data_2W2M
# 
_entry.id   2W2M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W2M         
PDBE  EBI-37849    
WWPDB D_1290037849 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1F5Y unspecified 'NMR STRUCTURE OF A CONCATEMER OF THE FIRST AND SECOND LIGAND-BINDING MODULES OF THE HUMAN LDL RECEPTOR' 
PDB 1HJ7 unspecified 'NMR STUDY OF A PAIR OF LDL RECEPTOR CA ==2+== BINDING EPIDERMAL GROWTH FACTOR-LIKE DOMAINS, 20 STRUCTURES' 
PDB 1N7D unspecified 'EXTRACELLULAR DOMAIN OF THE LDL RECEPTOR' 
PDB 2FCW unspecified 
'STRUCTURE OF A COMPLEX BETWEEN THE PAIR OF THE LDL RECEPTORLIGAND-BINDING MODULES 3-4 AND THE RECEPTOR ASSOCIATEDPROTEIN (RAP).' 
PDB 1I0U unspecified 
'SOLUTION STRUCTURE AND BACKBONE DYNAMICS OF A CONCATEMER OFEGF-HOMOLOGY MODULES OF THE HUMAN LOW DENSITY LIPOPROTEINRECEPTOR'    
PDB 1D2J unspecified 'LDL RECEPTOR LIGAND-BINDING MODULE 6' 
PDB 1LRX unspecified 'THEORETIC MODEL OF THE HUMAN LOW-DENSITY LIPOPROTEINRECEPTOR YWTD BETA-PROPELLER DOMAIN' 
PDB 1HZ8 unspecified 
'SOLUTION STRUCTURE AND BACKBONE DYNAMICS OF A CONCATEMER OFEGF-HOMOLOGY MODULES OF THE HUMAN LOW DENSITY LIPOPROTEINRECEPTOR'    
PDB 1XFE unspecified 'SOLUTION STRUCTURE OF THE LA7-EGFA PAIR FROM THE LDLRECEPTOR' 
PDB 1F8Z unspecified 'NMR STRUCTURE OF THE SIXTH LIGAND-BINDING MODULE OF THE LDLRECEPTOR' 
PDB 1AJJ unspecified 'LDL RECEPTOR LIGAND-BINDING MODULE 5, CALCIUM-COORDINATING' 
PDB 1LDL unspecified . 
PDB 1LDR unspecified 'SECOND REPEAT OF THE LDL RECEPTOR LIGAND- BINDING DOMAIN' 
PDB 1IJQ unspecified 'CRYSTAL STRUCTURE OF THE LDL RECEPTOR YWTD- EGF DOMAIN PAIR' 
PDB 2W2N unspecified 'WT PCSK9-DELTAC BOUND TO EGF-A H306Y MUTANT OF LDLR' 
PDB 2W2P unspecified 'PCSK9-DELTAC D374A MUTANT BOUND TO WT EGF -A OF LDLR' 
PDB 2W2O unspecified 'PCSK9-DELTAC D374Y MUTANT BOUND TO WT EGF -A OF LDLR' 
PDB 2W2Q unspecified 'PCSK9-DELTAC D374H MUTANT BOUND TO WT EGF -A OF LDLR' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W2M 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bottomley, M.J.'  1  
'Cirillo, A.'      2  
'Orsatti, L.'      3  
'Ruggeri, L.'      4  
'Fisher, T.S.'     5  
'Santoro, J.C.'    6  
'Cummings, R.T.'   7  
'Cubbon, R.M.'     8  
'Lo Surdo, P.'     9  
'Calzetta, A.'     10 
'Noto, A.'         11 
'Baysarowich, J.'  12 
'Mattu, M.'        13 
'Talamo, F.'       14 
'De Francesco, R.' 15 
'Sparrow, C.P.'    16 
'Sitlani, A.'      17 
'Carfi, A.'        18 
# 
_citation.id                        primary 
_citation.title                     
'Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                1313 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19001363 
_citation.pdbx_database_id_DOI      10.1074/JBC.M808363200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bottomley, M.J.'  1  
primary 'Cirillo, A.'      2  
primary 'Orsatti, L.'      3  
primary 'Ruggeri, L.'      4  
primary 'Fisher, T.S.'     5  
primary 'Santoro, J.C.'    6  
primary 'Cummings, R.T.'   7  
primary 'Cubbon, R.M.'     8  
primary 'Lo Surdo, P.'     9  
primary 'Calzetta, A.'     10 
primary 'Noto, A.'         11 
primary 'Baysarowich, J.'  12 
primary 'Mattu, M.'        13 
primary 'Talamo, F.'       14 
primary 'De Francesco, R.' 15 
primary 'Sparrow, C.P.'    16 
primary 'Sitlani, A.'      17 
primary 'Carfi, A.'        18 
# 
_cell.entry_id           2W2M 
_cell.length_a           83.004 
_cell.length_b           83.004 
_cell.length_c           211.566 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W2M 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9' 33108.227 1   3.4.21.- ? 'CATALYTIC DOMAIN, RESIDUES 153-451' ? 
2 polymer     man 'LOW-DENSITY LIPOPROTEIN RECEPTOR'              12095.453 1   ?        ? 'EGF-A DOMAIN, RESIDUES 314-393'     ? 
3 polymer     man 'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9' 12679.604 1   3.4.21.- ? 'PROPEPTIDE, RESIDUES 53-152'        ? 
4 non-polymer syn 'CALCIUM ION'                                   40.078    3   ?        ? ?                                    ? 
5 water       nat water                                           18.015    215 ?        ? ?                                    ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PROPROTEIN CONVERTASE PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1, PCSK9' 
2 'LDL RECEPTOR'                                                                                                          
3 'PROPROTEIN CONVERTASE PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1, PCSK9' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
;
;SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
;
A ? 
2 'polypeptide(L)' no no 
;MKHHHHHHPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQ
LCVNLEGGYKCQCEEGFQLDPHTKACK
;
;MKHHHHHHPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQ
LCVNLEGGYKCQCEEGFQLDPHTKACK
;
E ? 
3 'polypeptide(L)' no no 
;MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
;
;MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
;
P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ILE n 
1 3   PRO n 
1 4   TRP n 
1 5   ASN n 
1 6   LEU n 
1 7   GLU n 
1 8   ARG n 
1 9   ILE n 
1 10  THR n 
1 11  PRO n 
1 12  PRO n 
1 13  ARG n 
1 14  TYR n 
1 15  ARG n 
1 16  ALA n 
1 17  ASP n 
1 18  GLU n 
1 19  TYR n 
1 20  GLN n 
1 21  PRO n 
1 22  PRO n 
1 23  ASP n 
1 24  GLY n 
1 25  GLY n 
1 26  SER n 
1 27  LEU n 
1 28  VAL n 
1 29  GLU n 
1 30  VAL n 
1 31  TYR n 
1 32  LEU n 
1 33  LEU n 
1 34  ASP n 
1 35  THR n 
1 36  SER n 
1 37  ILE n 
1 38  GLN n 
1 39  SER n 
1 40  ASP n 
1 41  HIS n 
1 42  ARG n 
1 43  GLU n 
1 44  ILE n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  VAL n 
1 49  MET n 
1 50  VAL n 
1 51  THR n 
1 52  ASP n 
1 53  PHE n 
1 54  GLU n 
1 55  ASN n 
1 56  VAL n 
1 57  PRO n 
1 58  GLU n 
1 59  GLU n 
1 60  ASP n 
1 61  GLY n 
1 62  THR n 
1 63  ARG n 
1 64  PHE n 
1 65  HIS n 
1 66  ARG n 
1 67  GLN n 
1 68  ALA n 
1 69  SER n 
1 70  LYS n 
1 71  CYS n 
1 72  ASP n 
1 73  SER n 
1 74  HIS n 
1 75  GLY n 
1 76  THR n 
1 77  HIS n 
1 78  LEU n 
1 79  ALA n 
1 80  GLY n 
1 81  VAL n 
1 82  VAL n 
1 83  SER n 
1 84  GLY n 
1 85  ARG n 
1 86  ASP n 
1 87  ALA n 
1 88  GLY n 
1 89  VAL n 
1 90  ALA n 
1 91  LYS n 
1 92  GLY n 
1 93  ALA n 
1 94  SER n 
1 95  MET n 
1 96  ARG n 
1 97  SER n 
1 98  LEU n 
1 99  ARG n 
1 100 VAL n 
1 101 LEU n 
1 102 ASN n 
1 103 CYS n 
1 104 GLN n 
1 105 GLY n 
1 106 LYS n 
1 107 GLY n 
1 108 THR n 
1 109 VAL n 
1 110 SER n 
1 111 GLY n 
1 112 THR n 
1 113 LEU n 
1 114 ILE n 
1 115 GLY n 
1 116 LEU n 
1 117 GLU n 
1 118 PHE n 
1 119 ILE n 
1 120 ARG n 
1 121 LYS n 
1 122 SER n 
1 123 GLN n 
1 124 LEU n 
1 125 VAL n 
1 126 GLN n 
1 127 PRO n 
1 128 VAL n 
1 129 GLY n 
1 130 PRO n 
1 131 LEU n 
1 132 VAL n 
1 133 VAL n 
1 134 LEU n 
1 135 LEU n 
1 136 PRO n 
1 137 LEU n 
1 138 ALA n 
1 139 GLY n 
1 140 GLY n 
1 141 TYR n 
1 142 SER n 
1 143 ARG n 
1 144 VAL n 
1 145 LEU n 
1 146 ASN n 
1 147 ALA n 
1 148 ALA n 
1 149 CYS n 
1 150 GLN n 
1 151 ARG n 
1 152 LEU n 
1 153 ALA n 
1 154 ARG n 
1 155 ALA n 
1 156 GLY n 
1 157 VAL n 
1 158 VAL n 
1 159 LEU n 
1 160 VAL n 
1 161 THR n 
1 162 ALA n 
1 163 ALA n 
1 164 GLY n 
1 165 ASN n 
1 166 PHE n 
1 167 ARG n 
1 168 ASP n 
1 169 ASP n 
1 170 ALA n 
1 171 CYS n 
1 172 LEU n 
1 173 TYR n 
1 174 SER n 
1 175 PRO n 
1 176 ALA n 
1 177 SER n 
1 178 ALA n 
1 179 PRO n 
1 180 GLU n 
1 181 VAL n 
1 182 ILE n 
1 183 THR n 
1 184 VAL n 
1 185 GLY n 
1 186 ALA n 
1 187 THR n 
1 188 ASN n 
1 189 ALA n 
1 190 GLN n 
1 191 ASP n 
1 192 GLN n 
1 193 PRO n 
1 194 VAL n 
1 195 THR n 
1 196 LEU n 
1 197 GLY n 
1 198 THR n 
1 199 LEU n 
1 200 GLY n 
1 201 THR n 
1 202 ASN n 
1 203 PHE n 
1 204 GLY n 
1 205 ARG n 
1 206 CYS n 
1 207 VAL n 
1 208 ASP n 
1 209 LEU n 
1 210 PHE n 
1 211 ALA n 
1 212 PRO n 
1 213 GLY n 
1 214 GLU n 
1 215 ASP n 
1 216 ILE n 
1 217 ILE n 
1 218 GLY n 
1 219 ALA n 
1 220 SER n 
1 221 SER n 
1 222 ASP n 
1 223 CYS n 
1 224 SER n 
1 225 THR n 
1 226 CYS n 
1 227 PHE n 
1 228 VAL n 
1 229 SER n 
1 230 GLN n 
1 231 SER n 
1 232 GLY n 
1 233 THR n 
1 234 SER n 
1 235 GLN n 
1 236 ALA n 
1 237 ALA n 
1 238 ALA n 
1 239 HIS n 
1 240 VAL n 
1 241 ALA n 
1 242 GLY n 
1 243 ILE n 
1 244 ALA n 
1 245 ALA n 
1 246 MET n 
1 247 MET n 
1 248 LEU n 
1 249 SER n 
1 250 ALA n 
1 251 GLU n 
1 252 PRO n 
1 253 GLU n 
1 254 LEU n 
1 255 THR n 
1 256 LEU n 
1 257 ALA n 
1 258 GLU n 
1 259 LEU n 
1 260 ARG n 
1 261 GLN n 
1 262 ARG n 
1 263 LEU n 
1 264 ILE n 
1 265 HIS n 
1 266 PHE n 
1 267 SER n 
1 268 ALA n 
1 269 LYS n 
1 270 ASP n 
1 271 VAL n 
1 272 ILE n 
1 273 ASN n 
1 274 GLU n 
1 275 ALA n 
1 276 TRP n 
1 277 PHE n 
1 278 PRO n 
1 279 GLU n 
1 280 ASP n 
1 281 GLN n 
1 282 ARG n 
1 283 VAL n 
1 284 LEU n 
1 285 THR n 
1 286 PRO n 
1 287 ASN n 
1 288 LEU n 
1 289 VAL n 
1 290 ALA n 
1 291 ALA n 
1 292 LEU n 
1 293 PRO n 
1 294 PRO n 
1 295 SER n 
1 296 THR n 
1 297 HIS n 
1 298 GLY n 
1 299 ALA n 
1 300 ALA n 
1 301 GLY n 
1 302 THR n 
1 303 ALA n 
1 304 ALA n 
1 305 ALA n 
1 306 SER n 
1 307 HIS n 
1 308 HIS n 
1 309 HIS n 
1 310 HIS n 
1 311 HIS n 
1 312 HIS n 
2 1   MET n 
2 2   LYS n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   PRO n 
2 10  MET n 
2 11  SER n 
2 12  ASP n 
2 13  TYR n 
2 14  ASP n 
2 15  ILE n 
2 16  PRO n 
2 17  THR n 
2 18  THR n 
2 19  GLU n 
2 20  ASN n 
2 21  LEU n 
2 22  TYR n 
2 23  PHE n 
2 24  GLN n 
2 25  GLY n 
2 26  ALA n 
2 27  MET n 
2 28  GLY n 
2 29  THR n 
2 30  ASN n 
2 31  GLU n 
2 32  CYS n 
2 33  LEU n 
2 34  ASP n 
2 35  ASN n 
2 36  ASN n 
2 37  GLY n 
2 38  GLY n 
2 39  CYS n 
2 40  SER n 
2 41  HIS n 
2 42  VAL n 
2 43  CYS n 
2 44  ASN n 
2 45  ASP n 
2 46  LEU n 
2 47  LYS n 
2 48  ILE n 
2 49  GLY n 
2 50  TYR n 
2 51  GLU n 
2 52  CYS n 
2 53  LEU n 
2 54  CYS n 
2 55  PRO n 
2 56  ASP n 
2 57  GLY n 
2 58  PHE n 
2 59  GLN n 
2 60  LEU n 
2 61  VAL n 
2 62  ALA n 
2 63  GLN n 
2 64  ARG n 
2 65  ARG n 
2 66  CYS n 
2 67  GLU n 
2 68  ASP n 
2 69  ILE n 
2 70  ASP n 
2 71  GLU n 
2 72  CYS n 
2 73  GLN n 
2 74  ASP n 
2 75  PRO n 
2 76  ASP n 
2 77  THR n 
2 78  CYS n 
2 79  SER n 
2 80  GLN n 
2 81  LEU n 
2 82  CYS n 
2 83  VAL n 
2 84  ASN n 
2 85  LEU n 
2 86  GLU n 
2 87  GLY n 
2 88  GLY n 
2 89  TYR n 
2 90  LYS n 
2 91  CYS n 
2 92  GLN n 
2 93  CYS n 
2 94  GLU n 
2 95  GLU n 
2 96  GLY n 
2 97  PHE n 
2 98  GLN n 
2 99  LEU n 
2 100 ASP n 
2 101 PRO n 
2 102 HIS n 
2 103 THR n 
2 104 LYS n 
2 105 ALA n 
2 106 CYS n 
2 107 LYS n 
3 1   MET n 
3 2   LYS n 
3 3   GLY n 
3 4   SER n 
3 5   LYS n 
3 6   GLY n 
3 7   SER n 
3 8   LYS n 
3 9   GLY n 
3 10  SER n 
3 11  LYS n 
3 12  PRO n 
3 13  MET n 
3 14  SER n 
3 15  ALA n 
3 16  GLU n 
3 17  ALA n 
3 18  PRO n 
3 19  GLU n 
3 20  HIS n 
3 21  GLY n 
3 22  THR n 
3 23  THR n 
3 24  ALA n 
3 25  THR n 
3 26  PHE n 
3 27  HIS n 
3 28  ARG n 
3 29  CYS n 
3 30  ALA n 
3 31  LYS n 
3 32  ASP n 
3 33  PRO n 
3 34  TRP n 
3 35  ARG n 
3 36  LEU n 
3 37  PRO n 
3 38  GLY n 
3 39  THR n 
3 40  TYR n 
3 41  VAL n 
3 42  VAL n 
3 43  VAL n 
3 44  LEU n 
3 45  LYS n 
3 46  GLU n 
3 47  GLU n 
3 48  THR n 
3 49  HIS n 
3 50  LEU n 
3 51  SER n 
3 52  GLN n 
3 53  SER n 
3 54  GLU n 
3 55  ARG n 
3 56  THR n 
3 57  ALA n 
3 58  ARG n 
3 59  ARG n 
3 60  LEU n 
3 61  GLN n 
3 62  ALA n 
3 63  GLN n 
3 64  ALA n 
3 65  ALA n 
3 66  ARG n 
3 67  ARG n 
3 68  GLY n 
3 69  TYR n 
3 70  LEU n 
3 71  THR n 
3 72  LYS n 
3 73  ILE n 
3 74  LEU n 
3 75  HIS n 
3 76  VAL n 
3 77  PHE n 
3 78  HIS n 
3 79  GLY n 
3 80  LEU n 
3 81  LEU n 
3 82  PRO n 
3 83  GLY n 
3 84  PHE n 
3 85  LEU n 
3 86  VAL n 
3 87  LYS n 
3 88  MET n 
3 89  SER n 
3 90  GLY n 
3 91  ASP n 
3 92  LEU n 
3 93  LEU n 
3 94  GLU n 
3 95  LEU n 
3 96  ALA n 
3 97  LEU n 
3 98  LYS n 
3 99  LEU n 
3 100 PRO n 
3 101 HIS n 
3 102 VAL n 
3 103 ASP n 
3 104 TYR n 
3 105 ILE n 
3 106 GLU n 
3 107 GLU n 
3 108 ASP n 
3 109 SER n 
3 110 SER n 
3 111 VAL n 
3 112 PHE n 
3 113 ALA n 
3 114 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-10 ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-11 ? ? 
3 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? ? ? ? ? PETM-10 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PCSK9_HUMAN 1 ? ? Q8NBP7 ? 
2 UNP LDLR_HUMAN  2 ? ? P01130 ? 
3 UNP PCSK9_HUMAN 3 ? ? Q8NBP7 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W2M A 1  ? 299 ? Q8NBP7 153 ? 451 ? 153 451 
2 2 2W2M E 28 ? 107 ? P01130 314 ? 393 ? 293 372 
3 3 2W2M P 15 ? 114 ? Q8NBP7 53  ? 152 ? 53  152 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2W2M ALA A 300 ? UNP Q8NBP7 ? ? 'expression tag' 452 1  
1 2W2M GLY A 301 ? UNP Q8NBP7 ? ? 'expression tag' 453 2  
1 2W2M THR A 302 ? UNP Q8NBP7 ? ? 'expression tag' 454 3  
1 2W2M ALA A 303 ? UNP Q8NBP7 ? ? 'expression tag' 455 4  
1 2W2M ALA A 304 ? UNP Q8NBP7 ? ? 'expression tag' 456 5  
1 2W2M ALA A 305 ? UNP Q8NBP7 ? ? 'expression tag' 457 6  
1 2W2M SER A 306 ? UNP Q8NBP7 ? ? 'expression tag' 458 7  
1 2W2M HIS A 307 ? UNP Q8NBP7 ? ? 'expression tag' 459 8  
1 2W2M HIS A 308 ? UNP Q8NBP7 ? ? 'expression tag' 460 9  
1 2W2M HIS A 309 ? UNP Q8NBP7 ? ? 'expression tag' 461 10 
1 2W2M HIS A 310 ? UNP Q8NBP7 ? ? 'expression tag' 462 11 
1 2W2M HIS A 311 ? UNP Q8NBP7 ? ? 'expression tag' 463 12 
1 2W2M HIS A 312 ? UNP Q8NBP7 ? ? 'expression tag' 464 13 
2 2W2M MET E 1   ? UNP P01130 ? ? 'expression tag' 266 14 
2 2W2M LYS E 2   ? UNP P01130 ? ? 'expression tag' 267 15 
2 2W2M HIS E 3   ? UNP P01130 ? ? 'expression tag' 268 16 
2 2W2M HIS E 4   ? UNP P01130 ? ? 'expression tag' 269 17 
2 2W2M HIS E 5   ? UNP P01130 ? ? 'expression tag' 270 18 
2 2W2M HIS E 6   ? UNP P01130 ? ? 'expression tag' 271 19 
2 2W2M HIS E 7   ? UNP P01130 ? ? 'expression tag' 272 20 
2 2W2M HIS E 8   ? UNP P01130 ? ? 'expression tag' 273 21 
2 2W2M PRO E 9   ? UNP P01130 ? ? 'expression tag' 274 22 
2 2W2M MET E 10  ? UNP P01130 ? ? 'expression tag' 275 23 
2 2W2M SER E 11  ? UNP P01130 ? ? 'expression tag' 276 24 
2 2W2M ASP E 12  ? UNP P01130 ? ? 'expression tag' 277 25 
2 2W2M TYR E 13  ? UNP P01130 ? ? 'expression tag' 278 26 
2 2W2M ASP E 14  ? UNP P01130 ? ? 'expression tag' 279 27 
2 2W2M ILE E 15  ? UNP P01130 ? ? 'expression tag' 280 28 
2 2W2M PRO E 16  ? UNP P01130 ? ? 'expression tag' 281 29 
2 2W2M THR E 17  ? UNP P01130 ? ? 'expression tag' 282 30 
2 2W2M THR E 18  ? UNP P01130 ? ? 'expression tag' 283 31 
2 2W2M GLU E 19  ? UNP P01130 ? ? 'expression tag' 284 32 
2 2W2M ASN E 20  ? UNP P01130 ? ? 'expression tag' 285 33 
2 2W2M LEU E 21  ? UNP P01130 ? ? 'expression tag' 286 34 
2 2W2M TYR E 22  ? UNP P01130 ? ? 'expression tag' 287 35 
2 2W2M PHE E 23  ? UNP P01130 ? ? 'expression tag' 288 36 
2 2W2M GLN E 24  ? UNP P01130 ? ? 'expression tag' 289 37 
2 2W2M GLY E 25  ? UNP P01130 ? ? 'expression tag' 290 38 
2 2W2M ALA E 26  ? UNP P01130 ? ? 'expression tag' 291 39 
2 2W2M MET E 27  ? UNP P01130 ? ? 'expression tag' 292 40 
3 2W2M MET P 1   ? UNP Q8NBP7 ? ? 'expression tag' 39  41 
3 2W2M LYS P 2   ? UNP Q8NBP7 ? ? 'expression tag' 40  42 
3 2W2M GLY P 3   ? UNP Q8NBP7 ? ? 'expression tag' 41  43 
3 2W2M SER P 4   ? UNP Q8NBP7 ? ? 'expression tag' 42  44 
3 2W2M LYS P 5   ? UNP Q8NBP7 ? ? 'expression tag' 43  45 
3 2W2M GLY P 6   ? UNP Q8NBP7 ? ? 'expression tag' 44  46 
3 2W2M SER P 7   ? UNP Q8NBP7 ? ? 'expression tag' 45  47 
3 2W2M LYS P 8   ? UNP Q8NBP7 ? ? 'expression tag' 46  48 
3 2W2M GLY P 9   ? UNP Q8NBP7 ? ? 'expression tag' 47  49 
3 2W2M SER P 10  ? UNP Q8NBP7 ? ? 'expression tag' 48  50 
3 2W2M LYS P 11  ? UNP Q8NBP7 ? ? 'expression tag' 49  51 
3 2W2M PRO P 12  ? UNP Q8NBP7 ? ? 'expression tag' 50  52 
3 2W2M MET P 13  ? UNP Q8NBP7 ? ? 'expression tag' 51  53 
3 2W2M SER P 14  ? UNP Q8NBP7 ? ? 'expression tag' 52  54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W2M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.1 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M HEPES PH 7.5, 10% (V/V) 2-PROPANOL, 20% (W/V) PEG 4000' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2008-01-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             0.976 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W2M 
_reflns.observed_criterion_sigma_I   3.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             45.00 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   29902 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.13 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.40 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.53 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.68 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.10 
_reflns_shell.pdbx_redundancy        5.9 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W2M 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     28296 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    99.87 
_refine.ls_R_factor_obs                          0.21719 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21524 
_refine.ls_R_factor_R_free                       0.25421 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1512 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.926 
_refine.correlation_coeff_Fo_to_Fc_free          0.896 
_refine.B_iso_mean                               26.756 
_refine.aniso_B[1][1]                            1.07 
_refine.aniso_B[2][2]                            1.07 
_refine.aniso_B[3][3]                            -2.15 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2QTW' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.254 
_refine.pdbx_overall_ESU_R_Free                  0.216 
_refine.overall_SU_ML                            0.152 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             12.177 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3145 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             215 
_refine_hist.number_atoms_total               3363 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        45.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.022  ? 3266 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.228  1.968  ? 4448 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.307  5.000  ? 430  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.082 23.901 ? 141  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.846 15.000 ? 535  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.463 15.000 ? 25   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.079  0.200  ? 514  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 2479 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.187  0.200  ? 1380 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.293  0.200  ? 2171 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.133  0.200  ? 172  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.260  0.200  ? 25   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.211  0.200  ? 16   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.449  1.500  ? 2156 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.807  2.000  ? 3374 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.975  3.000  ? 1228 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.647  4.500  ? 1066 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.462 
_refine_ls_shell.number_reflns_R_work             2035 
_refine_ls_shell.R_factor_R_work                  0.280 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.329 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             116 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2W2M 
_struct.title                     'WT PCSK9-DELTAC BOUND TO WT EGF-A OF LDLR' 
_struct.pdbx_descriptor           'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9 (E.C.3.4.21.-), LOW-DENSITY LIPOPROTEIN RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W2M 
_struct_keywords.pdbx_keywords   HYDROLASE/RECEPTOR 
_struct_keywords.text            
;HYDROLASE-RECEPTOR COMPLEX, CARDIOVASCULAR DISEASE, FAMILIAL HYPERCHOLESTEROLEMIA, LIPID METABOLISM, SERINE PROTEASE, LIPID TRANSPORT, STEROID METABOLISM
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 3   ? THR A 10  ? PRO A 155 THR A 162 1 ? 8  
HELX_P HELX_P2  2  ASP A 72  ? GLY A 84  ? ASP A 224 GLY A 236 1 ? 13 
HELX_P HELX_P3  3  VAL A 109 ? GLN A 126 ? VAL A 261 GLN A 278 1 ? 18 
HELX_P HELX_P4  4  SER A 142 ? ALA A 155 ? SER A 294 ALA A 307 1 ? 14 
HELX_P HELX_P5  5  GLY A 232 ? GLU A 251 ? GLY A 384 GLU A 403 1 ? 20 
HELX_P HELX_P6  6  THR A 255 ? SER A 267 ? THR A 407 SER A 419 1 ? 13 
HELX_P HELX_P7  7  ASN A 273 ? PHE A 277 ? ASN A 425 PHE A 429 5 ? 5  
HELX_P HELX_P8  8  PRO A 278 ? ARG A 282 ? PRO A 430 ARG A 434 5 ? 5  
HELX_P HELX_P9  9  ASN B 30  ? ASP B 34  ? ASN E 295 ASP E 299 5 ? 5  
HELX_P HELX_P10 10 ASP B 34  ? CYS B 39  ? ASP E 299 CYS E 304 5 ? 6  
HELX_P HELX_P11 11 LYS C 31  ? PRO C 33  ? LYS P 69  PRO P 71  5 ? 3  
HELX_P HELX_P12 12 HIS C 49  ? ARG C 67  ? HIS P 87  ARG P 105 1 ? 19 
HELX_P HELX_P13 13 SER C 89  ? ASP C 91  ? SER P 127 ASP P 129 5 ? 3  
HELX_P HELX_P14 14 LEU C 92  ? LYS C 98  ? LEU P 130 LYS P 136 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 71  SG ? ? ? 1_555 A CYS 103 SG  ? ? A CYS 223  A CYS 255  1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf2  disulf ? ? A CYS 171 SG ? ? ? 1_555 A CYS 206 SG  ? ? A CYS 323  A CYS 358  1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf3  disulf ? ? A CYS 223 SG ? ? ? 1_555 A CYS 226 SG  ? ? A CYS 375  A CYS 378  1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf4  disulf ? ? B CYS 32  SG ? ? ? 1_555 B CYS 43  SG  ? ? E CYS 297  E CYS 308  1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf5  disulf ? ? B CYS 39  SG ? ? ? 1_555 B CYS 52  SG  ? ? E CYS 304  E CYS 317  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf6  disulf ? ? B CYS 54  SG ? ? ? 1_555 B CYS 66  SG  ? ? E CYS 319  E CYS 331  1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc1  metalc ? ? D CA  .   CA ? ? ? 1_555 A VAL 181 O   ? ? A CA  1448 A VAL 333  1_555 ? ? ? ? ? ? ? 2.718 ? 
metalc2  metalc ? ? D CA  .   CA ? ? ? 1_555 A THR 183 OG1 ? ? A CA  1448 A THR 335  1_555 ? ? ? ? ? ? ? 2.702 ? 
metalc3  metalc ? ? D CA  .   CA ? ? ? 1_555 A CYS 206 O   ? ? A CA  1448 A CYS 358  1_555 ? ? ? ? ? ? ? 3.126 ? 
metalc4  metalc ? ? D CA  .   CA ? ? ? 1_555 A ASP 208 OD2 ? ? A CA  1448 A ASP 360  1_555 ? ? ? ? ? ? ? 2.704 ? 
metalc5  metalc ? ? E CA  .   CA ? ? ? 1_555 B THR 29  O   ? ? E CA  1334 E THR 294  1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc6  metalc ? ? E CA  .   CA ? ? ? 1_555 B LEU 46  O   ? ? E CA  1334 E LEU 311  1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc7  metalc ? ? E CA  .   CA ? ? ? 1_555 H HOH .   O   ? ? E CA  1334 E HOH 2013 1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc8  metalc ? ? E CA  .   CA ? ? ? 1_555 B GLU 31  OE1 ? ? E CA  1334 E GLU 296  1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc9  metalc ? ? E CA  .   CA ? ? ? 1_555 B GLY 49  O   ? ? E CA  1334 E GLY 314  1_555 ? ? ? ? ? ? ? 2.440 ? 
metalc10 metalc ? ? E CA  .   CA ? ? ? 1_555 B ASP 45  OD2 ? ? E CA  1334 E ASP 310  1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc11 metalc ? ? E CA  .   CA ? ? ? 1_555 H HOH .   O   ? ? E CA  1334 E HOH 2010 1_555 ? ? ? ? ? ? ? 2.457 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           174 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            326 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    175 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     327 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
AB ? 4 ? 
AC ? 3 ? 
AD ? 4 ? 
AE ? 2 ? 
EA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 48  ? GLU A 54  ? VAL A 200 GLU A 206 
AA 2 SER A 94  ? ARG A 99  ? SER A 246 ARG A 251 
AA 3 GLU A 29  ? ASP A 34  ? GLU A 181 ASP A 186 
AA 4 LEU A 131 ? LEU A 135 ? LEU A 283 LEU A 287 
AA 5 VAL A 158 ? ALA A 162 ? VAL A 310 ALA A 314 
AA 6 ILE A 182 ? THR A 187 ? ILE A 334 THR A 339 
AA 7 LEU A 209 ? PRO A 212 ? LEU A 361 PRO A 364 
AB 1 LYS A 106 ? THR A 108 ? LYS A 258 THR A 260 
AB 2 VAL C 102 ? ALA C 113 ? VAL P 140 ALA P 151 
AB 3 LEU A 137 ? GLY A 140 ? LEU A 289 GLY A 292 
AB 4 TYR A 173 ? SER A 174 ? TYR A 325 SER A 326 
AC 1 LYS A 106 ? THR A 108 ? LYS A 258 THR A 260 
AC 2 VAL C 102 ? ALA C 113 ? VAL P 140 ALA P 151 
AC 3 THR C 25  ? HIS C 27  ? THR P 63  HIS P 65  
AD 1 ILE A 216 ? ALA A 219 ? ILE A 368 ALA A 371 
AD 2 CYS A 226 ? GLN A 230 ? CYS A 378 GLN A 382 
AD 3 VAL B 42  ? ASN B 44  ? VAL E 307 ASN E 309 
AD 4 GLU B 51  ? LEU B 53  ? GLU E 316 LEU E 318 
AE 1 ALA A 268 ? LYS A 269 ? ALA A 420 LYS A 421 
AE 2 LEU A 288 ? VAL A 289 ? LEU A 440 VAL A 441 
EA 1 GLN B 59  ? VAL B 61  ? GLN E 324 VAL E 326 
EA 2 ARG B 65  ? GLU B 67  ? ARG E 330 GLU E 332 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N MET A 49  ? N MET A 201 O MET A 95  ? O MET A 247 
AA 2 3 N ARG A 96  ? N ARG A 248 O VAL A 30  ? O VAL A 182 
AA 3 4 N TYR A 31  ? N TYR A 183 O VAL A 132 ? O VAL A 284 
AA 4 5 N VAL A 133 ? N VAL A 285 O VAL A 158 ? O VAL A 310 
AA 5 6 N THR A 161 ? N THR A 313 O ILE A 182 ? O ILE A 334 
AA 6 7 N GLY A 185 ? N GLY A 337 O LEU A 209 ? O LEU A 361 
AB 1 2 N GLY A 107 ? N GLY A 259 O VAL C 111 ? O VAL P 149 
AB 2 3 N PHE C 112 ? N PHE P 150 O ALA A 138 ? O ALA A 290 
AB 3 4 N GLY A 139 ? N GLY A 291 O SER A 174 ? O SER A 326 
AC 1 2 N GLY A 107 ? N GLY A 259 O VAL C 111 ? O VAL P 149 
AC 2 3 N ILE C 105 ? N ILE P 143 O THR C 25  ? O THR P 63  
AD 1 2 N GLY A 218 ? N GLY A 370 O VAL A 228 ? O VAL A 380 
AD 2 3 N PHE A 227 ? N PHE A 379 O CYS B 43  ? O CYS E 308 
AD 3 4 N ASN B 44  ? N ASN E 309 O GLU B 51  ? O GLU E 316 
AE 1 2 N ALA A 268 ? N ALA A 420 O VAL A 289 ? O VAL A 441 
EA 1 2 N VAL B 61  ? N VAL E 326 O ARG B 65  ? O ARG E 330 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA E1334' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A1448' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 THR B 29  ? THR E 294  . ? 1_555 ? 
2  AC1 7 GLU B 31  ? GLU E 296  . ? 1_555 ? 
3  AC1 7 ASP B 45  ? ASP E 310  . ? 1_555 ? 
4  AC1 7 LEU B 46  ? LEU E 311  . ? 1_555 ? 
5  AC1 7 GLY B 49  ? GLY E 314  . ? 1_555 ? 
6  AC1 7 HOH H .   ? HOH E 2010 . ? 1_555 ? 
7  AC1 7 HOH H .   ? HOH E 2013 . ? 1_555 ? 
8  AC2 6 ALA A 176 ? ALA A 328  . ? 1_555 ? 
9  AC2 6 ALA A 178 ? ALA A 330  . ? 1_555 ? 
10 AC2 6 VAL A 181 ? VAL A 333  . ? 1_555 ? 
11 AC2 6 THR A 183 ? THR A 335  . ? 1_555 ? 
12 AC2 6 CYS A 206 ? CYS A 358  . ? 1_555 ? 
13 AC2 6 ASP A 208 ? ASP A 360  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2W2M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W2M 
_atom_sites.fract_transf_matrix[1][1]   0.012048 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012048 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004727 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? -0.166  -1.340  8.635  1.00 33.79 ? 153  SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 0.382   -2.293  9.652  1.00 33.73 ? 153  SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 0.152   -1.803  11.090 1.00 33.10 ? 153  SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? -0.745  -0.987  11.345 1.00 33.29 ? 153  SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 1.874   -2.551  9.390  1.00 33.92 ? 153  SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 2.574   -1.335  9.162  1.00 35.09 ? 153  SER A OG  1 
ATOM   7    N  N   . ILE A 1 2   ? 0.933   -2.350  12.023 1.00 32.12 ? 154  ILE A N   1 
ATOM   8    C  CA  . ILE A 1 2   ? 1.055   -1.810  13.380 1.00 30.97 ? 154  ILE A CA  1 
ATOM   9    C  C   . ILE A 1 2   ? 2.530   -1.467  13.646 1.00 29.68 ? 154  ILE A C   1 
ATOM   10   O  O   . ILE A 1 2   ? 3.404   -2.011  12.967 1.00 29.56 ? 154  ILE A O   1 
ATOM   11   C  CB  . ILE A 1 2   ? 0.457   -2.761  14.456 1.00 31.35 ? 154  ILE A CB  1 
ATOM   12   C  CG1 . ILE A 1 2   ? 1.133   -4.140  14.445 1.00 31.43 ? 154  ILE A CG1 1 
ATOM   13   C  CG2 . ILE A 1 2   ? -1.071  -2.835  14.309 1.00 31.79 ? 154  ILE A CG2 1 
ATOM   14   C  CD1 . ILE A 1 2   ? 2.122   -4.333  15.586 1.00 31.37 ? 154  ILE A CD1 1 
ATOM   15   N  N   . PRO A 1 3   ? 2.813   -0.560  14.616 1.00 28.43 ? 155  PRO A N   1 
ATOM   16   C  CA  . PRO A 1 3   ? 4.182   -0.035  14.785 1.00 27.26 ? 155  PRO A CA  1 
ATOM   17   C  C   . PRO A 1 3   ? 5.274   -1.115  14.707 1.00 26.22 ? 155  PRO A C   1 
ATOM   18   O  O   . PRO A 1 3   ? 5.112   -2.201  15.278 1.00 26.10 ? 155  PRO A O   1 
ATOM   19   C  CB  . PRO A 1 3   ? 4.146   0.601   16.175 1.00 27.17 ? 155  PRO A CB  1 
ATOM   20   C  CG  . PRO A 1 3   ? 2.733   0.983   16.380 1.00 27.60 ? 155  PRO A CG  1 
ATOM   21   C  CD  . PRO A 1 3   ? 1.882   0.015   15.609 1.00 28.26 ? 155  PRO A CD  1 
ATOM   22   N  N   . TRP A 1 4   ? 6.366   -0.808  14.005 1.00 24.95 ? 156  TRP A N   1 
ATOM   23   C  CA  . TRP A 1 4   ? 7.431   -1.784  13.735 1.00 23.95 ? 156  TRP A CA  1 
ATOM   24   C  C   . TRP A 1 4   ? 7.986   -2.400  15.016 1.00 23.65 ? 156  TRP A C   1 
ATOM   25   O  O   . TRP A 1 4   ? 8.266   -3.597  15.061 1.00 23.67 ? 156  TRP A O   1 
ATOM   26   C  CB  . TRP A 1 4   ? 8.561   -1.179  12.867 1.00 23.21 ? 156  TRP A CB  1 
ATOM   27   C  CG  . TRP A 1 4   ? 9.554   -0.334  13.630 1.00 22.67 ? 156  TRP A CG  1 
ATOM   28   C  CD1 . TRP A 1 4   ? 9.536   1.022   13.775 1.00 21.58 ? 156  TRP A CD1 1 
ATOM   29   C  CD2 . TRP A 1 4   ? 10.703  -0.799  14.361 1.00 22.25 ? 156  TRP A CD2 1 
ATOM   30   N  NE1 . TRP A 1 4   ? 10.589  1.432   14.550 1.00 21.04 ? 156  TRP A NE1 1 
ATOM   31   C  CE2 . TRP A 1 4   ? 11.323  0.339   14.927 1.00 21.43 ? 156  TRP A CE2 1 
ATOM   32   C  CE3 . TRP A 1 4   ? 11.258  -2.066  14.602 1.00 21.54 ? 156  TRP A CE3 1 
ATOM   33   C  CZ2 . TRP A 1 4   ? 12.473  0.253   15.721 1.00 21.19 ? 156  TRP A CZ2 1 
ATOM   34   C  CZ3 . TRP A 1 4   ? 12.405  -2.151  15.391 1.00 22.18 ? 156  TRP A CZ3 1 
ATOM   35   C  CH2 . TRP A 1 4   ? 12.998  -0.991  15.941 1.00 21.94 ? 156  TRP A CH2 1 
ATOM   36   N  N   . ASN A 1 5   ? 8.125   -1.567  16.049 1.00 23.53 ? 157  ASN A N   1 
ATOM   37   C  CA  . ASN A 1 5   ? 8.721   -1.945  17.336 1.00 23.03 ? 157  ASN A CA  1 
ATOM   38   C  C   . ASN A 1 5   ? 7.879   -2.911  18.158 1.00 23.16 ? 157  ASN A C   1 
ATOM   39   O  O   . ASN A 1 5   ? 8.419   -3.761  18.864 1.00 22.89 ? 157  ASN A O   1 
ATOM   40   C  CB  . ASN A 1 5   ? 9.006   -0.692  18.162 1.00 22.74 ? 157  ASN A CB  1 
ATOM   41   C  CG  . ASN A 1 5   ? 7.825   0.258   18.218 1.00 22.44 ? 157  ASN A CG  1 
ATOM   42   O  OD1 . ASN A 1 5   ? 7.433   0.840   17.205 1.00 21.77 ? 157  ASN A OD1 1 
ATOM   43   N  ND2 . ASN A 1 5   ? 7.255   0.431   19.411 1.00 21.25 ? 157  ASN A ND2 1 
ATOM   44   N  N   . LEU A 1 6   ? 6.559   -2.761  18.070 1.00 23.65 ? 158  LEU A N   1 
ATOM   45   C  CA  . LEU A 1 6   ? 5.623   -3.640  18.767 1.00 24.30 ? 158  LEU A CA  1 
ATOM   46   C  C   . LEU A 1 6   ? 5.613   -5.020  18.125 1.00 24.89 ? 158  LEU A C   1 
ATOM   47   O  O   . LEU A 1 6   ? 5.533   -6.038  18.816 1.00 25.02 ? 158  LEU A O   1 
ATOM   48   C  CB  . LEU A 1 6   ? 4.214   -3.036  18.791 1.00 23.80 ? 158  LEU A CB  1 
ATOM   49   C  CG  . LEU A 1 6   ? 4.019   -1.737  19.580 1.00 23.18 ? 158  LEU A CG  1 
ATOM   50   C  CD1 . LEU A 1 6   ? 2.549   -1.430  19.712 1.00 21.25 ? 158  LEU A CD1 1 
ATOM   51   C  CD2 . LEU A 1 6   ? 4.695   -1.783  20.962 1.00 22.09 ? 158  LEU A CD2 1 
ATOM   52   N  N   . GLU A 1 7   ? 5.710   -5.023  16.800 1.00 25.66 ? 159  GLU A N   1 
ATOM   53   C  CA  . GLU A 1 7   ? 5.903   -6.223  15.997 1.00 26.52 ? 159  GLU A CA  1 
ATOM   54   C  C   . GLU A 1 7   ? 7.208   -6.945  16.350 1.00 26.47 ? 159  GLU A C   1 
ATOM   55   O  O   . GLU A 1 7   ? 7.232   -8.170  16.464 1.00 26.60 ? 159  GLU A O   1 
ATOM   56   C  CB  . GLU A 1 7   ? 5.905   -5.825  14.518 1.00 26.94 ? 159  GLU A CB  1 
ATOM   57   C  CG  . GLU A 1 7   ? 5.917   -6.974  13.518 1.00 29.77 ? 159  GLU A CG  1 
ATOM   58   C  CD  . GLU A 1 7   ? 4.530   -7.528  13.255 1.00 33.22 ? 159  GLU A CD  1 
ATOM   59   O  OE1 . GLU A 1 7   ? 4.057   -7.405  12.102 1.00 34.21 ? 159  GLU A OE1 1 
ATOM   60   O  OE2 . GLU A 1 7   ? 3.911   -8.077  14.202 1.00 34.93 ? 159  GLU A OE2 1 
ATOM   61   N  N   . ARG A 1 8   ? 8.281   -6.175  16.526 1.00 26.46 ? 160  ARG A N   1 
ATOM   62   C  CA  . ARG A 1 8   ? 9.623   -6.706  16.771 1.00 26.52 ? 160  ARG A CA  1 
ATOM   63   C  C   . ARG A 1 8   ? 9.768   -7.427  18.108 1.00 27.22 ? 160  ARG A C   1 
ATOM   64   O  O   . ARG A 1 8   ? 10.582  -8.343  18.232 1.00 27.18 ? 160  ARG A O   1 
ATOM   65   C  CB  . ARG A 1 8   ? 10.662  -5.580  16.671 1.00 26.19 ? 160  ARG A CB  1 
ATOM   66   C  CG  . ARG A 1 8   ? 12.102  -6.043  16.473 1.00 24.97 ? 160  ARG A CG  1 
ATOM   67   C  CD  . ARG A 1 8   ? 12.280  -6.868  15.200 1.00 23.51 ? 160  ARG A CD  1 
ATOM   68   N  NE  . ARG A 1 8   ? 11.888  -6.129  14.000 1.00 22.76 ? 160  ARG A NE  1 
ATOM   69   C  CZ  . ARG A 1 8   ? 12.738  -5.501  13.194 1.00 22.37 ? 160  ARG A CZ  1 
ATOM   70   N  NH1 . ARG A 1 8   ? 14.044  -5.523  13.441 1.00 22.02 ? 160  ARG A NH1 1 
ATOM   71   N  NH2 . ARG A 1 8   ? 12.281  -4.852  12.135 1.00 21.44 ? 160  ARG A NH2 1 
ATOM   72   N  N   . ILE A 1 9   ? 8.993   -7.007  19.107 1.00 28.11 ? 161  ILE A N   1 
ATOM   73   C  CA  . ILE A 1 9   ? 9.055   -7.616  20.442 1.00 29.00 ? 161  ILE A CA  1 
ATOM   74   C  C   . ILE A 1 9   ? 8.046   -8.757  20.612 1.00 30.11 ? 161  ILE A C   1 
ATOM   75   O  O   . ILE A 1 9   ? 8.076   -9.475  21.608 1.00 30.27 ? 161  ILE A O   1 
ATOM   76   C  CB  . ILE A 1 9   ? 8.921   -6.567  21.594 1.00 28.82 ? 161  ILE A CB  1 
ATOM   77   C  CG1 . ILE A 1 9   ? 7.591   -5.805  21.511 1.00 28.81 ? 161  ILE A CG1 1 
ATOM   78   C  CG2 . ILE A 1 9   ? 10.120  -5.612  21.596 1.00 28.54 ? 161  ILE A CG2 1 
ATOM   79   C  CD1 . ILE A 1 9   ? 7.165   -5.139  22.801 1.00 28.45 ? 161  ILE A CD1 1 
ATOM   80   N  N   . THR A 1 10  ? 7.170   -8.923  19.625 1.00 31.62 ? 162  THR A N   1 
ATOM   81   C  CA  . THR A 1 10  ? 6.125   -9.943  19.655 1.00 33.20 ? 162  THR A CA  1 
ATOM   82   C  C   . THR A 1 10  ? 6.565   -11.186 18.878 1.00 34.35 ? 162  THR A C   1 
ATOM   83   O  O   . THR A 1 10  ? 6.707   -11.130 17.655 1.00 34.59 ? 162  THR A O   1 
ATOM   84   C  CB  . THR A 1 10  ? 4.807   -9.404  19.048 1.00 33.18 ? 162  THR A CB  1 
ATOM   85   O  OG1 . THR A 1 10  ? 4.396   -8.226  19.753 1.00 33.49 ? 162  THR A OG1 1 
ATOM   86   C  CG2 . THR A 1 10  ? 3.697   -10.448 19.122 1.00 33.51 ? 162  THR A CG2 1 
ATOM   87   N  N   . PRO A 1 11  ? 6.779   -12.315 19.579 1.00 35.54 ? 163  PRO A N   1 
ATOM   88   C  CA  . PRO A 1 11  ? 7.139   -13.546 18.868 1.00 36.60 ? 163  PRO A CA  1 
ATOM   89   C  C   . PRO A 1 11  ? 5.953   -14.058 18.052 1.00 37.65 ? 163  PRO A C   1 
ATOM   90   O  O   . PRO A 1 11  ? 4.809   -13.711 18.364 1.00 37.75 ? 163  PRO A O   1 
ATOM   91   C  CB  . PRO A 1 11  ? 7.485   -14.521 19.999 1.00 36.48 ? 163  PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 11  ? 6.758   -14.011 21.181 1.00 35.97 ? 163  PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 11  ? 6.698   -12.520 21.037 1.00 35.64 ? 163  PRO A CD  1 
ATOM   94   N  N   . PRO A 1 12  ? 6.217   -14.855 16.998 1.00 38.78 ? 164  PRO A N   1 
ATOM   95   C  CA  . PRO A 1 12  ? 5.112   -15.400 16.195 1.00 39.49 ? 164  PRO A CA  1 
ATOM   96   C  C   . PRO A 1 12  ? 4.157   -16.279 17.015 1.00 40.14 ? 164  PRO A C   1 
ATOM   97   O  O   . PRO A 1 12  ? 2.938   -16.208 16.818 1.00 40.47 ? 164  PRO A O   1 
ATOM   98   C  CB  . PRO A 1 12  ? 5.830   -16.231 15.120 1.00 39.58 ? 164  PRO A CB  1 
ATOM   99   C  CG  . PRO A 1 12  ? 7.218   -15.663 15.058 1.00 39.30 ? 164  PRO A CG  1 
ATOM   100  C  CD  . PRO A 1 12  ? 7.529   -15.283 16.478 1.00 38.95 ? 164  PRO A CD  1 
ATOM   101  N  N   . ARG A 1 13  ? 4.708   -17.081 17.932 1.00 40.51 ? 165  ARG A N   1 
ATOM   102  C  CA  . ARG A 1 13  ? 3.903   -17.969 18.775 1.00 40.80 ? 165  ARG A CA  1 
ATOM   103  C  C   . ARG A 1 13  ? 3.463   -17.283 20.064 1.00 40.97 ? 165  ARG A C   1 
ATOM   104  O  O   . ARG A 1 13  ? 3.127   -16.097 20.071 1.00 41.15 ? 165  ARG A O   1 
ATOM   105  C  CB  . ARG A 1 13  ? 4.662   -19.264 19.083 1.00 40.83 ? 165  ARG A CB  1 
ATOM   106  N  N   . GLY A 1 24  ? -0.909  -6.346  31.042 1.00 49.78 ? 176  GLY A N   1 
ATOM   107  C  CA  . GLY A 1 24  ? 0.132   -5.752  31.874 1.00 49.69 ? 176  GLY A CA  1 
ATOM   108  C  C   . GLY A 1 24  ? -0.415  -4.778  32.900 1.00 49.60 ? 176  GLY A C   1 
ATOM   109  O  O   . GLY A 1 24  ? -1.488  -4.194  32.705 1.00 49.75 ? 176  GLY A O   1 
ATOM   110  N  N   . GLY A 1 25  ? 0.324   -4.619  33.998 1.00 49.29 ? 177  GLY A N   1 
ATOM   111  C  CA  . GLY A 1 25  ? -0.014  -3.668  35.059 1.00 48.98 ? 177  GLY A CA  1 
ATOM   112  C  C   . GLY A 1 25  ? -1.381  -3.813  35.710 1.00 48.80 ? 177  GLY A C   1 
ATOM   113  O  O   . GLY A 1 25  ? -2.074  -2.811  35.934 1.00 48.71 ? 177  GLY A O   1 
ATOM   114  N  N   . SER A 1 26  ? -1.769  -5.054  36.015 1.00 48.50 ? 178  SER A N   1 
ATOM   115  C  CA  . SER A 1 26  ? -3.015  -5.328  36.743 1.00 47.98 ? 178  SER A CA  1 
ATOM   116  C  C   . SER A 1 26  ? -2.833  -5.105  38.250 1.00 47.34 ? 178  SER A C   1 
ATOM   117  O  O   . SER A 1 26  ? -3.561  -4.315  38.858 1.00 47.44 ? 178  SER A O   1 
ATOM   118  C  CB  . SER A 1 26  ? -3.536  -6.743  36.448 1.00 48.29 ? 178  SER A CB  1 
ATOM   119  O  OG  . SER A 1 26  ? -4.015  -6.849  35.112 1.00 48.59 ? 178  SER A OG  1 
ATOM   120  N  N   . LEU A 1 27  ? -1.862  -5.800  38.842 1.00 46.27 ? 179  LEU A N   1 
ATOM   121  C  CA  . LEU A 1 27  ? -1.451  -5.542  40.223 1.00 45.10 ? 179  LEU A CA  1 
ATOM   122  C  C   . LEU A 1 27  ? -0.089  -4.827  40.220 1.00 44.05 ? 179  LEU A C   1 
ATOM   123  O  O   . LEU A 1 27  ? 0.356   -4.297  41.245 1.00 43.96 ? 179  LEU A O   1 
ATOM   124  C  CB  . LEU A 1 27  ? -1.399  -6.847  41.026 1.00 45.21 ? 179  LEU A CB  1 
ATOM   125  C  CG  . LEU A 1 27  ? -1.938  -6.834  42.467 1.00 45.70 ? 179  LEU A CG  1 
ATOM   126  C  CD1 . LEU A 1 27  ? -2.450  -8.218  42.869 1.00 45.68 ? 179  LEU A CD1 1 
ATOM   127  C  CD2 . LEU A 1 27  ? -0.912  -6.325  43.480 1.00 46.14 ? 179  LEU A CD2 1 
ATOM   128  N  N   . VAL A 1 28  ? 0.547   -4.807  39.048 1.00 42.63 ? 180  VAL A N   1 
ATOM   129  C  CA  . VAL A 1 28  ? 1.850   -4.173  38.848 1.00 41.22 ? 180  VAL A CA  1 
ATOM   130  C  C   . VAL A 1 28  ? 1.689   -2.671  38.609 1.00 40.37 ? 180  VAL A C   1 
ATOM   131  O  O   . VAL A 1 28  ? 0.857   -2.245  37.807 1.00 40.34 ? 180  VAL A O   1 
ATOM   132  C  CB  . VAL A 1 28  ? 2.598   -4.783  37.627 1.00 41.14 ? 180  VAL A CB  1 
ATOM   133  C  CG1 . VAL A 1 28  ? 4.084   -4.454  37.676 1.00 40.83 ? 180  VAL A CG1 1 
ATOM   134  C  CG2 . VAL A 1 28  ? 2.399   -6.287  37.557 1.00 41.15 ? 180  VAL A CG2 1 
ATOM   135  N  N   . GLU A 1 29  ? 2.484   -1.870  39.310 1.00 39.18 ? 181  GLU A N   1 
ATOM   136  C  CA  . GLU A 1 29  ? 2.590   -0.451  38.983 1.00 38.07 ? 181  GLU A CA  1 
ATOM   137  C  C   . GLU A 1 29  ? 3.960   -0.085  38.437 1.00 36.66 ? 181  GLU A C   1 
ATOM   138  O  O   . GLU A 1 29  ? 4.991   -0.570  38.916 1.00 36.62 ? 181  GLU A O   1 
ATOM   139  C  CB  . GLU A 1 29  ? 2.203   0.438   40.164 1.00 38.48 ? 181  GLU A CB  1 
ATOM   140  C  CG  . GLU A 1 29  ? 0.813   1.037   40.003 1.00 40.24 ? 181  GLU A CG  1 
ATOM   141  C  CD  . GLU A 1 29  ? 0.154   1.386   41.320 1.00 43.27 ? 181  GLU A CD  1 
ATOM   142  O  OE1 . GLU A 1 29  ? 0.735   1.077   42.387 1.00 45.04 ? 181  GLU A OE1 1 
ATOM   143  O  OE2 . GLU A 1 29  ? -0.952  1.976   41.289 1.00 44.25 ? 181  GLU A OE2 1 
ATOM   144  N  N   . VAL A 1 30  ? 3.950   0.761   37.415 1.00 34.99 ? 182  VAL A N   1 
ATOM   145  C  CA  . VAL A 1 30  ? 5.171   1.253   36.797 1.00 33.40 ? 182  VAL A CA  1 
ATOM   146  C  C   . VAL A 1 30  ? 5.358   2.712   37.182 1.00 32.32 ? 182  VAL A C   1 
ATOM   147  O  O   . VAL A 1 30  ? 4.521   3.558   36.866 1.00 32.24 ? 182  VAL A O   1 
ATOM   148  C  CB  . VAL A 1 30  ? 5.152   1.090   35.248 1.00 33.45 ? 182  VAL A CB  1 
ATOM   149  C  CG1 . VAL A 1 30  ? 6.468   1.570   34.631 1.00 32.88 ? 182  VAL A CG1 1 
ATOM   150  C  CG2 . VAL A 1 30  ? 4.884   -0.367  34.859 1.00 33.35 ? 182  VAL A CG2 1 
ATOM   151  N  N   . TYR A 1 31  ? 6.443   2.990   37.895 1.00 31.05 ? 183  TYR A N   1 
ATOM   152  C  CA  . TYR A 1 31  ? 6.824   4.361   38.217 1.00 30.02 ? 183  TYR A CA  1 
ATOM   153  C  C   . TYR A 1 31  ? 7.688   4.924   37.109 1.00 29.15 ? 183  TYR A C   1 
ATOM   154  O  O   . TYR A 1 31  ? 8.610   4.260   36.632 1.00 28.83 ? 183  TYR A O   1 
ATOM   155  C  CB  . TYR A 1 31  ? 7.585   4.431   39.542 1.00 30.23 ? 183  TYR A CB  1 
ATOM   156  C  CG  . TYR A 1 31  ? 6.711   4.317   40.766 1.00 30.42 ? 183  TYR A CG  1 
ATOM   157  C  CD1 . TYR A 1 31  ? 6.282   5.457   41.447 1.00 30.76 ? 183  TYR A CD1 1 
ATOM   158  C  CD2 . TYR A 1 31  ? 6.304   3.073   41.241 1.00 30.67 ? 183  TYR A CD2 1 
ATOM   159  C  CE1 . TYR A 1 31  ? 5.473   5.357   42.579 1.00 30.69 ? 183  TYR A CE1 1 
ATOM   160  C  CE2 . TYR A 1 31  ? 5.497   2.963   42.369 1.00 30.98 ? 183  TYR A CE2 1 
ATOM   161  C  CZ  . TYR A 1 31  ? 5.090   4.105   43.031 1.00 30.42 ? 183  TYR A CZ  1 
ATOM   162  O  OH  . TYR A 1 31  ? 4.295   3.988   44.141 1.00 31.12 ? 183  TYR A OH  1 
ATOM   163  N  N   . LEU A 1 32  ? 7.370   6.146   36.701 1.00 28.20 ? 184  LEU A N   1 
ATOM   164  C  CA  . LEU A 1 32  ? 8.155   6.869   35.716 1.00 27.38 ? 184  LEU A CA  1 
ATOM   165  C  C   . LEU A 1 32  ? 8.765   8.104   36.380 1.00 26.97 ? 184  LEU A C   1 
ATOM   166  O  O   . LEU A 1 32  ? 8.046   8.939   36.933 1.00 27.00 ? 184  LEU A O   1 
ATOM   167  C  CB  . LEU A 1 32  ? 7.270   7.243   34.516 1.00 27.22 ? 184  LEU A CB  1 
ATOM   168  C  CG  . LEU A 1 32  ? 7.829   8.074   33.354 1.00 27.32 ? 184  LEU A CG  1 
ATOM   169  C  CD1 . LEU A 1 32  ? 8.946   7.355   32.600 1.00 26.41 ? 184  LEU A CD1 1 
ATOM   170  C  CD2 . LEU A 1 32  ? 6.713   8.479   32.399 1.00 27.44 ? 184  LEU A CD2 1 
ATOM   171  N  N   . LEU A 1 33  ? 10.091  8.192   36.363 1.00 26.64 ? 185  LEU A N   1 
ATOM   172  C  CA  . LEU A 1 33  ? 10.799  9.398   36.811 1.00 26.26 ? 185  LEU A CA  1 
ATOM   173  C  C   . LEU A 1 33  ? 11.312  10.148  35.596 1.00 26.05 ? 185  LEU A C   1 
ATOM   174  O  O   . LEU A 1 33  ? 12.340  9.786   35.022 1.00 26.02 ? 185  LEU A O   1 
ATOM   175  C  CB  . LEU A 1 33  ? 11.964  9.067   37.752 1.00 26.10 ? 185  LEU A CB  1 
ATOM   176  C  CG  . LEU A 1 33  ? 11.644  8.622   39.176 1.00 25.91 ? 185  LEU A CG  1 
ATOM   177  C  CD1 . LEU A 1 33  ? 11.513  7.118   39.207 1.00 26.52 ? 185  LEU A CD1 1 
ATOM   178  C  CD2 . LEU A 1 33  ? 12.730  9.077   40.132 1.00 25.30 ? 185  LEU A CD2 1 
ATOM   179  N  N   . ASP A 1 34  ? 10.586  11.192  35.209 1.00 25.84 ? 186  ASP A N   1 
ATOM   180  C  CA  . ASP A 1 34  ? 10.836  11.874  33.950 1.00 25.89 ? 186  ASP A CA  1 
ATOM   181  C  C   . ASP A 1 34  ? 10.366  13.327  34.043 1.00 25.19 ? 186  ASP A C   1 
ATOM   182  O  O   . ASP A 1 34  ? 10.363  13.921  35.124 1.00 25.09 ? 186  ASP A O   1 
ATOM   183  C  CB  . ASP A 1 34  ? 10.121  11.130  32.805 1.00 26.51 ? 186  ASP A CB  1 
ATOM   184  C  CG  . ASP A 1 34  ? 10.839  11.277  31.461 1.00 28.96 ? 186  ASP A CG  1 
ATOM   185  O  OD1 . ASP A 1 34  ? 10.329  11.994  30.581 1.00 31.00 ? 186  ASP A OD1 1 
ATOM   186  O  OD2 . ASP A 1 34  ? 11.930  10.697  31.283 1.00 32.48 ? 186  ASP A OD2 1 
ATOM   187  N  N   . THR A 1 35  ? 9.987   13.894  32.903 1.00 24.39 ? 187  THR A N   1 
ATOM   188  C  CA  . THR A 1 35  ? 9.424   15.232  32.833 1.00 23.93 ? 187  THR A CA  1 
ATOM   189  C  C   . THR A 1 35  ? 7.981   15.205  33.335 1.00 24.00 ? 187  THR A C   1 
ATOM   190  O  O   . THR A 1 35  ? 7.495   14.173  33.811 1.00 23.75 ? 187  THR A O   1 
ATOM   191  C  CB  . THR A 1 35  ? 9.439   15.763  31.372 1.00 23.74 ? 187  THR A CB  1 
ATOM   192  O  OG1 . THR A 1 35  ? 8.551   14.980  30.562 1.00 23.56 ? 187  THR A OG1 1 
ATOM   193  C  CG2 . THR A 1 35  ? 10.829  15.697  30.780 1.00 23.20 ? 187  THR A CG2 1 
ATOM   194  N  N   . SER A 1 36  ? 7.290   16.335  33.222 1.00 24.08 ? 188  SER A N   1 
ATOM   195  C  CA  . SER A 1 36  ? 5.849   16.355  33.419 1.00 24.55 ? 188  SER A CA  1 
ATOM   196  C  C   . SER A 1 36  ? 5.180   15.557  32.292 1.00 24.52 ? 188  SER A C   1 
ATOM   197  O  O   . SER A 1 36  ? 5.770   15.369  31.229 1.00 24.60 ? 188  SER A O   1 
ATOM   198  C  CB  . SER A 1 36  ? 5.335   17.793  33.458 1.00 24.56 ? 188  SER A CB  1 
ATOM   199  O  OG  . SER A 1 36  ? 5.684   18.481  32.272 1.00 25.26 ? 188  SER A OG  1 
ATOM   200  N  N   . ILE A 1 37  ? 3.972   15.060  32.535 1.00 24.56 ? 189  ILE A N   1 
ATOM   201  C  CA  . ILE A 1 37  ? 3.234   14.310  31.514 1.00 24.57 ? 189  ILE A CA  1 
ATOM   202  C  C   . ILE A 1 37  ? 1.885   14.968  31.234 1.00 24.21 ? 189  ILE A C   1 
ATOM   203  O  O   . ILE A 1 37  ? 1.354   15.674  32.086 1.00 24.14 ? 189  ILE A O   1 
ATOM   204  C  CB  . ILE A 1 37  ? 3.034   12.810  31.894 1.00 24.65 ? 189  ILE A CB  1 
ATOM   205  C  CG1 . ILE A 1 37  ? 2.215   12.674  33.178 1.00 25.76 ? 189  ILE A CG1 1 
ATOM   206  C  CG2 . ILE A 1 37  ? 4.380   12.100  32.061 1.00 24.92 ? 189  ILE A CG2 1 
ATOM   207  C  CD1 . ILE A 1 37  ? 1.376   11.424  33.223 1.00 26.58 ? 189  ILE A CD1 1 
ATOM   208  N  N   . GLN A 1 38  ? 1.359   14.763  30.026 1.00 23.91 ? 190  GLN A N   1 
ATOM   209  C  CA  . GLN A 1 38  ? -0.024  15.105  29.721 1.00 23.44 ? 190  GLN A CA  1 
ATOM   210  C  C   . GLN A 1 38  ? -0.858  13.864  30.007 1.00 23.20 ? 190  GLN A C   1 
ATOM   211  O  O   . GLN A 1 38  ? -0.952  12.969  29.171 1.00 22.86 ? 190  GLN A O   1 
ATOM   212  C  CB  . GLN A 1 38  ? -0.183  15.539  28.259 1.00 23.50 ? 190  GLN A CB  1 
ATOM   213  C  CG  . GLN A 1 38  ? -1.552  16.137  27.926 1.00 24.00 ? 190  GLN A CG  1 
ATOM   214  C  CD  . GLN A 1 38  ? -1.993  15.860  26.492 1.00 25.87 ? 190  GLN A CD  1 
ATOM   215  O  OE1 . GLN A 1 38  ? -1.196  15.438  25.659 1.00 26.19 ? 190  GLN A OE1 1 
ATOM   216  N  NE2 . GLN A 1 38  ? -3.273  16.092  26.204 1.00 26.13 ? 190  GLN A NE2 1 
