data_2W5A
# 
_entry.id   2W5A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W5A         
PDBE  EBI-38277    
WWPDB D_1290038277 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2W5B unspecified 'HUMAN NEK2 KINASE ATPGAMMAS-BOUND'           
PDB 2JAV unspecified 'HUMAN KINASE WITH PYRROLE-INDOLINONE LIGAND' 
PDB 2W5H unspecified 'HUMAN NEK2 KINASE ATPGAMMAS-BOUND'           
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W5A 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-08 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Westwood, I.' 1 
'Bayliss, R.'  2 
# 
_citation.id                        primary 
_citation.title                     'Insights Into the Conformational Variability and Regulation of Human Nek2 Kinase.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            386 
_citation.page_first                476 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19124027 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2008.12.033 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Westwood, I.'       1 
primary 'Cheary, D.M.'       2 
primary 'Baxter, J.E.'       3 
primary 'Richards, M.W.'     4 
primary 'Van Montfort, R.L.' 5 
primary 'Fry, A.M.'          6 
primary 'Bayliss, R.'        7 
# 
_cell.entry_id           2W5A 
_cell.length_a           99.467 
_cell.length_b           57.103 
_cell.length_c           80.213 
_cell.angle_alpha        90.00 
_cell.angle_beta         132.99 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W5A 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SERINE/THREONINE-PROTEIN KINASE NEK2' 32662.479 1   2.7.11.1 ? 'KINASE DOMAIN, RESIDUES 1-271' ? 
2 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"             427.201   1   ?        ? ?                               ? 
3 non-polymer syn 'MAGNESIUM ION'                        24.305    1   ?        ? ?                               ? 
4 non-polymer syn 1,2-ETHANEDIOL                         62.068    4   ?        ? ?                               ? 
5 water       nat water                                  18.015    355 ?        ? ?                               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'NIMA-RELATED PROTEIN KINASE 2, NIMA-LIKE PROTEIN KINASE 1, HSPK 21, NEK2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT
TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF
GLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT
TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF
GLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   SER n 
1 4   ARG n 
1 5   ALA n 
1 6   GLU n 
1 7   ASP n 
1 8   TYR n 
1 9   GLU n 
1 10  VAL n 
1 11  LEU n 
1 12  TYR n 
1 13  THR n 
1 14  ILE n 
1 15  GLY n 
1 16  THR n 
1 17  GLY n 
1 18  SER n 
1 19  TYR n 
1 20  GLY n 
1 21  ARG n 
1 22  CYS n 
1 23  GLN n 
1 24  LYS n 
1 25  ILE n 
1 26  ARG n 
1 27  ARG n 
1 28  LYS n 
1 29  SER n 
1 30  ASP n 
1 31  GLY n 
1 32  LYS n 
1 33  ILE n 
1 34  LEU n 
1 35  VAL n 
1 36  TRP n 
1 37  LYS n 
1 38  GLU n 
1 39  LEU n 
1 40  ASP n 
1 41  TYR n 
1 42  GLY n 
1 43  SER n 
1 44  MET n 
1 45  THR n 
1 46  GLU n 
1 47  ALA n 
1 48  GLU n 
1 49  LYS n 
1 50  GLN n 
1 51  MET n 
1 52  LEU n 
1 53  VAL n 
1 54  SER n 
1 55  GLU n 
1 56  VAL n 
1 57  ASN n 
1 58  LEU n 
1 59  LEU n 
1 60  ARG n 
1 61  GLU n 
1 62  LEU n 
1 63  LYS n 
1 64  HIS n 
1 65  PRO n 
1 66  ASN n 
1 67  ILE n 
1 68  VAL n 
1 69  ARG n 
1 70  TYR n 
1 71  TYR n 
1 72  ASP n 
1 73  ARG n 
1 74  ILE n 
1 75  ILE n 
1 76  ASP n 
1 77  ARG n 
1 78  THR n 
1 79  ASN n 
1 80  THR n 
1 81  THR n 
1 82  LEU n 
1 83  TYR n 
1 84  ILE n 
1 85  VAL n 
1 86  MET n 
1 87  GLU n 
1 88  TYR n 
1 89  CYS n 
1 90  GLU n 
1 91  GLY n 
1 92  GLY n 
1 93  ASP n 
1 94  LEU n 
1 95  ALA n 
1 96  SER n 
1 97  VAL n 
1 98  ILE n 
1 99  THR n 
1 100 LYS n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 GLU n 
1 105 ARG n 
1 106 GLN n 
1 107 TYR n 
1 108 LEU n 
1 109 ASP n 
1 110 GLU n 
1 111 GLU n 
1 112 PHE n 
1 113 VAL n 
1 114 LEU n 
1 115 ARG n 
1 116 VAL n 
1 117 MET n 
1 118 THR n 
1 119 GLN n 
1 120 LEU n 
1 121 THR n 
1 122 LEU n 
1 123 ALA n 
1 124 LEU n 
1 125 LYS n 
1 126 GLU n 
1 127 CYS n 
1 128 HIS n 
1 129 ARG n 
1 130 ARG n 
1 131 SER n 
1 132 ASP n 
1 133 GLY n 
1 134 GLY n 
1 135 HIS n 
1 136 THR n 
1 137 VAL n 
1 138 LEU n 
1 139 HIS n 
1 140 ARG n 
1 141 ASP n 
1 142 LEU n 
1 143 LYS n 
1 144 PRO n 
1 145 ALA n 
1 146 ASN n 
1 147 VAL n 
1 148 PHE n 
1 149 LEU n 
1 150 ASP n 
1 151 GLY n 
1 152 LYS n 
1 153 GLN n 
1 154 ASN n 
1 155 VAL n 
1 156 LYS n 
1 157 LEU n 
1 158 GLY n 
1 159 ASP n 
1 160 PHE n 
1 161 GLY n 
1 162 LEU n 
1 163 ALA n 
1 164 ARG n 
1 165 ILE n 
1 166 LEU n 
1 167 ASN n 
1 168 HIS n 
1 169 ASP n 
1 170 THR n 
1 171 SER n 
1 172 PHE n 
1 173 ALA n 
1 174 LYS n 
1 175 THR n 
1 176 PHE n 
1 177 VAL n 
1 178 GLY n 
1 179 THR n 
1 180 PRO n 
1 181 TYR n 
1 182 TYR n 
1 183 MET n 
1 184 SER n 
1 185 PRO n 
1 186 GLU n 
1 187 GLN n 
1 188 MET n 
1 189 ASN n 
1 190 ARG n 
1 191 MET n 
1 192 SER n 
1 193 TYR n 
1 194 ASN n 
1 195 GLU n 
1 196 LYS n 
1 197 SER n 
1 198 ASP n 
1 199 ILE n 
1 200 TRP n 
1 201 SER n 
1 202 LEU n 
1 203 GLY n 
1 204 CYS n 
1 205 LEU n 
1 206 LEU n 
1 207 TYR n 
1 208 GLU n 
1 209 LEU n 
1 210 CYS n 
1 211 ALA n 
1 212 LEU n 
1 213 MET n 
1 214 PRO n 
1 215 PRO n 
1 216 PHE n 
1 217 THR n 
1 218 ALA n 
1 219 PHE n 
1 220 SER n 
1 221 GLN n 
1 222 LYS n 
1 223 GLU n 
1 224 LEU n 
1 225 ALA n 
1 226 GLY n 
1 227 LYS n 
1 228 ILE n 
1 229 ARG n 
1 230 GLU n 
1 231 GLY n 
1 232 LYS n 
1 233 PHE n 
1 234 ARG n 
1 235 ARG n 
1 236 ILE n 
1 237 PRO n 
1 238 TYR n 
1 239 ARG n 
1 240 TYR n 
1 241 SER n 
1 242 ASP n 
1 243 GLU n 
1 244 LEU n 
1 245 ASN n 
1 246 GLU n 
1 247 ILE n 
1 248 ILE n 
1 249 THR n 
1 250 ARG n 
1 251 MET n 
1 252 LEU n 
1 253 ASN n 
1 254 LEU n 
1 255 LYS n 
1 256 ASP n 
1 257 TYR n 
1 258 HIS n 
1 259 ARG n 
1 260 PRO n 
1 261 SER n 
1 262 VAL n 
1 263 GLU n 
1 264 GLU n 
1 265 ILE n 
1 266 LEU n 
1 267 GLU n 
1 268 ASN n 
1 269 PRO n 
1 270 LEU n 
1 271 ILE n 
1 272 LEU n 
1 273 GLU n 
1 274 HIS n 
1 275 HIS n 
1 276 HIS n 
1 277 HIS n 
1 278 HIS n 
1 279 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET30 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NEK2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P51955 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2W5A 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 271 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P51955 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  271 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       271 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2W5A LEU A 272 ? UNP P51955 ? ? 'expression tag' 272 1 
1 2W5A GLU A 273 ? UNP P51955 ? ? 'expression tag' 273 2 
1 2W5A HIS A 274 ? UNP P51955 ? ? 'expression tag' 274 3 
1 2W5A HIS A 275 ? UNP P51955 ? ? 'expression tag' 275 4 
1 2W5A HIS A 276 ? UNP P51955 ? ? 'expression tag' 276 5 
1 2W5A HIS A 277 ? UNP P51955 ? ? 'expression tag' 277 6 
1 2W5A HIS A 278 ? UNP P51955 ? ? 'expression tag' 278 7 
1 2W5A HIS A 279 ? UNP P51955 ? ? 'expression tag' 279 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ?                 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ?                 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ?                 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ?                 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ?                 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ?                 'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL             'ETHYLENE GLYCOL' 'C2 H6 O2'          62.068  
GLN 'L-peptide linking' y GLUTAMINE                  ?                 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ?                 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ?                 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ?                 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ?                 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ?                 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ?                 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ?                 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ?                 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ?                 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ?                 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ?                 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ?                 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ?                 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ?                 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ?                 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ?                 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2W5A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   57.04 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '50 MM TRIS, PH 8.5 2-10% PEG8000' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.92 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W5A 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             26.23 
_reflns.d_resolution_high            1.55 
_reflns.number_obs                   45663 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.80 
_reflns.B_iso_Wilson_estimate        14.14 
_reflns.pdbx_redundancy              3.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W5A 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     43905 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.020 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.74 
_refine.ls_d_res_high                            1.55 
_refine.ls_percent_reflns_obs                    91.9 
_refine.ls_R_factor_obs                          0.173 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.172 
_refine.ls_R_factor_R_free                       0.190 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2241 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               25.23 
_refine.aniso_B[1][1]                            -1.75410 
_refine.aniso_B[2][2]                            -2.55310 
_refine.aniso_B[3][3]                            4.30730 
_refine.aniso_B[1][2]                            -0.00000 
_refine.aniso_B[1][3]                            -3.96800 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.36 
_refine.solvent_model_param_bsol                 55.36 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.180 
_refine.pdbx_overall_phase_error                 19.180 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2175 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             355 
_refine_hist.number_atoms_total               2574 
_refine_hist.d_res_high                       1.55 
_refine_hist.d_res_low                        24.74 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 2396 'X-RAY DIFFRACTION' ? 
f_angle_d          0.977  ? ? 3245 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.264 ? ? 916  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.066  ? ? 351  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 413  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.5500 1.5837  1632 0.2217 59.00  0.2295 . . 84  . . 
'X-RAY DIFFRACTION' . 1.5837 1.6205  1935 0.2163 68.00  0.2445 . . 90  . . 
'X-RAY DIFFRACTION' . 1.6205 1.6611  2222 0.2016 79.00  0.2487 . . 117 . . 
'X-RAY DIFFRACTION' . 1.6611 1.7060  2592 0.1899 91.00  0.2100 . . 127 . . 
'X-RAY DIFFRACTION' . 1.7060 1.7561  2617 0.1826 94.00  0.2433 . . 153 . . 
'X-RAY DIFFRACTION' . 1.7561 1.8128  2668 0.1758 95.00  0.2029 . . 153 . . 
'X-RAY DIFFRACTION' . 1.8128 1.8776  2728 0.1709 96.00  0.1821 . . 121 . . 
'X-RAY DIFFRACTION' . 1.8776 1.9527  2726 0.1732 97.00  0.1987 . . 141 . . 
'X-RAY DIFFRACTION' . 1.9527 2.0416  2794 0.1585 98.00  0.2004 . . 159 . . 
'X-RAY DIFFRACTION' . 2.0416 2.1491  2771 0.1575 99.00  0.1778 . . 148 . . 
'X-RAY DIFFRACTION' . 2.1491 2.2837  2808 0.1556 99.00  0.1716 . . 164 . . 
'X-RAY DIFFRACTION' . 2.2837 2.4599  2791 0.1605 99.00  0.1912 . . 161 . . 
'X-RAY DIFFRACTION' . 2.4599 2.7072  2829 0.1701 99.00  0.1647 . . 137 . . 
'X-RAY DIFFRACTION' . 2.7072 3.0982  2806 0.1669 99.00  0.1970 . . 185 . . 
'X-RAY DIFFRACTION' . 3.0982 3.9010  2838 0.1585 100.00 0.1710 . . 157 . . 
'X-RAY DIFFRACTION' . 3.9010 24.7425 2907 0.1686 99.00  0.1752 . . 144 . . 
# 
_struct.entry_id                  2W5A 
_struct.title                     'Human Nek2 kinase ADP-bound' 
_struct.pdbx_descriptor           'SERINE/THREONINE-PROTEIN KINASE NEK2 (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W5A 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;SER/THR PROTEIN KINASE, KINASE, NUCLEUS, MEIOSIS, MITOSIS, CYTOPLASM, SERINE/THREONINE-PROTEIN KINASE, METAL-BINDING, PHOSPHOPROTEIN, NUCLEOTIDE-BINDING, MAGNESIUM, CELL CYCLE, ATP-BINDING, TRANSFERASE, CENTROSOME SPLITTING, ALTERNATIVE SPLICING, COILED COIL, POLYMORPHISM, CELL DIVISION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 4   ? GLU A 6   ? ARG A 4   GLU A 6   5 ? 3  
HELX_P HELX_P2  2  THR A 45  ? LEU A 62  ? THR A 45  LEU A 62  1 ? 18 
HELX_P HELX_P3  3  ARG A 77  ? ASN A 79  ? ARG A 77  ASN A 79  5 ? 3  
HELX_P HELX_P4  4  LEU A 94  ? GLU A 104 ? LEU A 94  GLU A 104 1 ? 11 
HELX_P HELX_P5  5  ASP A 109 ? SER A 131 ? ASP A 109 SER A 131 1 ? 23 
HELX_P HELX_P6  6  LYS A 143 ? ALA A 145 ? LYS A 143 ALA A 145 5 ? 3  
HELX_P HELX_P7  7  GLY A 161 ? LEU A 166 ? GLY A 161 LEU A 166 1 ? 6  
HELX_P HELX_P8  8  THR A 170 ? GLY A 178 ? THR A 170 GLY A 178 1 ? 9  
HELX_P HELX_P9  9  SER A 184 ? ARG A 190 ? SER A 184 ARG A 190 1 ? 7  
HELX_P HELX_P10 10 ASN A 194 ? LEU A 212 ? ASN A 194 LEU A 212 1 ? 19 
HELX_P HELX_P11 11 SER A 220 ? GLY A 231 ? SER A 220 GLY A 231 1 ? 12 
HELX_P HELX_P12 12 SER A 241 ? LEU A 252 ? SER A 241 LEU A 252 1 ? 12 
HELX_P HELX_P13 13 LYS A 255 ? ARG A 259 ? LYS A 255 ARG A 259 5 ? 5  
HELX_P HELX_P14 14 SER A 261 ? GLU A 267 ? SER A 261 GLU A 267 1 ? 7  
HELX_P HELX_P15 15 LEU A 272 ? HIS A 276 ? LEU A 272 HIS A 276 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C MG . MG ? ? ? 1_555 B ADP . O2B ? ? A MG 1281 A ADP 1280 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc2 metalc ? ? C MG . MG ? ? ? 1_555 H HOH . O   ? ? A MG 1281 A HOH 2221 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc3 metalc ? ? C MG . MG ? ? ? 1_555 B ADP . O1A ? ? A MG 1281 A ADP 1280 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc4 metalc ? ? C MG . MG ? ? ? 1_555 H HOH . O   ? ? A MG 1281 A HOH 2347 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc5 metalc ? ? C MG . MG ? ? ? 1_555 H HOH . O   ? ? A MG 1281 A HOH 2220 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc6 metalc ? ? C MG . MG ? ? ? 1_555 H HOH . O   ? ? A MG 1281 A HOH 2207 1_555 ? ? ? ? ? ? ? 2.309 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 8   ? THR A 16  ? TYR A 8   THR A 16  
AA 2 ARG A 21  ? ARG A 27  ? ARG A 21  ARG A 27  
AA 3 ILE A 33  ? ASP A 40  ? ILE A 33  ASP A 40  
AA 4 THR A 81  ? GLU A 87  ? THR A 81  GLU A 87  
AA 5 TYR A 70  ? ASP A 76  ? TYR A 70  ASP A 76  
AB 1 GLY A 92  ? ASP A 93  ? GLY A 92  ASP A 93  
AB 2 VAL A 147 ? LEU A 149 ? VAL A 147 LEU A 149 
AB 3 VAL A 155 ? LEU A 157 ? VAL A 155 LEU A 157 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 14  ? N ILE A 14  O CYS A 22  ? O CYS A 22  
AA 2 3 N ILE A 25  ? N ILE A 25  O LEU A 34  ? O LEU A 34  
AA 3 4 N LEU A 39  ? N LEU A 39  O LEU A 82  ? O LEU A 82  
AA 4 5 O VAL A 85  ? O VAL A 85  N TYR A 71  ? N TYR A 71  
AB 1 2 O GLY A 92  ? O GLY A 92  N LEU A 149 ? N LEU A 149 
AB 2 3 N PHE A 148 ? N PHE A 148 O LYS A 156 ? O LYS A 156 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE ADP A 1280' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 1281'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 1282' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 1283' 
AC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE EDO A 1284' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 1285' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 GLY A 17  ? GLY A 17   . ? 1_555 ? 
2  AC1 23 SER A 18  ? SER A 18   . ? 1_555 ? 
3  AC1 23 CYS A 22  ? CYS A 22   . ? 1_555 ? 
4  AC1 23 LYS A 37  ? LYS A 37   . ? 1_555 ? 
5  AC1 23 GLU A 87  ? GLU A 87   . ? 1_555 ? 
6  AC1 23 TYR A 88  ? TYR A 88   . ? 1_555 ? 
7  AC1 23 CYS A 89  ? CYS A 89   . ? 1_555 ? 
8  AC1 23 ASP A 93  ? ASP A 93   . ? 1_555 ? 
9  AC1 23 PHE A 148 ? PHE A 148  . ? 1_555 ? 
10 AC1 23 ARG A 164 ? ARG A 164  . ? 1_555 ? 
11 AC1 23 MG  C .   ? MG  A 1281 . ? 1_555 ? 
12 AC1 23 HOH H .   ? HOH A 2034 . ? 1_555 ? 
13 AC1 23 HOH H .   ? HOH A 2158 . ? 1_555 ? 
14 AC1 23 HOH H .   ? HOH A 2159 . ? 1_555 ? 
15 AC1 23 HOH H .   ? HOH A 2205 . ? 1_555 ? 
16 AC1 23 HOH H .   ? HOH A 2207 . ? 1_555 ? 
17 AC1 23 HOH H .   ? HOH A 2342 . ? 1_555 ? 
18 AC1 23 HOH H .   ? HOH A 2343 . ? 1_555 ? 
19 AC1 23 HOH H .   ? HOH A 2344 . ? 1_555 ? 
20 AC1 23 HOH H .   ? HOH A 2345 . ? 1_555 ? 
21 AC1 23 HOH H .   ? HOH A 2346 . ? 1_555 ? 
22 AC1 23 HOH H .   ? HOH A 2347 . ? 1_555 ? 
23 AC1 23 HOH H .   ? HOH A 2348 . ? 1_555 ? 
24 AC2 7  LYS A 37  ? LYS A 37   . ? 1_555 ? 
25 AC2 7  ARG A 164 ? ARG A 164  . ? 1_555 ? 
26 AC2 7  ADP B .   ? ADP A 1280 . ? 1_555 ? 
27 AC2 7  HOH H .   ? HOH A 2207 . ? 1_555 ? 
28 AC2 7  HOH H .   ? HOH A 2220 . ? 1_555 ? 
29 AC2 7  HOH H .   ? HOH A 2221 . ? 1_555 ? 
30 AC2 7  HOH H .   ? HOH A 2347 . ? 1_555 ? 
31 AC3 6  LEU A 11  ? LEU A 11   . ? 2_556 ? 
32 AC3 6  LYS A 152 ? LYS A 152  . ? 1_555 ? 
33 AC3 6  GLN A 153 ? GLN A 153  . ? 1_555 ? 
34 AC3 6  HOH H .   ? HOH A 2337 . ? 1_555 ? 
35 AC3 6  HOH H .   ? HOH A 2349 . ? 1_555 ? 
36 AC3 6  HOH H .   ? HOH A 2350 . ? 1_555 ? 
37 AC4 6  HIS A 139 ? HIS A 139  . ? 1_555 ? 
38 AC4 6  ARG A 140 ? ARG A 140  . ? 1_555 ? 
39 AC4 6  ASP A 159 ? ASP A 159  . ? 1_555 ? 
40 AC4 6  HOH H .   ? HOH A 2110 . ? 1_555 ? 
41 AC4 6  HOH H .   ? HOH A 2351 . ? 1_555 ? 
42 AC4 6  HOH H .   ? HOH A 2352 . ? 1_555 ? 
43 AC5 8  LEU A 122 ? LEU A 122  . ? 4_556 ? 
44 AC5 8  ARG A 235 ? ARG A 235  . ? 1_555 ? 
45 AC5 8  ASP A 242 ? ASP A 242  . ? 1_555 ? 
46 AC5 8  HIS A 276 ? HIS A 276  . ? 4_556 ? 
47 AC5 8  HIS A 277 ? HIS A 277  . ? 4_556 ? 
48 AC5 8  HOH H .   ? HOH A 2109 . ? 4_556 ? 
49 AC5 8  HOH H .   ? HOH A 2278 . ? 1_555 ? 
50 AC5 8  HOH H .   ? HOH A 2353 . ? 1_555 ? 
51 AC6 4  GLU A 246 ? GLU A 246  . ? 1_555 ? 
52 AC6 4  ILE A 247 ? ILE A 247  . ? 1_555 ? 
53 AC6 4  GLU A 264 ? GLU A 264  . ? 1_555 ? 
54 AC6 4  ASN A 268 ? ASN A 268  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2W5A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W5A 
_atom_sites.fract_transf_matrix[1][1]   0.010054 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.009372 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017512 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017043 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 3   ? -29.672 -8.589  9.386   1.00 41.97 ? 3    SER A N     1 
ATOM   2    C  CA    . SER A 1 3   ? -29.739 -7.813  8.152   1.00 43.72 ? 3    SER A CA    1 
ATOM   3    C  C     . SER A 1 3   ? -31.155 -7.753  7.585   1.00 46.96 ? 3    SER A C     1 
ATOM   4    O  O     . SER A 1 3   ? -31.346 -7.590  6.380   1.00 54.43 ? 3    SER A O     1 
ATOM   5    C  CB    . SER A 1 3   ? -28.767 -8.365  7.110   1.00 48.93 ? 3    SER A CB    1 
ATOM   6    O  OG    . SER A 1 3   ? -27.426 -8.140  7.503   1.00 52.53 ? 3    SER A OG    1 
ATOM   7    N  N     . ARG A 1 4   ? -32.142 -7.902  8.460   1.00 38.55 ? 4    ARG A N     1 
ATOM   8    C  CA    . ARG A 1 4   ? -33.527 -7.617  8.109   1.00 35.14 ? 4    ARG A CA    1 
ATOM   9    C  C     . ARG A 1 4   ? -34.087 -6.651  9.139   1.00 27.55 ? 4    ARG A C     1 
ATOM   10   O  O     . ARG A 1 4   ? -33.746 -6.734  10.317  1.00 24.87 ? 4    ARG A O     1 
ATOM   11   C  CB    . ARG A 1 4   ? -34.372 -8.891  8.079   1.00 42.18 ? 4    ARG A CB    1 
ATOM   12   C  CG    . ARG A 1 4   ? -33.975 -9.892  7.006   1.00 49.39 ? 4    ARG A CG    1 
ATOM   13   C  CD    . ARG A 1 4   ? -35.048 -10.960 6.816   1.00 54.52 ? 4    ARG A CD    1 
ATOM   14   N  NE    . ARG A 1 4   ? -35.705 -11.323 8.070   1.00 60.46 ? 4    ARG A NE    1 
ATOM   15   C  CZ    . ARG A 1 4   ? -35.110 -11.960 9.074   1.00 63.19 ? 4    ARG A CZ    1 
ATOM   16   N  NH1   . ARG A 1 4   ? -33.830 -12.299 8.982   1.00 64.56 ? 4    ARG A NH1   1 
ATOM   17   N  NH2   . ARG A 1 4   ? -35.790 -12.249 10.176  1.00 61.69 ? 4    ARG A NH2   1 
ATOM   18   N  N     . ALA A 1 5   ? -34.943 -5.739  8.693   1.00 32.27 ? 5    ALA A N     1 
ATOM   19   C  CA    . ALA A 1 5   ? -35.560 -4.768  9.590   1.00 32.81 ? 5    ALA A CA    1 
ATOM   20   C  C     . ALA A 1 5   ? -36.304 -5.444  10.739  1.00 31.46 ? 5    ALA A C     1 
ATOM   21   O  O     . ALA A 1 5   ? -36.325 -4.931  11.857  1.00 28.15 ? 5    ALA A O     1 
ATOM   22   C  CB    . ALA A 1 5   ? -36.493 -3.849  8.818   1.00 41.28 ? 5    ALA A CB    1 
ATOM   23   N  N     . GLU A 1 6   ? -36.909 -6.597  10.465  1.00 28.28 ? 6    GLU A N     1 
ATOM   24   C  CA    . GLU A 1 6   ? -37.691 -7.307  11.477  1.00 24.35 ? 6    GLU A CA    1 
ATOM   25   C  C     . GLU A 1 6   ? -36.829 -7.927  12.573  1.00 26.34 ? 6    GLU A C     1 
ATOM   26   O  O     . GLU A 1 6   ? -37.349 -8.423  13.569  1.00 26.02 ? 6    GLU A O     1 
ATOM   27   C  CB    . GLU A 1 6   ? -38.582 -8.380  10.838  1.00 33.84 ? 6    GLU A CB    1 
ATOM   28   C  CG    . GLU A 1 6   ? -37.936 -9.117  9.683   1.00 43.96 ? 6    GLU A CG    1 
ATOM   29   C  CD    . GLU A 1 6   ? -38.289 -8.508  8.340   1.00 55.14 ? 6    GLU A CD    1 
ATOM   30   O  OE1   . GLU A 1 6   ? -37.432 -7.804  7.760   1.00 54.95 ? 6    GLU A OE1   1 
ATOM   31   O  OE2   . GLU A 1 6   ? -39.428 -8.727  7.870   1.00 54.45 ? 6    GLU A OE2   1 
ATOM   32   N  N     . ASP A 1 7   ? -35.512 -7.890  12.391  1.00 24.10 ? 7    ASP A N     1 
ATOM   33   C  CA    . ASP A 1 7   ? -34.589 -8.404  13.397  1.00 26.28 ? 7    ASP A CA    1 
ATOM   34   C  C     . ASP A 1 7   ? -34.417 -7.418  14.552  1.00 22.29 ? 7    ASP A C     1 
ATOM   35   O  O     . ASP A 1 7   ? -33.829 -7.750  15.581  1.00 22.53 ? 7    ASP A O     1 
ATOM   36   C  CB    . ASP A 1 7   ? -33.226 -8.704  12.771  1.00 26.44 ? 7    ASP A CB    1 
ATOM   37   C  CG    . ASP A 1 7   ? -33.281 -9.850  11.780  1.00 30.61 ? 7    ASP A CG    1 
ATOM   38   O  OD1   . ASP A 1 7   ? -34.179 -10.708 11.912  1.00 38.08 ? 7    ASP A OD1   1 
ATOM   39   O  OD2   . ASP A 1 7   ? -32.425 -9.892  10.875  1.00 35.69 ? 7    ASP A OD2   1 
ATOM   40   N  N     . TYR A 1 8   ? -34.936 -6.208  14.372  1.00 20.43 ? 8    TYR A N     1 
ATOM   41   C  CA    . TYR A 1 8   ? -34.777 -5.148  15.360  1.00 15.73 ? 8    TYR A CA    1 
ATOM   42   C  C     . TYR A 1 8   ? -36.103 -4.457  15.635  1.00 16.12 ? 8    TYR A C     1 
ATOM   43   O  O     . TYR A 1 8   ? -36.995 -4.442  14.786  1.00 17.89 ? 8    TYR A O     1 
ATOM   44   C  CB    . TYR A 1 8   ? -33.789 -4.093  14.853  1.00 15.45 ? 8    TYR A CB    1 
ATOM   45   C  CG    . TYR A 1 8   ? -32.418 -4.613  14.485  1.00 15.87 ? 8    TYR A CG    1 
ATOM   46   C  CD1   . TYR A 1 8   ? -32.169 -5.143  13.222  1.00 20.65 ? 8    TYR A CD1   1 
ATOM   47   C  CD2   . TYR A 1 8   ? -31.369 -4.551  15.389  1.00 15.33 ? 8    TYR A CD2   1 
ATOM   48   C  CE1   . TYR A 1 8   ? -30.917 -5.611  12.878  1.00 23.91 ? 8    TYR A CE1   1 
ATOM   49   C  CE2   . TYR A 1 8   ? -30.110 -5.016  15.055  1.00 15.42 ? 8    TYR A CE2   1 
ATOM   50   C  CZ    . TYR A 1 8   ? -29.888 -5.542  13.802  1.00 20.19 ? 8    TYR A CZ    1 
ATOM   51   O  OH    . TYR A 1 8   ? -28.628 -6.001  13.471  1.00 20.77 ? 8    TYR A OH    1 
ATOM   52   N  N     . GLU A 1 9   ? -36.223 -3.867  16.816  1.00 12.90 ? 9    GLU A N     1 
ATOM   53   C  CA    . GLU A 1 9   ? -37.386 -3.041  17.123  1.00 15.62 ? 9    GLU A CA    1 
ATOM   54   C  C     . GLU A 1 9   ? -36.954 -1.622  17.474  1.00 14.73 ? 9    GLU A C     1 
ATOM   55   O  O     . GLU A 1 9   ? -36.134 -1.420  18.374  1.00 14.05 ? 9    GLU A O     1 
ATOM   56   C  CB    . GLU A 1 9   ? -38.185 -3.632  18.276  1.00 17.49 ? 9    GLU A CB    1 
ATOM   57   C  CG    . GLU A 1 9   ? -39.437 -2.827  18.602  1.00 16.62 ? 9    GLU A CG    1 
ATOM   58   C  CD    . GLU A 1 9   ? -40.202 -3.400  19.768  1.00 29.34 ? 9    GLU A CD    1 
ATOM   59   O  OE1   . GLU A 1 9   ? -39.795 -4.471  20.264  1.00 30.49 ? 9    GLU A OE1   1 
ATOM   60   O  OE2   . GLU A 1 9   ? -41.208 -2.784  20.184  1.00 26.13 ? 9    GLU A OE2   1 
ATOM   61   N  N     . VAL A 1 10  ? -37.498 -0.641  16.761  1.00 14.27 ? 10   VAL A N     1 
ATOM   62   C  CA    . VAL A 1 10  ? -37.215 0.756   17.070  1.00 15.57 ? 10   VAL A CA    1 
ATOM   63   C  C     . VAL A 1 10  ? -37.852 1.106   18.407  1.00 16.97 ? 10   VAL A C     1 
ATOM   64   O  O     . VAL A 1 10  ? -39.040 0.846   18.627  1.00 16.49 ? 10   VAL A O     1 
ATOM   65   C  CB    . VAL A 1 10  ? -37.743 1.712   15.972  1.00 16.59 ? 10   VAL A CB    1 
ATOM   66   C  CG1   . VAL A 1 10  ? -37.642 3.169   16.417  1.00 16.24 ? 10   VAL A CG1   1 
ATOM   67   C  CG2   . VAL A 1 10  ? -36.990 1.503   14.666  1.00 14.23 ? 10   VAL A CG2   1 
ATOM   68   N  N     . LEU A 1 11  ? -37.057 1.676   19.305  1.00 13.14 ? 11   LEU A N     1 
ATOM   69   C  CA    . LEU A 1 11  ? -37.579 2.159   20.578  1.00 13.64 ? 11   LEU A CA    1 
ATOM   70   C  C     . LEU A 1 11  ? -38.024 3.617   20.461  1.00 16.45 ? 11   LEU A C     1 
ATOM   71   O  O     . LEU A 1 11  ? -39.158 3.960   20.799  1.00 16.60 ? 11   LEU A O     1 
ATOM   72   C  CB    . LEU A 1 11  ? -36.541 1.984   21.691  1.00 13.10 ? 11   LEU A CB    1 
ATOM   73   C  CG    . LEU A 1 11  ? -36.093 0.532   21.909  1.00 14.56 ? 11   LEU A CG    1 
ATOM   74   C  CD1   . LEU A 1 11  ? -35.197 0.424   23.137  1.00 20.44 ? 11   LEU A CD1   1 
ATOM   75   C  CD2   . LEU A 1 11  ? -37.298 -0.393  22.042  1.00 18.37 ? 11   LEU A CD2   1 
ATOM   76   N  N     . TYR A 1 12  ? -37.134 4.474   19.972  1.00 14.64 ? 12   TYR A N     1 
ATOM   77   C  CA    . TYR A 1 12  ? -37.462 5.881   19.758  1.00 14.63 ? 12   TYR A CA    1 
ATOM   78   C  C     . TYR A 1 12  ? -36.359 6.581   18.989  1.00 14.17 ? 12   TYR A C     1 
ATOM   79   O  O     . TYR A 1 12  ? -35.261 6.045   18.830  1.00 15.18 ? 12   TYR A O     1 
ATOM   80   C  CB    . TYR A 1 12  ? -37.721 6.608   21.087  1.00 13.07 ? 12   TYR A CB    1 
ATOM   81   C  CG    . TYR A 1 12  ? -36.540 6.626   22.030  1.00 13.13 ? 12   TYR A CG    1 
ATOM   82   C  CD1   . TYR A 1 12  ? -35.572 7.623   21.950  1.00 14.34 ? 12   TYR A CD1   1 
ATOM   83   C  CD2   . TYR A 1 12  ? -36.400 5.650   23.002  1.00 15.39 ? 12   TYR A CD2   1 
ATOM   84   C  CE1   . TYR A 1 12  ? -34.489 7.633   22.821  1.00 15.76 ? 12   TYR A CE1   1 
ATOM   85   C  CE2   . TYR A 1 12  ? -35.327 5.651   23.871  1.00 13.99 ? 12   TYR A CE2   1 
ATOM   86   C  CZ    . TYR A 1 12  ? -34.380 6.643   23.772  1.00 16.37 ? 12   TYR A CZ    1 
ATOM   87   O  OH    . TYR A 1 12  ? -33.317 6.641   24.644  1.00 20.08 ? 12   TYR A OH    1 
ATOM   88   N  N     . THR A 1 13  ? -36.665 7.778   18.510  1.00 13.48 ? 13   THR A N     1 
ATOM   89   C  CA    . THR A 1 13  ? -35.706 8.571   17.763  1.00 14.06 ? 13   THR A CA    1 
ATOM   90   C  C     . THR A 1 13  ? -34.857 9.370   18.739  1.00 16.68 ? 13   THR A C     1 
ATOM   91   O  O     . THR A 1 13  ? -35.378 10.121  19.562  1.00 16.22 ? 13   THR A O     1 
ATOM   92   C  CB    . THR A 1 13  ? -36.418 9.517   16.772  1.00 18.39 ? 13   THR A CB    1 
ATOM   93   O  OG1   . THR A 1 13  ? -37.121 8.743   15.786  1.00 17.72 ? 13   THR A OG1   1 
ATOM   94   C  CG2   . THR A 1 13  ? -35.415 10.429  16.082  1.00 17.66 ? 13   THR A CG2   1 
ATOM   95   N  N     . ILE A 1 14  ? -33.545 9.182   18.665  1.00 14.28 ? 14   ILE A N     1 
ATOM   96   C  CA    . ILE A 1 14  ? -32.617 9.920   19.511  1.00 13.97 ? 14   ILE A CA    1 
ATOM   97   C  C     . ILE A 1 14  ? -32.500 11.354  19.013  1.00 16.55 ? 14   ILE A C     1 
ATOM   98   O  O     . ILE A 1 14  ? -32.567 12.314  19.790  1.00 18.88 ? 14   ILE A O     1 
ATOM   99   C  CB    . ILE A 1 14  ? -31.224 9.250   19.524  1.00 13.85 ? 14   ILE A CB    1 
ATOM   100  C  CG1   . ILE A 1 14  ? -31.293 7.899   20.239  1.00 15.59 ? 14   ILE A CG1   1 
ATOM   101  C  CG2   . ILE A 1 14  ? -30.192 10.154  20.200  1.00 17.34 ? 14   ILE A CG2   1 
ATOM   102  C  CD1   . ILE A 1 14  ? -30.054 7.028   20.032  1.00 14.83 ? 14   ILE A CD1   1 
ATOM   103  N  N     . GLY A 1 15  ? -32.321 11.501  17.709  1.00 14.86 ? 15   GLY A N     1 
ATOM   104  C  CA    . GLY A 1 15  ? -32.269 12.814  17.102  1.00 20.37 ? 15   GLY A CA    1 
ATOM   105  C  C     . GLY A 1 15  ? -32.322 12.727  15.595  1.00 23.55 ? 15   GLY A C     1 
ATOM   106  O  O     . GLY A 1 15  ? -32.107 11.664  15.014  1.00 23.60 ? 15   GLY A O     1 
ATOM   107  N  N     . THR A 1 16  ? -32.617 13.849  14.955  1.00 24.48 ? 16   THR A N     1 
ATOM   108  C  CA    . THR A 1 16  ? -32.577 13.913  13.506  1.00 22.06 ? 16   THR A CA    1 
ATOM   109  C  C     . THR A 1 16  ? -31.298 14.598  13.042  1.00 28.56 ? 16   THR A C     1 
ATOM   110  O  O     . THR A 1 16  ? -31.075 15.776  13.320  1.00 31.69 ? 16   THR A O     1 
ATOM   111  C  CB    . THR A 1 16  ? -33.812 14.630  12.935  1.00 28.39 ? 16   THR A CB    1 
ATOM   112  O  OG1   . THR A 1 16  ? -34.987 13.882  13.271  1.00 28.37 ? 16   THR A OG1   1 
ATOM   113  C  CG2   . THR A 1 16  ? -33.705 14.742  11.421  1.00 33.36 ? 16   THR A CG2   1 
ATOM   114  N  N     . GLY A 1 17  ? -30.451 13.841  12.351  1.00 24.32 ? 17   GLY A N     1 
ATOM   115  C  CA    . GLY A 1 17  ? -29.224 14.369  11.795  1.00 27.07 ? 17   GLY A CA    1 
ATOM   116  C  C     . GLY A 1 17  ? -29.467 15.033  10.456  1.00 31.33 ? 17   GLY A C     1 
ATOM   117  O  O     . GLY A 1 17  ? -30.610 15.166  10.012  1.00 33.62 ? 17   GLY A O     1 
ATOM   118  N  N     . SER A 1 18  ? -28.387 15.447  9.807   1.00 24.48 ? 18   SER A N     1 
ATOM   119  C  CA    . SER A 1 18  ? -28.486 16.159  8.538   1.00 29.26 ? 18   SER A CA    1 
ATOM   120  C  C     . SER A 1 18  ? -29.021 15.273  7.418   1.00 31.13 ? 18   SER A C     1 
ATOM   121  O  O     . SER A 1 18  ? -29.596 15.771  6.448   1.00 31.99 ? 18   SER A O     1 
ATOM   122  C  CB    . SER A 1 18  ? -27.124 16.737  8.143   1.00 31.86 ? 18   SER A CB    1 
ATOM   123  O  OG    . SER A 1 18  ? -26.655 17.647  9.123   1.00 35.17 ? 18   SER A OG    1 
ATOM   124  N  N     . TYR A 1 19  ? -28.839 13.962  7.549   1.00 24.99 ? 19   TYR A N     1 
ATOM   125  C  CA    . TYR A 1 19  ? -29.188 13.050  6.459   1.00 25.59 ? 19   TYR A CA    1 
ATOM   126  C  C     . TYR A 1 19  ? -30.225 12.005  6.836   1.00 29.15 ? 19   TYR A C     1 
ATOM   127  O  O     . TYR A 1 19  ? -30.587 11.151  6.022   1.00 32.50 ? 19   TYR A O     1 
ATOM   128  C  CB    . TYR A 1 19  ? -27.928 12.387  5.902   1.00 30.45 ? 19   TYR A CB    1 
ATOM   129  C  CG    . TYR A 1 19  ? -26.899 13.398  5.457   1.00 31.11 ? 19   TYR A CG    1 
ATOM   130  C  CD1   . TYR A 1 19  ? -26.958 13.964  4.188   1.00 33.00 ? 19   TYR A CD1   1 
ATOM   131  C  CD2   . TYR A 1 19  ? -25.885 13.809  6.312   1.00 30.93 ? 19   TYR A CD2   1 
ATOM   132  C  CE1   . TYR A 1 19  ? -26.025 14.898  3.779   1.00 36.44 ? 19   TYR A CE1   1 
ATOM   133  C  CE2   . TYR A 1 19  ? -24.947 14.744  5.910   1.00 36.04 ? 19   TYR A CE2   1 
ATOM   134  C  CZ    . TYR A 1 19  ? -25.025 15.285  4.643   1.00 37.06 ? 19   TYR A CZ    1 
ATOM   135  O  OH    . TYR A 1 19  ? -24.097 16.215  4.237   1.00 42.60 ? 19   TYR A OH    1 
ATOM   136  N  N     . GLY A 1 20  ? -30.716 12.079  8.065   1.00 25.06 ? 20   GLY A N     1 
ATOM   137  C  CA    . GLY A 1 20  ? -31.750 11.164  8.501   1.00 23.92 ? 20   GLY A CA    1 
ATOM   138  C  C     . GLY A 1 20  ? -31.768 11.001  10.003  1.00 22.35 ? 20   GLY A C     1 
ATOM   139  O  O     . GLY A 1 20  ? -30.939 11.578  10.713  1.00 24.40 ? 20   GLY A O     1 
ATOM   140  N  N     . ARG A 1 21  ? -32.713 10.201  10.482  1.00 22.69 ? 21   ARG A N     1 
ATOM   141  C  CA    . ARG A 1 21  ? -32.875 9.974   11.910  1.00 19.22 ? 21   ARG A CA    1 
ATOM   142  C  C     . ARG A 1 21  ? -31.861 8.979   12.452  1.00 18.44 ? 21   ARG A C     1 
ATOM   143  O  O     . ARG A 1 21  ? -31.473 8.028   11.771  1.00 17.74 ? 21   ARG A O     1 
ATOM   144  C  CB    . ARG A 1 21  ? -34.283 9.460   12.207  1.00 22.43 ? 21   ARG A CB    1 
ATOM   145  C  CG    . ARG A 1 21  ? -35.382 10.453  11.883  1.00 25.90 ? 21   ARG A CG    1 
ATOM   146  C  CD    . ARG A 1 21  ? -36.750 9.872   12.196  1.00 23.18 ? 21   ARG A CD    1 
ATOM   147  N  NE    . ARG A 1 21  ? -37.047 8.693   11.388  1.00 25.05 ? 21   ARG A NE    1 
ATOM   148  C  CZ    . ARG A 1 21  ? -38.164 7.980   11.502  1.00 29.86 ? 21   ARG A CZ    1 
ATOM   149  N  NH1   . ARG A 1 21  ? -39.079 8.324   12.398  1.00 29.03 ? 21   ARG A NH1   1 
ATOM   150  N  NH2   . ARG A 1 21  ? -38.363 6.920   10.729  1.00 26.07 ? 21   ARG A NH2   1 
ATOM   151  N  N     . CYS A 1 22  ? -31.436 9.221   13.687  1.00 13.19 ? 22   CYS A N     1 
ATOM   152  C  CA    . CYS A 1 22  ? -30.711 8.238   14.469  1.00 12.84 ? 22   CYS A CA    1 
ATOM   153  C  C     . CYS A 1 22  ? -31.698 7.717   15.498  1.00 13.27 ? 22   CYS A C     1 
ATOM   154  O  O     . CYS A 1 22  ? -32.258 8.494   16.271  1.00 14.47 ? 22   CYS A O     1 
ATOM   155  C  CB    . CYS A 1 22  ? -29.518 8.871   15.178  1.00 10.79 ? 22   CYS A CB    1 
ATOM   156  S  SG    . CYS A 1 22  ? -28.590 7.699   16.201  1.00 14.71 ? 22   CYS A SG    1 
ATOM   157  N  N     . GLN A 1 23  ? -31.926 6.408   15.498  1.00 10.43 ? 23   GLN A N     1 
ATOM   158  C  CA    . GLN A 1 23  ? -32.934 5.830   16.376  1.00 12.24 ? 23   GLN A CA    1 
ATOM   159  C  C     . GLN A 1 23  ? -32.320 4.783   17.285  1.00 12.29 ? 23   GLN A C     1 
ATOM   160  O  O     . GLN A 1 23  ? -31.467 4.001   16.854  1.00 12.91 ? 23   GLN A O     1 
ATOM   161  C  CB    . GLN A 1 23  ? -34.054 5.185   15.554  1.00 13.22 ? 23   GLN A CB    1 
ATOM   162  C  CG    . GLN A 1 23  ? -34.699 6.112   14.528  1.00 13.53 ? 23   GLN A CG    1 
ATOM   163  C  CD    . GLN A 1 23  ? -35.957 5.508   13.923  1.00 17.42 ? 23   GLN A CD    1 
ATOM   164  O  OE1   . GLN A 1 23  ? -35.905 4.471   13.263  1.00 19.70 ? 23   GLN A OE1   1 
ATOM   165  N  NE2   . GLN A 1 23  ? -37.094 6.147   14.162  1.00 19.19 ? 23   GLN A NE2   1 
ATOM   166  N  N     . LYS A 1 24  ? -32.750 4.769   18.544  1.00 11.96 ? 24   LYS A N     1 
ATOM   167  C  CA    . LYS A 1 24  ? -32.368 3.690   19.439  1.00 12.75 ? 24   LYS A CA    1 
ATOM   168  C  C     . LYS A 1 24  ? -33.193 2.468   19.085  1.00 12.93 ? 24   LYS A C     1 
ATOM   169  O  O     . LYS A 1 24  ? -34.411 2.563   18.920  1.00 13.39 ? 24   LYS A O     1 
ATOM   170  C  CB    . LYS A 1 24  ? -32.580 4.057   20.910  1.00 13.43 ? 24   LYS A CB    1 
ATOM   171  C  CG    . LYS A 1 24  ? -32.204 2.915   21.840  1.00 14.01 ? 24   LYS A CG    1 
ATOM   172  C  CD    . LYS A 1 24  ? -32.452 3.252   23.304  1.00 14.13 ? 24   LYS A CD    1 
ATOM   173  C  CE    . LYS A 1 24  ? -31.440 4.256   23.818  1.00 17.68 ? 24   LYS A CE    1 
ATOM   174  N  NZ    . LYS A 1 24  ? -31.504 4.381   25.305  1.00 17.49 ? 24   LYS A NZ    1 
ATOM   175  N  N     . ILE A 1 25  ? -32.520 1.333   18.928  1.00 12.60 ? 25   ILE A N     1 
ATOM   176  C  CA    . ILE A 1 25  ? -33.179 0.091   18.562  1.00 13.74 ? 25   ILE A CA    1 
ATOM   177  C  C     . ILE A 1 25  ? -32.756 -1.048  19.477  1.00 12.94 ? 25   ILE A C     1 
ATOM   178  O  O     . ILE A 1 25  ? -31.721 -0.984  20.143  1.00 14.18 ? 25   ILE A O     1 
ATOM   179  C  CB    . ILE A 1 25  ? -32.902 -0.296  17.091  1.00 12.42 ? 25   ILE A CB    1 
ATOM   180  C  CG1   . ILE A 1 25  ? -31.441 -0.717  16.912  1.00 13.07 ? 25   ILE A CG1   1 
ATOM   181  C  CG2   . ILE A 1 25  ? -33.242 0.860   16.169  1.00 13.25 ? 25   ILE A CG2   1 
ATOM   182  C  CD1   . ILE A 1 25  ? -31.066 -1.018  15.470  1.00 14.80 ? 25   ILE A CD1   1 
ATOM   183  N  N     A ARG A 1 26  ? -33.564 -2.103  19.492  0.50 13.80 ? 26   ARG A N     1 
ATOM   184  N  N     B ARG A 1 26  ? -33.586 -2.084  19.519  0.50 13.68 ? 26   ARG A N     1 
ATOM   185  C  CA    A ARG A 1 26  ? -33.291 -3.283  20.303  0.50 15.39 ? 26   ARG A CA    1 
ATOM   186  C  CA    B ARG A 1 26  ? -33.285 -3.283  20.283  0.50 14.91 ? 26   ARG A CA    1 
ATOM   187  C  C     A ARG A 1 26  ? -33.230 -4.536  19.430  0.50 15.87 ? 26   ARG A C     1 
ATOM   188  C  C     B ARG A 1 26  ? -33.175 -4.459  19.325  0.50 15.58 ? 26   ARG A C     1 
ATOM   189  O  O     A ARG A 1 26  ? -34.205 -4.884  18.765  0.50 17.73 ? 26   ARG A O     1 
ATOM   190  O  O     B ARG A 1 26  ? -34.056 -4.671  18.494  0.50 14.03 ? 26   ARG A O     1 
ATOM   191  C  CB    A ARG A 1 26  ? -34.365 -3.431  21.386  0.50 17.96 ? 26   ARG A CB    1 
ATOM   192  C  CB    B ARG A 1 26  ? -34.380 -3.544  21.321  0.50 17.73 ? 26   ARG A CB    1 
ATOM   193  C  CG    A ARG A 1 26  ? -34.484 -4.818  21.996  0.50 20.97 ? 26   ARG A CG    1 
ATOM   194  C  CG    B ARG A 1 26  ? -34.101 -4.705  22.270  0.50 18.63 ? 26   ARG A CG    1 
ATOM   195  C  CD    A ARG A 1 26  ? -35.746 -4.911  22.850  0.50 26.83 ? 26   ARG A CD    1 
ATOM   196  C  CD    B ARG A 1 26  ? -35.300 -4.953  23.179  0.50 24.39 ? 26   ARG A CD    1 
ATOM   197  N  NE    A ARG A 1 26  ? -35.541 -4.389  24.198  0.50 32.13 ? 26   ARG A NE    1 
ATOM   198  N  NE    B ARG A 1 26  ? -35.119 -6.098  24.068  0.50 20.52 ? 26   ARG A NE    1 
ATOM   199  C  CZ    A ARG A 1 26  ? -36.444 -3.692  24.881  0.50 30.49 ? 26   ARG A CZ    1 
ATOM   200  C  CZ    B ARG A 1 26  ? -35.470 -7.345  23.763  0.50 25.51 ? 26   ARG A CZ    1 
ATOM   201  N  NH1   A ARG A 1 26  ? -36.166 -3.266  26.106  0.50 25.93 ? 26   ARG A NH1   1 
ATOM   202  N  NH1   B ARG A 1 26  ? -36.015 -7.614  22.585  0.50 21.01 ? 26   ARG A NH1   1 
ATOM   203  N  NH2   A ARG A 1 26  ? -37.619 -3.404  24.337  0.50 32.02 ? 26   ARG A NH2   1 
ATOM   204  N  NH2   B ARG A 1 26  ? -35.272 -8.324  24.635  0.50 26.15 ? 26   ARG A NH2   1 
ATOM   205  N  N     . ARG A 1 27  ? -32.077 -5.201  19.426  1.00 15.46 ? 27   ARG A N     1 
ATOM   206  C  CA    . ARG A 1 27  ? -31.880 -6.405  18.628  1.00 17.17 ? 27   ARG A CA    1 
ATOM   207  C  C     . ARG A 1 27  ? -32.670 -7.538  19.271  1.00 19.05 ? 27   ARG A C     1 
ATOM   208  O  O     . ARG A 1 27  ? -32.496 -7.823  20.454  1.00 22.15 ? 27   ARG A O     1 
ATOM   209  C  CB    . ARG A 1 27  ? -30.391 -6.763  18.558  1.00 18.56 ? 27   ARG A CB    1 
ATOM   210  C  CG    . ARG A 1 27  ? -30.071 -7.898  17.597  1.00 18.66 ? 27   ARG A CG    1 
ATOM   211  C  CD    . ARG A 1 27  ? -28.578 -7.954  17.284  1.00 18.75 ? 27   ARG A CD    1 
ATOM   212  N  NE    . ARG A 1 27  ? -27.765 -8.237  18.465  1.00 22.84 ? 27   ARG A NE    1 
ATOM   213  C  CZ    . ARG A 1 27  ? -26.435 -8.170  18.488  1.00 22.87 ? 27   ARG A CZ    1 
ATOM   214  N  NH1   . ARG A 1 27  ? -25.766 -7.814  17.399  1.00 22.39 ? 27   ARG A NH1   1 
ATOM   215  N  NH2   . ARG A 1 27  ? -25.772 -8.453  19.602  1.00 26.63 ? 27   ARG A NH2   1 
ATOM   216  N  N     . LYS A 1 28  ? -33.546 -8.168  18.497  1.00 19.66 ? 28   LYS A N     1 
ATOM   217  C  CA    . LYS A 1 28  ? -34.475 -9.154  19.048  1.00 19.76 ? 28   LYS A CA    1 
ATOM   218  C  C     . LYS A 1 28  ? -33.796 -10.428 19.539  1.00 26.29 ? 28   LYS A C     1 
ATOM   219  O  O     . LYS A 1 28  ? -34.228 -11.029 20.523  1.00 31.47 ? 28   LYS A O     1 
ATOM   220  C  CB    . LYS A 1 28  ? -35.549 -9.506  18.022  1.00 23.91 ? 28   LYS A CB    1 
ATOM   221  C  CG    . LYS A 1 28  ? -36.489 -8.366  17.709  1.00 26.48 ? 28   LYS A CG    1 
ATOM   222  C  CD    . LYS A 1 28  ? -37.638 -8.856  16.856  1.00 27.81 ? 28   LYS A CD    1 
ATOM   223  C  CE    . LYS A 1 28  ? -38.698 -7.786  16.709  1.00 27.74 ? 28   LYS A CE    1 
ATOM   224  N  NZ    . LYS A 1 28  ? -39.884 -8.327  16.016  1.00 25.98 ? 28   LYS A NZ    1 
ATOM   225  N  N     . SER A 1 29  ? -32.735 -10.837 18.857  1.00 25.20 ? 29   SER A N     1 
ATOM   226  C  CA    . SER A 1 29  ? -32.072 -12.096 19.190  1.00 31.57 ? 29   SER A CA    1 
ATOM   227  C  C     . SER A 1 29  ? -31.596 -12.142 20.641  1.00 37.18 ? 29   SER A C     1 
ATOM   228  O  O     . SER A 1 29  ? -31.746 -13.161 21.316  1.00 37.15 ? 29   SER A O     1 
ATOM   229  C  CB    . SER A 1 29  ? -30.907 -12.365 18.234  1.00 32.14 ? 29   SER A CB    1 
ATOM   230  O  OG    . SER A 1 29  ? -29.957 -11.318 18.270  1.00 28.54 ? 29   SER A OG    1 
ATOM   231  N  N     . ASP A 1 30  ? -31.034 -11.036 21.125  1.00 25.95 ? 30   ASP A N     1 
ATOM   232  C  CA    . ASP A 1 30  ? -30.443 -11.014 22.463  1.00 31.50 ? 30   ASP A CA    1 
ATOM   233  C  C     . ASP A 1 30  ? -30.821 -9.787  23.287  1.00 28.62 ? 30   ASP A C     1 
ATOM   234  O  O     . ASP A 1 30  ? -30.369 -9.637  24.421  1.00 25.18 ? 30   ASP A O     1 
ATOM   235  C  CB    . ASP A 1 30  ? -28.917 -11.133 22.379  1.00 27.72 ? 30   ASP A CB    1 
ATOM   236  C  CG    . ASP A 1 30  ? -28.282 -9.977  21.634  1.00 31.91 ? 30   ASP A CG    1 
ATOM   237  O  OD1   . ASP A 1 30  ? -29.028 -9.194  21.007  1.00 25.17 ? 30   ASP A OD1   1 
ATOM   238  O  OD2   . ASP A 1 30  ? -27.037 -9.851  21.673  1.00 33.49 ? 30   ASP A OD2   1 
ATOM   239  N  N     . GLY A 1 31  ? -31.642 -8.910  22.718  1.00 24.18 ? 31   GLY A N     1 
ATOM   240  C  CA    . GLY A 1 31  ? -32.081 -7.717  23.417  1.00 25.12 ? 31   GLY A CA    1 
ATOM   241  C  C     . GLY A 1 31  ? -31.050 -6.603  23.472  1.00 26.07 ? 31   GLY A C     1 
ATOM   242  O  O     . GLY A 1 31  ? -31.216 -5.635  24.213  1.00 25.03 ? 31   GLY A O     1 
ATOM   243  N  N     . LYS A 1 32  ? -29.980 -6.730  22.695  1.00 21.08 ? 32   LYS A N     1 
ATOM   244  C  CA    . LYS A 1 32  ? -28.916 -5.730  22.733  1.00 20.16 ? 32   LYS A CA    1 
ATOM   245  C  C     . LYS A 1 32  ? -29.407 -4.380  22.234  1.00 17.62 ? 32   LYS A C     1 
ATOM   246  O  O     . LYS A 1 32  ? -30.043 -4.290  21.185  1.00 17.39 ? 32   LYS A O     1 
ATOM   247  C  CB    . LYS A 1 32  ? -27.700 -6.175  21.920  1.00 20.00 ? 32   LYS A CB    1 
ATOM   248  C  CG    . LYS A 1 32  ? -26.559 -5.167  21.953  1.00 23.98 ? 32   LYS A CG    1 
ATOM   249  C  CD    . LYS A 1 32  ? -25.274 -5.740  21.397  1.00 30.41 ? 32   LYS A CD    1 
ATOM   250  C  CE    . LYS A 1 32  ? -24.108 -4.783  21.608  1.00 35.39 ? 32   LYS A CE    1 
ATOM   251  N  NZ    . LYS A 1 32  ? -23.789 -4.593  23.054  1.00 37.88 ? 32   LYS A NZ    1 
ATOM   252  N  N     . ILE A 1 33  ? -29.100 -3.332  22.991  1.00 15.21 ? 33   ILE A N     1 
ATOM   253  C  CA    . ILE A 1 33  ? -29.454 -1.975  22.601  1.00 13.02 ? 33   ILE A CA    1 
ATOM   254  C  C     . ILE A 1 33  ? -28.388 -1.397  21.672  1.00 16.15 ? 33   ILE A C     1 
ATOM   255  O  O     . ILE A 1 33  ? -27.193 -1.415  21.982  1.00 17.04 ? 33   ILE A O     1 
ATOM   256  C  CB    . ILE A 1 33  ? -29.642 -1.066  23.830  1.00 15.58 ? 33   ILE A CB    1 
ATOM   257  C  CG1   . ILE A 1 33  ? -30.742 -1.629  24.737  1.00 17.93 ? 33   ILE A CG1   1 
ATOM   258  C  CG2   . ILE A 1 33  ? -29.963 0.361   23.403  1.00 15.48 ? 33   ILE A CG2   1 
ATOM   259  C  CD1   . ILE A 1 33  ? -32.109 -1.707  24.068  1.00 18.17 ? 33   ILE A CD1   1 
ATOM   260  N  N     . LEU A 1 34  ? -28.839 -0.902  20.525  1.00 13.47 ? 34   LEU A N     1 
ATOM   261  C  CA    . LEU A 1 34  ? -27.974 -0.370  19.482  1.00 12.34 ? 34   LEU A CA    1 
ATOM   262  C  C     . LEU A 1 34  ? -28.638 0.896   18.955  1.00 12.10 ? 34   LEU A C     1 
ATOM   263  O  O     . LEU A 1 34  ? -29.688 1.298   19.449  1.00 12.55 ? 34   LEU A O     1 
ATOM   264  C  CB    . LEU A 1 34  ? -27.850 -1.393  18.347  1.00 13.16 ? 34   LEU A CB    1 
ATOM   265  C  CG    . LEU A 1 34  ? -27.153 -2.703  18.729  1.00 12.80 ? 34   LEU A CG    1 
ATOM   266  C  CD1   . LEU A 1 34  ? -27.535 -3.848  17.789  1.00 14.84 ? 34   LEU A CD1   1 
ATOM   267  C  CD2   . LEU A 1 34  ? -25.639 -2.498  18.755  1.00 17.54 ? 34   LEU A CD2   1 
ATOM   268  N  N     . VAL A 1 35  ? -28.024 1.534   17.964  1.00 12.23 ? 35   VAL A N     1 
ATOM   269  C  CA    . VAL A 1 35  ? -28.731 2.555   17.201  1.00 11.08 ? 35   VAL A CA    1 
ATOM   270  C  C     . VAL A 1 35  ? -28.703 2.171   15.737  1.00 12.63 ? 35   VAL A C     1 
ATOM   271  O  O     . VAL A 1 35  ? -27.901 1.336   15.319  1.00 13.11 ? 35   VAL A O     1 
ATOM   272  C  CB    . VAL A 1 35  ? -28.117 3.972   17.361  1.00 11.73 ? 35   VAL A CB    1 
ATOM   273  C  CG1   . VAL A 1 35  ? -27.994 4.331   18.830  1.00 12.57 ? 35   VAL A CG1   1 
ATOM   274  C  CG2   . VAL A 1 35  ? -26.768 4.073   16.647  1.00 12.06 ? 35   VAL A CG2   1 
ATOM   275  N  N     . TRP A 1 36  ? -29.602 2.751   14.956  1.00 11.47 ? 36   TRP A N     1 
ATOM   276  C  CA    . TRP A 1 36  ? -29.372 2.769   13.522  1.00 13.04 ? 36   TRP A CA    1 
ATOM   277  C  C     . TRP A 1 36  ? -29.568 4.159   12.948  1.00 14.81 ? 36   TRP A C     1 
ATOM   278  O  O     . TRP A 1 36  ? -30.256 4.997   13.540  1.00 13.79 ? 36   TRP A O     1 
ATOM   279  C  CB    . TRP A 1 36  ? -30.160 1.686   12.759  1.00 13.92 ? 36   TRP A CB    1 
ATOM   280  C  CG    . TRP A 1 36  ? -31.660 1.805   12.699  1.00 13.07 ? 36   TRP A CG    1 
