13   CYS A CB  1 
ATOM   105  S SG  . CYS A 1 14 ? 5.111   19.292  -13.549 1.00 18.22 ? 13   CYS A SG  1 
ATOM   106  N N   . LYS A 1 15 ? 6.684   17.253  -16.326 1.00 12.58 ? 14   LYS A N   1 
ATOM   107  C CA  . LYS A 1 15 ? 8.094   17.380  -16.673 1.00 12.59 ? 14   LYS A CA  1 
ATOM   108  C C   . LYS A 1 15 ? 8.422   18.804  -17.084 1.00 16.86 ? 14   LYS A C   1 
ATOM   109  O O   . LYS A 1 15 ? 9.419   19.060  -17.760 1.00 17.50 ? 14   LYS A O   1 
ATOM   110  C CB  . LYS A 1 15 ? 8.509   16.370  -17.745 1.00 16.16 ? 14   LYS A CB  1 
ATOM   111  C CG  . LYS A 1 15 ? 7.697   16.431  -19.019 1.00 23.76 ? 14   LYS A CG  1 
ATOM   112  C CD  . LYS A 1 15 ? 8.297   15.522  -20.077 1.00 29.32 ? 14   LYS A CD  1 
ATOM   113  C CE  . LYS A 1 15 ? 7.539   15.640  -21.388 1.00 34.59 ? 14   LYS A CE  1 
ATOM   114  N NZ  . LYS A 1 15 ? 7.918   14.563  -22.342 1.00 43.80 ? 14   LYS A NZ  1 
ATOM   115  N N   . THR A 1 16 ? 7.602   19.734  -16.610 1.00 13.66 ? 15   THR A N   1 
ATOM   116  C CA  . THR A 1 16 ? 7.820   21.149  -16.862 1.00 13.93 ? 15   THR A CA  1 
ATOM   117  C C   . THR A 1 16 ? 8.871   21.668  -15.896 1.00 16.42 ? 15   THR A C   1 
ATOM   118  O O   . THR A 1 16 ? 8.595   21.866  -14.712 1.00 14.47 ? 15   THR A O   1 
ATOM   119  C CB  . THR A 1 16 ? 6.514   21.949  -16.718 1.00 21.28 ? 15   THR A CB  1 
ATOM   120  O OG1 . THR A 1 16 ? 5.549   21.465  -17.659 1.00 22.29 ? 15   THR A OG1 1 
ATOM   121  C CG2 . THR A 1 16 ? 6.774   23.427  -16.971 1.00 21.28 ? 15   THR A CG2 1 
ATOM   122  N N   . ALA A 1 17 ? 10.082  21.868  -16.399 1.00 12.57 ? 16   ALA A N   1 
ATOM   123  C CA  . ALA A 1 17 ? 11.164  22.388  -15.573 1.00 12.99 ? 16   ALA A CA  1 
ATOM   124  C C   . ALA A 1 17 ? 11.036  23.899  -15.431 1.00 18.19 ? 16   ALA A C   1 
ATOM   125  O O   . ALA A 1 17 ? 10.898  24.619  -16.427 1.00 16.85 ? 16   ALA A O   1 
ATOM   126  C CB  . ALA A 1 17 ? 12.510  22.030  -16.184 1.00 14.00 ? 16   ALA A CB  1 
ATOM   127  N N   . VAL A 1 18 ? 11.035  24.372  -14.189 1.00 14.86 ? 17   VAL A N   1 
ATOM   128  C CA  . VAL A 1 18 ? 10.967  25.798  -13.929 1.00 15.37 ? 17   VAL A CA  1 
ATOM   129  C C   . VAL A 1 18 ? 12.145  26.247  -13.099 1.00 16.82 ? 17   VAL A C   1 
ATOM   130  O O   . VAL A 1 18 ? 12.636  25.531  -12.224 1.00 15.28 ? 17   VAL A O   1 
ATOM   131  C CB  . VAL A 1 18 ? 9.649   26.229  -13.258 1.00 20.48 ? 17   VAL A CB  1 
ATOM   132  C CG1 . VAL A 1 18 ? 8.446   25.792  -14.084 1.00 20.95 ? 17   VAL A CG1 1 
ATOM   133  C CG2 . VAL A 1 18 ? 9.574   25.704  -11.837 1.00 20.52 ? 17   VAL A CG2 1 
ATOM   134  N N   . ASN A 1 19 ? 12.547  27.479  -13.351 1.00 13.10 ? 18   ASN A N   1 
ATOM   135  C CA  . ASN A 1 19 ? 13.564  28.135  -12.574 1.00 12.73 ? 18   ASN A CA  1 
ATOM   136  C C   . ASN A 1 19 ? 12.822  28.837  -11.427 1.00 16.53 ? 18   ASN A C   1 
ATOM   137  O O   . ASN A 1 19 ? 12.151  29.840  -11.658 1.00 15.74 ? 18   ASN A O   1 
ATOM   138  C CB  . ASN A 1 19 ? 14.232  29.162  -13.492 1.00 15.23 ? 18   ASN A CB  1 
ATOM   139  C CG  . ASN A 1 19 ? 15.313  28.546  -14.370 1.00 26.78 ? 18   ASN A CG  1 
ATOM   140  O OD1 . ASN A 1 19 ? 15.535  27.338  -14.344 1.00 28.31 ? 18   ASN A OD1 1 
ATOM   141  N ND2 . ASN A 1 19 ? 16.051  29.392  -15.076 1.00 23.99 ? 18   ASN A ND2 1 
ATOM   142  N N   . CYS A 1 20 ? 12.815  28.241  -10.233 1.00 13.73 ? 19   CYS A N   1 
ATOM   143  C CA  . CYS A 1 20 ? 12.012  28.790  -9.133  1.00 14.08 ? 19   CYS A CA  1 
ATOM   144  C C   . CYS A 1 20 ? 12.447  30.193  -8.722  1.00 16.18 ? 19   CYS A C   1 
ATOM   145  O O   . CYS A 1 20 ? 13.631  30.517  -8.755  1.00 14.36 ? 19   CYS A O   1 
ATOM   146  C CB  . CYS A 1 20 ? 12.008  27.868  -7.906  1.00 14.50 ? 19   CYS A CB  1 
ATOM   147  S SG  . CYS A 1 20 ? 11.486  26.163  -8.223  1.00 18.15 ? 19   CYS A SG  1 
ATOM   148  N N   . SER A 1 21 ? 11.489  31.011  -8.297  1.00 13.99 ? 20   SER A N   1 
ATOM   149  C CA  . SER A 1 21 ? 11.816  32.345  -7.803  1.00 13.80 ? 20   SER A CA  1 
ATOM   150  C C   . SER A 1 21 ? 12.611  32.212  -6.508  1.00 17.93 ? 20   SER A C   1 
ATOM   151  O O   . SER A 1 21 ? 12.684  31.125  -5.928  1.00 17.25 ? 20   SER A O   1 
ATOM   152  C CB  . SER A 1 21 ? 10.554  33.186  -7.597  1.00 17.94 ? 20   SER A CB  1 
ATOM   153  O OG  . SER A 1 21 ? 9.476   32.389  -7.141  1.00 25.59 ? 20   SER A OG  1 
ATOM   154  N N   . SER A 1 22 ? 13.253  33.299  -6.087  1.00 15.00 ? 21   SER A N   1 
ATOM   155  C CA  . SER A 1 22 ? 14.162  33.251  -4.945  1.00 15.45 ? 21   SER A CA  1 
ATOM   156  C C   . SER A 1 22 ? 13.512  32.973  -3.590  1.00 19.13 ? 21   SER A C   1 
ATOM   157  O O   . SER A 1 22 ? 14.195  32.598  -2.639  1.00 20.26 ? 21   SER A O   1 
ATOM   158  C CB  . SER A 1 22 ? 15.046  34.500  -4.888  1.00 20.31 ? 21   SER A CB  1 
ATOM   159  O OG  . SER A 1 22 ? 14.268  35.675  -4.777  1.00 24.04 ? 21   SER A OG  1 
ATOM   160  N N   . ASP A 1 23 ? 12.192  33.100  -3.517  1.00 16.16 ? 22   ASP A N   1 
ATOM   161  C CA  . ASP A 1 23 ? 11.477  32.811  -2.275  1.00 16.87 ? 22   ASP A CA  1 
ATOM   162  C C   . ASP A 1 23 ? 11.345  31.307  -2.047  1.00 19.47 ? 22   ASP A C   1 
ATOM   163  O O   . ASP A 1 23 ? 10.957  30.866  -0.964  1.00 19.97 ? 22   ASP A O   1 
ATOM   164  C CB  . ASP A 1 23 ? 10.095  33.459  -2.280  1.00 18.89 ? 22   ASP A CB  1 
ATOM   165  C CG  . ASP A 1 23 ? 9.333   33.193  -3.557  1.00 33.61 ? 22   ASP A CG  1 
ATOM   166  O OD1 . ASP A 1 23 ? 9.849   33.541  -4.641  1.00 35.54 ? 22   ASP A OD1 1 
ATOM   167  O OD2 . ASP A 1 23 ? 8.207   32.657  -3.477  1.00 40.89 ? 22   ASP A OD2 1 
ATOM   168  N N   . PHE A 1 24 ? 11.650  30.525  -3.078  1.00 13.33 ? 23   PHE A N   1 
ATOM   169  C CA  . PHE A 1 24 ? 11.574  29.070  -2.988  1.00 12.28 ? 23   PHE A CA  1 
ATOM   170  C C   . PHE A 1 24 ? 12.964  28.472  -2.793  1.00 17.78 ? 23   PHE A C   1 
ATOM   171  O O   . PHE A 1 24 ? 13.898  28.793  -3.533  1.00 19.28 ? 23   PHE A O   1 
ATOM   172  C CB  . PHE A 1 24 ? 10.928  28.492  -4.251  1.00 13.12 ? 23   PHE A CB  1 
ATOM   173  C CG  . PHE A 1 24 ? 9.486   28.866  -4.420  1.00 13.98 ? 23   PHE A CG  1 
ATOM   174  C CD1 . PHE A 1 24 ? 8.538   28.467  -3.489  1.00 16.75 ? 23   PHE A CD1 1 
ATOM   175  C CD2 . PHE A 1 24 ? 9.075   29.614  -5.510  1.00 16.34 ? 23   PHE A CD2 1 
ATOM   176  C CE1 . PHE A 1 24 ? 7.208   28.816  -3.640  1.00 18.31 ? 23   PHE A CE1 1 
ATOM   177  C CE2 . PHE A 1 24 ? 7.746   29.952  -5.676  1.00 20.09 ? 23   PHE A CE2 1 
ATOM   178  C CZ  . PHE A 1 24 ? 6.809   29.551  -4.741  1.00 18.06 ? 23   PHE A CZ  1 
ATOM   179  N N   . ASP A 1 25 ? 13.110  27.624  -1.781  1.00 12.83 ? 24   ASP A N   1 
ATOM   180  C CA  . ASP A 1 25 ? 14.401  27.006  -1.505  1.00 13.14 ? 24   ASP A CA  1 
ATOM   181  C C   . ASP A 1 25 ? 14.367  25.484  -1.584  1.00 14.48 ? 24   ASP A C   1 
ATOM   182  O O   . ASP A 1 25 ? 15.349  24.821  -1.261  1.00 13.59 ? 24   ASP A O   1 
ATOM   183  C CB  . ASP A 1 25 ? 14.957  27.463  -0.152  1.00 14.81 ? 24   ASP A CB  1 
ATOM   184  C CG  . ASP A 1 25 ? 14.087  27.033  1.026   1.00 21.45 ? 24   ASP A CG  1 
ATOM   185  O OD1 . ASP A 1 25 ? 13.105  26.286  0.822   1.00 17.54 ? 24   ASP A OD1 1 
ATOM   186  O OD2 . ASP A 1 25 ? 14.398  27.435  2.169   1.00 24.01 ? 24   ASP A OD2 1 
ATOM   187  N N   . ALA A 1 26 ? 13.259  24.938  -2.073  1.00 10.26 ? 25   ALA A N   1 
ATOM   188  C CA  . ALA A 1 26 ? 13.110  23.491  -2.168  1.00 8.86  ? 25   ALA A CA  1 
ATOM   189  C C   . ALA A 1 26 ? 12.164  23.100  -3.293  1.00 13.00 ? 25   ALA A C   1 
ATOM   190  O O   . ALA A 1 26 ? 11.411  23.929  -3.800  1.00 12.38 ? 25   ALA A O   1 
ATOM   191  C CB  . ALA A 1 26 ? 12.607  22.926  -0.841  1.00 9.35  ? 25   ALA A CB  1 
ATOM   192  N N   . CYS A 1 27 ? 12.190  21.821  -3.652  1.00 8.85  ? 26   CYS A N   1 
ATOM   193  C CA  . CYS A 1 27 ? 11.250  21.261  -4.614  1.00 8.30  ? 26   CYS A CA  1 
ATOM   194  C C   . CYS A 1 27 ? 10.370  20.295  -3.833  1.00 10.39 ? 26   CYS A C   1 
ATOM   195  O O   . CYS A 1 27 ? 10.830  19.673  -2.878  1.00 9.81  ? 26   CYS A O   1 
ATOM   196  C CB  . CYS A 1 27 ? 11.986  20.477  -5.702  1.00 8.97  ? 26   CYS A CB  1 
ATOM   197  S SG  . CYS A 1 27 ? 13.208  21.400  -6.663  1.00 13.34 ? 26   CYS A SG  1 
ATOM   198  N N   . LEU A 1 28 ? 9.117   20.160  -4.245  1.00 6.71  ? 27   LEU A N   1 
ATOM   199  C CA  . LEU A 1 28 ? 8.190   19.255  -3.568  1.00 6.40  ? 27   LEU A CA  1 
ATOM   200  C C   . LEU A 1 28 ? 7.555   18.294  -4.566  1.00 8.07  ? 27   LEU A C   1 
ATOM   201  O O   . LEU A 1 28 ? 7.129   18.706  -5.642  1.00 7.19  ? 27   LEU A O   1 
ATOM   202  C CB  . LEU A 1 28 ? 7.086   20.063  -2.865  1.00 6.93  ? 27   LEU A CB  1 
ATOM   203  C CG  . LEU A 1 28 ? 5.861   19.282  -2.372  1.00 11.38 ? 27   LEU A CG  1 
ATOM   204  C CD1 . LEU A 1 28 ? 6.196   18.554  -1.088  1.00 10.81 ? 27   LEU A CD1 1 
ATOM   205  C CD2 . LEU A 1 28 ? 4.636   20.183  -2.175  1.00 13.89 ? 27   LEU A CD2 1 
ATOM   206  N N   . ILE A 1 29 ? 7.440   17.025  -4.184  1.00 4.93  ? 28   ILE A N   1 
ATOM   207  C CA  . ILE A 1 29 ? 6.619   16.082  -4.932  1.00 4.20  ? 28   ILE A CA  1 
ATOM   208  C C   . ILE A 1 29 ? 5.717   15.369  -3.934  1.00 7.56  ? 28   ILE A C   1 
ATOM   209  O O   . ILE A 1 29 ? 6.168   14.979  -2.860  1.00 6.22  ? 28   ILE A O   1 
ATOM   210  C CB  . ILE A 1 29 ? 7.437   15.119  -5.848  1.00 6.42  ? 28   ILE A CB  1 
ATOM   211  C CG1 . ILE A 1 29 ? 6.509   14.208  -6.675  1.00 7.12  ? 28   ILE A CG1 1 
ATOM   212  C CG2 . ILE A 1 29 ? 8.481   14.341  -5.062  1.00 6.95  ? 28   ILE A CG2 1 
ATOM   213  C CD1 . ILE A 1 29 ? 6.116   12.898  -5.988  1.00 10.04 ? 28   ILE A CD1 1 
ATOM   214  N N   . THR A 1 30 ? 4.417   15.392  -4.207  1.00 6.21  ? 29   THR A N   1 
ATOM   215  C CA  . THR A 1 30 ? 3.434   14.808  -3.299  1.00 6.91  ? 29   THR A CA  1 
ATOM   216  C C   . THR A 1 30 ? 2.533   13.842  -4.041  1.00 11.23 ? 29   THR A C   1 
ATOM   217  O O   . THR A 1 30 ? 2.041   14.147  -5.125  1.00 10.72 ? 29   THR A O   1 
ATOM   218  C CB  . THR A 1 30 ? 2.578   15.898  -2.610  1.00 16.93 ? 29   THR A CB  1 
ATOM   219  O OG1 . THR A 1 30 ? 3.423   16.774  -1.858  1.00 20.07 ? 29   THR A OG1 1 
ATOM   220  C CG2 . THR A 1 30 ? 1.556   15.262  -1.679  1.00 18.28 ? 29   THR A CG2 1 
ATOM   221  N N   . LYS A 1 31 ? 2.281   12.695  -3.426  1.00 8.99  ? 30   LYS A N   1 
ATOM   222  C CA  . LYS A 1 31 ? 1.320   11.742  -3.957  1.00 8.75  ? 30   LYS A CA  1 
ATOM   223  C C   . LYS A 1 31 ? 0.131   11.705  -2.998  1.00 13.31 ? 30   LYS A C   1 
ATOM   224  O O   . LYS A 1 31 ? 0.292   11.403  -1.815  1.00 10.48 ? 30   LYS A O   1 
ATOM   225  C CB  . LYS A 1 31 ? 1.969   10.366  -4.120  1.00 10.86 ? 30   LYS A CB  1 
ATOM   226  C CG  . LYS A 1 31 ? 3.026   10.352  -5.219  1.00 12.91 ? 30   LYS A CG  1 
ATOM   227  C CD  . LYS A 1 31 ? 3.671   8.993   -5.414  1.00 14.08 ? 30   LYS A CD  1 
ATOM   228  C CE  . LYS A 1 31 ? 4.532   8.995   -6.675  1.00 16.66 ? 30   LYS A CE  1 
ATOM   229  N NZ  . LYS A 1 31 ? 5.113   7.659   -6.989  1.00 21.16 ? 30   LYS A NZ  1 
ATOM   230  N N   . ALA A 1 32 ? -0.991  12.249  -3.458  1.00 13.18 ? 31   ALA A N   1 
ATOM   231  C CA  . ALA A 1 32 ? -2.196  12.356  -2.640  1.00 14.84 ? 31   ALA A CA  1 
ATOM   232  C C   . ALA A 1 32 ? -3.304  11.570  -3.321  1.00 21.87 ? 31   ALA A C   1 
ATOM   233  O O   . ALA A 1 32 ? -3.875  12.016  -4.318  1.00 19.63 ? 31   ALA A O   1 
ATOM   234  C CB  . ALA A 1 32 ? -2.599  13.818  -2.481  1.00 16.12 ? 31   ALA A CB  1 
ATOM   235  N N   . GLY A 1 33 ? -3.534  10.354  -2.842  1.00 22.58 ? 32   GLY A N   1 
ATOM   236  C CA  . GLY A 1 33 ? -4.476  9.457   -3.493  1.00 23.21 ? 32   GLY A CA  1 
ATOM   237  C C   . GLY A 1 33 ? -3.924  9.103   -4.869  1.00 27.85 ? 32   GLY A C   1 
ATOM   238  O O   . GLY A 1 33 ? -2.775  8.677   -4.993  1.00 28.49 ? 32   GLY A O   1 
ATOM   239  N N   . LEU A 1 34 ? -4.713  9.369   -5.904  1.00 23.61 ? 33   LEU A N   1 
ATOM   240  C CA  . LEU A 1 34 ? -4.315  9.069   -7.276  1.00 23.82 ? 33   LEU A CA  1 
ATOM   241  C C   . LEU A 1 34 ? -3.651  10.263  -7.961  1.00 25.67 ? 33   LEU A C   1 
ATOM   242  O O   . LEU A 1 34 ? -3.208  10.161  -9.104  1.00 26.52 ? 33   LEU A O   1 
ATOM   243  C CB  . LEU A 1 34 ? -5.536  8.625   -8.088  1.00 24.44 ? 33   LEU A CB  1 
ATOM   244  C CG  . LEU A 1 34 ? -5.596  7.186   -8.609  1.00 29.94 ? 33   LEU A CG  1 
ATOM   245  C CD1 . LEU A 1 34 ? -5.642  6.186   -7.461  1.00 30.65 ? 33   LEU A CD1 1 
ATOM   246  C CD2 . LEU A 1 34 ? -6.804  7.012   -9.525  1.00 32.65 ? 33   LEU A CD2 1 
ATOM   247  N N   . GLN A 1 35 ? -3.605  11.398  -7.272  1.00 19.45 ? 34   GLN A N   1 
ATOM   248  C CA  . GLN A 1 35 ? -3.035  12.609  -7.847  1.00 17.52 ? 34   GLN A CA  1 
ATOM   249  C C   . GLN A 1 35 ? -1.571  12.803  -7.468  1.00 17.39 ? 34   GLN A C   1 
ATOM   250  O O   . GLN A 1 35 ? -1.114  12.312  -6.437  1.00 15.92 ? 34   GLN A O   1 
ATOM   251  C CB  . GLN A 1 35 ? -3.849  13.834  -7.436  1.00 18.93 ? 34   GLN A CB  1 
ATOM   252  C CG  . GLN A 1 35 ? -5.348  13.676  -7.643  1.00 27.36 ? 34   GLN A CG  1 
ATOM   253  C CD  . GLN A 1 35 ? -6.062  15.006  -7.758  1.00 38.40 ? 34   GLN A CD  1 
ATOM   254  O OE1 . GLN A 1 35 ? -6.713  15.458  -6.816  1.00 34.58 ? 34   GLN A OE1 1 
ATOM   255  N NE2 . GLN A 1 35 ? -5.935  15.646  -8.913  1.00 29.39 ? 34   GLN A NE2 1 
ATOM   256  N N   . VAL A 1 36 ? -0.841  13.519  -8.317  1.00 12.40 ? 35   VAL A N   1 
ATOM   257  C CA  . VAL A 1 36 ? 0.559   13.821  -8.055  1.00 11.33 ? 35   VAL A CA  1 
ATOM   258  C C   . VAL A 1 36 ? 0.796   15.313  -8.231  1.00 12.88 ? 35   VAL A C   1 
ATOM   259  O O   . VAL A 1 36 ? 0.343   15.912  -9.206  1.00 12.48 ? 35   VAL A O   1 
ATOM   260  C CB  . VAL A 1 36 ? 1.506   13.002  -8.954  1.00 14.95 ? 35   VAL A CB  1 
ATOM   261  C CG1 . VAL A 1 36 ? 2.962   13.246  -8.557  1.00 14.47 ? 35   VAL A CG1 1 
ATOM   262  C CG2 . VAL A 1 36 ? 1.160   11.517  -8.890  1.00 14.78 ? 35   VAL A CG2 1 
ATOM   263  N N   . TYR A 1 37 ? 1.494   15.910  -7.274  1.00 9.03  ? 36   TYR A N   1 
ATOM   264  C CA  . TYR A 1 37 ? 1.812   17.326  -7.339  1.00 9.00  ? 36   TYR A CA  1 
ATOM   265  C C   . TYR A 1 37 ? 3.324   17.494  -7.409  1.00 11.95 ? 36   TYR A C   1 
ATOM   266  O O   . TYR A 1 37 ? 4.067   16.769  -6.744  1.00 12.12 ? 36   TYR A O   1 
ATOM   267  C CB  . TYR A 1 37 ? 1.284   18.052  -6.099  1.00 10.31 ? 36   TYR A CB  1 
ATOM   268  C CG  . TYR A 1 37 ? -0.224  18.050  -5.967  1.00 11.43 ? 36   TYR A CG  1 
ATOM   269  C CD1 . TYR A 1 37 ? -0.970  19.162  -6.335  1.00 13.59 ? 36   TYR A CD1 1 
ATOM   270  C CD2 . TYR A 1 37 ? -0.886  16.986  -5.371  1.00 12.51 ? 36   TYR A CD2 1 
ATOM   271  C CE1 . TYR A 1 37 ? -2.342  19.192  -6.165  1.00 12.67 ? 36   TYR A CE1 1 
ATOM   272  C CE2 . TYR A 1 37 ? -2.260  17.009  -5.193  1.00 12.51 ? 36   TYR A CE2 1 
ATOM   273  C CZ  . TYR A 1 37 ? -2.980  18.116  -5.590  1.00 16.87 ? 36   TYR A CZ  1 
ATOM   274  O OH  . TYR A 1 37 ? -4.344  18.149  -5.413  1.00 18.68 ? 36   TYR A OH  1 
ATOM   275  N N   . ASN A 1 38 ? 3.766   18.465  -8.201  1.00 6.78  ? 37   ASN A N   1 
ATOM   276  C CA  . ASN A 1 38 ? 5.183   18.806  -8.304  1.00 6.13  ? 37   ASN A CA  1 
ATOM   277  C C   . ASN A 1 38 ? 5.275   20.323  -8.287  1.00 9.64  ? 37   ASN A C   1 
ATOM   278  O O   . ASN A 1 38 ? 4.666   20.991  -9.128  1.00 8.23  ? 37   ASN A O   1 
ATOM   279  C CB  . ASN A 1 38 ? 5.785   18.266  -9.603  1.00 8.80  ? 37   ASN A CB  1 
ATOM   280  C CG  . ASN A 1 38 ? 5.512   16.795  -9.802  1.00 15.93 ? 37   ASN A CG  1 
ATOM   281  O OD1 . ASN A 1 38 ? 4.484   16.404  -10.322 1.00 10.66 ? 37   ASN A OD1 1 
ATOM   282  N ND2 . ASN A 1 38 ? 6.486   15.962  -9.421  1.00 6.32  ? 37   ASN A ND2 1 
ATOM   283  N N   . LYS A 1 39 ? 5.962   20.867  -7.285  1.00 6.67  ? 38   LYS A N   1 
ATOM   284  C CA  . LYS A 1 39 ? 5.988   22.314  -7.081  1.00 7.18  ? 38   LYS A CA  1 
ATOM   285  C C   . LYS A 1 39 ? 7.329   22.850  -6.603  1.00 12.02 ? 38   LYS A C   1 
ATOM   286  O O   . LYS A 1 39 ? 8.048   22.186  -5.855  1.00 12.05 ? 38   LYS A O   1 
ATOM   287  C CB  . LYS A 1 39 ? 4.946   22.709  -6.025  1.00 9.06  ? 38   LYS A CB  1 
ATOM   288  C CG  . LYS A 1 39 ? 3.590   22.068  -6.195  1.00 13.47 ? 38   LYS A CG  1 
ATOM   289  C CD  . LYS A 1 39 ? 2.771   22.833  -7.210  1.00 14.64 ? 38   LYS A CD  1 
ATOM   290  C CE  . LYS A 1 39 ? 1.287   22.553  -7.046  1.00 16.73 ? 38   LYS A CE  1 
ATOM   291  N NZ  . LYS A 1 39 ? 0.474   23.383  -7.975  1.00 20.00 ? 38   LYS A NZ  1 
ATOM   292  N N   . CYS A 1 40 ? 7.583   24.115  -6.927  1.00 11.00 ? 39   CYS A N   1 
ATOM   293  C CA  . CYS A 1 40 ? 8.604   24.899  -6.249  1.00 10.88 ? 39   CYS A CA  1 
ATOM   294  C C   . CYS A 1 40 ? 8.011   25.073  -4.855  1.00 11.54 ? 39   CYS A C   1 
ATOM   295  O O   . CYS A 1 40 ? 6.806   25.277  -4.719  1.00 10.65 ? 39   CYS A O   1 
ATOM   296  C CB  . CYS A 1 40 ? 8.752   26.279  -6.905  1.00 12.30 ? 39   CYS A CB  1 
ATOM   297  S SG  . CYS A 1 40 ? 9.488   26.275  -8.562  1.00 17.15 ? 39   CYS A SG  1 
ATOM   298  N N   . TRP A 1 41 ? 8.829   24.927  -3.822  1.00 8.54  ? 40   TRP A N   1 
ATOM   299  C CA  . TRP A 1 41 ? 8.313   24.917  -2.458  1.00 9.33  ? 40   TRP A CA  1 
ATOM   300  C C   . TRP A 1 41 ? 9.284   25.588  -1.495  1.00 13.88 ? 40   TRP A C   1 
ATOM   301  O O   . TRP A 1 41 ? 10.365  26.032  -1.886  1.00 13.02 ? 40   TRP A O   1 
ATOM   302  C CB  . TRP A 1 41 ? 8.068   23.469  -2.014  1.00 8.42  ? 40   TRP A CB  1 
ATOM   303  C CG  . TRP A 1 41 ? 6.988   23.287  -0.978  1.00 10.37 ? 40   TRP A CG  1 
ATOM   304  C CD1 . TRP A 1 41 ? 7.139   22.746  0.270   1.00 13.40 ? 40   TRP A CD1 1 
ATOM   305  C CD2 . TRP A 1 41 ? 5.578   23.466  -1.165  1.00 10.94 ? 40   TRP A CD2 1 
ATOM   306  N NE1 . TRP A 1 41 ? 5.918   22.657  0.899   1.00 13.27 ? 40   TRP A NE1 1 
ATOM   307  C CE2 . TRP A 1 41 ? 4.943   23.083  0.036   1.00 15.31 ? 40   TRP A CE2 1 
ATOM   308  C CE3 . TRP A 1 41 ? 4.791   23.920  -2.230  1.00 12.79 ? 40   TRP A CE3 1 
ATOM   309  C CZ2 . TRP A 1 41 ? 3.560   23.138  0.200   1.00 15.25 ? 40   TRP A CZ2 1 
ATOM   310  C CZ3 . TRP A 1 41 ? 3.419   23.994  -2.059  1.00 15.14 ? 40   TRP A CZ3 1 
ATOM   311  C CH2 . TRP A 1 41 ? 2.816   23.601  -0.853  1.00 15.91 ? 40   TRP A CH2 1 
ATOM   312  N N   . LYS A 1 42 ? 8.895   25.631  -0.225  1.00 10.98 ? 41   LYS A N   1 
ATOM   313  C CA  . LYS A 1 42 ? 9.732   26.208  0.817   1.00 10.81 ? 41   LYS A CA  1 
ATOM   314  C C   . LYS A 1 42 ? 9.965   25.163  1.894   1.00 14.22 ? 41   LYS A C   1 
ATOM   315  O O   . LYS A 1 42 ? 9.027   24.501  2.342   1.00 12.49 ? 41   LYS A O   1 
ATOM   316  C CB  . LYS A 1 42 ? 9.057   27.435  1.427   1.00 13.97 ? 41   LYS A CB  1 
ATOM   317  C CG  . LYS A 1 42 ? 8.735   28.520  0.420   1.00 21.96 ? 41   LYS A CG  1 
ATOM   318  C CD  . LYS A 1 42 ? 8.069   29.721  1.074   1.00 25.50 ? 41   LYS A CD  1 
ATOM   319  C CE  . LYS A 1 42 ? 7.524   30.670  0.015   1.00 29.52 ? 41   LYS A CE  1 
ATOM   320  N NZ  . LYS A 1 42 ? 6.987   31.935  0.593   1.00 33.70 ? 41   LYS A NZ  1 
ATOM   321  N N   . PHE A 1 43 ? 11.219  25.007  2.296   1.00 12.31 ? 42   PHE A N   1 
ATOM   322  C CA  . PHE A 1 43 ? 11.570  24.029  3.313   1.00 13.38 ? 42   PHE A CA  1 
ATOM   323  C C   . PHE A 1 43 ? 10.725  24.172  4.581   1.00 16.76 ? 42   PHE A C   1 
ATOM   324  O O   . PHE A 1 43 ? 10.318  23.175  5.177   1.00 15.70 ? 42   PHE A O   1 
ATOM   325  C CB  . PHE A 1 43 ? 13.057  24.106  3.647   1.00 16.49 ? 42   PHE A CB  1 
ATOM   326  C CG  . PHE A 1 43 ? 13.525  23.002  4.542   1.00 19.63 ? 42   PHE A CG  1 
ATOM   327  C CD1 . PHE A 1 43 ? 13.440  21.681  4.133   1.00 24.08 ? 42   PHE A CD1 1 
ATOM   328  C CD2 . PHE A 1 43 ? 13.981  23.276  5.819   1.00 23.49 ? 42   PHE A CD2 1 
ATOM   329  C CE1 . PHE A 1 43 ? 13.851  20.657  4.964   1.00 25.92 ? 42   PHE A CE1 1 
ATOM   330  C CE2 . PHE A 1 43 ? 14.390  22.259  6.657   1.00 26.85 ? 42   PHE A CE2 1 
ATOM   331  C CZ  . PHE A 1 43 ? 14.322  20.946  6.230   1.00 25.68 ? 42   PHE A CZ  1 
ATOM   332  N N   . GLU A 1 44 ? 10.429  25.411  4.963   1.00 13.99 ? 43   GLU A N   1 
ATOM   333  C CA  . GLU A 1 44 ? 9.604   25.677  6.140   1.00 14.37 ? 43   GLU A CA  1 
ATOM   334  C C   . GLU A 1 44 ? 8.214   25.044  6.033   1.00 17.49 ? 43   GLU A C   1 
ATOM   335  O O   . GLU A 1 44 ? 7.525   24.865  7.041   1.00 17.40 ? 43   GLU A O   1 
ATOM   336  C CB  . GLU A 1 44 ? 9.472   27.185  6.375   1.00 15.73 ? 43   GLU A CB  1 
ATOM   337  C CG  . GLU A 1 44 ? 8.785   27.932  5.243   1.00 24.14 ? 43   GLU A CG  1 
ATOM   338  C CD  . GLU A 1 44 ? 8.398   29.350  5.620   1.00 36.99 ? 43   GLU A CD  1 
ATOM   339  O OE1 . GLU A 1 44 ? 8.482   29.695  6.817   1.00 40.21 ? 43   GLU A OE1 1 
ATOM   340  O OE2 . GLU A 1 44 ? 7.971   30.107  4.724   1.00 34.88 ? 43   GLU A OE2 1 
ATOM   341  N N   . HIS A 1 45 ? 7.800   24.715  4.812   1.00 12.45 ? 44   HIS A N   1 
ATOM   342  C CA  . HIS A 1 45 ? 6.472   24.149  4.589   1.00 12.58 ? 44   HIS A CA  1 
ATOM   343  C C   . HIS A 1 45 ? 6.511   22.664  4.261   1.00 16.53 ? 44   HIS A C   1 
ATOM   344  O O   . HIS A 1 45 ? 5.528   22.099  3.777   1.00 14.57 ? 44   HIS A O   1 
ATOM   345  C CB  . HIS A 1 45 ? 5.735   24.912  3.487   1.00 13.71 ? 44   HIS A CB  1 
ATOM   346  C CG  . HIS A 1 45 ? 5.452   26.340  3.833   1.00 17.51 ? 44   HIS A CG  1 
ATOM   347  N ND1 . HIS A 1 45 ? 5.362   27.333  2.880   1.00 19.98 ? 44   HIS A ND1 1 
ATOM   348  C CD2 . HIS A 1 45 ? 5.224   26.940  5.024   1.00 19.77 ? 44   HIS A CD2 1 
ATOM   349  C CE1 . HIS A 1 45 ? 5.114   28.486  3.473   1.00 19.67 ? 44   HIS A CE1 1 
ATOM   350  N NE2 . HIS A 1 45 ? 5.027   28.278  4.774   1.00 19.76 ? 44   HIS A NE2 1 
ATOM   351  N N   . CYS A 1 46 ? 7.650   22.034  4.521   1.00 15.69 ? 45   CYS A N   1 
ATOM   352  C CA  . CYS A 1 46 ? 7.791   20.605  4.279   1.00 17.34 ? 45   CYS A CA  1 
ATOM   353  C C   . CYS A 1 46 ? 7.363   19.804  5.500   1.00 18.45 ? 45   CYS A C   1 
ATOM   354  O O   . CYS A 1 46 ? 8.189   19.272  6.243   1.00 19.03 ? 45   CYS A O   1 
ATOM   355  C CB  . CYS A 1 46 ? 9.214   20.263  3.846   1.00 19.54 ? 45   CYS A CB  1 
ATOM   356  S SG  . CYS A 1 46 ? 9.626   20.964  2.231   1.00 24.65 ? 45   CYS A SG  1 
ATOM   357  N N   . ASN A 1 47 ? 6.057   19.815  5.742   1.00 12.96 ? 46   ASN A N   1 
ATOM   358  C CA  . ASN A 1 47 ? 5.445   19.093  6.851   1.00 11.46 ? 46   ASN A CA  1 
ATOM   359  C C   . ASN A 1 47 ? 3.977   18.864  6.480   1.00 13.45 ? 46   ASN A C   1 
ATOM   360  O O   . ASN A 1 47 ? 3.465   19.486  5.549   1.00 11.28 ? 46   ASN A O   1 
ATOM   361  C CB  . ASN A 1 47 ? 5.563   19.897  8.154   1.00 13.47 ? 46   ASN A CB  1 
ATOM   362  C CG  . ASN A 1 47 ? 5.002   21.301  8.030   1.00 23.60 ? 46   ASN A CG  1 
ATOM   363  O OD1 . ASN A 1 47 ? 3.790   21.495  8.038   1.00 16.88 ? 46   ASN A OD1 1 
ATOM   364  N ND2 . ASN A 1 47 ? 5.886   22.294  7.978   1.00 15.56 ? 46   ASN A ND2 1 
ATOM   365  N N   . PHE A 1 48 ? 3.334   17.900  7.132   1.00 10.22 ? 47   PHE A N   1 
ATOM   366  C CA  . PHE A 1 48 ? 1.962   17.545  6.791   1.00 9.11  ? 47   PHE A CA  1 
ATOM   367  C C   . PHE A 1 48 ? 0.992   18.722  6.884   1.00 12.26 ? 47   PHE A C   1 
ATOM   368  O O   . PHE A 1 48 ? 0.114   18.881  6.038   1.00 10.92 ? 47   PHE A O   1 
ATOM   369  C CB  . PHE A 1 48 ? 1.470   16.380  7.656   1.00 11.29 ? 47   PHE A CB  1 
ATOM   370  C CG  . PHE A 1 48 ? 1.959   15.037  7.194   1.00 12.97 ? 47   PHE A CG  1 
ATOM   371  C CD1 . PHE A 1 48 ? 1.600   14.544  5.951   1.00 16.06 ? 47   PHE A CD1 1 
ATOM   372  C CD2 . PHE A 1 48 ? 2.825   14.293  7.982   1.00 16.78 ? 47   PHE A CD2 1 
ATOM   373  C CE1 . PHE A 1 48 ? 2.066   13.319  5.516   1.00 17.11 ? 47   PHE A CE1 1 
ATOM   374  C CE2 . PHE A 1 48 ? 3.293   13.064  7.553   1.00 19.20 ? 47   PHE A CE2 1 
ATOM   375  C CZ  . PHE A 1 48 ? 2.922   12.583  6.314   1.00 16.78 ? 47   PHE A CZ  1 
ATOM   376  N N   . ASN A 1 49 ? 1.121   19.529  7.930   1.00 9.88  ? 48   ASN A N   1 
ATOM   377  C CA  . ASN A 1 49 ? 0.190   20.636  8.117   1.00 10.07 ? 48   ASN A CA  1 
ATOM   378  C C   . ASN A 1 49 ? 0.190   21.580  6.918   1.00 13.54 ? 48   ASN A C   1 
ATOM   379  O O   . ASN A 1 49 ? -0.866  21.939  6.396   1.00 13.03 ? 48   ASN A O   1 
ATOM   380  C CB  . ASN A 1 49 ? 0.511   21.422  9.386   1.00 12.88 ? 48   ASN A CB  1 