ATOM   217  N  N   . SER A 1 39  ? -1.454  13.817  31.198 1.00 23.15 ? 191  SER A N   1 
ATOM   218  C  CA  . SER A 1 39  ? -2.162  12.620  31.672 1.00 22.97 ? 191  SER A CA  1 
ATOM   219  C  C   . SER A 1 39  ? -3.544  12.405  31.055 1.00 22.88 ? 191  SER A C   1 
ATOM   220  O  O   . SER A 1 39  ? -4.118  11.320  31.193 1.00 22.88 ? 191  SER A O   1 
ATOM   221  C  CB  . SER A 1 39  ? -2.246  12.599  33.206 1.00 23.01 ? 191  SER A CB  1 
ATOM   222  O  OG  . SER A 1 39  ? -2.762  13.814  33.719 1.00 23.03 ? 191  SER A OG  1 
ATOM   223  N  N   . ASP A 1 40  ? -4.065  13.433  30.381 1.00 22.71 ? 192  ASP A N   1 
ATOM   224  C  CA  A ASP A 1 40  ? -5.369  13.382  29.720 0.50 22.50 ? 192  ASP A CA  1 
ATOM   225  C  CA  B ASP A 1 40  ? -5.375  13.330  29.745 0.50 22.57 ? 192  ASP A CA  1 
ATOM   226  C  C   . ASP A 1 40  ? -5.290  12.842  28.293 1.00 22.39 ? 192  ASP A C   1 
ATOM   227  O  O   . ASP A 1 40  ? -6.321  12.682  27.621 1.00 22.58 ? 192  ASP A O   1 
ATOM   228  C  CB  A ASP A 1 40  ? -6.008  14.773  29.697 0.50 22.60 ? 192  ASP A CB  1 
ATOM   229  C  CB  B ASP A 1 40  ? -6.175  14.640  29.872 0.50 22.70 ? 192  ASP A CB  1 
ATOM   230  C  CG  A ASP A 1 40  ? -6.663  15.146  31.011 0.50 23.04 ? 192  ASP A CG  1 
ATOM   231  C  CG  B ASP A 1 40  ? -5.451  15.842  29.290 0.50 23.44 ? 192  ASP A CG  1 
ATOM   232  O  OD1 A ASP A 1 40  ? -6.832  14.268  31.887 0.50 23.79 ? 192  ASP A OD1 1 
ATOM   233  O  OD1 B ASP A 1 40  ? -4.267  16.063  29.630 0.50 24.83 ? 192  ASP A OD1 1 
ATOM   234  O  OD2 A ASP A 1 40  ? -7.022  16.331  31.166 0.50 23.83 ? 192  ASP A OD2 1 
ATOM   235  O  OD2 B ASP A 1 40  ? -6.079  16.586  28.507 0.50 23.88 ? 192  ASP A OD2 1 
ATOM   236  N  N   . HIS A 1 41  ? -4.071  12.576  27.819 1.00 21.90 ? 193  HIS A N   1 
ATOM   237  C  CA  . HIS A 1 41  ? -3.869  12.072  26.466 1.00 21.29 ? 193  HIS A CA  1 
ATOM   238  C  C   . HIS A 1 41  ? -4.610  10.748  26.315 1.00 21.15 ? 193  HIS A C   1 
ATOM   239  O  O   . HIS A 1 41  ? -4.597  9.922   27.230 1.00 20.96 ? 193  HIS A O   1 
ATOM   240  C  CB  . HIS A 1 41  ? -2.378  11.904  26.147 1.00 21.27 ? 193  HIS A CB  1 
ATOM   241  C  CG  . HIS A 1 41  ? -2.097  11.596  24.705 1.00 20.73 ? 193  HIS A CG  1 
ATOM   242  N  ND1 . HIS A 1 41  ? -1.639  12.545  23.815 1.00 20.38 ? 193  HIS A ND1 1 
ATOM   243  C  CD2 . HIS A 1 41  ? -2.212  10.446  24.000 1.00 19.97 ? 193  HIS A CD2 1 
ATOM   244  C  CE1 . HIS A 1 41  ? -1.486  11.992  22.625 1.00 19.62 ? 193  HIS A CE1 1 
ATOM   245  N  NE2 . HIS A 1 41  ? -1.828  10.719  22.710 1.00 19.43 ? 193  HIS A NE2 1 
ATOM   246  N  N   . ARG A 1 42  ? -5.263  10.566  25.167 1.00 20.95 ? 194  ARG A N   1 
ATOM   247  C  CA  . ARG A 1 42  ? -6.125  9.404   24.916 1.00 20.89 ? 194  ARG A CA  1 
ATOM   248  C  C   . ARG A 1 42  ? -5.430  8.052   25.155 1.00 21.19 ? 194  ARG A C   1 
ATOM   249  O  O   . ARG A 1 42  ? -6.079  7.059   25.510 1.00 21.14 ? 194  ARG A O   1 
ATOM   250  C  CB  . ARG A 1 42  ? -6.712  9.468   23.501 1.00 20.67 ? 194  ARG A CB  1 
ATOM   251  C  CG  . ARG A 1 42  ? -7.857  8.499   23.243 1.00 20.14 ? 194  ARG A CG  1 
ATOM   252  C  CD  . ARG A 1 42  ? -8.239  8.473   21.771 1.00 20.08 ? 194  ARG A CD  1 
ATOM   253  N  NE  . ARG A 1 42  ? -7.199  7.857   20.951 1.00 18.54 ? 194  ARG A NE  1 
ATOM   254  C  CZ  . ARG A 1 42  ? -7.121  7.949   19.626 1.00 18.21 ? 194  ARG A CZ  1 
ATOM   255  N  NH1 . ARG A 1 42  ? -8.026  8.641   18.945 1.00 17.98 ? 194  ARG A NH1 1 
ATOM   256  N  NH2 . ARG A 1 42  ? -6.127  7.351   18.978 1.00 17.54 ? 194  ARG A NH2 1 
ATOM   257  N  N   . GLU A 1 43  ? -4.116  8.024   24.962 1.00 21.30 ? 195  GLU A N   1 
ATOM   258  C  CA  . GLU A 1 43  ? -3.341  6.804   25.146 1.00 21.85 ? 195  GLU A CA  1 
ATOM   259  C  C   . GLU A 1 43  ? -3.295  6.335   26.597 1.00 22.33 ? 195  GLU A C   1 
ATOM   260  O  O   . GLU A 1 43  ? -3.304  5.126   26.868 1.00 22.39 ? 195  GLU A O   1 
ATOM   261  C  CB  . GLU A 1 43  ? -1.913  6.994   24.624 1.00 21.56 ? 195  GLU A CB  1 
ATOM   262  C  CG  . GLU A 1 43  ? -1.774  6.880   23.117 1.00 21.35 ? 195  GLU A CG  1 
ATOM   263  C  CD  . GLU A 1 43  ? -1.854  5.444   22.624 1.00 20.88 ? 195  GLU A CD  1 
ATOM   264  O  OE1 . GLU A 1 43  ? -2.982  4.927   22.448 1.00 19.74 ? 195  GLU A OE1 1 
ATOM   265  O  OE2 . GLU A 1 43  ? -0.784  4.837   22.410 1.00 20.41 ? 195  GLU A OE2 1 
ATOM   266  N  N   . ILE A 1 44  ? -3.249  7.299   27.515 1.00 22.94 ? 196  ILE A N   1 
ATOM   267  C  CA  . ILE A 1 44  ? -2.928  7.040   28.915 1.00 23.75 ? 196  ILE A CA  1 
ATOM   268  C  C   . ILE A 1 44  ? -3.982  7.539   29.912 1.00 24.51 ? 196  ILE A C   1 
ATOM   269  O  O   . ILE A 1 44  ? -3.847  7.320   31.119 1.00 24.46 ? 196  ILE A O   1 
ATOM   270  C  CB  . ILE A 1 44  ? -1.521  7.619   29.294 1.00 23.75 ? 196  ILE A CB  1 
ATOM   271  C  CG1 . ILE A 1 44  ? -1.464  9.139   29.050 1.00 23.71 ? 196  ILE A CG1 1 
ATOM   272  C  CG2 . ILE A 1 44  ? -0.408  6.870   28.550 1.00 23.01 ? 196  ILE A CG2 1 
ATOM   273  C  CD1 . ILE A 1 44  ? -0.148  9.803   29.470 1.00 23.78 ? 196  ILE A CD1 1 
ATOM   274  N  N   . GLU A 1 45  ? -5.029  8.196   29.411 1.00 25.49 ? 197  GLU A N   1 
ATOM   275  C  CA  . GLU A 1 45  ? -6.048  8.791   30.273 1.00 26.65 ? 197  GLU A CA  1 
ATOM   276  C  C   . GLU A 1 45  ? -6.669  7.772   31.229 1.00 26.86 ? 197  GLU A C   1 
ATOM   277  O  O   . GLU A 1 45  ? -7.045  6.675   30.817 1.00 27.03 ? 197  GLU A O   1 
ATOM   278  C  CB  . GLU A 1 45  ? -7.133  9.482   29.445 1.00 26.40 ? 197  GLU A CB  1 
ATOM   279  C  CG  . GLU A 1 45  ? -8.100  10.314  30.289 1.00 27.75 ? 197  GLU A CG  1 
ATOM   280  C  CD  . GLU A 1 45  ? -9.102  11.114  29.469 1.00 28.31 ? 197  GLU A CD  1 
ATOM   281  O  OE1 . GLU A 1 45  ? -9.353  10.759  28.286 1.00 30.55 ? 197  GLU A OE1 1 
ATOM   282  O  OE2 . GLU A 1 45  ? -9.643  12.102  30.022 1.00 29.84 ? 197  GLU A OE2 1 
ATOM   283  N  N   . GLY A 1 46  ? -6.749  8.145   32.507 1.00 27.35 ? 198  GLY A N   1 
ATOM   284  C  CA  . GLY A 1 46  ? -7.360  7.315   33.546 1.00 27.93 ? 198  GLY A CA  1 
ATOM   285  C  C   . GLY A 1 46  ? -6.498  6.166   34.034 1.00 28.54 ? 198  GLY A C   1 
ATOM   286  O  O   . GLY A 1 46  ? -6.920  5.379   34.877 1.00 28.40 ? 198  GLY A O   1 
ATOM   287  N  N   . ARG A 1 47  ? -5.275  6.088   33.519 1.00 29.42 ? 199  ARG A N   1 
ATOM   288  C  CA  . ARG A 1 47  ? -4.406  4.946   33.745 1.00 30.09 ? 199  ARG A CA  1 
ATOM   289  C  C   . ARG A 1 47  ? -3.065  5.385   34.326 1.00 30.31 ? 199  ARG A C   1 
ATOM   290  O  O   . ARG A 1 47  ? -2.301  4.566   34.838 1.00 30.36 ? 199  ARG A O   1 
ATOM   291  C  CB  . ARG A 1 47  ? -4.198  4.208   32.424 1.00 30.41 ? 199  ARG A CB  1 
ATOM   292  C  CG  . ARG A 1 47  ? -4.273  2.698   32.520 1.00 31.91 ? 199  ARG A CG  1 
ATOM   293  C  CD  . ARG A 1 47  ? -5.700  2.201   32.766 1.00 33.97 ? 199  ARG A CD  1 
ATOM   294  N  NE  . ARG A 1 47  ? -5.710  0.810   33.224 1.00 35.94 ? 199  ARG A NE  1 
ATOM   295  C  CZ  . ARG A 1 47  ? -5.499  0.422   34.483 1.00 36.61 ? 199  ARG A CZ  1 
ATOM   296  N  NH1 . ARG A 1 47  ? -5.255  1.313   35.435 1.00 36.70 ? 199  ARG A NH1 1 
ATOM   297  N  NH2 . ARG A 1 47  ? -5.527  -0.869  34.794 1.00 37.43 ? 199  ARG A NH2 1 
ATOM   298  N  N   . VAL A 1 48  ? -2.776  6.680   34.232 1.00 30.64 ? 200  VAL A N   1 
ATOM   299  C  CA  . VAL A 1 48  ? -1.566  7.238   34.822 1.00 30.81 ? 200  VAL A CA  1 
ATOM   300  C  C   . VAL A 1 48  ? -1.910  8.211   35.946 1.00 30.92 ? 200  VAL A C   1 
ATOM   301  O  O   . VAL A 1 48  ? -2.683  9.152   35.761 1.00 31.18 ? 200  VAL A O   1 
ATOM   302  C  CB  . VAL A 1 48  ? -0.650  7.917   33.770 1.00 30.90 ? 200  VAL A CB  1 
ATOM   303  C  CG1 . VAL A 1 48  ? 0.608   8.457   34.435 1.00 31.07 ? 200  VAL A CG1 1 
ATOM   304  C  CG2 . VAL A 1 48  ? -0.253  6.920   32.688 1.00 31.11 ? 200  VAL A CG2 1 
ATOM   305  N  N   . MET A 1 49  ? -1.340  7.962   37.117 1.00 30.89 ? 201  MET A N   1 
ATOM   306  C  CA  . MET A 1 49  ? -1.499  8.853   38.249 1.00 31.21 ? 201  MET A CA  1 
ATOM   307  C  C   . MET A 1 49  ? -0.297  9.789   38.347 1.00 30.18 ? 201  MET A C   1 
ATOM   308  O  O   . MET A 1 49  ? 0.842   9.343   38.483 1.00 29.83 ? 201  MET A O   1 
ATOM   309  C  CB  . MET A 1 49  ? -1.644  8.044   39.537 1.00 31.24 ? 201  MET A CB  1 
ATOM   310  C  CG  . MET A 1 49  ? -2.313  8.797   40.682 1.00 32.52 ? 201  MET A CG  1 
ATOM   311  S  SD  . MET A 1 49  ? -1.712  8.241   42.295 1.00 33.99 ? 201  MET A SD  1 
ATOM   312  C  CE  . MET A 1 49  ? -0.349  9.368   42.551 1.00 33.83 ? 201  MET A CE  1 
ATOM   313  N  N   . VAL A 1 50  ? -0.561  11.087  38.265 1.00 29.64 ? 202  VAL A N   1 
ATOM   314  C  CA  . VAL A 1 50  ? 0.460   12.100  38.501 1.00 28.99 ? 202  VAL A CA  1 
ATOM   315  C  C   . VAL A 1 50  ? 0.604   12.288  40.008 1.00 28.63 ? 202  VAL A C   1 
ATOM   316  O  O   . VAL A 1 50  ? -0.327  12.748  40.667 1.00 28.48 ? 202  VAL A O   1 
ATOM   317  C  CB  . VAL A 1 50  ? 0.092   13.446  37.822 1.00 28.93 ? 202  VAL A CB  1 
ATOM   318  C  CG1 . VAL A 1 50  ? 1.102   14.532  38.169 1.00 28.54 ? 202  VAL A CG1 1 
ATOM   319  C  CG2 . VAL A 1 50  ? -0.011  13.278  36.317 1.00 28.71 ? 202  VAL A CG2 1 
ATOM   320  N  N   . THR A 1 51  ? 1.760   11.909  40.554 1.00 28.35 ? 203  THR A N   1 
ATOM   321  C  CA  . THR A 1 51  ? 2.050   12.144  41.968 1.00 28.01 ? 203  THR A CA  1 
ATOM   322  C  C   . THR A 1 51  ? 2.294   13.638  42.189 1.00 28.35 ? 203  THR A C   1 
ATOM   323  O  O   . THR A 1 51  ? 2.446   14.393  41.232 1.00 28.37 ? 203  THR A O   1 
ATOM   324  C  CB  . THR A 1 51  ? 3.271   11.325  42.479 1.00 27.97 ? 203  THR A CB  1 
ATOM   325  O  OG1 . THR A 1 51  ? 4.481   11.824  41.890 1.00 27.23 ? 203  THR A OG1 1 
ATOM   326  C  CG2 . THR A 1 51  ? 3.117   9.835   42.176 1.00 27.29 ? 203  THR A CG2 1 
ATOM   327  N  N   . ASP A 1 52  ? 2.320   14.075  43.442 1.00 28.62 ? 204  ASP A N   1 
ATOM   328  C  CA  . ASP A 1 52  ? 2.645   15.471  43.709 1.00 29.12 ? 204  ASP A CA  1 
ATOM   329  C  C   . ASP A 1 52  ? 4.160   15.687  43.863 1.00 28.82 ? 204  ASP A C   1 
ATOM   330  O  O   . ASP A 1 52  ? 4.607   16.771  44.247 1.00 28.98 ? 204  ASP A O   1 
ATOM   331  C  CB  . ASP A 1 52  ? 1.843   16.030  44.899 1.00 29.41 ? 204  ASP A CB  1 
ATOM   332  C  CG  . ASP A 1 52  ? 1.882   15.128  46.125 1.00 31.18 ? 204  ASP A CG  1 
ATOM   333  O  OD1 . ASP A 1 52  ? 1.115   15.404  47.074 1.00 32.27 ? 204  ASP A OD1 1 
ATOM   334  O  OD2 . ASP A 1 52  ? 2.668   14.149  46.151 1.00 33.60 ? 204  ASP A OD2 1 
ATOM   335  N  N   . PHE A 1 53  ? 4.945   14.658  43.542 1.00 28.35 ? 205  PHE A N   1 
ATOM   336  C  CA  . PHE A 1 53  ? 6.394   14.793  43.575 1.00 27.83 ? 205  PHE A CA  1 
ATOM   337  C  C   . PHE A 1 53  ? 6.932   15.635  42.420 1.00 27.74 ? 205  PHE A C   1 
ATOM   338  O  O   . PHE A 1 53  ? 6.669   15.357  41.244 1.00 27.60 ? 205  PHE A O   1 
ATOM   339  C  CB  . PHE A 1 53  ? 7.112   13.442  43.618 1.00 27.52 ? 205  PHE A CB  1 
ATOM   340  C  CG  . PHE A 1 53  ? 8.580   13.574  43.888 1.00 27.49 ? 205  PHE A CG  1 
ATOM   341  C  CD1 . PHE A 1 53  ? 9.057   13.576  45.193 1.00 27.08 ? 205  PHE A CD1 1 
ATOM   342  C  CD2 . PHE A 1 53  ? 9.483   13.765  42.840 1.00 27.63 ? 205  PHE A CD2 1 
ATOM   343  C  CE1 . PHE A 1 53  ? 10.411  13.735  45.453 1.00 27.33 ? 205  PHE A CE1 1 
ATOM   344  C  CE2 . PHE A 1 53  ? 10.842  13.928  43.091 1.00 27.09 ? 205  PHE A CE2 1 
ATOM   345  C  CZ  . PHE A 1 53  ? 11.306  13.914  44.399 1.00 27.47 ? 205  PHE A CZ  1 
ATOM   346  N  N   . GLU A 1 54  ? 7.690   16.665  42.782 1.00 27.58 ? 206  GLU A N   1 
ATOM   347  C  CA  . GLU A 1 54  ? 8.386   17.508  41.826 1.00 27.75 ? 206  GLU A CA  1 
ATOM   348  C  C   . GLU A 1 54  ? 9.711   17.983  42.425 1.00 27.45 ? 206  GLU A C   1 
ATOM   349  O  O   . GLU A 1 54  ? 9.728   18.616  43.480 1.00 27.13 ? 206  GLU A O   1 
ATOM   350  C  CB  . GLU A 1 54  ? 7.511   18.694  41.421 1.00 27.92 ? 206  GLU A CB  1 
ATOM   351  C  CG  . GLU A 1 54  ? 8.165   19.634  40.426 1.00 29.49 ? 206  GLU A CG  1 
ATOM   352  C  CD  . GLU A 1 54  ? 7.170   20.542  39.743 1.00 31.83 ? 206  GLU A CD  1 
ATOM   353  O  OE1 . GLU A 1 54  ? 6.099   20.048  39.326 1.00 33.58 ? 206  GLU A OE1 1 
ATOM   354  O  OE2 . GLU A 1 54  ? 7.459   21.749  39.612 1.00 33.21 ? 206  GLU A OE2 1 
ATOM   355  N  N   . ASN A 1 55  ? 10.815  17.639  41.761 1.00 27.28 ? 207  ASN A N   1 
ATOM   356  C  CA  . ASN A 1 55  ? 12.143  18.114  42.150 1.00 27.18 ? 207  ASN A CA  1 
ATOM   357  C  C   . ASN A 1 55  ? 13.003  18.385  40.915 1.00 27.38 ? 207  ASN A C   1 
ATOM   358  O  O   . ASN A 1 55  ? 13.736  17.507  40.443 1.00 27.42 ? 207  ASN A O   1 
ATOM   359  C  CB  . ASN A 1 55  ? 12.829  17.137  43.115 1.00 26.86 ? 207  ASN A CB  1 
ATOM   360  C  CG  . ASN A 1 55  ? 13.961  17.790  43.911 1.00 26.73 ? 207  ASN A CG  1 
ATOM   361  O  OD1 . ASN A 1 55  ? 14.896  18.355  43.343 1.00 26.58 ? 207  ASN A OD1 1 
ATOM   362  N  ND2 . ASN A 1 55  ? 13.881  17.703  45.232 1.00 26.25 ? 207  ASN A ND2 1 
ATOM   363  N  N   . VAL A 1 56  ? 12.893  19.605  40.393 1.00 27.51 ? 208  VAL A N   1 
ATOM   364  C  CA  . VAL A 1 56  ? 13.551  19.975  39.140 1.00 27.94 ? 208  VAL A CA  1 
ATOM   365  C  C   . VAL A 1 56  ? 14.436  21.218  39.297 1.00 28.54 ? 208  VAL A C   1 
ATOM   366  O  O   . VAL A 1 56  ? 14.106  22.120  40.073 1.00 28.28 ? 208  VAL A O   1 
ATOM   367  C  CB  . VAL A 1 56  ? 12.528  20.183  37.969 1.00 27.87 ? 208  VAL A CB  1 
ATOM   368  C  CG1 . VAL A 1 56  ? 11.643  18.948  37.785 1.00 27.44 ? 208  VAL A CG1 1 
ATOM   369  C  CG2 . VAL A 1 56  ? 11.669  21.446  38.172 1.00 27.40 ? 208  VAL A CG2 1 
ATOM   370  N  N   . PRO A 1 57  ? 15.566  21.266  38.562 1.00 29.22 ? 209  PRO A N   1 
ATOM   371  C  CA  . PRO A 1 57  ? 16.374  22.481  38.523 1.00 30.15 ? 209  PRO A CA  1 
ATOM   372  C  C   . PRO A 1 57  ? 15.727  23.541  37.629 1.00 31.41 ? 209  PRO A C   1 
ATOM   373  O  O   . PRO A 1 57  ? 14.900  23.211  36.773 1.00 31.39 ? 209  PRO A O   1 
ATOM   374  C  CB  . PRO A 1 57  ? 17.693  21.997  37.923 1.00 29.76 ? 209  PRO A CB  1 
ATOM   375  C  CG  . PRO A 1 57  ? 17.313  20.854  37.069 1.00 29.34 ? 209  PRO A CG  1 
ATOM   376  C  CD  . PRO A 1 57  ? 16.150  20.190  37.740 1.00 29.08 ? 209  PRO A CD  1 
ATOM   377  N  N   . GLU A 1 58  ? 16.087  24.806  37.832 1.00 33.10 ? 210  GLU A N   1 
ATOM   378  C  CA  . GLU A 1 58  ? 15.553  25.885  36.997 1.00 34.96 ? 210  GLU A CA  1 
ATOM   379  C  C   . GLU A 1 58  ? 16.048  25.772  35.550 1.00 35.47 ? 210  GLU A C   1 
ATOM   380  O  O   . GLU A 1 58  ? 17.055  25.113  35.280 1.00 35.28 ? 210  GLU A O   1 
ATOM   381  C  CB  . GLU A 1 58  ? 15.874  27.265  37.593 1.00 34.91 ? 210  GLU A CB  1 
ATOM   382  C  CG  . GLU A 1 58  ? 17.345  27.516  37.902 1.00 35.98 ? 210  GLU A CG  1 
ATOM   383  C  CD  . GLU A 1 58  ? 17.590  28.893  38.513 1.00 36.53 ? 210  GLU A CD  1 
ATOM   384  O  OE1 . GLU A 1 58  ? 17.598  29.890  37.753 1.00 38.33 ? 210  GLU A OE1 1 
ATOM   385  O  OE2 . GLU A 1 58  ? 17.788  28.977  39.751 1.00 38.26 ? 210  GLU A OE2 1 
ATOM   386  N  N   . GLU A 1 59  ? 15.323  26.404  34.630 1.00 36.71 ? 211  GLU A N   1 
ATOM   387  C  CA  . GLU A 1 59  ? 15.699  26.415  33.217 1.00 38.04 ? 211  GLU A CA  1 
ATOM   388  C  C   . GLU A 1 59  ? 16.881  27.340  32.939 1.00 38.73 ? 211  GLU A C   1 
ATOM   389  O  O   . GLU A 1 59  ? 17.058  28.347  33.624 1.00 38.84 ? 211  GLU A O   1 
ATOM   390  C  CB  . GLU A 1 59  ? 14.507  26.805  32.341 1.00 38.16 ? 211  GLU A CB  1 
ATOM   391  C  CG  . GLU A 1 59  ? 13.689  25.619  31.833 1.00 39.39 ? 211  GLU A CG  1 
ATOM   392  C  CD  . GLU A 1 59  ? 12.481  25.314  32.694 1.00 40.75 ? 211  GLU A CD  1 
ATOM   393  O  OE1 . GLU A 1 59  ? 12.645  24.903  33.864 1.00 41.56 ? 211  GLU A OE1 1 
ATOM   394  O  OE2 . GLU A 1 59  ? 11.355  25.478  32.186 1.00 41.77 ? 211  GLU A OE2 1 
ATOM   395  N  N   . ASP A 1 60  ? 17.689  26.974  31.941 1.00 39.73 ? 212  ASP A N   1 
ATOM   396  C  CA  . ASP A 1 60  ? 18.809  27.797  31.468 1.00 40.69 ? 212  ASP A CA  1 
ATOM   397  C  C   . ASP A 1 60  ? 19.268  27.380  30.073 1.00 40.93 ? 212  ASP A C   1 
ATOM   398  O  O   . ASP A 1 60  ? 19.025  28.088  29.095 1.00 41.42 ? 212  ASP A O   1 
ATOM   399  C  CB  . ASP A 1 60  ? 19.992  27.769  32.452 1.00 41.08 ? 212  ASP A CB  1 
ATOM   400  C  CG  . ASP A 1 60  ? 20.619  26.384  32.605 1.00 42.29 ? 212  ASP A CG  1 
ATOM   401  O  OD1 . ASP A 1 60  ? 19.948  25.364  32.311 1.00 43.40 ? 212  ASP A OD1 1 
ATOM   402  O  OD2 . ASP A 1 60  ? 21.796  26.324  33.039 1.00 43.22 ? 212  ASP A OD2 1 
ATOM   403  N  N   . SER A 1 69  ? 2.268   21.074  25.262 1.00 35.50 ? 221  SER A N   1 
ATOM   404  C  CA  . SER A 1 69  ? 3.154   20.995  24.106 1.00 35.48 ? 221  SER A CA  1 
ATOM   405  C  C   . SER A 1 69  ? 4.540   20.468  24.502 1.00 35.05 ? 221  SER A C   1 
ATOM   406  O  O   . SER A 1 69  ? 4.721   19.257  24.627 1.00 35.66 ? 221  SER A O   1 
ATOM   407  C  CB  . SER A 1 69  ? 3.247   22.358  23.399 1.00 35.88 ? 221  SER A CB  1 
ATOM   408  O  OG  . SER A 1 69  ? 3.605   22.221  22.030 1.00 36.85 ? 221  SER A OG  1 
ATOM   409  N  N   . LYS A 1 70  ? 5.497   21.363  24.746 1.00 34.22 ? 222  LYS A N   1 
ATOM   410  C  CA  . LYS A 1 70  ? 6.915   20.982  24.825 1.00 33.17 ? 222  LYS A CA  1 
ATOM   411  C  C   . LYS A 1 70  ? 7.452   20.468  26.175 1.00 32.16 ? 222  LYS A C   1 
ATOM   412  O  O   . LYS A 1 70  ? 8.210   19.498  26.182 1.00 32.12 ? 222  LYS A O   1 
ATOM   413  C  CB  . LYS A 1 70  ? 7.807   22.108  24.279 1.00 33.54 ? 222  LYS A CB  1 
ATOM   414  C  CG  . LYS A 1 70  ? 9.150   21.632  23.749 1.00 34.08 ? 222  LYS A CG  1 
ATOM   415  C  CD  . LYS A 1 70  ? 9.006   20.924  22.398 1.00 34.64 ? 222  LYS A CD  1 
ATOM   416  C  CE  . LYS A 1 70  ? 9.799   19.617  22.361 1.00 35.09 ? 222  LYS A CE  1 
ATOM   417  N  NZ  . LYS A 1 70  ? 11.163  19.724  22.965 1.00 34.33 ? 222  LYS A NZ  1 
ATOM   418  N  N   . CYS A 1 71  ? 7.083   21.101  27.294 1.00 30.85 ? 223  CYS A N   1 
ATOM   419  C  CA  . CYS A 1 71  ? 7.553   20.663  28.632 1.00 29.72 ? 223  CYS A CA  1 
ATOM   420  C  C   . CYS A 1 71  ? 7.323   19.182  28.930 1.00 28.56 ? 223  CYS A C   1 
ATOM   421  O  O   . CYS A 1 71  ? 8.166   18.531  29.559 1.00 28.42 ? 223  CYS A O   1 
ATOM   422  C  CB  . CYS A 1 71  ? 6.910   21.475  29.770 1.00 29.70 ? 223  CYS A CB  1 
ATOM   423  S  SG  . CYS A 1 71  ? 7.500   23.171  29.954 1.00 31.26 ? 223  CYS A SG  1 
ATOM   424  N  N   . ASP A 1 72  ? 6.176   18.667  28.494 1.00 27.06 ? 224  ASP A N   1 
ATOM   425  C  CA  . ASP A 1 72  ? 5.751   17.308  28.827 1.00 25.81 ? 224  ASP A CA  1 
ATOM   426  C  C   . ASP A 1 72  ? 5.899   16.271  27.706 1.00 24.81 ? 224  ASP A C   1 
ATOM   427  O  O   . ASP A 1 72  ? 5.375   15.156  27.817 1.00 24.62 ? 224  ASP A O   1 
ATOM   428  C  CB  . ASP A 1 72  ? 4.309   17.314  29.366 1.00 25.82 ? 224  ASP A CB  1 
ATOM   429  C  CG  . ASP A 1 72  ? 3.324   18.017  28.443 1.00 26.31 ? 224  ASP A CG  1 
ATOM   430  O  OD1 . ASP A 1 72  ? 3.706   18.466  27.334 1.00 26.53 ? 224  ASP A OD1 1 
ATOM   431  O  OD2 . ASP A 1 72  ? 2.145   18.120  28.842 1.00 27.19 ? 224  ASP A OD2 1 
ATOM   432  N  N   . SER A 1 73  ? 6.630   16.623  26.651 1.00 23.54 ? 225  SER A N   1 
ATOM   433  C  CA  . SER A 1 73  ? 6.694   15.784  25.452 1.00 22.68 ? 225  SER A CA  1 
ATOM   434  C  C   . SER A 1 73  ? 7.444   14.457  25.642 1.00 21.96 ? 225  SER A C   1 
ATOM   435  O  O   . SER A 1 73  ? 6.958   13.405  25.213 1.00 21.76 ? 225  SER A O   1 
ATOM   436  C  CB  . SER A 1 73  ? 7.209   16.574  24.234 1.00 22.69 ? 225  SER A CB  1 
ATOM   437  O  OG  . SER A 1 73  ? 8.589   16.858  24.319 1.00 23.00 ? 225  SER A OG  1 
ATOM   438  N  N   . HIS A 1 74  ? 8.605   14.516  26.295 1.00 21.16 ? 226  HIS A N   1 
ATOM   439  C  CA  . HIS A 1 74  ? 9.423   13.335  26.575 1.00 20.47 ? 226  HIS A CA  1 
ATOM   440  C  C   . HIS A 1 74  ? 8.663   12.314  27.424 1.00 20.29 ? 226  HIS A C   1 
ATOM   441  O  O   . HIS A 1 74  ? 8.561   11.141  27.042 1.00 20.34 ? 226  HIS A O   1 
ATOM   442  C  CB  . HIS A 1 74  ? 10.735  13.754  27.264 1.00 20.61 ? 226  HIS A CB  1 
ATOM   443  C  CG  . HIS A 1 74  ? 11.757  12.661  27.366 1.00 20.35 ? 226  HIS A CG  1 
ATOM   444  N  ND1 . HIS A 1 74  ? 12.077  12.046  28.560 1.00 20.92 ? 226  HIS A ND1 1 
ATOM   445  C  CD2 . HIS A 1 74  ? 12.536  12.079  26.423 1.00 19.73 ? 226  HIS A CD2 1 
ATOM   446  C  CE1 . HIS A 1 74  ? 13.005  11.129  28.346 1.00 20.74 ? 226  HIS A CE1 1 
ATOM   447  N  NE2 . HIS A 1 74  ? 13.298  11.126  27.056 1.00 20.39 ? 226  HIS A NE2 1 
ATOM   448  N  N   . GLY A 1 75  ? 8.117   12.769  28.557 1.00 19.78 ? 227  GLY A N   1 
ATOM   449  C  CA  . GLY A 1 75  ? 7.437   11.897  29.520 1.00 19.23 ? 227  GLY A CA  1 
ATOM   450  C  C   . GLY A 1 75  ? 6.146   11.294  29.014 1.00 19.22 ? 227  GLY A C   1 
ATOM   451  O  O   . GLY A 1 75  ? 5.864   10.114  29.254 1.00 19.35 ? 227  GLY A O   1 
ATOM   452  N  N   . THR A 1 76  ? 5.360   12.104  28.307 1.00 19.02 ? 228  THR A N   1 
ATOM   453  C  CA  . THR A 1 76  ? 4.108   11.650  27.706 1.00 18.62 ? 228  THR A CA  1 
ATOM   454  C  C   . THR A 1 76  ? 4.359   10.530  26.699 1.00 18.59 ? 228  THR A C   1 
ATOM   455  O  O   . THR A 1 76  ? 3.655   9.507   26.707 1.00 18.56 ? 228  THR A O   1 
ATOM   456  C  CB  . THR A 1 76  ? 3.365   12.814  27.033 1.00 18.64 ? 228  THR A CB  1 
ATOM   457  O  OG1 . THR A 1 76  ? 3.280   13.907  27.955 1.00 18.22 ? 228  THR A OG1 1 
ATOM   458  C  CG2 . THR A 1 76  ? 1.962   12.400  26.604 1.00 18.04 ? 228  THR A CG2 1 
ATOM   459  N  N   . HIS A 1 77  ? 5.367   10.722  25.845 1.00 18.16 ? 229  HIS A N   1 
ATOM   460  C  CA  . HIS A 1 77  ? 5.720   9.727   24.843 1.00 18.00 ? 229  HIS A CA  1 
ATOM   461  C  C   . HIS A 1 77  ? 6.084   8.399   25.501 1.00 18.16 ? 229  HIS A C   1 
ATOM   462  O  O   . HIS A 1 77  ? 5.628   7.339   25.067 1.00 18.08 ? 229  HIS A O   1 
ATOM   463  C  CB  . HIS A 1 77  ? 6.860   10.225  23.937 1.00 17.98 ? 229  HIS A CB  1 
ATOM   464  C  CG  . HIS A 1 77  ? 7.125   9.338   22.756 1.00 16.67 ? 229  HIS A CG  1 
ATOM   465  N  ND1 . HIS A 1 77  ? 8.052   8.318   22.783 1.00 16.46 ? 229  HIS A ND1 1 
ATOM   466  C  CD2 . HIS A 1 77  ? 6.571   9.308   21.522 1.00 15.91 ? 229  HIS A CD2 1 
ATOM   467  C  CE1 . HIS A 1 77  ? 8.060   7.699   21.616 1.00 15.73 ? 229  HIS A CE1 1 
ATOM   468  N  NE2 . HIS A 1 77  ? 7.174   8.283   20.831 1.00 15.98 ? 229  HIS A NE2 1 
ATOM   469  N  N   . LEU A 1 78  ? 6.884   8.474   26.561 1.00 18.53 ? 230  LEU A N   1 
ATOM   470  C  CA  . LEU A 1 78  ? 7.353   7.291   27.285 1.00 18.68 ? 230  LEU A CA  1 
ATOM   471  C  C   . LEU A 1 78  ? 6.257   6.587   28.073 1.00 18.78 ? 230  LEU A C   1 
ATOM   472  O  O   . LEU A 1 78  ? 6.250   5.357   28.155 1.00 19.49 ? 230  LEU A O   1 
ATOM   473  C  CB  . LEU A 1 78  ? 8.532   7.648   28.195 1.00 18.73 ? 230  LEU A CB  1 
ATOM   474  C  CG  . LEU A 1 78  ? 9.807   8.064   27.454 1.00 19.10 ? 230  LEU A CG  1 
ATOM   475  C  CD1 . LEU A 1 78  ? 10.854  8.517   28.440 1.00 19.50 ? 230  LEU A CD1 1 
ATOM   476  C  CD2 . LEU A 1 78  ? 10.337  6.926   26.602 1.00 18.80 ? 230  LEU A CD2 1 
ATOM   477  N  N   . ALA A 1 79  ? 5.343   7.360   28.656 1.00 18.71 ? 231  ALA A N   1 
ATOM   478  C  CA  . ALA A 1 79  ? 4.139   6.806   29.276 1.00 18.65 ? 231  ALA A CA  1 
ATOM   479  C  C   . ALA A 1 79  ? 3.319   6.036   28.245 1.00 18.81 ? 231  ALA A C   1 
ATOM   480  O  O   . ALA A 1 79  ? 2.783   4.966   28.542 1.00 19.08 ? 231  ALA A O   1 
ATOM   481  C  CB  . ALA A 1 79  ? 3.300   7.910   29.907 1.00 18.36 ? 231  ALA A CB  1 
ATOM   482  N  N   . GLY A 1 80  ? 3.229   6.593   27.035 1.00 18.93 ? 232  GLY A N   1 
ATOM   483  C  CA  . GLY A 1 80  ? 2.569   5.938   25.904 1.00 19.06 ? 232  GLY A CA  1 
ATOM   484  C  C   . GLY A 1 80  ? 3.267   4.678   25.418 1.00 19.01 ? 232  GLY A C   1 
ATOM   485  O  O   . GLY A 1 80  ? 2.614   3.701   25.088 1.00 19.29 ? 232  GLY A O   1 
ATOM   486  N  N   . VAL A 1 81  ? 4.595   4.695   25.379 1.00 19.24 ? 233  VAL A N   1 
ATOM   487  C  CA  . VAL A 1 81  ? 5.379   3.507   24.989 1.00 19.22 ? 233  VAL A CA  1 
ATOM   488  C  C   . VAL A 1 81  ? 5.169   2.334   25.958 1.00 19.34 ? 233  VAL A C   1 
ATOM   489  O  O   . VAL A 1 81  ? 5.042   1.188   25.528 1.00 19.53 ? 233  VAL A O   1 
ATOM   490  C  CB  . VAL A 1 81  ? 6.906   3.828   24.827 1.00 19.09 ? 233  VAL A CB  1 
ATOM   491  C  CG1 . VAL A 1 81  ? 7.704   2.570   24.487 1.00 18.77 ? 233  VAL A CG1 1 
ATOM   492  C  CG2 . VAL A 1 81  ? 7.123   4.871   23.754 1.00 18.51 ? 233  VAL A CG2 1 
ATOM   493  N  N   . VAL A 1 82  ? 5.133   2.630   27.257 1.00 19.36 ? 234  VAL A N   1 
ATOM   494  C  CA  . VAL A 1 82  ? 4.916   1.613   28.290 1.00 19.16 ? 234  VAL A CA  1 
ATOM   495  C  C   . VAL A 1 82  ? 3.476   1.079   28.275 1.00 19.49 ? 234  VAL A C   1 
ATOM   496  O  O   . VAL A 1 82  ? 3.260   -0.135  28.326 1.00 19.59 ? 234  VAL A O   1 
ATOM   497  C  CB  . VAL A 1 82  ? 5.272   2.146   29.722 1.00 18.87 ? 234  VAL A CB  1 
ATOM   498  C  CG1 . VAL A 1 82  ? 4.944   1.119   30.792 1.00 18.54 ? 234  VAL A CG1 1 
ATOM   499  C  CG2 . VAL A 1 82  ? 6.743   2.525   29.820 1.00 18.76 ? 234  VAL A CG2 1 
ATOM   500  N  N   . SER A 1 83  ? 2.504   1.984   28.179 1.00 19.81 ? 235  SER A N   1 
ATOM   501  C  CA  . SER A 1 83  ? 1.119   1.655   28.512 1.00 20.25 ? 235  SER A CA  1 
ATOM   502  C  C   . SER A 1 83  ? 0.049   2.241   27.592 1.00 20.67 ? 235  SER A C   1 
ATOM   503  O  O   . SER A 1 83  ? -1.138  2.157   27.915 1.00 20.90 ? 235  SER A O   1 
ATOM   504  C  CB  . SER A 1 83  ? 0.825   2.118   29.940 1.00 20.48 ? 235  SER A CB  1 
ATOM   505  O  OG  . SER A 1 83  ? 0.729   3.537   30.002 1.00 20.86 ? 235  SER A OG  1 
ATOM   506  N  N   . GLY A 1 84  ? 0.449   2.842   26.471 1.00 20.81 ? 236  GLY A N   1 
ATOM   507  C  CA  . GLY A 1 84  ? -0.514  3.458   25.556 1.00 21.51 ? 236  GLY A CA  1 
ATOM   508  C  C   . GLY A 1 84  ? -1.527  2.445   25.064 1.00 21.95 ? 236  GLY A C   1 
ATOM   509  O  O   . GLY A 1 84  ? -1.168  1.299   24.788 1.00 21.99 ? 236  GLY A O   1 
ATOM   510  N  N   . ARG A 1 85  ? -2.792  2.856   24.963 1.00 22.50 ? 237  ARG A N   1 
ATOM   511  C  CA  . ARG A 1 85  ? -3.865  1.930   24.571 1.00 23.38 ? 237  ARG A CA  1 
ATOM   512  C  C   . ARG A 1 85  ? -3.758  1.410   23.130 1.00 22.82 ? 237  ARG A C   1 
ATOM   513  O  O   . ARG A 1 85  ? -4.161  0.279   22.854 1.00 22.88 ? 237  ARG A O   1 
ATOM   514  C  CB  . ARG A 1 85  ? -5.266  2.489   24.879 1.00 23.22 ? 237  ARG A CB  1 
ATOM   515  C  CG  . ARG A 1 85  ? -5.610  3.807   24.205 1.00 25.15 ? 237  ARG A CG  1 
ATOM   516  C  CD  . ARG A 1 85  ? -7.121  4.043   24.166 1.00 25.60 ? 237  ARG A CD  1 
ATOM   517  N  NE  . ARG A 1 85  ? -7.788  3.200   23.170 1.00 31.04 ? 237  ARG A NE  1 
ATOM   518  C  CZ  . ARG A 1 85  ? -8.290  3.630   22.009 1.00 33.35 ? 237  ARG A CZ  1 
ATOM   519  N  NH1 . ARG A 1 85  ? -8.224  4.916   21.669 1.00 34.29 ? 237  ARG A NH1 1 
ATOM   520  N  NH2 . ARG A 1 85  ? -8.872  2.766   21.183 1.00 33.95 ? 237  ARG A NH2 1 
ATOM   521  N  N   . ASP A 1 86  ? -3.203  2.222   22.229 1.00 22.56 ? 238  ASP A N   1 
ATOM   522  C  CA  . ASP A 1 86  ? -3.003  1.806   20.839 1.00 22.35 ? 238  ASP A CA  1 
ATOM   523  C  C   . ASP A 1 86  ? -1.566  1.412   20.521 1.00 22.19 ? 238  ASP A C   1 
ATOM   524  O  O   . ASP A 1 86  ? -1.331  0.407   19.848 1.00 22.25 ? 238  ASP A O   1 
ATOM   525  C  CB  . ASP A 1 86  ? -3.452  2.894   19.858 1.00 22.49 ? 238  ASP A CB  1 
ATOM   526  C  CG  . ASP A 1 86  ? -4.952  3.076   19.824 1.00 22.35 ? 238  ASP A CG  1 
ATOM   527  O  OD1 . ASP A 1 86  ? -5.693  2.134   20.176 1.00 22.65 ? 238  ASP A OD1 1 
ATOM   528  O  OD2 . ASP A 1 86  ? -5.391  4.177   19.437 1.00 23.46 ? 238  ASP A OD2 1 
ATOM   529  N  N   . ALA A 1 87  ? -0.614  2.210   21.001 1.00 21.79 ? 239  ALA A N   1 
ATOM   530  C  CA  . ALA A 1 87  ? 0.787   2.068   20.612 1.00 21.58 ? 239  ALA A CA  1 
ATOM   531  C  C   . ALA A 1 87  ? 1.718   1.623   21.749 1.00 21.78 ? 239  ALA A C   1 
ATOM   532  O  O   . ALA A 1 87  ? 2.942   1.699   21.616 1.00 21.65 ? 239  ALA A O   1 
ATOM   533  C  CB  . ALA A 1 87  ? 1.285   3.380   19.983 1.00 21.49 ? 239  ALA A CB  1 
ATOM   534  N  N   . GLY A 1 88  ? 1.142   1.146   22.853 1.00 21.82 ? 240  GLY A N   1 
ATOM   535  C  CA  . GLY A 1 88  ? 1.930   0.727   24.012 1.00 21.92 ? 240  GLY A CA  1 
ATOM   536  C  C   . GLY A 1 88  ? 2.285   -0.745  24.043 1.00 22.06 ? 240  GLY A C   1 
ATOM   537  O  O   . GLY A 1 88  ? 1.665   -1.560  23.364 1.00 22.17 ? 240  GLY A O   1 
ATOM   538  N  N   . VAL A 1 89  ? 3.289   -1.080  24.847 1.00 22.46 ? 241  VAL A N   1 
ATOM   539  C  CA  . VAL A 1 89  ? 3.744   -2.461  25.017 1.00 22.72 ? 241  VAL A CA  1 
ATOM   540  C  C   . VAL A 1 89  ? 2.794   -3.230  25.934 1.00 23.23 ? 241  VAL A C   1 
ATOM   541  O  O   . VAL A 1 89  ? 2.213   -4.244  25.531 1.00 23.21 ? 241  VAL A O   1 
ATOM   542  C  CB  . VAL A 1 89  ? 5.186   -2.513  25.582 1.00 22.65 ? 241  VAL A CB  1 
ATOM   543  C  CG1 . VAL A 1 89  ? 5.581   -3.944  25.967 1.00 22.15 ? 241  VAL A CG1 1 
ATOM   544  C  CG2 . VAL A 1 89  ? 6.173   -1.917  24.586 1.00 22.04 ? 241  VAL A CG2 1 
ATOM   545  N  N   . ALA A 1 90  ? 2.658   -2.744  27.168 1.00 23.88 ? 242  ALA A N   1 
ATOM   546  C  CA  . ALA A 1 90  ? 1.734   -3.301  28.146 1.00 24.35 ? 242  ALA A CA  1 
ATOM   547  C  C   . ALA A 1 90  ? 0.498   -2.406  28.213 1.00 24.95 ? 242  ALA A C   1 
ATOM   548  O  O   . ALA A 1 90  ? 0.359   -1.582  29.118 1.00 25.09 ? 242  ALA A O   1 
ATOM   549  C  CB  . ALA A 1 90  ? 2.417   -3.412  29.510 1.00 24.17 ? 242  ALA A CB  1 
ATOM   550  N  N   . LYS A 1 91  ? -0.394  -2.585  27.242 1.00 25.89 ? 243  LYS A N   1 
ATOM   551  C  CA  . LYS A 1 91  ? -1.556  -1.708  27.024 1.00 26.83 ? 243  LYS A CA  1 
ATOM   552  C  C   . LYS A 1 91  ? -2.419  -1.456  28.270 1.00 27.65 ? 243  LYS A C   1 
ATOM   553  O  O   . LYS A 1 91  ? -3.005  -0.377  28.428 1.00 28.19 ? 243  LYS A O   1 
ATOM   554  C  CB  . LYS A 1 91  ? -2.397  -2.218  25.844 1.00 26.76 ? 243  LYS A CB  1 
ATOM   555  C  CG  . LYS A 1 91  ? -1.690  -2.051  24.495 1.00 26.55 ? 243  LYS A CG  1 
ATOM   556  C  CD  . LYS A 1 91  ? -2.382  -2.801  23.371 1.00 26.59 ? 243  LYS A CD  1 
ATOM   557  C  CE  . LYS A 1 91  ? -1.759  -2.487  22.007 1.00 26.30 ? 243  LYS A CE  1 
ATOM   558  N  NZ  . LYS A 1 91  ? -0.293  -2.780  21.935 1.00 26.11 ? 243  LYS A NZ  1 
ATOM   559  N  N   . GLY A 1 92  ? -2.476  -2.434  29.167 1.00 28.13 ? 244  GLY A N   1 
ATOM   560  C  CA  . GLY A 1 92  ? -3.075  -2.204  30.483 1.00 28.73 ? 244  GLY A CA  1 
ATOM   561  C  C   . GLY A 1 92  ? -2.344  -1.151  31.318 1.00 28.79 ? 244  GLY A C   1 
ATOM   562  O  O   . GLY A 1 92  ? -2.873  -0.059  31.556 1.00 28.87 ? 244  GLY A O   1 
ATOM   563  N  N   . ALA A 1 93  ? -1.113  -1.495  31.709 1.00 28.57 ? 245  ALA A N   1 
ATOM   564  C  CA  . ALA A 1 93  ? -0.312  -0.857  32.776 1.00 28.18 ? 245  ALA A CA  1 
ATOM   565  C  C   . ALA A 1 93  ? -0.861  0.360   33.517 1.00 28.03 ? 245  ALA A C   1 
ATOM   566  O  O   . ALA A 1 93  ? -1.164  1.388   32.909 1.00 28.18 ? 245  ALA A O   1 
ATOM   567  C  CB  . ALA A 1 93  ? 1.123   -0.591  32.290 1.00 28.20 ? 245  ALA A CB  1 
ATOM   568  N  N   . SER A 1 94  ? -0.970  0.228   34.839 1.00 27.69 ? 246  SER A N   1 
ATOM   569  C  CA  . SER A 1 94  ? -1.148  1.371   35.728 1.00 27.55 ? 246  SER A CA  1 
ATOM   570  C  C   . SER A 1 94  ? 0.209   2.027   35.927 1.00 27.01 ? 246  SER A C   1 
ATOM   571  O  O   . SER A 1 94  ? 1.208   1.340   36.162 1.00 27.01 ? 246  SER A O   1 
ATOM   572  C  CB  . SER A 1 94  ? -1.689  0.932   37.089 1.00 27.59 ? 246  SER A CB  1 
ATOM   573  O  OG  . SER A 1 94  ? -3.022  0.475   36.984 1.00 29.60 ? 246  SER A OG  1 
ATOM   574  N  N   . MET A 1 95  ? 0.246   3.351   35.839 1.00 26.36 ? 247  MET A N   1 
ATOM   575  C  CA  . MET A 1 95  ? 1.500   4.079   35.985 1.00 25.87 ? 247  MET A CA  1 
ATOM   576  C  C   . MET A 1 95  ? 1.404   5.223   36.977 1.00 25.52 ? 247  MET A C   1 
ATOM   577  O  O   . MET A 1 95  ? 0.312   5.722   37.261 1.00 25.42 ? 247  MET A O   1 
ATOM   578  C  CB  . MET A 1 95  ? 1.988   4.591   34.632 1.00 25.81 ? 247  MET A CB  1 
ATOM   579  C  CG  . MET A 1 95  ? 2.484   3.492   33.711 1.00 25.38 ? 247  MET A CG  1 
ATOM   580  S  SD  . MET A 1 95  ? 3.141   4.151   32.181 1.00 26.11 ? 247  MET A SD  1 
ATOM   581  C  CE  . MET A 1 95  ? 4.770   4.704   32.710 1.00 24.58 ? 247  MET A CE  1 
ATOM   582  N  N   . ARG A 1 96  ? 2.560   5.614   37.511 1.00 25.00 ? 248  ARG A N   1 
ATOM   583  C  CA  . ARG A 1 96  ? 2.660   6.724   38.452 1.00 24.80 ? 248  ARG A CA  1 
ATOM   584  C  C   . ARG A 1 96  ? 3.861   7.581   38.089 1.00 24.10 ? 248  ARG A C   1 
ATOM   585  O  O   . ARG A 1 96  ? 4.991   7.099   38.058 1.00 24.10 ? 248  ARG A O   1 
ATOM   586  C  CB  . ARG A 1 96  ? 2.804   6.217   39.886 1.00 25.04 ? 248  ARG A CB  1 
ATOM   587  C  CG  . ARG A 1 96  ? 1.592   5.508   40.449 1.00 26.19 ? 248  ARG A CG  1 
ATOM   588  C  CD  . ARG A 1 96  ? 1.960   4.876   41.773 1.00 29.04 ? 248  ARG A CD  1 
ATOM   589  N  NE  . ARG A 1 96  ? 0.863   4.124   42.370 1.00 31.65 ? 248  ARG A NE  1 
ATOM   590  C  CZ  . ARG A 1 96  ? 0.029   4.605   43.288 1.00 33.18 ? 248  ARG A CZ  1 
ATOM   591  N  NH1 . ARG A 1 96  ? -0.935  3.831   43.768 1.00 33.59 ? 248  ARG A NH1 1 
ATOM   592  N  NH2 . ARG A 1 96  ? 0.154   5.855   43.727 1.00 33.95 ? 248  ARG A NH2 1 
ATOM   593  N  N   . SER A 1 97  ? 3.619   8.854   37.811 1.00 23.47 ? 249  SER A N   1 
ATOM   594  C  CA  . SER A 1 97  ? 4.694   9.716   37.361 1.00 23.03 ? 249  SER A CA  1 
ATOM   595  C  C   . SER A 1 97  ? 5.227   10.615  38.468 1.00 22.36 ? 249  SER A C   1 
ATOM   596  O  O   . SER A 1 97  ? 4.463   11.192  39.238 1.00 22.11 ? 249  SER A O   1 
ATOM   597  C  CB  . SER A 1 97  ? 4.271   10.531  36.139 1.00 22.94 ? 249  SER A CB  1 
ATOM   598  O  OG  . SER A 1 97  ? 3.476   11.633  36.517 1.00 24.45 ? 249  SER A OG  1 
ATOM   599  N  N   . LEU A 1 98  ? 6.553   10.696  38.539 1.00 22.00 ? 250  LEU A N   1 
ATOM   600  C  CA  . LEU A 1 98  ? 7.261   11.655  39.377 1.00 21.42 ? 250  LEU A CA  1 
ATOM   601  C  C   . LEU A 1 98  ? 8.009   12.606  38.458 1.00 21.57 ? 250  LEU A C   1 
ATOM   602  O  O   . LEU A 1 98  ? 8.596   12.176  37.453 1.00 21.66 ? 250  LEU A O   1 
ATOM   603  C  CB  . LEU A 1 98  ? 8.257   10.946  40.298 1.00 21.35 ? 250  LEU A CB  1 
ATOM   604  C  CG  . LEU A 1 98  ? 7.768   10.211  41.551 1.00 21.33 ? 250  LEU A CG  1 
ATOM   605  C  CD1 . LEU A 1 98  ? 6.932   8.979   41.206 1.00 21.99 ? 250  LEU A CD1 1 
ATOM   606  C  CD2 . LEU A 1 98  ? 8.949   9.817   42.416 1.00 21.03 ? 250  LEU A CD2 1 
ATOM   607  N  N   . ARG A 1 99  ? 7.991   13.893  38.790 1.00 21.30 ? 251  ARG A N   1 
ATOM   608  C  CA  . ARG A 1 99  ? 8.719   14.869  37.991 1.00 21.06 ? 251  ARG A CA  1 
ATOM   609  C  C   . ARG A 1 99  ? 10.103  15.178  38.571 1.00 21.03 ? 251  ARG A C   1 
ATOM   610  O  O   . ARG A 1 99  ? 10.232  15.861  39.593 1.00 20.96 ? 251  ARG A O   1 
ATOM   611  C  CB  . ARG A 1 99  ? 7.903   16.143  37.781 1.00 21.00 ? 251  ARG A CB  1 
ATOM   612  C  CG  . ARG A 1 99  ? 8.332   16.920  36.567 1.00 20.43 ? 251  ARG A CG  1 
ATOM   613  C  CD  . ARG A 1 99  ? 7.845   18.342  36.640 1.00 20.55 ? 251  ARG A CD  1 
ATOM   614  N  NE  . ARG A 1 99  ? 8.341   19.136  35.522 1.00 21.12 ? 251  ARG A NE  1 
ATOM   615  C  CZ  . ARG A 1 99  ? 8.397   20.463  35.507 1.00 21.92 ? 251  ARG A CZ  1 
ATOM   616  N  NH1 . ARG A 1 99  ? 8.860   21.091  34.439 1.00 21.72 ? 251  ARG A NH1 1 
ATOM   617  N  NH2 . ARG A 1 99  ? 7.999   21.165  36.559 1.00 22.87 ? 251  ARG A NH2 1 
ATOM   618  N  N   . VAL A 1 100 ? 11.131  14.658  37.897 1.00 20.92 ? 252  VAL A N   1 
ATOM   619  C  CA  . VAL A 1 100 ? 12.523  14.915  38.254 1.00 20.51 ? 252  VAL A CA  1 
ATOM   620  C  C   . VAL A 1 100 ? 13.298  15.611  37.123 1.00 20.57 ? 252  VAL A C   1 
ATOM   621  O  O   . VAL A 1 100 ? 14.489  15.902  37.269 1.00 20.18 ? 252  VAL A O   1 
ATOM   622  C  CB  . VAL A 1 100 ? 13.265  13.614  38.688 1.00 20.69 ? 252  VAL A CB  1 
ATOM   623  C  CG1 . VAL A 1 100 ? 12.538  12.931  39.863 1.00 19.81 ? 252  VAL A CG1 1 
ATOM   624  C  CG2 . VAL A 1 100 ? 13.457  12.658  37.506 1.00 20.09 ? 252  VAL A CG2 1 
ATOM   625  N  N   . LEU A 1 101 ? 12.624  15.860  35.999 1.00 20.60 ? 253  LEU A N   1 
ATOM   626  C  CA  . LEU A 1 101 ? 13.240  16.559  34.866 1.00 20.50 ? 253  LEU A CA  1 
ATOM   627  C  C   . LEU A 1 101 ? 12.455  17.814  34.512 1.00 20.74 ? 253  LEU A C   1 
ATOM   628  O  O   . LEU A 1 101 ? 11.217  17.789  34.485 1.00 20.59 ? 253  LEU A O   1 
ATOM   629  C  CB  . LEU A 1 101 ? 13.359  15.642  33.637 1.00 20.25 ? 253  LEU A CB  1 
ATOM   630  C  CG  . LEU A 1 101 ? 14.160  14.327  33.689 1.00 19.34 ? 253  LEU A CG  1 
ATOM   631  C  CD1 . LEU A 1 101 ? 13.993  13.560  32.374 1.00 18.28 ? 253  LEU A CD1 1 
ATOM   632  C  CD2 . LEU A 1 101 ? 15.635  14.535  33.998 1.00 17.09 ? 253  LEU A CD2 1 
ATOM   633  N  N   . ASN A 1 102 ? 13.175  18.906  34.243 1.00 20.77 ? 254  ASN A N   1 
ATOM   634  C  CA  . ASN A 1 102 ? 12.542  20.183  33.913 1.00 21.02 ? 254  ASN A CA  1 
ATOM   635  C  C   . ASN A 1 102 ? 12.049  20.256  32.457 1.00 21.35 ? 254  ASN A C   1 
ATOM   636  O  O   . ASN A 1 102 ? 12.000  19.237  31.760 1.00 21.50 ? 254  ASN A O   1 
ATOM   637  C  CB  . ASN A 1 102 ? 13.435  21.383  34.315 1.00 20.97 ? 254  ASN A CB  1 
ATOM   638  C  CG  . ASN A 1 102 ? 14.717  21.492  33.492 1.00 20.49 ? 254  ASN A CG  1 
ATOM   639  O  OD1 . ASN A 1 102 ? 14.883  20.833  32.474 1.00 20.82 ? 254  ASN A OD1 1 
ATOM   640  N  ND2 . ASN A 1 102 ? 15.624  22.348  33.936 1.00 19.08 ? 254  ASN A ND2 1 
ATOM   641  N  N   . CYS A 1 103 ? 11.677  21.451  32.004 1.00 21.65 ? 255  CYS A N   1 
ATOM   642  C  CA  . CYS A 1 103 ? 11.124  21.619  30.656 1.00 22.22 ? 255  CYS A CA  1 
ATOM   643  C  C   . CYS A 1 103 ? 12.109  21.323  29.530 1.00 21.60 ? 255  CYS A C   1 
ATOM   644  O  O   . CYS A 1 103 ? 11.694  21.036  28.413 1.00 21.52 ? 255  CYS A O   1 
ATOM   645  C  CB  . CYS A 1 103 ? 10.495  23.001  30.489 1.00 22.42 ? 255  CYS A CB  1 
ATOM   646  S  SG  . CYS A 1 103 ? 8.955   23.126  31.399 1.00 26.02 ? 255  CYS A SG  1 
ATOM   647  N  N   . GLN A 1 104 ? 13.402  21.396  29.835 1.00 21.35 ? 256  GLN A N   1 
ATOM   648  C  CA  . GLN A 1 104 ? 14.458  21.118  28.864 1.00 21.08 ? 256  GLN A CA  1 
ATOM   649  C  C   . GLN A 1 104 ? 15.033  19.712  29.038 1.00 20.55 ? 256  GLN A C   1 
ATOM   650  O  O   . GLN A 1 104 ? 16.018  19.358  28.396 1.00 20.43 ? 256  GLN A O   1 
ATOM   651  C  CB  . GLN A 1 104 ? 15.569  22.160  28.972 1.00 21.19 ? 256  GLN A CB  1 
ATOM   652  C  CG  . GLN A 1 104 ? 15.134  23.583  28.646 1.00 22.30 ? 256  GLN A CG  1 
ATOM   653  C  CD  . GLN A 1 104 ? 16.042  24.617  29.283 1.00 24.56 ? 256  GLN A CD  1 
ATOM   654  O  OE1 . GLN A 1 104 ? 16.462  24.462  30.433 1.00 25.55 ? 256  GLN A OE1 1 
ATOM   655  N  NE2 . GLN A 1 104 ? 16.358  25.675  28.539 1.00 24.76 ? 256  GLN A NE2 1 
ATOM   656  N  N   . GLY A 1 105 ? 14.409  18.920  29.908 1.00 20.21 ? 257  GLY A N   1 
ATOM   657  C  CA  . GLY A 1 105 ? 14.769  17.515  30.098 1.00 19.84 ? 257  GLY A CA  1 
ATOM   658  C  C   . GLY A 1 105 ? 15.966  17.324  30.999 1.00 19.86 ? 257  GLY A C   1 
ATOM   659  O  O   . GLY A 1 105 ? 16.631  16.291  30.943 1.00 19.80 ? 257  GLY A O   1 
ATOM   660  N  N   . LYS A 1 106 ? 16.228  18.324  31.836 1.00 19.85 ? 258  LYS A N   1 
ATOM   661  C  CA  . LYS A 1 106 ? 17.363  18.327  32.741 1.00 20.22 ? 258  LYS A CA  1 
ATOM   662  C  C   . LYS A 1 106 ? 16.931  18.152  34.203 1.00 19.95 ? 258  LYS A C   1 
ATOM   663  O  O   . LYS A 1 106 ? 15.979  18.779  34.665 1.00 19.72 ? 258  LYS A O   1 
ATOM   664  C  CB  . LYS A 1 106 ? 18.150  19.626  32.575 1.00 20.18 ? 258  LYS A CB  1 
ATOM   665  C  CG  . LYS A 1 106 ? 19.561  19.576  33.140 1.00 20.99 ? 258  LYS A CG  1 
ATOM   666  C  CD  . LYS A 1 106 ? 20.304  20.892  32.925 1.00 21.26 ? 258  LYS A CD  1 
ATOM   667  C  CE  . LYS A 1 106 ? 19.996  21.887  34.032 1.00 23.80 ? 258  LYS A CE  1 
ATOM   668  N  NZ  . LYS A 1 106 ? 20.557  23.242  33.732 1.00 26.60 ? 258  LYS A NZ  1 
ATOM   669  N  N   . GLY A 1 107 ? 17.641  17.285  34.917 1.00 19.77 ? 259  GLY A N   1 
ATOM   670  C  CA  . GLY A 1 107 ? 17.421  17.088  36.340 1.00 19.61 ? 259  GLY A CA  1 
ATOM   671  C  C   . GLY A 1 107 ? 18.721  17.088  37.116 1.00 19.68 ? 259  GLY A C   1 
ATOM   672  O  O   . GLY A 1 107 ? 19.779  17.416  36.576 1.00 19.64 ? 259  GLY A O   1 
ATOM   673  N  N   . THR A 1 108 ? 18.641  16.725  38.393 1.00 19.84 ? 260  THR A N   1 
ATOM   674  C  CA  . THR A 1 108 ? 19.831  16.594  39.239 1.00 19.89 ? 260  THR A CA  1 
ATOM   675  C  C   . THR A 1 108 ? 19.865  15.195  39.843 1.00 19.79 ? 260  THR A C   1 
ATOM   676  O  O   . THR A 1 108 ? 18.829  14.537  39.948 1.00 20.14 ? 260  THR A O   1 
ATOM   677  C  CB  . THR A 1 108 ? 19.876  17.651  40.376 1.00 19.81 ? 260  THR A CB  1 
ATOM   678  O  OG1 . THR A 1 108 ? 18.719  17.517  41.211 1.00 20.12 ? 260  THR A OG1 1 
ATOM   679  C  CG2 . THR A 1 108 ? 19.922  19.068  39.824 1.00 19.42 ? 260  THR A CG2 1 
ATOM   680  N  N   . VAL A 1 109 ? 21.057  14.748  40.225 1.00 19.78 ? 261  VAL A N   1 
ATOM   681  C  CA  . VAL A 1 109 ? 21.242  13.485  40.946 1.00 19.82 ? 261  VAL A CA  1 
ATOM   682  C  C   . VAL A 1 109 ? 20.492  13.496  42.285 1.00 19.99 ? 261  VAL A C   1 
ATOM   683  O  O   . VAL A 1 109 ? 19.795  12.536  42.627 1.00 20.14 ? 261  VAL A O   1 
ATOM   684  C  CB  . VAL A 1 109 ? 22.754  13.176  41.156 1.00 19.73 ? 261  VAL A CB  1 
ATOM   685  C  CG1 . VAL A 1 109 ? 22.973  12.074  42.202 1.00 19.21 ? 261  VAL A CG1 1 
ATOM   686  C  CG2 . VAL A 1 109 ? 23.399  12.791  39.837 1.00 19.76 ? 261  VAL A CG2 1 
ATOM   687  N  N   . SER A 1 110 ? 20.624  14.589  43.030 1.00 20.02 ? 262  SER A N   1 
ATOM   688  C  CA  . SER A 1 110 ? 19.947  14.719  44.315 1.00 20.14 ? 262  SER A CA  1 
ATOM   689  C  C   . SER A 1 110 ? 18.416  14.651  44.179 1.00 20.24 ? 262  SER A C   1 
ATOM   690  O  O   . SER A 1 110 ? 17.746  14.021  45.005 1.00 20.17 ? 262  SER A O   1 
ATOM   691  C  CB  . SER A 1 110 ? 20.401  15.984  45.056 1.00 19.91 ? 262  SER A CB  1 
ATOM   692  O  OG  . SER A 1 110 ? 20.210  17.157  44.288 1.00 19.74 ? 262  SER A OG  1 
ATOM   693  N  N   . GLY A 1 111 ? 17.882  15.275  43.129 1.00 20.26 ? 263  GLY A N   1 
ATOM   694  C  CA  . GLY A 1 111 ? 16.441  15.267  42.852 1.00 20.46 ? 263  GLY A CA  1 
ATOM   695  C  C   . GLY A 1 111 ? 15.916  13.893  42.465 1.00 20.80 ? 263  GLY A C   1 
ATOM   696  O  O   . GLY A 1 111 ? 14.781  13.539  42.791 1.00 20.65 ? 263  GLY A O   1 
ATOM   697  N  N   . THR A 1 112 ? 16.753  13.125  41.767 1.00 21.13 ? 264  THR A N   1 
ATOM   698  C  CA  . THR A 1 112 ? 16.467  11.733  41.427 1.00 21.43 ? 264  THR A CA  1 
ATOM   699  C  C   . THR A 1 112 ? 16.491  10.831  42.676 1.00 21.72 ? 264  THR A C   1 
ATOM   700  O  O   . THR A 1 112 ? 15.626  9.969   42.832 1.00 21.94 ? 264  THR A O   1 
ATOM   701  C  CB  . THR A 1 112 ? 17.461  11.197  40.353 1.00 21.46 ? 264  THR A CB  1 
ATOM   702  O  OG1 . THR A 1 112 ? 17.541  12.120  39.256 1.00 21.30 ? 264  THR A OG1 1 
ATOM   703  C  CG2 . THR A 1 112 ? 17.030  9.834   39.831 1.00 21.17 ? 264  THR A CG2 1 
ATOM   704  N  N   . LEU A 1 113 ? 17.486  11.031  43.544 1.00 22.00 ? 265  LEU A N   1 
ATOM   705  C  CA  . LEU A 1 113 ? 17.590  10.329  44.830 1.00 22.23 ? 265  LEU A CA  1 
ATOM   706  C  C   . LEU A 1 113 ? 16.375  10.547  45.725 1.00 22.07 ? 265  LEU A C   1 
ATOM   707  O  O   . LEU A 1 113 ? 15.840  9.593   46.286 1.00 22.02 ? 265  LEU A O   1 
ATOM   708  C  CB  . LEU A 1 113 ? 18.838  10.773  45.596 1.00 22.47 ? 265  LEU A CB  1 
ATOM   709  C  CG  . LEU A 1 113 ? 20.221  10.369  45.090 1.00 23.38 ? 265  LEU A CG  1 
ATOM   710  C  CD1 . LEU A 1 113 ? 21.282  11.123  45.883 1.00 23.74 ? 265  LEU A CD1 1 
ATOM   711  C  CD2 . LEU A 1 113 ? 20.422  8.874   45.203 1.00 23.86 ? 265  LEU A CD2 1 
ATOM   712  N  N   . ILE A 1 114 ? 15.957  11.805  45.866 1.00 21.88 ? 266  ILE A N   1 
ATOM   713  C  CA  . ILE A 1 114 ? 14.735  12.132  46.602 1.00 21.81 ? 266  ILE A CA  1 
ATOM   714  C  C   . ILE A 1 114 ? 13.515  11.484  45.920 1.00 22.10 ? 266  ILE A C   1 
ATOM   715  O  O   . ILE A 1 114 ? 12.589  11.025  46.599 1.00 22.51 ? 266  ILE A O   1 
ATOM   716  C  CB  . ILE A 1 114 ? 14.570  13.669  46.810 1.00 21.67 ? 266  ILE A CB  1 
ATOM   717  C  CG1 . ILE A 1 114 ? 15.762  14.228  47.591 1.00 21.33 ? 266  ILE A CG1 1 
ATOM   718  C  CG2 . ILE A 1 114 ? 13.291  13.993  47.574 1.00 21.66 ? 266  ILE A CG2 1 
ATOM   719  C  CD1 . ILE A 1 114 ? 15.889  15.737  47.551 1.00 21.42 ? 266  ILE A CD1 1 
ATOM   720  N  N   . GLY A 1 115 ? 13.536  11.421  44.587 1.00 22.05 ? 267  GLY A N   1 
ATOM   721  C  CA  . GLY A 1 115 ? 12.524  10.692  43.821 1.00 21.86 ? 267  GLY A CA  1 
ATOM   722  C  C   . GLY A 1 115 ? 12.492  9.205   44.142 1.00 22.04 ? 267  GLY A C   1 
ATOM   723  O  O   . GLY A 1 115 ? 11.425  8.623   44.315 1.00 22.02 ? 267  GLY A O   1 
ATOM   724  N  N   . LEU A 1 116 ? 13.666  8.589   44.229 1.00 21.97 ? 268  LEU A N   1 
ATOM   725  C  CA  . LEU A 1 116 ? 13.765  7.169   44.553 1.00 22.22 ? 268  LEU A CA  1 
ATOM   726  C  C   . LEU A 1 116 ? 13.392  6.873   46.001 1.00 22.36 ? 268  LEU A C   1 
ATOM   727  O  O   . LEU A 1 116 ? 12.828  5.820   46.296 1.00 22.56 ? 268  LEU A O   1 
ATOM   728  C  CB  . LEU A 1 116 ? 15.165  6.641   44.243 1.00 22.12 ? 268  LEU A CB  1 
ATOM   729  C  CG  . LEU A 1 116 ? 15.624  6.719   42.782 1.00 22.09 ? 268  LEU A CG  1 
ATOM   730  C  CD1 . LEU A 1 116 ? 17.118  6.420   42.692 1.00 21.88 ? 268  LEU A CD1 1 
ATOM   731  C  CD2 . LEU A 1 116 ? 14.810  5.792   41.879 1.00 21.25 ? 268  LEU A CD2 1 
ATOM   732  N  N   . GLU A 1 117 ? 13.711  7.807   46.894 1.00 22.60 ? 269  GLU A N   1 
ATOM   733  C  CA  . GLU A 1 117 ? 13.299  7.739   48.288 1.00 22.79 ? 269  GLU A CA  1 