ATOM   281  C  CD1   . TRP A 1 36  ? -32.424 2.935   12.849  1.00 14.71 ? 36   TRP A CD1   1 
ATOM   282  C  CD2   . TRP A 1 36  ? -32.573 0.738   12.398  1.00 14.58 ? 36   TRP A CD2   1 
ATOM   283  N  NE1   . TRP A 1 36  ? -33.762 2.619   12.686  1.00 16.91 ? 36   TRP A NE1   1 
ATOM   284  C  CE2   . TRP A 1 36  ? -33.874 1.280   12.411  1.00 15.19 ? 36   TRP A CE2   1 
ATOM   285  C  CE3   . TRP A 1 36  ? -32.412 -0.629  12.140  1.00 16.93 ? 36   TRP A CE3   1 
ATOM   286  C  CZ2   . TRP A 1 36  ? -35.010 0.503   12.169  1.00 16.59 ? 36   TRP A CZ2   1 
ATOM   287  C  CZ3   . TRP A 1 36  ? -33.549 -1.403  11.899  1.00 19.55 ? 36   TRP A CZ3   1 
ATOM   288  C  CH2   . TRP A 1 36  ? -34.825 -0.831  11.919  1.00 18.15 ? 36   TRP A CH2   1 
ATOM   289  N  N     . LYS A 1 37  ? -28.926 4.404   11.813  1.00 18.78 ? 37   LYS A N     1 
ATOM   290  C  CA    . LYS A 1 37  ? -29.032 5.685   11.137  1.00 17.48 ? 37   LYS A CA    1 
ATOM   291  C  C     . LYS A 1 37  ? -29.676 5.488   9.776   1.00 23.53 ? 37   LYS A C     1 
ATOM   292  O  O     . LYS A 1 37  ? -29.288 4.603   9.020   1.00 24.72 ? 37   LYS A O     1 
ATOM   293  C  CB    . LYS A 1 37  ? -27.656 6.338   11.021  1.00 21.57 ? 37   LYS A CB    1 
ATOM   294  C  CG    . LYS A 1 37  ? -27.090 6.674   12.396  1.00 23.71 ? 37   LYS A CG    1 
ATOM   295  C  CD    . LYS A 1 37  ? -25.765 7.414   12.355  1.00 30.67 ? 37   LYS A CD    1 
ATOM   296  C  CE    . LYS A 1 37  ? -25.379 7.833   13.765  1.00 30.50 ? 37   LYS A CE    1 
ATOM   297  N  NZ    . LYS A 1 37  ? -24.117 8.614   13.818  1.00 40.76 ? 37   LYS A NZ    1 
ATOM   298  N  N     . GLU A 1 38  ? -30.679 6.307   9.491   1.00 19.81 ? 38   GLU A N     1 
ATOM   299  C  CA    . GLU A 1 38  ? -31.422 6.217   8.240   1.00 23.85 ? 38   GLU A CA    1 
ATOM   300  C  C     . GLU A 1 38  ? -30.743 6.976   7.109   1.00 32.49 ? 38   GLU A C     1 
ATOM   301  O  O     . GLU A 1 38  ? -30.293 8.110   7.285   1.00 36.47 ? 38   GLU A O     1 
ATOM   302  C  CB    . GLU A 1 38  ? -32.832 6.765   8.426   1.00 26.92 ? 38   GLU A CB    1 
ATOM   303  C  CG    . GLU A 1 38  ? -33.731 5.901   9.283   1.00 33.94 ? 38   GLU A CG    1 
ATOM   304  C  CD    . GLU A 1 38  ? -35.158 6.413   9.309   1.00 43.29 ? 38   GLU A CD    1 
ATOM   305  O  OE1   . GLU A 1 38  ? -35.351 7.636   9.146   1.00 42.85 ? 38   GLU A OE1   1 
ATOM   306  O  OE2   . GLU A 1 38  ? -36.083 5.597   9.493   1.00 48.90 ? 38   GLU A OE2   1 
ATOM   307  N  N     A LEU A 1 39  ? -30.652 6.327   5.955   0.50 27.15 ? 39   LEU A N     1 
ATOM   308  N  N     B LEU A 1 39  ? -30.690 6.351   5.938   0.50 27.13 ? 39   LEU A N     1 
ATOM   309  C  CA    A LEU A 1 39  ? -30.148 6.959   4.750   0.50 28.04 ? 39   LEU A CA    1 
ATOM   310  C  CA    B LEU A 1 39  ? -30.128 6.978   4.751   0.50 28.03 ? 39   LEU A CA    1 
ATOM   311  C  C     A LEU A 1 39  ? -31.138 6.684   3.631   0.50 28.57 ? 39   LEU A C     1 
ATOM   312  C  C     B LEU A 1 39  ? -31.039 6.694   3.562   0.50 28.70 ? 39   LEU A C     1 
ATOM   313  O  O     A LEU A 1 39  ? -31.453 5.531   3.347   0.50 28.29 ? 39   LEU A O     1 
ATOM   314  O  O     B LEU A 1 39  ? -31.198 5.543   3.160   0.50 30.15 ? 39   LEU A O     1 
ATOM   315  C  CB    A LEU A 1 39  ? -28.775 6.400   4.364   0.50 30.58 ? 39   LEU A CB    1 
ATOM   316  C  CB    B LEU A 1 39  ? -28.717 6.443   4.484   0.50 30.39 ? 39   LEU A CB    1 
ATOM   317  C  CG    A LEU A 1 39  ? -27.567 6.658   5.270   0.50 32.61 ? 39   LEU A CG    1 
ATOM   318  C  CG    B LEU A 1 39  ? -27.895 7.009   3.319   0.50 33.65 ? 39   LEU A CG    1 
ATOM   319  C  CD1   A LEU A 1 39  ? -27.506 8.119   5.697   0.50 32.59 ? 39   LEU A CD1   1 
ATOM   320  C  CD1   B LEU A 1 39  ? -28.391 6.496   1.972   0.50 39.52 ? 39   LEU A CD1   1 
ATOM   321  C  CD2   A LEU A 1 39  ? -27.570 5.730   6.477   0.50 35.15 ? 39   LEU A CD2   1 
ATOM   322  C  CD2   B LEU A 1 39  ? -27.889 8.529   3.346   0.50 30.43 ? 39   LEU A CD2   1 
ATOM   323  N  N     . ASP A 1 40  ? -31.642 7.741   3.009   1.00 28.02 ? 40   ASP A N     1 
ATOM   324  C  CA    . ASP A 1 40  ? -32.519 7.579   1.856   1.00 30.32 ? 40   ASP A CA    1 
ATOM   325  C  C     . ASP A 1 40  ? -31.659 7.549   0.604   1.00 31.63 ? 40   ASP A C     1 
ATOM   326  O  O     . ASP A 1 40  ? -30.993 8.537   0.281   1.00 30.31 ? 40   ASP A O     1 
ATOM   327  C  CB    . ASP A 1 40  ? -33.532 8.717   1.779   1.00 32.88 ? 40   ASP A CB    1 
ATOM   328  C  CG    . ASP A 1 40  ? -34.595 8.480   0.720   1.00 43.72 ? 40   ASP A CG    1 
ATOM   329  O  OD1   . ASP A 1 40  ? -34.491 7.472   -0.012  1.00 38.90 ? 40   ASP A OD1   1 
ATOM   330  O  OD2   . ASP A 1 40  ? -35.535 9.298   0.624   1.00 50.64 ? 40   ASP A OD2   1 
ATOM   331  N  N     . TYR A 1 41  ? -31.654 6.416   -0.092  1.00 30.37 ? 41   TYR A N     1 
ATOM   332  C  CA    . TYR A 1 41  ? -30.841 6.285   -1.296  1.00 25.09 ? 41   TYR A CA    1 
ATOM   333  C  C     . TYR A 1 41  ? -31.685 6.375   -2.559  1.00 22.60 ? 41   TYR A C     1 
ATOM   334  O  O     . TYR A 1 41  ? -31.194 6.101   -3.651  1.00 27.48 ? 41   TYR A O     1 
ATOM   335  C  CB    . TYR A 1 41  ? -30.032 4.982   -1.288  1.00 25.61 ? 41   TYR A CB    1 
ATOM   336  C  CG    . TYR A 1 41  ? -30.857 3.712   -1.289  1.00 29.05 ? 41   TYR A CG    1 
ATOM   337  C  CD1   . TYR A 1 41  ? -31.301 3.147   -2.479  1.00 31.80 ? 41   TYR A CD1   1 
ATOM   338  C  CD2   . TYR A 1 41  ? -31.175 3.066   -0.102  1.00 32.18 ? 41   TYR A CD2   1 
ATOM   339  C  CE1   . TYR A 1 41  ? -32.049 1.983   -2.484  1.00 32.06 ? 41   TYR A CE1   1 
ATOM   340  C  CE2   . TYR A 1 41  ? -31.922 1.900   -0.096  1.00 33.54 ? 41   TYR A CE2   1 
ATOM   341  C  CZ    . TYR A 1 41  ? -32.355 1.364   -1.291  1.00 34.62 ? 41   TYR A CZ    1 
ATOM   342  O  OH    . TYR A 1 41  ? -33.099 0.206   -1.286  1.00 40.24 ? 41   TYR A OH    1 
ATOM   343  N  N     . GLY A 1 42  ? -32.941 6.781   -2.398  1.00 21.60 ? 42   GLY A N     1 
ATOM   344  C  CA    . GLY A 1 42  ? -33.892 6.803   -3.500  1.00 27.86 ? 42   GLY A CA    1 
ATOM   345  C  C     . GLY A 1 42  ? -33.542 7.715   -4.663  1.00 33.88 ? 42   GLY A C     1 
ATOM   346  O  O     . GLY A 1 42  ? -33.948 7.462   -5.800  1.00 33.05 ? 42   GLY A O     1 
ATOM   347  N  N     . SER A 1 43  ? -32.799 8.781   -4.392  1.00 32.83 ? 43   SER A N     1 
ATOM   348  C  CA    . SER A 1 43  ? -32.445 9.736   -5.436  1.00 33.95 ? 43   SER A CA    1 
ATOM   349  C  C     . SER A 1 43  ? -31.035 9.512   -5.971  1.00 32.18 ? 43   SER A C     1 
ATOM   350  O  O     . SER A 1 43  ? -30.545 10.281  -6.794  1.00 34.12 ? 43   SER A O     1 
ATOM   351  C  CB    . SER A 1 43  ? -32.593 11.171  -4.927  1.00 41.90 ? 43   SER A CB    1 
ATOM   352  O  OG    . SER A 1 43  ? -33.939 11.455  -4.592  1.00 44.45 ? 43   SER A OG    1 
ATOM   353  N  N     . MET A 1 44  ? -30.387 8.448   -5.509  1.00 34.89 ? 44   MET A N     1 
ATOM   354  C  CA    . MET A 1 44  ? -29.000 8.196   -5.885  1.00 29.83 ? 44   MET A CA    1 
ATOM   355  C  C     . MET A 1 44  ? -28.860 7.456   -7.208  1.00 28.44 ? 44   MET A C     1 
ATOM   356  O  O     . MET A 1 44  ? -29.684 6.612   -7.555  1.00 29.92 ? 44   MET A O     1 
ATOM   357  C  CB    . MET A 1 44  ? -28.279 7.415   -4.788  1.00 26.37 ? 44   MET A CB    1 
ATOM   358  C  CG    . MET A 1 44  ? -28.128 8.176   -3.493  1.00 28.67 ? 44   MET A CG    1 
ATOM   359  S  SD    . MET A 1 44  ? -27.193 7.214   -2.293  1.00 33.97 ? 44   MET A SD    1 
ATOM   360  C  CE    . MET A 1 44  ? -27.269 8.295   -0.867  1.00 40.48 ? 44   MET A CE    1 
ATOM   361  N  N     . THR A 1 45  ? -27.797 7.780   -7.935  1.00 30.20 ? 45   THR A N     1 
ATOM   362  C  CA    . THR A 1 45  ? -27.440 7.064   -9.145  1.00 31.22 ? 45   THR A CA    1 
ATOM   363  C  C     . THR A 1 45  ? -26.720 5.777   -8.769  1.00 29.46 ? 45   THR A C     1 
ATOM   364  O  O     . THR A 1 45  ? -26.298 5.607   -7.623  1.00 25.08 ? 45   THR A O     1 
ATOM   365  C  CB    . THR A 1 45  ? -26.502 7.907   -10.022 1.00 33.72 ? 45   THR A CB    1 
ATOM   366  O  OG1   . THR A 1 45  ? -25.290 8.172   -9.301  1.00 29.93 ? 45   THR A OG1   1 
ATOM   367  C  CG2   . THR A 1 45  ? -27.164 9.226   -10.393 1.00 32.37 ? 45   THR A CG2   1 
ATOM   368  N  N     . GLU A 1 46  ? -26.570 4.878   -9.737  1.00 27.64 ? 46   GLU A N     1 
ATOM   369  C  CA    . GLU A 1 46  ? -25.855 3.630   -9.503  1.00 26.04 ? 46   GLU A CA    1 
ATOM   370  C  C     . GLU A 1 46  ? -24.433 3.904   -9.025  1.00 25.82 ? 46   GLU A C     1 
ATOM   371  O  O     . GLU A 1 46  ? -23.928 3.225   -8.133  1.00 27.73 ? 46   GLU A O     1 
ATOM   372  C  CB    . GLU A 1 46  ? -25.836 2.770   -10.771 1.00 27.71 ? 46   GLU A CB    1 
ATOM   373  C  CG    . GLU A 1 46  ? -27.203 2.227   -11.164 1.00 34.58 ? 46   GLU A CG    1 
ATOM   374  C  CD    . GLU A 1 46  ? -27.132 1.216   -12.295 1.00 44.78 ? 46   GLU A CD    1 
ATOM   375  O  OE1   . GLU A 1 46  ? -26.014 0.931   -12.774 1.00 41.48 ? 46   GLU A OE1   1 
ATOM   376  O  OE2   . GLU A 1 46  ? -28.198 0.704   -12.708 1.00 45.22 ? 46   GLU A OE2   1 
ATOM   377  N  N     . ALA A 1 47  ? -23.797 4.914   -9.612  1.00 30.80 ? 47   ALA A N     1 
ATOM   378  C  CA    . ALA A 1 47  ? -22.428 5.269   -9.248  1.00 29.65 ? 47   ALA A CA    1 
ATOM   379  C  C     . ALA A 1 47  ? -22.348 5.737   -7.801  1.00 31.46 ? 47   ALA A C     1 
ATOM   380  O  O     . ALA A 1 47  ? -21.394 5.424   -7.087  1.00 31.07 ? 47   ALA A O     1 
ATOM   381  C  CB    . ALA A 1 47  ? -21.887 6.344   -10.186 1.00 31.21 ? 47   ALA A CB    1 
ATOM   382  N  N     . GLU A 1 48  ? -23.352 6.493   -7.372  1.00 27.22 ? 48   GLU A N     1 
ATOM   383  C  CA    . GLU A 1 48  ? -23.385 6.980   -6.000  1.00 27.81 ? 48   GLU A CA    1 
ATOM   384  C  C     . GLU A 1 48  ? -23.616 5.833   -5.023  1.00 24.37 ? 48   GLU A C     1 
ATOM   385  O  O     . GLU A 1 48  ? -22.997 5.779   -3.958  1.00 26.45 ? 48   GLU A O     1 
ATOM   386  C  CB    . GLU A 1 48  ? -24.455 8.061   -5.837  1.00 30.27 ? 48   GLU A CB    1 
ATOM   387  C  CG    . GLU A 1 48  ? -24.123 9.359   -6.563  1.00 33.05 ? 48   GLU A CG    1 
ATOM   388  C  CD    . GLU A 1 48  ? -25.275 10.347  -6.558  1.00 38.98 ? 48   GLU A CD    1 
ATOM   389  O  OE1   . GLU A 1 48  ? -26.439 9.905   -6.475  1.00 40.67 ? 48   GLU A OE1   1 
ATOM   390  O  OE2   . GLU A 1 48  ? -25.016 11.566  -6.641  1.00 44.34 ? 48   GLU A OE2   1 
ATOM   391  N  N     . LYS A 1 49  ? -24.507 4.917   -5.386  1.00 25.40 ? 49   LYS A N     1 
ATOM   392  C  CA    . LYS A 1 49  ? -24.769 3.748   -4.553  1.00 24.72 ? 49   LYS A CA    1 
ATOM   393  C  C     . LYS A 1 49  ? -23.536 2.847   -4.459  1.00 30.68 ? 49   LYS A C     1 
ATOM   394  O  O     . LYS A 1 49  ? -23.271 2.253   -3.410  1.00 27.36 ? 49   LYS A O     1 
ATOM   395  C  CB    . LYS A 1 49  ? -25.987 2.973   -5.066  1.00 30.20 ? 49   LYS A CB    1 
ATOM   396  C  CG    . LYS A 1 49  ? -27.308 3.664   -4.761  1.00 33.13 ? 49   LYS A CG    1 
ATOM   397  C  CD    . LYS A 1 49  ? -28.502 2.854   -5.234  1.00 30.44 ? 49   LYS A CD    1 
ATOM   398  C  CE    . LYS A 1 49  ? -28.585 2.822   -6.743  1.00 31.25 ? 49   LYS A CE    1 
ATOM   399  N  NZ    . LYS A 1 49  ? -29.818 2.134   -7.211  1.00 33.78 ? 49   LYS A NZ    1 
ATOM   400  N  N     . GLN A 1 50  ? -22.777 2.757   -5.548  1.00 30.32 ? 50   GLN A N     1 
ATOM   401  C  CA    . GLN A 1 50  ? -21.539 1.981   -5.537  1.00 32.36 ? 50   GLN A CA    1 
ATOM   402  C  C     . GLN A 1 50  ? -20.523 2.587   -4.572  1.00 29.75 ? 50   GLN A C     1 
ATOM   403  O  O     . GLN A 1 50  ? -19.818 1.865   -3.864  1.00 30.23 ? 50   GLN A O     1 
ATOM   404  C  CB    . GLN A 1 50  ? -20.938 1.877   -6.942  1.00 35.50 ? 50   GLN A CB    1 
ATOM   405  C  CG    . GLN A 1 50  ? -19.694 1.005   -7.006  1.00 46.41 ? 50   GLN A CG    1 
ATOM   406  C  CD    . GLN A 1 50  ? -19.944 -0.406  -6.502  1.00 48.97 ? 50   GLN A CD    1 
ATOM   407  O  OE1   . GLN A 1 50  ? -20.732 -1.153  -7.082  1.00 49.39 ? 50   GLN A OE1   1 
ATOM   408  N  NE2   . GLN A 1 50  ? -19.270 -0.777  -5.419  1.00 52.09 ? 50   GLN A NE2   1 
ATOM   409  N  N     . MET A 1 51  ? -20.447 3.915   -4.549  1.00 28.64 ? 51   MET A N     1 
ATOM   410  C  CA    . MET A 1 51  ? -19.572 4.601   -3.604  1.00 31.46 ? 51   MET A CA    1 
ATOM   411  C  C     . MET A 1 51  ? -20.009 4.293   -2.178  1.00 30.92 ? 51   MET A C     1 
ATOM   412  O  O     . MET A 1 51  ? -19.180 4.038   -1.305  1.00 28.62 ? 51   MET A O     1 
ATOM   413  C  CB    . MET A 1 51  ? -19.586 6.112   -3.840  1.00 29.84 ? 51   MET A CB    1 
ATOM   414  C  CG    . MET A 1 51  ? -18.961 6.541   -5.154  1.00 40.52 ? 51   MET A CG    1 
ATOM   415  S  SD    . MET A 1 51  ? -18.868 8.335   -5.301  1.00 84.78 ? 51   MET A SD    1 
ATOM   416  C  CE    . MET A 1 51  ? -17.976 8.742   -3.802  1.00 40.97 ? 51   MET A CE    1 
ATOM   417  N  N     A LEU A 1 52  ? -21.320 4.306   -1.961  0.70 28.85 ? 52   LEU A N     1 
ATOM   418  N  N     B LEU A 1 52  ? -21.315 4.324   -1.940  0.30 29.42 ? 52   LEU A N     1 
ATOM   419  C  CA    A LEU A 1 52  ? -21.896 4.018   -0.653  0.70 29.65 ? 52   LEU A CA    1 
ATOM   420  C  CA    B LEU A 1 52  ? -21.845 4.009   -0.619  0.30 28.64 ? 52   LEU A CA    1 
ATOM   421  C  C     A LEU A 1 52  ? -21.504 2.623   -0.166  0.70 25.98 ? 52   LEU A C     1 
ATOM   422  C  C     B LEU A 1 52  ? -21.393 2.626   -0.182  0.30 26.22 ? 52   LEU A C     1 
ATOM   423  O  O     A LEU A 1 52  ? -21.176 2.432   1.005   0.70 28.06 ? 52   LEU A O     1 
ATOM   424  O  O     B LEU A 1 52  ? -20.923 2.441   0.941   0.30 27.64 ? 52   LEU A O     1 
ATOM   425  C  CB    A LEU A 1 52  ? -23.418 4.148   -0.712  0.70 33.51 ? 52   LEU A CB    1 
ATOM   426  C  CB    B LEU A 1 52  ? -23.369 4.061   -0.622  0.30 32.73 ? 52   LEU A CB    1 
ATOM   427  C  CG    A LEU A 1 52  ? -24.164 4.086   0.620   0.70 34.80 ? 52   LEU A CG    1 
ATOM   428  C  CG    B LEU A 1 52  ? -24.035 5.421   -0.800  0.30 35.54 ? 52   LEU A CG    1 
ATOM   429  C  CD1   A LEU A 1 52  ? -23.479 4.958   1.648   0.70 36.46 ? 52   LEU A CD1   1 
ATOM   430  C  CD1   B LEU A 1 52  ? -25.525 5.243   -0.634  0.30 37.85 ? 52   LEU A CD1   1 
ATOM   431  C  CD2   A LEU A 1 52  ? -25.613 4.510   0.437   0.70 39.97 ? 52   LEU A CD2   1 
ATOM   432  C  CD2   B LEU A 1 52  ? -23.498 6.427   0.204   0.30 34.42 ? 52   LEU A CD2   1 
ATOM   433  N  N     . VAL A 1 53  ? -21.543 1.655   -1.076  1.00 25.88 ? 53   VAL A N     1 
ATOM   434  C  CA    . VAL A 1 53  ? -21.156 0.280   -0.779  1.00 24.87 ? 53   VAL A CA    1 
ATOM   435  C  C     . VAL A 1 53  ? -19.699 0.196   -0.334  1.00 28.67 ? 53   VAL A C     1 
ATOM   436  O  O     . VAL A 1 53  ? -19.385 -0.408  0.694   1.00 29.47 ? 53   VAL A O     1 
ATOM   437  C  CB    . VAL A 1 53  ? -21.366 -0.636  -2.001  1.00 30.10 ? 53   VAL A CB    1 
ATOM   438  C  CG1   . VAL A 1 53  ? -20.629 -1.960  -1.815  1.00 31.34 ? 53   VAL A CG1   1 
ATOM   439  C  CG2   . VAL A 1 53  ? -22.857 -0.863  -2.247  1.00 27.71 ? 53   VAL A CG2   1 
ATOM   440  N  N     A SER A 1 54  ? -18.811 0.807   -1.112  0.50 29.20 ? 54   SER A N     1 
ATOM   441  N  N     B SER A 1 54  ? -18.812 0.813   -1.109  0.50 29.22 ? 54   SER A N     1 
ATOM   442  C  CA    A SER A 1 54  ? -17.391 0.808   -0.785  0.50 31.20 ? 54   SER A CA    1 
ATOM   443  C  CA    B SER A 1 54  ? -17.389 0.811   -0.789  0.50 31.21 ? 54   SER A CA    1 
ATOM   444  C  C     A SER A 1 54  ? -17.131 1.486   0.557   0.50 31.07 ? 54   SER A C     1 
ATOM   445  C  C     B SER A 1 54  ? -17.109 1.507   0.541   0.50 31.14 ? 54   SER A C     1 
ATOM   446  O  O     A SER A 1 54  ? -16.272 1.051   1.325   0.50 29.84 ? 54   SER A O     1 
ATOM   447  O  O     B SER A 1 54  ? -16.214 1.105   1.285   0.50 30.00 ? 54   SER A O     1 
ATOM   448  C  CB    A SER A 1 54  ? -16.584 1.490   -1.892  0.50 34.51 ? 54   SER A CB    1 
ATOM   449  C  CB    B SER A 1 54  ? -16.586 1.474   -1.910  0.50 34.48 ? 54   SER A CB    1 
ATOM   450  O  OG    A SER A 1 54  ? -17.013 2.825   -2.092  0.50 38.84 ? 54   SER A OG    1 
ATOM   451  O  OG    B SER A 1 54  ? -16.787 0.808   -3.145  0.50 33.86 ? 54   SER A OG    1 
ATOM   452  N  N     . GLU A 1 55  ? -17.877 2.550   0.838   1.00 28.85 ? 55   GLU A N     1 
ATOM   453  C  CA    . GLU A 1 55  ? -17.694 3.300   2.081   1.00 32.43 ? 55   GLU A CA    1 
ATOM   454  C  C     . GLU A 1 55  ? -18.247 2.575   3.312   1.00 32.89 ? 55   GLU A C     1 
ATOM   455  O  O     . GLU A 1 55  ? -17.660 2.644   4.393   1.00 30.55 ? 55   GLU A O     1 
ATOM   456  C  CB    . GLU A 1 55  ? -18.283 4.709   1.966   1.00 40.36 ? 55   GLU A CB    1 
ATOM   457  C  CG    . GLU A 1 55  ? -17.609 5.578   0.906   1.00 47.95 ? 55   GLU A CG    1 
ATOM   458  C  CD    . GLU A 1 55  ? -16.134 5.815   1.186   1.00 53.99 ? 55   GLU A CD    1 
ATOM   459  O  OE1   . GLU A 1 55  ? -15.761 5.933   2.373   1.00 50.76 ? 55   GLU A OE1   1 
ATOM   460  O  OE2   . GLU A 1 55  ? -15.347 5.890   0.216   1.00 54.71 ? 55   GLU A OE2   1 
ATOM   461  N  N     . VAL A 1 56  ? -19.371 1.882   3.156   1.00 29.62 ? 56   VAL A N     1 
ATOM   462  C  CA    . VAL A 1 56  ? -19.902 1.076   4.250   1.00 28.71 ? 56   VAL A CA    1 
ATOM   463  C  C     . VAL A 1 56  ? -18.912 -0.023  4.610   1.00 29.56 ? 56   VAL A C     1 
ATOM   464  O  O     . VAL A 1 56  ? -18.695 -0.317  5.785   1.00 31.82 ? 56   VAL A O     1 
ATOM   465  C  CB    . VAL A 1 56  ? -21.256 0.429   3.895   1.00 32.12 ? 56   VAL A CB    1 
ATOM   466  C  CG1   . VAL A 1 56  ? -21.642 -0.606  4.944   1.00 37.90 ? 56   VAL A CG1   1 
ATOM   467  C  CG2   . VAL A 1 56  ? -22.328 1.485   3.772   1.00 33.63 ? 56   VAL A CG2   1 
ATOM   468  N  N     . ASN A 1 57  ? -18.311 -0.624  3.588   1.00 26.77 ? 57   ASN A N     1 
ATOM   469  C  CA    . ASN A 1 57  ? -17.335 -1.686  3.792   1.00 29.61 ? 57   ASN A CA    1 
ATOM   470  C  C     . ASN A 1 57  ? -16.091 -1.195  4.529   1.00 33.44 ? 57   ASN A C     1 
ATOM   471  O  O     . ASN A 1 57  ? -15.498 -1.932  5.316   1.00 36.17 ? 57   ASN A O     1 
ATOM   472  C  CB    . ASN A 1 57  ? -16.951 -2.327  2.456   1.00 36.32 ? 57   ASN A CB    1 
ATOM   473  C  CG    . ASN A 1 57  ? -18.095 -3.112  1.837   1.00 45.61 ? 57   ASN A CG    1 
ATOM   474  O  OD1   . ASN A 1 57  ? -19.038 -3.506  2.525   1.00 46.97 ? 57   ASN A OD1   1 
ATOM   475  N  ND2   . ASN A 1 57  ? -18.018 -3.340  0.530   1.00 45.70 ? 57   ASN A ND2   1 
ATOM   476  N  N     . LEU A 1 58  ? -15.700 0.051   4.275   1.00 28.03 ? 58   LEU A N     1 
ATOM   477  C  CA    . LEU A 1 58  ? -14.550 0.636   4.964   1.00 26.18 ? 58   LEU A CA    1 
ATOM   478  C  C     . LEU A 1 58  ? -14.903 0.914   6.418   1.00 27.42 ? 58   LEU A C     1 
ATOM   479  O  O     . LEU A 1 58  ? -14.080 0.733   7.317   1.00 32.47 ? 58   LEU A O     1 
ATOM   480  C  CB    . LEU A 1 58  ? -14.097 1.921   4.274   1.00 34.06 ? 58   LEU A CB    1 
ATOM   481  C  CG    . LEU A 1 58  ? -13.435 1.739   2.908   1.00 43.09 ? 58   LEU A CG    1 
ATOM   482  C  CD1   . LEU A 1 58  ? -13.370 3.060   2.154   1.00 47.03 ? 58   LEU A CD1   1 
ATOM   483  C  CD2   . LEU A 1 58  ? -12.048 1.130   3.059   1.00 41.61 ? 58   LEU A CD2   1 
ATOM   484  N  N     . LEU A 1 59  ? -16.137 1.355   6.634   1.00 26.16 ? 59   LEU A N     1 
ATOM   485  C  CA    . LEU A 1 59  ? -16.658 1.570   7.976   1.00 26.96 ? 59   LEU A CA    1 
ATOM   486  C  C     . LEU A 1 59  ? -16.611 0.265   8.767   1.00 26.93 ? 59   LEU A C     1 
ATOM   487  O  O     . LEU A 1 59  ? -16.236 0.245   9.940   1.00 28.86 ? 59   LEU A O     1 
ATOM   488  C  CB    . LEU A 1 59  ? -18.094 2.094   7.899   1.00 30.84 ? 59   LEU A CB    1 
ATOM   489  C  CG    . LEU A 1 59  ? -18.793 2.474   9.204   1.00 31.63 ? 59   LEU A CG    1 
ATOM   490  C  CD1   . LEU A 1 59  ? -18.086 3.641   9.872   1.00 29.07 ? 59   LEU A CD1   1 
ATOM   491  C  CD2   . LEU A 1 59  ? -20.252 2.815   8.935   1.00 34.73 ? 59   LEU A CD2   1 
ATOM   492  N  N     . ARG A 1 60  ? -16.978 -0.829  8.110   1.00 27.78 ? 60   ARG A N     1 
ATOM   493  C  CA    . ARG A 1 60  ? -17.010 -2.131  8.761   1.00 29.27 ? 60   ARG A CA    1 
ATOM   494  C  C     . ARG A 1 60  ? -15.617 -2.603  9.168   1.00 30.88 ? 60   ARG A C     1 
ATOM   495  O  O     . ARG A 1 60  ? -15.473 -3.401  10.095  1.00 35.59 ? 60   ARG A O     1 
ATOM   496  C  CB    . ARG A 1 60  ? -17.670 -3.164  7.848   1.00 37.44 ? 60   ARG A CB    1 
ATOM   497  C  CG    . ARG A 1 60  ? -17.758 -4.557  8.453   1.00 44.05 ? 60   ARG A CG    1 
ATOM   498  C  CD    . ARG A 1 60  ? -18.420 -5.522  7.490   1.00 47.89 ? 60   ARG A CD    1 
ATOM   499  N  NE    . ARG A 1 60  ? -17.674 -5.633  6.240   1.00 50.11 ? 60   ARG A NE    1 
ATOM   500  C  CZ    . ARG A 1 60  ? -18.163 -6.166  5.127   1.00 49.56 ? 60   ARG A CZ    1 
ATOM   501  N  NH1   . ARG A 1 60  ? -19.405 -6.633  5.105   1.00 46.56 ? 60   ARG A NH1   1 
ATOM   502  N  NH2   . ARG A 1 60  ? -17.414 -6.228  4.035   1.00 50.49 ? 60   ARG A NH2   1 
ATOM   503  N  N     . GLU A 1 61  ? -14.594 -2.102  8.482   1.00 29.17 ? 61   GLU A N     1 
ATOM   504  C  CA    . GLU A 1 61  ? -13.221 -2.543  8.726   1.00 33.00 ? 61   GLU A CA    1 
ATOM   505  C  C     . GLU A 1 61  ? -12.597 -1.921  9.975   1.00 37.96 ? 61   GLU A C     1 
ATOM   506  O  O     . GLU A 1 61  ? -11.682 -2.494  10.569  1.00 39.90 ? 61   GLU A O     1 
ATOM   507  C  CB    . GLU A 1 61  ? -12.341 -2.265  7.503   1.00 37.53 ? 61   GLU A CB    1 
ATOM   508  C  CG    . GLU A 1 61  ? -12.668 -3.131  6.297   1.00 46.61 ? 61   GLU A CG    1 
ATOM   509  C  CD    . GLU A 1 61  ? -11.785 -2.822  5.101   1.00 56.86 ? 61   GLU A CD    1 
ATOM   510  O  OE1   . GLU A 1 61  ? -10.739 -2.165  5.289   1.00 56.34 ? 61   GLU A OE1   1 
ATOM   511  O  OE2   . GLU A 1 61  ? -12.136 -3.237  3.975   1.00 59.23 ? 61   GLU A OE2   1 
ATOM   512  N  N     . LEU A 1 62  ? -13.089 -0.749  10.365  1.00 32.32 ? 62   LEU A N     1 
ATOM   513  C  CA    . LEU A 1 62  ? -12.572 -0.038  11.534  1.00 32.73 ? 62   LEU A CA    1 
ATOM   514  C  C     . LEU A 1 62  ? -13.110 -0.601  12.845  1.00 34.93 ? 62   LEU A C     1 
ATOM   515  O  O     . LEU A 1 62  ? -14.200 -0.233  13.277  1.00 39.68 ? 62   LEU A O     1 
ATOM   516  C  CB    . LEU A 1 62  ? -12.926 1.448   11.453  1.00 40.07 ? 62   LEU A CB    1 
ATOM   517  C  CG    . LEU A 1 62  ? -11.977 2.373   10.694  1.00 45.20 ? 62   LEU A CG    1 
ATOM   518  C  CD1   . LEU A 1 62  ? -12.547 3.781   10.638  1.00 46.14 ? 62   LEU A CD1   1 
ATOM   519  C  CD2   . LEU A 1 62  ? -10.610 2.372   11.353  1.00 38.26 ? 62   LEU A CD2   1 
ATOM   520  N  N     . LYS A 1 63  ? -12.341 -1.476  13.485  1.00 27.54 ? 63   LYS A N     1 
ATOM   521  C  CA    . LYS A 1 63  ? -12.742 -2.042  14.768  1.00 23.78 ? 63   LYS A CA    1 
ATOM   522  C  C     . LYS A 1 63  ? -11.745 -1.634  15.840  1.00 21.32 ? 63   LYS A C     1 
ATOM   523  O  O     . LYS A 1 63  ? -10.600 -2.072  15.833  1.00 28.16 ? 63   LYS A O     1 
ATOM   524  C  CB    . LYS A 1 63  ? -12.825 -3.564  14.691  1.00 28.74 ? 63   LYS A CB    1 
ATOM   525  C  CG    . LYS A 1 63  ? -13.726 -4.084  13.586  1.00 38.07 ? 63   LYS A CG    1 
ATOM   526  C  CD    . LYS A 1 63  ? -13.471 -5.559  13.345  1.00 43.96 ? 63   LYS A CD    1 
ATOM   527  C  CE    . LYS A 1 63  ? -13.899 -5.971  11.950  1.00 52.13 ? 63   LYS A CE    1 
ATOM   528  N  NZ    . LYS A 1 63  ? -13.352 -7.309  11.585  1.00 59.44 ? 63   LYS A NZ    1 
ATOM   529  N  N     . HIS A 1 64  ? -12.191 -0.790  16.760  1.00 16.23 ? 64   HIS A N     1 
ATOM   530  C  CA    . HIS A 1 64  ? -11.299 -0.225  17.760  1.00 14.30 ? 64   HIS A CA    1 
ATOM   531  C  C     . HIS A 1 64  ? -12.144 0.199   18.948  1.00 10.53 ? 64   HIS A C     1 
ATOM   532  O  O     . HIS A 1 64  ? -13.253 0.680   18.766  1.00 10.72 ? 64   HIS A O     1 
ATOM   533  C  CB    . HIS A 1 64  ? -10.563 0.980   17.167  1.00 16.20 ? 64   HIS A CB    1 
ATOM   534  C  CG    . HIS A 1 64  ? -9.447  1.490   18.021  1.00 14.66 ? 64   HIS A CG    1 
ATOM   535  N  ND1   . HIS A 1 64  ? -9.647  2.371   19.060  1.00 12.63 ? 64   HIS A ND1   1 
ATOM   536  C  CD2   . HIS A 1 64  ? -8.117  1.238   17.991  1.00 14.12 ? 64   HIS A CD2   1 
ATOM   537  C  CE1   . HIS A 1 64  ? -8.488  2.638   19.637  1.00 14.39 ? 64   HIS A CE1   1 
ATOM   538  N  NE2   . HIS A 1 64  ? -7.543  1.965   19.004  1.00 14.92 ? 64   HIS A NE2   1 
ATOM   539  N  N     . PRO A 1 65  ? -11.623 0.017   20.173  1.00 10.23 ? 65   PRO A N     1 
ATOM   540  C  CA    . PRO A 1 65  ? -12.441 0.360   21.341  1.00 10.14 ? 65   PRO A CA    1 
ATOM   541  C  C     . PRO A 1 65  ? -12.820 1.832   21.408  1.00 9.61  ? 65   PRO A C     1 
ATOM   542  O  O     . PRO A 1 65  ? -13.795 2.172   22.081  1.00 11.51 ? 65   PRO A O     1 
ATOM   543  C  CB    . PRO A 1 65  ? -11.536 -0.018  22.529  1.00 12.87 ? 65   PRO A CB    1 
ATOM   544  C  CG    . PRO A 1 65  ? -10.151 -0.082  21.946  1.00 17.60 ? 65   PRO A CG    1 
ATOM   545  C  CD    . PRO A 1 65  ? -10.356 -0.621  20.564  1.00 12.41 ? 65   PRO A CD    1 
ATOM   546  N  N     . ASN A 1 66  ? -12.076 2.688   20.707  1.00 7.64  ? 66   ASN A N     1 
ATOM   547  C  CA    . ASN A 1 66  ? -12.322 4.126   20.731  1.00 7.14  ? 66   ASN A CA    1 
ATOM   548  C  C     . ASN A 1 66  ? -12.908 4.695   19.436  1.00 7.15  ? 66   ASN A C     1 
ATOM   549  O  O     . ASN A 1 66  ? -12.861 5.906   19.193  1.00 9.28  ? 66   ASN A O     1 
ATOM   550  C  CB    . ASN A 1 66  ? -11.045 4.856   21.130  1.00 8.42  ? 66   ASN A CB    1 
ATOM   551  C  CG    . ASN A 1 66  ? -10.566 4.456   22.514  1.00 9.17  ? 66   ASN A CG    1 
ATOM   552  O  OD1   . ASN A 1 66  ? -9.443  3.982   22.685  1.00 10.97 ? 66   ASN A OD1   1 
ATOM   553  N  ND2   . ASN A 1 66  ? -11.420 4.648   23.511  1.00 9.49  ? 66   ASN A ND2   1 
ATOM   554  N  N     . ILE A 1 67  ? -13.472 3.804   18.623  1.00 9.27  ? 67   ILE A N     1 
ATOM   555  C  CA    . ILE A 1 67  ? -14.217 4.197   17.435  1.00 8.84  ? 67   ILE A CA    1 
ATOM   556  C  C     . ILE A 1 67  ? -15.603 3.569   17.535  1.00 7.98  ? 67   ILE A C     1 
ATOM   557  O  O     . ILE A 1 67  ? -15.715 2.381   17.811  1.00 10.56 ? 67   ILE A O     1 
ATOM   558  C  CB    . ILE A 1 67  ? -13.484 3.746   16.153  1.00 9.97  ? 67   ILE A CB    1 
ATOM   559  C  CG1   . ILE A 1 67  ? -12.150 4.503   16.029  1.00 11.78 ? 67   ILE A CG1   1 
ATOM   560  C  CG2   . ILE A 1 67  ? -14.340 4.010   14.918  1.00 11.89 ? 67   ILE A CG2   1 
ATOM   561  C  CD1   . ILE A 1 67  ? -11.300 4.071   14.843  1.00 12.95 ? 67   ILE A CD1   1 
ATOM   562  N  N     . VAL A 1 68  ? -16.658 4.366   17.343  1.00 8.85  ? 68   VAL A N     1 
ATOM   563  C  CA    . VAL A 1 68  ? -18.020 3.832   17.418  1.00 8.79  ? 68   VAL A CA    1 
ATOM   564  C  C     . VAL A 1 68  ? -18.121 2.639   16.473  1.00 12.14 ? 68   VAL A C     1 
ATOM   565  O  O     . VAL A 1 68  ? -17.790 2.739   15.288  1.00 13.11 ? 68   VAL A O     1 
ATOM   566  C  CB    . VAL A 1 68  ? -19.087 4.891   17.090  1.00 10.45 ? 68   VAL A CB    1 
ATOM   567  C  CG1   . VAL A 1 68  ? -20.482 4.272   17.147  1.00 11.57 ? 68   VAL A CG1   1 
ATOM   568  C  CG2   . VAL A 1 68  ? -19.000 6.054   18.066  1.00 11.82 ? 68   VAL A CG2   1 
ATOM   569  N  N     A ARG A 1 69  ? -18.586 1.521   17.021  0.50 11.96 ? 69   ARG A N     1 
ATOM   570  N  N     B ARG A 1 69  ? -18.575 1.511   17.007  0.50 12.01 ? 69   ARG A N     1 
ATOM   571  C  CA    A ARG A 1 69  ? -18.572 0.224   16.350  0.50 13.32 ? 69   ARG A CA    1 
ATOM   572  C  CA    B ARG A 1 69  ? -18.491 0.228   16.310  0.50 13.04 ? 69   ARG A CA    1 
ATOM   573  C  C     A ARG A 1 69  ? -19.682 0.065   15.311  0.50 16.17 ? 69   ARG A C     1 
ATOM   574  C  C     B ARG A 1 69  ? -19.656 -0.042  15.360  0.50 16.61 ? 69   ARG A C     1 
ATOM   575  O  O     A ARG A 1 69  ? -20.840 0.381   15.572  0.50 15.14 ? 69   ARG A O     1 
ATOM   576  O  O     B ARG A 1 69  ? -20.822 0.085   15.734  0.50 12.62 ? 69   ARG A O     1 
ATOM   577  C  CB    A ARG A 1 69  ? -18.687 -0.875  17.410  0.50 12.55 ? 69   ARG A CB    1 
ATOM   578  C  CB    B ARG A 1 69  ? -18.383 -0.897  17.338  0.50 13.40 ? 69   ARG A CB    1 
ATOM   579  C  CG    A ARG A 1 69  ? -18.757 -2.295  16.878  0.50 19.65 ? 69   ARG A CG    1 
ATOM   580  C  CG    B ARG A 1 69  ? -18.194 -2.287  16.758  0.50 16.64 ? 69   ARG A CG    1 
ATOM   581  C  CD    A ARG A 1 69  ? -17.474 -2.687  16.186  0.50 22.02 ? 69   ARG A CD    1 
ATOM   582  C  CD    B ARG A 1 69  ? -18.289 -3.316  17.872  0.50 16.74 ? 69   ARG A CD    1 
ATOM   583  N  NE    A ARG A 1 69  ? -16.294 -2.185  16.879  0.50 28.47 ? 69   ARG A NE    1 
ATOM   584  N  NE    B ARG A 1 69  ? -18.203 -4.690  17.386  0.50 28.45 ? 69   ARG A NE    1 
ATOM   585  C  CZ    A ARG A 1 69  ? -15.558 -2.900  17.720  0.50 28.10 ? 69   ARG A CZ    1 
ATOM   586  C  CZ    B ARG A 1 69  ? -18.519 -5.755  18.116  0.50 30.53 ? 69   ARG A CZ    1 
ATOM   587  N  NH1   A ARG A 1 69  ? -14.501 -2.353  18.298  0.50 18.77 ? 69   ARG A NH1   1 
ATOM   588  N  NH1   B ARG A 1 69  ? -18.947 -5.602  19.362  0.50 30.31 ? 69   ARG A NH1   1 
ATOM   589  N  NH2   A ARG A 1 69  ? -15.874 -4.162  17.981  0.50 35.08 ? 69   ARG A NH2   1 
ATOM   590  N  NH2   B ARG A 1 69  ? -18.414 -6.972  17.601  0.50 37.19 ? 69   ARG A NH2   1 
ATOM   591  N  N     . TYR A 1 70  ? -19.323 -0.436  14.133  1.00 14.11 ? 70   TYR A N     1 
ATOM   592  C  CA    . TYR A 1 70  ? -20.317 -0.790  13.125  1.00 15.06 ? 70   TYR A CA    1 
ATOM   593  C  C     . TYR A 1 70  ? -20.814 -2.212  13.389  1.00 16.94 ? 70   TYR A C     1 
ATOM   594  O  O     . TYR A 1 70  ? -20.020 -3.089  13.738  1.00 17.48 ? 70   TYR A O     1 
ATOM   595  C  CB    . TYR A 1 70  ? -19.702 -0.700  11.725  1.00 20.03 ? 70   TYR A CB    1 
ATOM   596  C  CG    . TYR A 1 70  ? -20.513 -1.393  10.655  1.00 23.30 ? 70   TYR A CG    1 
ATOM   597  C  CD1   . TYR A 1 70  ? -20.323 -2.742  10.381  1.00 23.25 ? 70   TYR A CD1   1 
ATOM   598  C  CD2   . TYR A 1 70  ? -21.469 -0.703  9.921   1.00 20.69 ? 70   TYR A CD2   1 
ATOM   599  C  CE1   . TYR A 1 70  ? -21.065 -3.385  9.411   1.00 25.94 ? 70   TYR A CE1   1 
ATOM   600  C  CE2   . TYR A 1 70  ? -22.217 -1.338  8.942   1.00 19.73 ? 70   TYR A CE2   1 
ATOM   601  C  CZ    . TYR A 1 70  ? -22.008 -2.681  8.692   1.00 25.17 ? 70   TYR A CZ    1 
ATOM   602  O  OH    . TYR A 1 70  ? -22.745 -3.330  7.725   1.00 27.58 ? 70   TYR A OH    1 
ATOM   603  N  N     . TYR A 1 71  ? -22.121 -2.439  13.237  1.00 15.98 ? 71   TYR A N     1 
ATOM   604  C  CA    . TYR A 1 71  ? -22.707 -3.765  13.463  1.00 19.31 ? 71   TYR A CA    1 
ATOM   605  C  C     . TYR A 1 71  ? -23.357 -4.414  12.247  1.00 23.82 ? 71   TYR A C     1 
ATOM   606  O  O     . TYR A 1 71  ? -23.185 -5.610  12.014  1.00 23.34 ? 71   TYR A O     1 
ATOM   607  C  CB    . TYR A 1 71  ? -23.740 -3.725  14.595  1.00 16.40 ? 71   TYR A CB    1 
ATOM   608  C  CG    . TYR A 1 71  ? -23.127 -3.833  15.970  1.00 18.14 ? 71   TYR A CG    1 
ATOM   609  C  CD1   . TYR A 1 71  ? -22.559 -2.730  16.580  1.00 16.24 ? 71   TYR A CD1   1 
ATOM   610  C  CD2   . TYR A 1 71  ? -23.116 -5.038  16.659  1.00 21.32 ? 71   TYR A CD2   1 
ATOM   611  C  CE1   . TYR A 1 71  ? -21.992 -2.820  17.835  1.00 16.90 ? 71   TYR A CE1   1 
ATOM   612  C  CE2   . TYR A 1 71  ? -22.552 -5.135  17.918  1.00 20.47 ? 71   TYR A CE2   1 
ATOM   613  C  CZ    . TYR A 1 71  ? -21.990 -4.023  18.499  1.00 22.90 ? 71   TYR A CZ    1 
ATOM   614  O  OH    . TYR A 1 71  ? -21.424 -4.106  19.751  1.00 22.56 ? 71   TYR A OH    1 
ATOM   615  N  N     . ASP A 1 72  ? -24.120 -3.642  11.484  1.00 20.69 ? 72   ASP A N     1 
ATOM   616  C  CA    . ASP A 1 72  ? -25.012 -4.237  10.496  1.00 25.39 ? 72   ASP A CA    1 
ATOM   617  C  C     . ASP A 1 72  ? -25.484 -3.193  9.496   1.00 28.43 ? 72   ASP A C     1 
ATOM   618  O  O     . ASP A 1 72  ? -25.351 -1.989  9.721   1.00 22.09 ? 72   ASP A O     1 
ATOM   619  C  CB    . ASP A 1 72  ? -26.219 -4.859  11.215  1.00 24.80 ? 72   ASP A CB    1 
ATOM   620  C  CG    . ASP A 1 72  ? -26.912 -5.947  10.402  1.00 29.26 ? 72   ASP A CG    1 
ATOM   621  O  OD1   . ASP A 1 72  ? -26.370 -6.379  9.365   1.00 29.72 ? 72   ASP A OD1   1 
ATOM   622  O  OD2   . ASP A 1 72  ? -28.013 -6.376  10.817  1.00 32.99 ? 72   ASP A OD2   1 
ATOM   623  N  N     A ARG A 1 73  ? -26.032 -3.669  8.385   0.50 25.23 ? 73   ARG A N     1 
ATOM   624  N  N     B ARG A 1 73  ? -26.030 -3.662  8.380   0.50 25.23 ? 73   ARG A N     1 
ATOM   625  C  CA    A ARG A 1 73  ? -26.620 -2.805  7.377   0.50 25.56 ? 73   ARG A CA    1 
ATOM   626  C  CA    B ARG A 1 73  ? -26.618 -2.781  7.380   0.50 25.56 ? 73   ARG A CA    1 
ATOM   627  C  C     A ARG A 1 73  ? -27.929 -3.441  6.939   0.50 29.82 ? 73   ARG A C     1 
ATOM   628  C  C     B ARG A 1 73  ? -27.903 -3.419  6.868   0.50 29.65 ? 73   ARG A C     1 
ATOM   629  O  O     A ARG A 1 73  ? -28.003 -4.657  6.752   0.50 32.33 ? 73   ARG A O     1 
ATOM   630  O  O     B ARG A 1 73  ? -27.935 -4.613  6.564   0.50 32.44 ? 73   ARG A O     1 
ATOM   631  C  CB    A ARG A 1 73  ? -25.683 -2.668  6.182   0.50 27.50 ? 73   ARG A CB    1 
ATOM   632  C  CB    B ARG A 1 73  ? -25.643 -2.540  6.228   0.50 26.49 ? 73   ARG A CB    1 
ATOM   633  C  CG    A ARG A 1 73  ? -25.347 -4.004  5.549   0.50 29.35 ? 73   ARG A CG    1 
ATOM   634  C  CG    B ARG A 1 73  ? -25.406 -3.767  5.370   0.50 29.53 ? 73   ARG A CG    1 
ATOM   635  C  CD    A ARG A 1 73  ? -24.244 -3.894  4.521   0.50 33.27 ? 73   ARG A CD    1 
ATOM   636  C  CD    B ARG A 1 73  ? -24.005 -3.797  4.798   0.50 32.71 ? 73   ARG A CD    1 
ATOM   637  N  NE    A ARG A 1 73  ? -23.775 -5.197  4.041   0.50 36.00 ? 73   ARG A NE    1 
ATOM   638  N  NE    B ARG A 1 73  ? -23.645 -5.148  4.379   0.50 34.76 ? 73   ARG A NE    1 
ATOM   639  C  CZ    A ARG A 1 73  ? -24.508 -6.307  3.971   0.50 37.90 ? 73   ARG A CZ    1 
ATOM   640  C  CZ    B ARG A 1 73  ? -22.445 -5.502  3.934   0.50 34.16 ? 73   ARG A CZ    1 
ATOM   641  N  NH1   A ARG A 1 73  ? -25.785 -6.312  4.335   0.50 36.48 ? 73   ARG A NH1   1 
ATOM   642  N  NH1   B ARG A 1 73  ? -21.474 -4.602  3.845   0.50 34.41 ? 73   ARG A NH1   1 
ATOM   643  N  NH2   A ARG A 1 73  ? -23.961 -7.425  3.515   0.50 41.85 ? 73   ARG A NH2   1 
ATOM   644  N  NH2   B ARG A 1 73  ? -22.216 -6.758  3.577   0.50 31.59 ? 73   ARG A NH2   1 
ATOM   645  N  N     . ILE A 1 74  ? -28.964 -2.626  6.787   1.00 25.82 ? 74   ILE A N     1 
ATOM   646  C  CA    . ILE A 1 74  ? -30.269 -3.139  6.403   1.00 27.73 ? 74   ILE A CA    1 
ATOM   647  C  C     . ILE A 1 74  ? -30.844 -2.358  5.238   1.00 30.97 ? 74   ILE A C     1 
ATOM   648  O  O     . ILE A 1 74  ? -30.852 -1.128  5.243   1.00 27.03 ? 74   ILE A O     1 
ATOM   649  C  CB    . ILE A 1 74  ? -31.261 -3.089  7.581   1.00 33.10 ? 74   ILE A CB    1 
ATOM   650  C  CG1   . ILE A 1 74  ? -30.763 -3.963  8.733   1.00 39.60 ? 74   ILE A CG1   1 
ATOM   651  C  CG2   . ILE A 1 74  ? -32.646 -3.531  7.136   1.00 38.26 ? 74   ILE A CG2   1 
ATOM   652  C  CD1   . ILE A 1 74  ? -31.677 -3.962  9.931   1.00 39.08 ? 74   ILE A CD1   1 
ATOM   653  N  N     . ILE A 1 75  ? -31.330 -3.083  4.237   1.00 30.89 ? 75   ILE A N     1 
ATOM   654  C  CA    . ILE A 1 75  ? -31.995 -2.458  3.111   1.00 32.32 ? 75   ILE A CA    1 
ATOM   655  C  C     . ILE A 1 75  ? -33.499 -2.620  3.249   1.00 34.99 ? 75   ILE A C     1 
ATOM   656  O  O     . ILE A 1 75  ? -34.008 -3.736  3.354   1.00 36.62 ? 75   ILE A O     1 
ATOM   657  C  CB    . ILE A 1 75  ? -31.554 -3.070  1.767   1.00 41.19 ? 75   ILE A CB    1 
ATOM   658  C  CG1   . ILE A 1 75  ? -30.038 -2.975  1.599   1.00 51.02 ? 75   ILE A CG1   1 
ATOM   659  C  CG2   . ILE A 1 75  ? -32.254 -2.373  0.614   1.00 42.21 ? 75   ILE A CG2   1 
ATOM   660  C  CD1   . ILE A 1 75  ? -29.549 -3.510  0.272   1.00 56.29 ? 75   ILE A CD1   1 
ATOM   661  N  N     . ASP A 1 76  ? -34.202 -1.496  3.275   1.00 37.22 ? 76   ASP A N     1 
ATOM   662  C  CA    . ASP A 1 76  ? -35.648 -1.496  3.157   1.00 42.76 ? 76   ASP A CA    1 
ATOM   663  C  C     . ASP A 1 76  ? -35.959 -1.019  1.747   1.00 43.16 ? 76   ASP A C     1 
ATOM   664  O  O     . ASP A 1 76  ? -36.205 0.165   1.522   1.00 43.25 ? 76   ASP A O     1 
ATOM   665  C  CB    . ASP A 1 76  ? -36.276 -0.567  4.196   1.00 47.03 ? 76   ASP A CB    1 
ATOM   666  C  CG    . ASP A 1 76  ? -37.789 -0.683  4.245   1.00 56.02 ? 76   ASP A CG    1 
ATOM   667  O  OD1   . ASP A 1 76  ? -38.418 -0.783  3.170   1.00 54.61 ? 76   ASP A OD1   1 
ATOM   668  O  OD2   . ASP A 1 76  ? -38.349 -0.670  5.363   1.00 59.34 ? 76   ASP A OD2   1 
ATOM   669  N  N     . ARG A 1 77  ? -35.921 -1.946  0.795   1.00 43.80 ? 77   ARG A N     1 
ATOM   670  C  CA    . ARG A 1 77  ? -36.088 -1.606  -0.613  1.00 49.17 ? 77   ARG A CA    1 
ATOM   671  C  C     . ARG A 1 77  ? -37.410 -0.890  -0.872  1.00 57.20 ? 77   ARG A C     1 
ATOM   672  O  O     . ARG A 1 77  ? -37.500 -0.034  -1.752  1.00 59.10 ? 77   ARG A O     1 
ATOM   673  C  CB    . ARG A 1 77  ? -35.983 -2.863  -1.483  1.00 48.97 ? 77   ARG A CB    1 
ATOM   674  N  N     . THR A 1 78  ? -38.429 -1.243  -0.095  1.00 56.00 ? 78   THR A N     1 
ATOM   675  C  CA    . THR A 1 78  ? -39.766 -0.684  -0.267  1.00 57.78 ? 78   THR A CA    1 
ATOM   676  C  C     . THR A 1 78  ? -39.800 0.827   -0.049  1.00 52.93 ? 78   THR A C     1 
ATOM   677  O  O     . THR A 1 78  ? -40.599 1.534   -0.663  1.00 50.68 ? 78   THR A O     1 
ATOM   678  C  CB    . THR A 1 78  ? -40.777 -1.358  0.679   1.00 59.17 ? 78   THR A CB    1 
ATOM   679  O  OG1   . THR A 1 78  ? -40.817 -2.764  0.409   1.00 58.38 ? 78   THR A OG1   1 
ATOM   680  C  CG2   . THR A 1 78  ? -42.163 -0.768  0.488   1.00 62.95 ? 78   THR A CG2   1 
ATOM   681  N  N     . ASN A 1 79  ? -38.931 1.317   0.829   1.00 49.86 ? 79   ASN A N     1 
ATOM   682  C  CA    . ASN A 1 79  ? -38.846 2.748   1.102   1.00 48.14 ? 79   ASN A CA    1 
ATOM   683  C  C     . ASN A 1 79  ? -37.475 3.310   0.739   1.00 42.55 ? 79   ASN A C     1 
ATOM   684  O  O     . ASN A 1 79  ? -37.102 4.401   1.176   1.00 43.86 ? 79   ASN A O     1 
ATOM   685  C  CB    . ASN A 1 79  ? -39.169 3.035   2.571   1.00 52.19 ? 79   ASN A CB    1 
ATOM   686  N  N     . THR A 1 80  ? -36.739 2.554   -0.073  1.00 32.40 ? 80   THR A N     1 
ATOM   687  C  CA    . THR A 1 80  ? -35.381 2.912   -0.477  1.00 33.83 ? 80   THR A CA    1 
ATOM   688  C  C     . THR A 1 80  ? -34.595 3.510   0.681   1.00 27.95 ? 80   THR A C     1 
ATOM   689  O  O     . THR A 1 80  ? -33.980 4.567   0.546   1.00 29.84 ? 80   THR A O     1 
ATOM   690  C  CB    . THR A 1 80  ? -35.364 3.897   -1.657  1.00 38.96 ? 80   THR A CB    1 
ATOM   691  O  OG1   . THR A 1 80  ? -36.016 5.115   -1.282  1.00 36.53 ? 80   THR A OG1   1 
ATOM   692  C  CG2   . THR A 1 80  ? -36.069 3.299   -2.853  1.00 36.57 ? 80   THR A CG2   1 
ATOM   693  N  N     . THR A 1 81  ? -34.638 2.832   1.821   1.00 28.57 ? 81   THR A N     1 
ATOM   694  C  CA    . THR A 1 81  ? -33.908 3.278   3.003   1.00 29.55 ? 81   THR A CA    1 
ATOM   695  C  C     . THR A 1 81  ? -32.823 2.284   3.385   1.00 25.96 ? 81   THR A C     1 
ATOM   696  O  O     . THR A 1 81  ? -33.065 1.080   3.462   1.00 27.48 ? 81   THR A O     1 
ATOM   697  C  CB    . THR A 1 81  ? -34.850 3.488   4.207   1.00 31.71 ? 81   THR A CB    1 
ATOM   698  O  OG1   . THR A 1 81  ? -35.781 4.534   3.912   1.00 45.42 ? 81   THR A OG1   1 
ATOM   699  C  CG2   . THR A 1 81  ? -34.056 3.871   5.447   1.00 27.28 ? 81   THR A CG2   1 
ATOM   700  N  N     . LEU A 1 82  ? -31.620 2.801   3.617   1.00 24.26 ? 82   LEU A N     1 
ATOM   701  C  CA    . LEU A 1 82  ? -30.526 2.004   4.141   1.00 22.66 ? 82   LEU A CA    1 
ATOM   702  C  C     . LEU A 1 82  ? -30.365 2.348   5.615   1.00 24.69 ? 82   LEU A C     1 
ATOM   703  O  O     . LEU A 1 82  ? -30.254 3.519   5.973   1.00 29.12 ? 82   LEU A O     1 
ATOM   704  C  CB    . LEU A 1 82  ? -29.227 2.303   3.386   1.00 24.53 ? 82   LEU A CB    1 
ATOM   705  C  CG    . LEU A 1 82  ? -27.968 1.614   3.914   1.00 26.20 ? 82   LEU A CG    1 
ATOM   706  C  CD1   . LEU A 1 82  ? -28.057 0.110   3.722   1.00 29.04 ? 82   LEU A CD1   1 
ATOM   707  C  CD2   . LEU A 1 82  ? -26.717 2.175   3.248   1.00 31.16 ? 82   LEU A CD2   1 
ATOM   708  N  N     . TYR A 1 83  ? -30.383 1.331   6.469   1.00 21.85 ? 83   TYR A N     1 
ATOM   709  C  CA    . TYR A 1 83  ? -30.153 1.536   7.894   1.00 22.15 ? 83   TYR A CA    1 
ATOM   710  C  C     . TYR A 1 83  ? -28.783 1.003   8.272   1.00 22.03 ? 83   TYR A C     1 
ATOM   711  O  O     . TYR A 1 83  ? -28.478 -0.166  8.040   1.00 22.52 ? 83   TYR A O     1 
ATOM   712  C  CB    . TYR A 1 83  ? -31.211 0.813   8.731   1.00 20.82 ? 83   TYR A CB    1 
ATOM   713  C  CG    . TYR A 1 83  ? -32.638 1.248   8.477   1.00 26.38 ? 83   TYR A CG    1 
ATOM   714  C  CD1   . TYR A 1 83  ? -33.389 0.664   7.468   1.00 32.30 ? 83   TYR A CD1   1 
ATOM   715  C  CD2   . TYR A 1 83  ? -33.240 2.226   9.262   1.00 26.27 ? 83   TYR A CD2   1 
ATOM   716  C  CE1   . TYR A 1 83  ? -34.700 1.047   7.238   1.00 34.39 ? 83   TYR A CE1   1 
ATOM   717  C  CE2   . TYR A 1 83  ? -34.551 2.616   9.037   1.00 30.62 ? 83   TYR A CE2   1 
ATOM   718  C  CZ    . TYR A 1 83  ? -35.272 2.024   8.024   1.00 37.10 ? 83   TYR A CZ    1 
ATOM   719  O  OH    . TYR A 1 83  ? -36.575 2.409   7.797   1.00 39.66 ? 83   TYR A OH    1 
ATOM   720  N  N     A ILE A 1 84  ? -27.958 1.860   8.864   0.50 16.43 ? 84   ILE A N     1 
ATOM   721  N  N     B ILE A 1 84  ? -27.947 1.865   8.839   0.50 16.39 ? 84   ILE A N     1 
ATOM   722  C  CA    A ILE A 1 84  ? -26.651 1.436   9.346   0.50 16.65 ? 84   ILE A CA    1 
ATOM   723  C  CA    B ILE A 1 84  ? -26.656 1.426   9.347   0.50 16.68 ? 84   ILE A CA    1 
ATOM   724  C  C     A ILE A 1 84  ? -26.714 1.271   10.856  0.50 16.20 ? 84   ILE A C     1 
ATOM   725  C  C     B ILE A 1 84  ? -26.759 1.260   10.851  0.50 16.56 ? 84   ILE A C     1 
ATOM   726  O  O     A ILE A 1 84  ? -26.947 2.236   11.583  0.50 16.02 ? 84   ILE A O     1 
ATOM   727  O  O     B ILE A 1 84  ? -27.062 2.213   11.569  0.50 15.49 ? 84   ILE A O     1 
ATOM   728  C  CB    A ILE A 1 84  ? -25.553 2.451   8.988   0.50 18.47 ? 84   ILE A CB    1 
ATOM   729  C  CB    B ILE A 1 84  ? -25.523 2.418   9.029   0.50 17.78 ? 84   ILE A CB    1 
ATOM   730  C  CG1   A ILE A 1 84  ? -25.549 2.725   7.482   0.50 22.02 ? 84   ILE A CG1   1 
ATOM   731  C  CG1   B ILE A 1 84  ? -25.371 2.601   7.519   0.50 21.85 ? 84   ILE A CG1   1 
ATOM   732  C  CG2   A ILE A 1 84  ? -24.194 1.943   9.446   0.50 19.20 ? 84   ILE A CG2   1 
ATOM   733  C  CG2   B ILE A 1 84  ? -24.216 1.934   9.635   0.50 17.87 ? 84   ILE A CG2   1 
ATOM   734  C  CD1   A ILE A 1 84  ? -25.183 1.521   6.641   0.50 18.53 ? 84   ILE A CD1   1 
ATOM   735  C  CD1   B ILE A 1 84  ? -26.234 3.699   6.950   0.50 26.11 ? 84   ILE A CD1   1 
ATOM   736  N  N     . VAL A 1 85  ? -26.524 0.041   11.320  1.00 14.77 ? 85   VAL A N     1 
ATOM   737  C  CA    . VAL A 1 85  ? -26.645 -0.280  12.736  1.00 13.44 ? 85   VAL A CA    1 
ATOM   738  C  C     . VAL A 1 85  ? -25.297 -0.096  13.417  1.00 14.95 ? 85   VAL A C     1 
ATOM   739  O  O     . VAL A 1 85  ? -24.293 -0.633  12.961  1.00 15.24 ? 85   VAL A O     1 
ATOM   740  C  CB    . VAL A 1 85  ? -27.114 -1.736  12.908  1.00 13.17 ? 85   VAL A CB    1 
ATOM   741  C  CG1   . VAL A 1 85  ? -27.176 -2.119  14.372  1.00 16.34 ? 85   VAL A CG1   1 
ATOM   742  C  CG2   . VAL A 1 85  ? -28.477 -1.933  12.239  1.00 15.81 ? 85   VAL A CG2   1 
ATOM   743  N  N     A MET A 1 86  ? -25.274 0.656   14.510  0.60 12.76 ? 86   MET A N     1 
ATOM   744  N  N     B MET A 1 86  ? -25.287 0.669   14.507  0.40 12.82 ? 86   MET A N     1 
ATOM   745  C  CA    A MET A 1 86  ? -24.020 0.914   15.206  0.60 12.25 ? 86   MET A CA    1 
ATOM   746  C  CA    B MET A 1 86  ? -24.052 1.021   15.206  0.40 12.96 ? 86   MET A CA    1 
ATOM   747  C  C     A MET A 1 86  ? -24.164 0.855   16.718  0.60 13.05 ? 86   MET A C     1 
ATOM   748  C  C     B MET A 1 86  ? -24.167 0.837   16.716  0.40 12.78 ? 86   MET A C     1 
ATOM   749  O  O     A MET A 1 86  ? -25.267 0.810   17.263  0.60 12.20 ? 86   MET A O     1 
ATOM   750  O  O     B MET A 1 86  ? -25.260 0.688   17.261  0.40 13.25 ? 86   MET A O     1 
ATOM   751  C  CB    A MET A 1 86  ? -23.441 2.273   14.794  0.60 12.93 ? 86   MET A CB    1 
ATOM   752  C  CB    B MET A 1 86  ? -23.675 2.482   14.924  0.40 12.46 ? 86   MET A CB    1 
ATOM   753  C  CG    A MET A 1 86  ? -23.232 2.419   13.302  0.60 16.86 ? 86   MET A CG    1 
ATOM   754  C  CG    B MET A 1 86  ? -23.674 2.869   13.456  0.40 12.66 ? 86   MET A CG    1 
ATOM   755  S  SD    A MET A 1 86  ? -22.452 3.974   12.845  0.60 21.22 ? 86   MET A SD    1 
ATOM   756  S  SD    B MET A 1 86  ? -22.251 2.221   12.562  0.40 18.50 ? 86   MET A SD    1 
ATOM   757  C  CE    A MET A 1 86  ? -20.757 3.675   13.346  0.60 19.22 ? 86   MET A CE    1 
ATOM   758  C  CE    B MET A 1 86  ? -20.904 2.994   13.456  0.40 13.38 ? 86   MET A CE    1 
ATOM   759  N  N     . GLU A 1 87  ? -23.017 0.863   17.385  1.00 11.03 ? 87   GLU A N     1 
ATOM   760  C  CA    . GLU A 1 87  ? -22.954 0.881   18.834  1.00 12.34 ? 87   GLU A CA    1 
ATOM   761  C  C     . GLU A 1 87  ? -23.727 2.078   19.399  1.00 11.28 ? 87   GLU A C     1 
ATOM   762  O  O     . GLU A 1 87  ? -23.631 3.188   18.867  1.00 13.24 ? 87   GLU A O     1 
ATOM   763  C  CB    . GLU A 1 87  ? -21.474 0.963   19.228  1.00 15.41 ? 87   GLU A CB    1 