ATOM   381  C CG  . ASN A 1 49 ? -0.491  22.525  9.646   1.00 27.78 ? 48   ASN A CG  1 
ATOM   382  O OD1 . ASN A 1 49 ? -0.330  23.648  9.165   1.00 27.31 ? 48   ASN A OD1 1 
ATOM   383  N ND2 . ASN A 1 49 ? -1.611  22.165  10.258  1.00 24.39 ? 48   ASN A ND2 1 
ATOM   384  N N   . ASP A 1 50 ? 1.378   21.992  6.493   1.00 10.51 ? 49   ASP A N   1 
ATOM   385  C CA  . ASP A 1 50 ? 1.489   22.959  5.406   1.00 10.69 ? 49   ASP A CA  1 
ATOM   386  C C   . ASP A 1 50 ? 1.200   22.378  4.023   1.00 13.16 ? 49   ASP A C   1 
ATOM   387  O O   . ASP A 1 50 ? 0.611   23.050  3.175   1.00 12.67 ? 49   ASP A O   1 
ATOM   388  C CB  . ASP A 1 50 ? 2.841   23.670  5.449   1.00 13.40 ? 49   ASP A CB  1 
ATOM   389  C CG  . ASP A 1 50 ? 3.063   24.414  6.755   1.00 24.16 ? 49   ASP A CG  1 
ATOM   390  O OD1 . ASP A 1 50 ? 2.083   24.604  7.511   1.00 27.36 ? 49   ASP A OD1 1 
ATOM   391  O OD2 . ASP A 1 50 ? 4.216   24.805  7.029   1.00 22.43 ? 49   ASP A OD2 1 
ATOM   392  N N   . VAL A 1 51 ? 1.564   21.116  3.810   1.00 9.80  ? 50   VAL A N   1 
ATOM   393  C CA  . VAL A 1 51 ? 1.296   20.461  2.533   1.00 8.74  ? 50   VAL A CA  1 
ATOM   394  C C   . VAL A 1 51 ? -0.191  20.172  2.336   1.00 11.58 ? 50   VAL A C   1 
ATOM   395  O O   . VAL A 1 51 ? -0.760  20.502  1.296   1.00 10.27 ? 50   VAL A O   1 
ATOM   396  C CB  . VAL A 1 51 ? 2.153   19.193  2.338   1.00 11.77 ? 50   VAL A CB  1 
ATOM   397  C CG1 . VAL A 1 51 ? 1.704   18.437  1.093   1.00 11.16 ? 50   VAL A CG1 1 
ATOM   398  C CG2 . VAL A 1 51 ? 3.628   19.562  2.235   1.00 11.66 ? 50   VAL A CG2 1 
ATOM   399  N N   . THR A 1 52 ? -0.815  19.543  3.328   1.00 9.03  ? 51   THR A N   1 
ATOM   400  C CA  . THR A 1 52 ? -2.236  19.210  3.231   1.00 9.32  ? 51   THR A CA  1 
ATOM   401  C C   . THR A 1 52 ? -3.100  20.460  3.078   1.00 13.27 ? 51   THR A C   1 
ATOM   402  O O   . THR A 1 52 ? -3.993  20.508  2.234   1.00 13.18 ? 51   THR A O   1 
ATOM   403  C CB  . THR A 1 52 ? -2.720  18.329  4.415   1.00 14.05 ? 51   THR A CB  1 
ATOM   404  O OG1 . THR A 1 52 ? -2.554  19.038  5.646   1.00 12.66 ? 51   THR A OG1 1 
ATOM   405  C CG2 . THR A 1 52 ? -1.943  17.020  4.481   1.00 13.12 ? 51   THR A CG2 1 
ATOM   406  N N   . THR A 1 53 ? -2.852  21.463  3.913   1.00 11.05 ? 52   THR A N   1 
ATOM   407  C CA  . THR A 1 53 ? -3.658  22.677  3.883   1.00 11.35 ? 52   THR A CA  1 
ATOM   408  C C   . THR A 1 53 ? -3.517  23.471  2.589   1.00 15.87 ? 52   THR A C   1 
ATOM   409  O O   . THR A 1 53 ? -4.497  24.000  2.077   1.00 14.27 ? 52   THR A O   1 
ATOM   410  C CB  . THR A 1 53 ? -3.435  23.559  5.126   1.00 16.94 ? 52   THR A CB  1 
ATOM   411  O OG1 . THR A 1 53 ? -2.066  23.975  5.181   1.00 20.01 ? 52   THR A OG1 1 
ATOM   412  C CG2 . THR A 1 53 ? -3.784  22.791  6.397   1.00 15.11 ? 52   THR A CG2 1 
ATOM   413  N N   . ARG A 1 54 ? -2.299  23.559  2.063   1.00 13.70 ? 53   ARG A N   1 
ATOM   414  C CA  . ARG A 1 54 ? -2.063  24.340  0.851   1.00 12.85 ? 53   ARG A CA  1 
ATOM   415  C C   . ARG A 1 54 ? -2.582  23.662  -0.414  1.00 17.25 ? 53   ARG A C   1 
ATOM   416  O O   . ARG A 1 54 ? -3.142  24.318  -1.294  1.00 16.39 ? 53   ARG A O   1 
ATOM   417  C CB  . ARG A 1 54 ? -0.586  24.727  0.727   1.00 12.80 ? 53   ARG A CB  1 
ATOM   418  C CG  . ARG A 1 54 ? -0.177  25.794  1.735   1.00 16.52 ? 53   ARG A CG  1 
ATOM   419  C CD  . ARG A 1 54 ? 1.317   26.081  1.741   1.00 23.35 ? 53   ARG A CD  1 
ATOM   420  N NE  . ARG A 1 54 ? 1.662   26.973  2.845   1.00 29.07 ? 53   ARG A NE  1 
ATOM   421  C CZ  . ARG A 1 54 ? 1.765   28.294  2.738   1.00 43.95 ? 53   ARG A CZ  1 
ATOM   422  N NH1 . ARG A 1 54 ? 1.634   28.879  1.554   1.00 37.43 ? 53   ARG A NH1 1 
ATOM   423  N NH2 . ARG A 1 54 ? 2.029   29.030  3.809   1.00 30.53 ? 53   ARG A NH2 1 
ATOM   424  N N   . LEU A 1 55 ? -2.491  22.336  -0.453  1.00 13.61 ? 54   LEU A N   1 
ATOM   425  C CA  . LEU A 1 55 ? -2.990  21.570  -1.586  1.00 14.11 ? 54   LEU A CA  1 
ATOM   426  C C   . LEU A 1 55 ? -4.450  21.171  -1.396  1.00 18.69 ? 54   LEU A C   1 
ATOM   427  O O   . LEU A 1 55 ? -5.077  20.627  -2.310  1.00 18.16 ? 54   LEU A O   1 
ATOM   428  C CB  . LEU A 1 55 ? -2.141  20.317  -1.787  1.00 14.25 ? 54   LEU A CB  1 
ATOM   429  C CG  . LEU A 1 55 ? -0.656  20.540  -2.086  1.00 19.56 ? 54   LEU A CG  1 
ATOM   430  C CD1 . LEU A 1 55 ? 0.041   19.213  -2.331  1.00 20.77 ? 54   LEU A CD1 1 
ATOM   431  C CD2 . LEU A 1 55 ? -0.490  21.468  -3.281  1.00 22.02 ? 54   LEU A CD2 1 
ATOM   432  N N   . ARG A 1 56 ? -4.969  21.396  -0.193  1.00 15.41 ? 55   ARG A N   1 
ATOM   433  C CA  . ARG A 1 56 ? -6.320  20.970  0.155   1.00 14.85 ? 55   ARG A CA  1 
ATOM   434  C C   . ARG A 1 56 ? -6.486  19.470  -0.081  1.00 17.98 ? 55   ARG A C   1 
ATOM   435  O O   . ARG A 1 56 ? -7.460  19.011  -0.682  1.00 17.86 ? 55   ARG A O   1 
ATOM   436  C CB  . ARG A 1 56 ? -7.368  21.801  -0.594  1.00 14.64 ? 55   ARG A CB  1 
ATOM   437  C CG  . ARG A 1 56 ? -7.320  23.282  -0.214  1.00 21.44 ? 55   ARG A CG  1 
ATOM   438  C CD  . ARG A 1 56 ? -8.274  24.130  -1.042  1.00 28.75 ? 55   ARG A CD  1 
ATOM   439  N NE  . ARG A 1 56 ? -9.629  24.126  -0.496  1.00 35.79 ? 55   ARG A NE  1 
ATOM   440  C CZ  . ARG A 1 56 ? -10.082 24.998  0.400   1.00 46.69 ? 55   ARG A CZ  1 
ATOM   441  N NH1 . ARG A 1 56 ? -9.287  25.950  0.870   1.00 35.54 ? 55   ARG A NH1 1 
ATOM   442  N NH2 . ARG A 1 56 ? -11.335 24.918  0.827   1.00 33.68 ? 55   ARG A NH2 1 
ATOM   443  N N   . GLU A 1 57 ? -5.502  18.714  0.394   1.00 12.95 ? 56   GLU A N   1 
ATOM   444  C CA  . GLU A 1 57 ? -5.525  17.264  0.309   1.00 13.06 ? 56   GLU A CA  1 
ATOM   445  C C   . GLU A 1 57 ? -5.422  16.723  1.727   1.00 16.27 ? 56   GLU A C   1 
ATOM   446  O O   . GLU A 1 57 ? -4.917  17.399  2.623   1.00 16.57 ? 56   GLU A O   1 
ATOM   447  C CB  . GLU A 1 57 ? -4.356  16.752  -0.540  1.00 14.56 ? 56   GLU A CB  1 
ATOM   448  C CG  . GLU A 1 57 ? -4.450  17.130  -2.012  1.00 21.96 ? 56   GLU A CG  1 
ATOM   449  C CD  . GLU A 1 57 ? -5.300  16.162  -2.813  1.00 32.70 ? 56   GLU A CD  1 
ATOM   450  O OE1 . GLU A 1 57 ? -5.806  15.186  -2.221  1.00 22.85 ? 56   GLU A OE1 1 
ATOM   451  O OE2 . GLU A 1 57 ? -5.454  16.371  -4.036  1.00 24.92 ? 56   GLU A OE2 1 
ATOM   452  N N   . ASN A 1 58 ? -5.972  15.539  1.949   1.00 12.09 ? 57   ASN A N   1 
ATOM   453  C CA  . ASN A 1 58 ? -5.992  14.965  3.285   1.00 11.96 ? 57   ASN A CA  1 
ATOM   454  C C   . ASN A 1 58 ? -4.928  13.877  3.428   1.00 14.46 ? 57   ASN A C   1 
ATOM   455  O O   . ASN A 1 58 ? -3.879  14.098  4.040   1.00 14.40 ? 57   ASN A O   1 
ATOM   456  C CB  . ASN A 1 58 ? -7.394  14.437  3.608   1.00 13.29 ? 57   ASN A CB  1 
ATOM   457  C CG  . ASN A 1 58 ? -7.494  13.854  5.002   1.00 14.59 ? 57   ASN A CG  1 
ATOM   458  O OD1 . ASN A 1 58 ? -6.483  13.624  5.662   1.00 13.74 ? 57   ASN A OD1 1 
ATOM   459  N ND2 . ASN A 1 58 ? -8.716  13.559  5.435   1.00 9.52  ? 57   ASN A ND2 1 
ATOM   460  N N   . GLU A 1 59 ? -5.184  12.714  2.842   1.00 10.86 ? 58   GLU A N   1 
ATOM   461  C CA  . GLU A 1 59 ? -4.206  11.631  2.870   1.00 11.50 ? 58   GLU A CA  1 
ATOM   462  C C   . GLU A 1 59 ? -3.156  11.873  1.797   1.00 13.14 ? 58   GLU A C   1 
ATOM   463  O O   . GLU A 1 59 ? -3.491  12.086  0.630   1.00 13.02 ? 58   GLU A O   1 
ATOM   464  C CB  . GLU A 1 59 ? -4.877  10.278  2.630   1.00 13.49 ? 58   GLU A CB  1 
ATOM   465  C CG  . GLU A 1 59 ? -5.606  9.719   3.841   1.00 26.38 ? 58   GLU A CG  1 
ATOM   466  C CD  . GLU A 1 59 ? -4.662  9.230   4.926   1.00 38.71 ? 58   GLU A CD  1 
ATOM   467  O OE1 . GLU A 1 59 ? -3.490  8.929   4.617   1.00 38.00 ? 58   GLU A OE1 1 
ATOM   468  O OE2 . GLU A 1 59 ? -5.107  9.110   6.085   1.00 33.91 ? 58   GLU A OE2 1 
ATOM   469  N N   . LEU A 1 60 ? -1.887  11.819  2.188   1.00 9.53  ? 59   LEU A N   1 
ATOM   470  C CA  . LEU A 1 60 ? -0.804  12.017  1.232   1.00 9.37  ? 59   LEU A CA  1 
ATOM   471  C C   . LEU A 1 60 ? 0.547   11.632  1.813   1.00 12.51 ? 59   LEU A C   1 
ATOM   472  O O   . LEU A 1 60 ? 0.699   11.474  3.025   1.00 12.72 ? 59   LEU A O   1 
ATOM   473  C CB  . LEU A 1 60 ? -0.762  13.480  0.765   1.00 9.18  ? 59   LEU A CB  1 
ATOM   474  C CG  . LEU A 1 60 ? -0.472  14.559  1.817   1.00 11.61 ? 59   LEU A CG  1 
ATOM   475  C CD1 . LEU A 1 60 ? 1.031   14.739  2.028   1.00 11.07 ? 59   LEU A CD1 1 
ATOM   476  C CD2 . LEU A 1 60 ? -1.121  15.888  1.424   1.00 13.36 ? 59   LEU A CD2 1 
ATOM   477  N N   . THR A 1 61 ? 1.531   11.507  0.929   1.00 10.09 ? 60   THR A N   1 
ATOM   478  C CA  . THR A 1 61 ? 2.930   11.391  1.321   1.00 10.31 ? 60   THR A CA  1 
ATOM   479  C C   . THR A 1 61 ? 3.668   12.464  0.533   1.00 11.39 ? 60   THR A C   1 
ATOM   480  O O   . THR A 1 61 ? 3.246   12.831  -0.560  1.00 10.40 ? 60   THR A O   1 
ATOM   481  C CB  . THR A 1 61 ? 3.508   9.998   1.015   1.00 19.83 ? 60   THR A CB  1 
ATOM   482  O OG1 . THR A 1 61 ? 3.249   9.659   -0.352  1.00 20.30 ? 60   THR A OG1 1 
ATOM   483  C CG2 . THR A 1 61 ? 2.893   8.953   1.930   1.00 22.79 ? 60   THR A CG2 1 
ATOM   484  N N   . TYR A 1 62 ? 4.715   13.026  1.121   1.00 8.89  ? 61   TYR A N   1 
ATOM   485  C CA  . TYR A 1 62 ? 5.448   14.093  0.455   1.00 8.36  ? 61   TYR A CA  1 
ATOM   486  C C   . TYR A 1 62 ? 6.954   13.889  0.534   1.00 11.19 ? 61   TYR A C   1 
ATOM   487  O O   . TYR A 1 62 ? 7.459   13.161  1.394   1.00 10.15 ? 61   TYR A O   1 
ATOM   488  C CB  . TYR A 1 62 ? 5.059   15.456  1.032   1.00 10.43 ? 61   TYR A CB  1 
ATOM   489  C CG  . TYR A 1 62 ? 5.483   15.643  2.473   1.00 12.06 ? 61   TYR A CG  1 
ATOM   490  C CD1 . TYR A 1 62 ? 6.724   16.177  2.790   1.00 13.79 ? 61   TYR A CD1 1 
ATOM   491  C CD2 . TYR A 1 62 ? 4.666   15.218  3.514   1.00 13.51 ? 61   TYR A CD2 1 
ATOM   492  C CE1 . TYR A 1 62 ? 7.126   16.309  4.107   1.00 16.10 ? 61   TYR A CE1 1 
ATOM   493  C CE2 . TYR A 1 62 ? 5.063   15.332  4.829   1.00 15.03 ? 61   TYR A CE2 1 
ATOM   494  C CZ  . TYR A 1 62 ? 6.285   15.893  5.124   1.00 22.54 ? 61   TYR A CZ  1 
ATOM   495  O OH  . TYR A 1 62 ? 6.668   16.007  6.440   1.00 24.09 ? 61   TYR A OH  1 
ATOM   496  N N   . TYR A 1 63 ? 7.667   14.539  -0.377  1.00 8.30  ? 62   TYR A N   1 
ATOM   497  C CA  . TYR A 1 63 ? 9.118   14.458  -0.430  1.00 8.58  ? 62   TYR A CA  1 
ATOM   498  C C   . TYR A 1 63 ? 9.647   15.820  -0.840  1.00 13.14 ? 62   TYR A C   1 
ATOM   499  O O   . TYR A 1 63 ? 9.207   16.387  -1.840  1.00 10.93 ? 62   TYR A O   1 
ATOM   500  C CB  . TYR A 1 63 ? 9.565   13.408  -1.451  1.00 10.16 ? 62   TYR A CB  1 
ATOM   501  C CG  . TYR A 1 63 ? 11.067  13.237  -1.524  1.00 14.07 ? 62   TYR A CG  1 
ATOM   502  C CD1 . TYR A 1 63 ? 11.726  12.336  -0.692  1.00 17.45 ? 62   TYR A CD1 1 
ATOM   503  C CD2 . TYR A 1 63 ? 11.830  13.987  -2.412  1.00 14.59 ? 62   TYR A CD2 1 
ATOM   504  C CE1 . TYR A 1 63 ? 13.102  12.183  -0.751  1.00 20.17 ? 62   TYR A CE1 1 
ATOM   505  C CE2 . TYR A 1 63 ? 13.204  13.835  -2.482  1.00 16.17 ? 62   TYR A CE2 1 
ATOM   506  C CZ  . TYR A 1 63 ? 13.835  12.937  -1.645  1.00 24.64 ? 62   TYR A CZ  1 
ATOM   507  O OH  . TYR A 1 63 ? 15.203  12.786  -1.712  1.00 28.11 ? 62   TYR A OH  1 
ATOM   508  N N   . CYS A 1 64 ? 10.529  16.373  -0.017  1.00 11.93 ? 63   CYS A N   1 
ATOM   509  C CA  . CYS A 1 64 ? 11.131  17.669  -0.287  1.00 14.67 ? 63   CYS A CA  1 
ATOM   510  C C   . CYS A 1 64 ? 12.630  17.476  -0.482  1.00 14.81 ? 63   CYS A C   1 
ATOM   511  O O   . CYS A 1 64 ? 13.251  16.648  0.191   1.00 12.29 ? 63   CYS A O   1 
ATOM   512  C CB  . CYS A 1 64 ? 10.899  18.614  0.892   1.00 18.40 ? 63   CYS A CB  1 
ATOM   513  S SG  . CYS A 1 64 ? 9.292   19.435  0.940   1.00 24.48 ? 63   CYS A SG  1 
ATOM   514  N N   . CYS A 1 65 ? 13.217  18.280  -1.359  1.00 11.45 ? 64   CYS A N   1 
ATOM   515  C CA  . CYS A 1 65 ? 14.644  18.184  -1.647  1.00 11.58 ? 64   CYS A CA  1 
ATOM   516  C C   . CYS A 1 65 ? 15.149  19.530  -2.175  1.00 15.71 ? 64   CYS A C   1 
ATOM   517  O O   . CYS A 1 65 ? 14.354  20.445  -2.406  1.00 13.64 ? 64   CYS A O   1 
ATOM   518  C CB  . CYS A 1 65 ? 14.882  17.076  -2.669  1.00 12.06 ? 64   CYS A CB  1 
ATOM   519  S SG  . CYS A 1 65 ? 13.792  17.199  -4.102  1.00 15.90 ? 64   CYS A SG  1 
ATOM   520  N N   . LYS A 1 66 ? 16.466  19.675  -2.310  1.00 13.30 ? 65   LYS A N   1 
ATOM   521  C CA  . LYS A 1 66 ? 17.031  20.955  -2.727  1.00 13.53 ? 65   LYS A CA  1 
ATOM   522  C C   . LYS A 1 66 ? 18.061  20.882  -3.849  1.00 18.29 ? 65   LYS A C   1 
ATOM   523  O O   . LYS A 1 66 ? 18.901  21.772  -3.989  1.00 18.46 ? 65   LYS A O   1 
ATOM   524  C CB  . LYS A 1 66 ? 17.584  21.728  -1.528  1.00 16.77 ? 65   LYS A CB  1 
ATOM   525  C CG  . LYS A 1 66 ? 18.617  20.976  -0.699  1.00 21.71 ? 65   LYS A CG  1 
ATOM   526  C CD  . LYS A 1 66 ? 19.106  21.858  0.447   1.00 29.18 ? 65   LYS A CD  1 
ATOM   527  C CE  . LYS A 1 66 ? 19.961  21.093  1.440   1.00 29.90 ? 65   LYS A CE  1 
ATOM   528  N NZ  . LYS A 1 66 ? 20.335  21.959  2.595   1.00 37.30 ? 65   LYS A NZ  1 
ATOM   529  N N   . LYS A 1 67 ? 17.934  19.866  -4.696  1.00 14.81 ? 66   LYS A N   1 
ATOM   530  C CA  . LYS A 1 67 ? 18.801  19.712  -5.860  1.00 14.09 ? 66   LYS A CA  1 
ATOM   531  C C   . LYS A 1 67 ? 17.952  19.847  -7.125  1.00 15.16 ? 66   LYS A C   1 
ATOM   532  O O   . LYS A 1 67 ? 16.787  19.453  -7.138  1.00 12.93 ? 66   LYS A O   1 
ATOM   533  C CB  . LYS A 1 67 ? 19.494  18.346  -5.832  1.00 16.28 ? 66   LYS A CB  1 
ATOM   534  C CG  . LYS A 1 67 ? 20.532  18.186  -4.726  1.00 23.00 ? 66   LYS A CG  1 
ATOM   535  C CD  . LYS A 1 67 ? 21.394  16.945  -4.941  1.00 26.36 ? 66   LYS A CD  1 
ATOM   536  C CE  . LYS A 1 67 ? 20.581  15.662  -4.789  1.00 33.78 ? 66   LYS A CE  1 
ATOM   537  N NZ  . LYS A 1 67 ? 21.403  14.433  -5.009  1.00 35.90 ? 66   LYS A NZ  1 
ATOM   538  N N   . ASP A 1 68 ? 18.523  20.441  -8.169  1.00 11.37 ? 67   ASP A N   1 
ATOM   539  C CA  . ASP A 1 68 ? 17.793  20.675  -9.414  1.00 10.95 ? 67   ASP A CA  1 
ATOM   540  C C   . ASP A 1 68 ? 17.012  19.448  -9.888  1.00 13.75 ? 67   ASP A C   1 
ATOM   541  O O   . ASP A 1 68 ? 17.570  18.356  -10.016 1.00 13.37 ? 67   ASP A O   1 
ATOM   542  C CB  . ASP A 1 68 ? 18.746  21.135  -10.520 1.00 12.67 ? 67   ASP A CB  1 
ATOM   543  C CG  . ASP A 1 68 ? 19.263  22.548  -10.298 1.00 19.91 ? 67   ASP A CG  1 
ATOM   544  O OD1 . ASP A 1 68 ? 18.629  23.311  -9.538  1.00 16.43 ? 67   ASP A OD1 1 
ATOM   545  O OD2 . ASP A 1 68 ? 20.329  22.881  -10.856 1.00 27.05 ? 67   ASP A OD2 1 
ATOM   546  N N   . LEU A 1 69 ? 15.731  19.655  -10.188 1.00 10.10 ? 68   LEU A N   1 
ATOM   547  C CA  . LEU A 1 69 ? 14.859  18.607  -10.722 1.00 9.40  ? 68   LEU A CA  1 
ATOM   548  C C   . LEU A 1 69 ? 14.823  17.347  -9.859  1.00 12.01 ? 68   LEU A C   1 
ATOM   549  O O   . LEU A 1 69 ? 14.565  16.250  -10.355 1.00 11.92 ? 68   LEU A O   1 
ATOM   550  C CB  . LEU A 1 69 ? 15.241  18.266  -12.170 1.00 9.50  ? 68   LEU A CB  1 
ATOM   551  C CG  . LEU A 1 69 ? 15.299  19.432  -13.168 1.00 13.80 ? 68   LEU A CG  1 
ATOM   552  C CD1 . LEU A 1 69 ? 15.492  18.927  -14.596 1.00 14.15 ? 68   LEU A CD1 1 
ATOM   553  C CD2 . LEU A 1 69 ? 14.062  20.326  -13.077 1.00 14.61 ? 68   LEU A CD2 1 
ATOM   554  N N   . CYS A 1 70 ? 15.002  17.526  -8.555  1.00 9.03  ? 69   CYS A N   1 
ATOM   555  C CA  . CYS A 1 70 ? 15.016  16.411  -7.615  1.00 9.39  ? 69   CYS A CA  1 
ATOM   556  C C   . CYS A 1 70 ? 13.623  15.875  -7.271  1.00 10.64 ? 69   CYS A C   1 
ATOM   557  O O   . CYS A 1 70 ? 13.500  14.777  -6.723  1.00 10.12 ? 69   CYS A O   1 
ATOM   558  C CB  . CYS A 1 70 ? 15.754  16.809  -6.336  1.00 11.04 ? 69   CYS A CB  1 
ATOM   559  S SG  . CYS A 1 70 ? 14.961  18.172  -5.443  1.00 16.10 ? 69   CYS A SG  1 
ATOM   560  N N   . ASN A 1 71 ? 12.582  16.643  -7.595  1.00 6.73  ? 70   ASN A N   1 
ATOM   561  C CA  . ASN A 1 71 ? 11.211  16.254  -7.257  1.00 5.77  ? 70   ASN A CA  1 
ATOM   562  C C   . ASN A 1 71 ? 10.532  15.393  -8.309  1.00 9.10  ? 70   ASN A C   1 
ATOM   563  O O   . ASN A 1 71 ? 9.399   15.667  -8.704  1.00 8.37  ? 70   ASN A O   1 
ATOM   564  C CB  . ASN A 1 71 ? 10.342  17.463  -6.869  1.00 5.06  ? 70   ASN A CB  1 
ATOM   565  C CG  . ASN A 1 71 ? 10.140  18.444  -8.011  1.00 9.22  ? 70   ASN A CG  1 
ATOM   566  O OD1 . ASN A 1 71 ? 11.000  18.591  -8.877  1.00 7.75  ? 70   ASN A OD1 1 
ATOM   567  N ND2 . ASN A 1 71 ? 9.019   19.160  -7.986  1.00 6.01  ? 70   ASN A ND2 1 
ATOM   568  N N   . PHE A 1 72 ? 11.224  14.344  -8.754  1.00 8.06  ? 71   PHE A N   1 
ATOM   569  C CA  . PHE A 1 72 ? 10.635  13.392  -9.695  1.00 7.50  ? 71   PHE A CA  1 
ATOM   570  C C   . PHE A 1 72 ? 9.767   12.397  -8.923  1.00 9.76  ? 71   PHE A C   1 
ATOM   571  O O   . PHE A 1 72 ? 9.970   12.190  -7.724  1.00 7.70  ? 71   PHE A O   1 
ATOM   572  C CB  . PHE A 1 72 ? 11.711  12.677  -10.527 1.00 8.22  ? 71   PHE A CB  1 
ATOM   573  C CG  . PHE A 1 72 ? 12.784  12.020  -9.705  1.00 8.24  ? 71   PHE A CG  1 
ATOM   574  C CD1 . PHE A 1 72 ? 13.934  12.715  -9.354  1.00 10.36 ? 71   PHE A CD1 1 
ATOM   575  C CD2 . PHE A 1 72 ? 12.680  10.681  -9.354  1.00 8.86  ? 71   PHE A CD2 1 
ATOM   576  C CE1 . PHE A 1 72 ? 14.933  12.104  -8.614  1.00 10.86 ? 71   PHE A CE1 1 
ATOM   577  C CE2 . PHE A 1 72 ? 13.669  10.065  -8.607  1.00 11.09 ? 71   PHE A CE2 1 
ATOM   578  C CZ  . PHE A 1 72 ? 14.797  10.777  -8.237  1.00 9.78  ? 71   PHE A CZ  1 
ATOM   579  N N   . ASN A 1 73 ? 8.737   11.875  -9.586  1.00 6.83  ? 72   ASN A N   1 
ATOM   580  C CA  . ASN A 1 73 ? 7.703   11.076  -8.923  1.00 6.25  ? 72   ASN A CA  1 
ATOM   581  C C   . ASN A 1 73 ? 8.223   9.819   -8.233  1.00 11.48 ? 72   ASN A C   1 
ATOM   582  O O   . ASN A 1 73 ? 7.686   9.392   -7.210  1.00 11.74 ? 72   ASN A O   1 
ATOM   583  C CB  . ASN A 1 73 ? 6.596   10.711  -9.915  1.00 7.59  ? 72   ASN A CB  1 
ATOM   584  C CG  . ASN A 1 73 ? 5.892   11.934  -10.482 1.00 15.77 ? 72   ASN A CG  1 
ATOM   585  O OD1 . ASN A 1 73 ? 6.142   13.064  -10.058 1.00 10.78 ? 72   ASN A OD1 1 
ATOM   586  N ND2 . ASN A 1 73 ? 5.023   11.714  -11.462 1.00 11.67 ? 72   ASN A ND2 1 
ATOM   587  N N   . GLU A 1 74 ? 9.254   9.216   -8.813  1.00 8.64  ? 73   GLU A N   1 
ATOM   588  C CA  . GLU A 1 74 ? 9.818   7.988   -8.277  1.00 9.25  ? 73   GLU A CA  1 
ATOM   589  C C   . GLU A 1 74 ? 10.518  8.173   -6.928  1.00 11.94 ? 73   GLU A C   1 
ATOM   590  O O   . GLU A 1 74 ? 10.931  7.200   -6.301  1.00 10.49 ? 73   GLU A O   1 
ATOM   591  C CB  . GLU A 1 74 ? 10.737  7.330   -9.310  1.00 10.08 ? 73   GLU A CB  1 
ATOM   592  C CG  . GLU A 1 74 ? 9.981   6.753   -10.504 1.00 12.68 ? 73   GLU A CG  1 
ATOM   593  C CD  . GLU A 1 74 ? 9.869   7.722   -11.667 1.00 20.35 ? 73   GLU A CD  1 
ATOM   594  O OE1 . GLU A 1 74 ? 10.359  8.868   -11.555 1.00 15.52 ? 73   GLU A OE1 1 
ATOM   595  O OE2 . GLU A 1 74 ? 9.292   7.329   -12.702 1.00 17.24 ? 73   GLU A OE2 1 
ATOM   596  N N   . GLN A 1 75 ? 10.555  9.408   -6.434  1.00 8.95  ? 74   GLN A N   1 
ATOM   597  C CA  . GLN A 1 75 ? 11.097  9.666   -5.103  1.00 9.00  ? 74   GLN A CA  1 
ATOM   598  C C   . GLN A 1 75 ? 10.164  9.069   -4.054  1.00 13.75 ? 74   GLN A C   1 
ATOM   599  O O   . GLN A 1 75 ? 10.573  8.799   -2.925  1.00 12.66 ? 74   GLN A O   1 
ATOM   600  C CB  . GLN A 1 75 ? 11.269  11.171  -4.856  1.00 9.72  ? 74   GLN A CB  1 
ATOM   601  C CG  . GLN A 1 75 ? 12.386  11.831  -5.664  1.00 7.99  ? 74   GLN A CG  1 
ATOM   602  C CD  . GLN A 1 75 ? 13.767  11.637  -5.053  1.00 19.59 ? 74   GLN A CD  1 
ATOM   603  O OE1 . GLN A 1 75 ? 14.055  10.602  -4.450  1.00 14.26 ? 74   GLN A OE1 1 
ATOM   604  N NE2 . GLN A 1 75 ? 14.660  12.589  -5.306  1.00 12.86 ? 74   GLN A NE2 1 
ATOM   605  N N   . LEU A 1 76 ? 8.908   8.867   -4.447  1.00 12.55 ? 75   LEU A N   1 
ATOM   606  C CA  . LEU A 1 76 ? 7.895   8.271   -3.569  1.00 13.24 ? 75   LEU A CA  1 
ATOM   607  C C   . LEU A 1 76 ? 7.321   6.957   -4.110  1.00 21.98 ? 75   LEU A C   1 
ATOM   608  O O   . LEU A 1 76 ? 7.053   6.869   -5.337  1.00 21.94 ? 75   LEU A O   1 
ATOM   609  C CB  . LEU A 1 76 ? 6.753   9.250   -3.301  1.00 12.20 ? 75   LEU A CB  1 
ATOM   610  C CG  . LEU A 1 76 ? 7.001   10.439  -2.367  1.00 15.51 ? 75   LEU A CG  1 
ATOM   611  C CD1 . LEU A 1 76 ? 5.783   11.361  -2.348  1.00 15.22 ? 75   LEU A CD1 1 
ATOM   612  C CD2 . LEU A 1 76 ? 7.355   9.986   -0.955  1.00 15.68 ? 75   LEU A CD2 1 
ATOM   613  N N   . GLU A 1 77 ? 6.894   6.073   -3.188  1.00 24.17 ? 76   GLU A N   1 
ATOM   614  C CA  . GLU A 1 77 ? 6.498   4.700   -3.573  1.00 25.58 ? 76   GLU A CA  1 
ATOM   615  C C   . GLU A 1 77 ? 5.036   4.650   -4.006  1.00 32.14 ? 76   GLU A C   1 
ATOM   616  O O   . GLU A 1 77 ? 4.328   5.642   -3.871  1.00 33.89 ? 76   GLU A O   1 
ATOM   617  C CB  . GLU A 1 77 ? 6.795   3.694   -2.460  1.00 27.23 ? 76   GLU A CB  1 
ATOM   618  C CG  . GLU A 1 77 ? 8.303   3.516   -2.300  1.00 36.94 ? 76   GLU A CG  1 
ATOM   619  C CD  . GLU A 1 77 ? 8.645   2.597   -1.137  1.00 49.55 ? 76   GLU A CD  1 
ATOM   620  O OE1 . GLU A 1 77 ? 8.254   2.917   0.007   1.00 44.11 ? 76   GLU A OE1 1 
ATOM   621  O OE2 . GLU A 1 77 ? 9.277   1.539   -1.353  1.00 43.27 ? 76   GLU A OE2 1 
ATOM   622  N N   . ASN A 1 78 ? 4.510   3.526   -4.473  1.00 29.54 ? 77   ASN A N   1 
ATOM   623  C CA  . ASN A 1 78 ? 3.074   3.564   -4.795  1.00 29.13 ? 77   ASN A CA  1 
ATOM   624  C C   . ASN A 1 78 ? 2.233   3.090   -3.654  1.00 32.21 ? 77   ASN A C   1 
ATOM   625  O O   . ASN A 1 78 ? 2.020   3.900   -2.759  1.00 32.06 ? 77   ASN A O   1 
ATOM   626  C CB  . ASN A 1 78 ? 2.708   3.151   -6.228  1.00 28.28 ? 77   ASN A CB  1 
ATOM   627  C CG  . ASN A 1 78 ? 3.253   4.151   -7.262  1.00 36.34 ? 77   ASN A CG  1 
ATOM   628  O OD1 . ASN A 1 78 ? 3.060   5.375   -7.144  1.00 32.73 ? 77   ASN A OD1 1 
ATOM   629  N ND2 . ASN A 1 78 ? 3.721   3.615   -8.377  1.00 30.32 ? 77   ASN A ND2 1 
ATOM   630  N N   . MET B 1 1  ? 35.366  2.393   9.354   1.00 33.05 ? 0    MET B N   1 
ATOM   631  C CA  . MET B 1 1  ? 34.546  3.267   8.523   1.00 32.42 ? 0    MET B CA  1 
ATOM   632  C C   . MET B 1 1  ? 33.203  2.610   8.227   1.00 30.81 ? 0    MET B C   1 
ATOM   633  O O   . MET B 1 1  ? 33.128  1.657   7.462   1.00 32.41 ? 0    MET B O   1 
ATOM   634  C CB  . MET B 1 1  ? 35.282  3.614   7.229   1.00 35.78 ? 0    MET B CB  1 
ATOM   635  C CG  . MET B 1 1  ? 36.369  4.663   7.422   1.00 41.05 ? 0    MET B CG  1 
ATOM   636  S SD  . MET B 1 1  ? 37.605  4.697   6.112   1.00 47.34 ? 0    MET B SD  1 
ATOM   637  C CE  . MET B 1 1  ? 37.907  2.951   5.867   1.00 43.99 ? 0    MET B CE  1 
ATOM   638  N N   . LEU B 1 2  ? 32.152  3.117   8.861   1.00 21.34 ? 1    LEU B N   1 
ATOM   639  C CA  . LEU B 1 2  ? 30.827  2.505   8.817   1.00 17.57 ? 1    LEU B CA  1 
ATOM   640  C C   . LEU B 1 2  ? 29.920  3.039   7.703   1.00 17.13 ? 1    LEU B C   1 
ATOM   641  O O   . LEU B 1 2  ? 29.867  4.244   7.452   1.00 16.39 ? 1    LEU B O   1 
ATOM   642  C CB  . LEU B 1 2  ? 30.149  2.700   10.177  1.00 17.00 ? 1    LEU B CB  1 
ATOM   643  C CG  . LEU B 1 2  ? 28.779  2.088   10.465  1.00 19.85 ? 1    LEU B CG  1 
ATOM   644  C CD1 . LEU B 1 2  ? 28.824  0.571   10.353  1.00 19.47 ? 1    LEU B CD1 1 
ATOM   645  C CD2 . LEU B 1 2  ? 28.340  2.510   11.860  1.00 19.85 ? 1    LEU B CD2 1 
ATOM   646  N N   . GLN B 1 3  ? 29.156  2.135   7.095   1.00 10.94 ? 2    GLN B N   1 
ATOM   647  C CA  . GLN B 1 3  ? 28.161  2.498   6.085   1.00 10.05 ? 2    GLN B CA  1 
ATOM   648  C C   . GLN B 1 3  ? 26.786  2.482   6.757   1.00 11.83 ? 2    GLN B C   1 
ATOM   649  O O   . GLN B 1 3  ? 26.447  1.516   7.433   1.00 10.70 ? 2    GLN B O   1 
ATOM   650  C CB  . GLN B 1 3  ? 28.153  1.463   4.950   1.00 11.10 ? 2    GLN B CB  1 
ATOM   651  C CG  . GLN B 1 3  ? 29.364  1.505   4.030   1.00 18.88 ? 2    GLN B CG  1 
ATOM   652  C CD  . GLN B 1 3  ? 29.220  0.582   2.830   1.00 30.65 ? 2    GLN B CD  1 
ATOM   653  O OE1 . GLN B 1 3  ? 28.277  -0.205  2.745   1.00 27.70 ? 2    GLN B OE1 1 
ATOM   654  N NE2 . GLN B 1 3  ? 30.172  0.658   1.908   1.00 19.27 ? 2    GLN B NE2 1 
ATOM   655  N N   . CYS B 1 4  ? 25.996  3.537   6.561   1.00 8.79  ? 3    CYS B N   1 
ATOM   656  C CA  . CYS B 1 4  ? 24.637  3.589   7.106   1.00 8.93  ? 3    CYS B CA  1 