ATOM   734  C  C   . GLU A 1 117 ? 11.774  7.791   48.427 1.00 22.92 ? 269  GLU A C   1 
ATOM   735  O  O   . GLU A 1 117 ? 11.204  7.073   49.248 1.00 22.77 ? 269  GLU A O   1 
ATOM   736  C  CB  . GLU A 1 117 ? 13.932  8.875   49.089 1.00 22.96 ? 269  GLU A CB  1 
ATOM   737  C  CG  . GLU A 1 117 ? 13.740  8.739   50.590 1.00 23.56 ? 269  GLU A CG  1 
ATOM   738  C  CD  . GLU A 1 117 ? 13.958  10.034  51.347 1.00 25.47 ? 269  GLU A CD  1 
ATOM   739  O  OE1 . GLU A 1 117 ? 13.519  11.104  50.873 1.00 27.63 ? 269  GLU A OE1 1 
ATOM   740  O  OE2 . GLU A 1 117 ? 14.550  9.982   52.438 1.00 26.06 ? 269  GLU A OE2 1 
ATOM   741  N  N   . PHE A 1 118 ? 11.134  8.652   47.633 1.00 23.23 ? 270  PHE A N   1 
ATOM   742  C  CA  . PHE A 1 118 ? 9.676   8.746   47.570 1.00 23.76 ? 270  PHE A CA  1 
ATOM   743  C  C   . PHE A 1 118 ? 9.066   7.391   47.217 1.00 24.07 ? 270  PHE A C   1 
ATOM   744  O  O   . PHE A 1 118 ? 8.055   6.999   47.788 1.00 24.12 ? 270  PHE A O   1 
ATOM   745  C  CB  . PHE A 1 118 ? 9.251   9.811   46.552 1.00 23.96 ? 270  PHE A CB  1 
ATOM   746  C  CG  . PHE A 1 118 ? 7.753   9.997   46.434 1.00 24.40 ? 270  PHE A CG  1 
ATOM   747  C  CD1 . PHE A 1 118 ? 7.092   10.939  47.216 1.00 24.76 ? 270  PHE A CD1 1 
ATOM   748  C  CD2 . PHE A 1 118 ? 7.007   9.243   45.526 1.00 25.20 ? 270  PHE A CD2 1 
ATOM   749  C  CE1 . PHE A 1 118 ? 5.708   11.120  47.102 1.00 25.37 ? 270  PHE A CE1 1 
ATOM   750  C  CE2 . PHE A 1 118 ? 5.619   9.414   45.410 1.00 25.08 ? 270  PHE A CE2 1 
ATOM   751  C  CZ  . PHE A 1 118 ? 4.972   10.353  46.198 1.00 24.39 ? 270  PHE A CZ  1 
ATOM   752  N  N   . ILE A 1 119 ? 9.691   6.682   46.282 1.00 24.51 ? 271  ILE A N   1 
ATOM   753  C  CA  . ILE A 1 119 ? 9.228   5.354   45.873 1.00 25.20 ? 271  ILE A CA  1 
ATOM   754  C  C   . ILE A 1 119 ? 9.397   4.319   46.998 1.00 25.80 ? 271  ILE A C   1 
ATOM   755  O  O   . ILE A 1 119 ? 8.461   3.567   47.292 1.00 25.80 ? 271  ILE A O   1 
ATOM   756  C  CB  . ILE A 1 119 ? 9.907   4.898   44.558 1.00 25.02 ? 271  ILE A CB  1 
ATOM   757  C  CG1 . ILE A 1 119 ? 9.335   5.703   43.389 1.00 24.80 ? 271  ILE A CG1 1 
ATOM   758  C  CG2 . ILE A 1 119 ? 9.733   3.386   44.332 1.00 24.87 ? 271  ILE A CG2 1 
ATOM   759  C  CD1 . ILE A 1 119 ? 10.147  5.628   42.135 1.00 25.11 ? 271  ILE A CD1 1 
ATOM   760  N  N   . ARG A 1 120 ? 10.573  4.303   47.627 1.00 26.37 ? 272  ARG A N   1 
ATOM   761  C  CA  . ARG A 1 120 ? 10.833  3.434   48.776 1.00 27.04 ? 272  ARG A CA  1 
ATOM   762  C  C   . ARG A 1 120 ? 9.828   3.654   49.914 1.00 27.50 ? 272  ARG A C   1 
ATOM   763  O  O   . ARG A 1 120 ? 9.328   2.694   50.491 1.00 27.43 ? 272  ARG A O   1 
ATOM   764  C  CB  . ARG A 1 120 ? 12.268  3.616   49.284 1.00 26.94 ? 272  ARG A CB  1 
ATOM   765  C  CG  . ARG A 1 120 ? 12.640  2.730   50.481 1.00 27.32 ? 272  ARG A CG  1 
ATOM   766  C  CD  . ARG A 1 120 ? 12.827  1.268   50.088 1.00 27.81 ? 272  ARG A CD  1 
ATOM   767  N  NE  . ARG A 1 120 ? 13.078  0.427   51.258 1.00 28.95 ? 272  ARG A NE  1 
ATOM   768  C  CZ  . ARG A 1 120 ? 12.306  -0.584  51.655 1.00 28.94 ? 272  ARG A CZ  1 
ATOM   769  N  NH1 . ARG A 1 120 ? 11.221  -0.923  50.969 1.00 29.32 ? 272  ARG A NH1 1 
ATOM   770  N  NH2 . ARG A 1 120 ? 12.629  -1.273  52.741 1.00 28.29 ? 272  ARG A NH2 1 
ATOM   771  N  N   . LYS A 1 121 ? 9.543   4.918   50.222 1.00 28.34 ? 273  LYS A N   1 
ATOM   772  C  CA  . LYS A 1 121 ? 8.546   5.287   51.231 1.00 29.17 ? 273  LYS A CA  1 
ATOM   773  C  C   . LYS A 1 121 ? 7.135   4.834   50.865 1.00 29.49 ? 273  LYS A C   1 
ATOM   774  O  O   . LYS A 1 121 ? 6.372   4.417   51.734 1.00 29.67 ? 273  LYS A O   1 
ATOM   775  C  CB  . LYS A 1 121 ? 8.535   6.799   51.445 1.00 29.31 ? 273  LYS A CB  1 
ATOM   776  C  CG  . LYS A 1 121 ? 9.753   7.349   52.155 1.00 30.75 ? 273  LYS A CG  1 
ATOM   777  C  CD  . LYS A 1 121 ? 9.513   8.795   52.555 1.00 32.39 ? 273  LYS A CD  1 
ATOM   778  C  CE  . LYS A 1 121 ? 10.651  9.335   53.377 1.00 32.91 ? 273  LYS A CE  1 
ATOM   779  N  NZ  . LYS A 1 121 ? 10.189  10.518  54.149 1.00 35.27 ? 273  LYS A NZ  1 
ATOM   780  N  N   . SER A 1 122 ? 6.796   4.943   49.582 1.00 30.07 ? 274  SER A N   1 
ATOM   781  C  CA  . SER A 1 122 ? 5.501   4.516   49.058 1.00 30.72 ? 274  SER A CA  1 
ATOM   782  C  C   . SER A 1 122 ? 5.334   3.005   49.168 1.00 31.24 ? 274  SER A C   1 
ATOM   783  O  O   . SER A 1 122 ? 4.275   2.519   49.561 1.00 31.17 ? 274  SER A O   1 
ATOM   784  C  CB  . SER A 1 122 ? 5.342   4.958   47.602 1.00 30.55 ? 274  SER A CB  1 
ATOM   785  O  OG  . SER A 1 122 ? 5.327   6.368   47.512 1.00 30.26 ? 274  SER A OG  1 
ATOM   786  N  N   . GLN A 1 123 ? 6.397   2.282   48.819 1.00 32.06 ? 275  GLN A N   1 
ATOM   787  C  CA  . GLN A 1 123 ? 6.472   0.830   48.950 1.00 32.99 ? 275  GLN A CA  1 
ATOM   788  C  C   . GLN A 1 123 ? 6.197   0.359   50.385 1.00 33.64 ? 275  GLN A C   1 
ATOM   789  O  O   . GLN A 1 123 ? 5.591   -0.693  50.590 1.00 33.73 ? 275  GLN A O   1 
ATOM   790  C  CB  . GLN A 1 123 ? 7.854   0.346   48.496 1.00 32.92 ? 275  GLN A CB  1 
ATOM   791  C  CG  . GLN A 1 123 ? 7.924   -1.129  48.119 1.00 33.25 ? 275  GLN A CG  1 
ATOM   792  C  CD  . GLN A 1 123 ? 9.347   -1.646  47.995 1.00 33.13 ? 275  GLN A CD  1 
ATOM   793  O  OE1 . GLN A 1 123 ? 10.302  -0.977  48.387 1.00 33.80 ? 275  GLN A OE1 1 
ATOM   794  N  NE2 . GLN A 1 123 ? 9.493   -2.850  47.452 1.00 32.94 ? 275  GLN A NE2 1 
ATOM   795  N  N   . LEU A 1 124 ? 6.630   1.150   51.366 1.00 34.42 ? 276  LEU A N   1 
ATOM   796  C  CA  . LEU A 1 124 ? 6.508   0.786   52.778 1.00 35.39 ? 276  LEU A CA  1 
ATOM   797  C  C   . LEU A 1 124 ? 5.186   1.212   53.431 1.00 36.08 ? 276  LEU A C   1 
ATOM   798  O  O   . LEU A 1 124 ? 4.668   0.511   54.307 1.00 36.24 ? 276  LEU A O   1 
ATOM   799  C  CB  . LEU A 1 124 ? 7.696   1.335   53.582 1.00 35.28 ? 276  LEU A CB  1 
ATOM   800  C  CG  . LEU A 1 124 ? 9.085   0.749   53.299 1.00 35.35 ? 276  LEU A CG  1 
ATOM   801  C  CD1 . LEU A 1 124 ? 10.162  1.613   53.935 1.00 35.44 ? 276  LEU A CD1 1 
ATOM   802  C  CD2 . LEU A 1 124 ? 9.201   -0.701  53.765 1.00 35.20 ? 276  LEU A CD2 1 
ATOM   803  N  N   . VAL A 1 125 ? 4.654   2.358   53.012 1.00 36.91 ? 277  VAL A N   1 
ATOM   804  C  CA  . VAL A 1 125 ? 3.429   2.910   53.598 1.00 37.70 ? 277  VAL A CA  1 
ATOM   805  C  C   . VAL A 1 125 ? 2.175   2.357   52.915 1.00 38.11 ? 277  VAL A C   1 
ATOM   806  O  O   . VAL A 1 125 ? 1.193   2.030   53.585 1.00 38.33 ? 277  VAL A O   1 
ATOM   807  C  CB  . VAL A 1 125 ? 3.437   4.469   53.592 1.00 37.76 ? 277  VAL A CB  1 
ATOM   808  C  CG1 . VAL A 1 125 ? 2.091   5.036   54.025 1.00 38.02 ? 277  VAL A CG1 1 
ATOM   809  C  CG2 . VAL A 1 125 ? 4.543   5.005   54.503 1.00 38.04 ? 277  VAL A CG2 1 
ATOM   810  N  N   . GLN A 1 126 ? 2.216   2.249   51.590 1.00 38.70 ? 278  GLN A N   1 
ATOM   811  C  CA  . GLN A 1 126 ? 1.090   1.718   50.823 1.00 39.14 ? 278  GLN A CA  1 
ATOM   812  C  C   . GLN A 1 126 ? 1.574   0.775   49.698 1.00 39.18 ? 278  GLN A C   1 
ATOM   813  O  O   . GLN A 1 126 ? 1.713   1.184   48.539 1.00 39.43 ? 278  GLN A O   1 
ATOM   814  C  CB  . GLN A 1 126 ? 0.160   2.864   50.344 1.00 39.37 ? 278  GLN A CB  1 
ATOM   815  C  CG  . GLN A 1 126 ? 0.107   3.192   48.830 1.00 40.70 ? 278  GLN A CG  1 
ATOM   816  C  CD  . GLN A 1 126 ? 1.299   3.997   48.313 1.00 42.33 ? 278  GLN A CD  1 
ATOM   817  O  OE1 . GLN A 1 126 ? 1.643   5.057   48.851 1.00 43.65 ? 278  GLN A OE1 1 
ATOM   818  N  NE2 . GLN A 1 126 ? 1.923   3.499   47.248 1.00 42.09 ? 278  GLN A NE2 1 
ATOM   819  N  N   . PRO A 1 127 ? 1.871   -0.493  50.048 1.00 39.09 ? 279  PRO A N   1 
ATOM   820  C  CA  . PRO A 1 127 ? 2.320   -1.459  49.051 1.00 38.95 ? 279  PRO A CA  1 
ATOM   821  C  C   . PRO A 1 127 ? 1.182   -2.171  48.328 1.00 38.67 ? 279  PRO A C   1 
ATOM   822  O  O   . PRO A 1 127 ? 0.085   -2.341  48.868 1.00 38.61 ? 279  PRO A O   1 
ATOM   823  C  CB  . PRO A 1 127 ? 3.127   -2.461  49.874 1.00 38.96 ? 279  PRO A CB  1 
ATOM   824  C  CG  . PRO A 1 127 ? 2.485   -2.447  51.196 1.00 39.23 ? 279  PRO A CG  1 
ATOM   825  C  CD  . PRO A 1 127 ? 1.838   -1.089  51.392 1.00 39.21 ? 279  PRO A CD  1 
ATOM   826  N  N   . VAL A 1 128 ? 1.476   -2.570  47.098 1.00 38.43 ? 280  VAL A N   1 
ATOM   827  C  CA  . VAL A 1 128 ? 0.559   -3.315  46.255 1.00 38.09 ? 280  VAL A CA  1 
ATOM   828  C  C   . VAL A 1 128 ? 1.170   -4.692  45.986 1.00 37.55 ? 280  VAL A C   1 
ATOM   829  O  O   . VAL A 1 128 ? 0.843   -5.670  46.666 1.00 37.73 ? 280  VAL A O   1 
ATOM   830  C  CB  . VAL A 1 128 ? 0.240   -2.550  44.928 1.00 38.17 ? 280  VAL A CB  1 
ATOM   831  C  CG1 . VAL A 1 128 ? -0.972  -1.639  45.108 1.00 38.21 ? 280  VAL A CG1 1 
ATOM   832  C  CG2 . VAL A 1 128 ? 1.457   -1.744  44.436 1.00 38.45 ? 280  VAL A CG2 1 
ATOM   833  N  N   . GLY A 1 129 ? 2.076   -4.751  45.015 1.00 36.62 ? 281  GLY A N   1 
ATOM   834  C  CA  . GLY A 1 129 ? 2.786   -5.973  44.681 1.00 35.37 ? 281  GLY A CA  1 
ATOM   835  C  C   . GLY A 1 129 ? 4.060   -5.631  43.937 1.00 34.27 ? 281  GLY A C   1 
ATOM   836  O  O   . GLY A 1 129 ? 4.892   -4.875  44.450 1.00 34.48 ? 281  GLY A O   1 
ATOM   837  N  N   . PRO A 1 130 ? 4.214   -6.163  42.714 1.00 33.24 ? 282  PRO A N   1 
ATOM   838  C  CA  . PRO A 1 130 ? 5.443   -5.931  41.960 1.00 32.40 ? 282  PRO A CA  1 
ATOM   839  C  C   . PRO A 1 130 ? 5.562   -4.472  41.521 1.00 31.51 ? 282  PRO A C   1 
ATOM   840  O  O   . PRO A 1 130 ? 4.603   -3.892  41.000 1.00 31.40 ? 282  PRO A O   1 
ATOM   841  C  CB  . PRO A 1 130 ? 5.297   -6.850  40.739 1.00 32.42 ? 282  PRO A CB  1 
ATOM   842  C  CG  . PRO A 1 130 ? 4.118   -7.736  41.028 1.00 32.82 ? 282  PRO A CG  1 
ATOM   843  C  CD  . PRO A 1 130 ? 3.250   -6.983  41.963 1.00 33.08 ? 282  PRO A CD  1 
ATOM   844  N  N   . LEU A 1 131 ? 6.734   -3.891  41.756 1.00 30.58 ? 283  LEU A N   1 
ATOM   845  C  CA  . LEU A 1 131 ? 7.035   -2.525  41.340 1.00 29.60 ? 283  LEU A CA  1 
ATOM   846  C  C   . LEU A 1 131 ? 8.084   -2.514  40.241 1.00 28.64 ? 283  LEU A C   1 
ATOM   847  O  O   . LEU A 1 131 ? 9.133   -3.151  40.361 1.00 28.47 ? 283  LEU A O   1 
ATOM   848  C  CB  . LEU A 1 131 ? 7.523   -1.694  42.528 1.00 29.75 ? 283  LEU A CB  1 
ATOM   849  C  CG  . LEU A 1 131 ? 6.727   -0.484  43.028 1.00 30.35 ? 283  LEU A CG  1 
ATOM   850  C  CD1 . LEU A 1 131 ? 5.224   -0.745  43.125 1.00 31.18 ? 283  LEU A CD1 1 
ATOM   851  C  CD2 . LEU A 1 131 ? 7.283   -0.043  44.374 1.00 30.09 ? 283  LEU A CD2 1 
ATOM   852  N  N   . VAL A 1 132 ? 7.777   -1.801  39.163 1.00 27.56 ? 284  VAL A N   1 
ATOM   853  C  CA  . VAL A 1 132 ? 8.739   -1.524  38.104 1.00 26.46 ? 284  VAL A CA  1 
ATOM   854  C  C   . VAL A 1 132 ? 9.024   -0.023  38.150 1.00 25.87 ? 284  VAL A C   1 
ATOM   855  O  O   . VAL A 1 132 ? 8.097   0.783   38.200 1.00 25.84 ? 284  VAL A O   1 
ATOM   856  C  CB  . VAL A 1 132 ? 8.209   -1.948  36.692 1.00 26.36 ? 284  VAL A CB  1 
ATOM   857  C  CG1 . VAL A 1 132 ? 9.228   -1.626  35.601 1.00 26.22 ? 284  VAL A CG1 1 
ATOM   858  C  CG2 . VAL A 1 132 ? 7.856   -3.427  36.659 1.00 25.45 ? 284  VAL A CG2 1 
ATOM   859  N  N   . VAL A 1 133 ? 10.301  0.347   38.162 1.00 25.01 ? 285  VAL A N   1 
ATOM   860  C  CA  . VAL A 1 133 ? 10.691  1.754   38.096 1.00 24.11 ? 285  VAL A CA  1 
ATOM   861  C  C   . VAL A 1 133 ? 11.465  2.037   36.807 1.00 23.65 ? 285  VAL A C   1 
ATOM   862  O  O   . VAL A 1 133 ? 12.512  1.437   36.547 1.00 23.57 ? 285  VAL A O   1 
ATOM   863  C  CB  . VAL A 1 133 ? 11.497  2.205   39.350 1.00 24.21 ? 285  VAL A CB  1 
ATOM   864  C  CG1 . VAL A 1 133 ? 12.047  3.611   39.166 1.00 23.80 ? 285  VAL A CG1 1 
ATOM   865  C  CG2 . VAL A 1 133 ? 10.626  2.146   40.601 1.00 23.53 ? 285  VAL A CG2 1 
ATOM   866  N  N   . LEU A 1 134 ? 10.931  2.950   36.001 1.00 22.90 ? 286  LEU A N   1 
ATOM   867  C  CA  . LEU A 1 134 ? 11.578  3.360   34.762 1.00 22.12 ? 286  LEU A CA  1 
ATOM   868  C  C   . LEU A 1 134 ? 12.335  4.672   34.948 1.00 21.67 ? 286  LEU A C   1 
ATOM   869  O  O   . LEU A 1 134 ? 11.753  5.701   35.314 1.00 20.99 ? 286  LEU A O   1 
ATOM   870  C  CB  . LEU A 1 134 ? 10.560  3.460   33.611 1.00 21.96 ? 286  LEU A CB  1 
ATOM   871  C  CG  . LEU A 1 134 ? 11.079  3.900   32.236 1.00 21.80 ? 286  LEU A CG  1 
ATOM   872  C  CD1 . LEU A 1 134 ? 12.147  2.949   31.678 1.00 21.19 ? 286  LEU A CD1 1 
ATOM   873  C  CD2 . LEU A 1 134 ? 9.928   4.057   31.255 1.00 22.06 ? 286  LEU A CD2 1 
ATOM   874  N  N   . LEU A 1 135 ? 13.637  4.607   34.691 1.00 21.51 ? 287  LEU A N   1 
ATOM   875  C  CA  . LEU A 1 135 ? 14.542  5.749   34.796 1.00 21.45 ? 287  LEU A CA  1 
ATOM   876  C  C   . LEU A 1 135 ? 15.156  6.044   33.433 1.00 21.25 ? 287  LEU A C   1 
ATOM   877  O  O   . LEU A 1 135 ? 16.272  5.594   33.138 1.00 21.74 ? 287  LEU A O   1 
ATOM   878  C  CB  . LEU A 1 135 ? 15.650  5.459   35.804 1.00 21.53 ? 287  LEU A CB  1 
ATOM   879  C  CG  . LEU A 1 135 ? 15.312  5.469   37.294 1.00 22.48 ? 287  LEU A CG  1 
ATOM   880  C  CD1 . LEU A 1 135 ? 16.248  4.535   38.047 1.00 23.33 ? 287  LEU A CD1 1 
ATOM   881  C  CD2 . LEU A 1 135 ? 15.394  6.889   37.848 1.00 24.01 ? 287  LEU A CD2 1 
ATOM   882  N  N   . PRO A 1 136 ? 14.440  6.811   32.594 1.00 20.82 ? 288  PRO A N   1 
ATOM   883  C  CA  . PRO A 1 136 ? 14.863  7.053   31.222 1.00 20.53 ? 288  PRO A CA  1 
ATOM   884  C  C   . PRO A 1 136 ? 15.743  8.308   31.136 1.00 20.23 ? 288  PRO A C   1 
ATOM   885  O  O   . PRO A 1 136 ? 15.459  9.236   30.369 1.00 20.04 ? 288  PRO A O   1 
ATOM   886  C  CB  . PRO A 1 136 ? 13.534  7.250   30.493 1.00 20.60 ? 288  PRO A CB  1 
ATOM   887  C  CG  . PRO A 1 136 ? 12.599  7.806   31.555 1.00 20.63 ? 288  PRO A CG  1 
ATOM   888  C  CD  . PRO A 1 136 ? 13.190  7.526   32.909 1.00 20.75 ? 288  PRO A CD  1 
ATOM   889  N  N   . LEU A 1 137 ? 16.805  8.311   31.939 1.00 19.63 ? 289  LEU A N   1 
ATOM   890  C  CA  . LEU A 1 137 ? 17.691  9.460   32.084 1.00 19.12 ? 289  LEU A CA  1 
ATOM   891  C  C   . LEU A 1 137 ? 19.106  8.977   32.368 1.00 18.75 ? 289  LEU A C   1 
ATOM   892  O  O   . LEU A 1 137 ? 19.313  7.804   32.681 1.00 18.21 ? 289  LEU A O   1 
ATOM   893  C  CB  . LEU A 1 137 ? 17.201  10.371  33.223 1.00 19.09 ? 289  LEU A CB  1 
ATOM   894  C  CG  . LEU A 1 137 ? 16.764  9.702   34.538 1.00 19.42 ? 289  LEU A CG  1 
ATOM   895  C  CD1 . LEU A 1 137 ? 17.946  9.395   35.448 1.00 19.28 ? 289  LEU A CD1 1 
ATOM   896  C  CD2 . LEU A 1 137 ? 15.733  10.547  35.272 1.00 19.44 ? 289  LEU A CD2 1 
ATOM   897  N  N   . ALA A 1 138 ? 20.068  9.895   32.276 1.00 18.50 ? 290  ALA A N   1 
ATOM   898  C  CA  . ALA A 1 138 ? 21.469  9.588   32.525 1.00 18.16 ? 290  ALA A CA  1 
ATOM   899  C  C   . ALA A 1 138 ? 22.284  10.834  32.860 1.00 18.38 ? 290  ALA A C   1 
ATOM   900  O  O   . ALA A 1 138 ? 22.061  11.923  32.312 1.00 18.17 ? 290  ALA A O   1 
ATOM   901  C  CB  . ALA A 1 138 ? 22.090  8.856   31.323 1.00 18.20 ? 290  ALA A CB  1 
ATOM   902  N  N   . GLY A 1 139 ? 23.224  10.649  33.782 1.00 18.16 ? 291  GLY A N   1 
ATOM   903  C  CA  . GLY A 1 139 ? 24.270  11.612  34.045 1.00 18.03 ? 291  GLY A CA  1 
ATOM   904  C  C   . GLY A 1 139 ? 25.550  10.808  34.091 1.00 18.19 ? 291  GLY A C   1 
ATOM   905  O  O   . GLY A 1 139 ? 25.567  9.661   33.648 1.00 17.66 ? 291  GLY A O   1 
ATOM   906  N  N   . GLY A 1 140 ? 26.612  11.409  34.630 1.00 18.40 ? 292  GLY A N   1 
ATOM   907  C  CA  . GLY A 1 140 ? 27.891  10.732  34.812 1.00 18.87 ? 292  GLY A CA  1 
ATOM   908  C  C   . GLY A 1 140 ? 27.805  9.672   35.895 1.00 19.38 ? 292  GLY A C   1 
ATOM   909  O  O   . GLY A 1 140 ? 26.819  9.621   36.648 1.00 19.37 ? 292  GLY A O   1 
ATOM   910  N  N   . TYR A 1 141 ? 28.825  8.817   35.972 1.00 19.72 ? 293  TYR A N   1 
ATOM   911  C  CA  . TYR A 1 141 ? 28.888  7.814   37.026 1.00 20.18 ? 293  TYR A CA  1 
ATOM   912  C  C   . TYR A 1 141 ? 28.660  8.498   38.375 1.00 20.14 ? 293  TYR A C   1 
ATOM   913  O  O   . TYR A 1 141 ? 29.316  9.488   38.703 1.00 19.97 ? 293  TYR A O   1 
ATOM   914  C  CB  . TYR A 1 141 ? 30.223  7.043   37.025 1.00 20.55 ? 293  TYR A CB  1 
ATOM   915  C  CG  . TYR A 1 141 ? 30.363  6.144   38.239 1.00 21.20 ? 293  TYR A CG  1 
ATOM   916  C  CD1 . TYR A 1 141 ? 29.777  4.877   38.263 1.00 22.35 ? 293  TYR A CD1 1 
ATOM   917  C  CD2 . TYR A 1 141 ? 31.053  6.571   39.376 1.00 21.25 ? 293  TYR A CD2 1 
ATOM   918  C  CE1 . TYR A 1 141 ? 29.887  4.050   39.386 1.00 21.92 ? 293  TYR A CE1 1 
ATOM   919  C  CE2 . TYR A 1 141 ? 31.158  5.758   40.505 1.00 21.67 ? 293  TYR A CE2 1 
ATOM   920  C  CZ  . TYR A 1 141 ? 30.571  4.498   40.501 1.00 21.95 ? 293  TYR A CZ  1 
ATOM   921  O  OH  . TYR A 1 141 ? 30.668  3.681   41.612 1.00 22.37 ? 293  TYR A OH  1 
ATOM   922  N  N   . SER A 1 142 ? 27.714  7.963   39.138 1.00 20.25 ? 294  SER A N   1 
ATOM   923  C  CA  . SER A 1 142 ? 27.350  8.510   40.430 1.00 20.16 ? 294  SER A CA  1 
ATOM   924  C  C   . SER A 1 142 ? 27.318  7.393   41.457 1.00 20.10 ? 294  SER A C   1 
ATOM   925  O  O   . SER A 1 142 ? 26.478  6.497   41.384 1.00 20.23 ? 294  SER A O   1 
ATOM   926  C  CB  . SER A 1 142 ? 25.991  9.196   40.343 1.00 20.11 ? 294  SER A CB  1 
ATOM   927  O  OG  . SER A 1 142 ? 25.494  9.515   41.632 1.00 21.67 ? 294  SER A OG  1 
ATOM   928  N  N   . ARG A 1 143 ? 28.245  7.445   42.408 1.00 20.25 ? 295  ARG A N   1 
ATOM   929  C  CA  . ARG A 1 143 ? 28.299  6.461   43.485 1.00 20.44 ? 295  ARG A CA  1 
ATOM   930  C  C   . ARG A 1 143 ? 26.968  6.372   44.221 1.00 20.72 ? 295  ARG A C   1 
ATOM   931  O  O   . ARG A 1 143 ? 26.430  5.276   44.394 1.00 20.91 ? 295  ARG A O   1 
ATOM   932  C  CB  . ARG A 1 143 ? 29.430  6.772   44.470 1.00 20.30 ? 295  ARG A CB  1 
ATOM   933  C  CG  . ARG A 1 143 ? 29.757  5.602   45.381 1.00 20.34 ? 295  ARG A CG  1 
ATOM   934  C  CD  . ARG A 1 143 ? 30.980  5.849   46.246 1.00 20.63 ? 295  ARG A CD  1 
ATOM   935  N  NE  . ARG A 1 143 ? 31.147  4.775   47.227 1.00 20.52 ? 295  ARG A NE  1 
ATOM   936  C  CZ  . ARG A 1 143 ? 32.079  4.738   48.176 1.00 19.57 ? 295  ARG A CZ  1 
ATOM   937  N  NH1 . ARG A 1 143 ? 32.965  5.714   48.307 1.00 19.64 ? 295  ARG A NH1 1 
ATOM   938  N  NH2 . ARG A 1 143 ? 32.120  3.711   49.004 1.00 19.50 ? 295  ARG A NH2 1 
ATOM   939  N  N   . VAL A 1 144 ? 26.435  7.524   44.628 1.00 20.72 ? 296  VAL A N   1 
ATOM   940  C  CA  . VAL A 1 144 ? 25.227  7.559   45.452 1.00 20.95 ? 296  VAL A CA  1 
ATOM   941  C  C   . VAL A 1 144 ? 23.973  7.093   44.702 1.00 21.10 ? 296  VAL A C   1 
ATOM   942  O  O   . VAL A 1 144 ? 23.144  6.378   45.272 1.00 21.16 ? 296  VAL A O   1 
ATOM   943  C  CB  . VAL A 1 144 ? 25.018  8.941   46.166 1.00 20.74 ? 296  VAL A CB  1 
ATOM   944  C  CG1 . VAL A 1 144 ? 24.774  10.063  45.170 1.00 21.19 ? 296  VAL A CG1 1 
ATOM   945  C  CG2 . VAL A 1 144 ? 23.879  8.865   47.165 1.00 20.69 ? 296  VAL A CG2 1 
ATOM   946  N  N   . LEU A 1 145 ? 23.852  7.473   43.431 1.00 21.39 ? 297  LEU A N   1 
ATOM   947  C  CA  . LEU A 1 145 ? 22.702  7.071   42.626 1.00 21.38 ? 297  LEU A CA  1 
ATOM   948  C  C   . LEU A 1 145 ? 22.692  5.564   42.432 1.00 21.54 ? 297  LEU A C   1 
ATOM   949  O  O   . LEU A 1 145 ? 21.656  4.930   42.609 1.00 21.60 ? 297  LEU A O   1 
ATOM   950  C  CB  . LEU A 1 145 ? 22.662  7.805   41.278 1.00 21.39 ? 297  LEU A CB  1 
ATOM   951  C  CG  . LEU A 1 145 ? 21.309  7.833   40.548 1.00 21.24 ? 297  LEU A CG  1 
ATOM   952  C  CD1 . LEU A 1 145 ? 20.220  8.416   41.433 1.00 21.03 ? 297  LEU A CD1 1 
ATOM   953  C  CD2 . LEU A 1 145 ? 21.393  8.605   39.231 1.00 20.93 ? 297  LEU A CD2 1 
ATOM   954  N  N   . ASN A 1 146 ? 23.855  5.006   42.089 1.00 21.93 ? 298  ASN A N   1 
ATOM   955  C  CA  . ASN A 1 146 ? 24.042  3.556   41.954 1.00 22.20 ? 298  ASN A CA  1 
ATOM   956  C  C   . ASN A 1 146 ? 23.731  2.788   43.235 1.00 22.68 ? 298  ASN A C   1 
ATOM   957  O  O   . ASN A 1 146 ? 23.139  1.706   43.186 1.00 22.70 ? 298  ASN A O   1 
ATOM   958  C  CB  . ASN A 1 146 ? 25.472  3.234   41.495 1.00 21.99 ? 298  ASN A CB  1 
ATOM   959  C  CG  . ASN A 1 146 ? 25.707  3.551   40.025 1.00 21.47 ? 298  ASN A CG  1 
ATOM   960  O  OD1 . ASN A 1 146 ? 24.883  4.191   39.362 1.00 20.37 ? 298  ASN A OD1 1 
ATOM   961  N  ND2 . ASN A 1 146 ? 26.835  3.094   39.508 1.00 19.67 ? 298  ASN A ND2 1 
ATOM   962  N  N   . ALA A 1 147 ? 24.146  3.355   44.370 1.00 23.15 ? 299  ALA A N   1 
ATOM   963  C  CA  . ALA A 1 147 ? 23.868  2.793   45.687 1.00 23.71 ? 299  ALA A CA  1 
ATOM   964  C  C   . ALA A 1 147 ? 22.372  2.814   46.011 1.00 24.21 ? 299  ALA A C   1 
ATOM   965  O  O   . ALA A 1 147 ? 21.850  1.867   46.598 1.00 24.32 ? 299  ALA A O   1 
ATOM   966  C  CB  . ALA A 1 147 ? 24.655  3.532   46.756 1.00 23.47 ? 299  ALA A CB  1 
ATOM   967  N  N   . ALA A 1 148 ? 21.693  3.892   45.625 1.00 24.79 ? 300  ALA A N   1 
ATOM   968  C  CA  . ALA A 1 148 ? 20.258  4.028   45.854 1.00 25.74 ? 300  ALA A CA  1 
ATOM   969  C  C   . ALA A 1 148 ? 19.453  3.058   44.988 1.00 26.41 ? 300  ALA A C   1 
ATOM   970  O  O   . ALA A 1 148 ? 18.429  2.534   45.417 1.00 26.70 ? 300  ALA A O   1 
ATOM   971  C  CB  . ALA A 1 148 ? 19.811  5.463   45.610 1.00 25.53 ? 300  ALA A CB  1 
ATOM   972  N  N   . CYS A 1 149 ? 19.924  2.831   43.769 1.00 27.26 ? 301  CYS A N   1 
ATOM   973  C  CA  . CYS A 1 149 ? 19.307  1.869   42.864 1.00 28.06 ? 301  CYS A CA  1 
ATOM   974  C  C   . CYS A 1 149 ? 19.516  0.436   43.346 1.00 28.80 ? 301  CYS A C   1 
ATOM   975  O  O   . CYS A 1 149 ? 18.574  -0.354  43.373 1.00 28.91 ? 301  CYS A O   1 
ATOM   976  C  CB  . CYS A 1 149 ? 19.852  2.057   41.452 1.00 27.85 ? 301  CYS A CB  1 
ATOM   977  S  SG  . CYS A 1 149 ? 19.284  3.583   40.663 1.00 27.38 ? 301  CYS A SG  1 
ATOM   978  N  N   . GLN A 1 150 ? 20.748  0.122   43.746 1.00 29.87 ? 302  GLN A N   1 
ATOM   979  C  CA  . GLN A 1 150 ? 21.099  -1.186  44.306 1.00 30.93 ? 302  GLN A CA  1 
ATOM   980  C  C   . GLN A 1 150 ? 20.264  -1.525  45.537 1.00 31.32 ? 302  GLN A C   1 
ATOM   981  O  O   . GLN A 1 150 ? 19.736  -2.628  45.654 1.00 31.60 ? 302  GLN A O   1 
ATOM   982  C  CB  . GLN A 1 150 ? 22.589  -1.228  44.649 1.00 30.99 ? 302  GLN A CB  1 
ATOM   983  C  CG  . GLN A 1 150 ? 23.044  -2.483  45.365 1.00 32.32 ? 302  GLN A CG  1 
ATOM   984  C  CD  . GLN A 1 150 ? 24.553  -2.662  45.318 1.00 34.73 ? 302  GLN A CD  1 
ATOM   985  O  OE1 . GLN A 1 150 ? 25.309  -1.729  45.601 1.00 36.23 ? 302  GLN A OE1 1 
ATOM   986  N  NE2 . GLN A 1 150 ? 24.999  -3.868  44.960 1.00 34.30 ? 302  GLN A NE2 1 
ATOM   987  N  N   . ARG A 1 151 ? 20.150  -0.565  46.445 1.00 31.98 ? 303  ARG A N   1 
ATOM   988  C  CA  . ARG A 1 151 ? 19.392  -0.736  47.677 1.00 32.72 ? 303  ARG A CA  1 
ATOM   989  C  C   . ARG A 1 151 ? 17.895  -0.911  47.403 1.00 32.47 ? 303  ARG A C   1 
ATOM   990  O  O   . ARG A 1 151 ? 17.232  -1.734  48.030 1.00 32.59 ? 303  ARG A O   1 
ATOM   991  C  CB  . ARG A 1 151 ? 19.671  0.446   48.620 1.00 33.12 ? 303  ARG A CB  1 
ATOM   992  C  CG  . ARG A 1 151 ? 18.593  0.748   49.655 1.00 35.64 ? 303  ARG A CG  1 
ATOM   993  C  CD  . ARG A 1 151 ? 18.565  -0.264  50.803 1.00 40.04 ? 303  ARG A CD  1 
ATOM   994  N  NE  . ARG A 1 151 ? 17.280  -0.239  51.504 1.00 42.64 ? 303  ARG A NE  1 
ATOM   995  C  CZ  . ARG A 1 151 ? 16.931  -1.085  52.468 1.00 44.19 ? 303  ARG A CZ  1 
ATOM   996  N  NH1 . ARG A 1 151 ? 17.771  -2.036  52.866 1.00 45.18 ? 303  ARG A NH1 1 
ATOM   997  N  NH2 . ARG A 1 151 ? 15.740  -0.976  53.039 1.00 45.10 ? 303  ARG A NH2 1 
ATOM   998  N  N   . LEU A 1 152 ? 17.375  -0.137  46.458 1.00 32.48 ? 304  LEU A N   1 
ATOM   999  C  CA  . LEU A 1 152 ? 15.975  -0.228  46.061 1.00 32.36 ? 304  LEU A CA  1 
ATOM   1000 C  C   . LEU A 1 152 ? 15.658  -1.568  45.376 1.00 32.33 ? 304  LEU A C   1 
ATOM   1001 O  O   . LEU A 1 152 ? 14.543  -2.072  45.482 1.00 32.48 ? 304  LEU A O   1 
ATOM   1002 C  CB  . LEU A 1 152 ? 15.623  0.957   45.158 1.00 32.37 ? 304  LEU A CB  1 
ATOM   1003 C  CG  . LEU A 1 152 ? 14.174  1.370   44.893 1.00 32.53 ? 304  LEU A CG  1 
ATOM   1004 C  CD1 . LEU A 1 152 ? 13.423  1.693   46.172 1.00 31.85 ? 304  LEU A CD1 1 
ATOM   1005 C  CD2 . LEU A 1 152 ? 14.158  2.561   43.951 1.00 32.36 ? 304  LEU A CD2 1 
ATOM   1006 N  N   . ALA A 1 153 ? 16.646  -2.145  44.697 1.00 32.22 ? 305  ALA A N   1 
ATOM   1007 C  CA  . ALA A 1 153 ? 16.484  -3.421  44.002 1.00 32.33 ? 305  ALA A CA  1 
ATOM   1008 C  C   . ALA A 1 153 ? 16.550  -4.637  44.936 1.00 32.54 ? 305  ALA A C   1 
ATOM   1009 O  O   . ALA A 1 153 ? 15.912  -5.661  44.678 1.00 32.74 ? 305  ALA A O   1 
ATOM   1010 C  CB  . ALA A 1 153 ? 17.511  -3.547  42.893 1.00 32.29 ? 305  ALA A CB  1 
ATOM   1011 N  N   . ARG A 1 154 ? 17.329  -4.529  46.010 1.00 32.53 ? 306  ARG A N   1 
ATOM   1012 C  CA  . ARG A 1 154 ? 17.375  -5.568  47.037 1.00 32.88 ? 306  ARG A CA  1 
ATOM   1013 C  C   . ARG A 1 154 ? 16.048  -5.644  47.797 1.00 32.11 ? 306  ARG A C   1 
ATOM   1014 O  O   . ARG A 1 154 ? 15.754  -6.653  48.443 1.00 32.18 ? 306  ARG A O   1 
ATOM   1015 C  CB  . ARG A 1 154 ? 18.533  -5.329  48.010 1.00 32.89 ? 306  ARG A CB  1 
ATOM   1016 C  CG  . ARG A 1 154 ? 19.916  -5.565  47.408 1.00 34.10 ? 306  ARG A CG  1 
ATOM   1017 C  CD  . ARG A 1 154 ? 21.012  -5.306  48.442 1.00 34.64 ? 306  ARG A CD  1 
ATOM   1018 N  NE  . ARG A 1 154 ? 22.346  -5.303  47.839 1.00 38.57 ? 306  ARG A NE  1 
ATOM   1019 C  CZ  . ARG A 1 154 ? 23.159  -6.358  47.789 1.00 40.25 ? 306  ARG A CZ  1 
ATOM   1020 N  NH1 . ARG A 1 154 ? 22.787  -7.526  48.310 1.00 41.00 ? 306  ARG A NH1 1 
ATOM   1021 N  NH2 . ARG A 1 154 ? 24.353  -6.247  47.217 1.00 40.96 ? 306  ARG A NH2 1 
ATOM   1022 N  N   . ALA A 1 155 ? 15.261  -4.571  47.709 1.00 31.18 ? 307  ALA A N   1 
ATOM   1023 C  CA  . ALA A 1 155 ? 13.915  -4.517  48.270 1.00 30.36 ? 307  ALA A CA  1 
ATOM   1024 C  C   . ALA A 1 155 ? 12.863  -5.052  47.283 1.00 29.95 ? 307  ALA A C   1 
ATOM   1025 O  O   . ALA A 1 155 ? 11.657  -4.889  47.494 1.00 30.02 ? 307  ALA A O   1 
ATOM   1026 C  CB  . ALA A 1 155 ? 13.584  -3.096  48.696 1.00 30.29 ? 307  ALA A CB  1 
ATOM   1027 N  N   . GLY A 1 156 ? 13.328  -5.685  46.206 1.00 29.19 ? 308  GLY A N   1 
ATOM   1028 C  CA  . GLY A 1 156 ? 12.450  -6.322  45.228 1.00 28.31 ? 308  GLY A CA  1 
ATOM   1029 C  C   . GLY A 1 156 ? 11.913  -5.432  44.118 1.00 27.60 ? 308  GLY A C   1 
ATOM   1030 O  O   . GLY A 1 156 ? 10.990  -5.817  43.405 1.00 27.77 ? 308  GLY A O   1 
ATOM   1031 N  N   . VAL A 1 157 ? 12.490  -4.247  43.957 1.00 26.82 ? 309  VAL A N   1 
ATOM   1032 C  CA  . VAL A 1 157 ? 12.035  -3.321  42.923 1.00 25.74 ? 309  VAL A CA  1 
ATOM   1033 C  C   . VAL A 1 157 ? 12.786  -3.568  41.612 1.00 25.19 ? 309  VAL A C   1 
ATOM   1034 O  O   . VAL A 1 157 ? 14.011  -3.722  41.596 1.00 24.99 ? 309  VAL A O   1 
ATOM   1035 C  CB  . VAL A 1 157 ? 12.140  -1.843  43.384 1.00 25.77 ? 309  VAL A CB  1 
ATOM   1036 C  CG1 . VAL A 1 157 ? 11.661  -0.889  42.299 1.00 25.61 ? 309  VAL A CG1 1 
ATOM   1037 C  CG2 . VAL A 1 157 ? 11.327  -1.627  44.653 1.00 25.15 ? 309  VAL A CG2 1 
ATOM   1038 N  N   . VAL A 1 158 ? 12.032  -3.628  40.519 1.00 24.45 ? 310  VAL A N   1 
ATOM   1039 C  CA  . VAL A 1 158 ? 12.606  -3.803  39.195 1.00 23.53 ? 310  VAL A CA  1 
ATOM   1040 C  C   . VAL A 1 158 ? 12.891  -2.427  38.607 1.00 23.01 ? 310  VAL A C   1 
ATOM   1041 O  O   . VAL A 1 158 ? 11.976  -1.665  38.329 1.00 22.98 ? 310  VAL A O   1 
ATOM   1042 C  CB  . VAL A 1 158 ? 11.674  -4.624  38.266 1.00 23.76 ? 310  VAL A CB  1 
ATOM   1043 C  CG1 . VAL A 1 158 ? 12.312  -4.812  36.893 1.00 23.00 ? 310  VAL A CG1 1 
ATOM   1044 C  CG2 . VAL A 1 158 ? 11.324  -5.977  38.901 1.00 22.88 ? 310  VAL A CG2 1 
ATOM   1045 N  N   . LEU A 1 159 ? 14.170  -2.111  38.449 1.00 22.44 ? 311  LEU A N   1 
ATOM   1046 C  CA  . LEU A 1 159 ? 14.589  -0.826  37.915 1.00 21.82 ? 311  LEU A CA  1 
ATOM   1047 C  C   . LEU A 1 159 ? 15.099  -0.984  36.486 1.00 21.59 ? 311  LEU A C   1 
ATOM   1048 O  O   . LEU A 1 159 ? 15.977  -1.811  36.209 1.00 21.03 ? 311  LEU A O   1 
ATOM   1049 C  CB  . LEU A 1 159 ? 15.654  -0.170  38.804 1.00 21.84 ? 311  LEU A CB  1 
ATOM   1050 C  CG  . LEU A 1 159 ? 15.215  0.339   40.179 1.00 21.74 ? 311  LEU A CG  1 
ATOM   1051 C  CD1 . LEU A 1 159 ? 15.531  -0.682  41.257 1.00 22.01 ? 311  LEU A CD1 1 
ATOM   1052 C  CD2 . LEU A 1 159 ? 15.903  1.655   40.494 1.00 21.73 ? 311  LEU A CD2 1 
ATOM   1053 N  N   . VAL A 1 160 ? 14.512  -0.197  35.586 1.00 21.22 ? 312  VAL A N   1 
ATOM   1054 C  CA  . VAL A 1 160 ? 14.861  -0.223  34.173 1.00 21.03 ? 312  VAL A CA  1 
ATOM   1055 C  C   . VAL A 1 160 ? 15.368  1.162   33.759 1.00 21.02 ? 312  VAL A C   1 
ATOM   1056 O  O   . VAL A 1 160 ? 14.703  2.173   33.988 1.00 20.87 ? 312  VAL A O   1 
ATOM   1057 C  CB  . VAL A 1 160 ? 13.665  -0.670  33.285 1.00 20.98 ? 312  VAL A CB  1 
ATOM   1058 C  CG1 . VAL A 1 160 ? 14.094  -0.791  31.833 1.00 20.15 ? 312  VAL A CG1 1 
ATOM   1059 C  CG2 . VAL A 1 160 ? 13.089  -1.999  33.775 1.00 20.70 ? 312  VAL A CG2 1 
ATOM   1060 N  N   . THR A 1 161 ? 16.550  1.201   33.150 1.00 21.07 ? 313  THR A N   1 
ATOM   1061 C  CA  . THR A 1 161 ? 17.194  2.473   32.840 1.00 20.93 ? 313  THR A CA  1 
ATOM   1062 C  C   . THR A 1 161 ? 17.688  2.571   31.402 1.00 20.39 ? 313  THR A C   1 
ATOM   1063 O  O   . THR A 1 161 ? 17.954  1.562   30.756 1.00 19.97 ? 313  THR A O   1 
ATOM   1064 C  CB  . THR A 1 161 ? 18.366  2.788   33.832 1.00 21.06 ? 313  THR A CB  1 
ATOM   1065 O  OG1 . THR A 1 161 ? 18.782  4.154   33.670 1.00 22.53 ? 313  THR A OG1 1 
ATOM   1066 C  CG2 . THR A 1 161 ? 19.556  1.872   33.599 1.00 21.04 ? 313  THR A CG2 1 
ATOM   1067 N  N   . ALA A 1 162 ? 17.797  3.809   30.922 1.00 20.16 ? 314  ALA A N   1 
ATOM   1068 C  CA  . ALA A 1 162 ? 18.430  4.121   29.650 1.00 19.59 ? 314  ALA A CA  1 
ATOM   1069 C  C   . ALA A 1 162 ? 19.934  3.885   29.752 1.00 19.58 ? 314  ALA A C   1 
ATOM   1070 O  O   . ALA A 1 162 ? 20.567  4.313   30.728 1.00 19.49 ? 314  ALA A O   1 
ATOM   1071 C  CB  . ALA A 1 162 ? 18.156  5.577   29.281 1.00 19.40 ? 314  ALA A CB  1 
ATOM   1072 N  N   . ALA A 1 163 ? 20.498  3.204   28.751 1.00 19.05 ? 315  ALA A N   1 
ATOM   1073 C  CA  . ALA A 1 163 ? 21.943  2.991   28.667 1.00 18.83 ? 315  ALA A CA  1 
ATOM   1074 C  C   . ALA A 1 163 ? 22.708  4.308   28.481 1.00 18.81 ? 315  ALA A C   1 
ATOM   1075 O  O   . ALA A 1 163 ? 23.836  4.461   28.968 1.00 18.16 ? 315  ALA A O   1 
ATOM   1076 C  CB  . ALA A 1 163 ? 22.274  2.014   27.537 1.00 18.87 ? 315  ALA A CB  1 
ATOM   1077 N  N   . GLY A 1 164 ? 22.070  5.255   27.788 1.00 18.97 ? 316  GLY A N   1 
ATOM   1078 C  CA  . GLY A 1 164 ? 22.675  6.542   27.447 1.00 18.87 ? 316  GLY A CA  1 
ATOM   1079 C  C   . GLY A 1 164 ? 22.842  6.681   25.945 1.00 18.93 ? 316  GLY A C   1 
ATOM   1080 O  O   . GLY A 1 164 ? 23.029  5.686   25.239 1.00 19.00 ? 316  GLY A O   1 
ATOM   1081 N  N   . ASN A 1 165 ? 22.782  7.917   25.458 1.00 19.06 ? 317  ASN A N   1 
ATOM   1082 C  CA  . ASN A 1 165 ? 22.831  8.192   24.019 1.00 19.25 ? 317  ASN A CA  1 
ATOM   1083 C  C   . ASN A 1 165 ? 24.155  8.804   23.571 1.00 19.59 ? 317  ASN A C   1 
ATOM   1084 O  O   . ASN A 1 165 ? 24.178  9.672   22.697 1.00 19.74 ? 317  ASN A O   1 
ATOM   1085 C  CB  . ASN A 1 165 ? 21.701  9.141   23.614 1.00 18.86 ? 317  ASN A CB  1 
ATOM   1086 C  CG  . ASN A 1 165 ? 20.328  8.579   23.881 1.00 18.57 ? 317  ASN A CG  1 
ATOM   1087 O  OD1 . ASN A 1 165 ? 20.140  7.367   24.014 1.00 18.58 ? 317  ASN A OD1 1 
ATOM   1088 N  ND2 . ASN A 1 165 ? 19.343  9.466   23.946 1.00 17.32 ? 317  ASN A ND2 1 
ATOM   1089 N  N   . PHE A 1 166 ? 25.257  8.341   24.147 1.00 20.09 ? 318  PHE A N   1 
ATOM   1090 C  CA  . PHE A 1 166 ? 26.538  9.028   23.971 1.00 20.59 ? 318  PHE A CA  1 
ATOM   1091 C  C   . PHE A 1 166 ? 27.575  8.246   23.177 1.00 21.12 ? 318  PHE A C   1 
ATOM   1092 O  O   . PHE A 1 166 ? 28.716  8.690   23.061 1.00 21.30 ? 318  PHE A O   1 
ATOM   1093 C  CB  . PHE A 1 166 ? 27.108  9.448   25.334 1.00 20.42 ? 318  PHE A CB  1 
ATOM   1094 C  CG  . PHE A 1 166 ? 26.173  10.298  26.139 1.00 19.84 ? 318  PHE A CG  1 
ATOM   1095 C  CD1 . PHE A 1 166 ? 25.895  11.606  25.755 1.00 20.03 ? 318  PHE A CD1 1 
ATOM   1096 C  CD2 . PHE A 1 166 ? 25.550  9.784   27.269 1.00 19.72 ? 318  PHE A CD2 1 
ATOM   1097 C  CE1 . PHE A 1 166 ? 25.014  12.397  26.493 1.00 19.84 ? 318  PHE A CE1 1 
ATOM   1098 C  CE2 . PHE A 1 166 ? 24.669  10.563  28.017 1.00 19.93 ? 318  PHE A CE2 1 
ATOM   1099 C  CZ  . PHE A 1 166 ? 24.403  11.875  27.630 1.00 19.88 ? 318  PHE A CZ  1 
ATOM   1100 N  N   . ARG A 1 167 ? 27.175  7.095   22.632 1.00 21.92 ? 319  ARG A N   1 
ATOM   1101 C  CA  . ARG A 1 167 ? 28.067  6.221   21.851 1.00 22.70 ? 319  ARG A CA  1 
ATOM   1102 C  C   . ARG A 1 167 ? 29.348  5.939   22.638 1.00 22.78 ? 319  ARG A C   1 
ATOM   1103 O  O   . ARG A 1 167 ? 30.468  6.017   22.115 1.00 23.12 ? 319  ARG A O   1 
ATOM   1104 C  CB  . ARG A 1 167 ? 28.379  6.853   20.496 1.00 22.79 ? 319  ARG A CB  1 
ATOM   1105 C  CG  . ARG A 1 167 ? 28.713  5.871   19.411 1.00 25.03 ? 319  ARG A CG  1 
ATOM   1106 C  CD  . ARG A 1 167 ? 28.663  6.576   18.079 1.00 28.70 ? 319  ARG A CD  1 
ATOM   1107 N  NE  . ARG A 1 167 ? 28.807  5.664   16.949 1.00 31.00 ? 319  ARG A NE  1 
ATOM   1108 C  CZ  . ARG A 1 167 ? 28.504  5.988   15.693 1.00 32.01 ? 319  ARG A CZ  1 
ATOM   1109 N  NH1 . ARG A 1 167 ? 28.028  7.201   15.413 1.00 31.83 ? 319  ARG A NH1 1 
ATOM   1110 N  NH2 . ARG A 1 167 ? 28.666  5.095   14.720 1.00 32.20 ? 319  ARG A NH2 1 
ATOM   1111 N  N   . ASP A 1 168 ? 29.152  5.603   23.905 1.00 22.78 ? 320  ASP A N   1 
ATOM   1112 C  CA  . ASP A 1 168 ? 30.221  5.482   24.870 1.00 22.83 ? 320  ASP A CA  1 
ATOM   1113 C  C   . ASP A 1 168 ? 29.943  4.253   25.730 1.00 22.93 ? 320  ASP A C   1 
ATOM   1114 O  O   . ASP A 1 168 ? 28.905  3.607   25.578 1.00 22.84 ? 320  ASP A O   1 
ATOM   1115 C  CB  . ASP A 1 168 ? 30.258  6.753   25.725 1.00 22.94 ? 320  ASP A CB  1 
ATOM   1116 C  CG  . ASP A 1 168 ? 31.588  6.972   26.403 1.00 23.31 ? 320  ASP A CG  1 
ATOM   1117 O  OD1 . ASP A 1 168 ? 32.490  6.122   26.255 1.00 23.63 ? 320  ASP A OD1 1 
ATOM   1118 O  OD2 . ASP A 1 168 ? 31.727  8.004   27.093 1.00 23.74 ? 320  ASP A OD2 1 
ATOM   1119 N  N   . ASP A 1 169 ? 30.884  3.921   26.609 1.00 23.02 ? 321  ASP A N   1 
ATOM   1120 C  CA  . ASP A 1 169 ? 30.726  2.841   27.574 1.00 23.30 ? 321  ASP A CA  1 
ATOM   1121 C  C   . ASP A 1 169 ? 29.680  3.243   28.623 1.00 23.04 ? 321  ASP A C   1 
ATOM   1122 O  O   . ASP A 1 169 ? 29.790  4.304   29.241 1.00 22.84 ? 321  ASP A O   1 
ATOM   1123 C  CB  . ASP A 1 169 ? 32.080  2.564   28.238 1.00 23.69 ? 321  ASP A CB  1 
ATOM   1124 C  CG  . ASP A 1 169 ? 32.103  1.280   29.050 1.00 25.02 ? 321  ASP A CG  1 
ATOM   1125 O  OD1 . ASP A 1 169 ? 31.054  0.635   29.232 1.00 27.19 ? 321  ASP A OD1 1 
ATOM   1126 O  OD2 . ASP A 1 169 ? 33.199  0.910   29.519 1.00 27.38 ? 321  ASP A OD2 1 
ATOM   1127 N  N   . ALA A 1 170 ? 28.669  2.394   28.809 1.00 22.76 ? 322  ALA A N   1 
ATOM   1128 C  CA  . ALA A 1 170 ? 27.585  2.656   29.764 1.00 22.85 ? 322  ALA A CA  1 
ATOM   1129 C  C   . ALA A 1 170 ? 28.038  2.640   31.236 1.00 22.94 ? 322  ALA A C   1 
ATOM   1130 O  O   . ALA A 1 170 ? 27.339  3.151   32.111 1.00 22.58 ? 322  ALA A O   1 
ATOM   1131 C  CB  . ALA A 1 170 ? 26.429  1.683   29.546 1.00 22.50 ? 322  ALA A CB  1 
ATOM   1132 N  N   . CYS A 1 171 ? 29.206  2.054   31.497 1.00 23.10 ? 323  CYS A N   1 
ATOM   1133 C  CA  . CYS A 1 171 ? 29.760  2.001   32.850 1.00 23.47 ? 323  CYS A CA  1 
ATOM   1134 C  C   . CYS A 1 171 ? 30.255  3.359   33.361 1.00 22.61 ? 323  CYS A C   1 
ATOM   1135 O  O   . CYS A 1 171 ? 30.543  3.509   34.548 1.00 22.63 ? 323  CYS A O   1 
ATOM   1136 C  CB  . CYS A 1 171 ? 30.867  0.942   32.948 1.00 23.71 ? 323  CYS A CB  1 
ATOM   1137 S  SG  . CYS A 1 171 ? 30.333  -0.763  32.550 1.00 27.55 ? 323  CYS A SG  1 
ATOM   1138 N  N   . LEU A 1 172 ? 30.331  4.341   32.462 1.00 21.93 ? 324  LEU A N   1 
ATOM   1139 C  CA  . LEU A 1 172 ? 30.722  5.711   32.808 1.00 21.15 ? 324  LEU A CA  1 
ATOM   1140 C  C   . LEU A 1 172 ? 29.513  6.621   33.076 1.00 20.60 ? 324  LEU A C   1 
ATOM   1141 O  O   . LEU A 1 172 ? 29.664  7.834   33.231 1.00 20.67 ? 324  LEU A O   1 
ATOM   1142 C  CB  . LEU A 1 172 ? 31.605  6.312   31.698 1.00 21.13 ? 324  LEU A CB  1 
ATOM   1143 C  CG  . LEU A 1 172 ? 32.865  5.556   31.238 1.00 21.63 ? 324  LEU A CG  1 
ATOM   1144 C  CD1 . LEU A 1 172 ? 33.459  6.193   29.991 1.00 21.04 ? 324  LEU A CD1 1 
ATOM   1145 C  CD2 . LEU A 1 172 ? 33.925  5.448   32.342 1.00 20.93 ? 324  LEU A CD2 1 
ATOM   1146 N  N   . TYR A 1 173 ? 28.318  6.033   33.128 1.00 19.97 ? 325  TYR A N   1 
ATOM   1147 C  CA  . TYR A 1 173 ? 27.068  6.787   33.295 1.00 19.35 ? 325  TYR A CA  1 
ATOM   1148 C  C   . TYR A 1 173 ? 26.180  6.178   34.382 1.00 19.30 ? 325  TYR A C   1 
ATOM   1149 O  O   . TYR A 1 173 ? 26.263  4.981   34.667 1.00 19.43 ? 325  TYR A O   1 
ATOM   1150 C  CB  . TYR A 1 173 ? 26.312  6.897   31.951 1.00 18.96 ? 325  TYR A CB  1 
ATOM   1151 C  CG  . TYR A 1 173 ? 27.143  7.552   30.863 1.00 18.72 ? 325  TYR A CG  1 
ATOM   1152 C  CD1 . TYR A 1 173 ? 27.081  8.929   30.637 1.00 17.95 ? 325  TYR A CD1 1 
ATOM   1153 C  CD2 . TYR A 1 173 ? 28.023  6.797   30.084 1.00 19.00 ? 325  TYR A CD2 1 
ATOM   1154 C  CE1 . TYR A 1 173 ? 27.865  9.532   29.659 1.00 17.30 ? 325  TYR A CE1 1 
ATOM   1155 C  CE2 . TYR A 1 173 ? 28.815  7.388   29.111 1.00 18.35 ? 325  TYR A CE2 1 
ATOM   1156 C  CZ  . TYR A 1 173 ? 28.729  8.753   28.896 1.00 18.30 ? 325  TYR A CZ  1 
ATOM   1157 O  OH  . TYR A 1 173 ? 29.513  9.323   27.913 1.00 17.81 ? 325  TYR A OH  1 
ATOM   1158 N  N   . SER A 1 174 ? 25.346  7.011   34.995 1.00 19.14 ? 326  SER A N   1 
ATOM   1159 C  CA  . SER A 1 174 ? 24.409  6.562   36.020 1.00 19.19 ? 326  SER A CA  1 
ATOM   1160 C  C   . SER A 1 174 ? 23.002  7.097   35.740 1.00 19.49 ? 326  SER A C   1 
ATOM   1161 O  O   . SER A 1 174 ? 22.860  8.227   35.265 1.00 19.11 ? 326  SER A O   1 
ATOM   1162 C  CB  . SER A 1 174 ? 24.872  6.993   37.417 1.00 19.25 ? 326  SER A CB  1 
ATOM   1163 O  OG  . SER A 1 174 ? 25.863  6.117   37.922 1.00 18.43 ? 326  SER A OG  1 
ATOM   1164 N  N   . PRO A 1 175 ? 21.957  6.299   36.063 1.00 19.92 ? 327  PRO A N   1 
ATOM   1165 C  CA  . PRO A 1 175 ? 22.020  4.960   36.706 1.00 20.29 ? 327  PRO A CA  1 
ATOM   1166 C  C   . PRO A 1 175 ? 22.411  3.752   35.819 1.00 20.86 ? 327  PRO A C   1 
ATOM   1167 O  O   . PRO A 1 175 ? 22.343  2.611   36.283 1.00 20.89 ? 327  PRO A O   1 
ATOM   1168 C  CB  . PRO A 1 175 ? 20.609  4.778   37.279 1.00 20.20 ? 327  PRO A CB  1 
ATOM   1169 C  CG  . PRO A 1 175 ? 19.727  5.664   36.450 1.00 19.95 ? 327  PRO A CG  1 
ATOM   1170 C  CD  . PRO A 1 175 ? 20.567  6.750   35.845 1.00 19.68 ? 327  PRO A CD  1 
ATOM   1171 N  N   . ALA A 1 176 ? 22.829  4.001   34.577 1.00 21.42 ? 328  ALA A N   1 
ATOM   1172 C  CA  . ALA A 1 176 ? 23.221  2.938   33.634 1.00 21.95 ? 328  ALA A CA  1 
ATOM   1173 C  C   . ALA A 1 176 ? 24.193  1.894   34.208 1.00 22.53 ? 328  ALA A C   1 
ATOM   1174 O  O   . ALA A 1 176 ? 23.981  0.691   34.039 1.00 22.38 ? 328  ALA A O   1 
ATOM   1175 C  CB  . ALA A 1 176 ? 23.795  3.549   32.350 1.00 21.61 ? 328  ALA A CB  1 
ATOM   1176 N  N   . SER A 1 177 ? 25.250  2.360   34.876 1.00 23.27 ? 329  SER A N   1 
ATOM   1177 C  CA  . SER A 1 177 ? 26.287  1.484   35.432 1.00 24.13 ? 329  SER A CA  1 
ATOM   1178 C  C   . SER A 1 177 ? 25.903  0.796   36.752 1.00 24.96 ? 329  SER A C   1 
ATOM   1179 O  O   . SER A 1 177 ? 26.673  -0.011  37.275 1.00 24.93 ? 329  SER A O   1 
ATOM   1180 C  CB  . SER A 1 177 ? 27.584  2.268   35.634 1.00 24.02 ? 329  SER A CB  1 
ATOM   1181 O  OG  . SER A 1 177 ? 27.385  3.368   36.506 1.00 23.83 ? 329  SER A OG  1 
ATOM   1182 N  N   . ALA A 1 178 ? 24.727  1.118   37.290 1.00 26.02 ? 330  ALA A N   1 
ATOM   1183 C  CA  . ALA A 1 178 ? 24.295  0.559   38.567 1.00 27.31 ? 330  ALA A CA  1 
ATOM   1184 C  C   . ALA A 1 178 ? 24.097  -0.948  38.466 1.00 28.27 ? 330  ALA A C   1 
ATOM   1185 O  O   . ALA A 1 178 ? 23.456  -1.429  37.532 1.00 28.62 ? 330  ALA A O   1 
ATOM   1186 C  CB  . ALA A 1 178 ? 23.024  1.243   39.067 1.00 27.02 ? 330  ALA A CB  1 
ATOM   1187 N  N   . PRO A 1 179 ? 24.675  -1.704  39.417 1.00 29.32 ? 331  PRO A N   1 
ATOM   1188 C  CA  . PRO A 1 179 ? 24.397  -3.137  39.449 1.00 29.98 ? 331  PRO A CA  1 
ATOM   1189 C  C   . PRO A 1 179 ? 22.996  -3.362  40.031 1.00 30.32 ? 331  PRO A C   1 
ATOM   1190 O  O   . PRO A 1 179 ? 22.543  -2.573  40.871 1.00 30.76 ? 331  PRO A O   1 
ATOM   1191 C  CB  . PRO A 1 179 ? 25.475  -3.677  40.395 1.00 30.02 ? 331  PRO A CB  1 
ATOM   1192 C  CG  . PRO A 1 179 ? 25.746  -2.541  41.331 1.00 29.75 ? 331  PRO A CG  1 
ATOM   1193 C  CD  . PRO A 1 179 ? 25.583  -1.287  40.507 1.00 29.43 ? 331  PRO A CD  1 
ATOM   1194 N  N   . GLU A 1 180 ? 22.327  -4.424  39.586 1.00 30.29 ? 332  GLU A N   1 
ATOM   1195 C  CA  . GLU A 1 180 ? 20.942  -4.739  39.984 1.00 30.22 ? 332  GLU A CA  1 
ATOM   1196 C  C   . GLU A 1 180 ? 19.922  -4.078  39.056 1.00 29.45 ? 332  GLU A C   1 
ATOM   1197 O  O   . GLU A 1 180 ? 18.780  -4.535  38.952 1.00 29.91 ? 332  GLU A O   1 
ATOM   1198 C  CB  . GLU A 1 180 ? 20.642  -4.362  41.449 1.00 30.51 ? 332  GLU A CB  1 
ATOM   1199 C  CG  . GLU A 1 180 ? 21.611  -4.905  42.506 1.00 32.22 ? 332  GLU A CG  1 
ATOM   1200 C  CD  . GLU A 1 180 ? 21.552  -6.410  42.667 1.00 34.33 ? 332  GLU A CD  1 
ATOM   1201 O  OE1 . GLU A 1 180 ? 21.788  -7.129  41.667 1.00 34.94 ? 332  GLU A OE1 1 
ATOM   1202 O  OE2 . GLU A 1 180 ? 21.285  -6.866  43.805 1.00 34.97 ? 332  GLU A OE2 1 
ATOM   1203 N  N   . VAL A 1 181 ? 20.341  -3.007  38.391 1.00 28.32 ? 333  VAL A N   1 
ATOM   1204 C  CA  . VAL A 1 181 ? 19.494  -2.276  37.447 1.00 27.20 ? 333  VAL A CA  1 
ATOM   1205 C  C   . VAL A 1 181 ? 19.561  -2.914  36.053 1.00 26.38 ? 333  VAL A C   1 
ATOM   1206 O  O   . VAL A 1 181 ? 20.620  -3.379  35.627 1.00 26.39 ? 333  VAL A O   1 
ATOM   1207 C  CB  . VAL A 1 181 ? 19.902  -0.781  37.389 1.00 27.12 ? 333  VAL A CB  1 
ATOM   1208 C  CG1 . VAL A 1 181 ? 19.197  -0.070  36.281 1.00 27.84 ? 333  VAL A CG1 1 
ATOM   1209 C  CG2 . VAL A 1 181 ? 19.579  -0.097  38.702 1.00 27.00 ? 333  VAL A CG2 1 
ATOM   1210 N  N   . ILE A 1 182 ? 18.423  -2.950  35.362 1.00 25.19 ? 334  ILE A N   1 
ATOM   1211 C  CA  . ILE A 1 182 ? 18.358  -3.428  33.983 1.00 23.94 ? 334  ILE A CA  1 
ATOM   1212 C  C   . ILE A 1 182 ? 18.636  -2.241  33.065 1.00 23.40 ? 334  ILE A C   1 
ATOM   1213 O  O   . ILE A 1 182 ? 17.893  -1.255  33.070 1.00 23.37 ? 334  ILE A O   1 
ATOM   1214 C  CB  . ILE A 1 182 ? 16.995  -4.113  33.673 1.00 24.06 ? 334  ILE A CB  1 
ATOM   1215 C  CG1 . ILE A 1 182 ? 16.794  -5.330  34.591 1.00 23.63 ? 334  ILE A CG1 1 
ATOM   1216 C  CG2 . ILE A 1 182 ? 16.904  -4.539  32.207 1.00 23.30 ? 334  ILE A CG2 1 
ATOM   1217 C  CD1 . ILE A 1 182 ? 15.352  -5.742  34.787 1.00 23.61 ? 334  ILE A CD1 1 
ATOM   1218 N  N   . THR A 1 183 ? 19.729  -2.343  32.311 1.00 22.42 ? 335  THR A N   1 
ATOM   1219 C  CA  . THR A 1 183 ? 20.238  -1.260  31.472 1.00 21.89 ? 335  THR A CA  1 
ATOM   1220 C  C   . THR A 1 183 ? 19.975  -1.594  30.012 1.00 21.33 ? 335  THR A C   1 
ATOM   1221 O  O   . THR A 1 183 ? 20.390  -2.648  29.524 1.00 21.33 ? 335  THR A O   1 
ATOM   1222 C  CB  . THR A 1 183 ? 21.753  -1.050  31.690 1.00 21.92 ? 335  THR A CB  1 
ATOM   1223 O  OG1 . THR A 1 183 ? 22.007  -0.830  33.081 1.00 22.19 ? 335  THR A OG1 1 
ATOM   1224 C  CG2 . THR A 1 183 ? 22.272  0.142   30.905 1.00 21.97 ? 335  THR A CG2 1 
ATOM   1225 N  N   . VAL A 1 184 ? 19.275  -0.694  29.324 1.00 20.38 ? 336  VAL A N   1 
ATOM   1226 C  CA  . VAL A 1 184 ? 18.775  -0.990  27.988 1.00 19.39 ? 336  VAL A CA  1 
ATOM   1227 C  C   . VAL A 1 184 ? 19.333  -0.055  26.923 1.00 19.07 ? 336  VAL A C   1 
ATOM   1228 O  O   . VAL A 1 184 ? 19.153  1.170   27.004 1.00 18.72 ? 336  VAL A O   1 
ATOM   1229 C  CB  . VAL A 1 184 ? 17.223  -0.999  27.928 1.00 19.62 ? 336  VAL A CB  1 
ATOM   1230 C  CG1 . VAL A 1 184 ? 16.744  -1.633  26.610 1.00 18.57 ? 336  VAL A CG1 1 
ATOM   1231 C  CG2 . VAL A 1 184 ? 16.626  -1.738  29.130 1.00 18.65 ? 336  VAL A CG2 1 
ATOM   1232 N  N   . GLY A 1 185 ? 20.018  -0.653  25.942 1.00 18.31 ? 337  GLY A N   1 
ATOM   1233 C  CA  . GLY A 1 185 ? 20.482  0.046   24.742 1.00 18.01 ? 337  GLY A CA  1 
ATOM   1234 C  C   . GLY A 1 185 ? 19.442  0.034   23.631 1.00 17.80 ? 337  GLY A C   1 
ATOM   1235 O  O   . GLY A 1 185 ? 18.493  -0.755  23.665 1.00 17.76 ? 337  GLY A O   1 
ATOM   1236 N  N   . ALA A 1 186 ? 19.628  0.897   22.636 1.00 17.69 ? 338  ALA A N   1 
ATOM   1237 C  CA  . ALA A 1 186 ? 18.666  1.044   21.548 1.00 17.82 ? 338  ALA A CA  1 
ATOM   1238 C  C   . ALA A 1 186 ? 19.111  0.422   20.218 1.00 18.21 ? 338  ALA A C   1 
ATOM   1239 O  O   . ALA A 1 186 ? 20.233  0.652   19.744 1.00 18.01 ? 338  ALA A O   1 
ATOM   1240 C  CB  . ALA A 1 186 ? 18.304  2.519   21.355 1.00 17.99 ? 338  ALA A CB  1 
ATOM   1241 N  N   . THR A 1 187 ? 18.216  -0.370  19.629 1.00 18.48 ? 339  THR A N   1 
ATOM   1242 C  CA  . THR A 1 187 ? 18.381  -0.878  18.267 1.00 18.82 ? 339  THR A CA  1 
ATOM   1243 C  C   . THR A 1 187 ? 17.303  -0.308  17.333 1.00 19.14 ? 339  THR A C   1 
ATOM   1244 O  O   . THR A 1 187 ? 16.236  0.126   17.791 1.00 19.12 ? 339  THR A O   1 
ATOM   1245 C  CB  . THR A 1 187 ? 18.389  -2.428  18.202 1.00 18.88 ? 339  THR A CB  1 
ATOM   1246 O  OG1 . THR A 1 187 ? 17.300  -2.969  18.970 1.00 18.94 ? 339  THR A OG1 1 
ATOM   1247 C  CG2 . THR A 1 187 ? 19.717  -2.983  18.712 1.00 18.77 ? 339  THR A CG2 1 
ATOM   1248 N  N   . ASN A 1 188 ? 17.603  -0.281  16.033 1.00 19.32 ? 340  ASN A N   1 
ATOM   1249 C  CA  . ASN A 1 188 ? 16.651  0.197   15.022 1.00 19.66 ? 340  ASN A CA  1 
ATOM   1250 C  C   . ASN A 1 188 ? 15.893  -0.953  14.344 1.00 19.88 ? 340  ASN A C   1 