ATOM   764  C  CG    . GLU A 1 87  ? -21.192 1.274   20.673  1.00 16.33 ? 87   GLU A CG    1 
ATOM   765  C  CD    . GLU A 1 87  ? -19.703 1.371   20.944  1.00 18.53 ? 87   GLU A CD    1 
ATOM   766  O  OE1   . GLU A 1 87  ? -19.324 1.417   22.129  1.00 21.67 ? 87   GLU A OE1   1 
ATOM   767  O  OE2   . GLU A 1 87  ? -18.918 1.403   19.970  1.00 16.10 ? 87   GLU A OE2   1 
ATOM   768  N  N     . TYR A 1 88  ? -24.492 1.857   20.468  1.00 11.44 ? 88   TYR A N     1 
ATOM   769  C  CA    . TYR A 1 88  ? -25.182 2.947   21.162  1.00 10.62 ? 88   TYR A CA    1 
ATOM   770  C  C     . TYR A 1 88  ? -24.283 3.505   22.264  1.00 12.24 ? 88   TYR A C     1 
ATOM   771  O  O     . TYR A 1 88  ? -23.732 2.750   23.067  1.00 15.09 ? 88   TYR A O     1 
ATOM   772  C  CB    . TYR A 1 88  ? -26.504 2.462   21.770  1.00 11.96 ? 88   TYR A CB    1 
ATOM   773  C  CG    . TYR A 1 88  ? -27.141 3.457   22.722  1.00 13.01 ? 88   TYR A CG    1 
ATOM   774  C  CD1   . TYR A 1 88  ? -27.562 4.705   22.275  1.00 13.37 ? 88   TYR A CD1   1 
ATOM   775  C  CD2   . TYR A 1 88  ? -27.321 3.147   24.066  1.00 15.06 ? 88   TYR A CD2   1 
ATOM   776  C  CE1   . TYR A 1 88  ? -28.148 5.621   23.144  1.00 12.41 ? 88   TYR A CE1   1 
ATOM   777  C  CE2   . TYR A 1 88  ? -27.906 4.053   24.939  1.00 17.96 ? 88   TYR A CE2   1 
ATOM   778  C  CZ    . TYR A 1 88  ? -28.316 5.285   24.473  1.00 16.54 ? 88   TYR A CZ    1 
ATOM   779  O  OH    . TYR A 1 88  ? -28.900 6.188   25.336  1.00 21.90 ? 88   TYR A OH    1 
ATOM   780  N  N     . CYS A 1 89  ? -24.138 4.827   22.289  1.00 9.41  ? 89   CYS A N     1 
ATOM   781  C  CA    . CYS A 1 89  ? -23.296 5.499   23.274  1.00 10.66 ? 89   CYS A CA    1 
ATOM   782  C  C     . CYS A 1 89  ? -24.166 6.299   24.237  1.00 11.73 ? 89   CYS A C     1 
ATOM   783  O  O     . CYS A 1 89  ? -24.577 7.426   23.935  1.00 11.52 ? 89   CYS A O     1 
ATOM   784  C  CB    . CYS A 1 89  ? -22.303 6.425   22.573  1.00 9.34  ? 89   CYS A CB    1 
ATOM   785  S  SG    . CYS A 1 89  ? -21.147 5.557   21.472  1.00 13.24 ? 89   CYS A SG    1 
ATOM   786  N  N     . GLU A 1 90  ? -24.432 5.716   25.403  1.00 12.21 ? 90   GLU A N     1 
ATOM   787  C  CA    . GLU A 1 90  ? -25.413 6.271   26.335  1.00 11.37 ? 90   GLU A CA    1 
ATOM   788  C  C     . GLU A 1 90  ? -25.067 7.646   26.908  1.00 9.79  ? 90   GLU A C     1 
ATOM   789  O  O     . GLU A 1 90  ? -25.954 8.367   27.365  1.00 14.70 ? 90   GLU A O     1 
ATOM   790  C  CB    . GLU A 1 90  ? -25.702 5.287   27.473  1.00 19.08 ? 90   GLU A CB    1 
ATOM   791  C  CG    . GLU A 1 90  ? -24.583 5.174   28.487  1.00 19.62 ? 90   GLU A CG    1 
ATOM   792  C  CD    . GLU A 1 90  ? -25.047 4.532   29.781  1.00 22.28 ? 90   GLU A CD    1 
ATOM   793  O  OE1   . GLU A 1 90  ? -25.108 5.239   30.808  1.00 33.86 ? 90   GLU A OE1   1 
ATOM   794  O  OE2   . GLU A 1 90  ? -25.355 3.332   29.761  1.00 26.47 ? 90   GLU A OE2   1 
ATOM   795  N  N     . GLY A 1 91  ? -23.782 8.000   26.896  1.00 11.51 ? 91   GLY A N     1 
ATOM   796  C  CA    . GLY A 1 91  ? -23.348 9.283   27.416  1.00 12.53 ? 91   GLY A CA    1 
ATOM   797  C  C     . GLY A 1 91  ? -23.536 10.431  26.449  1.00 13.99 ? 91   GLY A C     1 
ATOM   798  O  O     . GLY A 1 91  ? -23.312 11.591  26.804  1.00 13.16 ? 91   GLY A O     1 
ATOM   799  N  N     . GLY A 1 92  ? -23.937 10.111  25.219  1.00 13.07 ? 92   GLY A N     1 
ATOM   800  C  CA    . GLY A 1 92  ? -24.162 11.124  24.202  1.00 12.71 ? 92   GLY A CA    1 
ATOM   801  C  C     . GLY A 1 92  ? -22.884 11.762  23.683  1.00 12.83 ? 92   GLY A C     1 
ATOM   802  O  O     . GLY A 1 92  ? -21.795 11.219  23.856  1.00 14.12 ? 92   GLY A O     1 
ATOM   803  N  N     . ASP A 1 93  ? -23.023 12.930  23.062  1.00 12.69 ? 93   ASP A N     1 
ATOM   804  C  CA    . ASP A 1 93  ? -21.910 13.571  22.369  1.00 13.85 ? 93   ASP A CA    1 
ATOM   805  C  C     . ASP A 1 93  ? -21.240 14.640  23.224  1.00 12.34 ? 93   ASP A C     1 
ATOM   806  O  O     . ASP A 1 93  ? -21.817 15.133  24.196  1.00 12.07 ? 93   ASP A O     1 
ATOM   807  C  CB    . ASP A 1 93  ? -22.414 14.212  21.081  1.00 12.84 ? 93   ASP A CB    1 
ATOM   808  C  CG    . ASP A 1 93  ? -23.332 15.381  21.351  1.00 18.10 ? 93   ASP A CG    1 
ATOM   809  O  OD1   . ASP A 1 93  ? -24.497 15.150  21.745  1.00 22.74 ? 93   ASP A OD1   1 
ATOM   810  O  OD2   . ASP A 1 93  ? -22.891 16.533  21.185  1.00 20.26 ? 93   ASP A OD2   1 
ATOM   811  N  N     . LEU A 1 94  ? -20.026 15.026  22.837  1.00 10.32 ? 94   LEU A N     1 
ATOM   812  C  CA    . LEU A 1 94  ? -19.277 16.019  23.598  1.00 10.41 ? 94   LEU A CA    1 
ATOM   813  C  C     . LEU A 1 94  ? -19.771 17.456  23.438  1.00 12.72 ? 94   LEU A C     1 
ATOM   814  O  O     . LEU A 1 94  ? -19.532 18.289  24.310  1.00 13.78 ? 94   LEU A O     1 
ATOM   815  C  CB    . LEU A 1 94  ? -17.786 15.949  23.259  1.00 12.42 ? 94   LEU A CB    1 
ATOM   816  C  CG    . LEU A 1 94  ? -17.060 14.696  23.739  1.00 16.44 ? 94   LEU A CG    1 
ATOM   817  C  CD1   . LEU A 1 94  ? -15.568 14.940  23.696  1.00 16.33 ? 94   LEU A CD1   1 
ATOM   818  C  CD2   . LEU A 1 94  ? -17.506 14.321  25.149  1.00 17.51 ? 94   LEU A CD2   1 
ATOM   819  N  N     . ALA A 1 95  ? -20.437 17.759  22.327  1.00 12.20 ? 95   ALA A N     1 
ATOM   820  C  CA    . ALA A 1 95  ? -20.993 19.096  22.164  1.00 14.83 ? 95   ALA A CA    1 
ATOM   821  C  C     . ALA A 1 95  ? -22.033 19.350  23.256  1.00 14.91 ? 95   ALA A C     1 
ATOM   822  O  O     . ALA A 1 95  ? -22.090 20.436  23.840  1.00 17.00 ? 95   ALA A O     1 
ATOM   823  C  CB    . ALA A 1 95  ? -21.591 19.266  20.778  1.00 19.00 ? 95   ALA A CB    1 
ATOM   824  N  N     . SER A 1 96  ? -22.844 18.335  23.543  1.00 13.54 ? 96   SER A N     1 
ATOM   825  C  CA    . SER A 1 96  ? -23.824 18.431  24.616  1.00 14.87 ? 96   SER A CA    1 
ATOM   826  C  C     . SER A 1 96  ? -23.156 18.580  25.981  1.00 15.17 ? 96   SER A C     1 
ATOM   827  O  O     . SER A 1 96  ? -23.647 19.312  26.838  1.00 15.90 ? 96   SER A O     1 
ATOM   828  C  CB    . SER A 1 96  ? -24.758 17.219  24.604  1.00 14.86 ? 96   SER A CB    1 
ATOM   829  O  OG    . SER A 1 96  ? -25.523 17.183  23.407  1.00 17.64 ? 96   SER A OG    1 
ATOM   830  N  N     . VAL A 1 97  ? -22.031 17.895  26.175  1.00 13.24 ? 97   VAL A N     1 
ATOM   831  C  CA    . VAL A 1 97  ? -21.284 17.989  27.424  1.00 14.03 ? 97   VAL A CA    1 
ATOM   832  C  C     . VAL A 1 97  ? -20.775 19.413  27.636  1.00 14.63 ? 97   VAL A C     1 
ATOM   833  O  O     . VAL A 1 97  ? -20.842 19.956  28.739  1.00 14.85 ? 97   VAL A O     1 
ATOM   834  C  CB    . VAL A 1 97  ? -20.089 17.003  27.435  1.00 11.37 ? 97   VAL A CB    1 
ATOM   835  C  CG1   . VAL A 1 97  ? -19.159 17.290  28.605  1.00 15.11 ? 97   VAL A CG1   1 
ATOM   836  C  CG2   . VAL A 1 97  ? -20.588 15.567  27.498  1.00 13.93 ? 97   VAL A CG2   1 
ATOM   837  N  N     . ILE A 1 98  ? -20.278 20.021  26.563  1.00 14.07 ? 98   ILE A N     1 
ATOM   838  C  CA    . ILE A 1 98  ? -19.764 21.386  26.612  1.00 13.12 ? 98   ILE A CA    1 
ATOM   839  C  C     . ILE A 1 98  ? -20.880 22.384  26.914  1.00 20.28 ? 98   ILE A C     1 
ATOM   840  O  O     . ILE A 1 98  ? -20.720 23.275  27.747  1.00 18.39 ? 98   ILE A O     1 
ATOM   841  C  CB    . ILE A 1 98  ? -19.048 21.741  25.291  1.00 12.51 ? 98   ILE A CB    1 
ATOM   842  C  CG1   . ILE A 1 98  ? -17.728 20.969  25.195  1.00 12.71 ? 98   ILE A CG1   1 
ATOM   843  C  CG2   . ILE A 1 98  ? -18.813 23.251  25.182  1.00 16.64 ? 98   ILE A CG2   1 
ATOM   844  C  CD1   . ILE A 1 98  ? -17.172 20.859  23.791  1.00 15.39 ? 98   ILE A CD1   1 
ATOM   845  N  N     . THR A 1 99  ? -22.012 22.216  26.239  1.00 14.87 ? 99   THR A N     1 
ATOM   846  C  CA    . THR A 1 99  ? -23.182 23.059  26.463  1.00 18.03 ? 99   THR A CA    1 
ATOM   847  C  C     . THR A 1 99  ? -23.649 22.969  27.908  1.00 18.40 ? 99   THR A C     1 
ATOM   848  O  O     . THR A 1 99  ? -23.996 23.980  28.523  1.00 21.44 ? 99   THR A O     1 
ATOM   849  C  CB    . THR A 1 99  ? -24.333 22.640  25.531  1.00 20.43 ? 99   THR A CB    1 
ATOM   850  O  OG1   . THR A 1 99  ? -23.992 22.975  24.181  1.00 26.86 ? 99   THR A OG1   1 
ATOM   851  C  CG2   . THR A 1 99  ? -25.631 23.343  25.919  1.00 21.32 ? 99   THR A CG2   1 
ATOM   852  N  N     . LYS A 1 100 ? -23.663 21.752  28.441  1.00 19.79 ? 100  LYS A N     1 
ATOM   853  C  CA    . LYS A 1 100 ? -24.060 21.511  29.822  1.00 22.98 ? 100  LYS A CA    1 
ATOM   854  C  C     . LYS A 1 100 ? -23.137 22.259  30.777  1.00 25.86 ? 100  LYS A C     1 
ATOM   855  O  O     . LYS A 1 100 ? -23.595 22.893  31.726  1.00 24.50 ? 100  LYS A O     1 
ATOM   856  C  CB    . LYS A 1 100 ? -24.035 20.017  30.127  1.00 24.90 ? 100  LYS A CB    1 
ATOM   857  C  CG    . LYS A 1 100 ? -24.473 19.659  31.535  1.00 30.19 ? 100  LYS A CG    1 
ATOM   858  C  CD    . LYS A 1 100 ? -24.483 18.152  31.720  1.00 31.99 ? 100  LYS A CD    1 
ATOM   859  C  CE    . LYS A 1 100 ? -24.681 17.765  33.177  1.00 40.88 ? 100  LYS A CE    1 
ATOM   860  N  NZ    . LYS A 1 100 ? -26.085 17.977  33.628  1.00 49.56 ? 100  LYS A NZ    1 
ATOM   861  N  N     . GLY A 1 101 ? -21.836 22.185  30.516  1.00 19.34 ? 101  GLY A N     1 
ATOM   862  C  CA    . GLY A 1 101 ? -20.856 22.882  31.328  1.00 23.51 ? 101  GLY A CA    1 
ATOM   863  C  C     . GLY A 1 101 ? -21.107 24.377  31.329  1.00 26.62 ? 101  GLY A C     1 
ATOM   864  O  O     . GLY A 1 101 ? -21.010 25.033  32.365  1.00 30.66 ? 101  GLY A O     1 
ATOM   865  N  N     . THR A 1 102 ? -21.431 24.917  30.158  1.00 24.75 ? 102  THR A N     1 
ATOM   866  C  CA    . THR A 1 102 ? -21.706 26.341  30.020  1.00 27.71 ? 102  THR A CA    1 
ATOM   867  C  C     . THR A 1 102 ? -22.962 26.752  30.788  1.00 30.01 ? 102  THR A C     1 
ATOM   868  O  O     . THR A 1 102 ? -22.946 27.725  31.542  1.00 29.65 ? 102  THR A O     1 
ATOM   869  C  CB    . THR A 1 102 ? -21.866 26.743  28.540  1.00 30.91 ? 102  THR A CB    1 
ATOM   870  O  OG1   . THR A 1 102 ? -20.686 26.382  27.810  1.00 29.56 ? 102  THR A OG1   1 
ATOM   871  C  CG2   . THR A 1 102 ? -22.093 28.238  28.417  1.00 27.03 ? 102  THR A CG2   1 
ATOM   872  N  N     . LYS A 1 103 ? -24.048 26.009  30.601  1.00 28.50 ? 103  LYS A N     1 
ATOM   873  C  CA    . LYS A 1 103 ? -25.312 26.354  31.248  1.00 37.39 ? 103  LYS A CA    1 
ATOM   874  C  C     . LYS A 1 103 ? -25.231 26.219  32.765  1.00 44.86 ? 103  LYS A C     1 
ATOM   875  O  O     . LYS A 1 103 ? -25.677 27.099  33.505  1.00 42.79 ? 103  LYS A O     1 
ATOM   876  C  CB    . LYS A 1 103 ? -26.450 25.488  30.714  1.00 39.18 ? 103  LYS A CB    1 
ATOM   877  C  CG    . LYS A 1 103 ? -27.828 25.974  31.138  1.00 49.50 ? 103  LYS A CG    1 
ATOM   878  N  N     . GLU A 1 104 ? -24.660 25.111  33.224  1.00 43.56 ? 104  GLU A N     1 
ATOM   879  C  CA    . GLU A 1 104 ? -24.568 24.837  34.651  1.00 43.45 ? 104  GLU A CA    1 
ATOM   880  C  C     . GLU A 1 104 ? -23.365 25.546  35.274  1.00 41.60 ? 104  GLU A C     1 
ATOM   881  O  O     . GLU A 1 104 ? -23.074 25.374  36.458  1.00 46.27 ? 104  GLU A O     1 
ATOM   882  C  CB    . GLU A 1 104 ? -24.526 23.324  34.895  1.00 42.45 ? 104  GLU A CB    1 
ATOM   883  C  CG    . GLU A 1 104 ? -25.655 22.585  34.175  1.00 43.47 ? 104  GLU A CG    1 
ATOM   884  C  CD    . GLU A 1 104 ? -25.819 21.145  34.623  1.00 48.53 ? 104  GLU A CD    1 
ATOM   885  O  OE1   . GLU A 1 104 ? -26.881 20.550  34.328  1.00 41.40 ? 104  GLU A OE1   1 
ATOM   886  O  OE2   . GLU A 1 104 ? -24.893 20.610  35.268  1.00 51.73 ? 104  GLU A OE2   1 
ATOM   887  N  N     . ARG A 1 105 ? -22.686 26.356  34.465  1.00 36.96 ? 105  ARG A N     1 
ATOM   888  C  CA    . ARG A 1 105 ? -21.534 27.140  34.912  1.00 37.92 ? 105  ARG A CA    1 
ATOM   889  C  C     . ARG A 1 105 ? -20.512 26.292  35.668  1.00 40.71 ? 105  ARG A C     1 
ATOM   890  O  O     . ARG A 1 105 ? -20.018 26.689  36.726  1.00 43.17 ? 105  ARG A O     1 
ATOM   891  C  CB    . ARG A 1 105 ? -21.994 28.321  35.771  1.00 43.99 ? 105  ARG A CB    1 
ATOM   892  C  CG    . ARG A 1 105 ? -22.776 29.376  35.000  1.00 43.43 ? 105  ARG A CG    1 
ATOM   893  C  CD    . ARG A 1 105 ? -23.490 30.334  35.939  1.00 46.48 ? 105  ARG A CD    1 
ATOM   894  N  N     . GLN A 1 106 ? -20.194 25.128  35.109  1.00 33.37 ? 106  GLN A N     1 
ATOM   895  C  CA    A GLN A 1 106 ? -19.266 24.196  35.737  0.50 34.75 ? 106  GLN A CA    1 
ATOM   896  C  CA    B GLN A 1 106 ? -19.261 24.202  35.739  0.50 34.74 ? 106  GLN A CA    1 
ATOM   897  C  C     . GLN A 1 106 ? -18.231 23.688  34.738  1.00 29.70 ? 106  GLN A C     1 
ATOM   898  O  O     . GLN A 1 106 ? -18.580 23.022  33.761  1.00 27.91 ? 106  GLN A O     1 
ATOM   899  C  CB    A GLN A 1 106 ? -20.032 23.012  36.333  0.50 34.61 ? 106  GLN A CB    1 
ATOM   900  C  CB    B GLN A 1 106 ? -20.014 23.024  36.363  0.50 34.66 ? 106  GLN A CB    1 
ATOM   901  C  CG    A GLN A 1 106 ? -19.141 21.893  36.845  0.50 33.89 ? 106  GLN A CG    1 
ATOM   902  C  CG    B GLN A 1 106 ? -20.868 23.392  37.567  0.50 40.52 ? 106  GLN A CG    1 
ATOM   903  C  CD    A GLN A 1 106 ? -18.339 22.304  38.062  0.50 33.99 ? 106  GLN A CD    1 
ATOM   904  C  CD    B GLN A 1 106 ? -21.680 22.219  38.086  0.50 44.14 ? 106  GLN A CD    1 
ATOM   905  O  OE1   A GLN A 1 106 ? -18.899 22.605  39.117  0.50 34.14 ? 106  GLN A OE1   1 
ATOM   906  O  OE1   B GLN A 1 106 ? -22.049 21.322  37.329  0.50 44.20 ? 106  GLN A OE1   1 
ATOM   907  N  NE2   A GLN A 1 106 ? -17.019 22.321  37.922  0.50 26.40 ? 106  GLN A NE2   1 
ATOM   908  N  NE2   B GLN A 1 106 ? -21.967 22.225  39.383  0.50 45.74 ? 106  GLN A NE2   1 
ATOM   909  N  N     . TYR A 1 107 ? -16.962 24.002  34.982  1.00 23.49 ? 107  TYR A N     1 
ATOM   910  C  CA    . TYR A 1 107 ? -15.887 23.494  34.131  1.00 21.58 ? 107  TYR A CA    1 
ATOM   911  C  C     . TYR A 1 107 ? -15.734 21.980  34.328  1.00 22.87 ? 107  TYR A C     1 
ATOM   912  O  O     . TYR A 1 107 ? -16.052 21.436  35.386  1.00 23.09 ? 107  TYR A O     1 
ATOM   913  C  CB    . TYR A 1 107 ? -14.550 24.195  34.423  1.00 20.92 ? 107  TYR A CB    1 
ATOM   914  C  CG    . TYR A 1 107 ? -14.386 25.612  33.876  1.00 21.97 ? 107  TYR A CG    1 
ATOM   915  C  CD1   . TYR A 1 107 ? -14.004 26.654  34.710  1.00 25.71 ? 107  TYR A CD1   1 
ATOM   916  C  CD2   . TYR A 1 107 ? -14.592 25.898  32.529  1.00 19.55 ? 107  TYR A CD2   1 
ATOM   917  C  CE1   . TYR A 1 107 ? -13.841 27.938  34.225  1.00 23.02 ? 107  TYR A CE1   1 
ATOM   918  C  CE2   . TYR A 1 107 ? -14.431 27.186  32.031  1.00 17.47 ? 107  TYR A CE2   1 
ATOM   919  C  CZ    . TYR A 1 107 ? -14.057 28.203  32.887  1.00 22.96 ? 107  TYR A CZ    1 
ATOM   920  O  OH    . TYR A 1 107 ? -13.898 29.490  32.416  1.00 25.55 ? 107  TYR A OH    1 
ATOM   921  N  N     . LEU A 1 108 ? -15.230 21.310  33.301  1.00 15.64 ? 108  LEU A N     1 
ATOM   922  C  CA    . LEU A 1 108 ? -15.068 19.862  33.314  1.00 12.21 ? 108  LEU A CA    1 
ATOM   923  C  C     . LEU A 1 108 ? -13.787 19.461  34.054  1.00 11.86 ? 108  LEU A C     1 
ATOM   924  O  O     . LEU A 1 108 ? -12.800 20.200  34.032  1.00 14.48 ? 108  LEU A O     1 
ATOM   925  C  CB    . LEU A 1 108 ? -15.032 19.342  31.873  1.00 13.31 ? 108  LEU A CB    1 
ATOM   926  C  CG    . LEU A 1 108 ? -16.239 19.740  31.019  1.00 16.43 ? 108  LEU A CG    1 
ATOM   927  C  CD1   . LEU A 1 108 ? -16.098 19.230  29.604  1.00 17.53 ? 108  LEU A CD1   1 
ATOM   928  C  CD2   . LEU A 1 108 ? -17.520 19.212  31.652  1.00 27.45 ? 108  LEU A CD2   1 
ATOM   929  N  N     . ASP A 1 109 ? -13.803 18.287  34.694  1.00 12.76 ? 109  ASP A N     1 
ATOM   930  C  CA    . ASP A 1 109 ? -12.627 17.780  35.414  1.00 14.10 ? 109  ASP A CA    1 
ATOM   931  C  C     . ASP A 1 109 ? -11.438 17.584  34.480  1.00 11.40 ? 109  ASP A C     1 
ATOM   932  O  O     . ASP A 1 109 ? -11.601 17.094  33.360  1.00 12.58 ? 109  ASP A O     1 
ATOM   933  C  CB    . ASP A 1 109 ? -12.931 16.425  36.069  1.00 13.55 ? 109  ASP A CB    1 
ATOM   934  C  CG    . ASP A 1 109 ? -13.998 16.510  37.144  1.00 31.04 ? 109  ASP A CG    1 
ATOM   935  O  OD1   . ASP A 1 109 ? -14.307 17.631  37.601  1.00 33.49 ? 109  ASP A OD1   1 
ATOM   936  O  OD2   . ASP A 1 109 ? -14.526 15.443  37.531  1.00 34.72 ? 109  ASP A OD2   1 
ATOM   937  N  N     . GLU A 1 110 ? -10.243 17.933  34.948  1.00 10.88 ? 110  GLU A N     1 
ATOM   938  C  CA    . GLU A 1 110 ? -9.028  17.640  34.196  1.00 9.49  ? 110  GLU A CA    1 
ATOM   939  C  C     . GLU A 1 110 ? -8.943  16.143  33.864  1.00 8.81  ? 110  GLU A C     1 
ATOM   940  O  O     . GLU A 1 110 ? -8.507  15.760  32.774  1.00 10.50 ? 110  GLU A O     1 
ATOM   941  C  CB    . GLU A 1 110 ? -7.778  18.108  34.953  1.00 9.41  ? 110  GLU A CB    1 
ATOM   942  C  CG    . GLU A 1 110 ? -6.471  17.735  34.249  1.00 9.97  ? 110  GLU A CG    1 
ATOM   943  C  CD    . GLU A 1 110 ? -5.330  18.713  34.491  1.00 13.19 ? 110  GLU A CD    1 
ATOM   944  O  OE1   . GLU A 1 110 ? -5.572  19.839  34.987  1.00 11.30 ? 110  GLU A OE1   1 
ATOM   945  O  OE2   . GLU A 1 110 ? -4.186  18.349  34.164  1.00 11.22 ? 110  GLU A OE2   1 
ATOM   946  N  N     . GLU A 1 111 ? -9.373  15.297  34.797  1.00 10.74 ? 111  GLU A N     1 
ATOM   947  C  CA    . GLU A 1 111 ? -9.352  13.850  34.551  1.00 9.05  ? 111  GLU A CA    1 
ATOM   948  C  C     . GLU A 1 111 ? -10.181 13.459  33.340  1.00 10.63 ? 111  GLU A C     1 
ATOM   949  O  O     . GLU A 1 111 ? -9.796  12.571  32.573  1.00 10.18 ? 111  GLU A O     1 
ATOM   950  C  CB    . GLU A 1 111 ? -9.806  13.070  35.788  1.00 10.74 ? 111  GLU A CB    1 
ATOM   951  C  CG    . GLU A 1 111 ? -8.753  13.027  36.882  1.00 10.41 ? 111  GLU A CG    1 
ATOM   952  C  CD    . GLU A 1 111 ? -7.638  12.056  36.566  1.00 12.74 ? 111  GLU A CD    1 
ATOM   953  O  OE1   . GLU A 1 111 ? -6.626  12.482  35.981  1.00 11.97 ? 111  GLU A OE1   1 
ATOM   954  O  OE2   . GLU A 1 111 ? -7.790  10.863  36.898  1.00 17.40 ? 111  GLU A OE2   1 
ATOM   955  N  N     . PHE A 1 112 ? -11.317 14.121  33.165  1.00 9.74  ? 112  PHE A N     1 
ATOM   956  C  CA    . PHE A 1 112 ? -12.148 13.875  31.995  1.00 9.70  ? 112  PHE A CA    1 
ATOM   957  C  C     . PHE A 1 112 ? -11.441 14.318  30.714  1.00 9.57  ? 112  PHE A C     1 
ATOM   958  O  O     . PHE A 1 112 ? -11.440 13.603  29.709  1.00 8.40  ? 112  PHE A O     1 
ATOM   959  C  CB    . PHE A 1 112 ? -13.492 14.592  32.123  1.00 9.01  ? 112  PHE A CB    1 
ATOM   960  C  CG    . PHE A 1 112 ? -14.379 14.417  30.924  1.00 8.44  ? 112  PHE A CG    1 
ATOM   961  C  CD1   . PHE A 1 112 ? -14.992 13.201  30.676  1.00 12.28 ? 112  PHE A CD1   1 
ATOM   962  C  CD2   . PHE A 1 112 ? -14.574 15.453  30.030  1.00 12.83 ? 112  PHE A CD2   1 
ATOM   963  C  CE1   . PHE A 1 112 ? -15.801 13.029  29.571  1.00 16.47 ? 112  PHE A CE1   1 
ATOM   964  C  CE2   . PHE A 1 112 ? -15.396 15.286  28.927  1.00 12.03 ? 112  PHE A CE2   1 
ATOM   965  C  CZ    . PHE A 1 112 ? -16.005 14.071  28.701  1.00 13.64 ? 112  PHE A CZ    1 
ATOM   966  N  N     . VAL A 1 113 ? -10.838 15.499  30.747  1.00 8.61  ? 113  VAL A N     1 
ATOM   967  C  CA    . VAL A 1 113 ? -10.097 15.979  29.584  1.00 9.81  ? 113  VAL A CA    1 
ATOM   968  C  C     . VAL A 1 113 ? -8.962  15.008  29.220  1.00 9.36  ? 113  VAL A C     1 
ATOM   969  O  O     . VAL A 1 113 ? -8.730  14.723  28.039  1.00 7.71  ? 113  VAL A O     1 
ATOM   970  C  CB    . VAL A 1 113 ? -9.568  17.413  29.798  1.00 9.36  ? 113  VAL A CB    1 
ATOM   971  C  CG1   . VAL A 1 113 ? -8.786  17.886  28.570  1.00 9.27  ? 113  VAL A CG1   1 
ATOM   972  C  CG2   . VAL A 1 113 ? -10.732 18.363  30.109  1.00 9.85  ? 113  VAL A CG2   1 
ATOM   973  N  N     . LEU A 1 114 ? -8.269  14.478  30.228  1.00 8.82  ? 114  LEU A N     1 
ATOM   974  C  CA    . LEU A 1 114 ? -7.210  13.498  29.969  1.00 8.40  ? 114  LEU A CA    1 
ATOM   975  C  C     . LEU A 1 114 ? -7.736  12.197  29.352  1.00 8.51  ? 114  LEU A C     1 
ATOM   976  O  O     . LEU A 1 114 ? -7.062  11.587  28.521  1.00 8.12  ? 114  LEU A O     1 
ATOM   977  C  CB    . LEU A 1 114 ? -6.398  13.216  31.235  1.00 7.75  ? 114  LEU A CB    1 
ATOM   978  C  CG    . LEU A 1 114 ? -5.640  14.435  31.760  1.00 9.80  ? 114  LEU A CG    1 
ATOM   979  C  CD1   . LEU A 1 114 ? -4.888  14.080  33.029  1.00 11.48 ? 114  LEU A CD1   1 
ATOM   980  C  CD2   . LEU A 1 114 ? -4.680  14.968  30.707  1.00 11.73 ? 114  LEU A CD2   1 
ATOM   981  N  N     . ARG A 1 115 ? -8.931  11.772  29.757  1.00 8.45  ? 115  ARG A N     1 
ATOM   982  C  CA    . ARG A 1 115 ? -9.565  10.609  29.143  1.00 8.74  ? 115  ARG A CA    1 
ATOM   983  C  C     . ARG A 1 115 ? -9.825  10.843  27.660  1.00 7.84  ? 115  ARG A C     1 
ATOM   984  O  O     . ARG A 1 115 ? -9.516  9.996   26.811  1.00 8.98  ? 115  ARG A O     1 
ATOM   985  C  CB    . ARG A 1 115 ? -10.870 10.267  29.863  1.00 10.80 ? 115  ARG A CB    1 
ATOM   986  C  CG    . ARG A 1 115 ? -10.626 9.661   31.227  1.00 12.35 ? 115  ARG A CG    1 
ATOM   987  C  CD    . ARG A 1 115 ? -11.892 9.094   31.830  1.00 13.95 ? 115  ARG A CD    1 
ATOM   988  N  NE    . ARG A 1 115 ? -11.536 8.165   32.894  1.00 18.91 ? 115  ARG A NE    1 
ATOM   989  C  CZ    . ARG A 1 115 ? -11.503 8.480   34.181  1.00 19.87 ? 115  ARG A CZ    1 
ATOM   990  N  NH1   . ARG A 1 115 ? -11.837 9.702   34.583  1.00 19.19 ? 115  ARG A NH1   1 
ATOM   991  N  NH2   . ARG A 1 115 ? -11.147 7.565   35.070  1.00 23.99 ? 115  ARG A NH2   1 
ATOM   992  N  N     . VAL A 1 116 ? -10.385 12.005  27.342  1.00 7.86  ? 116  VAL A N     1 
ATOM   993  C  CA    . VAL A 1 116 ? -10.654 12.337  25.955  1.00 8.22  ? 116  VAL A CA    1 
ATOM   994  C  C     . VAL A 1 116 ? -9.362  12.420  25.145  1.00 6.71  ? 116  VAL A C     1 
ATOM   995  O  O     . VAL A 1 116 ? -9.276  11.873  24.046  1.00 8.44  ? 116  VAL A O     1 
ATOM   996  C  CB    . VAL A 1 116 ? -11.456 13.651  25.851  1.00 6.33  ? 116  VAL A CB    1 
ATOM   997  C  CG1   . VAL A 1 116 ? -11.654 14.046  24.391  1.00 6.83  ? 116  VAL A CG1   1 
ATOM   998  C  CG2   . VAL A 1 116 ? -12.801 13.476  26.546  1.00 8.61  ? 116  VAL A CG2   1 
ATOM   999  N  N     . MET A 1 117 ? -8.354  13.097  25.682  1.00 7.95  ? 117  MET A N     1 
ATOM   1000 C  CA    . MET A 1 117 ? -7.080  13.217  24.982  1.00 7.26  ? 117  MET A CA    1 
ATOM   1001 C  C     . MET A 1 117 ? -6.482  11.841  24.689  1.00 7.80  ? 117  MET A C     1 
ATOM   1002 O  O     . MET A 1 117 ? -6.052  11.554  23.568  1.00 8.67  ? 117  MET A O     1 
ATOM   1003 C  CB    . MET A 1 117 ? -6.098  14.036  25.812  1.00 9.81  ? 117  MET A CB    1 
ATOM   1004 C  CG    . MET A 1 117 ? -4.727  14.101  25.187  1.00 8.29  ? 117  MET A CG    1 
ATOM   1005 S  SD    . MET A 1 117 ? -3.668  15.350  25.954  1.00 13.17 ? 117  MET A SD    1 
ATOM   1006 C  CE    . MET A 1 117 ? -3.304  14.592  27.520  1.00 15.46 ? 117  MET A CE    1 
ATOM   1007 N  N     . THR A 1 118 ? -6.459  10.982  25.704  1.00 8.08  ? 118  THR A N     1 
ATOM   1008 C  CA    . THR A 1 118 ? -5.853  9.662   25.565  1.00 8.15  ? 118  THR A CA    1 
ATOM   1009 C  C     . THR A 1 118 ? -6.607  8.823   24.544  1.00 9.26  ? 118  THR A C     1 
ATOM   1010 O  O     . THR A 1 118 ? -6.026  8.291   23.596  1.00 8.36  ? 118  THR A O     1 
ATOM   1011 C  CB    . THR A 1 118 ? -5.862  8.932   26.909  1.00 7.61  ? 118  THR A CB    1 
ATOM   1012 O  OG1   . THR A 1 118 ? -5.090  9.680   27.849  1.00 8.73  ? 118  THR A OG1   1 
ATOM   1013 C  CG2   . THR A 1 118 ? -5.272  7.527   26.772  1.00 8.36  ? 118  THR A CG2   1 
ATOM   1014 N  N     . GLN A 1 119 ? -7.915  8.724   24.739  1.00 6.84  ? 119  GLN A N     1 
ATOM   1015 C  CA    . GLN A 1 119 ? -8.727  7.816   23.947  1.00 8.03  ? 119  GLN A CA    1 
ATOM   1016 C  C     . GLN A 1 119 ? -8.924  8.289   22.505  1.00 8.88  ? 119  GLN A C     1 
ATOM   1017 O  O     . GLN A 1 119 ? -8.882  7.477   21.581  1.00 8.67  ? 119  GLN A O     1 
ATOM   1018 C  CB    . GLN A 1 119 ? -10.031 7.517   24.676  1.00 8.01  ? 119  GLN A CB    1 
ATOM   1019 C  CG    . GLN A 1 119 ? -9.763  6.765   25.979  1.00 8.04  ? 119  GLN A CG    1 
ATOM   1020 C  CD    . GLN A 1 119 ? -11.029 6.348   26.702  1.00 9.89  ? 119  GLN A CD    1 
ATOM   1021 O  OE1   . GLN A 1 119 ? -11.940 5.767   26.104  1.00 8.89  ? 119  GLN A OE1   1 
ATOM   1022 N  NE2   . GLN A 1 119 ? -11.088 6.631   28.006  1.00 10.23 ? 119  GLN A NE2   1 
ATOM   1023 N  N     . LEU A 1 120 ? -9.084  9.595   22.295  1.00 8.66  ? 120  LEU A N     1 
ATOM   1024 C  CA    . LEU A 1 120 ? -9.171  10.101  20.926  1.00 10.17 ? 120  LEU A CA    1 
ATOM   1025 C  C     . LEU A 1 120 ? -7.830  10.033  20.200  1.00 9.90  ? 120  LEU A C     1 
ATOM   1026 O  O     . LEU A 1 120 ? -7.787  9.810   18.993  1.00 10.70 ? 120  LEU A O     1 
ATOM   1027 C  CB    . LEU A 1 120 ? -9.701  11.535  20.883  1.00 9.92  ? 120  LEU A CB    1 
ATOM   1028 C  CG    . LEU A 1 120 ? -11.196 11.675  21.094  1.00 13.07 ? 120  LEU A CG    1 
ATOM   1029 C  CD1   . LEU A 1 120 ? -11.585 13.139  20.929  1.00 14.84 ? 120  LEU A CD1   1 
ATOM   1030 C  CD2   . LEU A 1 120 ? -11.970 10.791  20.111  1.00 14.87 ? 120  LEU A CD2   1 
ATOM   1031 N  N     . THR A 1 121 ? -6.730  10.242  20.916  1.00 7.58  ? 121  THR A N     1 
ATOM   1032 C  CA    . THR A 1 121 ? -5.426  10.082  20.280  1.00 9.08  ? 121  THR A CA    1 
ATOM   1033 C  C     . THR A 1 121 ? -5.283  8.657   19.755  1.00 9.54  ? 121  THR A C     1 
ATOM   1034 O  O     . THR A 1 121 ? -4.784  8.441   18.652  1.00 10.98 ? 121  THR A O     1 
ATOM   1035 C  CB    . THR A 1 121 ? -4.266  10.428  21.230  1.00 9.68  ? 121  THR A CB    1 
ATOM   1036 O  OG1   . THR A 1 121 ? -4.315  11.833  21.513  1.00 10.68 ? 121  THR A OG1   1 
ATOM   1037 C  CG2   . THR A 1 121 ? -2.924  10.094  20.580  1.00 11.35 ? 121  THR A CG2   1 
ATOM   1038 N  N     . LEU A 1 122 ? -5.741  7.687   20.539  1.00 9.32  ? 122  LEU A N     1 
ATOM   1039 C  CA    . LEU A 1 122 ? -5.694  6.292   20.102  1.00 10.12 ? 122  LEU A CA    1 
ATOM   1040 C  C     . LEU A 1 122 ? -6.625  6.005   18.920  1.00 9.54  ? 122  LEU A C     1 
ATOM   1041 O  O     . LEU A 1 122 ? -6.271  5.237   18.021  1.00 10.97 ? 122  LEU A O     1 
ATOM   1042 C  CB    . LEU A 1 122 ? -5.956  5.343   21.275  1.00 9.99  ? 122  LEU A CB    1 
ATOM   1043 C  CG    . LEU A 1 122 ? -4.778  5.312   22.265  1.00 10.26 ? 122  LEU A CG    1 
ATOM   1044 C  CD1   . LEU A 1 122 ? -5.195  4.775   23.628  1.00 13.60 ? 122  LEU A CD1   1 
ATOM   1045 C  CD2   . LEU A 1 122 ? -3.589  4.520   21.709  1.00 11.06 ? 122  LEU A CD2   1 
ATOM   1046 N  N     . ALA A 1 123 ? -7.799  6.626   18.917  1.00 8.44  ? 123  ALA A N     1 
ATOM   1047 C  CA    . ALA A 1 123 ? -8.700  6.523   17.772  1.00 9.34  ? 123  ALA A CA    1 
ATOM   1048 C  C     . ALA A 1 123 ? -8.013  7.060   16.523  1.00 10.32 ? 123  ALA A C     1 
ATOM   1049 O  O     . ALA A 1 123 ? -8.056  6.430   15.465  1.00 11.16 ? 123  ALA A O     1 
ATOM   1050 C  CB    . ALA A 1 123 ? -10.017 7.273   18.035  1.00 10.09 ? 123  ALA A CB    1 
ATOM   1051 N  N     . LEU A 1 124 ? -7.365  8.222   16.647  1.00 10.64 ? 124  LEU A N     1 
ATOM   1052 C  CA    . LEU A 1 124 ? -6.645  8.803   15.515  1.00 10.09 ? 124  LEU A CA    1 
ATOM   1053 C  C     . LEU A 1 124 ? -5.504  7.904   15.042  1.00 12.50 ? 124  LEU A C     1 
ATOM   1054 O  O     . LEU A 1 124 ? -5.296  7.744   13.845  1.00 15.02 ? 124  LEU A O     1 
ATOM   1055 C  CB    . LEU A 1 124 ? -6.093  10.188  15.852  1.00 10.99 ? 124  LEU A CB    1 
ATOM   1056 C  CG    . LEU A 1 124 ? -7.113  11.312  15.942  1.00 15.00 ? 124  LEU A CG    1 
ATOM   1057 C  CD1   . LEU A 1 124 ? -6.405  12.600  16.354  1.00 16.56 ? 124  LEU A CD1   1 
ATOM   1058 C  CD2   . LEU A 1 124 ? -7.836  11.489  14.606  1.00 14.00 ? 124  LEU A CD2   1 
ATOM   1059 N  N     . LYS A 1 125 ? -4.759  7.337   15.985  1.00 10.66 ? 125  LYS A N     1 
ATOM   1060 C  CA    . LYS A 1 125 ? -3.685  6.407   15.650  1.00 10.99 ? 125  LYS A CA    1 
ATOM   1061 C  C     . LYS A 1 125 ? -4.205  5.295   14.734  1.00 13.17 ? 125  LYS A C     1 
ATOM   1062 O  O     . LYS A 1 125 ? -3.576  4.958   13.733  1.00 15.66 ? 125  LYS A O     1 
ATOM   1063 C  CB    . LYS A 1 125 ? -3.065  5.826   16.922  1.00 13.87 ? 125  LYS A CB    1 
ATOM   1064 C  CG    . LYS A 1 125 ? -1.926  4.834   16.689  1.00 15.88 ? 125  LYS A CG    1 
ATOM   1065 C  CD    . LYS A 1 125 ? -1.253  4.486   18.013  1.00 21.71 ? 125  LYS A CD    1 
ATOM   1066 C  CE    . LYS A 1 125 ? -0.415  3.225   17.924  1.00 27.90 ? 125  LYS A CE    1 
ATOM   1067 N  NZ    . LYS A 1 125 ? 0.112   2.866   19.275  1.00 26.12 ? 125  LYS A NZ    1 
ATOM   1068 N  N     . GLU A 1 126 ? -5.360  4.734   15.075  1.00 12.77 ? 126  GLU A N     1 
ATOM   1069 C  CA    . GLU A 1 126 ? -5.962  3.683   14.258  1.00 15.32 ? 126  GLU A CA    1 
ATOM   1070 C  C     . GLU A 1 126 ? -6.405  4.210   12.895  1.00 16.45 ? 126  GLU A C     1 
ATOM   1071 O  O     . GLU A 1 126 ? -6.190  3.549   11.884  1.00 16.65 ? 126  GLU A O     1 
ATOM   1072 C  CB    . GLU A 1 126 ? -7.124  3.018   15.004  1.00 15.30 ? 126  GLU A CB    1 
ATOM   1073 C  CG    . GLU A 1 126 ? -7.845  1.904   14.234  1.00 16.98 ? 126  GLU A CG    1 
ATOM   1074 C  CD    . GLU A 1 126 ? -6.947  0.729   13.894  1.00 22.02 ? 126  GLU A CD    1 
ATOM   1075 O  OE1   . GLU A 1 126 ? -5.845  0.614   14.467  1.00 21.65 ? 126  GLU A OE1   1 
ATOM   1076 O  OE2   . GLU A 1 126 ? -7.351  -0.092  13.046  1.00 25.05 ? 126  GLU A OE2   1 
ATOM   1077 N  N     . CYS A 1 127 ? -7.006  5.401   12.860  1.00 14.49 ? 127  CYS A N     1 
ATOM   1078 C  CA    . CYS A 1 127 ? -7.378  6.014   11.585  1.00 15.66 ? 127  CYS A CA    1 
ATOM   1079 C  C     . CYS A 1 127 ? -6.165  6.199   10.682  1.00 20.76 ? 127  CYS A C     1 
ATOM   1080 O  O     . CYS A 1 127 ? -6.234  5.957   9.476   1.00 18.83 ? 127  CYS A O     1 
ATOM   1081 C  CB    . CYS A 1 127 ? -8.068  7.360   11.801  1.00 15.08 ? 127  CYS A CB    1 
ATOM   1082 S  SG    . CYS A 1 127 ? -9.716  7.219   12.506  1.00 17.31 ? 127  CYS A SG    1 
ATOM   1083 N  N     . HIS A 1 128 ? -5.053  6.629   11.267  1.00 14.60 ? 128  HIS A N     1 
ATOM   1084 C  CA    . HIS A 1 128 ? -3.834  6.856   10.497  1.00 17.41 ? 128  HIS A CA    1 
ATOM   1085 C  C     . HIS A 1 128 ? -3.242  5.551   9.969   1.00 18.34 ? 128  HIS A C     1 
ATOM   1086 O  O     . HIS A 1 128 ? -2.723  5.505   8.850   1.00 22.65 ? 128  HIS A O     1 
ATOM   1087 C  CB    . HIS A 1 128 ? -2.808  7.627   11.326  1.00 19.08 ? 128  HIS A CB    1 
ATOM   1088 C  CG    . HIS A 1 128 ? -3.260  9.003   11.700  1.00 19.86 ? 128  HIS A CG    1 
ATOM   1089 N  ND1   . HIS A 1 128 ? -2.693  9.725   12.728  1.00 20.38 ? 128  HIS A ND1   1 
ATOM   1090 C  CD2   . HIS A 1 128 ? -4.242  9.781   11.190  1.00 18.39 ? 128  HIS A CD2   1 
ATOM   1091 C  CE1   . HIS A 1 128 ? -3.296  10.896  12.825  1.00 21.23 ? 128  HIS A CE1   1 
ATOM   1092 N  NE2   . HIS A 1 128 ? -4.240  10.955  11.903  1.00 20.57 ? 128  HIS A NE2   1 
ATOM   1093 N  N     . ARG A 1 129 ? -3.328  4.499   10.775  1.00 22.40 ? 129  ARG A N     1 
ATOM   1094 C  CA    . ARG A 1 129 ? -2.822  3.193   10.375  1.00 22.33 ? 129  ARG A CA    1 
ATOM   1095 C  C     . ARG A 1 129 ? -3.572  2.704   9.140   1.00 28.87 ? 129  ARG A C     1 
ATOM   1096 O  O     . ARG A 1 129 ? -2.969  2.193   8.195   1.00 31.05 ? 129  ARG A O     1 
ATOM   1097 C  CB    . ARG A 1 129 ? -2.973  2.190   11.523  1.00 22.60 ? 129  ARG A CB    1 
ATOM   1098 C  CG    . ARG A 1 129 ? -2.216  0.889   11.322  1.00 34.48 ? 129  ARG A CG    1 
ATOM   1099 C  CD    . ARG A 1 129 ? -2.474  -0.087  12.461  1.00 34.65 ? 129  ARG A CD    1 
ATOM   1100 N  NE    . ARG A 1 129 ? -3.865  -0.528  12.500  1.00 38.22 ? 129  ARG A NE    1 
ATOM   1101 C  CZ    . ARG A 1 129 ? -4.381  -1.440  11.682  1.00 40.88 ? 129  ARG A CZ    1 
ATOM   1102 N  NH1   . ARG A 1 129 ? -3.621  -2.006  10.753  1.00 43.81 ? 129  ARG A NH1   1 
ATOM   1103 N  NH2   . ARG A 1 129 ? -5.656  -1.784  11.789  1.00 34.49 ? 129  ARG A NH2   1 
ATOM   1104 N  N     . ARG A 1 130 ? -4.891  2.874   9.151   1.00 28.13 ? 130  ARG A N     1 
ATOM   1105 C  CA    . ARG A 1 130 ? -5.739  2.421   8.050   1.00 33.51 ? 130  ARG A CA    1 
ATOM   1106 C  C     . ARG A 1 130 ? -5.542  3.247   6.780   1.00 40.85 ? 130  ARG A C     1 
ATOM   1107 O  O     . ARG A 1 130 ? -5.637  2.723   5.669   1.00 50.26 ? 130  ARG A O     1 
ATOM   1108 C  CB    . ARG A 1 130 ? -7.213  2.435   8.464   1.00 29.59 ? 130  ARG A CB    1 
ATOM   1109 C  CG    . ARG A 1 130 ? -7.509  1.636   9.721   1.00 34.55 ? 130  ARG A CG    1 
ATOM   1110 C  CD    . ARG A 1 130 ? -6.959  0.226   9.618   1.00 42.90 ? 130  ARG A CD    1 
ATOM   1111 N  N     . SER A 1 131 ? -5.271  4.538   6.946   1.00 38.23 ? 131  SER A N     1 
ATOM   1112 C  CA    . SER A 1 131 ? -5.030  5.415   5.806   1.00 43.47 ? 131  SER A CA    1 
ATOM   1113 C  C     . SER A 1 131 ? -3.746  5.026   5.083   1.00 44.44 ? 131  SER A C     1 
ATOM   1114 O  O     . SER A 1 131 ? -3.660  5.128   3.860   1.00 53.48 ? 131  SER A O     1 
ATOM   1115 C  CB    . SER A 1 131 ? -4.957  6.878   6.251   1.00 41.28 ? 131  SER A CB    1 
ATOM   1116 O  OG    . SER A 1 131 ? -6.198  7.317   6.774   1.00 47.40 ? 131  SER A OG    1 
ATOM   1117 N  N     . LEU A 1 138 ? -9.808  8.110   4.175   1.00 49.11 ? 138  LEU A N     1 
ATOM   1118 C  CA    . LEU A 1 138 ? -10.533 7.848   5.413   1.00 45.51 ? 138  LEU A CA    1 
ATOM   1119 C  C     . LEU A 1 138 ? -10.971 9.154   6.067   1.00 49.71 ? 138  LEU A C     1 
ATOM   1120 O  O     . LEU A 1 138 ? -10.191 9.800   6.766   1.00 55.70 ? 138  LEU A O     1 
ATOM   1121 C  CB    . LEU A 1 138 ? -9.668  7.034   6.380   1.00 40.59 ? 138  LEU A CB    1 
ATOM   1122 C  CG    . LEU A 1 138 ? -10.364 6.355   7.565   1.00 39.34 ? 138  LEU A CG    1 
ATOM   1123 C  CD1   . LEU A 1 138 ? -9.451  5.310   8.190   1.00 40.44 ? 138  LEU A CD1   1 
ATOM   1124 C  CD2   . LEU A 1 138 ? -10.819 7.362   8.614   1.00 39.22 ? 138  LEU A CD2   1 
ATOM   1125 N  N     . HIS A 1 139 ? -12.222 9.537   5.836   1.00 45.01 ? 139  HIS A N     1 
ATOM   1126 C  CA    . HIS A 1 139 ? -12.757 10.780  6.383   1.00 40.53 ? 139  HIS A CA    1 
ATOM   1127 C  C     . HIS A 1 139 ? -13.002 10.674  7.882   1.00 41.47 ? 139  HIS A C     1 
ATOM   1128 O  O     . HIS A 1 139 ? -13.632 9.726   8.350   1.00 45.37 ? 139  HIS A O     1 
ATOM   1129 C  CB    . HIS A 1 139 ? -14.069 11.151  5.685   1.00 45.69 ? 139  HIS A CB    1 
ATOM   1130 C  CG    . HIS A 1 139 ? -13.922 11.426  4.222   1.00 48.69 ? 139  HIS A CG    1 
ATOM   1131 N  ND1   . HIS A 1 139 ? -13.628 12.678  3.726   1.00 53.30 ? 139  HIS A ND1   1 
ATOM   1132 C  CD2   . HIS A 1 139 ? -14.038 10.613  3.144   1.00 47.73 ? 139  HIS A CD2   1 
ATOM   1133 C  CE1   . HIS A 1 139 ? -13.565 12.624  2.407   1.00 54.80 ? 139  HIS A CE1   1 
ATOM   1134 N  NE2   . HIS A 1 139 ? -13.808 11.382  2.029   1.00 52.64 ? 139  HIS A NE2   1 
ATOM   1135 N  N     . ARG A 1 140 ? -12.497 11.647  8.633   1.00 39.38 ? 140  ARG A N     1 
ATOM   1136 C  CA    . ARG A 1 140 ? -12.815 11.751  10.053  1.00 34.89 ? 140  ARG A CA    1 
ATOM   1137 C  C     . ARG A 1 140 ? -13.098 13.201  10.447  1.00 35.83 ? 140  ARG A C     1 
ATOM   1138 O  O     . ARG A 1 140 ? -12.586 14.141  9.834   1.00 38.59 ? 140  ARG A O     1 
ATOM   1139 C  CB    . ARG A 1 140 ? -11.714 11.142  10.933  1.00 30.10 ? 140  ARG A CB    1 
ATOM   1140 C  CG    . ARG A 1 140 ? -10.331 11.751  10.751  1.00 30.41 ? 140  ARG A CG    1 
ATOM   1141 C  CD    . ARG A 1 140 ? -9.490  10.925  9.791   1.00 36.20 ? 140  ARG A CD    1 
ATOM   1142 N  NE    . ARG A 1 140 ? -8.143  11.464  9.636   1.00 36.88 ? 140  ARG A NE    1 
ATOM   1143 C  CZ    . ARG A 1 140 ? -7.223  10.950  8.827   1.00 43.85 ? 140  ARG A CZ    1 
ATOM   1144 N  NH1   . ARG A 1 140 ? -7.502  9.877   8.098   1.00 43.94 ? 140  ARG A NH1   1 
ATOM   1145 N  NH2   . ARG A 1 140 ? -6.022  11.508  8.746   1.00 46.55 ? 140  ARG A NH2   1 
ATOM   1146 N  N     . ASP A 1 141 ? -13.929 13.368  11.470  1.00 28.63 ? 141  ASP A N     1 
ATOM   1147 C  CA    . ASP A 1 141 ? -14.376 14.684  11.912  1.00 32.98 ? 141  ASP A CA    1 
ATOM   1148 C  C     . ASP A 1 141 ? -14.326 14.748  13.435  1.00 29.51 ? 141  ASP A C     1 
ATOM   1149 O  O     . ASP A 1 141 ? -15.098 14.072  14.112  1.00 26.23 ? 141  ASP A O     1 
ATOM   1150 C  CB    . ASP A 1 141 ? -15.796 14.942  11.401  1.00 42.02 ? 141  ASP A CB    1 
ATOM   1151 C  CG    . ASP A 1 141 ? -16.556 15.936  12.252  1.00 47.02 ? 141  ASP A CG    1 
ATOM   1152 O  OD1   . ASP A 1 141 ? -15.951 16.939  12.692  1.00 39.16 ? 141  ASP A OD1   1 
ATOM   1153 O  OD2   . ASP A 1 141 ? -17.766 15.710  12.473  1.00 51.73 ? 141  ASP A OD2   1 
ATOM   1154 N  N     . LEU A 1 142 ? -13.421 15.573  13.963  1.00 29.42 ? 142  LEU A N     1 
ATOM   1155 C  CA    A LEU A 1 142 ? -13.165 15.622  15.402  0.50 27.50 ? 142  LEU A CA    1 
ATOM   1156 C  CA    B LEU A 1 142 ? -13.153 15.623  15.398  0.50 27.59 ? 142  LEU A CA    1 
ATOM   1157 C  C     . LEU A 1 142 ? -13.995 16.648  16.163  1.00 25.37 ? 142  LEU A C     1 
ATOM   1158 O  O     . LEU A 1 142 ? -13.730 16.919  17.340  1.00 26.93 ? 142  LEU A O     1 
ATOM   1159 C  CB    A LEU A 1 142 ? -11.679 15.871  15.677  0.50 28.36 ? 142  LEU A CB    1 
ATOM   1160 C  CB    B LEU A 1 142 ? -11.666 15.906  15.646  0.50 28.49 ? 142  LEU A CB    1 
ATOM   1161 C  CG    A LEU A 1 142 ? -10.906 14.709  16.296  0.50 27.57 ? 142  LEU A CG    1 
ATOM   1162 C  CG    B LEU A 1 142 ? -10.643 14.814  15.327  0.50 27.93 ? 142  LEU A CG    1 
ATOM   1163 C  CD1   A LEU A 1 142 ? -11.147 13.427  15.521  0.50 29.67 ? 142  LEU A CD1   1 
ATOM   1164 C  CD1   B LEU A 1 142 ? -10.821 14.253  13.925  0.50 29.35 ? 142  LEU A CD1   1 
ATOM   1165 C  CD2   A LEU A 1 142 ? -9.421  15.034  16.358  0.50 28.57 ? 142  LEU A CD2   1 
ATOM   1166 C  CD2   B LEU A 1 142 ? -9.235  15.357  15.503  0.50 29.51 ? 142  LEU A CD2   1 
ATOM   1167 N  N     . LYS A 1 143 ? -14.997 17.222  15.514  1.00 19.27 ? 143  LYS A N     1 
ATOM   1168 C  CA    . LYS A 1 143 ? -15.830 18.193  16.212  1.00 18.43 ? 143  LYS A CA    1 
ATOM   1169 C  C     . LYS A 1 143 ? -16.496 17.503  17.398  1.00 16.12 ? 143  LYS A C     1 
ATOM   1170 O  O     . LYS A 1 143 ? -16.730 16.292  17.366  1.00 15.10 ? 143  LYS A O     1 
ATOM   1171 C  CB    . LYS A 1 143 ? -16.870 18.813  15.279  1.00 23.68 ? 143  LYS A CB    1 
ATOM   1172 C  CG    . LYS A 1 143 ? -17.969 17.871  14.841  1.00 32.75 ? 143  LYS A CG    1 
ATOM   1173 C  CD    . LYS A 1 143 ? -18.863 18.534  13.801  1.00 39.66 ? 143  LYS A CD    1 
ATOM   1174 C  CE    . LYS A 1 143 ? -20.006 17.619  13.397  1.00 43.30 ? 143  LYS A CE    1 
ATOM   1175 N  NZ    . LYS A 1 143 ? -20.843 18.225  12.319  1.00 50.35 ? 143  LYS A NZ    1 
ATOM   1176 N  N     . PRO A 1 144 ? -16.790 18.263  18.460  1.00 17.04 ? 144  PRO A N     1 
ATOM   1177 C  CA    . PRO A 1 144 ? -17.372 17.684  19.676  1.00 15.50 ? 144  PRO A CA    1 
ATOM   1178 C  C     . PRO A 1 144 ? -18.654 16.892  19.401  1.00 13.57 ? 144  PRO A C     1 
ATOM   1179 O  O     . PRO A 1 144 ? -18.898 15.873  20.043  1.00 12.56 ? 144  PRO A O     1 
ATOM   1180 C  CB    . PRO A 1 144 ? -17.678 18.911  20.538  1.00 18.28 ? 144  PRO A CB    1 
ATOM   1181 C  CG    . PRO A 1 144 ? -16.719 19.947  20.070  1.00 19.49 ? 144  PRO A CG    1 
ATOM   1182 C  CD    . PRO A 1 144 ? -16.506 19.701  18.605  1.00 20.68 ? 144  PRO A CD    1 
ATOM   1183 N  N     . ALA A 1 145 ? -19.461 17.345  18.444  1.00 15.13 ? 145  ALA A N     1 
ATOM   1184 C  CA    . ALA A 1 145 ? -20.718 16.680  18.153  1.00 14.96 ? 145  ALA A CA    1 
ATOM   1185 C  C     . ALA A 1 145 ? -20.504 15.290  17.567  1.00 14.70 ? 145  ALA A C     1 
ATOM   1186 O  O     . ALA A 1 145 ? -21.444 14.506  17.459  1.00 18.26 ? 145  ALA A O     1 
ATOM   1187 C  CB    . ALA A 1 145 ? -21.572 17.532  17.207  1.00 19.19 ? 145  ALA A CB    1 
ATOM   1188 N  N     . ASN A 1 146 ? -19.270 14.987  17.174  1.00 13.00 ? 146  ASN A N     1 
ATOM   1189 C  CA    . ASN A 1 146 ? -18.982 13.677  16.612  1.00 11.11 ? 146  ASN A CA    1 
ATOM   1190 C  C     . ASN A 1 146 ? -18.089 12.822  17.504  1.00 9.38  ? 146  ASN A C     1 
ATOM   1191 O  O     . ASN A 1 146 ? -17.469 11.876  17.038  1.00 13.42 ? 146  ASN A O     1 
ATOM   1192 C  CB    . ASN A 1 146 ? -18.353 13.790  15.234  1.00 15.75 ? 146  ASN A CB    1 
ATOM   1193 C  CG    . ASN A 1 146 ? -18.508 12.516  14.434  1.00 25.17 ? 146  ASN A CG    1 
ATOM   1194 O  OD1   . ASN A 1 146 ? -19.540 11.845  14.519  1.00 24.30 ? 146  ASN A OD1   1 
ATOM   1195 N  ND2   . ASN A 1 146 ? -17.487 12.165  13.666  1.00 24.40 ? 146  ASN A ND2   1 
ATOM   1196 N  N     . VAL A 1 147 ? -18.020 13.171  18.781  1.00 9.97  ? 147  VAL A N     1 
ATOM   1197 C  CA    . VAL A 1 147 ? -17.291 12.365  19.749  1.00 9.42  ? 147  VAL A CA    1 
ATOM   1198 C  C     . VAL A 1 147 ? -18.263 11.958  20.840  1.00 11.71 ? 147  VAL A C     1 
ATOM   1199 O  O     . VAL A 1 147 ? -19.007 12.792  21.361  1.00 12.09 ? 147  VAL A O     1 
ATOM   1200 C  CB    . VAL A 1 147 ? -16.113 13.140  20.353  1.00 7.71  ? 147  VAL A CB    1 
ATOM   1201 C  CG1   . VAL A 1 147 ? -15.424 12.312  21.446  1.00 10.12 ? 147  VAL A CG1   1 
ATOM   1202 C  CG2   . VAL A 1 147 ? -15.127 13.532  19.259  1.00 10.78 ? 147  VAL A CG2   1 
ATOM   1203 N  N     . PHE A 1 148 ? -18.265 10.670  21.171  1.00 9.30  ? 148  PHE A N     1 
ATOM   1204 C  CA    . PHE A 1 148 ? -19.301 10.099  22.023  1.00 8.43  ? 148  PHE A CA    1 
ATOM   1205 C  C     . PHE A 1 148 ? -18.759 9.437   23.277  1.00 8.61  ? 148  PHE A C     1 
ATOM   1206 O  O     . PHE A 1 148 ? -17.591 9.047   23.343  1.00 10.33 ? 148  PHE A O     1 
ATOM   1207 C  CB    . PHE A 1 148 ? -20.147 9.106   21.214  1.00 10.11 ? 148  PHE A CB    1 
ATOM   1208 C  CG    . PHE A 1 148 ? -20.910 9.757   20.105  1.00 10.48 ? 148  PHE A CG    1 
ATOM   1209 C  CD1   . PHE A 1 148 ? -20.327 9.941   18.862  1.00 11.08 ? 148  PHE A CD1   1 
ATOM   1210 C  CD2   . PHE A 1 148 ? -22.192 10.235  20.319  1.00 12.74 ? 148  PHE A CD2   1 
ATOM   1211 C  CE1   . PHE A 1 148 ? -21.013 10.583  17.842  1.00 11.67 ? 148  PHE A CE1   1 
ATOM   1212 C  CE2   . PHE A 1 148 ? -22.884 10.873  19.300  1.00 13.96 ? 148  PHE A CE2   1 
ATOM   1213 C  CZ    . PHE A 1 148 ? -22.292 11.046  18.066  1.00 13.92 ? 148  PHE A CZ    1 
ATOM   1214 N  N     . LEU A 1 149 ? -19.632 9.305   24.268  1.00 8.51  ? 149  LEU A N     1 
ATOM   1215 C  CA    . LEU A 1 149 ? -19.294 8.678   25.531  1.00 11.22 ? 149  LEU A CA    1 
ATOM   1216 C  C     . LEU A 1 149 ? -20.211 7.488   25.739  1.00 8.38  ? 149  LEU A C     1 
ATOM   1217 O  O     . LEU A 1 149 ? -21.414 7.584   25.500  1.00 11.16 ? 149  LEU A O     1 
ATOM   1218 C  CB    . LEU A 1 149 ? -19.507 9.669   26.670  1.00 12.27 ? 149  LEU A CB    1 
ATOM   1219 C  CG    . LEU A 1 149 ? -18.733 10.978  26.550  1.00 13.24 ? 149  LEU A CG    1 
ATOM   1220 C  CD1   . LEU A 1 149 ? -19.124 11.919  27.689  1.00 15.88 ? 149  LEU A CD1   1 
ATOM   1221 C  CD2   . LEU A 1 149 ? -17.240 10.702  26.559  1.00 15.52 ? 149  LEU A CD2   1 
ATOM   1222 N  N     . ASP A 1 150 ? -19.642 6.365   26.165  1.00 9.47  ? 150  ASP A N     1 
ATOM   1223 C  CA    . ASP A 1 150 ? -20.466 5.237   26.580  1.00 10.61 ? 150  ASP A CA    1 
ATOM   1224 C  C     . ASP A 1 150 ? -20.754 5.358   28.078  1.00 10.54 ? 150  ASP A C     1 
ATOM   1225 O  O     . ASP A 1 150 ? -20.623 6.438   28.657  1.00 13.18 ? 150  ASP A O     1 
ATOM   1226 C  CB    . ASP A 1 150 ? -19.842 3.885   26.191  1.00 9.33  ? 150  ASP A CB    1 
ATOM   1227 C  CG    . ASP A 1 150 ? -18.638 3.504   27.042  1.00 11.42 ? 150  ASP A CG    1 
ATOM   1228 O  OD1   . ASP A 1 150 ? -18.244 4.274   27.940  1.00 11.36 ? 150  ASP A OD1   1 
ATOM   1229 O  OD2   . ASP A 1 150 ? -18.097 2.406   26.793  1.00 13.87 ? 150  ASP A OD2   1 
ATOM   1230 N  N     . GLY A 1 151 ? -21.182 4.270   28.703  1.00 12.48 ? 151  GLY A N     1 
ATOM   1231 C  CA    . GLY A 1 151 ? -21.555 4.342   30.103  1.00 14.26 ? 151  GLY A CA    1 
ATOM   1232 C  C     . GLY A 1 151 ? -20.446 3.943   31.060  1.00 12.97 ? 151  GLY A C     1 
ATOM   1233 O  O     . GLY A 1 151 ? -20.689 3.802   32.255  1.00 14.74 ? 151  GLY A O     1 
ATOM   1234 N  N     . LYS A 1 152 ? -19.231 3.784   30.540  1.00 10.91 ? 152  LYS A N     1 
ATOM   1235 C  CA    A LYS A 1 152 ? -18.108 3.295   31.336  0.50 10.09 ? 152  LYS A CA    1 
ATOM   1236 C  CA    B LYS A 1 152 ? -18.113 3.303   31.348  0.50 10.03 ? 152  LYS A CA    1 
ATOM   1237 C  C     . LYS A 1 152 ? -16.880 4.205   31.252  1.00 9.91  ? 152  LYS A C     1 
ATOM   1238 O  O     . LYS A 1 152 ? -15.740 3.748   31.405  1.00 11.58 ? 152  LYS A O     1 
ATOM   1239 C  CB    A LYS A 1 152 ? -17.724 1.886   30.882  0.50 12.79 ? 152  LYS A CB    1 
ATOM   1240 C  CB    B LYS A 1 152 ? -17.759 1.868   30.951  0.50 14.02 ? 152  LYS A CB    1 
ATOM   1241 C  CG    A LYS A 1 152 ? -18.854 0.869   30.946  0.50 16.74 ? 152  LYS A CG    1 
ATOM   1242 C  CG    B LYS A 1 152 ? -18.831 0.845   31.319  0.50 13.86 ? 152  LYS A CG    1 
ATOM   1243 C  CD    A LYS A 1 152 ? -18.366 -0.471  30.430  0.50 22.60 ? 152  LYS A CD    1 
ATOM   1244 C  CD    B LYS A 1 152 ? -18.442 -0.549  30.851  0.50 20.84 ? 152  LYS A CD    1 
ATOM   1245 C  CE    A LYS A 1 152 ? -19.509 -1.368  30.007  0.50 24.14 ? 152  LYS A CE    1 