ATOM   657  C C   . CYS B 1 4  ? 23.668  4.125   6.056   1.00 12.04 ? 3    CYS B C   1 
ATOM   658  O O   . CYS B 1 4  ? 24.060  4.914   5.192   1.00 11.48 ? 3    CYS B O   1 
ATOM   659  C CB  . CYS B 1 4  ? 24.569  4.527   8.321   1.00 9.20  ? 3    CYS B CB  1 
ATOM   660  S SG  . CYS B 1 4  ? 25.659  4.132   9.716   1.00 12.77 ? 3    CYS B SG  1 
ATOM   661  N N   . TYR B 1 5  ? 22.381  3.827   6.222   1.00 8.81  ? 4    TYR B N   1 
ATOM   662  C CA  . TYR B 1 5  ? 21.366  4.526   5.442   1.00 8.45  ? 4    TYR B CA  1 
ATOM   663  C C   . TYR B 1 5  ? 21.254  5.892   6.111   1.00 11.15 ? 4    TYR B C   1 
ATOM   664  O O   . TYR B 1 5  ? 21.182  5.982   7.340   1.00 10.28 ? 4    TYR B O   1 
ATOM   665  C CB  . TYR B 1 5  ? 20.013  3.805   5.498   1.00 10.09 ? 4    TYR B CB  1 
ATOM   666  C CG  . TYR B 1 5  ? 19.988  2.483   4.760   1.00 10.84 ? 4    TYR B CG  1 
ATOM   667  C CD1 . TYR B 1 5  ? 20.289  2.415   3.404   1.00 12.82 ? 4    TYR B CD1 1 
ATOM   668  C CD2 . TYR B 1 5  ? 19.750  1.293   5.440   1.00 11.64 ? 4    TYR B CD2 1 
ATOM   669  C CE1 . TYR B 1 5  ? 20.335  1.193   2.740   1.00 12.57 ? 4    TYR B CE1 1 
ATOM   670  C CE2 . TYR B 1 5  ? 19.773  0.073   4.781   1.00 13.09 ? 4    TYR B CE2 1 
ATOM   671  C CZ  . TYR B 1 5  ? 20.075  0.029   3.433   1.00 19.60 ? 4    TYR B CZ  1 
ATOM   672  O OH  . TYR B 1 5  ? 20.109  -1.183  2.772   1.00 19.03 ? 4    TYR B OH  1 
ATOM   673  N N   . ASN B 1 6  ? 21.360  6.951   5.319   1.00 7.63  ? 5    ASN B N   1 
ATOM   674  C CA  . ASN B 1 6  ? 21.343  8.301   5.865   1.00 7.90  ? 5    ASN B CA  1 
ATOM   675  C C   . ASN B 1 6  ? 20.620  9.248   4.919   1.00 13.97 ? 5    ASN B C   1 
ATOM   676  O O   . ASN B 1 6  ? 21.043  9.439   3.780   1.00 14.32 ? 5    ASN B O   1 
ATOM   677  C CB  . ASN B 1 6  ? 22.768  8.804   6.116   1.00 10.02 ? 5    ASN B CB  1 
ATOM   678  C CG  . ASN B 1 6  ? 22.795  10.183  6.759   1.00 18.19 ? 5    ASN B CG  1 
ATOM   679  O OD1 . ASN B 1 6  ? 22.797  10.308  7.979   1.00 15.39 ? 5    ASN B OD1 1 
ATOM   680  N ND2 . ASN B 1 6  ? 22.759  11.225  5.933   1.00 18.57 ? 5    ASN B ND2 1 
ATOM   681  N N   . CYS B 1 7  ? 19.524  9.827   5.400   1.00 11.37 ? 6    CYS B N   1 
ATOM   682  C CA  . CYS B 1 7  ? 18.739  10.778  4.619   1.00 12.00 ? 6    CYS B CA  1 
ATOM   683  C C   . CYS B 1 7  ? 18.556  12.044  5.459   1.00 15.04 ? 6    CYS B C   1 
ATOM   684  O O   . CYS B 1 7  ? 18.367  11.963  6.670   1.00 13.47 ? 6    CYS B O   1 
ATOM   685  C CB  . CYS B 1 7  ? 17.381  10.161  4.252   1.00 13.01 ? 6    CYS B CB  1 
ATOM   686  S SG  . CYS B 1 7  ? 17.478  8.878   2.957   1.00 17.86 ? 6    CYS B SG  1 
ATOM   687  N N   . PRO B 1 8  ? 18.717  13.211  4.842   1.00 14.16 ? 7    PRO B N   1 
ATOM   688  C CA  . PRO B 1 8  ? 18.659  14.468  5.589   1.00 14.60 ? 7    PRO B CA  1 
ATOM   689  C C   . PRO B 1 8  ? 17.273  14.747  6.169   1.00 18.29 ? 7    PRO B C   1 
ATOM   690  O O   . PRO B 1 8  ? 17.143  15.390  7.210   1.00 19.01 ? 7    PRO B O   1 
ATOM   691  C CB  . PRO B 1 8  ? 19.036  15.524  4.542   1.00 16.07 ? 7    PRO B CB  1 
ATOM   692  C CG  . PRO B 1 8  ? 18.692  14.907  3.236   1.00 20.01 ? 7    PRO B CG  1 
ATOM   693  C CD  . PRO B 1 8  ? 18.934  13.430  3.400   1.00 14.94 ? 7    PRO B CD  1 
ATOM   694  N N   . ASN B 1 9  ? 16.243  14.232  5.506   1.00 14.78 ? 8    ASN B N   1 
ATOM   695  C CA  . ASN B 1 9  ? 14.867  14.400  5.963   1.00 14.73 ? 8    ASN B CA  1 
ATOM   696  C C   . ASN B 1 9  ? 14.229  13.029  6.164   1.00 16.77 ? 8    ASN B C   1 
ATOM   697  O O   . ASN B 1 9  ? 14.595  12.074  5.485   1.00 15.78 ? 8    ASN B O   1 
ATOM   698  C CB  . ASN B 1 9  ? 14.067  15.190  4.927   1.00 16.15 ? 8    ASN B CB  1 
ATOM   699  C CG  . ASN B 1 9  ? 14.663  16.554  4.653   1.00 27.98 ? 8    ASN B CG  1 
ATOM   700  O OD1 . ASN B 1 9  ? 14.860  17.347  5.571   1.00 21.07 ? 8    ASN B OD1 1 
ATOM   701  N ND2 . ASN B 1 9  ? 14.928  16.844  3.383   1.00 23.32 ? 8    ASN B ND2 1 
ATOM   702  N N   . PRO B 1 10 ? 13.251  12.937  7.061   1.00 13.94 ? 9    PRO B N   1 
ATOM   703  C CA  . PRO B 1 10 ? 12.577  11.659  7.283   1.00 13.49 ? 9    PRO B CA  1 
ATOM   704  C C   . PRO B 1 10 ? 11.803  11.254  6.036   1.00 17.91 ? 9    PRO B C   1 
ATOM   705  O O   . PRO B 1 10 ? 11.312  12.101  5.288   1.00 16.02 ? 9    PRO B O   1 
ATOM   706  C CB  . PRO B 1 10 ? 11.618  11.947  8.447   1.00 15.01 ? 9    PRO B CB  1 
ATOM   707  C CG  . PRO B 1 10 ? 11.478  13.440  8.489   1.00 19.44 ? 9    PRO B CG  1 
ATOM   708  C CD  . PRO B 1 10 ? 12.787  13.981  7.992   1.00 14.74 ? 9    PRO B CD  1 
ATOM   709  N N   . THR B 1 11 ? 11.724  9.951   5.802   1.00 15.34 ? 10   THR B N   1 
ATOM   710  C CA  . THR B 1 11 ? 11.061  9.432   4.615   1.00 15.43 ? 10   THR B CA  1 
ATOM   711  C C   . THR B 1 11 ? 10.771  7.952   4.830   1.00 16.58 ? 10   THR B C   1 
ATOM   712  O O   . THR B 1 11 ? 11.401  7.314   5.670   1.00 13.12 ? 10   THR B O   1 
ATOM   713  C CB  . THR B 1 11 ? 11.910  9.693   3.352   1.00 26.74 ? 10   THR B CB  1 
ATOM   714  O OG1 . THR B 1 11 ? 11.134  9.425   2.177   1.00 30.08 ? 10   THR B OG1 1 
ATOM   715  C CG2 . THR B 1 11 ? 13.160  8.826   3.354   1.00 26.28 ? 10   THR B CG2 1 
ATOM   716  N N   . ALA B 1 12 ? 9.741   7.446   4.158   1.00 14.14 ? 11   ALA B N   1 
ATOM   717  C CA  . ALA B 1 12 ? 9.284   6.076   4.364   1.00 14.31 ? 11   ALA B CA  1 
ATOM   718  C C   . ALA B 1 12 ? 10.301  5.000   3.990   1.00 17.05 ? 11   ALA B C   1 
ATOM   719  O O   . ALA B 1 12 ? 10.289  3.908   4.561   1.00 16.23 ? 11   ALA B O   1 
ATOM   720  C CB  . ALA B 1 12 ? 7.962   5.837   3.637   1.00 15.31 ? 11   ALA B CB  1 
ATOM   721  N N   . ASP B 1 13 ? 11.141  5.277   2.998   1.00 11.86 ? 12   ASP B N   1 
ATOM   722  C CA  . ASP B 1 13 ? 12.098  4.278   2.542   1.00 11.29 ? 12   ASP B CA  1 
ATOM   723  C C   . ASP B 1 13 ? 13.452  4.852   2.153   1.00 16.31 ? 12   ASP B C   1 
ATOM   724  O O   . ASP B 1 13 ? 13.821  4.870   0.976   1.00 16.24 ? 12   ASP B O   1 
ATOM   725  C CB  . ASP B 1 13 ? 11.527  3.456   1.388   1.00 12.32 ? 12   ASP B CB  1 
ATOM   726  C CG  . ASP B 1 13 ? 12.458  2.340   0.958   1.00 19.21 ? 12   ASP B CG  1 
ATOM   727  O OD1 . ASP B 1 13 ? 13.269  1.889   1.795   1.00 18.83 ? 12   ASP B OD1 1 
ATOM   728  O OD2 . ASP B 1 13 ? 12.420  1.957   -0.229  1.00 21.51 ? 12   ASP B OD2 1 
ATOM   729  N N   . CYS B 1 14 ? 14.214  5.271   3.154   1.00 12.82 ? 13   CYS B N   1 
ATOM   730  C CA  . CYS B 1 14 ? 15.547  5.804   2.912   1.00 12.33 ? 13   CYS B CA  1 
ATOM   731  C C   . CYS B 1 14 ? 16.504  4.679   2.538   1.00 16.03 ? 13   CYS B C   1 
ATOM   732  O O   . CYS B 1 14 ? 16.845  3.848   3.378   1.00 16.53 ? 13   CYS B O   1 
ATOM   733  C CB  . CYS B 1 14 ? 16.069  6.513   4.161   1.00 12.81 ? 13   CYS B CB  1 
ATOM   734  S SG  . CYS B 1 14 ? 17.752  7.145   3.979   1.00 16.56 ? 13   CYS B SG  1 
ATOM   735  N N   . LYS B 1 15 ? 16.970  4.676   1.293   1.00 11.75 ? 14   LYS B N   1 
ATOM   736  C CA  . LYS B 1 15 ? 17.957  3.690   0.866   1.00 12.12 ? 14   LYS B CA  1 
ATOM   737  C C   . LYS B 1 15 ? 19.248  4.345   0.386   1.00 16.12 ? 14   LYS B C   1 
ATOM   738  O O   . LYS B 1 15 ? 20.042  3.737   -0.335  1.00 15.84 ? 14   LYS B O   1 
ATOM   739  C CB  . LYS B 1 15 ? 17.388  2.748   -0.197  1.00 14.57 ? 14   LYS B CB  1 
ATOM   740  C CG  . LYS B 1 15 ? 16.884  3.436   -1.448  1.00 22.65 ? 14   LYS B CG  1 
ATOM   741  C CD  . LYS B 1 15 ? 16.066  2.468   -2.294  1.00 29.70 ? 14   LYS B CD  1 
ATOM   742  C CE  . LYS B 1 15 ? 15.514  3.147   -3.539  1.00 39.28 ? 14   LYS B CE  1 
ATOM   743  N NZ  . LYS B 1 15 ? 15.035  2.156   -4.541  1.00 42.23 ? 14   LYS B NZ  1 
ATOM   744  N N   . THR B 1 16 ? 19.471  5.578   0.825   1.00 13.09 ? 15   THR B N   1 
ATOM   745  C CA  . THR B 1 16 ? 20.693  6.293   0.485   1.00 12.81 ? 15   THR B CA  1 
ATOM   746  C C   . THR B 1 16 ? 21.832  5.817   1.384   1.00 16.00 ? 15   THR B C   1 
ATOM   747  O O   . THR B 1 16 ? 21.848  6.099   2.582   1.00 14.58 ? 15   THR B O   1 
ATOM   748  C CB  . THR B 1 16 ? 20.489  7.823   0.567   1.00 19.47 ? 15   THR B CB  1 
ATOM   749  O OG1 . THR B 1 16 ? 19.378  8.200   -0.256  1.00 16.68 ? 15   THR B OG1 1 
ATOM   750  C CG2 . THR B 1 16 ? 21.737  8.559   0.095   1.00 20.88 ? 15   THR B CG2 1 
ATOM   751  N N   . ALA B 1 17 ? 22.750  5.043   0.813   1.00 13.96 ? 16   ALA B N   1 
ATOM   752  C CA  . ALA B 1 17 ? 23.867  4.491   1.577   1.00 14.48 ? 16   ALA B CA  1 
ATOM   753  C C   . ALA B 1 17 ? 25.024  5.479   1.644   1.00 18.51 ? 16   ALA B C   1 
ATOM   754  O O   . ALA B 1 17 ? 25.516  5.949   0.616   1.00 18.42 ? 16   ALA B O   1 
ATOM   755  C CB  . ALA B 1 17 ? 24.325  3.168   0.982   1.00 15.29 ? 16   ALA B CB  1 
ATOM   756  N N   . VAL B 1 18 ? 25.442  5.795   2.864   1.00 14.38 ? 17   VAL B N   1 
ATOM   757  C CA  . VAL B 1 18 ? 26.491  6.776   3.099   1.00 14.78 ? 17   VAL B CA  1 
ATOM   758  C C   . VAL B 1 18 ? 27.677  6.132   3.809   1.00 18.32 ? 17   VAL B C   1 
ATOM   759  O O   . VAL B 1 18 ? 27.498  5.292   4.690   1.00 17.54 ? 17   VAL B O   1 
ATOM   760  C CB  . VAL B 1 18 ? 25.941  7.955   3.930   1.00 19.36 ? 17   VAL B CB  1 
ATOM   761  C CG1 . VAL B 1 18 ? 27.077  8.779   4.529   1.00 20.18 ? 17   VAL B CG1 1 
ATOM   762  C CG2 . VAL B 1 18 ? 25.019  8.822   3.086   1.00 19.40 ? 17   VAL B CG2 1 
ATOM   763  N N   . ASN B 1 19 ? 28.885  6.535   3.427   1.00 14.97 ? 18   ASN B N   1 
ATOM   764  C CA  . ASN B 1 19 ? 30.084  6.137   4.150   1.00 15.92 ? 18   ASN B CA  1 
ATOM   765  C C   . ASN B 1 19 ? 30.302  7.196   5.226   1.00 20.20 ? 18   ASN B C   1 
ATOM   766  O O   . ASN B 1 19 ? 30.813  8.283   4.946   1.00 19.14 ? 18   ASN B O   1 
ATOM   767  C CB  . ASN B 1 19 ? 31.290  6.073   3.208   1.00 18.51 ? 18   ASN B CB  1 
ATOM   768  C CG  . ASN B 1 19 ? 31.172  4.960   2.180   1.00 34.09 ? 18   ASN B CG  1 
ATOM   769  O OD1 . ASN B 1 19 ? 30.944  3.798   2.522   1.00 23.81 ? 18   ASN B OD1 1 
ATOM   770  N ND2 . ASN B 1 19 ? 31.335  5.311   0.910   1.00 27.02 ? 18   ASN B ND2 1 
ATOM   771  N N   . CYS B 1 20 ? 29.771  6.935   6.417   1.00 16.66 ? 19   CYS B N   1 
ATOM   772  C CA  . CYS B 1 20 ? 29.791  7.917   7.495   1.00 16.39 ? 19   CYS B CA  1 
ATOM   773  C C   . CYS B 1 20 ? 31.210  8.365   7.833   1.00 20.21 ? 19   CYS B C   1 
ATOM   774  O O   . CYS B 1 20 ? 32.140  7.557   7.838   1.00 20.58 ? 19   CYS B O   1 
ATOM   775  C CB  . CYS B 1 20 ? 29.097  7.368   8.748   1.00 16.35 ? 19   CYS B CB  1 
ATOM   776  S SG  . CYS B 1 20 ? 27.429  6.696   8.484   1.00 19.71 ? 19   CYS B SG  1 
ATOM   777  N N   . SER B 1 21 ? 31.367  9.653   8.127   1.00 17.00 ? 20   SER B N   1 
ATOM   778  C CA  . SER B 1 21 ? 32.670  10.198  8.501   1.00 17.47 ? 20   SER B CA  1 
ATOM   779  C C   . SER B 1 21 ? 33.128  9.631   9.841   1.00 22.32 ? 20   SER B C   1 
ATOM   780  O O   . SER B 1 21 ? 32.338  9.022   10.566  1.00 20.46 ? 20   SER B O   1 
ATOM   781  C CB  . SER B 1 21 ? 32.639  11.729  8.541   1.00 19.93 ? 20   SER B CB  1 
ATOM   782  O OG  . SER B 1 21 ? 31.932  12.206  9.669   1.00 29.85 ? 20   SER B OG  1 
ATOM   783  N N   . SER B 1 22 ? 34.410  9.813   10.150  1.00 21.34 ? 21   SER B N   1 
ATOM   784  C CA  . SER B 1 22 ? 34.999  9.259   11.365  1.00 22.01 ? 21   SER B CA  1 
ATOM   785  C C   . SER B 1 22 ? 34.370  9.789   12.649  1.00 25.57 ? 21   SER B C   1 
ATOM   786  O O   . SER B 1 22 ? 34.589  9.234   13.725  1.00 26.58 ? 21   SER B O   1 
ATOM   787  C CB  . SER B 1 22 ? 36.514  9.474   11.386  1.00 26.37 ? 21   SER B CB  1 
ATOM   788  O OG  . SER B 1 22 ? 36.833  10.821  11.693  1.00 36.80 ? 21   SER B OG  1 
ATOM   789  N N   . ASP B 1 23 ? 33.578  10.850  12.534  1.00 21.28 ? 22   ASP B N   1 
ATOM   790  C CA  . ASP B 1 23 ? 32.882  11.414  13.689  1.00 21.18 ? 22   ASP B CA  1 
ATOM   791  C C   . ASP B 1 23 ? 31.821  10.443  14.216  1.00 22.69 ? 22   ASP B C   1 
ATOM   792  O O   . ASP B 1 23 ? 31.398  10.538  15.369  1.00 23.62 ? 22   ASP B O   1 
ATOM   793  C CB  . ASP B 1 23 ? 32.207  12.736  13.306  1.00 23.81 ? 22   ASP B CB  1 
ATOM   794  C CG  . ASP B 1 23 ? 33.189  13.886  13.189  1.00 36.43 ? 22   ASP B CG  1 
ATOM   795  O OD1 . ASP B 1 23 ? 34.384  13.688  13.493  1.00 37.66 ? 22   ASP B OD1 1 
ATOM   796  O OD2 . ASP B 1 23 ? 32.760  14.996  12.804  1.00 41.72 ? 22   ASP B OD2 1 
ATOM   797  N N   . PHE B 1 24 ? 31.370  9.538   13.352  1.00 14.99 ? 23   PHE B N   1 
ATOM   798  C CA  . PHE B 1 24 ? 30.268  8.626   13.671  1.00 13.45 ? 23   PHE B CA  1 
ATOM   799  C C   . PHE B 1 24 ? 30.740  7.190   13.908  1.00 17.71 ? 23   PHE B C   1 
ATOM   800  O O   . PHE B 1 24 ? 31.614  6.692   13.204  1.00 19.84 ? 23   PHE B O   1 
ATOM   801  C CB  . PHE B 1 24 ? 29.242  8.641   12.532  1.00 14.38 ? 23   PHE B CB  1 
ATOM   802  C CG  . PHE B 1 24 ? 28.669  10.005  12.242  1.00 15.52 ? 23   PHE B CG  1 
ATOM   803  C CD1 . PHE B 1 24 ? 27.696  10.550  13.065  1.00 17.55 ? 23   PHE B CD1 1 
ATOM   804  C CD2 . PHE B 1 24 ? 29.067  10.717  11.120  1.00 17.25 ? 23   PHE B CD2 1 
ATOM   805  C CE1 . PHE B 1 24 ? 27.149  11.796  12.793  1.00 18.34 ? 23   PHE B CE1 1 
ATOM   806  C CE2 . PHE B 1 24 ? 28.528  11.969  10.845  1.00 20.08 ? 23   PHE B CE2 1 
ATOM   807  C CZ  . PHE B 1 24 ? 27.563  12.504  11.680  1.00 17.73 ? 23   PHE B CZ  1 
ATOM   808  N N   . ASP B 1 25 ? 30.126  6.512   14.873  1.00 12.59 ? 24   ASP B N   1 
ATOM   809  C CA  . ASP B 1 25 ? 30.467  5.122   15.165  1.00 11.10 ? 24   ASP B CA  1 
ATOM   810  C C   . ASP B 1 25 ? 29.257  4.188   15.157  1.00 13.99 ? 24   ASP B C   1 
ATOM   811  O O   . ASP B 1 25 ? 29.382  2.998   15.448  1.00 12.60 ? 24   ASP B O   1 
ATOM   812  C CB  . ASP B 1 25 ? 31.240  5.002   16.487  1.00 12.44 ? 24   ASP B CB  1 
ATOM   813  C CG  . ASP B 1 25 ? 30.380  5.307   17.715  1.00 19.79 ? 24   ASP B CG  1 
ATOM   814  O OD1 . ASP B 1 25 ? 29.175  5.596   17.561  1.00 17.28 ? 24   ASP B OD1 1 
ATOM   815  O OD2 . ASP B 1 25 ? 30.928  5.295   18.839  1.00 24.18 ? 24   ASP B OD2 1 
ATOM   816  N N   . ALA B 1 26 ? 28.104  4.708   14.748  1.00 10.70 ? 25   ALA B N   1 
ATOM   817  C CA  . ALA B 1 26 ? 26.881  3.915   14.747  1.00 9.17  ? 25   ALA B CA  1 
ATOM   818  C C   . ALA B 1 26 ? 25.914  4.348   13.651  1.00 11.42 ? 25   ALA B C   1 
ATOM   819  O O   . ALA B 1 26 ? 26.048  5.435   13.088  1.00 10.14 ? 25   ALA B O   1 
ATOM   820  C CB  . ALA B 1 26 ? 26.194  4.005   16.111  1.00 10.07 ? 25   ALA B CB  1 
ATOM   821  N N   . CYS B 1 27 ? 24.948  3.481   13.362  1.00 7.42  ? 26   CYS B N   1 
ATOM   822  C CA  . CYS B 1 27 ? 23.829  3.805   12.482  1.00 7.53  ? 26   CYS B CA  1 
ATOM   823  C C   . CYS B 1 27 ? 22.593  3.864   13.371  1.00 10.54 ? 26   CYS B C   1 
ATOM   824  O O   . CYS B 1 27 ? 22.447  3.067   14.299  1.00 10.74 ? 26   CYS B O   1 
ATOM   825  C CB  . CYS B 1 27 ? 23.607  2.713   11.429  1.00 8.22  ? 26   CYS B CB  1 
ATOM   826  S SG  . CYS B 1 27 ? 25.013  2.322   10.368  1.00 12.66 ? 26   CYS B SG  1 
ATOM   827  N N   . LEU B 1 28 ? 21.682  4.770   13.046  1.00 6.32  ? 27   LEU B N   1 
ATOM   828  C CA  . LEU B 1 28 ? 20.455  4.918   13.806  1.00 5.24  ? 27   LEU B CA  1 
ATOM   829  C C   . LEU B 1 28 ? 19.244  4.788   12.897  1.00 7.02  ? 27   LEU B C   1 
ATOM   830  O O   . LEU B 1 28 ? 19.220  5.338   11.799  1.00 6.34  ? 27   LEU B O   1 
ATOM   831  C CB  . LEU B 1 28 ? 20.418  6.310   14.458  1.00 5.61  ? 27   LEU B CB  1 
ATOM   832  C CG  . LEU B 1 28 ? 19.086  6.809   15.036  1.00 10.67 ? 27   LEU B CG  1 
ATOM   833  C CD1 . LEU B 1 28 ? 18.737  6.078   16.328  1.00 11.05 ? 27   LEU B CD1 1 
ATOM   834  C CD2 . LEU B 1 28 ? 19.126  8.317   15.275  1.00 12.40 ? 27   LEU B CD2 1 
ATOM   835  N N   A ILE B 1 29 ? 18.229  4.092   13.387  0.50 4.34  ? 28   ILE B N   1 
ATOM   836  N N   B ILE B 1 29 ? 18.216  4.085   13.369  0.50 3.18  ? 28   ILE B N   1 
ATOM   837  C CA  A ILE B 1 29 ? 16.921  4.139   12.773  0.50 4.63  ? 28   ILE B CA  1 
ATOM   838  C CA  B ILE B 1 29 ? 16.904  4.096   12.719  0.50 2.88  ? 28   ILE B CA  1 
ATOM   839  C C   A ILE B 1 29 ? 15.890  4.442   13.842  0.50 8.33  ? 28   ILE B C   1 
ATOM   840  C C   B ILE B 1 29 ? 15.807  4.343   13.758  0.50 7.92  ? 28   ILE B C   1 
ATOM   841  O O   A ILE B 1 29 ? 15.955  3.914   14.952  0.50 7.02  ? 28   ILE B O   1 
ATOM   842  O O   B ILE B 1 29 ? 15.762  3.673   14.791  0.50 6.71  ? 28   ILE B O   1 
ATOM   843  C CB  A ILE B 1 29 ? 16.577  2.889   11.960  0.50 8.15  ? 28   ILE B CB  1 
ATOM   844  C CB  B ILE B 1 29 ? 16.644  2.860   11.807  0.50 5.50  ? 28   ILE B CB  1 
ATOM   845  C CG1 A ILE B 1 29 ? 15.270  3.123   11.206  0.50 8.90  ? 28   ILE B CG1 1 
ATOM   846  C CG1 B ILE B 1 29 ? 15.268  2.958   11.131  0.50 5.35  ? 28   ILE B CG1 1 
ATOM   847  C CG2 A ILE B 1 29 ? 16.463  1.665   12.858  0.50 9.23  ? 28   ILE B CG2 1 
ATOM   848  C CG2 B ILE B 1 29 ? 16.813  1.548   12.569  0.50 5.78  ? 28   ILE B CG2 1 
ATOM   849  C CD1 A ILE B 1 29 ? 15.047  2.150   10.118  0.50 17.96 ? 28   ILE B CD1 1 
ATOM   850  C CD1 B ILE B 1 29 ? 14.131  2.338   11.931  0.50 4.86  ? 28   ILE B CD1 1 
ATOM   851  N N   . THR B 1 30 ? 15.018  5.394   13.543  1.00 5.83  ? 29   THR B N   1 
ATOM   852  C CA  . THR B 1 30 ? 13.994  5.812   14.495  1.00 6.62  ? 29   THR B CA  1 
ATOM   853  C C   . THR B 1 30 ? 12.650  5.916   13.806  1.00 12.48 ? 29   THR B C   1 
ATOM   854  O O   . THR B 1 30 ? 12.536  6.520   12.736  1.00 12.64 ? 29   THR B O   1 
ATOM   855  C CB  . THR B 1 30 ? 14.342  7.178   15.123  1.00 15.98 ? 29   THR B CB  1 
ATOM   856  O OG1 . THR B 1 30 ? 15.644  7.126   15.713  1.00 19.49 ? 29   THR B OG1 1 
ATOM   857  C CG2 . THR B 1 30 ? 13.313  7.558   16.184  1.00 16.90 ? 29   THR B CG2 1 
ATOM   858  N N   . LYS B 1 31 ? 11.618  5.428   14.481  1.00 10.16 ? 30   LYS B N   1 
ATOM   859  C CA  . LYS B 1 31 ? 10.261  5.562   13.982  1.00 10.50 ? 30   LYS B CA  1 
ATOM   860  C C   . LYS B 1 31 ? 9.482   6.434   14.952  1.00 14.97 ? 30   LYS B C   1 
ATOM   861  O O   . LYS B 1 31 ? 9.370   6.117   16.137  1.00 12.43 ? 30   LYS B O   1 
ATOM   862  C CB  . LYS B 1 31 ? 9.602   4.194   13.824  1.00 14.06 ? 30   LYS B CB  1 
ATOM   863  C CG  . LYS B 1 31 ? 10.340  3.289   12.849  1.00 25.71 ? 30   LYS B CG  1 
ATOM   864  C CD  . LYS B 1 31 ? 9.570   2.016   12.562  1.00 30.60 ? 30   LYS B CD  1 
ATOM   865  C CE  . LYS B 1 31 ? 10.119  1.325   11.322  1.00 26.80 ? 30   LYS B CE  1 
ATOM   866  N NZ  . LYS B 1 31 ? 9.497   -0.009  11.115  1.00 38.84 ? 30   LYS B NZ  1 
ATOM   867  N N   . ALA B 1 32 ? 9.098   7.611   14.475  1.00 13.41 ? 31   ALA B N   1 
ATOM   868  C CA  . ALA B 1 32 ? 8.357   8.565   15.286  1.00 14.67 ? 31   ALA B CA  1 
ATOM   869  C C   . ALA B 1 32 ? 7.030   8.847   14.595  1.00 20.01 ? 31   ALA B C   1 
ATOM   870  O O   . ALA B 1 32 ? 6.938   9.730   13.743  1.00 16.86 ? 31   ALA B O   1 
ATOM   871  C CB  . ALA B 1 32 ? 9.158   9.848   15.459  1.00 15.59 ? 31   ALA B CB  1 
ATOM   872  N N   . GLY B 1 33 ? 6.050   7.990   14.856  1.00 21.53 ? 32   GLY B N   1 
ATOM   873  C CA  . GLY B 1 33 ? 4.756   8.091   14.197  1.00 22.32 ? 32   GLY B CA  1 
ATOM   874  C C   . GLY B 1 33 ? 4.900   7.749   12.718  1.00 26.89 ? 32   GLY B C   1 
ATOM   875  O O   . GLY B 1 33 ? 5.451   6.708   12.362  1.00 27.22 ? 32   GLY B O   1 
ATOM   876  N N   . LEU B 1 34 ? 4.456   8.663   11.862  1.00 23.17 ? 33   LEU B N   1 
ATOM   877  C CA  . LEU B 1 34 ? 4.516   8.467   10.421  1.00 23.31 ? 33   LEU B CA  1 
ATOM   878  C C   . LEU B 1 34 ? 5.913   8.698   9.867   1.00 25.73 ? 33   LEU B C   1 
ATOM   879  O O   . LEU B 1 34 ? 6.203   8.327   8.729   1.00 27.29 ? 33   LEU B O   1 
ATOM   880  C CB  . LEU B 1 34 ? 3.535   9.407   9.717   1.00 23.91 ? 33   LEU B CB  1 
ATOM   881  C CG  . LEU B 1 34 ? 2.173   8.822   9.340   1.00 29.73 ? 33   LEU B CG  1 
ATOM   882  C CD1 . LEU B 1 34 ? 1.343   8.574   10.590  1.00 30.64 ? 33   LEU B CD1 1 
ATOM   883  C CD2 . LEU B 1 34 ? 1.445   9.756   8.382   1.00 31.92 ? 33   LEU B CD2 1 
ATOM   884  N N   . GLN B 1 35 ? 6.755   9.371   10.644  1.00 17.82 ? 34   GLN B N   1 
ATOM   885  C CA  . GLN B 1 35 ? 8.088   9.726   10.180  1.00 16.02 ? 34   GLN B CA  1 
ATOM   886  C C   . GLN B 1 35 ? 9.115   8.645   10.520  1.00 18.54 ? 34   GLN B C   1 
ATOM   887  O O   . GLN B 1 35 ? 9.088   8.071   11.607  1.00 17.91 ? 34   GLN B O   1 
ATOM   888  C CB  . GLN B 1 35 ? 8.521   11.073  10.771  1.00 16.99 ? 34   GLN B CB  1 
ATOM   889  C CG  . GLN B 1 35 ? 7.527   12.212  10.545  1.00 23.52 ? 34   GLN B CG  1 
ATOM   890  C CD  . GLN B 1 35 ? 7.508   12.696  9.105   1.00 33.80 ? 34   GLN B CD  1 
ATOM   891  O OE1 . GLN B 1 35 ? 8.351   12.311  8.298   1.00 32.20 ? 34   GLN B OE1 1 
ATOM   892  N NE2 . GLN B 1 35 ? 6.527   13.526  8.772   1.00 32.10 ? 34   GLN B NE2 1 
ATOM   893  N N   . VAL B 1 36 ? 9.986   8.339   9.562   1.00 13.61 ? 35   VAL B N   1 
ATOM   894  C CA  . VAL B 1 36 ? 11.098  7.422   9.797   1.00 11.73 ? 35   VAL B CA  1 
ATOM   895  C C   . VAL B 1 36 ? 12.414  8.148   9.518   1.00 12.39 ? 35   VAL B C   1 
ATOM   896  O O   . VAL B 1 36 ? 12.553  8.831   8.498   1.00 10.64 ? 35   VAL B O   1 
ATOM   897  C CB  . VAL B 1 36 ? 10.989  6.121   8.965   1.00 14.97 ? 35   VAL B CB  1 
ATOM   898  C CG1 . VAL B 1 36 ? 12.129  5.170   9.321   1.00 14.24 ? 35   VAL B CG1 1 
ATOM   899  C CG2 . VAL B 1 36 ? 9.637   5.443   9.179   1.00 14.70 ? 35   VAL B CG2 1 
ATOM   900  N N   . TYR B 1 37 ? 13.358  8.036   10.451  1.00 8.88  ? 36   TYR B N   1 
ATOM   901  C CA  . TYR B 1 37 ? 14.675  8.649   10.295  1.00 9.31  ? 36   TYR B CA  1 
ATOM   902  C C   . TYR B 1 37 ? 15.749  7.565   10.201  1.00 10.75 ? 36   TYR B C   1 
ATOM   903  O O   . TYR B 1 37 ? 15.682  6.558   10.901  1.00 8.68  ? 36   TYR B O   1 
ATOM   904  C CB  . TYR B 1 37 ? 14.993  9.566   11.485  1.00 10.49 ? 36   TYR B CB  1 
ATOM   905  C CG  . TYR B 1 37 ? 14.033  10.723  11.662  1.00 11.61 ? 36   TYR B CG  1 
ATOM   906  C CD1 . TYR B 1 37 ? 14.392  12.012  11.288  1.00 14.36 ? 36   TYR B CD1 1 
ATOM   907  C CD2 . TYR B 1 37 ? 12.799  10.538  12.267  1.00 12.19 ? 36   TYR B CD2 1 
ATOM   908  C CE1 . TYR B 1 37 ? 13.530  13.083  11.483  1.00 15.40 ? 36   TYR B CE1 1 
ATOM   909  C CE2 . TYR B 1 37 ? 11.927  11.602  12.461  1.00 13.04 ? 36   TYR B CE2 1 
ATOM   910  C CZ  . TYR B 1 37 ? 12.301  12.870  12.069  1.00 17.86 ? 36   TYR B CZ  1 
ATOM   911  O OH  . TYR B 1 37 ? 11.436  13.926  12.250  1.00 17.87 ? 36   TYR B OH  1 
ATOM   912  N N   . ASN B 1 38 ? 16.732  7.778   9.329   1.00 6.27  ? 37   ASN B N   1 
ATOM   913  C CA  . ASN B 1 38 ? 17.886  6.883   9.215   1.00 5.23  ? 37   ASN B CA  1 
ATOM   914  C C   . ASN B 1 38 ? 19.129  7.762   9.134   1.00 9.34  ? 37   ASN B C   1 
ATOM   915  O O   . ASN B 1 38 ? 19.237  8.602   8.240   1.00 6.95  ? 37   ASN B O   1 
ATOM   916  C CB  . ASN B 1 38 ? 17.783  6.013   7.955   1.00 6.04  ? 37   ASN B CB  1 
ATOM   917  C CG  . ASN B 1 38 ? 16.486  5.229   7.886   1.00 13.61 ? 37   ASN B CG  1 
ATOM   918  O OD1 . ASN B 1 38 ? 16.440  4.043   8.225   1.00 7.05  ? 37   ASN B OD1 1 
ATOM   919  N ND2 . ASN B 1 38 ? 15.427  5.885   7.439   1.00 6.50  ? 37   ASN B ND2 1 
ATOM   920  N N   . LYS B 1 39 ? 20.022  7.633   10.113  1.00 7.42  ? 38   LYS B N   1 
ATOM   921  C CA  . LYS B 1 39 ? 21.177  8.524   10.200  1.00 8.18  ? 38   LYS B CA  1 
ATOM   922  C C   . LYS B 1 39 ? 22.484  7.834   10.560  1.00 11.85 ? 38   LYS B C   1 
ATOM   923  O O   . LYS B 1 39 ? 22.500  6.861   11.311  1.00 10.82 ? 38   LYS B O   1 
ATOM   924  C CB  . LYS B 1 39 ? 20.930  9.599   11.264  1.00 9.35  ? 38   LYS B CB  1 
ATOM   925  C CG  . LYS B 1 39 ? 19.593  10.306  11.165  1.00 12.58 ? 38   LYS B CG  1 
ATOM   926  C CD  . LYS B 1 39 ? 19.667  11.448  10.166  1.00 12.77 ? 38   LYS B CD  1 
ATOM   927  C CE  . LYS B 1 39 ? 18.442  12.351  10.265  1.00 13.68 ? 38   LYS B CE  1 
ATOM   928  N NZ  . LYS B 1 39 ? 18.388  13.341  9.149   1.00 15.56 ? 38   LYS B NZ  1 
ATOM   929  N N   . CYS B 1 40 ? 23.584  8.462   10.155  1.00 11.99 ? 39   CYS B N   1 
ATOM   930  C CA  . CYS B 1 40 ? 24.890  8.197   10.739  1.00 12.26 ? 39   CYS B CA  1 
ATOM   931  C C   . CYS B 1 40 ? 24.771  8.795   12.146  1.00 12.32 ? 39   CYS B C   1 
ATOM   932  O O   . CYS B 1 40 ? 24.154  9.847   12.324  1.00 10.66 ? 39   CYS B O   1 