ATOM   1251 O  O   . ASN A 1 188 ? 15.983  -2.104  14.793 1.00 19.91 ? 340  ASN A O   1 
ATOM   1252 C  CB  . ASN A 1 188 ? 17.350  1.098   13.989 1.00 19.69 ? 340  ASN A CB  1 
ATOM   1253 C  CG  . ASN A 1 188 ? 18.527  0.418   13.302 1.00 19.67 ? 340  ASN A CG  1 
ATOM   1254 O  OD1 . ASN A 1 188 ? 18.503  -0.780  13.043 1.00 21.23 ? 340  ASN A OD1 1 
ATOM   1255 N  ND2 . ASN A 1 188 ? 19.558  1.193   12.988 1.00 19.60 ? 340  ASN A ND2 1 
ATOM   1256 N  N   . ALA A 1 189 ? 15.157  -0.634  13.273 1.00 19.98 ? 341  ALA A N   1 
ATOM   1257 C  CA  . ALA A 1 189 ? 14.353  -1.608  12.515 1.00 20.08 ? 341  ALA A CA  1 
ATOM   1258 C  C   . ALA A 1 189 ? 15.193  -2.648  11.762 1.00 20.52 ? 341  ALA A C   1 
ATOM   1259 O  O   . ALA A 1 189 ? 14.671  -3.669  11.301 1.00 20.46 ? 341  ALA A O   1 
ATOM   1260 C  CB  . ALA A 1 189 ? 13.402  -0.888  11.559 1.00 19.67 ? 341  ALA A CB  1 
ATOM   1261 N  N   . GLN A 1 190 ? 16.489  -2.372  11.644 1.00 21.04 ? 342  GLN A N   1 
ATOM   1262 C  CA  . GLN A 1 190 ? 17.436  -3.282  11.023 1.00 21.70 ? 342  GLN A CA  1 
ATOM   1263 C  C   . GLN A 1 190 ? 18.146  -4.103  12.107 1.00 21.76 ? 342  GLN A C   1 
ATOM   1264 O  O   . GLN A 1 190 ? 19.032  -4.911  11.805 1.00 21.77 ? 342  GLN A O   1 
ATOM   1265 C  CB  . GLN A 1 190 ? 18.449  -2.503  10.170 1.00 21.91 ? 342  GLN A CB  1 
ATOM   1266 C  CG  . GLN A 1 190 ? 17.900  -1.910  8.854  1.00 24.33 ? 342  GLN A CG  1 
ATOM   1267 C  CD  . GLN A 1 190 ? 16.991  -0.692  9.059  1.00 28.04 ? 342  GLN A CD  1 
ATOM   1268 O  OE1 . GLN A 1 190 ? 17.364  0.278   9.729  1.00 29.21 ? 342  GLN A OE1 1 
ATOM   1269 N  NE2 . GLN A 1 190 ? 15.790  -0.740  8.474  1.00 28.94 ? 342  GLN A NE2 1 
ATOM   1270 N  N   . ASP A 1 191 ? 17.734  -3.887  13.361 1.00 21.90 ? 343  ASP A N   1 
ATOM   1271 C  CA  . ASP A 1 191 ? 18.286  -4.554  14.560 1.00 21.95 ? 343  ASP A CA  1 
ATOM   1272 C  C   . ASP A 1 191 ? 19.704  -4.099  14.874 1.00 21.96 ? 343  ASP A C   1 
ATOM   1273 O  O   . ASP A 1 191 ? 20.464  -4.790  15.553 1.00 21.95 ? 343  ASP A O   1 
ATOM   1274 C  CB  . ASP A 1 191 ? 18.219  -6.088  14.455 1.00 22.01 ? 343  ASP A CB  1 
ATOM   1275 C  CG  . ASP A 1 191 ? 16.816  -6.639  14.671 1.00 21.99 ? 343  ASP A CG  1 
ATOM   1276 O  OD1 . ASP A 1 191 ? 16.074  -6.132  15.546 1.00 21.39 ? 343  ASP A OD1 1 
ATOM   1277 O  OD2 . ASP A 1 191 ? 16.460  -7.599  13.960 1.00 22.63 ? 343  ASP A OD2 1 
ATOM   1278 N  N   . GLN A 1 192 ? 20.043  -2.914  14.384 1.00 22.04 ? 344  GLN A N   1 
ATOM   1279 C  CA  . GLN A 1 192 ? 21.381  -2.374  14.536 1.00 21.98 ? 344  GLN A CA  1 
ATOM   1280 C  C   . GLN A 1 192 ? 21.384  -1.290  15.604 1.00 22.32 ? 344  GLN A C   1 
ATOM   1281 O  O   . GLN A 1 192 ? 20.334  -0.727  15.897 1.00 22.13 ? 344  GLN A O   1 
ATOM   1282 C  CB  . GLN A 1 192 ? 21.890  -1.852  13.186 1.00 21.73 ? 344  GLN A CB  1 
ATOM   1283 C  CG  . GLN A 1 192 ? 22.014  -2.948  12.130 1.00 20.53 ? 344  GLN A CG  1 
ATOM   1284 C  CD  . GLN A 1 192 ? 22.597  -4.236  12.703 1.00 19.38 ? 344  GLN A CD  1 
ATOM   1285 O  OE1 . GLN A 1 192 ? 23.717  -4.243  13.230 1.00 18.94 ? 344  GLN A OE1 1 
ATOM   1286 N  NE2 . GLN A 1 192 ? 21.834  -5.327  12.616 1.00 16.64 ? 344  GLN A NE2 1 
ATOM   1287 N  N   . PRO A 1 193 ? 22.559  -1.009  16.206 1.00 22.84 ? 345  PRO A N   1 
ATOM   1288 C  CA  . PRO A 1 193 ? 22.622  0.036   17.231 1.00 23.41 ? 345  PRO A CA  1 
ATOM   1289 C  C   . PRO A 1 193 ? 22.219  1.405   16.669 1.00 24.07 ? 345  PRO A C   1 
ATOM   1290 O  O   . PRO A 1 193 ? 22.665  1.783   15.584 1.00 24.16 ? 345  PRO A O   1 
ATOM   1291 C  CB  . PRO A 1 193 ? 24.094  0.026   17.651 1.00 23.08 ? 345  PRO A CB  1 
ATOM   1292 C  CG  . PRO A 1 193 ? 24.606  -1.309  17.245 1.00 22.93 ? 345  PRO A CG  1 
ATOM   1293 C  CD  . PRO A 1 193 ? 23.876  -1.634  15.990 1.00 22.67 ? 345  PRO A CD  1 
ATOM   1294 N  N   . VAL A 1 194 ? 21.377  2.128   17.403 1.00 24.96 ? 346  VAL A N   1 
ATOM   1295 C  CA  . VAL A 1 194 ? 20.821  3.397   16.924 1.00 25.86 ? 346  VAL A CA  1 
ATOM   1296 C  C   . VAL A 1 194 ? 21.885  4.492   16.889 1.00 27.03 ? 346  VAL A C   1 
ATOM   1297 O  O   . VAL A 1 194 ? 22.564  4.749   17.887 1.00 26.93 ? 346  VAL A O   1 
ATOM   1298 C  CB  . VAL A 1 194 ? 19.580  3.848   17.756 1.00 25.53 ? 346  VAL A CB  1 
ATOM   1299 C  CG1 . VAL A 1 194 ? 19.092  5.224   17.322 1.00 25.24 ? 346  VAL A CG1 1 
ATOM   1300 C  CG2 . VAL A 1 194 ? 18.453  2.846   17.619 1.00 24.57 ? 346  VAL A CG2 1 
ATOM   1301 N  N   . THR A 1 195 ? 22.033  5.095   15.712 1.00 28.52 ? 347  THR A N   1 
ATOM   1302 C  CA  . THR A 1 195 ? 22.866  6.271   15.506 1.00 30.26 ? 347  THR A CA  1 
ATOM   1303 C  C   . THR A 1 195 ? 21.898  7.437   15.494 1.00 31.37 ? 347  THR A C   1 
ATOM   1304 O  O   . THR A 1 195 ? 20.910  7.425   14.748 1.00 31.68 ? 347  THR A O   1 
ATOM   1305 C  CB  . THR A 1 195 ? 23.615  6.224   14.154 1.00 30.25 ? 347  THR A CB  1 
ATOM   1306 O  OG1 . THR A 1 195 ? 24.156  4.914   13.940 1.00 30.84 ? 347  THR A OG1 1 
ATOM   1307 C  CG2 . THR A 1 195 ? 24.743  7.239   14.130 1.00 30.93 ? 347  THR A CG2 1 
ATOM   1308 N  N   . LEU A 1 196 ? 22.174  8.437   16.325 1.00 32.48 ? 348  LEU A N   1 
ATOM   1309 C  CA  . LEU A 1 196 ? 21.198  9.491   16.592 1.00 33.51 ? 348  LEU A CA  1 
ATOM   1310 C  C   . LEU A 1 196 ? 21.541  10.793  15.868 1.00 34.16 ? 348  LEU A C   1 
ATOM   1311 O  O   . LEU A 1 196 ? 20.692  11.371  15.176 1.00 34.64 ? 348  LEU A O   1 
ATOM   1312 C  CB  . LEU A 1 196 ? 21.004  9.672   18.114 1.00 33.54 ? 348  LEU A CB  1 
ATOM   1313 C  CG  . LEU A 1 196 ? 20.132  8.561   18.747 1.00 33.23 ? 348  LEU A CG  1 
ATOM   1314 C  CD1 . LEU A 1 196 ? 20.370  8.341   20.239 1.00 31.25 ? 348  LEU A CD1 1 
ATOM   1315 C  CD2 . LEU A 1 196 ? 18.645  8.794   18.453 1.00 32.30 ? 348  LEU A CD2 1 
ATOM   1316 N  N   . GLY A 1 197 ? 22.786  11.235  16.024 1.00 34.39 ? 349  GLY A N   1 
ATOM   1317 C  CA  . GLY A 1 197 ? 23.348  12.303  15.213 1.00 34.46 ? 349  GLY A CA  1 
ATOM   1318 C  C   . GLY A 1 197 ? 24.829  12.019  15.105 1.00 34.60 ? 349  GLY A C   1 
ATOM   1319 O  O   . GLY A 1 197 ? 25.243  11.078  14.418 1.00 34.56 ? 349  GLY A O   1 
ATOM   1320 N  N   . THR A 1 198 ? 25.623  12.826  15.804 1.00 34.56 ? 350  THR A N   1 
ATOM   1321 C  CA  . THR A 1 198 ? 27.050  12.560  15.970 1.00 34.43 ? 350  THR A CA  1 
ATOM   1322 C  C   . THR A 1 198 ? 27.214  11.311  16.843 1.00 34.05 ? 350  THR A C   1 
ATOM   1323 O  O   . THR A 1 198 ? 28.089  10.475  16.593 1.00 34.33 ? 350  THR A O   1 
ATOM   1324 C  CB  . THR A 1 198 ? 27.801  13.763  16.622 1.00 34.53 ? 350  THR A CB  1 
ATOM   1325 O  OG1 . THR A 1 198 ? 27.340  13.953  17.967 1.00 34.82 ? 350  THR A OG1 1 
ATOM   1326 C  CG2 . THR A 1 198 ? 27.578  15.054  15.826 1.00 34.47 ? 350  THR A CG2 1 
ATOM   1327 N  N   . LEU A 1 199 ? 26.346  11.194  17.852 1.00 33.18 ? 351  LEU A N   1 
ATOM   1328 C  CA  . LEU A 1 199 ? 26.378  10.093  18.812 1.00 32.36 ? 351  LEU A CA  1 
ATOM   1329 C  C   . LEU A 1 199 ? 25.168  9.138   18.673 1.00 31.58 ? 351  LEU A C   1 
ATOM   1330 O  O   . LEU A 1 199 ? 24.330  9.301   17.781 1.00 31.93 ? 351  LEU A O   1 
ATOM   1331 C  CB  . LEU A 1 199 ? 26.481  10.655  20.236 1.00 32.63 ? 351  LEU A CB  1 
ATOM   1332 C  CG  . LEU A 1 199 ? 27.624  11.638  20.533 1.00 32.83 ? 351  LEU A CG  1 
ATOM   1333 C  CD1 . LEU A 1 199 ? 27.356  12.402  21.825 1.00 33.26 ? 351  LEU A CD1 1 
ATOM   1334 C  CD2 . LEU A 1 199 ? 28.991  10.947  20.580 1.00 33.55 ? 351  LEU A CD2 1 
ATOM   1335 N  N   . GLY A 1 200 ? 25.092  8.141   19.550 1.00 30.11 ? 352  GLY A N   1 
ATOM   1336 C  CA  . GLY A 1 200 ? 24.057  7.111   19.481 1.00 28.14 ? 352  GLY A CA  1 
ATOM   1337 C  C   . GLY A 1 200 ? 24.060  6.244   20.723 1.00 26.92 ? 352  GLY A C   1 
ATOM   1338 O  O   . GLY A 1 200 ? 24.527  6.670   21.772 1.00 26.88 ? 352  GLY A O   1 
ATOM   1339 N  N   . THR A 1 201 ? 23.557  5.018   20.612 1.00 25.81 ? 353  THR A N   1 
ATOM   1340 C  CA  . THR A 1 201 ? 23.425  4.150   21.785 1.00 24.43 ? 353  THR A CA  1 
ATOM   1341 C  C   . THR A 1 201 ? 24.751  3.809   22.478 1.00 23.96 ? 353  THR A C   1 
ATOM   1342 O  O   . THR A 1 201 ? 25.780  3.596   21.824 1.00 23.75 ? 353  THR A O   1 
ATOM   1343 C  CB  . THR A 1 201 ? 22.623  2.854   21.492 1.00 24.25 ? 353  THR A CB  1 
ATOM   1344 O  OG1 . THR A 1 201 ? 22.342  2.178   22.726 1.00 23.69 ? 353  THR A OG1 1 
ATOM   1345 C  CG2 . THR A 1 201 ? 23.385  1.923   20.579 1.00 23.59 ? 353  THR A CG2 1 
ATOM   1346 N  N   . ASN A 1 202 ? 24.704  3.781   23.811 1.00 23.07 ? 354  ASN A N   1 
ATOM   1347 C  CA  . ASN A 1 202 ? 25.815  3.301   24.621 1.00 22.18 ? 354  ASN A CA  1 
ATOM   1348 C  C   . ASN A 1 202 ? 25.924  1.781   24.551 1.00 22.01 ? 354  ASN A C   1 
ATOM   1349 O  O   . ASN A 1 202 ? 24.995  1.095   24.105 1.00 21.89 ? 354  ASN A O   1 
ATOM   1350 C  CB  . ASN A 1 202 ? 25.685  3.776   26.077 1.00 21.98 ? 354  ASN A CB  1 
ATOM   1351 C  CG  . ASN A 1 202 ? 26.183  5.197   26.281 1.00 20.58 ? 354  ASN A CG  1 
ATOM   1352 O  OD1 . ASN A 1 202 ? 26.641  5.851   25.347 1.00 19.24 ? 354  ASN A OD1 1 
ATOM   1353 N  ND2 . ASN A 1 202 ? 26.105  5.676   27.513 1.00 18.63 ? 354  ASN A ND2 1 
ATOM   1354 N  N   . PHE A 1 203 ? 27.069  1.267   24.988 1.00 21.89 ? 355  PHE A N   1 
ATOM   1355 C  CA  . PHE A 1 203 ? 27.405  -0.149  24.856 1.00 21.86 ? 355  PHE A CA  1 
ATOM   1356 C  C   . PHE A 1 203 ? 28.239  -0.599  26.053 1.00 22.16 ? 355  PHE A C   1 
ATOM   1357 O  O   . PHE A 1 203 ? 28.447  0.169   26.992 1.00 22.14 ? 355  PHE A O   1 
ATOM   1358 C  CB  . PHE A 1 203 ? 28.173  -0.390  23.545 1.00 21.45 ? 355  PHE A CB  1 
ATOM   1359 C  CG  . PHE A 1 203 ? 29.228  0.656   23.250 1.00 20.87 ? 355  PHE A CG  1 
ATOM   1360 C  CD1 . PHE A 1 203 ? 29.002  1.633   22.283 1.00 20.27 ? 355  PHE A CD1 1 
ATOM   1361 C  CD2 . PHE A 1 203 ? 30.440  0.671   23.948 1.00 19.95 ? 355  PHE A CD2 1 
ATOM   1362 C  CE1 . PHE A 1 203 ? 29.966  2.603   22.011 1.00 20.54 ? 355  PHE A CE1 1 
ATOM   1363 C  CE2 . PHE A 1 203 ? 31.405  1.635   23.686 1.00 19.46 ? 355  PHE A CE2 1 
ATOM   1364 C  CZ  . PHE A 1 203 ? 31.171  2.603   22.716 1.00 20.26 ? 355  PHE A CZ  1 
ATOM   1365 N  N   . GLY A 1 204 ? 28.706  -1.843  26.014 1.00 22.67 ? 356  GLY A N   1 
ATOM   1366 C  CA  . GLY A 1 204 ? 29.615  -2.361  27.022 1.00 23.44 ? 356  GLY A CA  1 
ATOM   1367 C  C   . GLY A 1 204 ? 28.986  -3.350  27.980 1.00 24.16 ? 356  GLY A C   1 
ATOM   1368 O  O   . GLY A 1 204 ? 27.832  -3.749  27.809 1.00 24.15 ? 356  GLY A O   1 
ATOM   1369 N  N   . ARG A 1 205 ? 29.758  -3.722  28.999 1.00 24.84 ? 357  ARG A N   1 
ATOM   1370 C  CA  . ARG A 1 205 ? 29.398  -4.764  29.968 1.00 25.68 ? 357  ARG A CA  1 
ATOM   1371 C  C   . ARG A 1 205 ? 28.279  -4.358  30.922 1.00 25.60 ? 357  ARG A C   1 
ATOM   1372 O  O   . ARG A 1 205 ? 27.677  -5.218  31.572 1.00 25.98 ? 357  ARG A O   1 
ATOM   1373 C  CB  . ARG A 1 205 ? 30.638  -5.195  30.770 1.00 25.61 ? 357  ARG A CB  1 
ATOM   1374 C  CG  . ARG A 1 205 ? 31.258  -4.076  31.607 1.00 26.62 ? 357  ARG A CG  1 
ATOM   1375 C  CD  . ARG A 1 205 ? 32.538  -4.503  32.300 1.00 27.02 ? 357  ARG A CD  1 
ATOM   1376 N  NE  . ARG A 1 205 ? 33.094  -3.423  33.116 1.00 30.96 ? 357  ARG A NE  1 
ATOM   1377 C  CZ  . ARG A 1 205 ? 32.829  -3.229  34.411 1.00 32.66 ? 357  ARG A CZ  1 
ATOM   1378 N  NH1 . ARG A 1 205 ? 32.006  -4.043  35.069 1.00 33.53 ? 357  ARG A NH1 1 
ATOM   1379 N  NH2 . ARG A 1 205 ? 33.388  -2.212  35.055 1.00 32.92 ? 357  ARG A NH2 1 
ATOM   1380 N  N   . CYS A 1 206 ? 28.011  -3.054  31.011 1.00 25.45 ? 358  CYS A N   1 
ATOM   1381 C  CA  . CYS A 1 206 ? 26.962  -2.535  31.893 1.00 25.07 ? 358  CYS A CA  1 
ATOM   1382 C  C   . CYS A 1 206 ? 25.591  -2.520  31.222 1.00 24.75 ? 358  CYS A C   1 
ATOM   1383 O  O   . CYS A 1 206 ? 24.583  -2.283  31.877 1.00 24.84 ? 358  CYS A O   1 
ATOM   1384 C  CB  . CYS A 1 206 ? 27.315  -1.138  32.422 1.00 25.17 ? 358  CYS A CB  1 
ATOM   1385 S  SG  . CYS A 1 206 ? 28.640  -1.096  33.670 1.00 24.79 ? 358  CYS A SG  1 
ATOM   1386 N  N   . VAL A 1 207 ? 25.560  -2.766  29.916 1.00 24.21 ? 359  VAL A N   1 
ATOM   1387 C  CA  . VAL A 1 207 ? 24.300  -2.926  29.199 1.00 23.45 ? 359  VAL A CA  1 
ATOM   1388 C  C   . VAL A 1 207 ? 23.810  -4.375  29.341 1.00 23.22 ? 359  VAL A C   1 
ATOM   1389 O  O   . VAL A 1 207 ? 24.567  -5.329  29.134 1.00 23.05 ? 359  VAL A O   1 
ATOM   1390 C  CB  . VAL A 1 207 ? 24.413  -2.480  27.704 1.00 23.53 ? 359  VAL A CB  1 
ATOM   1391 C  CG1 . VAL A 1 207 ? 23.114  -2.733  26.940 1.00 22.87 ? 359  VAL A CG1 1 
ATOM   1392 C  CG2 . VAL A 1 207 ? 24.775  -1.007  27.619 1.00 23.21 ? 359  VAL A CG2 1 
ATOM   1393 N  N   . ASP A 1 208 ? 22.542  -4.524  29.710 1.00 22.83 ? 360  ASP A N   1 
ATOM   1394 C  CA  . ASP A 1 208 ? 21.937  -5.835  29.914 1.00 22.58 ? 360  ASP A CA  1 
ATOM   1395 C  C   . ASP A 1 208 ? 21.334  -6.408  28.630 1.00 22.08 ? 360  ASP A C   1 
ATOM   1396 O  O   . ASP A 1 208 ? 21.465  -7.604  28.354 1.00 22.05 ? 360  ASP A O   1 
ATOM   1397 C  CB  . ASP A 1 208 ? 20.894  -5.756  31.029 1.00 22.95 ? 360  ASP A CB  1 
ATOM   1398 C  CG  . ASP A 1 208 ? 21.518  -5.507  32.384 1.00 23.66 ? 360  ASP A CG  1 
ATOM   1399 O  OD1 . ASP A 1 208 ? 21.884  -6.487  33.060 1.00 26.38 ? 360  ASP A OD1 1 
ATOM   1400 O  OD2 . ASP A 1 208 ? 21.653  -4.333  32.778 1.00 25.06 ? 360  ASP A OD2 1 
ATOM   1401 N  N   . LEU A 1 209 ? 20.680  -5.547  27.852 1.00 21.50 ? 361  LEU A N   1 
ATOM   1402 C  CA  . LEU A 1 209 ? 20.107  -5.919  26.560 1.00 20.66 ? 361  LEU A CA  1 
ATOM   1403 C  C   . LEU A 1 209 ? 19.767  -4.679  25.730 1.00 20.24 ? 361  LEU A C   1 
ATOM   1404 O  O   . LEU A 1 209 ? 19.850  -3.551  26.218 1.00 19.62 ? 361  LEU A O   1 
ATOM   1405 C  CB  . LEU A 1 209 ? 18.864  -6.810  26.744 1.00 20.89 ? 361  LEU A CB  1 
ATOM   1406 C  CG  . LEU A 1 209 ? 17.512  -6.287  27.255 1.00 20.76 ? 361  LEU A CG  1 
ATOM   1407 C  CD1 . LEU A 1 209 ? 16.514  -7.434  27.276 1.00 21.47 ? 361  LEU A CD1 1 
ATOM   1408 C  CD2 . LEU A 1 209 ? 17.597  -5.662  28.632 1.00 21.07 ? 361  LEU A CD2 1 
ATOM   1409 N  N   . PHE A 1 210 ? 19.395  -4.908  24.471 1.00 19.58 ? 362  PHE A N   1 
ATOM   1410 C  CA  . PHE A 1 210 ? 18.894  -3.855  23.594 1.00 18.69 ? 362  PHE A CA  1 
ATOM   1411 C  C   . PHE A 1 210 ? 17.389  -4.018  23.359 1.00 18.41 ? 362  PHE A C   1 
ATOM   1412 O  O   . PHE A 1 210 ? 16.833  -5.092  23.555 1.00 18.29 ? 362  PHE A O   1 
ATOM   1413 C  CB  . PHE A 1 210 ? 19.667  -3.844  22.268 1.00 18.27 ? 362  PHE A CB  1 
ATOM   1414 C  CG  . PHE A 1 210 ? 21.115  -3.460  22.416 1.00 18.00 ? 362  PHE A CG  1 
ATOM   1415 C  CD1 . PHE A 1 210 ? 21.545  -2.183  22.084 1.00 17.04 ? 362  PHE A CD1 1 
ATOM   1416 C  CD2 . PHE A 1 210 ? 22.052  -4.374  22.909 1.00 17.63 ? 362  PHE A CD2 1 
ATOM   1417 C  CE1 . PHE A 1 210 ? 22.890  -1.821  22.238 1.00 17.55 ? 362  PHE A CE1 1 
ATOM   1418 C  CE2 . PHE A 1 210 ? 23.390  -4.018  23.059 1.00 17.05 ? 362  PHE A CE2 1 
ATOM   1419 C  CZ  . PHE A 1 210 ? 23.808  -2.739  22.727 1.00 16.39 ? 362  PHE A CZ  1 
ATOM   1420 N  N   . ALA A 1 211 ? 16.730  -2.939  22.956 1.00 18.30 ? 363  ALA A N   1 
ATOM   1421 C  CA  . ALA A 1 211 ? 15.317  -2.985  22.602 1.00 18.13 ? 363  ALA A CA  1 
ATOM   1422 C  C   . ALA A 1 211 ? 15.059  -1.881  21.582 1.00 18.05 ? 363  ALA A C   1 
ATOM   1423 O  O   . ALA A 1 211 ? 15.876  -0.970  21.464 1.00 18.15 ? 363  ALA A O   1 
ATOM   1424 C  CB  . ALA A 1 211 ? 14.444  -2.807  23.846 1.00 18.13 ? 363  ALA A CB  1 
ATOM   1425 N  N   . PRO A 1 212 ? 13.946  -1.966  20.822 1.00 18.01 ? 364  PRO A N   1 
ATOM   1426 C  CA  . PRO A 1 212 ? 13.628  -0.932  19.828 1.00 17.90 ? 364  PRO A CA  1 
ATOM   1427 C  C   . PRO A 1 212 ? 13.675  0.487   20.386 1.00 18.06 ? 364  PRO A C   1 
ATOM   1428 O  O   . PRO A 1 212 ? 13.059  0.773   21.415 1.00 17.95 ? 364  PRO A O   1 
ATOM   1429 C  CB  . PRO A 1 212 ? 12.210  -1.303  19.390 1.00 17.63 ? 364  PRO A CB  1 
ATOM   1430 C  CG  . PRO A 1 212 ? 12.178  -2.782  19.529 1.00 17.73 ? 364  PRO A CG  1 
ATOM   1431 C  CD  . PRO A 1 212 ? 12.945  -3.053  20.800 1.00 17.94 ? 364  PRO A CD  1 
ATOM   1432 N  N   . GLY A 1 213 ? 14.413  1.359   19.701 1.00 18.47 ? 365  GLY A N   1 
ATOM   1433 C  CA  . GLY A 1 213 ? 14.649  2.719   20.167 1.00 18.78 ? 365  GLY A CA  1 
ATOM   1434 C  C   . GLY A 1 213 ? 14.800  3.768   19.080 1.00 19.16 ? 365  GLY A C   1 
ATOM   1435 O  O   . GLY A 1 213 ? 15.216  4.890   19.362 1.00 19.16 ? 365  GLY A O   1 
ATOM   1436 N  N   . GLU A 1 214 ? 14.474  3.410   17.841 1.00 19.50 ? 366  GLU A N   1 
ATOM   1437 C  CA  . GLU A 1 214 ? 14.467  4.373   16.741 1.00 20.40 ? 366  GLU A CA  1 
ATOM   1438 C  C   . GLU A 1 214 ? 13.104  4.394   16.068 1.00 20.41 ? 366  GLU A C   1 
ATOM   1439 O  O   . GLU A 1 214 ? 12.525  3.331   15.822 1.00 20.69 ? 366  GLU A O   1 
ATOM   1440 C  CB  . GLU A 1 214 ? 15.560  4.053   15.708 1.00 20.10 ? 366  GLU A CB  1 
ATOM   1441 C  CG  . GLU A 1 214 ? 15.631  5.049   14.566 1.00 20.75 ? 366  GLU A CG  1 
ATOM   1442 C  CD  . GLU A 1 214 ? 16.783  4.789   13.630 1.00 21.95 ? 366  GLU A CD  1 
ATOM   1443 O  OE1 . GLU A 1 214 ? 17.899  5.272   13.922 1.00 24.17 ? 366  GLU A OE1 1 
ATOM   1444 O  OE2 . GLU A 1 214 ? 16.574  4.117   12.592 1.00 23.98 ? 366  GLU A OE2 1 
ATOM   1445 N  N   . ASP A 1 215 ? 12.618  5.600   15.760 1.00 20.30 ? 367  ASP A N   1 
ATOM   1446 C  CA  . ASP A 1 215 ? 11.313  5.815   15.122 1.00 20.59 ? 367  ASP A CA  1 
ATOM   1447 C  C   . ASP A 1 215 ? 10.179  5.066   15.833 1.00 20.12 ? 367  ASP A C   1 
ATOM   1448 O  O   . ASP A 1 215 ? 9.500   4.225   15.250 1.00 20.10 ? 367  ASP A O   1 
ATOM   1449 C  CB  . ASP A 1 215 ? 11.357  5.480   13.619 1.00 20.90 ? 367  ASP A CB  1 
ATOM   1450 C  CG  . ASP A 1 215 ? 12.336  6.360   12.844 1.00 22.33 ? 367  ASP A CG  1 
ATOM   1451 O  OD1 . ASP A 1 215 ? 12.603  7.510   13.269 1.00 23.36 ? 367  ASP A OD1 1 
ATOM   1452 O  OD2 . ASP A 1 215 ? 12.842  5.896   11.796 1.00 24.46 ? 367  ASP A OD2 1 
ATOM   1453 N  N   . ILE A 1 216 ? 9.996   5.382   17.108 1.00 19.98 ? 368  ILE A N   1 
ATOM   1454 C  CA  . ILE A 1 216 ? 8.979   4.747   17.937 1.00 19.61 ? 368  ILE A CA  1 
ATOM   1455 C  C   . ILE A 1 216 ? 7.755   5.658   17.998 1.00 19.67 ? 368  ILE A C   1 
ATOM   1456 O  O   . ILE A 1 216 ? 7.806   6.743   18.589 1.00 19.51 ? 368  ILE A O   1 
ATOM   1457 C  CB  . ILE A 1 216 ? 9.521   4.454   19.372 1.00 19.50 ? 368  ILE A CB  1 
ATOM   1458 C  CG1 . ILE A 1 216 ? 10.824  3.633   19.325 1.00 18.71 ? 368  ILE A CG1 1 
ATOM   1459 C  CG2 . ILE A 1 216 ? 8.434   3.833   20.273 1.00 19.22 ? 368  ILE A CG2 1 
ATOM   1460 C  CD1 . ILE A 1 216 ? 10.747  2.302   18.590 1.00 16.72 ? 368  ILE A CD1 1 
ATOM   1461 N  N   . ILE A 1 217 ? 6.672   5.228   17.354 1.00 19.70 ? 369  ILE A N   1 
ATOM   1462 C  CA  . ILE A 1 217 ? 5.406   5.959   17.409 1.00 19.90 ? 369  ILE A CA  1 
ATOM   1463 C  C   . ILE A 1 217 ? 4.857   5.919   18.838 1.00 19.82 ? 369  ILE A C   1 
ATOM   1464 O  O   . ILE A 1 217 ? 4.825   4.858   19.470 1.00 19.60 ? 369  ILE A O   1 
ATOM   1465 C  CB  . ILE A 1 217 ? 4.358   5.411   16.385 1.00 20.14 ? 369  ILE A CB  1 
ATOM   1466 C  CG1 . ILE A 1 217 ? 4.872   5.560   14.943 1.00 20.12 ? 369  ILE A CG1 1 
ATOM   1467 C  CG2 . ILE A 1 217 ? 3.001   6.123   16.543 1.00 20.05 ? 369  ILE A CG2 1 
ATOM   1468 C  CD1 . ILE A 1 217 ? 4.288   4.545   13.950 1.00 19.78 ? 369  ILE A CD1 1 
ATOM   1469 N  N   . GLY A 1 218 ? 4.461   7.086   19.345 1.00 19.65 ? 370  GLY A N   1 
ATOM   1470 C  CA  . GLY A 1 218 ? 3.867   7.194   20.670 1.00 19.54 ? 370  GLY A CA  1 
ATOM   1471 C  C   . GLY A 1 218 ? 3.149   8.510   20.898 1.00 19.50 ? 370  GLY A C   1 
ATOM   1472 O  O   . GLY A 1 218 ? 3.155   9.386   20.039 1.00 19.52 ? 370  GLY A O   1 
ATOM   1473 N  N   . ALA A 1 219 ? 2.544   8.646   22.075 1.00 19.37 ? 371  ALA A N   1 
ATOM   1474 C  CA  . ALA A 1 219 ? 1.765   9.825   22.433 1.00 19.27 ? 371  ALA A CA  1 
ATOM   1475 C  C   . ALA A 1 219 ? 2.542   11.139  22.300 1.00 19.36 ? 371  ALA A C   1 
ATOM   1476 O  O   . ALA A 1 219 ? 3.642   11.291  22.854 1.00 19.10 ? 371  ALA A O   1 
ATOM   1477 C  CB  . ALA A 1 219 ? 1.208   9.678   23.852 1.00 19.16 ? 371  ALA A CB  1 
ATOM   1478 N  N   . SER A 1 220 ? 1.955   12.074  21.556 1.00 19.17 ? 372  SER A N   1 
ATOM   1479 C  CA  . SER A 1 220 ? 2.446   13.446  21.485 1.00 19.28 ? 372  SER A CA  1 
ATOM   1480 C  C   . SER A 1 220 ? 1.577   14.344  22.360 1.00 19.49 ? 372  SER A C   1 
ATOM   1481 O  O   . SER A 1 220 ? 0.354   14.351  22.230 1.00 19.58 ? 372  SER A O   1 
ATOM   1482 C  CB  . SER A 1 220 ? 2.432   13.956  20.039 1.00 19.20 ? 372  SER A CB  1 
ATOM   1483 O  OG  . SER A 1 220 ? 2.730   15.341  19.968 1.00 18.31 ? 372  SER A OG  1 
ATOM   1484 N  N   . SER A 1 221 ? 2.216   15.106  23.241 1.00 19.72 ? 373  SER A N   1 
ATOM   1485 C  CA  . SER A 1 221 ? 1.508   16.047  24.113 1.00 19.76 ? 373  SER A CA  1 
ATOM   1486 C  C   . SER A 1 221 ? 1.040   17.321  23.393 1.00 20.06 ? 373  SER A C   1 
ATOM   1487 O  O   . SER A 1 221 ? 0.519   18.230  24.028 1.00 20.47 ? 373  SER A O   1 
ATOM   1488 C  CB  . SER A 1 221 ? 2.360   16.392  25.339 1.00 19.70 ? 373  SER A CB  1 
ATOM   1489 O  OG  . SER A 1 221 ? 3.660   16.826  24.962 1.00 19.35 ? 373  SER A OG  1 
ATOM   1490 N  N   . ASP A 1 222 ? 1.219   17.383  22.073 1.00 20.36 ? 374  ASP A N   1 
ATOM   1491 C  CA  . ASP A 1 222 ? 0.719   18.502  21.260 1.00 20.51 ? 374  ASP A CA  1 
ATOM   1492 C  C   . ASP A 1 222 ? -0.806  18.548  21.240 1.00 20.58 ? 374  ASP A C   1 
ATOM   1493 O  O   . ASP A 1 222 ? -1.402  19.618  21.159 1.00 20.72 ? 374  ASP A O   1 
ATOM   1494 C  CB  . ASP A 1 222 ? 1.250   18.422  19.820 1.00 20.54 ? 374  ASP A CB  1 
ATOM   1495 C  CG  . ASP A 1 222 ? 2.678   18.950  19.677 1.00 20.82 ? 374  ASP A CG  1 
ATOM   1496 O  OD1 . ASP A 1 222 ? 3.343   19.219  20.700 1.00 20.84 ? 374  ASP A OD1 1 
ATOM   1497 O  OD2 . ASP A 1 222 ? 3.138   19.093  18.524 1.00 21.38 ? 374  ASP A OD2 1 
ATOM   1498 N  N   . CYS A 1 223 ? -1.428  17.375  21.284 1.00 20.73 ? 375  CYS A N   1 
ATOM   1499 C  CA  . CYS A 1 223 ? -2.878  17.258  21.429 1.00 20.65 ? 375  CYS A CA  1 
ATOM   1500 C  C   . CYS A 1 223 ? -3.216  15.860  21.957 1.00 20.26 ? 375  CYS A C   1 
ATOM   1501 O  O   . CYS A 1 223 ? -2.388  14.958  21.903 1.00 20.53 ? 375  CYS A O   1 
ATOM   1502 C  CB  . CYS A 1 223 ? -3.594  17.591  20.108 1.00 20.64 ? 375  CYS A CB  1 
ATOM   1503 S  SG  . CYS A 1 223 ? -3.870  16.240  18.947 1.00 21.73 ? 375  CYS A SG  1 
ATOM   1504 N  N   . SER A 1 224 ? -4.422  15.684  22.482 1.00 19.97 ? 376  SER A N   1 
ATOM   1505 C  CA  . SER A 1 224 ? -4.788  14.439  23.161 1.00 19.41 ? 376  SER A CA  1 
ATOM   1506 C  C   . SER A 1 224 ? -4.952  13.224  22.241 1.00 18.84 ? 376  SER A C   1 
ATOM   1507 O  O   . SER A 1 224 ? -4.982  12.097  22.721 1.00 18.97 ? 376  SER A O   1 
ATOM   1508 C  CB  . SER A 1 224 ? -6.051  14.650  23.995 1.00 19.43 ? 376  SER A CB  1 
ATOM   1509 O  OG  . SER A 1 224 ? -7.122  15.055  23.164 1.00 20.38 ? 376  SER A OG  1 
ATOM   1510 N  N   . THR A 1 225 ? -5.057  13.452  20.932 1.00 18.27 ? 377  THR A N   1 
ATOM   1511 C  CA  . THR A 1 225 ? -5.150  12.362  19.942 1.00 17.56 ? 377  THR A CA  1 
ATOM   1512 C  C   . THR A 1 225 ? -3.957  12.371  18.964 1.00 17.39 ? 377  THR A C   1 
ATOM   1513 O  O   . THR A 1 225 ? -3.990  11.736  17.899 1.00 16.88 ? 377  THR A O   1 
ATOM   1514 C  CB  . THR A 1 225 ? -6.475  12.420  19.154 1.00 17.38 ? 377  THR A CB  1 
ATOM   1515 O  OG1 . THR A 1 225 ? -6.705  13.761  18.712 1.00 17.10 ? 377  THR A OG1 1 
ATOM   1516 C  CG2 . THR A 1 225 ? -7.649  11.972  20.025 1.00 17.62 ? 377  THR A CG2 1 
ATOM   1517 N  N   . CYS A 1 226 ? -2.903  13.081  19.361 1.00 17.14 ? 378  CYS A N   1 
ATOM   1518 C  CA  . CYS A 1 226 ? -1.724  13.295  18.537 1.00 17.21 ? 378  CYS A CA  1 
ATOM   1519 C  C   . CYS A 1 226 ? -0.625  12.260  18.792 1.00 16.87 ? 378  CYS A C   1 
ATOM   1520 O  O   . CYS A 1 226 ? -0.459  11.772  19.911 1.00 16.99 ? 378  CYS A O   1 
ATOM   1521 C  CB  . CYS A 1 226 ? -1.192  14.712  18.758 1.00 17.34 ? 378  CYS A CB  1 
ATOM   1522 S  SG  . CYS A 1 226 ? -2.119  16.006  17.893 1.00 19.17 ? 378  CYS A SG  1 
ATOM   1523 N  N   . PHE A 1 227 ? 0.117   11.931  17.739 1.00 16.56 ? 379  PHE A N   1 
ATOM   1524 C  CA  . PHE A 1 227 ? 1.198   10.950  17.804 1.00 16.13 ? 379  PHE A CA  1 
ATOM   1525 C  C   . PHE A 1 227 ? 2.465   11.483  17.146 1.00 16.40 ? 379  PHE A C   1 
ATOM   1526 O  O   . PHE A 1 227 ? 2.400   12.285  16.217 1.00 16.31 ? 379  PHE A O   1 
ATOM   1527 C  CB  . PHE A 1 227 ? 0.762   9.631   17.156 1.00 15.90 ? 379  PHE A CB  1 
ATOM   1528 C  CG  . PHE A 1 227 ? -0.227  8.851   17.979 1.00 15.13 ? 379  PHE A CG  1 
ATOM   1529 C  CD1 . PHE A 1 227 ? 0.206   7.837   18.827 1.00 15.01 ? 379  PHE A CD1 1 
ATOM   1530 C  CD2 . PHE A 1 227 ? -1.589  9.133   17.912 1.00 13.83 ? 379  PHE A CD2 1 
ATOM   1531 C  CE1 . PHE A 1 227 ? -0.705  7.111   19.600 1.00 15.76 ? 379  PHE A CE1 1 
ATOM   1532 C  CE2 . PHE A 1 227 ? -2.509  8.423   18.686 1.00 14.35 ? 379  PHE A CE2 1 
ATOM   1533 C  CZ  . PHE A 1 227 ? -2.071  7.410   19.530 1.00 15.11 ? 379  PHE A CZ  1 
ATOM   1534 N  N   . VAL A 1 228 ? 3.615   11.035  17.643 1.00 16.87 ? 380  VAL A N   1 
ATOM   1535 C  CA  . VAL A 1 228 ? 4.922   11.453  17.135 1.00 17.37 ? 380  VAL A CA  1 
ATOM   1536 C  C   . VAL A 1 228 ? 5.911   10.279  17.209 1.00 17.88 ? 380  VAL A C   1 
ATOM   1537 O  O   . VAL A 1 228 ? 5.726   9.367   18.011 1.00 18.20 ? 380  VAL A O   1 
ATOM   1538 C  CB  . VAL A 1 228 ? 5.455   12.700  17.925 1.00 17.29 ? 380  VAL A CB  1 
ATOM   1539 C  CG1 . VAL A 1 228 ? 5.928   12.319  19.332 1.00 16.74 ? 380  VAL A CG1 1 
ATOM   1540 C  CG2 . VAL A 1 228 ? 6.554   13.426  17.158 1.00 17.11 ? 380  VAL A CG2 1 
ATOM   1541 N  N   . SER A 1 229 ? 6.937   10.296  16.358 1.00 18.75 ? 381  SER A N   1 
ATOM   1542 C  CA  . SER A 1 229 ? 8.058   9.352   16.446 1.00 19.47 ? 381  SER A CA  1 
ATOM   1543 C  C   . SER A 1 229 ? 9.233   9.976   17.176 1.00 19.80 ? 381  SER A C   1 
ATOM   1544 O  O   . SER A 1 229 ? 9.643   11.096  16.855 1.00 20.24 ? 381  SER A O   1 
ATOM   1545 C  CB  . SER A 1 229 ? 8.517   8.913   15.062 1.00 19.53 ? 381  SER A CB  1 
ATOM   1546 O  OG  . SER A 1 229 ? 7.695   7.872   14.583 1.00 21.36 ? 381  SER A OG  1 
ATOM   1547 N  N   . GLN A 1 230 ? 9.763   9.247   18.157 1.00 19.81 ? 382  GLN A N   1 
ATOM   1548 C  CA  . GLN A 1 230 ? 10.925  9.673   18.929 1.00 20.16 ? 382  GLN A CA  1 
ATOM   1549 C  C   . GLN A 1 230 ? 11.953  8.545   18.954 1.00 19.68 ? 382  GLN A C   1 
ATOM   1550 O  O   . GLN A 1 230 ? 11.614  7.379   18.739 1.00 19.51 ? 382  GLN A O   1 
ATOM   1551 C  CB  . GLN A 1 230 ? 10.521  10.074  20.362 1.00 19.90 ? 382  GLN A CB  1 
ATOM   1552 C  CG  . GLN A 1 230 ? 9.721   11.389  20.467 1.00 21.12 ? 382  GLN A CG  1 
ATOM   1553 C  CD  . GLN A 1 230 ? 9.448   11.843  21.919 1.00 22.50 ? 382  GLN A CD  1 
ATOM   1554 O  OE1 . GLN A 1 230 ? 9.885   11.207  22.895 1.00 26.86 ? 382  GLN A OE1 1 
ATOM   1555 N  NE2 . GLN A 1 230 ? 8.722   12.952  22.059 1.00 24.12 ? 382  GLN A NE2 1 
ATOM   1556 N  N   . SER A 1 231 ? 13.207  8.899   19.221 1.00 19.49 ? 383  SER A N   1 
ATOM   1557 C  CA  . SER A 1 231 ? 14.301  7.927   19.280 1.00 18.90 ? 383  SER A CA  1 
ATOM   1558 C  C   . SER A 1 231 ? 15.172  8.124   20.521 1.00 18.66 ? 383  SER A C   1 
ATOM   1559 O  O   . SER A 1 231 ? 15.340  9.246   21.000 1.00 18.56 ? 383  SER A O   1 
ATOM   1560 C  CB  . SER A 1 231 ? 15.175  8.025   18.027 1.00 18.73 ? 383  SER A CB  1 
ATOM   1561 O  OG  . SER A 1 231 ? 14.426  7.822   16.848 1.00 18.66 ? 383  SER A OG  1 
ATOM   1562 N  N   . GLY A 1 232 ? 15.729  7.026   21.027 1.00 18.36 ? 384  GLY A N   1 
ATOM   1563 C  CA  . GLY A 1 232 ? 16.672  7.076   22.140 1.00 17.91 ? 384  GLY A CA  1 
ATOM   1564 C  C   . GLY A 1 232 ? 16.629  5.841   23.012 1.00 17.75 ? 384  GLY A C   1 
ATOM   1565 O  O   . GLY A 1 232 ? 15.766  4.976   22.835 1.00 17.79 ? 384  GLY A O   1 
ATOM   1566 N  N   . THR A 1 233 ? 17.557  5.770   23.964 1.00 17.62 ? 385  THR A N   1 
ATOM   1567 C  CA  . THR A 1 233 ? 17.609  4.665   24.926 1.00 17.57 ? 385  THR A CA  1 
ATOM   1568 C  C   . THR A 1 233 ? 16.506  4.738   25.990 1.00 17.83 ? 385  THR A C   1 
ATOM   1569 O  O   . THR A 1 233 ? 16.218  3.733   26.652 1.00 17.68 ? 385  THR A O   1 
ATOM   1570 C  CB  . THR A 1 233 ? 19.010  4.511   25.580 1.00 17.70 ? 385  THR A CB  1 
ATOM   1571 O  OG1 . THR A 1 233 ? 19.416  5.753   26.168 1.00 17.16 ? 385  THR A OG1 1 
ATOM   1572 C  CG2 . THR A 1 233 ? 20.047  4.066   24.537 1.00 16.63 ? 385  THR A CG2 1 
ATOM   1573 N  N   . SER A 1 234 ? 15.902  5.924   26.136 1.00 18.00 ? 386  SER A N   1 
ATOM   1574 C  CA  . SER A 1 234 ? 14.648  6.123   26.877 1.00 18.43 ? 386  SER A CA  1 
ATOM   1575 C  C   . SER A 1 234 ? 13.529  5.249   26.333 1.00 18.67 ? 386  SER A C   1 
ATOM   1576 O  O   . SER A 1 234 ? 12.854  4.536   27.087 1.00 18.73 ? 386  SER A O   1 
ATOM   1577 C  CB  . SER A 1 234 ? 14.182  7.570   26.741 1.00 18.68 ? 386  SER A CB  1 
ATOM   1578 O  OG  . SER A 1 234 ? 14.790  8.412   27.692 1.00 20.09 ? 386  SER A OG  1 
ATOM   1579 N  N   . GLN A 1 235 ? 13.318  5.349   25.019 1.00 19.01 ? 387  GLN A N   1 
ATOM   1580 C  CA  . GLN A 1 235 ? 12.283  4.591   24.311 1.00 19.35 ? 387  GLN A CA  1 
ATOM   1581 C  C   . GLN A 1 235 ? 12.566  3.102   24.393 1.00 19.13 ? 387  GLN A C   1 
ATOM   1582 O  O   . GLN A 1 235 ? 11.651  2.308   24.633 1.00 19.23 ? 387  GLN A O   1 
ATOM   1583 C  CB  . GLN A 1 235 ? 12.166  5.044   22.841 1.00 19.48 ? 387  GLN A CB  1 
ATOM   1584 C  CG  . GLN A 1 235 ? 11.295  6.281   22.629 1.00 20.65 ? 387  GLN A CG  1 
ATOM   1585 C  CD  . GLN A 1 235 ? 11.952  7.554   23.119 1.00 22.92 ? 387  GLN A CD  1 
ATOM   1586 O  OE1 . GLN A 1 235 ? 13.169  7.695   23.042 1.00 25.31 ? 387  GLN A OE1 1 
ATOM   1587 N  NE2 . GLN A 1 235 ? 11.151  8.489   23.625 1.00 23.17 ? 387  GLN A NE2 1 
ATOM   1588 N  N   . ALA A 1 236 ? 13.836  2.738   24.198 1.00 18.77 ? 388  ALA A N   1 
ATOM   1589 C  CA  . ALA A 1 236 ? 14.300  1.359   24.377 1.00 18.64 ? 388  ALA A CA  1 
ATOM   1590 C  C   . ALA A 1 236 ? 13.935  0.803   25.754 1.00 18.58 ? 388  ALA A C   1 
ATOM   1591 O  O   . ALA A 1 236 ? 13.319  -0.249  25.848 1.00 19.19 ? 388  ALA A O   1 
ATOM   1592 C  CB  . ALA A 1 236 ? 15.815  1.269   24.137 1.00 18.22 ? 388  ALA A CB  1 
ATOM   1593 N  N   . ALA A 1 237 ? 14.296  1.529   26.810 1.00 18.57 ? 389  ALA A N   1 
ATOM   1594 C  CA  . ALA A 1 237 ? 14.038  1.122   28.195 1.00 18.40 ? 389  ALA A CA  1 
ATOM   1595 C  C   . ALA A 1 237 ? 12.546  1.011   28.536 1.00 18.45 ? 389  ALA A C   1 
ATOM   1596 O  O   . ALA A 1 237 ? 12.142  0.151   29.323 1.00 18.49 ? 389  ALA A O   1 
ATOM   1597 C  CB  . ALA A 1 237 ? 14.739  2.073   29.159 1.00 18.28 ? 389  ALA A CB  1 
ATOM   1598 N  N   . ALA A 1 238 ? 11.735  1.882   27.937 1.00 18.50 ? 390  ALA A N   1 
ATOM   1599 C  CA  . ALA A 1 238 ? 10.287  1.865   28.127 1.00 18.24 ? 390  ALA A CA  1 
ATOM   1600 C  C   . ALA A 1 238 ? 9.659   0.586   27.574 1.00 18.20 ? 390  ALA A C   1 
ATOM   1601 O  O   . ALA A 1 238 ? 8.621   0.141   28.060 1.00 18.31 ? 390  ALA A O   1 
ATOM   1602 C  CB  . ALA A 1 238 ? 9.659   3.089   27.493 1.00 18.16 ? 390  ALA A CB  1 
ATOM   1603 N  N   . HIS A 1 239 ? 10.298  0.009   26.559 1.00 18.13 ? 391  HIS A N   1 
ATOM   1604 C  CA  . HIS A 1 239 ? 9.903   -1.285  25.991 1.00 18.11 ? 391  HIS A CA  1 
ATOM   1605 C  C   . HIS A 1 239 ? 10.146  -2.422  26.978 1.00 18.18 ? 391  HIS A C   1 
ATOM   1606 O  O   . HIS A 1 239 ? 9.286   -3.277  27.175 1.00 18.28 ? 391  HIS A O   1 
ATOM   1607 C  CB  . HIS A 1 239 ? 10.669  -1.570  24.689 1.00 17.73 ? 391  HIS A CB  1 
ATOM   1608 C  CG  . HIS A 1 239 ? 10.059  -0.946  23.473 1.00 16.64 ? 391  HIS A CG  1 
ATOM   1609 N  ND1 . HIS A 1 239 ? 10.349  0.341   23.069 1.00 15.58 ? 391  HIS A ND1 1 
ATOM   1610 C  CD2 . HIS A 1 239 ? 9.188   -1.439  22.559 1.00 15.81 ? 391  HIS A CD2 1 
ATOM   1611 C  CE1 . HIS A 1 239 ? 9.676   0.616   21.966 1.00 15.05 ? 391  HIS A CE1 1 
ATOM   1612 N  NE2 . HIS A 1 239 ? 8.963   -0.445  21.636 1.00 14.56 ? 391  HIS A NE2 1 
ATOM   1613 N  N   . VAL A 1 240 ? 11.330  -2.425  27.585 1.00 18.48 ? 392  VAL A N   1 
ATOM   1614 C  CA  . VAL A 1 240 ? 11.701  -3.445  28.565 1.00 18.35 ? 392  VAL A CA  1 
ATOM   1615 C  C   . VAL A 1 240 ? 10.882  -3.332  29.856 1.00 18.49 ? 392  VAL A C   1 
ATOM   1616 O  O   . VAL A 1 240 ? 10.464  -4.348  30.416 1.00 18.77 ? 392  VAL A O   1 
ATOM   1617 C  CB  . VAL A 1 240 ? 13.224  -3.437  28.836 1.00 18.42 ? 392  VAL A CB  1 
ATOM   1618 C  CG1 . VAL A 1 240 ? 13.576  -4.295  30.053 1.00 17.54 ? 392  VAL A CG1 1 
ATOM   1619 C  CG2 . VAL A 1 240 ? 13.971  -3.928  27.596 1.00 18.09 ? 392  VAL A CG2 1 
ATOM   1620 N  N   . ALA A 1 241 ? 10.653  -2.101  30.316 1.00 18.50 ? 393  ALA A N   1 
ATOM   1621 C  CA  . ALA A 1 241 ? 9.732   -1.830  31.430 1.00 18.63 ? 393  ALA A CA  1 
ATOM   1622 C  C   . ALA A 1 241 ? 8.320   -2.350  31.145 1.00 18.81 ? 393  ALA A C   1 
ATOM   1623 O  O   . ALA A 1 241 ? 7.658   -2.895  32.033 1.00 19.10 ? 393  ALA A O   1 
ATOM   1624 C  CB  . ALA A 1 241 ? 9.694   -0.333  31.750 1.00 18.38 ? 393  ALA A CB  1 
ATOM   1625 N  N   . GLY A 1 242 ? 7.867   -2.175  29.907 1.00 19.07 ? 394  GLY A N   1 
ATOM   1626 C  CA  . GLY A 1 242 ? 6.587   -2.713  29.461 1.00 19.58 ? 394  GLY A CA  1 
ATOM   1627 C  C   . GLY A 1 242 ? 6.548   -4.230  29.467 1.00 19.99 ? 394  GLY A C   1 
ATOM   1628 O  O   . GLY A 1 242 ? 5.576   -4.815  29.924 1.00 19.81 ? 394  GLY A O   1 
ATOM   1629 N  N   . ILE A 1 243 ? 7.600   -4.864  28.946 1.00 20.90 ? 395  ILE A N   1 
ATOM   1630 C  CA  . ILE A 1 243 ? 7.730   -6.329  28.975 1.00 21.56 ? 395  ILE A CA  1 
ATOM   1631 C  C   . ILE A 1 243 ? 7.756   -6.850  30.416 1.00 22.35 ? 395  ILE A C   1 
ATOM   1632 O  O   . ILE A 1 243 ? 7.011   -7.774  30.756 1.00 22.22 ? 395  ILE A O   1 
ATOM   1633 C  CB  . ILE A 1 243 ? 8.982   -6.841  28.189 1.00 21.71 ? 395  ILE A CB  1 
ATOM   1634 C  CG1 . ILE A 1 243 ? 8.866   -6.510  26.696 1.00 21.33 ? 395  ILE A CG1 1 
ATOM   1635 C  CG2 . ILE A 1 243 ? 9.163   -8.352  28.374 1.00 21.16 ? 395  ILE A CG2 1 
ATOM   1636 C  CD1 . ILE A 1 243 ? 10.173  -6.611  25.914 1.00 21.09 ? 395  ILE A CD1 1 
ATOM   1637 N  N   . ALA A 1 244 ? 8.601   -6.247  31.255 1.00 23.21 ? 396  ALA A N   1 
ATOM   1638 C  CA  . ALA A 1 244 ? 8.687   -6.620  32.671 1.00 24.25 ? 396  ALA A CA  1 
ATOM   1639 C  C   . ALA A 1 244 ? 7.325   -6.541  33.384 1.00 24.98 ? 396  ALA A C   1 
ATOM   1640 O  O   . ALA A 1 244 ? 6.989   -7.414  34.185 1.00 25.01 ? 396  ALA A O   1 
ATOM   1641 C  CB  . ALA A 1 244 ? 9.734   -5.768  33.391 1.00 24.26 ? 396  ALA A CB  1 
ATOM   1642 N  N   . ALA A 1 245 ? 6.548   -5.503  33.073 1.00 25.83 ? 397  ALA A N   1 
ATOM   1643 C  CA  . ALA A 1 245 ? 5.202   -5.337  33.614 1.00 26.64 ? 397  ALA A CA  1 
ATOM   1644 C  C   . ALA A 1 245 ? 4.263   -6.446  33.139 1.00 27.60 ? 397  ALA A C   1 
ATOM   1645 O  O   . ALA A 1 245 ? 3.436   -6.941  33.916 1.00 27.78 ? 397  ALA A O   1 
ATOM   1646 C  CB  . ALA A 1 245 ? 4.648   -3.979  33.248 1.00 26.41 ? 397  ALA A CB  1 
ATOM   1647 N  N   . MET A 1 246 ? 4.400   -6.833  31.870 1.00 28.46 ? 398  MET A N   1 
ATOM   1648 C  CA  . MET A 1 246 ? 3.639   -7.943  31.294 1.00 29.38 ? 398  MET A CA  1 
ATOM   1649 C  C   . MET A 1 246 ? 3.948   -9.245  32.010 1.00 29.60 ? 398  MET A C   1 
ATOM   1650 O  O   . MET A 1 246 ? 3.037   -9.970  32.410 1.00 29.98 ? 398  MET A O   1 
ATOM   1651 C  CB  . MET A 1 246 ? 3.954   -8.105  29.803 1.00 29.88 ? 398  MET A CB  1 
ATOM   1652 C  CG  . MET A 1 246 ? 3.522   -6.936  28.938 1.00 31.26 ? 398  MET A CG  1 
ATOM   1653 S  SD  . MET A 1 246 ? 1.743   -6.934  28.763 1.00 36.28 ? 398  MET A SD  1 
ATOM   1654 C  CE  . MET A 1 246 ? 1.589   -7.849  27.221 1.00 35.11 ? 398  MET A CE  1 
ATOM   1655 N  N   . MET A 1 247 ? 5.238   -9.531  32.162 1.00 29.94 ? 399  MET A N   1 
ATOM   1656 C  CA  . MET A 1 247 ? 5.712   -10.750 32.814 1.00 30.27 ? 399  MET A CA  1 
ATOM   1657 C  C   . MET A 1 247 ? 5.239   -10.845 34.262 1.00 30.60 ? 399  MET A C   1 
ATOM   1658 O  O   . MET A 1 247 ? 4.853   -11.922 34.723 1.00 30.54 ? 399  MET A O   1 
ATOM   1659 C  CB  . MET A 1 247 ? 7.239   -10.832 32.755 1.00 30.10 ? 399  MET A CB  1 
ATOM   1660 C  CG  . MET A 1 247 ? 7.800   -11.120 31.375 1.00 30.19 ? 399  MET A CG  1 
ATOM   1661 S  SD  . MET A 1 247 ? 9.597   -10.976 31.333 1.00 30.41 ? 399  MET A SD  1 
ATOM   1662 C  CE  . MET A 1 247 ? 9.970   -11.795 29.781 1.00 30.64 ? 399  MET A CE  1 
ATOM   1663 N  N   . LEU A 1 248 ? 5.263   -9.709  34.960 1.00 31.03 ? 400  LEU A N   1 
ATOM   1664 C  CA  . LEU A 1 248 ? 4.883   -9.636  36.370 1.00 31.43 ? 400  LEU A CA  1 
ATOM   1665 C  C   . LEU A 1 248 ? 3.371   -9.666  36.619 1.00 32.05 ? 400  LEU A C   1 
ATOM   1666 O  O   . LEU A 1 248 ? 2.938   -9.984  37.728 1.00 32.15 ? 400  LEU A O   1 
ATOM   1667 C  CB  . LEU A 1 248 ? 5.524   -8.414  37.043 1.00 31.15 ? 400  LEU A CB  1 
ATOM   1668 C  CG  . LEU A 1 248 ? 7.034   -8.484  37.308 1.00 30.56 ? 400  LEU A CG  1 
ATOM   1669 C  CD1 . LEU A 1 248 ? 7.591   -7.104  37.613 1.00 29.85 ? 400  LEU A CD1 1 
ATOM   1670 C  CD2 . LEU A 1 248 ? 7.371   -9.464  38.429 1.00 29.67 ? 400  LEU A CD2 1 
ATOM   1671 N  N   . SER A 1 249 ? 2.571   -9.336  35.604 1.00 32.68 ? 401  SER A N   1 
ATOM   1672 C  CA  . SER A 1 249 ? 1.118   -9.516  35.689 1.00 33.36 ? 401  SER A CA  1 
ATOM   1673 C  C   . SER A 1 249 ? 0.752   -10.990 35.567 1.00 33.73 ? 401  SER A C   1 
ATOM   1674 O  O   . SER A 1 249 ? -0.175  -11.465 36.227 1.00 33.86 ? 401  SER A O   1 
ATOM   1675 C  CB  . SER A 1 249 ? 0.395   -8.720  34.611 1.00 33.36 ? 401  SER A CB  1 
ATOM   1676 O  OG  . SER A 1 249 ? 0.617   -7.338  34.786 1.00 34.76 ? 401  SER A OG  1 
ATOM   1677 N  N   . ALA A 1 250 ? 1.483   -11.701 34.710 1.00 34.11 ? 402  ALA A N   1 
ATOM   1678 C  CA  . ALA A 1 250 ? 1.316   -13.138 34.542 1.00 34.36 ? 402  ALA A CA  1 
ATOM   1679 C  C   . ALA A 1 250 ? 1.793   -13.880 35.788 1.00 34.61 ? 402  ALA A C   1 
ATOM   1680 O  O   . ALA A 1 250 ? 1.088   -14.748 36.305 1.00 34.75 ? 402  ALA A O   1 
ATOM   1681 C  CB  . ALA A 1 250 ? 2.069   -13.620 33.309 1.00 34.29 ? 402  ALA A CB  1 
ATOM   1682 N  N   . GLU A 1 251 ? 2.981   -13.517 36.269 1.00 34.87 ? 403  GLU A N   1 
ATOM   1683 C  CA  . GLU A 1 251 ? 3.612   -14.182 37.411 1.00 35.20 ? 403  GLU A CA  1 
ATOM   1684 C  C   . GLU A 1 251 ? 4.142   -13.174 38.435 1.00 35.35 ? 403  GLU A C   1 
ATOM   1685 O  O   . GLU A 1 251 ? 5.323   -12.818 38.404 1.00 35.34 ? 403  GLU A O   1 
ATOM   1686 C  CB  . GLU A 1 251 ? 4.736   -15.104 36.934 1.00 35.20 ? 403  GLU A CB  1 
ATOM   1687 C  CG  . GLU A 1 251 ? 4.260   -16.251 36.057 1.00 36.11 ? 403  GLU A CG  1 
ATOM   1688 C  CD  . GLU A 1 251 ? 5.399   -17.033 35.444 1.00 37.71 ? 403  GLU A CD  1 
ATOM   1689 O  OE1 . GLU A 1 251 ? 6.179   -16.441 34.659 1.00 38.00 ? 403  GLU A OE1 1 
ATOM   1690 O  OE2 . GLU A 1 251 ? 5.504   -18.247 35.739 1.00 38.28 ? 403  GLU A OE2 1 
ATOM   1691 N  N   . PRO A 1 252 ? 3.265   -12.711 39.349 1.00 35.56 ? 404  PRO A N   1 
ATOM   1692 C  CA  . PRO A 1 252 ? 3.605   -11.686 40.342 1.00 35.68 ? 404  PRO A CA  1 
ATOM   1693 C  C   . PRO A 1 252 ? 4.667   -12.118 41.352 1.00 35.85 ? 404  PRO A C   1 
ATOM   1694 O  O   . PRO A 1 252 ? 5.299   -11.268 41.980 1.00 35.93 ? 404  PRO A O   1 
ATOM   1695 C  CB  . PRO A 1 252 ? 2.271   -11.433 41.059 1.00 35.68 ? 404  PRO A CB  1 
ATOM   1696 C  CG  . PRO A 1 252 ? 1.222   -11.968 40.142 1.00 35.66 ? 404  PRO A CG  1 
ATOM   1697 C  CD  . PRO A 1 252 ? 1.861   -13.140 39.481 1.00 35.51 ? 404  PRO A CD  1 
ATOM   1698 N  N   . GLU A 1 253 ? 4.862   -13.425 41.495 1.00 36.09 ? 405  GLU A N   1 
ATOM   1699 C  CA  . GLU A 1 253 ? 5.793   -13.968 42.483 1.00 36.41 ? 405  GLU A CA  1 
ATOM   1700 C  C   . GLU A 1 253 ? 7.197   -14.228 41.922 1.00 36.11 ? 405  GLU A C   1 
ATOM   1701 O  O   . GLU A 1 253 ? 8.047   -14.809 42.605 1.00 36.16 ? 405  GLU A O   1 
ATOM   1702 C  CB  . GLU A 1 253 ? 5.213   -15.236 43.127 1.00 36.42 ? 405  GLU A CB  1 
ATOM   1703 C  CG  . GLU A 1 253 ? 4.059   -14.975 44.100 1.00 37.00 ? 405  GLU A CG  1 
ATOM   1704 C  CD  . GLU A 1 253 ? 3.772   -16.161 45.021 1.00 37.42 ? 405  GLU A CD  1 
ATOM   1705 O  OE1 . GLU A 1 253 ? 4.344   -17.256 44.799 1.00 38.86 ? 405  GLU A OE1 1 
ATOM   1706 O  OE2 . GLU A 1 253 ? 2.970   -16.000 45.973 1.00 38.20 ? 405  GLU A OE2 1 
ATOM   1707 N  N   . LEU A 1 254 ? 7.432   -13.796 40.681 1.00 35.87 ? 406  LEU A N   1 
ATOM   1708 C  CA  . LEU A 1 254 ? 8.766   -13.820 40.077 1.00 35.59 ? 406  LEU A CA  1 
ATOM   1709 C  C   . LEU A 1 254 ? 9.719   -12.922 40.850 1.00 35.37 ? 406  LEU A C   1 
ATOM   1710 O  O   . LEU A 1 254 ? 9.397   -11.767 41.138 1.00 35.27 ? 406  LEU A O   1 
ATOM   1711 C  CB  . LEU A 1 254 ? 8.720   -13.331 38.626 1.00 35.60 ? 406  LEU A CB  1 
ATOM   1712 C  CG  . LEU A 1 254 ? 8.335   -14.277 37.492 1.00 35.53 ? 406  LEU A CG  1 
ATOM   1713 C  CD1 . LEU A 1 254 ? 8.127   -13.476 36.209 1.00 35.38 ? 406  LEU A CD1 1 
ATOM   1714 C  CD2 . LEU A 1 254 ? 9.390   -15.359 37.299 1.00 35.16 ? 406  LEU A CD2 1 
ATOM   1715 N  N   . THR A 1 255 ? 10.888  -13.457 41.182 1.00 35.16 ? 407  THR A N   1 
ATOM   1716 C  CA  . THR A 1 255 ? 11.935  -12.662 41.807 1.00 35.01 ? 407  THR A CA  1 
ATOM   1717 C  C   . THR A 1 255 ? 12.615  -11.793 40.748 1.00 34.96 ? 407  THR A C   1 
ATOM   1718 O  O   . THR A 1 255 ? 12.423  -11.991 39.544 1.00 34.95 ? 407  THR A O   1 
ATOM   1719 C  CB  . THR A 1 255 ? 12.996  -13.541 42.505 1.00 35.00 ? 407  THR A CB  1 
ATOM   1720 O  OG1 . THR A 1 255 ? 13.659  -14.354 41.531 1.00 35.17 ? 407  THR A OG1 1 
ATOM   1721 C  CG2 . THR A 1 255 ? 12.359  -14.435 43.570 1.00 35.05 ? 407  THR A CG2 1 
ATOM   1722 N  N   . LEU A 1 256 ? 13.407  -10.830 41.207 1.00 34.73 ? 408  LEU A N   1 
ATOM   1723 C  CA  . LEU A 1 256 ? 14.198  -9.994  40.322 1.00 34.47 ? 408  LEU A CA  1 
ATOM   1724 C  C   . LEU A 1 256 ? 15.171  -10.832 39.488 1.00 34.23 ? 408  LEU A C   1 
ATOM   1725 O  O   . LEU A 1 256 ? 15.288  -10.631 38.279 1.00 34.16 ? 408  LEU A O   1 
ATOM   1726 C  CB  . LEU A 1 256 ? 14.935  -8.924  41.134 1.00 34.45 ? 408  LEU A CB  1 
ATOM   1727 C  CG  . LEU A 1 256 ? 15.709  -7.811  40.425 1.00 34.67 ? 408  LEU A CG  1 
ATOM   1728 C  CD1 . LEU A 1 256 ? 14.908  -7.169  39.293 1.00 34.59 ? 408  LEU A CD1 1 
ATOM   1729 C  CD2 . LEU A 1 256 ? 16.130  -6.772  41.452 1.00 34.65 ? 408  LEU A CD2 1 
ATOM   1730 N  N   . ALA A 1 257 ? 15.848  -11.779 40.133 1.00 34.04 ? 409  ALA A N   1 
ATOM   1731 C  CA  . ALA A 1 257 ? 16.811  -12.650 39.457 1.00 33.96 ? 409  ALA A CA  1 
ATOM   1732 C  C   . ALA A 1 257 ? 16.161  -13.524 38.375 1.00 33.99 ? 409  ALA A C   1 
ATOM   1733 O  O   . ALA A 1 257 ? 16.773  -13.790 37.340 1.00 33.82 ? 409  ALA A O   1 
ATOM   1734 C  CB  . ALA A 1 257 ? 17.543  -13.511 40.472 1.00 33.97 ? 409  ALA A CB  1 
ATOM   1735 N  N   . GLU A 1 258 ? 14.925  -13.960 38.624 1.00 33.96 ? 410  GLU A N   1 
ATOM   1736 C  CA  . GLU A 1 258 ? 14.174  -14.786 37.675 1.00 33.96 ? 410  GLU A CA  1 
ATOM   1737 C  C   . GLU A 1 258 ? 13.670  -13.985 36.476 1.00 33.70 ? 410  GLU A C   1 
ATOM   1738 O  O   . GLU A 1 258 ? 13.739  -14.457 35.345 1.00 33.61 ? 410  GLU A O   1 
ATOM   1739 C  CB  . GLU A 1 258 ? 13.007  -15.495 38.370 1.00 33.91 ? 410  GLU A CB  1 
ATOM   1740 C  CG  . GLU A 1 258 ? 13.418  -16.678 39.238 1.00 34.33 ? 410  GLU A CG  1 
ATOM   1741 C  CD  . GLU A 1 258 ? 12.349  -17.084 40.247 1.00 34.45 ? 410  GLU A CD  1 
ATOM   1742 O  OE1 . GLU A 1 258 ? 11.142  -16.998 39.931 1.00 34.98 ? 410  GLU A OE1 1 
ATOM   1743 O  OE2 . GLU A 1 258 ? 12.722  -17.503 41.364 1.00 35.61 ? 410  GLU A OE2 1 
ATOM   1744 N  N   . LEU A 1 259 ? 13.161  -12.781 36.737 1.00 33.69 ? 411  LEU A N   1 
ATOM   1745 C  CA  . LEU A 1 259 ? 12.721  -11.850 35.691 1.00 33.57 ? 411  LEU A CA  1 
ATOM   1746 C  C   . LEU A 1 259 ? 13.851  -11.508 34.714 1.00 33.41 ? 411  LEU A C   1 
ATOM   1747 O  O   . LEU A 1 259 ? 13.649  -11.501 33.498 1.00 33.26 ? 411  LEU A O   1 
ATOM   1748 C  CB  . LEU A 1 259 ? 12.170  -10.562 36.316 1.00 33.62 ? 411  LEU A CB  1 
ATOM   1749 C  CG  . LEU A 1 259 ? 11.761  -9.461  35.330 1.00 33.95 ? 411  LEU A CG  1 
ATOM   1750 C  CD1 . LEU A 1 259 ? 10.271  -9.519  35.008 1.00 34.67 ? 411  LEU A CD1 1 
ATOM   1751 C  CD2 . LEU A 1 259 ? 12.126  -8.119  35.883 1.00 34.15 ? 411  LEU A CD2 1 
ATOM   1752 N  N   . ARG A 1 260 ? 15.032  -11.230 35.261 1.00 33.26 ? 412  ARG A N   1 
ATOM   1753 C  CA  . ARG A 1 260 ? 16.212  -10.906 34.472 1.00 33.32 ? 412  ARG A CA  1 
ATOM   1754 C  C   . ARG A 1 260 ? 16.622  -12.029 33.520 1.00 33.04 ? 412  ARG A C   1 
ATOM   1755 O  O   . ARG A 1 260 ? 16.969  -11.759 32.365 1.00 33.07 ? 412  ARG A O   1 
ATOM   1756 C  CB  . ARG A 1 260 ? 17.378  -10.550 35.393 1.00 33.69 ? 412  ARG A CB  1 
ATOM   1757 C  CG  . ARG A 1 260 ? 18.472  -9.740  34.723 1.00 35.26 ? 412  ARG A CG  1 
ATOM   1758 C  CD  . ARG A 1 260 ? 19.648  -9.547  35.664 1.00 37.65 ? 412  ARG A CD  1 
ATOM   1759 N  NE  . ARG A 1 260 ? 20.355  -8.296  35.392 1.00 39.58 ? 412  ARG A NE  1 
ATOM   1760 C  CZ  . ARG A 1 260 ? 20.091  -7.131  35.985 1.00 39.90 ? 412  ARG A CZ  1 
ATOM   1761 N  NH1 . ARG A 1 260 ? 19.128  -7.034  36.898 1.00 39.94 ? 412  ARG A NH1 1 
ATOM   1762 N  NH2 . ARG A 1 260 ? 20.802  -6.059  35.664 1.00 39.86 ? 412  ARG A NH2 1 
ATOM   1763 N  N   . GLN A 1 261 ? 16.585  -13.275 34.000 1.00 32.79 ? 413  GLN A N   1 
ATOM   1764 C  CA  A GLN A 1 261 ? 16.942  -14.423 33.169 0.50 32.64 ? 413  GLN A CA  1 
ATOM   1765 C  CA  B GLN A 1 261 ? 16.940  -14.437 33.179 0.50 32.66 ? 413  GLN A CA  1 
ATOM   1766 C  C   . GLN A 1 261 ? 15.853  -14.732 32.148 1.00 32.55 ? 413  GLN A C   1 
ATOM   1767 O  O   . GLN A 1 261 ? 16.139  -15.233 31.062 1.00 32.51 ? 413  GLN A O   1 