ATOM   1246 C  CE    B LYS A 1 152 ? -18.282 -0.596  29.339  0.50 22.80 ? 152  LYS A CE    1 
ATOM   1247 N  NZ    A LYS A 1 152 ? -19.015 -2.392  29.049  0.50 20.94 ? 152  LYS A NZ    1 
ATOM   1248 N  NZ    B LYS A 1 152 ? -19.557 -0.297  28.637  0.50 35.56 ? 152  LYS A NZ    1 
ATOM   1249 N  N     . GLN A 1 153 ? -17.118 5.486   31.010  1.00 11.93 ? 153  GLN A N     1 
ATOM   1250 C  CA    . GLN A 1 153 ? -16.055 6.480   30.862  1.00 11.44 ? 153  GLN A CA    1 
ATOM   1251 C  C     . GLN A 1 153 ? -15.197 6.290   29.619  1.00 12.59 ? 153  GLN A C     1 
ATOM   1252 O  O     . GLN A 1 153 ? -14.074 6.807   29.545  1.00 16.08 ? 153  GLN A O     1 
ATOM   1253 C  CB    . GLN A 1 153 ? -15.181 6.551   32.116  1.00 10.97 ? 153  GLN A CB    1 
ATOM   1254 C  CG    . GLN A 1 153 ? -15.977 6.897   33.360  1.00 12.64 ? 153  GLN A CG    1 
ATOM   1255 C  CD    . GLN A 1 153 ? -15.089 7.126   34.565  1.00 12.33 ? 153  GLN A CD    1 
ATOM   1256 O  OE1   . GLN A 1 153 ? -14.308 6.253   34.950  1.00 15.40 ? 153  GLN A OE1   1 
ATOM   1257 N  NE2   . GLN A 1 153 ? -15.223 8.294   35.179  1.00 15.44 ? 153  GLN A NE2   1 
ATOM   1258 N  N     . ASN A 1 154 ? -15.715 5.555   28.643  1.00 10.66 ? 154  ASN A N     1 
ATOM   1259 C  CA    . ASN A 1 154 ? -15.009 5.401   27.381  1.00 9.55  ? 154  ASN A CA    1 
ATOM   1260 C  C     . ASN A 1 154 ? -15.437 6.427   26.343  1.00 9.79  ? 154  ASN A C     1 
ATOM   1261 O  O     . ASN A 1 154 ? -16.605 6.837   26.285  1.00 12.42 ? 154  ASN A O     1 
ATOM   1262 C  CB    . ASN A 1 154 ? -15.148 3.982   26.848  1.00 10.98 ? 154  ASN A CB    1 
ATOM   1263 C  CG    . ASN A 1 154 ? -14.728 2.962   27.869  1.00 10.55 ? 154  ASN A CG    1 
ATOM   1264 O  OD1   . ASN A 1 154 ? -13.688 3.113   28.514  1.00 10.11 ? 154  ASN A OD1   1 
ATOM   1265 N  ND2   . ASN A 1 154 ? -15.537 1.927   28.044  1.00 12.74 ? 154  ASN A ND2   1 
ATOM   1266 N  N     . VAL A 1 155 ? -14.468 6.845   25.540  1.00 7.08  ? 155  VAL A N     1 
ATOM   1267 C  CA    . VAL A 1 155 ? -14.657 7.898   24.561  1.00 9.03  ? 155  VAL A CA    1 
ATOM   1268 C  C     . VAL A 1 155 ? -14.501 7.309   23.175  1.00 9.75  ? 155  VAL A C     1 
ATOM   1269 O  O     . VAL A 1 155 ? -13.538 6.591   22.906  1.00 12.25 ? 155  VAL A O     1 
ATOM   1270 C  CB    . VAL A 1 155 ? -13.596 9.002   24.749  1.00 9.61  ? 155  VAL A CB    1 
ATOM   1271 C  CG1   . VAL A 1 155 ? -13.844 10.134  23.776  1.00 13.51 ? 155  VAL A CG1   1 
ATOM   1272 C  CG2   . VAL A 1 155 ? -13.591 9.505   26.200  1.00 10.10 ? 155  VAL A CG2   1 
ATOM   1273 N  N     . LYS A 1 156 ? -15.450 7.596   22.290  1.00 9.82  ? 156  LYS A N     1 
ATOM   1274 C  CA    . LYS A 1 156 ? -15.430 7.010   20.957  1.00 9.92  ? 156  LYS A CA    1 
ATOM   1275 C  C     . LYS A 1 156 ? -15.600 8.048   19.861  1.00 11.94 ? 156  LYS A C     1 
ATOM   1276 O  O     . LYS A 1 156 ? -16.498 8.886   19.927  1.00 12.50 ? 156  LYS A O     1 
ATOM   1277 C  CB    . LYS A 1 156 ? -16.528 5.956   20.844  1.00 12.92 ? 156  LYS A CB    1 
ATOM   1278 C  CG    . LYS A 1 156 ? -16.175 4.678   21.584  1.00 19.03 ? 156  LYS A CG    1 
ATOM   1279 C  CD    . LYS A 1 156 ? -17.287 4.246   22.499  1.00 21.12 ? 156  LYS A CD    1 
ATOM   1280 C  CE    . LYS A 1 156 ? -16.822 3.127   23.419  1.00 14.45 ? 156  LYS A CE    1 
ATOM   1281 N  NZ    . LYS A 1 156 ? -16.718 1.825   22.701  1.00 16.66 ? 156  LYS A NZ    1 
ATOM   1282 N  N     . LEU A 1 157 ? -14.732 7.979   18.859  1.00 9.47  ? 157  LEU A N     1 
ATOM   1283 C  CA    . LEU A 1 157 ? -14.865 8.807   17.668  1.00 11.95 ? 157  LEU A CA    1 
ATOM   1284 C  C     . LEU A 1 157 ? -16.028 8.301   16.822  1.00 14.26 ? 157  LEU A C     1 
ATOM   1285 O  O     . LEU A 1 157 ? -16.101 7.116   16.488  1.00 14.85 ? 157  LEU A O     1 
ATOM   1286 C  CB    . LEU A 1 157 ? -13.559 8.794   16.872  1.00 12.46 ? 157  LEU A CB    1 
ATOM   1287 C  CG    . LEU A 1 157 ? -13.527 9.607   15.582  1.00 15.01 ? 157  LEU A CG    1 
ATOM   1288 C  CD1   . LEU A 1 157 ? -13.748 11.082  15.884  1.00 15.20 ? 157  LEU A CD1   1 
ATOM   1289 C  CD2   . LEU A 1 157 ? -12.205 9.393   14.862  1.00 19.21 ? 157  LEU A CD2   1 
ATOM   1290 N  N     . GLY A 1 158 ? -16.950 9.201   16.500  1.00 12.16 ? 158  GLY A N     1 
ATOM   1291 C  CA    . GLY A 1 158 ? -18.142 8.826   15.765  1.00 15.69 ? 158  GLY A CA    1 
ATOM   1292 C  C     . GLY A 1 158 ? -17.885 8.676   14.283  1.00 22.60 ? 158  GLY A C     1 
ATOM   1293 O  O     . GLY A 1 158 ? -16.864 9.127   13.769  1.00 26.17 ? 158  GLY A O     1 
ATOM   1294 N  N     . ASP A 1 159 ? -18.823 8.037   13.592  1.00 27.53 ? 159  ASP A N     1 
ATOM   1295 C  CA    . ASP A 1 159 ? -18.722 7.865   12.152  1.00 28.85 ? 159  ASP A CA    1 
ATOM   1296 C  C     . ASP A 1 159 ? -18.731 9.223   11.463  1.00 30.46 ? 159  ASP A C     1 
ATOM   1297 O  O     . ASP A 1 159 ? -19.369 10.166  11.936  1.00 29.29 ? 159  ASP A O     1 
ATOM   1298 C  CB    . ASP A 1 159 ? -19.888 7.018   11.633  1.00 29.90 ? 159  ASP A CB    1 
ATOM   1299 C  CG    . ASP A 1 159 ? -21.239 7.636   11.943  1.00 32.32 ? 159  ASP A CG    1 
ATOM   1300 O  OD1   . ASP A 1 159 ? -21.585 7.746   13.140  1.00 32.18 ? 159  ASP A OD1   1 
ATOM   1301 O  OD2   . ASP A 1 159 ? -21.955 8.008   10.990  1.00 30.81 ? 159  ASP A OD2   1 
ATOM   1302 N  N     . PHE A 1 160 ? -18.030 9.314   10.340  1.00 27.63 ? 160  PHE A N     1 
ATOM   1303 C  CA    . PHE A 1 160 ? -18.013 10.542  9.554   1.00 33.58 ? 160  PHE A CA    1 
ATOM   1304 C  C     . PHE A 1 160 ? -19.393 10.867  8.983   1.00 32.30 ? 160  PHE A C     1 
ATOM   1305 O  O     . PHE A 1 160 ? -19.801 12.030  8.935   1.00 32.90 ? 160  PHE A O     1 
ATOM   1306 C  CB    . PHE A 1 160 ? -16.999 10.433  8.415   1.00 36.03 ? 160  PHE A CB    1 
ATOM   1307 C  CG    . PHE A 1 160 ? -16.798 11.714  7.663   1.00 39.54 ? 160  PHE A CG    1 
ATOM   1308 C  CD1   . PHE A 1 160 ? -17.369 11.900  6.415   1.00 43.94 ? 160  PHE A CD1   1 
ATOM   1309 C  CD2   . PHE A 1 160 ? -16.043 12.740  8.211   1.00 38.44 ? 160  PHE A CD2   1 
ATOM   1310 C  CE1   . PHE A 1 160 ? -17.184 13.084  5.720   1.00 41.71 ? 160  PHE A CE1   1 
ATOM   1311 C  CE2   . PHE A 1 160 ? -15.855 13.925  7.524   1.00 42.19 ? 160  PHE A CE2   1 
ATOM   1312 C  CZ    . PHE A 1 160 ? -16.427 14.098  6.276   1.00 43.39 ? 160  PHE A CZ    1 
ATOM   1313 N  N     . GLY A 1 161 ? -20.106 9.829   8.557   1.00 24.14 ? 161  GLY A N     1 
ATOM   1314 C  CA    . GLY A 1 161 ? -21.380 9.991   7.882   1.00 26.20 ? 161  GLY A CA    1 
ATOM   1315 C  C     . GLY A 1 161 ? -21.268 9.552   6.434   1.00 33.81 ? 161  GLY A C     1 
ATOM   1316 O  O     . GLY A 1 161 ? -20.620 10.212  5.621   1.00 31.66 ? 161  GLY A O     1 
ATOM   1317 N  N     . LEU A 1 162 ? -21.896 8.426   6.111   1.00 37.77 ? 162  LEU A N     1 
ATOM   1318 C  CA    . LEU A 1 162 ? -21.821 7.872   4.764   1.00 41.35 ? 162  LEU A CA    1 
ATOM   1319 C  C     . LEU A 1 162 ? -22.269 8.874   3.710   1.00 36.09 ? 162  LEU A C     1 
ATOM   1320 O  O     . LEU A 1 162 ? -21.581 9.084   2.714   1.00 37.80 ? 162  LEU A O     1 
ATOM   1321 C  CB    . LEU A 1 162 ? -22.664 6.602   4.657   1.00 42.90 ? 162  LEU A CB    1 
ATOM   1322 C  CG    . LEU A 1 162 ? -22.139 5.377   5.401   1.00 49.98 ? 162  LEU A CG    1 
ATOM   1323 C  CD1   . LEU A 1 162 ? -23.134 4.241   5.269   1.00 50.57 ? 162  LEU A CD1   1 
ATOM   1324 C  CD2   . LEU A 1 162 ? -20.770 4.969   4.871   1.00 52.08 ? 162  LEU A CD2   1 
ATOM   1325 N  N     . ALA A 1 163 ? -23.429 9.481   3.931   1.00 42.45 ? 163  ALA A N     1 
ATOM   1326 C  CA    . ALA A 1 163 ? -23.965 10.466  2.997   1.00 50.84 ? 163  ALA A CA    1 
ATOM   1327 C  C     . ALA A 1 163 ? -23.051 11.683  2.916   1.00 55.20 ? 163  ALA A C     1 
ATOM   1328 O  O     . ALA A 1 163 ? -22.995 12.366  1.892   1.00 53.15 ? 163  ALA A O     1 
ATOM   1329 C  CB    . ALA A 1 163 ? -25.365 10.883  3.413   1.00 45.14 ? 163  ALA A CB    1 
ATOM   1330 N  N     . ARG A 1 164 ? -22.337 11.945  4.006   1.00 51.41 ? 164  ARG A N     1 
ATOM   1331 C  CA    . ARG A 1 164 ? -21.456 13.103  4.095   1.00 57.99 ? 164  ARG A CA    1 
ATOM   1332 C  C     . ARG A 1 164 ? -20.220 12.927  3.213   1.00 65.42 ? 164  ARG A C     1 
ATOM   1333 O  O     . ARG A 1 164 ? -19.790 13.866  2.543   1.00 65.65 ? 164  ARG A O     1 
ATOM   1334 C  CB    . ARG A 1 164 ? -21.065 13.352  5.553   1.00 53.73 ? 164  ARG A CB    1 
ATOM   1335 C  CG    . ARG A 1 164 ? -20.536 14.744  5.847   1.00 60.98 ? 164  ARG A CG    1 
ATOM   1336 C  CD    . ARG A 1 164 ? -21.213 15.308  7.085   1.00 61.46 ? 164  ARG A CD    1 
ATOM   1337 N  NE    . ARG A 1 164 ? -21.632 14.245  7.992   1.00 62.39 ? 164  ARG A NE    1 
ATOM   1338 C  CZ    . ARG A 1 164 ? -22.644 14.344  8.848   1.00 56.81 ? 164  ARG A CZ    1 
ATOM   1339 N  NH1   . ARG A 1 164 ? -23.357 15.462  8.919   1.00 47.31 ? 164  ARG A NH1   1 
ATOM   1340 N  NH2   . ARG A 1 164 ? -22.950 13.319  9.628   1.00 58.62 ? 164  ARG A NH2   1 
ATOM   1341 N  N     . ILE A 1 165 ? -19.659 11.720  3.214   1.00 65.87 ? 165  ILE A N     1 
ATOM   1342 C  CA    . ILE A 1 165 ? -18.580 11.368  2.293   1.00 60.66 ? 165  ILE A CA    1 
ATOM   1343 C  C     . ILE A 1 165 ? -19.083 11.506  0.860   1.00 63.95 ? 165  ILE A C     1 
ATOM   1344 O  O     . ILE A 1 165 ? -18.306 11.694  -0.078  1.00 65.70 ? 165  ILE A O     1 
ATOM   1345 C  CB    . ILE A 1 165 ? -18.114 9.911   2.508   1.00 57.25 ? 165  ILE A CB    1 
ATOM   1346 C  CG1   . ILE A 1 165 ? -17.487 9.742   3.894   1.00 59.42 ? 165  ILE A CG1   1 
ATOM   1347 C  CG2   . ILE A 1 165 ? -17.130 9.490   1.424   1.00 51.96 ? 165  ILE A CG2   1 
ATOM   1348 C  CD1   . ILE A 1 165 ? -17.122 8.309   4.224   1.00 58.10 ? 165  ILE A CD1   1 
ATOM   1349 N  N     . LEU A 1 166 ? -20.400 11.420  0.711   1.00 62.25 ? 166  LEU A N     1 
ATOM   1350 C  CA    . LEU A 1 166 ? -21.050 11.407  -0.590  1.00 63.45 ? 166  LEU A CA    1 
ATOM   1351 C  C     . LEU A 1 166 ? -21.297 12.831  -1.083  1.00 63.77 ? 166  LEU A C     1 
ATOM   1352 O  O     . LEU A 1 166 ? -20.754 13.250  -2.106  1.00 66.36 ? 166  LEU A O     1 
ATOM   1353 C  CB    . LEU A 1 166 ? -22.374 10.645  -0.477  1.00 64.77 ? 166  LEU A CB    1 
ATOM   1354 C  CG    . LEU A 1 166 ? -22.795 9.662   -1.573  1.00 64.65 ? 166  LEU A CG    1 
ATOM   1355 C  CD1   . LEU A 1 166 ? -23.782 10.295  -2.543  1.00 65.86 ? 166  LEU A CD1   1 
ATOM   1356 C  CD2   . LEU A 1 166 ? -21.582 9.091   -2.299  1.00 64.07 ? 166  LEU A CD2   1 
ATOM   1357 N  N     . THR A 1 170 ? -27.715 18.884  1.125   1.00 73.34 ? 170  THR A N     1 
ATOM   1358 C  CA    . THR A 1 170 ? -27.470 19.032  2.554   1.00 69.16 ? 170  THR A CA    1 
ATOM   1359 C  C     . THR A 1 170 ? -25.991 19.263  2.847   1.00 67.17 ? 170  THR A C     1 
ATOM   1360 O  O     . THR A 1 170 ? -25.639 20.064  3.714   1.00 67.13 ? 170  THR A O     1 
ATOM   1361 C  CB    . THR A 1 170 ? -27.953 17.802  3.341   1.00 63.48 ? 170  THR A CB    1 
ATOM   1362 O  OG1   . THR A 1 170 ? -29.364 17.641  3.157   1.00 63.70 ? 170  THR A OG1   1 
ATOM   1363 C  CG2   . THR A 1 170 ? -27.656 17.969  4.823   1.00 59.65 ? 170  THR A CG2   1 
ATOM   1364 N  N     . SER A 1 171 ? -25.128 18.558  2.123   1.00 63.93 ? 171  SER A N     1 
ATOM   1365 C  CA    . SER A 1 171 ? -23.689 18.720  2.299   1.00 65.07 ? 171  SER A CA    1 
ATOM   1366 C  C     . SER A 1 171 ? -23.223 20.117  1.891   1.00 62.91 ? 171  SER A C     1 
ATOM   1367 O  O     . SER A 1 171 ? -22.213 20.607  2.390   1.00 60.88 ? 171  SER A O     1 
ATOM   1368 C  CB    . SER A 1 171 ? -22.915 17.633  1.545   1.00 67.93 ? 171  SER A CB    1 
ATOM   1369 O  OG    . SER A 1 171 ? -23.561 17.285  0.334   1.00 73.02 ? 171  SER A OG    1 
ATOM   1370 N  N     . PHE A 1 172 ? -23.963 20.755  0.988   1.00 60.13 ? 172  PHE A N     1 
ATOM   1371 C  CA    . PHE A 1 172 ? -23.687 22.140  0.617   1.00 55.28 ? 172  PHE A CA    1 
ATOM   1372 C  C     . PHE A 1 172 ? -24.170 23.092  1.702   1.00 57.08 ? 172  PHE A C     1 
ATOM   1373 O  O     . PHE A 1 172 ? -23.538 24.113  1.971   1.00 62.95 ? 172  PHE A O     1 
ATOM   1374 C  CB    . PHE A 1 172 ? -24.352 22.498  -0.716  1.00 60.68 ? 172  PHE A CB    1 
ATOM   1375 C  CG    . PHE A 1 172 ? -24.525 23.979  -0.926  1.00 62.71 ? 172  PHE A CG    1 
ATOM   1376 C  CD1   . PHE A 1 172 ? -23.422 24.812  -1.018  1.00 65.01 ? 172  PHE A CD1   1 
ATOM   1377 C  CD2   . PHE A 1 172 ? -25.789 24.536  -1.033  1.00 68.30 ? 172  PHE A CD2   1 
ATOM   1378 C  CE1   . PHE A 1 172 ? -23.575 26.174  -1.207  1.00 64.13 ? 172  PHE A CE1   1 
ATOM   1379 C  CE2   . PHE A 1 172 ? -25.949 25.898  -1.226  1.00 69.18 ? 172  PHE A CE2   1 
ATOM   1380 C  CZ    . PHE A 1 172 ? -24.840 26.718  -1.311  1.00 67.64 ? 172  PHE A CZ    1 
ATOM   1381 N  N     . ALA A 1 173 ? -25.293 22.746  2.323   1.00 57.49 ? 173  ALA A N     1 
ATOM   1382 C  CA    . ALA A 1 173 ? -25.896 23.570  3.367   1.00 60.34 ? 173  ALA A CA    1 
ATOM   1383 C  C     . ALA A 1 173 ? -24.941 23.868  4.525   1.00 62.99 ? 173  ALA A C     1 
ATOM   1384 O  O     . ALA A 1 173 ? -24.677 25.029  4.831   1.00 57.55 ? 173  ALA A O     1 
ATOM   1385 C  CB    . ALA A 1 173 ? -27.172 22.918  3.885   1.00 61.85 ? 173  ALA A CB    1 
ATOM   1386 N  N     . LYS A 1 174 ? -24.424 22.827  5.170   1.00 66.11 ? 174  LYS A N     1 
ATOM   1387 C  CA    . LYS A 1 174 ? -23.555 23.041  6.329   1.00 64.11 ? 174  LYS A CA    1 
ATOM   1388 C  C     . LYS A 1 174 ? -22.062 23.154  6.020   1.00 57.52 ? 174  LYS A C     1 
ATOM   1389 O  O     . LYS A 1 174 ? -21.289 23.636  6.850   1.00 50.94 ? 174  LYS A O     1 
ATOM   1390 C  CB    . LYS A 1 174 ? -23.825 22.028  7.444   1.00 61.53 ? 174  LYS A CB    1 
ATOM   1391 C  CG    . LYS A 1 174 ? -24.540 22.668  8.620   1.00 62.80 ? 174  LYS A CG    1 
ATOM   1392 C  CD    . LYS A 1 174 ? -23.863 23.994  8.954   1.00 58.19 ? 174  LYS A CD    1 
ATOM   1393 C  CE    . LYS A 1 174 ? -24.834 25.016  9.528   1.00 60.99 ? 174  LYS A CE    1 
ATOM   1394 N  NZ    . LYS A 1 174 ? -24.926 24.957  11.013  1.00 60.23 ? 174  LYS A NZ    1 
ATOM   1395 N  N     . THR A 1 175 ? -21.657 22.715  4.834   1.00 58.90 ? 175  THR A N     1 
ATOM   1396 C  CA    . THR A 1 175 ? -20.316 23.025  4.362   1.00 60.98 ? 175  THR A CA    1 
ATOM   1397 C  C     . THR A 1 175 ? -20.263 24.532  4.175   1.00 61.49 ? 175  THR A C     1 
ATOM   1398 O  O     . THR A 1 175 ? -19.215 25.158  4.334   1.00 63.25 ? 175  THR A O     1 
ATOM   1399 C  CB    . THR A 1 175 ? -19.991 22.322  3.033   1.00 63.05 ? 175  THR A CB    1 
ATOM   1400 O  OG1   . THR A 1 175 ? -19.741 20.933  3.277   1.00 62.27 ? 175  THR A OG1   1 
ATOM   1401 C  CG2   . THR A 1 175 ? -18.762 22.942  2.383   1.00 63.14 ? 175  THR A CG2   1 
ATOM   1402 N  N     . PHE A 1 176 ? -21.415 25.110  3.851   1.00 57.60 ? 176  PHE A N     1 
ATOM   1403 C  CA    . PHE A 1 176 ? -21.527 26.550  3.681   1.00 55.11 ? 176  PHE A CA    1 
ATOM   1404 C  C     . PHE A 1 176 ? -21.754 27.248  5.021   1.00 55.26 ? 176  PHE A C     1 
ATOM   1405 O  O     . PHE A 1 176 ? -20.838 27.846  5.579   1.00 63.01 ? 176  PHE A O     1 
ATOM   1406 C  CB    . PHE A 1 176 ? -22.652 26.890  2.700   1.00 45.02 ? 176  PHE A CB    1 
ATOM   1407 C  CG    . PHE A 1 176 ? -22.518 28.246  2.078   1.00 48.06 ? 176  PHE A CG    1 
ATOM   1408 C  CD1   . PHE A 1 176 ? -21.364 28.593  1.397   1.00 47.00 ? 176  PHE A CD1   1 
ATOM   1409 C  CD2   . PHE A 1 176 ? -23.543 29.172  2.166   1.00 54.06 ? 176  PHE A CD2   1 
ATOM   1410 C  CE1   . PHE A 1 176 ? -21.230 29.839  0.822   1.00 51.49 ? 176  PHE A CE1   1 
ATOM   1411 C  CE2   . PHE A 1 176 ? -23.417 30.421  1.590   1.00 57.61 ? 176  PHE A CE2   1 
ATOM   1412 C  CZ    . PHE A 1 176 ? -22.257 30.754  0.917   1.00 57.49 ? 176  PHE A CZ    1 
ATOM   1413 N  N     . VAL A 1 177 ? -22.972 27.149  5.544   1.00 47.55 ? 177  VAL A N     1 
ATOM   1414 C  CA    . VAL A 1 177 ? -23.368 27.908  6.729   1.00 40.27 ? 177  VAL A CA    1 
ATOM   1415 C  C     . VAL A 1 177 ? -22.398 27.795  7.912   1.00 37.42 ? 177  VAL A C     1 
ATOM   1416 O  O     . VAL A 1 177 ? -22.041 28.800  8.522   1.00 29.73 ? 177  VAL A O     1 
ATOM   1417 C  CB    . VAL A 1 177 ? -24.790 27.530  7.192   1.00 37.76 ? 177  VAL A CB    1 
ATOM   1418 C  CG1   . VAL A 1 177 ? -25.224 28.421  8.341   1.00 41.33 ? 177  VAL A CG1   1 
ATOM   1419 C  CG2   . VAL A 1 177 ? -25.768 27.642  6.034   1.00 36.30 ? 177  VAL A CG2   1 
ATOM   1420 N  N     . GLY A 1 178 ? -21.969 26.577  8.227   1.00 40.29 ? 178  GLY A N     1 
ATOM   1421 C  CA    . GLY A 1 178 ? -21.131 26.341  9.393   1.00 39.90 ? 178  GLY A CA    1 
ATOM   1422 C  C     . GLY A 1 178 ? -19.806 27.087  9.416   1.00 35.99 ? 178  GLY A C     1 
ATOM   1423 O  O     . GLY A 1 178 ? -19.219 27.377  8.373   1.00 38.63 ? 178  GLY A O     1 
ATOM   1424 N  N     . THR A 1 179 ? -19.338 27.402  10.621  1.00 30.09 ? 179  THR A N     1 
ATOM   1425 C  CA    . THR A 1 179 ? -18.035 28.037  10.809  1.00 30.17 ? 179  THR A CA    1 
ATOM   1426 C  C     . THR A 1 179 ? -17.001 26.973  11.164  1.00 27.72 ? 179  THR A C     1 
ATOM   1427 O  O     . THR A 1 179 ? -17.185 26.232  12.126  1.00 24.67 ? 179  THR A O     1 
ATOM   1428 C  CB    . THR A 1 179 ? -18.079 29.097  11.928  1.00 31.17 ? 179  THR A CB    1 
ATOM   1429 O  OG1   . THR A 1 179 ? -19.064 30.088  11.613  1.00 32.57 ? 179  THR A OG1   1 
ATOM   1430 C  CG2   . THR A 1 179 ? -16.724 29.776  12.085  1.00 26.85 ? 179  THR A CG2   1 
ATOM   1431 N  N     . PRO A 1 180 ? -15.906 26.900  10.389  1.00 28.47 ? 180  PRO A N     1 
ATOM   1432 C  CA    . PRO A 1 180 ? -14.903 25.832  10.500  1.00 23.33 ? 180  PRO A CA    1 
ATOM   1433 C  C     . PRO A 1 180 ? -13.916 26.082  11.636  1.00 20.26 ? 180  PRO A C     1 
ATOM   1434 O  O     . PRO A 1 180 ? -12.727 26.289  11.378  1.00 23.81 ? 180  PRO A O     1 
ATOM   1435 C  CB    . PRO A 1 180 ? -14.156 25.907  9.160   1.00 29.84 ? 180  PRO A CB    1 
ATOM   1436 C  CG    . PRO A 1 180 ? -14.741 27.093  8.413   1.00 30.67 ? 180  PRO A CG    1 
ATOM   1437 C  CD    . PRO A 1 180 ? -15.518 27.903  9.388   1.00 28.58 ? 180  PRO A CD    1 
ATOM   1438 N  N     . TYR A 1 181 ? -14.401 26.044  12.872  1.00 18.60 ? 181  TYR A N     1 
ATOM   1439 C  CA    . TYR A 1 181 ? -13.579 26.380  14.039  1.00 16.83 ? 181  TYR A CA    1 
ATOM   1440 C  C     . TYR A 1 181 ? -12.279 25.584  14.175  1.00 19.44 ? 181  TYR A C     1 
ATOM   1441 O  O     . TYR A 1 181 ? -11.295 26.098  14.706  1.00 18.48 ? 181  TYR A O     1 
ATOM   1442 C  CB    . TYR A 1 181 ? -14.399 26.234  15.323  1.00 18.33 ? 181  TYR A CB    1 
ATOM   1443 C  CG    . TYR A 1 181 ? -15.507 27.251  15.462  1.00 19.87 ? 181  TYR A CG    1 
ATOM   1444 C  CD1   . TYR A 1 181 ? -16.836 26.883  15.315  1.00 23.26 ? 181  TYR A CD1   1 
ATOM   1445 C  CD2   . TYR A 1 181 ? -15.222 28.581  15.732  1.00 18.56 ? 181  TYR A CD2   1 
ATOM   1446 C  CE1   . TYR A 1 181 ? -17.851 27.814  15.441  1.00 25.01 ? 181  TYR A CE1   1 
ATOM   1447 C  CE2   . TYR A 1 181 ? -16.228 29.517  15.861  1.00 21.65 ? 181  TYR A CE2   1 
ATOM   1448 C  CZ    . TYR A 1 181 ? -17.540 29.130  15.710  1.00 22.63 ? 181  TYR A CZ    1 
ATOM   1449 O  OH    . TYR A 1 181 ? -18.554 30.056  15.838  1.00 28.32 ? 181  TYR A OH    1 
ATOM   1450 N  N     . TYR A 1 182 ? -12.272 24.334  13.719  1.00 18.17 ? 182  TYR A N     1 
ATOM   1451 C  CA    . TYR A 1 182 ? -11.143 23.441  13.991  1.00 20.36 ? 182  TYR A CA    1 
ATOM   1452 C  C     . TYR A 1 182 ? -10.167 23.256  12.830  1.00 22.04 ? 182  TYR A C     1 
ATOM   1453 O  O     . TYR A 1 182 ? -9.262  22.423  12.909  1.00 22.43 ? 182  TYR A O     1 
ATOM   1454 C  CB    . TYR A 1 182 ? -11.652 22.065  14.409  1.00 18.69 ? 182  TYR A CB    1 
ATOM   1455 C  CG    . TYR A 1 182 ? -12.278 21.994  15.785  1.00 19.03 ? 182  TYR A CG    1 
ATOM   1456 C  CD1   . TYR A 1 182 ? -12.633 23.144  16.478  1.00 18.18 ? 182  TYR A CD1   1 
ATOM   1457 C  CD2   . TYR A 1 182 ? -12.542 20.767  16.375  1.00 16.52 ? 182  TYR A CD2   1 
ATOM   1458 C  CE1   . TYR A 1 182 ? -13.218 23.066  17.733  1.00 16.75 ? 182  TYR A CE1   1 
ATOM   1459 C  CE2   . TYR A 1 182 ? -13.127 20.682  17.615  1.00 18.56 ? 182  TYR A CE2   1 
ATOM   1460 C  CZ    . TYR A 1 182 ? -13.462 21.831  18.291  1.00 16.81 ? 182  TYR A CZ    1 
ATOM   1461 O  OH    . TYR A 1 182 ? -14.041 21.732  19.533  1.00 17.82 ? 182  TYR A OH    1 
ATOM   1462 N  N     A MET A 1 183 ? -10.345 24.019  11.759  0.50 22.24 ? 183  MET A N     1 
ATOM   1463 N  N     B MET A 1 183 ? -10.351 24.028  11.763  0.50 22.23 ? 183  MET A N     1 
ATOM   1464 C  CA    A MET A 1 183 ? -9.511  23.838  10.577  0.50 24.38 ? 183  MET A CA    1 
ATOM   1465 C  CA    B MET A 1 183 ? -9.514  23.901  10.574  0.50 24.88 ? 183  MET A CA    1 
ATOM   1466 C  C     A MET A 1 183 ? -8.104  24.396  10.763  0.50 21.65 ? 183  MET A C     1 
ATOM   1467 C  C     B MET A 1 183 ? -8.093  24.377  10.850  0.50 22.03 ? 183  MET A C     1 
ATOM   1468 O  O     A MET A 1 183 ? -7.925  25.550  11.153  0.50 21.69 ? 183  MET A O     1 
ATOM   1469 O  O     B MET A 1 183 ? -7.889  25.458  11.400  0.50 18.54 ? 183  MET A O     1 
ATOM   1470 C  CB    A MET A 1 183 ? -10.170 24.439  9.337   0.50 27.17 ? 183  MET A CB    1 
ATOM   1471 C  CB    B MET A 1 183 ? -10.118 24.681  9.400   0.50 29.55 ? 183  MET A CB    1 
ATOM   1472 C  CG    A MET A 1 183 ? -9.234  24.530  8.151   0.50 30.57 ? 183  MET A CG    1 
ATOM   1473 C  CG    B MET A 1 183 ? -9.983  26.193  9.515   0.50 30.82 ? 183  MET A CG    1 
ATOM   1474 S  SD    A MET A 1 183 ? -10.075 24.279  6.581   0.50 33.33 ? 183  MET A SD    1 
ATOM   1475 S  SD    B MET A 1 183 ? -10.711 27.092  8.130   0.50 53.87 ? 183  MET A SD    1 
ATOM   1476 C  CE    A MET A 1 183 ? -10.238 22.496  6.578   0.50 43.54 ? 183  MET A CE    1 
ATOM   1477 C  CE    B MET A 1 183 ? -10.046 26.178  6.741   0.50 29.61 ? 183  MET A CE    1 
ATOM   1478 N  N     . SER A 1 184 ? -7.113  23.558  10.477  1.00 21.16 ? 184  SER A N     1 
ATOM   1479 C  CA    . SER A 1 184 ? -5.710  23.906  10.680  1.00 22.68 ? 184  SER A CA    1 
ATOM   1480 C  C     . SER A 1 184 ? -5.240  24.960  9.682   1.00 20.80 ? 184  SER A C     1 
ATOM   1481 O  O     . SER A 1 184 ? -5.846  25.133  8.624   1.00 21.70 ? 184  SER A O     1 
ATOM   1482 C  CB    . SER A 1 184 ? -4.838  22.656  10.563  1.00 24.83 ? 184  SER A CB    1 
ATOM   1483 O  OG    . SER A 1 184 ? -4.954  22.081  9.272   1.00 23.31 ? 184  SER A OG    1 
ATOM   1484 N  N     . PRO A 1 185 ? -4.149  25.669  10.013  1.00 22.58 ? 185  PRO A N     1 
ATOM   1485 C  CA    . PRO A 1 185 ? -3.634  26.700  9.106   1.00 21.62 ? 185  PRO A CA    1 
ATOM   1486 C  C     . PRO A 1 185 ? -3.281  26.142  7.730   1.00 22.88 ? 185  PRO A C     1 
ATOM   1487 O  O     . PRO A 1 185 ? -3.550  26.787  6.720   1.00 27.39 ? 185  PRO A O     1 
ATOM   1488 C  CB    . PRO A 1 185 ? -2.360  27.187  9.808   1.00 26.95 ? 185  PRO A CB    1 
ATOM   1489 C  CG    . PRO A 1 185 ? -2.546  26.841  11.235  1.00 23.85 ? 185  PRO A CG    1 
ATOM   1490 C  CD    . PRO A 1 185 ? -3.370  25.587  11.263  1.00 22.52 ? 185  PRO A CD    1 
ATOM   1491 N  N     . GLU A 1 186 ? -2.679  24.958  7.687   1.00 25.03 ? 186  GLU A N     1 
ATOM   1492 C  CA    . GLU A 1 186 ? -2.245  24.393  6.413   1.00 28.97 ? 186  GLU A CA    1 
ATOM   1493 C  C     . GLU A 1 186 ? -3.418  23.899  5.566   1.00 30.61 ? 186  GLU A C     1 
ATOM   1494 O  O     . GLU A 1 186 ? -3.391  24.000  4.339   1.00 32.08 ? 186  GLU A O     1 
ATOM   1495 C  CB    . GLU A 1 186 ? -1.195  23.290  6.611   1.00 29.21 ? 186  GLU A CB    1 
ATOM   1496 C  CG    . GLU A 1 186 ? -1.673  22.061  7.353   1.00 24.61 ? 186  GLU A CG    1 
ATOM   1497 C  CD    . GLU A 1 186 ? -1.537  22.185  8.862   1.00 23.38 ? 186  GLU A CD    1 
ATOM   1498 O  OE1   . GLU A 1 186 ? -1.165  23.272  9.357   1.00 25.96 ? 186  GLU A OE1   1 
ATOM   1499 O  OE2   . GLU A 1 186 ? -1.810  21.187  9.551   1.00 19.76 ? 186  GLU A OE2   1 
ATOM   1500 N  N     . GLN A 1 187 ? -4.452  23.378  6.215   1.00 27.23 ? 187  GLN A N     1 
ATOM   1501 C  CA    . GLN A 1 187 ? -5.641  22.946  5.484   1.00 32.47 ? 187  GLN A CA    1 
ATOM   1502 C  C     . GLN A 1 187 ? -6.400  24.158  4.948   1.00 32.88 ? 187  GLN A C     1 
ATOM   1503 O  O     . GLN A 1 187 ? -7.087  24.072  3.926   1.00 33.02 ? 187  GLN A O     1 
ATOM   1504 C  CB    . GLN A 1 187 ? -6.540  22.063  6.351   1.00 30.69 ? 187  GLN A CB    1 
ATOM   1505 C  CG    . GLN A 1 187 ? -5.894  20.747  6.771   1.00 36.67 ? 187  GLN A CG    1 
ATOM   1506 C  CD    . GLN A 1 187 ? -5.501  19.866  5.591   1.00 44.74 ? 187  GLN A CD    1 
ATOM   1507 O  OE1   . GLN A 1 187 ? -6.206  19.804  4.582   1.00 48.50 ? 187  GLN A OE1   1 
ATOM   1508 N  NE2   . GLN A 1 187 ? -4.374  19.170  5.721   1.00 40.58 ? 187  GLN A NE2   1 
ATOM   1509 N  N     A MET A 1 188 ? -6.257  25.300  5.613   0.50 33.77 ? 188  MET A N     1 
ATOM   1510 N  N     B MET A 1 188 ? -6.283  25.272  5.667   0.50 33.40 ? 188  MET A N     1 
ATOM   1511 C  CA    A MET A 1 188 ? -6.887  26.526  5.127   0.50 37.55 ? 188  MET A CA    1 
ATOM   1512 C  CA    B MET A 1 188 ? -6.778  26.560  5.202   0.50 38.10 ? 188  MET A CA    1 
ATOM   1513 C  C     A MET A 1 188 ? -6.227  27.071  3.857   0.50 43.28 ? 188  MET A C     1 
ATOM   1514 C  C     B MET A 1 188 ? -6.253  26.816  3.804   0.50 43.54 ? 188  MET A C     1 
ATOM   1515 O  O     A MET A 1 188 ? -6.888  27.701  3.032   0.50 44.62 ? 188  MET A O     1 
ATOM   1516 O  O     B MET A 1 188 ? -7.013  26.999  2.853   0.50 44.96 ? 188  MET A O     1 
ATOM   1517 C  CB    A MET A 1 188 ? -6.942  27.600  6.217   0.50 38.88 ? 188  MET A CB    1 
ATOM   1518 C  CB    B MET A 1 188 ? -6.255  27.684  6.098   0.50 40.10 ? 188  MET A CB    1 
ATOM   1519 C  CG    A MET A 1 188 ? -8.177  27.506  7.098   0.50 40.72 ? 188  MET A CG    1 
ATOM   1520 C  CG    B MET A 1 188 ? -7.094  28.024  7.311   0.50 40.54 ? 188  MET A CG    1 
ATOM   1521 S  SD    A MET A 1 188 ? -8.634  29.067  7.873   0.50 41.09 ? 188  MET A SD    1 
ATOM   1522 S  SD    B MET A 1 188 ? -6.452  29.523  8.089   0.50 52.23 ? 188  MET A SD    1 
ATOM   1523 C  CE    A MET A 1 188 ? -10.303 28.693  8.409   0.50 26.15 ? 188  MET A CE    1 
ATOM   1524 C  CE    B MET A 1 188 ? -6.093  30.514  6.641   0.50 47.79 ? 188  MET A CE    1 
ATOM   1525 N  N     . ASN A 1 189 ? -4.929  26.828  3.702   1.00 46.64 ? 189  ASN A N     1 
ATOM   1526 C  CA    . ASN A 1 189 ? -4.234  27.197  2.474   1.00 49.66 ? 189  ASN A CA    1 
ATOM   1527 C  C     . ASN A 1 189 ? -4.507  26.225  1.333   1.00 53.58 ? 189  ASN A C     1 
ATOM   1528 O  O     . ASN A 1 189 ? -4.679  26.638  0.185   1.00 60.04 ? 189  ASN A O     1 
ATOM   1529 C  CB    . ASN A 1 189 ? -2.729  27.306  2.726   1.00 53.64 ? 189  ASN A CB    1 
ATOM   1530 C  CG    . ASN A 1 189 ? -2.391  28.323  3.799   1.00 57.39 ? 189  ASN A CG    1 
ATOM   1531 O  OD1   . ASN A 1 189 ? -3.103  29.312  3.980   1.00 59.83 ? 189  ASN A OD1   1 
ATOM   1532 N  ND2   . ASN A 1 189 ? -1.299  28.087  4.516   1.00 59.49 ? 189  ASN A ND2   1 
ATOM   1533 N  N     . ARG A 1 190 ? -4.545  24.935  1.652   1.00 53.62 ? 190  ARG A N     1 
ATOM   1534 C  CA    . ARG A 1 190 ? -4.815  23.910  0.649   1.00 55.99 ? 190  ARG A CA    1 
ATOM   1535 C  C     . ARG A 1 190 ? -5.004  22.532  1.277   1.00 56.62 ? 190  ARG A C     1 
ATOM   1536 O  O     . ARG A 1 190 ? -4.138  22.045  2.009   1.00 54.09 ? 190  ARG A O     1 
ATOM   1537 C  CB    . ARG A 1 190 ? -3.688  23.863  -0.387  1.00 58.19 ? 190  ARG A CB    1 
ATOM   1538 N  N     . MET A 1 191 ? -6.141  21.907  0.986   1.00 56.19 ? 191  MET A N     1 
ATOM   1539 C  CA    . MET A 1 191 ? -6.418  20.561  1.473   1.00 56.09 ? 191  MET A CA    1 
ATOM   1540 C  C     . MET A 1 191 ? -5.544  19.537  0.758   1.00 57.57 ? 191  MET A C     1 
ATOM   1541 O  O     . MET A 1 191 ? -5.986  18.880  -0.185  1.00 62.67 ? 191  MET A O     1 
ATOM   1542 C  CB    . MET A 1 191 ? -7.896  20.212  1.288   1.00 52.20 ? 191  MET A CB    1 
ATOM   1543 N  N     . TYR A 1 193 ? -3.573  15.421  2.425   1.00 52.40 ? 193  TYR A N     1 
ATOM   1544 C  CA    . TYR A 1 193 ? -3.441  14.563  3.598   1.00 50.55 ? 193  TYR A CA    1 
ATOM   1545 C  C     . TYR A 1 193 ? -2.264  14.998  4.469   1.00 43.38 ? 193  TYR A C     1 
ATOM   1546 O  O     . TYR A 1 193 ? -1.140  15.157  3.985   1.00 39.88 ? 193  TYR A O     1 
ATOM   1547 C  CB    . TYR A 1 193 ? -3.282  13.099  3.173   1.00 54.31 ? 193  TYR A CB    1 
ATOM   1548 C  CG    . TYR A 1 193 ? -3.324  12.111  4.320   1.00 56.92 ? 193  TYR A CG    1 
ATOM   1549 C  CD1   . TYR A 1 193 ? -2.165  11.492  4.772   1.00 58.23 ? 193  TYR A CD1   1 
ATOM   1550 C  CD2   . TYR A 1 193 ? -4.523  11.796  4.948   1.00 58.42 ? 193  TYR A CD2   1 
ATOM   1551 C  CE1   . TYR A 1 193 ? -2.198  10.588  5.819   1.00 58.35 ? 193  TYR A CE1   1 
ATOM   1552 C  CE2   . TYR A 1 193 ? -4.567  10.893  5.995   1.00 59.59 ? 193  TYR A CE2   1 
ATOM   1553 C  CZ    . TYR A 1 193 ? -3.402  10.293  6.426   1.00 62.09 ? 193  TYR A CZ    1 
ATOM   1554 O  OH    . TYR A 1 193 ? -3.440  9.394   7.467   1.00 64.24 ? 193  TYR A OH    1 
ATOM   1555 N  N     . ASN A 1 194 ? -2.536  15.194  5.755   1.00 39.34 ? 194  ASN A N     1 
ATOM   1556 C  CA    . ASN A 1 194 ? -1.513  15.582  6.718   1.00 28.82 ? 194  ASN A CA    1 
ATOM   1557 C  C     . ASN A 1 194 ? -1.960  15.211  8.127   1.00 26.12 ? 194  ASN A C     1 
ATOM   1558 O  O     . ASN A 1 194 ? -2.839  15.853  8.696   1.00 26.14 ? 194  ASN A O     1 
ATOM   1559 C  CB    . ASN A 1 194 ? -1.230  17.083  6.619   1.00 36.06 ? 194  ASN A CB    1 
ATOM   1560 C  CG    . ASN A 1 194 ? -0.088  17.527  7.521   1.00 35.03 ? 194  ASN A CG    1 
ATOM   1561 O  OD1   . ASN A 1 194 ? 0.305   16.816  8.447   1.00 32.10 ? 194  ASN A OD1   1 
ATOM   1562 N  ND2   . ASN A 1 194 ? 0.449   18.714  7.253   1.00 35.97 ? 194  ASN A ND2   1 
ATOM   1563 N  N     . GLU A 1 195 ? -1.357  14.164  8.683   1.00 23.86 ? 195  GLU A N     1 
ATOM   1564 C  CA    . GLU A 1 195 ? -1.766  13.644  9.987   1.00 20.10 ? 195  GLU A CA    1 
ATOM   1565 C  C     . GLU A 1 195 ? -1.585  14.673  11.120  1.00 20.44 ? 195  GLU A C     1 
ATOM   1566 O  O     . GLU A 1 195 ? -2.279  14.626  12.139  1.00 15.83 ? 195  GLU A O     1 
ATOM   1567 C  CB    . GLU A 1 195 ? -1.030  12.335  10.287  1.00 23.54 ? 195  GLU A CB    1 
ATOM   1568 C  CG    . GLU A 1 195 ? -1.297  11.256  9.237   1.00 27.62 ? 195  GLU A CG    1 
ATOM   1569 C  CD    . GLU A 1 195 ? -0.426  10.020  9.395   1.00 33.57 ? 195  GLU A CD    1 
ATOM   1570 O  OE1   . GLU A 1 195 ? 0.454   9.999   10.279  1.00 32.10 ? 195  GLU A OE1   1 
ATOM   1571 O  OE2   . GLU A 1 195 ? -0.623  9.061   8.623   1.00 34.11 ? 195  GLU A OE2   1 
ATOM   1572 N  N     . LYS A 1 196 ? -0.669  15.617  10.938  1.00 17.03 ? 196  LYS A N     1 
ATOM   1573 C  CA    . LYS A 1 196 ? -0.499  16.667  11.939  1.00 15.13 ? 196  LYS A CA    1 
ATOM   1574 C  C     . LYS A 1 196 ? -1.687  17.631  11.972  1.00 13.04 ? 196  LYS A C     1 
ATOM   1575 O  O     . LYS A 1 196 ? -1.910  18.317  12.967  1.00 13.89 ? 196  LYS A O     1 
ATOM   1576 C  CB    . LYS A 1 196 ? 0.816   17.431  11.741  1.00 14.28 ? 196  LYS A CB    1 
ATOM   1577 C  CG    . LYS A 1 196 ? 2.063   16.639  12.135  1.00 19.21 ? 196  LYS A CG    1 
ATOM   1578 C  CD    . LYS A 1 196 ? 2.045   16.239  13.604  1.00 18.21 ? 196  LYS A CD    1 
ATOM   1579 C  CE    . LYS A 1 196 ? 3.345   15.553  14.023  1.00 16.83 ? 196  LYS A CE    1 
ATOM   1580 N  NZ    . LYS A 1 196 ? 4.515   16.471  13.986  1.00 18.02 ? 196  LYS A NZ    1 
ATOM   1581 N  N     . SER A 1 197 ? -2.453  17.683  10.886  1.00 18.60 ? 197  SER A N     1 
ATOM   1582 C  CA    . SER A 1 197 ? -3.665  18.501  10.869  1.00 16.65 ? 197  SER A CA    1 
ATOM   1583 C  C     . SER A 1 197 ? -4.711  17.946  11.836  1.00 15.04 ? 197  SER A C     1 
ATOM   1584 O  O     . SER A 1 197 ? -5.447  18.710  12.465  1.00 15.72 ? 197  SER A O     1 
ATOM   1585 C  CB    . SER A 1 197 ? -4.243  18.601  9.451   1.00 15.86 ? 197  SER A CB    1 
ATOM   1586 O  OG    . SER A 1 197 ? -3.297  19.172  8.563   1.00 21.88 ? 197  SER A OG    1 
ATOM   1587 N  N     . ASP A 1 198 ? -4.771  16.620  11.954  1.00 13.93 ? 198  ASP A N     1 
ATOM   1588 C  CA    . ASP A 1 198 ? -5.651  15.978  12.926  1.00 12.12 ? 198  ASP A CA    1 
ATOM   1589 C  C     . ASP A 1 198 ? -5.250  16.363  14.347  1.00 11.84 ? 198  ASP A C     1 
ATOM   1590 O  O     . ASP A 1 198 ? -6.100  16.507  15.218  1.00 13.36 ? 198  ASP A O     1 
ATOM   1591 C  CB    . ASP A 1 198 ? -5.622  14.456  12.780  1.00 13.62 ? 198  ASP A CB    1 
ATOM   1592 C  CG    . ASP A 1 198 ? -6.366  13.970  11.552  1.00 20.51 ? 198  ASP A CG    1 
ATOM   1593 O  OD1   . ASP A 1 198 ? -7.227  14.704  11.035  1.00 24.26 ? 198  ASP A OD1   1 
ATOM   1594 O  OD2   . ASP A 1 198 ? -6.085  12.844  11.104  1.00 25.50 ? 198  ASP A OD2   1 
ATOM   1595 N  N     . ILE A 1 199 ? -3.948  16.512  14.584  1.00 11.37 ? 199  ILE A N     1 
ATOM   1596 C  CA    . ILE A 1 199 ? -3.469  16.891  15.916  1.00 11.35 ? 199  ILE A CA    1 
ATOM   1597 C  C     . ILE A 1 199 ? -3.919  18.320  16.271  1.00 10.90 ? 199  ILE A C     1 
ATOM   1598 O  O     . ILE A 1 199 ? -4.297  18.600  17.413  1.00 10.17 ? 199  ILE A O     1 
ATOM   1599 C  CB    . ILE A 1 199 ? -1.940  16.752  16.039  1.00 11.67 ? 199  ILE A CB    1 
ATOM   1600 C  CG1   . ILE A 1 199 ? -1.506  15.312  15.729  1.00 13.22 ? 199  ILE A CG1   1 
ATOM   1601 C  CG2   . ILE A 1 199 ? -1.478  17.150  17.435  1.00 12.69 ? 199  ILE A CG2   1 
ATOM   1602 C  CD1   . ILE A 1 199 ? -2.183  14.273  16.597  1.00 15.43 ? 199  ILE A CD1   1 
ATOM   1603 N  N     . TRP A 1 200 ? -3.890  19.219  15.291  1.00 10.08 ? 200  TRP A N     1 
ATOM   1604 C  CA    . TRP A 1 200 ? -4.403  20.576  15.494  1.00 9.27  ? 200  TRP A CA    1 
ATOM   1605 C  C     . TRP A 1 200 ? -5.882  20.519  15.879  1.00 10.98 ? 200  TRP A C     1 
ATOM   1606 O  O     . TRP A 1 200 ? -6.310  21.166  16.837  1.00 10.36 ? 200  TRP A O     1 
ATOM   1607 C  CB    . TRP A 1 200 ? -4.208  21.416  14.227  1.00 11.72 ? 200  TRP A CB    1 
ATOM   1608 C  CG    . TRP A 1 200 ? -4.917  22.750  14.238  1.00 12.63 ? 200  TRP A CG    1 
ATOM   1609 C  CD1   . TRP A 1 200 ? -6.249  22.968  14.006  1.00 13.22 ? 200  TRP A CD1   1 
ATOM   1610 C  CD2   . TRP A 1 200 ? -4.334  24.044  14.467  1.00 13.98 ? 200  TRP A CD2   1 
ATOM   1611 N  NE1   . TRP A 1 200 ? -6.527  24.313  14.091  1.00 14.96 ? 200  TRP A NE1   1 
ATOM   1612 C  CE2   . TRP A 1 200 ? -5.373  24.995  14.371  1.00 13.81 ? 200  TRP A CE2   1 
ATOM   1613 C  CE3   . TRP A 1 200 ? -3.038  24.491  14.753  1.00 12.58 ? 200  TRP A CE3   1 
ATOM   1614 C  CZ2   . TRP A 1 200 ? -5.154  26.367  14.543  1.00 14.75 ? 200  TRP A CZ2   1 
ATOM   1615 C  CZ3   . TRP A 1 200 ? -2.824  25.855  14.927  1.00 11.46 ? 200  TRP A CZ3   1 
ATOM   1616 C  CH2   . TRP A 1 200 ? -3.878  26.774  14.820  1.00 13.16 ? 200  TRP A CH2   1 
ATOM   1617 N  N     . SER A 1 201 ? -6.658  19.743  15.131  1.00 12.81 ? 201  SER A N     1 
ATOM   1618 C  CA    . SER A 1 201 ? -8.092  19.621  15.405  1.00 12.25 ? 201  SER A CA    1 
ATOM   1619 C  C     . SER A 1 201 ? -8.352  19.033  16.787  1.00 11.83 ? 201  SER A C     1 
ATOM   1620 O  O     . SER A 1 201 ? -9.237  19.497  17.518  1.00 11.53 ? 201  SER A O     1 
ATOM   1621 C  CB    . SER A 1 201 ? -8.784  18.804  14.312  1.00 13.60 ? 201  SER A CB    1 
ATOM   1622 O  OG    . SER A 1 201 ? -8.623  19.449  13.057  1.00 18.75 ? 201  SER A OG    1 
ATOM   1623 N  N     . LEU A 1 202 ? -7.571  18.022  17.157  1.00 10.88 ? 202  LEU A N     1 
ATOM   1624 C  CA    . LEU A 1 202 ? -7.631  17.493  18.521  1.00 11.40 ? 202  LEU A CA    1 
ATOM   1625 C  C     . LEU A 1 202 ? -7.333  18.576  19.551  1.00 10.07 ? 202  LEU A C     1 
ATOM   1626 O  O     . LEU A 1 202 ? -7.995  18.647  20.582  1.00 10.73 ? 202  LEU A O     1 
ATOM   1627 C  CB    . LEU A 1 202 ? -6.668  16.309  18.702  1.00 11.17 ? 202  LEU A CB    1 
ATOM   1628 C  CG    . LEU A 1 202 ? -6.593  15.699  20.108  1.00 11.71 ? 202  LEU A CG    1 
ATOM   1629 C  CD1   . LEU A 1 202 ? -7.928  15.081  20.506  1.00 14.16 ? 202  LEU A CD1   1 
ATOM   1630 C  CD2   . LEU A 1 202 ? -5.474  14.646  20.189  1.00 14.12 ? 202  LEU A CD2   1 
ATOM   1631 N  N     . GLY A 1 203 ? -6.321  19.402  19.284  1.00 8.94  ? 203  GLY A N     1 
ATOM   1632 C  CA    . GLY A 1 203 ? -6.001  20.506  20.175  1.00 9.05  ? 203  GLY A CA    1 
ATOM   1633 C  C     . GLY A 1 203 ? -7.176  21.452  20.357  1.00 9.23  ? 203  GLY A C     1 
ATOM   1634 O  O     . GLY A 1 203 ? -7.460  21.909  21.470  1.00 8.81  ? 203  GLY A O     1 
ATOM   1635 N  N     . CYS A 1 204 ? -7.854  21.766  19.259  1.00 8.09  ? 204  CYS A N     1 
ATOM   1636 C  CA    . CYS A 1 204 ? -9.024  22.627  19.337  1.00 9.89  ? 204  CYS A CA    1 
ATOM   1637 C  C     . CYS A 1 204 ? -10.115 22.024  20.213  1.00 10.89 ? 204  CYS A C     1 
ATOM   1638 O  O     . CYS A 1 204 ? -10.740 22.736  21.016  1.00 9.92  ? 204  CYS A O     1 
ATOM   1639 C  CB    . CYS A 1 204 ? -9.582  22.905  17.940  1.00 10.99 ? 204  CYS A CB    1 
ATOM   1640 S  SG    . CYS A 1 204 ? -8.545  23.956  16.911  1.00 12.20 ? 204  CYS A SG    1 
ATOM   1641 N  N     . LEU A 1 205 ? -10.347 20.721  20.050  1.00 9.29  ? 205  LEU A N     1 
ATOM   1642 C  CA    . LEU A 1 205 ? -11.382 20.037  20.815  1.00 10.71 ? 205  LEU A CA    1 
ATOM   1643 C  C     . LEU A 1 205 ? -11.046 20.050  22.297  1.00 10.21 ? 205  LEU A C     1 
ATOM   1644 O  O     . LEU A 1 205 ? -11.886 20.387  23.134  1.00 10.69 ? 205  LEU A O     1 
ATOM   1645 C  CB    . LEU A 1 205 ? -11.547 18.584  20.349  1.00 11.45 ? 205  LEU A CB    1 
ATOM   1646 C  CG    . LEU A 1 205 ? -12.466 17.740  21.238  1.00 15.32 ? 205  LEU A CG    1 
ATOM   1647 C  CD1   . LEU A 1 205 ? -13.885 18.260  21.220  1.00 21.21 ? 205  LEU A CD1   1 
ATOM   1648 C  CD2   . LEU A 1 205 ? -12.418 16.288  20.806  1.00 21.16 ? 205  LEU A CD2   1 
ATOM   1649 N  N     . LEU A 1 206 ? -9.816  19.662  22.624  1.00 8.00  ? 206  LEU A N     1 
ATOM   1650 C  CA    . LEU A 1 206 ? -9.407  19.623  24.023  1.00 8.23  ? 206  LEU A CA    1 
ATOM   1651 C  C     . LEU A 1 206 ? -9.456  21.022  24.631  1.00 9.80  ? 206  LEU A C     1 
ATOM   1652 O  O     . LEU A 1 206 ? -9.858  21.202  25.781  1.00 9.85  ? 206  LEU A O     1 
ATOM   1653 C  CB    . LEU A 1 206 ? -8.010  19.024  24.162  1.00 8.11  ? 206  LEU A CB    1 
ATOM   1654 C  CG    . LEU A 1 206 ? -7.915  17.565  23.707  1.00 8.25  ? 206  LEU A CG    1 
ATOM   1655 C  CD1   . LEU A 1 206 ? -6.456  17.110  23.705  1.00 9.88  ? 206  LEU A CD1   1 
ATOM   1656 C  CD2   . LEU A 1 206 ? -8.759  16.654  24.601  1.00 10.19 ? 206  LEU A CD2   1 
ATOM   1657 N  N     . TYR A 1 207 ? -9.040  22.014  23.855  1.00 9.34  ? 207  TYR A N     1 
ATOM   1658 C  CA    . TYR A 1 207 ? -9.100  23.395  24.315  1.00 8.48  ? 207  TYR A CA    1 
ATOM   1659 C  C     . TYR A 1 207 ? -10.549 23.761  24.659  1.00 8.48  ? 207  TYR A C     1 
ATOM   1660 O  O     . TYR A 1 207 ? -10.829 24.330  25.719  1.00 9.20  ? 207  TYR A O     1 
ATOM   1661 C  CB    . TYR A 1 207 ? -8.537  24.337  23.245  1.00 7.51  ? 207  TYR A CB    1 
ATOM   1662 C  CG    . TYR A 1 207 ? -8.485  25.779  23.689  1.00 8.83  ? 207  TYR A CG    1 
ATOM   1663 C  CD1   . TYR A 1 207 ? -9.637  26.553  23.723  1.00 8.11  ? 207  TYR A CD1   1 
ATOM   1664 C  CD2   . TYR A 1 207 ? -7.289  26.360  24.095  1.00 9.67  ? 207  TYR A CD2   1 
ATOM   1665 C  CE1   . TYR A 1 207 ? -9.603  27.871  24.142  1.00 10.40 ? 207  TYR A CE1   1 
ATOM   1666 C  CE2   . TYR A 1 207 ? -7.244  27.687  24.518  1.00 8.51  ? 207  TYR A CE2   1 
ATOM   1667 C  CZ    . TYR A 1 207 ? -8.405  28.429  24.537  1.00 9.91  ? 207  TYR A CZ    1 
ATOM   1668 O  OH    . TYR A 1 207 ? -8.382  29.743  24.946  1.00 12.14 ? 207  TYR A OH    1 
ATOM   1669 N  N     . GLU A 1 208 ? -11.470 23.430  23.762  1.00 8.87  ? 208  GLU A N     1 
ATOM   1670 C  CA    . GLU A 1 208 ? -12.875 23.761  23.981  1.00 9.61  ? 208  GLU A CA    1 
ATOM   1671 C  C     . GLU A 1 208 ? -13.468 23.026  25.187  1.00 10.02 ? 208  GLU A C     1 
ATOM   1672 O  O     . GLU A 1 208 ? -14.289 23.584  25.914  1.00 12.46 ? 208  GLU A O     1 
ATOM   1673 C  CB    . GLU A 1 208 ? -13.709 23.543  22.713  1.00 9.64  ? 208  GLU A CB    1 
ATOM   1674 C  CG    . GLU A 1 208 ? -15.140 24.059  22.860  1.00 12.95 ? 208  GLU A CG    1 
ATOM   1675 C  CD    . GLU A 1 208 ? -15.931 24.048  21.568  1.00 15.94 ? 208  GLU A CD    1 
ATOM   1676 O  OE1   . GLU A 1 208 ? -15.382 23.667  20.518  1.00 16.23 ? 208  GLU A OE1   1 
ATOM   1677 O  OE2   . GLU A 1 208 ? -17.126 24.420  21.605  1.00 19.99 ? 208  GLU A OE2   1 
ATOM   1678 N  N     . LEU A 1 209 ? -13.043 21.782  25.412  1.00 9.07  ? 209  LEU A N     1 
ATOM   1679 C  CA    . LEU A 1 209 ? -13.474 21.055  26.606  1.00 8.76  ? 209  LEU A CA    1 
ATOM   1680 C  C     . LEU A 1 209 ? -13.056 21.776  27.887  1.00 11.41 ? 209  LEU A C     1 
ATOM   1681 O  O     . LEU A 1 209 ? -13.772 21.745  28.882  1.00 14.51 ? 209  LEU A O     1 
ATOM   1682 C  CB    . LEU A 1 209 ? -12.908 19.630  26.626  1.00 10.90 ? 209  LEU A CB    1 
ATOM   1683 C  CG    . LEU A 1 209 ? -13.530 18.628  25.659  1.00 14.25 ? 209  LEU A CG    1 
ATOM   1684 C  CD1   . LEU A 1 209 ? -12.800 17.294  25.754  1.00 14.78 ? 209  LEU A CD1   1 
ATOM   1685 C  CD2   . LEU A 1 209 ? -15.007 18.439  25.954  1.00 15.25 ? 209  LEU A CD2   1 
ATOM   1686 N  N     . CYS A 1 210 ? -11.890 22.418  27.858  1.00 10.49 ? 210  CYS A N     1 
ATOM   1687 C  CA    . CYS A 1 210 ? -11.378 23.141  29.022  1.00 9.59  ? 210  CYS A CA    1 
ATOM   1688 C  C     . CYS A 1 210 ? -11.991 24.530  29.184  1.00 10.07 ? 210  CYS A C     1 
ATOM   1689 O  O     . CYS A 1 210 ? -12.392 24.918  30.281  1.00 11.20 ? 210  CYS A O     1 
ATOM   1690 C  CB    . CYS A 1 210 ? -9.860  23.297  28.917  1.00 9.26  ? 210  CYS A CB    1 
ATOM   1691 S  SG    . CYS A 1 210 ? -8.938  21.743  29.047  1.00 10.54 ? 210  CYS A SG    1 
ATOM   1692 N  N     . ALA A 1 211 ? -12.037 25.274  28.083  1.00 10.75 ? 211  ALA A N     1 
ATOM   1693 C  CA    . ALA A 1 211 ? -12.445 26.676  28.103  1.00 9.42  ? 211  ALA A CA    1 
ATOM   1694 C  C     . ALA A 1 211 ? -13.951 26.864  27.890  1.00 10.23 ? 211  ALA A C     1 
ATOM   1695 O  O     . ALA A 1 211 ? -14.490 27.939  28.185  1.00 12.24 ? 211  ALA A O     1 
ATOM   1696 C  CB    . ALA A 1 211 ? -11.654 27.465  27.052  1.00 10.99 ? 211  ALA A CB    1 
ATOM   1697 N  N     . LEU A 1 212 ? -14.610 25.814  27.400  1.00 10.87 ? 212  LEU A N     1 
ATOM   1698 C  CA    . LEU A 1 212 ? -16.015 25.844  26.996  1.00 11.99 ? 212  LEU A CA    1 
ATOM   1699 C  C     . LEU A 1 212 ? -16.246 26.789  25.812  1.00 14.79 ? 212  LEU A C     1 
ATOM   1700 O  O     . LEU A 1 212 ? -17.376 27.196  25.532  1.00 19.12 ? 212  LEU A O     1 
ATOM   1701 C  CB    . LEU A 1 212 ? -16.931 26.166  28.186  1.00 13.09 ? 212  LEU A CB    1 
ATOM   1702 C  CG    . LEU A 1 212 ? -16.836 25.153  29.334  1.00 15.05 ? 212  LEU A CG    1 
ATOM   1703 C  CD1   . LEU A 1 212 ? -17.798 25.514  30.463  1.00 19.11 ? 212  LEU A CD1   1 
ATOM   1704 C  CD2   . LEU A 1 212 ? -17.091 23.734  28.844  1.00 13.74 ? 212  LEU A CD2   1 
ATOM   1705 N  N     . MET A 1 213 ? -15.155 27.124  25.129  1.00 14.63 ? 213  MET A N     1 
ATOM   1706 C  CA    . MET A 1 213 ? -15.191 27.877  23.878  1.00 14.81 ? 213  MET A CA    1 
ATOM   1707 C  C     . MET A 1 213 ? -13.970 27.467  23.053  1.00 14.09 ? 213  MET A C     1 
ATOM   1708 O  O     . MET A 1 213 ? -12.944 27.081  23.611  1.00 12.63 ? 213  MET A O     1 
ATOM   1709 C  CB    . MET A 1 213 ? -15.173 29.383  24.142  1.00 16.98 ? 213  MET A CB    1 
ATOM   1710 C  CG    . MET A 1 213 ? -13.958 29.858  24.901  1.00 20.08 ? 213  MET A CG    1 
ATOM   1711 S  SD    . MET A 1 213 ? -13.998 31.636  25.217  1.00 37.87 ? 213  MET A SD    1 
ATOM   1712 C  CE    . MET A 1 213 ? -15.542 31.776  26.106  1.00 24.80 ? 213  MET A CE    1 
ATOM   1713 N  N     . PRO A 1 214 ? -14.078 27.535  21.719  1.00 14.64 ? 214  PRO A N     1 
ATOM   1714 C  CA    . PRO A 1 214 ? -12.930 27.167  20.885  1.00 15.00 ? 214  PRO A CA    1 
ATOM   1715 C  C     . PRO A 1 214 ? -11.835 28.220  20.972  1.00 12.09 ? 214  PRO A C     1 
ATOM   1716 O  O     . PRO A 1 214 ? -12.103 29.368  21.355  1.00 12.90 ? 214  PRO A O     1 
ATOM   1717 C  CB    . PRO A 1 214 ? -13.518 27.117  19.469  1.00 15.09 ? 214  PRO A CB    1 
ATOM   1718 C  CG    . PRO A 1 214 ? -14.710 28.002  19.521  1.00 20.15 ? 214  PRO A CG    1 
ATOM   1719 C  CD    . PRO A 1 214 ? -15.250 27.937  20.920  1.00 19.40 ? 214  PRO A CD    1 
ATOM   1720 N  N     . PRO A 1 215 ? -10.606 27.843  20.607  1.00 10.56 ? 215  PRO A N     1 
ATOM   1721 C  CA    . PRO A 1 215 ? -9.470  28.756  20.769  1.00 10.34 ? 215  PRO A CA    1 
ATOM   1722 C  C     . PRO A 1 215 ? -9.548  29.980  19.870  1.00 12.91 ? 215  PRO A C     1 
ATOM   1723 O  O     . PRO A 1 215 ? -9.033  31.036  20.249  1.00 12.12 ? 215  PRO A O     1 
ATOM   1724 C  CB    . PRO A 1 215 ? -8.258  27.891  20.403  1.00 12.67 ? 215  PRO A CB    1 
ATOM   1725 C  CG    . PRO A 1 215 ? -8.800  26.749  19.638  1.00 10.71 ? 215  PRO A CG    1 
ATOM   1726 C  CD    . PRO A 1 215 ? -10.191 26.506  20.139  1.00 10.31 ? 215  PRO A CD    1 
ATOM   1727 N  N     . PHE A 1 216 ? -10.181 29.837  18.709  1.00 12.65 ? 216  PHE A N     1 
ATOM   1728 C  CA    . PHE A 1 216 ? -10.329 30.943  17.764  1.00 12.52 ? 216  PHE A CA    1 