ATOM   933  C CB  . CYS B 1 40 ? 25.980  8.936   9.950   1.00 13.77 ? 39   CYS B CB  1 
ATOM   934  S SG  . CYS B 1 40 ? 26.248  8.331   8.254   1.00 18.64 ? 39   CYS B SG  1 
ATOM   935  N N   . TRP B 1 41 ? 25.278  8.095   13.156  1.00 8.99  ? 40   TRP B N   1 
ATOM   936  C CA  . TRP B 1 41 ? 25.054  8.516   14.538  1.00 9.03  ? 40   TRP B CA  1 
ATOM   937  C C   . TRP B 1 41 ? 26.218  8.091   15.437  1.00 12.92 ? 40   TRP B C   1 
ATOM   938  O O   . TRP B 1 41 ? 27.229  7.574   14.960  1.00 11.73 ? 40   TRP B O   1 
ATOM   939  C CB  . TRP B 1 41 ? 23.743  7.882   15.045  1.00 8.44  ? 40   TRP B CB  1 
ATOM   940  C CG  . TRP B 1 41 ? 22.974  8.685   16.071  1.00 9.67  ? 40   TRP B CG  1 
ATOM   941  C CD1 . TRP B 1 41 ? 22.740  8.331   17.373  1.00 12.48 ? 40   TRP B CD1 1 
ATOM   942  C CD2 . TRP B 1 41 ? 22.168  9.844   15.829  1.00 9.87  ? 40   TRP B CD2 1 
ATOM   943  N NE1 . TRP B 1 41 ? 21.895  9.235   17.970  1.00 11.65 ? 40   TRP B NE1 1 
ATOM   944  C CE2 . TRP B 1 41 ? 21.536  10.184  17.043  1.00 13.15 ? 40   TRP B CE2 1 
ATOM   945  C CE3 . TRP B 1 41 ? 21.904  10.624  14.697  1.00 11.58 ? 40   TRP B CE3 1 
ATOM   946  C CZ2 . TRP B 1 41 ? 20.684  11.279  17.168  1.00 12.96 ? 40   TRP B CZ2 1 
ATOM   947  C CZ3 . TRP B 1 41 ? 21.061  11.718  14.822  1.00 13.29 ? 40   TRP B CZ3 1 
ATOM   948  C CH2 . TRP B 1 41 ? 20.463  12.035  16.049  1.00 13.83 ? 40   TRP B CH2 1 
ATOM   949  N N   A LYS B 1 42 ? 26.071  8.334   16.735  0.50 10.82 ? 41   LYS B N   1 
ATOM   950  N N   B LYS B 1 42 ? 26.076  8.347   16.735  0.50 10.87 ? 41   LYS B N   1 
ATOM   951  C CA  A LYS B 1 42 ? 27.059  7.906   17.721  0.50 10.31 ? 41   LYS B CA  1 
ATOM   952  C CA  B LYS B 1 42 ? 27.067  7.943   17.735  0.50 10.39 ? 41   LYS B CA  1 
ATOM   953  C C   A LYS B 1 42 ? 26.343  7.169   18.843  0.50 13.90 ? 41   LYS B C   1 
ATOM   954  C C   B LYS B 1 42 ? 26.349  7.180   18.849  0.50 13.94 ? 41   LYS B C   1 
ATOM   955  O O   A LYS B 1 42 ? 25.238  7.544   19.233  0.50 13.10 ? 41   LYS B O   1 
ATOM   956  O O   B LYS B 1 42 ? 25.237  7.542   19.230  0.50 13.15 ? 41   LYS B O   1 
ATOM   957  C CB  A LYS B 1 42 ? 27.800  9.107   18.311  0.50 12.05 ? 41   LYS B CB  1 
ATOM   958  C CB  B LYS B 1 42 ? 27.754  9.174   18.341  0.50 12.20 ? 41   LYS B CB  1 
ATOM   959  C CG  A LYS B 1 42 ? 28.376  10.064  17.289  0.50 17.93 ? 41   LYS B CG  1 
ATOM   960  C CG  B LYS B 1 42 ? 28.844  9.795   17.480  0.50 18.36 ? 41   LYS B CG  1 
ATOM   961  C CD  A LYS B 1 42 ? 29.184  11.151  17.974  0.50 21.16 ? 41   LYS B CD  1 
ATOM   962  C CD  B LYS B 1 42 ? 29.673  10.800  18.276  0.50 18.69 ? 41   LYS B CD  1 
ATOM   963  C CE  A LYS B 1 42 ? 29.611  12.226  16.992  0.50 25.51 ? 41   LYS B CE  1 
ATOM   964  C CE  B LYS B 1 42 ? 30.746  10.108  19.107  0.50 16.25 ? 41   LYS B CE  1 
ATOM   965  N NZ  A LYS B 1 42 ? 30.711  13.068  17.539  0.50 31.95 ? 41   LYS B NZ  1 
ATOM   966  N NZ  B LYS B 1 42 ? 31.645  11.081  19.794  0.50 22.25 ? 41   LYS B NZ  1 
ATOM   967  N N   . PHE B 1 43 ? 26.999  6.158   19.400  1.00 10.82 ? 42   PHE B N   1 
ATOM   968  C CA  . PHE B 1 43 ? 26.410  5.390   20.488  1.00 11.11 ? 42   PHE B CA  1 
ATOM   969  C C   . PHE B 1 43 ? 26.174  6.237   21.733  1.00 14.89 ? 42   PHE B C   1 
ATOM   970  O O   . PHE B 1 43 ? 25.226  6.005   22.476  1.00 14.56 ? 42   PHE B O   1 
ATOM   971  C CB  . PHE B 1 43 ? 27.253  4.157   20.821  1.00 12.99 ? 42   PHE B CB  1 
ATOM   972  C CG  . PHE B 1 43 ? 27.033  3.005   19.881  1.00 13.55 ? 42   PHE B CG  1 
ATOM   973  C CD1 . PHE B 1 43 ? 25.816  2.346   19.839  1.00 15.73 ? 42   PHE B CD1 1 
ATOM   974  C CD2 . PHE B 1 43 ? 28.040  2.599   19.020  1.00 15.25 ? 42   PHE B CD2 1 
ATOM   975  C CE1 . PHE B 1 43 ? 25.613  1.290   18.967  1.00 16.78 ? 42   PHE B CE1 1 
ATOM   976  C CE2 . PHE B 1 43 ? 27.842  1.547   18.144  1.00 17.35 ? 42   PHE B CE2 1 
ATOM   977  C CZ  . PHE B 1 43 ? 26.629  0.889   18.121  1.00 15.48 ? 42   PHE B CZ  1 
ATOM   978  N N   . GLU B 1 44 ? 27.025  7.232   21.954  1.00 12.40 ? 43   GLU B N   1 
ATOM   979  C CA  . GLU B 1 44 ? 26.859  8.095   23.118  1.00 12.87 ? 43   GLU B CA  1 
ATOM   980  C C   . GLU B 1 44 ? 25.589  8.933   23.009  1.00 16.73 ? 43   GLU B C   1 
ATOM   981  O O   . GLU B 1 44 ? 25.105  9.472   24.004  1.00 16.24 ? 43   GLU B O   1 
ATOM   982  C CB  . GLU B 1 44 ? 28.086  8.981   23.334  1.00 14.32 ? 43   GLU B CB  1 
ATOM   983  C CG  . GLU B 1 44 ? 28.274  10.059  22.288  1.00 22.59 ? 43   GLU B CG  1 
ATOM   984  C CD  . GLU B 1 44 ? 29.238  11.139  22.735  1.00 39.80 ? 43   GLU B CD  1 
ATOM   985  O OE1 . GLU B 1 44 ? 29.433  11.295  23.959  1.00 42.06 ? 43   GLU B OE1 1 
ATOM   986  O OE2 . GLU B 1 44 ? 29.784  11.845  21.863  1.00 33.91 ? 43   GLU B OE2 1 
ATOM   987  N N   . HIS B 1 45 ? 25.019  8.994   21.808  1.00 13.01 ? 44   HIS B N   1 
ATOM   988  C CA  . HIS B 1 45 ? 23.764  9.714   21.607  1.00 12.55 ? 44   HIS B CA  1 
ATOM   989  C C   . HIS B 1 45 ? 22.599  8.776   21.317  1.00 17.34 ? 44   HIS B C   1 
ATOM   990  O O   . HIS B 1 45 ? 21.528  9.213   20.900  1.00 15.83 ? 44   HIS B O   1 
ATOM   991  C CB  . HIS B 1 45 ? 23.898  10.751  20.494  1.00 12.81 ? 44   HIS B CB  1 
ATOM   992  C CG  . HIS B 1 45 ? 24.965  11.769  20.747  1.00 15.84 ? 44   HIS B CG  1 
ATOM   993  N ND1 . HIS B 1 45 ? 25.036  12.501  21.911  1.00 17.60 ? 44   HIS B ND1 1 
ATOM   994  C CD2 . HIS B 1 45 ? 26.006  12.177  19.981  1.00 17.14 ? 44   HIS B CD2 1 
ATOM   995  C CE1 . HIS B 1 45 ? 26.072  13.322  21.852  1.00 17.27 ? 44   HIS B CE1 1 
ATOM   996  N NE2 . HIS B 1 45 ? 26.682  13.136  20.693  1.00 17.20 ? 44   HIS B NE2 1 
ATOM   997  N N   . CYS B 1 46 ? 22.804  7.486   21.559  1.00 15.97 ? 45   CYS B N   1 
ATOM   998  C CA  . CYS B 1 46 ? 21.746  6.508   21.358  1.00 16.26 ? 45   CYS B CA  1 
ATOM   999  C C   . CYS B 1 46 ? 20.951  6.337   22.641  1.00 19.70 ? 45   CYS B C   1 
ATOM   1000 O O   . CYS B 1 46 ? 21.095  5.346   23.355  1.00 20.15 ? 45   CYS B O   1 
ATOM   1001 C CB  . CYS B 1 46 ? 22.311  5.178   20.865  1.00 17.24 ? 45   CYS B CB  1 
ATOM   1002 S SG  . CYS B 1 46 ? 22.878  5.273   19.152  1.00 21.10 ? 45   CYS B SG  1 
ATOM   1003 N N   . ASN B 1 47 ? 20.202  7.380   22.976  1.00 14.68 ? 46   ASN B N   1 
ATOM   1004 C CA  . ASN B 1 47 ? 19.373  7.396   24.173  1.00 14.36 ? 46   ASN B CA  1 
ATOM   1005 C C   . ASN B 1 47 ? 18.206  8.337   23.908  1.00 15.31 ? 46   ASN B C   1 
ATOM   1006 O O   . ASN B 1 47 ? 18.252  9.144   22.981  1.00 13.42 ? 46   ASN B O   1 
ATOM   1007 C CB  . ASN B 1 47 ? 20.188  7.868   25.383  1.00 15.35 ? 46   ASN B CB  1 
ATOM   1008 C CG  . ASN B 1 47 ? 20.822  9.227   25.167  1.00 23.76 ? 46   ASN B CG  1 
ATOM   1009 O OD1 . ASN B 1 47 ? 20.157  10.254  25.276  1.00 15.56 ? 46   ASN B OD1 1 
ATOM   1010 N ND2 . ASN B 1 47 ? 22.127  9.241   24.914  1.00 15.81 ? 46   ASN B ND2 1 
ATOM   1011 N N   . PHE B 1 48 ? 17.136  8.199   24.680  1.00 11.94 ? 47   PHE B N   1 
ATOM   1012 C CA  . PHE B 1 48 ? 15.941  8.989   24.427  1.00 11.75 ? 47   PHE B CA  1 
ATOM   1013 C C   . PHE B 1 48 ? 16.165  10.500  24.430  1.00 12.79 ? 47   PHE B C   1 
ATOM   1014 O O   . PHE B 1 48 ? 15.617  11.210  23.592  1.00 11.00 ? 47   PHE B O   1 
ATOM   1015 C CB  . PHE B 1 48 ? 14.803  8.594   25.369  1.00 13.67 ? 47   PHE B CB  1 
ATOM   1016 C CG  . PHE B 1 48 ? 14.044  7.379   24.919  1.00 15.05 ? 47   PHE B CG  1 
ATOM   1017 C CD1 . PHE B 1 48 ? 14.191  6.172   25.578  1.00 19.03 ? 47   PHE B CD1 1 
ATOM   1018 C CD2 . PHE B 1 48 ? 13.174  7.447   23.842  1.00 16.48 ? 47   PHE B CD2 1 
ATOM   1019 C CE1 . PHE B 1 48 ? 13.484  5.051   25.171  1.00 19.95 ? 47   PHE B CE1 1 
ATOM   1020 C CE2 . PHE B 1 48 ? 12.476  6.326   23.424  1.00 18.50 ? 47   PHE B CE2 1 
ATOM   1021 C CZ  . PHE B 1 48 ? 12.618  5.134   24.100  1.00 16.85 ? 47   PHE B CZ  1 
ATOM   1022 N N   . ASN B 1 49 ? 16.931  11.010  25.388  1.00 10.49 ? 48   ASN B N   1 
ATOM   1023 C CA  . ASN B 1 49 ? 17.131  12.455  25.445  1.00 10.92 ? 48   ASN B CA  1 
ATOM   1024 C C   . ASN B 1 49 ? 17.759  12.980  24.159  1.00 14.65 ? 48   ASN B C   1 
ATOM   1025 O O   . ASN B 1 49 ? 17.280  13.944  23.566  1.00 14.52 ? 48   ASN B O   1 
ATOM   1026 C CB  . ASN B 1 49 ? 17.992  12.865  26.640  1.00 12.90 ? 48   ASN B CB  1 
ATOM   1027 C CG  . ASN B 1 49 ? 18.189  14.372  26.715  1.00 30.94 ? 48   ASN B CG  1 
ATOM   1028 O OD1 . ASN B 1 49 ? 17.282  15.099  27.123  1.00 23.28 ? 48   ASN B OD1 1 
ATOM   1029 N ND2 . ASN B 1 49 ? 19.279  14.854  26.125  1.00 24.05 ? 48   ASN B ND2 1 
ATOM   1030 N N   . ASP B 1 50 ? 18.854  12.356  23.749  1.00 10.24 ? 49   ASP B N   1 
ATOM   1031 C CA  . ASP B 1 50 ? 19.595  12.814  22.584  1.00 9.53  ? 49   ASP B CA  1 
ATOM   1032 C C   . ASP B 1 50 ? 18.854  12.588  21.263  1.00 10.86 ? 49   ASP B C   1 
ATOM   1033 O O   . ASP B 1 50 ? 18.884  13.438  20.378  1.00 11.14 ? 49   ASP B O   1 
ATOM   1034 C CB  . ASP B 1 50 ? 20.995  12.198  22.566  1.00 11.70 ? 49   ASP B CB  1 
ATOM   1035 C CG  . ASP B 1 50 ? 21.833  12.634  23.759  1.00 19.93 ? 49   ASP B CG  1 
ATOM   1036 O OD1 . ASP B 1 50 ? 21.395  13.549  24.488  1.00 20.01 ? 49   ASP B OD1 1 
ATOM   1037 O OD2 . ASP B 1 50 ? 22.918  12.054  23.979  1.00 23.93 ? 49   ASP B OD2 1 
ATOM   1038 N N   . VAL B 1 51 ? 18.138  11.475  21.153  1.00 7.34  ? 50   VAL B N   1 
ATOM   1039 C CA  . VAL B 1 51 ? 17.383  11.193  19.938  1.00 6.99  ? 50   VAL B CA  1 
ATOM   1040 C C   . VAL B 1 51 ? 16.169  12.108  19.791  1.00 10.40 ? 50   VAL B C   1 
ATOM   1041 O O   . VAL B 1 51 ? 15.984  12.734  18.751  1.00 10.37 ? 50   VAL B O   1 
ATOM   1042 C CB  . VAL B 1 51 ? 17.002  9.703   19.815  1.00 10.88 ? 50   VAL B CB  1 
ATOM   1043 C CG1 . VAL B 1 51 ? 16.094  9.490   18.610  1.00 10.92 ? 50   VAL B CG1 1 
ATOM   1044 C CG2 . VAL B 1 51 ? 18.257  8.841   19.702  1.00 10.54 ? 50   VAL B CG2 1 
ATOM   1045 N N   . THR B 1 52 ? 15.352  12.198  20.836  1.00 8.57  ? 51   THR B N   1 
ATOM   1046 C CA  . THR B 1 52 ? 14.170  13.060  20.792  1.00 8.92  ? 51   THR B CA  1 
ATOM   1047 C C   . THR B 1 52 ? 14.544  14.522  20.541  1.00 12.52 ? 51   THR B C   1 
ATOM   1048 O O   . THR B 1 52 ? 13.925  15.191  19.721  1.00 12.50 ? 51   THR B O   1 
ATOM   1049 C CB  . THR B 1 52 ? 13.304  12.937  22.070  1.00 13.59 ? 51   THR B CB  1 
ATOM   1050 O OG1 . THR B 1 52 ? 14.071  13.310  23.223  1.00 11.36 ? 51   THR B OG1 1 
ATOM   1051 C CG2 . THR B 1 52 ? 12.775  11.523  22.236  1.00 12.44 ? 51   THR B CG2 1 
ATOM   1052 N N   . THR B 1 53 ? 15.507  15.038  21.299  1.00 10.05 ? 52   THR B N   1 
ATOM   1053 C CA  . THR B 1 53 ? 15.879  16.447  21.176  1.00 10.24 ? 52   THR B CA  1 
ATOM   1054 C C   . THR B 1 53 ? 16.508  16.784  19.823  1.00 15.57 ? 52   THR B C   1 
ATOM   1055 O O   . THR B 1 53 ? 16.185  17.809  19.219  1.00 15.04 ? 52   THR B O   1 
ATOM   1056 C CB  . THR B 1 53 ? 16.756  16.933  22.355  1.00 14.30 ? 52   THR B CB  1 
ATOM   1057 O OG1 . THR B 1 53 ? 17.987  16.199  22.382  1.00 16.36 ? 52   THR B OG1 1 
ATOM   1058 C CG2 . THR B 1 53 ? 16.026  16.757  23.684  1.00 10.19 ? 52   THR B CG2 1 
ATOM   1059 N N   . ARG B 1 54 ? 17.405  15.923  19.347  1.00 12.81 ? 53   ARG B N   1 
ATOM   1060 C CA  . ARG B 1 54 ? 18.096  16.178  18.086  1.00 12.47 ? 53   ARG B CA  1 
ATOM   1061 C C   . ARG B 1 54 ? 17.194  16.067  16.860  1.00 15.40 ? 53   ARG B C   1 
ATOM   1062 O O   . ARG B 1 54 ? 17.337  16.833  15.907  1.00 14.23 ? 53   ARG B O   1 
ATOM   1063 C CB  . ARG B 1 54 ? 19.337  15.293  17.945  1.00 10.40 ? 53   ARG B CB  1 
ATOM   1064 C CG  . ARG B 1 54 ? 20.410  15.642  18.961  1.00 10.87 ? 53   ARG B CG  1 
ATOM   1065 C CD  . ARG B 1 54 ? 21.654  14.786  18.829  1.00 12.60 ? 53   ARG B CD  1 
ATOM   1066 N NE  . ARG B 1 54 ? 22.678  15.230  19.771  1.00 16.57 ? 53   ARG B NE  1 
ATOM   1067 C CZ  . ARG B 1 54 ? 23.975  15.317  19.492  1.00 26.78 ? 53   ARG B CZ  1 
ATOM   1068 N NH1 . ARG B 1 54 ? 24.431  14.937  18.307  1.00 17.31 ? 53   ARG B NH1 1 
ATOM   1069 N NH2 . ARG B 1 54 ? 24.817  15.775  20.407  1.00 22.30 ? 53   ARG B NH2 1 
ATOM   1070 N N   . LEU B 1 55 ? 16.244  15.140  16.904  1.00 12.47 ? 54   LEU B N   1 
ATOM   1071 C CA  . LEU B 1 55 ? 15.302  14.967  15.804  1.00 12.03 ? 54   LEU B CA  1 
ATOM   1072 C C   . LEU B 1 55 ? 14.038  15.802  15.992  1.00 13.31 ? 54   LEU B C   1 
ATOM   1073 O O   . LEU B 1 55 ? 13.175  15.837  15.113  1.00 11.96 ? 54   LEU B O   1 
ATOM   1074 C CB  . LEU B 1 55 ? 14.930  13.493  15.638  1.00 12.25 ? 54   LEU B CB  1 
ATOM   1075 C CG  . LEU B 1 55 ? 16.074  12.523  15.343  1.00 16.66 ? 54   LEU B CG  1 
ATOM   1076 C CD1 . LEU B 1 55 ? 15.529  11.116  15.123  1.00 17.05 ? 54   LEU B CD1 1 
ATOM   1077 C CD2 . LEU B 1 55 ? 16.871  13.000  14.135  1.00 19.23 ? 54   LEU B CD2 1 
ATOM   1078 N N   . ARG B 1 56 ? 13.926  16.449  17.148  1.00 10.55 ? 55   ARG B N   1 
ATOM   1079 C CA  . ARG B 1 56 ? 12.757  17.260  17.475  1.00 10.11 ? 55   ARG B CA  1 
ATOM   1080 C C   . ARG B 1 56 ? 11.477  16.438  17.337  1.00 13.65 ? 55   ARG B C   1 
ATOM   1081 O O   . ARG B 1 56 ? 10.507  16.839  16.683  1.00 12.18 ? 55   ARG B O   1 
ATOM   1082 C CB  . ARG B 1 56 ? 12.742  18.557  16.654  1.00 11.91 ? 55   ARG B CB  1 
ATOM   1083 C CG  . ARG B 1 56 ? 13.912  19.488  17.034  1.00 22.65 ? 55   ARG B CG  1 
ATOM   1084 C CD  . ARG B 1 56 ? 13.954  20.784  16.233  1.00 26.74 ? 55   ARG B CD  1 
ATOM   1085 N NE  . ARG B 1 56 ? 13.102  21.830  16.797  1.00 25.32 ? 55   ARG B NE  1 
ATOM   1086 C CZ  . ARG B 1 56 ? 13.418  22.593  17.841  1.00 33.34 ? 55   ARG B CZ  1 
ATOM   1087 N NH1 . ARG B 1 56 ? 14.554  22.406  18.500  1.00 21.23 ? 55   ARG B NH1 1 
ATOM   1088 N NH2 . ARG B 1 56 ? 12.576  23.533  18.248  1.00 22.90 ? 55   ARG B NH2 1 
ATOM   1089 N N   . GLU B 1 57 ? 11.525  15.251  17.935  1.00 10.32 ? 56   GLU B N   1 
ATOM   1090 C CA  . GLU B 1 57 ? 10.420  14.300  17.924  1.00 10.80 ? 56   GLU B CA  1 
ATOM   1091 C C   . GLU B 1 57 ? 10.154  13.871  19.366  1.00 15.65 ? 56   GLU B C   1 
ATOM   1092 O O   . GLU B 1 57 ? 11.070  13.822  20.191  1.00 15.48 ? 56   GLU B O   1 
ATOM   1093 C CB  . GLU B 1 57 ? 10.774  13.074  17.072  1.00 11.87 ? 56   GLU B CB  1 
ATOM   1094 C CG  . GLU B 1 57 ? 10.827  13.345  15.568  1.00 18.18 ? 56   GLU B CG  1 
ATOM   1095 C CD  . GLU B 1 57 ? 9.452   13.377  14.923  1.00 31.89 ? 56   GLU B CD  1 
ATOM   1096 O OE1 . GLU B 1 57 ? 8.464   13.020  15.603  1.00 21.06 ? 56   GLU B OE1 1 
ATOM   1097 O OE2 . GLU B 1 57 ? 9.362   13.757  13.734  1.00 22.13 ? 56   GLU B OE2 1 
ATOM   1098 N N   . ASN B 1 58 ? 8.897   13.585  19.669  1.00 12.13 ? 57   ASN B N   1 
ATOM   1099 C CA  . ASN B 1 58 ? 8.496   13.260  21.030  1.00 10.47 ? 57   ASN B CA  1 
ATOM   1100 C C   . ASN B 1 58 ? 8.393   11.756  21.274  1.00 14.25 ? 57   ASN B C   1 
ATOM   1101 O O   . ASN B 1 58 ? 9.288   11.159  21.877  1.00 14.91 ? 57   ASN B O   1 
ATOM   1102 C CB  . ASN B 1 58 ? 7.183   13.961  21.364  1.00 8.88  ? 57   ASN B CB  1 
ATOM   1103 C CG  . ASN B 1 58 ? 6.773   13.777  22.813  1.00 16.01 ? 57   ASN B CG  1 
ATOM   1104 O OD1 . ASN B 1 58 ? 7.296   12.910  23.522  1.00 10.48 ? 57   ASN B OD1 1 
ATOM   1105 N ND2 . ASN B 1 58 ? 5.817   14.582  23.256  1.00 12.47 ? 57   ASN B ND2 1 
ATOM   1106 N N   . GLU B 1 59 ? 7.295   11.151  20.830  1.00 10.48 ? 58   GLU B N   1 
ATOM   1107 C CA  . GLU B 1 59 ? 7.117   9.709   20.972  1.00 10.91 ? 58   GLU B CA  1 
ATOM   1108 C C   . GLU B 1 59 ? 7.862   9.013   19.847  1.00 13.50 ? 58   GLU B C   1 
ATOM   1109 O O   . GLU B 1 59 ? 7.687   9.351   18.676  1.00 12.91 ? 58   GLU B O   1 
ATOM   1110 C CB  . GLU B 1 59 ? 5.634   9.324   20.909  1.00 12.85 ? 58   GLU B CB  1 
ATOM   1111 C CG  . GLU B 1 59 ? 4.814   9.759   22.115  1.00 23.31 ? 58   GLU B CG  1 
ATOM   1112 C CD  . GLU B 1 59 ? 4.906   8.784   23.276  1.00 33.36 ? 58   GLU B CD  1 
ATOM   1113 O OE1 . GLU B 1 59 ? 5.785   7.897   23.248  1.00 36.48 ? 58   GLU B OE1 1 
ATOM   1114 O OE2 . GLU B 1 59 ? 4.107   8.917   24.226  1.00 33.37 ? 58   GLU B OE2 1 
ATOM   1115 N N   . LEU B 1 60 ? 8.691   8.038   20.199  1.00 8.99  ? 59   LEU B N   1 
ATOM   1116 C CA  . LEU B 1 60 ? 9.433   7.305   19.184  1.00 9.10  ? 59   LEU B CA  1 
ATOM   1117 C C   . LEU B 1 60 ? 10.046  6.029   19.736  1.00 12.29 ? 59   LEU B C   1 
ATOM   1118 O O   . LEU B 1 60 ? 10.129  5.837   20.952  1.00 11.10 ? 59   LEU B O   1 
ATOM   1119 C CB  . LEU B 1 60 ? 10.522  8.192   18.571  1.00 8.86  ? 59   LEU B CB  1 
ATOM   1120 C CG  . LEU B 1 60 ? 11.590  8.765   19.512  1.00 11.71 ? 59   LEU B CG  1 
ATOM   1121 C CD1 . LEU B 1 60 ? 12.631  7.705   19.868  1.00 12.10 ? 59   LEU B CD1 1 
ATOM   1122 C CD2 . LEU B 1 60 ? 12.256  9.983   18.885  1.00 12.56 ? 59   LEU B CD2 1 
ATOM   1123 N N   . THR B 1 61 ? 10.468  5.158   18.827  1.00 9.97  ? 60   THR B N   1 
ATOM   1124 C CA  . THR B 1 61 ? 11.282  4.003   19.178  1.00 9.22  ? 60   THR B CA  1 
ATOM   1125 C C   . THR B 1 61 ? 12.515  4.089   18.292  1.00 10.54 ? 60   THR B C   1 
ATOM   1126 O O   . THR B 1 61 ? 12.471  4.707   17.233  1.00 10.29 ? 60   THR B O   1 
ATOM   1127 C CB  . THR B 1 61 ? 10.536  2.668   18.989  1.00 16.26 ? 60   THR B CB  1 
ATOM   1128 O OG1 . THR B 1 61 ? 10.063  2.561   17.640  1.00 17.49 ? 60   THR B OG1 1 
ATOM   1129 C CG2 . THR B 1 61 ? 9.356   2.575   19.961  1.00 14.33 ? 60   THR B CG2 1 
ATOM   1130 N N   . TYR B 1 62 ? 13.642  3.587   18.781  1.00 7.47  ? 61   TYR B N   1 
ATOM   1131 C CA  . TYR B 1 62 ? 14.880  3.696   18.017  1.00 7.93  ? 61   TYR B CA  1 
ATOM   1132 C C   . TYR B 1 62 ? 15.760  2.474   18.170  1.00 10.97 ? 61   TYR B C   1 
ATOM   1133 O O   . TYR B 1 62 ? 15.631  1.711   19.130  1.00 10.27 ? 61   TYR B O   1 
ATOM   1134 C CB  . TYR B 1 62 ? 15.663  4.954   18.404  1.00 9.25  ? 61   TYR B CB  1 
ATOM   1135 C CG  . TYR B 1 62 ? 16.256  4.894   19.794  1.00 11.88 ? 61   TYR B CG  1 
ATOM   1136 C CD1 . TYR B 1 62 ? 17.518  4.351   20.014  1.00 14.00 ? 61   TYR B CD1 1 
ATOM   1137 C CD2 . TYR B 1 62 ? 15.534  5.336   20.893  1.00 13.32 ? 61   TYR B CD2 1 
ATOM   1138 C CE1 . TYR B 1 62 ? 18.049  4.269   21.290  1.00 15.51 ? 61   TYR B CE1 1 
ATOM   1139 C CE2 . TYR B 1 62 ? 16.061  5.274   22.168  1.00 15.03 ? 61   TYR B CE2 1 
ATOM   1140 C CZ  . TYR B 1 62 ? 17.315  4.735   22.363  1.00 21.70 ? 61   TYR B CZ  1 
ATOM   1141 O OH  . TYR B 1 62 ? 17.823  4.642   23.640  1.00 23.99 ? 61   TYR B OH  1 
ATOM   1142 N N   . TYR B 1 63 ? 16.656  2.306   17.206  1.00 8.74  ? 62   TYR B N   1 
ATOM   1143 C CA  . TYR B 1 63 ? 17.592  1.195   17.181  1.00 8.84  ? 62   TYR B CA  1 
ATOM   1144 C C   . TYR B 1 63 ? 18.930  1.717   16.670  1.00 12.94 ? 62   TYR B C   1 
ATOM   1145 O O   . TYR B 1 63 ? 18.986  2.413   15.656  1.00 10.73 ? 62   TYR B O   1 
ATOM   1146 C CB  . TYR B 1 63 ? 17.079  0.103   16.239  1.00 10.54 ? 62   TYR B CB  1 
ATOM   1147 C CG  . TYR B 1 63 ? 18.032  -1.060  16.061  1.00 13.38 ? 62   TYR B CG  1 
ATOM   1148 C CD1 . TYR B 1 63 ? 18.185  -2.016  17.059  1.00 15.72 ? 62   TYR B CD1 1 
ATOM   1149 C CD2 . TYR B 1 63 ? 18.716  -1.245  14.870  1.00 14.68 ? 62   TYR B CD2 1 
ATOM   1150 C CE1 . TYR B 1 63 ? 19.024  -3.109  16.883  1.00 16.00 ? 62   TYR B CE1 1 
ATOM   1151 C CE2 . TYR B 1 63 ? 19.547  -2.340  14.681  1.00 15.10 ? 62   TYR B CE2 1 
ATOM   1152 C CZ  . TYR B 1 63 ? 19.697  -3.267  15.690  1.00 19.80 ? 62   TYR B CZ  1 
ATOM   1153 O OH  . TYR B 1 63 ? 20.529  -4.351  15.506  1.00 19.09 ? 62   TYR B OH  1 
ATOM   1154 N N   . CYS B 1 64 ? 20.000  1.409   17.392  1.00 11.07 ? 63   CYS B N   1 
ATOM   1155 C CA  . CYS B 1 64 ? 21.339  1.773   16.952  1.00 12.18 ? 63   CYS B CA  1 
ATOM   1156 C C   . CYS B 1 64 ? 22.142  0.496   16.759  1.00 13.62 ? 63   CYS B C   1 
ATOM   1157 O O   . CYS B 1 64 ? 21.956  -0.486  17.485  1.00 13.64 ? 63   CYS B O   1 
ATOM   1158 C CB  . CYS B 1 64 ? 22.032  2.658   17.983  1.00 14.96 ? 63   CYS B CB  1 
ATOM   1159 S SG  . CYS B 1 64 ? 21.414  4.348   18.091  1.00 20.48 ? 63   CYS B SG  1 
ATOM   1160 N N   . CYS B 1 65 ? 23.063  0.528   15.809  1.00 9.39  ? 64   CYS B N   1 
ATOM   1161 C CA  . CYS B 1 65 ? 23.844  -0.648  15.471  1.00 10.22 ? 64   CYS B CA  1 
ATOM   1162 C C   . CYS B 1 65 ? 25.149  -0.215  14.801  1.00 13.80 ? 64   CYS B C   1 
ATOM   1163 O O   . CYS B 1 65 ? 25.312  0.953   14.449  1.00 12.68 ? 64   CYS B O   1 
ATOM   1164 C CB  . CYS B 1 65 ? 23.021  -1.529  14.536  1.00 11.16 ? 64   CYS B CB  1 
ATOM   1165 S SG  . CYS B 1 65 ? 22.363  -0.612  13.125  1.00 15.29 ? 64   CYS B SG  1 
ATOM   1166 N N   . LYS B 1 66 ? 26.090  -1.145  14.660  1.00 10.38 ? 65   LYS B N   1 
ATOM   1167 C CA  . LYS B 1 66 ? 27.401  -0.807  14.113  1.00 9.71  ? 65   LYS B CA  1 
ATOM   1168 C C   . LYS B 1 66 ? 27.896  -1.741  13.008  1.00 13.97 ? 65   LYS B C   1 
ATOM   1169 O O   . LYS B 1 66 ? 29.103  -1.931  12.846  1.00 14.31 ? 65   LYS B O   1 
ATOM   1170 C CB  . LYS B 1 66 ? 28.436  -0.724  15.236  1.00 12.45 ? 65   LYS B CB  1 
ATOM   1171 C CG  . LYS B 1 66 ? 28.477  -1.957  16.115  1.00 17.78 ? 65   LYS B CG  1 
ATOM   1172 C CD  . LYS B 1 66 ? 29.432  -1.774  17.285  1.00 23.96 ? 65   LYS B CD  1 
ATOM   1173 C CE  . LYS B 1 66 ? 30.880  -1.814  16.827  1.00 26.36 ? 65   LYS B CE  1 
ATOM   1174 N NZ  . LYS B 1 66 ? 31.813  -1.956  17.983  1.00 33.18 ? 65   LYS B NZ  1 
ATOM   1175 N N   . LYS B 1 67 ? 26.967  -2.286  12.228  1.00 10.59 ? 66   LYS B N   1 
ATOM   1176 C CA  . LYS B 1 67 ? 27.310  -3.097  11.060  1.00 10.34 ? 66   LYS B CA  1 
ATOM   1177 C C   . LYS B 1 67 ? 26.813  -2.345  9.823   1.00 14.03 ? 66   LYS B C   1 
ATOM   1178 O O   . LYS B 1 67 ? 25.826  -1.615  9.897   1.00 13.49 ? 66   LYS B O   1 
ATOM   1179 C CB  . LYS B 1 67 ? 26.638  -4.473  11.136  1.00 13.35 ? 66   LYS B CB  1 
ATOM   1180 C CG  . LYS B 1 67 ? 27.090  -5.339  12.314  1.00 25.27 ? 66   LYS B CG  1 
ATOM   1181 C CD  . LYS B 1 67 ? 26.813  -6.817  12.056  1.00 30.87 ? 66   LYS B CD  1 
ATOM   1182 C CE  . LYS B 1 67 ? 25.568  -7.295  12.793  1.00 37.37 ? 66   LYS B CE  1 
ATOM   1183 N NZ  . LYS B 1 67 ? 24.829  -8.338  12.023  1.00 41.50 ? 66   LYS B NZ  1 
ATOM   1184 N N   . ASP B 1 68 ? 27.523  -2.477  8.707   1.00 11.57 ? 67   ASP B N   1 
ATOM   1185 C CA  . ASP B 1 68 ? 27.157  -1.768  7.477   1.00 11.33 ? 67   ASP B CA  1 
ATOM   1186 C C   . ASP B 1 68 ? 25.678  -1.936  7.116   1.00 12.95 ? 67   ASP B C   1 
ATOM   1187 O O   . ASP B 1 68 ? 25.197  -3.059  6.953   1.00 13.08 ? 67   ASP B O   1 
ATOM   1188 C CB  . ASP B 1 68 ? 28.020  -2.248  6.306   1.00 13.40 ? 67   ASP B CB  1 
ATOM   1189 C CG  . ASP B 1 68 ? 29.422  -1.667  6.330   1.00 21.27 ? 67   ASP B CG  1 
ATOM   1190 O OD1 . ASP B 1 68 ? 29.728  -0.858  7.236   1.00 19.10 ? 67   ASP B OD1 1 
ATOM   1191 O OD2 . ASP B 1 68 ? 30.232  -2.060  5.463   1.00 23.33 ? 67   ASP B OD2 1 
ATOM   1192 N N   . LEU B 1 69 ? 24.987  -0.811  6.925   1.00 8.78  ? 68   LEU B N   1 
ATOM   1193 C CA  . LEU B 1 69 ? 23.580  -0.794  6.508   1.00 8.52  ? 68   LEU B CA  1 
ATOM   1194 C C   . LEU B 1 69 ? 22.659  -1.576  7.447   1.00 12.30 ? 68   LEU B C   1 
ATOM   1195 O O   . LEU B 1 69 ? 21.631  -2.118  7.030   1.00 11.21 ? 68   LEU B O   1 
ATOM   1196 C CB  . LEU B 1 69 ? 23.427  -1.286  5.066   1.00 9.16  ? 68   LEU B CB  1 
ATOM   1197 C CG  . LEU B 1 69 ? 24.227  -0.541  3.984   1.00 13.92 ? 68   LEU B CG  1 
ATOM   1198 C CD1 . LEU B 1 69 ? 23.842  -1.022  2.587   1.00 14.68 ? 68   LEU B CD1 1 
ATOM   1199 C CD2 . LEU B 1 69 ? 24.070  0.972   4.090   1.00 16.49 ? 68   LEU B CD2 1 
ATOM   1200 N N   . CYS B 1 70 ? 23.011  -1.577  8.726   1.00 8.90  ? 69   CYS B N   1 
ATOM   1201 C CA  . CYS B 1 70 ? 22.255  -2.296  9.741   1.00 8.79  ? 69   CYS B CA  1 
ATOM   1202 C C   . CYS B 1 70 ? 20.985  -1.547  10.150  1.00 10.70 ? 69   CYS B C   1 
ATOM   1203 O O   . CYS B 1 70 ? 20.079  -2.131  10.744  1.00 11.34 ? 69   CYS B O   1 
ATOM   1204 C CB  . CYS B 1 70 ? 23.143  -2.537  10.964  1.00 10.02 ? 69   CYS B CB  1 
ATOM   1205 S SG  . CYS B 1 70 ? 23.755  -1.007  11.703  1.00 15.01 ? 69   CYS B SG  1 
ATOM   1206 N N   . ASN B 1 71 ? 20.922  -0.257  9.835   1.00 6.72  ? 70   ASN B N   1 
ATOM   1207 C CA  . ASN B 1 71 ? 19.773  0.559   10.231  1.00 5.96  ? 70   ASN B CA  1 
ATOM   1208 C C   . ASN B 1 71 ? 18.604  0.539   9.249   1.00 8.64  ? 70   ASN B C   1 