ATOM   1768 C  CB  A GLN A 1 261 ? 17.262  -15.654 34.025 0.50 32.66 ? 413  GLN A CB  1 
ATOM   1769 C  CB  B GLN A 1 261 ? 17.249  -15.670 34.049 0.50 32.69 ? 413  GLN A CB  1 
ATOM   1770 C  CG  A GLN A 1 261 ? 18.555  -15.538 34.844 0.50 32.62 ? 413  GLN A CG  1 
ATOM   1771 C  CG  B GLN A 1 261 ? 16.077  -16.621 34.334 0.50 32.72 ? 413  GLN A CG  1 
ATOM   1772 C  CD  A GLN A 1 261 ? 19.766  -15.129 34.009 0.50 32.58 ? 413  GLN A CD  1 
ATOM   1773 C  CD  B GLN A 1 261 ? 16.002  -17.796 33.362 0.50 32.76 ? 413  GLN A CD  1 
ATOM   1774 O  OE1 A GLN A 1 261 ? 20.412  -14.118 34.291 0.50 32.58 ? 413  GLN A OE1 1 
ATOM   1775 O  OE1 B GLN A 1 261 ? 17.015  -18.413 33.033 0.50 32.64 ? 413  GLN A OE1 1 
ATOM   1776 N  NE2 A GLN A 1 261 ? 20.071  -15.910 32.976 0.50 32.33 ? 413  GLN A NE2 1 
ATOM   1777 N  NE2 B GLN A 1 261 ? 14.793  -18.117 32.912 0.50 32.71 ? 413  GLN A NE2 1 
ATOM   1778 N  N   . ARG A 1 262 ? 14.609  -14.416 32.506 1.00 32.43 ? 414  ARG A N   1 
ATOM   1779 C  CA  . ARG A 1 262 ? 13.458  -14.588 31.624 1.00 32.25 ? 414  ARG A CA  1 
ATOM   1780 C  C   . ARG A 1 262 ? 13.547  -13.581 30.475 1.00 31.93 ? 414  ARG A C   1 
ATOM   1781 O  O   . ARG A 1 262 ? 13.145  -13.880 29.350 1.00 32.17 ? 414  ARG A O   1 
ATOM   1782 C  CB  . ARG A 1 262 ? 12.163  -14.357 32.404 1.00 32.45 ? 414  ARG A CB  1 
ATOM   1783 C  CG  . ARG A 1 262 ? 11.071  -15.378 32.181 1.00 32.80 ? 414  ARG A CG  1 
ATOM   1784 C  CD  . ARG A 1 262 ? 11.170  -16.474 33.218 1.00 34.31 ? 414  ARG A CD  1 
ATOM   1785 N  NE  . ARG A 1 262 ? 9.858   -16.978 33.619 1.00 35.52 ? 414  ARG A NE  1 
ATOM   1786 C  CZ  . ARG A 1 262 ? 9.649   -17.802 34.644 1.00 36.44 ? 414  ARG A CZ  1 
ATOM   1787 N  NH1 . ARG A 1 262 ? 8.418   -18.199 34.928 1.00 36.82 ? 414  ARG A NH1 1 
ATOM   1788 N  NH2 . ARG A 1 262 ? 10.663  -18.230 35.390 1.00 36.62 ? 414  ARG A NH2 1 
ATOM   1789 N  N   . LEU A 1 263 ? 14.070  -12.390 30.770 1.00 31.21 ? 415  LEU A N   1 
ATOM   1790 C  CA  . LEU A 1 263 ? 14.307  -11.375 29.748 1.00 30.69 ? 415  LEU A CA  1 
ATOM   1791 C  C   . LEU A 1 263 ? 15.376  -11.822 28.754 1.00 30.37 ? 415  LEU A C   1 
ATOM   1792 O  O   . LEU A 1 263 ? 15.213  -11.653 27.544 1.00 30.32 ? 415  LEU A O   1 
ATOM   1793 C  CB  . LEU A 1 263 ? 14.693  -10.031 30.379 1.00 30.59 ? 415  LEU A CB  1 
ATOM   1794 C  CG  . LEU A 1 263 ? 13.587  -9.160  30.985 1.00 30.43 ? 415  LEU A CG  1 
ATOM   1795 C  CD1 . LEU A 1 263 ? 14.195  -7.998  31.755 1.00 29.71 ? 415  LEU A CD1 1 
ATOM   1796 C  CD2 . LEU A 1 263 ? 12.611  -8.650  29.931 1.00 29.88 ? 415  LEU A CD2 1 
ATOM   1797 N  N   . ILE A 1 264 ? 16.463  -12.391 29.275 1.00 30.05 ? 416  ILE A N   1 
ATOM   1798 C  CA  . ILE A 1 264 ? 17.567  -12.890 28.453 1.00 29.64 ? 416  ILE A CA  1 
ATOM   1799 C  C   . ILE A 1 264 ? 17.143  -14.103 27.627 1.00 29.30 ? 416  ILE A C   1 
ATOM   1800 O  O   . ILE A 1 264 ? 17.433  -14.178 26.434 1.00 29.39 ? 416  ILE A O   1 
ATOM   1801 C  CB  . ILE A 1 264 ? 18.823  -13.222 29.310 1.00 29.59 ? 416  ILE A CB  1 
ATOM   1802 C  CG1 . ILE A 1 264 ? 19.422  -11.938 29.889 1.00 29.61 ? 416  ILE A CG1 1 
ATOM   1803 C  CG2 . ILE A 1 264 ? 19.877  -13.961 28.480 1.00 29.43 ? 416  ILE A CG2 1 
ATOM   1804 C  CD1 . ILE A 1 264 ? 20.543  -12.175 30.881 1.00 29.90 ? 416  ILE A CD1 1 
ATOM   1805 N  N   . HIS A 1 265 ? 16.450  -15.039 28.266 1.00 29.00 ? 417  HIS A N   1 
ATOM   1806 C  CA  . HIS A 1 265 ? 15.994  -16.262 27.613 1.00 28.61 ? 417  HIS A CA  1 
ATOM   1807 C  C   . HIS A 1 265 ? 15.066  -15.987 26.419 1.00 28.31 ? 417  HIS A C   1 
ATOM   1808 O  O   . HIS A 1 265 ? 15.154  -16.659 25.389 1.00 28.08 ? 417  HIS A O   1 
ATOM   1809 C  CB  . HIS A 1 265 ? 15.310  -17.181 28.635 1.00 28.64 ? 417  HIS A CB  1 
ATOM   1810 C  CG  . HIS A 1 265 ? 14.850  -18.483 28.061 1.00 28.97 ? 417  HIS A CG  1 
ATOM   1811 N  ND1 . HIS A 1 265 ? 15.674  -19.583 27.961 1.00 29.39 ? 417  HIS A ND1 1 
ATOM   1812 C  CD2 . HIS A 1 265 ? 13.655  -18.858 27.546 1.00 29.27 ? 417  HIS A CD2 1 
ATOM   1813 C  CE1 . HIS A 1 265 ? 15.005  -20.582 27.411 1.00 29.63 ? 417  HIS A CE1 1 
ATOM   1814 N  NE2 . HIS A 1 265 ? 13.778  -20.167 27.149 1.00 29.61 ? 417  HIS A NE2 1 
ATOM   1815 N  N   . PHE A 1 266 ? 14.190  -14.994 26.559 1.00 27.99 ? 418  PHE A N   1 
ATOM   1816 C  CA  . PHE A 1 266 ? 13.207  -14.685 25.520 1.00 27.82 ? 418  PHE A CA  1 
ATOM   1817 C  C   . PHE A 1 266 ? 13.643  -13.633 24.496 1.00 27.37 ? 418  PHE A C   1 
ATOM   1818 O  O   . PHE A 1 266 ? 12.913  -13.350 23.545 1.00 27.48 ? 418  PHE A O   1 
ATOM   1819 C  CB  . PHE A 1 266 ? 11.854  -14.333 26.144 1.00 27.97 ? 418  PHE A CB  1 
ATOM   1820 C  CG  . PHE A 1 266 ? 11.155  -15.510 26.747 1.00 28.81 ? 418  PHE A CG  1 
ATOM   1821 C  CD1 . PHE A 1 266 ? 10.770  -16.590 25.951 1.00 29.21 ? 418  PHE A CD1 1 
ATOM   1822 C  CD2 . PHE A 1 266 ? 10.883  -15.554 28.112 1.00 29.74 ? 418  PHE A CD2 1 
ATOM   1823 C  CE1 . PHE A 1 266 ? 10.131  -17.689 26.506 1.00 29.16 ? 418  PHE A CE1 1 
ATOM   1824 C  CE2 . PHE A 1 266 ? 10.239  -16.656 28.676 1.00 29.29 ? 418  PHE A CE2 1 
ATOM   1825 C  CZ  . PHE A 1 266 ? 9.865   -17.722 27.872 1.00 28.99 ? 418  PHE A CZ  1 
ATOM   1826 N  N   . SER A 1 267 ? 14.831  -13.067 24.693 1.00 26.95 ? 419  SER A N   1 
ATOM   1827 C  CA  . SER A 1 267 ? 15.422  -12.117 23.749 1.00 26.60 ? 419  SER A CA  1 
ATOM   1828 C  C   . SER A 1 267 ? 15.817  -12.792 22.441 1.00 26.08 ? 419  SER A C   1 
ATOM   1829 O  O   . SER A 1 267 ? 16.145  -13.975 22.427 1.00 25.97 ? 419  SER A O   1 
ATOM   1830 C  CB  . SER A 1 267 ? 16.671  -11.465 24.357 1.00 26.56 ? 419  SER A CB  1 
ATOM   1831 O  OG  . SER A 1 267 ? 16.331  -10.442 25.273 1.00 27.27 ? 419  SER A OG  1 
ATOM   1832 N  N   . ALA A 1 268 ? 15.788  -12.030 21.350 1.00 25.55 ? 420  ALA A N   1 
ATOM   1833 C  CA  . ALA A 1 268 ? 16.398  -12.453 20.093 1.00 25.17 ? 420  ALA A CA  1 
ATOM   1834 C  C   . ALA A 1 268 ? 17.914  -12.333 20.202 1.00 24.87 ? 420  ALA A C   1 
ATOM   1835 O  O   . ALA A 1 268 ? 18.436  -11.323 20.666 1.00 24.57 ? 420  ALA A O   1 
ATOM   1836 C  CB  . ALA A 1 268 ? 15.888  -11.615 18.942 1.00 25.07 ? 420  ALA A CB  1 
ATOM   1837 N  N   . LYS A 1 269 ? 18.613  -13.366 19.746 1.00 24.78 ? 421  LYS A N   1 
ATOM   1838 C  CA  . LYS A 1 269 ? 20.055  -13.468 19.934 1.00 24.63 ? 421  LYS A CA  1 
ATOM   1839 C  C   . LYS A 1 269 ? 20.862  -13.359 18.641 1.00 24.26 ? 421  LYS A C   1 
ATOM   1840 O  O   . LYS A 1 269 ? 20.376  -13.713 17.564 1.00 24.21 ? 421  LYS A O   1 
ATOM   1841 C  CB  . LYS A 1 269 ? 20.379  -14.782 20.656 1.00 24.92 ? 421  LYS A CB  1 
ATOM   1842 C  CG  . LYS A 1 269 ? 19.954  -14.767 22.115 1.00 25.54 ? 421  LYS A CG  1 
ATOM   1843 C  CD  . LYS A 1 269 ? 19.606  -16.138 22.629 1.00 27.01 ? 421  LYS A CD  1 
ATOM   1844 C  CE  . LYS A 1 269 ? 19.118  -16.054 24.071 1.00 27.86 ? 421  LYS A CE  1 
ATOM   1845 N  NZ  . LYS A 1 269 ? 17.742  -15.502 24.135 1.00 28.38 ? 421  LYS A NZ  1 
ATOM   1846 N  N   . ASP A 1 270 ? 22.088  -12.846 18.786 1.00 23.95 ? 422  ASP A N   1 
ATOM   1847 C  CA  A ASP A 1 270 ? 23.076  -12.766 17.699 0.50 23.66 ? 422  ASP A CA  1 
ATOM   1848 C  CA  B ASP A 1 270 ? 23.076  -12.757 17.704 0.50 23.70 ? 422  ASP A CA  1 
ATOM   1849 C  C   . ASP A 1 270 ? 22.524  -12.146 16.408 1.00 23.54 ? 422  ASP A C   1 
ATOM   1850 O  O   . ASP A 1 270 ? 22.804  -12.617 15.307 1.00 23.45 ? 422  ASP A O   1 
ATOM   1851 C  CB  A ASP A 1 270 ? 23.712  -14.142 17.433 0.50 23.60 ? 422  ASP A CB  1 
ATOM   1852 C  CB  B ASP A 1 270 ? 23.743  -14.121 17.469 0.50 23.66 ? 422  ASP A CB  1 
ATOM   1853 C  CG  A ASP A 1 270 ? 25.062  -14.044 16.734 0.50 23.42 ? 422  ASP A CG  1 
ATOM   1854 C  CG  B ASP A 1 270 ? 24.396  -14.679 18.730 0.50 23.62 ? 422  ASP A CG  1 
ATOM   1855 O  OD1 A ASP A 1 270 ? 25.874  -13.169 17.106 0.50 23.11 ? 422  ASP A OD1 1 
ATOM   1856 O  OD1 B ASP A 1 270 ? 24.969  -13.893 19.518 0.50 23.10 ? 422  ASP A OD1 1 
ATOM   1857 O  OD2 A ASP A 1 270 ? 25.315  -14.849 15.813 0.50 23.33 ? 422  ASP A OD2 1 
ATOM   1858 O  OD2 B ASP A 1 270 ? 24.336  -15.911 18.932 0.50 23.95 ? 422  ASP A OD2 1 
ATOM   1859 N  N   . VAL A 1 271 ? 21.751  -11.079 16.552 1.00 23.51 ? 423  VAL A N   1 
ATOM   1860 C  CA  . VAL A 1 271 ? 21.112  -10.438 15.414 1.00 23.18 ? 423  VAL A CA  1 
ATOM   1861 C  C   . VAL A 1 271 ? 21.649  -9.006  15.204 1.00 23.18 ? 423  VAL A C   1 
ATOM   1862 O  O   . VAL A 1 271 ? 21.438  -8.400  14.154 1.00 23.11 ? 423  VAL A O   1 
ATOM   1863 C  CB  . VAL A 1 271 ? 19.561  -10.547 15.551 1.00 23.23 ? 423  VAL A CB  1 
ATOM   1864 C  CG1 . VAL A 1 271 ? 18.930  -9.278  16.155 1.00 22.94 ? 423  VAL A CG1 1 
ATOM   1865 C  CG2 . VAL A 1 271 ? 18.935  -10.921 14.241 1.00 22.88 ? 423  VAL A CG2 1 
ATOM   1866 N  N   . ILE A 1 272 ? 22.364  -8.490  16.203 1.00 23.37 ? 424  ILE A N   1 
ATOM   1867 C  CA  . ILE A 1 272 ? 23.064  -7.202  16.106 1.00 23.65 ? 424  ILE A CA  1 
ATOM   1868 C  C   . ILE A 1 272 ? 24.438  -7.424  15.477 1.00 24.30 ? 424  ILE A C   1 
ATOM   1869 O  O   . ILE A 1 272 ? 25.137  -8.377  15.828 1.00 24.42 ? 424  ILE A O   1 
ATOM   1870 C  CB  . ILE A 1 272 ? 23.268  -6.535  17.503 1.00 23.52 ? 424  ILE A CB  1 
ATOM   1871 C  CG1 . ILE A 1 272 ? 21.951  -6.476  18.289 1.00 23.59 ? 424  ILE A CG1 1 
ATOM   1872 C  CG2 . ILE A 1 272 ? 23.904  -5.148  17.366 1.00 22.83 ? 424  ILE A CG2 1 
ATOM   1873 C  CD1 . ILE A 1 272 ? 22.113  -6.135  19.758 1.00 23.17 ? 424  ILE A CD1 1 
ATOM   1874 N  N   . ASN A 1 273 ? 24.819  -6.555  14.543 1.00 24.86 ? 425  ASN A N   1 
ATOM   1875 C  CA  . ASN A 1 273 ? 26.174  -6.568  14.005 1.00 25.48 ? 425  ASN A CA  1 
ATOM   1876 C  C   . ASN A 1 273 ? 27.115  -5.807  14.941 1.00 26.36 ? 425  ASN A C   1 
ATOM   1877 O  O   . ASN A 1 273 ? 27.147  -4.572  14.962 1.00 26.47 ? 425  ASN A O   1 
ATOM   1878 C  CB  . ASN A 1 273 ? 26.220  -6.026  12.568 1.00 25.12 ? 425  ASN A CB  1 
ATOM   1879 C  CG  . ASN A 1 273 ? 25.434  -6.889  11.586 1.00 24.09 ? 425  ASN A CG  1 
ATOM   1880 O  OD1 . ASN A 1 273 ? 25.335  -8.104  11.743 1.00 23.02 ? 425  ASN A OD1 1 
ATOM   1881 N  ND2 . ASN A 1 273 ? 24.876  -6.256  10.563 1.00 23.65 ? 425  ASN A ND2 1 
ATOM   1882 N  N   . GLU A 1 274 ? 27.865  -6.570  15.730 1.00 27.43 ? 426  GLU A N   1 
ATOM   1883 C  CA  . GLU A 1 274 ? 28.712  -6.025  16.790 1.00 28.40 ? 426  GLU A CA  1 
ATOM   1884 C  C   . GLU A 1 274 ? 29.956  -5.275  16.296 1.00 28.81 ? 426  GLU A C   1 
ATOM   1885 O  O   . GLU A 1 274 ? 30.666  -4.666  17.095 1.00 29.07 ? 426  GLU A O   1 
ATOM   1886 C  CB  . GLU A 1 274 ? 29.094  -7.120  17.804 1.00 28.60 ? 426  GLU A CB  1 
ATOM   1887 C  CG  . GLU A 1 274 ? 29.977  -8.245  17.265 1.00 29.16 ? 426  GLU A CG  1 
ATOM   1888 C  CD  . GLU A 1 274 ? 29.186  -9.325  16.553 1.00 30.60 ? 426  GLU A CD  1 
ATOM   1889 O  OE1 . GLU A 1 274 ? 28.683  -9.071  15.442 1.00 31.92 ? 426  GLU A OE1 1 
ATOM   1890 O  OE2 . GLU A 1 274 ? 29.072  -10.437 17.097 1.00 31.33 ? 426  GLU A OE2 1 
ATOM   1891 N  N   . ALA A 1 275 ? 30.197  -5.297  14.989 1.00 29.09 ? 427  ALA A N   1 
ATOM   1892 C  CA  . ALA A 1 275 ? 31.282  -4.530  14.383 1.00 29.60 ? 427  ALA A CA  1 
ATOM   1893 C  C   . ALA A 1 275 ? 31.087  -3.022  14.549 1.00 29.95 ? 427  ALA A C   1 
ATOM   1894 O  O   . ALA A 1 275 ? 32.022  -2.248  14.364 1.00 30.14 ? 427  ALA A O   1 
ATOM   1895 C  CB  . ALA A 1 275 ? 31.421  -4.889  12.912 1.00 29.65 ? 427  ALA A CB  1 
ATOM   1896 N  N   . TRP A 1 276 ? 29.865  -2.621  14.895 1.00 30.48 ? 428  TRP A N   1 
ATOM   1897 C  CA  . TRP A 1 276 ? 29.518  -1.231  15.198 1.00 30.88 ? 428  TRP A CA  1 
ATOM   1898 C  C   . TRP A 1 276 ? 30.193  -0.721  16.477 1.00 30.55 ? 428  TRP A C   1 
ATOM   1899 O  O   . TRP A 1 276 ? 30.555  0.453   16.558 1.00 30.47 ? 428  TRP A O   1 
ATOM   1900 C  CB  . TRP A 1 276 ? 28.004  -1.116  15.341 1.00 31.82 ? 428  TRP A CB  1 
ATOM   1901 C  CG  . TRP A 1 276 ? 27.458  0.286   15.341 1.00 33.05 ? 428  TRP A CG  1 
ATOM   1902 C  CD1 . TRP A 1 276 ? 27.067  1.011   14.249 1.00 33.88 ? 428  TRP A CD1 1 
ATOM   1903 C  CD2 . TRP A 1 276 ? 27.204  1.118   16.487 1.00 34.32 ? 428  TRP A CD2 1 
ATOM   1904 N  NE1 . TRP A 1 276 ? 26.596  2.243   14.641 1.00 34.54 ? 428  TRP A NE1 1 
ATOM   1905 C  CE2 . TRP A 1 276 ? 26.668  2.337   16.008 1.00 34.61 ? 428  TRP A CE2 1 
ATOM   1906 C  CE3 . TRP A 1 276 ? 27.385  0.956   17.872 1.00 34.60 ? 428  TRP A CE3 1 
ATOM   1907 C  CZ2 . TRP A 1 276 ? 26.307  3.391   16.866 1.00 34.19 ? 428  TRP A CZ2 1 
ATOM   1908 C  CZ3 . TRP A 1 276 ? 27.023  2.005   18.725 1.00 34.10 ? 428  TRP A CZ3 1 
ATOM   1909 C  CH2 . TRP A 1 276 ? 26.491  3.205   18.216 1.00 33.81 ? 428  TRP A CH2 1 
ATOM   1910 N  N   . PHE A 1 277 ? 30.345  -1.600  17.469 1.00 30.04 ? 429  PHE A N   1 
ATOM   1911 C  CA  . PHE A 1 277 ? 30.994  -1.257  18.736 1.00 29.81 ? 429  PHE A CA  1 
ATOM   1912 C  C   . PHE A 1 277 ? 32.514  -1.242  18.577 1.00 29.89 ? 429  PHE A C   1 
ATOM   1913 O  O   . PHE A 1 277 ? 33.044  -1.910  17.686 1.00 29.89 ? 429  PHE A O   1 
ATOM   1914 C  CB  . PHE A 1 277 ? 30.596  -2.247  19.844 1.00 29.59 ? 429  PHE A CB  1 
ATOM   1915 C  CG  . PHE A 1 277 ? 29.130  -2.583  19.870 1.00 29.53 ? 429  PHE A CG  1 
ATOM   1916 C  CD1 . PHE A 1 277 ? 28.177  -1.598  20.097 1.00 28.90 ? 429  PHE A CD1 1 
ATOM   1917 C  CD2 . PHE A 1 277 ? 28.702  -3.891  19.666 1.00 30.12 ? 429  PHE A CD2 1 
ATOM   1918 C  CE1 . PHE A 1 277 ? 26.821  -1.908  20.119 1.00 29.03 ? 429  PHE A CE1 1 
ATOM   1919 C  CE2 . PHE A 1 277 ? 27.341  -4.213  19.683 1.00 29.81 ? 429  PHE A CE2 1 
ATOM   1920 C  CZ  . PHE A 1 277 ? 26.401  -3.216  19.909 1.00 29.09 ? 429  PHE A CZ  1 
ATOM   1921 N  N   . PRO A 1 278 ? 33.226  -0.475  19.433 1.00 29.92 ? 430  PRO A N   1 
ATOM   1922 C  CA  . PRO A 1 278 ? 34.689  -0.578  19.469 1.00 29.97 ? 430  PRO A CA  1 
ATOM   1923 C  C   . PRO A 1 278 ? 35.147  -2.022  19.687 1.00 30.05 ? 430  PRO A C   1 
ATOM   1924 O  O   . PRO A 1 278 ? 34.471  -2.789  20.381 1.00 30.05 ? 430  PRO A O   1 
ATOM   1925 C  CB  . PRO A 1 278 ? 35.071  0.294   20.671 1.00 29.97 ? 430  PRO A CB  1 
ATOM   1926 C  CG  . PRO A 1 278 ? 33.971  1.276   20.786 1.00 29.53 ? 430  PRO A CG  1 
ATOM   1927 C  CD  . PRO A 1 278 ? 32.729  0.536   20.385 1.00 29.78 ? 430  PRO A CD  1 
ATOM   1928 N  N   . GLU A 1 279 ? 36.285  -2.381  19.095 1.00 30.22 ? 431  GLU A N   1 
ATOM   1929 C  CA  . GLU A 1 279 ? 36.791  -3.757  19.121 1.00 30.47 ? 431  GLU A CA  1 
ATOM   1930 C  C   . GLU A 1 279 ? 36.795  -4.376  20.522 1.00 30.25 ? 431  GLU A C   1 
ATOM   1931 O  O   . GLU A 1 279 ? 36.407  -5.530  20.688 1.00 30.17 ? 431  GLU A O   1 
ATOM   1932 C  CB  . GLU A 1 279 ? 38.187  -3.832  18.484 1.00 30.42 ? 431  GLU A CB  1 
ATOM   1933 C  CG  . GLU A 1 279 ? 38.695  -5.259  18.248 1.00 31.07 ? 431  GLU A CG  1 
ATOM   1934 C  CD  . GLU A 1 279 ? 39.985  -5.318  17.438 1.00 31.43 ? 431  GLU A CD  1 
ATOM   1935 O  OE1 . GLU A 1 279 ? 40.051  -4.696  16.351 1.00 32.79 ? 431  GLU A OE1 1 
ATOM   1936 O  OE2 . GLU A 1 279 ? 40.932  -6.005  17.880 1.00 32.62 ? 431  GLU A OE2 1 
ATOM   1937 N  N   . ASP A 1 280 ? 37.215  -3.593  21.515 1.00 30.26 ? 432  ASP A N   1 
ATOM   1938 C  CA  . ASP A 1 280 ? 37.331  -4.053  22.905 1.00 30.31 ? 432  ASP A CA  1 
ATOM   1939 C  C   . ASP A 1 280 ? 36.009  -4.091  23.686 1.00 29.96 ? 432  ASP A C   1 
ATOM   1940 O  O   . ASP A 1 280 ? 35.988  -4.494  24.850 1.00 29.90 ? 432  ASP A O   1 
ATOM   1941 C  CB  . ASP A 1 280 ? 38.371  -3.215  23.665 1.00 30.55 ? 432  ASP A CB  1 
ATOM   1942 C  CG  . ASP A 1 280 ? 38.179  -1.719  23.467 1.00 31.77 ? 432  ASP A CG  1 
ATOM   1943 O  OD1 . ASP A 1 280 ? 38.260  -1.256  22.302 1.00 34.03 ? 432  ASP A OD1 1 
ATOM   1944 O  OD2 . ASP A 1 280 ? 37.961  -1.008  24.471 1.00 31.66 ? 432  ASP A OD2 1 
ATOM   1945 N  N   . GLN A 1 281 ? 34.915  -3.684  23.047 1.00 29.59 ? 433  GLN A N   1 
ATOM   1946 C  CA  . GLN A 1 281 ? 33.594  -3.719  23.679 1.00 29.12 ? 433  GLN A CA  1 
ATOM   1947 C  C   . GLN A 1 281 ? 32.693  -4.819  23.113 1.00 28.98 ? 433  GLN A C   1 
ATOM   1948 O  O   . GLN A 1 281 ? 31.621  -5.084  23.659 1.00 29.05 ? 433  GLN A O   1 
ATOM   1949 C  CB  . GLN A 1 281 ? 32.892  -2.360  23.551 1.00 29.09 ? 433  GLN A CB  1 
ATOM   1950 C  CG  . GLN A 1 281 ? 33.614  -1.185  24.205 1.00 28.85 ? 433  GLN A CG  1 
ATOM   1951 C  CD  . GLN A 1 281 ? 33.479  -1.140  25.725 1.00 28.75 ? 433  GLN A CD  1 
ATOM   1952 O  OE1 . GLN A 1 281 ? 32.830  -1.988  26.341 1.00 28.31 ? 433  GLN A OE1 1 
ATOM   1953 N  NE2 . GLN A 1 281 ? 34.101  -0.136  26.334 1.00 28.80 ? 433  GLN A NE2 1 
ATOM   1954 N  N   . ARG A 1 282 ? 33.135  -5.452  22.026 1.00 28.62 ? 434  ARG A N   1 
ATOM   1955 C  CA  . ARG A 1 282 ? 32.334  -6.443  21.296 1.00 28.30 ? 434  ARG A CA  1 
ATOM   1956 C  C   . ARG A 1 282 ? 31.996  -7.715  22.075 1.00 28.36 ? 434  ARG A C   1 
ATOM   1957 O  O   . ARG A 1 282 ? 30.859  -8.181  22.024 1.00 28.65 ? 434  ARG A O   1 
ATOM   1958 C  CB  . ARG A 1 282 ? 32.997  -6.790  19.961 1.00 28.13 ? 434  ARG A CB  1 
ATOM   1959 C  CG  . ARG A 1 282 ? 32.822  -5.708  18.924 1.00 27.17 ? 434  ARG A CG  1 
ATOM   1960 C  CD  . ARG A 1 282 ? 33.793  -5.833  17.775 1.00 25.62 ? 434  ARG A CD  1 
ATOM   1961 N  NE  . ARG A 1 282 ? 33.970  -4.536  17.128 1.00 24.56 ? 434  ARG A NE  1 
ATOM   1962 C  CZ  . ARG A 1 282 ? 34.805  -4.292  16.122 1.00 24.04 ? 434  ARG A CZ  1 
ATOM   1963 N  NH1 . ARG A 1 282 ? 35.561  -5.259  15.621 1.00 24.03 ? 434  ARG A NH1 1 
ATOM   1964 N  NH2 . ARG A 1 282 ? 34.885  -3.069  15.619 1.00 23.61 ? 434  ARG A NH2 1 
ATOM   1965 N  N   . VAL A 1 283 ? 32.974  -8.271  22.785 1.00 28.33 ? 435  VAL A N   1 
ATOM   1966 C  CA  . VAL A 1 283 ? 32.764  -9.474  23.599 1.00 28.28 ? 435  VAL A CA  1 
ATOM   1967 C  C   . VAL A 1 283 ? 31.864  -9.198  24.811 1.00 28.31 ? 435  VAL A C   1 
ATOM   1968 O  O   . VAL A 1 283 ? 31.075  -10.058 25.213 1.00 28.32 ? 435  VAL A O   1 
ATOM   1969 C  CB  . VAL A 1 283 ? 34.117  -10.107 24.046 1.00 28.39 ? 435  VAL A CB  1 
ATOM   1970 C  CG1 . VAL A 1 283 ? 33.905  -11.210 25.082 1.00 28.50 ? 435  VAL A CG1 1 
ATOM   1971 C  CG2 . VAL A 1 283 ? 34.875  -10.665 22.839 1.00 28.02 ? 435  VAL A CG2 1 
ATOM   1972 N  N   . LEU A 1 284 ? 31.978  -7.987  25.361 1.00 28.15 ? 436  LEU A N   1 
ATOM   1973 C  CA  . LEU A 1 284 ? 31.286  -7.590  26.594 1.00 27.77 ? 436  LEU A CA  1 
ATOM   1974 C  C   . LEU A 1 284 ? 29.862  -7.081  26.367 1.00 27.27 ? 436  LEU A C   1 
ATOM   1975 O  O   . LEU A 1 284 ? 29.021  -7.152  27.267 1.00 27.19 ? 436  LEU A O   1 
ATOM   1976 C  CB  . LEU A 1 284 ? 32.098  -6.520  27.336 1.00 27.90 ? 436  LEU A CB  1 
ATOM   1977 C  CG  . LEU A 1 284 ? 33.549  -6.833  27.730 1.00 28.32 ? 436  LEU A CG  1 
ATOM   1978 C  CD1 . LEU A 1 284 ? 34.328  -5.531  27.928 1.00 28.37 ? 436  LEU A CD1 1 
ATOM   1979 C  CD2 . LEU A 1 284 ? 33.630  -7.731  28.977 1.00 27.51 ? 436  LEU A CD2 1 
ATOM   1980 N  N   . THR A 1 285 ? 29.606  -6.552  25.174 1.00 26.66 ? 437  THR A N   1 
ATOM   1981 C  CA  . THR A 1 285 ? 28.278  -6.066  24.809 1.00 26.10 ? 437  THR A CA  1 
ATOM   1982 C  C   . THR A 1 285 ? 27.373  -7.248  24.440 1.00 25.87 ? 437  THR A C   1 
ATOM   1983 O  O   . THR A 1 285 ? 27.656  -7.971  23.484 1.00 26.05 ? 437  THR A O   1 
ATOM   1984 C  CB  . THR A 1 285 ? 28.340  -5.040  23.650 1.00 26.02 ? 437  THR A CB  1 
ATOM   1985 O  OG1 . THR A 1 285 ? 29.202  -3.956  24.011 1.00 25.51 ? 437  THR A OG1 1 
ATOM   1986 C  CG2 . THR A 1 285 ? 26.967  -4.479  23.348 1.00 26.15 ? 437  THR A CG2 1 
ATOM   1987 N  N   . PRO A 1 286 ? 26.283  -7.450  25.204 1.00 25.53 ? 438  PRO A N   1 
ATOM   1988 C  CA  . PRO A 1 286 ? 25.405  -8.582  24.928 1.00 25.09 ? 438  PRO A CA  1 
ATOM   1989 C  C   . PRO A 1 286 ? 24.662  -8.414  23.605 1.00 24.74 ? 438  PRO A C   1 
ATOM   1990 O  O   . PRO A 1 286 ? 24.082  -7.358  23.332 1.00 24.96 ? 438  PRO A O   1 
ATOM   1991 C  CB  . PRO A 1 286 ? 24.425  -8.565  26.109 1.00 25.00 ? 438  PRO A CB  1 
ATOM   1992 C  CG  . PRO A 1 286 ? 24.409  -7.156  26.561 1.00 25.34 ? 438  PRO A CG  1 
ATOM   1993 C  CD  . PRO A 1 286 ? 25.800  -6.644  26.344 1.00 25.46 ? 438  PRO A CD  1 
ATOM   1994 N  N   . ASN A 1 287 ? 24.696  -9.452  22.783 1.00 24.20 ? 439  ASN A N   1 
ATOM   1995 C  CA  . ASN A 1 287 ? 23.961  -9.441  21.537 1.00 23.51 ? 439  ASN A CA  1 
ATOM   1996 C  C   . ASN A 1 287 ? 22.537  -9.937  21.767 1.00 23.03 ? 439  ASN A C   1 
ATOM   1997 O  O   . ASN A 1 287 ? 22.203  -11.082 21.459 1.00 22.88 ? 439  ASN A O   1 
ATOM   1998 C  CB  . ASN A 1 287 ? 24.691  -10.266 20.477 1.00 23.39 ? 439  ASN A CB  1 
ATOM   1999 C  CG  . ASN A 1 287 ? 24.341  -9.839  19.071 1.00 23.22 ? 439  ASN A CG  1 
ATOM   2000 O  OD1 . ASN A 1 287 ? 23.180  -9.583  18.765 1.00 23.41 ? 439  ASN A OD1 1 
ATOM   2001 N  ND2 . ASN A 1 287 ? 25.343  -9.769  18.203 1.00 22.75 ? 439  ASN A ND2 1 
ATOM   2002 N  N   . LEU A 1 288 ? 21.705  -9.056  22.317 1.00 22.56 ? 440  LEU A N   1 
ATOM   2003 C  CA  . LEU A 1 288 ? 20.343  -9.407  22.708 1.00 22.23 ? 440  LEU A CA  1 
ATOM   2004 C  C   . LEU A 1 288 ? 19.392  -8.275  22.389 1.00 22.17 ? 440  LEU A C   1 
ATOM   2005 O  O   . LEU A 1 288 ? 19.658  -7.126  22.734 1.00 22.00 ? 440  LEU A O   1 
ATOM   2006 C  CB  . LEU A 1 288 ? 20.259  -9.718  24.215 1.00 22.08 ? 440  LEU A CB  1 
ATOM   2007 C  CG  . LEU A 1 288 ? 21.120  -10.820 24.850 1.00 21.48 ? 440  LEU A CG  1 
ATOM   2008 C  CD1 . LEU A 1 288 ? 21.103  -10.706 26.359 1.00 20.26 ? 440  LEU A CD1 1 
ATOM   2009 C  CD2 . LEU A 1 288 ? 20.688  -12.211 24.406 1.00 20.78 ? 440  LEU A CD2 1 
ATOM   2010 N  N   . VAL A 1 289 ? 18.289  -8.611  21.727 1.00 22.37 ? 441  VAL A N   1 
ATOM   2011 C  CA  . VAL A 1 289 ? 17.193  -7.674  21.508 1.00 22.59 ? 441  VAL A CA  1 
ATOM   2012 C  C   . VAL A 1 289 ? 15.946  -8.209  22.206 1.00 23.09 ? 441  VAL A C   1 
ATOM   2013 O  O   . VAL A 1 289 ? 15.489  -9.317  21.910 1.00 23.05 ? 441  VAL A O   1 
ATOM   2014 C  CB  . VAL A 1 289 ? 16.909  -7.414  20.000 1.00 22.60 ? 441  VAL A CB  1 
ATOM   2015 C  CG1 . VAL A 1 289 ? 15.762  -6.421  19.839 1.00 21.77 ? 441  VAL A CG1 1 
ATOM   2016 C  CG2 . VAL A 1 289 ? 18.159  -6.888  19.291 1.00 22.16 ? 441  VAL A CG2 1 
ATOM   2017 N  N   . ALA A 1 290 ? 15.410  -7.408  23.128 1.00 23.55 ? 442  ALA A N   1 
ATOM   2018 C  CA  . ALA A 1 290 ? 14.252  -7.779  23.955 1.00 24.21 ? 442  ALA A CA  1 
ATOM   2019 C  C   . ALA A 1 290 ? 13.046  -8.281  23.164 1.00 24.73 ? 442  ALA A C   1 
ATOM   2020 O  O   . ALA A 1 290 ? 12.779  -7.822  22.053 1.00 24.45 ? 442  ALA A O   1 
ATOM   2021 C  CB  . ALA A 1 290 ? 13.839  -6.608  24.849 1.00 23.95 ? 442  ALA A CB  1 
ATOM   2022 N  N   . ALA A 1 291 ? 12.334  -9.236  23.762 1.00 25.77 ? 443  ALA A N   1 
ATOM   2023 C  CA  . ALA A 1 291 ? 11.057  -9.716  23.252 1.00 26.84 ? 443  ALA A CA  1 
ATOM   2024 C  C   . ALA A 1 291 ? 10.185  -10.257 24.385 1.00 27.91 ? 443  ALA A C   1 
ATOM   2025 O  O   . ALA A 1 291 ? 10.695  -10.779 25.381 1.00 27.95 ? 443  ALA A O   1 
ATOM   2026 C  CB  . ALA A 1 291 ? 11.274  -10.784 22.191 1.00 26.76 ? 443  ALA A CB  1 
ATOM   2027 N  N   . LEU A 1 292 ? 8.872   -10.118 24.223 1.00 29.21 ? 444  LEU A N   1 
ATOM   2028 C  CA  . LEU A 1 292 ? 7.887   -10.767 25.090 1.00 30.82 ? 444  LEU A CA  1 
ATOM   2029 C  C   . LEU A 1 292 ? 7.949   -12.302 24.972 1.00 31.99 ? 444  LEU A C   1 
ATOM   2030 O  O   . LEU A 1 292 ? 8.370   -12.827 23.938 1.00 32.05 ? 444  LEU A O   1 
ATOM   2031 C  CB  . LEU A 1 292 ? 6.473   -10.292 24.723 1.00 30.63 ? 444  LEU A CB  1 
ATOM   2032 C  CG  . LEU A 1 292 ? 6.048   -8.866  25.086 1.00 30.69 ? 444  LEU A CG  1 
ATOM   2033 C  CD1 . LEU A 1 292 ? 4.856   -8.424  24.240 1.00 29.85 ? 444  LEU A CD1 1 
ATOM   2034 C  CD2 . LEU A 1 292 ? 5.742   -8.752  26.579 1.00 30.19 ? 444  LEU A CD2 1 
ATOM   2035 N  N   . PRO A 1 293 ? 7.534   -13.027 26.031 1.00 33.28 ? 445  PRO A N   1 
ATOM   2036 C  CA  . PRO A 1 293 ? 7.337   -14.477 25.888 1.00 34.37 ? 445  PRO A CA  1 
ATOM   2037 C  C   . PRO A 1 293 ? 6.135   -14.794 24.981 1.00 35.44 ? 445  PRO A C   1 
ATOM   2038 O  O   . PRO A 1 293 ? 5.222   -13.965 24.875 1.00 35.63 ? 445  PRO A O   1 
ATOM   2039 C  CB  . PRO A 1 293 ? 7.065   -14.936 27.322 1.00 34.32 ? 445  PRO A CB  1 
ATOM   2040 C  CG  . PRO A 1 293 ? 6.540   -13.731 28.015 1.00 33.90 ? 445  PRO A CG  1 
ATOM   2041 C  CD  . PRO A 1 293 ? 7.252   -12.566 27.402 1.00 33.47 ? 445  PRO A CD  1 
ATOM   2042 N  N   . PRO A 1 294 ? 6.142   -15.971 24.311 1.00 36.30 ? 446  PRO A N   1 
ATOM   2043 C  CA  . PRO A 1 294 ? 5.029   -16.368 23.434 1.00 36.94 ? 446  PRO A CA  1 
ATOM   2044 C  C   . PRO A 1 294 ? 3.721   -16.614 24.193 1.00 37.60 ? 446  PRO A C   1 
ATOM   2045 O  O   . PRO A 1 294 ? 3.754   -16.977 25.376 1.00 37.73 ? 446  PRO A O   1 
ATOM   2046 C  CB  . PRO A 1 294 ? 5.526   -17.679 22.803 1.00 36.87 ? 446  PRO A CB  1 
ATOM   2047 C  CG  . PRO A 1 294 ? 7.007   -17.678 23.000 1.00 36.68 ? 446  PRO A CG  1 
ATOM   2048 C  CD  . PRO A 1 294 ? 7.209   -16.987 24.313 1.00 36.41 ? 446  PRO A CD  1 
ATOM   2049 N  N   . SER A 1 295 ? 2.591   -16.403 23.512 1.00 38.27 ? 447  SER A N   1 
ATOM   2050 C  CA  . SER A 1 295 ? 1.255   -16.687 24.067 1.00 38.88 ? 447  SER A CA  1 
ATOM   2051 C  C   . SER A 1 295 ? 0.724   -18.045 23.600 1.00 39.02 ? 447  SER A C   1 
ATOM   2052 O  O   . SER A 1 295 ? 1.071   -19.089 24.158 1.00 39.30 ? 447  SER A O   1 
ATOM   2053 C  CB  . SER A 1 295 ? 0.253   -15.583 23.698 1.00 38.95 ? 447  SER A CB  1 
ATOM   2054 O  OG  . SER A 1 295 ? 0.248   -14.544 24.663 1.00 39.25 ? 447  SER A OG  1 
ATOM   2055 N  N   . ASN B 2 20  ? -15.807 3.076   -4.523 1.00 30.87 ? 285  ASN E N   1 
ATOM   2056 C  CA  . ASN B 2 20  ? -14.399 2.877   -4.827 1.00 30.37 ? 285  ASN E CA  1 
ATOM   2057 C  C   . ASN B 2 20  ? -13.613 4.132   -5.057 1.00 29.99 ? 285  ASN E C   1 
ATOM   2058 O  O   . ASN B 2 20  ? -12.479 4.068   -5.447 1.00 30.14 ? 285  ASN E O   1 
ATOM   2059 C  CB  . ASN B 2 20  ? -14.225 1.949   -5.961 1.00 30.57 ? 285  ASN E CB  1 
ATOM   2060 N  N   . LEU B 2 21  ? -14.206 5.276   -4.770 1.00 29.14 ? 286  LEU E N   1 
ATOM   2061 C  CA  . LEU B 2 21  ? -13.445 6.515   -4.527 1.00 28.19 ? 286  LEU E CA  1 
ATOM   2062 C  C   . LEU B 2 21  ? -13.211 6.745   -3.036 1.00 27.49 ? 286  LEU E C   1 
ATOM   2063 O  O   . LEU B 2 21  ? -14.012 6.325   -2.200 1.00 27.42 ? 286  LEU E O   1 
ATOM   2064 C  CB  . LEU B 2 21  ? -14.179 7.741   -5.099 1.00 28.09 ? 286  LEU E CB  1 
ATOM   2065 C  CG  . LEU B 2 21  ? -14.338 7.989   -6.602 1.00 27.84 ? 286  LEU E CG  1 
ATOM   2066 C  CD1 . LEU B 2 21  ? -15.128 9.269   -6.828 1.00 27.37 ? 286  LEU E CD1 1 
ATOM   2067 C  CD2 . LEU B 2 21  ? -13.003 8.066   -7.322 1.00 27.78 ? 286  LEU E CD2 1 
ATOM   2068 N  N   . TYR B 2 22  ? -12.116 7.427   -2.716 1.00 26.66 ? 287  TYR E N   1 
ATOM   2069 C  CA  . TYR B 2 22  ? -11.801 7.798   -1.340 1.00 26.19 ? 287  TYR E CA  1 
ATOM   2070 C  C   . TYR B 2 22  ? -12.596 9.045   -0.943 1.00 25.94 ? 287  TYR E C   1 
ATOM   2071 O  O   . TYR B 2 22  ? -12.729 9.978   -1.735 1.00 26.07 ? 287  TYR E O   1 
ATOM   2072 C  CB  . TYR B 2 22  ? -10.292 8.038   -1.194 1.00 25.90 ? 287  TYR E CB  1 
ATOM   2073 C  CG  . TYR B 2 22  ? -9.845  8.393   0.203  1.00 25.41 ? 287  TYR E CG  1 
ATOM   2074 C  CD1 . TYR B 2 22  ? -9.813  9.724   0.624  1.00 25.15 ? 287  TYR E CD1 1 
ATOM   2075 C  CD2 . TYR B 2 22  ? -9.442  7.403   1.103  1.00 24.63 ? 287  TYR E CD2 1 
ATOM   2076 C  CE1 . TYR B 2 22  ? -9.405  10.063  1.907  1.00 24.42 ? 287  TYR E CE1 1 
ATOM   2077 C  CE2 . TYR B 2 22  ? -9.031  7.732   2.392  1.00 23.91 ? 287  TYR E CE2 1 
ATOM   2078 C  CZ  . TYR B 2 22  ? -9.018  9.064   2.783  1.00 24.76 ? 287  TYR E CZ  1 
ATOM   2079 O  OH  . TYR B 2 22  ? -8.615  9.413   4.046  1.00 25.08 ? 287  TYR E OH  1 
ATOM   2080 N  N   . PHE B 2 23  ? -13.138 9.052   0.272  1.00 25.40 ? 288  PHE E N   1 
ATOM   2081 C  CA  . PHE B 2 23  ? -13.873 10.214  0.766  1.00 25.01 ? 288  PHE E CA  1 
ATOM   2082 C  C   . PHE B 2 23  ? -13.108 10.906  1.897  1.00 24.96 ? 288  PHE E C   1 
ATOM   2083 O  O   . PHE B 2 23  ? -12.362 11.856  1.650  1.00 24.76 ? 288  PHE E O   1 
ATOM   2084 C  CB  . PHE B 2 23  ? -15.307 9.829   1.168  1.00 25.01 ? 288  PHE E CB  1 
ATOM   2085 C  CG  . PHE B 2 23  ? -16.184 11.001  1.556  1.00 25.09 ? 288  PHE E CG  1 
ATOM   2086 C  CD1 . PHE B 2 23  ? -16.161 12.193  0.830  1.00 24.29 ? 288  PHE E CD1 1 
ATOM   2087 C  CD2 . PHE B 2 23  ? -17.068 10.891  2.634  1.00 25.22 ? 288  PHE E CD2 1 
ATOM   2088 C  CE1 . PHE B 2 23  ? -16.981 13.265  1.190  1.00 24.17 ? 288  PHE E CE1 1 
ATOM   2089 C  CE2 . PHE B 2 23  ? -17.898 11.960  2.995  1.00 24.87 ? 288  PHE E CE2 1 
ATOM   2090 C  CZ  . PHE B 2 23  ? -17.849 13.147  2.273  1.00 24.34 ? 288  PHE E CZ  1 
ATOM   2091 N  N   . GLN B 2 24  ? -13.273 10.423  3.126  1.00 24.77 ? 289  GLN E N   1 
ATOM   2092 C  CA  . GLN B 2 24  ? -12.578 11.006  4.269  1.00 24.76 ? 289  GLN E CA  1 
ATOM   2093 C  C   . GLN B 2 24  ? -11.814 9.976   5.098  1.00 25.12 ? 289  GLN E C   1 
ATOM   2094 O  O   . GLN B 2 24  ? -11.114 10.326  6.048  1.00 25.07 ? 289  GLN E O   1 
ATOM   2095 C  CB  . GLN B 2 24  ? -13.554 11.786  5.148  1.00 24.44 ? 289  GLN E CB  1 
ATOM   2096 C  CG  . GLN B 2 24  ? -13.986 13.108  4.553  1.00 23.80 ? 289  GLN E CG  1 
ATOM   2097 C  CD  . GLN B 2 24  ? -15.017 13.824  5.392  1.00 23.26 ? 289  GLN E CD  1 
ATOM   2098 O  OE1 . GLN B 2 24  ? -15.777 13.205  6.141  1.00 22.70 ? 289  GLN E OE1 1 
ATOM   2099 N  NE2 . GLN B 2 24  ? -15.058 15.141  5.264  1.00 23.65 ? 289  GLN E NE2 1 
ATOM   2100 N  N   . GLY B 2 25  ? -11.942 8.706   4.725  1.00 25.68 ? 290  GLY E N   1 
ATOM   2101 C  CA  . GLY B 2 25  ? -11.271 7.621   5.436  1.00 26.21 ? 290  GLY E CA  1 
ATOM   2102 C  C   . GLY B 2 25  ? -12.250 6.835   6.281  1.00 26.68 ? 290  GLY E C   1 
ATOM   2103 O  O   . GLY B 2 25  ? -13.462 7.064   6.216  1.00 26.72 ? 290  GLY E O   1 
ATOM   2104 N  N   . ALA B 2 26  ? -11.725 5.905   7.073  1.00 27.11 ? 291  ALA E N   1 
ATOM   2105 C  CA  . ALA B 2 26  ? -12.550 5.066   7.936  1.00 27.42 ? 291  ALA E CA  1 
ATOM   2106 C  C   . ALA B 2 26  ? -12.856 5.765   9.254  1.00 27.80 ? 291  ALA E C   1 
ATOM   2107 O  O   . ALA B 2 26  ? -12.210 6.749   9.612  1.00 27.99 ? 291  ALA E O   1 
ATOM   2108 C  CB  . ALA B 2 26  ? -11.868 3.728   8.183  1.00 27.40 ? 291  ALA E CB  1 
ATOM   2109 N  N   . MET B 2 27  ? -13.856 5.256   9.965  1.00 28.41 ? 292  MET E N   1 
ATOM   2110 C  CA  . MET B 2 27  ? -14.204 5.759   11.288 1.00 29.01 ? 292  MET E CA  1 
ATOM   2111 C  C   . MET B 2 27  ? -13.670 4.803   12.344 1.00 28.57 ? 292  MET E C   1 
ATOM   2112 O  O   . MET B 2 27  ? -13.867 3.592   12.247 1.00 28.56 ? 292  MET E O   1 
ATOM   2113 C  CB  . MET B 2 27  ? -15.722 5.910   11.424 1.00 29.00 ? 292  MET E CB  1 
ATOM   2114 C  CG  . MET B 2 27  ? -16.156 6.655   12.673 1.00 29.67 ? 292  MET E CG  1 
ATOM   2115 S  SD  . MET B 2 27  ? -17.947 6.766   12.854 1.00 30.80 ? 292  MET E SD  1 
ATOM   2116 C  CE  . MET B 2 27  ? -18.052 7.109   14.611 1.00 30.40 ? 292  MET E CE  1 
ATOM   2117 N  N   . GLY B 2 28  ? -12.981 5.355   13.340 1.00 28.44 ? 293  GLY E N   1 
ATOM   2118 C  CA  . GLY B 2 28  ? -12.489 4.578   14.473 1.00 28.04 ? 293  GLY E CA  1 
ATOM   2119 C  C   . GLY B 2 28  ? -11.238 3.764   14.210 1.00 27.93 ? 293  GLY E C   1 
ATOM   2120 O  O   . GLY B 2 28  ? -10.967 2.791   14.914 1.00 28.09 ? 293  GLY E O   1 
ATOM   2121 N  N   . THR B 2 29  ? -10.476 4.152   13.192 1.00 27.72 ? 294  THR E N   1 
ATOM   2122 C  CA  . THR B 2 29  ? -9.173  3.552   12.932 1.00 27.37 ? 294  THR E CA  1 
ATOM   2123 C  C   . THR B 2 29  ? -8.097  4.538   13.375 1.00 27.04 ? 294  THR E C   1 
ATOM   2124 O  O   . THR B 2 29  ? -8.235  5.746   13.166 1.00 26.99 ? 294  THR E O   1 
ATOM   2125 C  CB  . THR B 2 29  ? -8.992  3.188   11.431 1.00 27.48 ? 294  THR E CB  1 
ATOM   2126 O  OG1 . THR B 2 29  ? -9.975  2.216   11.050 1.00 27.92 ? 294  THR E OG1 1 
ATOM   2127 C  CG2 . THR B 2 29  ? -7.606  2.607   11.159 1.00 27.18 ? 294  THR E CG2 1 
ATOM   2128 N  N   . ASN B 2 30  ? -7.045  4.026   14.008 1.00 26.49 ? 295  ASN E N   1 
ATOM   2129 C  CA  . ASN B 2 30  ? -5.875  4.838   14.310 1.00 26.07 ? 295  ASN E CA  1 
ATOM   2130 C  C   . ASN B 2 30  ? -4.832  4.710   13.202 1.00 25.93 ? 295  ASN E C   1 
ATOM   2131 O  O   . ASN B 2 30  ? -3.988  3.808   13.218 1.00 25.75 ? 295  ASN E O   1 
ATOM   2132 C  CB  . ASN B 2 30  ? -5.290  4.485   15.683 1.00 26.03 ? 295  ASN E CB  1 
ATOM   2133 C  CG  . ASN B 2 30  ? -4.264  5.507   16.165 1.00 25.20 ? 295  ASN E CG  1 
ATOM   2134 O  OD1 . ASN B 2 30  ? -3.749  6.309   15.388 1.00 24.34 ? 295  ASN E OD1 1 
ATOM   2135 N  ND2 . ASN B 2 30  ? -3.966  5.476   17.455 1.00 24.40 ? 295  ASN E ND2 1 
ATOM   2136 N  N   . GLU B 2 31  ? -4.906  5.631   12.246 1.00 25.76 ? 296  GLU E N   1 
ATOM   2137 C  CA  . GLU B 2 31  ? -4.044  5.622   11.067 1.00 25.71 ? 296  GLU E CA  1 
ATOM   2138 C  C   . GLU B 2 31  ? -2.582  5.949   11.374 1.00 25.63 ? 296  GLU E C   1 
ATOM   2139 O  O   . GLU B 2 31  ? -1.702  5.713   10.545 1.00 25.75 ? 296  GLU E O   1 
ATOM   2140 C  CB  . GLU B 2 31  ? -4.575  6.595   10.011 1.00 25.80 ? 296  GLU E CB  1 
ATOM   2141 C  CG  . GLU B 2 31  ? -5.853  6.155   9.314  1.00 25.77 ? 296  GLU E CG  1 
ATOM   2142 C  CD  . GLU B 2 31  ? -7.117  6.563   10.047 1.00 26.62 ? 296  GLU E CD  1 
ATOM   2143 O  OE1 . GLU B 2 31  ? -7.035  7.222   11.111 1.00 26.67 ? 296  GLU E OE1 1 
ATOM   2144 O  OE2 . GLU B 2 31  ? -8.212  6.221   9.551  1.00 27.54 ? 296  GLU E OE2 1 
ATOM   2145 N  N   . CYS B 2 32  ? -2.334  6.499   12.558 1.00 25.64 ? 297  CYS E N   1 
ATOM   2146 C  CA  . CYS B 2 32  ? -0.979  6.855   12.986 1.00 25.57 ? 297  CYS E CA  1 
ATOM   2147 C  C   . CYS B 2 32  ? -0.154  5.622   13.347 1.00 25.27 ? 297  CYS E C   1 
ATOM   2148 O  O   . CYS B 2 32  ? 1.068   5.689   13.378 1.00 25.29 ? 297  CYS E O   1 
ATOM   2149 C  CB  . CYS B 2 32  ? -1.017  7.853   14.149 1.00 25.35 ? 297  CYS E CB  1 
ATOM   2150 S  SG  . CYS B 2 32  ? -2.035  9.347   13.834 1.00 26.15 ? 297  CYS E SG  1 
ATOM   2151 N  N   . LEU B 2 33  ? -0.831  4.502   13.608 1.00 25.36 ? 298  LEU E N   1 
ATOM   2152 C  CA  . LEU B 2 33  ? -0.177  3.215   13.871 1.00 25.37 ? 298  LEU E CA  1 
ATOM   2153 C  C   . LEU B 2 33  ? 0.541   2.703   12.622 1.00 25.53 ? 298  LEU E C   1 
ATOM   2154 O  O   . LEU B 2 33  ? 1.448   1.869   12.713 1.00 25.24 ? 298  LEU E O   1 
ATOM   2155 C  CB  . LEU B 2 33  ? -1.184  2.169   14.369 1.00 25.08 ? 298  LEU E CB  1 
ATOM   2156 C  CG  . LEU B 2 33  ? -1.933  2.386   15.690 1.00 25.06 ? 298  LEU E CG  1 
ATOM   2157 C  CD1 . LEU B 2 33  ? -2.897  1.236   15.933 1.00 23.53 ? 298  LEU E CD1 1 
ATOM   2158 C  CD2 . LEU B 2 33  ? -0.998  2.578   16.901 1.00 24.25 ? 298  LEU E CD2 1 
ATOM   2159 N  N   . ASP B 2 34  ? 0.115   3.211   11.464 1.00 25.93 ? 299  ASP E N   1 
ATOM   2160 C  CA  . ASP B 2 34  ? 0.764   2.932   10.183 1.00 26.35 ? 299  ASP E CA  1 
ATOM   2161 C  C   . ASP B 2 34  ? 1.753   4.041   9.821  1.00 26.60 ? 299  ASP E C   1 
ATOM   2162 O  O   . ASP B 2 34  ? 1.450   4.917   9.013  1.00 26.66 ? 299  ASP E O   1 
ATOM   2163 C  CB  . ASP B 2 34  ? -0.280  2.746   9.072  1.00 26.30 ? 299  ASP E CB  1 
ATOM   2164 C  CG  . ASP B 2 34  ? 0.308   2.145   7.790  1.00 26.60 ? 299  ASP E CG  1 
ATOM   2165 O  OD1 . ASP B 2 34  ? 1.544   1.966   7.688  1.00 25.96 ? 299  ASP E OD1 1 
ATOM   2166 O  OD2 . ASP B 2 34  ? -0.486  1.845   6.872  1.00 27.27 ? 299  ASP E OD2 1 
ATOM   2167 N  N   . ASN B 2 35  ? 2.951   3.901   10.343 1.00 27.02 ? 300  ASN E N   1 
ATOM   2168 C  CA  . ASN B 2 35  ? 4.072   4.710   9.962  1.00 27.67 ? 300  ASN E CA  1 
ATOM   2169 C  C   . ASN B 2 35  ? 3.870   6.169   10.208 1.00 27.47 ? 300  ASN E C   1 
ATOM   2170 O  O   . ASN B 2 35  ? 4.195   6.967   9.414  1.00 28.58 ? 300  ASN E O   1 
ATOM   2171 C  CB  . ASN B 2 35  ? 4.490   4.440   8.525  1.00 27.98 ? 300  ASN E CB  1 
ATOM   2172 C  CG  . ASN B 2 35  ? 5.893   4.874   8.230  1.00 29.11 ? 300  ASN E CG  1 
ATOM   2173 O  OD1 . ASN B 2 35  ? 6.818   4.492   8.908  1.00 31.60 ? 300  ASN E OD1 1 
ATOM   2174 N  ND2 . ASN B 2 35  ? 6.056   5.672   7.208  1.00 28.85 ? 300  ASN E ND2 1 
ATOM   2175 N  N   . ASN B 2 36  ? 3.374   6.473   11.385 1.00 27.04 ? 301  ASN E N   1 
ATOM   2176 C  CA  . ASN B 2 36  ? 2.871   7.738   11.769 1.00 26.34 ? 301  ASN E CA  1 
ATOM   2177 C  C   . ASN B 2 36  ? 1.961   8.422   10.798 1.00 26.36 ? 301  ASN E C   1 
ATOM   2178 O  O   . ASN B 2 36  ? 2.010   9.591   10.666 1.00 26.20 ? 301  ASN E O   1 
ATOM   2179 C  CB  . ASN B 2 36  ? 3.971   8.628   12.274 1.00 26.20 ? 301  ASN E CB  1 
ATOM   2180 C  CG  . ASN B 2 36  ? 3.504   9.572   13.307 1.00 25.81 ? 301  ASN E CG  1 
ATOM   2181 O  OD1 . ASN B 2 36  ? 2.674   9.250   14.091 1.00 26.61 ? 301  ASN E OD1 1 
ATOM   2182 N  ND2 . ASN B 2 36  ? 4.001   10.745  13.281 1.00 24.86 ? 301  ASN E ND2 1 
ATOM   2183 N  N   . GLY B 2 37  ? 1.137   7.672   10.104 1.00 26.14 ? 302  GLY E N   1 
ATOM   2184 C  CA  . GLY B 2 37  ? 0.283   8.297   9.095  1.00 25.79 ? 302  GLY E CA  1 
ATOM   2185 C  C   . GLY B 2 37  ? 1.050   8.736   7.848  1.00 25.95 ? 302  GLY E C   1 
ATOM   2186 O  O   . GLY B 2 37  ? 0.490   9.365   6.952  1.00 25.97 ? 302  GLY E O   1 
ATOM   2187 N  N   . GLY B 2 38  ? 2.336   8.405   7.778  1.00 25.91 ? 303  GLY E N   1 
ATOM   2188 C  CA  . GLY B 2 38  ? 3.218   8.948   6.743  1.00 25.83 ? 303  GLY E CA  1 
ATOM   2189 C  C   . GLY B 2 38  ? 3.625   10.385  7.026  1.00 25.77 ? 303  GLY E C   1 
ATOM   2190 O  O   . GLY B 2 38  ? 4.343   10.998  6.239  1.00 25.86 ? 303  GLY E O   1 
ATOM   2191 N  N   . CYS B 2 39  ? 3.166   10.921  8.155  1.00 26.00 ? 304  CYS E N   1 
ATOM   2192 C  CA  . CYS B 2 39  ? 3.461   12.298  8.548  1.00 26.08 ? 304  CYS E CA  1 
ATOM   2193 C  C   . CYS B 2 39  ? 4.900   12.469  9.001  1.00 25.85 ? 304  CYS E C   1 
ATOM   2194 O  O   . CYS B 2 39  ? 5.456   11.627  9.710  1.00 25.77 ? 304  CYS E O   1 
ATOM   2195 C  CB  . CYS B 2 39  ? 2.518   12.781  9.651  1.00 26.15 ? 304  CYS E CB  1 
ATOM   2196 S  SG  . CYS B 2 39  ? 0.777   12.517  9.314  1.00 27.02 ? 304  CYS E SG  1 
ATOM   2197 N  N   . SER B 2 40  ? 5.480   13.586  8.583  1.00 25.63 ? 305  SER E N   1 
ATOM   2198 C  CA  . SER B 2 40  ? 6.850   13.952  8.901  1.00 25.11 ? 305  SER E CA  1 
ATOM   2199 C  C   . SER B 2 40  ? 7.051   14.172  10.404 1.00 24.97 ? 305  SER E C   1 
ATOM   2200 O  O   . SER B 2 40  ? 8.047   13.717  10.979 1.00 24.92 ? 305  SER E O   1 
ATOM   2201 C  CB  . SER B 2 40  ? 7.198   15.219  8.126  1.00 24.89 ? 305  SER E CB  1 
ATOM   2202 O  OG  . SER B 2 40  ? 8.440   15.744  8.523  1.00 26.10 ? 305  SER E OG  1 
ATOM   2203 N  N   . HIS B 2 41  ? 6.095   14.861  11.031 1.00 24.72 ? 306  HIS E N   1 
ATOM   2204 C  CA  . HIS B 2 41  ? 6.209   15.270  12.428 1.00 24.45 ? 306  HIS E CA  1 
ATOM   2205 C  C   . HIS B 2 41  ? 5.098   14.677  13.300 1.00 24.11 ? 306  HIS E C   1 
ATOM   2206 O  O   . HIS B 2 41  ? 5.229   13.569  13.810 1.00 23.95 ? 306  HIS E O   1 
ATOM   2207 C  CB  . HIS B 2 41  ? 6.252   16.802  12.532 1.00 24.48 ? 306  HIS E CB  1 
ATOM   2208 C  CG  . HIS B 2 41  ? 7.550   17.406  12.081 1.00 25.43 ? 306  HIS E CG  1 
ATOM   2209 N  ND1 . HIS B 2 41  ? 7.974   17.378  10.768 1.00 25.69 ? 306  HIS E ND1 1 
ATOM   2210 C  CD2 . HIS B 2 41  ? 8.515   18.062  12.770 1.00 25.86 ? 306  HIS E CD2 1 
ATOM   2211 C  CE1 . HIS B 2 41  ? 9.142   17.985  10.669 1.00 25.13 ? 306  HIS E CE1 1 
ATOM   2212 N  NE2 . HIS B 2 41  ? 9.494   18.409  11.870 1.00 25.48 ? 306  HIS E NE2 1 
ATOM   2213 N  N   . VAL B 2 42  ? 4.003   15.409  13.462 1.00 24.16 ? 307  VAL E N   1 
ATOM   2214 C  CA  . VAL B 2 42  ? 2.898   14.963  14.308 1.00 23.86 ? 307  VAL E CA  1 
ATOM   2215 C  C   . VAL B 2 42  ? 1.731   14.444  13.469 1.00 23.80 ? 307  VAL E C   1 
ATOM   2216 O  O   . VAL B 2 42  ? 1.341   15.063  12.480 1.00 23.69 ? 307  VAL E O   1 
ATOM   2217 C  CB  . VAL B 2 42  ? 2.448   16.085  15.294 1.00 23.83 ? 307  VAL E CB  1 
ATOM   2218 C  CG1 . VAL B 2 42  ? 1.144   15.735  15.993 1.00 23.81 ? 307  VAL E CG1 1 
ATOM   2219 C  CG2 . VAL B 2 42  ? 3.528   16.350  16.324 1.00 23.26 ? 307  VAL E CG2 1 
ATOM   2220 N  N   . CYS B 2 43  ? 1.208   13.288  13.873 1.00 23.89 ? 308  CYS E N   1 
ATOM   2221 C  CA  . CYS B 2 43  ? 0.012   12.691  13.292 1.00 23.92 ? 308  CYS E CA  1 
ATOM   2222 C  C   . CYS B 2 43  ? -1.145  12.832  14.274 1.00 24.00 ? 308  CYS E C   1 
ATOM   2223 O  O   . CYS B 2 43  ? -1.050  12.398  15.423 1.00 23.88 ? 308  CYS E O   1 
ATOM   2224 C  CB  . CYS B 2 43  ? 0.257   11.207  12.978 1.00 23.99 ? 308  CYS E CB  1 
ATOM   2225 S  SG  . CYS B 2 43  ? -1.144  10.287  12.244 1.00 24.45 ? 308  CYS E SG  1 
ATOM   2226 N  N   . ASN B 2 44  ? -2.232  13.450  13.819 1.00 24.10 ? 309  ASN E N   1 
ATOM   2227 C  CA  . ASN B 2 44  ? -3.426  13.604  14.636 1.00 23.96 ? 309  ASN E CA  1 
ATOM   2228 C  C   . ASN B 2 44  ? -4.524  12.627  14.212 1.00 24.22 ? 309  ASN E C   1 
ATOM   2229 O  O   . ASN B 2 44  ? -5.084  12.732  13.114 1.00 24.49 ? 309  ASN E O   1 
ATOM   2230 C  CB  . ASN B 2 44  ? -3.923  15.050  14.583 1.00 23.97 ? 309  ASN E CB  1 
ATOM   2231 C  CG  . ASN B 2 44  ? -5.027  15.340  15.585 1.00 23.46 ? 309  ASN E CG  1 
ATOM   2232 O  OD1 . ASN B 2 44  ? -5.742  16.322  15.444 1.00 23.95 ? 309  ASN E OD1 1 
ATOM   2233 N  ND2 . ASN B 2 44  ? -5.166  14.499  16.600 1.00 23.58 ? 309  ASN E ND2 1 
ATOM   2234 N  N   . ASP B 2 45  ? -4.815  11.677  15.097 1.00 24.03 ? 310  ASP E N   1 
ATOM   2235 C  CA  . ASP B 2 45  ? -5.743  10.640  14.865 1.00 26.25 ? 310  ASP E CA  1 
ATOM   2236 C  C   . ASP B 2 45  ? -7.137  11.251  15.046 1.00 26.21 ? 310  ASP E C   1 
ATOM   2237 O  O   . ASP B 2 45  ? -7.667  11.323  16.157 1.00 26.44 ? 310  ASP E O   1 
ATOM   2238 C  CB  . ASP B 2 45  ? -5.576  9.433   15.796 1.00 26.30 ? 310  ASP E CB  1 
ATOM   2239 C  CG  . ASP B 2 45  ? -6.548  8.315   15.468 1.00 26.28 ? 310  ASP E CG  1 
ATOM   2240 O  OD1 . ASP B 2 45  ? -6.872  7.498   16.341 1.00 27.42 ? 310  ASP E OD1 1 
ATOM   2241 O  OD2 . ASP B 2 45  ? -6.998  8.245   14.316 1.00 28.22 ? 310  ASP E OD2 1 
ATOM   2242 N  N   . LEU B 2 46  ? -7.729  11.675  13.936 1.00 26.36 ? 311  LEU E N   1 
ATOM   2243 C  CA  . LEU B 2 46  ? -9.087  12.198  13.931 1.00 26.19 ? 311  LEU E CA  1 
ATOM   2244 C  C   . LEU B 2 46  ? -10.109 11.064  14.012 1.00 26.62 ? 311  LEU E C   1 
ATOM   2245 O  O   . LEU B 2 46  ? -9.803  9.907   13.699 1.00 26.56 ? 311  LEU E O   1 
ATOM   2246 C  CB  . LEU B 2 46  ? -9.322  13.025  12.670 1.00 26.27 ? 311  LEU E CB  1 
ATOM   2247 C  CG  . LEU B 2 46  ? -8.379  14.213  12.457 1.00 25.73 ? 311  LEU E CG  1 
ATOM   2248 C  CD1 . LEU B 2 46  ? -8.662  14.872  11.112 1.00 24.47 ? 311  LEU E CD1 1 
ATOM   2249 C  CD2 . LEU B 2 46  ? -8.501  15.206  13.601 1.00 25.50 ? 311  LEU E CD2 1 
ATOM   2250 N  N   . LYS B 2 47  ? -11.323 11.401  14.434 1.00 27.08 ? 312  LYS E N   1 
ATOM   2251 C  CA  . LYS B 2 47  ? -12.407 10.428  14.505 1.00 27.45 ? 312  LYS E CA  1 
ATOM   2252 C  C   . LYS B 2 47  ? -12.651 9.774   13.149 1.00 27.22 ? 312  LYS E C   1 
ATOM   2253 O  O   . LYS B 2 47  ? -12.742 8.551   13.047 1.00 27.04 ? 312  LYS E O   1 
ATOM   2254 C  CB  . LYS B 2 47  ? -13.691 11.092  15.007 1.00 27.71 ? 312  LYS E CB  1 
ATOM   2255 C  CG  . LYS B 2 47  ? -14.859 10.135  15.177 1.00 29.27 ? 312  LYS E CG  1 
ATOM   2256 C  CD  . LYS B 2 47  ? -16.078 10.846  15.744 1.00 30.66 ? 312  LYS E CD  1 
ATOM   2257 C  CE  . LYS B 2 47  ? -17.250 9.891   15.902 1.00 31.37 ? 312  LYS E CE  1 
ATOM   2258 N  NZ  . LYS B 2 47  ? -18.450 10.575  16.459 1.00 31.91 ? 312  LYS E NZ  1 
ATOM   2259 N  N   . ILE B 2 48  ? -12.756 10.597  12.111 1.00 27.02 ? 313  ILE E N   1 
ATOM   2260 C  CA  . ILE B 2 48  ? -12.720 10.106  10.738 1.00 27.05 ? 313  ILE E CA  1 
ATOM   2261 C  C   . ILE B 2 48  ? -11.367 10.380  10.090 1.00 27.00 ? 313  ILE E C   1 
ATOM   2262 O  O   . ILE B 2 48  ? -10.974 11.533  9.914  1.00 26.89 ? 313  ILE E O   1 
ATOM   2263 C  CB  . ILE B 2 48  ? -13.828 10.745  9.881  1.00 27.21 ? 313  ILE E CB  1 
ATOM   2264 C  CG1 . ILE B 2 48  ? -15.166 10.704  10.622 1.00 26.85 ? 313  ILE E CG1 1 
ATOM   2265 C  CG2 . ILE B 2 48  ? -13.936 10.040  8.537  1.00 26.69 ? 313  ILE E CG2 1 
ATOM   2266 C  CD1 . ILE B 2 48  ? -15.986 9.465   10.334 1.00 27.38 ? 313  ILE E CD1 1 
ATOM   2267 N  N   . GLY B 2 49  ? -10.659 9.312   9.736  1.00 27.01 ? 314  GLY E N   1 
ATOM   2268 C  CA  . GLY B 2 49  ? -9.324  9.433   9.181  1.00 27.13 ? 314  GLY E CA  1 
ATOM   2269 C  C   . GLY B 2 49  ? -8.373  10.162  10.109 1.00 27.05 ? 314  GLY E C   1 
ATOM   2270 O  O   . GLY B 2 49  ? -8.387  9.946   11.321 1.00 26.84 ? 314  GLY E O   1 
ATOM   2271 N  N   . TYR B 2 50  ? -7.543  11.029  9.538  1.00 26.90 ? 315  TYR E N   1 
ATOM   2272 C  CA  . TYR B 2 50  ? -6.455  11.652  10.282 1.00 26.87 ? 315  TYR E CA  1 
ATOM   2273 C  C   . TYR B 2 50  ? -5.861  12.828  9.514  1.00 27.06 ? 315  TYR E C   1 
ATOM   2274 O  O   . TYR B 2 50  ? -6.207  13.064  8.357  1.00 27.19 ? 315  TYR E O   1 
ATOM   2275 C  CB  . TYR B 2 50  ? -5.364  10.625  10.596 1.00 26.39 ? 315  TYR E CB  1 
ATOM   2276 C  CG  . TYR B 2 50  ? -4.495  10.272  9.411  1.00 26.00 ? 315  TYR E CG  1 
ATOM   2277 C  CD1 . TYR B 2 50  ? -4.930  9.367   8.451  1.00 25.80 ? 315  TYR E CD1 1 
ATOM   2278 C  CD2 . TYR B 2 50  ? -3.240  10.843  9.251  1.00 25.96 ? 315  TYR E CD2 1 
ATOM   2279 C  CE1 . TYR B 2 50  ? -4.140  9.041   7.366  1.00 25.43 ? 315  TYR E CE1 1 
ATOM   2280 C  CE2 . TYR B 2 50  ? -2.442  10.523  8.168  1.00 25.88 ? 315  TYR E CE2 1 
ATOM   2281 C  CZ  . TYR B 2 50  ? -2.897  9.622   7.229  1.00 25.95 ? 315  TYR E CZ  1 
ATOM   2282 O  OH  . TYR B 2 50  ? -2.106  9.301   6.150  1.00 25.63 ? 315  TYR E OH  1 
ATOM   2283 N  N   . GLU B 2 51  ? -4.966  13.562  10.167 1.00 27.39 ? 316  GLU E N   1 
ATOM   2284 C  CA  . GLU B 2 51  ? -4.245  14.649  9.515  1.00 27.89 ? 316  GLU E CA  1 