ATOM   1729 C  C     . PHE A 1 216 ? -11.807 31.130  17.460  1.00 15.44 ? 216  PHE A C     1 
ATOM   1730 O  O     . PHE A 1 216 ? -12.449 30.245  16.918  1.00 16.09 ? 216  PHE A O     1 
ATOM   1731 C  CB    . PHE A 1 216 ? -9.555  30.661  16.469  1.00 13.68 ? 216  PHE A CB    1 
ATOM   1732 C  CG    . PHE A 1 216 ? -8.152  30.160  16.700  1.00 11.13 ? 216  PHE A CG    1 
ATOM   1733 C  CD1   . PHE A 1 216 ? -7.120  31.042  16.962  1.00 13.05 ? 216  PHE A CD1   1 
ATOM   1734 C  CD2   . PHE A 1 216 ? -7.874  28.795  16.660  1.00 13.36 ? 216  PHE A CD2   1 
ATOM   1735 C  CE1   . PHE A 1 216 ? -5.822  30.579  17.185  1.00 12.61 ? 216  PHE A CE1   1 
ATOM   1736 C  CE2   . PHE A 1 216 ? -6.586  28.324  16.883  1.00 14.15 ? 216  PHE A CE2   1 
ATOM   1737 C  CZ    . PHE A 1 216 ? -5.559  29.216  17.149  1.00 13.13 ? 216  PHE A CZ    1 
ATOM   1738 N  N     . THR A 1 217 ? -12.349 32.280  17.836  1.00 17.78 ? 217  THR A N     1 
ATOM   1739 C  CA    . THR A 1 217 ? -13.758 32.555  17.585  1.00 20.86 ? 217  THR A CA    1 
ATOM   1740 C  C     . THR A 1 217 ? -13.893 33.689  16.582  1.00 20.34 ? 217  THR A C     1 
ATOM   1741 O  O     . THR A 1 217 ? -13.019 34.538  16.476  1.00 18.78 ? 217  THR A O     1 
ATOM   1742 C  CB    . THR A 1 217 ? -14.504 32.923  18.880  1.00 19.95 ? 217  THR A CB    1 
ATOM   1743 O  OG1   . THR A 1 217 ? -13.974 34.144  19.411  1.00 23.97 ? 217  THR A OG1   1 
ATOM   1744 C  CG2   . THR A 1 217 ? -14.354 31.818  19.917  1.00 34.25 ? 217  THR A CG2   1 
ATOM   1745 N  N     . ALA A 1 218 ? -14.997 33.700  15.844  1.00 23.02 ? 218  ALA A N     1 
ATOM   1746 C  CA    . ALA A 1 218 ? -15.234 34.746  14.865  1.00 27.47 ? 218  ALA A CA    1 
ATOM   1747 C  C     . ALA A 1 218 ? -16.664 34.671  14.359  1.00 24.33 ? 218  ALA A C     1 
ATOM   1748 O  O     . ALA A 1 218 ? -17.341 33.657  14.533  1.00 25.71 ? 218  ALA A O     1 
ATOM   1749 C  CB    . ALA A 1 218 ? -14.255 34.625  13.712  1.00 35.81 ? 218  ALA A CB    1 
ATOM   1750 N  N     . PHE A 1 219 ? -17.120 35.751  13.739  1.00 26.87 ? 219  PHE A N     1 
ATOM   1751 C  CA    . PHE A 1 219 ? -18.470 35.793  13.194  1.00 26.47 ? 219  PHE A CA    1 
ATOM   1752 C  C     . PHE A 1 219 ? -18.454 35.564  11.690  1.00 32.62 ? 219  PHE A C     1 
ATOM   1753 O  O     . PHE A 1 219 ? -19.501 35.392  11.066  1.00 33.46 ? 219  PHE A O     1 
ATOM   1754 C  CB    . PHE A 1 219 ? -19.146 37.123  13.532  1.00 31.71 ? 219  PHE A CB    1 
ATOM   1755 C  CG    . PHE A 1 219 ? -19.419 37.303  14.996  1.00 39.68 ? 219  PHE A CG    1 
ATOM   1756 C  CD1   . PHE A 1 219 ? -18.691 38.213  15.744  1.00 45.74 ? 219  PHE A CD1   1 
ATOM   1757 C  CD2   . PHE A 1 219 ? -20.392 36.549  15.629  1.00 44.92 ? 219  PHE A CD2   1 
ATOM   1758 C  CE1   . PHE A 1 219 ? -18.938 38.376  17.095  1.00 49.36 ? 219  PHE A CE1   1 
ATOM   1759 C  CE2   . PHE A 1 219 ? -20.643 36.708  16.980  1.00 47.97 ? 219  PHE A CE2   1 
ATOM   1760 C  CZ    . PHE A 1 219 ? -19.914 37.622  17.713  1.00 48.56 ? 219  PHE A CZ    1 
ATOM   1761 N  N     . SER A 1 220 ? -17.257 35.566  11.114  1.00 27.53 ? 220  SER A N     1 
ATOM   1762 C  CA    . SER A 1 220 ? -17.100 35.329  9.684   1.00 29.68 ? 220  SER A CA    1 
ATOM   1763 C  C     . SER A 1 220 ? -15.863 34.482  9.429   1.00 29.38 ? 220  SER A C     1 
ATOM   1764 O  O     . SER A 1 220 ? -14.981 34.382  10.280  1.00 25.29 ? 220  SER A O     1 
ATOM   1765 C  CB    . SER A 1 220 ? -17.006 36.650  8.920   1.00 30.78 ? 220  SER A CB    1 
ATOM   1766 O  OG    . SER A 1 220 ? -15.753 37.277  9.130   1.00 30.21 ? 220  SER A OG    1 
ATOM   1767 N  N     A GLN A 1 221 ? -15.817 33.869  8.251   0.50 24.74 ? 221  GLN A N     1 
ATOM   1768 N  N     B GLN A 1 221 ? -15.784 33.869  8.254   0.50 24.97 ? 221  GLN A N     1 
ATOM   1769 C  CA    A GLN A 1 221 ? -14.697 33.027  7.861   0.50 24.47 ? 221  GLN A CA    1 
ATOM   1770 C  CA    B GLN A 1 221 ? -14.647 33.005  7.950   0.50 23.75 ? 221  GLN A CA    1 
ATOM   1771 C  C     A GLN A 1 221 ? -13.410 33.833  7.755   0.50 21.04 ? 221  GLN A C     1 
ATOM   1772 C  C     B GLN A 1 221 ? -13.367 33.789  7.652   0.50 21.22 ? 221  GLN A C     1 
ATOM   1773 O  O     A GLN A 1 221 ? -12.351 33.390  8.197   0.50 20.55 ? 221  GLN A O     1 
ATOM   1774 O  O     B GLN A 1 221 ? -12.265 33.289  7.878   0.50 20.20 ? 221  GLN A O     1 
ATOM   1775 C  CB    A GLN A 1 221 ? -14.986 32.357  6.520   0.50 27.95 ? 221  GLN A CB    1 
ATOM   1776 C  CB    B GLN A 1 221 ? -14.987 32.027  6.821   0.50 27.87 ? 221  GLN A CB    1 
ATOM   1777 C  CG    A GLN A 1 221 ? -13.812 31.579  5.964   0.50 30.93 ? 221  GLN A CG    1 
ATOM   1778 C  CG    B GLN A 1 221 ? -16.004 30.974  7.237   0.50 23.71 ? 221  GLN A CG    1 
ATOM   1779 C  CD    A GLN A 1 221 ? -13.645 30.228  6.617   0.50 32.56 ? 221  GLN A CD    1 
ATOM   1780 C  CD    B GLN A 1 221 ? -16.309 29.975  6.141   0.50 21.69 ? 221  GLN A CD    1 
ATOM   1781 O  OE1   A GLN A 1 221 ? -14.016 30.035  7.773   0.50 37.12 ? 221  GLN A OE1   1 
ATOM   1782 O  OE1   B GLN A 1 221 ? -15.409 29.331  5.601   0.50 22.08 ? 221  GLN A OE1   1 
ATOM   1783 N  NE2   A GLN A 1 221 ? -13.083 29.280  5.876   0.50 34.51 ? 221  GLN A NE2   1 
ATOM   1784 N  NE2   B GLN A 1 221 ? -17.588 29.830  5.817   0.50 24.63 ? 221  GLN A NE2   1 
ATOM   1785 N  N     . LYS A 1 222 ? -13.510 35.015  7.157   1.00 24.02 ? 222  LYS A N     1 
ATOM   1786 C  CA    . LYS A 1 222 ? -12.352 35.883  6.962   1.00 22.87 ? 222  LYS A CA    1 
ATOM   1787 C  C     . LYS A 1 222 ? -11.721 36.208  8.312   1.00 21.45 ? 222  LYS A C     1 
ATOM   1788 O  O     . LYS A 1 222 ? -10.509 36.103  8.484   1.00 20.35 ? 222  LYS A O     1 
ATOM   1789 C  CB    . LYS A 1 222 ? -12.759 37.174  6.248   1.00 34.42 ? 222  LYS A CB    1 
ATOM   1790 C  CG    . LYS A 1 222 ? -11.618 38.161  6.051   1.00 38.36 ? 222  LYS A CG    1 
ATOM   1791 C  CD    . LYS A 1 222 ? -12.148 39.562  5.769   1.00 47.94 ? 222  LYS A CD    1 
ATOM   1792 C  CE    . LYS A 1 222 ? -11.017 40.569  5.617   1.00 53.63 ? 222  LYS A CE    1 
ATOM   1793 N  NZ    . LYS A 1 222 ? -10.264 40.377  4.345   1.00 57.41 ? 222  LYS A NZ    1 
ATOM   1794 N  N     . GLU A 1 223 ? -12.559 36.597  9.267   1.00 21.49 ? 223  GLU A N     1 
ATOM   1795 C  CA    . GLU A 1 223 ? -12.091 36.930  10.612  1.00 23.57 ? 223  GLU A CA    1 
ATOM   1796 C  C     . GLU A 1 223 ? -11.443 35.723  11.278  1.00 20.45 ? 223  GLU A C     1 
ATOM   1797 O  O     . GLU A 1 223 ? -10.381 35.833  11.888  1.00 22.73 ? 223  GLU A O     1 
ATOM   1798 C  CB    . GLU A 1 223 ? -13.245 37.440  11.479  1.00 31.93 ? 223  GLU A CB    1 
ATOM   1799 C  CG    . GLU A 1 223 ? -12.848 37.715  12.926  1.00 45.11 ? 223  GLU A CG    1 
ATOM   1800 C  CD    . GLU A 1 223 ? -14.041 37.976  13.831  1.00 52.03 ? 223  GLU A CD    1 
ATOM   1801 O  OE1   . GLU A 1 223 ? -15.193 37.857  13.359  1.00 53.56 ? 223  GLU A OE1   1 
ATOM   1802 O  OE2   . GLU A 1 223 ? -13.822 38.296  15.020  1.00 50.89 ? 223  GLU A OE2   1 
ATOM   1803 N  N     . LEU A 1 224 ? -12.095 34.572  11.163  1.00 18.16 ? 224  LEU A N     1 
ATOM   1804 C  CA    . LEU A 1 224 ? -11.576 33.337  11.736  1.00 17.26 ? 224  LEU A CA    1 
ATOM   1805 C  C     . LEU A 1 224 ? -10.197 32.984  11.179  1.00 18.02 ? 224  LEU A C     1 
ATOM   1806 O  O     . LEU A 1 224 ? -9.270  32.685  11.933  1.00 17.77 ? 224  LEU A O     1 
ATOM   1807 C  CB    . LEU A 1 224 ? -12.549 32.184  11.491  1.00 22.20 ? 224  LEU A CB    1 
ATOM   1808 C  CG    . LEU A 1 224 ? -12.135 30.832  12.067  1.00 20.71 ? 224  LEU A CG    1 
ATOM   1809 C  CD1   . LEU A 1 224 ? -12.092 30.897  13.589  1.00 23.01 ? 224  LEU A CD1   1 
ATOM   1810 C  CD2   . LEU A 1 224 ? -13.078 29.734  11.595  1.00 24.16 ? 224  LEU A CD2   1 
ATOM   1811 N  N     . ALA A 1 225 ? -10.064 33.018  9.856   1.00 18.28 ? 225  ALA A N     1 
ATOM   1812 C  CA    . ALA A 1 225 ? -8.799  32.680  9.217   1.00 18.46 ? 225  ALA A CA    1 
ATOM   1813 C  C     . ALA A 1 225 ? -7.680  33.598  9.699   1.00 17.34 ? 225  ALA A C     1 
ATOM   1814 O  O     . ALA A 1 225 ? -6.553  33.159  9.914   1.00 17.87 ? 225  ALA A O     1 
ATOM   1815 C  CB    . ALA A 1 225 ? -8.931  32.749  7.705   1.00 23.10 ? 225  ALA A CB    1 
ATOM   1816 N  N     . GLY A 1 226 ? -7.999  34.876  9.874   1.00 19.23 ? 226  GLY A N     1 
ATOM   1817 C  CA    . GLY A 1 226 ? -7.036  35.831  10.385  1.00 19.30 ? 226  GLY A CA    1 
ATOM   1818 C  C     . GLY A 1 226 ? -6.520  35.426  11.752  1.00 20.23 ? 226  GLY A C     1 
ATOM   1819 O  O     . GLY A 1 226 ? -5.321  35.490  12.022  1.00 22.01 ? 226  GLY A O     1 
ATOM   1820 N  N     . LYS A 1 227 ? -7.434  34.998  12.617  1.00 16.74 ? 227  LYS A N     1 
ATOM   1821 C  CA    . LYS A 1 227 ? -7.064  34.595  13.972  1.00 16.63 ? 227  LYS A CA    1 
ATOM   1822 C  C     . LYS A 1 227 ? -6.255  33.308  13.972  1.00 18.63 ? 227  LYS A C     1 
ATOM   1823 O  O     . LYS A 1 227 ? -5.268  33.193  14.696  1.00 19.57 ? 227  LYS A O     1 
ATOM   1824 C  CB    . LYS A 1 227 ? -8.307  34.420  14.844  1.00 15.48 ? 227  LYS A CB    1 
ATOM   1825 C  CG    . LYS A 1 227 ? -9.005  35.714  15.217  1.00 19.72 ? 227  LYS A CG    1 
ATOM   1826 C  CD    . LYS A 1 227 ? -10.043 35.450  16.287  1.00 23.43 ? 227  LYS A CD    1 
ATOM   1827 C  CE    . LYS A 1 227 ? -10.710 36.728  16.760  1.00 30.06 ? 227  LYS A CE    1 
ATOM   1828 N  NZ    . LYS A 1 227 ? -11.648 36.448  17.882  1.00 35.11 ? 227  LYS A NZ    1 
ATOM   1829 N  N     . ILE A 1 228 ? -6.685  32.338  13.169  1.00 15.41 ? 228  ILE A N     1 
ATOM   1830 C  CA    . ILE A 1 228 ? -5.991  31.055  13.070  1.00 16.85 ? 228  ILE A CA    1 
ATOM   1831 C  C     . ILE A 1 228 ? -4.548  31.259  12.611  1.00 23.96 ? 228  ILE A C     1 
ATOM   1832 O  O     . ILE A 1 228 ? -3.618  30.694  13.189  1.00 20.77 ? 228  ILE A O     1 
ATOM   1833 C  CB    . ILE A 1 228 ? -6.723  30.083  12.117  1.00 17.34 ? 228  ILE A CB    1 
ATOM   1834 C  CG1   . ILE A 1 228 ? -8.058  29.647  12.722  1.00 17.05 ? 228  ILE A CG1   1 
ATOM   1835 C  CG2   . ILE A 1 228 ? -5.846  28.876  11.807  1.00 19.96 ? 228  ILE A CG2   1 
ATOM   1836 C  CD1   . ILE A 1 228 ? -8.964  28.907  11.759  1.00 18.31 ? 228  ILE A CD1   1 
ATOM   1837 N  N     . ARG A 1 229 ? -4.362  32.085  11.585  1.00 21.08 ? 229  ARG A N     1 
ATOM   1838 C  CA    . ARG A 1 229 ? -3.025  32.352  11.059  1.00 19.16 ? 229  ARG A CA    1 
ATOM   1839 C  C     . ARG A 1 229 ? -2.102  33.030  12.073  1.00 20.35 ? 229  ARG A C     1 
ATOM   1840 O  O     . ARG A 1 229 ? -0.886  32.834  12.042  1.00 24.34 ? 229  ARG A O     1 
ATOM   1841 C  CB    . ARG A 1 229 ? -3.098  33.172  9.769   1.00 26.05 ? 229  ARG A CB    1 
ATOM   1842 C  CG    . ARG A 1 229 ? -3.504  32.353  8.546   1.00 31.31 ? 229  ARG A CG    1 
ATOM   1843 C  CD    . ARG A 1 229 ? -3.330  33.160  7.266   1.00 36.24 ? 229  ARG A CD    1 
ATOM   1844 N  NE    . ARG A 1 229 ? -4.109  34.393  7.304   1.00 44.60 ? 229  ARG A NE    1 
ATOM   1845 C  CZ    . ARG A 1 229 ? -5.260  34.574  6.662   1.00 43.26 ? 229  ARG A CZ    1 
ATOM   1846 N  NH1   . ARG A 1 229 ? -5.768  33.602  5.915   1.00 44.09 ? 229  ARG A NH1   1 
ATOM   1847 N  NH2   . ARG A 1 229 ? -5.900  35.730  6.764   1.00 41.84 ? 229  ARG A NH2   1 
ATOM   1848 N  N     . GLU A 1 230 ? -2.673  33.831  12.965  1.00 17.51 ? 230  GLU A N     1 
ATOM   1849 C  CA    . GLU A 1 230 ? -1.886  34.486  14.004  1.00 21.22 ? 230  GLU A CA    1 
ATOM   1850 C  C     . GLU A 1 230 ? -1.485  33.508  15.117  1.00 22.24 ? 230  GLU A C     1 
ATOM   1851 O  O     . GLU A 1 230 ? -0.455  33.689  15.773  1.00 20.64 ? 230  GLU A O     1 
ATOM   1852 C  CB    . GLU A 1 230 ? -2.639  35.682  14.586  1.00 24.35 ? 230  GLU A CB    1 
ATOM   1853 C  CG    . GLU A 1 230 ? -1.806  36.521  15.537  1.00 33.92 ? 230  GLU A CG    1 
ATOM   1854 C  CD    . GLU A 1 230 ? -0.533  37.046  14.890  1.00 45.68 ? 230  GLU A CD    1 
ATOM   1855 O  OE1   . GLU A 1 230 ? -0.614  37.587  13.765  1.00 43.66 ? 230  GLU A OE1   1 
ATOM   1856 O  OE2   . GLU A 1 230 ? 0.549   36.916  15.507  1.00 49.50 ? 230  GLU A OE2   1 
ATOM   1857 N  N     . GLY A 1 231 ? -2.303  32.482  15.332  1.00 18.56 ? 231  GLY A N     1 
ATOM   1858 C  CA    . GLY A 1 231 ? -1.965  31.414  16.263  1.00 15.35 ? 231  GLY A CA    1 
ATOM   1859 C  C     . GLY A 1 231 ? -1.990  31.779  17.739  1.00 13.77 ? 231  GLY A C     1 
ATOM   1860 O  O     . GLY A 1 231 ? -1.405  31.069  18.555  1.00 13.89 ? 231  GLY A O     1 
ATOM   1861 N  N     . LYS A 1 232 ? -2.660  32.877  18.088  1.00 13.46 ? 232  LYS A N     1 
ATOM   1862 C  CA    . LYS A 1 232 ? -2.758  33.315  19.481  1.00 12.15 ? 232  LYS A CA    1 
ATOM   1863 C  C     . LYS A 1 232 ? -4.138  33.009  20.072  1.00 12.20 ? 232  LYS A C     1 
ATOM   1864 O  O     . LYS A 1 232 ? -5.150  33.045  19.368  1.00 12.77 ? 232  LYS A O     1 
ATOM   1865 C  CB    . LYS A 1 232 ? -2.436  34.806  19.614  1.00 16.11 ? 232  LYS A CB    1 
ATOM   1866 C  CG    . LYS A 1 232 ? -1.021  35.154  19.157  1.00 22.41 ? 232  LYS A CG    1 
ATOM   1867 C  CD    . LYS A 1 232 ? -0.721  36.633  19.274  1.00 28.68 ? 232  LYS A CD    1 
ATOM   1868 C  CE    . LYS A 1 232 ? 0.616   36.964  18.621  1.00 37.86 ? 232  LYS A CE    1 
ATOM   1869 N  NZ    . LYS A 1 232 ? 1.680   35.980  18.964  1.00 39.75 ? 232  LYS A NZ    1 
ATOM   1870 N  N     . PHE A 1 233 ? -4.169  32.713  21.369  1.00 10.80 ? 233  PHE A N     1 
ATOM   1871 C  CA    . PHE A 1 233 ? -5.398  32.309  22.051  1.00 8.94  ? 233  PHE A CA    1 
ATOM   1872 C  C     . PHE A 1 233 ? -5.202  32.481  23.552  1.00 11.06 ? 233  PHE A C     1 
ATOM   1873 O  O     . PHE A 1 233 ? -4.063  32.561  24.034  1.00 10.97 ? 233  PHE A O     1 
ATOM   1874 C  CB    . PHE A 1 233 ? -5.758  30.848  21.727  1.00 8.09  ? 233  PHE A CB    1 
ATOM   1875 C  CG    . PHE A 1 233 ? -4.575  29.918  21.717  1.00 9.07  ? 233  PHE A CG    1 
ATOM   1876 C  CD1   . PHE A 1 233 ? -4.095  29.373  22.896  1.00 10.92 ? 233  PHE A CD1   1 
ATOM   1877 C  CD2   . PHE A 1 233 ? -3.941  29.602  20.527  1.00 10.97 ? 233  PHE A CD2   1 
ATOM   1878 C  CE1   . PHE A 1 233 ? -3.002  28.521  22.885  1.00 11.39 ? 233  PHE A CE1   1 
ATOM   1879 C  CE2   . PHE A 1 233 ? -2.848  28.754  20.508  1.00 11.26 ? 233  PHE A CE2   1 
ATOM   1880 C  CZ    . PHE A 1 233 ? -2.378  28.219  21.692  1.00 11.65 ? 233  PHE A CZ    1 
ATOM   1881 N  N     . ARG A 1 234 ? -6.300  32.554  24.296  1.00 10.06 ? 234  ARG A N     1 
ATOM   1882 C  CA    . ARG A 1 234 ? -6.210  32.662  25.748  1.00 8.95  ? 234  ARG A CA    1 
ATOM   1883 C  C     . ARG A 1 234 ? -5.693  31.357  26.335  1.00 10.22 ? 234  ARG A C     1 
ATOM   1884 O  O     . ARG A 1 234 ? -5.900  30.285  25.760  1.00 11.19 ? 234  ARG A O     1 
ATOM   1885 C  CB    . ARG A 1 234 ? -7.574  33.008  26.355  1.00 11.30 ? 234  ARG A CB    1 
ATOM   1886 C  CG    . ARG A 1 234 ? -8.175  34.304  25.824  1.00 11.71 ? 234  ARG A CG    1 
ATOM   1887 C  CD    . ARG A 1 234 ? -9.342  34.764  26.692  1.00 15.61 ? 234  ARG A CD    1 
ATOM   1888 N  NE    . ARG A 1 234 ? -8.931  34.953  28.083  1.00 16.61 ? 234  ARG A NE    1 
ATOM   1889 C  CZ    . ARG A 1 234 ? -8.257  36.006  28.528  1.00 20.95 ? 234  ARG A CZ    1 
ATOM   1890 N  NH1   . ARG A 1 234 ? -7.915  36.976  27.694  1.00 20.66 ? 234  ARG A NH1   1 
ATOM   1891 N  NH2   . ARG A 1 234 ? -7.923  36.085  29.808  1.00 22.18 ? 234  ARG A NH2   1 
ATOM   1892 N  N     . ARG A 1 235 ? -5.012  31.431  27.473  1.00 9.03  ? 235  ARG A N     1 
ATOM   1893 C  CA    . ARG A 1 235 ? -4.696  30.198  28.189  1.00 8.10  ? 235  ARG A CA    1 
ATOM   1894 C  C     . ARG A 1 235 ? -6.009  29.527  28.598  1.00 8.32  ? 235  ARG A C     1 
ATOM   1895 O  O     . ARG A 1 235 ? -6.991  30.205  28.910  1.00 10.48 ? 235  ARG A O     1 
ATOM   1896 C  CB    . ARG A 1 235 ? -3.867  30.483  29.440  1.00 8.83  ? 235  ARG A CB    1 
ATOM   1897 C  CG    . ARG A 1 235 ? -3.275  29.212  30.075  1.00 9.81  ? 235  ARG A CG    1 
ATOM   1898 C  CD    . ARG A 1 235 ? -2.986  29.430  31.554  1.00 9.05  ? 235  ARG A CD    1 
ATOM   1899 N  NE    . ARG A 1 235 ? -2.284  28.302  32.165  1.00 9.72  ? 235  ARG A NE    1 
ATOM   1900 C  CZ    . ARG A 1 235 ? -2.888  27.253  32.720  1.00 10.76 ? 235  ARG A CZ    1 
ATOM   1901 N  NH1   . ARG A 1 235 ? -4.213  27.165  32.727  1.00 9.59  ? 235  ARG A NH1   1 
ATOM   1902 N  NH2   . ARG A 1 235 ? -2.156  26.283  33.256  1.00 10.58 ? 235  ARG A NH2   1 
ATOM   1903 N  N     . ILE A 1 236 ? -6.031  28.198  28.599  1.00 10.42 ? 236  ILE A N     1 
ATOM   1904 C  CA    . ILE A 1 236 ? -7.150  27.495  29.217  1.00 8.94  ? 236  ILE A CA    1 
ATOM   1905 C  C     . ILE A 1 236 ? -7.241  27.934  30.683  1.00 9.29  ? 236  ILE A C     1 
ATOM   1906 O  O     . ILE A 1 236 ? -6.269  28.462  31.241  1.00 9.55  ? 236  ILE A O     1 
ATOM   1907 C  CB    . ILE A 1 236 ? -7.008  25.958  29.087  1.00 7.96  ? 236  ILE A CB    1 
ATOM   1908 C  CG1   . ILE A 1 236 ? -5.750  25.451  29.796  1.00 8.74  ? 236  ILE A CG1   1 
ATOM   1909 C  CG2   . ILE A 1 236 ? -7.022  25.541  27.605  1.00 10.14 ? 236  ILE A CG2   1 
ATOM   1910 C  CD1   . ILE A 1 236 ? -5.615  23.910  29.767  1.00 7.67  ? 236  ILE A CD1   1 
ATOM   1911 N  N     . PRO A 1 237 ? -8.414  27.755  31.310  1.00 9.51  ? 237  PRO A N     1 
ATOM   1912 C  CA    . PRO A 1 237 ? -8.593  28.203  32.695  1.00 9.32  ? 237  PRO A CA    1 
ATOM   1913 C  C     . PRO A 1 237 ? -7.536  27.679  33.675  1.00 10.79 ? 237  PRO A C     1 
ATOM   1914 O  O     . PRO A 1 237 ? -6.989  26.584  33.521  1.00 9.62  ? 237  PRO A O     1 
ATOM   1915 C  CB    . PRO A 1 237 ? -9.986  27.680  33.051  1.00 10.43 ? 237  PRO A CB    1 
ATOM   1916 C  CG    . PRO A 1 237 ? -10.709 27.672  31.738  1.00 10.65 ? 237  PRO A CG    1 
ATOM   1917 C  CD    . PRO A 1 237 ? -9.672  27.258  30.725  1.00 11.21 ? 237  PRO A CD    1 
ATOM   1918 N  N     . TYR A 1 238 ? -7.255  28.483  34.693  1.00 8.91  ? 238  TYR A N     1 
ATOM   1919 C  CA    . TYR A 1 238 ? -6.169  28.196  35.620  1.00 9.11  ? 238  TYR A CA    1 
ATOM   1920 C  C     . TYR A 1 238 ? -6.390  26.961  36.491  1.00 8.98  ? 238  TYR A C     1 
ATOM   1921 O  O     . TYR A 1 238 ? -5.457  26.472  37.116  1.00 13.79 ? 238  TYR A O     1 
ATOM   1922 C  CB    . TYR A 1 238 ? -5.856  29.435  36.474  1.00 11.45 ? 238  TYR A CB    1 
ATOM   1923 C  CG    . TYR A 1 238 ? -5.292  30.546  35.627  1.00 9.51  ? 238  TYR A CG    1 
ATOM   1924 C  CD1   . TYR A 1 238 ? -6.066  31.645  35.281  1.00 10.15 ? 238  TYR A CD1   1 
ATOM   1925 C  CD2   . TYR A 1 238 ? -3.998  30.470  35.132  1.00 8.70  ? 238  TYR A CD2   1 
ATOM   1926 C  CE1   . TYR A 1 238 ? -5.555  32.648  34.480  1.00 12.74 ? 238  TYR A CE1   1 
ATOM   1927 C  CE2   . TYR A 1 238 ? -3.476  31.468  34.331  1.00 9.03  ? 238  TYR A CE2   1 
ATOM   1928 C  CZ    . TYR A 1 238 ? -4.262  32.556  34.010  1.00 10.78 ? 238  TYR A CZ    1 
ATOM   1929 O  OH    . TYR A 1 238 ? -3.760  33.552  33.212  1.00 11.57 ? 238  TYR A OH    1 
ATOM   1930 N  N     . ARG A 1 239 ? -7.626  26.484  36.538  1.00 11.12 ? 239  ARG A N     1 
ATOM   1931 C  CA    . ARG A 1 239 ? -7.914  25.246  37.254  1.00 14.44 ? 239  ARG A CA    1 
ATOM   1932 C  C     . ARG A 1 239 ? -7.188  24.074  36.598  1.00 13.91 ? 239  ARG A C     1 
ATOM   1933 O  O     . ARG A 1 239 ? -6.960  23.048  37.238  1.00 16.50 ? 239  ARG A O     1 
ATOM   1934 C  CB    . ARG A 1 239 ? -9.413  24.983  37.295  1.00 17.05 ? 239  ARG A CB    1 
ATOM   1935 C  CG    . ARG A 1 239 ? -10.001 24.657  35.944  1.00 17.89 ? 239  ARG A CG    1 
ATOM   1936 C  CD    . ARG A 1 239 ? -11.524 24.726  35.962  1.00 31.83 ? 239  ARG A CD    1 
ATOM   1937 N  NE    . ARG A 1 239 ? -12.112 24.207  37.196  1.00 34.24 ? 239  ARG A NE    1 
ATOM   1938 C  CZ    . ARG A 1 239 ? -12.384 22.925  37.427  1.00 41.86 ? 239  ARG A CZ    1 
ATOM   1939 N  NH1   . ARG A 1 239 ? -12.925 22.564  38.583  1.00 41.87 ? 239  ARG A NH1   1 
ATOM   1940 N  NH2   . ARG A 1 239 ? -12.112 22.003  36.513  1.00 38.87 ? 239  ARG A NH2   1 
ATOM   1941 N  N     . TYR A 1 240 ? -6.818  24.232  35.328  1.00 10.28 ? 240  TYR A N     1 
ATOM   1942 C  CA    . TYR A 1 240 ? -6.099  23.185  34.598  1.00 9.05  ? 240  TYR A CA    1 
ATOM   1943 C  C     . TYR A 1 240 ? -4.595  23.334  34.719  1.00 10.72 ? 240  TYR A C     1 
ATOM   1944 O  O     . TYR A 1 240 ? -4.053  24.442  34.661  1.00 10.63 ? 240  TYR A O     1 
ATOM   1945 C  CB    . TYR A 1 240 ? -6.511  23.159  33.123  1.00 7.94  ? 240  TYR A CB    1 
ATOM   1946 C  CG    . TYR A 1 240 ? -7.989  22.925  32.972  1.00 7.02  ? 240  TYR A CG    1 
ATOM   1947 C  CD1   . TYR A 1 240 ? -8.846  23.967  32.648  1.00 9.78  ? 240  TYR A CD1   1 
ATOM   1948 C  CD2   . TYR A 1 240 ? -8.544  21.671  33.223  1.00 9.57  ? 240  TYR A CD2   1 
ATOM   1949 C  CE1   . TYR A 1 240 ? -10.216 23.767  32.541  1.00 11.85 ? 240  TYR A CE1   1 
ATOM   1950 C  CE2   . TYR A 1 240 ? -9.909  21.458  33.114  1.00 12.56 ? 240  TYR A CE2   1 
ATOM   1951 C  CZ    . TYR A 1 240 ? -10.741 22.513  32.777  1.00 12.69 ? 240  TYR A CZ    1 
ATOM   1952 O  OH    . TYR A 1 240 ? -12.099 22.314  32.677  1.00 14.83 ? 240  TYR A OH    1 
ATOM   1953 N  N     . SER A 1 241 ? -3.927  22.198  34.871  1.00 9.29  ? 241  SER A N     1 
ATOM   1954 C  CA    . SER A 1 241 ? -2.491  22.176  35.106  1.00 10.60 ? 241  SER A CA    1 
ATOM   1955 C  C     . SER A 1 241 ? -1.686  22.802  33.975  1.00 8.43  ? 241  SER A C     1 
ATOM   1956 O  O     . SER A 1 241 ? -2.102  22.812  32.810  1.00 9.95  ? 241  SER A O     1 
ATOM   1957 C  CB    . SER A 1 241 ? -2.011  20.738  35.321  1.00 10.56 ? 241  SER A CB    1 
ATOM   1958 O  OG    . SER A 1 241 ? -2.094  19.991  34.117  1.00 11.84 ? 241  SER A OG    1 
ATOM   1959 N  N     . ASP A 1 242 ? -0.516  23.308  34.339  1.00 8.96  ? 242  ASP A N     1 
ATOM   1960 C  CA    . ASP A 1 242 ? 0.440   23.803  33.358  1.00 9.93  ? 242  ASP A CA    1 
ATOM   1961 C  C     . ASP A 1 242 ? 0.823   22.693  32.385  1.00 9.21  ? 242  ASP A C     1 
ATOM   1962 O  O     . ASP A 1 242 ? 1.077   22.952  31.214  1.00 9.89  ? 242  ASP A O     1 
ATOM   1963 C  CB    . ASP A 1 242 ? 1.702   24.336  34.050  1.00 8.81  ? 242  ASP A CB    1 
ATOM   1964 C  CG    . ASP A 1 242 ? 1.521   25.736  34.621  1.00 10.36 ? 242  ASP A CG    1 
ATOM   1965 O  OD1   . ASP A 1 242 ? 0.508   26.395  34.312  1.00 11.28 ? 242  ASP A OD1   1 
ATOM   1966 O  OD2   . ASP A 1 242 ? 2.412   26.182  35.377  1.00 13.91 ? 242  ASP A OD2   1 
ATOM   1967 N  N     . GLU A 1 243 ? 0.865   21.451  32.863  1.00 9.26  ? 243  GLU A N     1 
ATOM   1968 C  CA    . GLU A 1 243 ? 1.213   20.328  31.984  1.00 9.57  ? 243  GLU A CA    1 
ATOM   1969 C  C     . GLU A 1 243 ? 0.153   20.105  30.895  1.00 9.15  ? 243  GLU A C     1 
ATOM   1970 O  O     . GLU A 1 243 ? 0.480   19.886  29.730  1.00 9.63  ? 243  GLU A O     1 
ATOM   1971 C  CB    . GLU A 1 243 ? 1.428   19.050  32.805  1.00 8.75  ? 243  GLU A CB    1 
ATOM   1972 C  CG    . GLU A 1 243 ? 2.697   19.074  33.655  1.00 13.56 ? 243  GLU A CG    1 
ATOM   1973 C  CD    . GLU A 1 243 ? 2.573   19.911  34.926  1.00 19.68 ? 243  GLU A CD    1 
ATOM   1974 O  OE1   . GLU A 1 243 ? 1.446   20.220  35.375  1.00 13.50 ? 243  GLU A OE1   1 
ATOM   1975 O  OE2   . GLU A 1 243 ? 3.627   20.255  35.503  1.00 21.96 ? 243  GLU A OE2   1 
ATOM   1976 N  N     . LEU A 1 244 ? -1.119  20.175  31.276  1.00 9.96  ? 244  LEU A N     1 
ATOM   1977 C  CA    . LEU A 1 244 ? -2.199  20.044  30.303  1.00 10.42 ? 244  LEU A CA    1 
ATOM   1978 C  C     . LEU A 1 244 ? -2.213  21.245  29.360  1.00 7.77  ? 244  LEU A C     1 
ATOM   1979 O  O     . LEU A 1 244 ? -2.352  21.098  28.144  1.00 7.95  ? 244  LEU A O     1 
ATOM   1980 C  CB    . LEU A 1 244 ? -3.548  19.891  31.011  1.00 7.71  ? 244  LEU A CB    1 
ATOM   1981 C  CG    . LEU A 1 244 ? -4.755  19.781  30.077  1.00 10.11 ? 244  LEU A CG    1 
ATOM   1982 C  CD1   . LEU A 1 244 ? -4.572  18.639  29.071  1.00 11.95 ? 244  LEU A CD1   1 
ATOM   1983 C  CD2   . LEU A 1 244 ? -6.043  19.592  30.859  1.00 10.20 ? 244  LEU A CD2   1 
ATOM   1984 N  N     . ASN A 1 245 ? -2.058  22.444  29.909  1.00 8.73  ? 245  ASN A N     1 
ATOM   1985 C  CA    . ASN A 1 245 ? -2.001  23.610  29.043  1.00 9.51  ? 245  ASN A CA    1 
ATOM   1986 C  C     . ASN A 1 245 ? -0.861  23.504  28.034  1.00 8.91  ? 245  ASN A C     1 
ATOM   1987 O  O     . ASN A 1 245 ? -1.016  23.881  26.870  1.00 10.02 ? 245  ASN A O     1 
ATOM   1988 C  CB    . ASN A 1 245 ? -1.845  24.893  29.853  1.00 9.40  ? 245  ASN A CB    1 
ATOM   1989 C  CG    . ASN A 1 245 ? -1.728  26.106  28.966  1.00 8.08  ? 245  ASN A CG    1 
ATOM   1990 O  OD1   . ASN A 1 245 ? -2.691  26.491  28.302  1.00 11.47 ? 245  ASN A OD1   1 
ATOM   1991 N  ND2   . ASN A 1 245 ? -0.537  26.708  28.936  1.00 9.07  ? 245  ASN A ND2   1 
ATOM   1992 N  N     A GLU A 1 246 ? 0.278   22.991  28.487  0.50 7.62  ? 246  GLU A N     1 
ATOM   1993 N  N     B GLU A 1 246 ? 0.286   22.994  28.470  0.50 7.83  ? 246  GLU A N     1 
ATOM   1994 C  CA    A GLU A 1 246 ? 1.452   22.860  27.633  0.50 9.49  ? 246  GLU A CA    1 
ATOM   1995 C  CA    B GLU A 1 246 ? 1.438   22.912  27.577  0.50 9.14  ? 246  GLU A CA    1 
ATOM   1996 C  C     A GLU A 1 246 ? 1.166   21.986  26.412  0.50 10.01 ? 246  GLU A C     1 
ATOM   1997 C  C     B GLU A 1 246 ? 1.174   21.979  26.389  0.50 9.80  ? 246  GLU A C     1 
ATOM   1998 O  O     A GLU A 1 246 ? 1.468   22.358  25.278  0.50 11.19 ? 246  GLU A O     1 
ATOM   1999 O  O     B GLU A 1 246 ? 1.495   22.310  25.249  0.50 10.44 ? 246  GLU A O     1 
ATOM   2000 C  CB    A GLU A 1 246 ? 2.615   22.277  28.433  0.50 11.19 ? 246  GLU A CB    1 
ATOM   2001 C  CB    B GLU A 1 246 ? 2.700   22.493  28.337  0.50 9.19  ? 246  GLU A CB    1 
ATOM   2002 C  CG    A GLU A 1 246 ? 3.900   22.129  27.652  0.50 12.74 ? 246  GLU A CG    1 
ATOM   2003 C  CG    B GLU A 1 246 ? 3.983   22.638  27.535  0.50 10.89 ? 246  GLU A CG    1 
ATOM   2004 C  CD    A GLU A 1 246 ? 5.036   21.620  28.516  0.50 14.99 ? 246  GLU A CD    1 
ATOM   2005 C  CD    B GLU A 1 246 ? 4.320   21.396  26.728  0.50 13.57 ? 246  GLU A CD    1 
ATOM   2006 O  OE1   A GLU A 1 246 ? 4.936   20.485  29.035  0.50 20.66 ? 246  GLU A OE1   1 
ATOM   2007 O  OE1   B GLU A 1 246 ? 3.639   20.366  26.907  0.50 15.72 ? 246  GLU A OE1   1 
ATOM   2008 O  OE2   A GLU A 1 246 ? 6.028   22.359  28.675  0.50 22.26 ? 246  GLU A OE2   1 
ATOM   2009 O  OE2   B GLU A 1 246 ? 5.278   21.445  25.925  0.50 20.70 ? 246  GLU A OE2   1 
ATOM   2010 N  N     . ILE A 1 247 ? 0.577   20.820  26.644  1.00 9.52  ? 247  ILE A N     1 
ATOM   2011 C  CA    . ILE A 1 247 ? 0.375   19.873  25.557  1.00 8.81  ? 247  ILE A CA    1 
ATOM   2012 C  C     . ILE A 1 247 ? -0.695  20.360  24.572  1.00 7.91  ? 247  ILE A C     1 
ATOM   2013 O  O     . ILE A 1 247 ? -0.509  20.267  23.360  1.00 9.51  ? 247  ILE A O     1 
ATOM   2014 C  CB    . ILE A 1 247 ? 0.127   18.427  26.032  1.00 9.82  ? 247  ILE A CB    1 
ATOM   2015 C  CG1   . ILE A 1 247 ? 0.213   17.470  24.836  1.00 13.48 ? 247  ILE A CG1   1 
ATOM   2016 C  CG2   . ILE A 1 247 ? -1.198  18.303  26.743  1.00 9.53  ? 247  ILE A CG2   1 
ATOM   2017 C  CD1   . ILE A 1 247 ? 0.150   16.019  25.225  1.00 16.87 ? 247  ILE A CD1   1 
ATOM   2018 N  N     . ILE A 1 248 ? -1.786  20.920  25.082  1.00 7.33  ? 248  ILE A N     1 
ATOM   2019 C  CA    . ILE A 1 248 ? -2.790  21.500  24.193  1.00 7.69  ? 248  ILE A CA    1 
ATOM   2020 C  C     . ILE A 1 248 ? -2.181  22.621  23.343  1.00 7.51  ? 248  ILE A C     1 
ATOM   2021 O  O     . ILE A 1 248 ? -2.404  22.701  22.124  1.00 9.01  ? 248  ILE A O     1 
ATOM   2022 C  CB    . ILE A 1 248 ? -4.029  21.991  24.985  1.00 9.41  ? 248  ILE A CB    1 
ATOM   2023 C  CG1   . ILE A 1 248 ? -4.758  20.789  25.601  1.00 9.06  ? 248  ILE A CG1   1 
ATOM   2024 C  CG2   . ILE A 1 248 ? -4.967  22.794  24.092  1.00 12.22 ? 248  ILE A CG2   1 
ATOM   2025 C  CD1   . ILE A 1 248 ? -5.902  21.165  26.537  1.00 11.45 ? 248  ILE A CD1   1 
ATOM   2026 N  N     . THR A 1 249 ? -1.393  23.479  23.981  1.00 7.25  ? 249  THR A N     1 
ATOM   2027 C  CA    . THR A 1 249 ? -0.737  24.574  23.273  1.00 9.34  ? 249  THR A CA    1 
ATOM   2028 C  C     . THR A 1 249 ? 0.198   24.053  22.180  1.00 8.53  ? 249  THR A C     1 
ATOM   2029 O  O     . THR A 1 249 ? 0.226   24.610  21.086  1.00 10.45 ? 249  THR A O     1 
ATOM   2030 C  CB    . THR A 1 249 ? -0.009  25.502  24.253  1.00 9.77  ? 249  THR A CB    1 
ATOM   2031 O  OG1   . THR A 1 249 ? -0.984  26.142  25.083  1.00 10.43 ? 249  THR A OG1   1 
ATOM   2032 C  CG2   . THR A 1 249 ? 0.788   26.579  23.523  1.00 10.94 ? 249  THR A CG2   1 
ATOM   2033 N  N     . ARG A 1 250 ? 0.921   22.966  22.462  1.00 8.39  ? 250  ARG A N     1 
ATOM   2034 C  CA    . ARG A 1 250 ? 1.788   22.348  21.453  1.00 9.63  ? 250  ARG A CA    1 
ATOM   2035 C  C     . ARG A 1 250 ? 0.981   21.851  20.259  1.00 9.33  ? 250  ARG A C     1 
ATOM   2036 O  O     . ARG A 1 250 ? 1.426   21.959  19.114  1.00 11.03 ? 250  ARG A O     1 
ATOM   2037 C  CB    . ARG A 1 250 ? 2.610   21.187  22.032  1.00 10.07 ? 250  ARG A CB    1 
ATOM   2038 C  CG    . ARG A 1 250 ? 3.631   21.586  23.088  1.00 15.80 ? 250  ARG A CG    1 
ATOM   2039 C  CD    . ARG A 1 250 ? 4.583   22.641  22.562  1.00 22.06 ? 250  ARG A CD    1 
ATOM   2040 N  NE    . ARG A 1 250 ? 5.565   22.100  21.624  1.00 25.99 ? 250  ARG A NE    1 
ATOM   2041 C  CZ    . ARG A 1 250 ? 6.496   22.839  21.027  1.00 29.44 ? 250  ARG A CZ    1 
ATOM   2042 N  NH1   . ARG A 1 250 ? 6.554   24.144  21.267  1.00 21.12 ? 250  ARG A NH1   1 
ATOM   2043 N  NH2   . ARG A 1 250 ? 7.359   22.280  20.191  1.00 26.43 ? 250  ARG A NH2   1 
ATOM   2044 N  N     . MET A 1 251 ? -0.198  21.288  20.520  1.00 8.39  ? 251  MET A N     1 
ATOM   2045 C  CA    . MET A 1 251 ? -1.048  20.826  19.431  1.00 9.88  ? 251  MET A CA    1 
ATOM   2046 C  C     . MET A 1 251 ? -1.533  21.979  18.561  1.00 10.74 ? 251  MET A C     1 
ATOM   2047 O  O     . MET A 1 251 ? -1.873  21.776  17.396  1.00 11.01 ? 251  MET A O     1 
ATOM   2048 C  CB    . MET A 1 251 ? -2.257  20.066  19.976  1.00 9.96  ? 251  MET A CB    1 
ATOM   2049 C  CG    . MET A 1 251 ? -1.901  18.804  20.739  1.00 8.42  ? 251  MET A CG    1 
ATOM   2050 S  SD    . MET A 1 251 ? -3.424  17.958  21.215  1.00 12.36 ? 251  MET A SD    1 
ATOM   2051 C  CE    . MET A 1 251 ? -2.813  16.802  22.441  1.00 14.35 ? 251  MET A CE    1 
ATOM   2052 N  N     . LEU A 1 252 ? -1.572  23.180  19.133  1.00 8.79  ? 252  LEU A N     1 
ATOM   2053 C  CA    . LEU A 1 252 ? -2.022  24.368  18.409  1.00 11.05 ? 252  LEU A CA    1 
ATOM   2054 C  C     . LEU A 1 252 ? -0.862  25.199  17.852  1.00 9.06  ? 252  LEU A C     1 
ATOM   2055 O  O     . LEU A 1 252 ? -1.017  26.383  17.572  1.00 12.47 ? 252  LEU A O     1 
ATOM   2056 C  CB    . LEU A 1 252 ? -2.912  25.233  19.304  1.00 11.22 ? 252  LEU A CB    1 
ATOM   2057 C  CG    . LEU A 1 252 ? -4.212  24.542  19.719  1.00 9.70  ? 252  LEU A CG    1 
ATOM   2058 C  CD1   . LEU A 1 252 ? -4.992  25.391  20.712  1.00 10.79 ? 252  LEU A CD1   1 
ATOM   2059 C  CD2   . LEU A 1 252 ? -5.073  24.232  18.494  1.00 12.13 ? 252  LEU A CD2   1 
ATOM   2060 N  N     . ASN A 1 253 ? 0.294   24.571  17.678  1.00 9.90  ? 253  ASN A N     1 
ATOM   2061 C  CA    . ASN A 1 253 ? 1.419   25.254  17.050  1.00 9.24  ? 253  ASN A CA    1 
ATOM   2062 C  C     . ASN A 1 253 ? 1.124   25.527  15.572  1.00 11.05 ? 253  ASN A C     1 
ATOM   2063 O  O     . ASN A 1 253 ? 0.524   24.701  14.888  1.00 13.82 ? 253  ASN A O     1 
ATOM   2064 C  CB    . ASN A 1 253 ? 2.698   24.429  17.196  1.00 10.76 ? 253  ASN A CB    1 
ATOM   2065 C  CG    . ASN A 1 253 ? 3.952   25.272  17.039  1.00 14.78 ? 253  ASN A CG    1 
ATOM   2066 O  OD1   . ASN A 1 253 ? 4.320   25.670  15.929  1.00 16.12 ? 253  ASN A OD1   1 
ATOM   2067 N  ND2   . ASN A 1 253 ? 4.612   25.554  18.154  1.00 15.32 ? 253  ASN A ND2   1 
ATOM   2068 N  N     . LEU A 1 254 ? 1.540   26.694  15.083  1.00 12.27 ? 254  LEU A N     1 
ATOM   2069 C  CA    . LEU A 1 254 ? 1.328   27.044  13.679  1.00 14.23 ? 254  LEU A CA    1 
ATOM   2070 C  C     . LEU A 1 254 ? 2.062   26.099  12.725  1.00 16.54 ? 254  LEU A C     1 
ATOM   2071 O  O     . LEU A 1 254 ? 1.605   25.857  11.612  1.00 20.39 ? 254  LEU A O     1 
ATOM   2072 C  CB    . LEU A 1 254 ? 1.753   28.492  13.408  1.00 13.44 ? 254  LEU A CB    1 
ATOM   2073 C  CG    . LEU A 1 254 ? 0.848   29.561  14.017  1.00 15.83 ? 254  LEU A CG    1 
ATOM   2074 C  CD1   . LEU A 1 254 ? 1.439   30.954  13.797  1.00 17.64 ? 254  LEU A CD1   1 
ATOM   2075 C  CD2   . LEU A 1 254 ? -0.556  29.472  13.448  1.00 17.82 ? 254  LEU A CD2   1 
ATOM   2076 N  N     . LYS A 1 255 ? 3.203   25.583  13.164  1.00 14.82 ? 255  LYS A N     1 
ATOM   2077 C  CA    . LYS A 1 255 ? 3.996   24.650  12.369  1.00 15.12 ? 255  LYS A CA    1 
ATOM   2078 C  C     . LYS A 1 255 ? 3.561   23.217  12.645  1.00 17.84 ? 255  LYS A C     1 
ATOM   2079 O  O     . LYS A 1 255 ? 3.627   22.756  13.784  1.00 15.81 ? 255  LYS A O     1 
ATOM   2080 C  CB    . LYS A 1 255 ? 5.477   24.786  12.717  1.00 15.22 ? 255  LYS A CB    1 
ATOM   2081 C  CG    . LYS A 1 255 ? 6.054   26.171  12.508  1.00 23.22 ? 255  LYS A CG    1 
ATOM   2082 C  CD    . LYS A 1 255 ? 6.125   26.517  11.037  1.00 29.73 ? 255  LYS A CD    1 
ATOM   2083 C  CE    . LYS A 1 255 ? 6.885   27.822  10.824  1.00 39.21 ? 255  LYS A CE    1 
ATOM   2084 N  NZ    . LYS A 1 255 ? 6.990   28.169  9.379   1.00 43.60 ? 255  LYS A NZ    1 
ATOM   2085 N  N     . ASP A 1 256 ? 3.130   22.505  11.607  1.00 14.89 ? 256  ASP A N     1 
ATOM   2086 C  CA    . ASP A 1 256 ? 2.705   21.124  11.798  1.00 15.89 ? 256  ASP A CA    1 
ATOM   2087 C  C     . ASP A 1 256 ? 3.813   20.284  12.432  1.00 17.07 ? 256  ASP A C     1 
ATOM   2088 O  O     . ASP A 1 256 ? 3.546   19.432  13.277  1.00 15.26 ? 256  ASP A O     1 
ATOM   2089 C  CB    . ASP A 1 256 ? 2.168   20.497  10.497  1.00 15.14 ? 256  ASP A CB    1 
ATOM   2090 C  CG    . ASP A 1 256 ? 3.137   20.606  9.331   1.00 25.22 ? 256  ASP A CG    1 
ATOM   2091 O  OD1   . ASP A 1 256 ? 2.794   20.108  8.239   1.00 29.65 ? 256  ASP A OD1   1 
ATOM   2092 O  OD2   . ASP A 1 256 ? 4.229   21.186  9.489   1.00 24.40 ? 256  ASP A OD2   1 
ATOM   2093 N  N     . TYR A 1 257 ? 5.061   20.552  12.060  1.00 16.64 ? 257  TYR A N     1 
ATOM   2094 C  CA    . TYR A 1 257 ? 6.172   19.751  12.563  1.00 16.76 ? 257  TYR A CA    1 
ATOM   2095 C  C     . TYR A 1 257 ? 6.543   20.023  14.023  1.00 19.16 ? 257  TYR A C     1 
ATOM   2096 O  O     . TYR A 1 257 ? 7.329   19.281  14.606  1.00 21.82 ? 257  TYR A O     1 
ATOM   2097 C  CB    . TYR A 1 257 ? 7.400   19.852  11.649  1.00 18.16 ? 257  TYR A CB    1 
ATOM   2098 C  CG    . TYR A 1 257 ? 7.903   21.252  11.398  1.00 21.01 ? 257  TYR A CG    1 
ATOM   2099 C  CD1   . TYR A 1 257 ? 7.643   21.900  10.196  1.00 21.33 ? 257  TYR A CD1   1 
ATOM   2100 C  CD2   . TYR A 1 257 ? 8.651   21.921  12.352  1.00 21.01 ? 257  TYR A CD2   1 
ATOM   2101 C  CE1   . TYR A 1 257 ? 8.115   23.179  9.956   1.00 21.42 ? 257  TYR A CE1   1 
ATOM   2102 C  CE2   . TYR A 1 257 ? 9.127   23.199  12.119  1.00 21.43 ? 257  TYR A CE2   1 
ATOM   2103 C  CZ    . TYR A 1 257 ? 8.852   23.822  10.923  1.00 23.12 ? 257  TYR A CZ    1 
ATOM   2104 O  OH    . TYR A 1 257 ? 9.328   25.093  10.689  1.00 25.28 ? 257  TYR A OH    1 
ATOM   2105 N  N     . HIS A 1 258 ? 5.972   21.068  14.618  1.00 14.26 ? 258  HIS A N     1 
ATOM   2106 C  CA    . HIS A 1 258 ? 6.165   21.307  16.047  1.00 14.05 ? 258  HIS A CA    1 
ATOM   2107 C  C     . HIS A 1 258 ? 5.066   20.669  16.891  1.00 14.89 ? 258  HIS A C     1 
ATOM   2108 O  O     . HIS A 1 258 ? 5.216   20.518  18.103  1.00 16.50 ? 258  HIS A O     1 
ATOM   2109 C  CB    . HIS A 1 258 ? 6.228   22.801  16.369  1.00 14.80 ? 258  HIS A CB    1 
ATOM   2110 C  CG    . HIS A 1 258 ? 7.485   23.473  15.911  1.00 16.51 ? 258  HIS A CG    1 
ATOM   2111 N  ND1   . HIS A 1 258 ? 8.686   22.808  15.784  1.00 17.15 ? 258  HIS A ND1   1 
ATOM   2112 C  CD2   . HIS A 1 258 ? 7.726   24.759  15.568  1.00 16.22 ? 258  HIS A CD2   1 
ATOM   2113 C  CE1   . HIS A 1 258 ? 9.613   23.659  15.374  1.00 15.92 ? 258  HIS A CE1   1 
ATOM   2114 N  NE2   . HIS A 1 258 ? 9.056   24.848  15.235  1.00 15.37 ? 258  HIS A NE2   1 
ATOM   2115 N  N     . ARG A 1 259 ? 3.952   20.308  16.260  1.00 11.78 ? 259  ARG A N     1 
ATOM   2116 C  CA    . ARG A 1 259 ? 2.889   19.628  16.996  1.00 10.74 ? 259  ARG A CA    1 
ATOM   2117 C  C     . ARG A 1 259 ? 3.327   18.216  17.340  1.00 12.76 ? 259  ARG A C     1 
ATOM   2118 O  O     . ARG A 1 259 ? 4.043   17.583  16.568  1.00 13.94 ? 259  ARG A O     1 
ATOM   2119 C  CB    . ARG A 1 259 ? 1.600   19.573  16.169  1.00 12.13 ? 259  ARG A CB    1 
ATOM   2120 C  CG    . ARG A 1 259 ? 1.085   20.937  15.761  1.00 11.35 ? 259  ARG A CG    1 
ATOM   2121 C  CD    . ARG A 1 259 ? -0.082  20.839  14.773  1.00 10.81 ? 259  ARG A CD    1 
ATOM   2122 N  NE    . ARG A 1 259 ? -0.192  22.095  14.040  1.00 13.80 ? 259  ARG A NE    1 
ATOM   2123 C  CZ    . ARG A 1 259 ? -0.638  22.204  12.794  1.00 13.43 ? 259  ARG A CZ    1 
ATOM   2124 N  NH1   . ARG A 1 259 ? -1.056  21.129  12.140  1.00 13.64 ? 259  ARG A NH1   1 
ATOM   2125 N  NH2   . ARG A 1 259 ? -0.667  23.393  12.207  1.00 14.49 ? 259  ARG A NH2   1 
ATOM   2126 N  N     . PRO A 1 260 ? 2.890   17.706  18.498  1.00 10.55 ? 260  PRO A N     1 
ATOM   2127 C  CA    . PRO A 1 260 ? 3.317   16.351  18.861  1.00 14.24 ? 260  PRO A CA    1 
ATOM   2128 C  C     . PRO A 1 260 ? 2.656   15.287  17.993  1.00 11.74 ? 260  PRO A C     1 
ATOM   2129 O  O     . PRO A 1 260 ? 1.496   15.435  17.603  1.00 11.97 ? 260  PRO A O     1 
ATOM   2130 C  CB    . PRO A 1 260 ? 2.836   16.203  20.305  1.00 11.73 ? 260  PRO A CB    1 
ATOM   2131 C  CG    . PRO A 1 260 ? 1.667   17.138  20.412  1.00 14.70 ? 260  PRO A CG    1 
ATOM   2132 C  CD    . PRO A 1 260 ? 1.965   18.296  19.483  1.00 12.51 ? 260  PRO A CD    1 
ATOM   2133 N  N     . SER A 1 261 ? 3.396   14.227  17.694  1.00 11.17 ? 261  SER A N     1 
ATOM   2134 C  CA    . SER A 1 261 ? 2.815   13.066  17.044  1.00 12.74 ? 261  SER A CA    1 
ATOM   2135 C  C     . SER A 1 261 ? 1.922   12.315  18.023  1.00 11.03 ? 261  SER A C     1 
ATOM   2136 O  O     . SER A 1 261 ? 1.937   12.580  19.228  1.00 12.42 ? 261  SER A O     1 
ATOM   2137 C  CB    . SER A 1 261 ? 3.923   12.124  16.579  1.00 15.43 ? 261  SER A CB    1 
ATOM   2138 O  OG    . SER A 1 261 ? 4.655   11.647  17.697  1.00 15.57 ? 261  SER A OG    1 
ATOM   2139 N  N     . VAL A 1 262 ? 1.152   11.366  17.504  1.00 12.38 ? 262  VAL A N     1 
ATOM   2140 C  CA    . VAL A 1 262 ? 0.378   10.483  18.360  1.00 12.33 ? 262  VAL A CA    1 
ATOM   2141 C  C     . VAL A 1 262 ? 1.281   9.835   19.405  1.00 13.32 ? 262  VAL A C     1 
ATOM   2142 O  O     . VAL A 1 262 ? 0.947   9.784   20.590  1.00 13.43 ? 262  VAL A O     1 
ATOM   2143 C  CB    . VAL A 1 262 ? -0.309  9.393   17.531  1.00 16.06 ? 262  VAL A CB    1 
ATOM   2144 C  CG1   . VAL A 1 262 ? -0.638  8.187   18.401  1.00 21.67 ? 262  VAL A CG1   1 
ATOM   2145 C  CG2   . VAL A 1 262 ? -1.542  9.962   16.852  1.00 17.97 ? 262  VAL A CG2   1 
ATOM   2146 N  N     . GLU A 1 263 ? 2.439   9.354   18.962  1.00 13.99 ? 263  GLU A N     1 
ATOM   2147 C  CA    . GLU A 1 263 ? 3.374   8.694   19.860  1.00 15.15 ? 263  GLU A CA    1 
ATOM   2148 C  C     . GLU A 1 263 ? 3.848   9.648   20.959  1.00 15.96 ? 263  GLU A C     1 
ATOM   2149 O  O     . GLU A 1 263 ? 3.878   9.289   22.137  1.00 15.93 ? 263  GLU A O     1 
ATOM   2150 C  CB    . GLU A 1 263 ? 4.554   8.123   19.068  1.00 17.72 ? 263  GLU A CB    1 
ATOM   2151 C  CG    . GLU A 1 263 ? 4.169   6.948   18.160  1.00 26.06 ? 263  GLU A CG    1 
ATOM   2152 C  CD    . GLU A 1 263 ? 3.387   7.367   16.913  1.00 27.51 ? 263  GLU A CD    1 
ATOM   2153 O  OE1   . GLU A 1 263 ? 2.705   6.497   16.326  1.00 31.57 ? 263  GLU A OE1   1 
ATOM   2154 O  OE2   . GLU A 1 263 ? 3.459   8.551   16.510  1.00 22.74 ? 263  GLU A OE2   1 
ATOM   2155 N  N     . GLU A 1 264 ? 4.194   10.873  20.574  1.00 12.20 ? 264  GLU A N     1 
ATOM   2156 C  CA    . GLU A 1 264 ? 4.650   11.875  21.536  1.00 11.38 ? 264  GLU A CA    1 
ATOM   2157 C  C     . GLU A 1 264 ? 3.558   12.278  22.528  1.00 12.21 ? 264  GLU A C     1 
ATOM   2158 O  O     . GLU A 1 264 ? 3.834   12.524  23.697  1.00 14.69 ? 264  GLU A O     1 
ATOM   2159 C  CB    . GLU A 1 264 ? 5.213   13.105  20.809  1.00 12.09 ? 264  GLU A CB    1 
ATOM   2160 C  CG    . GLU A 1 264 ? 6.569   12.819  20.144  1.00 14.19 ? 264  GLU A CG    1 
ATOM   2161 C  CD    . GLU A 1 264 ? 7.012   13.895  19.168  1.00 25.76 ? 264  GLU A CD    1 
ATOM   2162 O  OE1   . GLU A 1 264 ? 8.236   14.036  18.963  1.00 27.95 ? 264  GLU A OE1   1 
ATOM   2163 O  OE2   . GLU A 1 264 ? 6.154   14.597  18.600  1.00 19.02 ? 264  GLU A OE2   1 
ATOM   2164 N  N     . ILE A 1 265 ? 2.314   12.349  22.069  1.00 10.16 ? 265  ILE A N     1 
ATOM   2165 C  CA    . ILE A 1 265 ? 1.218   12.630  22.990  1.00 9.73  ? 265  ILE A CA    1 
ATOM   2166 C  C     . ILE A 1 265 ? 1.118   11.542  24.053  1.00 9.37  ? 265  ILE A C     1 
ATOM   2167 O  O     . ILE A 1 265 ? 1.049   11.829  25.252  1.00 9.84  ? 265  ILE A O     1 
ATOM   2168 C  CB    . ILE A 1 265 ? -0.127  12.763  22.231  1.00 9.19  ? 265  ILE A CB    1 
ATOM   2169 C  CG1   . ILE A 1 265 ? -0.133  14.045  21.400  1.00 9.40  ? 265  ILE A CG1   1 
ATOM   2170 C  CG2   . ILE A 1 265 ? -1.315  12.773  23.206  1.00 9.30  ? 265  ILE A CG2   1 
ATOM   2171 C  CD1   . ILE A 1 265 ? -1.274  14.100  20.372  1.00 13.47 ? 265  ILE A CD1   1 
ATOM   2172 N  N     . LEU A 1 266 ? 1.121   10.288  23.608  1.00 10.58 ? 266  LEU A N     1 
ATOM   2173 C  CA    . LEU A 1 266 ? 0.885   9.169   24.513  1.00 10.82 ? 266  LEU A CA    1 
ATOM   2174 C  C     . LEU A 1 266 ? 2.034   8.954   25.504  1.00 12.14 ? 266  LEU A C     1 
ATOM   2175 O  O     . LEU A 1 266 ? 1.843   8.337   26.552  1.00 13.08 ? 266  LEU A O     1 
ATOM   2176 C  CB    . LEU A 1 266 ? 0.596   7.892   23.727  1.00 12.30 ? 266  LEU A CB    1 
ATOM   2177 C  CG    . LEU A 1 266 ? -0.692  7.963   22.904  1.00 11.47 ? 266  LEU A CG    1 
ATOM   2178 C  CD1   . LEU A 1 266 ? -0.779  6.774   21.958  1.00 15.00 ? 266  LEU A CD1   1 
ATOM   2179 C  CD2   . LEU A 1 266 ? -1.917  8.044   23.819  1.00 10.77 ? 266  LEU A CD2   1 
ATOM   2180 N  N     . GLU A 1 267 ? 3.208   9.489   25.186  1.00 10.77 ? 267  GLU A N     1 
ATOM   2181 C  CA    . GLU A 1 267 ? 4.358   9.422   26.091  1.00 13.98 ? 267  GLU A CA    1 
ATOM   2182 C  C     . GLU A 1 267 ? 4.279   10.462  27.205  1.00 12.70 ? 267  GLU A C     1 
ATOM   2183 O  O     . GLU A 1 267 ? 5.084   10.454  28.140  1.00 12.99 ? 267  GLU A O     1 
ATOM   2184 C  CB    . GLU A 1 267 ? 5.669   9.607   25.319  1.00 18.57 ? 267  GLU A CB    1 
ATOM   2185 C  CG    . GLU A 1 267 ? 6.010   8.485   24.354  1.00 28.11 ? 267  GLU A CG    1 
ATOM   2186 C  CD    . GLU A 1 267 ? 7.215   8.818   23.486  1.00 45.74 ? 267  GLU A CD    1 
ATOM   2187 O  OE1   . GLU A 1 267 ? 7.637   9.998   23.473  1.00 43.75 ? 267  GLU A OE1   1 
ATOM   2188 O  OE2   . GLU A 1 267 ? 7.738   7.900   22.816  1.00 48.76 ? 267  GLU A OE2   1 
ATOM   2189 N  N     . ASN A 1 268 ? 3.308   11.363  27.118  1.00 12.65 ? 268  ASN A N     1 
ATOM   2190 C  CA    . ASN A 1 268 ? 3.222   12.436  28.100  1.00 11.01 ? 268  ASN A CA    1 
ATOM   2191 C  C     . ASN A 1 268 ? 2.954   11.885  29.497  1.00 11.16 ? 268  ASN A C     1 
ATOM   2192 O  O     . ASN A 1 268 ? 2.094   11.028  29.670  1.00 11.00 ? 268  ASN A O     1 
ATOM   2193 C  CB    . ASN A 1 268 ? 2.151   13.455  27.701  1.00 10.43 ? 268  ASN A CB    1 
ATOM   2194 C  CG    . ASN A 1 268 ? 2.261   14.747  28.494  1.00 12.70 ? 268  ASN A CG    1 
ATOM   2195 O  OD1   . ASN A 1 268 ? 1.947   14.789  29.684  1.00 12.00 ? 268  ASN A OD1   1 
ATOM   2196 N  ND2   . ASN A 1 268 ? 2.710   15.808  27.834  1.00 13.07 ? 268  ASN A ND2   1 
ATOM   2197 N  N     . PRO A 1 269 ? 3.707   12.359  30.500  1.00 10.74 ? 269  PRO A N     1 
ATOM   2198 C  CA    . PRO A 1 269 ? 3.521   11.840  31.861  1.00 14.00 ? 269  PRO A CA    1 
ATOM   2199 C  C     . PRO A 1 269 ? 2.105   12.000  32.417  1.00 11.22 ? 269  PRO A C     1 
ATOM   2200 O  O     . PRO A 1 269 ? 1.750   11.276  33.350  1.00 13.75 ? 269  PRO A O     1 
ATOM   2201 C  CB    . PRO A 1 269 ? 4.531   12.651  32.683  1.00 15.52 ? 269  PRO A CB    1 
ATOM   2202 C  CG    . PRO A 1 269 ? 5.607   12.985  31.704  1.00 16.06 ? 269  PRO A CG    1 
ATOM   2203 C  CD    . PRO A 1 269 ? 4.907   13.207  30.387  1.00 13.48 ? 269  PRO A CD    1 
ATOM   2204 N  N     . LEU A 1 270 ? 1.310   12.915  31.863  1.00 10.21 ? 270  LEU A N     1 
ATOM   2205 C  CA    . LEU A 1 270 ? -0.089  13.062  32.271  1.00 9.28  ? 270  LEU A CA    1 
ATOM   2206 C  C     . LEU A 1 270 ? -0.919  11.799  32.041  1.00 9.60  ? 270  LEU A C     1 
ATOM   2207 O  O     . LEU A 1 270 ? -1.894  11.549  32.750  1.00 11.40 ? 270  LEU A O     1 
ATOM   2208 C  CB    . LEU A 1 270 ? -0.758  14.200  31.501  1.00 11.24 ? 270  LEU A CB    1 
ATOM   2209 C  CG    . LEU A 1 270 ? -0.469  15.655  31.869  1.00 12.33 ? 270  LEU A CG    1 
ATOM   2210 C  CD1   . LEU A 1 270 ? -0.900  16.573  30.738  1.00 18.47 ? 270  LEU A CD1   1 
ATOM   2211 C  CD2   . LEU A 1 270 ? -1.163  16.030  33.171  1.00 14.13 ? 270  LEU A CD2   1 