ATOM   1209 O O   . ASN B 1 71 ? 18.095  1.590   8.861   1.00 6.80  ? 70   ASN B O   1 
ATOM   1210 C CB  . ASN B 1 71 ? 20.195  2.000   10.588  1.00 5.89  ? 70   ASN B CB  1 
ATOM   1211 C CG  . ASN B 1 71 ? 20.776  2.756   9.406   1.00 9.97  ? 70   ASN B CG  1 
ATOM   1212 O OD1 . ASN B 1 71 ? 21.412  2.172   8.533   1.00 10.11 ? 70   ASN B OD1 1 
ATOM   1213 N ND2 . ASN B 1 71 ? 20.570  4.069   9.384   1.00 4.94  ? 70   ASN B ND2 1 
ATOM   1214 N N   . PHE B 1 72 ? 18.171  -0.660  8.858   1.00 6.42  ? 71   PHE B N   1 
ATOM   1215 C CA  . PHE B 1 72 ? 17.000  -0.796  8.001   1.00 5.60  ? 71   PHE B CA  1 
ATOM   1216 C C   . PHE B 1 72 ? 15.736  -0.774  8.858   1.00 7.08  ? 71   PHE B C   1 
ATOM   1217 O O   . PHE B 1 72 ? 15.780  -1.087  10.054  1.00 5.91  ? 71   PHE B O   1 
ATOM   1218 C CB  . PHE B 1 72 ? 17.071  -2.058  7.124   1.00 6.91  ? 71   PHE B CB  1 
ATOM   1219 C CG  . PHE B 1 72 ? 17.323  -3.326  7.890   1.00 7.47  ? 71   PHE B CG  1 
ATOM   1220 C CD1 . PHE B 1 72 ? 18.617  -3.771  8.119   1.00 10.13 ? 71   PHE B CD1 1 
ATOM   1221 C CD2 . PHE B 1 72 ? 16.265  -4.094  8.355   1.00 9.70  ? 71   PHE B CD2 1 
ATOM   1222 C CE1 . PHE B 1 72 ? 18.854  -4.938  8.823   1.00 10.55 ? 71   PHE B CE1 1 
ATOM   1223 C CE2 . PHE B 1 72 ? 16.496  -5.268  9.053   1.00 12.02 ? 71   PHE B CE2 1 
ATOM   1224 C CZ  . PHE B 1 72 ? 17.791  -5.685  9.296   1.00 10.03 ? 71   PHE B CZ  1 
ATOM   1225 N N   . ASN B 1 73 ? 14.637  -0.309  8.272   1.00 5.58  ? 72   ASN B N   1 
ATOM   1226 C CA  . ASN B 1 73 ? 13.414  -0.028  9.023   1.00 6.01  ? 72   ASN B CA  1 
ATOM   1227 C C   . ASN B 1 73 ? 12.842  -1.212  9.788   1.00 9.79  ? 72   ASN B C   1 
ATOM   1228 O O   . ASN B 1 73 ? 12.264  -1.050  10.871  1.00 9.42  ? 72   ASN B O   1 
ATOM   1229 C CB  . ASN B 1 73 ? 12.349  0.578   8.112   1.00 8.18  ? 72   ASN B CB  1 
ATOM   1230 C CG  . ASN B 1 73 ? 12.787  1.897   7.505   1.00 13.96 ? 72   ASN B CG  1 
ATOM   1231 O OD1 . ASN B 1 73 ? 13.882  2.388   7.780   1.00 11.58 ? 72   ASN B OD1 1 
ATOM   1232 N ND2 . ASN B 1 73 ? 11.941  2.466   6.658   1.00 7.14  ? 72   ASN B ND2 1 
ATOM   1233 N N   . GLU B 1 74 ? 12.944  -2.389  9.182   1.00 7.39  ? 73   GLU B N   1 
ATOM   1234 C CA  . GLU B 1 74 ? 12.416  -3.611  9.771   1.00 7.77  ? 73   GLU B CA  1 
ATOM   1235 C C   . GLU B 1 74 ? 13.040  -3.968  11.125  1.00 12.56 ? 73   GLU B C   1 
ATOM   1236 O O   . GLU B 1 74 ? 12.518  -4.820  11.845  1.00 12.66 ? 73   GLU B O   1 
ATOM   1237 C CB  . GLU B 1 74 ? 12.543  -4.768  8.777   1.00 8.40  ? 73   GLU B CB  1 
ATOM   1238 C CG  . GLU B 1 74 ? 11.605  -4.648  7.571   1.00 15.09 ? 73   GLU B CG  1 
ATOM   1239 C CD  . GLU B 1 74 ? 12.233  -3.946  6.370   1.00 20.64 ? 73   GLU B CD  1 
ATOM   1240 O OE1 . GLU B 1 74 ? 13.361  -3.425  6.485   1.00 13.13 ? 73   GLU B OE1 1 
ATOM   1241 O OE2 . GLU B 1 74 ? 11.564  -3.870  5.317   1.00 21.89 ? 73   GLU B OE2 1 
ATOM   1242 N N   . GLN B 1 75 ? 14.132  -3.295  11.485  1.00 8.85  ? 74   GLN B N   1 
ATOM   1243 C CA  . GLN B 1 75 ? 14.778  -3.521  12.776  1.00 8.81  ? 74   GLN B CA  1 
ATOM   1244 C C   . GLN B 1 75 ? 13.845  -3.217  13.953  1.00 13.07 ? 74   GLN B C   1 
ATOM   1245 O O   . GLN B 1 75 ? 14.029  -3.743  15.051  1.00 13.29 ? 74   GLN B O   1 
ATOM   1246 C CB  . GLN B 1 75 ? 16.054  -2.684  12.903  1.00 9.63  ? 74   GLN B CB  1 
ATOM   1247 C CG  . GLN B 1 75 ? 17.203  -3.154  12.023  1.00 13.00 ? 74   GLN B CG  1 
ATOM   1248 C CD  . GLN B 1 75 ? 17.911  -4.374  12.581  1.00 20.92 ? 74   GLN B CD  1 
ATOM   1249 O OE1 . GLN B 1 75 ? 17.322  -5.170  13.313  1.00 13.60 ? 74   GLN B OE1 1 
ATOM   1250 N NE2 . GLN B 1 75 ? 19.181  -4.532  12.226  1.00 12.08 ? 74   GLN B NE2 1 
ATOM   1251 N N   . LEU B 1 76 ? 12.873  -2.339  13.732  1.00 10.21 ? 75   LEU B N   1 
ATOM   1252 C CA  . LEU B 1 76 ? 11.929  -1.962  14.784  1.00 11.19 ? 75   LEU B CA  1 
ATOM   1253 C C   . LEU B 1 76 ? 10.604  -2.706  14.664  1.00 20.73 ? 75   LEU B C   1 
ATOM   1254 O O   . LEU B 1 76 ? 9.613   -2.337  15.301  1.00 21.52 ? 75   LEU B O   1 
ATOM   1255 C CB  . LEU B 1 76 ? 11.686  -0.453  14.763  1.00 11.35 ? 75   LEU B CB  1 
ATOM   1256 C CG  . LEU B 1 76 ? 12.883  0.392   15.210  1.00 15.72 ? 75   LEU B CG  1 
ATOM   1257 C CD1 . LEU B 1 76 ? 12.576  1.886   15.138  1.00 16.08 ? 75   LEU B CD1 1 
ATOM   1258 C CD2 . LEU B 1 76 ? 13.340  -0.017  16.600  1.00 18.05 ? 75   LEU B CD2 1 
ATOM   1259 N N   . GLU B 1 77 ? 10.586  -3.748  13.839  1.00 18.26 ? 76   GLU B N   1 
ATOM   1260 C CA  . GLU B 1 77 ? 9.358   -4.493  13.575  1.00 17.74 ? 76   GLU B CA  1 
ATOM   1261 C C   . GLU B 1 77 ? 9.520   -5.997  13.790  1.00 21.71 ? 76   GLU B C   1 
ATOM   1262 O O   . GLU B 1 77 ? 8.778   -6.792  13.214  1.00 21.88 ? 76   GLU B O   1 
ATOM   1263 C CB  . GLU B 1 77 ? 8.874   -4.227  12.143  1.00 18.86 ? 76   GLU B CB  1 
ATOM   1264 C CG  . GLU B 1 77 ? 8.550   -2.769  11.839  1.00 27.86 ? 76   GLU B CG  1 
ATOM   1265 C CD  . GLU B 1 77 ? 8.201   -2.539  10.376  1.00 44.48 ? 76   GLU B CD  1 
ATOM   1266 O OE1 . GLU B 1 77 ? 9.057   -2.804  9.505   1.00 39.55 ? 76   GLU B OE1 1 
ATOM   1267 O OE2 . GLU B 1 77 ? 7.080   -2.064  10.098  1.00 44.15 ? 76   GLU B OE2 1 
ATOM   1268 N N   . ASN B 1 78 ? 10.466  -6.383  14.642  1.00 18.91 ? 77   ASN B N   1 
ATOM   1269 C CA  . ASN B 1 78 ? 10.740  -7.796  14.903  1.00 18.76 ? 77   ASN B CA  1 
ATOM   1270 C C   . ASN B 1 78 ? 11.071  -8.555  13.619  1.00 24.90 ? 77   ASN B C   1 
ATOM   1271 O O   . ASN B 1 78 ? 11.846  -8.077  12.787  1.00 25.86 ? 77   ASN B O   1 
ATOM   1272 C CB  . ASN B 1 78 ? 9.565   -8.472  15.623  1.00 18.09 ? 77   ASN B CB  1 
ATOM   1273 C CG  . ASN B 1 78 ? 9.944   -9.824  16.208  1.00 28.52 ? 77   ASN B CG  1 
ATOM   1274 O OD1 . ASN B 1 78 ? 11.094  -10.044 16.587  1.00 22.98 ? 77   ASN B OD1 1 
ATOM   1275 N ND2 . ASN B 1 78 ? 8.986   -10.746 16.255  1.00 17.58 ? 77   ASN B ND2 1 
ATOM   1276 N N   . MET C 1 1  ? 16.950  20.027  13.305  1.00 30.84 ? 0    MET C N   1 
ATOM   1277 C CA  . MET C 1 1  ? 18.164  20.525  12.671  1.00 30.17 ? 0    MET C CA  1 
ATOM   1278 C C   . MET C 1 1  ? 18.100  22.036  12.465  1.00 28.32 ? 0    MET C C   1 
ATOM   1279 O O   . MET C 1 1  ? 17.081  22.576  12.030  1.00 27.53 ? 0    MET C O   1 
ATOM   1280 C CB  . MET C 1 1  ? 18.415  19.805  11.342  1.00 33.45 ? 0    MET C CB  1 
ATOM   1281 C CG  . MET C 1 1  ? 18.792  18.336  11.508  1.00 38.43 ? 0    MET C CG  1 
ATOM   1282 S SD  . MET C 1 1  ? 19.559  17.598  10.047  1.00 43.74 ? 0    MET C SD  1 
ATOM   1283 C CE  . MET C 1 1  ? 18.210  17.720  8.843   1.00 40.14 ? 0    MET C CE  1 
ATOM   1284 N N   . LEU C 1 2  ? 19.184  22.718  12.816  1.00 20.65 ? 1    LEU C N   1 
ATOM   1285 C CA  . LEU C 1 2  ? 19.235  24.170  12.724  1.00 18.88 ? 1    LEU C CA  1 
ATOM   1286 C C   . LEU C 1 2  ? 20.097  24.603  11.546  1.00 18.78 ? 1    LEU C C   1 
ATOM   1287 O O   . LEU C 1 2  ? 21.185  24.074  11.339  1.00 17.76 ? 1    LEU C O   1 
ATOM   1288 C CB  . LEU C 1 2  ? 19.814  24.743  14.022  1.00 18.82 ? 1    LEU C CB  1 
ATOM   1289 C CG  . LEU C 1 2  ? 19.727  26.247  14.279  1.00 23.00 ? 1    LEU C CG  1 
ATOM   1290 C CD1 . LEU C 1 2  ? 18.297  26.755  14.123  1.00 23.30 ? 1    LEU C CD1 1 
ATOM   1291 C CD2 . LEU C 1 2  ? 20.259  26.555  15.672  1.00 24.51 ? 1    LEU C CD2 1 
ATOM   1292 N N   . GLN C 1 3  ? 19.615  25.576  10.783  1.00 14.62 ? 2    GLN C N   1 
ATOM   1293 C CA  . GLN C 1 3  ? 20.400  26.134  9.689   1.00 13.84 ? 2    GLN C CA  1 
ATOM   1294 C C   . GLN C 1 3  ? 20.978  27.471  10.137  1.00 13.96 ? 2    GLN C C   1 
ATOM   1295 O O   . GLN C 1 3  ? 20.268  28.299  10.702  1.00 12.90 ? 2    GLN C O   1 
ATOM   1296 C CB  . GLN C 1 3  ? 19.537  26.330  8.442   1.00 15.53 ? 2    GLN C CB  1 
ATOM   1297 C CG  . GLN C 1 3  ? 20.329  26.731  7.211   1.00 26.82 ? 2    GLN C CG  1 
ATOM   1298 C CD  . GLN C 1 3  ? 19.585  26.438  5.923   1.00 40.06 ? 2    GLN C CD  1 
ATOM   1299 O OE1 . GLN C 1 3  ? 18.365  26.576  5.855   1.00 34.41 ? 2    GLN C OE1 1 
ATOM   1300 N NE2 . GLN C 1 3  ? 20.314  25.992  4.905   1.00 32.50 ? 2    GLN C NE2 1 
ATOM   1301 N N   . CYS C 1 4  ? 22.275  27.653  9.918   1.00 11.14 ? 3    CYS C N   1 
ATOM   1302 C CA  . CYS C 1 4  ? 22.973  28.870  10.330  1.00 11.07 ? 3    CYS C CA  1 
ATOM   1303 C C   . CYS C 1 4  ? 23.865  29.322  9.188   1.00 11.96 ? 3    CYS C C   1 
ATOM   1304 O O   . CYS C 1 4  ? 24.297  28.500  8.375   1.00 11.17 ? 3    CYS C O   1 
ATOM   1305 C CB  . CYS C 1 4  ? 23.885  28.581  11.534  1.00 11.09 ? 3    CYS C CB  1 
ATOM   1306 S SG  . CYS C 1 4  ? 23.094  27.918  13.026  1.00 14.44 ? 3    CYS C SG  1 
ATOM   1307 N N   . TYR C 1 5  ? 24.243  30.598  9.196   1.00 8.41  ? 4    TYR C N   1 
ATOM   1308 C CA  . TYR C 1 5  ? 25.327  31.049  8.337   1.00 8.68  ? 4    TYR C CA  1 
ATOM   1309 C C   . TYR C 1 5  ? 26.598  30.516  8.986   1.00 12.19 ? 4    TYR C C   1 
ATOM   1310 O O   . TYR C 1 5  ? 26.778  30.639  10.200  1.00 11.70 ? 4    TYR C O   1 
ATOM   1311 C CB  . TYR C 1 5  ? 25.377  32.577  8.258   1.00 9.72  ? 4    TYR C CB  1 
ATOM   1312 C CG  . TYR C 1 5  ? 24.199  33.182  7.525   1.00 10.43 ? 4    TYR C CG  1 
ATOM   1313 C CD1 . TYR C 1 5  ? 23.949  32.867  6.195   1.00 12.79 ? 4    TYR C CD1 1 
ATOM   1314 C CD2 . TYR C 1 5  ? 23.278  33.981  8.194   1.00 11.32 ? 4    TYR C CD2 1 
ATOM   1315 C CE1 . TYR C 1 5  ? 22.829  33.366  5.537   1.00 12.99 ? 4    TYR C CE1 1 
ATOM   1316 C CE2 . TYR C 1 5  ? 22.170  34.496  7.542   1.00 12.18 ? 4    TYR C CE2 1 
ATOM   1317 C CZ  . TYR C 1 5  ? 21.948  34.181  6.217   1.00 14.74 ? 4    TYR C CZ  1 
ATOM   1318 O OH  . TYR C 1 5  ? 20.834  34.676  5.574   1.00 15.77 ? 4    TYR C OH  1 
ATOM   1319 N N   . ASN C 1 6  ? 27.404  29.799  8.211   1.00 8.95  ? 5    ASN C N   1 
ATOM   1320 C CA  . ASN C 1 6  ? 28.613  29.194  8.749   1.00 9.85  ? 5    ASN C CA  1 
ATOM   1321 C C   . ASN C 1 6  ? 29.760  29.319  7.764   1.00 16.02 ? 5    ASN C C   1 
ATOM   1322 O O   . ASN C 1 6  ? 29.690  28.812  6.642   1.00 16.30 ? 5    ASN C O   1 
ATOM   1323 C CB  . ASN C 1 6  ? 28.380  27.722  9.102   1.00 12.14 ? 5    ASN C CB  1 
ATOM   1324 C CG  . ASN C 1 6  ? 29.559  27.101  9.830   1.00 24.40 ? 5    ASN C CG  1 
ATOM   1325 O OD1 . ASN C 1 6  ? 29.718  27.274  11.037  1.00 16.28 ? 5    ASN C OD1 1 
ATOM   1326 N ND2 . ASN C 1 6  ? 30.403  26.389  9.093   1.00 23.80 ? 5    ASN C ND2 1 
ATOM   1327 N N   . CYS C 1 7  ? 30.792  30.043  8.176   1.00 13.12 ? 6    CYS C N   1 
ATOM   1328 C CA  . CYS C 1 7  ? 31.998  30.191  7.375   1.00 14.20 ? 6    CYS C CA  1 
ATOM   1329 C C   . CYS C 1 7  ? 33.187  29.747  8.224   1.00 15.84 ? 6    CYS C C   1 
ATOM   1330 O O   . CYS C 1 7  ? 33.231  30.019  9.422   1.00 13.38 ? 6    CYS C O   1 
ATOM   1331 C CB  . CYS C 1 7  ? 32.150  31.642  6.918   1.00 15.52 ? 6    CYS C CB  1 
ATOM   1332 S SG  . CYS C 1 7  ? 31.001  32.089  5.580   1.00 20.19 ? 6    CYS C SG  1 
ATOM   1333 N N   . PRO C 1 8  ? 34.087  28.966  7.637   1.00 14.22 ? 7    PRO C N   1 
ATOM   1334 C CA  . PRO C 1 8  ? 35.188  28.382  8.405   1.00 13.25 ? 7    PRO C CA  1 
ATOM   1335 C C   . PRO C 1 8  ? 36.146  29.403  9.016   1.00 14.31 ? 7    PRO C C   1 
ATOM   1336 O O   . PRO C 1 8  ? 36.737  29.151  10.064  1.00 14.22 ? 7    PRO C O   1 
ATOM   1337 C CB  . PRO C 1 8  ? 35.904  27.485  7.389   1.00 15.36 ? 7    PRO C CB  1 
ATOM   1338 C CG  . PRO C 1 8  ? 35.473  27.981  6.053   1.00 20.18 ? 7    PRO C CG  1 
ATOM   1339 C CD  . PRO C 1 8  ? 34.081  28.503  6.240   1.00 15.35 ? 7    PRO C CD  1 
ATOM   1340 N N   . ASN C 1 9  ? 36.309  30.548  8.359   1.00 10.46 ? 8    ASN C N   1 
ATOM   1341 C CA  . ASN C 1 9  ? 37.161  31.616  8.881   1.00 10.05 ? 8    ASN C CA  1 
ATOM   1342 C C   . ASN C 1 9  ? 36.415  32.941  8.753   1.00 13.30 ? 8    ASN C C   1 
ATOM   1343 O O   . ASN C 1 9  ? 35.476  33.049  7.960   1.00 13.84 ? 8    ASN C O   1 
ATOM   1344 C CB  . ASN C 1 9  ? 38.491  31.669  8.120   1.00 11.14 ? 8    ASN C CB  1 
ATOM   1345 C CG  . ASN C 1 9  ? 39.260  30.367  8.207   1.00 28.63 ? 8    ASN C CG  1 
ATOM   1346 O OD1 . ASN C 1 9  ? 39.093  29.487  7.366   1.00 30.00 ? 8    ASN C OD1 1 
ATOM   1347 N ND2 . ASN C 1 9  ? 39.998  30.186  9.295   1.00 20.38 ? 8    ASN C ND2 1 
ATOM   1348 N N   . PRO C 1 10 ? 36.760  33.918  9.584   1.00 10.69 ? 9    PRO C N   1 
ATOM   1349 C CA  . PRO C 1 10 ? 36.010  35.173  9.582   1.00 10.44 ? 9    PRO C CA  1 
ATOM   1350 C C   . PRO C 1 10 ? 36.042  35.866  8.221   1.00 14.63 ? 9    PRO C C   1 
ATOM   1351 O O   . PRO C 1 10 ? 36.991  35.716  7.448   1.00 13.57 ? 9    PRO C O   1 
ATOM   1352 C CB  . PRO C 1 10 ? 36.697  36.020  10.660  1.00 11.98 ? 9    PRO C CB  1 
ATOM   1353 C CG  . PRO C 1 10 ? 38.005  35.365  10.928  1.00 17.08 ? 9    PRO C CG  1 
ATOM   1354 C CD  . PRO C 1 10 ? 37.853  33.917  10.574  1.00 12.26 ? 9    PRO C CD  1 
ATOM   1355 N N   . THR C 1 11 ? 34.945  36.543  7.899   1.00 11.67 ? 10   THR C N   1 
ATOM   1356 C CA  . THR C 1 11 ? 34.802  37.244  6.627   1.00 11.71 ? 10   THR C CA  1 
ATOM   1357 C C   . THR C 1 11 ? 33.671  38.255  6.775   1.00 14.39 ? 10   THR C C   1 
ATOM   1358 O O   . THR C 1 11 ? 32.780  38.072  7.602   1.00 12.18 ? 10   THR C O   1 
ATOM   1359 C CB  . THR C 1 11 ? 34.537  36.262  5.468   1.00 20.27 ? 10   THR C CB  1 
ATOM   1360 O OG1 . THR C 1 11 ? 34.607  36.960  4.216   1.00 23.01 ? 10   THR C OG1 1 
ATOM   1361 C CG2 . THR C 1 11 ? 33.163  35.614  5.614   1.00 16.79 ? 10   THR C CG2 1 
ATOM   1362 N N   . ALA C 1 12 ? 33.738  39.340  6.010   1.00 12.28 ? 11   ALA C N   1 
ATOM   1363 C CA  . ALA C 1 12 ? 32.784  40.445  6.130   1.00 12.83 ? 11   ALA C CA  1 
ATOM   1364 C C   . ALA C 1 12 ? 31.322  40.093  5.868   1.00 15.44 ? 11   ALA C C   1 
ATOM   1365 O O   . ALA C 1 12 ? 30.424  40.701  6.452   1.00 15.03 ? 11   ALA C O   1 
ATOM   1366 C CB  . ALA C 1 12 ? 33.207  41.614  5.247   1.00 13.71 ? 11   ALA C CB  1 
ATOM   1367 N N   . ASP C 1 13 ? 31.078  39.209  4.905   1.00 12.61 ? 12   ASP C N   1 
ATOM   1368 C CA  . ASP C 1 13 ? 29.706  38.870  4.532   1.00 11.70 ? 12   ASP C CA  1 
ATOM   1369 C C   . ASP C 1 13 ? 29.518  37.383  4.272   1.00 15.66 ? 12   ASP C C   1 
ATOM   1370 O O   . ASP C 1 13 ? 29.342  36.951  3.133   1.00 14.93 ? 12   ASP C O   1 
ATOM   1371 C CB  . ASP C 1 13 ? 29.241  39.688  3.323   1.00 12.67 ? 12   ASP C CB  1 
ATOM   1372 C CG  . ASP C 1 13 ? 27.790  39.410  2.949   1.00 19.52 ? 12   ASP C CG  1 
ATOM   1373 O OD1 . ASP C 1 13 ? 27.009  39.008  3.838   1.00 17.88 ? 12   ASP C OD1 1 
ATOM   1374 O OD2 . ASP C 1 13 ? 27.423  39.624  1.772   1.00 22.37 ? 12   ASP C OD2 1 
ATOM   1375 N N   . CYS C 1 14 ? 29.505  36.609  5.347   1.00 13.61 ? 13   CYS C N   1 
ATOM   1376 C CA  . CYS C 1 14 ? 29.245  35.182  5.252   1.00 14.09 ? 13   CYS C CA  1 
ATOM   1377 C C   . CYS C 1 14 ? 27.772  34.932  4.932   1.00 18.16 ? 13   CYS C C   1 
ATOM   1378 O O   . CYS C 1 14 ? 26.901  35.206  5.757   1.00 18.01 ? 13   CYS C O   1 
ATOM   1379 C CB  . CYS C 1 14 ? 29.577  34.509  6.583   1.00 14.75 ? 13   CYS C CB  1 
ATOM   1380 S SG  . CYS C 1 14 ? 29.331  32.738  6.535   1.00 18.98 ? 13   CYS C SG  1 
ATOM   1381 N N   . LYS C 1 15 ? 27.496  34.355  3.767   1.00 14.73 ? 14   LYS C N   1 
ATOM   1382 C CA  . LYS C 1 15 ? 26.124  33.996  3.421   1.00 14.77 ? 14   LYS C CA  1 
ATOM   1383 C C   . LYS C 1 15 ? 25.992  32.505  3.106   1.00 18.51 ? 14   LYS C C   1 
ATOM   1384 O O   . LYS C 1 15 ? 24.982  32.056  2.557   1.00 16.76 ? 14   LYS C O   1 
ATOM   1385 C CB  . LYS C 1 15 ? 25.604  34.852  2.265   1.00 17.70 ? 14   LYS C CB  1 
ATOM   1386 C CG  . LYS C 1 15 ? 26.413  34.722  0.991   1.00 25.60 ? 14   LYS C CG  1 
ATOM   1387 C CD  . LYS C 1 15 ? 25.694  35.360  -0.186  1.00 28.72 ? 14   LYS C CD  1 
ATOM   1388 C CE  . LYS C 1 15 ? 26.248  34.837  -1.500  1.00 30.08 ? 14   LYS C CE  1 
ATOM   1389 N NZ  . LYS C 1 15 ? 26.322  35.897  -2.542  1.00 36.14 ? 14   LYS C NZ  1 
ATOM   1390 N N   . THR C 1 16 ? 27.004  31.741  3.505   1.00 15.66 ? 15   THR C N   1 
ATOM   1391 C CA  . THR C 1 16 ? 26.994  30.292  3.353   1.00 16.10 ? 15   THR C CA  1 
ATOM   1392 C C   . THR C 1 16 ? 26.025  29.688  4.369   1.00 20.39 ? 15   THR C C   1 
ATOM   1393 O O   . THR C 1 16 ? 26.321  29.636  5.562   1.00 19.17 ? 15   THR C O   1 
ATOM   1394 C CB  . THR C 1 16 ? 28.415  29.711  3.525   1.00 23.89 ? 15   THR C CB  1 
ATOM   1395 O OG1 . THR C 1 16 ? 29.315  30.365  2.620   1.00 20.14 ? 15   THR C OG1 1 
ATOM   1396 C CG2 . THR C 1 16 ? 28.424  28.213  3.257   1.00 23.89 ? 15   THR C CG2 1 
ATOM   1397 N N   . ALA C 1 17 ? 24.852  29.277  3.893   1.00 17.56 ? 16   ALA C N   1 
ATOM   1398 C CA  . ALA C 1 17 ? 23.818  28.709  4.754   1.00 18.03 ? 16   ALA C CA  1 
ATOM   1399 C C   . ALA C 1 17 ? 23.967  27.196  4.835   1.00 23.24 ? 16   ALA C C   1 
ATOM   1400 O O   . ALA C 1 17 ? 23.854  26.498  3.828   1.00 22.95 ? 16   ALA C O   1 
ATOM   1401 C CB  . ALA C 1 17 ? 22.434  29.077  4.234   1.00 18.89 ? 16   ALA C CB  1 
ATOM   1402 N N   . VAL C 1 18 ? 24.224  26.696  6.039   1.00 19.79 ? 17   VAL C N   1 
ATOM   1403 C CA  . VAL C 1 18 ? 24.468  25.274  6.246   1.00 19.07 ? 17   VAL C CA  1 
ATOM   1404 C C   . VAL C 1 18 ? 23.445  24.663  7.192   1.00 21.36 ? 17   VAL C C   1 
ATOM   1405 O O   . VAL C 1 18 ? 23.044  25.293  8.169   1.00 20.10 ? 17   VAL C O   1 
ATOM   1406 C CB  . VAL C 1 18 ? 25.882  25.040  6.813   1.00 23.25 ? 17   VAL C CB  1 
ATOM   1407 C CG1 . VAL C 1 18 ? 26.938  25.738  5.959   1.00 23.08 ? 17   VAL C CG1 1 
ATOM   1408 C CG2 . VAL C 1 18 ? 25.950  25.518  8.257   1.00 23.15 ? 17   VAL C CG2 1 
ATOM   1409 N N   . ASN C 1 19 ? 23.110  23.397  6.957   1.00 16.75 ? 18   ASN C N   1 
ATOM   1410 C CA  . ASN C 1 19 ? 22.307  22.632  7.904   1.00 16.63 ? 18   ASN C CA  1 
ATOM   1411 C C   . ASN C 1 19 ? 23.297  22.098  8.934   1.00 20.89 ? 18   ASN C C   1 
ATOM   1412 O O   . ASN C 1 19 ? 24.059  21.178  8.643   1.00 22.15 ? 18   ASN C O   1 
ATOM   1413 C CB  . ASN C 1 19 ? 21.635  21.442  7.210   1.00 18.33 ? 18   ASN C CB  1 
ATOM   1414 C CG  . ASN C 1 19 ? 20.590  21.864  6.195   1.00 36.25 ? 18   ASN C CG  1 
ATOM   1415 O OD1 . ASN C 1 19 ? 20.314  23.050  6.020   1.00 28.71 ? 18   ASN C OD1 1 
ATOM   1416 N ND2 . ASN C 1 19 ? 19.994  20.884  5.522   1.00 35.39 ? 18   ASN C ND2 1 
ATOM   1417 N N   . CYS C 1 20 ? 23.368  22.739  10.095  1.00 15.79 ? 19   CYS C N   1 
ATOM   1418 C CA  . CYS C 1 20 ? 24.337  22.340  11.111  1.00 14.41 ? 19   CYS C CA  1 
ATOM   1419 C C   . CYS C 1 20 ? 24.150  20.888  11.536  1.00 17.68 ? 19   CYS C C   1 
ATOM   1420 O O   . CYS C 1 20 ? 23.029  20.379  11.561  1.00 15.48 ? 19   CYS C O   1 
ATOM   1421 C CB  . CYS C 1 20 ? 24.239  23.255  12.333  1.00 14.50 ? 19   CYS C CB  1 
ATOM   1422 S SG  . CYS C 1 20 ? 24.420  25.014  11.960  1.00 17.94 ? 19   CYS C SG  1 
ATOM   1423 N N   . SER C 1 21 ? 25.248  20.235  11.904  1.00 15.44 ? 20   SER C N   1 
ATOM   1424 C CA  . SER C 1 21 ? 25.169  18.887  12.452  1.00 16.05 ? 20   SER C CA  1 
ATOM   1425 C C   . SER C 1 21 ? 24.392  18.954  13.760  1.00 19.38 ? 20   SER C C   1 
ATOM   1426 O O   . SER C 1 21 ? 24.311  20.006  14.394  1.00 17.81 ? 20   SER C O   1 
ATOM   1427 C CB  . SER C 1 21 ? 26.564  18.312  12.703  1.00 21.10 ? 20   SER C CB  1 
ATOM   1428 O OG  . SER C 1 21 ? 27.212  18.982  13.770  1.00 31.38 ? 20   SER C OG  1 
ATOM   1429 N N   . SER C 1 22 ? 23.851  17.818  14.179  1.00 17.06 ? 21   SER C N   1 
ATOM   1430 C CA  . SER C 1 22 ? 23.040  17.763  15.386  1.00 16.58 ? 21   SER C CA  1 
ATOM   1431 C C   . SER C 1 22 ? 23.811  17.978  16.688  1.00 18.56 ? 21   SER C C   1 
ATOM   1432 O O   . SER C 1 22 ? 23.209  18.069  17.757  1.00 17.60 ? 21   SER C O   1 
ATOM   1433 C CB  . SER C 1 22 ? 22.212  16.481  15.419  1.00 19.50 ? 21   SER C CB  1 
ATOM   1434 O OG  . SER C 1 22 ? 21.132  16.577  14.505  1.00 25.67 ? 21   SER C OG  1 
ATOM   1435 N N   . ASP C 1 23 ? 25.130  18.133  16.592  1.00 15.20 ? 22   ASP C N   1 
ATOM   1436 C CA  . ASP C 1 23 ? 25.928  18.480  17.764  1.00 15.14 ? 22   ASP C CA  1 
ATOM   1437 C C   . ASP C 1 23 ? 25.683  19.952  18.111  1.00 18.11 ? 22   ASP C C   1 
ATOM   1438 O O   . ASP C 1 23 ? 26.008  20.407  19.208  1.00 17.41 ? 22   ASP C O   1 
ATOM   1439 C CB  . ASP C 1 23 ? 27.423  18.271  17.498  1.00 17.80 ? 22   ASP C CB  1 
ATOM   1440 C CG  . ASP C 1 23 ? 27.779  16.819  17.223  1.00 29.73 ? 22   ASP C CG  1 
ATOM   1441 O OD1 . ASP C 1 23 ? 27.121  15.915  17.786  1.00 29.18 ? 22   ASP C OD1 1 
ATOM   1442 O OD2 . ASP C 1 23 ? 28.757  16.586  16.481  1.00 35.16 ? 22   ASP C OD2 1 
ATOM   1443 N N   . PHE C 1 24 ? 25.127  20.693  17.154  1.00 12.93 ? 23   PHE C N   1 
ATOM   1444 C CA  . PHE C 1 24 ? 24.898  22.127  17.311  1.00 12.33 ? 23   PHE C CA  1 
ATOM   1445 C C   . PHE C 1 24 ? 23.418  22.455  17.482  1.00 16.66 ? 23   PHE C C   1 
ATOM   1446 O O   . PHE C 1 24 ? 22.573  21.973  16.721  1.00 19.22 ? 23   PHE C O   1 
ATOM   1447 C CB  . PHE C 1 24 ? 25.457  22.885  16.104  1.00 14.01 ? 23   PHE C CB  1 
ATOM   1448 C CG  . PHE C 1 24 ? 26.930  22.686  15.889  1.00 15.60 ? 23   PHE C CG  1 
ATOM   1449 C CD1 . PHE C 1 24 ? 27.853  23.282  16.735  1.00 18.59 ? 23   PHE C CD1 1 
ATOM   1450 C CD2 . PHE C 1 24 ? 27.393  21.923  14.829  1.00 17.57 ? 23   PHE C CD2 1 
ATOM   1451 C CE1 . PHE C 1 24 ? 29.211  23.108  16.536  1.00 19.80 ? 23   PHE C CE1 1 
ATOM   1452 C CE2 . PHE C 1 24 ? 28.748  21.758  14.616  1.00 20.63 ? 23   PHE C CE2 1 
ATOM   1453 C CZ  . PHE C 1 24 ? 29.659  22.352  15.471  1.00 18.91 ? 23   PHE C CZ  1 
ATOM   1454 N N   . ASP C 1 25 ? 23.113  23.301  18.461  1.00 10.53 ? 24   ASP C N   1 
ATOM   1455 C CA  . ASP C 1 25 ? 21.731  23.668  18.757  1.00 10.73 ? 24   ASP C CA  1 
ATOM   1456 C C   . ASP C 1 25 ? 21.489  25.180  18.701  1.00 13.47 ? 24   ASP C C   1 
ATOM   1457 O O   . ASP C 1 25 ? 20.415  25.659  19.067  1.00 13.82 ? 24   ASP C O   1 
ATOM   1458 C CB  . ASP C 1 25 ? 21.312  23.114  20.123  1.00 12.66 ? 24   ASP C CB  1 
ATOM   1459 C CG  . ASP C 1 25 ? 22.210  23.599  21.262  1.00 22.48 ? 24   ASP C CG  1 
ATOM   1460 O OD1 . ASP C 1 25 ? 23.019  24.527  21.045  1.00 21.23 ? 24   ASP C OD1 1 
ATOM   1461 O OD2 . ASP C 1 25 ? 22.061  23.090  22.394  1.00 25.79 ? 24   ASP C OD2 1 
ATOM   1462 N N   . ALA C 1 26 ? 22.472  25.920  18.195  1.00 9.72  ? 25   ALA C N   1 
ATOM   1463 C CA  . ALA C 1 26 ? 22.366  27.374  18.108  1.00 9.12  ? 25   ALA C CA  1 
ATOM   1464 C C   . ALA C 1 26 ? 23.222  27.945  16.980  1.00 12.35 ? 25   ALA C C   1 
ATOM   1465 O O   . ALA C 1 26 ? 24.071  27.251  16.419  1.00 11.80 ? 25   ALA C O   1 
ATOM   1466 C CB  . ALA C 1 26 ? 22.753  28.013  19.440  1.00 9.79  ? 25   ALA C CB  1 
ATOM   1467 N N   . CYS C 1 27 ? 22.953  29.201  16.626  1.00 8.74  ? 26   CYS C N   1 
ATOM   1468 C CA  . CYS C 1 27 ? 23.749  29.927  15.636  1.00 8.90  ? 26   CYS C CA  1 
ATOM   1469 C C   . CYS C 1 27 ? 24.448  31.062  16.384  1.00 11.13 ? 26   CYS C C   1 
ATOM   1470 O O   . CYS C 1 27 ? 23.861  31.668  17.280  1.00 11.31 ? 26   CYS C O   1 
ATOM   1471 C CB  . CYS C 1 27 ? 22.851  30.542  14.554  1.00 9.73  ? 26   CYS C CB  1 
ATOM   1472 S SG  . CYS C 1 27 ? 21.821  29.396  13.594  1.00 13.78 ? 26   CYS C SG  1 
ATOM   1473 N N   . LEU C 1 28 ? 25.678  31.368  15.984  1.00 6.50  ? 27   LEU C N   1 
ATOM   1474 C CA  . LEU C 1 28 ? 26.454  32.441  16.599  1.00 5.65  ? 27   LEU C CA  1 
ATOM   1475 C C   . LEU C 1 28 ? 26.881  33.470  15.554  1.00 8.29  ? 27   LEU C C   1 
ATOM   1476 O O   . LEU C 1 28 ? 27.331  33.112  14.467  1.00 6.75  ? 27   LEU C O   1 
ATOM   1477 C CB  . LEU C 1 28 ? 27.708  31.863  17.275  1.00 5.90  ? 27   LEU C CB  1 
ATOM   1478 C CG  . LEU C 1 28 ? 28.758  32.857  17.795  1.00 11.20 ? 27   LEU C CG  1 
ATOM   1479 C CD1 . LEU C 1 28 ? 28.301  33.480  19.104  1.00 12.03 ? 27   LEU C CD1 1 
ATOM   1480 C CD2 . LEU C 1 28 ? 30.127  32.189  17.970  1.00 13.33 ? 27   LEU C CD2 1 
ATOM   1481 N N   . ILE C 1 29 ? 26.784  34.747  15.910  1.00 5.82  ? 28   ILE C N   1 
ATOM   1482 C CA  . ILE C 1 29 ? 27.404  35.809  15.130  1.00 5.84  ? 28   ILE C CA  1 
ATOM   1483 C C   . ILE C 1 29 ? 28.170  36.729  16.080  1.00 8.90  ? 28   ILE C C   1 