ATOM   2285 C  C   . GLU B 2 51  ? -2.779  14.668  9.938  1.00 29.54 ? 316  GLU E C   1 
ATOM   2286 O  O   . GLU B 2 51  ? -2.398  14.029  10.918 1.00 29.71 ? 316  GLU E O   1 
ATOM   2287 C  CB  . GLU B 2 51  ? -4.901  15.994  9.833  1.00 29.30 ? 316  GLU E CB  1 
ATOM   2288 C  CG  . GLU B 2 51  ? -4.782  16.414  11.289 1.00 29.23 ? 316  GLU E CG  1 
ATOM   2289 C  CD  . GLU B 2 51  ? -5.649  17.612  11.623 1.00 29.67 ? 316  GLU E CD  1 
ATOM   2290 O  OE1 . GLU B 2 51  ? -5.787  17.931  12.822 1.00 30.30 ? 316  GLU E OE1 1 
ATOM   2291 O  OE2 . GLU B 2 51  ? -6.193  18.233  10.686 1.00 30.01 ? 316  GLU E OE2 1 
ATOM   2292 N  N   . CYS B 2 52  ? -1.963  15.406  9.192  1.00 29.80 ? 317  CYS E N   1 
ATOM   2293 C  CA  . CYS B 2 52  ? -0.579  15.647  9.581  1.00 29.74 ? 317  CYS E CA  1 
ATOM   2294 C  C   . CYS B 2 52  ? -0.421  17.062  10.091 1.00 30.32 ? 317  CYS E C   1 
ATOM   2295 O  O   . CYS B 2 52  ? -0.970  17.998  9.516  1.00 30.39 ? 317  CYS E O   1 
ATOM   2296 C  CB  . CYS B 2 52  ? 0.372   15.407  8.418  1.00 29.39 ? 317  CYS E CB  1 
ATOM   2297 S  SG  . CYS B 2 52  ? 0.337   13.742  7.749  1.00 28.77 ? 317  CYS E SG  1 
ATOM   2298 N  N   . LEU B 2 53  ? 0.340   17.210  11.171 1.00 31.10 ? 318  LEU E N   1 
ATOM   2299 C  CA  . LEU B 2 53  ? 0.532   18.505  11.809 1.00 32.00 ? 318  LEU E CA  1 
ATOM   2300 C  C   . LEU B 2 53  ? 1.989   18.952  11.732 1.00 32.68 ? 318  LEU E C   1 
ATOM   2301 O  O   . LEU B 2 53  ? 2.906   18.132  11.746 1.00 32.61 ? 318  LEU E O   1 
ATOM   2302 C  CB  . LEU B 2 53  ? 0.072   18.458  13.267 1.00 31.79 ? 318  LEU E CB  1 
ATOM   2303 C  CG  . LEU B 2 53  ? -1.432  18.602  13.508 1.00 31.53 ? 318  LEU E CG  1 
ATOM   2304 C  CD1 . LEU B 2 53  ? -2.207  17.572  12.700 1.00 31.06 ? 318  LEU E CD1 1 
ATOM   2305 C  CD2 . LEU B 2 53  ? -1.753  18.479  14.989 1.00 31.32 ? 318  LEU E CD2 1 
ATOM   2306 N  N   . CYS B 2 54  ? 2.186   20.263  11.651 1.00 33.79 ? 319  CYS E N   1 
ATOM   2307 C  CA  . CYS B 2 54  ? 3.516   20.855  11.599 1.00 34.91 ? 319  CYS E CA  1 
ATOM   2308 C  C   . CYS B 2 54  ? 3.761   21.779  12.786 1.00 35.32 ? 319  CYS E C   1 
ATOM   2309 O  O   . CYS B 2 54  ? 2.819   22.394  13.293 1.00 35.35 ? 319  CYS E O   1 
ATOM   2310 C  CB  . CYS B 2 54  ? 3.703   21.616  10.283 1.00 35.02 ? 319  CYS E CB  1 
ATOM   2311 S  SG  . CYS B 2 54  ? 3.795   20.543  8.826  1.00 36.81 ? 319  CYS E SG  1 
ATOM   2312 N  N   . PRO B 2 55  ? 5.028   21.873  13.245 1.00 35.97 ? 320  PRO E N   1 
ATOM   2313 C  CA  . PRO B 2 55  ? 5.365   22.879  14.256 1.00 36.35 ? 320  PRO E CA  1 
ATOM   2314 C  C   . PRO B 2 55  ? 5.334   24.289  13.660 1.00 36.80 ? 320  PRO E C   1 
ATOM   2315 O  O   . PRO B 2 55  ? 5.113   24.443  12.456 1.00 36.82 ? 320  PRO E O   1 
ATOM   2316 C  CB  . PRO B 2 55  ? 6.787   22.494  14.676 1.00 36.32 ? 320  PRO E CB  1 
ATOM   2317 C  CG  . PRO B 2 55  ? 7.342   21.754  13.517 1.00 35.99 ? 320  PRO E CG  1 
ATOM   2318 C  CD  . PRO B 2 55  ? 6.197   21.055  12.865 1.00 35.89 ? 320  PRO E CD  1 
ATOM   2319 N  N   . ASP B 2 56  ? 5.548   25.304  14.496 1.00 37.45 ? 321  ASP E N   1 
ATOM   2320 C  CA  . ASP B 2 56  ? 5.544   26.697  14.034 1.00 37.88 ? 321  ASP E CA  1 
ATOM   2321 C  C   . ASP B 2 56  ? 6.747   27.021  13.150 1.00 37.88 ? 321  ASP E C   1 
ATOM   2322 O  O   . ASP B 2 56  ? 7.855   26.536  13.387 1.00 37.88 ? 321  ASP E O   1 
ATOM   2323 C  CB  . ASP B 2 56  ? 5.457   27.665  15.220 1.00 38.10 ? 321  ASP E CB  1 
ATOM   2324 C  CG  . ASP B 2 56  ? 4.072   27.685  15.863 1.00 38.80 ? 321  ASP E CG  1 
ATOM   2325 O  OD1 . ASP B 2 56  ? 3.991   27.942  17.085 1.00 39.45 ? 321  ASP E OD1 1 
ATOM   2326 O  OD2 . ASP B 2 56  ? 3.067   27.446  15.152 1.00 39.07 ? 321  ASP E OD2 1 
ATOM   2327 N  N   . GLY B 2 57  ? 6.511   27.841  12.129 1.00 37.94 ? 322  GLY E N   1 
ATOM   2328 C  CA  . GLY B 2 57  ? 7.541   28.184  11.151 1.00 38.07 ? 322  GLY E CA  1 
ATOM   2329 C  C   . GLY B 2 57  ? 7.634   27.168  10.025 1.00 38.18 ? 322  GLY E C   1 
ATOM   2330 O  O   . GLY B 2 57  ? 8.487   27.286  9.142  1.00 38.24 ? 322  GLY E O   1 
ATOM   2331 N  N   . PHE B 2 58  ? 6.746   26.177  10.059 1.00 38.21 ? 323  PHE E N   1 
ATOM   2332 C  CA  . PHE B 2 58  ? 6.733   25.089  9.089  1.00 38.13 ? 323  PHE E CA  1 
ATOM   2333 C  C   . PHE B 2 58  ? 5.376   24.981  8.408  1.00 38.09 ? 323  PHE E C   1 
ATOM   2334 O  O   . PHE B 2 58  ? 4.333   25.183  9.042  1.00 38.12 ? 323  PHE E O   1 
ATOM   2335 C  CB  . PHE B 2 58  ? 7.058   23.755  9.776  1.00 38.15 ? 323  PHE E CB  1 
ATOM   2336 C  CG  . PHE B 2 58  ? 8.513   23.583  10.134 1.00 38.47 ? 323  PHE E CG  1 
ATOM   2337 C  CD1 . PHE B 2 58  ? 9.021   24.096  11.328 1.00 38.64 ? 323  PHE E CD1 1 
ATOM   2338 C  CD2 . PHE B 2 58  ? 9.376   22.894  9.285  1.00 38.70 ? 323  PHE E CD2 1 
ATOM   2339 C  CE1 . PHE B 2 58  ? 10.366  23.933  11.664 1.00 38.37 ? 323  PHE E CE1 1 
ATOM   2340 C  CE2 . PHE B 2 58  ? 10.725  22.726  9.614  1.00 38.32 ? 323  PHE E CE2 1 
ATOM   2341 C  CZ  . PHE B 2 58  ? 11.218  23.247  10.805 1.00 38.31 ? 323  PHE E CZ  1 
ATOM   2342 N  N   . GLN B 2 59  ? 5.408   24.660  7.116  1.00 38.01 ? 324  GLN E N   1 
ATOM   2343 C  CA  A GLN B 2 59  ? 4.185   24.412  6.359  0.50 37.91 ? 324  GLN E CA  1 
ATOM   2344 C  CA  B GLN B 2 59  ? 4.205   24.428  6.317  0.50 37.90 ? 324  GLN E CA  1 
ATOM   2345 C  C   . GLN B 2 59  ? 4.149   22.976  5.843  1.00 37.88 ? 324  GLN E C   1 
ATOM   2346 O  O   . GLN B 2 59  ? 5.192   22.338  5.665  1.00 37.85 ? 324  GLN E O   1 
ATOM   2347 C  CB  A GLN B 2 59  ? 4.028   25.418  5.212  0.50 37.98 ? 324  GLN E CB  1 
ATOM   2348 C  CB  B GLN B 2 59  ? 4.168   25.374  5.109  0.50 37.97 ? 324  GLN E CB  1 
ATOM   2349 C  CG  A GLN B 2 59  ? 3.676   26.835  5.670  0.50 37.94 ? 324  GLN E CG  1 
ATOM   2350 C  CG  B GLN B 2 59  ? 5.423   25.336  4.229  0.50 37.91 ? 324  GLN E CG  1 
ATOM   2351 C  CD  A GLN B 2 59  ? 3.119   27.708  4.555  0.50 37.93 ? 324  GLN E CD  1 
ATOM   2352 C  CD  B GLN B 2 59  ? 5.191   25.875  2.829  0.50 37.84 ? 324  GLN E CD  1 
ATOM   2353 O  OE1 A GLN B 2 59  ? 3.618   28.805  4.305  0.50 37.79 ? 324  GLN E OE1 1 
ATOM   2354 O  OE1 B GLN B 2 59  ? 4.159   25.614  2.209  0.50 37.83 ? 324  GLN E OE1 1 
ATOM   2355 N  NE2 A GLN B 2 59  ? 2.077   27.225  3.884  0.50 37.97 ? 324  GLN E NE2 1 
ATOM   2356 N  NE2 B GLN B 2 59  ? 6.162   26.620  2.318  0.50 37.72 ? 324  GLN E NE2 1 
ATOM   2357 N  N   . LEU B 2 60  ? 2.939   22.463  5.627  1.00 37.73 ? 325  LEU E N   1 
ATOM   2358 C  CA  . LEU B 2 60  ? 2.758   21.096  5.153  1.00 37.61 ? 325  LEU E CA  1 
ATOM   2359 C  C   . LEU B 2 60  ? 2.861   21.021  3.629  1.00 37.67 ? 325  LEU E C   1 
ATOM   2360 O  O   . LEU B 2 60  ? 2.117   21.694  2.910  1.00 37.68 ? 325  LEU E O   1 
ATOM   2361 C  CB  . LEU B 2 60  ? 1.422   20.516  5.644  1.00 37.57 ? 325  LEU E CB  1 
ATOM   2362 C  CG  . LEU B 2 60  ? 1.229   18.992  5.607  1.00 37.33 ? 325  LEU E CG  1 
ATOM   2363 C  CD1 . LEU B 2 60  ? 2.163   18.272  6.573  1.00 37.47 ? 325  LEU E CD1 1 
ATOM   2364 C  CD2 . LEU B 2 60  ? -0.207  18.633  5.915  1.00 37.54 ? 325  LEU E CD2 1 
ATOM   2365 N  N   . VAL B 2 61  ? 3.794   20.200  3.154  1.00 37.61 ? 326  VAL E N   1 
ATOM   2366 C  CA  . VAL B 2 61  ? 4.014   19.989  1.724  1.00 37.60 ? 326  VAL E CA  1 
ATOM   2367 C  C   . VAL B 2 61  ? 3.604   18.564  1.348  1.00 37.65 ? 326  VAL E C   1 
ATOM   2368 O  O   . VAL B 2 61  ? 3.913   17.612  2.072  1.00 37.69 ? 326  VAL E O   1 
ATOM   2369 C  CB  . VAL B 2 61  ? 5.495   20.249  1.333  1.00 37.57 ? 326  VAL E CB  1 
ATOM   2370 C  CG1 . VAL B 2 61  ? 5.707   20.081  -0.169 1.00 37.58 ? 326  VAL E CG1 1 
ATOM   2371 C  CG2 . VAL B 2 61  ? 5.932   21.643  1.779  1.00 37.49 ? 326  VAL E CG2 1 
ATOM   2372 N  N   . ALA B 2 62  ? 2.902   18.434  0.219  1.00 37.69 ? 327  ALA E N   1 
ATOM   2373 C  CA  . ALA B 2 62  ? 2.377   17.151  -0.271 1.00 37.67 ? 327  ALA E CA  1 
ATOM   2374 C  C   . ALA B 2 62  ? 1.606   16.385  0.810  1.00 37.79 ? 327  ALA E C   1 
ATOM   2375 O  O   . ALA B 2 62  ? 1.674   15.152  0.890  1.00 37.71 ? 327  ALA E O   1 
ATOM   2376 C  CB  . ALA B 2 62  ? 3.491   16.292  -0.877 1.00 37.59 ? 327  ALA E CB  1 
ATOM   2377 N  N   . GLN B 2 63  ? 0.892   17.143  1.644  1.00 37.88 ? 328  GLN E N   1 
ATOM   2378 C  CA  . GLN B 2 63  ? -0.026  16.613  2.661  1.00 37.95 ? 328  GLN E CA  1 
ATOM   2379 C  C   . GLN B 2 63  ? 0.631   15.779  3.778  1.00 38.02 ? 328  GLN E C   1 
ATOM   2380 O  O   . GLN B 2 63  ? -0.067  15.277  4.663  1.00 38.15 ? 328  GLN E O   1 
ATOM   2381 C  CB  . GLN B 2 63  ? -1.186  15.841  2.001  1.00 37.86 ? 328  GLN E CB  1 
ATOM   2382 C  CG  . GLN B 2 63  ? -2.144  16.712  1.180  1.00 37.91 ? 328  GLN E CG  1 
ATOM   2383 C  CD  . GLN B 2 63  ? -1.631  17.041  -0.224 1.00 38.37 ? 328  GLN E CD  1 
ATOM   2384 O  OE1 . GLN B 2 63  ? -1.301  16.146  -1.003 1.00 38.55 ? 328  GLN E OE1 1 
ATOM   2385 N  NE2 . GLN B 2 63  ? -1.572  18.332  -0.549 1.00 37.96 ? 328  GLN E NE2 1 
ATOM   2386 N  N   . ARG B 2 64  ? 1.961   15.652  3.746  1.00 37.92 ? 329  ARG E N   1 
ATOM   2387 C  CA  . ARG B 2 64  ? 2.687   14.779  4.677  1.00 37.88 ? 329  ARG E CA  1 
ATOM   2388 C  C   . ARG B 2 64  ? 3.946   15.401  5.297  1.00 38.07 ? 329  ARG E C   1 
ATOM   2389 O  O   . ARG B 2 64  ? 4.248   15.150  6.467  1.00 37.84 ? 329  ARG E O   1 
ATOM   2390 C  CB  . ARG B 2 64  ? 3.070   13.456  3.996  1.00 37.78 ? 329  ARG E CB  1 
ATOM   2391 C  CG  . ARG B 2 64  ? 1.914   12.659  3.390  1.00 37.48 ? 329  ARG E CG  1 
ATOM   2392 C  CD  . ARG B 2 64  ? 1.096   11.926  4.436  1.00 36.93 ? 329  ARG E CD  1 
ATOM   2393 N  NE  . ARG B 2 64  ? -0.017  11.204  3.824  1.00 37.57 ? 329  ARG E NE  1 
ATOM   2394 C  CZ  . ARG B 2 64  ? -1.286  11.621  3.804  1.00 37.50 ? 329  ARG E CZ  1 
ATOM   2395 N  NH1 . ARG B 2 64  ? -1.644  12.763  4.381  1.00 36.67 ? 329  ARG E NH1 1 
ATOM   2396 N  NH2 . ARG B 2 64  ? -2.207  10.873  3.217  1.00 37.66 ? 329  ARG E NH2 1 
ATOM   2397 N  N   . ARG B 2 65  ? 4.671   16.200  4.512  1.00 38.49 ? 330  ARG E N   1 
ATOM   2398 C  CA  . ARG B 2 65  ? 5.994   16.706  4.899  1.00 38.94 ? 330  ARG E CA  1 
ATOM   2399 C  C   . ARG B 2 65  ? 5.996   18.150  5.387  1.00 38.89 ? 330  ARG E C   1 
ATOM   2400 O  O   . ARG B 2 65  ? 5.502   19.042  4.701  1.00 39.21 ? 330  ARG E O   1 
ATOM   2401 C  CB  . ARG B 2 65  ? 6.972   16.578  3.729  1.00 38.90 ? 330  ARG E CB  1 
ATOM   2402 C  CG  . ARG B 2 65  ? 7.689   15.239  3.630  1.00 39.60 ? 330  ARG E CG  1 
ATOM   2403 C  CD  . ARG B 2 65  ? 8.617   15.194  2.405  1.00 39.75 ? 330  ARG E CD  1 
ATOM   2404 N  NE  . ARG B 2 65  ? 7.866   15.199  1.147  1.00 41.46 ? 330  ARG E NE  1 
ATOM   2405 C  CZ  . ARG B 2 65  ? 7.874   16.189  0.255  1.00 42.22 ? 330  ARG E CZ  1 
ATOM   2406 N  NH1 . ARG B 2 65  ? 7.144   16.085  -0.849 1.00 42.37 ? 330  ARG E NH1 1 
ATOM   2407 N  NH2 . ARG B 2 65  ? 8.611   17.277  0.450  1.00 42.13 ? 330  ARG E NH2 1 
ATOM   2408 N  N   . CYS B 2 66  ? 6.571   18.373  6.565  1.00 38.98 ? 331  CYS E N   1 
ATOM   2409 C  CA  . CYS B 2 66  ? 6.770   19.721  7.095  1.00 39.09 ? 331  CYS E CA  1 
ATOM   2410 C  C   . CYS B 2 66  ? 8.106   20.288  6.618  1.00 39.52 ? 331  CYS E C   1 
ATOM   2411 O  O   . CYS B 2 66  ? 9.153   19.646  6.761  1.00 39.44 ? 331  CYS E O   1 
ATOM   2412 C  CB  . CYS B 2 66  ? 6.718   19.724  8.625  1.00 38.92 ? 331  CYS E CB  1 
ATOM   2413 S  SG  . CYS B 2 66  ? 5.173   19.119  9.345  1.00 38.34 ? 331  CYS E SG  1 
ATOM   2414 N  N   . GLU B 2 67  ? 8.061   21.491  6.051  1.00 39.91 ? 332  GLU E N   1 
ATOM   2415 C  CA  . GLU B 2 67  ? 9.250   22.141  5.503  1.00 40.51 ? 332  GLU E CA  1 
ATOM   2416 C  C   . GLU B 2 67  ? 9.252   23.652  5.739  1.00 40.43 ? 332  GLU E C   1 
ATOM   2417 O  O   . GLU B 2 67  ? 8.224   24.231  6.101  1.00 40.44 ? 332  GLU E O   1 
ATOM   2418 C  CB  . GLU B 2 67  ? 9.370   21.847  4.001  1.00 40.46 ? 332  GLU E CB  1 
ATOM   2419 C  CG  . GLU B 2 67  ? 9.920   20.461  3.670  1.00 41.09 ? 332  GLU E CG  1 
ATOM   2420 C  CD  . GLU B 2 67  ? 9.680   20.040  2.222  1.00 41.38 ? 332  GLU E CD  1 
ATOM   2421 O  OE1 . GLU B 2 67  ? 9.165   20.855  1.420  1.00 42.13 ? 332  GLU E OE1 1 
ATOM   2422 O  OE2 . GLU B 2 67  ? 10.014  18.880  1.888  1.00 42.50 ? 332  GLU E OE2 1 
ATOM   2423 N  N   . ASP B 2 68  ? 10.425  24.262  5.552  1.00 40.55 ? 333  ASP E N   1 
ATOM   2424 C  CA  . ASP B 2 68  ? 10.599  25.722  5.437  1.00 40.58 ? 333  ASP E CA  1 
ATOM   2425 C  C   . ASP B 2 68  ? 9.665   26.567  6.311  1.00 40.58 ? 333  ASP E C   1 
ATOM   2426 O  O   . ASP B 2 68  ? 8.927   27.425  5.813  1.00 40.52 ? 333  ASP E O   1 
ATOM   2427 C  CB  . ASP B 2 68  ? 10.500  26.151  3.962  1.00 40.49 ? 333  ASP E CB  1 
ATOM   2428 N  N   . THR C 3 23  ? 38.944  5.830   55.333 1.00 35.85 ? 61   THR P N   1 
ATOM   2429 C  CA  . THR C 3 23  ? 38.454  7.175   55.607 1.00 34.86 ? 61   THR P CA  1 
ATOM   2430 C  C   . THR C 3 23  ? 37.405  7.599   54.584 1.00 33.80 ? 61   THR P C   1 
ATOM   2431 O  O   . THR C 3 23  ? 37.290  7.000   53.514 1.00 33.65 ? 61   THR P O   1 
ATOM   2432 C  CB  . THR C 3 23  ? 39.600  8.204   55.608 1.00 35.03 ? 61   THR P CB  1 
ATOM   2433 O  OG1 . THR C 3 23  ? 40.843  7.538   55.863 1.00 35.60 ? 61   THR P OG1 1 
ATOM   2434 C  CG2 . THR C 3 23  ? 39.367  9.260   56.678 1.00 35.27 ? 61   THR P CG2 1 
ATOM   2435 N  N   . ALA C 3 24  ? 36.642  8.634   54.920 1.00 32.50 ? 62   ALA P N   1 
ATOM   2436 C  CA  . ALA C 3 24  ? 35.610  9.152   54.022 1.00 31.29 ? 62   ALA P CA  1 
ATOM   2437 C  C   . ALA C 3 24  ? 36.217  9.816   52.789 1.00 30.51 ? 62   ALA P C   1 
ATOM   2438 O  O   . ALA C 3 24  ? 37.220  10.529  52.890 1.00 30.27 ? 62   ALA P O   1 
ATOM   2439 C  CB  . ALA C 3 24  ? 34.702  10.124  54.758 1.00 31.15 ? 62   ALA P CB  1 
ATOM   2440 N  N   . THR C 3 25  ? 35.600  9.574   51.632 1.00 29.41 ? 63   THR P N   1 
ATOM   2441 C  CA  . THR C 3 25  ? 36.085  10.107  50.359 1.00 28.48 ? 63   THR P CA  1 
ATOM   2442 C  C   . THR C 3 25  ? 35.117  11.105  49.708 1.00 28.02 ? 63   THR P C   1 
ATOM   2443 O  O   . THR C 3 25  ? 33.921  11.114  50.004 1.00 27.67 ? 63   THR P O   1 
ATOM   2444 C  CB  . THR C 3 25  ? 36.418  8.975   49.358 1.00 28.54 ? 63   THR P CB  1 
ATOM   2445 O  OG1 . THR C 3 25  ? 35.328  8.045   49.296 1.00 28.69 ? 63   THR P OG1 1 
ATOM   2446 C  CG2 . THR C 3 25  ? 37.688  8.244   49.775 1.00 27.98 ? 63   THR P CG2 1 
ATOM   2447 N  N   . PHE C 3 26  ? 35.652  11.946  48.827 1.00 27.38 ? 64   PHE P N   1 
ATOM   2448 C  CA  . PHE C 3 26  ? 34.851  12.901  48.072 1.00 26.82 ? 64   PHE P CA  1 
ATOM   2449 C  C   . PHE C 3 26  ? 34.779  12.503  46.598 1.00 26.72 ? 64   PHE P C   1 
ATOM   2450 O  O   . PHE C 3 26  ? 35.782  12.112  46.000 1.00 26.61 ? 64   PHE P O   1 
ATOM   2451 C  CB  . PHE C 3 26  ? 35.418  14.314  48.233 1.00 26.60 ? 64   PHE P CB  1 
ATOM   2452 C  CG  . PHE C 3 26  ? 34.756  15.347  47.361 1.00 26.17 ? 64   PHE P CG  1 
ATOM   2453 C  CD1 . PHE C 3 26  ? 33.517  15.870  47.697 1.00 25.29 ? 64   PHE P CD1 1 
ATOM   2454 C  CD2 . PHE C 3 26  ? 35.385  15.807  46.206 1.00 26.16 ? 64   PHE P CD2 1 
ATOM   2455 C  CE1 . PHE C 3 26  ? 32.911  16.826  46.896 1.00 25.08 ? 64   PHE P CE1 1 
ATOM   2456 C  CE2 . PHE C 3 26  ? 34.786  16.768  45.403 1.00 25.43 ? 64   PHE P CE2 1 
ATOM   2457 C  CZ  . PHE C 3 26  ? 33.548  17.277  45.751 1.00 25.42 ? 64   PHE P CZ  1 
ATOM   2458 N  N   . HIS C 3 27  ? 33.578  12.607  46.030 1.00 26.57 ? 65   HIS P N   1 
ATOM   2459 C  CA  . HIS C 3 27  ? 33.318  12.229  44.640 1.00 26.36 ? 65   HIS P CA  1 
ATOM   2460 C  C   . HIS C 3 27  ? 32.571  13.341  43.915 1.00 26.00 ? 65   HIS P C   1 
ATOM   2461 O  O   . HIS C 3 27  ? 31.713  14.007  44.491 1.00 25.84 ? 65   HIS P O   1 
ATOM   2462 C  CB  . HIS C 3 27  ? 32.510  10.929  44.575 1.00 26.44 ? 65   HIS P CB  1 
ATOM   2463 C  CG  . HIS C 3 27  ? 33.057  9.836   45.439 1.00 27.25 ? 65   HIS P CG  1 
ATOM   2464 N  ND1 . HIS C 3 27  ? 33.823  8.804   44.940 1.00 28.13 ? 65   HIS P ND1 1 
ATOM   2465 C  CD2 . HIS C 3 27  ? 32.953  9.616   46.771 1.00 27.64 ? 65   HIS P CD2 1 
ATOM   2466 C  CE1 . HIS C 3 27  ? 34.167  7.996   45.927 1.00 28.21 ? 65   HIS P CE1 1 
ATOM   2467 N  NE2 . HIS C 3 27  ? 33.656  8.468   47.049 1.00 28.23 ? 65   HIS P NE2 1 
ATOM   2468 N  N   . ARG C 3 28  ? 32.916  13.543  42.651 1.00 25.86 ? 66   ARG P N   1 
ATOM   2469 C  CA  . ARG C 3 28  ? 32.255  14.544  41.818 1.00 25.76 ? 66   ARG P CA  1 
ATOM   2470 C  C   . ARG C 3 28  ? 32.189  14.037  40.383 1.00 25.63 ? 66   ARG P C   1 
ATOM   2471 O  O   . ARG C 3 28  ? 32.909  13.100  40.016 1.00 25.46 ? 66   ARG P O   1 
ATOM   2472 C  CB  . ARG C 3 28  ? 32.994  15.888  41.892 1.00 25.76 ? 66   ARG P CB  1 
ATOM   2473 C  CG  . ARG C 3 28  ? 34.283  15.935  41.099 1.00 26.26 ? 66   ARG P CG  1 
ATOM   2474 C  CD  . ARG C 3 28  ? 35.009  17.232  41.306 1.00 28.51 ? 66   ARG P CD  1 
ATOM   2475 N  NE  . ARG C 3 28  ? 35.885  17.519  40.172 1.00 30.37 ? 66   ARG P NE  1 
ATOM   2476 C  CZ  . ARG C 3 28  ? 37.013  18.224  40.244 1.00 30.76 ? 66   ARG P CZ  1 
ATOM   2477 N  NH1 . ARG C 3 28  ? 37.433  18.714  41.410 1.00 29.82 ? 66   ARG P NH1 1 
ATOM   2478 N  NH2 . ARG C 3 28  ? 37.729  18.428  39.144 1.00 30.26 ? 66   ARG P NH2 1 
ATOM   2479 N  N   . CYS C 3 29  ? 31.332  14.658  39.575 1.00 25.55 ? 67   CYS P N   1 
ATOM   2480 C  CA  . CYS C 3 29  ? 31.167  14.257  38.181 1.00 25.42 ? 67   CYS P CA  1 
ATOM   2481 C  C   . CYS C 3 29  ? 32.452  14.458  37.378 1.00 25.51 ? 67   CYS P C   1 
ATOM   2482 O  O   . CYS C 3 29  ? 33.109  15.502  37.487 1.00 25.53 ? 67   CYS P O   1 
ATOM   2483 C  CB  . CYS C 3 29  ? 30.008  15.002  37.526 1.00 25.25 ? 67   CYS P CB  1 
ATOM   2484 S  SG  . CYS C 3 29  ? 29.465  14.252  35.986 1.00 25.60 ? 67   CYS P SG  1 
ATOM   2485 N  N   . ALA C 3 30  ? 32.802  13.446  36.583 1.00 25.41 ? 68   ALA P N   1 
ATOM   2486 C  CA  . ALA C 3 30  ? 33.999  13.482  35.746 1.00 25.39 ? 68   ALA P CA  1 
ATOM   2487 C  C   . ALA C 3 30  ? 33.838  14.447  34.582 1.00 25.25 ? 68   ALA P C   1 
ATOM   2488 O  O   . ALA C 3 30  ? 34.828  14.892  34.001 1.00 25.52 ? 68   ALA P O   1 
ATOM   2489 C  CB  . ALA C 3 30  ? 34.346  12.082  35.236 1.00 25.17 ? 68   ALA P CB  1 
ATOM   2490 N  N   . LYS C 3 31  ? 32.585  14.766  34.261 1.00 25.26 ? 69   LYS P N   1 
ATOM   2491 C  CA  A LYS C 3 31  ? 32.261  15.628  33.132 0.50 25.18 ? 69   LYS P CA  1 
ATOM   2492 C  CA  B LYS C 3 31  ? 32.264  15.634  33.131 0.50 25.04 ? 69   LYS P CA  1 
ATOM   2493 C  C   . LYS C 3 31  ? 31.965  17.053  33.601 1.00 24.97 ? 69   LYS P C   1 
ATOM   2494 O  O   . LYS C 3 31  ? 30.887  17.342  34.126 1.00 25.24 ? 69   LYS P O   1 
ATOM   2495 C  CB  A LYS C 3 31  ? 31.101  15.027  32.328 0.50 25.36 ? 69   LYS P CB  1 
ATOM   2496 C  CB  B LYS C 3 31  ? 31.120  15.045  32.288 0.50 25.14 ? 69   LYS P CB  1 
ATOM   2497 C  CG  A LYS C 3 31  ? 31.171  13.499  32.246 0.50 25.77 ? 69   LYS P CG  1 
ATOM   2498 C  CG  B LYS C 3 31  ? 30.405  16.045  31.383 0.50 24.89 ? 69   LYS P CG  1 
ATOM   2499 C  CD  A LYS C 3 31  ? 30.686  12.949  30.913 0.50 26.55 ? 69   LYS P CD  1 
ATOM   2500 C  CD  B LYS C 3 31  ? 30.206  15.527  29.976 0.50 24.73 ? 69   LYS P CD  1 
ATOM   2501 C  CE  A LYS C 3 31  ? 31.253  11.550  30.655 0.50 26.63 ? 69   LYS P CE  1 
ATOM   2502 C  CE  B LYS C 3 31  ? 31.269  16.080  29.046 0.50 24.76 ? 69   LYS P CE  1 
ATOM   2503 N  NZ  A LYS C 3 31  ? 30.930  10.574  31.739 0.50 26.35 ? 69   LYS P NZ  1 
ATOM   2504 N  NZ  B LYS C 3 31  ? 30.833  16.031  27.627 0.50 24.69 ? 69   LYS P NZ  1 
ATOM   2505 N  N   . ASP C 3 32  ? 32.949  17.923  33.411 1.00 24.73 ? 70   ASP P N   1 
ATOM   2506 C  CA  . ASP C 3 32  ? 32.923  19.323  33.836 1.00 24.37 ? 70   ASP P CA  1 
ATOM   2507 C  C   . ASP C 3 32  ? 31.575  20.060  33.742 1.00 23.64 ? 70   ASP P C   1 
ATOM   2508 O  O   . ASP C 3 32  ? 31.128  20.622  34.745 1.00 23.59 ? 70   ASP P O   1 
ATOM   2509 C  CB  . ASP C 3 32  ? 34.023  20.110  33.103 1.00 24.80 ? 70   ASP P CB  1 
ATOM   2510 C  CG  . ASP C 3 32  ? 34.111  21.560  33.554 1.00 25.76 ? 70   ASP P CG  1 
ATOM   2511 O  OD1 . ASP C 3 32  ? 34.435  21.802  34.740 1.00 25.96 ? 70   ASP P OD1 1 
ATOM   2512 O  OD2 . ASP C 3 32  ? 33.870  22.454  32.710 1.00 27.00 ? 70   ASP P OD2 1 
ATOM   2513 N  N   . PRO C 3 33  ? 30.939  20.088  32.546 1.00 22.86 ? 71   PRO P N   1 
ATOM   2514 C  CA  . PRO C 3 33  ? 29.689  20.849  32.440 1.00 22.24 ? 71   PRO P CA  1 
ATOM   2515 C  C   . PRO C 3 33  ? 28.493  20.264  33.202 1.00 21.62 ? 71   PRO P C   1 
ATOM   2516 O  O   . PRO C 3 33  ? 27.487  20.957  33.355 1.00 21.66 ? 71   PRO P O   1 
ATOM   2517 C  CB  . PRO C 3 33  ? 29.400  20.856  30.927 1.00 22.12 ? 71   PRO P CB  1 
ATOM   2518 C  CG  . PRO C 3 33  ? 30.651  20.418  30.278 1.00 22.43 ? 71   PRO P CG  1 
ATOM   2519 C  CD  . PRO C 3 33  ? 31.306  19.498  31.248 1.00 22.82 ? 71   PRO P CD  1 
ATOM   2520 N  N   . TRP C 3 34  ? 28.596  19.021  33.674 1.00 20.71 ? 72   TRP P N   1 
ATOM   2521 C  CA  . TRP C 3 34  ? 27.487  18.392  34.403 1.00 20.05 ? 72   TRP P CA  1 
ATOM   2522 C  C   . TRP C 3 34  ? 27.600  18.550  35.917 1.00 19.77 ? 72   TRP P C   1 
ATOM   2523 O  O   . TRP C 3 34  ? 26.692  18.170  36.650 1.00 19.59 ? 72   TRP P O   1 
ATOM   2524 C  CB  . TRP C 3 34  ? 27.322  16.914  34.022 1.00 19.75 ? 72   TRP P CB  1 
ATOM   2525 C  CG  . TRP C 3 34  ? 27.043  16.692  32.562 1.00 19.59 ? 72   TRP P CG  1 
ATOM   2526 C  CD1 . TRP C 3 34  ? 26.783  17.649  31.618 1.00 19.51 ? 72   TRP P CD1 1 
ATOM   2527 C  CD2 . TRP C 3 34  ? 26.963  15.434  31.886 1.00 19.92 ? 72   TRP P CD2 1 
ATOM   2528 N  NE1 . TRP C 3 34  ? 26.575  17.069  30.398 1.00 18.78 ? 72   TRP P NE1 1 
ATOM   2529 C  CE2 . TRP C 3 34  ? 26.671  15.709  30.529 1.00 19.81 ? 72   TRP P CE2 1 
ATOM   2530 C  CE3 . TRP C 3 34  ? 27.116  14.099  32.290 1.00 19.71 ? 72   TRP P CE3 1 
ATOM   2531 C  CZ2 . TRP C 3 34  ? 26.526  14.696  29.571 1.00 19.72 ? 72   TRP P CZ2 1 
ATOM   2532 C  CZ3 . TRP C 3 34  ? 26.973  13.094  31.340 1.00 19.61 ? 72   TRP P CZ3 1 
ATOM   2533 C  CH2 . TRP C 3 34  ? 26.682  13.400  29.994 1.00 19.93 ? 72   TRP P CH2 1 
ATOM   2534 N  N   . ARG C 3 35  ? 28.713  19.120  36.368 1.00 19.50 ? 73   ARG P N   1 
ATOM   2535 C  CA  . ARG C 3 35  ? 28.971  19.345  37.787 1.00 19.28 ? 73   ARG P CA  1 
ATOM   2536 C  C   . ARG C 3 35  ? 28.081  20.450  38.334 1.00 19.36 ? 73   ARG P C   1 
ATOM   2537 O  O   . ARG C 3 35  ? 27.850  21.458  37.667 1.00 19.56 ? 73   ARG P O   1 
ATOM   2538 C  CB  . ARG C 3 35  ? 30.435  19.730  38.015 1.00 19.19 ? 73   ARG P CB  1 
ATOM   2539 C  CG  . ARG C 3 35  ? 31.457  18.618  37.777 1.00 18.12 ? 73   ARG P CG  1 
ATOM   2540 C  CD  . ARG C 3 35  ? 32.842  19.100  38.172 1.00 17.12 ? 73   ARG P CD  1 
ATOM   2541 N  NE  . ARG C 3 35  ? 32.811  19.790  39.464 1.00 15.82 ? 73   ARG P NE  1 
ATOM   2542 C  CZ  . ARG C 3 35  ? 33.728  20.651  39.900 1.00 16.56 ? 73   ARG P CZ  1 
ATOM   2543 N  NH1 . ARG C 3 35  ? 33.581  21.212  41.097 1.00 15.73 ? 73   ARG P NH1 1 
ATOM   2544 N  NH2 . ARG C 3 35  ? 34.790  20.956  39.154 1.00 15.44 ? 73   ARG P NH2 1 
ATOM   2545 N  N   . LEU C 3 36  ? 27.582  20.246  39.549 1.00 19.40 ? 74   LEU P N   1 
ATOM   2546 C  CA  . LEU C 3 36  ? 26.803  21.258  40.266 1.00 19.28 ? 74   LEU P CA  1 
ATOM   2547 C  C   . LEU C 3 36  ? 27.449  21.523  41.623 1.00 19.12 ? 74   LEU P C   1 
ATOM   2548 O  O   . LEU C 3 36  ? 27.010  20.975  42.635 1.00 19.01 ? 74   LEU P O   1 
ATOM   2549 C  CB  . LEU C 3 36  ? 25.351  20.813  40.451 1.00 18.86 ? 74   LEU P CB  1 
ATOM   2550 C  CG  . LEU C 3 36  ? 24.529  20.594  39.186 1.00 19.31 ? 74   LEU P CG  1 
ATOM   2551 C  CD1 . LEU C 3 36  ? 23.245  19.858  39.511 1.00 17.46 ? 74   LEU P CD1 1 
ATOM   2552 C  CD2 . LEU C 3 36  ? 24.247  21.917  38.473 1.00 18.87 ? 74   LEU P CD2 1 
ATOM   2553 N  N   . PRO C 3 37  ? 28.512  22.354  41.639 1.00 19.15 ? 75   PRO P N   1 
ATOM   2554 C  CA  . PRO C 3 37  ? 29.245  22.661  42.867 1.00 18.94 ? 75   PRO P CA  1 
ATOM   2555 C  C   . PRO C 3 37  ? 28.389  23.391  43.900 1.00 18.91 ? 75   PRO P C   1 
ATOM   2556 O  O   . PRO C 3 37  ? 27.453  24.101  43.542 1.00 18.98 ? 75   PRO P O   1 
ATOM   2557 C  CB  . PRO C 3 37  ? 30.378  23.571  42.375 1.00 18.59 ? 75   PRO P CB  1 
ATOM   2558 C  CG  . PRO C 3 37  ? 30.506  23.282  40.935 1.00 18.59 ? 75   PRO P CG  1 
ATOM   2559 C  CD  . PRO C 3 37  ? 29.106  23.046  40.481 1.00 18.84 ? 75   PRO P CD  1 
ATOM   2560 N  N   . GLY C 3 38  ? 28.710  23.202  45.174 1.00 19.07 ? 76   GLY P N   1 
ATOM   2561 C  CA  . GLY C 3 38  ? 28.013  23.894  46.242 1.00 19.28 ? 76   GLY P CA  1 
ATOM   2562 C  C   . GLY C 3 38  ? 26.896  23.106  46.887 1.00 19.51 ? 76   GLY P C   1 
ATOM   2563 O  O   . GLY C 3 38  ? 26.426  23.472  47.962 1.00 19.86 ? 76   GLY P O   1 
ATOM   2564 N  N   . THR C 3 39  ? 26.471  22.029  46.232 1.00 19.70 ? 77   THR P N   1 
ATOM   2565 C  CA  . THR C 3 39  ? 25.468  21.120  46.785 1.00 20.01 ? 77   THR P CA  1 
ATOM   2566 C  C   . THR C 3 39  ? 26.049  19.707  46.873 1.00 20.16 ? 77   THR P C   1 
ATOM   2567 O  O   . THR C 3 39  ? 26.628  19.197  45.910 1.00 20.08 ? 77   THR P O   1 
ATOM   2568 C  CB  . THR C 3 39  ? 24.156  21.144  45.965 1.00 20.14 ? 77   THR P CB  1 
ATOM   2569 O  OG1 . THR C 3 39  ? 23.654  22.485  45.911 1.00 20.48 ? 77   THR P OG1 1 
ATOM   2570 C  CG2 . THR C 3 39  ? 23.088  20.236  46.593 1.00 19.72 ? 77   THR P CG2 1 
ATOM   2571 N  N   . TYR C 3 40  ? 25.904  19.091  48.043 1.00 20.20 ? 78   TYR P N   1 
ATOM   2572 C  CA  . TYR C 3 40  ? 26.555  17.818  48.324 1.00 20.30 ? 78   TYR P CA  1 
ATOM   2573 C  C   . TYR C 3 40  ? 25.612  16.825  49.003 1.00 20.53 ? 78   TYR P C   1 
ATOM   2574 O  O   . TYR C 3 40  ? 24.821  17.196  49.879 1.00 20.60 ? 78   TYR P O   1 
ATOM   2575 C  CB  . TYR C 3 40  ? 27.813  18.041  49.184 1.00 20.13 ? 78   TYR P CB  1 
ATOM   2576 C  CG  . TYR C 3 40  ? 28.718  19.124  48.638 1.00 19.88 ? 78   TYR P CG  1 
ATOM   2577 C  CD1 . TYR C 3 40  ? 29.679  18.833  47.668 1.00 19.42 ? 78   TYR P CD1 1 
ATOM   2578 C  CD2 . TYR C 3 40  ? 28.590  20.450  49.066 1.00 19.59 ? 78   TYR P CD2 1 
ATOM   2579 C  CE1 . TYR C 3 40  ? 30.493  19.831  47.147 1.00 19.37 ? 78   TYR P CE1 1 
ATOM   2580 C  CE2 . TYR C 3 40  ? 29.402  21.453  48.552 1.00 18.34 ? 78   TYR P CE2 1 
ATOM   2581 C  CZ  . TYR C 3 40  ? 30.346  21.139  47.593 1.00 19.31 ? 78   TYR P CZ  1 
ATOM   2582 O  OH  . TYR C 3 40  ? 31.149  22.131  47.077 1.00 20.12 ? 78   TYR P OH  1 
ATOM   2583 N  N   . VAL C 3 41  ? 25.696  15.569  48.576 1.00 20.50 ? 79   VAL P N   1 
ATOM   2584 C  CA  . VAL C 3 41  ? 25.028  14.472  49.260 1.00 20.59 ? 79   VAL P CA  1 
ATOM   2585 C  C   . VAL C 3 41  ? 26.039  13.860  50.222 1.00 20.86 ? 79   VAL P C   1 
ATOM   2586 O  O   . VAL C 3 41  ? 27.046  13.276  49.800 1.00 20.81 ? 79   VAL P O   1 
ATOM   2587 C  CB  . VAL C 3 41  ? 24.495  13.388  48.274 1.00 20.52 ? 79   VAL P CB  1 
ATOM   2588 C  CG1 . VAL C 3 41  ? 23.626  12.379  49.008 1.00 20.19 ? 79   VAL P CG1 1 
ATOM   2589 C  CG2 . VAL C 3 41  ? 23.708  14.023  47.128 1.00 20.87 ? 79   VAL P CG2 1 
ATOM   2590 N  N   . VAL C 3 42  ? 25.785  14.029  51.517 1.00 21.46 ? 80   VAL P N   1 
ATOM   2591 C  CA  . VAL C 3 42  ? 26.622  13.421  52.551 1.00 21.64 ? 80   VAL P CA  1 
ATOM   2592 C  C   . VAL C 3 42  ? 26.035  12.047  52.855 1.00 22.31 ? 80   VAL P C   1 
ATOM   2593 O  O   . VAL C 3 42  ? 24.925  11.938  53.379 1.00 22.38 ? 80   VAL P O   1 
ATOM   2594 C  CB  . VAL C 3 42  ? 26.730  14.308  53.835 1.00 21.55 ? 80   VAL P CB  1 
ATOM   2595 C  CG1 . VAL C 3 42  ? 27.657  13.672  54.862 1.00 20.53 ? 80   VAL P CG1 1 
ATOM   2596 C  CG2 . VAL C 3 42  ? 27.203  15.723  53.482 1.00 20.28 ? 80   VAL P CG2 1 
ATOM   2597 N  N   . VAL C 3 43  ? 26.768  11.004  52.481 1.00 22.92 ? 81   VAL P N   1 
ATOM   2598 C  CA  . VAL C 3 43  ? 26.308  9.635   52.685 1.00 23.54 ? 81   VAL P CA  1 
ATOM   2599 C  C   . VAL C 3 43  ? 26.981  9.046   53.912 1.00 24.13 ? 81   VAL P C   1 
ATOM   2600 O  O   . VAL C 3 43  ? 28.207  8.978   53.990 1.00 24.44 ? 81   VAL P O   1 
ATOM   2601 C  CB  . VAL C 3 43  ? 26.543  8.730   51.442 1.00 23.35 ? 81   VAL P CB  1 
ATOM   2602 C  CG1 . VAL C 3 43  ? 26.058  7.312   51.711 1.00 23.12 ? 81   VAL P CG1 1 
ATOM   2603 C  CG2 . VAL C 3 43  ? 25.828  9.293   50.232 1.00 23.13 ? 81   VAL P CG2 1 
ATOM   2604 N  N   . LEU C 3 44  ? 26.161  8.627   54.868 1.00 24.69 ? 82   LEU P N   1 
ATOM   2605 C  CA  . LEU C 3 44  ? 26.651  8.052   56.103 1.00 25.35 ? 82   LEU P CA  1 
ATOM   2606 C  C   . LEU C 3 44  ? 26.682  6.532   56.007 1.00 26.14 ? 82   LEU P C   1 
ATOM   2607 O  O   . LEU C 3 44  ? 26.059  5.940   55.123 1.00 26.25 ? 82   LEU P O   1 
ATOM   2608 C  CB  . LEU C 3 44  ? 25.786  8.516   57.281 1.00 25.25 ? 82   LEU P CB  1 
ATOM   2609 C  CG  . LEU C 3 44  ? 25.525  10.023  57.400 1.00 24.71 ? 82   LEU P CG  1 
ATOM   2610 C  CD1 . LEU C 3 44  ? 24.515  10.266  58.472 1.00 24.58 ? 82   LEU P CD1 1 
ATOM   2611 C  CD2 . LEU C 3 44  ? 26.793  10.832  57.674 1.00 23.83 ? 82   LEU P CD2 1 
ATOM   2612 N  N   . LYS C 3 45  ? 27.420  5.905   56.915 1.00 27.10 ? 83   LYS P N   1 
ATOM   2613 C  CA  . LYS C 3 45  ? 27.573  4.457   56.917 1.00 28.00 ? 83   LYS P CA  1 
ATOM   2614 C  C   . LYS C 3 45  ? 26.231  3.733   57.076 1.00 28.82 ? 83   LYS P C   1 
ATOM   2615 O  O   . LYS C 3 45  ? 25.284  4.272   57.656 1.00 28.89 ? 83   LYS P O   1 
ATOM   2616 C  CB  . LYS C 3 45  ? 28.576  4.037   57.987 1.00 28.00 ? 83   LYS P CB  1 
ATOM   2617 C  CG  . LYS C 3 45  ? 30.001  4.469   57.681 1.00 28.31 ? 83   LYS P CG  1 
ATOM   2618 C  CD  . LYS C 3 45  ? 30.871  4.359   58.910 1.00 30.46 ? 83   LYS P CD  1 
ATOM   2619 C  CE  . LYS C 3 45  ? 32.292  4.812   58.623 1.00 31.91 ? 83   LYS P CE  1 
ATOM   2620 N  NZ  . LYS C 3 45  ? 33.183  4.590   59.808 1.00 32.72 ? 83   LYS P NZ  1 
ATOM   2621 N  N   . GLU C 3 46  ? 26.175  2.509   56.552 1.00 29.78 ? 84   GLU P N   1 
ATOM   2622 C  CA  . GLU C 3 46  ? 24.932  1.757   56.342 1.00 30.70 ? 84   GLU P CA  1 
ATOM   2623 C  C   . GLU C 3 46  ? 23.934  1.745   57.511 1.00 31.06 ? 84   GLU P C   1 
ATOM   2624 O  O   . GLU C 3 46  ? 22.737  1.983   57.309 1.00 31.36 ? 84   GLU P O   1 
ATOM   2625 C  CB  . GLU C 3 46  ? 25.263  0.318   55.928 1.00 30.95 ? 84   GLU P CB  1 
ATOM   2626 C  CG  . GLU C 3 46  ? 24.191  -0.356  55.079 1.00 31.99 ? 84   GLU P CG  1 
ATOM   2627 C  CD  . GLU C 3 46  ? 24.135  -1.864  55.279 1.00 33.76 ? 84   GLU P CD  1 
ATOM   2628 O  OE1 . GLU C 3 46  ? 24.934  -2.403  56.081 1.00 34.10 ? 84   GLU P OE1 1 
ATOM   2629 O  OE2 . GLU C 3 46  ? 23.276  -2.512  54.638 1.00 34.57 ? 84   GLU P OE2 1 
ATOM   2630 N  N   . GLU C 3 47  ? 24.413  1.464   58.720 1.00 31.21 ? 85   GLU P N   1 
ATOM   2631 C  CA  . GLU C 3 47  ? 23.504  1.264   59.854 1.00 31.70 ? 85   GLU P CA  1 
ATOM   2632 C  C   . GLU C 3 47  ? 23.268  2.499   60.730 1.00 31.29 ? 85   GLU P C   1 
ATOM   2633 O  O   . GLU C 3 47  ? 22.820  2.377   61.873 1.00 31.36 ? 85   GLU P O   1 
ATOM   2634 C  CB  . GLU C 3 47  ? 23.949  0.061   60.696 1.00 31.71 ? 85   GLU P CB  1 
ATOM   2635 C  CG  . GLU C 3 47  ? 23.606  -1.277  60.050 1.00 32.63 ? 85   GLU P CG  1 
ATOM   2636 C  CD  . GLU C 3 47  ? 24.034  -2.470  60.884 1.00 33.14 ? 85   GLU P CD  1 
ATOM   2637 O  OE1 . GLU C 3 47  ? 24.783  -3.320  60.351 1.00 35.69 ? 85   GLU P OE1 1 
ATOM   2638 O  OE2 . GLU C 3 47  ? 23.624  -2.565  62.065 1.00 34.79 ? 85   GLU P OE2 1 
ATOM   2639 N  N   . THR C 3 48  ? 23.546  3.681   60.174 1.00 30.90 ? 86   THR P N   1 
ATOM   2640 C  CA  . THR C 3 48  ? 23.331  4.956   60.858 1.00 30.26 ? 86   THR P CA  1 
ATOM   2641 C  C   . THR C 3 48  ? 21.837  5.262   60.980 1.00 30.11 ? 86   THR P C   1 
ATOM   2642 O  O   . THR C 3 48  ? 21.114  5.268   59.982 1.00 30.12 ? 86   THR P O   1 
ATOM   2643 C  CB  . THR C 3 48  ? 24.055  6.116   60.127 1.00 30.17 ? 86   THR P CB  1 
ATOM   2644 O  OG1 . THR C 3 48  ? 25.432  5.778   59.929 1.00 29.79 ? 86   THR P OG1 1 
ATOM   2645 C  CG2 . THR C 3 48  ? 23.984  7.398   60.931 1.00 29.73 ? 86   THR P CG2 1 
ATOM   2646 N  N   . HIS C 3 49  ? 21.387  5.506   62.209 1.00 29.86 ? 87   HIS P N   1 
ATOM   2647 C  CA  . HIS C 3 49  ? 19.984  5.827   62.484 1.00 29.71 ? 87   HIS P CA  1 
ATOM   2648 C  C   . HIS C 3 49  ? 19.648  7.275   62.122 1.00 29.12 ? 87   HIS P C   1 
ATOM   2649 O  O   . HIS C 3 49  ? 20.539  8.123   62.034 1.00 29.07 ? 87   HIS P O   1 
ATOM   2650 C  CB  . HIS C 3 49  ? 19.650  5.567   63.958 1.00 30.05 ? 87   HIS P CB  1 
ATOM   2651 C  CG  . HIS C 3 49  ? 19.796  4.135   64.374 1.00 31.48 ? 87   HIS P CG  1 
ATOM   2652 N  ND1 . HIS C 3 49  ? 20.654  3.734   65.376 1.00 32.90 ? 87   HIS P ND1 1 
ATOM   2653 C  CD2 . HIS C 3 49  ? 19.192  3.007   63.924 1.00 32.58 ? 87   HIS P CD2 1 
ATOM   2654 C  CE1 . HIS C 3 49  ? 20.569  2.424   65.529 1.00 33.38 ? 87   HIS P CE1 1 
ATOM   2655 N  NE2 . HIS C 3 49  ? 19.691  1.958   64.658 1.00 33.08 ? 87   HIS P NE2 1 
ATOM   2656 N  N   . LEU C 3 50  ? 18.359  7.552   61.925 1.00 28.42 ? 88   LEU P N   1 
ATOM   2657 C  CA  . LEU C 3 50  ? 17.885  8.895   61.580 1.00 27.87 ? 88   LEU P CA  1 
ATOM   2658 C  C   . LEU C 3 50  ? 18.359  9.985   62.551 1.00 27.66 ? 88   LEU P C   1 
ATOM   2659 O  O   . LEU C 3 50  ? 18.750  11.074  62.124 1.00 27.68 ? 88   LEU P O   1 
ATOM   2660 C  CB  . LEU C 3 50  ? 16.353  8.918   61.457 1.00 27.81 ? 88   LEU P CB  1 
ATOM   2661 C  CG  . LEU C 3 50  ? 15.680  10.263  61.136 1.00 27.73 ? 88   LEU P CG  1 
ATOM   2662 C  CD1 . LEU C 3 50  ? 16.172  10.844  59.801 1.00 26.98 ? 88   LEU P CD1 1 
ATOM   2663 C  CD2 . LEU C 3 50  ? 14.163  10.147  61.161 1.00 27.43 ? 88   LEU P CD2 1 
ATOM   2664 N  N   . SER C 3 51  ? 18.315  9.687   63.847 1.00 27.50 ? 89   SER P N   1 
ATOM   2665 C  CA  . SER C 3 51  ? 18.712  10.635  64.890 1.00 27.23 ? 89   SER P CA  1 
ATOM   2666 C  C   . SER C 3 51  ? 20.209  10.932  64.862 1.00 27.18 ? 89   SER P C   1 
ATOM   2667 O  O   . SER C 3 51  ? 20.631  12.048  65.181 1.00 27.26 ? 89   SER P O   1 
ATOM   2668 C  CB  . SER C 3 51  ? 18.308  10.109  66.268 1.00 27.20 ? 89   SER P CB  1 
ATOM   2669 O  OG  . SER C 3 51  ? 18.789  8.789   66.465 1.00 27.22 ? 89   SER P OG  1 
ATOM   2670 N  N   . GLN C 3 52  ? 20.999  9.924   64.493 1.00 27.09 ? 90   GLN P N   1 
ATOM   2671 C  CA  . GLN C 3 52  ? 22.444  10.070  64.303 1.00 27.11 ? 90   GLN P CA  1 
ATOM   2672 C  C   . GLN C 3 52  ? 22.752  10.937  63.088 1.00 26.79 ? 90   GLN P C   1 
ATOM   2673 O  O   . GLN C 3 52  ? 23.730  11.688  63.090 1.00 27.19 ? 90   GLN P O   1 
ATOM   2674 C  CB  . GLN C 3 52  ? 23.116  8.701   64.163 1.00 27.09 ? 90   GLN P CB  1 
ATOM   2675 C  CG  . GLN C 3 52  ? 23.096  7.863   65.438 1.00 27.46 ? 90   GLN P CG  1 
ATOM   2676 C  CD  . GLN C 3 52  ? 23.818  6.529   65.288 1.00 27.78 ? 90   GLN P CD  1 
ATOM   2677 O  OE1 . GLN C 3 52  ? 23.447  5.694   64.459 1.00 28.96 ? 90   GLN P OE1 1 
ATOM   2678 N  NE2 . GLN C 3 52  ? 24.843  6.317   66.108 1.00 27.86 ? 90   GLN P NE2 1 
ATOM   2679 N  N   . SER C 3 53  ? 21.906  10.828  62.063 1.00 26.50 ? 91   SER P N   1 
ATOM   2680 C  CA  A SER C 3 53  ? 22.033  11.633  60.850 0.50 26.37 ? 91   SER P CA  1 
ATOM   2681 C  CA  B SER C 3 53  ? 22.030  11.628  60.850 0.50 26.28 ? 91   SER P CA  1 
ATOM   2682 C  C   . SER C 3 53  ? 21.713  13.094  61.123 1.00 26.26 ? 91   SER P C   1 
ATOM   2683 O  O   . SER C 3 53  ? 22.390  13.991  60.612 1.00 26.28 ? 91   SER P O   1 
ATOM   2684 C  CB  A SER C 3 53  ? 21.115  11.106  59.744 0.50 26.33 ? 91   SER P CB  1 
ATOM   2685 C  CB  B SER C 3 53  ? 21.108  11.081  59.756 0.50 26.23 ? 91   SER P CB  1 
ATOM   2686 O  OG  A SER C 3 53  ? 21.428  9.768   59.409 0.50 26.36 ? 91   SER P OG  1 
ATOM   2687 O  OG  B SER C 3 53  ? 21.122  11.904  58.605 0.50 25.71 ? 91   SER P OG  1 
ATOM   2688 N  N   . GLU C 3 54  ? 20.678  13.323  61.927 1.00 26.18 ? 92   GLU P N   1 
ATOM   2689 C  CA  . GLU C 3 54  ? 20.249  14.673  62.295 1.00 26.08 ? 92   GLU P CA  1 
ATOM   2690 C  C   . GLU C 3 54  ? 21.272  15.373  63.186 1.00 25.77 ? 92   GLU P C   1 
ATOM   2691 O  O   . GLU C 3 54  ? 21.548  16.561  62.996 1.00 25.80 ? 92   GLU P O   1 
ATOM   2692 C  CB  . GLU C 3 54  ? 18.872  14.628  62.957 1.00 26.09 ? 92   GLU P CB  1 
ATOM   2693 C  CG  . GLU C 3 54  ? 17.749  14.385  61.956 1.00 26.68 ? 92   GLU P CG  1 
ATOM   2694 C  CD  . GLU C 3 54  ? 16.477  13.842  62.580 1.00 28.17 ? 92   GLU P CD  1 
ATOM   2695 O  OE1 . GLU C 3 54  ? 16.504  13.399  63.753 1.00 28.35 ? 92   GLU P OE1 1 
ATOM   2696 O  OE2 . GLU C 3 54  ? 15.439  13.846  61.878 1.00 29.51 ? 92   GLU P OE2 1 
ATOM   2697 N  N   . ARG C 3 55  ? 21.841  14.620  64.132 1.00 25.51 ? 93   ARG P N   1 
ATOM   2698 C  CA  A ARG C 3 55  ? 22.881  15.135  65.023 0.50 25.47 ? 93   ARG P CA  1 
ATOM   2699 C  CA  B ARG C 3 55  ? 22.881  15.127  65.028 0.50 25.34 ? 93   ARG P CA  1 
ATOM   2700 C  C   . ARG C 3 55  ? 24.149  15.512  64.259 1.00 25.26 ? 93   ARG P C   1 
ATOM   2701 O  O   . ARG C 3 55  ? 24.811  16.497  64.603 1.00 25.32 ? 93   ARG P O   1 
ATOM   2702 C  CB  A ARG C 3 55  ? 23.213  14.121  66.121 0.50 25.46 ? 93   ARG P CB  1 
ATOM   2703 C  CB  B ARG C 3 55  ? 23.201  14.095  66.120 0.50 25.30 ? 93   ARG P CB  1 
ATOM   2704 C  CG  A ARG C 3 55  ? 22.213  14.085  67.267 0.50 25.84 ? 93   ARG P CG  1 
ATOM   2705 C  CG  B ARG C 3 55  ? 24.149  14.591  67.210 0.50 25.21 ? 93   ARG P CG  1 
ATOM   2706 C  CD  A ARG C 3 55  ? 22.351  12.789  68.047 0.50 26.19 ? 93   ARG P CD  1 
ATOM   2707 C  CD  B ARG C 3 55  ? 24.368  13.542  68.289 0.50 25.20 ? 93   ARG P CD  1 
ATOM   2708 N  NE  A ARG C 3 55  ? 21.181  12.491  68.870 0.50 26.19 ? 93   ARG P NE  1 
ATOM   2709 N  NE  B ARG C 3 55  ? 25.647  13.724  68.976 0.50 24.56 ? 93   ARG P NE  1 
ATOM   2710 C  CZ  A ARG C 3 55  ? 20.756  11.261  69.154 0.50 26.27 ? 93   ARG P CZ  1 
ATOM   2711 C  CZ  B ARG C 3 55  ? 26.082  12.969  69.983 0.50 24.06 ? 93   ARG P CZ  1 
ATOM   2712 N  NH1 A ARG C 3 55  ? 21.390  10.200  68.668 0.50 25.94 ? 93   ARG P NH1 1 
ATOM   2713 N  NH1 B ARG C 3 55  ? 25.343  11.967  70.442 0.50 24.00 ? 93   ARG P NH1 1 
ATOM   2714 N  NH2 A ARG C 3 55  ? 19.685  11.088  69.916 0.50 26.39 ? 93   ARG P NH2 1 
ATOM   2715 N  NH2 B ARG C 3 55  ? 27.264  13.215  70.532 0.50 23.18 ? 93   ARG P NH2 1 
ATOM   2716 N  N   . THR C 3 56  ? 24.476  14.728  63.228 1.00 25.01 ? 94   THR P N   1 
ATOM   2717 C  CA  . THR C 3 56  ? 25.646  14.964  62.369 1.00 24.81 ? 94   THR P CA  1 
ATOM   2718 C  C   . THR C 3 56  ? 25.456  16.222  61.511 1.00 24.87 ? 94   THR P C   1 
ATOM   2719 O  O   . THR C 3 56  ? 26.389  17.003  61.332 1.00 24.77 ? 94   THR P O   1 
ATOM   2720 C  CB  . THR C 3 56  ? 25.945  13.726  61.472 1.00 24.90 ? 94   THR P CB  1 
ATOM   2721 O  OG1 . THR C 3 56  ? 26.211  12.587  62.297 1.00 24.93 ? 94   THR P OG1 1 
ATOM   2722 C  CG2 . THR C 3 56  ? 27.149  13.956  60.549 1.00 24.39 ? 94   THR P CG2 1 
ATOM   2723 N  N   . ALA C 3 57  ? 24.243  16.408  60.991 1.00 25.00 ? 95   ALA P N   1 
ATOM   2724 C  CA  . ALA C 3 57  ? 23.878  17.612  60.238 1.00 25.07 ? 95   ALA P CA  1 
ATOM   2725 C  C   . ALA C 3 57  ? 23.949  18.863  61.117 1.00 25.15 ? 95   ALA P C   1 
ATOM   2726 O  O   . ALA C 3 57  ? 24.477  19.890  60.694 1.00 25.53 ? 95   ALA P O   1 
ATOM   2727 C  CB  . ALA C 3 57  ? 22.489  17.466  59.615 1.00 24.72 ? 95   ALA P CB  1 
ATOM   2728 N  N   . ARG C 3 58  ? 23.429  18.761  62.338 1.00 25.08 ? 96   ARG P N   1 
ATOM   2729 C  CA  . ARG C 3 58  ? 23.496  19.846  63.317 1.00 25.22 ? 96   ARG P CA  1 
ATOM   2730 C  C   . ARG C 3 58  ? 24.925  20.224  63.721 1.00 24.91 ? 96   ARG P C   1 
ATOM   2731 O  O   . ARG C 3 58  ? 25.229  21.405  63.936 1.00 24.84 ? 96   ARG P O   1 
ATOM   2732 C  CB  . ARG C 3 58  ? 22.663  19.502  64.548 1.00 25.26 ? 96   ARG P CB  1 
ATOM   2733 C  CG  . ARG C 3 58  ? 21.271  20.110  64.507 1.00 26.61 ? 96   ARG P CG  1 
ATOM   2734 C  CD  . ARG C 3 58  ? 20.217  19.152  65.008 1.00 28.67 ? 96   ARG P CD  1 
ATOM   2735 N  NE  . ARG C 3 58  ? 20.525  18.599  66.326 1.00 29.70 ? 96   ARG P NE  1 
ATOM   2736 C  CZ  . ARG C 3 58  ? 19.996  17.474  66.801 1.00 30.46 ? 96   ARG P CZ  1 
ATOM   2737 N  NH1 . ARG C 3 58  ? 19.133  16.777  66.069 1.00 30.54 ? 96   ARG P NH1 1 
ATOM   2738 N  NH2 . ARG C 3 58  ? 20.336  17.040  68.006 1.00 31.45 ? 96   ARG P NH2 1 
ATOM   2739 N  N   . ARG C 3 59  ? 25.789  19.215  63.809 1.00 24.40 ? 97   ARG P N   1 
ATOM   2740 C  CA  . ARG C 3 59  ? 27.204  19.409  64.095 1.00 24.00 ? 97   ARG P CA  1 
ATOM   2741 C  C   . ARG C 3 59  ? 27.884  20.161  62.959 1.00 23.80 ? 97   ARG P C   1 
ATOM   2742 O  O   . ARG C 3 59  ? 28.658  21.088  63.205 1.00 23.90 ? 97   ARG P O   1 
ATOM   2743 C  CB  . ARG C 3 59  ? 27.878  18.058  64.336 1.00 23.98 ? 97   ARG P CB  1 
ATOM   2744 C  CG  . ARG C 3 59  ? 29.360  18.119  64.672 1.00 23.82 ? 97   ARG P CG  1 
ATOM   2745 C  CD  . ARG C 3 59  ? 29.592  17.301  65.912 1.00 24.90 ? 97   ARG P CD  1 
ATOM   2746 N  NE  . ARG C 3 59  ? 30.584  16.251  65.744 1.00 25.29 ? 97   ARG P NE  1 
ATOM   2747 C  CZ  . ARG C 3 59  ? 30.826  15.307  66.651 1.00 24.03 ? 97   ARG P CZ  1 
ATOM   2748 N  NH1 . ARG C 3 59  ? 30.150  15.285  67.796 1.00 22.38 ? 97   ARG P NH1 1 
ATOM   2749 N  NH2 . ARG C 3 59  ? 31.748  14.384  66.409 1.00 23.02 ? 97   ARG P NH2 1 
ATOM   2750 N  N   . LEU C 3 60  ? 27.588  19.757  61.723 1.00 23.33 ? 98   LEU P N   1 
ATOM   2751 C  CA  . LEU C 3 60  ? 28.097  20.434  60.530 1.00 23.04 ? 98   LEU P CA  1 
ATOM   2752 C  C   . LEU C 3 60  ? 27.725  21.909  60.548 1.00 22.49 ? 98   LEU P C   1 
ATOM   2753 O  O   . LEU C 3 60  ? 28.592  22.764  60.369 1.00 22.92 ? 98   LEU P O   1 
ATOM   2754 C  CB  . LEU C 3 60  ? 27.596  19.738  59.250 1.00 23.11 ? 98   LEU P CB  1 
ATOM   2755 C  CG  . LEU C 3 60  ? 27.609  20.350  57.838 1.00 23.13 ? 98   LEU P CG  1 
ATOM   2756 C  CD1 . LEU C 3 60  ? 28.821  21.205  57.547 1.00 25.73 ? 98   LEU P CD1 1 
ATOM   2757 C  CD2 . LEU C 3 60  ? 27.519  19.240  56.810 1.00 23.60 ? 98   LEU P CD2 1 
ATOM   2758 N  N   . GLN C 3 61  ? 26.447  22.202  60.780 1.00 21.83 ? 99   GLN P N   1 
ATOM   2759 C  CA  . GLN C 3 61  ? 25.959  23.581  60.824 1.00 21.46 ? 99   GLN P CA  1 
ATOM   2760 C  C   . GLN C 3 61  ? 26.614  24.391  61.941 1.00 21.06 ? 99   GLN P C   1 
ATOM   2761 O  O   . GLN C 3 61  ? 26.979  25.556  61.735 1.00 20.98 ? 99   GLN P O   1 
ATOM   2762 C  CB  . GLN C 3 61  ? 24.432  23.618  60.970 1.00 21.61 ? 99   GLN P CB  1 
ATOM   2763 C  CG  . GLN C 3 61  ? 23.676  23.061  59.773 1.00 22.24 ? 99   GLN P CG  1 
ATOM   2764 C  CD  . GLN C 3 61  ? 22.206  23.426  59.801 1.00 23.93 ? 99   GLN P CD  1 
ATOM   2765 O  OE1 . GLN C 3 61  ? 21.433  22.877  60.585 1.00 24.39 ? 99   GLN P OE1 1 
ATOM   2766 N  NE2 . GLN C 3 61  ? 21.811  24.356  58.936 1.00 24.35 ? 99   GLN P NE2 1 
ATOM   2767 N  N   . ALA C 3 62  ? 26.769  23.765  63.109 1.00 20.50 ? 100  ALA P N   1 
ATOM   2768 C  CA  . ALA C 3 62  ? 27.378  24.404  64.282 1.00 20.15 ? 100  ALA P CA  1 
ATOM   2769 C  C   . ALA C 3 62  ? 28.867  24.656  64.094 1.00 19.89 ? 100  ALA P C   1 
ATOM   2770 O  O   . ALA C 3 62  ? 29.333  25.764  64.347 1.00 19.88 ? 100  ALA P O   1 
ATOM   2771 C  CB  . ALA C 3 62  ? 27.128  23.578  65.553 1.00 20.05 ? 100  ALA P CB  1 
ATOM   2772 N  N   . GLN C 3 63  ? 29.602  23.630  63.654 1.00 19.52 ? 101  GLN P N   1 
ATOM   2773 C  CA  . GLN C 3 63  ? 31.035  23.752  63.363 1.00 19.21 ? 101  GLN P CA  1 
ATOM   2774 C  C   . GLN C 3 63  ? 31.302  24.818  62.304 1.00 19.13 ? 101  GLN P C   1 
ATOM   2775 O  O   . GLN C 3 63  ? 32.242  25.598  62.434 1.00 19.16 ? 101  GLN P O   1 
ATOM   2776 C  CB  . GLN C 3 63  ? 31.632  22.418  62.902 1.00 19.17 ? 101  GLN P CB  1 
ATOM   2777 C  CG  . GLN C 3 63  ? 31.829  21.379  63.998 1.00 19.06 ? 101  GLN P CG  1 
ATOM   2778 C  CD  . GLN C 3 63  ? 32.423  20.075  63.487 1.00 19.16 ? 101  GLN P CD  1 
ATOM   2779 O  OE1 . GLN C 3 63  ? 32.336  19.757  62.302 1.00 18.97 ? 101  GLN P OE1 1 
ATOM   2780 N  NE2 . GLN C 3 63  ? 33.027  19.310  64.387 1.00 18.26 ? 101  GLN P NE2 1 
ATOM   2781 N  N   . ALA C 3 64  ? 30.465  24.842  61.267 1.00 19.20 ? 102  ALA P N   1 
ATOM   2782 C  CA  . ALA C 3 64  ? 30.584  25.799  60.161 1.00 19.15 ? 102  ALA P CA  1 
ATOM   2783 C  C   . ALA C 3 64  ? 30.262  27.240  60.549 1.00 19.06 ? 102  ALA P C   1 
ATOM   2784 O  O   . ALA C 3 64  ? 31.015  28.144  60.201 1.00 19.46 ? 102  ALA P O   1 
ATOM   2785 C  CB  . ALA C 3 64  ? 29.723  25.361  58.971 1.00 18.97 ? 102  ALA P CB  1 
ATOM   2786 N  N   . ALA C 3 65  ? 29.144  27.453  61.247 1.00 19.17 ? 103  ALA P N   1 
ATOM   2787 C  CA  . ALA C 3 65  ? 28.734  28.798  61.693 1.00 19.11 ? 103  ALA P CA  1 
ATOM   2788 C  C   . ALA C 3 65  ? 29.778  29.444  62.598 1.00 19.20 ? 103  ALA P C   1 
ATOM   2789 O  O   . ALA C 3 65  ? 30.033  30.647  62.497 1.00 19.37 ? 103  ALA P O   1 
ATOM   2790 C  CB  . ALA C 3 65  ? 27.384  28.750  62.396 1.00 18.92 ? 103  ALA P CB  1 
ATOM   2791 N  N   . ARG C 3 66  ? 30.384  28.636  63.469 1.00 19.17 ? 104  ARG P N   1 
ATOM   2792 C  CA  . ARG C 3 66  ? 31.449  29.098  64.361 1.00 19.28 ? 104  ARG P CA  1 
ATOM   2793 C  C   . ARG C 3 66  ? 32.701  29.526  63.592 1.00 19.50 ? 104  ARG P C   1 
ATOM   2794 O  O   . ARG C 3 66  ? 33.445  30.382  64.064 1.00 19.14 ? 104  ARG P O   1 
ATOM   2795 C  CB  . ARG C 3 66  ? 31.789  28.032  65.408 1.00 19.20 ? 104  ARG P CB  1 
ATOM   2796 C  CG  . ARG C 3 66  ? 30.731  27.888  66.492 1.00 18.89 ? 104  ARG P CG  1 
ATOM   2797 C  CD  . ARG C 3 66  ? 30.816  26.552  67.225 1.00 19.19 ? 104  ARG P CD  1 
ATOM   2798 N  NE  . ARG C 3 66  ? 31.985  26.429  68.104 1.00 18.95 ? 104  ARG P NE  1 
ATOM   2799 C  CZ  . ARG C 3 66  ? 32.087  26.976  69.315 1.00 18.37 ? 104  ARG P CZ  1 
ATOM   2800 N  NH1 . ARG C 3 66  ? 31.098  27.713  69.804 1.00 18.16 ? 104  ARG P NH1 1 
ATOM   2801 N  NH2 . ARG C 3 66  ? 33.184  26.797  70.037 1.00 17.43 ? 104  ARG P NH2 1 