ATOM   2212 N  N     . ILE A 1 271 ? -0.563  11.041  31.010  1.00 8.91  ? 271  ILE A N     1 
ATOM   2213 C  CA    . ILE A 1 271 ? -1.436  9.970   30.528  1.00 9.88  ? 271  ILE A CA    1 
ATOM   2214 C  C     . ILE A 1 271 ? -1.122  8.645   31.210  1.00 9.22  ? 271  ILE A C     1 
ATOM   2215 O  O     . ILE A 1 271 ? -0.004  8.142   31.125  1.00 11.17 ? 271  ILE A O     1 
ATOM   2216 C  CB    . ILE A 1 271 ? -1.347  9.846   28.996  1.00 8.78  ? 271  ILE A CB    1 
ATOM   2217 C  CG1   . ILE A 1 271 ? -2.018  11.067  28.359  1.00 10.96 ? 271  ILE A CG1   1 
ATOM   2218 C  CG2   . ILE A 1 271 ? -2.021  8.562   28.510  1.00 10.79 ? 271  ILE A CG2   1 
ATOM   2219 C  CD1   . ILE A 1 271 ? -1.939  11.103  26.830  1.00 13.67 ? 271  ILE A CD1   1 
ATOM   2220 N  N     . LEU A 1 272 ? -2.126  8.103   31.891  1.00 8.20  ? 272  LEU A N     1 
ATOM   2221 C  CA    . LEU A 1 272 ? -1.961  6.886   32.674  1.00 8.70  ? 272  LEU A CA    1 
ATOM   2222 C  C     . LEU A 1 272 ? -2.960  5.815   32.250  1.00 9.77  ? 272  LEU A C     1 
ATOM   2223 O  O     . LEU A 1 272 ? -3.886  6.086   31.468  1.00 9.16  ? 272  LEU A O     1 
ATOM   2224 C  CB    . LEU A 1 272 ? -2.117  7.217   34.166  1.00 8.18  ? 272  LEU A CB    1 
ATOM   2225 C  CG    . LEU A 1 272 ? -1.131  8.271   34.675  1.00 10.29 ? 272  LEU A CG    1 
ATOM   2226 C  CD1   . LEU A 1 272 ? -1.490  8.719   36.085  1.00 14.52 ? 272  LEU A CD1   1 
ATOM   2227 C  CD2   . LEU A 1 272 ? 0.288   7.723   34.634  1.00 11.59 ? 272  LEU A CD2   1 
ATOM   2228 N  N     . GLU A 1 273 ? -2.771  4.591   32.750  1.00 8.95  ? 273  GLU A N     1 
ATOM   2229 C  CA    . GLU A 1 273 ? -3.644  3.479   32.356  1.00 9.16  ? 273  GLU A CA    1 
ATOM   2230 C  C     . GLU A 1 273 ? -5.124  3.801   32.524  1.00 8.17  ? 273  GLU A C     1 
ATOM   2231 O  O     . GLU A 1 273 ? -5.927  3.529   31.627  1.00 7.96  ? 273  GLU A O     1 
ATOM   2232 C  CB    . GLU A 1 273 ? -3.289  2.196   33.127  1.00 9.94  ? 273  GLU A CB    1 
ATOM   2233 C  CG    . GLU A 1 273 ? -3.770  0.889   32.441  1.00 9.44  ? 273  GLU A CG    1 
ATOM   2234 C  CD    . GLU A 1 273 ? -5.273  0.635   32.527  1.00 9.60  ? 273  GLU A CD    1 
ATOM   2235 O  OE1   . GLU A 1 273 ? -5.794  -0.070  31.636  1.00 11.29 ? 273  GLU A OE1   1 
ATOM   2236 O  OE2   . GLU A 1 273 ? -5.936  1.121   33.475  1.00 10.96 ? 273  GLU A OE2   1 
ATOM   2237 N  N     . HIS A 1 274 ? -5.489  4.386   33.662  1.00 9.45  ? 274  HIS A N     1 
ATOM   2238 C  CA    . HIS A 1 274 ? -6.903  4.642   33.940  1.00 10.39 ? 274  HIS A CA    1 
ATOM   2239 C  C     . HIS A 1 274 ? -7.569  5.625   32.971  1.00 10.36 ? 274  HIS A C     1 
ATOM   2240 O  O     . HIS A 1 274 ? -8.793  5.670   32.890  1.00 10.49 ? 274  HIS A O     1 
ATOM   2241 C  CB    . HIS A 1 274 ? -7.131  5.048   35.402  1.00 8.85  ? 274  HIS A CB    1 
ATOM   2242 C  CG    . HIS A 1 274 ? -6.714  6.448   35.723  1.00 10.50 ? 274  HIS A CG    1 
ATOM   2243 N  ND1   . HIS A 1 274 ? -5.397  6.803   35.907  1.00 9.29  ? 274  HIS A ND1   1 
ATOM   2244 C  CD2   . HIS A 1 274 ? -7.441  7.574   35.917  1.00 10.29 ? 274  HIS A CD2   1 
ATOM   2245 C  CE1   . HIS A 1 274 ? -5.325  8.094   36.186  1.00 9.98  ? 274  HIS A CE1   1 
ATOM   2246 N  NE2   . HIS A 1 274 ? -6.552  8.585   36.201  1.00 10.30 ? 274  HIS A NE2   1 
ATOM   2247 N  N     . HIS A 1 275 ? -6.770  6.380   32.217  1.00 8.76  ? 275  HIS A N     1 
ATOM   2248 C  CA    . HIS A 1 275 ? -7.332  7.303   31.217  1.00 7.83  ? 275  HIS A CA    1 
ATOM   2249 C  C     . HIS A 1 275 ? -7.712  6.589   29.930  1.00 8.73  ? 275  HIS A C     1 
ATOM   2250 O  O     . HIS A 1 275 ? -8.369  7.177   29.074  1.00 9.15  ? 275  HIS A O     1 
ATOM   2251 C  CB    . HIS A 1 275 ? -6.347  8.426   30.880  1.00 8.00  ? 275  HIS A CB    1 
ATOM   2252 C  CG    . HIS A 1 275 ? -6.012  9.311   32.039  1.00 8.75  ? 275  HIS A CG    1 
ATOM   2253 N  ND1   . HIS A 1 275 ? -4.723  9.478   32.491  1.00 9.55  ? 275  HIS A ND1   1 
ATOM   2254 C  CD2   . HIS A 1 275 ? -6.794  10.087  32.830  1.00 8.40  ? 275  HIS A CD2   1 
ATOM   2255 C  CE1   . HIS A 1 275 ? -4.724  10.315  33.515  1.00 9.00  ? 275  HIS A CE1   1 
ATOM   2256 N  NE2   . HIS A 1 275 ? -5.968  10.698  33.742  1.00 8.46  ? 275  HIS A NE2   1 
ATOM   2257 N  N     . HIS A 1 276 ? -7.288  5.328   29.798  1.00 9.38  ? 276  HIS A N     1 
ATOM   2258 C  CA    . HIS A 1 276 ? -7.594  4.512   28.624  1.00 9.28  ? 276  HIS A CA    1 
ATOM   2259 C  C     . HIS A 1 276 ? -8.962  3.843   28.781  1.00 7.89  ? 276  HIS A C     1 
ATOM   2260 O  O     . HIS A 1 276 ? -9.610  3.961   29.823  1.00 8.75  ? 276  HIS A O     1 
ATOM   2261 C  CB    . HIS A 1 276 ? -6.516  3.433   28.431  1.00 9.03  ? 276  HIS A CB    1 
ATOM   2262 C  CG    . HIS A 1 276 ? -5.163  3.976   28.078  1.00 6.51  ? 276  HIS A CG    1 
ATOM   2263 N  ND1   . HIS A 1 276 ? -4.371  4.659   28.978  1.00 8.42  ? 276  HIS A ND1   1 
ATOM   2264 C  CD2   . HIS A 1 276 ? -4.447  3.899   26.931  1.00 7.98  ? 276  HIS A CD2   1 
ATOM   2265 C  CE1   . HIS A 1 276 ? -3.233  4.996   28.395  1.00 9.37  ? 276  HIS A CE1   1 
ATOM   2266 N  NE2   . HIS A 1 276 ? -3.253  4.547   27.153  1.00 8.48  ? 276  HIS A NE2   1 
ATOM   2267 N  N     . HIS A 1 277 ? -9.402  3.133   27.750  1.00 8.74  ? 277  HIS A N     1 
ATOM   2268 C  CA    . HIS A 1 277 ? -10.706 2.479   27.805  1.00 11.44 ? 277  HIS A CA    1 
ATOM   2269 C  C     . HIS A 1 277 ? -10.732 1.316   28.791  1.00 10.30 ? 277  HIS A C     1 
ATOM   2270 O  O     . HIS A 1 277 ? -9.713  0.669   29.045  1.00 10.97 ? 277  HIS A O     1 
ATOM   2271 C  CB    . HIS A 1 277 ? -11.133 1.981   26.420  1.00 9.11  ? 277  HIS A CB    1 
ATOM   2272 C  CG    . HIS A 1 277 ? -10.485 0.696   26.014  1.00 8.96  ? 277  HIS A CG    1 
ATOM   2273 N  ND1   . HIS A 1 277 ? -11.054 -0.538  26.251  1.00 14.01 ? 277  HIS A ND1   1 
ATOM   2274 C  CD2   . HIS A 1 277 ? -9.307  0.455   25.393  1.00 10.96 ? 277  HIS A CD2   1 
ATOM   2275 C  CE1   . HIS A 1 277 ? -10.251 -1.484  25.794  1.00 13.06 ? 277  HIS A CE1   1 
ATOM   2276 N  NE2   . HIS A 1 277 ? -9.187  -0.907  25.265  1.00 14.55 ? 277  HIS A NE2   1 
ATOM   2277 N  N     . HIS A 1 278 ? -11.914 1.062   29.343  1.00 8.66  ? 278  HIS A N     1 
ATOM   2278 C  CA    . HIS A 1 278 ? -12.165 -0.127  30.155  1.00 9.74  ? 278  HIS A CA    1 
ATOM   2279 C  C     . HIS A 1 278 ? -13.565 -0.589  29.841  1.00 13.36 ? 278  HIS A C     1 
ATOM   2280 O  O     . HIS A 1 278 ? -14.530 0.138   30.056  1.00 14.36 ? 278  HIS A O     1 
ATOM   2281 C  CB    . HIS A 1 278 ? -12.031 0.187   31.641  1.00 11.57 ? 278  HIS A CB    1 
ATOM   2282 C  CG    . HIS A 1 278 ? -10.701 0.757   32.008  1.00 9.61  ? 278  HIS A CG    1 
ATOM   2283 N  ND1   . HIS A 1 278 ? -10.384 2.084   31.809  1.00 8.54  ? 278  HIS A ND1   1 
ATOM   2284 C  CD2   . HIS A 1 278 ? -9.595  0.177   32.534  1.00 11.44 ? 278  HIS A CD2   1 
ATOM   2285 C  CE1   . HIS A 1 278 ? -9.141  2.300   32.209  1.00 8.50  ? 278  HIS A CE1   1 
ATOM   2286 N  NE2   . HIS A 1 278 ? -8.639  1.157   32.645  1.00 12.04 ? 278  HIS A NE2   1 
ATOM   2287 N  N     . HIS A 1 279 ? -13.692 -1.790  29.303  1.00 15.02 ? 279  HIS A N     1 
ATOM   2288 C  CA    . HIS A 1 279 ? -15.013 -2.204  28.860  1.00 16.48 ? 279  HIS A CA    1 
ATOM   2289 C  C     . HIS A 1 279 ? -15.624 -3.238  29.792  1.00 29.55 ? 279  HIS A C     1 
ATOM   2290 O  O     . HIS A 1 279 ? -16.767 -3.651  29.608  1.00 25.27 ? 279  HIS A O     1 
ATOM   2291 C  CB    . HIS A 1 279 ? -14.988 -2.646  27.393  1.00 21.70 ? 279  HIS A CB    1 
ATOM   2292 C  CG    . HIS A 1 279 ? -15.053 -1.504  26.421  1.00 22.65 ? 279  HIS A CG    1 
ATOM   2293 N  ND1   . HIS A 1 279 ? -13.966 -0.706  26.126  1.00 20.47 ? 279  HIS A ND1   1 
ATOM   2294 C  CD2   . HIS A 1 279 ? -16.082 -1.020  25.684  1.00 27.06 ? 279  HIS A CD2   1 
ATOM   2295 C  CE1   . HIS A 1 279 ? -14.321 0.211   25.242  1.00 18.19 ? 279  HIS A CE1   1 
ATOM   2296 N  NE2   . HIS A 1 279 ? -15.601 0.043   24.959  1.00 27.11 ? 279  HIS A NE2   1 
ATOM   2297 O  OXT   . HIS A 1 279 ? -14.998 -3.646  30.772  1.00 32.71 ? 279  HIS A OXT   1 
HETATM 2298 P  PB    . ADP B 2 .   ? -25.437 14.110  12.114  1.00 25.93 ? 1280 ADP A PB    1 
HETATM 2299 O  O1B   . ADP B 2 .   ? -25.587 15.073  13.261  1.00 32.20 ? 1280 ADP A O1B   1 
HETATM 2300 O  O2B   . ADP B 2 .   ? -24.029 13.627  11.931  1.00 27.64 ? 1280 ADP A O2B   1 
HETATM 2301 O  O3B   . ADP B 2 .   ? -26.049 14.557  10.811  1.00 30.61 ? 1280 ADP A O3B   1 
HETATM 2302 P  PA    . ADP B 2 .   ? -26.189 11.777  13.724  1.00 20.90 ? 1280 ADP A PA    1 
HETATM 2303 O  O1A   . ADP B 2 .   ? -24.739 11.491  13.994  1.00 22.09 ? 1280 ADP A O1A   1 
HETATM 2304 O  O2A   . ADP B 2 .   ? -27.116 10.631  13.376  1.00 22.90 ? 1280 ADP A O2A   1 
HETATM 2305 O  O3A   . ADP B 2 .   ? -26.313 12.798  12.472  1.00 21.17 ? 1280 ADP A O3A   1 
HETATM 2306 O  "O5'" . ADP B 2 .   ? -26.794 12.477  15.042  1.00 16.52 ? 1280 ADP A "O5'" 1 
HETATM 2307 C  "C5'" . ADP B 2 .   ? -28.199 12.515  15.328  1.00 14.77 ? 1280 ADP A "C5'" 1 
HETATM 2308 C  "C4'" . ADP B 2 .   ? -28.394 12.423  16.841  1.00 14.13 ? 1280 ADP A "C4'" 1 
HETATM 2309 O  "O4'" . ADP B 2 .   ? -28.058 11.108  17.301  1.00 15.35 ? 1280 ADP A "O4'" 1 
HETATM 2310 C  "C3'" . ADP B 2 .   ? -27.487 13.381  17.591  1.00 16.57 ? 1280 ADP A "C3'" 1 
HETATM 2311 O  "O3'" . ADP B 2 .   ? -28.190 13.823  18.754  1.00 18.87 ? 1280 ADP A "O3'" 1 
HETATM 2312 C  "C2'" . ADP B 2 .   ? -26.323 12.516  18.036  1.00 15.43 ? 1280 ADP A "C2'" 1 
HETATM 2313 O  "O2'" . ADP B 2 .   ? -25.740 12.990  19.251  1.00 16.51 ? 1280 ADP A "O2'" 1 
HETATM 2314 C  "C1'" . ADP B 2 .   ? -26.986 11.170  18.252  1.00 14.74 ? 1280 ADP A "C1'" 1 
HETATM 2315 N  N9    . ADP B 2 .   ? -26.106 10.013  17.987  1.00 13.43 ? 1280 ADP A N9    1 
HETATM 2316 C  C8    . ADP B 2 .   ? -25.436 9.754   16.845  1.00 16.98 ? 1280 ADP A C8    1 
HETATM 2317 N  N7    . ADP B 2 .   ? -24.750 8.586   16.939  1.00 16.32 ? 1280 ADP A N7    1 
HETATM 2318 C  C5    . ADP B 2 .   ? -25.003 8.070   18.160  1.00 12.32 ? 1280 ADP A C5    1 
HETATM 2319 C  C6    . ADP B 2 .   ? -24.604 6.858   18.907  1.00 12.06 ? 1280 ADP A C6    1 
HETATM 2320 N  N6    . ADP B 2 .   ? -23.779 5.935   18.355  1.00 13.16 ? 1280 ADP A N6    1 
HETATM 2321 N  N1    . ADP B 2 .   ? -25.075 6.708   20.164  1.00 13.14 ? 1280 ADP A N1    1 
HETATM 2322 C  C2    . ADP B 2 .   ? -25.894 7.618   20.721  1.00 13.39 ? 1280 ADP A C2    1 
HETATM 2323 N  N3    . ADP B 2 .   ? -26.298 8.746   20.107  1.00 14.36 ? 1280 ADP A N3    1 
HETATM 2324 C  C4    . ADP B 2 .   ? -25.890 9.018   18.845  1.00 13.12 ? 1280 ADP A C4    1 
HETATM 2325 MG MG    . MG  C 3 .   ? -22.905 11.936  12.810  1.00 25.09 ? 1281 MG  A MG    1 
HETATM 2326 C  C1    . EDO D 4 .   ? -15.022 2.433   34.652  1.00 17.00 ? 1282 EDO A C1    1 
HETATM 2327 O  O1    . EDO D 4 .   ? -15.317 1.789   33.405  1.00 19.34 ? 1282 EDO A O1    1 
HETATM 2328 C  C2    . EDO D 4 .   ? -13.549 2.838   34.690  1.00 17.21 ? 1282 EDO A C2    1 
HETATM 2329 O  O2    . EDO D 4 .   ? -13.315 3.976   33.847  1.00 18.02 ? 1282 EDO A O2    1 
HETATM 2330 C  C1    . EDO E 4 .   ? -14.396 6.843   12.224  1.00 33.97 ? 1283 EDO A C1    1 
HETATM 2331 O  O1    . EDO E 4 .   ? -15.519 6.160   11.650  1.00 36.24 ? 1283 EDO A O1    1 
HETATM 2332 C  C2    . EDO E 4 .   ? -13.601 7.543   11.127  1.00 32.45 ? 1283 EDO A C2    1 
HETATM 2333 O  O2    . EDO E 4 .   ? -14.326 8.690   10.667  1.00 31.76 ? 1283 EDO A O2    1 
HETATM 2334 C  C1    . EDO F 4 .   ? 0.321   29.470  36.033  1.00 32.27 ? 1284 EDO A C1    1 
HETATM 2335 O  O1    . EDO F 4 .   ? -0.612  28.540  35.459  1.00 25.88 ? 1284 EDO A O1    1 
HETATM 2336 C  C2    . EDO F 4 .   ? 1.550   29.628  35.137  1.00 25.32 ? 1284 EDO A C2    1 
HETATM 2337 O  O2    . EDO F 4 .   ? 1.192   30.149  33.843  1.00 14.55 ? 1284 EDO A O2    1 
HETATM 2338 C  C1    . EDO G 4 .   ? 4.433   16.036  24.246  1.00 36.78 ? 1285 EDO A C1    1 
HETATM 2339 O  O1    . EDO G 4 .   ? 3.580   15.210  25.055  1.00 25.12 ? 1285 EDO A O1    1 
HETATM 2340 C  C2    . EDO G 4 .   ? 3.982   17.492  24.305  1.00 39.11 ? 1285 EDO A C2    1 
HETATM 2341 O  O2    . EDO G 4 .   ? 4.226   18.027  25.612  1.00 44.86 ? 1285 EDO A O2    1 
HETATM 2342 O  O     . HOH H 5 .   ? -38.200 -0.360  9.712   1.00 53.78 ? 2001 HOH A O     1 
HETATM 2343 O  O     . HOH H 5 .   ? -39.431 -11.388 10.818  1.00 42.31 ? 2002 HOH A O     1 
HETATM 2344 O  O     . HOH H 5 .   ? -29.722 -10.193 14.138  1.00 46.02 ? 2003 HOH A O     1 
HETATM 2345 O  O     . HOH H 5 .   ? -38.062 -2.791  12.353  1.00 22.19 ? 2004 HOH A O     1 
HETATM 2346 O  O     . HOH H 5 .   ? -35.915 -5.143  5.849   1.00 43.75 ? 2005 HOH A O     1 
HETATM 2347 O  O     . HOH H 5 .   ? -38.989 -10.411 13.804  1.00 51.48 ? 2006 HOH A O     1 
HETATM 2348 O  O     . HOH H 5 .   ? -38.946 12.742  13.654  1.00 50.48 ? 2007 HOH A O     1 
HETATM 2349 O  O     . HOH H 5 .   ? -32.387 -10.148 16.112  1.00 26.67 ? 2008 HOH A O     1 
HETATM 2350 O  O     . HOH H 5 .   ? -34.181 -11.922 15.086  1.00 33.62 ? 2009 HOH A O     1 
HETATM 2351 O  O     . HOH H 5 .   ? -26.955 10.434  -13.778 1.00 46.74 ? 2010 HOH A O     1 
HETATM 2352 O  O     . HOH H 5 .   ? -38.845 -6.749  19.642  1.00 37.44 ? 2011 HOH A O     1 
HETATM 2353 O  O     . HOH H 5 .   ? -39.183 -4.638  22.712  1.00 44.42 ? 2012 HOH A O     1 
HETATM 2354 O  O     . HOH H 5 .   ? -42.802 -1.305  18.519  1.00 18.31 ? 2013 HOH A O     1 
HETATM 2355 O  O     . HOH H 5 .   ? -41.255 -0.775  22.290  1.00 28.19 ? 2014 HOH A O     1 
HETATM 2356 O  O     . HOH H 5 .   ? -41.074 0.137   16.922  1.00 26.45 ? 2015 HOH A O     1 
HETATM 2357 O  O     . HOH H 5 .   ? -41.303 1.590   20.658  1.00 34.68 ? 2016 HOH A O     1 
HETATM 2358 O  O     . HOH H 5 .   ? -31.771 -2.332  28.084  1.00 39.00 ? 2017 HOH A O     1 
HETATM 2359 O  O     . HOH H 5 .   ? 9.903   6.954   31.952  1.00 53.86 ? 2018 HOH A O     1 
HETATM 2360 O  O     . HOH H 5 .   ? -31.321 8.113   24.198  1.00 36.48 ? 2019 HOH A O     1 
HETATM 2361 O  O     . HOH H 5 .   ? -19.364 13.931  31.593  1.00 51.36 ? 2020 HOH A O     1 
HETATM 2362 O  O     . HOH H 5 .   ? -37.949 10.780  20.564  1.00 44.61 ? 2021 HOH A O     1 
HETATM 2363 O  O     . HOH H 5 .   ? -39.313 8.819   18.718  1.00 26.19 ? 2022 HOH A O     1 
HETATM 2364 O  O     . HOH H 5 .   ? -39.113 10.177  14.578  1.00 30.76 ? 2023 HOH A O     1 
HETATM 2365 O  O     . HOH H 5 .   ? -33.230 11.789  22.562  1.00 43.46 ? 2024 HOH A O     1 
HETATM 2366 O  O     . HOH H 5 .   ? -2.726  14.088  39.257  1.00 37.55 ? 2025 HOH A O     1 
HETATM 2367 O  O     . HOH H 5 .   ? -7.118  14.694  40.633  1.00 46.86 ? 2026 HOH A O     1 
HETATM 2368 O  O     . HOH H 5 .   ? -7.462  11.411  40.583  1.00 46.08 ? 2027 HOH A O     1 
HETATM 2369 O  O     . HOH H 5 .   ? -2.848  11.104  41.402  1.00 54.53 ? 2028 HOH A O     1 
HETATM 2370 O  O     . HOH H 5 .   ? -36.136 14.128  15.659  1.00 53.66 ? 2029 HOH A O     1 
HETATM 2371 O  O     . HOH H 5 .   ? -37.096 13.631  11.755  1.00 41.57 ? 2030 HOH A O     1 
HETATM 2372 O  O     . HOH H 5 .   ? -32.960 16.329  16.149  1.00 35.14 ? 2031 HOH A O     1 
HETATM 2373 O  O     . HOH H 5 .   ? -1.445  -2.383  14.897  1.00 59.52 ? 2032 HOH A O     1 
HETATM 2374 O  O     . HOH H 5 .   ? -32.907 14.888  8.230   1.00 46.81 ? 2033 HOH A O     1 
HETATM 2375 O  O     . HOH H 5 .   ? -26.368 17.570  11.775  1.00 39.18 ? 2034 HOH A O     1 
HETATM 2376 O  O     . HOH H 5 .   ? -30.586 15.430  4.097   1.00 47.51 ? 2035 HOH A O     1 
HETATM 2377 O  O     . HOH H 5 .   ? -23.361 8.280   -12.732 1.00 46.58 ? 2036 HOH A O     1 
HETATM 2378 O  O     . HOH H 5 .   ? -26.524 7.520   -13.773 1.00 39.30 ? 2037 HOH A O     1 
HETATM 2379 O  O     . HOH H 5 .   ? -30.450 10.879  3.251   1.00 45.77 ? 2038 HOH A O     1 
HETATM 2380 O  O     . HOH H 5 .   ? -33.101 9.468   5.549   1.00 33.87 ? 2039 HOH A O     1 
HETATM 2381 O  O     . HOH H 5 .   ? -41.645 7.154   12.739  1.00 46.87 ? 2040 HOH A O     1 
HETATM 2382 O  O     . HOH H 5 .   ? -39.709 5.206   13.567  1.00 38.84 ? 2041 HOH A O     1 
HETATM 2383 O  O     . HOH H 5 .   ? -37.690 3.445   11.380  1.00 27.12 ? 2042 HOH A O     1 
HETATM 2384 O  O     . HOH H 5 .   ? -8.106  -2.997  18.939  1.00 38.31 ? 2043 HOH A O     1 
HETATM 2385 O  O     . HOH H 5 .   ? -36.198 -6.338  20.074  1.00 43.49 ? 2044 HOH A O     1 
HETATM 2386 O  O     . HOH H 5 .   ? -33.346 -4.474  26.293  1.00 48.69 ? 2045 HOH A O     1 
HETATM 2387 O  O     . HOH H 5 .   ? -13.693 -2.989  21.855  1.00 41.68 ? 2046 HOH A O     1 
HETATM 2388 O  O     . HOH H 5 .   ? -7.572  38.619  16.956  1.00 43.72 ? 2047 HOH A O     1 
HETATM 2389 O  O     . HOH H 5 .   ? -3.671  22.056  38.659  1.00 32.22 ? 2048 HOH A O     1 
HETATM 2390 O  O     . HOH H 5 .   ? 7.852   24.223  32.551  1.00 41.87 ? 2049 HOH A O     1 
HETATM 2391 O  O     . HOH H 5 .   ? -26.346 -6.804  14.890  1.00 29.47 ? 2050 HOH A O     1 
HETATM 2392 O  O     . HOH H 5 .   ? -22.832 -8.480  20.001  1.00 32.97 ? 2051 HOH A O     1 
HETATM 2393 O  O     . HOH H 5 .   ? -23.018 -8.649  17.299  1.00 27.19 ? 2052 HOH A O     1 
HETATM 2394 O  O     . HOH H 5 .   ? -41.094 -10.232 17.585  1.00 34.12 ? 2053 HOH A O     1 
HETATM 2395 O  O     . HOH H 5 .   ? -36.637 -10.747 21.562  1.00 47.54 ? 2054 HOH A O     1 
HETATM 2396 O  O     . HOH H 5 .   ? 7.567   6.503   33.288  1.00 37.24 ? 2055 HOH A O     1 
HETATM 2397 O  O     . HOH H 5 .   ? 8.486   15.039  30.687  1.00 42.85 ? 2056 HOH A O     1 
HETATM 2398 O  O     . HOH H 5 .   ? -29.496 -11.592 26.075  1.00 38.82 ? 2057 HOH A O     1 
HETATM 2399 O  O     . HOH H 5 .   ? -22.449 0.369   30.786  1.00 31.56 ? 2058 HOH A O     1 
HETATM 2400 O  O     . HOH H 5 .   ? -23.628 14.811  30.401  1.00 36.29 ? 2059 HOH A O     1 
HETATM 2401 O  O     . HOH H 5 .   ? -24.539 19.394  17.047  1.00 48.84 ? 2060 HOH A O     1 
HETATM 2402 O  O     . HOH H 5 .   ? -21.114 25.654  23.802  1.00 40.96 ? 2061 HOH A O     1 
HETATM 2403 O  O     . HOH H 5 .   ? -21.347 -2.948  23.678  1.00 55.88 ? 2062 HOH A O     1 
HETATM 2404 O  O     . HOH H 5 .   ? -21.297 16.328  31.932  1.00 47.07 ? 2063 HOH A O     1 
HETATM 2405 O  O     . HOH H 5 .   ? -27.772 -3.681  25.538  1.00 25.73 ? 2064 HOH A O     1 
HETATM 2406 O  O     . HOH H 5 .   ? -24.583 -0.718  21.612  1.00 17.93 ? 2065 HOH A O     1 
HETATM 2407 O  O     . HOH H 5 .   ? -25.695 -2.125  24.152  1.00 35.76 ? 2066 HOH A O     1 
HETATM 2408 O  O     . HOH H 5 .   ? -28.016 17.134  30.491  1.00 22.34 ? 2067 HOH A O     1 
HETATM 2409 O  O     . HOH H 5 .   ? -18.403 18.472  35.304  1.00 44.37 ? 2068 HOH A O     1 
HETATM 2410 O  O     . HOH H 5 .   ? -11.473 31.328  28.415  1.00 27.26 ? 2069 HOH A O     1 
HETATM 2411 O  O     . HOH H 5 .   ? -17.517 14.995  33.202  1.00 58.34 ? 2070 HOH A O     1 
HETATM 2412 O  O     . HOH H 5 .   ? -3.140  14.739  36.567  1.00 22.23 ? 2071 HOH A O     1 
HETATM 2413 O  O     . HOH H 5 .   ? -3.397  18.353  38.478  1.00 26.80 ? 2072 HOH A O     1 
HETATM 2414 O  O     . HOH H 5 .   ? -34.695 9.895   8.174   1.00 40.76 ? 2073 HOH A O     1 
HETATM 2415 O  O     . HOH H 5 .   ? -27.973 9.280   8.556   1.00 37.66 ? 2074 HOH A O     1 
HETATM 2416 O  O     . HOH H 5 .   ? -10.935 14.284  39.723  1.00 39.90 ? 2075 HOH A O     1 
HETATM 2417 O  O     . HOH H 5 .   ? -7.148  16.221  38.437  1.00 20.81 ? 2076 HOH A O     1 
HETATM 2418 O  O     . HOH H 5 .   ? -4.576  11.055  39.436  1.00 36.70 ? 2077 HOH A O     1 
HETATM 2419 O  O     . HOH H 5 .   ? -9.475  3.837   38.145  1.00 36.85 ? 2078 HOH A O     1 
HETATM 2420 O  O     . HOH H 5 .   ? -31.258 9.523   -2.162  1.00 34.18 ? 2079 HOH A O     1 
HETATM 2421 O  O     . HOH H 5 .   ? -36.732 8.779   -1.976  1.00 53.22 ? 2080 HOH A O     1 
HETATM 2422 O  O     . HOH H 5 .   ? -33.191 -1.608  -3.476  1.00 52.31 ? 2081 HOH A O     1 
HETATM 2423 O  O     . HOH H 5 .   ? 0.416   5.058   10.881  1.00 38.07 ? 2082 HOH A O     1 
HETATM 2424 O  O     . HOH H 5 .   ? 0.130   2.317   14.142  1.00 35.84 ? 2083 HOH A O     1 
HETATM 2425 O  O     . HOH H 5 .   ? -1.652  0.687   15.696  1.00 41.28 ? 2084 HOH A O     1 
HETATM 2426 O  O     . HOH H 5 .   ? -31.577 5.139   -6.277  1.00 26.63 ? 2085 HOH A O     1 
HETATM 2427 O  O     . HOH H 5 .   ? -23.675 9.857   -10.488 1.00 40.92 ? 2086 HOH A O     1 
HETATM 2428 O  O     . HOH H 5 .   ? -27.876 5.480   -12.352 1.00 24.93 ? 2087 HOH A O     1 
HETATM 2429 O  O     . HOH H 5 .   ? -28.916 -2.163  -13.006 1.00 41.58 ? 2088 HOH A O     1 
HETATM 2430 O  O     . HOH H 5 .   ? -23.340 1.254   -13.026 1.00 54.26 ? 2089 HOH A O     1 
HETATM 2431 O  O     . HOH H 5 .   ? -18.968 4.692   -8.209  1.00 39.94 ? 2090 HOH A O     1 
HETATM 2432 O  O     . HOH H 5 .   ? -24.323 5.899   -12.348 1.00 31.76 ? 2091 HOH A O     1 
HETATM 2433 O  O     . HOH H 5 .   ? -28.148 11.916  -6.843  1.00 45.36 ? 2092 HOH A O     1 
HETATM 2434 O  O     . HOH H 5 .   ? -19.382 22.340  18.673  1.00 32.90 ? 2093 HOH A O     1 
HETATM 2435 O  O     . HOH H 5 .   ? -30.365 3.459   -9.591  1.00 35.97 ? 2094 HOH A O     1 
HETATM 2436 O  O     . HOH H 5 .   ? -21.071 -0.596  -9.776  1.00 52.72 ? 2095 HOH A O     1 
HETATM 2437 O  O     . HOH H 5 .   ? -17.697 9.965   30.823  1.00 42.27 ? 2096 HOH A O     1 
HETATM 2438 O  O     . HOH H 5 .   ? -13.965 -0.014  0.347   1.00 48.47 ? 2097 HOH A O     1 
HETATM 2439 O  O     . HOH H 5 .   ? -16.132 4.773   5.004   1.00 45.39 ? 2098 HOH A O     1 
HETATM 2440 O  O     . HOH H 5 .   ? -20.559 -5.083  -0.419  1.00 38.76 ? 2099 HOH A O     1 
HETATM 2441 O  O     . HOH H 5 .   ? -16.453 1.946   11.895  1.00 49.01 ? 2100 HOH A O     1 
HETATM 2442 O  O     . HOH H 5 .   ? -14.410 -5.789  7.310   1.00 57.92 ? 2101 HOH A O     1 
HETATM 2443 O  O     . HOH H 5 .   ? -17.252 -4.792  11.639  1.00 52.18 ? 2102 HOH A O     1 
HETATM 2444 O  O     . HOH H 5 .   ? -17.573 31.044  20.045  1.00 44.06 ? 2103 HOH A O     1 
HETATM 2445 O  O     . HOH H 5 .   ? -8.990  -1.900  9.114   1.00 52.36 ? 2104 HOH A O     1 
HETATM 2446 O  O     . HOH H 5 .   ? -8.576  -0.765  5.992   1.00 44.33 ? 2105 HOH A O     1 
HETATM 2447 O  O     . HOH H 5 .   ? -16.673 -0.563  13.155  1.00 39.97 ? 2106 HOH A O     1 
HETATM 2448 O  O     . HOH H 5 .   ? -8.068  -2.151  16.542  1.00 35.80 ? 2107 HOH A O     1 
HETATM 2449 O  O     . HOH H 5 .   ? 7.953   15.997  11.517  1.00 44.04 ? 2108 HOH A O     1 
HETATM 2450 O  O     . HOH H 5 .   ? -8.163  3.517   25.118  1.00 11.64 ? 2109 HOH A O     1 
HETATM 2451 O  O     . HOH H 5 .   ? -17.403 5.134   13.697  1.00 35.31 ? 2110 HOH A O     1 
HETATM 2452 O  O     . HOH H 5 .   ? -15.889 22.576  15.736  1.00 42.88 ? 2111 HOH A O     1 
HETATM 2453 O  O     . HOH H 5 .   ? -18.496 28.610  19.344  1.00 45.87 ? 2112 HOH A O     1 
HETATM 2454 O  O     . HOH H 5 .   ? -15.743 -1.762  20.392  1.00 33.61 ? 2113 HOH A O     1 
HETATM 2455 O  O     . HOH H 5 .   ? -12.030 -3.332  18.732  1.00 36.06 ? 2114 HOH A O     1 
HETATM 2456 O  O     . HOH H 5 .   ? -21.114 -7.609  15.577  1.00 54.07 ? 2115 HOH A O     1 
HETATM 2457 O  O     . HOH H 5 .   ? -19.561 -5.527  15.195  1.00 37.51 ? 2116 HOH A O     1 
HETATM 2458 O  O     . HOH H 5 .   ? -14.872 0.084   16.285  1.00 14.53 ? 2117 HOH A O     1 
HETATM 2459 O  O     . HOH H 5 .   ? -8.512  35.465  22.140  1.00 31.04 ? 2118 HOH A O     1 
HETATM 2460 O  O     . HOH H 5 .   ? -17.069 -3.295  13.574  1.00 46.79 ? 2119 HOH A O     1 
HETATM 2461 O  O     . HOH H 5 .   ? -22.350 -6.186  7.633   1.00 40.75 ? 2120 HOH A O     1 
HETATM 2462 O  O     . HOH H 5 .   ? -24.164 -7.582  13.641  1.00 47.36 ? 2121 HOH A O     1 
HETATM 2463 O  O     . HOH H 5 .   ? -19.963 -2.025  20.868  1.00 41.74 ? 2122 HOH A O     1 
HETATM 2464 O  O     . HOH H 5 .   ? -3.956  39.034  12.911  1.00 62.89 ? 2123 HOH A O     1 
HETATM 2465 O  O     . HOH H 5 .   ? -5.275  37.118  16.819  1.00 32.97 ? 2124 HOH A O     1 
HETATM 2466 O  O     . HOH H 5 .   ? -20.099 -8.186  2.884   1.00 48.73 ? 2125 HOH A O     1 
HETATM 2467 O  O     . HOH H 5 .   ? -9.175  32.835  36.845  1.00 28.13 ? 2126 HOH A O     1 
HETATM 2468 O  O     . HOH H 5 .   ? 0.426   34.100  8.184   1.00 48.48 ? 2127 HOH A O     1 
HETATM 2469 O  O     . HOH H 5 .   ? -9.191  28.967  39.139  1.00 40.10 ? 2128 HOH A O     1 
HETATM 2470 O  O     . HOH H 5 .   ? -6.156  18.777  39.089  1.00 30.72 ? 2129 HOH A O     1 
HETATM 2471 O  O     . HOH H 5 .   ? -1.442  20.969  38.799  1.00 46.45 ? 2130 HOH A O     1 
HETATM 2472 O  O     . HOH H 5 .   ? 5.227   23.947  33.440  1.00 34.55 ? 2131 HOH A O     1 
HETATM 2473 O  O     . HOH H 5 .   ? 2.004   28.353  20.388  1.00 18.94 ? 2132 HOH A O     1 
HETATM 2474 O  O     . HOH H 5 .   ? 6.031   17.182  21.595  1.00 39.14 ? 2133 HOH A O     1 
HETATM 2475 O  O     . HOH H 5 .   ? -36.588 7.088   5.025   1.00 50.48 ? 2134 HOH A O     1 
HETATM 2476 O  O     . HOH H 5 .   ? 9.282   23.686  6.232   1.00 54.08 ? 2135 HOH A O     1 
HETATM 2477 O  O     . HOH H 5 .   ? 2.625   12.396  12.967  1.00 31.05 ? 2136 HOH A O     1 
HETATM 2478 O  O     . HOH H 5 .   ? 3.444   8.106   11.711  1.00 44.80 ? 2137 HOH A O     1 
HETATM 2479 O  O     . HOH H 5 .   ? 4.706   5.840   25.280  1.00 41.18 ? 2138 HOH A O     1 
HETATM 2480 O  O     . HOH H 5 .   ? 7.615   15.386  23.158  1.00 29.34 ? 2139 HOH A O     1 
HETATM 2481 O  O     . HOH H 5 .   ? 6.231   9.269   32.927  1.00 27.83 ? 2140 HOH A O     1 
HETATM 2482 O  O     . HOH H 5 .   ? 8.925   11.150  30.254  1.00 51.58 ? 2141 HOH A O     1 
HETATM 2483 O  O     . HOH H 5 .   ? 5.798   17.031  31.523  1.00 41.12 ? 2142 HOH A O     1 
HETATM 2484 O  O     . HOH H 5 .   ? 2.648   15.635  34.369  1.00 35.30 ? 2143 HOH A O     1 
HETATM 2485 O  O     . HOH H 5 .   ? -21.280 1.380   23.932  1.00 35.93 ? 2144 HOH A O     1 
HETATM 2486 O  O     . HOH H 5 .   ? -16.199 0.759   20.162  1.00 15.31 ? 2145 HOH A O     1 
HETATM 2487 O  O     . HOH H 5 .   ? -10.608 -0.414  36.076  1.00 25.75 ? 2146 HOH A O     1 
HETATM 2488 O  O     . HOH H 5 .   ? -23.725 0.273   24.309  1.00 33.04 ? 2147 HOH A O     1 
HETATM 2489 O  O     . HOH H 5 .   ? -27.318 9.152   24.467  1.00 33.56 ? 2148 HOH A O     1 
HETATM 2490 O  O     . HOH H 5 .   ? -23.251 3.144   25.913  1.00 14.49 ? 2149 HOH A O     1 
HETATM 2491 O  O     . HOH H 5 .   ? -27.183 11.298  26.146  1.00 44.89 ? 2150 HOH A O     1 
HETATM 2492 O  O     . HOH H 5 .   ? -28.651 8.347   28.057  1.00 37.82 ? 2151 HOH A O     1 
HETATM 2493 O  O     . HOH H 5 .   ? -23.657 7.559   31.386  1.00 42.88 ? 2152 HOH A O     1 
HETATM 2494 O  O     . HOH H 5 .   ? -24.620 1.960   27.720  1.00 43.15 ? 2153 HOH A O     1 
HETATM 2495 O  O     . HOH H 5 .   ? -24.417 2.083   31.957  1.00 19.60 ? 2154 HOH A O     1 
HETATM 2496 O  O     . HOH H 5 .   ? -23.758 14.200  25.994  1.00 15.88 ? 2155 HOH A O     1 
HETATM 2497 O  O     . HOH H 5 .   ? -22.715 11.990  29.580  1.00 32.09 ? 2156 HOH A O     1 
HETATM 2498 O  O     . HOH H 5 .   ? -24.931 17.615  19.509  1.00 34.96 ? 2157 HOH A O     1 
HETATM 2499 O  O     . HOH H 5 .   ? -26.983 15.570  20.591  1.00 30.84 ? 2158 HOH A O     1 
HETATM 2500 O  O     . HOH H 5 .   ? -26.192 12.881  22.134  1.00 39.78 ? 2159 HOH A O     1 
HETATM 2501 O  O     . HOH H 5 .   ? -21.456 22.895  22.418  1.00 28.42 ? 2160 HOH A O     1 
HETATM 2502 O  O     . HOH H 5 .   ? -26.247 14.025  24.906  1.00 29.87 ? 2161 HOH A O     1 
HETATM 2503 O  O     . HOH H 5 .   ? -26.387 19.733  27.195  1.00 22.74 ? 2162 HOH A O     1 
HETATM 2504 O  O     . HOH H 5 .   ? -20.822 18.929  31.403  1.00 29.26 ? 2163 HOH A O     1 
HETATM 2505 O  O     . HOH H 5 .   ? -24.212 15.976  28.067  1.00 21.48 ? 2164 HOH A O     1 
HETATM 2506 O  O     . HOH H 5 .   ? -25.369 21.219  22.514  1.00 40.18 ? 2165 HOH A O     1 
HETATM 2507 O  O     . HOH H 5 .   ? -26.772 15.503  32.480  1.00 37.59 ? 2166 HOH A O     1 
HETATM 2508 O  O     . HOH H 5 .   ? -19.409 28.457  26.811  1.00 47.59 ? 2167 HOH A O     1 
HETATM 2509 O  O     . HOH H 5 .   ? -22.279 20.059  35.074  1.00 47.99 ? 2168 HOH A O     1 
HETATM 2510 O  O     . HOH H 5 .   ? -20.085 20.423  33.615  1.00 35.75 ? 2169 HOH A O     1 
HETATM 2511 O  O     . HOH H 5 .   ? -16.181 25.378  37.347  1.00 44.62 ? 2170 HOH A O     1 
HETATM 2512 O  O     . HOH H 5 .   ? -13.673 29.924  29.856  1.00 22.65 ? 2171 HOH A O     1 
HETATM 2513 O  O     . HOH H 5 .   ? -11.776 31.015  33.498  1.00 36.86 ? 2172 HOH A O     1 
HETATM 2514 O  O     . HOH H 5 .   ? -16.248 16.705  34.637  1.00 23.48 ? 2173 HOH A O     1 
HETATM 2515 O  O     . HOH H 5 .   ? -13.732 13.048  36.243  1.00 46.96 ? 2174 HOH A O     1 
HETATM 2516 O  O     . HOH H 5 .   ? -17.011 17.157  38.738  1.00 52.93 ? 2175 HOH A O     1 
HETATM 2517 O  O     . HOH H 5 .   ? -14.234 20.259  37.560  1.00 36.50 ? 2176 HOH A O     1 
HETATM 2518 O  O     . HOH H 5 .   ? -2.569  17.352  36.077  1.00 23.16 ? 2177 HOH A O     1 
HETATM 2519 O  O     . HOH H 5 .   ? -9.839  19.581  37.394  1.00 19.00 ? 2178 HOH A O     1 
HETATM 2520 O  O     . HOH H 5 .   ? -9.897  9.786   37.879  1.00 40.34 ? 2179 HOH A O     1 
HETATM 2521 O  O     . HOH H 5 .   ? -4.301  11.190  36.877  1.00 13.55 ? 2180 HOH A O     1 
HETATM 2522 O  O     . HOH H 5 .   ? -5.862  15.010  36.444  1.00 17.42 ? 2181 HOH A O     1 
HETATM 2523 O  O     . HOH H 5 .   ? -9.850  16.105  37.647  1.00 19.53 ? 2182 HOH A O     1 
HETATM 2524 O  O     . HOH H 5 .   ? -13.789 11.499  33.732  1.00 22.17 ? 2183 HOH A O     1 
HETATM 2525 O  O     . HOH H 5 .   ? -12.276 11.019  37.514  1.00 32.38 ? 2184 HOH A O     1 
HETATM 2526 O  O     . HOH H 5 .   ? -10.745 6.120   37.307  1.00 44.94 ? 2185 HOH A O     1 
HETATM 2527 O  O     . HOH H 5 .   ? -11.157 6.044   31.142  1.00 13.23 ? 2186 HOH A O     1 
HETATM 2528 O  O     . HOH H 5 .   ? -4.746  2.843   18.583  1.00 19.61 ? 2187 HOH A O     1 
HETATM 2529 O  O     . HOH H 5 .   ? 1.983   4.663   20.125  1.00 30.12 ? 2188 HOH A O     1 
HETATM 2530 O  O     . HOH H 5 .   ? -0.778  4.799   13.401  1.00 24.02 ? 2189 HOH A O     1 
HETATM 2531 O  O     . HOH H 5 .   ? -2.316  1.573   20.049  1.00 23.77 ? 2190 HOH A O     1 
HETATM 2532 O  O     . HOH H 5 .   ? 1.790   0.857   18.426  1.00 38.14 ? 2191 HOH A O     1 
HETATM 2533 O  O     . HOH H 5 .   ? -5.862  -2.142  15.266  1.00 50.26 ? 2192 HOH A O     1 
HETATM 2534 O  O     . HOH H 5 .   ? -9.325  -1.744  12.527  1.00 40.44 ? 2193 HOH A O     1 
HETATM 2535 O  O     . HOH H 5 .   ? -4.003  1.633   16.203  1.00 21.75 ? 2194 HOH A O     1 
HETATM 2536 O  O     . HOH H 5 .   ? -0.412  5.663   7.173   1.00 58.79 ? 2195 HOH A O     1 
HETATM 2537 O  O     . HOH H 5 .   ? -0.040  9.175   13.272  1.00 25.21 ? 2196 HOH A O     1 
HETATM 2538 O  O     . HOH H 5 .   ? -0.720  -1.839  10.419  1.00 49.96 ? 2197 HOH A O     1 
HETATM 2539 O  O     . HOH H 5 .   ? -2.138  2.881   2.322   1.00 55.75 ? 2198 HOH A O     1 
HETATM 2540 O  O     . HOH H 5 .   ? -7.416  9.417   4.827   1.00 48.07 ? 2199 HOH A O     1 
HETATM 2541 O  O     . HOH H 5 .   ? -7.961  6.871   2.232   1.00 54.99 ? 2200 HOH A O     1 
HETATM 2542 O  O     . HOH H 5 .   ? -13.474 16.803  9.433   1.00 45.82 ? 2201 HOH A O     1 
HETATM 2543 O  O     . HOH H 5 .   ? -12.326 18.685  12.947  1.00 44.12 ? 2202 HOH A O     1 
HETATM 2544 O  O     . HOH H 5 .   ? -11.839 16.430  11.737  1.00 50.89 ? 2203 HOH A O     1 
HETATM 2545 O  O     . HOH H 5 .   ? -23.388 18.714  14.530  1.00 38.93 ? 2204 HOH A O     1 
HETATM 2546 O  O     . HOH H 5 .   ? -24.130 14.978  18.095  1.00 22.78 ? 2205 HOH A O     1 
HETATM 2547 O  O     . HOH H 5 .   ? -19.545 19.989  17.137  1.00 25.46 ? 2206 HOH A O     1 
HETATM 2548 O  O     . HOH H 5 .   ? -21.799 10.559  14.298  1.00 25.47 ? 2207 HOH A O     1 
HETATM 2549 O  O     . HOH H 5 .   ? -18.076 7.817   28.926  1.00 33.29 ? 2208 HOH A O     1 
HETATM 2550 O  O     . HOH H 5 .   ? -19.496 7.299   31.161  1.00 23.79 ? 2209 HOH A O     1 
HETATM 2551 O  O     . HOH H 5 .   ? -21.553 8.862   30.606  1.00 41.86 ? 2210 HOH A O     1 
HETATM 2552 O  O     . HOH H 5 .   ? -19.664 0.416   26.057  1.00 26.08 ? 2211 HOH A O     1 
HETATM 2553 O  O     . HOH H 5 .   ? -21.663 1.457   28.246  1.00 21.04 ? 2212 HOH A O     1 
HETATM 2554 O  O     . HOH H 5 .   ? -21.282 -3.604  28.651  1.00 42.65 ? 2213 HOH A O     1 
HETATM 2555 O  O     . HOH H 5 .   ? -13.705 8.562   37.832  1.00 34.19 ? 2214 HOH A O     1 
HETATM 2556 O  O     . HOH H 5 .   ? -14.871 9.747   29.887  1.00 36.57 ? 2215 HOH A O     1 
HETATM 2557 O  O     . HOH H 5 .   ? -17.127 10.395  33.857  1.00 41.26 ? 2216 HOH A O     1 
HETATM 2558 O  O     . HOH H 5 .   ? -13.338 5.966   37.680  1.00 28.67 ? 2217 HOH A O     1 
HETATM 2559 O  O     . HOH H 5 .   ? -24.269 6.606   8.817   1.00 44.43 ? 2218 HOH A O     1 
HETATM 2560 O  O     . HOH H 5 .   ? -22.954 6.186   15.245  1.00 29.21 ? 2219 HOH A O     1 
HETATM 2561 O  O     . HOH H 5 .   ? -20.959 12.541  11.605  1.00 27.78 ? 2220 HOH A O     1 
HETATM 2562 O  O     . HOH H 5 .   ? -23.512 10.154  11.368  1.00 26.79 ? 2221 HOH A O     1 
HETATM 2563 O  O     . HOH H 5 .   ? -21.766 6.566   8.753   1.00 42.81 ? 2222 HOH A O     1 
HETATM 2564 O  O     . HOH H 5 .   ? -19.190 7.285   7.902   1.00 35.35 ? 2223 HOH A O     1 
HETATM 2565 O  O     . HOH H 5 .   ? -24.235 10.779  6.424   1.00 43.80 ? 2224 HOH A O     1 
HETATM 2566 O  O     . HOH H 5 .   ? -23.355 18.736  7.317   1.00 35.79 ? 2225 HOH A O     1 
HETATM 2567 O  O     . HOH H 5 .   ? -24.607 11.084  9.067   1.00 31.57 ? 2226 HOH A O     1 
HETATM 2568 O  O     . HOH H 5 .   ? -27.459 18.901  -1.484  1.00 43.32 ? 2227 HOH A O     1 
HETATM 2569 O  O     . HOH H 5 .   ? -18.363 27.351  5.431   1.00 38.67 ? 2228 HOH A O     1 
HETATM 2570 O  O     . HOH H 5 .   ? -17.714 24.181  8.637   1.00 45.67 ? 2229 HOH A O     1 
HETATM 2571 O  O     . HOH H 5 .   ? -17.340 32.180  17.509  1.00 40.49 ? 2230 HOH A O     1 
HETATM 2572 O  O     . HOH H 5 .   ? -21.049 29.254  15.451  1.00 47.50 ? 2231 HOH A O     1 
HETATM 2573 O  O     . HOH H 5 .   ? -8.681  26.124  13.934  1.00 16.04 ? 2232 HOH A O     1 
HETATM 2574 O  O     . HOH H 5 .   ? -14.195 22.899  11.993  1.00 25.64 ? 2233 HOH A O     1 
HETATM 2575 O  O     . HOH H 5 .   ? -7.429  20.734  9.407   1.00 40.18 ? 2234 HOH A O     1 
HETATM 2576 O  O     . HOH H 5 .   ? -0.732  23.479  2.421   1.00 48.39 ? 2235 HOH A O     1 
HETATM 2577 O  O     . HOH H 5 .   ? -2.455  18.666  2.974   1.00 48.69 ? 2236 HOH A O     1 
HETATM 2578 O  O     . HOH H 5 .   ? -9.466  23.915  2.421   1.00 48.14 ? 2237 HOH A O     1 
HETATM 2579 O  O     . HOH H 5 .   ? -2.230  29.605  6.746   1.00 55.91 ? 2238 HOH A O     1 
HETATM 2580 O  O     . HOH H 5 .   ? -4.759  17.249  3.828   1.00 45.68 ? 2239 HOH A O     1 
HETATM 2581 O  O     . HOH H 5 .   ? -2.654  14.835  -0.077  1.00 57.68 ? 2240 HOH A O     1 
HETATM 2582 O  O     . HOH H 5 .   ? 3.268   16.675  8.958   1.00 39.18 ? 2241 HOH A O     1 
HETATM 2583 O  O     . HOH H 5 .   ? -5.269  14.986  6.523   1.00 46.47 ? 2242 HOH A O     1 
HETATM 2584 O  O     . HOH H 5 .   ? -0.167  20.078  4.502   1.00 40.69 ? 2243 HOH A O     1 
HETATM 2585 O  O     . HOH H 5 .   ? 1.146   12.919  7.282   1.00 38.60 ? 2244 HOH A O     1 
HETATM 2586 O  O     . HOH H 5 .   ? 6.582   14.650  15.077  1.00 43.84 ? 2245 HOH A O     1 
HETATM 2587 O  O     . HOH H 5 .   ? 5.347   16.603  11.169  1.00 30.70 ? 2246 HOH A O     1 
HETATM 2588 O  O     . HOH H 5 .   ? -9.260  16.392  11.750  1.00 45.23 ? 2247 HOH A O     1 
HETATM 2589 O  O     . HOH H 5 .   ? -10.636 31.013  25.917  1.00 33.58 ? 2248 HOH A O     1 
HETATM 2590 O  O     . HOH H 5 .   ? -18.091 26.023  19.311  1.00 37.72 ? 2249 HOH A O     1 
HETATM 2591 O  O     . HOH H 5 .   ? -16.957 23.505  18.224  1.00 30.85 ? 2250 HOH A O     1 
HETATM 2592 O  O     . HOH H 5 .   ? -19.120 22.455  21.354  1.00 27.28 ? 2251 HOH A O     1 
HETATM 2593 O  O     . HOH H 5 .   ? -18.479 26.374  23.083  1.00 21.46 ? 2252 HOH A O     1 
HETATM 2594 O  O     . HOH H 5 .   ? -14.480 22.978  31.147  1.00 16.39 ? 2253 HOH A O     1 
HETATM 2595 O  O     . HOH H 5 .   ? -11.276 31.338  23.187  1.00 33.03 ? 2254 HOH A O     1 
HETATM 2596 O  O     . HOH H 5 .   ? -8.834  32.406  22.674  1.00 15.56 ? 2255 HOH A O     1 
HETATM 2597 O  O     . HOH H 5 .   ? -11.354 27.746  17.031  1.00 16.96 ? 2256 HOH A O     1 
HETATM 2598 O  O     . HOH H 5 .   ? -19.779 32.210  13.760  1.00 46.97 ? 2257 HOH A O     1 
HETATM 2599 O  O     . HOH H 5 .   ? -15.982 39.347  11.004  1.00 52.76 ? 2258 HOH A O     1 
HETATM 2600 O  O     . HOH H 5 .   ? -10.578 30.560  4.953   1.00 46.79 ? 2259 HOH A O     1 
HETATM 2601 O  O     . HOH H 5 .   ? -8.490  36.636  6.777   1.00 34.91 ? 2260 HOH A O     1 
HETATM 2602 O  O     . HOH H 5 .   ? -9.128  38.145  12.168  1.00 28.77 ? 2261 HOH A O     1 
HETATM 2603 O  O     . HOH H 5 .   ? -15.566 37.428  17.852  1.00 50.90 ? 2262 HOH A O     1 
HETATM 2604 O  O     . HOH H 5 .   ? -11.731 40.245  15.620  1.00 49.56 ? 2263 HOH A O     1 
HETATM 2605 O  O     . HOH H 5 .   ? -3.535  36.893  10.626  1.00 30.95 ? 2264 HOH A O     1 
HETATM 2606 O  O     . HOH H 5 .   ? -4.887  34.503  16.966  1.00 17.50 ? 2265 HOH A O     1 
HETATM 2607 O  O     . HOH H 5 .   ? -10.594 34.111  19.498  1.00 21.82 ? 2266 HOH A O     1 
HETATM 2608 O  O     . HOH H 5 .   ? -3.817  37.069  8.047   1.00 44.86 ? 2267 HOH A O     1 
HETATM 2609 O  O     . HOH H 5 .   ? -8.212  34.509  4.527   1.00 47.71 ? 2268 HOH A O     1 
HETATM 2610 O  O     . HOH H 5 .   ? 0.109   30.700  9.646   1.00 46.90 ? 2269 HOH A O     1 
HETATM 2611 O  O     . HOH H 5 .   ? 1.738   34.152  11.958  1.00 46.27 ? 2270 HOH A O     1 
HETATM 2612 O  O     . HOH H 5 .   ? 1.946   32.954  16.843  1.00 36.06 ? 2271 HOH A O     1 
HETATM 2613 O  O     . HOH H 5 .   ? 0.147   31.487  20.905  1.00 15.38 ? 2272 HOH A O     1 
HETATM 2614 O  O     . HOH H 5 .   ? -7.843  33.580  19.377  1.00 20.44 ? 2273 HOH A O     1 
HETATM 2615 O  O     . HOH H 5 .   ? 2.152   32.863  19.386  1.00 24.10 ? 2274 HOH A O     1 
HETATM 2616 O  O     . HOH H 5 .   ? 4.550   35.914  19.367  1.00 48.50 ? 2275 HOH A O     1 
HETATM 2617 O  O     . HOH H 5 .   ? -9.500  29.825  27.917  1.00 23.95 ? 2276 HOH A O     1 
HETATM 2618 O  O     . HOH H 5 .   ? -7.676  32.205  30.962  1.00 26.66 ? 2277 HOH A O     1 
HETATM 2619 O  O     . HOH H 5 .   ? -2.823  27.208  37.028  1.00 29.68 ? 2278 HOH A O     1 
HETATM 2620 O  O     . HOH H 5 .   ? -5.456  34.569  31.318  1.00 13.31 ? 2279 HOH A O     1 
HETATM 2621 O  O     . HOH H 5 .   ? -9.390  30.660  35.077  1.00 13.69 ? 2280 HOH A O     1 
HETATM 2622 O  O     . HOH H 5 .   ? -6.077  26.660  40.203  1.00 54.24 ? 2281 HOH A O     1 
HETATM 2623 O  O     . HOH H 5 .   ? -7.449  22.943  40.033  1.00 32.28 ? 2282 HOH A O     1 
HETATM 2624 O  O     . HOH H 5 .   ? -6.981  20.456  37.244  1.00 25.16 ? 2283 HOH A O     1 
HETATM 2625 O  O     . HOH H 5 .   ? -10.019 28.414  36.596  1.00 19.94 ? 2284 HOH A O     1 
HETATM 2626 O  O     . HOH H 5 .   ? 4.528   24.515  36.049  1.00 25.76 ? 2285 HOH A O     1 
HETATM 2627 O  O     . HOH H 5 .   ? 1.671   25.705  30.808  1.00 12.79 ? 2286 HOH A O     1 
HETATM 2628 O  O     . HOH H 5 .   ? 1.924   27.196  37.843  1.00 37.06 ? 2287 HOH A O     1 
HETATM 2629 O  O     . HOH H 5 .   ? 0.147   23.468  37.174  1.00 25.29 ? 2288 HOH A O     1 
HETATM 2630 O  O     . HOH H 5 .   ? 0.213   17.909  36.232  1.00 28.04 ? 2289 HOH A O     1 
HETATM 2631 O  O     . HOH H 5 .   ? 6.099   20.435  34.787  1.00 41.01 ? 2290 HOH A O     1 
HETATM 2632 O  O     . HOH H 5 .   ? 1.056   21.033  38.031  1.00 44.73 ? 2291 HOH A O     1 
HETATM 2633 O  O     . HOH H 5 .   ? 2.856   18.606  29.014  1.00 14.26 ? 2292 HOH A O     1 
HETATM 2634 O  O     . HOH H 5 .   ? 3.259   22.308  37.251  1.00 43.60 ? 2293 HOH A O     1 
HETATM 2635 O  O     . HOH H 5 .   ? -4.139  27.368  26.477  1.00 22.12 ? 2294 HOH A O     1 
HETATM 2636 O  O     . HOH H 5 .   ? 6.282   24.999  29.136  1.00 20.71 ? 2295 HOH A O     1 
HETATM 2637 O  O     . HOH H 5 .   ? 8.460   21.235  28.873  1.00 51.06 ? 2296 HOH A O     1 
HETATM 2638 O  O     . HOH H 5 .   ? 3.326   24.599  24.871  1.00 19.20 ? 2297 HOH A O     1 
HETATM 2639 O  O     . HOH H 5 .   ? 4.357   22.179  31.967  1.00 39.44 ? 2298 HOH A O     1 
HETATM 2640 O  O     . HOH H 5 .   ? 2.663   25.765  20.412  1.00 15.96 ? 2299 HOH A O     1 
HETATM 2641 O  O     . HOH H 5 .   ? 7.997   19.455  20.362  1.00 35.94 ? 2300 HOH A O     1 
HETATM 2642 O  O     . HOH H 5 .   ? 4.496   25.759  22.633  1.00 19.69 ? 2301 HOH A O     1 
HETATM 2643 O  O     . HOH H 5 .   ? 0.188   28.792  18.161  1.00 15.89 ? 2302 HOH A O     1 
HETATM 2644 O  O     . HOH H 5 .   ? 5.323   28.208  15.292  1.00 26.40 ? 2303 HOH A O     1 
HETATM 2645 O  O     . HOH H 5 .   ? 4.866   28.829  19.638  1.00 28.78 ? 2304 HOH A O     1 
HETATM 2646 O  O     . HOH H 5 .   ? 1.121   27.890  9.768   1.00 34.54 ? 2305 HOH A O     1 
HETATM 2647 O  O     . HOH H 5 .   ? 2.664   28.576  16.946  1.00 16.21 ? 2306 HOH A O     1 
HETATM 2648 O  O     . HOH H 5 .   ? 2.170   24.048  9.149   1.00 41.13 ? 2307 HOH A O     1 
HETATM 2649 O  O     . HOH H 5 .   ? 2.595   21.472  5.677   1.00 45.57 ? 2308 HOH A O     1 
HETATM 2650 O  O     . HOH H 5 .   ? 5.290   22.216  7.110   1.00 45.51 ? 2309 HOH A O     1 
HETATM 2651 O  O     . HOH H 5 .   ? 8.457   16.870  14.160  1.00 51.77 ? 2310 HOH A O     1 
HETATM 2652 O  O     . HOH H 5 .   ? 9.593   25.732  7.837   1.00 47.39 ? 2311 HOH A O     1 
HETATM 2653 O  O     . HOH H 5 .   ? 5.245   19.316  20.647  1.00 25.67 ? 2312 HOH A O     1 
HETATM 2654 O  O     . HOH H 5 .   ? 10.475  27.157  14.451  1.00 19.15 ? 2313 HOH A O     1 
HETATM 2655 O  O     . HOH H 5 .   ? 6.641   16.707  16.874  1.00 26.56 ? 2314 HOH A O     1 
HETATM 2656 O  O     . HOH H 5 .   ? 6.910   10.496  17.033  1.00 33.30 ? 2315 HOH A O     1 
HETATM 2657 O  O     . HOH H 5 .   ? 0.989   11.188  14.680  1.00 21.74 ? 2316 HOH A O     1 
HETATM 2658 O  O     . HOH H 5 .   ? 3.728   6.543   22.526  1.00 26.38 ? 2317 HOH A O     1 
HETATM 2659 O  O     . HOH H 5 .   ? 0.545   6.791   14.701  1.00 37.68 ? 2318 HOH A O     1 
HETATM 2660 O  O     . HOH H 5 .   ? 3.638   9.486   13.953  1.00 33.72 ? 2319 HOH A O     1 
HETATM 2661 O  O     . HOH H 5 .   ? 3.172   3.828   16.945  1.00 47.83 ? 2320 HOH A O     1 
HETATM 2662 O  O     . HOH H 5 .   ? 6.554   13.184  24.505  1.00 28.39 ? 2321 HOH A O     1 
HETATM 2663 O  O     . HOH H 5 .   ? 10.000  16.034  18.169  1.00 42.69 ? 2322 HOH A O     1 
HETATM 2664 O  O     . HOH H 5 .   ? 10.056  12.100  19.577  1.00 42.32 ? 2323 HOH A O     1 
HETATM 2665 O  O     . HOH H 5 .   ? 6.567   9.241   30.001  1.00 28.71 ? 2324 HOH A O     1 
HETATM 2666 O  O     . HOH H 5 .   ? 9.538   9.598   25.646  1.00 48.82 ? 2325 HOH A O     1 
HETATM 2667 O  O     . HOH H 5 .   ? 8.450   9.440   19.977  1.00 54.58 ? 2326 HOH A O     1 
HETATM 2668 O  O     . HOH H 5 .   ? 10.172  12.177  22.222  1.00 54.89 ? 2327 HOH A O     1 
HETATM 2669 O  O     . HOH H 5 .   ? 3.240   16.211  31.773  1.00 19.27 ? 2328 HOH A O     1 
HETATM 2670 O  O     . HOH H 5 .   ? 3.687   9.010   34.021  1.00 24.61 ? 2329 HOH A O     1 
HETATM 2671 O  O     . HOH H 5 .   ? 2.871   10.791  35.704  1.00 37.32 ? 2330 HOH A O     1 
HETATM 2672 O  O     . HOH H 5 .   ? 0.465   11.919  35.859  1.00 35.02 ? 2331 HOH A O     1 
HETATM 2673 O  O     . HOH H 5 .   ? -2.170  12.433  35.328  1.00 15.53 ? 2332 HOH A O     1 
HETATM 2674 O  O     . HOH H 5 .   ? -0.058  5.566   30.039  1.00 11.35 ? 2333 HOH A O     1 
HETATM 2675 O  O     . HOH H 5 .   ? -6.604  1.368   36.083  1.00 14.44 ? 2334 HOH A O     1 
HETATM 2676 O  O     . HOH H 5 .   ? -7.434  -2.338  31.728  1.00 12.30 ? 2335 HOH A O     1 
HETATM 2677 O  O     . HOH H 5 .   ? -6.896  0.316   29.093  1.00 12.38 ? 2336 HOH A O     1 
HETATM 2678 O  O     . HOH H 5 .   ? -10.642 4.424   34.482  1.00 16.26 ? 2337 HOH A O     1 
HETATM 2679 O  O     . HOH H 5 .   ? -3.625  4.569   36.094  1.00 11.40 ? 2338 HOH A O     1 
HETATM 2680 O  O     . HOH H 5 .   ? -9.015  -2.126  29.362  1.00 12.88 ? 2339 HOH A O     1 
HETATM 2681 O  O     . HOH H 5 .   ? -9.391  2.098   35.784  1.00 17.52 ? 2340 HOH A O     1 
HETATM 2682 O  O     . HOH H 5 .   ? -16.359 -5.931  32.072  1.00 50.09 ? 2341 HOH A O     1 
HETATM 2683 O  O     . HOH H 5 .   ? -27.306 10.406  22.304  1.00 20.83 ? 2342 HOH A O     1 
HETATM 2684 O  O     . HOH H 5 .   ? -28.289 10.589  10.907  1.00 25.54 ? 2343 HOH A O     1 
HETATM 2685 O  O     . HOH H 5 .   ? -27.187 12.576  9.411   1.00 29.28 ? 2344 HOH A O     1 
HETATM 2686 O  O     . HOH H 5 .   ? -27.206 16.086  14.918  1.00 31.29 ? 2345 HOH A O     1 
HETATM 2687 O  O     . HOH H 5 .   ? -30.070 15.718  17.207  1.00 47.12 ? 2346 HOH A O     1 
HETATM 2688 O  O     . HOH H 5 .   ? -22.646 13.451  14.725  1.00 33.58 ? 2347 HOH A O     1 
HETATM 2689 O  O     . HOH H 5 .   ? -23.684 15.720  15.026  1.00 49.34 ? 2348 HOH A O     1 
HETATM 2690 O  O     . HOH H 5 .   ? -12.668 3.710   31.130  1.00 12.78 ? 2349 HOH A O     1 
HETATM 2691 O  O     . HOH H 5 .   ? -15.127 -0.766  33.621  1.00 28.46 ? 2350 HOH A O     1 
HETATM 2692 O  O     . HOH H 5 .   ? -15.126 10.730  12.201  1.00 35.63 ? 2351 HOH A O     1 
HETATM 2693 O  O     . HOH H 5 .   ? -16.887 6.951   9.395   1.00 32.33 ? 2352 HOH A O     1 