ATOM   1484 O O   . ILE C 1 29 ? 27.670  37.080  17.150  1.00 8.81  ? 28   ILE C O   1 
ATOM   1485 C CB  . ILE C 1 29 ? 26.414  36.542  14.182  1.00 8.92  ? 28   ILE C CB  1 
ATOM   1486 C CG1 . ILE C 1 29 ? 27.147  37.571  13.310  1.00 9.11  ? 28   ILE C CG1 1 
ATOM   1487 C CG2 . ILE C 1 29 ? 25.243  37.139  14.945  1.00 11.84 ? 28   ILE C CG2 1 
ATOM   1488 C CD1 . ILE C 1 29 ? 27.377  38.910  13.989  1.00 16.43 ? 28   ILE C CD1 1 
ATOM   1489 N N   . THR C 1 30 ? 29.448  36.928  15.778  1.00 6.57  ? 29   THR C N   1 
ATOM   1490 C CA  . THR C 1 30 ? 30.347  37.702  16.634  1.00 6.76  ? 29   THR C CA  1 
ATOM   1491 C C   . THR C 1 30 ? 31.025  38.789  15.817  1.00 12.14 ? 29   THR C C   1 
ATOM   1492 O O   . THR C 1 30 ? 31.522  38.534  14.721  1.00 10.40 ? 29   THR C O   1 
ATOM   1493 C CB  . THR C 1 30 ? 31.422  36.793  17.279  1.00 13.85 ? 29   THR C CB  1 
ATOM   1494 O OG1 . THR C 1 30 ? 30.797  35.803  18.104  1.00 14.74 ? 29   THR C OG1 1 
ATOM   1495 C CG2 . THR C 1 30 ? 32.395  37.617  18.112  1.00 10.35 ? 29   THR C CG2 1 
ATOM   1496 N N   . LYS C 1 31 ? 31.110  39.984  16.390  1.00 10.31 ? 30   LYS C N   1 
ATOM   1497 C CA  . LYS C 1 31 ? 31.814  41.081  15.744  1.00 10.02 ? 30   LYS C CA  1 
ATOM   1498 C C   . LYS C 1 31 ? 32.973  41.535  16.619  1.00 14.16 ? 30   LYS C C   1 
ATOM   1499 O O   . LYS C 1 31 ? 32.806  41.773  17.810  1.00 12.65 ? 30   LYS C O   1 
ATOM   1500 C CB  . LYS C 1 31 ? 30.870  42.252  15.486  1.00 12.65 ? 30   LYS C CB  1 
ATOM   1501 C CG  . LYS C 1 31 ? 29.856  41.997  14.380  1.00 17.82 ? 30   LYS C CG  1 
ATOM   1502 C CD  . LYS C 1 31 ? 29.024  43.240  14.110  1.00 17.64 ? 30   LYS C CD  1 
ATOM   1503 C CE  . LYS C 1 31 ? 28.150  43.065  12.878  1.00 15.45 ? 30   LYS C CE  1 
ATOM   1504 N NZ  . LYS C 1 31 ? 27.393  44.315  12.578  1.00 23.44 ? 30   LYS C NZ  1 
ATOM   1505 N N   . ALA C 1 32 ? 34.161  41.582  16.032  1.00 13.36 ? 31   ALA C N   1 
ATOM   1506 C CA  . ALA C 1 32 ? 35.334  42.111  16.711  1.00 14.17 ? 31   ALA C CA  1 
ATOM   1507 C C   . ALA C 1 32 ? 36.048  43.017  15.715  1.00 17.35 ? 31   ALA C C   1 
ATOM   1508 O O   . ALA C 1 32 ? 36.986  42.592  15.041  1.00 15.50 ? 31   ALA C O   1 
ATOM   1509 C CB  . ALA C 1 32 ? 36.246  40.979  17.162  1.00 15.28 ? 31   ALA C CB  1 
ATOM   1510 N N   . GLY C 1 33 ? 35.491  44.207  15.514  1.00 15.60 ? 32   GLY C N   1 
ATOM   1511 C CA  . GLY C 1 33 ? 36.018  45.143  14.527  1.00 15.83 ? 32   GLY C CA  1 
ATOM   1512 C C   . GLY C 1 33 ? 35.812  44.601  13.116  1.00 19.91 ? 32   GLY C C   1 
ATOM   1513 O O   . GLY C 1 33 ? 34.694  44.249  12.733  1.00 19.93 ? 32   GLY C O   1 
ATOM   1514 N N   . LEU C 1 34 ? 36.903  44.492  12.363  1.00 16.20 ? 33   LEU C N   1 
ATOM   1515 C CA  . LEU C 1 34 ? 36.844  43.986  10.997  1.00 16.31 ? 33   LEU C CA  1 
ATOM   1516 C C   . LEU C 1 34 ? 36.566  42.489  10.953  1.00 19.73 ? 33   LEU C C   1 
ATOM   1517 O O   . LEU C 1 34 ? 36.151  41.960  9.921   1.00 21.23 ? 33   LEU C O   1 
ATOM   1518 C CB  . LEU C 1 34 ? 38.148  44.289  10.257  1.00 16.78 ? 33   LEU C CB  1 
ATOM   1519 C CG  . LEU C 1 34 ? 38.378  45.749  9.863   1.00 22.53 ? 33   LEU C CG  1 
ATOM   1520 C CD1 . LEU C 1 34 ? 39.839  45.973  9.502   1.00 23.83 ? 33   LEU C CD1 1 
ATOM   1521 C CD2 . LEU C 1 34 ? 37.469  46.141  8.709   1.00 24.68 ? 33   LEU C CD2 1 
ATOM   1522 N N   . GLN C 1 35 ? 36.836  41.803  12.060  1.00 14.36 ? 34   GLN C N   1 
ATOM   1523 C CA  . GLN C 1 35 ? 36.662  40.354  12.124  1.00 13.31 ? 34   GLN C CA  1 
ATOM   1524 C C   . GLN C 1 35 ? 35.229  39.987  12.499  1.00 15.97 ? 34   GLN C C   1 
ATOM   1525 O O   . GLN C 1 35 ? 34.752  40.338  13.575  1.00 16.23 ? 34   GLN C O   1 
ATOM   1526 C CB  . GLN C 1 35 ? 37.641  39.741  13.131  1.00 14.44 ? 34   GLN C CB  1 
ATOM   1527 C CG  . GLN C 1 35 ? 39.046  40.323  13.064  1.00 18.81 ? 34   GLN C CG  1 
ATOM   1528 C CD  . GLN C 1 35 ? 39.750  39.983  11.766  1.00 33.53 ? 34   GLN C CD  1 
ATOM   1529 O OE1 . GLN C 1 35 ? 39.515  38.925  11.180  1.00 28.95 ? 34   GLN C OE1 1 
ATOM   1530 N NE2 . GLN C 1 35 ? 40.573  40.906  11.278  1.00 21.17 ? 34   GLN C NE2 1 
ATOM   1531 N N   . VAL C 1 36 ? 34.533  39.318  11.586  1.00 10.12 ? 35   VAL C N   1 
ATOM   1532 C CA  . VAL C 1 36 ? 33.167  38.879  11.845  1.00 8.53  ? 35   VAL C CA  1 
ATOM   1533 C C   . VAL C 1 36 ? 33.092  37.363  11.716  1.00 11.47 ? 35   VAL C C   1 
ATOM   1534 O O   . VAL C 1 36 ? 33.596  36.792  10.750  1.00 9.46  ? 35   VAL C O   1 
ATOM   1535 C CB  . VAL C 1 36 ? 32.160  39.572  10.902  1.00 12.05 ? 35   VAL C CB  1 
ATOM   1536 C CG1 . VAL C 1 36 ? 30.732  39.156  11.245  1.00 11.18 ? 35   VAL C CG1 1 
ATOM   1537 C CG2 . VAL C 1 36 ? 32.319  41.092  10.965  1.00 11.71 ? 35   VAL C CG2 1 
ATOM   1538 N N   . TYR C 1 37 ? 32.512  36.711  12.719  1.00 8.54  ? 36   TYR C N   1 
ATOM   1539 C CA  . TYR C 1 37 ? 32.379  35.256  12.705  1.00 7.99  ? 36   TYR C CA  1 
ATOM   1540 C C   . TYR C 1 37 ? 30.907  34.856  12.615  1.00 9.22  ? 36   TYR C C   1 
ATOM   1541 O O   . TYR C 1 37 ? 30.046  35.485  13.230  1.00 7.92  ? 36   TYR C O   1 
ATOM   1542 C CB  . TYR C 1 37 ? 33.002  34.644  13.966  1.00 8.77  ? 36   TYR C CB  1 
ATOM   1543 C CG  . TYR C 1 37 ? 34.476  34.954  14.155  1.00 10.23 ? 36   TYR C CG  1 
ATOM   1544 C CD1 . TYR C 1 37 ? 34.892  36.189  14.642  1.00 12.55 ? 36   TYR C CD1 1 
ATOM   1545 C CD2 . TYR C 1 37 ? 35.448  34.004  13.861  1.00 11.22 ? 36   TYR C CD2 1 
ATOM   1546 C CE1 . TYR C 1 37 ? 36.240  36.476  14.811  1.00 13.50 ? 36   TYR C CE1 1 
ATOM   1547 C CE2 . TYR C 1 37 ? 36.796  34.278  14.038  1.00 12.45 ? 36   TYR C CE2 1 
ATOM   1548 C CZ  . TYR C 1 37 ? 37.184  35.515  14.512  1.00 19.17 ? 36   TYR C CZ  1 
ATOM   1549 O OH  . TYR C 1 37 ? 38.524  35.792  14.676  1.00 19.43 ? 36   TYR C OH  1 
ATOM   1550 N N   . ASN C 1 38 ? 30.629  33.801  11.857  1.00 7.52  ? 37   ASN C N   1 
ATOM   1551 C CA  . ASN C 1 38 ? 29.283  33.240  11.764  1.00 7.31  ? 37   ASN C CA  1 
ATOM   1552 C C   . ASN C 1 38 ? 29.441  31.727  11.823  1.00 10.07 ? 37   ASN C C   1 
ATOM   1553 O O   . ASN C 1 38 ? 30.137  31.140  10.993  1.00 8.76  ? 37   ASN C O   1 
ATOM   1554 C CB  . ASN C 1 38 ? 28.599  33.647  10.454  1.00 8.44  ? 37   ASN C CB  1 
ATOM   1555 C CG  . ASN C 1 38 ? 28.561  35.146  10.255  1.00 14.84 ? 37   ASN C CG  1 
ATOM   1556 O OD1 . ASN C 1 38 ? 29.529  35.743  9.784   1.00 10.98 ? 37   ASN C OD1 1 
ATOM   1557 N ND2 . ASN C 1 38 ? 27.413  35.754  10.540  1.00 6.04  ? 37   ASN C ND2 1 
ATOM   1558 N N   . LYS C 1 39 ? 28.891  31.114  12.868  1.00 7.84  ? 38   LYS C N   1 
ATOM   1559 C CA  . LYS C 1 39 ? 29.132  29.697  13.124  1.00 7.47  ? 38   LYS C CA  1 
ATOM   1560 C C   . LYS C 1 39 ? 27.901  28.941  13.584  1.00 11.61 ? 38   LYS C C   1 
ATOM   1561 O O   . LYS C 1 39 ? 27.079  29.470  14.334  1.00 10.48 ? 38   LYS C O   1 
ATOM   1562 C CB  . LYS C 1 39 ? 30.189  29.545  14.226  1.00 8.64  ? 38   LYS C CB  1 
ATOM   1563 C CG  . LYS C 1 39 ? 31.485  30.293  13.976  1.00 11.18 ? 38   LYS C CG  1 
ATOM   1564 C CD  . LYS C 1 39 ? 32.306  29.588  12.913  1.00 11.66 ? 38   LYS C CD  1 
ATOM   1565 C CE  . LYS C 1 39 ? 33.744  30.081  12.900  1.00 20.29 ? 38   LYS C CE  1 
ATOM   1566 N NZ  . LYS C 1 39 ? 34.542  29.403  11.840  1.00 13.35 ? 38   LYS C NZ  1 
ATOM   1567 N N   . CYS C 1 40 ? 27.896  27.640  13.300  1.00 10.69 ? 39   CYS C N   1 
ATOM   1568 C CA  . CYS C 1 40 ? 27.019  26.712  13.995  1.00 11.27 ? 39   CYS C CA  1 
ATOM   1569 C C   . CYS C 1 40 ? 27.641  26.657  15.383  1.00 13.54 ? 39   CYS C C   1 
ATOM   1570 O O   . CYS C 1 40 ? 28.868  26.675  15.509  1.00 11.94 ? 39   CYS C O   1 
ATOM   1571 C CB  . CYS C 1 40 ? 27.088  25.327  13.347  1.00 12.87 ? 39   CYS C CB  1 
ATOM   1572 S SG  . CYS C 1 40 ? 26.417  25.244  11.672  1.00 17.66 ? 39   CYS C SG  1 
ATOM   1573 N N   . TRP C 1 41 ? 26.810  26.687  16.422  1.00 10.91 ? 40   TRP C N   1 
ATOM   1574 C CA  . TRP C 1 41 ? 27.305  26.825  17.789  1.00 10.84 ? 40   TRP C CA  1 
ATOM   1575 C C   . TRP C 1 41 ? 26.546  25.940  18.781  1.00 13.97 ? 40   TRP C C   1 
ATOM   1576 O O   . TRP C 1 41 ? 25.474  25.424  18.479  1.00 12.50 ? 40   TRP C O   1 
ATOM   1577 C CB  . TRP C 1 41 ? 27.186  28.295  18.220  1.00 9.61  ? 40   TRP C CB  1 
ATOM   1578 C CG  . TRP C 1 41 ? 28.197  28.737  19.248  1.00 10.83 ? 40   TRP C CG  1 
ATOM   1579 C CD1 . TRP C 1 41 ? 27.930  29.234  20.492  1.00 13.74 ? 40   TRP C CD1 1 
ATOM   1580 C CD2 . TRP C 1 41 ? 29.615  28.852  19.070  1.00 10.85 ? 40   TRP C CD2 1 
ATOM   1581 N NE1 . TRP C 1 41 ? 29.098  29.583  21.125  1.00 13.29 ? 40   TRP C NE1 1 
ATOM   1582 C CE2 . TRP C 1 41 ? 30.148  29.363  20.272  1.00 14.94 ? 40   TRP C CE2 1 
ATOM   1583 C CE3 . TRP C 1 41 ? 30.489  28.555  18.019  1.00 12.52 ? 40   TRP C CE3 1 
ATOM   1584 C CZ2 . TRP C 1 41 ? 31.516  29.556  20.462  1.00 14.39 ? 40   TRP C CZ2 1 
ATOM   1585 C CZ3 . TRP C 1 41 ? 31.849  28.748  18.209  1.00 15.07 ? 40   TRP C CZ3 1 
ATOM   1586 C CH2 . TRP C 1 41 ? 32.347  29.257  19.416  1.00 15.88 ? 40   TRP C CH2 1 
ATOM   1587 N N   . LYS C 1 42 ? 27.104  25.789  19.977  1.00 11.93 ? 41   LYS C N   1 
ATOM   1588 C CA  . LYS C 1 42 ? 26.420  25.088  21.054  1.00 12.05 ? 41   LYS C CA  1 
ATOM   1589 C C   . LYS C 1 42 ? 25.956  26.119  22.072  1.00 16.95 ? 41   LYS C C   1 
ATOM   1590 O O   . LYS C 1 42 ? 26.713  27.014  22.445  1.00 15.48 ? 41   LYS C O   1 
ATOM   1591 C CB  . LYS C 1 42 ? 27.344  24.060  21.708  1.00 14.43 ? 41   LYS C CB  1 
ATOM   1592 C CG  . LYS C 1 42 ? 28.005  23.126  20.709  1.00 22.00 ? 41   LYS C CG  1 
ATOM   1593 C CD  . LYS C 1 42 ? 28.723  21.973  21.385  1.00 23.95 ? 41   LYS C CD  1 
ATOM   1594 C CE  . LYS C 1 42 ? 29.322  21.040  20.342  1.00 28.71 ? 41   LYS C CE  1 
ATOM   1595 N NZ  . LYS C 1 42 ? 30.148  19.960  20.947  1.00 32.01 ? 41   LYS C NZ  1 
ATOM   1596 N N   . PHE C 1 43 ? 24.696  26.022  22.484  1.00 16.80 ? 42   PHE C N   1 
ATOM   1597 C CA  . PHE C 1 43 ? 24.135  26.993  23.415  1.00 17.97 ? 42   PHE C CA  1 
ATOM   1598 C C   . PHE C 1 43 ? 24.894  27.055  24.741  1.00 20.53 ? 42   PHE C C   1 
ATOM   1599 O O   . PHE C 1 43 ? 25.028  28.123  25.334  1.00 20.38 ? 42   PHE C O   1 
ATOM   1600 C CB  . PHE C 1 43 ? 22.644  26.740  23.650  1.00 20.93 ? 42   PHE C CB  1 
ATOM   1601 C CG  . PHE C 1 43 ? 21.947  27.863  24.367  1.00 23.74 ? 42   PHE C CG  1 
ATOM   1602 C CD1 . PHE C 1 43 ? 21.883  29.129  23.804  1.00 27.63 ? 42   PHE C CD1 1 
ATOM   1603 C CD2 . PHE C 1 43 ? 21.411  27.668  25.629  1.00 26.43 ? 42   PHE C CD2 1 
ATOM   1604 C CE1 . PHE C 1 43 ? 21.267  30.172  24.476  1.00 29.14 ? 42   PHE C CE1 1 
ATOM   1605 C CE2 . PHE C 1 43 ? 20.803  28.707  26.309  1.00 29.66 ? 42   PHE C CE2 1 
ATOM   1606 C CZ  . PHE C 1 43 ? 20.723  29.957  25.729  1.00 28.20 ? 42   PHE C CZ  1 
ATOM   1607 N N   . GLU C 1 44 ? 25.412  25.916  25.189  1.00 16.51 ? 43   GLU C N   1 
ATOM   1608 C CA  . GLU C 1 44 ? 26.192  25.876  26.425  1.00 16.81 ? 43   GLU C CA  1 
ATOM   1609 C C   . GLU C 1 44 ? 27.393  26.813  26.331  1.00 19.78 ? 43   GLU C C   1 
ATOM   1610 O O   . GLU C 1 44 ? 27.946  27.235  27.351  1.00 18.55 ? 43   GLU C O   1 
ATOM   1611 C CB  . GLU C 1 44 ? 26.667  24.452  26.720  1.00 18.52 ? 43   GLU C CB  1 
ATOM   1612 C CG  . GLU C 1 44 ? 27.641  23.891  25.690  1.00 24.94 ? 43   GLU C CG  1 
ATOM   1613 C CD  . GLU C 1 44 ? 28.079  22.472  26.006  1.00 42.09 ? 43   GLU C CD  1 
ATOM   1614 O OE1 . GLU C 1 44 ? 28.283  22.159  27.198  1.00 42.42 ? 43   GLU C OE1 1 
ATOM   1615 O OE2 . GLU C 1 44 ? 28.262  21.679  25.057  1.00 38.97 ? 43   GLU C OE2 1 
ATOM   1616 N N   . HIS C 1 45 ? 27.795  27.133  25.104  1.00 15.61 ? 44   HIS C N   1 
ATOM   1617 C CA  . HIS C 1 45 ? 28.955  27.988  24.880  1.00 15.21 ? 44   HIS C CA  1 
ATOM   1618 C C   . HIS C 1 45 ? 28.574  29.426  24.552  1.00 18.80 ? 44   HIS C C   1 
ATOM   1619 O O   . HIS C 1 45 ? 29.386  30.188  24.029  1.00 16.28 ? 44   HIS C O   1 
ATOM   1620 C CB  . HIS C 1 45 ? 29.840  27.418  23.770  1.00 16.23 ? 44   HIS C CB  1 
ATOM   1621 C CG  . HIS C 1 45 ? 30.483  26.114  24.121  1.00 19.93 ? 44   HIS C CG  1 
ATOM   1622 N ND1 . HIS C 1 45 ? 30.795  25.161  23.175  1.00 22.11 ? 44   HIS C ND1 1 
ATOM   1623 C CD2 . HIS C 1 45 ? 30.883  25.607  25.311  1.00 22.03 ? 44   HIS C CD2 1 
ATOM   1624 C CE1 . HIS C 1 45 ? 31.344  24.117  23.770  1.00 21.63 ? 44   HIS C CE1 1 
ATOM   1625 N NE2 . HIS C 1 45 ? 31.411  24.363  25.066  1.00 21.81 ? 44   HIS C NE2 1 
ATOM   1626 N N   . CYS C 1 46 ? 27.341  29.802  24.865  1.00 17.86 ? 45   CYS C N   1 
ATOM   1627 C CA  . CYS C 1 46 ? 26.897  31.159  24.589  1.00 18.81 ? 45   CYS C CA  1 
ATOM   1628 C C   . CYS C 1 46 ? 27.162  32.095  25.760  1.00 19.51 ? 45   CYS C C   1 
ATOM   1629 O O   . CYS C 1 46 ? 26.249  32.529  26.462  1.00 19.11 ? 45   CYS C O   1 
ATOM   1630 C CB  . CYS C 1 46 ? 25.444  31.184  24.114  1.00 20.49 ? 45   CYS C CB  1 
ATOM   1631 S SG  . CYS C 1 46 ? 25.280  30.529  22.431  1.00 25.08 ? 45   CYS C SG  1 
ATOM   1632 N N   . ASN C 1 47 ? 28.447  32.352  25.982  1.00 13.66 ? 46   ASN C N   1 
ATOM   1633 C CA  . ASN C 1 47 ? 28.911  33.232  27.042  1.00 12.40 ? 46   ASN C CA  1 
ATOM   1634 C C   . ASN C 1 47 ? 30.296  33.762  26.662  1.00 15.36 ? 46   ASN C C   1 
ATOM   1635 O O   . ASN C 1 47 ? 30.971  33.194  25.800  1.00 12.67 ? 46   ASN C O   1 
ATOM   1636 C CB  . ASN C 1 47 ? 28.965  32.476  28.374  1.00 12.15 ? 46   ASN C CB  1 
ATOM   1637 C CG  . ASN C 1 47 ? 29.832  31.235  28.307  1.00 21.50 ? 46   ASN C CG  1 
ATOM   1638 O OD1 . ASN C 1 47 ? 31.048  31.312  28.455  1.00 15.78 ? 46   ASN C OD1 1 
ATOM   1639 N ND2 . ASN C 1 47 ? 29.202  30.075  28.144  1.00 15.98 ? 46   ASN C ND2 1 
ATOM   1640 N N   . PHE C 1 48 ? 30.699  34.875  27.265  1.00 12.80 ? 47   PHE C N   1 
ATOM   1641 C CA  . PHE C 1 48 ? 31.970  35.502  26.917  1.00 12.23 ? 47   PHE C CA  1 
ATOM   1642 C C   . PHE C 1 48 ? 33.176  34.574  27.027  1.00 14.94 ? 47   PHE C C   1 
ATOM   1643 O O   . PHE C 1 48 ? 34.061  34.598  26.173  1.00 14.16 ? 47   PHE C O   1 
ATOM   1644 C CB  . PHE C 1 48 ? 32.194  36.781  27.724  1.00 13.82 ? 47   PHE C CB  1 
ATOM   1645 C CG  . PHE C 1 48 ? 31.628  38.008  27.071  1.00 14.91 ? 47   PHE C CG  1 
ATOM   1646 C CD1 . PHE C 1 48 ? 32.099  38.432  25.837  1.00 16.69 ? 47   PHE C CD1 1 
ATOM   1647 C CD2 . PHE C 1 48 ? 30.597  38.715  27.668  1.00 17.32 ? 47   PHE C CD2 1 
ATOM   1648 C CE1 . PHE C 1 48 ? 31.571  39.552  25.223  1.00 17.35 ? 47   PHE C CE1 1 
ATOM   1649 C CE2 . PHE C 1 48 ? 30.062  39.833  27.056  1.00 19.54 ? 47   PHE C CE2 1 
ATOM   1650 C CZ  . PHE C 1 48 ? 30.545  40.249  25.831  1.00 17.35 ? 47   PHE C CZ  1 
ATOM   1651 N N   . ASN C 1 49 ? 33.241  33.786  28.094  1.00 11.77 ? 48   ASN C N   1 
ATOM   1652 C CA  . ASN C 1 49 ? 34.384  32.899  28.268  1.00 11.47 ? 48   ASN C CA  1 
ATOM   1653 C C   . ASN C 1 49 ? 34.547  31.943  27.096  1.00 14.21 ? 48   ASN C C   1 
ATOM   1654 O O   . ASN C 1 49 ? 35.641  31.778  26.558  1.00 13.35 ? 48   ASN C O   1 
ATOM   1655 C CB  . ASN C 1 49 ? 34.288  32.097  29.566  1.00 12.44 ? 48   ASN C CB  1 
ATOM   1656 C CG  . ASN C 1 49 ? 35.466  31.159  29.747  1.00 29.51 ? 48   ASN C CG  1 
ATOM   1657 O OD1 . ASN C 1 49 ? 35.392  29.987  29.379  1.00 26.70 ? 48   ASN C OD1 1 
ATOM   1658 N ND2 . ASN C 1 49 ? 36.615  31.726  30.097  1.00 20.78 ? 48   ASN C ND2 1 
ATOM   1659 N N   . ASP C 1 50 ? 33.460  31.279  26.725  1.00 10.92 ? 49   ASP C N   1 
ATOM   1660 C CA  . ASP C 1 50 ? 33.524  30.262  25.690  1.00 10.19 ? 49   ASP C CA  1 
ATOM   1661 C C   . ASP C 1 50 ? 33.694  30.842  24.282  1.00 12.98 ? 49   ASP C C   1 
ATOM   1662 O O   . ASP C 1 50 ? 34.398  30.270  23.455  1.00 12.61 ? 49   ASP C O   1 
ATOM   1663 C CB  . ASP C 1 50 ? 32.315  29.325  25.785  1.00 12.43 ? 49   ASP C CB  1 
ATOM   1664 C CG  . ASP C 1 50 ? 32.280  28.546  27.099  1.00 21.23 ? 49   ASP C CG  1 
ATOM   1665 O OD1 . ASP C 1 50 ? 33.328  28.462  27.777  1.00 22.90 ? 49   ASP C OD1 1 
ATOM   1666 O OD2 . ASP C 1 50 ? 31.205  28.027  27.462  1.00 24.31 ? 49   ASP C OD2 1 
ATOM   1667 N N   . VAL C 1 51 ? 33.095  32.003  24.035  1.00 9.48  ? 50   VAL C N   1 
ATOM   1668 C CA  . VAL C 1 51 ? 33.228  32.676  22.742  1.00 9.36  ? 50   VAL C CA  1 
ATOM   1669 C C   . VAL C 1 51 ? 34.641  33.225  22.537  1.00 12.03 ? 50   VAL C C   1 
ATOM   1670 O O   . VAL C 1 51 ? 35.289  32.936  21.528  1.00 11.31 ? 50   VAL C O   1 
ATOM   1671 C CB  . VAL C 1 51 ? 32.157  33.780  22.553  1.00 12.92 ? 50   VAL C CB  1 
ATOM   1672 C CG1 . VAL C 1 51 ? 32.436  34.588  21.282  1.00 12.59 ? 50   VAL C CG1 1 
ATOM   1673 C CG2 . VAL C 1 51 ? 30.756  33.169  22.498  1.00 13.20 ? 50   VAL C CG2 1 
ATOM   1674 N N   . THR C 1 52 ? 35.120  34.011  23.499  1.00 9.32  ? 51   THR C N   1 
ATOM   1675 C CA  . THR C 1 52 ? 36.452  34.598  23.403  1.00 9.11  ? 51   THR C CA  1 
ATOM   1676 C C   . THR C 1 52 ? 37.530  33.531  23.251  1.00 13.41 ? 51   THR C C   1 
ATOM   1677 O O   . THR C 1 52 ? 38.430  33.668  22.427  1.00 14.15 ? 51   THR C O   1 
ATOM   1678 C CB  . THR C 1 52 ? 36.776  35.532  24.598  1.00 11.09 ? 51   THR C CB  1 
ATOM   1679 O OG1 . THR C 1 52 ? 36.759  34.781  25.819  1.00 10.57 ? 51   THR C OG1 1 
ATOM   1680 C CG2 . THR C 1 52 ? 35.780  36.687  24.685  1.00 9.15  ? 51   THR C CG2 1 
ATOM   1681 N N   . THR C 1 53 ? 37.483  32.503  24.094  1.00 10.80 ? 52   THR C N   1 
ATOM   1682 C CA  . THR C 1 53 ? 38.517  31.474  24.071  1.00 11.48 ? 52   THR C CA  1 
ATOM   1683 C C   . THR C 1 53 ? 38.521  30.669  22.773  1.00 17.55 ? 52   THR C C   1 
ATOM   1684 O O   . THR C 1 53 ? 39.581  30.376  22.215  1.00 18.09 ? 52   THR C O   1 
ATOM   1685 C CB  . THR C 1 53 ? 38.472  30.561  25.320  1.00 16.55 ? 52   THR C CB  1 
ATOM   1686 O OG1 . THR C 1 53 ? 37.204  29.896  25.391  1.00 18.60 ? 52   THR C OG1 1 
ATOM   1687 C CG2 . THR C 1 53 ? 38.691  31.372  26.592  1.00 14.46 ? 52   THR C CG2 1 
ATOM   1688 N N   . ARG C 1 54 ? 37.335  30.337  22.279  1.00 13.82 ? 53   ARG C N   1 
ATOM   1689 C CA  . ARG C 1 54 ? 37.223  29.524  21.073  1.00 13.72 ? 53   ARG C CA  1 
ATOM   1690 C C   . ARG C 1 54 ? 37.544  30.279  19.787  1.00 18.00 ? 53   ARG C C   1 
ATOM   1691 O O   . ARG C 1 54 ? 38.071  29.702  18.837  1.00 18.10 ? 53   ARG C O   1 
ATOM   1692 C CB  . ARG C 1 54 ? 35.848  28.859  20.997  1.00 12.49 ? 53   ARG C CB  1 
ATOM   1693 C CG  . ARG C 1 54 ? 35.681  27.765  22.034  1.00 17.37 ? 53   ARG C CG  1 
ATOM   1694 C CD  . ARG C 1 54 ? 34.282  27.183  22.064  1.00 25.12 ? 53   ARG C CD  1 
ATOM   1695 N NE  . ARG C 1 54 ? 34.123  26.342  23.245  1.00 28.58 ? 53   ARG C NE  1 
ATOM   1696 C CZ  . ARG C 1 54 ? 34.421  25.049  23.289  1.00 42.46 ? 53   ARG C CZ  1 
ATOM   1697 N NH1 . ARG C 1 54 ? 34.321  24.388  24.433  1.00 29.68 ? 53   ARG C NH1 1 
ATOM   1698 N NH2 . ARG C 1 54 ? 34.779  24.407  22.183  1.00 31.51 ? 53   ARG C NH2 1 
ATOM   1699 N N   . LEU C 1 55 ? 37.267  31.579  19.776  1.00 14.40 ? 54   LEU C N   1 
ATOM   1700 C CA  . LEU C 1 55 ? 37.555  32.409  18.609  1.00 14.91 ? 54   LEU C CA  1 
ATOM   1701 C C   . LEU C 1 55 ? 38.914  33.097  18.746  1.00 20.28 ? 54   LEU C C   1 
ATOM   1702 O O   . LEU C 1 55 ? 39.408  33.707  17.799  1.00 20.61 ? 54   LEU C O   1 
ATOM   1703 C CB  . LEU C 1 55 ? 36.461  33.471  18.434  1.00 15.52 ? 54   LEU C CB  1 
ATOM   1704 C CG  . LEU C 1 55 ? 35.019  32.991  18.242  1.00 20.42 ? 54   LEU C CG  1 
ATOM   1705 C CD1 . LEU C 1 55 ? 34.074  34.166  18.028  1.00 20.41 ? 54   LEU C CD1 1 
ATOM   1706 C CD2 . LEU C 1 55 ? 34.931  32.014  17.081  1.00 23.70 ? 54   LEU C CD2 1 
ATOM   1707 N N   A ARG C 1 56 ? 39.500  32.989  19.935  0.50 17.26 ? 55   ARG C N   1 
ATOM   1708 N N   B ARG C 1 56 ? 39.526  32.975  19.920  0.50 17.27 ? 55   ARG C N   1 
ATOM   1709 C CA  A ARG C 1 56 ? 40.755  33.659  20.252  0.50 16.62 ? 55   ARG C CA  1 
ATOM   1710 C CA  B ARG C 1 56 ? 40.780  33.665  20.213  0.50 16.66 ? 55   ARG C CA  1 
ATOM   1711 C C   A ARG C 1 56 ? 40.668  35.153  19.940  0.50 19.07 ? 55   ARG C C   1 
ATOM   1712 C C   B ARG C 1 56 ? 40.663  35.161  19.916  0.50 19.01 ? 55   ARG C C   1 
ATOM   1713 O O   A ARG C 1 56 ? 41.560  35.739  19.325  0.50 17.90 ? 55   ARG C O   1 
ATOM   1714 O O   B ARG C 1 56 ? 41.535  35.761  19.285  0.50 17.75 ? 55   ARG C O   1 
ATOM   1715 C CB  A ARG C 1 56 ? 41.941  32.975  19.565  0.50 16.86 ? 55   ARG C CB  1 
ATOM   1716 C CB  B ARG C 1 56 ? 41.966  33.027  19.476  0.50 17.02 ? 55   ARG C CB  1 
ATOM   1717 C CG  A ARG C 1 56 ? 42.108  31.516  19.992  0.50 23.53 ? 55   ARG C CG  1 
ATOM   1718 C CG  B ARG C 1 56 ? 42.580  31.840  20.222  0.50 24.76 ? 55   ARG C CG  1 
ATOM   1719 C CD  A ARG C 1 56 ? 43.284  30.833  19.307  0.50 28.31 ? 55   ARG C CD  1 
ATOM   1720 C CD  B ARG C 1 56 ? 43.837  31.306  19.538  0.50 29.10 ? 55   ARG C CD  1 
ATOM   1721 N NE  A ARG C 1 56 ? 43.110  30.743  17.859  0.50 31.72 ? 55   ARG C NE  1 
ATOM   1722 N NE  B ARG C 1 56 ? 44.970  32.217  19.677  0.50 33.30 ? 55   ARG C NE  1 
ATOM   1723 C CZ  A ARG C 1 56 ? 42.287  29.894  17.251  0.50 42.20 ? 55   ARG C CZ  1 
ATOM   1724 C CZ  B ARG C 1 56 ? 45.431  32.985  18.695  0.50 43.37 ? 55   ARG C CZ  1 
ATOM   1725 N NH1 A ARG C 1 56 ? 41.545  29.055  17.962  0.50 27.63 ? 55   ARG C NH1 1 
ATOM   1726 N NH1 B ARG C 1 56 ? 44.867  32.938  17.496  0.50 33.02 ? 55   ARG C NH1 1 
ATOM   1727 N NH2 A ARG C 1 56 ? 42.201  29.888  15.928  0.50 27.90 ? 55   ARG C NH2 1 
ATOM   1728 N NH2 B ARG C 1 56 ? 46.458  33.796  18.908  0.50 30.76 ? 55   ARG C NH2 1 
ATOM   1729 N N   . GLU C 1 57 ? 39.568  35.753  20.388  1.00 14.67 ? 56   GLU C N   1 
ATOM   1730 C CA  . GLU C 1 57 ? 39.332  37.187  20.251  1.00 13.44 ? 56   GLU C CA  1 
ATOM   1731 C C   . GLU C 1 57 ? 39.072  37.707  21.661  1.00 16.41 ? 56   GLU C C   1 
ATOM   1732 O O   . GLU C 1 57 ? 38.471  37.016  22.486  1.00 15.43 ? 56   GLU C O   1 
ATOM   1733 C CB  . GLU C 1 57 ? 38.104  37.464  19.369  1.00 14.34 ? 56   GLU C CB  1 
ATOM   1734 C CG  . GLU C 1 57 ? 38.288  37.119  17.890  1.00 21.01 ? 56   GLU C CG  1 
ATOM   1735 C CD  . GLU C 1 57 ? 39.052  38.184  17.113  1.00 32.49 ? 56   GLU C CD  1 
ATOM   1736 O OE1 . GLU C 1 57 ? 39.444  39.208  17.711  1.00 19.38 ? 56   GLU C OE1 1 
ATOM   1737 O OE2 . GLU C 1 57 ? 39.266  37.992  15.897  1.00 23.83 ? 56   GLU C OE2 1 
ATOM   1738 N N   . ASN C 1 58 ? 39.522  38.926  21.929  1.00 12.90 ? 57   ASN C N   1 
ATOM   1739 C CA  . ASN C 1 58 ? 39.381  39.525  23.247  1.00 12.03 ? 57   ASN C CA  1 
ATOM   1740 C C   . ASN C 1 58 ? 38.134  40.404  23.324  1.00 15.62 ? 57   ASN C C   1 
ATOM   1741 O O   . ASN C 1 58 ? 37.094  39.970  23.821  1.00 16.04 ? 57   ASN C O   1 
ATOM   1742 C CB  . ASN C 1 58 ? 40.637  40.330  23.586  1.00 12.50 ? 57   ASN C CB  1 
ATOM   1743 C CG  . ASN C 1 58 ? 40.618  40.870  24.997  1.00 18.30 ? 57   ASN C CG  1 
ATOM   1744 O OD1 . ASN C 1 58 ? 39.587  40.836  25.671  1.00 14.05 ? 57   ASN C OD1 1 
ATOM   1745 N ND2 . ASN C 1 58 ? 41.743  41.429  25.432  1.00 15.64 ? 57   ASN C ND2 1 
ATOM   1746 N N   . GLU C 1 59 ? 38.237  41.635  22.830  1.00 11.81 ? 58   GLU C N   1 
ATOM   1747 C CA  . GLU C 1 59 ? 37.087  42.535  22.795  1.00 12.33 ? 58   GLU C CA  1 
ATOM   1748 C C   . GLU C 1 59 ? 36.178  42.113  21.652  1.00 13.52 ? 58   GLU C C   1 
ATOM   1749 O O   . GLU C 1 59 ? 36.622  41.978  20.508  1.00 12.27 ? 58   GLU C O   1 
ATOM   1750 C CB  . GLU C 1 59 ? 37.518  43.992  22.579  1.00 14.41 ? 58   GLU C CB  1 
ATOM   1751 C CG  . GLU C 1 59 ? 38.109  44.669  23.801  1.00 25.63 ? 58   GLU C CG  1 
ATOM   1752 C CD  . GLU C 1 59 ? 37.056  45.214  24.746  1.00 35.15 ? 58   GLU C CD  1 
ATOM   1753 O OE1 . GLU C 1 59 ? 35.871  45.298  24.356  1.00 33.22 ? 58   GLU C OE1 1 
ATOM   1754 O OE2 . GLU C 1 59 ? 37.426  45.587  25.877  1.00 26.11 ? 58   GLU C OE2 1 
ATOM   1755 N N   . LEU C 1 60 ? 34.910  41.891  21.967  1.00 9.80  ? 59   LEU C N   1 
ATOM   1756 C CA  . LEU C 1 60 ? 33.941  41.506  20.950  1.00 9.14  ? 59   LEU C CA  1 
ATOM   1757 C C   . LEU C 1 60 ? 32.529  41.653  21.483  1.00 12.86 ? 59   LEU C C   1 
ATOM   1758 O O   . LEU C 1 60 ? 32.321  41.839  22.682  1.00 13.10 ? 59   LEU C O   1 
ATOM   1759 C CB  . LEU C 1 60 ? 34.169  40.050  20.525  1.00 8.81  ? 59   LEU C CB  1 