ATOM   2802 N  N   . ARG C 3 67  ? 32.906  28.943  62.405 1.00 19.73 ? 105  ARG P N   1 
ATOM   2803 C  CA  . ARG C 3 67  ? 34.028  29.298  61.523 1.00 20.16 ? 105  ARG P CA  1 
ATOM   2804 C  C   . ARG C 3 67  ? 33.678  30.420  60.541 1.00 20.06 ? 105  ARG P C   1 
ATOM   2805 O  O   . ARG C 3 67  ? 34.519  30.838  59.749 1.00 20.25 ? 105  ARG P O   1 
ATOM   2806 C  CB  . ARG C 3 67  ? 34.545  28.071  60.755 1.00 20.07 ? 105  ARG P CB  1 
ATOM   2807 C  CG  . ARG C 3 67  ? 35.176  26.993  61.622 1.00 20.46 ? 105  ARG P CG  1 
ATOM   2808 C  CD  . ARG C 3 67  ? 35.567  25.764  60.800 1.00 20.98 ? 105  ARG P CD  1 
ATOM   2809 N  NE  . ARG C 3 67  ? 35.466  24.541  61.600 1.00 22.66 ? 105  ARG P NE  1 
ATOM   2810 C  CZ  . ARG C 3 67  ? 35.869  23.332  61.214 1.00 23.16 ? 105  ARG P CZ  1 
ATOM   2811 N  NH1 . ARG C 3 67  ? 36.425  23.148  60.020 1.00 23.24 ? 105  ARG P NH1 1 
ATOM   2812 N  NH2 . ARG C 3 67  ? 35.718  22.297  62.036 1.00 23.44 ? 105  ARG P NH2 1 
ATOM   2813 N  N   . GLY C 3 68  ? 32.436  30.894  60.586 1.00 20.19 ? 106  GLY P N   1 
ATOM   2814 C  CA  . GLY C 3 68  ? 32.006  32.029  59.768 1.00 19.96 ? 106  GLY P CA  1 
ATOM   2815 C  C   . GLY C 3 68  ? 31.157  31.703  58.548 1.00 19.92 ? 106  GLY P C   1 
ATOM   2816 O  O   . GLY C 3 68  ? 30.944  32.568  57.695 1.00 19.74 ? 106  GLY P O   1 
ATOM   2817 N  N   . TYR C 3 69  ? 30.650  30.472  58.477 1.00 19.99 ? 107  TYR P N   1 
ATOM   2818 C  CA  . TYR C 3 69  ? 29.955  29.980  57.284 1.00 20.03 ? 107  TYR P CA  1 
ATOM   2819 C  C   . TYR C 3 69  ? 28.464  29.672  57.474 1.00 20.28 ? 107  TYR P C   1 
ATOM   2820 O  O   . TYR C 3 69  ? 28.057  29.018  58.438 1.00 20.46 ? 107  TYR P O   1 
ATOM   2821 C  CB  . TYR C 3 69  ? 30.646  28.723  56.756 1.00 19.90 ? 107  TYR P CB  1 
ATOM   2822 C  CG  . TYR C 3 69  ? 32.040  28.927  56.205 1.00 19.62 ? 107  TYR P CG  1 
ATOM   2823 C  CD1 . TYR C 3 69  ? 32.259  28.997  54.832 1.00 19.64 ? 107  TYR P CD1 1 
ATOM   2824 C  CD2 . TYR C 3 69  ? 33.146  29.017  57.055 1.00 19.31 ? 107  TYR P CD2 1 
ATOM   2825 C  CE1 . TYR C 3 69  ? 33.535  29.166  54.320 1.00 19.08 ? 107  TYR P CE1 1 
ATOM   2826 C  CE2 . TYR C 3 69  ? 34.426  29.193  56.555 1.00 18.71 ? 107  TYR P CE2 1 
ATOM   2827 C  CZ  . TYR C 3 69  ? 34.612  29.263  55.187 1.00 19.70 ? 107  TYR P CZ  1 
ATOM   2828 O  OH  . TYR C 3 69  ? 35.877  29.436  54.680 1.00 20.30 ? 107  TYR P OH  1 
ATOM   2829 N  N   . LEU C 3 70  ? 27.654  30.121  56.524 1.00 20.57 ? 108  LEU P N   1 
ATOM   2830 C  CA  . LEU C 3 70  ? 26.267  29.690  56.444 1.00 20.75 ? 108  LEU P CA  1 
ATOM   2831 C  C   . LEU C 3 70  ? 26.220  28.333  55.745 1.00 21.00 ? 108  LEU P C   1 
ATOM   2832 O  O   . LEU C 3 70  ? 26.921  28.114  54.753 1.00 21.12 ? 108  LEU P O   1 
ATOM   2833 C  CB  . LEU C 3 70  ? 25.444  30.698  55.642 1.00 20.70 ? 108  LEU P CB  1 
ATOM   2834 C  CG  . LEU C 3 70  ? 24.012  31.101  56.029 1.00 20.86 ? 108  LEU P CG  1 
ATOM   2835 C  CD1 . LEU C 3 70  ? 23.166  31.209  54.756 1.00 18.74 ? 108  LEU P CD1 1 
ATOM   2836 C  CD2 . LEU C 3 70  ? 23.340  30.174  57.070 1.00 20.43 ? 108  LEU P CD2 1 
ATOM   2837 N  N   . THR C 3 71  ? 25.413  27.419  56.273 1.00 21.16 ? 109  THR P N   1 
ATOM   2838 C  CA  . THR C 3 71  ? 25.099  26.174  55.574 1.00 21.53 ? 109  THR P CA  1 
ATOM   2839 C  C   . THR C 3 71  ? 23.591  25.944  55.582 1.00 21.89 ? 109  THR P C   1 
ATOM   2840 O  O   . THR C 3 71  ? 22.887  26.407  56.484 1.00 21.85 ? 109  THR P O   1 
ATOM   2841 C  CB  . THR C 3 71  ? 25.801  24.943  56.189 1.00 21.44 ? 109  THR P CB  1 
ATOM   2842 O  OG1 . THR C 3 71  ? 25.365  24.764  57.539 1.00 21.59 ? 109  THR P OG1 1 
ATOM   2843 C  CG2 . THR C 3 71  ? 27.311  25.104  56.166 1.00 21.56 ? 109  THR P CG2 1 
ATOM   2844 N  N   . LYS C 3 72  ? 23.095  25.246  54.567 1.00 22.21 ? 110  LYS P N   1 
ATOM   2845 C  CA  A LYS C 3 72  ? 21.688  24.882  54.545 0.50 22.51 ? 110  LYS P CA  1 
ATOM   2846 C  CA  B LYS C 3 72  ? 21.680  24.902  54.480 0.50 22.20 ? 110  LYS P CA  1 
ATOM   2847 C  C   . LYS C 3 72  ? 21.510  23.392  54.325 1.00 22.43 ? 110  LYS P C   1 
ATOM   2848 O  O   . LYS C 3 72  ? 22.052  22.806  53.388 1.00 22.62 ? 110  LYS P O   1 
ATOM   2849 C  CB  A LYS C 3 72  ? 20.889  25.695  53.521 0.50 22.60 ? 110  LYS P CB  1 
ATOM   2850 C  CB  B LYS C 3 72  ? 21.023  25.641  53.306 0.50 22.18 ? 110  LYS P CB  1 
ATOM   2851 C  CG  A LYS C 3 72  ? 19.384  25.618  53.771 0.50 23.45 ? 110  LYS P CG  1 
ATOM   2852 C  CG  B LYS C 3 72  ? 21.007  27.162  53.449 0.50 21.97 ? 110  LYS P CG  1 
ATOM   2853 C  CD  A LYS C 3 72  ? 18.625  26.808  53.208 0.50 24.52 ? 110  LYS P CD  1 
ATOM   2854 C  CD  B LYS C 3 72  ? 20.377  27.840  52.248 0.50 21.79 ? 110  LYS P CD  1 
ATOM   2855 C  CE  A LYS C 3 72  ? 17.207  26.874  53.777 0.50 24.94 ? 110  LYS P CE  1 
ATOM   2856 C  CE  B LYS C 3 72  ? 20.211  29.330  52.498 0.50 21.89 ? 110  LYS P CE  1 
ATOM   2857 N  NZ  A LYS C 3 72  ? 16.364  25.708  53.377 0.50 24.83 ? 110  LYS P NZ  1 
ATOM   2858 N  NZ  B LYS C 3 72  ? 19.831  30.075  51.265 0.50 21.39 ? 110  LYS P NZ  1 
ATOM   2859 N  N   . ILE C 3 73  ? 20.769  22.778  55.242 1.00 22.48 ? 111  ILE P N   1 
ATOM   2860 C  CA  . ILE C 3 73  ? 20.411  21.376  55.134 1.00 22.34 ? 111  ILE P CA  1 
ATOM   2861 C  C   . ILE C 3 73  ? 19.126  21.381  54.332 1.00 22.43 ? 111  ILE P C   1 
ATOM   2862 O  O   . ILE C 3 73  ? 18.108  21.899  54.780 1.00 22.44 ? 111  ILE P O   1 
ATOM   2863 C  CB  . ILE C 3 73  ? 20.199  20.705  56.525 1.00 22.31 ? 111  ILE P CB  1 
ATOM   2864 C  CG1 . ILE C 3 73  ? 21.439  20.877  57.413 1.00 22.11 ? 111  ILE P CG1 1 
ATOM   2865 C  CG2 . ILE C 3 73  ? 19.794  19.220  56.374 1.00 21.95 ? 111  ILE P CG2 1 
ATOM   2866 C  CD1 . ILE C 3 73  ? 22.748  20.354  56.820 1.00 21.75 ? 111  ILE P CD1 1 
ATOM   2867 N  N   . LEU C 3 74  ? 19.195  20.840  53.123 1.00 22.71 ? 112  LEU P N   1 
ATOM   2868 C  CA  . LEU C 3 74  ? 18.083  20.903  52.191 1.00 22.83 ? 112  LEU P CA  1 
ATOM   2869 C  C   . LEU C 3 74  ? 17.118  19.743  52.392 1.00 23.14 ? 112  LEU P C   1 
ATOM   2870 O  O   . LEU C 3 74  ? 15.917  19.873  52.152 1.00 23.20 ? 112  LEU P O   1 
ATOM   2871 C  CB  . LEU C 3 74  ? 18.609  20.928  50.754 1.00 22.68 ? 112  LEU P CB  1 
ATOM   2872 C  CG  . LEU C 3 74  ? 19.422  22.152  50.319 1.00 22.62 ? 112  LEU P CG  1 
ATOM   2873 C  CD1 . LEU C 3 74  ? 19.783  22.054  48.843 1.00 21.74 ? 112  LEU P CD1 1 
ATOM   2874 C  CD2 . LEU C 3 74  ? 18.690  23.465  50.614 1.00 21.87 ? 112  LEU P CD2 1 
ATOM   2875 N  N   . HIS C 3 75  ? 17.658  18.619  52.850 1.00 23.53 ? 113  HIS P N   1 
ATOM   2876 C  CA  . HIS C 3 75  ? 16.923  17.376  52.959 1.00 23.91 ? 113  HIS P CA  1 
ATOM   2877 C  C   . HIS C 3 75  ? 17.713  16.389  53.811 1.00 24.56 ? 113  HIS P C   1 
ATOM   2878 O  O   . HIS C 3 75  ? 18.921  16.254  53.647 1.00 24.51 ? 113  HIS P O   1 
ATOM   2879 C  CB  . HIS C 3 75  ? 16.695  16.785  51.561 1.00 23.64 ? 113  HIS P CB  1 
ATOM   2880 C  CG  . HIS C 3 75  ? 15.804  15.583  51.548 1.00 23.27 ? 113  HIS P CG  1 
ATOM   2881 N  ND1 . HIS C 3 75  ? 16.293  14.296  51.480 1.00 22.82 ? 113  HIS P ND1 1 
ATOM   2882 C  CD2 . HIS C 3 75  ? 14.457  15.470  51.596 1.00 23.31 ? 113  HIS P CD2 1 
ATOM   2883 C  CE1 . HIS C 3 75  ? 15.286  13.443  51.484 1.00 22.39 ? 113  HIS P CE1 1 
ATOM   2884 N  NE2 . HIS C 3 75  ? 14.160  14.129  51.551 1.00 23.25 ? 113  HIS P NE2 1 
ATOM   2885 N  N   . VAL C 3 76  ? 17.023  15.707  54.722 1.00 25.47 ? 114  VAL P N   1 
ATOM   2886 C  CA  . VAL C 3 76  ? 17.600  14.575  55.447 1.00 26.31 ? 114  VAL P CA  1 
ATOM   2887 C  C   . VAL C 3 76  ? 16.994  13.290  54.882 1.00 27.10 ? 114  VAL P C   1 
ATOM   2888 O  O   . VAL C 3 76  ? 15.773  13.166  54.783 1.00 27.23 ? 114  VAL P O   1 
ATOM   2889 C  CB  . VAL C 3 76  ? 17.366  14.677  56.982 1.00 26.10 ? 114  VAL P CB  1 
ATOM   2890 C  CG1 . VAL C 3 76  ? 18.043  13.527  57.714 1.00 25.91 ? 114  VAL P CG1 1 
ATOM   2891 C  CG2 . VAL C 3 76  ? 17.890  16.006  57.513 1.00 25.84 ? 114  VAL P CG2 1 
ATOM   2892 N  N   . PHE C 3 77  ? 17.848  12.348  54.490 1.00 28.09 ? 115  PHE P N   1 
ATOM   2893 C  CA  . PHE C 3 77  ? 17.381  11.092  53.920 1.00 29.14 ? 115  PHE P CA  1 
ATOM   2894 C  C   . PHE C 3 77  ? 16.983  10.113  55.010 1.00 30.31 ? 115  PHE P C   1 
ATOM   2895 O  O   . PHE C 3 77  ? 17.779  9.808   55.901 1.00 30.81 ? 115  PHE P O   1 
ATOM   2896 C  CB  . PHE C 3 77  ? 18.449  10.456  53.014 1.00 28.98 ? 115  PHE P CB  1 
ATOM   2897 C  CG  . PHE C 3 77  ? 18.700  11.213  51.733 1.00 28.70 ? 115  PHE P CG  1 
ATOM   2898 C  CD1 . PHE C 3 77  ? 17.857  11.057  50.638 1.00 28.11 ? 115  PHE P CD1 1 
ATOM   2899 C  CD2 . PHE C 3 77  ? 19.785  12.079  51.624 1.00 28.34 ? 115  PHE P CD2 1 
ATOM   2900 C  CE1 . PHE C 3 77  ? 18.083  11.758  49.458 1.00 27.87 ? 115  PHE P CE1 1 
ATOM   2901 C  CE2 . PHE C 3 77  ? 20.024  12.782  50.445 1.00 28.05 ? 115  PHE P CE2 1 
ATOM   2902 C  CZ  . PHE C 3 77  ? 19.167  12.622  49.362 1.00 28.27 ? 115  PHE P CZ  1 
ATOM   2903 N  N   . HIS C 3 78  ? 15.738  9.650   54.953 1.00 31.36 ? 116  HIS P N   1 
ATOM   2904 C  CA  . HIS C 3 78  ? 15.333  8.453   55.679 1.00 32.50 ? 116  HIS P CA  1 
ATOM   2905 C  C   . HIS C 3 78  ? 14.472  7.532   54.819 1.00 32.50 ? 116  HIS P C   1 
ATOM   2906 O  O   . HIS C 3 78  ? 13.407  7.925   54.341 1.00 32.78 ? 116  HIS P O   1 
ATOM   2907 C  CB  . HIS C 3 78  ? 14.660  8.768   57.027 1.00 33.30 ? 116  HIS P CB  1 
ATOM   2908 C  CG  . HIS C 3 78  ? 13.700  9.924   57.003 1.00 35.43 ? 116  HIS P CG  1 
ATOM   2909 N  ND1 . HIS C 3 78  ? 14.075  11.212  57.330 1.00 37.50 ? 116  HIS P ND1 1 
ATOM   2910 C  CD2 . HIS C 3 78  ? 12.368  9.973   56.760 1.00 36.84 ? 116  HIS P CD2 1 
ATOM   2911 C  CE1 . HIS C 3 78  ? 13.022  12.008  57.266 1.00 37.89 ? 116  HIS P CE1 1 
ATOM   2912 N  NE2 . HIS C 3 78  ? 11.974  11.281  56.919 1.00 38.10 ? 116  HIS P NE2 1 
ATOM   2913 N  N   . GLY C 3 79  ? 14.959  6.312   54.604 1.00 32.38 ? 117  GLY P N   1 
ATOM   2914 C  CA  . GLY C 3 79  ? 14.216  5.316   53.837 1.00 32.15 ? 117  GLY P CA  1 
ATOM   2915 C  C   . GLY C 3 79  ? 15.079  4.432   52.960 1.00 31.81 ? 117  GLY P C   1 
ATOM   2916 O  O   . GLY C 3 79  ? 15.023  3.199   53.059 1.00 32.05 ? 117  GLY P O   1 
ATOM   2917 N  N   . LEU C 3 80  ? 15.860  5.062   52.087 1.00 31.24 ? 118  LEU P N   1 
ATOM   2918 C  CA  . LEU C 3 80  ? 16.730  4.333   51.172 1.00 30.60 ? 118  LEU P CA  1 
ATOM   2919 C  C   . LEU C 3 80  ? 18.131  4.220   51.731 1.00 30.21 ? 118  LEU P C   1 
ATOM   2920 O  O   . LEU C 3 80  ? 18.633  3.117   51.926 1.00 30.60 ? 118  LEU P O   1 
ATOM   2921 C  CB  . LEU C 3 80  ? 16.763  4.978   49.784 1.00 30.50 ? 118  LEU P CB  1 
ATOM   2922 C  CG  . LEU C 3 80  ? 15.895  4.354   48.693 1.00 30.06 ? 118  LEU P CG  1 
ATOM   2923 C  CD1 . LEU C 3 80  ? 16.274  4.931   47.351 1.00 29.23 ? 118  LEU P CD1 1 
ATOM   2924 C  CD2 . LEU C 3 80  ? 16.017  2.838   48.667 1.00 29.45 ? 118  LEU P CD2 1 
ATOM   2925 N  N   . LEU C 3 81  ? 18.755  5.365   51.985 1.00 29.53 ? 119  LEU P N   1 
ATOM   2926 C  CA  . LEU C 3 81  ? 20.077  5.409   52.598 1.00 29.00 ? 119  LEU P CA  1 
ATOM   2927 C  C   . LEU C 3 81  ? 20.141  6.501   53.661 1.00 28.10 ? 119  LEU P C   1 
ATOM   2928 O  O   . LEU C 3 81  ? 19.346  7.443   53.618 1.00 28.19 ? 119  LEU P O   1 
ATOM   2929 C  CB  . LEU C 3 81  ? 21.185  5.591   51.544 1.00 29.12 ? 119  LEU P CB  1 
ATOM   2930 C  CG  . LEU C 3 81  ? 20.995  6.365   50.233 1.00 29.71 ? 119  LEU P CG  1 
ATOM   2931 C  CD1 . LEU C 3 81  ? 20.772  7.863   50.449 1.00 29.73 ? 119  LEU P CD1 1 
ATOM   2932 C  CD2 . LEU C 3 81  ? 22.208  6.124   49.336 1.00 29.31 ? 119  LEU P CD2 1 
ATOM   2933 N  N   . PRO C 3 82  ? 21.068  6.369   54.632 1.00 27.19 ? 120  PRO P N   1 
ATOM   2934 C  CA  . PRO C 3 82  ? 21.233  7.440   55.608 1.00 26.50 ? 120  PRO P CA  1 
ATOM   2935 C  C   . PRO C 3 82  ? 22.097  8.573   55.067 1.00 25.77 ? 120  PRO P C   1 
ATOM   2936 O  O   . PRO C 3 82  ? 23.051  8.338   54.319 1.00 25.67 ? 120  PRO P O   1 
ATOM   2937 C  CB  . PRO C 3 82  ? 21.932  6.746   56.778 1.00 26.46 ? 120  PRO P CB  1 
ATOM   2938 C  CG  . PRO C 3 82  ? 22.707  5.641   56.152 1.00 26.86 ? 120  PRO P CG  1 
ATOM   2939 C  CD  . PRO C 3 82  ? 21.986  5.241   54.886 1.00 27.25 ? 120  PRO P CD  1 
ATOM   2940 N  N   . GLY C 3 83  ? 21.753  9.795   55.443 1.00 25.09 ? 121  GLY P N   1 
ATOM   2941 C  CA  . GLY C 3 83  ? 22.543  10.952  55.065 1.00 24.25 ? 121  GLY P CA  1 
ATOM   2942 C  C   . GLY C 3 83  ? 21.677  12.167  54.869 1.00 23.74 ? 121  GLY P C   1 
ATOM   2943 O  O   . GLY C 3 83  ? 20.516  12.184  55.274 1.00 24.06 ? 121  GLY P O   1 
ATOM   2944 N  N   . PHE C 3 84  ? 22.246  13.190  54.245 1.00 23.18 ? 122  PHE P N   1 
ATOM   2945 C  CA  . PHE C 3 84  ? 21.539  14.445  54.036 1.00 22.49 ? 122  PHE P CA  1 
ATOM   2946 C  C   . PHE C 3 84  ? 22.097  15.226  52.855 1.00 22.41 ? 122  PHE P C   1 
ATOM   2947 O  O   . PHE C 3 84  ? 23.208  14.961  52.378 1.00 22.41 ? 122  PHE P O   1 
ATOM   2948 C  CB  . PHE C 3 84  ? 21.542  15.306  55.315 1.00 22.33 ? 122  PHE P CB  1 
ATOM   2949 C  CG  . PHE C 3 84  ? 22.902  15.483  55.938 1.00 21.66 ? 122  PHE P CG  1 
ATOM   2950 C  CD1 . PHE C 3 84  ? 23.392  14.552  56.853 1.00 21.24 ? 122  PHE P CD1 1 
ATOM   2951 C  CD2 . PHE C 3 84  ? 23.684  16.587  55.626 1.00 20.62 ? 122  PHE P CD2 1 
ATOM   2952 C  CE1 . PHE C 3 84  ? 24.647  14.713  57.431 1.00 20.99 ? 122  PHE P CE1 1 
ATOM   2953 C  CE2 . PHE C 3 84  ? 24.933  16.758  56.203 1.00 21.22 ? 122  PHE P CE2 1 
ATOM   2954 C  CZ  . PHE C 3 84  ? 25.418  15.819  57.110 1.00 21.23 ? 122  PHE P CZ  1 
ATOM   2955 N  N   . LEU C 3 85  ? 21.304  16.185  52.392 1.00 22.06 ? 123  LEU P N   1 
ATOM   2956 C  CA  . LEU C 3 85  ? 21.672  17.065  51.300 1.00 21.90 ? 123  LEU P CA  1 
ATOM   2957 C  C   . LEU C 3 85  ? 22.008  18.447  51.865 1.00 21.71 ? 123  LEU P C   1 
ATOM   2958 O  O   . LEU C 3 85  ? 21.189  19.068  52.539 1.00 21.58 ? 123  LEU P O   1 
ATOM   2959 C  CB  . LEU C 3 85  ? 20.519  17.149  50.295 1.00 21.93 ? 123  LEU P CB  1 
ATOM   2960 C  CG  . LEU C 3 85  ? 20.697  17.880  48.964 1.00 22.31 ? 123  LEU P CG  1 
ATOM   2961 C  CD1 . LEU C 3 85  ? 21.755  17.204  48.086 1.00 22.36 ? 123  LEU P CD1 1 
ATOM   2962 C  CD2 . LEU C 3 85  ? 19.363  17.969  48.241 1.00 21.85 ? 123  LEU P CD2 1 
ATOM   2963 N  N   . VAL C 3 86  ? 23.218  18.919  51.586 1.00 21.46 ? 124  VAL P N   1 
ATOM   2964 C  CA  . VAL C 3 86  ? 23.685  20.194  52.126 1.00 21.13 ? 124  VAL P CA  1 
ATOM   2965 C  C   . VAL C 3 86  ? 24.108  21.156  51.011 1.00 21.23 ? 124  VAL P C   1 
ATOM   2966 O  O   . VAL C 3 86  ? 24.801  20.776  50.066 1.00 21.25 ? 124  VAL P O   1 
ATOM   2967 C  CB  . VAL C 3 86  ? 24.819  19.991  53.195 1.00 20.96 ? 124  VAL P CB  1 
ATOM   2968 C  CG1 . VAL C 3 86  ? 26.099  19.465  52.559 1.00 20.47 ? 124  VAL P CG1 1 
ATOM   2969 C  CG2 . VAL C 3 86  ? 25.077  21.270  53.998 1.00 19.60 ? 124  VAL P CG2 1 
ATOM   2970 N  N   . LYS C 3 87  ? 23.642  22.394  51.121 1.00 21.26 ? 125  LYS P N   1 
ATOM   2971 C  CA  . LYS C 3 87  ? 24.114  23.478  50.284 1.00 21.43 ? 125  LYS P CA  1 
ATOM   2972 C  C   . LYS C 3 87  ? 25.097  24.309  51.112 1.00 21.50 ? 125  LYS P C   1 
ATOM   2973 O  O   . LYS C 3 87  ? 24.727  24.860  52.156 1.00 21.37 ? 125  LYS P O   1 
ATOM   2974 C  CB  . LYS C 3 87  ? 22.943  24.332  49.807 1.00 21.37 ? 125  LYS P CB  1 
ATOM   2975 C  CG  . LYS C 3 87  ? 23.278  25.232  48.644 1.00 22.46 ? 125  LYS P CG  1 
ATOM   2976 C  CD  . LYS C 3 87  ? 22.030  25.823  48.025 1.00 24.08 ? 125  LYS P CD  1 
ATOM   2977 C  CE  . LYS C 3 87  ? 22.390  26.648  46.802 1.00 25.82 ? 125  LYS P CE  1 
ATOM   2978 N  NZ  . LYS C 3 87  ? 21.205  27.302  46.192 1.00 27.30 ? 125  LYS P NZ  1 
ATOM   2979 N  N   . MET C 3 88  ? 26.347  24.369  50.653 1.00 21.34 ? 126  MET P N   1 
ATOM   2980 C  CA  . MET C 3 88  ? 27.418  25.067  51.369 1.00 21.31 ? 126  MET P CA  1 
ATOM   2981 C  C   . MET C 3 88  ? 28.584  25.409  50.443 1.00 21.10 ? 126  MET P C   1 
ATOM   2982 O  O   . MET C 3 88  ? 28.593  25.036  49.274 1.00 21.44 ? 126  MET P O   1 
ATOM   2983 C  CB  . MET C 3 88  ? 27.917  24.216  52.544 1.00 21.09 ? 126  MET P CB  1 
ATOM   2984 C  CG  . MET C 3 88  ? 28.656  22.963  52.120 1.00 21.14 ? 126  MET P CG  1 
ATOM   2985 S  SD  . MET C 3 88  ? 29.120  21.883  53.474 1.00 22.00 ? 126  MET P SD  1 
ATOM   2986 C  CE  . MET C 3 88  ? 30.172  20.718  52.609 1.00 20.93 ? 126  MET P CE  1 
ATOM   2987 N  N   . SER C 3 89  ? 29.561  26.127  50.978 1.00 21.08 ? 127  SER P N   1 
ATOM   2988 C  CA  . SER C 3 89  ? 30.821  26.368  50.295 1.00 20.86 ? 127  SER P CA  1 
ATOM   2989 C  C   . SER C 3 89  ? 31.650  25.083  50.277 1.00 21.09 ? 127  SER P C   1 
ATOM   2990 O  O   . SER C 3 89  ? 31.650  24.325  51.246 1.00 20.67 ? 127  SER P O   1 
ATOM   2991 C  CB  . SER C 3 89  ? 31.589  27.478  51.015 1.00 20.75 ? 127  SER P CB  1 
ATOM   2992 O  OG  . SER C 3 89  ? 32.854  27.696  50.429 1.00 20.56 ? 127  SER P OG  1 
ATOM   2993 N  N   . GLY C 3 90  ? 32.355  24.845  49.173 1.00 21.53 ? 128  GLY P N   1 
ATOM   2994 C  CA  . GLY C 3 90  ? 33.256  23.697  49.057 1.00 21.98 ? 128  GLY P CA  1 
ATOM   2995 C  C   . GLY C 3 90  ? 34.486  23.778  49.947 1.00 22.46 ? 128  GLY P C   1 
ATOM   2996 O  O   . GLY C 3 90  ? 35.266  22.832  50.005 1.00 22.74 ? 128  GLY P O   1 
ATOM   2997 N  N   . ASP C 3 91  ? 34.665  24.913  50.628 1.00 22.81 ? 129  ASP P N   1 
ATOM   2998 C  CA  . ASP C 3 91  ? 35.708  25.084  51.651 1.00 22.92 ? 129  ASP P CA  1 
ATOM   2999 C  C   . ASP C 3 91  ? 35.437  24.256  52.899 1.00 22.91 ? 129  ASP P C   1 
ATOM   3000 O  O   . ASP C 3 91  ? 36.330  24.049  53.722 1.00 22.58 ? 129  ASP P O   1 
ATOM   3001 C  CB  . ASP C 3 91  ? 35.828  26.556  52.058 1.00 22.86 ? 129  ASP P CB  1 
ATOM   3002 C  CG  . ASP C 3 91  ? 36.517  27.398  51.011 1.00 23.56 ? 129  ASP P CG  1 
ATOM   3003 O  OD1 . ASP C 3 91  ? 36.961  26.832  49.986 1.00 23.77 ? 129  ASP P OD1 1 
ATOM   3004 O  OD2 . ASP C 3 91  ? 36.619  28.632  51.217 1.00 24.66 ? 129  ASP P OD2 1 
ATOM   3005 N  N   . LEU C 3 92  ? 34.194  23.792  53.027 1.00 23.17 ? 130  LEU P N   1 
ATOM   3006 C  CA  . LEU C 3 92  ? 33.737  23.059  54.205 1.00 23.12 ? 130  LEU P CA  1 
ATOM   3007 C  C   . LEU C 3 92  ? 33.676  21.559  53.957 1.00 23.58 ? 130  LEU P C   1 
ATOM   3008 O  O   . LEU C 3 92  ? 33.034  20.821  54.717 1.00 23.63 ? 130  LEU P O   1 
ATOM   3009 C  CB  . LEU C 3 92  ? 32.360  23.568  54.650 1.00 22.80 ? 130  LEU P CB  1 
ATOM   3010 C  CG  . LEU C 3 92  ? 32.208  25.042  55.029 1.00 21.87 ? 130  LEU P CG  1 
ATOM   3011 C  CD1 . LEU C 3 92  ? 30.748  25.363  55.194 1.00 20.70 ? 130  LEU P CD1 1 
ATOM   3012 C  CD2 . LEU C 3 92  ? 32.986  25.382  56.299 1.00 21.56 ? 130  LEU P CD2 1 
ATOM   3013 N  N   . LEU C 3 93  ? 34.340  21.111  52.896 1.00 24.05 ? 131  LEU P N   1 
ATOM   3014 C  CA  . LEU C 3 93  ? 34.368  19.692  52.565 1.00 24.59 ? 131  LEU P CA  1 
ATOM   3015 C  C   . LEU C 3 93  ? 35.283  18.904  53.497 1.00 24.81 ? 131  LEU P C   1 
ATOM   3016 O  O   . LEU C 3 93  ? 34.924  17.817  53.920 1.00 24.96 ? 131  LEU P O   1 
ATOM   3017 C  CB  . LEU C 3 93  ? 34.722  19.467  51.089 1.00 24.56 ? 131  LEU P CB  1 
ATOM   3018 C  CG  . LEU C 3 93  ? 33.593  19.713  50.075 1.00 24.80 ? 131  LEU P CG  1 
ATOM   3019 C  CD1 . LEU C 3 93  ? 34.151  19.809  48.660 1.00 24.57 ? 131  LEU P CD1 1 
ATOM   3020 C  CD2 . LEU C 3 93  ? 32.490  18.649  50.148 1.00 24.44 ? 131  LEU P CD2 1 
ATOM   3021 N  N   . GLU C 3 94  ? 36.450  19.454  53.826 1.00 25.52 ? 132  GLU P N   1 
ATOM   3022 C  CA  . GLU C 3 94  ? 37.328  18.855  54.842 1.00 26.16 ? 132  GLU P CA  1 
ATOM   3023 C  C   . GLU C 3 94  ? 36.584  18.637  56.159 1.00 25.88 ? 132  GLU P C   1 
ATOM   3024 O  O   . GLU C 3 94  ? 36.643  17.549  56.739 1.00 26.14 ? 132  GLU P O   1 
ATOM   3025 C  CB  . GLU C 3 94  ? 38.542  19.734  55.106 1.00 26.37 ? 132  GLU P CB  1 
ATOM   3026 C  CG  . GLU C 3 94  ? 39.809  19.323  54.383 1.00 29.36 ? 132  GLU P CG  1 
ATOM   3027 C  CD  . GLU C 3 94  ? 41.058  19.758  55.147 1.00 32.69 ? 132  GLU P CD  1 
ATOM   3028 O  OE1 . GLU C 3 94  ? 40.996  19.779  56.406 1.00 33.13 ? 132  GLU P OE1 1 
ATOM   3029 O  OE2 . GLU C 3 94  ? 42.090  20.074  54.497 1.00 33.63 ? 132  GLU P OE2 1 
ATOM   3030 N  N   . LEU C 3 95  ? 35.909  19.658  56.619 1.00 25.26 ? 133  LEU P N   1 
ATOM   3031 C  CA  . LEU C 3 95  ? 35.084  19.589  57.769 1.00 24.82 ? 133  LEU P CA  1 
ATOM   3032 C  C   . LEU C 3 95  ? 34.037  18.501  57.717 1.00 24.70 ? 133  LEU P C   1 
ATOM   3033 O  O   . LEU C 3 95  ? 33.938  17.677  58.575 1.00 24.76 ? 133  LEU P O   1 
ATOM   3034 C  CB  . LEU C 3 95  ? 34.452  20.953  57.980 1.00 24.86 ? 133  LEU P CB  1 
ATOM   3035 C  CG  . LEU C 3 95  ? 33.342  21.301  58.945 1.00 24.77 ? 133  LEU P CG  1 
ATOM   3036 C  CD1 . LEU C 3 95  ? 33.042  22.713  58.842 1.00 24.26 ? 133  LEU P CD1 1 
ATOM   3037 C  CD2 . LEU C 3 95  ? 32.109  20.517  58.776 1.00 24.39 ? 133  LEU P CD2 1 
ATOM   3038 N  N   . ALA C 3 96  ? 33.245  18.533  56.684 1.00 24.58 ? 134  ALA P N   1 
ATOM   3039 C  CA  . ALA C 3 96  ? 32.193  17.551  56.462 1.00 24.38 ? 134  ALA P CA  1 
ATOM   3040 C  C   . ALA C 3 96  ? 32.725  16.113  56.326 1.00 24.55 ? 134  ALA P C   1 
ATOM   3041 O  O   . ALA C 3 96  ? 32.094  15.170  56.801 1.00 24.40 ? 134  ALA P O   1 
ATOM   3042 C  CB  . ALA C 3 96  ? 31.352  17.948  55.256 1.00 24.17 ? 134  ALA P CB  1 
ATOM   3043 N  N   . LEU C 3 97  ? 33.890  15.954  55.695 1.00 24.81 ? 135  LEU P N   1 
ATOM   3044 C  CA  . LEU C 3 97  ? 34.523  14.635  55.543 1.00 25.18 ? 135  LEU P CA  1 
ATOM   3045 C  C   . LEU C 3 97  ? 34.990  14.025  56.864 1.00 25.54 ? 135  LEU P C   1 
ATOM   3046 O  O   . LEU C 3 97  ? 35.122  12.803  56.970 1.00 25.81 ? 135  LEU P O   1 
ATOM   3047 C  CB  . LEU C 3 97  ? 35.696  14.685  54.551 1.00 25.05 ? 135  LEU P CB  1 
ATOM   3048 C  CG  . LEU C 3 97  ? 35.386  14.702  53.050 1.00 25.03 ? 135  LEU P CG  1 
ATOM   3049 C  CD1 . LEU C 3 97  ? 36.649  14.997  52.252 1.00 24.57 ? 135  LEU P CD1 1 
ATOM   3050 C  CD2 . LEU C 3 97  ? 34.736  13.393  52.588 1.00 24.92 ? 135  LEU P CD2 1 
ATOM   3051 N  N   . LYS C 3 98  ? 35.236  14.879  57.859 1.00 25.75 ? 136  LYS P N   1 
ATOM   3052 C  CA  . LYS C 3 98  ? 35.691  14.446  59.181 1.00 25.90 ? 136  LYS P CA  1 
ATOM   3053 C  C   . LYS C 3 98  ? 34.571  14.284  60.226 1.00 25.66 ? 136  LYS P C   1 
ATOM   3054 O  O   . LYS C 3 98  ? 34.836  13.952  61.381 1.00 25.78 ? 136  LYS P O   1 
ATOM   3055 C  CB  . LYS C 3 98  ? 36.815  15.361  59.682 1.00 25.96 ? 136  LYS P CB  1 
ATOM   3056 C  CG  . LYS C 3 98  ? 38.175  14.963  59.118 1.00 27.53 ? 136  LYS P CG  1 
ATOM   3057 C  CD  . LYS C 3 98  ? 39.119  16.147  59.001 1.00 30.63 ? 136  LYS P CD  1 
ATOM   3058 C  CE  . LYS C 3 98  ? 40.295  15.814  58.076 1.00 32.26 ? 136  LYS P CE  1 
ATOM   3059 N  NZ  . LYS C 3 98  ? 41.240  16.965  57.903 1.00 33.40 ? 136  LYS P NZ  1 
ATOM   3060 N  N   . LEU C 3 99  ? 33.327  14.493  59.808 1.00 25.48 ? 137  LEU P N   1 
ATOM   3061 C  CA  . LEU C 3 99  ? 32.162  14.299  60.677 1.00 25.28 ? 137  LEU P CA  1 
ATOM   3062 C  C   . LEU C 3 99  ? 31.945  12.813  60.996 1.00 25.27 ? 137  LEU P C   1 
ATOM   3063 O  O   . LEU C 3 99  ? 32.364  11.949  60.216 1.00 25.17 ? 137  LEU P O   1 
ATOM   3064 C  CB  . LEU C 3 99  ? 30.902  14.890  60.031 1.00 25.02 ? 137  LEU P CB  1 
ATOM   3065 C  CG  . LEU C 3 99  ? 30.766  16.408  59.898 1.00 24.95 ? 137  LEU P CG  1 
ATOM   3066 C  CD1 . LEU C 3 99  ? 29.577  16.732  59.023 1.00 24.70 ? 137  LEU P CD1 1 
ATOM   3067 C  CD2 . LEU C 3 99  ? 30.631  17.084  61.254 1.00 24.67 ? 137  LEU P CD2 1 
ATOM   3068 N  N   . PRO C 3 100 ? 31.309  12.510  62.151 1.00 25.40 ? 138  PRO P N   1 
ATOM   3069 C  CA  . PRO C 3 100 ? 31.046  11.106  62.499 1.00 25.38 ? 138  PRO P CA  1 
ATOM   3070 C  C   . PRO C 3 100 ? 30.044  10.454  61.552 1.00 25.22 ? 138  PRO P C   1 
ATOM   3071 O  O   . PRO C 3 100 ? 29.134  11.121  61.052 1.00 25.34 ? 138  PRO P O   1 
ATOM   3072 C  CB  . PRO C 3 100 ? 30.450  11.192  63.914 1.00 25.33 ? 138  PRO P CB  1 
ATOM   3073 C  CG  . PRO C 3 100 ? 29.877  12.573  64.004 1.00 25.51 ? 138  PRO P CG  1 
ATOM   3074 C  CD  . PRO C 3 100 ? 30.813  13.432  63.195 1.00 25.40 ? 138  PRO P CD  1 
ATOM   3075 N  N   . HIS C 3 101 ? 30.238  9.160   61.306 1.00 24.98 ? 139  HIS P N   1 
ATOM   3076 C  CA  . HIS C 3 101 ? 29.306  8.327   60.540 1.00 24.70 ? 139  HIS P CA  1 
ATOM   3077 C  C   . HIS C 3 101 ? 29.456  8.446   59.031 1.00 24.49 ? 139  HIS P C   1 
ATOM   3078 O  O   . HIS C 3 101 ? 28.858  7.656   58.292 1.00 24.65 ? 139  HIS P O   1 
ATOM   3079 C  CB  . HIS C 3 101 ? 27.845  8.578   60.949 1.00 24.77 ? 139  HIS P CB  1 
ATOM   3080 C  CG  . HIS C 3 101 ? 27.593  8.422   62.416 1.00 25.21 ? 139  HIS P CG  1 
ATOM   3081 N  ND1 . HIS C 3 101 ? 27.658  7.203   63.056 1.00 24.92 ? 139  HIS P ND1 1 
ATOM   3082 C  CD2 . HIS C 3 101 ? 27.279  9.333   63.368 1.00 25.34 ? 139  HIS P CD2 1 
ATOM   3083 C  CE1 . HIS C 3 101 ? 27.397  7.371   64.340 1.00 25.36 ? 139  HIS P CE1 1 
ATOM   3084 N  NE2 . HIS C 3 101 ? 27.162  8.653   64.555 1.00 25.31 ? 139  HIS P NE2 1 
ATOM   3085 N  N   . VAL C 3 102 ? 30.255  9.414   58.581 1.00 24.05 ? 140  VAL P N   1 
ATOM   3086 C  CA  . VAL C 3 102 ? 30.393  9.711   57.151 1.00 23.81 ? 140  VAL P CA  1 
ATOM   3087 C  C   . VAL C 3 102 ? 31.090  8.579   56.394 1.00 23.67 ? 140  VAL P C   1 
ATOM   3088 O  O   . VAL C 3 102 ? 32.176  8.134   56.775 1.00 23.64 ? 140  VAL P O   1 
ATOM   3089 C  CB  . VAL C 3 102 ? 31.116  11.068  56.882 1.00 23.86 ? 140  VAL P CB  1 
ATOM   3090 C  CG1 . VAL C 3 102 ? 31.207  11.348  55.388 1.00 23.59 ? 140  VAL P CG1 1 
ATOM   3091 C  CG2 . VAL C 3 102 ? 30.389  12.217  57.571 1.00 23.40 ? 140  VAL P CG2 1 
ATOM   3092 N  N   . ASP C 3 103 ? 30.433  8.119   55.331 1.00 23.35 ? 141  ASP P N   1 
ATOM   3093 C  CA  . ASP C 3 103 ? 30.996  7.135   54.423 1.00 23.09 ? 141  ASP P CA  1 
ATOM   3094 C  C   . ASP C 3 103 ? 31.722  7.843   53.270 1.00 22.86 ? 141  ASP P C   1 
ATOM   3095 O  O   . ASP C 3 103 ? 32.914  7.632   53.048 1.00 23.05 ? 141  ASP P O   1 
ATOM   3096 C  CB  . ASP C 3 103 ? 29.888  6.223   53.896 1.00 23.07 ? 141  ASP P CB  1 
ATOM   3097 C  CG  . ASP C 3 103 ? 30.422  4.955   53.279 1.00 23.66 ? 141  ASP P CG  1 
ATOM   3098 O  OD1 . ASP C 3 103 ? 31.622  4.679   53.439 1.00 25.45 ? 141  ASP P OD1 1 
ATOM   3099 O  OD2 . ASP C 3 103 ? 29.642  4.223   52.639 1.00 24.90 ? 141  ASP P OD2 1 
ATOM   3100 N  N   . TYR C 3 104 ? 30.990  8.674   52.538 1.00 22.43 ? 142  TYR P N   1 
ATOM   3101 C  CA  . TYR C 3 104 ? 31.558  9.485   51.473 1.00 22.12 ? 142  TYR P CA  1 
ATOM   3102 C  C   . TYR C 3 104 ? 30.655  10.686  51.214 1.00 22.03 ? 142  TYR P C   1 
ATOM   3103 O  O   . TYR C 3 104 ? 29.498  10.703  51.640 1.00 21.83 ? 142  TYR P O   1 
ATOM   3104 C  CB  . TYR C 3 104 ? 31.763  8.664   50.187 1.00 21.97 ? 142  TYR P CB  1 
ATOM   3105 C  CG  . TYR C 3 104 ? 30.503  8.037   49.623 1.00 21.40 ? 142  TYR P CG  1 
ATOM   3106 C  CD1 . TYR C 3 104 ? 30.041  6.813   50.101 1.00 21.37 ? 142  TYR P CD1 1 
ATOM   3107 C  CD2 . TYR C 3 104 ? 29.781  8.663   48.608 1.00 20.24 ? 142  TYR P CD2 1 
ATOM   3108 C  CE1 . TYR C 3 104 ? 28.890  6.234   49.594 1.00 21.26 ? 142  TYR P CE1 1 
ATOM   3109 C  CE2 . TYR C 3 104 ? 28.628  8.094   48.097 1.00 20.36 ? 142  TYR P CE2 1 
ATOM   3110 C  CZ  . TYR C 3 104 ? 28.191  6.876   48.592 1.00 20.81 ? 142  TYR P CZ  1 
ATOM   3111 O  OH  . TYR C 3 104 ? 27.057  6.288   48.091 1.00 21.30 ? 142  TYR P OH  1 
ATOM   3112 N  N   . ILE C 3 105 ? 31.198  11.688  50.529 1.00 21.83 ? 143  ILE P N   1 
ATOM   3113 C  CA  . ILE C 3 105 ? 30.425  12.852  50.110 1.00 21.74 ? 143  ILE P CA  1 
ATOM   3114 C  C   . ILE C 3 105 ? 30.479  12.976  48.594 1.00 21.82 ? 143  ILE P C   1 
ATOM   3115 O  O   . ILE C 3 105 ? 31.530  12.813  47.981 1.00 21.62 ? 143  ILE P O   1 
ATOM   3116 C  CB  . ILE C 3 105 ? 30.912  14.168  50.776 1.00 21.71 ? 143  ILE P CB  1 
ATOM   3117 C  CG1 . ILE C 3 105 ? 30.823  14.066  52.304 1.00 21.44 ? 143  ILE P CG1 1 
ATOM   3118 C  CG2 . ILE C 3 105 ? 30.093  15.362  50.276 1.00 21.34 ? 143  ILE P CG2 1 
ATOM   3119 C  CD1 . ILE C 3 105 ? 31.425  15.246  53.034 1.00 21.36 ? 143  ILE P CD1 1 
ATOM   3120 N  N   . GLU C 3 106 ? 29.328  13.253  47.995 1.00 22.14 ? 144  GLU P N   1 
ATOM   3121 C  CA  . GLU C 3 106 ? 29.248  13.410  46.555 1.00 22.21 ? 144  GLU P CA  1 
ATOM   3122 C  C   . GLU C 3 106 ? 28.671  14.764  46.183 1.00 21.85 ? 144  GLU P C   1 
ATOM   3123 O  O   . GLU C 3 106 ? 27.614  15.163  46.670 1.00 21.94 ? 144  GLU P O   1 
ATOM   3124 C  CB  . GLU C 3 106 ? 28.434  12.276  45.925 1.00 22.36 ? 144  GLU P CB  1 
ATOM   3125 C  CG  . GLU C 3 106 ? 28.496  12.271  44.405 1.00 24.02 ? 144  GLU P CG  1 
ATOM   3126 C  CD  . GLU C 3 106 ? 27.825  11.065  43.792 1.00 25.98 ? 144  GLU P CD  1 
ATOM   3127 O  OE1 . GLU C 3 106 ? 28.106  9.939   44.257 1.00 27.07 ? 144  GLU P OE1 1 
ATOM   3128 O  OE2 . GLU C 3 106 ? 27.025  11.246  42.843 1.00 25.92 ? 144  GLU P OE2 1 
ATOM   3129 N  N   . GLU C 3 107 ? 29.392  15.466  45.320 1.00 21.68 ? 145  GLU P N   1 
ATOM   3130 C  CA  . GLU C 3 107 ? 28.936  16.720  44.758 1.00 21.44 ? 145  GLU P CA  1 
ATOM   3131 C  C   . GLU C 3 107 ? 27.787  16.405  43.810 1.00 21.31 ? 145  GLU P C   1 
ATOM   3132 O  O   . GLU C 3 107 ? 27.831  15.400  43.088 1.00 21.11 ? 145  GLU P O   1 
ATOM   3133 C  CB  . GLU C 3 107 ? 30.088  17.384  44.003 1.00 21.38 ? 145  GLU P CB  1 
ATOM   3134 C  CG  . GLU C 3 107 ? 29.844  18.822  43.585 1.00 21.32 ? 145  GLU P CG  1 
ATOM   3135 C  CD  . GLU C 3 107 ? 30.908  19.324  42.627 1.00 21.76 ? 145  GLU P CD  1 
ATOM   3136 O  OE1 . GLU C 3 107 ? 30.966  18.813  41.485 1.00 22.43 ? 145  GLU P OE1 1 
ATOM   3137 O  OE2 . GLU C 3 107 ? 31.683  20.230  43.009 1.00 21.73 ? 145  GLU P OE2 1 
ATOM   3138 N  N   . ASP C 3 108 ? 26.763  17.258  43.818 1.00 21.03 ? 146  ASP P N   1 
ATOM   3139 C  CA  . ASP C 3 108 ? 25.597  17.081  42.952 1.00 20.80 ? 146  ASP P CA  1 
ATOM   3140 C  C   . ASP C 3 108 ? 26.002  17.259  41.485 1.00 20.60 ? 146  ASP P C   1 
ATOM   3141 O  O   . ASP C 3 108 ? 27.013  17.904  41.179 1.00 20.66 ? 146  ASP P O   1 
ATOM   3142 C  CB  . ASP C 3 108 ? 24.491  18.071  43.349 1.00 20.92 ? 146  ASP P CB  1 
ATOM   3143 C  CG  . ASP C 3 108 ? 23.084  17.608  42.945 1.00 21.18 ? 146  ASP P CG  1 
ATOM   3144 O  OD1 . ASP C 3 108 ? 22.884  16.421  42.597 1.00 20.10 ? 146  ASP P OD1 1 
ATOM   3145 O  OD2 . ASP C 3 108 ? 22.160  18.452  42.996 1.00 21.68 ? 146  ASP P OD2 1 
ATOM   3146 N  N   . SER C 3 109 ? 25.227  16.656  40.586 1.00 20.21 ? 147  SER P N   1 
ATOM   3147 C  CA  . SER C 3 109 ? 25.487  16.728  39.153 1.00 19.45 ? 147  SER P CA  1 
ATOM   3148 C  C   . SER C 3 109 ? 24.202  16.561  38.346 1.00 19.03 ? 147  SER P C   1 
ATOM   3149 O  O   . SER C 3 109 ? 23.195  16.056  38.853 1.00 18.70 ? 147  SER P O   1 
ATOM   3150 C  CB  . SER C 3 109 ? 26.541  15.697  38.730 1.00 19.71 ? 147  SER P CB  1 
ATOM   3151 O  OG  . SER C 3 109 ? 26.107  14.365  38.979 1.00 20.70 ? 147  SER P OG  1 
ATOM   3152 N  N   . SER C 3 110 ? 24.254  16.994  37.086 1.00 18.42 ? 148  SER P N   1 
ATOM   3153 C  CA  . SER C 3 110 ? 23.107  16.970  36.187 1.00 17.46 ? 148  SER P CA  1 
ATOM   3154 C  C   . SER C 3 110 ? 22.796  15.580  35.622 1.00 17.02 ? 148  SER P C   1 
ATOM   3155 O  O   . SER C 3 110 ? 23.697  14.775  35.397 1.00 16.93 ? 148  SER P O   1 
ATOM   3156 C  CB  . SER C 3 110 ? 23.325  17.953  35.040 1.00 17.35 ? 148  SER P CB  1 
ATOM   3157 O  OG  . SER C 3 110 ? 23.487  19.275  35.516 1.00 17.43 ? 148  SER P OG  1 
ATOM   3158 N  N   . VAL C 3 111 ? 21.506  15.325  35.406 1.00 16.17 ? 149  VAL P N   1 
ATOM   3159 C  CA  . VAL C 3 111 ? 21.025  14.163  34.661 1.00 15.36 ? 149  VAL P CA  1 
ATOM   3160 C  C   . VAL C 3 111 ? 20.143  14.653  33.504 1.00 15.30 ? 149  VAL P C   1 
ATOM   3161 O  O   . VAL C 3 111 ? 19.580  15.756  33.560 1.00 15.38 ? 149  VAL P O   1 
ATOM   3162 C  CB  . VAL C 3 111 ? 20.254  13.125  35.560 1.00 15.37 ? 149  VAL P CB  1 
ATOM   3163 C  CG1 . VAL C 3 111 ? 21.147  12.591  36.694 1.00 14.43 ? 149  VAL P CG1 1 
ATOM   3164 C  CG2 . VAL C 3 111 ? 18.955  13.695  36.106 1.00 14.42 ? 149  VAL P CG2 1 
ATOM   3165 N  N   . PHE C 3 112 ? 20.024  13.847  32.456 1.00 15.08 ? 150  PHE P N   1 
ATOM   3166 C  CA  . PHE C 3 112 ? 19.345  14.290  31.236 1.00 14.85 ? 150  PHE P CA  1 
ATOM   3167 C  C   . PHE C 3 112 ? 18.417  13.251  30.660 1.00 14.86 ? 150  PHE P C   1 
ATOM   3168 O  O   . PHE C 3 112 ? 18.728  12.069  30.681 1.00 15.18 ? 150  PHE P O   1 
ATOM   3169 C  CB  . PHE C 3 112 ? 20.373  14.698  30.176 1.00 14.73 ? 150  PHE P CB  1 
ATOM   3170 C  CG  . PHE C 3 112 ? 21.334  15.741  30.650 1.00 14.35 ? 150  PHE P CG  1 
ATOM   3171 C  CD1 . PHE C 3 112 ? 21.018  17.088  30.550 1.00 12.66 ? 150  PHE P CD1 1 
ATOM   3172 C  CD2 . PHE C 3 112 ? 22.545  15.372  31.234 1.00 14.86 ? 150  PHE P CD2 1 
ATOM   3173 C  CE1 . PHE C 3 112 ? 21.897  18.057  31.000 1.00 13.72 ? 150  PHE P CE1 1 
ATOM   3174 C  CE2 . PHE C 3 112 ? 23.435  16.341  31.696 1.00 15.01 ? 150  PHE P CE2 1 
ATOM   3175 C  CZ  . PHE C 3 112 ? 23.109  17.687  31.570 1.00 14.17 ? 150  PHE P CZ  1 
ATOM   3176 N  N   . ALA C 3 113 ? 17.281  13.710  30.141 1.00 14.77 ? 151  ALA P N   1 
ATOM   3177 C  CA  . ALA C 3 113 ? 16.368  12.883  29.354 1.00 14.79 ? 151  ALA P CA  1 
ATOM   3178 C  C   . ALA C 3 113 ? 17.122  12.162  28.242 1.00 14.86 ? 151  ALA P C   1 
ATOM   3179 O  O   . ALA C 3 113 ? 17.836  12.799  27.467 1.00 15.08 ? 151  ALA P O   1 
ATOM   3180 C  CB  . ALA C 3 113 ? 15.260  13.761  28.747 1.00 14.54 ? 151  ALA P CB  1 
ATOM   3181 N  N   . GLN C 3 114 ? 16.953  10.844  28.150 1.00 14.98 ? 152  GLN P N   1 
ATOM   3182 C  CA  . GLN C 3 114 ? 17.652  10.058  27.120 1.00 14.99 ? 152  GLN P CA  1 
ATOM   3183 C  C   . GLN C 3 114 ? 16.761  9.673   25.944 1.00 15.23 ? 152  GLN P C   1 
ATOM   3184 O  O   . GLN C 3 114 ? 17.087  8.783   25.146 1.00 14.91 ? 152  GLN P O   1 
ATOM   3185 C  CB  . GLN C 3 114 ? 18.353  8.830   27.723 1.00 14.70 ? 152  GLN P CB  1 
ATOM   3186 C  CG  . GLN C 3 114 ? 19.557  9.178   28.600 1.00 14.12 ? 152  GLN P CG  1 
ATOM   3187 C  CD  . GLN C 3 114 ? 20.576  10.063  27.901 1.00 13.69 ? 152  GLN P CD  1 
ATOM   3188 O  OE1 . GLN C 3 114 ? 21.250  9.637   26.965 1.00 13.86 ? 152  GLN P OE1 1 
ATOM   3189 N  NE2 . GLN C 3 114 ? 20.698  11.299  28.361 1.00 13.18 ? 152  GLN P NE2 1 
ATOM   3190 O  OXT . GLN C 3 114 ? 15.689  10.264  25.762 1.00 15.85 ? 152  GLN P OXT 1 
HETATM 3191 CA CA  . CA  D 4 .   ? 23.056  -2.844  34.546 1.00 61.17 ? 1448 CA  A CA  1 
HETATM 3192 CA CA  . CA  E 4 .   ? -8.816  8.016   12.751 1.00 30.46 ? 1334 CA  E CA  1 
HETATM 3193 CA CA  . CA  F 4 .   ? 11.565  29.798  7.910  1.00 92.27 ? 1335 CA  E CA  1 
HETATM 3194 O  O   . HOH G 5 .   ? 5.647   -2.761  10.982 1.00 33.79 ? 2001 HOH A O   1 
HETATM 3195 O  O   . HOH G 5 .   ? 9.062   -5.249  12.963 1.00 25.47 ? 2002 HOH A O   1 
HETATM 3196 O  O   . HOH G 5 .   ? 6.407   1.784   12.641 1.00 31.51 ? 2003 HOH A O   1 
HETATM 3197 O  O   . HOH G 5 .   ? 7.130   2.834   15.773 1.00 15.37 ? 2004 HOH A O   1 
HETATM 3198 O  O   . HOH G 5 .   ? 4.923   1.992   19.586 1.00 20.77 ? 2005 HOH A O   1 
HETATM 3199 O  O   . HOH G 5 .   ? 10.357  -3.332  9.879  1.00 39.94 ? 2006 HOH A O   1 
HETATM 3200 O  O   . HOH G 5 .   ? 12.996  -8.769  19.462 1.00 19.95 ? 2007 HOH A O   1 
HETATM 3201 O  O   . HOH G 5 .   ? 9.603   -10.887 15.552 1.00 44.59 ? 2008 HOH A O   1 
HETATM 3202 O  O   . HOH G 5 .   ? 7.083   12.069  35.206 1.00 30.26 ? 2009 HOH A O   1 
HETATM 3203 O  O   . HOH G 5 .   ? 4.121   20.266  35.519 1.00 41.80 ? 2010 HOH A O   1 
HETATM 3204 O  O   . HOH G 5 .   ? 3.261   15.684  35.338 1.00 29.51 ? 2011 HOH A O   1 
HETATM 3205 O  O   . HOH G 5 .   ? -1.824  16.589  32.837 1.00 36.09 ? 2012 HOH A O   1 
HETATM 3206 O  O   . HOH G 5 .   ? -10.983 9.437   19.795 1.00 39.58 ? 2013 HOH A O   1 
HETATM 3207 O  O   . HOH G 5 .   ? -9.938  9.294   17.027 1.00 28.42 ? 2014 HOH A O   1 
HETATM 3208 O  O   . HOH G 5 .   ? -5.199  5.998   21.627 1.00 39.82 ? 2015 HOH A O   1 
HETATM 3209 O  O   . HOH G 5 .   ? 1.608   5.747   22.838 1.00 17.11 ? 2016 HOH A O   1 
HETATM 3210 O  O   . HOH G 5 .   ? -8.477  12.073  26.118 1.00 37.40 ? 2017 HOH A O   1 
HETATM 3211 O  O   . HOH G 5 .   ? -6.028  -2.037  31.819 1.00 52.50 ? 2018 HOH A O   1 
HETATM 3212 O  O   . HOH G 5 .   ? -3.632  12.066  38.143 1.00 38.90 ? 2019 HOH A O   1 
HETATM 3213 O  O   . HOH G 5 .   ? 4.403   14.839  39.657 1.00 23.07 ? 2020 HOH A O   1 
HETATM 3214 O  O   . HOH G 5 .   ? 6.218   14.321  48.274 1.00 45.07 ? 2021 HOH A O   1 
HETATM 3215 O  O   . HOH G 5 .   ? 7.957   17.151  45.848 1.00 39.40 ? 2022 HOH A O   1 
HETATM 3216 O  O   . HOH G 5 .   ? 11.029  17.598  46.641 1.00 33.74 ? 2023 HOH A O   1 
HETATM 3217 O  O   . HOH G 5 .   ? 13.574  22.101  43.463 1.00 39.41 ? 2024 HOH A O   1 
HETATM 3218 O  O   . HOH G 5 .   ? 11.188  21.773  42.147 1.00 28.38 ? 2025 HOH A O   1 
HETATM 3219 O  O   . HOH G 5 .   ? 12.140  24.442  36.575 1.00 36.32 ? 2026 HOH A O   1 
HETATM 3220 O  O   . HOH G 5 .   ? 4.701   17.761  22.484 1.00 28.87 ? 2027 HOH A O   1 
HETATM 3221 O  O   . HOH G 5 .   ? 4.389   23.553  27.206 1.00 36.36 ? 2028 HOH A O   1 
HETATM 3222 O  O   . HOH G 5 .   ? 10.799  24.040  21.694 1.00 41.78 ? 2029 HOH A O   1 
HETATM 3223 O  O   . HOH G 5 .   ? 1.464   18.645  31.439 1.00 42.85 ? 2030 HOH A O   1 
HETATM 3224 O  O   . HOH G 5 .   ? 4.906   13.633  23.708 1.00 20.40 ? 2031 HOH A O   1 
HETATM 3225 O  O   . HOH G 5 .   ? 11.143  15.026  23.695 1.00 41.88 ? 2032 HOH A O   1 
HETATM 3226 O  O   . HOH G 5 .   ? -3.238  3.132   29.383 1.00 40.90 ? 2033 HOH A O   1 
HETATM 3227 O  O   . HOH G 5 .   ? -8.199  4.055   18.562 1.00 41.02 ? 2034 HOH A O   1 
HETATM 3228 O  O   . HOH G 5 .   ? 3.707   4.220   22.167 1.00 21.47 ? 2035 HOH A O   1 
HETATM 3229 O  O   . HOH G 5 .   ? -0.389  -5.399  25.985 1.00 28.63 ? 2036 HOH A O   1 
HETATM 3230 O  O   . HOH G 5 .   ? 2.419   -4.882  22.287 1.00 34.81 ? 2037 HOH A O   1 
HETATM 3231 O  O   . HOH G 5 .   ? -6.139  -1.072  26.877 1.00 39.11 ? 2038 HOH A O   1 
HETATM 3232 O  O   . HOH G 5 .   ? -1.886  4.374   38.647 1.00 52.77 ? 2039 HOH A O   1 
HETATM 3233 O  O   . HOH G 5 .   ? -2.110  3.636   46.450 1.00 51.35 ? 2040 HOH A O   1 
HETATM 3234 O  O   . HOH G 5 .   ? 8.983   18.919  32.496 1.00 22.71 ? 2041 HOH A O   1 
HETATM 3235 O  O   . HOH G 5 .   ? 15.984  16.355  39.264 1.00 20.79 ? 2042 HOH A O   1 
HETATM 3236 O  O   . HOH G 5 .   ? 11.181  17.873  27.329 1.00 25.26 ? 2043 HOH A O   1 
HETATM 3237 O  O   . HOH G 5 .   ? 17.807  23.411  31.993 1.00 31.90 ? 2044 HOH A O   1 
HETATM 3238 O  O   . HOH G 5 .   ? 24.070  21.265  30.762 1.00 36.42 ? 2045 HOH A O   1 
HETATM 3239 O  O   . HOH G 5 .   ? 16.604  18.985  41.021 1.00 37.88 ? 2046 HOH A O   1 
HETATM 3240 O  O   . HOH G 5 .   ? 15.964  19.878  47.458 1.00 27.46 ? 2047 HOH A O   1 
HETATM 3241 O  O   . HOH G 5 .   ? 17.716  19.003  44.760 1.00 31.49 ? 2048 HOH A O   1 
HETATM 3242 O  O   . HOH G 5 .   ? 12.980  11.980  54.092 1.00 48.49 ? 2049 HOH A O   1 
HETATM 3243 O  O   . HOH G 5 .   ? 10.580  12.341  49.717 1.00 32.22 ? 2050 HOH A O   1 
HETATM 3244 O  O   . HOH G 5 .   ? 10.021  -3.915  51.093 1.00 55.31 ? 2051 HOH A O   1 
HETATM 3245 O  O   . HOH G 5 .   ? 2.214   -6.378  49.532 1.00 46.19 ? 2052 HOH A O   1 
HETATM 3246 O  O   . HOH G 5 .   ? 36.849  4.021   20.766 1.00 42.33 ? 2053 HOH A O   1 
HETATM 3247 O  O   . HOH G 5 .   ? 34.093  2.335   39.767 1.00 54.16 ? 2054 HOH A O   1 
HETATM 3248 O  O   . HOH G 5 .   ? 30.394  9.570   42.165 1.00 32.39 ? 2055 HOH A O   1 
HETATM 3249 O  O   . HOH G 5 .   ? 28.783  2.806   47.369 1.00 42.49 ? 2056 HOH A O   1 
HETATM 3250 O  O   . HOH G 5 .   ? 27.696  2.968   44.592 1.00 38.10 ? 2057 HOH A O   1 
HETATM 3251 O  O   . HOH G 5 .   ? 25.963  0.434   44.003 1.00 51.33 ? 2058 HOH A O   1 
HETATM 3252 O  O   . HOH G 5 .   ? 13.190  -8.687  48.322 1.00 44.96 ? 2059 HOH A O   1 
HETATM 3253 O  O   . HOH G 5 .   ? 14.738  -5.538  52.109 1.00 42.10 ? 2060 HOH A O   1 
HETATM 3254 O  O   . HOH G 5 .   ? 8.816   -8.037  41.687 1.00 33.44 ? 2061 HOH A O   1 
HETATM 3255 O  O   . HOH G 5 .   ? 8.521   -4.911  44.607 1.00 44.59 ? 2062 HOH A O   1 
HETATM 3256 O  O   . HOH G 5 .   ? 16.018  -3.980  39.404 1.00 25.88 ? 2063 HOH A O   1 
HETATM 3257 O  O   . HOH G 5 .   ? 21.319  5.791   32.754 1.00 9.28  ? 2064 HOH A O   1 
HETATM 3258 O  O   . HOH G 5 .   ? 23.379  12.305  21.564 1.00 35.15 ? 2065 HOH A O   1 
HETATM 3259 O  O   . HOH G 5 .   ? 19.735  12.399  24.461 1.00 34.36 ? 2066 HOH A O   1 
HETATM 3260 O  O   . HOH G 5 .   ? 30.707  10.215  23.615 1.00 42.65 ? 2067 HOH A O   1 
HETATM 3261 O  O   . HOH G 5 .   ? 20.094  -10.740 38.783 1.00 47.71 ? 2068 HOH A O   1 
HETATM 3262 O  O   . HOH G 5 .   ? 33.603  9.889   28.005 1.00 43.35 ? 2069 HOH A O   1 
HETATM 3263 O  O   . HOH G 5 .   ? 34.128  4.716   23.886 1.00 37.00 ? 2070 HOH A O   1 
HETATM 3264 O  O   . HOH G 5 .   ? 29.054  -0.611  29.749 1.00 24.57 ? 2071 HOH A O   1 
HETATM 3265 O  O   . HOH G 5 .   ? 31.465  1.632   36.424 1.00 39.86 ? 2072 HOH A O   1 
HETATM 3266 O  O   . HOH G 5 .   ? 29.668  12.344  27.295 1.00 41.02 ? 2073 HOH A O   1 
HETATM 3267 O  O   . HOH G 5 .   ? 29.760  -0.315  38.126 1.00 46.54 ? 2074 HOH A O   1 
HETATM 3268 O  O   . HOH G 5 .   ? 26.389  -3.650  35.565 1.00 42.06 ? 2075 HOH A O   1 
HETATM 3269 O  O   . HOH G 5 .   ? 17.184  2.586   10.352 1.00 34.89 ? 2076 HOH A O   1 
HETATM 3270 O  O   . HOH G 5 .   ? 14.131  -2.770  7.392  1.00 38.39 ? 2077 HOH A O   1 
HETATM 3271 O  O   . HOH G 5 .   ? 15.520  -3.908  16.991 1.00 21.39 ? 2078 HOH A O   1 
HETATM 3272 O  O   . HOH G 5 .   ? 16.570  -7.448  11.397 1.00 16.39 ? 2079 HOH A O   1 
HETATM 3273 O  O   . HOH G 5 .   ? 25.881  -2.439  13.175 1.00 39.09 ? 2080 HOH A O   1 
HETATM 3274 O  O   . HOH G 5 .   ? 23.664  1.910   12.908 1.00 33.72 ? 2081 HOH A O   1 
HETATM 3275 O  O   . HOH G 5 .   ? 25.936  -7.581  30.237 1.00 32.65 ? 2082 HOH A O   1 
HETATM 3276 O  O   . HOH G 5 .   ? 24.033  -11.849 28.872 1.00 31.98 ? 2083 HOH A O   1 
HETATM 3277 O  O   . HOH G 5 .   ? 20.120  4.000   13.609 1.00 22.60 ? 2084 HOH A O   1 
HETATM 3278 O  O   . HOH G 5 .   ? 12.016  9.645   15.010 1.00 35.32 ? 2085 HOH A O   1 
HETATM 3279 O  O   . HOH G 5 .   ? 12.195  3.243   10.980 1.00 23.66 ? 2086 HOH A O   1 
HETATM 3280 O  O   . HOH G 5 .   ? 5.221   15.943  20.318 1.00 32.56 ? 2087 HOH A O   1 
HETATM 3281 O  O   . HOH G 5 .   ? -6.053  18.310  22.916 1.00 32.64 ? 2088 HOH A O   1 
HETATM 3282 O  O   . HOH G 5 .   ? -7.168  16.086  20.465 1.00 39.76 ? 2089 HOH A O   1 
HETATM 3283 O  O   . HOH G 5 .   ? -9.037  14.756  17.457 1.00 35.23 ? 2090 HOH A O   1 
HETATM 3284 O  O   . HOH G 5 .   ? 9.752   13.115  14.631 1.00 35.42 ? 2091 HOH A O   1 
HETATM 3285 O  O   . HOH G 5 .   ? 13.709  11.667  18.989 1.00 23.92 ? 2092 HOH A O   1 
HETATM 3286 O  O   . HOH G 5 .   ? 17.268  11.173  21.668 1.00 38.96 ? 2093 HOH A O   1 
HETATM 3287 O  O   . HOH G 5 .   ? 13.903  10.128  23.487 1.00 29.96 ? 2094 HOH A O   1 
HETATM 3288 O  O   . HOH G 5 .   ? 17.761  -11.013 42.806 1.00 44.99 ? 2095 HOH A O   1 
HETATM 3289 O  O   . HOH G 5 .   ? 19.291  -12.923 36.933 1.00 60.52 ? 2096 HOH A O   1 
HETATM 3290 O  O   . HOH G 5 .   ? 13.914  -18.300 36.354 1.00 58.88 ? 2097 HOH A O   1 
HETATM 3291 O  O   . HOH G 5 .   ? 13.218  -10.113 26.418 1.00 25.92 ? 2098 HOH A O   1 
HETATM 3292 O  O   . HOH G 5 .   ? 21.673  -15.970 26.470 1.00 46.00 ? 2099 HOH A O   1 
HETATM 3293 O  O   . HOH G 5 .   ? 11.913  -13.221 19.431 1.00 38.68 ? 2100 HOH A O   1 
HETATM 3294 O  O   . HOH G 5 .   ? 17.003  -15.697 19.068 1.00 28.79 ? 2101 HOH A O   1 
HETATM 3295 O  O   . HOH G 5 .   ? 19.646  -16.238 15.539 1.00 44.77 ? 2102 HOH A O   1 
HETATM 3296 O  O   . HOH G 5 .   ? 23.656  -16.178 14.330 1.00 34.63 ? 2103 HOH A O   1 
HETATM 3297 O  O   . HOH G 5 .   ? 25.184  -3.307  10.237 1.00 32.65 ? 2104 HOH A O   1 
HETATM 3298 O  O   . HOH G 5 .   ? 27.918  -10.472 19.538 1.00 33.56 ? 2105 HOH A O   1 
HETATM 3299 O  O   . HOH G 5 .   ? 29.214  -7.625  13.161 1.00 26.10 ? 2106 HOH A O   1 
HETATM 3300 O  O   . HOH G 5 .   ? 30.697  -12.095 14.744 1.00 46.37 ? 2107 HOH A O   1 
HETATM 3301 O  O   . HOH G 5 .   ? 30.780  2.782   18.517 1.00 33.36 ? 2108 HOH A O   1 
HETATM 3302 O  O   . HOH G 5 .   ? 37.453  -0.409  17.466 1.00 39.68 ? 2109 HOH A O   1 
HETATM 3303 O  O   . HOH G 5 .   ? 35.607  -7.448  22.223 1.00 36.95 ? 2110 HOH A O   1 
HETATM 3304 O  O   . HOH G 5 .   ? 36.595  1.226   23.823 1.00 36.13 ? 2111 HOH A O   1 
HETATM 3305 O  O   . HOH G 5 .   ? 32.360  -2.266  28.985 1.00 33.94 ? 2112 HOH A O   1 
HETATM 3306 O  O   . HOH G 5 .   ? 28.225  -11.096 23.855 1.00 38.82 ? 2113 HOH A O   1 
HETATM 3307 O  O   . HOH G 5 .   ? 28.421  -8.132  21.089 1.00 27.92 ? 2114 HOH A O   1 
HETATM 3308 O  O   . HOH G 5 .   ? 20.599  -9.923  18.946 1.00 21.91 ? 2115 HOH A O   1 
HETATM 3309 O  O   . HOH G 5 .   ? 25.580  -12.113 23.843 1.00 29.31 ? 2116 HOH A O   1 
HETATM 3310 O  O   . HOH G 5 .   ? 10.223  -14.316 23.028 1.00 38.01 ? 2117 HOH A O   1 
HETATM 3311 O  O   . HOH H 5 .   ? -4.444  3.147   8.094  1.00 41.85 ? 2001 HOH E O   1 
HETATM 3312 O  O   . HOH H 5 .   ? -12.561 15.046  14.341 1.00 32.30 ? 2002 HOH E O   1 
HETATM 3313 O  O   . HOH H 5 .   ? -10.400 4.114   -1.029 1.00 58.00 ? 2003 HOH E O   1 
HETATM 3314 O  O   . HOH H 5 .   ? -5.878  6.713   4.804  1.00 35.79 ? 2004 HOH E O   1 
HETATM 3315 O  O   . HOH H 5 .   ? -12.864 7.189   2.224  1.00 19.01 ? 2005 HOH E O   1 
HETATM 3316 O  O   . HOH H 5 .   ? -12.423 13.591  -0.334 1.00 14.00 ? 2006 HOH E O   1 
HETATM 3317 O  O   . HOH H 5 .   ? -15.147 8.591   4.705  1.00 22.42 ? 2007 HOH E O   1 