HETATM 2694 O  O     . HOH H 5 .   ? 0.667   28.312  31.889  1.00 11.87 ? 2353 HOH A O     1 
HETATM 2695 O  O     . HOH H 5 .   ? 6.273   14.006  27.101  1.00 29.19 ? 2354 HOH A O     1 
HETATM 2696 O  O     . HOH H 5 .   ? 6.382   16.748  27.521  1.00 36.81 ? 2355 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 3   ? 0.4634 0.5302 0.6011 -0.0829 0.0829  -0.1377 3   SER A N   
2    C CA  . SER A 3   ? 0.4883 0.5676 0.6055 -0.0905 0.0826  -0.1433 3   SER A CA  
3    C C   . SER A 3   ? 0.5296 0.6191 0.6357 -0.0946 0.0801  -0.1440 3   SER A C   
4    O O   . SER A 3   ? 0.6231 0.7263 0.7188 -0.1037 0.0816  -0.1526 3   SER A O   
5    C CB  . SER A 3   ? 0.5481 0.6355 0.6754 -0.0990 0.0907  -0.1601 3   SER A CB  
6    O OG  . SER A 3   ? 0.5944 0.6740 0.7276 -0.0956 0.0920  -0.1584 3   SER A OG  
7    N N   . ARG A 4   ? 0.4241 0.5078 0.5328 -0.0885 0.0763  -0.1349 4   ARG A N   
8    C CA  . ARG A 4   ? 0.3823 0.4742 0.4788 -0.0907 0.0722  -0.1322 4   ARG A CA  
9    C C   . ARG A 4   ? 0.2929 0.3767 0.3771 -0.0817 0.0646  -0.1155 4   ARG A C   
10   O O   . ARG A 4   ? 0.2604 0.3323 0.3523 -0.0740 0.0638  -0.1077 4   ARG A O   
11   C CB  . ARG A 4   ? 0.4643 0.5593 0.5789 -0.0932 0.0761  -0.1400 4   ARG A CB  
12   C CG  . ARG A 4   ? 0.5479 0.6525 0.6763 -0.1029 0.0842  -0.1587 4   ARG A CG  
13   C CD  . ARG A 4   ? 0.6063 0.7163 0.7488 -0.1065 0.0869  -0.1663 4   ARG A CD  
14   N NE  . ARG A 4   ? 0.6819 0.7807 0.8348 -0.0980 0.0842  -0.1553 4   ARG A NE  
15   C CZ  . ARG A 4   ? 0.7140 0.8002 0.8867 -0.0920 0.0863  -0.1514 4   ARG A CZ  
16   N NH1 . ARG A 4   ? 0.7285 0.8107 0.9140 -0.0927 0.0909  -0.1579 4   ARG A NH1 
17   N NH2 . ARG A 4   ? 0.6952 0.7734 0.8751 -0.0855 0.0835  -0.1407 4   ARG A NH2 
18   N N   . ALA A 5   ? 0.3563 0.4473 0.4224 -0.0831 0.0590  -0.1102 5   ALA A N   
19   C CA  . ALA A 5   ? 0.3688 0.4535 0.4245 -0.0751 0.0521  -0.0958 5   ALA A CA  
20   C C   . ALA A 5   ? 0.3497 0.4274 0.4180 -0.0689 0.0523  -0.0912 5   ALA A C   
21   O O   . ALA A 5   ? 0.3117 0.3804 0.3776 -0.0612 0.0491  -0.0808 5   ALA A O   
22   C CB  . ALA A 5   ? 0.4781 0.5733 0.5171 -0.0785 0.0462  -0.0920 5   ALA A CB  
23   N N   . GLU A 6   ? 0.3035 0.3859 0.3853 -0.0729 0.0563  -0.0992 6   GLU A N   
24   C CA  . GLU A 6   ? 0.2511 0.3282 0.3457 -0.0682 0.0567  -0.0948 6   GLU A CA  
25   C C   . GLU A 6   ? 0.2753 0.3404 0.3850 -0.0630 0.0594  -0.0914 6   GLU A C   
26   O O   . GLU A 6   ? 0.2699 0.3299 0.3890 -0.0588 0.0592  -0.0853 6   GLU A O   
27   C CB  . GLU A 6   ? 0.3646 0.4504 0.4707 -0.0744 0.0601  -0.1045 6   GLU A CB  
28   C CG  . GLU A 6   ? 0.4877 0.5807 0.6019 -0.0831 0.0661  -0.1197 6   GLU A CG  
29   C CD  . GLU A 6   ? 0.6301 0.7376 0.7275 -0.0911 0.0641  -0.1254 6   GLU A CD  
30   O OE1 . GLU A 6   ? 0.6308 0.7408 0.7164 -0.0938 0.0636  -0.1266 6   GLU A OE1 
31   O OE2 . GLU A 6   ? 0.6186 0.7356 0.7146 -0.0950 0.0628  -0.1280 6   GLU A OE2 
32   N N   . ASP A 7   ? 0.2474 0.3087 0.3597 -0.0638 0.0618  -0.0948 7   ASP A N   
33   C CA  . ASP A 7   ? 0.2737 0.3242 0.4007 -0.0591 0.0636  -0.0907 7   ASP A CA  
34   C C   . ASP A 7   ? 0.2297 0.2724 0.3447 -0.0514 0.0582  -0.0768 7   ASP A C   
35   O O   . ASP A 7   ? 0.2321 0.2667 0.3571 -0.0471 0.0583  -0.0705 7   ASP A O   
36   C CB  . ASP A 7   ? 0.2731 0.3230 0.4086 -0.0627 0.0681  -0.0999 7   ASP A CB  
37   C CG  . ASP A 7   ? 0.3179 0.3749 0.4702 -0.0704 0.0747  -0.1152 7   ASP A CG  
38   O OD1 . ASP A 7   ? 0.4079 0.4666 0.5723 -0.0714 0.0762  -0.1172 7   ASP A OD1 
39   O OD2 . ASP A 7   ? 0.3803 0.4419 0.5341 -0.0757 0.0787  -0.1258 7   ASP A OD2 
40   N N   . TYR A 8   ? 0.2118 0.2579 0.3065 -0.0501 0.0535  -0.0722 8   TYR A N   
41   C CA  . TYR A 8   ? 0.1583 0.1981 0.2412 -0.0434 0.0487  -0.0610 8   TYR A CA  
42   C C   . TYR A 8   ? 0.1657 0.2091 0.2376 -0.0408 0.0445  -0.0550 8   TYR A C   
43   O O   . TYR A 8   ? 0.1865 0.2382 0.2548 -0.0447 0.0439  -0.0592 8   TYR A O   
44   C CB  . TYR A 8   ? 0.1594 0.1984 0.2293 -0.0439 0.0469  -0.0612 8   TYR A CB  
45   C CG  . TYR A 8   ? 0.1623 0.1987 0.2419 -0.0466 0.0511  -0.0678 8   TYR A CG  
46   C CD1 . TYR A 8   ? 0.2189 0.2627 0.3031 -0.0541 0.0555  -0.0796 8   TYR A CD1 
47   C CD2 . TYR A 8   ? 0.1568 0.1845 0.2413 -0.0422 0.0508  -0.0625 8   TYR A CD2 
48   C CE1 . TYR A 8   ? 0.2573 0.2994 0.3520 -0.0567 0.0600  -0.0868 8   TYR A CE1 
49   C CE2 . TYR A 8   ? 0.1550 0.1806 0.2503 -0.0445 0.0546  -0.0686 8   TYR A CE2 
50   C CZ  . TYR A 8   ? 0.2112 0.2438 0.3121 -0.0516 0.0594  -0.0810 8   TYR A CZ  
51   O OH  . TYR A 8   ? 0.2149 0.2460 0.3281 -0.0540 0.0638  -0.0880 8   TYR A OH  
52   N N   . GLU A 9   ? 0.1283 0.1665 0.1955 -0.0347 0.0416  -0.0457 9   GLU A N   
53   C CA  . GLU A 9   ? 0.1650 0.2064 0.2222 -0.0317 0.0377  -0.0405 9   GLU A CA  
54   C C   . GLU A 9   ? 0.1594 0.1972 0.2031 -0.0275 0.0335  -0.0349 9   GLU A C   
55   O O   . GLU A 9   ? 0.1531 0.1842 0.1966 -0.0240 0.0334  -0.0307 9   GLU A O   
56   C CB  . GLU A 9   ? 0.1864 0.2268 0.2515 -0.0287 0.0385  -0.0355 9   GLU A CB  
57   C CG  . GLU A 9   ? 0.1767 0.2213 0.2337 -0.0258 0.0353  -0.0315 9   GLU A CG  
58   C CD  . GLU A 9   ? 0.3354 0.3801 0.3995 -0.0235 0.0366  -0.0268 9   GLU A CD  
59   O OE1 . GLU A 9   ? 0.3471 0.3887 0.4227 -0.0245 0.0397  -0.0259 9   GLU A OE1 
60   O OE2 . GLU A 9   ? 0.2950 0.3434 0.3543 -0.0209 0.0347  -0.0238 9   GLU A OE2 
61   N N   . VAL A 10  ? 0.1553 0.1979 0.1888 -0.0282 0.0298  -0.0346 10  VAL A N   
62   C CA  . VAL A 10  ? 0.1765 0.2157 0.1992 -0.0242 0.0257  -0.0293 10  VAL A CA  
63   C C   . VAL A 10  ? 0.1949 0.2316 0.2181 -0.0183 0.0246  -0.0236 10  VAL A C   
64   O O   . VAL A 10  ? 0.1861 0.2274 0.2129 -0.0177 0.0247  -0.0231 10  VAL A O   
65   C CB  . VAL A 10  ? 0.1902 0.2357 0.2044 -0.0265 0.0213  -0.0290 10  VAL A CB  
66   C CG1 . VAL A 10  ? 0.1895 0.2312 0.1962 -0.0216 0.0168  -0.0229 10  VAL A CG1 
67   C CG2 . VAL A 10  ? 0.1601 0.2095 0.1713 -0.0333 0.0224  -0.0344 10  VAL A CG2 
68   N N   . LEU A 11  ? 0.1497 0.1800 0.1695 -0.0145 0.0240  -0.0200 11  LEU A N   
69   C CA  . LEU A 11  ? 0.1567 0.1860 0.1754 -0.0096 0.0232  -0.0156 11  LEU A CA  
70   C C   . LEU A 11  ? 0.1944 0.2246 0.2062 -0.0066 0.0190  -0.0139 11  LEU A C   
71   O O   . LEU A 11  ? 0.1944 0.2285 0.2077 -0.0044 0.0181  -0.0130 11  LEU A O   
72   C CB  . LEU A 11  ? 0.1517 0.1751 0.1709 -0.0076 0.0245  -0.0127 11  LEU A CB  
73   C CG  . LEU A 11  ? 0.1672 0.1894 0.1965 -0.0102 0.0281  -0.0129 11  LEU A CG  
74   C CD1 . LEU A 11  ? 0.2429 0.2608 0.2731 -0.0082 0.0283  -0.0081 11  LEU A CD1 
75   C CD2 . LEU A 11  ? 0.2112 0.2386 0.2483 -0.0116 0.0301  -0.0132 11  LEU A CD2 
76   N N   . TYR A 12  ? 0.1747 0.2011 0.1804 -0.0066 0.0166  -0.0135 12  TYR A N   
77   C CA  . TYR A 12  ? 0.1759 0.2026 0.1774 -0.0041 0.0123  -0.0114 12  TYR A CA  
78   C C   . TYR A 12  ? 0.1732 0.1962 0.1688 -0.0059 0.0100  -0.0108 12  TYR A C   
79   O O   . TYR A 12  ? 0.1875 0.2074 0.1820 -0.0082 0.0123  -0.0125 12  TYR A O   
80   C CB  . TYR A 12  ? 0.1568 0.1812 0.1586 0.0012  0.0121  -0.0096 12  TYR A CB  
81   C CG  . TYR A 12  ? 0.1605 0.1789 0.1593 0.0026  0.0138  -0.0090 12  TYR A CG  
82   C CD1 . TYR A 12  ? 0.1792 0.1924 0.1734 0.0038  0.0115  -0.0082 12  TYR A CD1 
83   C CD2 . TYR A 12  ? 0.1882 0.2068 0.1896 0.0024  0.0172  -0.0085 12  TYR A CD2 
84   C CE1 . TYR A 12  ? 0.1995 0.2081 0.1913 0.0048  0.0127  -0.0077 12  TYR A CE1 
85   C CE2 . TYR A 12  ? 0.1726 0.1870 0.1718 0.0033  0.0180  -0.0070 12  TYR A CE2 
86   C CZ  . TYR A 12  ? 0.2062 0.2157 0.2003 0.0045  0.0157  -0.0070 12  TYR A CZ  
87   O OH  . TYR A 12  ? 0.2550 0.2610 0.2470 0.0051  0.0162  -0.0055 12  TYR A OH  
88   N N   . THR A 13  ? 0.1650 0.1888 0.1583 -0.0048 0.0055  -0.0081 13  THR A N   
89   C CA  . THR A 13  ? 0.1751 0.1962 0.1629 -0.0068 0.0028  -0.0064 13  THR A CA  
90   C C   . THR A 13  ? 0.2113 0.2247 0.1977 -0.0025 0.0026  -0.0053 13  THR A C   
91   O O   . THR A 13  ? 0.2050 0.2169 0.1942 0.0021  0.0013  -0.0042 13  THR A O   
92   C CB  . THR A 13  ? 0.2285 0.2543 0.2159 -0.0081 -0.0028 -0.0025 13  THR A CB  
93   O OG1 . THR A 13  ? 0.2171 0.2514 0.2047 -0.0133 -0.0029 -0.0039 13  THR A OG1 
94   C CG2 . THR A 13  ? 0.2220 0.2449 0.2039 -0.0103 -0.0059 0.0005  13  THR A CG2 
95   N N   . ILE A 14  ? 0.1836 0.1926 0.1664 -0.0043 0.0042  -0.0062 14  ILE A N   
96   C CA  . ILE A 14  ? 0.1825 0.1847 0.1635 -0.0010 0.0038  -0.0054 14  ILE A CA  
97   C C   . ILE A 14  ? 0.2164 0.2166 0.1957 -0.0002 -0.0009 -0.0022 14  ILE A C   
98   O O   . ILE A 14  ? 0.2465 0.2431 0.2278 0.0040  -0.0025 -0.0013 14  ILE A O   
99   C CB  . ILE A 14  ? 0.1827 0.1813 0.1621 -0.0033 0.0067  -0.0072 14  ILE A CB  
100  C CG1 . ILE A 14  ? 0.2029 0.2024 0.1869 -0.0033 0.0109  -0.0091 14  ILE A CG1 
101  C CG2 . ILE A 14  ? 0.2299 0.2221 0.2068 -0.0007 0.0055  -0.0060 14  ILE A CG2 
102  C CD1 . ILE A 14  ? 0.1933 0.1905 0.1795 -0.0063 0.0138  -0.0111 14  ILE A CD1 
103  N N   . GLY A 15  ? 0.1951 0.1981 0.1713 -0.0049 -0.0030 -0.0004 15  GLY A N   
104  C CA  . GLY A 15  ? 0.2654 0.2675 0.2410 -0.0051 -0.0081 0.0043  15  GLY A CA  
105  C C   . GLY A 15  ? 0.3049 0.3137 0.2764 -0.0118 -0.0104 0.0067  15  GLY A C   
106  O O   . GLY A 15  ? 0.3050 0.3183 0.2733 -0.0166 -0.0071 0.0031  15  GLY A O   
107  N N   . THR A 16  ? 0.3160 0.3260 0.2883 -0.0126 -0.0161 0.0129  16  THR A N   
108  C CA  . THR A 16  ? 0.2845 0.3021 0.2515 -0.0200 -0.0191 0.0166  16  THR A CA  
109  C C   . THR A 16  ? 0.3696 0.3839 0.3315 -0.0232 -0.0201 0.0193  16  THR A C   
110  O O   . THR A 16  ? 0.4101 0.4186 0.3755 -0.0200 -0.0239 0.0242  16  THR A O   
111  C CB  . THR A 16  ? 0.3611 0.3846 0.3330 -0.0202 -0.0257 0.0236  16  THR A CB  
112  O OG1 . THR A 16  ? 0.3580 0.3857 0.3343 -0.0182 -0.0242 0.0205  16  THR A OG1 
113  C CG2 . THR A 16  ? 0.4232 0.4561 0.3882 -0.0291 -0.0294 0.0286  16  THR A CG2 
114  N N   . GLY A 17  ? 0.3170 0.3351 0.2718 -0.0295 -0.0164 0.0154  17  GLY A N   
115  C CA  . GLY A 17  ? 0.3540 0.3709 0.3035 -0.0338 -0.0167 0.0173  17  GLY A CA  
116  C C   . GLY A 17  ? 0.4066 0.4322 0.3514 -0.0410 -0.0221 0.0248  17  GLY A C   
117  O O   . GLY A 17  ? 0.4328 0.4651 0.3794 -0.0421 -0.0264 0.0293  17  GLY A O   
118  N N   . SER A 18  ? 0.3215 0.3481 0.2605 -0.0464 -0.0222 0.0267  18  SER A N   
119  C CA  . SER A 18  ? 0.3808 0.4164 0.3144 -0.0543 -0.0277 0.0354  18  SER A CA  
120  C C   . SER A 18  ? 0.4019 0.4522 0.3285 -0.0632 -0.0266 0.0328  18  SER A C   
121  O O   . SER A 18  ? 0.4106 0.4708 0.3339 -0.0693 -0.0326 0.0411  18  SER A O   
122  C CB  . SER A 18  ? 0.4161 0.4498 0.3447 -0.0587 -0.0271 0.0373  18  SER A CB  
123  O OG  . SER A 18  ? 0.4600 0.4807 0.3955 -0.0510 -0.0287 0.0399  18  SER A OG  
124  N N   . TYR A 19  ? 0.3239 0.3764 0.2492 -0.0643 -0.0193 0.0216  19  TYR A N   
125  C CA  . TYR A 19  ? 0.3288 0.3958 0.2478 -0.0737 -0.0170 0.0168  19  TYR A CA  
126  C C   . TYR A 19  ? 0.3715 0.4405 0.2957 -0.0708 -0.0145 0.0105  19  TYR A C   
127  O O   . TYR A 19  ? 0.4112 0.4921 0.3317 -0.0782 -0.0121 0.0050  19  TYR A O   
128  C CB  . TYR A 19  ? 0.3907 0.4621 0.3041 -0.0810 -0.0099 0.0079  19  TYR A CB  
129  C CG  . TYR A 19  ? 0.4012 0.4719 0.3090 -0.0849 -0.0121 0.0141  19  TYR A CG  
130  C CD1 . TYR A 19  ? 0.4238 0.5076 0.3225 -0.0952 -0.0164 0.0212  19  TYR A CD1 
131  C CD2 . TYR A 19  ? 0.4018 0.4596 0.3137 -0.0787 -0.0102 0.0137  19  TYR A CD2 
132  C CE1 . TYR A 19  ? 0.4690 0.5525 0.3629 -0.0992 -0.0185 0.0277  19  TYR A CE1 
133  C CE2 . TYR A 19  ? 0.4682 0.5253 0.3758 -0.0823 -0.0122 0.0194  19  TYR A CE2 
134  C CZ  . TYR A 19  ? 0.4798 0.5495 0.3786 -0.0926 -0.0163 0.0266  19  TYR A CZ  
135  O OH  . TYR A 19  ? 0.5514 0.6209 0.4463 -0.0967 -0.0183 0.0330  19  TYR A OH  
136  N N   . GLY A 20  ? 0.3203 0.3786 0.2532 -0.0606 -0.0149 0.0111  20  GLY A N   
137  C CA  . GLY A 20  ? 0.3036 0.3634 0.2420 -0.0575 -0.0129 0.0063  20  GLY A CA  
138  C C   . GLY A 20  ? 0.2851 0.3322 0.2318 -0.0472 -0.0103 0.0039  20  GLY A C   
139  O O   . GLY A 20  ? 0.3139 0.3513 0.2617 -0.0426 -0.0100 0.0053  20  GLY A O   
140  N N   . ARG A 21  ? 0.2872 0.3354 0.2394 -0.0442 -0.0084 0.0003  21  ARG A N   
141  C CA  . ARG A 21  ? 0.2441 0.2826 0.2035 -0.0355 -0.0060 -0.0015 21  ARG A CA  
142  C C   . ARG A 21  ? 0.2352 0.2686 0.1966 -0.0351 0.0009  -0.0089 21  ARG A C   
143  O O   . ARG A 21  ? 0.2248 0.2636 0.1855 -0.0410 0.0051  -0.0152 21  ARG A O   
144  C CB  . ARG A 21  ? 0.2815 0.3240 0.2466 -0.0332 -0.0064 -0.0021 21  ARG A CB  
145  C CG  . ARG A 21  ? 0.3235 0.3702 0.2903 -0.0320 -0.0136 0.0055  21  ARG A CG  
146  C CD  . ARG A 21  ? 0.2854 0.3365 0.2587 -0.0298 -0.0134 0.0041  21  ARG A CD  
147  N NE  . ARG A 21  ? 0.3067 0.3672 0.2779 -0.0367 -0.0105 -0.0015 21  ARG A NE  
148  C CZ  . ARG A 21  ? 0.3641 0.4297 0.3406 -0.0363 -0.0096 -0.0039 21  ARG A CZ  
149  N NH1 . ARG A 21  ? 0.3522 0.4147 0.3359 -0.0295 -0.0113 -0.0011 21  ARG A NH1 
150  N NH2 . ARG A 21  ? 0.3137 0.3879 0.2889 -0.0431 -0.0068 -0.0098 21  ARG A NH2 
151  N N   . CYS A 22  ? 0.1708 0.1945 0.1357 -0.0282 0.0018  -0.0081 22  CYS A N   
152  C CA  . CYS A 22  ? 0.1666 0.1853 0.1361 -0.0264 0.0073  -0.0133 22  CYS A CA  
153  C C   . CYS A 22  ? 0.1704 0.1878 0.1460 -0.0213 0.0082  -0.0134 22  CYS A C   
154  O O   . CYS A 22  ? 0.1865 0.2008 0.1627 -0.0160 0.0053  -0.0094 22  CYS A O   
155  C CB  . CYS A 22  ? 0.1438 0.1539 0.1123 -0.0230 0.0072  -0.0117 22  CYS A CB  
156  S SG  . CYS A 22  ? 0.1929 0.1974 0.1686 -0.0208 0.0128  -0.0162 22  CYS A SG  
157  N N   . GLN A 23  ? 0.1316 0.1519 0.1126 -0.0233 0.0125  -0.0182 23  GLN A N   
158  C CA  . GLN A 23  ? 0.1525 0.1731 0.1395 -0.0196 0.0135  -0.0179 23  GLN A CA  
159  C C   . GLN A 23  ? 0.1523 0.1683 0.1464 -0.0181 0.0179  -0.0201 23  GLN A C   
160  O O   . GLN A 23  ? 0.1589 0.1748 0.1569 -0.0217 0.0213  -0.0244 23  GLN A O   
161  C CB  . GLN A 23  ? 0.1613 0.1906 0.1503 -0.0237 0.0138  -0.0205 23  GLN A CB  
162  C CG  . GLN A 23  ? 0.1652 0.2009 0.1481 -0.0264 0.0087  -0.0174 23  GLN A CG  
163  C CD  . GLN A 23  ? 0.2104 0.2553 0.1961 -0.0296 0.0084  -0.0193 23  GLN A CD  
164  O OE1 . GLN A 23  ? 0.2369 0.2871 0.2246 -0.0352 0.0119  -0.0253 23  GLN A OE1 
165  N NE2 . GLN A 23  ? 0.2317 0.2788 0.2187 -0.0263 0.0043  -0.0147 23  GLN A NE2 
166  N N   . LYS A 24  ? 0.1483 0.1614 0.1449 -0.0132 0.0179  -0.0171 24  LYS A N   
167  C CA  . LYS A 24  ? 0.1565 0.1670 0.1609 -0.0123 0.0213  -0.0174 24  LYS A CA  
168  C C   . LYS A 24  ? 0.1545 0.1699 0.1668 -0.0152 0.0242  -0.0205 24  LYS A C   
169  O O   . LYS A 24  ? 0.1590 0.1793 0.1706 -0.0150 0.0231  -0.0203 24  LYS A O   
170  C CB  . LYS A 24  ? 0.1664 0.1741 0.1699 -0.0072 0.0203  -0.0128 24  LYS A CB  
171  C CG  . LYS A 24  ? 0.1715 0.1776 0.1831 -0.0071 0.0231  -0.0112 24  LYS A CG  
172  C CD  . LYS A 24  ? 0.1739 0.1797 0.1832 -0.0035 0.0222  -0.0066 24  LYS A CD  
173  C CE  . LYS A 24  ? 0.2225 0.2239 0.2252 -0.0013 0.0200  -0.0050 24  LYS A CE  
174  N NZ  . LYS A 24  ? 0.2203 0.2229 0.2214 0.0008  0.0197  -0.0012 24  LYS A NZ  
175  N N   . ILE A 25  ? 0.1476 0.1620 0.1691 -0.0180 0.0279  -0.0238 25  ILE A N   
176  C CA  . ILE A 25  ? 0.1572 0.1759 0.1888 -0.0212 0.0311  -0.0278 25  ILE A CA  
177  C C   . ILE A 25  ? 0.1440 0.1589 0.1887 -0.0203 0.0339  -0.0261 25  ILE A C   
178  O O   . ILE A 25  ? 0.1608 0.1705 0.2073 -0.0184 0.0336  -0.0229 25  ILE A O   
179  C CB  . ILE A 25  ? 0.1385 0.1619 0.1717 -0.0274 0.0333  -0.0358 25  ILE A CB  
180  C CG1 . ILE A 25  ? 0.1459 0.1653 0.1855 -0.0293 0.0363  -0.0393 25  ILE A CG1 
181  C CG2 . ILE A 25  ? 0.1518 0.1798 0.1718 -0.0291 0.0297  -0.0357 25  ILE A CG2 
182  C CD1 . ILE A 25  ? 0.1656 0.1909 0.2060 -0.0361 0.0392  -0.0485 25  ILE A CD1 
183  N N   A ARG A 26  ? 0.1505 0.1686 0.2053 -0.0220 0.0363  -0.0277 26  ARG A N   
184  N N   B ARG A 26  ? 0.1491 0.1671 0.2037 -0.0219 0.0362  -0.0275 26  ARG A N   
185  C CA  A ARG A 26  ? 0.1666 0.1818 0.2365 -0.0218 0.0387  -0.0250 26  ARG A CA  
186  C CA  B ARG A 26  ? 0.1604 0.1756 0.2303 -0.0219 0.0387  -0.0251 26  ARG A CA  
187  C C   A ARG A 26  ? 0.1668 0.1839 0.2522 -0.0266 0.0430  -0.0328 26  ARG A C   
188  C C   B ARG A 26  ? 0.1635 0.1808 0.2479 -0.0268 0.0429  -0.0334 26  ARG A C   
189  O O   A ARG A 26  ? 0.1881 0.2108 0.2749 -0.0295 0.0443  -0.0375 26  ARG A O   
190  O O   B ARG A 26  ? 0.1420 0.1652 0.2261 -0.0300 0.0441  -0.0390 26  ARG A O   
191  C CB  A ARG A 26  ? 0.1985 0.2155 0.2684 -0.0193 0.0376  -0.0185 26  ARG A CB  
192  C CB  B ARG A 26  ? 0.1950 0.2122 0.2663 -0.0197 0.0380  -0.0189 26  ARG A CB  
193  C CG  A ARG A 26  ? 0.2311 0.2475 0.3182 -0.0206 0.0401  -0.0156 26  ARG A CG  
194  C CG  B ARG A 26  ? 0.2023 0.2169 0.2888 -0.0197 0.0395  -0.0137 26  ARG A CG  
195  C CD  A ARG A 26  ? 0.3045 0.3249 0.3899 -0.0193 0.0395  -0.0103 26  ARG A CD  
196  C CD  B ARG A 26  ? 0.2738 0.2923 0.3606 -0.0187 0.0392  -0.0080 26  ARG A CD  
197  N NE  A ARG A 26  ? 0.3743 0.3937 0.4528 -0.0161 0.0372  -0.0017 26  ARG A NE  
198  N NE  B ARG A 26  ? 0.2202 0.2372 0.3221 -0.0196 0.0402  -0.0015 26  ARG A NE  
199  C CZ  A ARG A 26  ? 0.3555 0.3790 0.4238 -0.0141 0.0359  0.0014  26  ARG A CZ  
200  C CZ  B ARG A 26  ? 0.2775 0.2952 0.3965 -0.0226 0.0431  -0.0035 26  ARG A CZ  
201  N NH1 A ARG A 26  ? 0.2997 0.3234 0.3619 -0.0122 0.0343  0.0081  26  ARG A NH1 
202  N NH1 B ARG A 26  ? 0.2185 0.2390 0.3408 -0.0252 0.0455  -0.0129 26  ARG A NH1 
203  N NH2 A ARG A 26  ? 0.3747 0.4029 0.4392 -0.0142 0.0362  -0.0026 26  ARG A NH2 
204  N NH2 B ARG A 26  ? 0.2812 0.2974 0.4150 -0.0233 0.0433  0.0041  26  ARG A NH2 
205  N N   . ARG A 27  ? 0.1587 0.1718 0.2570 -0.0277 0.0453  -0.0347 27  ARG A N   
206  C CA  . ARG A 27  ? 0.1739 0.1885 0.2901 -0.0323 0.0500  -0.0434 27  ARG A CA  
207  C C   . ARG A 27  ? 0.1925 0.2071 0.3242 -0.0324 0.0514  -0.0402 27  ARG A C   
208  O O   . ARG A 27  ? 0.2310 0.2416 0.3689 -0.0294 0.0497  -0.0307 27  ARG A O   
209  C CB  . ARG A 27  ? 0.1890 0.1988 0.3173 -0.0329 0.0520  -0.0459 27  ARG A CB  
210  C CG  . ARG A 27  ? 0.1830 0.1950 0.3309 -0.0381 0.0578  -0.0576 27  ARG A CG  
211  C CD  . ARG A 27  ? 0.1823 0.1912 0.3389 -0.0390 0.0599  -0.0621 27  ARG A CD  
212  N NE  . ARG A 27  ? 0.2327 0.2342 0.4009 -0.0348 0.0578  -0.0525 27  ARG A NE  
213  C CZ  . ARG A 27  ? 0.2318 0.2297 0.4073 -0.0342 0.0583  -0.0533 27  ARG A CZ  
214  N NH1 . ARG A 27  ? 0.2261 0.2269 0.3978 -0.0377 0.0614  -0.0637 27  ARG A NH1 
215  N NH2 . ARG A 27  ? 0.2777 0.2699 0.4643 -0.0307 0.0555  -0.0433 27  ARG A NH2 
216  N N   . LYS A 28  ? 0.1964 0.2165 0.3342 -0.0363 0.0542  -0.0476 28  LYS A N   
217  C CA  . LYS A 28  ? 0.1929 0.2139 0.3441 -0.0366 0.0553  -0.0444 28  LYS A CA  
218  C C   . LYS A 28  ? 0.2687 0.2845 0.4457 -0.0371 0.0578  -0.0428 28  LYS A C   
219  O O   . LYS A 28  ? 0.3317 0.3458 0.5182 -0.0357 0.0569  -0.0340 28  LYS A O   
220  C CB  . LYS A 28  ? 0.2426 0.2711 0.3946 -0.0411 0.0577  -0.0537 28  LYS A CB  
221  C CG  . LYS A 28  ? 0.2807 0.3150 0.4105 -0.0403 0.0542  -0.0527 28  LYS A CG  
222  C CD  . LYS A 28  ? 0.2938 0.3362 0.4267 -0.0449 0.0560  -0.0602 28  LYS A CD  
223  C CE  . LYS A 28  ? 0.2973 0.3454 0.4115 -0.0435 0.0518  -0.0571 28  LYS A CE  
224  N NZ  . LYS A 28  ? 0.2707 0.3271 0.3893 -0.0478 0.0531  -0.0632 28  LYS A NZ  
225  N N   . SER A 29  ? 0.2514 0.2652 0.4408 -0.0395 0.0610  -0.0509 29  SER A N   
226  C CA  . SER A 29  ? 0.3240 0.3331 0.5423 -0.0403 0.0636  -0.0505 29  SER A CA  
227  C C   . SER A 29  ? 0.3956 0.3987 0.6184 -0.0359 0.0594  -0.0350 29  SER A C   
228  O O   . SER A 29  ? 0.3892 0.3900 0.6324 -0.0360 0.0595  -0.0287 29  SER A O   
229  C CB  . SER A 29  ? 0.3274 0.3358 0.5578 -0.0433 0.0678  -0.0624 29  SER A CB  
230  O OG  . SER A 29  ? 0.2878 0.2942 0.5025 -0.0409 0.0654  -0.0602 29  SER A OG  
231  N N   . ASP A 30  ? 0.2602 0.2616 0.4641 -0.0325 0.0555  -0.0287 30  ASP A N   
232  C CA  . ASP A 30  ? 0.3309 0.3281 0.5377 -0.0291 0.0513  -0.0148 30  ASP A CA  
233  C C   . ASP A 30  ? 0.3027 0.3017 0.4830 -0.0258 0.0467  -0.0061 30  ASP A C   
234  O O   . ASP A 30  ? 0.2602 0.2574 0.4391 -0.0237 0.0431  0.0051  30  ASP A O   
235  C CB  . ASP A 30  ? 0.2805 0.2729 0.4996 -0.0286 0.0515  -0.0159 30  ASP A CB  
236  C CG  . ASP A 30  ? 0.3398 0.3327 0.5400 -0.0282 0.0516  -0.0232 30  ASP A CG  
237  O OD1 . ASP A 30  ? 0.2598 0.2568 0.4399 -0.0289 0.0519  -0.0285 30  ASP A OD1 
238  O OD2 . ASP A 30  ? 0.3590 0.3483 0.5651 -0.0273 0.0511  -0.0231 30  ASP A OD2 
239  N N   . GLY A 31  ? 0.2518 0.2548 0.4121 -0.0257 0.0468  -0.0115 31  GLY A N   
240  C CA  . GLY A 31  ? 0.2707 0.2756 0.4081 -0.0226 0.0431  -0.0052 31  GLY A CA  
241  C C   . GLY A 31  ? 0.2881 0.2902 0.4120 -0.0203 0.0406  -0.0047 31  GLY A C   
242  O O   . GLY A 31  ? 0.2800 0.2830 0.3878 -0.0176 0.0374  0.0009  31  GLY A O   
243  N N   . LYS A 32  ? 0.2235 0.2226 0.3548 -0.0216 0.0423  -0.0111 32  LYS A N   
244  C CA  . LYS A 32  ? 0.2165 0.2127 0.3367 -0.0197 0.0401  -0.0105 32  LYS A CA  
245  C C   . LYS A 32  ? 0.1912 0.1898 0.2887 -0.0187 0.0386  -0.0138 32  LYS A C   
246  O O   . LYS A 32  ? 0.1883 0.1906 0.2819 -0.0211 0.0405  -0.0213 32  LYS A O   
247  C CB  . LYS A 32  ? 0.2109 0.2043 0.3448 -0.0218 0.0429  -0.0177 32  LYS A CB  
248  C CG  . LYS A 32  ? 0.2658 0.2563 0.3891 -0.0201 0.0407  -0.0170 32  LYS A CG  
249  C CD  . LYS A 32  ? 0.3424 0.3303 0.4829 -0.0220 0.0436  -0.0227 32  LYS A CD  
250  C CE  . LYS A 32  ? 0.4095 0.3944 0.5408 -0.0201 0.0410  -0.0204 32  LYS A CE  
251  N NZ  . LYS A 32  ? 0.4423 0.4248 0.5722 -0.0167 0.0361  -0.0080 32  LYS A NZ  
252  N N   . ILE A 33  ? 0.1657 0.1629 0.2494 -0.0156 0.0350  -0.0080 33  ILE A N   
253  C CA  . ILE A 33  ? 0.1438 0.1424 0.2086 -0.0142 0.0330  -0.0102 33  ILE A CA  
254  C C   . ILE A 33  ? 0.1854 0.1817 0.2464 -0.0155 0.0334  -0.0157 33  ILE A C   
255  O O   . ILE A 33  ? 0.1965 0.1889 0.2621 -0.0149 0.0329  -0.0141 33  ILE A O   
256  C CB  . ILE A 33  ? 0.1802 0.1787 0.2330 -0.0106 0.0295  -0.0029 33  ILE A CB  
257  C CG1 . ILE A 33  ? 0.2077 0.2101 0.2634 -0.0102 0.0297  0.0022  33  ILE A CG1 
258  C CG2 . ILE A 33  ? 0.1841 0.1833 0.2208 -0.0090 0.0274  -0.0055 33  ILE A CG2 
259  C CD1 . ILE A 33  ? 0.2099 0.2167 0.2638 -0.0111 0.0311  -0.0021 33  ILE A CD1 
260  N N   . LEU A 34  ? 0.1530 0.1526 0.2061 -0.0176 0.0340  -0.0218 34  LEU A N   
261  C CA  . LEU A 34  ? 0.1403 0.1397 0.1890 -0.0202 0.0347  -0.0273 34  LEU A CA  
262  C C   . LEU A 34  ? 0.1419 0.1440 0.1740 -0.0199 0.0316  -0.0270 34  LEU A C   
263  O O   . LEU A 34  ? 0.1489 0.1525 0.1753 -0.0173 0.0294  -0.0233 34  LEU A O   
264  C CB  . LEU A 34  ? 0.1456 0.1486 0.2057 -0.0255 0.0394  -0.0364 34  LEU A CB  
265  C CG  . LEU A 34  ? 0.1351 0.1352 0.2161 -0.0261 0.0427  -0.0376 34  LEU A CG  
266  C CD1 . LEU A 34  ? 0.1548 0.1595 0.2494 -0.0311 0.0477  -0.0470 34  LEU A CD1 
267  C CD2 . LEU A 34  ? 0.1952 0.1912 0.2803 -0.0259 0.0430  -0.0382 34  LEU A CD2 
268  N N   . VAL A 35  ? 0.1453 0.1485 0.1709 -0.0227 0.0315  -0.0307 35  VAL A N   
269  C CA  . VAL A 35  ? 0.1336 0.1410 0.1465 -0.0240 0.0286  -0.0304 35  VAL A CA  
270  C C   . VAL A 35  ? 0.1509 0.1652 0.1639 -0.0309 0.0313  -0.0378 35  VAL A C   
271  O O   . VAL A 35  ? 0.1537 0.1686 0.1757 -0.0344 0.0356  -0.0440 35  VAL A O   
272  C CB  . VAL A 35  ? 0.1466 0.1501 0.1488 -0.0216 0.0248  -0.0261 35  VAL A CB  
273  C CG1 . VAL A 35  ? 0.1593 0.1569 0.1615 -0.0156 0.0228  -0.0204 35  VAL A CG1 
274  C CG2 . VAL A 35  ? 0.1511 0.1537 0.1532 -0.0252 0.0266  -0.0298 35  VAL A CG2 
275  N N   . TRP A 36  ? 0.1371 0.1576 0.1413 -0.0333 0.0287  -0.0374 36  TRP A N   
276  C CA  . TRP A 36  ? 0.1558 0.1841 0.1556 -0.0407 0.0301  -0.0431 36  TRP A CA  
277  C C   . TRP A 36  ? 0.1818 0.2128 0.1681 -0.0417 0.0247  -0.0377 36  TRP A C   
278  O O   . TRP A 36  ? 0.1713 0.1994 0.1534 -0.0367 0.0201  -0.0307 36  TRP A O   
279  C CB  . TRP A 36  ? 0.1621 0.1990 0.1677 -0.0462 0.0334  -0.0503 36  TRP A CB  
280  C CG  . TRP A 36  ? 0.1507 0.1927 0.1531 -0.0456 0.0302  -0.0473 36  TRP A CG  
281  C CD1 . TRP A 36  ? 0.1744 0.2167 0.1677 -0.0424 0.0243  -0.0396 36  TRP A CD1 
282  C CD2 . TRP A 36  ? 0.1653 0.2135 0.1753 -0.0486 0.0329  -0.0527 36  TRP A CD2 
283  N NE1 . TRP A 36  ? 0.1998 0.2482 0.1947 -0.0431 0.0230  -0.0395 36  TRP A NE1 
284  C CE2 . TRP A 36  ? 0.1735 0.2257 0.1779 -0.0470 0.0282  -0.0475 36  TRP A CE2 
285  C CE3 . TRP A 36  ? 0.1899 0.2405 0.2128 -0.0525 0.0388  -0.0618 36  TRP A CE3 
286  C CZ2 . TRP A 36  ? 0.1873 0.2460 0.1971 -0.0493 0.0292  -0.0508 36  TRP A CZ2 
287  C CZ3 . TRP A 36  ? 0.2191 0.2759 0.2476 -0.0549 0.0400  -0.0653 36  TRP A CZ3 
288  C CH2 . TRP A 36  ? 0.2025 0.2634 0.2238 -0.0533 0.0351  -0.0597 36  TRP A CH2 
289  N N   . LYS A 37  ? 0.2214 0.3564 0.1356 0.0567  -0.0948 -0.0544 37  LYS A N   
290  C CA  . LYS A 37  ? 0.2003 0.3387 0.1252 0.0519  -0.1005 -0.0511 37  LYS A CA  
291  C C   . LYS A 37  ? 0.2768 0.4180 0.1991 0.0423  -0.0977 -0.0464 37  LYS A C   
292  O O   . LYS A 37  ? 0.2940 0.4352 0.2102 0.0373  -0.0920 -0.0454 37  LYS A O   
293  C CB  . LYS A 37  ? 0.2485 0.3889 0.1822 0.0519  -0.1050 -0.0521 37  LYS A CB  
294  C CG  . LYS A 37  ? 0.2755 0.4130 0.2125 0.0613  -0.1092 -0.0567 37  LYS A CG  
295  C CD  . LYS A 37  ? 0.3593 0.4993 0.3070 0.0616  -0.1144 -0.0581 37  LYS A CD  
296  C CE  . LYS A 37  ? 0.3575 0.4938 0.3077 0.0708  -0.1195 -0.0627 37  LYS A CE  
297  N NZ  . LYS A 37  ? 0.4825 0.6216 0.4445 0.0714  -0.1254 -0.0646 37  LYS A NZ  
298  N N   . GLU A 38  ? 0.2278 0.3701 0.1548 0.0399  -0.1010 -0.0436 38  GLU A N   
299  C CA  . GLU A 38  ? 0.2790 0.4235 0.2036 0.0311  -0.0998 -0.0390 38  GLU A CA  
300  C C   . GLU A 38  ? 0.3865 0.5324 0.3156 0.0242  -0.1033 -0.0356 38  GLU A C   
301  O O   . GLU A 38  ? 0.4337 0.5800 0.3720 0.0260  -0.1087 -0.0357 38  GLU A O   
302  C CB  . GLU A 38  ? 0.3165 0.4617 0.2446 0.0318  -0.1025 -0.0373 38  GLU A CB  
303  C CG  . GLU A 38  ? 0.4080 0.5515 0.3300 0.0365  -0.0984 -0.0401 38  GLU A CG  
304  C CD  . GLU A 38  ? 0.5244 0.6696 0.4510 0.0360  -0.1013 -0.0382 38  GLU A CD  
305  O OE1 . GLU A 38  ? 0.5152 0.6617 0.4511 0.0355  -0.1073 -0.0358 38  GLU A OE1 
306  O OE2 . GLU A 38  ? 0.5972 0.7425 0.5182 0.0362  -0.0975 -0.0392 38  GLU A OE2 
307  N N   A LEU A 39  ? 0.3213 0.4669 0.2432 0.0161  -0.0993 -0.0329 39  LEU A N   
308  N N   B LEU A 39  ? 0.3210 0.4667 0.2430 0.0160  -0.0995 -0.0328 39  LEU A N   
309  C CA  A LEU A 39  ? 0.3322 0.4769 0.2563 0.0086  -0.1010 -0.0293 39  LEU A CA  
310  C CA  B LEU A 39  ? 0.3320 0.4766 0.2563 0.0086  -0.1010 -0.0293 39  LEU A CA  
311  C C   A LEU A 39  ? 0.3417 0.4857 0.2584 0.0004  -0.1002 -0.0249 39  LEU A C   
312  C C   B LEU A 39  ? 0.3434 0.4872 0.2601 0.0000  -0.1000 -0.0248 39  LEU A C   
313  O O   A LEU A 39  ? 0.3416 0.4846 0.2487 -0.0026 -0.0941 -0.0247 39  LEU A O   
314  O O   B LEU A 39  ? 0.3655 0.5077 0.2723 -0.0037 -0.0935 -0.0244 39  LEU A O   
315  C CB  A LEU A 39  ? 0.3658 0.5078 0.2882 0.0063  -0.0953 -0.0304 39  LEU A CB  
316  C CB  B LEU A 39  ? 0.3630 0.5053 0.2863 0.0072  -0.0956 -0.0308 39  LEU A CB  
317  C CG  A LEU A 39  ? 0.3885 0.5312 0.3193 0.0132  -0.0964 -0.0347 39  LEU A CG  
318  C CG  B LEU A 39  ? 0.4046 0.5439 0.3302 -0.0002 -0.0954 -0.0281 39  LEU A CG  
319  C CD1 A LEU A 39  ? 0.3895 0.5325 0.3165 0.0212  -0.0935 -0.0389 39  LEU A CD1 
320  C CD1 B LEU A 39  ? 0.4751 0.6156 0.4110 0.0009  -0.1033 -0.0272 39  LEU A CD1 
321  C CD2 A LEU A 39  ? 0.4163 0.5608 0.3584 0.0165  -0.1047 -0.0351 39  LEU A CD2 
322  C CD2 B LEU A 39  ? 0.3686 0.5042 0.2833 -0.0099 -0.0915 -0.0237 39  LEU A CD2 
323  N N   . ASP A 40  ? 0.3330 0.4775 0.2539 -0.0031 -0.1065 -0.0213 40  ASP A N   
324  C CA  . ASP A 40  ? 0.3650 0.5082 0.2788 -0.0112 -0.1071 -0.0167 40  ASP A CA  
325  C C   . ASP A 40  ? 0.3854 0.5229 0.2933 -0.0194 -0.1041 -0.0141 40  ASP A C   
326  O O   . ASP A 40  ? 0.3676 0.5029 0.2810 -0.0204 -0.1073 -0.0131 40  ASP A O   
327  C CB  . ASP A 40  ? 0.3942 0.5395 0.3156 -0.0107 -0.1148 -0.0138 40  ASP A CB  
328  C CG  . ASP A 40  ? 0.5338 0.6785 0.4487 -0.0182 -0.1163 -0.0094 40  ASP A CG  
329  O OD1 . ASP A 40  ? 0.4776 0.6198 0.3808 -0.0244 -0.1117 -0.0086 40  ASP A OD1 
330  O OD2 . ASP A 40  ? 0.6189 0.7653 0.5401 -0.0178 -0.1222 -0.0067 40  ASP A OD2 
331  N N   . TYR A 41  ? 0.3745 0.5087 0.2708 -0.0254 -0.0975 -0.0131 41  TYR A N   
332  C CA  . TYR A 41  ? 0.3125 0.4393 0.2015 -0.0337 -0.0934 -0.0105 41  TYR A CA  
333  C C   . TYR A 41  ? 0.2855 0.4080 0.1650 -0.0426 -0.0960 -0.0055 41  TYR A C   
334  O O   . TYR A 41  ? 0.3532 0.4678 0.2231 -0.0505 -0.0918 -0.0030 41  TYR A O   
335  C CB  . TYR A 41  ? 0.3226 0.4465 0.2042 -0.0349 -0.0832 -0.0127 41  TYR A CB  
336  C CG  . TYR A 41  ? 0.3693 0.4941 0.2404 -0.0368 -0.0782 -0.0128 41  TYR A CG  
337  C CD1 . TYR A 41  ? 0.4103 0.5296 0.2684 -0.0464 -0.0753 -0.0092 41  TYR A CD1 
338  C CD2 . TYR A 41  ? 0.4065 0.5364 0.2796 -0.0292 -0.0762 -0.0168 41  TYR A CD2 
339  C CE1 . TYR A 41  ? 0.4164 0.5366 0.2651 -0.0485 -0.0705 -0.0097 41  TYR A CE1 
340  C CE2 . TYR A 41  ? 0.4269 0.5571 0.2904 -0.0309 -0.0709 -0.0173 41  TYR A CE2 
341  C CZ  . TYR A 41  ? 0.4459 0.5717 0.2977 -0.0407 -0.0680 -0.0138 41  TYR A CZ  
342  O OH  . TYR A 41  ? 0.5201 0.6463 0.3626 -0.0428 -0.0625 -0.0145 41  TYR A OH  
343  N N   . GLY A 42  ? 0.2703 0.3975 0.1527 -0.0412 -0.1030 -0.0040 42  GLY A N   
344  C CA  . GLY A 42  ? 0.3534 0.4778 0.2275 -0.0490 -0.1067 0.0007  42  GLY A CA  
345  C C   . GLY A 42  ? 0.4336 0.5500 0.3038 -0.0554 -0.1104 0.0049  42  GLY A C   
346  O O   . GLY A 42  ? 0.4291 0.5392 0.2875 -0.0637 -0.1109 0.0086  42  GLY A O   
347  N N   . SER A 43  ? 0.4174 0.5331 0.2969 -0.0516 -0.1129 0.0041  43  SER A N   
348  C CA  . SER A 43  ? 0.4355 0.5428 0.3116 -0.0570 -0.1160 0.0078  43  SER A CA  
349  C C   . SER A 43  ? 0.4177 0.5161 0.2887 -0.0611 -0.1079 0.0069  43  SER A C   
350  O O   . SER A 43  ? 0.4461 0.5359 0.3143 -0.0654 -0.1087 0.0091  43  SER A O   
351  C CB  . SER A 43  ? 0.5306 0.6418 0.4197 -0.0512 -0.1239 0.0080  43  SER A CB  
352  O OG  . SER A 43  ? 0.5590 0.6771 0.4528 -0.0483 -0.1313 0.0096  43  SER A OG  
353  N N   . MET A 44  ? 0.4519 0.5517 0.3219 -0.0597 -0.0997 0.0035  44  MET A N   
354  C CA  . MET A 44  ? 0.3909 0.4834 0.2590 -0.0626 -0.0914 0.0021  44  MET A CA  
355  C C   . MET A 44  ? 0.3831 0.4637 0.2339 -0.0731 -0.0849 0.0054  44  MET A C   
356  O O   . MET A 44  ? 0.4056 0.4858 0.2455 -0.0771 -0.0841 0.0072  44  MET A O   
357  C CB  . MET A 44  ? 0.3425 0.4414 0.2180 -0.0560 -0.0855 -0.0029 44  MET A CB  
358  C CG  . MET A 44  ? 0.3632 0.4712 0.2548 -0.0460 -0.0910 -0.0065 44  MET A CG  
359  S SD  . MET A 44  ? 0.4264 0.5398 0.3244 -0.0386 -0.0844 -0.0122 44  MET A SD  
360  C CE  . MET A 44  ? 0.5003 0.6227 0.4148 -0.0277 -0.0930 -0.0158 44  MET A CE  
361  N N   . THR A 45  ? 0.4095 0.4799 0.2580 -0.0777 -0.0800 0.0060  45  THR A N   
362  C CA  . THR A 45  ? 0.4325 0.4894 0.2645 -0.0875 -0.0719 0.0087  45  THR A CA  
363  C C   . THR A 45  ? 0.4100 0.4682 0.2411 -0.0869 -0.0614 0.0057  45  THR A C   
364  O O   . THR A 45  ? 0.3469 0.4150 0.1910 -0.0787 -0.0606 0.0016  45  THR A O   
365  C CB  . THR A 45  ? 0.4688 0.5130 0.2993 -0.0924 -0.0693 0.0100  45  THR A CB  
366  O OG1 . THR A 45  ? 0.4144 0.4624 0.2604 -0.0868 -0.0652 0.0057  45  THR A OG1 
367  C CG2 . THR A 45  ? 0.4524 0.4944 0.2832 -0.0926 -0.0795 0.0129  45  THR A CG2 
368  N N   . GLU A 46  ? 0.3961 0.4432 0.2110 -0.0956 -0.0532 0.0080  46  GLU A N   
369  C CA  . GLU A 46  ? 0.3767 0.4233 0.1895 -0.0958 -0.0421 0.0058  46  GLU A CA  
370  C C   . GLU A 46  ? 0.3688 0.4162 0.1962 -0.0913 -0.0369 0.0023  46  GLU A C   
371  O O   . GLU A 46  ? 0.3878 0.4427 0.2233 -0.0854 -0.0326 -0.0013 46  GLU A O   
372  C CB  . GLU A 46  ? 0.4096 0.4415 0.2019 -0.1070 -0.0336 0.0093  46  GLU A CB  
373  C CG  . GLU A 46  ? 0.5013 0.5334 0.2791 -0.1115 -0.0377 0.0121  46  GLU A CG  
374  C CD  . GLU A 46  ? 0.6423 0.6600 0.3991 -0.1223 -0.0283 0.0150  46  GLU A CD  
375  O OE1 . GLU A 46  ? 0.6051 0.6122 0.3586 -0.1263 -0.0180 0.0150  46  GLU A OE1 
376  O OE2 . GLU A 46  ? 0.6525 0.6693 0.3965 -0.1271 -0.0311 0.0172  46  GLU A OE2 
377  N N   . ALA A 47  ? 0.4334 0.4728 0.2641 -0.0941 -0.0376 0.0032  47  ALA A N   
378  C CA  . ALA A 47  ? 0.4137 0.4534 0.2595 -0.0906 -0.0330 -0.0003 47  ALA A CA  
379  C C   . ALA A 47  ? 0.4249 0.4804 0.2901 -0.0791 -0.0401 -0.0047 47  ALA A C   
380  O O   . ALA A 47  ? 0.4143 0.4748 0.2916 -0.0740 -0.0359 -0.0085 47  ALA A O   
381  C CB  . ALA A 47  ? 0.4377 0.4651 0.2829 -0.0960 -0.0326 0.0014  47  ALA A CB  
382  N N   . GLU A 48  ? 0.3679 0.4306 0.2358 -0.0752 -0.0509 -0.0040 48  GLU A N   
383  C CA  . GLU A 48  ? 0.3654 0.4416 0.2496 -0.0646 -0.0579 -0.0080 48  GLU A CA  
384  C C   . GLU A 48  ? 0.3187 0.4037 0.2034 -0.0588 -0.0557 -0.0106 48  GLU A C   
385  O O   . GLU A 48  ? 0.3384 0.4310 0.2356 -0.0509 -0.0560 -0.0148 48  GLU A O   
386  C CB  . GLU A 48  ? 0.3945 0.4749 0.2807 -0.0623 -0.0692 -0.0062 48  GLU A CB  
387  C CG  . GLU A 48  ? 0.4315 0.5043 0.3201 -0.0658 -0.0721 -0.0045 48  GLU A CG  
388  C CD  . GLU A 48  ? 0.5057 0.5813 0.3939 -0.0644 -0.0827 -0.0018 48  GLU A CD  
389  O OE1 . GLU A 48  ? 0.5281 0.6078 0.4094 -0.0643 -0.0866 0.0001  48  GLU A OE1 
390  O OE2 . GLU A 48  ? 0.5719 0.6456 0.4673 -0.0633 -0.0869 -0.0018 48  GLU A OE2 
391  N N   . LYS A 49  ? 0.3371 0.4205 0.2075 -0.0627 -0.0534 -0.0082 49  LYS A N   
392  C CA  . LYS A 49  ? 0.3269 0.4169 0.1953 -0.0579 -0.0499 -0.0106 49  LYS A CA  
393  C C   . LYS A 49  ? 0.4028 0.4901 0.2729 -0.0576 -0.0395 -0.0128 49  LYS A C   
394  O O   . LYS A 49  ? 0.3564 0.4508 0.2325 -0.0501 -0.0380 -0.0164 49  LYS A O   
395  C CB  . LYS A 49  ? 0.4023 0.4904 0.2549 -0.0632 -0.0491 -0.0076 49  LYS A CB  
396  C CG  . LYS A 49  ? 0.4366 0.5310 0.2910 -0.0606 -0.0597 -0.0065 49  LYS A CG  
397  C CD  . LYS A 49  ? 0.4075 0.5010 0.2480 -0.0658 -0.0591 -0.0040 49  LYS A CD  
398  C CE  . LYS A 49  ? 0.4266 0.5081 0.2525 -0.0772 -0.0569 0.0006  49  LYS A CE  
399  N NZ  . LYS A 49  ? 0.4631 0.5442 0.2762 -0.0824 -0.0579 0.0030  49  LYS A NZ  
400  N N   . GLN A 50  ? 0.4035 0.4800 0.2684 -0.0657 -0.0322 -0.0107 50  GLN A N   
401  C CA  . GLN A 50  ? 0.4293 0.5027 0.2976 -0.0658 -0.0218 -0.0126 50  GLN A CA  
402  C C   . GLN A 50  ? 0.3870 0.4678 0.2757 -0.0573 -0.0248 -0.0170 50  GLN A C   
403  O O   . GLN A 50  ? 0.3894 0.4744 0.2846 -0.0519 -0.0204 -0.0201 50  GLN A O   
404  C CB  . GLN A 50  ? 0.4771 0.5357 0.3360 -0.0765 -0.0130 -0.0093 50  GLN A CB  
405  C CG  . GLN A 50  ? 0.6154 0.6700 0.4778 -0.0773 -0.0011 -0.0109 50  GLN A CG  
406  C CD  . GLN A 50  ? 0.6490 0.7074 0.5041 -0.0747 0.0049  -0.0116 50  GLN A CD  
407  O OE1 . GLN A 50  ? 0.6619 0.7150 0.4995 -0.0807 0.0086  -0.0088 50  GLN A OE1 
408  N NE2 . GLN A 50  ? 0.6813 0.7484 0.5493 -0.0658 0.0058  -0.0156 50  GLN A NE2 
409  N N   . MET A 51  ? 0.3693 0.4513 0.2677 -0.0560 -0.0326 -0.0174 51  MET A N   
410  C CA  . MET A 51  ? 0.3960 0.4855 0.3139 -0.0481 -0.0368 -0.0219 51  MET A CA  
411  C C   . MET A 51  ? 0.3836 0.4846 0.3065 -0.0377 -0.0427 -0.0252 51  MET A C   
412  O O   . MET A 51  ? 0.3490 0.4553 0.2832 -0.0309 -0.0421 -0.0291 51  MET A O   
413  C CB  . MET A 51  ? 0.3733 0.4617 0.2989 -0.0489 -0.0443 -0.0215 51  MET A CB  
414  C CG  . MET A 51  ? 0.5138 0.5895 0.4361 -0.0581 -0.0382 -0.0191 51  MET A CG  
415  S SD  . MET A 51  ? 1.0713 1.1460 1.0039 -0.0578 -0.0464 -0.0194 51  MET A SD  
416  C CE  . MET A 51  ? 0.5042 0.5919 0.4604 -0.0468 -0.0513 -0.0259 51  MET A CE  
417  N N   A LEU A 52  ? 0.3592 0.4633 0.2735 -0.0367 -0.0482 -0.0236 52  LEU A N   
418  N N   B LEU A 52  ? 0.3663 0.4705 0.2809 -0.0365 -0.0484 -0.0236 52  LEU A N   
419  C CA  A LEU A 52  ? 0.3656 0.4786 0.2822 -0.0274 -0.0532 -0.0265 52  LEU A CA  
420  C CA  B LEU A 52  ? 0.3526 0.4658 0.2698 -0.0271 -0.0531 -0.0267 52  LEU A CA  
421  C C   A LEU A 52  ? 0.3202 0.4342 0.2328 -0.0242 -0.0455 -0.0285 52  LEU A C   
422  C C   B LEU A 52  ? 0.3231 0.4369 0.2365 -0.0242 -0.0451 -0.0286 52  LEU A C   
423  O O   A LEU A 52  ? 0.3421 0.4620 0.2621 -0.0152 -0.0478 -0.0324 52  LEU A O   
424  O O   B LEU A 52  ? 0.3363 0.4558 0.2581 -0.0155 -0.0469 -0.0326 52  LEU A O   
425  C CB  A LEU A 52  ? 0.4173 0.5318 0.3244 -0.0285 -0.0584 -0.0239 52  LEU A CB  
426  C CB  B LEU A 52  ? 0.4071 0.5219 0.3144 -0.0279 -0.0580 -0.0243 52  LEU A CB  
427  C CG  A LEU A 52  ? 0.4299 0.5523 0.3398 -0.0191 -0.0642 -0.0268 52  LEU A CG  
428  C CG  B LEU A 52  ? 0.4410 0.5569 0.3526 -0.0286 -0.0674 -0.0225 52  LEU A CG  
429  C CD1 A LEU A 52  ? 0.4441 0.5716 0.3694 -0.0109 -0.0705 -0.0307 52  LEU A CD1 
430  C CD1 B LEU A 52  ? 0.4719 0.5908 0.3754 -0.0281 -0.0715 -0.0207 52  LEU A CD1 
431  C CD2 A LEU A 52  ? 0.4969 0.6206 0.4011 -0.0210 -0.0701 -0.0241 52  LEU A CD2 
432  C CD2 B LEU A 52  ? 0.4196 0.5412 0.3470 -0.0206 -0.0743 -0.0261 52  LEU A CD2 
433  N N   . VAL A 53  ? 0.3254 0.4327 0.2253 -0.0316 -0.0362 -0.0258 53  VAL A N   
434  C CA  . VAL A 53  ? 0.3146 0.4214 0.2091 -0.0297 -0.0273 -0.0271 53  VAL A CA  
435  C C   . VAL A 53  ? 0.3576 0.4658 0.2659 -0.0251 -0.0243 -0.0303 53  VAL A C   
436  O O   . VAL A 53  ? 0.3649 0.4779 0.2769 -0.0169 -0.0239 -0.0336 53  VAL A O   
437  C CB  . VAL A 53  ? 0.3893 0.4870 0.2676 -0.0399 -0.0172 -0.0232 53  VAL A CB  
438  C CG1 . VAL A 53  ? 0.4066 0.5024 0.2817 -0.0386 -0.0064 -0.0244 53  VAL A CG1 
439  C CG2 . VAL A 53  ? 0.3636 0.4612 0.2279 -0.0433 -0.0199 -0.0208 53  VAL A CG2 
440  N N   A SER A 54  ? 0.3634 0.4669 0.2793 -0.0303 -0.0222 -0.0294 54  SER A N   
441  N N   B SER A 54  ? 0.3635 0.4671 0.2795 -0.0303 -0.0222 -0.0294 54  SER A N   
442  C CA  A SER A 54  ? 0.3830 0.4881 0.3145 -0.0267 -0.0194 -0.0324 54  SER A CA  
443  C CA  B SER A 54  ? 0.3831 0.4882 0.3146 -0.0268 -0.0194 -0.0324 54  SER A CA  
444  C C   A SER A 54  ? 0.3730 0.4878 0.3196 -0.0160 -0.0296 -0.0370 54  SER A C   
445  C C   B SER A 54  ? 0.3739 0.4886 0.3207 -0.0161 -0.0296 -0.0370 54  SER A C   
446  O O   A SER A 54  ? 0.3530 0.4717 0.3091 -0.0093 -0.0287 -0.0404 54  SER A O   
447  O O   B SER A 54  ? 0.3548 0.4734 0.3117 -0.0096 -0.0287 -0.0404 54  SER A O   
448  C CB  A SER A 54  ? 0.4254 0.5229 0.3629 -0.0347 -0.0154 -0.0308 54  SER A CB  
449  C CB  B SER A 54  ? 0.4251 0.5225 0.3624 -0.0349 -0.0153 -0.0308 54  SER A CB  
450  O OG  A SER A 54  ? 0.4790 0.5768 0.4200 -0.0362 -0.0240 -0.0302 54  SER A OG  
451  O OG  B SER A 54  ? 0.4261 0.5127 0.3477 -0.0449 -0.0054 -0.0265 54  SER A OG  
452  N N   . GLU A 55  ? 0.3433 0.4612 0.2916 -0.0143 -0.0394 -0.0371 55  GLU A N   
453  C CA  . GLU A 55  ? 0.3817 0.5075 0.3431 -0.0047 -0.0493 -0.0412 55  GLU A CA  
454  C C   . GLU A 55  ? 0.3878 0.5183 0.3437 0.0042  -0.0520 -0.0436 55  GLU A C   
455  O O   . GLU A 55  ? 0.3533 0.4885 0.3189 0.0128  -0.0566 -0.0477 55  GLU A O   
456  C CB  . GLU A 55  ? 0.4805 0.6073 0.4455 -0.0060 -0.0581 -0.0404 55  GLU A CB  
457  C CG  . GLU A 55  ? 0.5761 0.6977 0.5481 -0.0135 -0.0562 -0.0389 55  GLU A CG  
458  C CD  . GLU A 55  ? 0.6460 0.7696 0.6359 -0.0108 -0.0550 -0.0427 55  GLU A CD  
459  O OE1 . GLU A 55  ? 0.5992 0.7300 0.5995 -0.0020 -0.0611 -0.0470 55  GLU A OE1 
460  O OE2 . GLU A 55  ? 0.6559 0.7733 0.6494 -0.0176 -0.0481 -0.0417 55  GLU A OE2 
461  N N   . VAL A 56  ? 0.3522 0.4808 0.2923 0.0023  -0.0492 -0.0413 56  VAL A N   
462  C CA  . VAL A 56  ? 0.3421 0.4734 0.2754 0.0103  -0.0498 -0.0436 56  VAL A CA  
463  C C   . VAL A 56  ? 0.3527 0.4835 0.2871 0.0141  -0.0429 -0.0458 56  VAL A C   
464  O O   . VAL A 56  ? 0.3794 0.5132 0.3164 0.0235  -0.0461 -0.0494 56  VAL A O   
465  C CB  . VAL A 56  ? 0.3917 0.5205 0.3081 0.0064  -0.0463 -0.0408 56  VAL A CB  
466  C CG1 . VAL A 56  ? 0.4673 0.5971 0.3757 0.0141  -0.0440 -0.0435 56  VAL A CG1 
467  C CG2 . VAL A 56  ? 0.4104 0.5408 0.3267 0.0046  -0.0544 -0.0391 56  VAL A CG2 
468  N N   . ASN A 57  ? 0.3196 0.4459 0.2518 0.0068  -0.0334 -0.0434 57  ASN A N   
469  C CA  . ASN A 57  ? 0.3552 0.4806 0.2892 0.0097  -0.0257 -0.0448 57  ASN A CA  
470  C C   . ASN A 57  ? 0.3959 0.5259 0.3489 0.0166  -0.0310 -0.0488 57  ASN A C   
471  O O   . ASN A 57  ? 0.4290 0.5609 0.3846 0.0239  -0.0297 -0.0514 57  ASN A O   
472  C CB  . ASN A 57  ? 0.4444 0.5628 0.3726 -0.0005 -0.0139 -0.0411 57  ASN A CB  
473  C CG  . ASN A 57  ? 0.5705 0.6840 0.4785 -0.0067 -0.0076 -0.0377 57  ASN A CG  
474  O OD1 . ASN A 57  ? 0.5900 0.7057 0.4887 -0.0021 -0.0099 -0.0387 57  ASN A OD1 
475  N ND2 . ASN A 57  ? 0.5765 0.6825 0.4773 -0.0173 0.0005  -0.0339 57  ASN A ND2 
476  N N   . LEU A 58  ? 0.3223 0.4542 0.2885 0.0145  -0.0372 -0.0492 58  LEU A N   
477  C CA  . LEU A 58  ? 0.2908 0.4276 0.2763 0.0206  -0.0432 -0.0533 58  LEU A CA  
478  C C   . LEU A 58  ? 0.3045 0.4464 0.2911 0.0314  -0.0536 -0.0571 58  LEU A C   
479  O O   . LEU A 58  ? 0.3641 0.5094 0.3603 0.0392  -0.0572 -0.0608 58  LEU A O   
480  C CB  . LEU A 58  ? 0.3863 0.5230 0.3847 0.0149  -0.0463 -0.0530 58  LEU A CB  
481  C CG  . LEU A 58  ? 0.5022 0.6325 0.5026 0.0050  -0.0358 -0.0501 58  LEU A CG  
482  C CD1 . LEU A 58  ? 0.5506 0.6785 0.5580 -0.0014 -0.0388 -0.0492 58  LEU A CD1 
483  C CD2 . LEU A 58  ? 0.4784 0.6100 0.4925 0.0076  -0.0305 -0.0525 58  LEU A CD2 
484  N N   . LEU A 59  ? 0.2919 0.4335 0.2686 0.0316  -0.0585 -0.0561 59  LEU A N   
485  C CA  . LEU A 59  ? 0.3019 0.4460 0.2764 0.0412  -0.0672 -0.0592 59  LEU A CA  
486  C C   . LEU A 59  ? 0.3051 0.4479 0.2704 0.0482  -0.0632 -0.0610 59  LEU A C   
487  O O   . LEU A 59  ? 0.3278 0.4720 0.2967 0.0576  -0.0693 -0.0649 59  LEU A O   
488  C CB  . LEU A 59  ? 0.3549 0.4979 0.3190 0.0390  -0.0705 -0.0570 59  LEU A CB  
489  C CG  . LEU A 59  ? 0.3655 0.5095 0.3267 0.0478  -0.0790 -0.0599 59  LEU A CG  
490  C CD1 . LEU A 59  ? 0.3369 0.4796 0.2882 0.0443  -0.0800 -0.0571 59  LEU A CD1 
491  C CD2 . LEU A 59  ? 0.3986 0.5460 0.3751 0.0524  -0.0888 -0.0632 59  LEU A CD2 
492  N N   . ARG A 60  ? 0.3214 0.4604 0.2739 0.0436  -0.0529 -0.0582 60  ARG A N   
493  C CA  . ARG A 60  ? 0.3445 0.4812 0.2863 0.0496  -0.0476 -0.0595 60  ARG A CA  
494  C C   . ARG A 60  ? 0.3608 0.4990 0.3135 0.0550  -0.0466 -0.0621 60  ARG A C   
495  O O   . ARG A 60  ? 0.4227 0.5596 0.3698 0.0634  -0.0463 -0.0645 60  ARG A O   
496  C CB  . ARG A 60  ? 0.4547 0.5869 0.3809 0.0423  -0.0360 -0.0558 60  ARG A CB  
497  C CG  . ARG A 60  ? 0.5436 0.6726 0.4573 0.0480  -0.0291 -0.0571 60  ARG A CG  
498  C CD  . ARG A 60  ? 0.5989 0.7234 0.4974 0.0398  -0.0174 -0.0534 60  ARG A CD  
499  N NE  . ARG A 60  ? 0.6259 0.7488 0.5293 0.0306  -0.0101 -0.0502 60  ARG A NE  
500  C CZ  . ARG A 60  ? 0.6242 0.7425 0.5162 0.0209  -0.0011 -0.0464 60  ARG A CZ  
501  N NH1 . ARG A 60  ? 0.5921 0.7083 0.4685 0.0191  0.0013  -0.0454 60  ARG A NH1 
502  N NH2 . ARG A 60  ? 0.6356 0.7508 0.5318 0.0128  0.0057  -0.0437 60  ARG A NH2 
503  N N   . GLU A 61  ? 0.3331 0.4737 0.3016 0.0503  -0.0460 -0.0616 61  GLU A N   
504  C CA  . GLU A 61  ? 0.3766 0.5192 0.3581 0.0544  -0.0444 -0.0637 61  GLU A CA  
505  C C   . GLU A 61  ? 0.4336 0.5807 0.4278 0.0645  -0.0566 -0.0686 61  GLU A C   
506  O O   . GLU A 61  ? 0.4554 0.6040 0.4565 0.0711  -0.0571 -0.0711 61  GLU A O   
507  C CB  . GLU A 61  ? 0.4297 0.5722 0.4242 0.0454  -0.0382 -0.0616 61  GLU A CB  
508  C CG  . GLU A 61  ? 0.5509 0.6873 0.5327 0.0360  -0.0247 -0.0570 61  GLU A CG  
509  C CD  . GLU A 61  ? 0.6776 0.8118 0.6712 0.0270  -0.0182 -0.0551 61  GLU A CD  
510  O OE1 . GLU A 61  ? 0.6629 0.8011 0.6765 0.0292  -0.0227 -0.0578 61  GLU A OE1 
511  O OE2 . GLU A 61  ? 0.7134 0.8410 0.6960 0.0176  -0.0083 -0.0510 61  GLU A OE2 
512  N N   . LEU A 62  ? 0.3605 0.5096 0.3577 0.0655  -0.0665 -0.0700 62  LEU A N   
513  C CA  . LEU A 62  ? 0.3610 0.5136 0.3691 0.0742  -0.0787 -0.0746 62  LEU A CA  
514  C C   . LEU A 62  ? 0.3945 0.5438 0.3888 0.0845  -0.0830 -0.0771 62  LEU A C   
515  O O   . LEU A 62  ? 0.4593 0.6059 0.4423 0.0860  -0.0866 -0.0771 62  LEU A O   
516  C CB  . LEU A 62  ? 0.4507 0.6055 0.4661 0.0712  -0.0869 -0.0750 62  LEU A CB  
517  C CG  . LEU A 62  ? 0.5077 0.6665 0.5431 0.0652  -0.0879 -0.0753 62  LEU A CG  
518  C CD1 . LEU A 62  ? 0.5183 0.6781 0.5569 0.0624  -0.0952 -0.0752 62  LEU A CD1 
519  C CD2 . LEU A 62  ? 0.4124 0.5756 0.4657 0.0714  -0.0930 -0.0796 62  LEU A CD2 
520  N N   . LYS A 63  ? 0.3007 0.4496 0.2961 0.0918  -0.0824 -0.0793 63  LYS A N   
521  C CA  . LYS A 63  ? 0.2594 0.4035 0.2409 0.1022  -0.0864 -0.0820 63  LYS A CA  
522  C C   . LYS A 63  ? 0.2233 0.3697 0.2172 0.1112  -0.0980 -0.0867 63  LYS A C   
523  O O   . LYS A 63  ? 0.3048 0.4544 0.3108 0.1136  -0.0975 -0.0879 63  LYS A O   
524  C CB  . LYS A 63  ? 0.3282 0.4679 0.2959 0.1040  -0.0756 -0.0806 63  LYS A CB  
525  C CG  . LYS A 63  ? 0.4513 0.5885 0.4067 0.0947  -0.0636 -0.0760 63  LYS A CG  
526  C CD  . LYS A 63  ? 0.5301 0.6639 0.4762 0.0953  -0.0520 -0.0746 63  LYS A CD  
527  C CE  . LYS A 63  ? 0.6358 0.7685 0.5763 0.0838  -0.0398 -0.0699 63  LYS A CE  
528  N NZ  . LYS A 63  ? 0.7308 0.8608 0.6667 0.0834  -0.0280 -0.0683 63  LYS A NZ  
529  N N   . HIS A 64  ? 0.2101 0.1850 0.2216 -0.0119 0.0155  -0.0289 64  HIS A N   
530  C CA  . HIS A 64  ? 0.1855 0.1585 0.1993 -0.0077 0.0132  -0.0249 64  HIS A CA  
531  C C   . HIS A 64  ? 0.1406 0.1104 0.1491 -0.0094 0.0113  -0.0185 64  HIS A C   