ATOM   1760 C CG  . LEU C 1 60 ? 34.048  38.970  21.610  1.00 12.76 ? 59   LEU C CG  1 
ATOM   1761 C CD1 . LEU C 1 60 ? 32.591  38.568  21.844  1.00 12.91 ? 59   LEU C CD1 1 
ATOM   1762 C CD2 . LEU C 1 60 ? 34.877  37.748  21.234  1.00 14.17 ? 59   LEU C CD2 1 
ATOM   1763 N N   . THR C 1 61 ? 31.557  41.539  20.586  1.00 9.14  ? 60   THR C N   1 
ATOM   1764 C CA  . THR C 1 61 ? 30.169  41.390  20.986  1.00 9.16  ? 60   THR C CA  1 
ATOM   1765 C C   . THR C 1 61 ? 29.649  40.185  20.229  1.00 11.74 ? 60   THR C C   1 
ATOM   1766 O O   . THR C 1 61 ? 30.203  39.813  19.196  1.00 9.85  ? 60   THR C O   1 
ATOM   1767 C CB  . THR C 1 61 ? 29.326  42.645  20.724  1.00 17.32 ? 60   THR C CB  1 
ATOM   1768 O OG1 . THR C 1 61 ? 29.489  43.062  19.365  1.00 16.30 ? 60   THR C OG1 1 
ATOM   1769 C CG2 . THR C 1 61 ? 29.742  43.774  21.668  1.00 17.19 ? 60   THR C CG2 1 
ATOM   1770 N N   . TYR C 1 62 ? 28.698  39.482  20.827  1.00 9.51  ? 61   TYR C N   1 
ATOM   1771 C CA  . TYR C 1 62 ? 28.184  38.266  20.223  1.00 9.12  ? 61   TYR C CA  1 
ATOM   1772 C C   . TYR C 1 62 ? 26.684  38.161  20.393  1.00 11.74 ? 61   TYR C C   1 
ATOM   1773 O O   . TYR C 1 62 ? 26.093  38.798  21.268  1.00 10.82 ? 61   TYR C O   1 
ATOM   1774 C CB  . TYR C 1 62 ? 28.871  37.028  20.812  1.00 10.44 ? 61   TYR C CB  1 
ATOM   1775 C CG  . TYR C 1 62 ? 28.429  36.697  22.224  1.00 12.71 ? 61   TYR C CG  1 
ATOM   1776 C CD1 . TYR C 1 62 ? 27.366  35.832  22.458  1.00 14.74 ? 61   TYR C CD1 1 
ATOM   1777 C CD2 . TYR C 1 62 ? 29.047  37.287  23.321  1.00 14.10 ? 61   TYR C CD2 1 
ATOM   1778 C CE1 . TYR C 1 62 ? 26.934  35.561  23.744  1.00 16.07 ? 61   TYR C CE1 1 
ATOM   1779 C CE2 . TYR C 1 62 ? 28.626  37.014  24.614  1.00 15.35 ? 61   TYR C CE2 1 
ATOM   1780 C CZ  . TYR C 1 62 ? 27.582  36.138  24.818  1.00 23.02 ? 61   TYR C CZ  1 
ATOM   1781 O OH  . TYR C 1 62 ? 27.172  35.853  26.101  1.00 26.13 ? 61   TYR C OH  1 
ATOM   1782 N N   . TYR C 1 63 ? 26.076  37.352  19.538  1.00 9.24  ? 62   TYR C N   1 
ATOM   1783 C CA  . TYR C 1 63 ? 24.645  37.104  19.592  1.00 9.50  ? 62   TYR C CA  1 
ATOM   1784 C C   . TYR C 1 63 ? 24.419  35.642  19.250  1.00 13.16 ? 62   TYR C C   1 
ATOM   1785 O O   . TYR C 1 63 ? 24.995  35.132  18.291  1.00 10.13 ? 62   TYR C O   1 
ATOM   1786 C CB  . TYR C 1 63 ? 23.910  37.993  18.588  1.00 11.01 ? 62   TYR C CB  1 
ATOM   1787 C CG  . TYR C 1 63 ? 22.417  37.762  18.557  1.00 14.29 ? 62   TYR C CG  1 
ATOM   1788 C CD1 . TYR C 1 63 ? 21.830  37.011  17.545  1.00 15.45 ? 62   TYR C CD1 1 
ATOM   1789 C CD2 . TYR C 1 63 ? 21.598  38.257  19.564  1.00 16.35 ? 62   TYR C CD2 1 
ATOM   1790 C CE1 . TYR C 1 63 ? 20.467  36.802  17.509  1.00 16.33 ? 62   TYR C CE1 1 
ATOM   1791 C CE2 . TYR C 1 63 ? 20.233  38.031  19.551  1.00 17.99 ? 62   TYR C CE2 1 
ATOM   1792 C CZ  . TYR C 1 63 ? 19.674  37.304  18.519  1.00 22.63 ? 62   TYR C CZ  1 
ATOM   1793 O OH  . TYR C 1 63 ? 18.317  37.073  18.498  1.00 22.59 ? 62   TYR C OH  1 
ATOM   1794 N N   . CYS C 1 64 ? 23.683  34.951  20.114  1.00 12.87 ? 63   CYS C N   1 
ATOM   1795 C CA  . CYS C 1 64 ? 23.359  33.541  19.917  1.00 15.42 ? 63   CYS C CA  1 
ATOM   1796 C C   . CYS C 1 64 ? 21.851  33.443  19.730  1.00 15.25 ? 63   CYS C C   1 
ATOM   1797 O O   . CYS C 1 64 ? 21.095  34.171  20.374  1.00 13.25 ? 63   CYS C O   1 
ATOM   1798 C CB  . CYS C 1 64 ? 23.739  32.737  21.157  1.00 19.08 ? 63   CYS C CB  1 
ATOM   1799 S SG  . CYS C 1 64 ? 25.444  32.173  21.251  1.00 24.95 ? 63   CYS C SG  1 
ATOM   1800 N N   . CYS C 1 65 ? 21.413  32.511  18.896  1.00 12.00 ? 64   CYS C N   1 
ATOM   1801 C CA  . CYS C 1 65 ? 19.993  32.374  18.612  1.00 12.46 ? 64   CYS C CA  1 
ATOM   1802 C C   . CYS C 1 65 ? 19.679  30.965  18.108  1.00 14.94 ? 64   CYS C C   1 
ATOM   1803 O O   . CYS C 1 65 ? 20.588  30.211  17.755  1.00 12.36 ? 64   CYS C O   1 
ATOM   1804 C CB  . CYS C 1 65 ? 19.583  33.428  17.588  1.00 13.69 ? 64   CYS C CB  1 
ATOM   1805 S SG  . CYS C 1 65 ? 20.658  33.444  16.139  1.00 17.99 ? 64   CYS C SG  1 
ATOM   1806 N N   . LYS C 1 66 ? 18.404  30.587  18.143  1.00 11.93 ? 65   LYS C N   1 
ATOM   1807 C CA  . LYS C 1 66 ? 18.014  29.218  17.809  1.00 11.43 ? 65   LYS C CA  1 
ATOM   1808 C C   . LYS C 1 66 ? 16.968  29.093  16.703  1.00 16.39 ? 65   LYS C C   1 
ATOM   1809 O O   . LYS C 1 66 ? 16.192  28.133  16.679  1.00 15.87 ? 65   LYS C O   1 
ATOM   1810 C CB  . LYS C 1 66 ? 17.545  28.478  19.065  1.00 12.15 ? 65   LYS C CB  1 
ATOM   1811 C CG  . LYS C 1 66 ? 18.607  28.377  20.150  1.00 16.36 ? 65   LYS C CG  1 
ATOM   1812 C CD  . LYS C 1 66 ? 18.037  27.788  21.433  1.00 21.37 ? 65   LYS C CD  1 
ATOM   1813 C CE  . LYS C 1 66 ? 19.139  27.518  22.447  1.00 25.20 ? 65   LYS C CE  1 
ATOM   1814 N NZ  . LYS C 1 66 ? 18.599  27.195  23.797  1.00 27.63 ? 65   LYS C NZ  1 
ATOM   1815 N N   . LYS C 1 67 ? 16.979  30.034  15.767  1.00 13.53 ? 66   LYS C N   1 
ATOM   1816 C CA  . LYS C 1 67 ? 16.079  29.987  14.616  1.00 13.06 ? 66   LYS C CA  1 
ATOM   1817 C C   . LYS C 1 67 ? 16.909  29.994  13.332  1.00 14.11 ? 66   LYS C C   1 
ATOM   1818 O O   . LYS C 1 67 ? 18.007  30.541  13.305  1.00 12.02 ? 66   LYS C O   1 
ATOM   1819 C CB  . LYS C 1 67 ? 15.123  31.184  14.636  1.00 16.08 ? 66   LYS C CB  1 
ATOM   1820 C CG  . LYS C 1 67 ? 14.110  31.149  15.779  1.00 24.87 ? 66   LYS C CG  1 
ATOM   1821 C CD  . LYS C 1 67 ? 13.554  32.537  16.073  1.00 32.23 ? 66   LYS C CD  1 
ATOM   1822 C CE  . LYS C 1 67 ? 12.343  32.468  16.995  1.00 37.44 ? 66   LYS C CE  1 
ATOM   1823 N NZ  . LYS C 1 67 ? 11.081  32.211  16.245  1.00 43.65 ? 66   LYS C NZ  1 
ATOM   1824 N N   . ASP C 1 68 ? 16.410  29.332  12.292  1.00 12.18 ? 67   ASP C N   1 
ATOM   1825 C CA  . ASP C 1 68 ? 17.143  29.219  11.035  1.00 12.56 ? 67   ASP C CA  1 
ATOM   1826 C C   . ASP C 1 68 ? 17.675  30.564  10.533  1.00 15.75 ? 67   ASP C C   1 
ATOM   1827 O O   . ASP C 1 68 ? 16.919  31.529  10.382  1.00 15.18 ? 67   ASP C O   1 
ATOM   1828 C CB  . ASP C 1 68 ? 16.276  28.559  9.955   1.00 14.60 ? 67   ASP C CB  1 
ATOM   1829 C CG  . ASP C 1 68 ? 16.116  27.054  10.162  1.00 26.08 ? 67   ASP C CG  1 
ATOM   1830 O OD1 . ASP C 1 68 ? 16.804  26.483  11.036  1.00 24.08 ? 67   ASP C OD1 1 
ATOM   1831 O OD2 . ASP C 1 68 ? 15.310  26.439  9.431   1.00 34.32 ? 67   ASP C OD2 1 
ATOM   1832 N N   . LEU C 1 69 ? 18.970  30.593  10.223  1.00 11.98 ? 68   LEU C N   1 
ATOM   1833 C CA  . LEU C 1 69 ? 19.625  31.766  9.645   1.00 11.89 ? 68   LEU C CA  1 
ATOM   1834 C C   . LEU C 1 69 ? 19.463  33.033  10.481  1.00 14.01 ? 68   LEU C C   1 
ATOM   1835 O O   . LEU C 1 69 ? 19.481  34.149  9.962   1.00 12.99 ? 68   LEU C O   1 
ATOM   1836 C CB  . LEU C 1 69 ? 19.134  32.002  8.215   1.00 12.32 ? 68   LEU C CB  1 
ATOM   1837 C CG  . LEU C 1 69 ? 19.353  30.857  7.221   1.00 16.01 ? 68   LEU C CG  1 
ATOM   1838 C CD1 . LEU C 1 69 ? 18.902  31.272  5.820   1.00 16.57 ? 68   LEU C CD1 1 
ATOM   1839 C CD2 . LEU C 1 69 ? 20.814  30.407  7.215   1.00 16.62 ? 68   LEU C CD2 1 
ATOM   1840 N N   . CYS C 1 70 ? 19.371  32.857  11.790  1.00 10.93 ? 69   CYS C N   1 
ATOM   1841 C CA  . CYS C 1 70 ? 19.181  33.985  12.691  1.00 10.89 ? 69   CYS C CA  1 
ATOM   1842 C C   . CYS C 1 70 ? 20.479  34.747  12.964  1.00 11.20 ? 69   CYS C C   1 
ATOM   1843 O O   . CYS C 1 70 ? 20.447  35.861  13.493  1.00 11.54 ? 69   CYS C O   1 
ATOM   1844 C CB  . CYS C 1 70 ? 18.577  33.496  14.003  1.00 12.56 ? 69   CYS C CB  1 
ATOM   1845 S SG  . CYS C 1 70 ? 19.615  32.287  14.843  1.00 17.11 ? 69   CYS C SG  1 
ATOM   1846 N N   . ASN C 1 71 ? 21.615  34.139  12.628  1.00 7.62  ? 70   ASN C N   1 
ATOM   1847 C CA  . ASN C 1 71 ? 22.913  34.755  12.903  1.00 7.34  ? 70   ASN C CA  1 
ATOM   1848 C C   . ASN C 1 71 ? 23.428  35.669  11.795  1.00 10.33 ? 70   ASN C C   1 
ATOM   1849 O O   . ASN C 1 71 ? 24.583  35.567  11.376  1.00 9.45  ? 70   ASN C O   1 
ATOM   1850 C CB  . ASN C 1 71 ? 23.970  33.717  13.313  1.00 7.54  ? 70   ASN C CB  1 
ATOM   1851 C CG  . ASN C 1 71 ? 24.337  32.772  12.186  1.00 13.17 ? 70   ASN C CG  1 
ATOM   1852 O OD1 . ASN C 1 71 ? 23.514  32.466  11.326  1.00 10.75 ? 70   ASN C OD1 1 
ATOM   1853 N ND2 . ASN C 1 71 ? 25.553  32.232  12.239  1.00 8.89  ? 70   ASN C ND2 1 
ATOM   1854 N N   . PHE C 1 72 ? 22.571  36.582  11.345  1.00 7.18  ? 71   PHE C N   1 
ATOM   1855 C CA  . PHE C 1 72 ? 22.983  37.587  10.372  1.00 6.63  ? 71   PHE C CA  1 
ATOM   1856 C C   . PHE C 1 72 ? 23.702  38.742  11.063  1.00 9.43  ? 71   PHE C C   1 
ATOM   1857 O O   . PHE C 1 72 ? 23.511  38.985  12.255  1.00 8.55  ? 71   PHE C O   1 
ATOM   1858 C CB  . PHE C 1 72 ? 21.798  38.088  9.541   1.00 8.23  ? 71   PHE C CB  1 
ATOM   1859 C CG  . PHE C 1 72 ? 20.656  38.612  10.361  1.00 8.87  ? 71   PHE C CG  1 
ATOM   1860 C CD1 . PHE C 1 72 ? 19.656  37.759  10.806  1.00 11.52 ? 71   PHE C CD1 1 
ATOM   1861 C CD2 . PHE C 1 72 ? 20.552  39.967  10.638  1.00 9.89  ? 71   PHE C CD2 1 
ATOM   1862 C CE1 . PHE C 1 72 ? 18.597  38.241  11.558  1.00 12.24 ? 71   PHE C CE1 1 
ATOM   1863 C CE2 . PHE C 1 72 ? 19.478  40.462  11.366  1.00 11.62 ? 71   PHE C CE2 1 
ATOM   1864 C CZ  . PHE C 1 72 ? 18.504  39.594  11.832  1.00 9.66  ? 71   PHE C CZ  1 
ATOM   1865 N N   . ASN C 1 73 ? 24.563  39.421  10.315  1.00 7.91  ? 72   ASN C N   1 
ATOM   1866 C CA  . ASN C 1 73 ? 25.443  40.438  10.875  1.00 7.79  ? 72   ASN C CA  1 
ATOM   1867 C C   . ASN C 1 73 ? 24.731  41.605  11.546  1.00 11.57 ? 72   ASN C C   1 
ATOM   1868 O O   . ASN C 1 73 ? 25.236  42.176  12.511  1.00 11.35 ? 72   ASN C O   1 
ATOM   1869 C CB  . ASN C 1 73 ? 26.415  40.936  9.808   1.00 8.80  ? 72   ASN C CB  1 
ATOM   1870 C CG  . ASN C 1 73 ? 27.373  39.848  9.353   1.00 19.86 ? 72   ASN C CG  1 
ATOM   1871 O OD1 . ASN C 1 73 ? 27.305  38.711  9.824   1.00 12.20 ? 72   ASN C OD1 1 
ATOM   1872 N ND2 . ASN C 1 73 ? 28.303  40.205  8.481   1.00 12.90 ? 72   ASN C ND2 1 
ATOM   1873 N N   . GLU C 1 74 ? 23.572  41.974  11.015  1.00 9.63  ? 73   GLU C N   1 
ATOM   1874 C CA  . GLU C 1 74 ? 22.839  43.125  11.528  1.00 10.42 ? 73   GLU C CA  1 
ATOM   1875 C C   . GLU C 1 74 ? 22.204  42.890  12.894  1.00 14.33 ? 73   GLU C C   1 
ATOM   1876 O O   . GLU C 1 74 ? 21.602  43.796  13.467  1.00 13.07 ? 73   GLU C O   1 
ATOM   1877 C CB  . GLU C 1 74 ? 21.803  43.601  10.513  1.00 11.59 ? 73   GLU C CB  1 
ATOM   1878 C CG  . GLU C 1 74 ? 22.417  44.236  9.275   1.00 17.87 ? 73   GLU C CG  1 
ATOM   1879 C CD  . GLU C 1 74 ? 22.714  43.229  8.176   1.00 23.65 ? 73   GLU C CD  1 
ATOM   1880 O OE1 . GLU C 1 74 ? 22.451  42.023  8.373   1.00 15.25 ? 73   GLU C OE1 1 
ATOM   1881 O OE2 . GLU C 1 74 ? 23.233  43.645  7.120   1.00 20.44 ? 73   GLU C OE2 1 
ATOM   1882 N N   . GLN C 1 75 ? 22.393  41.694  13.445  1.00 11.66 ? 74   GLN C N   1 
ATOM   1883 C CA  . GLN C 1 75 ? 21.908  41.413  14.789  1.00 10.69 ? 74   GLN C CA  1 
ATOM   1884 C C   . GLN C 1 75 ? 22.721  42.226  15.792  1.00 15.22 ? 74   GLN C C   1 
ATOM   1885 O O   . GLN C 1 75 ? 22.261  42.499  16.898  1.00 14.81 ? 74   GLN C O   1 
ATOM   1886 C CB  . GLN C 1 75 ? 22.021  39.920  15.110  1.00 11.66 ? 74   GLN C CB  1 
ATOM   1887 C CG  . GLN C 1 75 ? 21.024  39.046  14.360  1.00 12.83 ? 74   GLN C CG  1 
ATOM   1888 C CD  . GLN C 1 75 ? 19.657  39.018  15.020  1.00 23.24 ? 74   GLN C CD  1 
ATOM   1889 O OE1 . GLN C 1 75 ? 19.269  39.963  15.709  1.00 18.59 ? 74   GLN C OE1 1 
ATOM   1890 N NE2 . GLN C 1 75 ? 18.896  37.959  14.763  1.00 14.26 ? 74   GLN C NE2 1 
ATOM   1891 N N   . LEU C 1 76 ? 23.914  42.645  15.373  1.00 12.62 ? 75   LEU C N   1 
ATOM   1892 C CA  . LEU C 1 76 ? 24.805  43.444  16.215  1.00 13.57 ? 75   LEU C CA  1 
ATOM   1893 C C   . LEU C 1 76 ? 25.109  44.812  15.605  1.00 21.19 ? 75   LEU C C   1 
ATOM   1894 O O   . LEU C 1 76 ? 25.321  44.927  14.402  1.00 18.45 ? 75   LEU C O   1 
ATOM   1895 C CB  . LEU C 1 76 ? 26.121  42.700  16.451  1.00 13.67 ? 75   LEU C CB  1 
ATOM   1896 C CG  . LEU C 1 76 ? 26.037  41.372  17.198  1.00 17.65 ? 75   LEU C CG  1 
ATOM   1897 C CD1 . LEU C 1 76 ? 27.407  40.704  17.245  1.00 18.31 ? 75   LEU C CD1 1 
ATOM   1898 C CD2 . LEU C 1 76 ? 25.494  41.599  18.599  1.00 20.43 ? 75   LEU C CD2 1 
ATOM   1899 N N   . GLU C 1 77 ? 25.238  45.824  16.459  1.00 23.06 ? 76   GLU C N   1 
ATOM   1900 C CA  . GLU C 1 77 ? 25.593  47.166  16.009  1.00 24.74 ? 76   GLU C CA  1 
ATOM   1901 C C   . GLU C 1 77 ? 27.105  47.316  15.851  1.00 31.65 ? 76   GLU C C   1 
ATOM   1902 O O   . GLU C 1 77 ? 27.879  46.639  16.525  1.00 31.38 ? 76   GLU C O   1 
ATOM   1903 C CB  . GLU C 1 77 ? 25.065  48.218  16.987  1.00 26.28 ? 76   GLU C CB  1 
ATOM   1904 C CG  . GLU C 1 77 ? 23.554  48.370  16.977  1.00 34.91 ? 76   GLU C CG  1 
ATOM   1905 C CD  . GLU C 1 77 ? 23.066  49.387  17.988  1.00 52.48 ? 76   GLU C CD  1 
ATOM   1906 O OE1 . GLU C 1 77 ? 23.486  50.562  17.901  1.00 47.10 ? 76   GLU C OE1 1 
ATOM   1907 O OE2 . GLU C 1 77 ? 22.245  49.016  18.855  1.00 45.45 ? 76   GLU C OE2 1 
ATOM   1908 N N   . ASN C 1 78 ? 27.514  48.219  14.964  1.00 30.57 ? 77   ASN C N   1 
ATOM   1909 C CA  . ASN C 1 78 ? 28.928  48.495  14.728  1.00 30.98 ? 77   ASN C CA  1 
ATOM   1910 C C   . ASN C 1 78 ? 29.540  49.212  15.929  1.00 36.44 ? 77   ASN C C   1 
ATOM   1911 O O   . ASN C 1 78 ? 28.822  49.769  16.763  1.00 36.67 ? 77   ASN C O   1 
ATOM   1912 C CB  . ASN C 1 78 ? 29.095  49.352  13.468  1.00 32.08 ? 77   ASN C CB  1 
ATOM   1913 C CG  . ASN C 1 78 ? 30.528  49.392  12.968  1.00 50.78 ? 77   ASN C CG  1 
ATOM   1914 O OD1 . ASN C 1 78 ? 31.404  48.698  13.488  1.00 45.67 ? 77   ASN C OD1 1 
ATOM   1915 N ND2 . ASN C 1 78 ? 30.772  50.202  11.944  1.00 44.76 ? 77   ASN C ND2 1 
HETATM 1916 O O   . HOH D 2 .  ? 14.561  25.375  -15.996 1.00 26.30 ? 2001 HOH A O   1 
HETATM 1917 O O   . HOH D 2 .  ? -0.679  8.937   -12.015 1.00 28.36 ? 2002 HOH A O   1 
HETATM 1918 O O   . HOH D 2 .  ? 4.788   25.884  -14.243 1.00 32.35 ? 2003 HOH A O   1 
HETATM 1919 O O   . HOH D 2 .  ? 1.473   19.926  -9.588  1.00 12.67 ? 2004 HOH A O   1 
HETATM 1920 O O   . HOH D 2 .  ? -4.544  22.914  -8.582  1.00 34.56 ? 2005 HOH A O   1 
HETATM 1921 O O   . HOH D 2 .  ? -0.969  21.333  -14.818 1.00 36.02 ? 2006 HOH A O   1 
HETATM 1922 O O   . HOH D 2 .  ? -5.370  18.352  -12.496 1.00 34.82 ? 2007 HOH A O   1 
HETATM 1923 O O   . HOH D 2 .  ? 0.858   14.371  -17.280 1.00 30.31 ? 2008 HOH A O   1 
HETATM 1924 O O   . HOH D 2 .  ? 3.641   14.379  -12.008 1.00 12.67 ? 2009 HOH A O   1 
HETATM 1925 O O   . HOH D 2 .  ? 1.952   9.310   -12.244 1.00 20.98 ? 2010 HOH A O   1 
HETATM 1926 O O   . HOH D 2 .  ? -2.762  12.940  -14.873 1.00 29.35 ? 2011 HOH A O   1 
HETATM 1927 O O   . HOH D 2 .  ? 2.314   17.417  -17.803 1.00 36.32 ? 2012 HOH A O   1 
HETATM 1928 O O   . HOH D 2 .  ? 4.003   14.849  -19.520 1.00 30.62 ? 2013 HOH A O   1 
HETATM 1929 O O   . HOH D 2 .  ? 4.799   18.537  -18.072 1.00 23.09 ? 2014 HOH A O   1 
HETATM 1930 O O   . HOH D 2 .  ? 8.430   12.106  -22.270 1.00 34.86 ? 2015 HOH A O   1 
HETATM 1931 O O   . HOH D 2 .  ? 3.111   22.393  -16.731 1.00 44.29 ? 2016 HOH A O   1 
HETATM 1932 O O   . HOH D 2 .  ? 3.896   27.929  -1.506  1.00 37.79 ? 2017 HOH A O   1 
HETATM 1933 O O   . HOH D 2 .  ? 8.589   26.155  -17.657 1.00 30.11 ? 2018 HOH A O   1 
HETATM 1934 O O   . HOH D 2 .  ? 10.464  22.141  -19.304 1.00 22.07 ? 2019 HOH A O   1 
HETATM 1935 O O   . HOH D 2 .  ? 7.148   17.610  10.110  1.00 36.04 ? 2020 HOH A O   1 
HETATM 1936 O O   . HOH D 2 .  ? 11.275  29.025  -15.650 1.00 21.04 ? 2021 HOH A O   1 
HETATM 1937 O O   . HOH D 2 .  ? 12.277  32.449  -11.849 1.00 28.73 ? 2022 HOH A O   1 
HETATM 1938 O O   . HOH D 2 .  ? 8.723   30.203  -9.150  1.00 25.61 ? 2023 HOH A O   1 
HETATM 1939 O O   . HOH D 2 .  ? 13.637  35.727  -2.092  1.00 30.68 ? 2024 HOH A O   1 
HETATM 1940 O O   . HOH D 2 .  ? 6.053   7.202   1.040   1.00 28.37 ? 2025 HOH A O   1 
HETATM 1941 O O   . HOH D 2 .  ? 12.162  29.280  0.899   1.00 31.88 ? 2026 HOH A O   1 
HETATM 1942 O O   . HOH D 2 .  ? 15.021  29.291  -6.063  1.00 25.72 ? 2027 HOH A O   1 
HETATM 1943 O O   . HOH D 2 .  ? 21.070  18.302  -1.373  1.00 30.43 ? 2028 HOH A O   1 
HETATM 1944 O O   . HOH D 2 .  ? 16.466  25.555  2.746   1.00 47.67 ? 2029 HOH A O   1 
HETATM 1945 O O   . HOH D 2 .  ? 17.807  25.566  -1.359  1.00 24.44 ? 2030 HOH A O   1 
HETATM 1946 O O   . HOH D 2 .  ? 15.428  23.116  1.230   1.00 22.69 ? 2031 HOH A O   1 
HETATM 1947 O O   . HOH D 2 .  ? 12.232  27.548  4.028   1.00 22.15 ? 2032 HOH A O   1 
HETATM 1948 O O   . HOH D 2 .  ? 6.353   7.262   -9.622  1.00 21.24 ? 2033 HOH A O   1 
HETATM 1949 O O   . HOH D 2 .  ? -0.742  9.664   -6.384  1.00 21.10 ? 2034 HOH A O   1 
HETATM 1950 O O   . HOH D 2 .  ? -2.636  9.032   -0.168  1.00 35.43 ? 2035 HOH A O   1 
HETATM 1951 O O   . HOH D 2 .  ? -4.812  14.490  -11.078 1.00 31.18 ? 2036 HOH A O   1 
HETATM 1952 O O   . HOH D 2 .  ? -2.183  13.643  -10.948 1.00 19.51 ? 2037 HOH A O   1 
HETATM 1953 O O   . HOH D 2 .  ? 1.991   17.547  -10.964 1.00 13.41 ? 2038 HOH A O   1 
HETATM 1954 O O   . HOH D 2 .  ? -2.262  22.355  -7.005  1.00 32.29 ? 2039 HOH A O   1 
HETATM 1955 O O   . HOH D 2 .  ? 5.864   26.654  -0.039  1.00 18.96 ? 2040 HOH A O   1 
HETATM 1956 O O   . HOH D 2 .  ? 4.797   16.654  9.510   1.00 18.53 ? 2041 HOH A O   1 
HETATM 1957 O O   . HOH D 2 .  ? 2.634   18.902  10.336  1.00 18.10 ? 2042 HOH A O   1 
HETATM 1958 O O   . HOH D 2 .  ? 3.254   23.749  10.469  1.00 35.89 ? 2043 HOH A O   1 
HETATM 1959 O O   . HOH D 2 .  ? -5.829  26.398  1.680   1.00 36.49 ? 2044 HOH A O   1 
HETATM 1960 O O   . HOH D 2 .  ? -1.187  26.413  5.689   1.00 37.11 ? 2045 HOH A O   1 
HETATM 1961 O O   . HOH D 2 .  ? -5.052  21.132  -4.871  1.00 29.75 ? 2046 HOH A O   1 
HETATM 1962 O O   . HOH D 2 .  ? -7.488  19.272  -3.500  1.00 27.77 ? 2047 HOH A O   1 
HETATM 1963 O O   . HOH D 2 .  ? -11.129 21.846  -1.921  1.00 31.63 ? 2048 HOH A O   1 
HETATM 1964 O O   . HOH D 2 .  ? -10.057 19.510  -0.933  1.00 25.57 ? 2049 HOH A O   1 
HETATM 1965 O O   . HOH D 2 .  ? -5.768  13.188  -0.271  1.00 17.71 ? 2050 HOH A O   1 
HETATM 1966 O O   . HOH D 2 .  ? 0.437   9.657   5.184   1.00 35.40 ? 2051 HOH A O   1 
HETATM 1967 O O   . HOH D 2 .  ? 4.502   7.392   -1.013  1.00 36.95 ? 2052 HOH A O   1 
HETATM 1968 O O   . HOH D 2 .  ? 5.352   11.833  3.856   1.00 20.67 ? 2053 HOH A O   1 
HETATM 1969 O O   . HOH D 2 .  ? 9.330   11.544  2.138   1.00 29.08 ? 2054 HOH A O   1 
HETATM 1970 O O   . HOH D 2 .  ? 15.917  10.884  0.543   1.00 35.04 ? 2055 HOH A O   1 
HETATM 1971 O O   . HOH D 2 .  ? 15.620  15.390  0.759   1.00 29.09 ? 2056 HOH A O   1 
HETATM 1972 O O   . HOH D 2 .  ? 11.206  15.006  2.366   1.00 27.79 ? 2057 HOH A O   1 
HETATM 1973 O O   . HOH D 2 .  ? 19.663  24.471  -3.359  1.00 29.11 ? 2058 HOH A O   1 
HETATM 1974 O O   . HOH D 2 .  ? 18.271  17.540  -1.981  1.00 27.85 ? 2059 HOH A O   1 
HETATM 1975 O O   . HOH D 2 .  ? 21.219  21.386  -13.007 1.00 33.98 ? 2060 HOH A O   1 
HETATM 1976 O O   . HOH D 2 .  ? 21.230  21.179  -7.697  1.00 25.11 ? 2061 HOH A O   1 
HETATM 1977 O O   . HOH D 2 .  ? 20.443  25.136  -12.153 1.00 32.87 ? 2062 HOH A O   1 
HETATM 1978 O O   . HOH D 2 .  ? 20.256  17.289  -9.374  1.00 31.47 ? 2063 HOH A O   1 
HETATM 1979 O O   . HOH D 2 .  ? 14.621  14.619  -12.462 1.00 12.32 ? 2064 HOH A O   1 
HETATM 1980 O O   . HOH D 2 .  ? 13.473  6.269   -5.997  1.00 30.61 ? 2065 HOH A O   1 
HETATM 1981 O O   . HOH D 2 .  ? 9.554   4.779   -5.241  1.00 46.61 ? 2066 HOH A O   1 
HETATM 1982 O O   . HOH D 2 .  ? 10.384  6.653   -1.531  1.00 37.72 ? 2067 HOH A O   1 
HETATM 1983 O O   . HOH D 2 .  ? 13.535  8.999   -2.439  1.00 23.41 ? 2068 HOH A O   1 
HETATM 1984 O O   . HOH D 2 .  ? 7.994   6.189   -0.459  1.00 23.89 ? 2069 HOH A O   1 
HETATM 1985 O O   . HOH D 2 .  ? 9.232   -1.028  -0.120  1.00 32.42 ? 2070 HOH A O   1 
HETATM 1986 O O   . HOH E 2 .  ? 32.175  0.509   5.975   1.00 30.96 ? 2001 HOH B O   1 
HETATM 1987 O O   . HOH E 2 .  ? 33.246  3.303   12.001  1.00 42.30 ? 2002 HOH B O   1 
HETATM 1988 O O   . HOH E 2 .  ? 24.234  11.104  0.491   1.00 23.95 ? 2003 HOH B O   1 
HETATM 1989 O O   . HOH E 2 .  ? 24.981  13.227  9.075   1.00 26.29 ? 2004 HOH B O   1 
HETATM 1990 O O   . HOH E 2 .  ? 20.188  -3.115  4.797   1.00 11.52 ? 2005 HOH B O   1 
HETATM 1991 O O   . HOH E 2 .  ? 22.605  11.439  2.702   1.00 23.91 ? 2006 HOH B O   1 
HETATM 1992 O O   . HOH E 2 .  ? 22.579  14.077  7.096   1.00 31.80 ? 2007 HOH B O   1 
HETATM 1993 O O   . HOH E 2 .  ? 14.670  8.633   -0.084  1.00 28.35 ? 2008 HOH B O   1 
HETATM 1994 O O   . HOH E 2 .  ? 16.829  6.793   -3.085  1.00 33.69 ? 2009 HOH B O   1 
HETATM 1995 O O   . HOH E 2 .  ? 16.368  10.430  7.930   1.00 14.40 ? 2010 HOH B O   1 
HETATM 1996 O O   . HOH E 2 .  ? 20.451  19.470  21.070  1.00 24.07 ? 2011 HOH B O   1 
HETATM 1997 O O   . HOH E 2 .  ? 14.219  16.851  8.495   1.00 40.85 ? 2012 HOH B O   1 
HETATM 1998 O O   . HOH E 2 .  ? 15.549  12.916  2.763   1.00 25.47 ? 2013 HOH B O   1 
HETATM 1999 O O   . HOH E 2 .  ? 17.263  19.036  5.894   1.00 36.74 ? 2014 HOH B O   1 
HETATM 2000 O O   . HOH E 2 .  ? 10.186  14.456  4.946   1.00 19.38 ? 2015 HOH B O   1 
HETATM 2001 O O   . HOH E 2 .  ? 8.463   3.286   6.455   1.00 26.17 ? 2016 HOH B O   1 
HETATM 2002 O O   . HOH E 2 .  ? 13.094  4.898   -1.559  1.00 26.54 ? 2017 HOH B O   1 
HETATM 2003 O O   . HOH E 2 .  ? 13.947  -0.219  -0.219  1.00 20.91 ? 2018 HOH B O   1 
HETATM 2004 O O   . HOH E 2 .  ? 21.378  1.554   -1.155  1.00 24.02 ? 2019 HOH B O   1 
HETATM 2005 O O   . HOH E 2 .  ? 13.868  3.545   -6.603  1.00 27.29 ? 2020 HOH B O   1 
HETATM 2006 O O   . HOH E 2 .  ? 17.492  1.149   -5.369  1.00 30.29 ? 2021 HOH B O   1 
HETATM 2007 O O   . HOH E 2 .  ? 13.691  0.556   -3.642  1.00 28.05 ? 2022 HOH B O   1 
HETATM 2008 O O   . HOH E 2 .  ? 16.830  7.014   -0.408  1.00 17.65 ? 2023 HOH B O   1 
HETATM 2009 O O   . HOH E 2 .  ? 22.891  5.004   -2.147  1.00 25.43 ? 2024 HOH B O   1 
HETATM 2010 O O   . HOH E 2 .  ? 28.516  3.203   1.168   1.00 34.11 ? 2025 HOH B O   1 
HETATM 2011 O O   . HOH E 2 .  ? 29.178  8.487   1.418   1.00 28.47 ? 2026 HOH B O   1 
HETATM 2012 O O   . HOH E 2 .  ? 18.135  21.071  21.856  1.00 26.69 ? 2027 HOH B O   1 
HETATM 2013 O O   . HOH E 2 .  ? 33.068  5.278   6.291   1.00 33.43 ? 2028 HOH B O   1 
HETATM 2014 O O   . HOH E 2 .  ? 29.304  11.509  7.314   1.00 20.67 ? 2029 HOH B O   1 
HETATM 2015 O O   . HOH E 2 .  ? 0.613   7.364   28.108  1.00 40.29 ? 2030 HOH B O   1 
HETATM 2016 O O   . HOH E 2 .  ? 11.083  1.956   23.274  1.00 30.60 ? 2031 HOH B O   1 
HETATM 2017 O O   . HOH E 2 .  ? 32.479  5.998   10.548  1.00 33.02 ? 2032 HOH B O   1 
HETATM 2018 O O   . HOH E 2 .  ? 27.374  -5.430  16.805  1.00 31.19 ? 2033 HOH B O   1 
HETATM 2019 O O   . HOH E 2 .  ? 31.572  1.579   14.972  1.00 25.17 ? 2034 HOH B O   1 
HETATM 2020 O O   . HOH E 2 .  ? 29.802  7.093   20.656  1.00 20.19 ? 2035 HOH B O   1 
HETATM 2021 O O   . HOH E 2 .  ? 6.690   5.312   7.129   1.00 35.66 ? 2036 HOH B O   1 
HETATM 2022 O O   . HOH E 2 .  ? 3.726   11.374  12.734  1.00 29.14 ? 2037 HOH B O   1 
HETATM 2023 O O   . HOH E 2 .  ? 9.010   9.127   7.001   1.00 19.31 ? 2038 HOH B O   1 
HETATM 2024 O O   . HOH E 2 .  ? 14.662  8.445   6.728   1.00 11.24 ? 2039 HOH B O   1 
HETATM 2025 O O   . HOH E 2 .  ? 13.254  5.190   5.873   1.00 10.87 ? 2040 HOH B O   1 
HETATM 2026 O O   . HOH E 2 .  ? 20.792  14.645  9.087   1.00 21.66 ? 2041 HOH B O   1 
HETATM 2027 O O   . HOH E 2 .  ? 16.185  14.849  10.000  1.00 23.76 ? 2042 HOH B O   1 
HETATM 2028 O O   . HOH E 2 .  ? 23.576  11.881  10.336  1.00 29.47 ? 2043 HOH B O   1 
HETATM 2029 O O   . HOH E 2 .  ? 25.499  11.450  16.789  1.00 23.73 ? 2044 HOH B O   1 
HETATM 2030 O O   . HOH E 2 .  ? 23.800  6.684   25.389  1.00 27.17 ? 2045 HOH B O   1 
HETATM 2031 O O   . HOH E 2 .  ? 17.387  6.297   26.938  1.00 25.54 ? 2046 HOH B O   1 
HETATM 2032 O O   . HOH E 2 .  ? 16.266  17.952  26.786  1.00 27.23 ? 2047 HOH B O   1 
HETATM 2033 O O   . HOH E 2 .  ? 17.810  9.575   27.987  1.00 24.45 ? 2048 HOH B O   1 
HETATM 2034 O O   . HOH E 2 .  ? 16.638  20.330  19.258  1.00 32.37 ? 2049 HOH B O   1 
HETATM 2035 O O   . HOH E 2 .  ? 27.511  16.451  20.748  1.00 40.08 ? 2050 HOH B O   1 