HETATM 3318 O  O   . HOH H 5 .   ? -16.549 6.008   7.492  1.00 33.90 ? 2008 HOH E O   1 
HETATM 3319 O  O   . HOH H 5 .   ? -13.984 3.505   4.602  1.00 40.56 ? 2009 HOH E O   1 
HETATM 3320 O  O   . HOH H 5 .   ? -10.269 6.698   11.271 1.00 33.97 ? 2010 HOH E O   1 
HETATM 3321 O  O   . HOH H 5 .   ? -15.677 3.474   8.507  1.00 40.05 ? 2011 HOH E O   1 
HETATM 3322 O  O   . HOH H 5 .   ? -14.667 6.854   17.539 1.00 48.45 ? 2012 HOH E O   1 
HETATM 3323 O  O   . HOH H 5 .   ? -10.085 7.216   14.874 1.00 31.07 ? 2013 HOH E O   1 
HETATM 3324 O  O   . HOH H 5 .   ? -3.814  1.270   11.547 1.00 44.51 ? 2014 HOH E O   1 
HETATM 3325 O  O   . HOH H 5 .   ? -8.774  5.593   7.072  1.00 27.16 ? 2015 HOH E O   1 
HETATM 3326 O  O   . HOH H 5 .   ? -2.170  5.453   6.608  1.00 50.75 ? 2016 HOH E O   1 
HETATM 3327 O  O   . HOH H 5 .   ? 7.721   4.606   11.822 1.00 34.54 ? 2017 HOH E O   1 
HETATM 3328 O  O   . HOH H 5 .   ? 3.073   5.496   5.487  1.00 34.19 ? 2018 HOH E O   1 
HETATM 3329 O  O   . HOH H 5 .   ? 4.026   1.455   11.349 1.00 25.30 ? 2019 HOH E O   1 
HETATM 3330 O  O   . HOH H 5 .   ? 6.891   12.370  5.306  1.00 45.42 ? 2020 HOH E O   1 
HETATM 3331 O  O   . HOH H 5 .   ? 7.295   10.239  11.787 1.00 42.99 ? 2021 HOH E O   1 
HETATM 3332 O  O   . HOH H 5 .   ? 6.542   9.182   8.708  1.00 28.56 ? 2022 HOH E O   1 
HETATM 3333 O  O   . HOH H 5 .   ? 11.435  20.522  13.528 1.00 48.45 ? 2023 HOH E O   1 
HETATM 3334 O  O   . HOH H 5 .   ? 7.297   12.116  14.064 1.00 26.53 ? 2024 HOH E O   1 
HETATM 3335 O  O   . HOH H 5 .   ? -8.646  5.500   16.456 1.00 18.72 ? 2025 HOH E O   1 
HETATM 3336 O  O   . HOH H 5 .   ? -12.914 13.790  12.184 1.00 26.71 ? 2026 HOH E O   1 
HETATM 3337 O  O   . HOH H 5 .   ? -10.855 13.823  7.257  1.00 40.11 ? 2027 HOH E O   1 
HETATM 3338 O  O   . HOH H 5 .   ? -12.375 13.942  9.686  1.00 34.57 ? 2028 HOH E O   1 
HETATM 3339 O  O   . HOH H 5 .   ? -6.862  15.693  6.920  1.00 34.24 ? 2029 HOH E O   1 
HETATM 3340 O  O   . HOH H 5 .   ? -7.628  17.773  8.603  1.00 27.32 ? 2030 HOH E O   1 
HETATM 3341 O  O   . HOH H 5 .   ? -2.869  16.428  6.536  1.00 27.38 ? 2031 HOH E O   1 
HETATM 3342 O  O   . HOH H 5 .   ? 3.670   16.277  9.698  1.00 25.57 ? 2032 HOH E O   1 
HETATM 3343 O  O   . HOH H 5 .   ? -0.433  22.031  10.811 1.00 32.43 ? 2033 HOH E O   1 
HETATM 3344 O  O   . HOH H 5 .   ? 0.327   19.901  1.820  1.00 42.34 ? 2034 HOH E O   1 
HETATM 3345 O  O   . HOH H 5 .   ? 2.456   13.102  -0.399 1.00 45.98 ? 2035 HOH E O   1 
HETATM 3346 O  O   . HOH H 5 .   ? 0.240   16.542  -3.417 1.00 44.17 ? 2036 HOH E O   1 
HETATM 3347 O  O   . HOH H 5 .   ? -1.144  13.048  -0.186 1.00 46.65 ? 2037 HOH E O   1 
HETATM 3348 O  O   . HOH H 5 .   ? -3.571  20.059  0.659  1.00 33.21 ? 2038 HOH E O   1 
HETATM 3349 O  O   . HOH H 5 .   ? -0.178  8.778   3.002  1.00 44.82 ? 2039 HOH E O   1 
HETATM 3350 O  O   . HOH H 5 .   ? -3.412  14.065  5.624  1.00 45.76 ? 2040 HOH E O   1 
HETATM 3351 O  O   . HOH H 5 .   ? 10.702  15.112  -2.171 1.00 41.25 ? 2041 HOH E O   1 
HETATM 3352 O  O   . HOH I 5 .   ? 34.902  5.395   50.848 1.00 33.78 ? 2001 HOH P O   1 
HETATM 3353 O  O   . HOH I 5 .   ? 38.818  11.641  48.665 1.00 31.15 ? 2002 HOH P O   1 
HETATM 3354 O  O   . HOH I 5 .   ? 33.517  5.542   43.388 1.00 48.51 ? 2003 HOH P O   1 
HETATM 3355 O  O   . HOH I 5 .   ? 33.079  10.542  38.703 1.00 51.18 ? 2004 HOH P O   1 
HETATM 3356 O  O   . HOH I 5 .   ? 35.882  11.503  42.109 1.00 34.90 ? 2005 HOH P O   1 
HETATM 3357 O  O   . HOH I 5 .   ? 36.476  13.893  38.536 1.00 38.37 ? 2006 HOH P O   1 
HETATM 3358 O  O   . HOH I 5 .   ? 31.291  11.199  36.756 1.00 32.31 ? 2007 HOH P O   1 
HETATM 3359 O  O   . HOH I 5 .   ? 34.244  13.571  30.561 1.00 47.79 ? 2008 HOH P O   1 
HETATM 3360 O  O   . HOH I 5 .   ? 33.721  18.306  28.807 1.00 52.11 ? 2009 HOH P O   1 
HETATM 3361 O  O   . HOH I 5 .   ? 36.023  20.813  36.671 1.00 26.59 ? 2010 HOH P O   1 
HETATM 3362 O  O   . HOH I 5 .   ? 33.563  24.100  35.899 1.00 32.50 ? 2011 HOH P O   1 
HETATM 3363 O  O   . HOH I 5 .   ? 37.928  21.145  35.050 1.00 40.76 ? 2012 HOH P O   1 
HETATM 3364 O  O   . HOH I 5 .   ? 23.618  16.663  27.259 1.00 29.31 ? 2013 HOH P O   1 
HETATM 3365 O  O   . HOH I 5 .   ? 25.809  24.930  41.106 1.00 43.26 ? 2014 HOH P O   1 
HETATM 3366 O  O   . HOH I 5 .   ? 23.273  23.063  42.820 1.00 47.05 ? 2015 HOH P O   1 
HETATM 3367 O  O   . HOH I 5 .   ? 24.715  24.759  45.192 1.00 28.61 ? 2016 HOH P O   1 
HETATM 3368 O  O   . HOH I 5 .   ? 28.378  1.534   55.201 1.00 34.34 ? 2017 HOH P O   1 
HETATM 3369 O  O   . HOH I 5 .   ? 27.202  3.919   61.775 1.00 46.84 ? 2018 HOH P O   1 
HETATM 3370 O  O   . HOH I 5 .   ? 16.520  7.530   64.882 1.00 35.33 ? 2019 HOH P O   1 
HETATM 3371 O  O   . HOH I 5 .   ? 14.676  15.181  59.661 1.00 30.49 ? 2020 HOH P O   1 
HETATM 3372 O  O   . HOH I 5 .   ? 18.803  18.413  60.620 1.00 34.69 ? 2021 HOH P O   1 
HETATM 3373 O  O   . HOH I 5 .   ? 23.967  10.040  68.044 1.00 43.04 ? 2022 HOH P O   1 
HETATM 3374 O  O   . HOH I 5 .   ? 19.524  24.518  57.204 1.00 29.10 ? 2023 HOH P O   1 
HETATM 3375 O  O   . HOH I 5 .   ? 24.175  26.380  64.283 1.00 37.07 ? 2024 HOH P O   1 
HETATM 3376 O  O   . HOH I 5 .   ? 34.149  18.154  61.294 1.00 17.80 ? 2025 HOH P O   1 
HETATM 3377 O  O   . HOH I 5 .   ? 32.584  31.837  66.546 1.00 32.29 ? 2026 HOH P O   1 
HETATM 3378 O  O   . HOH I 5 .   ? 37.145  25.673  57.490 1.00 27.74 ? 2027 HOH P O   1 
HETATM 3379 O  O   . HOH I 5 .   ? 34.553  33.192  56.627 1.00 31.21 ? 2028 HOH P O   1 
HETATM 3380 O  O   . HOH I 5 .   ? 38.288  19.977  59.777 1.00 29.72 ? 2029 HOH P O   1 
HETATM 3381 O  O   . HOH I 5 .   ? 26.406  26.987  59.385 1.00 20.43 ? 2030 HOH P O   1 
HETATM 3382 O  O   . HOH I 5 .   ? 21.599  33.093  51.804 1.00 39.50 ? 2031 HOH P O   1 
HETATM 3383 O  O   . HOH I 5 .   ? 14.063  17.240  55.400 1.00 35.77 ? 2032 HOH P O   1 
HETATM 3384 O  O   . HOH I 5 .   ? 19.261  9.123   57.870 1.00 35.63 ? 2033 HOH P O   1 
HETATM 3385 O  O   . HOH I 5 .   ? 16.170  7.609   52.148 1.00 46.25 ? 2034 HOH P O   1 
HETATM 3386 O  O   . HOH I 5 .   ? 21.532  2.619   50.117 1.00 44.04 ? 2035 HOH P O   1 
HETATM 3387 O  O   . HOH I 5 .   ? 33.488  29.300  48.534 1.00 31.67 ? 2036 HOH P O   1 
HETATM 3388 O  O   . HOH I 5 .   ? 31.954  26.070  46.402 1.00 27.21 ? 2037 HOH P O   1 
HETATM 3389 O  O   . HOH I 5 .   ? 36.212  31.569  51.204 1.00 45.03 ? 2038 HOH P O   1 
HETATM 3390 O  O   . HOH I 5 .   ? 36.416  25.254  47.829 1.00 25.86 ? 2039 HOH P O   1 
HETATM 3391 O  O   . HOH I 5 .   ? 36.838  22.364  55.817 1.00 24.15 ? 2040 HOH P O   1 
HETATM 3392 O  O   . HOH I 5 .   ? 34.532  12.107  63.660 1.00 35.12 ? 2041 HOH P O   1 
HETATM 3393 O  O   . HOH I 5 .   ? 37.899  13.304  63.153 1.00 52.09 ? 2042 HOH P O   1 
HETATM 3394 O  O   . HOH I 5 .   ? 34.449  10.570  59.112 1.00 30.21 ? 2043 HOH P O   1 
HETATM 3395 O  O   . HOH I 5 .   ? 26.053  10.952  66.134 1.00 45.12 ? 2044 HOH P O   1 
HETATM 3396 O  O   . HOH I 5 .   ? 33.994  5.415   55.346 1.00 52.21 ? 2045 HOH P O   1 
HETATM 3397 O  O   . HOH I 5 .   ? 29.755  2.254   50.872 1.00 35.37 ? 2046 HOH P O   1 
HETATM 3398 O  O   . HOH I 5 .   ? 26.678  3.592   49.408 1.00 42.01 ? 2047 HOH P O   1 
HETATM 3399 O  O   . HOH I 5 .   ? 29.744  16.628  40.517 1.00 25.85 ? 2048 HOH P O   1 
HETATM 3400 O  O   . HOH I 5 .   ? 32.583  21.467  45.038 1.00 34.72 ? 2049 HOH P O   1 
HETATM 3401 O  O   . HOH I 5 .   ? 21.444  21.022  42.852 1.00 24.05 ? 2050 HOH P O   1 
HETATM 3402 O  O   . HOH I 5 .   ? 26.457  13.608  41.526 1.00 37.58 ? 2051 HOH P O   1 
HETATM 3403 O  O   . HOH I 5 .   ? 25.934  13.856  36.098 1.00 28.77 ? 2052 HOH P O   1 
HETATM 3404 O  O   . HOH I 5 .   ? 18.254  15.983  27.099 1.00 33.50 ? 2053 HOH P O   1 
HETATM 3405 O  O   . HOH I 5 .   ? 15.840  13.417  24.624 1.00 37.65 ? 2054 HOH P O   1 
HETATM 3406 O  O   . HOH I 5 .   ? 31.524  23.560  36.992 1.00 24.37 ? 2055 HOH P O   1 
HETATM 3407 O  O   . HOH I 5 .   ? 15.103  19.896  56.274 1.00 41.40 ? 2056 HOH P O   1 
HETATM 3408 O  O   . HOH I 5 .   ? 18.144  6.599   58.199 1.00 33.73 ? 2057 HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   153 153 SER SER A . n 
A 1 2   ILE 2   154 154 ILE ILE A . n 
A 1 3   PRO 3   155 155 PRO PRO A . n 
A 1 4   TRP 4   156 156 TRP TRP A . n 
A 1 5   ASN 5   157 157 ASN ASN A . n 
A 1 6   LEU 6   158 158 LEU LEU A . n 
A 1 7   GLU 7   159 159 GLU GLU A . n 
A 1 8   ARG 8   160 160 ARG ARG A . n 
A 1 9   ILE 9   161 161 ILE ILE A . n 
A 1 10  THR 10  162 162 THR THR A . n 
A 1 11  PRO 11  163 163 PRO PRO A . n 
A 1 12  PRO 12  164 164 PRO PRO A . n 
A 1 13  ARG 13  165 165 ARG ARG A . n 
A 1 14  TYR 14  166 ?   ?   ?   A . n 
A 1 15  ARG 15  167 ?   ?   ?   A . n 
A 1 16  ALA 16  168 ?   ?   ?   A . n 
A 1 17  ASP 17  169 ?   ?   ?   A . n 
A 1 18  GLU 18  170 ?   ?   ?   A . n 
A 1 19  TYR 19  171 ?   ?   ?   A . n 
A 1 20  GLN 20  172 ?   ?   ?   A . n 
A 1 21  PRO 21  173 ?   ?   ?   A . n 
A 1 22  PRO 22  174 ?   ?   ?   A . n 
A 1 23  ASP 23  175 ?   ?   ?   A . n 
A 1 24  GLY 24  176 176 GLY GLY A . n 
A 1 25  GLY 25  177 177 GLY GLY A . n 
A 1 26  SER 26  178 178 SER SER A . n 
A 1 27  LEU 27  179 179 LEU LEU A . n 
A 1 28  VAL 28  180 180 VAL VAL A . n 
A 1 29  GLU 29  181 181 GLU GLU A . n 
A 1 30  VAL 30  182 182 VAL VAL A . n 
A 1 31  TYR 31  183 183 TYR TYR A . n 
A 1 32  LEU 32  184 184 LEU LEU A . n 
A 1 33  LEU 33  185 185 LEU LEU A . n 
A 1 34  ASP 34  186 186 ASP ASP A . n 
A 1 35  THR 35  187 187 THR THR A . n 
A 1 36  SER 36  188 188 SER SER A . n 
A 1 37  ILE 37  189 189 ILE ILE A . n 
A 1 38  GLN 38  190 190 GLN GLN A . n 
A 1 39  SER 39  191 191 SER SER A . n 
A 1 40  ASP 40  192 192 ASP ASP A . n 
A 1 41  HIS 41  193 193 HIS HIS A . n 
A 1 42  ARG 42  194 194 ARG ARG A . n 
A 1 43  GLU 43  195 195 GLU GLU A . n 
A 1 44  ILE 44  196 196 ILE ILE A . n 
A 1 45  GLU 45  197 197 GLU GLU A . n 
A 1 46  GLY 46  198 198 GLY GLY A . n 
A 1 47  ARG 47  199 199 ARG ARG A . n 
A 1 48  VAL 48  200 200 VAL VAL A . n 
A 1 49  MET 49  201 201 MET MET A . n 
A 1 50  VAL 50  202 202 VAL VAL A . n 
A 1 51  THR 51  203 203 THR THR A . n 
A 1 52  ASP 52  204 204 ASP ASP A . n 
A 1 53  PHE 53  205 205 PHE PHE A . n 
A 1 54  GLU 54  206 206 GLU GLU A . n 
A 1 55  ASN 55  207 207 ASN ASN A . n 
A 1 56  VAL 56  208 208 VAL VAL A . n 
A 1 57  PRO 57  209 209 PRO PRO A . n 
A 1 58  GLU 58  210 210 GLU GLU A . n 
A 1 59  GLU 59  211 211 GLU GLU A . n 
A 1 60  ASP 60  212 212 ASP ASP A . n 
A 1 61  GLY 61  213 ?   ?   ?   A . n 
A 1 62  THR 62  214 ?   ?   ?   A . n 
A 1 63  ARG 63  215 ?   ?   ?   A . n 
A 1 64  PHE 64  216 ?   ?   ?   A . n 
A 1 65  HIS 65  217 ?   ?   ?   A . n 
A 1 66  ARG 66  218 ?   ?   ?   A . n 
A 1 67  GLN 67  219 ?   ?   ?   A . n 
A 1 68  ALA 68  220 ?   ?   ?   A . n 
A 1 69  SER 69  221 221 SER SER A . n 
A 1 70  LYS 70  222 222 LYS LYS A . n 
A 1 71  CYS 71  223 223 CYS CYS A . n 
A 1 72  ASP 72  224 224 ASP ASP A . n 
A 1 73  SER 73  225 225 SER SER A . n 
A 1 74  HIS 74  226 226 HIS HIS A . n 
A 1 75  GLY 75  227 227 GLY GLY A . n 
A 1 76  THR 76  228 228 THR THR A . n 
A 1 77  HIS 77  229 229 HIS HIS A . n 
A 1 78  LEU 78  230 230 LEU LEU A . n 
A 1 79  ALA 79  231 231 ALA ALA A . n 
A 1 80  GLY 80  232 232 GLY GLY A . n 
A 1 81  VAL 81  233 233 VAL VAL A . n 
A 1 82  VAL 82  234 234 VAL VAL A . n 
A 1 83  SER 83  235 235 SER SER A . n 
A 1 84  GLY 84  236 236 GLY GLY A . n 
A 1 85  ARG 85  237 237 ARG ARG A . n 
A 1 86  ASP 86  238 238 ASP ASP A . n 
A 1 87  ALA 87  239 239 ALA ALA A . n 
A 1 88  GLY 88  240 240 GLY GLY A . n 
A 1 89  VAL 89  241 241 VAL VAL A . n 
A 1 90  ALA 90  242 242 ALA ALA A . n 
A 1 91  LYS 91  243 243 LYS LYS A . n 
A 1 92  GLY 92  244 244 GLY GLY A . n 
A 1 93  ALA 93  245 245 ALA ALA A . n 
A 1 94  SER 94  246 246 SER SER A . n 
A 1 95  MET 95  247 247 MET MET A . n 
A 1 96  ARG 96  248 248 ARG ARG A . n 
A 1 97  SER 97  249 249 SER SER A . n 
A 1 98  LEU 98  250 250 LEU LEU A . n 
A 1 99  ARG 99  251 251 ARG ARG A . n 
A 1 100 VAL 100 252 252 VAL VAL A . n 
A 1 101 LEU 101 253 253 LEU LEU A . n 
A 1 102 ASN 102 254 254 ASN ASN A . n 
A 1 103 CYS 103 255 255 CYS CYS A . n 
A 1 104 GLN 104 256 256 GLN GLN A . n 
A 1 105 GLY 105 257 257 GLY GLY A . n 
A 1 106 LYS 106 258 258 LYS LYS A . n 
A 1 107 GLY 107 259 259 GLY GLY A . n 
A 1 108 THR 108 260 260 THR THR A . n 
A 1 109 VAL 109 261 261 VAL VAL A . n 
A 1 110 SER 110 262 262 SER SER A . n 
A 1 111 GLY 111 263 263 GLY GLY A . n 
A 1 112 THR 112 264 264 THR THR A . n 
A 1 113 LEU 113 265 265 LEU LEU A . n 
A 1 114 ILE 114 266 266 ILE ILE A . n 
A 1 115 GLY 115 267 267 GLY GLY A . n 
A 1 116 LEU 116 268 268 LEU LEU A . n 
A 1 117 GLU 117 269 269 GLU GLU A . n 
A 1 118 PHE 118 270 270 PHE PHE A . n 
A 1 119 ILE 119 271 271 ILE ILE A . n 
A 1 120 ARG 120 272 272 ARG ARG A . n 
A 1 121 LYS 121 273 273 LYS LYS A . n 
A 1 122 SER 122 274 274 SER SER A . n 
A 1 123 GLN 123 275 275 GLN GLN A . n 
A 1 124 LEU 124 276 276 LEU LEU A . n 
A 1 125 VAL 125 277 277 VAL VAL A . n 
A 1 126 GLN 126 278 278 GLN GLN A . n 
A 1 127 PRO 127 279 279 PRO PRO A . n 
A 1 128 VAL 128 280 280 VAL VAL A . n 
A 1 129 GLY 129 281 281 GLY GLY A . n 
A 1 130 PRO 130 282 282 PRO PRO A . n 
A 1 131 LEU 131 283 283 LEU LEU A . n 
A 1 132 VAL 132 284 284 VAL VAL A . n 
A 1 133 VAL 133 285 285 VAL VAL A . n 
A 1 134 LEU 134 286 286 LEU LEU A . n 
A 1 135 LEU 135 287 287 LEU LEU A . n 
A 1 136 PRO 136 288 288 PRO PRO A . n 
A 1 137 LEU 137 289 289 LEU LEU A . n 
A 1 138 ALA 138 290 290 ALA ALA A . n 
A 1 139 GLY 139 291 291 GLY GLY A . n 
A 1 140 GLY 140 292 292 GLY GLY A . n 
A 1 141 TYR 141 293 293 TYR TYR A . n 
A 1 142 SER 142 294 294 SER SER A . n 
A 1 143 ARG 143 295 295 ARG ARG A . n 
A 1 144 VAL 144 296 296 VAL VAL A . n 
A 1 145 LEU 145 297 297 LEU LEU A . n 
A 1 146 ASN 146 298 298 ASN ASN A . n 
A 1 147 ALA 147 299 299 ALA ALA A . n 
A 1 148 ALA 148 300 300 ALA ALA A . n 
A 1 149 CYS 149 301 301 CYS CYS A . n 
A 1 150 GLN 150 302 302 GLN GLN A . n 
A 1 151 ARG 151 303 303 ARG ARG A . n 
A 1 152 LEU 152 304 304 LEU LEU A . n 
A 1 153 ALA 153 305 305 ALA ALA A . n 
A 1 154 ARG 154 306 306 ARG ARG A . n 
A 1 155 ALA 155 307 307 ALA ALA A . n 
A 1 156 GLY 156 308 308 GLY GLY A . n 
A 1 157 VAL 157 309 309 VAL VAL A . n 
A 1 158 VAL 158 310 310 VAL VAL A . n 
A 1 159 LEU 159 311 311 LEU LEU A . n 
A 1 160 VAL 160 312 312 VAL VAL A . n 
A 1 161 THR 161 313 313 THR THR A . n 
A 1 162 ALA 162 314 314 ALA ALA A . n 
A 1 163 ALA 163 315 315 ALA ALA A . n 
A 1 164 GLY 164 316 316 GLY GLY A . n 
A 1 165 ASN 165 317 317 ASN ASN A . n 
A 1 166 PHE 166 318 318 PHE PHE A . n 
A 1 167 ARG 167 319 319 ARG ARG A . n 
A 1 168 ASP 168 320 320 ASP ASP A . n 
A 1 169 ASP 169 321 321 ASP ASP A . n 
A 1 170 ALA 170 322 322 ALA ALA A . n 
A 1 171 CYS 171 323 323 CYS CYS A . n 
A 1 172 LEU 172 324 324 LEU LEU A . n 
A 1 173 TYR 173 325 325 TYR TYR A . n 
A 1 174 SER 174 326 326 SER SER A . n 
A 1 175 PRO 175 327 327 PRO PRO A . n 
A 1 176 ALA 176 328 328 ALA ALA A . n 
A 1 177 SER 177 329 329 SER SER A . n 
A 1 178 ALA 178 330 330 ALA ALA A . n 
A 1 179 PRO 179 331 331 PRO PRO A . n 
A 1 180 GLU 180 332 332 GLU GLU A . n 
A 1 181 VAL 181 333 333 VAL VAL A . n 
A 1 182 ILE 182 334 334 ILE ILE A . n 
A 1 183 THR 183 335 335 THR THR A . n 
A 1 184 VAL 184 336 336 VAL VAL A . n 
A 1 185 GLY 185 337 337 GLY GLY A . n 
A 1 186 ALA 186 338 338 ALA ALA A . n 
A 1 187 THR 187 339 339 THR THR A . n 
A 1 188 ASN 188 340 340 ASN ASN A . n 
A 1 189 ALA 189 341 341 ALA ALA A . n 
A 1 190 GLN 190 342 342 GLN GLN A . n 
A 1 191 ASP 191 343 343 ASP ASP A . n 
A 1 192 GLN 192 344 344 GLN GLN A . n 
A 1 193 PRO 193 345 345 PRO PRO A . n 
A 1 194 VAL 194 346 346 VAL VAL A . n 
A 1 195 THR 195 347 347 THR THR A . n 
A 1 196 LEU 196 348 348 LEU LEU A . n 
A 1 197 GLY 197 349 349 GLY GLY A . n 
A 1 198 THR 198 350 350 THR THR A . n 
A 1 199 LEU 199 351 351 LEU LEU A . n 
A 1 200 GLY 200 352 352 GLY GLY A . n 
A 1 201 THR 201 353 353 THR THR A . n 
A 1 202 ASN 202 354 354 ASN ASN A . n 
A 1 203 PHE 203 355 355 PHE PHE A . n 
A 1 204 GLY 204 356 356 GLY GLY A . n 
A 1 205 ARG 205 357 357 ARG ARG A . n 
A 1 206 CYS 206 358 358 CYS CYS A . n 
A 1 207 VAL 207 359 359 VAL VAL A . n 
A 1 208 ASP 208 360 360 ASP ASP A . n 
A 1 209 LEU 209 361 361 LEU LEU A . n 
A 1 210 PHE 210 362 362 PHE PHE A . n 
A 1 211 ALA 211 363 363 ALA ALA A . n 
A 1 212 PRO 212 364 364 PRO PRO A . n 
A 1 213 GLY 213 365 365 GLY GLY A . n 
A 1 214 GLU 214 366 366 GLU GLU A . n 
A 1 215 ASP 215 367 367 ASP ASP A . n 
A 1 216 ILE 216 368 368 ILE ILE A . n 
A 1 217 ILE 217 369 369 ILE ILE A . n 
A 1 218 GLY 218 370 370 GLY GLY A . n 
A 1 219 ALA 219 371 371 ALA ALA A . n 
A 1 220 SER 220 372 372 SER SER A . n 
A 1 221 SER 221 373 373 SER SER A . n 
A 1 222 ASP 222 374 374 ASP ASP A . n 
A 1 223 CYS 223 375 375 CYS CYS A . n 
A 1 224 SER 224 376 376 SER SER A . n 
A 1 225 THR 225 377 377 THR THR A . n 
A 1 226 CYS 226 378 378 CYS CYS A . n 
A 1 227 PHE 227 379 379 PHE PHE A . n 
A 1 228 VAL 228 380 380 VAL VAL A . n 
A 1 229 SER 229 381 381 SER SER A . n 
A 1 230 GLN 230 382 382 GLN GLN A . n 
A 1 231 SER 231 383 383 SER SER A . n 
A 1 232 GLY 232 384 384 GLY GLY A . n 
A 1 233 THR 233 385 385 THR THR A . n 
A 1 234 SER 234 386 386 SER SER A . n 
A 1 235 GLN 235 387 387 GLN GLN A . n 
A 1 236 ALA 236 388 388 ALA ALA A . n 
A 1 237 ALA 237 389 389 ALA ALA A . n 
A 1 238 ALA 238 390 390 ALA ALA A . n 
A 1 239 HIS 239 391 391 HIS HIS A . n 
A 1 240 VAL 240 392 392 VAL VAL A . n 
A 1 241 ALA 241 393 393 ALA ALA A . n 
A 1 242 GLY 242 394 394 GLY GLY A . n 
A 1 243 ILE 243 395 395 ILE ILE A . n 
A 1 244 ALA 244 396 396 ALA ALA A . n 
A 1 245 ALA 245 397 397 ALA ALA A . n 
A 1 246 MET 246 398 398 MET MET A . n 
A 1 247 MET 247 399 399 MET MET A . n 
A 1 248 LEU 248 400 400 LEU LEU A . n 
A 1 249 SER 249 401 401 SER SER A . n 
A 1 250 ALA 250 402 402 ALA ALA A . n 
A 1 251 GLU 251 403 403 GLU GLU A . n 
A 1 252 PRO 252 404 404 PRO PRO A . n 
A 1 253 GLU 253 405 405 GLU GLU A . n 
A 1 254 LEU 254 406 406 LEU LEU A . n 
A 1 255 THR 255 407 407 THR THR A . n 
A 1 256 LEU 256 408 408 LEU LEU A . n 
A 1 257 ALA 257 409 409 ALA ALA A . n 
A 1 258 GLU 258 410 410 GLU GLU A . n 
A 1 259 LEU 259 411 411 LEU LEU A . n 
A 1 260 ARG 260 412 412 ARG ARG A . n 
A 1 261 GLN 261 413 413 GLN GLN A . n 
A 1 262 ARG 262 414 414 ARG ARG A . n 
A 1 263 LEU 263 415 415 LEU LEU A . n 
A 1 264 ILE 264 416 416 ILE ILE A . n 
A 1 265 HIS 265 417 417 HIS HIS A . n 
A 1 266 PHE 266 418 418 PHE PHE A . n 
A 1 267 SER 267 419 419 SER SER A . n 
A 1 268 ALA 268 420 420 ALA ALA A . n 
A 1 269 LYS 269 421 421 LYS LYS A . n 
A 1 270 ASP 270 422 422 ASP ASP A . n 
A 1 271 VAL 271 423 423 VAL VAL A . n 
A 1 272 ILE 272 424 424 ILE ILE A . n 
A 1 273 ASN 273 425 425 ASN ASN A . n 
A 1 274 GLU 274 426 426 GLU GLU A . n 
A 1 275 ALA 275 427 427 ALA ALA A . n 
A 1 276 TRP 276 428 428 TRP TRP A . n 
A 1 277 PHE 277 429 429 PHE PHE A . n 
A 1 278 PRO 278 430 430 PRO PRO A . n 
A 1 279 GLU 279 431 431 GLU GLU A . n 
A 1 280 ASP 280 432 432 ASP ASP A . n 
A 1 281 GLN 281 433 433 GLN GLN A . n 
A 1 282 ARG 282 434 434 ARG ARG A . n 
A 1 283 VAL 283 435 435 VAL VAL A . n 
A 1 284 LEU 284 436 436 LEU LEU A . n 
A 1 285 THR 285 437 437 THR THR A . n 
A 1 286 PRO 286 438 438 PRO PRO A . n 
A 1 287 ASN 287 439 439 ASN ASN A . n 
A 1 288 LEU 288 440 440 LEU LEU A . n 
A 1 289 VAL 289 441 441 VAL VAL A . n 
A 1 290 ALA 290 442 442 ALA ALA A . n 
A 1 291 ALA 291 443 443 ALA ALA A . n 
A 1 292 LEU 292 444 444 LEU LEU A . n 
A 1 293 PRO 293 445 445 PRO PRO A . n 
A 1 294 PRO 294 446 446 PRO PRO A . n 
A 1 295 SER 295 447 447 SER SER A . n 
A 1 296 THR 296 448 ?   ?   ?   A . n 
A 1 297 HIS 297 449 ?   ?   ?   A . n 
A 1 298 GLY 298 450 ?   ?   ?   A . n 
A 1 299 ALA 299 451 ?   ?   ?   A . n 
A 1 300 ALA 300 452 ?   ?   ?   A . n 
A 1 301 GLY 301 453 ?   ?   ?   A . n 
A 1 302 THR 302 454 ?   ?   ?   A . n 
A 1 303 ALA 303 455 ?   ?   ?   A . n 
A 1 304 ALA 304 456 ?   ?   ?   A . n 
A 1 305 ALA 305 457 ?   ?   ?   A . n 
A 1 306 SER 306 458 ?   ?   ?   A . n 
A 1 307 HIS 307 459 ?   ?   ?   A . n 
A 1 308 HIS 308 460 ?   ?   ?   A . n 
A 1 309 HIS 309 461 ?   ?   ?   A . n 
A 1 310 HIS 310 462 ?   ?   ?   A . n 
A 1 311 HIS 311 463 ?   ?   ?   A . n 
A 1 312 HIS 312 464 ?   ?   ?   A . n 
B 2 1   MET 1   266 ?   ?   ?   E . n 
B 2 2   LYS 2   267 ?   ?   ?   E . n 
B 2 3   HIS 3   268 ?   ?   ?   E . n 
B 2 4   HIS 4   269 ?   ?   ?   E . n 
B 2 5   HIS 5   270 ?   ?   ?   E . n 
B 2 6   HIS 6   271 ?   ?   ?   E . n 
B 2 7   HIS 7   272 ?   ?   ?   E . n 
B 2 8   HIS 8   273 ?   ?   ?   E . n 
B 2 9   PRO 9   274 ?   ?   ?   E . n 
B 2 10  MET 10  275 ?   ?   ?   E . n 
B 2 11  SER 11  276 ?   ?   ?   E . n 
B 2 12  ASP 12  277 ?   ?   ?   E . n 
B 2 13  TYR 13  278 ?   ?   ?   E . n 
B 2 14  ASP 14  279 ?   ?   ?   E . n 
B 2 15  ILE 15  280 ?   ?   ?   E . n 
B 2 16  PRO 16  281 ?   ?   ?   E . n 
B 2 17  THR 17  282 ?   ?   ?   E . n 
B 2 18  THR 18  283 ?   ?   ?   E . n 
B 2 19  GLU 19  284 ?   ?   ?   E . n 
B 2 20  ASN 20  285 285 ASN ASN E . n 
B 2 21  LEU 21  286 286 LEU LEU E . n 
B 2 22  TYR 22  287 287 TYR TYR E . n 
B 2 23  PHE 23  288 288 PHE PHE E . n 
B 2 24  GLN 24  289 289 GLN GLN E . n 
B 2 25  GLY 25  290 290 GLY GLY E . n 
B 2 26  ALA 26  291 291 ALA ALA E . n 
B 2 27  MET 27  292 292 MET MET E . n 
B 2 28  GLY 28  293 293 GLY GLY E . n 
B 2 29  THR 29  294 294 THR THR E . n 
B 2 30  ASN 30  295 295 ASN ASN E . n 
B 2 31  GLU 31  296 296 GLU GLU E . n 
B 2 32  CYS 32  297 297 CYS CYS E . n 
B 2 33  LEU 33  298 298 LEU LEU E . n 
B 2 34  ASP 34  299 299 ASP ASP E . n 
B 2 35  ASN 35  300 300 ASN ASN E . n 
B 2 36  ASN 36  301 301 ASN ASN E . n 
B 2 37  GLY 37  302 302 GLY GLY E . n 
B 2 38  GLY 38  303 303 GLY GLY E . n 
B 2 39  CYS 39  304 304 CYS CYS E . n 
B 2 40  SER 40  305 305 SER SER E . n 
B 2 41  HIS 41  306 306 HIS HIS E . n 
B 2 42  VAL 42  307 307 VAL VAL E . n 
B 2 43  CYS 43  308 308 CYS CYS E . n 
B 2 44  ASN 44  309 309 ASN ASN E . n 
B 2 45  ASP 45  310 310 ASP ASP E . n 
B 2 46  LEU 46  311 311 LEU LEU E . n 
B 2 47  LYS 47  312 312 LYS LYS E . n 
B 2 48  ILE 48  313 313 ILE ILE E . n 
B 2 49  GLY 49  314 314 GLY GLY E . n 
B 2 50  TYR 50  315 315 TYR TYR E . n 
B 2 51  GLU 51  316 316 GLU GLU E . n 
B 2 52  CYS 52  317 317 CYS CYS E . n 
B 2 53  LEU 53  318 318 LEU LEU E . n 
B 2 54  CYS 54  319 319 CYS CYS E . n 
B 2 55  PRO 55  320 320 PRO PRO E . n 
B 2 56  ASP 56  321 321 ASP ASP E . n 
B 2 57  GLY 57  322 322 GLY GLY E . n 
B 2 58  PHE 58  323 323 PHE PHE E . n 
B 2 59  GLN 59  324 324 GLN GLN E . n 
B 2 60  LEU 60  325 325 LEU LEU E . n 
B 2 61  VAL 61  326 326 VAL VAL E . n 
B 2 62  ALA 62  327 327 ALA ALA E . n 
B 2 63  GLN 63  328 328 GLN GLN E . n 
B 2 64  ARG 64  329 329 ARG ARG E . n 
B 2 65  ARG 65  330 330 ARG ARG E . n 
B 2 66  CYS 66  331 331 CYS CYS E . n 
B 2 67  GLU 67  332 332 GLU GLU E . n 
B 2 68  ASP 68  333 333 ASP ASP E . n 
B 2 69  ILE 69  334 ?   ?   ?   E . n 
B 2 70  ASP 70  335 ?   ?   ?   E . n 
B 2 71  GLU 71  336 ?   ?   ?   E . n 
B 2 72  CYS 72  337 ?   ?   ?   E . n 
B 2 73  GLN 73  338 ?   ?   ?   E . n 
B 2 74  ASP 74  339 ?   ?   ?   E . n 
B 2 75  PRO 75  340 ?   ?   ?   E . n 
B 2 76  ASP 76  341 ?   ?   ?   E . n 
B 2 77  THR 77  342 ?   ?   ?   E . n 
B 2 78  CYS 78  343 ?   ?   ?   E . n 
B 2 79  SER 79  344 ?   ?   ?   E . n 
B 2 80  GLN 80  345 ?   ?   ?   E . n 
B 2 81  LEU 81  346 ?   ?   ?   E . n 
B 2 82  CYS 82  347 ?   ?   ?   E . n 
B 2 83  VAL 83  348 ?   ?   ?   E . n 
B 2 84  ASN 84  349 ?   ?   ?   E . n 
B 2 85  LEU 85  350 ?   ?   ?   E . n 
B 2 86  GLU 86  351 ?   ?   ?   E . n 
B 2 87  GLY 87  352 ?   ?   ?   E . n 
B 2 88  GLY 88  353 ?   ?   ?   E . n 
B 2 89  TYR 89  354 ?   ?   ?   E . n 
B 2 90  LYS 90  355 ?   ?   ?   E . n 
B 2 91  CYS 91  356 ?   ?   ?   E . n 
B 2 92  GLN 92  357 ?   ?   ?   E . n 
B 2 93  CYS 93  358 ?   ?   ?   E . n 
B 2 94  GLU 94  359 ?   ?   ?   E . n 
B 2 95  GLU 95  360 ?   ?   ?   E . n 
B 2 96  GLY 96  361 ?   ?   ?   E . n 
B 2 97  PHE 97  362 ?   ?   ?   E . n 
B 2 98  GLN 98  363 ?   ?   ?   E . n 
B 2 99  LEU 99  364 ?   ?   ?   E . n 
B 2 100 ASP 100 365 ?   ?   ?   E . n 
B 2 101 PRO 101 366 ?   ?   ?   E . n 
B 2 102 HIS 102 367 ?   ?   ?   E . n 
B 2 103 THR 103 368 ?   ?   ?   E . n 
B 2 104 LYS 104 369 ?   ?   ?   E . n 
B 2 105 ALA 105 370 ?   ?   ?   E . n 
B 2 106 CYS 106 371 ?   ?   ?   E . n 
B 2 107 LYS 107 372 ?   ?   ?   E . n 
C 3 1   MET 1   39  ?   ?   ?   P . n 
C 3 2   LYS 2   40  ?   ?   ?   P . n 
C 3 3   GLY 3   41  ?   ?   ?   P . n 
C 3 4   SER 4   42  ?   ?   ?   P . n 
C 3 5   LYS 5   43  ?   ?   ?   P . n 
C 3 6   GLY 6   44  ?   ?   ?   P . n 
C 3 7   SER 7   45  ?   ?   ?   P . n 
C 3 8   LYS 8   46  ?   ?   ?   P . n 
C 3 9   GLY 9   47  ?   ?   ?   P . n 
C 3 10  SER 10  48  ?   ?   ?   P . n 
C 3 11  LYS 11  49  ?   ?   ?   P . n 
C 3 12  PRO 12  50  ?   ?   ?   P . n 
C 3 13  MET 13  51  ?   ?   ?   P . n 
C 3 14  SER 14  52  ?   ?   ?   P . n 
C 3 15  ALA 15  53  ?   ?   ?   P . n 
C 3 16  GLU 16  54  ?   ?   ?   P . n 
C 3 17  ALA 17  55  ?   ?   ?   P . n 
C 3 18  PRO 18  56  ?   ?   ?   P . n 
C 3 19  GLU 19  57  ?   ?   ?   P . n 
C 3 20  HIS 20  58  ?   ?   ?   P . n 
C 3 21  GLY 21  59  ?   ?   ?   P . n 
C 3 22  THR 22  60  ?   ?   ?   P . n 
C 3 23  THR 23  61  61  THR THR P . n 
C 3 24  ALA 24  62  62  ALA ALA P . n 
C 3 25  THR 25  63  63  THR THR P . n 
C 3 26  PHE 26  64  64  PHE PHE P . n 
C 3 27  HIS 27  65  65  HIS HIS P . n 
C 3 28  ARG 28  66  66  ARG ARG P . n 
C 3 29  CYS 29  67  67  CYS CYS P . n 
C 3 30  ALA 30  68  68  ALA ALA P . n 
C 3 31  LYS 31  69  69  LYS LYS P . n 
C 3 32  ASP 32  70  70  ASP ASP P . n 
C 3 33  PRO 33  71  71  PRO PRO P . n 
C 3 34  TRP 34  72  72  TRP TRP P . n 
C 3 35  ARG 35  73  73  ARG ARG P . n 
C 3 36  LEU 36  74  74  LEU LEU P . n 
C 3 37  PRO 37  75  75  PRO PRO P . n 
C 3 38  GLY 38  76  76  GLY GLY P . n 
C 3 39  THR 39  77  77  THR THR P . n 
C 3 40  TYR 40  78  78  TYR TYR P . n 
C 3 41  VAL 41  79  79  VAL VAL P . n 
C 3 42  VAL 42  80  80  VAL VAL P . n 
C 3 43  VAL 43  81  81  VAL VAL P . n 
C 3 44  LEU 44  82  82  LEU LEU P . n 
C 3 45  LYS 45  83  83  LYS LYS P . n 
C 3 46  GLU 46  84  84  GLU GLU P . n 
C 3 47  GLU 47  85  85  GLU GLU P . n 
C 3 48  THR 48  86  86  THR THR P . n 
C 3 49  HIS 49  87  87  HIS HIS P . n 
C 3 50  LEU 50  88  88  LEU LEU P . n 
C 3 51  SER 51  89  89  SER SER P . n 
C 3 52  GLN 52  90  90  GLN GLN P . n 
C 3 53  SER 53  91  91  SER SER P . n 
C 3 54  GLU 54  92  92  GLU GLU P . n 
C 3 55  ARG 55  93  93  ARG ARG P . n 
C 3 56  THR 56  94  94  THR THR P . n 
C 3 57  ALA 57  95  95  ALA ALA P . n 
C 3 58  ARG 58  96  96  ARG ARG P . n 
C 3 59  ARG 59  97  97  ARG ARG P . n 
C 3 60  LEU 60  98  98  LEU LEU P . n 
C 3 61  GLN 61  99  99  GLN GLN P . n 
C 3 62  ALA 62  100 100 ALA ALA P . n 
C 3 63  GLN 63  101 101 GLN GLN P . n 
C 3 64  ALA 64  102 102 ALA ALA P . n 
C 3 65  ALA 65  103 103 ALA ALA P . n 
C 3 66  ARG 66  104 104 ARG ARG P . n 
C 3 67  ARG 67  105 105 ARG ARG P . n 
C 3 68  GLY 68  106 106 GLY GLY P . n 
C 3 69  TYR 69  107 107 TYR TYR P . n 
C 3 70  LEU 70  108 108 LEU LEU P . n 
C 3 71  THR 71  109 109 THR THR P . n 
C 3 72  LYS 72  110 110 LYS LYS P . n 
C 3 73  ILE 73  111 111 ILE ILE P . n 
C 3 74  LEU 74  112 112 LEU LEU P . n 
C 3 75  HIS 75  113 113 HIS HIS P . n 
C 3 76  VAL 76  114 114 VAL VAL P . n 
C 3 77  PHE 77  115 115 PHE PHE P . n 
C 3 78  HIS 78  116 116 HIS HIS P . n 
C 3 79  GLY 79  117 117 GLY GLY P . n 
C 3 80  LEU 80  118 118 LEU LEU P . n 
C 3 81  LEU 81  119 119 LEU LEU P . n 
C 3 82  PRO 82  120 120 PRO PRO P . n 
C 3 83  GLY 83  121 121 GLY GLY P . n 
C 3 84  PHE 84  122 122 PHE PHE P . n 
C 3 85  LEU 85  123 123 LEU LEU P . n 
C 3 86  VAL 86  124 124 VAL VAL P . n 
C 3 87  LYS 87  125 125 LYS LYS P . n 
C 3 88  MET 88  126 126 MET MET P . n 
C 3 89  SER 89  127 127 SER SER P . n 
C 3 90  GLY 90  128 128 GLY GLY P . n 
C 3 91  ASP 91  129 129 ASP ASP P . n 
C 3 92  LEU 92  130 130 LEU LEU P . n 
C 3 93  LEU 93  131 131 LEU LEU P . n 
C 3 94  GLU 94  132 132 GLU GLU P . n 
C 3 95  LEU 95  133 133 LEU LEU P . n 
C 3 96  ALA 96  134 134 ALA ALA P . n 
C 3 97  LEU 97  135 135 LEU LEU P . n 
C 3 98  LYS 98  136 136 LYS LYS P . n 
C 3 99  LEU 99  137 137 LEU LEU P . n 
C 3 100 PRO 100 138 138 PRO PRO P . n 
C 3 101 HIS 101 139 139 HIS HIS P . n 
C 3 102 VAL 102 140 140 VAL VAL P . n 
C 3 103 ASP 103 141 141 ASP ASP P . n 
C 3 104 TYR 104 142 142 TYR TYR P . n 
C 3 105 ILE 105 143 143 ILE ILE P . n 
C 3 106 GLU 106 144 144 GLU GLU P . n 
C 3 107 GLU 107 145 145 GLU GLU P . n 
C 3 108 ASP 108 146 146 ASP ASP P . n 
C 3 109 SER 109 147 147 SER SER P . n 
C 3 110 SER 110 148 148 SER SER P . n 
C 3 111 VAL 111 149 149 VAL VAL P . n 
C 3 112 PHE 112 150 150 PHE PHE P . n 
C 3 113 ALA 113 151 151 ALA ALA P . n 
C 3 114 GLN 114 152 152 GLN GLN P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1   1448 1448 CA  CA  A . 
E 4 CA  1   1334 1334 CA  CA  E . 
F 4 CA  1   1335 1335 CA  CA  E . 
G 5 HOH 1   2001 2001 HOH HOH A . 
G 5 HOH 2   2002 2002 HOH HOH A . 
G 5 HOH 3   2003 2003 HOH HOH A . 
G 5 HOH 4   2004 2004 HOH HOH A . 
G 5 HOH 5   2005 2005 HOH HOH A . 
G 5 HOH 6   2006 2006 HOH HOH A . 
G 5 HOH 7   2007 2007 HOH HOH A . 
G 5 HOH 8   2008 2008 HOH HOH A . 
G 5 HOH 9   2009 2009 HOH HOH A . 
G 5 HOH 10  2010 2010 HOH HOH A . 
G 5 HOH 11  2011 2011 HOH HOH A . 
G 5 HOH 12  2012 2012 HOH HOH A . 
G 5 HOH 13  2013 2013 HOH HOH A . 
G 5 HOH 14  2014 2014 HOH HOH A . 
G 5 HOH 15  2015 2015 HOH HOH A . 
G 5 HOH 16  2016 2016 HOH HOH A . 
G 5 HOH 17  2017 2017 HOH HOH A . 
G 5 HOH 18  2018 2018 HOH HOH A . 
G 5 HOH 19  2019 2019 HOH HOH A . 
G 5 HOH 20  2020 2020 HOH HOH A . 
G 5 HOH 21  2021 2021 HOH HOH A . 
G 5 HOH 22  2022 2022 HOH HOH A . 
G 5 HOH 23  2023 2023 HOH HOH A . 
G 5 HOH 24  2024 2024 HOH HOH A . 
G 5 HOH 25  2025 2025 HOH HOH A . 
G 5 HOH 26  2026 2026 HOH HOH A . 
G 5 HOH 27  2027 2027 HOH HOH A . 
G 5 HOH 28  2028 2028 HOH HOH A . 
G 5 HOH 29  2029 2029 HOH HOH A . 
G 5 HOH 30  2030 2030 HOH HOH A . 
G 5 HOH 31  2031 2031 HOH HOH A . 
G 5 HOH 32  2032 2032 HOH HOH A . 
G 5 HOH 33  2033 2033 HOH HOH A . 
G 5 HOH 34  2034 2034 HOH HOH A . 
G 5 HOH 35  2035 2035 HOH HOH A . 
G 5 HOH 36  2036 2036 HOH HOH A . 
G 5 HOH 37  2037 2037 HOH HOH A . 
G 5 HOH 38  2038 2038 HOH HOH A . 
G 5 HOH 39  2039 2039 HOH HOH A . 
G 5 HOH 40  2040 2040 HOH HOH A . 
G 5 HOH 41  2041 2041 HOH HOH A . 
G 5 HOH 42  2042 2042 HOH HOH A . 
G 5 HOH 43  2043 2043 HOH HOH A . 
G 5 HOH 44  2044 2044 HOH HOH A . 
G 5 HOH 45  2045 2045 HOH HOH A . 
G 5 HOH 46  2046 2046 HOH HOH A . 
G 5 HOH 47  2047 2047 HOH HOH A . 
G 5 HOH 48  2048 2048 HOH HOH A . 
G 5 HOH 49  2049 2049 HOH HOH A . 
G 5 HOH 50  2050 2050 HOH HOH A . 
G 5 HOH 51  2051 2051 HOH HOH A . 
G 5 HOH 52  2052 2052 HOH HOH A . 
G 5 HOH 53  2053 2053 HOH HOH A . 
G 5 HOH 54  2054 2054 HOH HOH A . 
G 5 HOH 55  2055 2055 HOH HOH A . 
G 5 HOH 56  2056 2056 HOH HOH A . 
G 5 HOH 57  2057 2057 HOH HOH A . 
G 5 HOH 58  2058 2058 HOH HOH A . 
G 5 HOH 59  2059 2059 HOH HOH A . 
G 5 HOH 60  2060 2060 HOH HOH A . 
G 5 HOH 61  2061 2061 HOH HOH A . 
G 5 HOH 62  2062 2062 HOH HOH A . 
G 5 HOH 63  2063 2063 HOH HOH A . 
G 5 HOH 64  2064 2064 HOH HOH A . 
G 5 HOH 65  2065 2065 HOH HOH A . 
G 5 HOH 66  2066 2066 HOH HOH A . 
G 5 HOH 67  2067 2067 HOH HOH A . 
G 5 HOH 68  2068 2068 HOH HOH A . 
G 5 HOH 69  2069 2069 HOH HOH A . 
G 5 HOH 70  2070 2070 HOH HOH A . 
G 5 HOH 71  2071 2071 HOH HOH A . 
G 5 HOH 72  2072 2072 HOH HOH A . 
G 5 HOH 73  2073 2073 HOH HOH A . 
G 5 HOH 74  2074 2074 HOH HOH A . 
G 5 HOH 75  2075 2075 HOH HOH A . 
G 5 HOH 76  2076 2076 HOH HOH A . 
G 5 HOH 77  2077 2077 HOH HOH A . 
G 5 HOH 78  2078 2078 HOH HOH A . 
G 5 HOH 79  2079 2079 HOH HOH A . 
G 5 HOH 80  2080 2080 HOH HOH A . 
G 5 HOH 81  2081 2081 HOH HOH A . 
G 5 HOH 82  2082 2082 HOH HOH A . 
G 5 HOH 83  2083 2083 HOH HOH A . 
G 5 HOH 84  2084 2084 HOH HOH A . 
G 5 HOH 85  2085 2085 HOH HOH A . 
G 5 HOH 86  2086 2086 HOH HOH A . 
G 5 HOH 87  2087 2087 HOH HOH A . 
G 5 HOH 88  2088 2088 HOH HOH A . 
G 5 HOH 89  2089 2089 HOH HOH A . 
G 5 HOH 90  2090 2090 HOH HOH A . 
G 5 HOH 91  2091 2091 HOH HOH A . 
G 5 HOH 92  2092 2092 HOH HOH A . 
G 5 HOH 93  2093 2093 HOH HOH A . 
G 5 HOH 94  2094 2094 HOH HOH A . 
G 5 HOH 95  2095 2095 HOH HOH A . 
G 5 HOH 96  2096 2096 HOH HOH A . 
G 5 HOH 97  2097 2097 HOH HOH A . 
G 5 HOH 98  2098 2098 HOH HOH A . 
G 5 HOH 99  2099 2099 HOH HOH A . 
G 5 HOH 100 2100 2100 HOH HOH A . 
G 5 HOH 101 2101 2101 HOH HOH A . 
G 5 HOH 102 2102 2102 HOH HOH A . 
G 5 HOH 103 2103 2103 HOH HOH A . 
G 5 HOH 104 2104 2104 HOH HOH A . 
G 5 HOH 105 2105 2105 HOH HOH A . 
G 5 HOH 106 2106 2106 HOH HOH A . 
G 5 HOH 107 2107 2107 HOH HOH A . 
G 5 HOH 108 2108 2108 HOH HOH A . 
G 5 HOH 109 2109 2109 HOH HOH A . 
G 5 HOH 110 2110 2110 HOH HOH A . 
G 5 HOH 111 2111 2111 HOH HOH A . 
G 5 HOH 112 2112 2112 HOH HOH A . 
G 5 HOH 113 2113 2113 HOH HOH A . 
G 5 HOH 114 2114 2114 HOH HOH A . 
G 5 HOH 115 2115 2115 HOH HOH A . 
G 5 HOH 116 2116 2116 HOH HOH A . 
G 5 HOH 117 2117 2117 HOH HOH A . 
H 5 HOH 1   2001 2001 HOH HOH E . 
H 5 HOH 2   2002 2002 HOH HOH E . 
H 5 HOH 3   2003 2003 HOH HOH E . 
H 5 HOH 4   2004 2004 HOH HOH E . 
H 5 HOH 5   2005 2005 HOH HOH E . 
H 5 HOH 6   2006 2006 HOH HOH E . 
H 5 HOH 7   2007 2007 HOH HOH E . 
H 5 HOH 8   2008 2008 HOH HOH E . 
H 5 HOH 9   2009 2009 HOH HOH E . 
H 5 HOH 10  2010 2010 HOH HOH E . 
H 5 HOH 11  2011 2011 HOH HOH E . 
H 5 HOH 12  2012 2012 HOH HOH E . 
H 5 HOH 13  2013 2013 HOH HOH E . 
H 5 HOH 14  2014 2014 HOH HOH E . 
H 5 HOH 15  2015 2015 HOH HOH E . 
H 5 HOH 16  2016 2016 HOH HOH E . 
H 5 HOH 17  2017 2017 HOH HOH E . 
H 5 HOH 18  2018 2018 HOH HOH E . 
H 5 HOH 19  2019 2019 HOH HOH E . 
H 5 HOH 20  2020 2020 HOH HOH E . 
H 5 HOH 21  2021 2021 HOH HOH E . 
H 5 HOH 22  2022 2022 HOH HOH E . 
H 5 HOH 23  2023 2023 HOH HOH E . 
H 5 HOH 24  2024 2024 HOH HOH E . 
H 5 HOH 25  2025 2025 HOH HOH E . 
H 5 HOH 26  2026 2026 HOH HOH E . 
H 5 HOH 27  2027 2027 HOH HOH E . 
H 5 HOH 28  2028 2028 HOH HOH E . 
H 5 HOH 29  2029 2029 HOH HOH E . 
H 5 HOH 30  2030 2030 HOH HOH E . 
H 5 HOH 31  2031 2031 HOH HOH E . 
H 5 HOH 32  2032 2032 HOH HOH E . 
H 5 HOH 33  2033 2033 HOH HOH E . 
H 5 HOH 34  2034 2034 HOH HOH E . 
H 5 HOH 35  2035 2035 HOH HOH E . 
H 5 HOH 36  2036 2036 HOH HOH E . 
H 5 HOH 37  2037 2037 HOH HOH E . 
H 5 HOH 38  2038 2038 HOH HOH E . 
H 5 HOH 39  2039 2039 HOH HOH E . 
H 5 HOH 40  2040 2040 HOH HOH E . 
H 5 HOH 41  2041 2041 HOH HOH E . 
I 5 HOH 1   2001 2001 HOH HOH P . 
I 5 HOH 2   2002 2002 HOH HOH P . 
I 5 HOH 3   2003 2003 HOH HOH P . 
I 5 HOH 4   2004 2004 HOH HOH P . 
I 5 HOH 5   2005 2005 HOH HOH P . 
I 5 HOH 6   2006 2006 HOH HOH P . 
I 5 HOH 7   2007 2007 HOH HOH P . 
I 5 HOH 8   2008 2008 HOH HOH P . 
I 5 HOH 9   2009 2009 HOH HOH P . 
I 5 HOH 10  2010 2010 HOH HOH P . 
I 5 HOH 11  2011 2011 HOH HOH P . 
I 5 HOH 12  2012 2012 HOH HOH P . 
I 5 HOH 13  2013 2013 HOH HOH P . 
I 5 HOH 14  2014 2014 HOH HOH P . 
I 5 HOH 15  2015 2015 HOH HOH P . 
I 5 HOH 16  2016 2016 HOH HOH P . 
I 5 HOH 17  2017 2017 HOH HOH P . 
I 5 HOH 18  2018 2018 HOH HOH P . 
I 5 HOH 19  2019 2019 HOH HOH P . 
I 5 HOH 20  2020 2020 HOH HOH P . 
I 5 HOH 21  2021 2021 HOH HOH P . 
I 5 HOH 22  2022 2022 HOH HOH P . 
I 5 HOH 23  2023 2023 HOH HOH P . 
I 5 HOH 24  2024 2024 HOH HOH P . 
I 5 HOH 25  2025 2025 HOH HOH P . 
I 5 HOH 26  2026 2026 HOH HOH P . 
I 5 HOH 27  2027 2027 HOH HOH P . 
I 5 HOH 28  2028 2028 HOH HOH P . 
I 5 HOH 29  2029 2029 HOH HOH P . 
I 5 HOH 30  2030 2030 HOH HOH P . 
I 5 HOH 31  2031 2031 HOH HOH P . 
I 5 HOH 32  2032 2032 HOH HOH P . 
I 5 HOH 33  2033 2033 HOH HOH P . 
I 5 HOH 34  2034 2034 HOH HOH P . 
I 5 HOH 35  2035 2035 HOH HOH P . 
I 5 HOH 36  2036 2036 HOH HOH P . 
I 5 HOH 37  2037 2037 HOH HOH P . 
I 5 HOH 38  2038 2038 HOH HOH P . 
I 5 HOH 39  2039 2039 HOH HOH P . 
I 5 HOH 40  2040 2040 HOH HOH P . 
I 5 HOH 41  2041 2041 HOH HOH P . 
I 5 HOH 42  2042 2042 HOH HOH P . 
I 5 HOH 43  2043 2043 HOH HOH P . 
I 5 HOH 44  2044 2044 HOH HOH P . 
I 5 HOH 45  2045 2045 HOH HOH P . 
I 5 HOH 46  2046 2046 HOH HOH P . 
I 5 HOH 47  2047 2047 HOH HOH P . 
I 5 HOH 48  2048 2048 HOH HOH P . 
I 5 HOH 49  2049 2049 HOH HOH P . 
I 5 HOH 50  2050 2050 HOH HOH P . 
I 5 HOH 51  2051 2051 HOH HOH P . 
I 5 HOH 52  2052 2052 HOH HOH P . 
I 5 HOH 53  2053 2053 HOH HOH P . 
I 5 HOH 54  2054 2054 HOH HOH P . 
I 5 HOH 55  2055 2055 HOH HOH P . 
I 5 HOH 56  2056 2056 HOH HOH P . 
I 5 HOH 57  2057 2057 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4000  ? 
1 MORE         -26.6 ? 
1 'SSA (A^2)'  22230 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A VAL 181 ? A VAL 333  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 OG1 ? A THR 183 ? A THR 335  ? 1_555 90.8  ? 
2  O   ? A VAL 181 ? A VAL 333  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 O   ? A CYS 206 ? A CYS 358  ? 1_555 144.4 ? 
3  OG1 ? A THR 183 ? A THR 335  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 O   ? A CYS 206 ? A CYS 358  ? 1_555 66.0  ? 
4  O   ? A VAL 181 ? A VAL 333  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 OD2 ? A ASP 208 ? A ASP 360  ? 1_555 71.7  ? 
5  OG1 ? A THR 183 ? A THR 335  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 OD2 ? A ASP 208 ? A ASP 360  ? 1_555 81.6  ? 
6  O   ? A CYS 206 ? A CYS 358  ? 1_555 CA ? D CA . ? A CA 1448 ? 1_555 OD2 ? A ASP 208 ? A ASP 360  ? 1_555 78.1  ? 
7  O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B LEU 46  ? E LEU 311  ? 1_555 143.6 ? 
8  O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? H HOH .   ? E HOH 2013 ? 1_555 71.5  ? 
9  O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? H HOH .   ? E HOH 2013 ? 1_555 73.2  ? 
10 O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 69.2  ? 
11 O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 144.0 ? 
12 O   ? H HOH .   ? E HOH 2013 ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 140.4 ? 
13 O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B GLY 49  ? E GLY 314  ? 1_555 144.5 ? 
14 O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B GLY 49  ? E GLY 314  ? 1_555 70.8  ? 
15 O   ? H HOH .   ? E HOH 2013 ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B GLY 49  ? E GLY 314  ? 1_555 143.9 ? 
16 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? B GLY 49  ? E GLY 314  ? 1_555 75.3  ? 
17 O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 78.1  ? 
18 O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 88.8  ? 
19 O   ? H HOH .   ? E HOH 2013 ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 82.4  ? 
20 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 85.4  ? 
21 O   ? B GLY 49  ? E GLY 314  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 100.0 ? 
22 O   ? B THR 29  ? E THR 294  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? H HOH .   ? E HOH 2010 ? 1_555 74.8  ? 
23 O   ? B LEU 46  ? E LEU 311  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? H HOH .   ? E HOH 2010 ? 1_555 115.4 ? 
24 O   ? H HOH .   ? E HOH 2013 ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? H HOH .   ? E HOH 2010 ? 1_555 92.2  ? 
25 OE1 ? B GLU 31  ? E GLU 296  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? H HOH .   ? E HOH 2010 ? 1_555 81.9  ? 
26 O   ? B GLY 49  ? E GLY 314  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? H HOH .   ? E HOH 2010 ? 1_555 100.1 ? 
27 OD2 ? B ASP 45  ? E ASP 310  ? 1_555 CA ? E CA . ? E CA 1334 ? 1_555 O   ? H HOH .   ? E HOH 2010 ? 1_555 152.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-11-18 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 26.9216 15.8754 52.1791 0.0194  0.0752 0.0253 -0.0480 -0.0059 0.0082 0.9680 0.6685 3.1479 0.2569  
1.1267 0.8473  0.1142  -0.0300 -0.0213 0.0767 -0.0414 -0.0519 0.2185  -0.0483 -0.0728 
'X-RAY DIFFRACTION' 2 ? refined 13.0170 2.2429  30.3393 0.0324  0.0270 0.0172 -0.0199 0.0044  0.0183 0.9333 0.7808 1.9975 -0.1463 
0.3278 0.7464  0.0435  -0.0461 -0.0190 0.0849 -0.0434 0.0430  0.1824  -0.0312 0.0000  
'X-RAY DIFFRACTION' 3 ? refined -1.9104 13.4421 8.4285  -0.0373 0.0799 0.0368 0.0300  0.0048  0.0172 2.8012 0.9918 5.2985 -0.4495 
2.2230 -0.5000 -0.0424 0.2259  0.2450  0.0025 -0.1085 -0.0198 -0.0230 0.2366  0.1509  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 P 61  ? ? P 152 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 153 ? ? A 447 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 E 285 ? ? E 333 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             2W2M 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;CHAIN A: HUMAN PCSK9 CATALYTIC DOMAIN. THE LAST 13 RESIDUES ARE A
LINKER AND A 6HIS TAG, RESULTING FROM THE CLONING
PROCEDURE. THE FIRST RESIDUE CORRESPONDS TO SER153 OF WT
PCSK9.
HUMAN LDLR EGF-AB DOMAINS. THE FIRST 27 RESIDUES IN THE
SEQUENCE ARE A 6HIS TAG AND A LINKER FROM THE CLONING
PROCEDURE. THE 28TH RESIDUE CORRESPONDS TO GLY293 OF WT
LDLR.
CHAIN P: HUMAN PCSK9 PRODOMAIN. THE FIRST 14 RESIDUES IN THE
SEQUENCE ARE A RESULT OF THE CLONING PROCEDURE. THE 15TH
RESIDUE CORRESPONDS TO ALA53 OF WT PCSK9.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 186 ? ? -153.74 -151.90 
2  1 ALA A 242 ? ? -101.81 79.84   
3  1 ALA A 245 ? ? -2.54   121.90  
4  1 ASN A 254 ? ? -78.92  -168.52 
5  1 VAL A 280 ? ? -116.23 -81.85  
6  1 PRO A 288 ? ? -90.61  54.83   
7  1 GLU A 332 ? ? 89.18   -23.02  
8  1 PHE E 288 ? ? -111.15 -84.66  
9  1 HIS E 306 ? ? -119.40 -92.39  
10 1 ARG E 329 ? ? -135.11 -36.62  
11 1 HIS P 139 ? ? 81.88   -9.56   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 165 ? CG  ? A ARG 13 CG  
2  1 Y 1 A ARG 165 ? CD  ? A ARG 13 CD  
3  1 Y 1 A ARG 165 ? NE  ? A ARG 13 NE  
4  1 Y 1 A ARG 165 ? CZ  ? A ARG 13 CZ  
5  1 Y 1 A ARG 165 ? NH1 ? A ARG 13 NH1 
6  1 Y 1 A ARG 165 ? NH2 ? A ARG 13 NH2 
7  1 Y 1 E ASN 285 ? CG  ? B ASN 20 CG  
8  1 Y 1 E ASN 285 ? OD1 ? B ASN 20 OD1 
9  1 Y 1 E ASN 285 ? ND2 ? B ASN 20 ND2 
10 1 Y 1 E ASP 333 ? CG  ? B ASP 68 CG  
11 1 Y 1 E ASP 333 ? OD1 ? B ASP 68 OD1 
12 1 Y 1 E ASP 333 ? OD2 ? B ASP 68 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A TYR 166 ? A TYR 14  
2   1 Y 1 A ARG 167 ? A ARG 15  
3   1 Y 1 A ALA 168 ? A ALA 16  
4   1 Y 1 A ASP 169 ? A ASP 17  
5   1 Y 1 A GLU 170 ? A GLU 18  
6   1 Y 1 A TYR 171 ? A TYR 19  
7   1 Y 1 A GLN 172 ? A GLN 20  
8   1 Y 1 A PRO 173 ? A PRO 21  
9   1 Y 1 A PRO 174 ? A PRO 22  
10  1 Y 1 A ASP 175 ? A ASP 23  
11  1 Y 1 A GLY 213 ? A GLY 61  
12  1 Y 1 A THR 214 ? A THR 62  
13  1 Y 1 A ARG 215 ? A ARG 63  
14  1 Y 1 A PHE 216 ? A PHE 64  
15  1 Y 1 A HIS 217 ? A HIS 65  
16  1 Y 1 A ARG 218 ? A ARG 66  
17  1 Y 1 A GLN 219 ? A GLN 67  
18  1 Y 1 A ALA 220 ? A ALA 68  
19  1 Y 1 A THR 448 ? A THR 296 
20  1 Y 1 A HIS 449 ? A HIS 297 
21  1 Y 1 A GLY 450 ? A GLY 298 
22  1 Y 1 A ALA 451 ? A ALA 299 
23  1 Y 1 A ALA 452 ? A ALA 300 
24  1 Y 1 A GLY 453 ? A GLY 301 
25  1 Y 1 A THR 454 ? A THR 302 
26  1 Y 1 A ALA 455 ? A ALA 303 
27  1 Y 1 A ALA 456 ? A ALA 304 
28  1 Y 1 A ALA 457 ? A ALA 305 
29  1 Y 1 A SER 458 ? A SER 306 
30  1 Y 1 A HIS 459 ? A HIS 307 
31  1 Y 1 A HIS 460 ? A HIS 308 
32  1 Y 1 A HIS 461 ? A HIS 309 
33  1 Y 1 A HIS 462 ? A HIS 310 
34  1 Y 1 A HIS 463 ? A HIS 311 
35  1 Y 1 A HIS 464 ? A HIS 312 
36  1 Y 1 E MET 266 ? B MET 1   
37  1 Y 1 E LYS 267 ? B LYS 2   
38  1 Y 1 E HIS 268 ? B HIS 3   
39  1 Y 1 E HIS 269 ? B HIS 4   
40  1 Y 1 E HIS 270 ? B HIS 5   
41  1 Y 1 E HIS 271 ? B HIS 6   
42  1 Y 1 E HIS 272 ? B HIS 7   
43  1 Y 1 E HIS 273 ? B HIS 8   
44  1 Y 1 E PRO 274 ? B PRO 9   
45  1 Y 1 E MET 275 ? B MET 10  
46  1 Y 1 E SER 276 ? B SER 11  
47  1 Y 1 E ASP 277 ? B ASP 12  
48  1 Y 1 E TYR 278 ? B TYR 13  
49  1 Y 1 E ASP 279 ? B ASP 14  
50  1 Y 1 E ILE 280 ? B ILE 15  
51  1 Y 1 E PRO 281 ? B PRO 16  
52  1 Y 1 E THR 282 ? B THR 17  
53  1 Y 1 E THR 283 ? B THR 18  
54  1 Y 1 E GLU 284 ? B GLU 19  
55  1 Y 1 E ILE 334 ? B ILE 69  
56  1 Y 1 E ASP 335 ? B ASP 70  
57  1 Y 1 E GLU 336 ? B GLU 71  
58  1 Y 1 E CYS 337 ? B CYS 72  
59  1 Y 1 E GLN 338 ? B GLN 73  
60  1 Y 1 E ASP 339 ? B ASP 74  
61  1 Y 1 E PRO 340 ? B PRO 75  
62  1 Y 1 E ASP 341 ? B ASP 76  
63  1 Y 1 E THR 342 ? B THR 77  
64  1 Y 1 E CYS 343 ? B CYS 78  
65  1 Y 1 E SER 344 ? B SER 79  
66  1 Y 1 E GLN 345 ? B GLN 80  
67  1 Y 1 E LEU 346 ? B LEU 81  
68  1 Y 1 E CYS 347 ? B CYS 82  
69  1 Y 1 E VAL 348 ? B VAL 83  
70  1 Y 1 E ASN 349 ? B ASN 84  
71  1 Y 1 E LEU 350 ? B LEU 85  
72  1 Y 1 E GLU 351 ? B GLU 86  
73  1 Y 1 E GLY 352 ? B GLY 87  
74  1 Y 1 E GLY 353 ? B GLY 88  
75  1 Y 1 E TYR 354 ? B TYR 89  
76  1 Y 1 E LYS 355 ? B LYS 90  
77  1 Y 1 E CYS 356 ? B CYS 91  
78  1 Y 1 E GLN 357 ? B GLN 92  
79  1 Y 1 E CYS 358 ? B CYS 93  
80  1 Y 1 E GLU 359 ? B GLU 94  
81  1 Y 1 E GLU 360 ? B GLU 95  
82  1 Y 1 E GLY 361 ? B GLY 96  
83  1 Y 1 E PHE 362 ? B PHE 97  
84  1 Y 1 E GLN 363 ? B GLN 98  
85  1 Y 1 E LEU 364 ? B LEU 99  
86  1 Y 1 E ASP 365 ? B ASP 100 
87  1 Y 1 E PRO 366 ? B PRO 101 
88  1 Y 1 E HIS 367 ? B HIS 102 
89  1 Y 1 E THR 368 ? B THR 103 
90  1 Y 1 E LYS 369 ? B LYS 104 
91  1 Y 1 E ALA 370 ? B ALA 105 
92  1 Y 1 E CYS 371 ? B CYS 106 
93  1 Y 1 E LYS 372 ? B LYS 107 
94  1 Y 1 P MET 39  ? C MET 1   
95  1 Y 1 P LYS 40  ? C LYS 2   
96  1 Y 1 P GLY 41  ? C GLY 3   
97  1 Y 1 P SER 42  ? C SER 4   
98  1 Y 1 P LYS 43  ? C LYS 5   
99  1 Y 1 P GLY 44  ? C GLY 6   
100 1 Y 1 P SER 45  ? C SER 7   
101 1 Y 1 P LYS 46  ? C LYS 8   
102 1 Y 1 P GLY 47  ? C GLY 9   
103 1 Y 1 P SER 48  ? C SER 10  
104 1 Y 1 P LYS 49  ? C LYS 11  
105 1 Y 1 P PRO 50  ? C PRO 12  
106 1 Y 1 P MET 51  ? C MET 13  
107 1 Y 1 P SER 52  ? C SER 14  
108 1 Y 1 P ALA 53  ? C ALA 15  
109 1 Y 1 P GLU 54  ? C GLU 16  
110 1 Y 1 P ALA 55  ? C ALA 17  
111 1 Y 1 P PRO 56  ? C PRO 18  
112 1 Y 1 P GLU 57  ? C GLU 19  
113 1 Y 1 P HIS 58  ? C HIS 20  
114 1 Y 1 P GLY 59  ? C GLY 21  
115 1 Y 1 P THR 60  ? C THR 22  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION' CA  
5 water         HOH 
#