HETATM 2036 O O   . HOH E 2 .  ? 23.600  13.070  15.963  1.00 24.97 ? 2051 HOH B O   1 
HETATM 2037 O O   . HOH E 2 .  ? 19.335  18.505  15.355  1.00 21.24 ? 2052 HOH B O   1 
HETATM 2038 O O   . HOH E 2 .  ? 22.343  15.537  22.385  1.00 32.21 ? 2053 HOH B O   1 
HETATM 2039 O O   . HOH E 2 .  ? 13.139  17.140  12.922  1.00 39.56 ? 2054 HOH B O   1 
HETATM 2040 O O   . HOH E 2 .  ? 15.430  23.927  15.132  1.00 30.97 ? 2055 HOH B O   1 
HETATM 2041 O O   . HOH E 2 .  ? 9.239   17.417  14.096  1.00 49.23 ? 2056 HOH B O   1 
HETATM 2042 O O   . HOH E 2 .  ? 17.993  21.943  17.530  1.00 27.16 ? 2057 HOH B O   1 
HETATM 2043 O O   . HOH E 2 .  ? 10.483  21.333  15.504  1.00 26.53 ? 2058 HOH B O   1 
HETATM 2044 O O   . HOH E 2 .  ? 3.239   8.437   26.637  1.00 34.49 ? 2059 HOH B O   1 
HETATM 2045 O O   . HOH E 2 .  ? 8.790   4.637   23.365  1.00 28.65 ? 2060 HOH B O   1 
HETATM 2046 O O   . HOH E 2 .  ? 7.766   3.892   17.140  1.00 22.37 ? 2061 HOH B O   1 
HETATM 2047 O O   . HOH E 2 .  ? 15.488  -1.046  19.560  1.00 22.66 ? 2062 HOH B O   1 
HETATM 2048 O O   . HOH E 2 .  ? 17.124  0.808   21.351  1.00 29.45 ? 2063 HOH B O   1 
HETATM 2049 O O   . HOH E 2 .  ? 13.087  2.309   21.353  1.00 16.54 ? 2064 HOH B O   1 
HETATM 2050 O O   . HOH E 2 .  ? 23.253  -2.459  18.545  1.00 31.53 ? 2065 HOH B O   1 
HETATM 2051 O O   . HOH E 2 .  ? 19.710  0.207   20.105  1.00 21.56 ? 2066 HOH B O   1 
HETATM 2052 O O   . HOH E 2 .  ? 25.344  -4.018  15.344  1.00 23.31 ? 2067 HOH B O   1 
HETATM 2053 O O   . HOH E 2 .  ? 31.593  -0.657  12.933  1.00 29.54 ? 2068 HOH B O   1 
HETATM 2054 O O   . HOH E 2 .  ? 29.338  -3.761  3.456   1.00 25.29 ? 2069 HOH B O   1 
HETATM 2055 O O   . HOH E 2 .  ? 31.946  -1.383  8.638   1.00 23.99 ? 2070 HOH B O   1 
HETATM 2056 O O   . HOH E 2 .  ? 29.810  -4.209  8.649   1.00 21.36 ? 2071 HOH B O   1 
HETATM 2057 O O   . HOH E 2 .  ? 26.478  -5.421  6.514   1.00 29.22 ? 2072 HOH B O   1 
HETATM 2058 O O   . HOH E 2 .  ? 15.065  -3.100  17.806  1.00 28.89 ? 2073 HOH B O   1 
HETATM 2059 O O   . HOH E 2 .  ? 8.233   -3.068  6.997   1.00 35.58 ? 2074 HOH B O   1 
HETATM 2060 O O   . HOH F 2 .  ? 16.586  17.540  13.370  1.00 34.32 ? 2001 HOH C O   1 
HETATM 2061 O O   . HOH F 2 .  ? 19.143  22.107  9.405   1.00 17.09 ? 2002 HOH C O   1 
HETATM 2062 O O   . HOH F 2 .  ? 29.571  23.616  7.497   1.00 41.19 ? 2003 HOH C O   1 
HETATM 2063 O O   . HOH F 2 .  ? 30.744  26.279  6.084   1.00 28.53 ? 2004 HOH C O   1 
HETATM 2064 O O   . HOH F 2 .  ? 33.203  25.712  10.103  1.00 37.29 ? 2005 HOH C O   1 
HETATM 2065 O O   . HOH F 2 .  ? 33.086  32.688  10.521  1.00 11.05 ? 2006 HOH C O   1 
HETATM 2066 O O   . HOH F 2 .  ? 25.927  15.990  10.001  1.00 37.85 ? 2007 HOH C O   1 
HETATM 2067 O O   . HOH F 2 .  ? 21.873  14.083  11.457  1.00 24.60 ? 2008 HOH C O   1 
HETATM 2068 O O   . HOH F 2 .  ? 35.527  31.792  5.473   1.00 32.13 ? 2009 HOH C O   1 
HETATM 2069 O O   . HOH F 2 .  ? 32.862  38.249  2.700   1.00 25.50 ? 2010 HOH C O   1 
HETATM 2070 O O   . HOH F 2 .  ? 36.256  39.897  4.768   1.00 27.07 ? 2011 HOH C O   1 
HETATM 2071 O O   . HOH F 2 .  ? 31.166  42.875  7.732   1.00 26.46 ? 2012 HOH C O   1 
HETATM 2072 O O   . HOH F 2 .  ? 29.372  37.338  0.441   1.00 33.05 ? 2013 HOH C O   1 
HETATM 2073 O O   . HOH F 2 .  ? 22.826  32.215  1.130   1.00 28.77 ? 2014 HOH C O   1 
HETATM 2074 O O   . HOH F 2 .  ? 29.551  33.311  1.955   1.00 27.42 ? 2015 HOH C O   1 
HETATM 2075 O O   . HOH F 2 .  ? 33.675  27.128  15.208  1.00 41.16 ? 2016 HOH C O   1 
HETATM 2076 O O   . HOH F 2 .  ? 31.685  23.908  19.050  1.00 45.57 ? 2017 HOH C O   1 
HETATM 2077 O O   . HOH F 2 .  ? 24.832  28.722  1.217   1.00 29.03 ? 2018 HOH C O   1 
HETATM 2078 O O   . HOH F 2 .  ? 24.308  22.033  4.645   1.00 30.03 ? 2019 HOH C O   1 
HETATM 2079 O O   . HOH F 2 .  ? 29.737  27.748  31.435  1.00 38.02 ? 2020 HOH C O   1 
HETATM 2080 O O   . HOH F 2 .  ? 34.709  26.106  18.676  1.00 22.60 ? 2021 HOH C O   1 
HETATM 2081 O O   . HOH F 2 .  ? 27.900  21.235  11.105  1.00 18.96 ? 2022 HOH C O   1 
HETATM 2082 O O   . HOH F 2 .  ? 24.033  15.765  12.401  1.00 30.64 ? 2023 HOH C O   1 
HETATM 2083 O O   . HOH F 2 .  ? 21.648  21.453  14.105  1.00 20.86 ? 2024 HOH C O   1 
HETATM 2084 O O   . HOH F 2 .  ? 19.759  24.368  23.517  1.00 41.66 ? 2025 HOH C O   1 
HETATM 2085 O O   . HOH F 2 .  ? 18.155  24.315  18.802  1.00 14.15 ? 2026 HOH C O   1 
HETATM 2086 O O   . HOH F 2 .  ? 26.032  44.453  10.079  1.00 28.32 ? 2027 HOH C O   1 
HETATM 2087 O O   . HOH F 2 .  ? 28.649  46.831  12.430  1.00 32.29 ? 2028 HOH C O   1 
HETATM 2088 O O   . HOH F 2 .  ? 33.489  45.434  16.794  1.00 30.33 ? 2029 HOH C O   1 
HETATM 2089 O O   . HOH F 2 .  ? 33.712  43.703  8.608   1.00 36.75 ? 2030 HOH C O   1 
HETATM 2090 O O   . HOH F 2 .  ? 35.729  39.350  8.866   1.00 17.67 ? 2031 HOH C O   1 
HETATM 2091 O O   . HOH F 2 .  ? 37.301  42.319  7.218   1.00 34.20 ? 2032 HOH C O   1 
HETATM 2092 O O   . HOH F 2 .  ? 38.699  38.390  8.569   1.00 33.50 ? 2033 HOH C O   1 
HETATM 2093 O O   . HOH F 2 .  ? 41.924  40.324  8.606   1.00 36.22 ? 2034 HOH C O   1 
HETATM 2094 O O   . HOH F 2 .  ? 32.136  34.868  9.007   1.00 8.80  ? 2035 HOH C O   1 
HETATM 2095 O O   . HOH F 2 .  ? 29.984  37.716  7.975   1.00 10.96 ? 2036 HOH C O   1 
HETATM 2096 O O   . HOH F 2 .  ? 31.471  25.690  15.402  1.00 27.45 ? 2037 HOH C O   1 
HETATM 2097 O O   . HOH F 2 .  ? 30.183  17.631  19.687  1.00 35.97 ? 2038 HOH C O   1 
HETATM 2098 O O   . HOH F 2 .  ? 32.024  21.254  22.653  1.00 37.35 ? 2039 HOH C O   1 
HETATM 2099 O O   . HOH F 2 .  ? 22.947  23.977  26.528  1.00 38.95 ? 2040 HOH C O   1 
HETATM 2100 O O   . HOH F 2 .  ? 24.382  23.354  24.293  1.00 25.80 ? 2041 HOH C O   1 
HETATM 2101 O O   . HOH F 2 .  ? 30.236  25.730  20.325  1.00 16.89 ? 2042 HOH C O   1 
HETATM 2102 O O   . HOH F 2 .  ? 31.186  31.526  31.485  1.00 32.70 ? 2043 HOH C O   1 
HETATM 2103 O O   . HOH F 2 .  ? 26.343  30.080  28.983  1.00 21.29 ? 2044 HOH C O   1 
HETATM 2104 O O   . HOH F 2 .  ? 29.059  35.809  29.548  1.00 20.42 ? 2045 HOH C O   1 
HETATM 2105 O O   . HOH F 2 .  ? 31.691  34.145  30.616  1.00 17.52 ? 2046 HOH C O   1 
HETATM 2106 O O   . HOH F 2 .  ? 32.128  28.964  30.460  1.00 26.24 ? 2047 HOH C O   1 
HETATM 2107 O O   . HOH F 2 .  ? 31.192  25.831  29.045  1.00 35.02 ? 2048 HOH C O   1 
HETATM 2108 O O   . HOH F 2 .  ? 35.416  28.083  17.184  1.00 43.51 ? 2049 HOH C O   1 
HETATM 2109 O O   . HOH F 2 .  ? 41.673  38.081  14.897  1.00 29.77 ? 2050 HOH C O   1 
HETATM 2110 O O   . HOH F 2 .  ? 39.275  40.950  19.771  1.00 19.36 ? 2051 HOH C O   1 
HETATM 2111 O O   . HOH F 2 .  ? 37.920  47.379  27.899  1.00 33.17 ? 2052 HOH C O   1 
HETATM 2112 O O   . HOH F 2 .  ? 37.058  44.208  18.744  1.00 27.02 ? 2053 HOH C O   1 
HETATM 2113 O O   . HOH F 2 .  ? 27.366  44.989  19.032  1.00 29.66 ? 2054 HOH C O   1 
HETATM 2114 O O   . HOH F 2 .  ? 31.552  44.560  18.629  1.00 21.68 ? 2055 HOH C O   1 
HETATM 2115 O O   . HOH F 2 .  ? 24.066  38.432  23.198  1.00 37.32 ? 2056 HOH C O   1 
HETATM 2116 O O   . HOH F 2 .  ? 27.745  40.807  23.365  1.00 17.64 ? 2057 HOH C O   1 
HETATM 2117 O O   . HOH F 2 .  ? 16.775  35.691  16.585  1.00 32.55 ? 2058 HOH C O   1 
HETATM 2118 O O   . HOH F 2 .  ? 22.957  36.088  22.700  1.00 23.05 ? 2059 HOH C O   1 
HETATM 2119 O O   . HOH F 2 .  ? 15.915  25.618  17.386  1.00 17.30 ? 2060 HOH C O   1 
HETATM 2120 O O   . HOH F 2 .  ? 16.453  32.310  19.004  1.00 34.67 ? 2061 HOH C O   1 
HETATM 2121 O O   . HOH F 2 .  ? 9.229   31.671  18.072  1.00 45.81 ? 2062 HOH C O   1 
HETATM 2122 O O   . HOH F 2 .  ? 14.064  27.826  12.736  1.00 22.56 ? 2063 HOH C O   1 
HETATM 2123 O O   . HOH F 2 .  ? 15.403  24.924  12.715  1.00 41.37 ? 2064 HOH C O   1 
HETATM 2124 O O   . HOH F 2 .  ? 19.215  35.678  7.717   1.00 15.40 ? 2065 HOH C O   1 
HETATM 2125 O O   . HOH F 2 .  ? 24.292  46.199  6.353   1.00 30.66 ? 2066 HOH C O   1 
HETATM 2126 O O   . HOH F 2 .  ? 19.912  41.371  17.834  1.00 28.67 ? 2067 HOH C O   1 
HETATM 2127 O O   . HOH F 2 .  ? 23.980  45.306  19.208  1.00 26.65 ? 2068 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  0  0  MET MET A . n 
A 1 2  LEU 2  1  1  LEU LEU A . n 
A 1 3  GLN 3  2  2  GLN GLN A . n 
A 1 4  CYS 4  3  3  CYS CYS A . n 
A 1 5  TYR 5  4  4  TYR TYR A . n 
A 1 6  ASN 6  5  5  ASN ASN A . n 
A 1 7  CYS 7  6  6  CYS CYS A . n 
A 1 8  PRO 8  7  7  PRO PRO A . n 
A 1 9  ASN 9  8  8  ASN ASN A . n 
A 1 10 PRO 10 9  9  PRO PRO A . n 
A 1 11 THR 11 10 10 THR THR A . n 
A 1 12 ALA 12 11 11 ALA ALA A . n 
A 1 13 ASP 13 12 12 ASP ASP A . n 
A 1 14 CYS 14 13 13 CYS CYS A . n 
A 1 15 LYS 15 14 14 LYS LYS A . n 
A 1 16 THR 16 15 15 THR THR A . n 
A 1 17 ALA 17 16 16 ALA ALA A . n 
A 1 18 VAL 18 17 17 VAL VAL A . n 
A 1 19 ASN 19 18 18 ASN ASN A . n 
A 1 20 CYS 20 19 19 CYS CYS A . n 
A 1 21 SER 21 20 20 SER SER A . n 
A 1 22 SER 22 21 21 SER SER A . n 
A 1 23 ASP 23 22 22 ASP ASP A . n 
A 1 24 PHE 24 23 23 PHE PHE A . n 
A 1 25 ASP 25 24 24 ASP ASP A . n 
A 1 26 ALA 26 25 25 ALA ALA A . n 
A 1 27 CYS 27 26 26 CYS CYS A . n 
A 1 28 LEU 28 27 27 LEU LEU A . n 
A 1 29 ILE 29 28 28 ILE ILE A . n 
A 1 30 THR 30 29 29 THR THR A . n 
A 1 31 LYS 31 30 30 LYS LYS A . n 
A 1 32 ALA 32 31 31 ALA ALA A . n 
A 1 33 GLY 33 32 32 GLY GLY A . n 
A 1 34 LEU 34 33 33 LEU LEU A . n 
A 1 35 GLN 35 34 34 GLN GLN A . n 
A 1 36 VAL 36 35 35 VAL VAL A . n 
A 1 37 TYR 37 36 36 TYR TYR A . n 
A 1 38 ASN 38 37 37 ASN ASN A . n 
A 1 39 LYS 39 38 38 LYS LYS A . n 
A 1 40 CYS 40 39 39 CYS CYS A . n 
A 1 41 TRP 41 40 40 TRP TRP A . n 
A 1 42 LYS 42 41 41 LYS LYS A . n 
A 1 43 PHE 43 42 42 PHE PHE A . n 
A 1 44 GLU 44 43 43 GLU GLU A . n 
A 1 45 HIS 45 44 44 HIS HIS A . n 
A 1 46 CYS 46 45 45 CYS CYS A . n 
A 1 47 ASN 47 46 46 ASN ASN A . n 
A 1 48 PHE 48 47 47 PHE PHE A . n 
A 1 49 ASN 49 48 48 ASN ASN A . n 
A 1 50 ASP 50 49 49 ASP ASP A . n 
A 1 51 VAL 51 50 50 VAL VAL A . n 
A 1 52 THR 52 51 51 THR THR A . n 
A 1 53 THR 53 52 52 THR THR A . n 
A 1 54 ARG 54 53 53 ARG ARG A . n 
A 1 55 LEU 55 54 54 LEU LEU A . n 
A 1 56 ARG 56 55 55 ARG ARG A . n 
A 1 57 GLU 57 56 56 GLU GLU A . n 
A 1 58 ASN 58 57 57 ASN ASN A . n 
A 1 59 GLU 59 58 58 GLU GLU A . n 
A 1 60 LEU 60 59 59 LEU LEU A . n 
A 1 61 THR 61 60 60 THR THR A . n 
A 1 62 TYR 62 61 61 TYR TYR A . n 
A 1 63 TYR 63 62 62 TYR TYR A . n 
A 1 64 CYS 64 63 63 CYS CYS A . n 
A 1 65 CYS 65 64 64 CYS CYS A . n 
A 1 66 LYS 66 65 65 LYS LYS A . n 
A 1 67 LYS 67 66 66 LYS LYS A . n 
A 1 68 ASP 68 67 67 ASP ASP A . n 
A 1 69 LEU 69 68 68 LEU LEU A . n 
A 1 70 CYS 70 69 69 CYS CYS A . n 
A 1 71 ASN 71 70 70 ASN ASN A . n 
A 1 72 PHE 72 71 71 PHE PHE A . n 
A 1 73 ASN 73 72 72 ASN ASN A . n 
A 1 74 GLU 74 73 73 GLU GLU A . n 
A 1 75 GLN 75 74 74 GLN GLN A . n 
A 1 76 LEU 76 75 75 LEU LEU A . n 
A 1 77 GLU 77 76 76 GLU GLU A . n 
A 1 78 ASN 78 77 77 ASN ASN A . n 
B 1 1  MET 1  0  0  MET MET B . n 
B 1 2  LEU 2  1  1  LEU LEU B . n 
B 1 3  GLN 3  2  2  GLN GLN B . n 
B 1 4  CYS 4  3  3  CYS CYS B . n 
B 1 5  TYR 5  4  4  TYR TYR B . n 
B 1 6  ASN 6  5  5  ASN ASN B . n 
B 1 7  CYS 7  6  6  CYS CYS B . n 
B 1 8  PRO 8  7  7  PRO PRO B . n 
B 1 9  ASN 9  8  8  ASN ASN B . n 
B 1 10 PRO 10 9  9  PRO PRO B . n 
B 1 11 THR 11 10 10 THR THR B . n 
B 1 12 ALA 12 11 11 ALA ALA B . n 
B 1 13 ASP 13 12 12 ASP ASP B . n 
B 1 14 CYS 14 13 13 CYS CYS B . n 
B 1 15 LYS 15 14 14 LYS LYS B . n 
B 1 16 THR 16 15 15 THR THR B . n 
B 1 17 ALA 17 16 16 ALA ALA B . n 
B 1 18 VAL 18 17 17 VAL VAL B . n 
B 1 19 ASN 19 18 18 ASN ASN B . n 
B 1 20 CYS 20 19 19 CYS CYS B . n 
B 1 21 SER 21 20 20 SER SER B . n 
B 1 22 SER 22 21 21 SER SER B . n 
B 1 23 ASP 23 22 22 ASP ASP B . n 
B 1 24 PHE 24 23 23 PHE PHE B . n 
B 1 25 ASP 25 24 24 ASP ASP B . n 
B 1 26 ALA 26 25 25 ALA ALA B . n 
B 1 27 CYS 27 26 26 CYS CYS B . n 
B 1 28 LEU 28 27 27 LEU LEU B . n 
B 1 29 ILE 29 28 28 ILE ILE B . n 
B 1 30 THR 30 29 29 THR THR B . n 
B 1 31 LYS 31 30 30 LYS LYS B . n 
B 1 32 ALA 32 31 31 ALA ALA B . n 
B 1 33 GLY 33 32 32 GLY GLY B . n 
B 1 34 LEU 34 33 33 LEU LEU B . n 
B 1 35 GLN 35 34 34 GLN GLN B . n 
B 1 36 VAL 36 35 35 VAL VAL B . n 
B 1 37 TYR 37 36 36 TYR TYR B . n 
B 1 38 ASN 38 37 37 ASN ASN B . n 
B 1 39 LYS 39 38 38 LYS LYS B . n 
B 1 40 CYS 40 39 39 CYS CYS B . n 
B 1 41 TRP 41 40 40 TRP TRP B . n 
B 1 42 LYS 42 41 41 LYS LYS B . n 
B 1 43 PHE 43 42 42 PHE PHE B . n 
B 1 44 GLU 44 43 43 GLU GLU B . n 
B 1 45 HIS 45 44 44 HIS HIS B . n 
B 1 46 CYS 46 45 45 CYS CYS B . n 
B 1 47 ASN 47 46 46 ASN ASN B . n 
B 1 48 PHE 48 47 47 PHE PHE B . n 
B 1 49 ASN 49 48 48 ASN ASN B . n 
B 1 50 ASP 50 49 49 ASP ASP B . n 
B 1 51 VAL 51 50 50 VAL VAL B . n 
B 1 52 THR 52 51 51 THR THR B . n 
B 1 53 THR 53 52 52 THR THR B . n 
B 1 54 ARG 54 53 53 ARG ARG B . n 
B 1 55 LEU 55 54 54 LEU LEU B . n 
B 1 56 ARG 56 55 55 ARG ARG B . n 
B 1 57 GLU 57 56 56 GLU GLU B . n 
B 1 58 ASN 58 57 57 ASN ASN B . n 
B 1 59 GLU 59 58 58 GLU GLU B . n 
B 1 60 LEU 60 59 59 LEU LEU B . n 
B 1 61 THR 61 60 60 THR THR B . n 
B 1 62 TYR 62 61 61 TYR TYR B . n 
B 1 63 TYR 63 62 62 TYR TYR B . n 
B 1 64 CYS 64 63 63 CYS CYS B . n 
B 1 65 CYS 65 64 64 CYS CYS B . n 
B 1 66 LYS 66 65 65 LYS LYS B . n 
B 1 67 LYS 67 66 66 LYS LYS B . n 
B 1 68 ASP 68 67 67 ASP ASP B . n 
B 1 69 LEU 69 68 68 LEU LEU B . n 
B 1 70 CYS 70 69 69 CYS CYS B . n 
B 1 71 ASN 71 70 70 ASN ASN B . n 
B 1 72 PHE 72 71 71 PHE PHE B . n 
B 1 73 ASN 73 72 72 ASN ASN B . n 
B 1 74 GLU 74 73 73 GLU GLU B . n 
B 1 75 GLN 75 74 74 GLN GLN B . n 
B 1 76 LEU 76 75 75 LEU LEU B . n 
B 1 77 GLU 77 76 76 GLU GLU B . n 
B 1 78 ASN 78 77 77 ASN ASN B . n 
C 1 1  MET 1  0  0  MET MET C . n 
C 1 2  LEU 2  1  1  LEU LEU C . n 
C 1 3  GLN 3  2  2  GLN GLN C . n 
C 1 4  CYS 4  3  3  CYS CYS C . n 
C 1 5  TYR 5  4  4  TYR TYR C . n 
C 1 6  ASN 6  5  5  ASN ASN C . n 
C 1 7  CYS 7  6  6  CYS CYS C . n 
C 1 8  PRO 8  7  7  PRO PRO C . n 
C 1 9  ASN 9  8  8  ASN ASN C . n 
C 1 10 PRO 10 9  9  PRO PRO C . n 
C 1 11 THR 11 10 10 THR THR C . n 
C 1 12 ALA 12 11 11 ALA ALA C . n 
C 1 13 ASP 13 12 12 ASP ASP C . n 
C 1 14 CYS 14 13 13 CYS CYS C . n 
C 1 15 LYS 15 14 14 LYS LYS C . n 
C 1 16 THR 16 15 15 THR THR C . n 
C 1 17 ALA 17 16 16 ALA ALA C . n 
C 1 18 VAL 18 17 17 VAL VAL C . n 
C 1 19 ASN 19 18 18 ASN ASN C . n 
C 1 20 CYS 20 19 19 CYS CYS C . n 
C 1 21 SER 21 20 20 SER SER C . n 
C 1 22 SER 22 21 21 SER SER C . n 
C 1 23 ASP 23 22 22 ASP ASP C . n 
C 1 24 PHE 24 23 23 PHE PHE C . n 
C 1 25 ASP 25 24 24 ASP ASP C . n 
C 1 26 ALA 26 25 25 ALA ALA C . n 
C 1 27 CYS 27 26 26 CYS CYS C . n 
C 1 28 LEU 28 27 27 LEU LEU C . n 
C 1 29 ILE 29 28 28 ILE ILE C . n 
C 1 30 THR 30 29 29 THR THR C . n 
C 1 31 LYS 31 30 30 LYS LYS C . n 
C 1 32 ALA 32 31 31 ALA ALA C . n 
C 1 33 GLY 33 32 32 GLY GLY C . n 
C 1 34 LEU 34 33 33 LEU LEU C . n 
C 1 35 GLN 35 34 34 GLN GLN C . n 
C 1 36 VAL 36 35 35 VAL VAL C . n 
C 1 37 TYR 37 36 36 TYR TYR C . n 
C 1 38 ASN 38 37 37 ASN ASN C . n 
C 1 39 LYS 39 38 38 LYS LYS C . n 
C 1 40 CYS 40 39 39 CYS CYS C . n 
C 1 41 TRP 41 40 40 TRP TRP C . n 
C 1 42 LYS 42 41 41 LYS LYS C . n 
C 1 43 PHE 43 42 42 PHE PHE C . n 
C 1 44 GLU 44 43 43 GLU GLU C . n 
C 1 45 HIS 45 44 44 HIS HIS C . n 
C 1 46 CYS 46 45 45 CYS CYS C . n 
C 1 47 ASN 47 46 46 ASN ASN C . n 
C 1 48 PHE 48 47 47 PHE PHE C . n 
C 1 49 ASN 49 48 48 ASN ASN C . n 
C 1 50 ASP 50 49 49 ASP ASP C . n 
C 1 51 VAL 51 50 50 VAL VAL C . n 
C 1 52 THR 52 51 51 THR THR C . n 
C 1 53 THR 53 52 52 THR THR C . n 
C 1 54 ARG 54 53 53 ARG ARG C . n 
C 1 55 LEU 55 54 54 LEU LEU C . n 
C 1 56 ARG 56 55 55 ARG ARG C . n 
C 1 57 GLU 57 56 56 GLU GLU C . n 
C 1 58 ASN 58 57 57 ASN ASN C . n 
C 1 59 GLU 59 58 58 GLU GLU C . n 
C 1 60 LEU 60 59 59 LEU LEU C . n 
C 1 61 THR 61 60 60 THR THR C . n 
C 1 62 TYR 62 61 61 TYR TYR C . n 
C 1 63 TYR 63 62 62 TYR TYR C . n 
C 1 64 CYS 64 63 63 CYS CYS C . n 
C 1 65 CYS 65 64 64 CYS CYS C . n 
C 1 66 LYS 66 65 65 LYS LYS C . n 
C 1 67 LYS 67 66 66 LYS LYS C . n 
C 1 68 ASP 68 67 67 ASP ASP C . n 
C 1 69 LEU 69 68 68 LEU LEU C . n 
C 1 70 CYS 70 69 69 CYS CYS C . n 
C 1 71 ASN 71 70 70 ASN ASN C . n 
C 1 72 PHE 72 71 71 PHE PHE C . n 
C 1 73 ASN 73 72 72 ASN ASN C . n 
C 1 74 GLU 74 73 73 GLU GLU C . n 
C 1 75 GLN 75 74 74 GLN GLN C . n 
C 1 76 LEU 76 75 75 LEU LEU C . n 
C 1 77 GLU 77 76 76 GLU GLU C . n 
C 1 78 ASN 78 77 77 ASN ASN C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 HOH 1  2001 2001 HOH HOH A . 
D 2 HOH 2  2002 2002 HOH HOH A . 
D 2 HOH 3  2003 2003 HOH HOH A . 
D 2 HOH 4  2004 2004 HOH HOH A . 
D 2 HOH 5  2005 2005 HOH HOH A . 
D 2 HOH 6  2006 2006 HOH HOH A . 
D 2 HOH 7  2007 2007 HOH HOH A . 
D 2 HOH 8  2008 2008 HOH HOH A . 
D 2 HOH 9  2009 2009 HOH HOH A . 
D 2 HOH 10 2010 2010 HOH HOH A . 
D 2 HOH 11 2011 2011 HOH HOH A . 
D 2 HOH 12 2012 2012 HOH HOH A . 
D 2 HOH 13 2013 2013 HOH HOH A . 
D 2 HOH 14 2014 2014 HOH HOH A . 
D 2 HOH 15 2015 2015 HOH HOH A . 
D 2 HOH 16 2016 2016 HOH HOH A . 
D 2 HOH 17 2017 2017 HOH HOH A . 
D 2 HOH 18 2018 2018 HOH HOH A . 
D 2 HOH 19 2019 2019 HOH HOH A . 
D 2 HOH 20 2020 2020 HOH HOH A . 
D 2 HOH 21 2021 2021 HOH HOH A . 
D 2 HOH 22 2022 2022 HOH HOH A . 
D 2 HOH 23 2023 2023 HOH HOH A . 
D 2 HOH 24 2024 2024 HOH HOH A . 
D 2 HOH 25 2025 2025 HOH HOH A . 
D 2 HOH 26 2026 2026 HOH HOH A . 
D 2 HOH 27 2027 2027 HOH HOH A . 
D 2 HOH 28 2028 2028 HOH HOH A . 
D 2 HOH 29 2029 2029 HOH HOH A . 
D 2 HOH 30 2030 2030 HOH HOH A . 
D 2 HOH 31 2031 2031 HOH HOH A . 
D 2 HOH 32 2032 2032 HOH HOH A . 
D 2 HOH 33 2033 2033 HOH HOH A . 
D 2 HOH 34 2034 2034 HOH HOH A . 
D 2 HOH 35 2035 2035 HOH HOH A . 
D 2 HOH 36 2036 2036 HOH HOH A . 
D 2 HOH 37 2037 2037 HOH HOH A . 
D 2 HOH 38 2038 2038 HOH HOH A . 
D 2 HOH 39 2039 2039 HOH HOH A . 
D 2 HOH 40 2040 2040 HOH HOH A . 
D 2 HOH 41 2041 2041 HOH HOH A . 
D 2 HOH 42 2042 2042 HOH HOH A . 
D 2 HOH 43 2043 2043 HOH HOH A . 
D 2 HOH 44 2044 2044 HOH HOH A . 
D 2 HOH 45 2045 2045 HOH HOH A . 
D 2 HOH 46 2046 2046 HOH HOH A . 
D 2 HOH 47 2047 2047 HOH HOH A . 
D 2 HOH 48 2048 2048 HOH HOH A . 
D 2 HOH 49 2049 2049 HOH HOH A . 
D 2 HOH 50 2050 2050 HOH HOH A . 
D 2 HOH 51 2051 2051 HOH HOH A . 
D 2 HOH 52 2052 2052 HOH HOH A . 
D 2 HOH 53 2053 2053 HOH HOH A . 
D 2 HOH 54 2054 2054 HOH HOH A . 
D 2 HOH 55 2055 2055 HOH HOH A . 
D 2 HOH 56 2056 2056 HOH HOH A . 
D 2 HOH 57 2057 2057 HOH HOH A . 
D 2 HOH 58 2058 2058 HOH HOH A . 
D 2 HOH 59 2059 2059 HOH HOH A . 
D 2 HOH 60 2060 2060 HOH HOH A . 
D 2 HOH 61 2061 2061 HOH HOH A . 
D 2 HOH 62 2062 2062 HOH HOH A . 
D 2 HOH 63 2063 2063 HOH HOH A . 
D 2 HOH 64 2064 2064 HOH HOH A . 
D 2 HOH 65 2065 2065 HOH HOH A . 
D 2 HOH 66 2066 2066 HOH HOH A . 
D 2 HOH 67 2067 2067 HOH HOH A . 
D 2 HOH 68 2068 2068 HOH HOH A . 
D 2 HOH 69 2069 2069 HOH HOH A . 
D 2 HOH 70 2070 2070 HOH HOH A . 
E 2 HOH 1  2001 2001 HOH HOH B . 
E 2 HOH 2  2002 2002 HOH HOH B . 
E 2 HOH 3  2003 2003 HOH HOH B . 
E 2 HOH 4  2004 2004 HOH HOH B . 
E 2 HOH 5  2005 2005 HOH HOH B . 
E 2 HOH 6  2006 2006 HOH HOH B . 
E 2 HOH 7  2007 2007 HOH HOH B . 
E 2 HOH 8  2008 2008 HOH HOH B . 
E 2 HOH 9  2009 2009 HOH HOH B . 
E 2 HOH 10 2010 2010 HOH HOH B . 
E 2 HOH 11 2011 2011 HOH HOH B . 
E 2 HOH 12 2012 2012 HOH HOH B . 
E 2 HOH 13 2013 2013 HOH HOH B . 
E 2 HOH 14 2014 2014 HOH HOH B . 
E 2 HOH 15 2015 2015 HOH HOH B . 
E 2 HOH 16 2016 2016 HOH HOH B . 
E 2 HOH 17 2017 2017 HOH HOH B . 
E 2 HOH 18 2018 2018 HOH HOH B . 
E 2 HOH 19 2019 2019 HOH HOH B . 
E 2 HOH 20 2020 2020 HOH HOH B . 
E 2 HOH 21 2021 2021 HOH HOH B . 
E 2 HOH 22 2022 2022 HOH HOH B . 
E 2 HOH 23 2023 2023 HOH HOH B . 
E 2 HOH 24 2024 2024 HOH HOH B . 
E 2 HOH 25 2025 2025 HOH HOH B . 
E 2 HOH 26 2026 2026 HOH HOH B . 
E 2 HOH 27 2027 2027 HOH HOH B . 
E 2 HOH 28 2028 2028 HOH HOH B . 
E 2 HOH 29 2029 2029 HOH HOH B . 
E 2 HOH 30 2030 2030 HOH HOH B . 
E 2 HOH 31 2031 2031 HOH HOH B . 
E 2 HOH 32 2032 2032 HOH HOH B . 
E 2 HOH 33 2033 2033 HOH HOH B . 
E 2 HOH 34 2034 2034 HOH HOH B . 
E 2 HOH 35 2035 2035 HOH HOH B . 
E 2 HOH 36 2036 2036 HOH HOH B . 
E 2 HOH 37 2037 2037 HOH HOH B . 
E 2 HOH 38 2038 2038 HOH HOH B . 
E 2 HOH 39 2039 2039 HOH HOH B . 
E 2 HOH 40 2040 2040 HOH HOH B . 
E 2 HOH 41 2041 2041 HOH HOH B . 
E 2 HOH 42 2042 2042 HOH HOH B . 
E 2 HOH 43 2043 2043 HOH HOH B . 
E 2 HOH 44 2044 2044 HOH HOH B . 
E 2 HOH 45 2045 2045 HOH HOH B . 
E 2 HOH 46 2046 2046 HOH HOH B . 
E 2 HOH 47 2047 2047 HOH HOH B . 
E 2 HOH 48 2048 2048 HOH HOH B . 
E 2 HOH 49 2049 2049 HOH HOH B . 
E 2 HOH 50 2050 2050 HOH HOH B . 
E 2 HOH 51 2051 2051 HOH HOH B . 
E 2 HOH 52 2052 2052 HOH HOH B . 
E 2 HOH 53 2053 2053 HOH HOH B . 
E 2 HOH 54 2054 2054 HOH HOH B . 
E 2 HOH 55 2055 2055 HOH HOH B . 
E 2 HOH 56 2056 2056 HOH HOH B . 
E 2 HOH 57 2057 2057 HOH HOH B . 
E 2 HOH 58 2058 2058 HOH HOH B . 
E 2 HOH 59 2059 2059 HOH HOH B . 
E 2 HOH 60 2060 2060 HOH HOH B . 
E 2 HOH 61 2061 2061 HOH HOH B . 
E 2 HOH 62 2062 2062 HOH HOH B . 
E 2 HOH 63 2063 2063 HOH HOH B . 
E 2 HOH 64 2064 2064 HOH HOH B . 
E 2 HOH 65 2065 2065 HOH HOH B . 
E 2 HOH 66 2066 2066 HOH HOH B . 
E 2 HOH 67 2067 2067 HOH HOH B . 
E 2 HOH 68 2068 2068 HOH HOH B . 
E 2 HOH 69 2069 2069 HOH HOH B . 
E 2 HOH 70 2070 2070 HOH HOH B . 
E 2 HOH 71 2071 2071 HOH HOH B . 
E 2 HOH 72 2072 2072 HOH HOH B . 
E 2 HOH 73 2073 2073 HOH HOH B . 
E 2 HOH 74 2074 2074 HOH HOH B . 
F 2 HOH 1  2001 2001 HOH HOH C . 
F 2 HOH 2  2002 2002 HOH HOH C . 
F 2 HOH 3  2003 2003 HOH HOH C . 
F 2 HOH 4  2004 2004 HOH HOH C . 
F 2 HOH 5  2005 2005 HOH HOH C . 
F 2 HOH 6  2006 2006 HOH HOH C . 
F 2 HOH 7  2007 2007 HOH HOH C . 
F 2 HOH 8  2008 2008 HOH HOH C . 
F 2 HOH 9  2009 2009 HOH HOH C . 
F 2 HOH 10 2010 2010 HOH HOH C . 
F 2 HOH 11 2011 2011 HOH HOH C . 
F 2 HOH 12 2012 2012 HOH HOH C . 
F 2 HOH 13 2013 2013 HOH HOH C . 
F 2 HOH 14 2014 2014 HOH HOH C . 
F 2 HOH 15 2015 2015 HOH HOH C . 
F 2 HOH 16 2016 2016 HOH HOH C . 
F 2 HOH 17 2017 2017 HOH HOH C . 
F 2 HOH 18 2018 2018 HOH HOH C . 
F 2 HOH 19 2019 2019 HOH HOH C . 
F 2 HOH 20 2020 2020 HOH HOH C . 
F 2 HOH 21 2021 2021 HOH HOH C . 
F 2 HOH 22 2022 2022 HOH HOH C . 
F 2 HOH 23 2023 2023 HOH HOH C . 
F 2 HOH 24 2024 2024 HOH HOH C . 
F 2 HOH 25 2025 2025 HOH HOH C . 
F 2 HOH 26 2026 2026 HOH HOH C . 
F 2 HOH 27 2027 2027 HOH HOH C . 
F 2 HOH 28 2028 2028 HOH HOH C . 
F 2 HOH 29 2029 2029 HOH HOH C . 
F 2 HOH 30 2030 2030 HOH HOH C . 
F 2 HOH 31 2031 2031 HOH HOH C . 
F 2 HOH 32 2032 2032 HOH HOH C . 
F 2 HOH 33 2033 2033 HOH HOH C . 
F 2 HOH 34 2034 2034 HOH HOH C . 
F 2 HOH 35 2035 2035 HOH HOH C . 
F 2 HOH 36 2036 2036 HOH HOH C . 
F 2 HOH 37 2037 2037 HOH HOH C . 
F 2 HOH 38 2038 2038 HOH HOH C . 
F 2 HOH 39 2039 2039 HOH HOH C . 
F 2 HOH 40 2040 2040 HOH HOH C . 
F 2 HOH 41 2041 2041 HOH HOH C . 
F 2 HOH 42 2042 2042 HOH HOH C . 
F 2 HOH 43 2043 2043 HOH HOH C . 
F 2 HOH 44 2044 2044 HOH HOH C . 
F 2 HOH 45 2045 2045 HOH HOH C . 
F 2 HOH 46 2046 2046 HOH HOH C . 
F 2 HOH 47 2047 2047 HOH HOH C . 
F 2 HOH 48 2048 2048 HOH HOH C . 
F 2 HOH 49 2049 2049 HOH HOH C . 
F 2 HOH 50 2050 2050 HOH HOH C . 
F 2 HOH 51 2051 2051 HOH HOH C . 
F 2 HOH 52 2052 2052 HOH HOH C . 
F 2 HOH 53 2053 2053 HOH HOH C . 
F 2 HOH 54 2054 2054 HOH HOH C . 
F 2 HOH 55 2055 2055 HOH HOH C . 
F 2 HOH 56 2056 2056 HOH HOH C . 
F 2 HOH 57 2057 2057 HOH HOH C . 
F 2 HOH 58 2058 2058 HOH HOH C . 
F 2 HOH 59 2059 2059 HOH HOH C . 
F 2 HOH 60 2060 2060 HOH HOH C . 
F 2 HOH 61 2061 2061 HOH HOH C . 
F 2 HOH 62 2062 2062 HOH HOH C . 
F 2 HOH 63 2063 2063 HOH HOH C . 
F 2 HOH 64 2064 2064 HOH HOH C . 
F 2 HOH 65 2065 2065 HOH HOH C . 
F 2 HOH 66 2066 2066 HOH HOH C . 
F 2 HOH 67 2067 2067 HOH HOH C . 
F 2 HOH 68 2068 2068 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
3 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D 
2 1 B,E 
3 1 C,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-08-07 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT    refinement       5.11.2.0 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   MET 
_pdbx_validate_close_contact.auth_seq_id_1    0 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2001 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.11 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 57 ? ? -102.96 -74.92 
2 1 ASN A 70 ? ? -88.33  49.02  
3 1 ASN B 57 ? ? -98.07  -78.94 
4 1 ASN C 57 ? ? -95.13  -81.30 
5 1 ASN C 70 ? ? -88.74  49.71  
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#