532  O O   . HIS A 64  ? 0.1426 0.1174 0.1472 -0.0127 0.0124  -0.0174 64  HIS A O   
533  C CB  . HIS A 64  ? 0.2055 0.1891 0.2209 -0.0066 0.0146  -0.0255 64  HIS A CB  
534  C CG  . HIS A 64  ? 0.1849 0.1682 0.2040 -0.0028 0.0126  -0.0231 64  HIS A CG  
535  N ND1 . HIS A 64  ? 0.1606 0.1431 0.1762 -0.0027 0.0107  -0.0173 64  HIS A ND1 
536  C CD2 . HIS A 64  ? 0.1751 0.1600 0.2016 0.0009  0.0121  -0.0265 64  HIS A CD2 
537  C CE1 . HIS A 64  ? 0.1813 0.1646 0.2010 0.0003  0.0091  -0.0168 64  HIS A CE1 
538  N NE2 . HIS A 64  ? 0.1849 0.1702 0.2119 0.0028  0.0097  -0.0221 64  HIS A NE2 
539  N N   . PRO A 65  ? 0.1391 0.1016 0.1478 -0.0072 0.0083  -0.0148 65  PRO A N   
540  C CA  . PRO A 65  ? 0.1410 0.1008 0.1436 -0.0100 0.0072  -0.0096 65  PRO A CA  
541  C C   . PRO A 65  ? 0.1315 0.1008 0.1327 -0.0105 0.0086  -0.0078 65  PRO A C   
542  O O   . PRO A 65  ? 0.1566 0.1269 0.1538 -0.0134 0.0091  -0.0056 65  PRO A O   
543  C CB  . PRO A 65  ? 0.1783 0.1295 0.1811 -0.0075 0.0031  -0.0059 65  PRO A CB  
544  C CG  . PRO A 65  ? 0.2346 0.1883 0.2457 -0.0020 0.0023  -0.0092 65  PRO A CG  
545  C CD  . PRO A 65  ? 0.1670 0.1233 0.1813 -0.0025 0.0054  -0.0153 65  PRO A CD  
546  N N   . ASN A 66  ? 0.1032 0.0793 0.1076 -0.0079 0.0094  -0.0092 66  ASN A N   
547  C CA  . ASN A 66  ? 0.0954 0.0779 0.0981 -0.0080 0.0103  -0.0073 66  ASN A CA  
548  C C   . ASN A 66  ? 0.0932 0.0829 0.0954 -0.0090 0.0120  -0.0090 66  ASN A C   
549  O O   . ASN A 66  ? 0.1193 0.1129 0.1205 -0.0084 0.0122  -0.0075 66  ASN A O   
550  C CB  . ASN A 66  ? 0.1107 0.0940 0.1154 -0.0055 0.0094  -0.0063 66  ASN A CB  
551  C CG  . ASN A 66  ? 0.1223 0.0996 0.1265 -0.0049 0.0067  -0.0037 66  ASN A CG  
552  O OD1 . ASN A 66  ? 0.1443 0.1200 0.1525 -0.0023 0.0047  -0.0043 66  ASN A OD1 
553  N ND2 . ASN A 66  ? 0.1288 0.1036 0.1282 -0.0073 0.0065  -0.0009 66  ASN A ND2 
554  N N   . ILE A 67  ? 0.1198 0.1104 0.1220 -0.0110 0.0128  -0.0119 67  ILE A N   
555  C CA  . ILE A 67  ? 0.1125 0.1104 0.1131 -0.0129 0.0136  -0.0130 67  ILE A CA  
556  C C   . ILE A 67  ? 0.1015 0.1006 0.1010 -0.0158 0.0136  -0.0137 67  ILE A C   
557  O O   . ILE A 67  ? 0.1360 0.1296 0.1356 -0.0177 0.0140  -0.0156 67  ILE A O   
558  C CB  . ILE A 67  ? 0.1256 0.1263 0.1269 -0.0139 0.0150  -0.0173 67  ILE A CB  
559  C CG1 . ILE A 67  ? 0.1477 0.1497 0.1502 -0.0120 0.0155  -0.0172 67  ILE A CG1 
560  C CG2 . ILE A 67  ? 0.1486 0.1568 0.1465 -0.0170 0.0152  -0.0182 67  ILE A CG2 
561  C CD1 . ILE A 67  ? 0.1607 0.1670 0.1645 -0.0135 0.0179  -0.0226 67  ILE A CD1 
562  N N   . VAL A 68  ? 0.1104 0.1164 0.1094 -0.0162 0.0128  -0.0122 68  VAL A N   
563  C CA  . VAL A 68  ? 0.1081 0.1183 0.1074 -0.0194 0.0130  -0.0135 68  VAL A CA  
564  C C   . VAL A 68  ? 0.1509 0.1613 0.1491 -0.0232 0.0140  -0.0176 68  VAL A C   
565  O O   . VAL A 68  ? 0.1622 0.1765 0.1594 -0.0236 0.0139  -0.0193 68  VAL A O   
566  C CB  . VAL A 68  ? 0.1253 0.1454 0.1264 -0.0182 0.0114  -0.0121 68  VAL A CB  
567  C CG1 . VAL A 68  ? 0.1366 0.1637 0.1395 -0.0219 0.0117  -0.0146 68  VAL A CG1 
568  C CG2 . VAL A 68  ? 0.1425 0.1612 0.1453 -0.0143 0.0109  -0.0092 68  VAL A CG2 
569  N N   A ARG A 69  ? 0.1505 0.1559 0.1479 -0.0267 0.0150  -0.0194 69  ARG A N   
570  N N   B ARG A 69  ? 0.1512 0.1566 0.1486 -0.0267 0.0150  -0.0194 69  ARG A N   
571  C CA  A ARG A 69  ? 0.1695 0.1711 0.1656 -0.0306 0.0164  -0.0238 69  ARG A CA  
572  C CA  B ARG A 69  ? 0.1659 0.1674 0.1621 -0.0304 0.0164  -0.0239 69  ARG A CA  
573  C C   A ARG A 69  ? 0.2023 0.2145 0.1977 -0.0351 0.0166  -0.0269 69  ARG A C   
574  C C   B ARG A 69  ? 0.2082 0.2195 0.2035 -0.0353 0.0167  -0.0271 69  ARG A C   
575  O O   A ARG A 69  ? 0.1861 0.2065 0.1825 -0.0370 0.0159  -0.0261 69  ARG A O   
576  O O   B ARG A 69  ? 0.1552 0.1730 0.1511 -0.0378 0.0164  -0.0266 69  ARG A O   
577  C CB  A ARG A 69  ? 0.1642 0.1543 0.1585 -0.0334 0.0169  -0.0237 69  ARG A CB  
578  C CB  B ARG A 69  ? 0.1752 0.1639 0.1698 -0.0324 0.0168  -0.0238 69  ARG A CB  
579  C CG  A ARG A 69  ? 0.2570 0.2399 0.2496 -0.0377 0.0183  -0.0284 69  ARG A CG  
580  C CG  B ARG A 69  ? 0.2193 0.1999 0.2130 -0.0356 0.0181  -0.0286 69  ARG A CG  
581  C CD  A ARG A 69  ? 0.2881 0.2654 0.2832 -0.0341 0.0187  -0.0316 69  ARG A CD  
582  C CD  B ARG A 69  ? 0.2264 0.1928 0.2170 -0.0382 0.0177  -0.0270 69  ARG A CD  
583  N NE  A ARG A 69  ? 0.3705 0.3430 0.3683 -0.0279 0.0171  -0.0282 69  ARG A NE  
584  N NE  B ARG A 69  ? 0.3785 0.3345 0.3679 -0.0415 0.0188  -0.0316 69  ARG A NE  
585  C CZ  A ARG A 69  ? 0.3698 0.3293 0.3684 -0.0256 0.0156  -0.0268 69  ARG A CZ  
586  C CZ  B ARG A 69  ? 0.4109 0.3531 0.3959 -0.0459 0.0184  -0.0307 69  ARG A CZ  
587  N NH1 A ARG A 69  ? 0.2513 0.2092 0.2528 -0.0202 0.0137  -0.0239 69  ARG A NH1 
588  N NH1 B ARG A 69  ? 0.4108 0.3495 0.3915 -0.0483 0.0173  -0.0253 69  ARG A NH1 
589  N NH2 A ARG A 69  ? 0.4630 0.4106 0.4592 -0.0289 0.0155  -0.0282 69  ARG A NH2 
590  N NH2 B ARG A 69  ? 0.4992 0.4305 0.4834 -0.0485 0.0194  -0.0354 69  ARG A NH2 
591  N N   . TYR A 70  ? 0.1761 0.1896 0.1703 -0.0370 0.0175  -0.0311 70  TYR A N   
592  C CA  . TYR A 70  ? 0.1855 0.2086 0.1780 -0.0425 0.0176  -0.0347 70  TYR A CA  
593  C C   . TYR A 70  ? 0.2121 0.2282 0.2032 -0.0484 0.0198  -0.0389 70  TYR A C   
594  O O   . TYR A 70  ? 0.2236 0.2260 0.2144 -0.0479 0.0213  -0.0408 70  TYR A O   
595  C CB  . TYR A 70  ? 0.2477 0.2754 0.2379 -0.0434 0.0181  -0.0379 70  TYR A CB  
596  C CG  . TYR A 70  ? 0.2875 0.3230 0.2748 -0.0504 0.0188  -0.0431 70  TYR A CG  
597  C CD1 . TYR A 70  ? 0.2897 0.3176 0.2759 -0.0549 0.0220  -0.0498 70  TYR A CD1 
598  C CD2 . TYR A 70  ? 0.2502 0.3001 0.2360 -0.0525 0.0157  -0.0414 70  TYR A CD2 
599  C CE1 . TYR A 70  ? 0.3226 0.3576 0.3056 -0.0622 0.0230  -0.0552 70  TYR A CE1 
600  C CE2 . TYR A 70  ? 0.2362 0.2945 0.2189 -0.0596 0.0159  -0.0462 70  TYR A CE2 
601  C CZ  . TYR A 70  ? 0.3081 0.3592 0.2892 -0.0649 0.0199  -0.0534 70  TYR A CZ  
602  O OH  . TYR A 70  ? 0.3370 0.3964 0.3146 -0.0728 0.0204  -0.0590 70  TYR A OH  
603  N N   . TYR A 71  ? 0.1972 0.2222 0.1878 -0.0539 0.0196  -0.0405 71  TYR A N   
604  C CA  . TYR A 71  ? 0.2423 0.2608 0.2304 -0.0612 0.0219  -0.0446 71  TYR A CA  
605  C C   . TYR A 71  ? 0.2975 0.3240 0.2835 -0.0683 0.0229  -0.0509 71  TYR A C   
606  O O   . TYR A 71  ? 0.2958 0.3120 0.2790 -0.0731 0.0255  -0.0560 71  TYR A O   
607  C CB  . TYR A 71  ? 0.2045 0.2256 0.1932 -0.0642 0.0219  -0.0423 71  TYR A CB  
608  C CG  . TYR A 71  ? 0.2317 0.2383 0.2191 -0.0616 0.0222  -0.0380 71  TYR A CG  
609  C CD1 . TYR A 71  ? 0.2065 0.2141 0.1964 -0.0544 0.0206  -0.0331 71  TYR A CD1 
610  C CD2 . TYR A 71  ? 0.2787 0.2699 0.2614 -0.0668 0.0237  -0.0387 71  TYR A CD2 
611  C CE1 . TYR A 71  ? 0.2195 0.2150 0.2075 -0.0526 0.0205  -0.0292 71  TYR A CE1 
612  C CE2 . TYR A 71  ? 0.2732 0.2511 0.2534 -0.0649 0.0230  -0.0339 71  TYR A CE2 
613  C CZ  . TYR A 71  ? 0.3020 0.2830 0.2849 -0.0578 0.0214  -0.0294 71  TYR A CZ  
614  O OH  . TYR A 71  ? 0.3029 0.2718 0.2826 -0.0565 0.0203  -0.0247 71  TYR A OH  
615  N N   . ASP A 72  ? 0.2516 0.2959 0.2387 -0.0691 0.0205  -0.0505 72  ASP A N   
616  C CA  . ASP A 72  ? 0.3083 0.3630 0.2933 -0.0772 0.0209  -0.0561 72  ASP A CA  
617  C C   . ASP A 72  ? 0.3404 0.4138 0.3261 -0.0758 0.0167  -0.0542 72  ASP A C   
618  O O   . ASP A 72  ? 0.2576 0.3356 0.2463 -0.0687 0.0135  -0.0483 72  ASP A O   
619  C CB  . ASP A 72  ? 0.2996 0.3572 0.2854 -0.0839 0.0220  -0.0578 72  ASP A CB  
620  C CG  . ASP A 72  ? 0.3560 0.4175 0.3382 -0.0943 0.0240  -0.0651 72  ASP A CG  
621  O OD1 . ASP A 72  ? 0.3638 0.4228 0.3425 -0.0963 0.0251  -0.0696 72  ASP A OD1 
622  O OD2 . ASP A 72  ? 0.4009 0.4687 0.3839 -0.1012 0.0248  -0.0671 72  ASP A OD2 
623  N N   A ARG A 73  ? 0.2976 0.3809 0.2802 -0.0829 0.0164  -0.0592 73  ARG A N   
624  N N   B ARG A 73  ? 0.2976 0.3809 0.2801 -0.0829 0.0164  -0.0592 73  ARG A N   
625  C CA  A ARG A 73  ? 0.2958 0.3973 0.2779 -0.0830 0.0114  -0.0572 73  ARG A CA  
626  C CA  B ARG A 73  ? 0.2958 0.3974 0.2779 -0.0828 0.0113  -0.0571 73  ARG A CA  
627  C C   A ARG A 73  ? 0.3450 0.4607 0.3274 -0.0918 0.0107  -0.0622 73  ARG A C   
628  C C   B ARG A 73  ? 0.3427 0.4588 0.3249 -0.0918 0.0106  -0.0621 73  ARG A C   
629  O O   A ARG A 73  ? 0.3798 0.4898 0.3586 -0.0999 0.0149  -0.0691 73  ARG A O   
630  O O   B ARG A 73  ? 0.3811 0.4920 0.3593 -0.0999 0.0146  -0.0692 73  ARG A O   
631  C CB  A ARG A 73  ? 0.3230 0.4235 0.2984 -0.0837 0.0115  -0.0584 73  ARG A CB  
632  C CB  B ARG A 73  ? 0.3102 0.4106 0.2858 -0.0828 0.0112  -0.0576 73  ARG A CB  
633  C CG  A ARG A 73  ? 0.3503 0.4442 0.3206 -0.0918 0.0167  -0.0675 73  ARG A CG  
634  C CG  B ARG A 73  ? 0.3516 0.4488 0.3215 -0.0915 0.0156  -0.0666 73  ARG A CG  
635  C CD  A ARG A 73  ? 0.4026 0.4944 0.3670 -0.0923 0.0184  -0.0700 73  ARG A CD  
636  C CD  B ARG A 73  ? 0.3963 0.4845 0.3620 -0.0900 0.0187  -0.0688 73  ARG A CD  
637  N NE  A ARG A 73  ? 0.4411 0.5244 0.4024 -0.0987 0.0243  -0.0800 73  ARG A NE  
638  N NE  B ARG A 73  ? 0.4260 0.5058 0.3890 -0.0965 0.0244  -0.0788 73  ARG A NE  
639  C CZ  A ARG A 73  ? 0.4656 0.5481 0.4261 -0.1066 0.0266  -0.0867 73  ARG A CZ  
640  C CZ  B ARG A 73  ? 0.4217 0.4931 0.3830 -0.0960 0.0286  -0.0839 73  ARG A CZ  
641  N NH1 A ARG A 73  ? 0.4439 0.5357 0.4065 -0.1098 0.0238  -0.0848 73  ARG A NH1 
642  N NH1 B ARG A 73  ? 0.4250 0.4961 0.3863 -0.0901 0.0280  -0.0798 73  ARG A NH1 
643  N NH2 A ARG A 73  ? 0.5199 0.5926 0.4779 -0.1115 0.0321  -0.0962 73  ARG A NH2 
644  N NH2 B ARG A 73  ? 0.3922 0.4558 0.3524 -0.1016 0.0338  -0.0938 73  ARG A NH2 
645  N N   . ILE A 74  ? 0.2865 0.4207 0.2739 -0.0902 0.0052  -0.0590 74  ILE A N   
646  C CA  . ILE A 74  ? 0.3044 0.4555 0.2938 -0.0983 0.0038  -0.0637 74  ILE A CA  
647  C C   . ILE A 74  ? 0.3389 0.5097 0.3279 -0.0981 -0.0036 -0.0613 74  ILE A C   
648  O O   . ILE A 74  ? 0.2860 0.4622 0.2788 -0.0894 -0.0093 -0.0542 74  ILE A O   
649  C CB  . ILE A 74  ? 0.3671 0.5249 0.3656 -0.0977 0.0043  -0.0637 74  ILE A CB  
650  C CG1 . ILE A 74  ? 0.4568 0.5945 0.4534 -0.0999 0.0111  -0.0655 74  ILE A CG1 
651  C CG2 . ILE A 74  ? 0.4243 0.6032 0.4263 -0.1063 0.0025  -0.0689 74  ILE A CG2 
652  C CD1 . ILE A 74  ? 0.4459 0.5895 0.4494 -0.1012 0.0125  -0.0659 74  ILE A CD1 
653  N N   . ILE A 75  ? 0.3363 0.5172 0.3202 -0.1079 -0.0038 -0.0671 75  ILE A N   
654  C CA  . ILE A 75  ? 0.3480 0.5492 0.3307 -0.1092 -0.0117 -0.0649 75  ILE A CA  
655  C C   . ILE A 75  ? 0.3717 0.5945 0.3632 -0.1132 -0.0150 -0.0678 75  ILE A C   
656  O O   . ILE A 75  ? 0.3918 0.6167 0.3828 -0.1231 -0.0102 -0.0756 75  ILE A O   
657  C CB  . ILE A 75  ? 0.4644 0.6659 0.4346 -0.1185 -0.0105 -0.0696 75  ILE A CB  
658  C CG1 . ILE A 75  ? 0.5980 0.7802 0.5605 -0.1154 -0.0063 -0.0684 75  ILE A CG1 
659  C CG2 . ILE A 75  ? 0.4711 0.6940 0.4386 -0.1203 -0.0197 -0.0661 75  ILE A CG2 
660  C CD1 . ILE A 75  ? 0.6682 0.8518 0.6187 -0.1246 -0.0044 -0.0740 75  ILE A CD1 
661  N N   . ASP A 76  ? 0.3917 0.6303 0.3921 -0.1054 -0.0231 -0.0619 76  ASP A N   
662  C CA  . ASP A 76  ? 0.4502 0.7143 0.4603 -0.1084 -0.0281 -0.0646 76  ASP A CA  
663  C C   . ASP A 76  ? 0.4516 0.7316 0.4565 -0.1100 -0.0374 -0.0615 76  ASP A C   
664  O O   . ASP A 76  ? 0.4482 0.7368 0.4582 -0.1007 -0.0464 -0.0537 76  ASP A O   
665  C CB  . ASP A 76  ? 0.4964 0.7684 0.5220 -0.0977 -0.0311 -0.0610 76  ASP A CB  
666  C CG  . ASP A 76  ? 0.5968 0.8966 0.6352 -0.1010 -0.0348 -0.0659 76  ASP A CG  
667  O OD1 . ASP A 76  ? 0.5733 0.8915 0.6102 -0.1062 -0.0411 -0.0671 76  ASP A OD1 
668  O OD2 . ASP A 76  ? 0.6334 0.9379 0.6833 -0.0989 -0.0313 -0.0688 76  ASP A OD2 
669  N N   . ARG A 77  ? 0.4625 0.7453 0.4565 -0.1222 -0.0353 -0.0674 77  ARG A N   
670  C CA  . ARG A 77  ? 0.5287 0.8252 0.5143 -0.1261 -0.0434 -0.0647 77  ARG A CA  
671  C C   . ARG A 77  ? 0.6175 0.9415 0.6144 -0.1224 -0.0548 -0.0613 77  ARG A C   
672  O O   . ARG A 77  ? 0.6398 0.9727 0.6329 -0.1189 -0.0650 -0.0539 77  ARG A O   
673  C CB  . ARG A 77  ? 0.5301 0.8271 0.5034 -0.1415 -0.0381 -0.0741 77  ARG A CB  
674  N N   . THR A 78  ? 0.5930 0.9306 0.6040 -0.1233 -0.0532 -0.0668 78  THR A N   
675  C CA  . THR A 78  ? 0.6012 0.9681 0.6262 -0.1199 -0.0633 -0.0657 78  THR A CA  
676  C C   . THR A 78  ? 0.5360 0.9045 0.5706 -0.1034 -0.0728 -0.0551 78  THR A C   
677  O O   . THR A 78  ? 0.4984 0.8875 0.5397 -0.0989 -0.0848 -0.0508 78  THR A O   
678  C CB  . THR A 78  ? 0.6095 0.9899 0.6487 -0.1243 -0.0579 -0.0747 78  THR A CB  
679  O OG1 . THR A 78  ? 0.6034 0.9818 0.6330 -0.1405 -0.0498 -0.0844 78  THR A OG1 
680  C CG2 . THR A 78  ? 0.6407 1.0543 0.6968 -0.1203 -0.0684 -0.0746 78  THR A CG2 
681  N N   . ASN A 79  ? 0.5045 0.8505 0.5396 -0.0944 -0.0679 -0.0510 79  ASN A N   
682  C CA  . ASN A 79  ? 0.4809 0.8241 0.5240 -0.0789 -0.0758 -0.0415 79  ASN A CA  
683  C C   . ASN A 79  ? 0.4236 0.7417 0.4514 -0.0753 -0.0756 -0.0332 79  ASN A C   
684  O O   . ASN A 79  ? 0.4424 0.7500 0.4743 -0.0634 -0.0789 -0.0258 79  ASN A O   
685  C CB  . ASN A 79  ? 0.5270 0.8691 0.5871 -0.0705 -0.0710 -0.0441 79  ASN A CB  
686  N N   . THR A 80  ? 0.3038 0.6132 0.3141 -0.0863 -0.0713 -0.0354 80  THR A N   
687  C CA  . THR A 80  ? 0.3344 0.6218 0.3293 -0.0856 -0.0693 -0.0297 80  THR A CA  
688  C C   . THR A 80  ? 0.2650 0.5320 0.2650 -0.0751 -0.0644 -0.0262 80  THR A C   
689  O O   . THR A 80  ? 0.2939 0.5501 0.2899 -0.0675 -0.0689 -0.0174 80  THR A O   
690  C CB  . THR A 80  ? 0.4007 0.6932 0.3864 -0.0835 -0.0814 -0.0197 80  THR A CB  
691  O OG1 . THR A 80  ? 0.3633 0.6622 0.3623 -0.0701 -0.0914 -0.0119 80  THR A OG1 
692  C CG2 . THR A 80  ? 0.3661 0.6788 0.3447 -0.0950 -0.0866 -0.0229 80  THR A CG2 
693  N N   . THR A 81  ? 0.2718 0.5337 0.2799 -0.0755 -0.0553 -0.0330 81  THR A N   
694  C CA  . THR A 81  ? 0.2889 0.5324 0.3015 -0.0670 -0.0500 -0.0306 81  THR A CA  
695  C C   . THR A 81  ? 0.2529 0.4768 0.2566 -0.0732 -0.0388 -0.0357 81  THR A C   
696  O O   . THR A 81  ? 0.2720 0.4978 0.2744 -0.0824 -0.0327 -0.0438 81  THR A O   
697  C CB  . THR A 81  ? 0.3071 0.5602 0.3376 -0.0607 -0.0493 -0.0334 81  THR A CB  
698  O OG1 . THR A 81  ? 0.4714 0.7417 0.5126 -0.0524 -0.0602 -0.0287 81  THR A OG1 
699  C CG2 . THR A 81  ? 0.2565 0.4903 0.2897 -0.0535 -0.0432 -0.0317 81  THR A CG2 
700  N N   . LEU A 82  ? 0.2397 0.4446 0.2376 -0.0681 -0.0364 -0.0310 82  LEU A N   
701  C CA  . LEU A 82  ? 0.2276 0.4135 0.2200 -0.0712 -0.0267 -0.0351 82  LEU A CA  
702  C C   . LEU A 82  ? 0.2535 0.4296 0.2551 -0.0633 -0.0232 -0.0337 82  LEU A C   
703  O O   . LEU A 82  ? 0.3089 0.4827 0.3149 -0.0540 -0.0272 -0.0273 82  LEU A O   
704  C CB  . LEU A 82  ? 0.2597 0.4329 0.2394 -0.0718 -0.0259 -0.0317 82  LEU A CB  
705  C CG  . LEU A 82  ? 0.2885 0.4425 0.2644 -0.0731 -0.0168 -0.0356 82  LEU A CG  
706  C CD1 . LEU A 82  ? 0.3257 0.4791 0.2988 -0.0829 -0.0104 -0.0452 82  LEU A CD1 
707  C CD2 . LEU A 82  ? 0.3579 0.5023 0.3238 -0.0723 -0.0166 -0.0319 82  LEU A CD2 
708  N N   . TYR A 83  ? 0.2188 0.3888 0.2226 -0.0676 -0.0159 -0.0397 83  TYR A N   
709  C CA  . TYR A 83  ? 0.2239 0.3837 0.2341 -0.0619 -0.0119 -0.0388 83  TYR A CA  
710  C C   . TYR A 83  ? 0.2320 0.3703 0.2349 -0.0626 -0.0056 -0.0393 83  TYR A C   
711  O O   . TYR A 83  ? 0.2421 0.3739 0.2395 -0.0700 -0.0010 -0.0447 83  TYR A O   
712  C CB  . TYR A 83  ? 0.2016 0.3701 0.2194 -0.0666 -0.0087 -0.0445 83  TYR A CB  
713  C CG  . TYR A 83  ? 0.2605 0.4532 0.2885 -0.0660 -0.0144 -0.0456 83  TYR A CG  
714  C CD1 . TYR A 83  ? 0.3309 0.5390 0.3572 -0.0739 -0.0170 -0.0495 83  TYR A CD1 
715  C CD2 . TYR A 83  ? 0.2523 0.4533 0.2924 -0.0576 -0.0171 -0.0435 83  TYR A CD2 
716  C CE1 . TYR A 83  ? 0.3458 0.5780 0.3828 -0.0731 -0.0229 -0.0508 83  TYR A CE1 
717  C CE2 . TYR A 83  ? 0.2956 0.5204 0.3474 -0.0561 -0.0226 -0.0454 83  TYR A CE2 
718  C CZ  . TYR A 83  ? 0.3728 0.6135 0.4232 -0.0637 -0.0258 -0.0488 83  TYR A CZ  
719  O OH  . TYR A 83  ? 0.3925 0.6587 0.4558 -0.0618 -0.0319 -0.0508 83  TYR A OH  
720  N N   A ILE A 84  ? 0.1644 0.2918 0.1680 -0.0547 -0.0057 -0.0341 84  ILE A N   
721  N N   B ILE A 84  ? 0.1640 0.2913 0.1674 -0.0547 -0.0058 -0.0340 84  ILE A N   
722  C CA  A ILE A 84  ? 0.1751 0.2837 0.1738 -0.0542 -0.0004 -0.0344 84  ILE A CA  
723  C CA  B ILE A 84  ? 0.1755 0.2841 0.1742 -0.0543 -0.0004 -0.0344 84  ILE A CA  
724  C C   A ILE A 84  ? 0.1702 0.2714 0.1741 -0.0520 0.0031  -0.0346 84  ILE A C   
725  C C   B ILE A 84  ? 0.1745 0.2762 0.1785 -0.0521 0.0031  -0.0347 84  ILE A C   
726  O O   A ILE A 84  ? 0.1653 0.2687 0.1749 -0.0456 0.0013  -0.0309 84  ILE A O   
727  O O   B ILE A 84  ? 0.1579 0.2627 0.1680 -0.0460 0.0011  -0.0312 84  ILE A O   
728  C CB  A ILE A 84  ? 0.2019 0.3031 0.1966 -0.0483 -0.0024 -0.0289 84  ILE A CB  
729  C CB  B ILE A 84  ? 0.1934 0.2941 0.1881 -0.0484 -0.0021 -0.0290 84  ILE A CB  
730  C CG1 A ILE A 84  ? 0.2464 0.3558 0.2342 -0.0515 -0.0063 -0.0278 84  ILE A CG1 
731  C CG1 B ILE A 84  ? 0.2453 0.3525 0.2325 -0.0519 -0.0053 -0.0284 84  ILE A CG1 
732  C CG2 A ILE A 84  ? 0.2179 0.3024 0.2091 -0.0480 0.0029  -0.0302 84  ILE A CG2 
733  C CG2 B ILE A 84  ? 0.2010 0.2847 0.1930 -0.0475 0.0032  -0.0301 84  ILE A CG2 
734  C CD1 A ILE A 84  ? 0.2050 0.3131 0.1859 -0.0602 -0.0024 -0.0345 84  ILE A CD1 
735  C CD1 B ILE A 84  ? 0.2943 0.4144 0.2832 -0.0486 -0.0132 -0.0230 84  ILE A CD1 
736  N N   . VAL A 85  ? 0.1561 0.2479 0.1573 -0.0577 0.0080  -0.0388 85  VAL A N   
737  C CA  . VAL A 85  ? 0.1409 0.2252 0.1445 -0.0579 0.0113  -0.0389 85  VAL A CA  
738  C C   . VAL A 85  ? 0.1667 0.2338 0.1677 -0.0527 0.0129  -0.0355 85  VAL A C   
739  O O   . VAL A 85  ? 0.1753 0.2320 0.1719 -0.0532 0.0144  -0.0366 85  VAL A O   
740  C CB  . VAL A 85  ? 0.1398 0.2202 0.1403 -0.0674 0.0151  -0.0444 85  VAL A CB  
741  C CG1 . VAL A 85  ? 0.1833 0.2540 0.1836 -0.0690 0.0183  -0.0436 85  VAL A CG1 
742  C CG2 . VAL A 85  ? 0.1660 0.2654 0.1694 -0.0736 0.0136  -0.0484 85  VAL A CG2 
743  N N   A MET A 86  ? 0.1383 0.2037 0.1428 -0.0479 0.0128  -0.0320 86  MET A N   
744  N N   B MET A 86  ? 0.1390 0.2046 0.1436 -0.0478 0.0127  -0.0320 86  MET A N   
745  C CA  A MET A 86  ? 0.1373 0.1883 0.1397 -0.0432 0.0138  -0.0287 86  MET A CA  
746  C CA  B MET A 86  ? 0.1460 0.1978 0.1487 -0.0427 0.0136  -0.0284 86  MET A CA  
747  C C   A MET A 86  ? 0.1490 0.1944 0.1522 -0.0435 0.0158  -0.0274 86  MET A C   
748  C C   B MET A 86  ? 0.1457 0.1910 0.1487 -0.0436 0.0158  -0.0275 86  MET A C   
749  O O   A MET A 86  ? 0.1346 0.1886 0.1406 -0.0469 0.0167  -0.0292 86  MET A O   
750  O O   B MET A 86  ? 0.1482 0.2015 0.1538 -0.0475 0.0169  -0.0294 86  MET A O   
751  C CB  A MET A 86  ? 0.1447 0.1981 0.1486 -0.0359 0.0108  -0.0245 86  MET A CB  
752  C CB  B MET A 86  ? 0.1376 0.1933 0.1427 -0.0353 0.0104  -0.0242 86  MET A CB  
753  C CG  A MET A 86  ? 0.1936 0.2522 0.1946 -0.0365 0.0086  -0.0249 86  MET A CG  
754  C CG  B MET A 86  ? 0.1382 0.2014 0.1416 -0.0350 0.0073  -0.0238 86  MET A CG  
755  S SD  A MET A 86  ? 0.2495 0.3075 0.2494 -0.0297 0.0053  -0.0192 86  MET A SD  
756  S SD  B MET A 86  ? 0.2177 0.2709 0.2143 -0.0369 0.0093  -0.0255 86  MET A SD  
757  C CE  A MET A 86  ? 0.2302 0.2728 0.2271 -0.0282 0.0088  -0.0191 86  MET A CE  
758  C CE  B MET A 86  ? 0.1567 0.1980 0.1536 -0.0305 0.0101  -0.0214 86  MET A CE  
759  N N   . GLU A 87  ? 0.1289 0.1608 0.1293 -0.0405 0.0164  -0.0247 87  GLU A N   
760  C CA  . GLU A 87  ? 0.1481 0.1735 0.1473 -0.0409 0.0178  -0.0226 87  GLU A CA  
761  C C   . GLU A 87  ? 0.1290 0.1660 0.1336 -0.0381 0.0175  -0.0220 87  GLU A C   
762  O O   . GLU A 87  ? 0.1505 0.1935 0.1590 -0.0321 0.0153  -0.0206 87  GLU A O   
763  C CB  . GLU A 87  ? 0.1923 0.2043 0.1889 -0.0365 0.0171  -0.0194 87  GLU A CB  
764  C CG  . GLU A 87  ? 0.2065 0.2125 0.2013 -0.0359 0.0176  -0.0164 87  GLU A CG  
765  C CD  . GLU A 87  ? 0.2386 0.2336 0.2319 -0.0314 0.0161  -0.0134 87  GLU A CD  
766  O OE1 . GLU A 87  ? 0.2815 0.2700 0.2719 -0.0317 0.0159  -0.0107 87  GLU A OE1 
767  O OE2 . GLU A 87  ? 0.2076 0.2018 0.2025 -0.0281 0.0153  -0.0142 87  GLU A OE2 
768  N N   . TYR A 88  ? 0.1303 0.1698 0.1348 -0.0426 0.0199  -0.0234 88  TYR A N   
769  C CA  . TYR A 88  ? 0.1143 0.1645 0.1248 -0.0399 0.0206  -0.0242 88  TYR A CA  
770  C C   . TYR A 88  ? 0.1391 0.1794 0.1465 -0.0371 0.0212  -0.0211 88  TYR A C   
771  O O   . TYR A 88  ? 0.1815 0.2102 0.1817 -0.0413 0.0224  -0.0193 88  TYR A O   
772  C CB  . TYR A 88  ? 0.1271 0.1879 0.1395 -0.0473 0.0237  -0.0286 88  TYR A CB  
773  C CG  . TYR A 88  ? 0.1348 0.2059 0.1535 -0.0454 0.0256  -0.0309 88  TYR A CG  
774  C CD1 . TYR A 88  ? 0.1321 0.2148 0.1610 -0.0373 0.0233  -0.0321 88  TYR A CD1 
775  C CD2 . TYR A 88  ? 0.1633 0.2317 0.1773 -0.0519 0.0296  -0.0320 88  TYR A CD2 
776  C CE1 . TYR A 88  ? 0.1146 0.2064 0.1507 -0.0349 0.0254  -0.0354 88  TYR A CE1 
777  C CE2 . TYR A 88  ? 0.1945 0.2733 0.2145 -0.0506 0.0322  -0.0355 88  TYR A CE2 
778  C CZ  . TYR A 88  ? 0.1687 0.2593 0.2006 -0.0417 0.0303  -0.0377 88  TYR A CZ  
779  O OH  . TYR A 88  ? 0.2308 0.3315 0.2700 -0.0399 0.0332  -0.0424 88  TYR A OH  
780  N N   . CYS A 89  ? 0.1001 0.1445 0.1127 -0.0302 0.0200  -0.0203 89  CYS A N   
781  C CA  . CYS A 89  ? 0.1196 0.1560 0.1295 -0.0276 0.0207  -0.0180 89  CYS A CA  
782  C C   . CYS A 89  ? 0.1283 0.1740 0.1433 -0.0277 0.0233  -0.0215 89  CYS A C   
783  O O   . CYS A 89  ? 0.1204 0.1738 0.1433 -0.0215 0.0222  -0.0230 89  CYS A O   
784  C CB  . CYS A 89  ? 0.1041 0.1358 0.1150 -0.0204 0.0178  -0.0148 89  CYS A CB  
785  S SG  . CYS A 89  ? 0.1583 0.1807 0.1643 -0.0205 0.0157  -0.0123 89  CYS A SG  
786  N N   . GLU A 90  ? 0.1364 0.1809 0.1465 -0.0347 0.0266  -0.0229 90  GLU A N   
787  C CA  . GLU A 90  ? 0.1205 0.1763 0.1353 -0.0369 0.0304  -0.0280 90  GLU A CA  
788  C C   . GLU A 90  ? 0.0993 0.1550 0.1178 -0.0310 0.0310  -0.0289 90  GLU A C   
789  O O   . GLU A 90  ? 0.1549 0.2222 0.1813 -0.0299 0.0337  -0.0345 90  GLU A O   
790  C CB  . GLU A 90  ? 0.2218 0.2753 0.2277 -0.0478 0.0342  -0.0289 90  GLU A CB  
791  C CG  . GLU A 90  ? 0.2371 0.2761 0.2322 -0.0502 0.0340  -0.0244 90  GLU A CG  
792  C CD  . GLU A 90  ? 0.2738 0.3127 0.2599 -0.0613 0.0379  -0.0257 90  GLU A CD  
793  O OE1 . GLU A 90  ? 0.4196 0.4622 0.4047 -0.0631 0.0408  -0.0282 90  GLU A OE1 
794  O OE2 . GLU A 90  ? 0.3305 0.3652 0.3100 -0.0690 0.0381  -0.0244 90  GLU A OE2 
795  N N   . GLY A 91  ? 0.1269 0.1700 0.1404 -0.0273 0.0287  -0.0241 91  GLY A N   
796  C CA  . GLY A 91  ? 0.1397 0.1808 0.1554 -0.0225 0.0292  -0.0249 91  GLY A CA  
797  C C   . GLY A 91  ? 0.1539 0.1986 0.1790 -0.0135 0.0265  -0.0253 91  GLY A C   
798  O O   . GLY A 91  ? 0.1432 0.1857 0.1712 -0.0090 0.0269  -0.0266 91  GLY A O   
799  N N   . GLY A 92  ? 0.1396 0.1887 0.1684 -0.0111 0.0234  -0.0241 92  GLY A N   
800  C CA  . GLY A 92  ? 0.1317 0.1834 0.1679 -0.0030 0.0196  -0.0232 92  GLY A CA  
801  C C   . GLY A 92  ? 0.1392 0.1782 0.1702 0.0007  0.0168  -0.0178 92  GLY A C   
802  O O   . GLY A 92  ? 0.1613 0.1913 0.1840 -0.0026 0.0172  -0.0148 92  GLY A O   
803  N N   . ASP A 93  ? 0.1359 0.1743 0.1719 0.0075  0.0137  -0.0167 93  ASP A N   
804  C CA  . ASP A 93  ? 0.1562 0.1833 0.1867 0.0101  0.0108  -0.0115 93  ASP A CA  
805  C C   . ASP A 93  ? 0.1406 0.1587 0.1697 0.0119  0.0125  -0.0119 93  ASP A C   
806  O O   . ASP A 93  ? 0.1344 0.1557 0.1687 0.0130  0.0153  -0.0167 93  ASP A O   
807  C CB  . ASP A 93  ? 0.1413 0.1708 0.1756 0.0155  0.0055  -0.0087 93  ASP A CB  
808  C CG  . ASP A 93  ? 0.2036 0.2363 0.2478 0.0223  0.0041  -0.0114 93  ASP A CG  
809  O OD1 . ASP A 93  ? 0.2552 0.3004 0.3086 0.0232  0.0053  -0.0166 93  ASP A OD1 
810  O OD2 . ASP A 93  ? 0.2346 0.2573 0.2779 0.0267  0.0019  -0.0087 93  ASP A OD2 
811  N N   . LEU A 94  ? 0.1207 0.1284 0.1430 0.0116  0.0113  -0.0076 94  LEU A N   
812  C CA  . LEU A 94  ? 0.1256 0.1243 0.1455 0.0121  0.0129  -0.0080 94  LEU A CA  
813  C C   . LEU A 94  ? 0.1545 0.1490 0.1797 0.0184  0.0111  -0.0087 94  LEU A C   
814  O O   . LEU A 94  ? 0.1697 0.1585 0.1952 0.0189  0.0135  -0.0114 94  LEU A O   
815  C CB  . LEU A 94  ? 0.1567 0.1470 0.1680 0.0090  0.0124  -0.0039 94  LEU A CB  
816  C CG  . LEU A 94  ? 0.2086 0.2005 0.2155 0.0038  0.0142  -0.0039 94  LEU A CG  
817  C CD1 . LEU A 94  ? 0.2114 0.1963 0.2126 0.0017  0.0141  -0.0015 94  LEU A CD1 
818  C CD2 . LEU A 94  ? 0.2207 0.2160 0.2285 0.0011  0.0174  -0.0078 94  LEU A CD2 
819  N N   . ALA A 95  ? 0.1461 0.1424 0.1750 0.0230  0.0065  -0.0061 95  ALA A N   
820  C CA  . ALA A 95  ? 0.1790 0.1703 0.2140 0.0300  0.0037  -0.0063 95  ALA A CA  
821  C C   . ALA A 95  ? 0.1738 0.1729 0.2197 0.0332  0.0070  -0.0142 95  ALA A C   
822  O O   . ALA A 95  ? 0.2013 0.1936 0.2511 0.0369  0.0081  -0.0173 95  ALA A O   
823  C CB  . ALA A 95  ? 0.2307 0.2238 0.2675 0.0343  -0.0030 -0.0014 95  ALA A CB  
824  N N   . SER A 96  ? 0.1500 0.1636 0.2009 0.0309  0.0091  -0.0181 96  SER A N   
825  C CA  . SER A 96  ? 0.1601 0.1839 0.2209 0.0320  0.0133  -0.0266 96  SER A CA  
826  C C   . SER A 96  ? 0.1674 0.1860 0.2229 0.0269  0.0194  -0.0306 96  SER A C   
827  O O   . SER A 96  ? 0.1737 0.1943 0.2362 0.0292  0.0228  -0.0375 96  SER A O   
828  C CB  . SER A 96  ? 0.1531 0.1933 0.2181 0.0284  0.0146  -0.0296 96  SER A CB  
829  O OG  . SER A 96  ? 0.1838 0.2312 0.2553 0.0333  0.0089  -0.0271 96  SER A OG  
830  N N   . VAL A 97  ? 0.1490 0.1616 0.1926 0.0201  0.0207  -0.0266 97  VAL A N   
831  C CA  . VAL A 97  ? 0.1628 0.1706 0.1999 0.0146  0.0253  -0.0292 97  VAL A CA  
832  C C   . VAL A 97  ? 0.1742 0.1704 0.2114 0.0182  0.0254  -0.0302 97  VAL A C   
833  O O   . VAL A 97  ? 0.1766 0.1725 0.2150 0.0166  0.0298  -0.0364 97  VAL A O   
834  C CB  . VAL A 97  ? 0.1344 0.1377 0.1599 0.0080  0.0249  -0.0237 97  VAL A CB  
835  C CG1 . VAL A 97  ? 0.1861 0.1834 0.2045 0.0031  0.0280  -0.0252 97  VAL A CG1 
836  C CG2 . VAL A 97  ? 0.1641 0.1766 0.1885 0.0034  0.0256  -0.0237 97  VAL A CG2 
837  N N   . ILE A 98  ? 0.1710 0.1573 0.2063 0.0221  0.0208  -0.0243 98  ILE A N   
838  C CA  . ILE A 98  ? 0.1639 0.1366 0.1980 0.0249  0.0203  -0.0243 98  ILE A CA  
839  C C   . ILE A 98  ? 0.2504 0.2238 0.2966 0.0324  0.0208  -0.0308 98  ILE A C   
840  O O   . ILE A 98  ? 0.2283 0.1951 0.2755 0.0326  0.0242  -0.0361 98  ILE A O   
841  C CB  . ILE A 98  ? 0.1617 0.1238 0.1897 0.0263  0.0149  -0.0159 98  ILE A CB  
842  C CG1 . ILE A 98  ? 0.1685 0.1291 0.1855 0.0188  0.0157  -0.0116 98  ILE A CG1 
843  C CG2 . ILE A 98  ? 0.2194 0.1659 0.2471 0.0301  0.0135  -0.0155 98  ILE A CG2 
844  C CD1 . ILE A 98  ? 0.2057 0.1620 0.2171 0.0185  0.0113  -0.0042 98  ILE A CD1 
845  N N   . THR A 99  ? 0.1755 0.1579 0.2317 0.0385  0.0175  -0.0310 99  THR A N   
846  C CA  . THR A 99  ? 0.2094 0.1955 0.2801 0.0469  0.0173  -0.0378 99  THR A CA  
847  C C   . THR A 99  ? 0.2090 0.2051 0.2851 0.0437  0.0251  -0.0487 99  THR A C   
848  O O   . THR A 99  ? 0.2461 0.2386 0.3299 0.0481  0.0276  -0.0561 99  THR A O   
849  C CB  . THR A 99  ? 0.2322 0.2309 0.3132 0.0528  0.0122  -0.0365 99  THR A CB  
850  O OG1 . THR A 99  ? 0.3186 0.3070 0.3948 0.0564  0.0044  -0.0268 99  THR A OG1 
851  C CG2 . THR A 99  ? 0.2345 0.2419 0.3335 0.0616  0.0126  -0.0454 99  THR A CG2 
852  N N   . LYS A 100 ? 0.2242 0.2321 0.2956 0.0356  0.0289  -0.0500 100 LYS A N   
853  C CA  . LYS A 100 ? 0.2606 0.2786 0.3339 0.0301  0.0364  -0.0595 100 LYS A CA  
854  C C   . LYS A 100 ? 0.3036 0.3099 0.3691 0.0261  0.0405  -0.0623 100 LYS A C   
855  O O   . LYS A 100 ? 0.2833 0.2928 0.3548 0.0263  0.0458  -0.0721 100 LYS A O   
856  C CB  . LYS A 100 ? 0.2841 0.3125 0.3496 0.0208  0.0386  -0.0576 100 LYS A CB  
857  C CG  . LYS A 100 ? 0.3477 0.3869 0.4126 0.0131  0.0462  -0.0664 100 LYS A CG  
858  C CD  . LYS A 100 ? 0.3708 0.4176 0.4271 0.0039  0.0471  -0.0631 100 LYS A CD  
859  C CE  . LYS A 100 ? 0.4828 0.5371 0.5334 -0.0062 0.0542  -0.0699 100 LYS A CE  
860  N NZ  . LYS A 100 ? 0.5827 0.6540 0.6465 -0.0053 0.0594  -0.0811 100 LYS A NZ  
861  N N   . GLY A 101 ? 0.2294 0.2233 0.2820 0.0221  0.0382  -0.0544 101 GLY A N   
862  C CA  . GLY A 101 ? 0.2885 0.2716 0.3330 0.0176  0.0413  -0.0564 101 GLY A CA  
863  C C   . GLY A 101 ? 0.3288 0.3014 0.3810 0.0247  0.0416  -0.0615 101 GLY A C   
864  O O   . GLY A 101 ? 0.3809 0.3510 0.4329 0.0220  0.0469  -0.0695 101 GLY A O   
865  N N   . THR A 102 ? 0.3054 0.2711 0.3639 0.0336  0.0357  -0.0568 102 THR A N   
866  C CA  . THR A 102 ? 0.3447 0.2975 0.4108 0.0417  0.0345  -0.0604 102 THR A CA  
867  C C   . THR A 102 ? 0.3650 0.3283 0.4469 0.0471  0.0389  -0.0729 102 THR A C   
868  O O   . THR A 102 ? 0.3619 0.3177 0.4470 0.0481  0.0431  -0.0811 102 THR A O   
869  C CB  . THR A 102 ? 0.3875 0.3308 0.4562 0.0500  0.0258  -0.0514 102 THR A CB  
870  O OG1 . THR A 102 ? 0.3780 0.3129 0.4322 0.0442  0.0226  -0.0409 102 THR A OG1 
871  C CG2 . THR A 102 ? 0.3416 0.2683 0.4171 0.0584  0.0237  -0.0541 102 THR A CG2 
872  N N   . LYS A 103 ? 0.3365 0.3178 0.4287 0.0500  0.0384  -0.0753 103 LYS A N   
873  C CA  . LYS A 103 ? 0.4389 0.4335 0.5483 0.0553  0.0427  -0.0880 103 LYS A CA  
874  C C   . LYS A 103 ? 0.5321 0.5345 0.6379 0.0460  0.0526  -0.0988 103 LYS A C   
875  O O   . LYS A 103 ? 0.5027 0.5051 0.6180 0.0492  0.0576  -0.1103 103 LYS A O   
876  C CB  . LYS A 103 ? 0.4512 0.4657 0.5715 0.0587  0.0403  -0.0882 103 LYS A CB  
877  C CG  . LYS A 103 ? 0.5699 0.5993 0.7116 0.0666  0.0433  -0.1013 103 LYS A CG  
878  N N   . GLU A 104 ? 0.5181 0.5268 0.6100 0.0344  0.0553  -0.0951 104 GLU A N   
879  C CA  . GLU A 104 ? 0.5161 0.5330 0.6018 0.0238  0.0638  -0.1037 104 GLU A CA  
880  C C   . GLU A 104 ? 0.5021 0.5031 0.5755 0.0185  0.0659  -0.1036 104 GLU A C   
881  O O   . GLU A 104 ? 0.5626 0.5681 0.6276 0.0085  0.0722  -0.1094 104 GLU A O   
882  C CB  . GLU A 104 ? 0.5026 0.5320 0.5782 0.0137  0.0648  -0.0991 104 GLU A CB  
883  C CG  . GLU A 104 ? 0.5068 0.5513 0.5935 0.0180  0.0623  -0.0986 104 GLU A CG  
884  C CD  . GLU A 104 ? 0.5696 0.6269 0.6475 0.0069  0.0650  -0.0969 104 GLU A CD  
885  O OE1 . GLU A 104 ? 0.4711 0.5437 0.5583 0.0080  0.0653  -0.0997 104 GLU A OE1 
886  O OE2 . GLU A 104 ? 0.6174 0.6691 0.6790 -0.0030 0.0664  -0.0927 104 GLU A OE2 
887  N N   . ARG A 105 ? 0.4500 0.4326 0.5217 0.0244  0.0605  -0.0970 105 ARG A N   
888  C CA  . ARG A 105 ? 0.4711 0.4376 0.5319 0.0196  0.0620  -0.0968 105 ARG A CA  
889  C C   . ARG A 105 ? 0.5109 0.4809 0.5548 0.0065  0.0642  -0.0932 105 ARG A C   
890  O O   . ARG A 105 ? 0.5451 0.5131 0.5820 -0.0009 0.0693  -0.0994 105 ARG A O   
891  C CB  . ARG A 105 ? 0.5463 0.5093 0.6157 0.0221  0.0682  -0.1106 105 ARG A CB  
892  C CG  . ARG A 105 ? 0.5368 0.4908 0.6226 0.0363  0.0647  -0.1133 105 ARG A CG  
893  C CD  . ARG A 105 ? 0.5709 0.5263 0.6689 0.0396  0.0718  -0.1296 105 ARG A CD  
894  N N   . GLN A 106 ? 0.4185 0.3936 0.4560 0.0038  0.0599  -0.0832 106 GLN A N   
895  C CA  A GLN A 106 ? 0.4396 0.4183 0.4625 -0.0072 0.0604  -0.0787 106 GLN A CA  
896  C CA  B GLN A 106 ? 0.4396 0.4181 0.4624 -0.0072 0.0604  -0.0787 106 GLN A CA  
897  C C   . GLN A 106 ? 0.3806 0.3518 0.3960 -0.0070 0.0537  -0.0662 106 GLN A C   
898  O O   . GLN A 106 ? 0.3556 0.3301 0.3747 -0.0026 0.0495  -0.0601 106 GLN A O   
899  C CB  A GLN A 106 ? 0.4325 0.4279 0.4548 -0.0126 0.0632  -0.0810 106 GLN A CB  
900  C CB  B GLN A 106 ? 0.4332 0.4285 0.4553 -0.0128 0.0633  -0.0811 106 GLN A CB  
901  C CG  A GLN A 106 ? 0.4275 0.4252 0.4348 -0.0228 0.0619  -0.0742 106 GLN A CG  
902  C CG  B GLN A 106 ? 0.5026 0.5079 0.5290 -0.0166 0.0714  -0.0943 106 GLN A CG  
903  C CD  A GLN A 106 ? 0.4333 0.4284 0.4299 -0.0319 0.0654  -0.0781 106 GLN A CD  
904  C CD  B GLN A 106 ? 0.5434 0.5653 0.5686 -0.0231 0.0743  -0.0963 106 GLN A CD  
905  O OE1 A GLN A 106 ? 0.4329 0.4348 0.4294 -0.0368 0.0718  -0.0880 106 GLN A OE1 
906  O OE1 B GLN A 106 ? 0.5417 0.5684 0.5692 -0.0208 0.0705  -0.0900 106 GLN A OE1 
907  N NE2 A GLN A 106 ? 0.3432 0.3295 0.3305 -0.0346 0.0614  -0.0711 106 GLN A NE2 
908  N NE2 B GLN A 106 ? 0.5623 0.5928 0.5829 -0.0322 0.0814  -0.1055 106 GLN A NE2 
909  N N   . TYR A 107 ? 0.3083 0.2708 0.3136 -0.0123 0.0529  -0.0632 107 TYR A N   
910  C CA  . TYR A 107 ? 0.2879 0.2456 0.2865 -0.0132 0.0474  -0.0528 107 TYR A CA  
911  C C   . TYR A 107 ? 0.3024 0.2707 0.2957 -0.0180 0.0457  -0.0479 107 TYR A C   
912  O O   . TYR A 107 ? 0.3036 0.2803 0.2934 -0.0239 0.0488  -0.0516 107 TYR A O   
913  C CB  . TYR A 107 ? 0.2855 0.2338 0.2755 -0.0184 0.0474  -0.0518 107 TYR A CB  
914  C CG  . TYR A 107 ? 0.3029 0.2362 0.2955 -0.0142 0.0473  -0.0533 107 TYR A CG  
915  C CD1 . TYR A 107 ? 0.3539 0.2797 0.3432 -0.0183 0.0513  -0.0601 107 TYR A CD1 
916  C CD2 . TYR A 107 ? 0.2734 0.1989 0.2705 -0.0068 0.0429  -0.0475 107 TYR A CD2 
917  C CE1 . TYR A 107 ? 0.3247 0.2344 0.3154 -0.0150 0.0511  -0.0612 107 TYR A CE1 
918  C CE2 . TYR A 107 ? 0.2522 0.1617 0.2499 -0.0035 0.0421  -0.0478 107 TYR A CE2 
919  C CZ  . TYR A 107 ? 0.3256 0.2265 0.3203 -0.0075 0.0463  -0.0546 107 TYR A CZ  
920  O OH  . TYR A 107 ? 0.3645 0.2470 0.3591 -0.0047 0.0455  -0.0548 107 TYR A OH  
921  N N   . LEU A 108 ? 0.2117 0.1787 0.2038 -0.0159 0.0407  -0.0395 108 LEU A N   
922  C CA  . LEU A 108 ? 0.1671 0.1416 0.1553 -0.0191 0.0384  -0.0345 108 LEU A CA  
923  C C   . LEU A 108 ? 0.1660 0.1401 0.1443 -0.0263 0.0371  -0.0317 108 LEU A C   
924  O O   . LEU A 108 ? 0.2022 0.1704 0.1776 -0.0277 0.0365  -0.0312 108 LEU A O   
925  C CB  . LEU A 108 ? 0.1802 0.1535 0.1719 -0.0137 0.0339  -0.0279 108 LEU A CB  
926  C CG  . LEU A 108 ? 0.2163 0.1904 0.2176 -0.0063 0.0336  -0.0295 108 LEU A CG  
927  C CD1 . LEU A 108 ? 0.2301 0.2032 0.2326 -0.0025 0.0291  -0.0229 108 LEU A CD1 
928  C CD2 . LEU A 108 ? 0.3507 0.3354 0.3568 -0.0070 0.0368  -0.0348 108 LEU A CD2 
929  N N   . ASP A 109 ? 0.1771 0.1575 0.1503 -0.0312 0.0362  -0.0296 109 ASP A N   
930  C CA  . ASP A 109 ? 0.1969 0.1777 0.1613 -0.0374 0.0335  -0.0261 109 ASP A CA  
931  C C   . ASP A 109 ? 0.1634 0.1410 0.1287 -0.0345 0.0287  -0.0201 109 ASP A C   
932  O O   . ASP A 109 ? 0.1769 0.1539 0.1472 -0.0294 0.0266  -0.0167 109 ASP A O   
933  C CB  . ASP A 109 ? 0.1901 0.1760 0.1488 -0.0420 0.0320  -0.0232 109 ASP A CB  
934  C CG  . ASP A 109 ? 0.4109 0.4019 0.3666 -0.0475 0.0372  -0.0293 109 ASP A CG  
935  O OD1 . ASP A 109 ? 0.4412 0.4325 0.3986 -0.0482 0.0419  -0.0366 109 ASP A OD1 
936  O OD2 . ASP A 109 ? 0.4577 0.4524 0.4091 -0.0515 0.0368  -0.0273 109 ASP A OD2 
937  N N   . GLU A 110 ? 0.1586 0.1355 0.1194 -0.0384 0.0272  -0.0195 110 GLU A N   
938  C CA  . GLU A 110 ? 0.1406 0.1173 0.1028 -0.0367 0.0230  -0.0148 110 GLU A CA  
939  C C   . GLU A 110 ? 0.1306 0.1105 0.0938 -0.0347 0.0186  -0.0094 110 GLU A C   
940  O O   . GLU A 110 ? 0.1504 0.1302 0.1184 -0.0306 0.0164  -0.0066 110 GLU A O   
941  C CB  . GLU A 110 ? 0.1407 0.1190 0.0979 -0.0423 0.0217  -0.0155 110 GLU A CB  
942  C CG  . GLU A 110 ? 0.1458 0.1270 0.1059 -0.0409 0.0174  -0.0116 110 GLU A CG  
943  C CD  . GLU A 110 ? 0.1870 0.1690 0.1452 -0.0455 0.0177  -0.0139 110 GLU A CD  
944  O OE1 . GLU A 110 ? 0.1657 0.1433 0.1204 -0.0490 0.0217  -0.0186 110 GLU A OE1 
945  O OE2 . GLU A 110 ? 0.1593 0.1468 0.1201 -0.0455 0.0141  -0.0116 110 GLU A OE2 
946  N N   . GLU A 111 ? 0.1559 0.1380 0.1141 -0.0383 0.0177  -0.0083 111 GLU A N   
947  C CA  . GLU A 111 ? 0.1343 0.1169 0.0927 -0.0367 0.0135  -0.0032 111 GLU A CA  
948  C C   . GLU A 111 ? 0.1525 0.1339 0.1174 -0.0312 0.0146  -0.0029 111 GLU A C   
949  O O   . GLU A 111 ? 0.1459 0.1268 0.1141 -0.0279 0.0114  0.0005  111 GLU A O   
950  C CB  . GLU A 111 ? 0.1583 0.1416 0.1081 -0.0428 0.0125  -0.0017 111 GLU A CB  
951  C CG  . GLU A 111 ? 0.1561 0.1409 0.0986 -0.0480 0.0085  0.0005  111 GLU A CG  
952  C CD  . GLU A 111 ? 0.1849 0.1694 0.1299 -0.0448 0.0012  0.0064  111 GLU A CD  
953  O OE1 . GLU A 111 ? 0.1721 0.1592 0.1233 -0.0414 -0.0003 0.0059  111 GLU A OE1 
954  O OE2 . GLU A 111 ? 0.2461 0.2277 0.1871 -0.0457 -0.0029 0.0112  111 GLU A OE2 
955  N N   . PHE A 112 ? 0.1404 0.1219 0.1077 -0.0302 0.0191  -0.0069 112 PHE A N   
956  C CA  . PHE A 112 ? 0.1378 0.1194 0.1113 -0.0251 0.0198  -0.0068 112 PHE A CA  
957  C C   . PHE A 112 ? 0.1353 0.1148 0.1135 -0.0205 0.0184  -0.0053 112 PHE A C   
958  O O   . PHE A 112 ? 0.1193 0.0993 0.1007 -0.0175 0.0165  -0.0030 112 PHE A O   
959  C CB  . PHE A 112 ? 0.1274 0.1110 0.1040 -0.0244 0.0243  -0.0118 112 PHE A CB  
960  C CG  . PHE A 112 ? 0.1173 0.1025 0.1008 -0.0192 0.0242  -0.0116 112 PHE A CG  
961  C CD1 . PHE A 112 ? 0.1649 0.1531 0.1487 -0.0199 0.0233  -0.0100 112 PHE A CD1 
962  C CD2 . PHE A 112 ? 0.1719 0.1549 0.1607 -0.0141 0.0246  -0.0128 112 PHE A CD2 
963  C CE1 . PHE A 112 ? 0.2151 0.2059 0.2049 -0.0158 0.0230  -0.0102 112 PHE A CE1 
964  C CE2 . PHE A 112 ? 0.1591 0.1443 0.1536 -0.0096 0.0236  -0.0121 112 PHE A CE2 
965  C CZ  . PHE A 112 ? 0.1776 0.1677 0.1728 -0.0106 0.0229  -0.0111 112 PHE A CZ  
966  N N   . VAL A 113 ? 0.1240 0.1011 0.1018 -0.0208 0.0195  -0.0069 113 VAL A N   
967  C CA  . VAL A 113 ? 0.1392 0.1141 0.1195 -0.0183 0.0185  -0.0054 113 VAL A CA  
968  C C   . VAL A 113 ? 0.1321 0.1103 0.1132 -0.0184 0.0151  -0.0025 113 VAL A C   
969  O O   . VAL A 113 ? 0.1099 0.0887 0.0942 -0.0159 0.0142  -0.0012 113 VAL A O   
970  C CB  . VAL A 113 ? 0.1357 0.1061 0.1140 -0.0202 0.0204  -0.0077 113 VAL A CB  
971  C CG1 . VAL A 113 ? 0.1350 0.1029 0.1143 -0.0192 0.0195  -0.0058 113 VAL A CG1 
972  C CG2 . VAL A 113 ? 0.1428 0.1092 0.1222 -0.0187 0.0236  -0.0115 113 VAL A CG2 
973  N N   . LEU A 114 ? 0.1254 0.1059 0.1038 -0.0214 0.0129  -0.0017 114 LEU A N   
974  C CA  . LEU A 114 ? 0.1180 0.1020 0.0991 -0.0203 0.0090  0.0006  114 LEU A CA  
975  C C   . LEU A 114 ? 0.1186 0.1022 0.1026 -0.0171 0.0075  0.0024  114 LEU A C   
976  O O   . LEU A 114 ? 0.1113 0.0971 0.1001 -0.0144 0.0057  0.0028  114 LEU A O   
977  C CB  . LEU A 114 ? 0.1100 0.0966 0.0878 -0.0237 0.0058  0.0017  114 LEU A CB  
978  C CG  . LEU A 114 ? 0.1363 0.1245 0.1116 -0.0277 0.0071  -0.0007 114 LEU A CG  
979  C CD1 . LEU A 114 ? 0.1575 0.1496 0.1290 -0.0314 0.0031  0.0007  114 LEU A CD1 
980  C CD2 . LEU A 114 ? 0.1582 0.1491 0.1384 -0.0266 0.0077  -0.0019 114 LEU A CD2 
981  N N   . ARG A 115 ? 0.1195 0.1008 0.1008 -0.0179 0.0085  0.0027  115 ARG A N   
982  C CA  . ARG A 115 ? 0.1229 0.1031 0.1061 -0.0158 0.0076  0.0039  115 ARG A CA  
983  C C   . ARG A 115 ? 0.1095 0.0909 0.0975 -0.0124 0.0093  0.0027  115 ARG A C   
984  O O   . ARG A 115 ? 0.1226 0.1046 0.1140 -0.0103 0.0079  0.0030  115 ARG A O   
985  C CB  . ARG A 115 ? 0.1507 0.1297 0.1298 -0.0187 0.0093  0.0037  115 ARG A CB  
986  C CG  . ARG A 115 ? 0.1733 0.1501 0.1457 -0.0232 0.0068  0.0061  115 ARG A CG  
987  C CD  . ARG A 115 ? 0.1956 0.1714 0.1630 -0.0274 0.0087  0.0060  115 ARG A CD  
988  N NE  . ARG A 115 ? 0.2624 0.2339 0.2221 -0.0319 0.0049  0.0101  115 ARG A NE  
989  C CZ  . ARG A 115 ? 0.2770 0.2491 0.2287 -0.0377 0.0050  0.0105  115 ARG A CZ  
990  N NH1 . ARG A 115 ? 0.2670 0.2439 0.2184 -0.0396 0.0095  0.0059  115 ARG A NH1 
991  N NH2 . ARG A 115 ? 0.3336 0.3008 0.2772 -0.0419 0.0003  0.0154  115 ARG A NH2 
992  N N   . VAL A 116 ? 0.1097 0.0912 0.0977 -0.0120 0.0119  0.0010  116 VAL A N   
993  C CA  . VAL A 116 ? 0.1132 0.0953 0.1040 -0.0094 0.0127  0.0007  116 VAL A CA  
994  C C   . VAL A 116 ? 0.0930 0.0765 0.0853 -0.0093 0.0119  0.0010  116 VAL A C   
995  O O   . VAL A 116 ? 0.1136 0.0991 0.1081 -0.0081 0.0117  0.0009  116 VAL A O   
996  C CB  . VAL A 116 ? 0.0900 0.0701 0.0805 -0.0086 0.0147  -0.0002 116 VAL A CB  
997  C CG1 . VAL A 116 ? 0.0960 0.0757 0.0877 -0.0064 0.0143  0.0008  116 VAL A CG1 
998  C CG2 . VAL A 116 ? 0.1181 0.0997 0.1093 -0.0086 0.0161  -0.0018 116 VAL A CG2 
999  N N   . MET A 117 ? 0.1092 0.0927 0.1003 -0.0112 0.0119  0.0007  117 MET A N   
1000 C CA  . MET A 117 ? 0.0986 0.0856 0.0917 -0.0119 0.0117  0.0000  117 MET A CA  
1001 C C   . MET A 117 ? 0.1023 0.0937 0.1005 -0.0100 0.0097  -0.0007 117 MET A C   
1002 O O   . MET A 117 ? 0.1111 0.1060 0.1122 -0.0094 0.0104  -0.0022 117 MET A O   
1003 C CB  . MET A 117 ? 0.1311 0.1190 0.1227 -0.0150 0.0117  -0.0008 117 MET A CB  
1004 C CG  . MET A 117 ? 0.1088 0.1027 0.1035 -0.0165 0.0117  -0.0024 117 MET A CG  
1005 S SD  . MET A 117 ? 0.1711 0.1663 0.1631 -0.0217 0.0125  -0.0038 117 MET A SD  
1006 C CE  . MET A 117 ? 0.1985 0.1973 0.1918 -0.0213 0.0087  -0.0033 117 MET A CE  
1007 N N   . THR A 118 ? 0.1060 0.0965 0.1046 -0.0093 0.0070  0.0004  118 THR A N   
1008 C CA  . THR A 118 ? 0.1043 0.0968 0.1083 -0.0066 0.0042  0.0000  118 THR A CA  
1009 C C   . THR A 118 ? 0.1184 0.1093 0.1240 -0.0048 0.0053  -0.0009 118 THR A C   
1010 O O   . THR A 118 ? 0.1041 0.0986 0.1149 -0.0031 0.0056  -0.0036 118 THR A O   
1011 C CB  . THR A 118 ? 0.0994 0.0885 0.1013 -0.0067 0.0003  0.0027  118 THR A CB  
1012 O OG1 . THR A 118 ? 0.1132 0.1051 0.1134 -0.0090 -0.0010 0.0032  118 THR A OG1 
1013 C CG2 . THR A 118 ? 0.1071 0.0956 0.1149 -0.0030 -0.0035 0.0028  118 THR A CG2 
1014 N N   . GLN A 119 ? 0.0906 0.0772 0.0920 -0.0056 0.0061  0.0005  119 GLN A N   
1015 C CA  . GLN A 119 ? 0.1058 0.0911 0.1082 -0.0048 0.0067  -0.0003 119 GLN A CA  
1016 C C   . GLN A 119 ? 0.1151 0.1042 0.1182 -0.0048 0.0092  -0.0023 119 GLN A C   
1017 O O   . GLN A 119 ? 0.1110 0.1015 0.1168 -0.0041 0.0097  -0.0046 119 GLN A O   
1018 C CB  . GLN A 119 ? 0.1083 0.0896 0.1063 -0.0066 0.0069  0.0014  119 GLN A CB  
1019 C CG  . GLN A 119 ? 0.1112 0.0877 0.1067 -0.0077 0.0039  0.0039  119 GLN A CG  
1020 C CD  . GLN A 119 ? 0.1375 0.1106 0.1276 -0.0112 0.0046  0.0052  119 GLN A CD  
1021 O OE1 . GLN A 119 ? 0.1250 0.0976 0.1153 -0.0119 0.0059  0.0041  119 GLN A OE1 
1022 N NE2 . GLN A 119 ? 0.1440 0.1156 0.1289 -0.0143 0.0039  0.0071  119 GLN A NE2 
1023 N N   . LEU A 120 ? 0.1128 0.1029 0.1132 -0.0059 0.0107  -0.0015 120 LEU A N   
1024 C CA  . LEU A 120 ? 0.1315 0.1242 0.1308 -0.0067 0.0122  -0.0022 120 LEU A CA  
1025 C C   . LEU A 120 ? 0.1257 0.1231 0.1275 -0.0077 0.0131  -0.0048 120 LEU A C   
1026 O O   . LEU A 120 ? 0.1347 0.1354 0.1363 -0.0089 0.0145  -0.0067 120 LEU A O   
1027 C CB  . LEU A 120 ? 0.1305 0.1207 0.1257 -0.0074 0.0127  0.0000  120 LEU A CB  
1028 C CG  . LEU A 120 ? 0.1711 0.1597 0.1656 -0.0060 0.0123  0.0012  120 LEU A CG  
1029 C CD1 . LEU A 120 ? 0.1920 0.1841 0.1875 -0.0058 0.0119  0.0004  120 LEU A CD1 
1030 C CD2 . LEU A 120 ? 0.1959 0.1813 0.1879 -0.0055 0.0122  0.0030  120 LEU A CD2 
1031 N N   . THR A 121 ? 0.0950 0.0939 0.0992 -0.0078 0.0126  -0.0054 121 THR A N   
1032 C CA  . THR A 121 ? 0.1101 0.1160 0.1187 -0.0087 0.0138  -0.0091 121 THR A CA  
1033 C C   . THR A 121 ? 0.1132 0.1216 0.1278 -0.0061 0.0135  -0.0127 121 THR A C   
1034 O O   . THR A 121 ? 0.1286 0.1430 0.1456 -0.0075 0.0159  -0.0168 121 THR A O   
1035 C CB  . THR A 121 ? 0.1157 0.1247 0.1275 -0.0089 0.0126  -0.0096 121 THR A CB  
1036 O OG1 . THR A 121 ? 0.1314 0.1375 0.1370 -0.0124 0.0137  -0.0073 121 THR A OG1 
1037 C CG2 . THR A 121 ? 0.1312 0.1500 0.1502 -0.0093 0.0138  -0.0147 121 THR A CG2 
1038 N N   . LEU A 122 ? 0.1114 0.1148 0.1280 -0.0031 0.0109  -0.0115 122 LEU A N   
1039 C CA  . LEU A 122 ? 0.1198 0.1227 0.1418 -0.0005 0.0104  -0.0149 122 LEU A CA  
1040 C C   . LEU A 122 ? 0.1135 0.1165 0.1324 -0.0025 0.0129  -0.0166 122 LEU A C   
1041 O O   . LEU A 122 ? 0.1291 0.1354 0.1522 -0.0021 0.0146  -0.0217 122 LEU A O   
1042 C CB  . LEU A 122 ? 0.1205 0.1157 0.1435 0.0022  0.0065  -0.0122 122 LEU A CB  
1043 C CG  . LEU A 122 ? 0.1216 0.1185 0.1496 0.0047  0.0029  -0.0114 122 LEU A CG  
1044 C CD1 . LEU A 122 ? 0.1681 0.1563 0.1925 0.0054  -0.0014 -0.0064 122 LEU A CD1 
1045 C CD2 . LEU A 122 ? 0.1262 0.1288 0.1653 0.0087  0.0023  -0.0170 122 LEU A CD2 
1046 N N   . ALA A 123 ? 0.1029 0.1031 0.1149 -0.0045 0.0132  -0.0129 123 ALA A N   
1047 C CA  . ALA A 123 ? 0.1148 0.1167 0.1233 -0.0067 0.0148  -0.0140 123 ALA A CA  
1048 C C   . ALA A 123 ? 0.1253 0.1340 0.1326 -0.0096 0.0174  -0.0167 123 ALA A C   
1049 O O   . ALA A 123 ? 0.1347 0.1470 0.1423 -0.0114 0.0192  -0.0208 123 ALA A O   
1050 C CB  . ALA A 123 ? 0.1269 0.1264 0.1300 -0.0076 0.0139  -0.0096 123 ALA A CB  
1051 N N   . LEU A 124 ? 0.1296 0.1399 0.1347 -0.0111 0.0178  -0.0149 124 LEU A N   
1052 C CA  . LEU A 124 ? 0.1216 0.1380 0.1239 -0.0154 0.0204  -0.0171 124 LEU A CA  
1053 C C   . LEU A 124 ? 0.1471 0.1711 0.1570 -0.0154 0.0229  -0.0244 124 LEU A C   
1054 O O   . LEU A 124 ? 0.1775 0.2075 0.1856 -0.0192 0.0259  -0.0285 124 LEU A O   
1055 C CB  . LEU A 124 ? 0.1347 0.1500 0.1330 -0.0177 0.0205  -0.0139 124 LEU A CB  
1056 C CG  . LEU A 124 ? 0.1905 0.1987 0.1809 -0.0184 0.0187  -0.0077 124 LEU A CG  
1057 C CD1 . LEU A 124 ? 0.2123 0.2178 0.1993 -0.0209 0.0191  -0.0055 124 LEU A CD1 
1058 C CD2 . LEU A 124 ? 0.1797 0.1888 0.1633 -0.0215 0.0186  -0.0063 124 LEU A CD2 
1059 N N   . LYS A 125 ? 0.1208 0.1449 0.1392 -0.0111 0.0216  -0.0263 125 LYS A N   
1060 C CA  . LYS A 125 ? 0.1192 0.1505 0.1477 -0.0092 0.0232  -0.0339 125 LYS A CA  
1061 C C   . LYS A 125 ? 0.1465 0.1777 0.1763 -0.0092 0.0249  -0.0387 125 LYS A C   
1062 O O   . LYS A 125 ? 0.1741 0.2136 0.2073 -0.0114 0.0287  -0.0459 125 LYS A O   
1063 C CB  . LYS A 125 ? 0.1534 0.1825 0.1909 -0.0032 0.0194  -0.0336 125 LYS A CB  
1064 C CG  . LYS A 125 ? 0.1722 0.2085 0.2229 0.0007  0.0199  -0.0416 125 LYS A CG  
1065 C CD  . LYS A 125 ? 0.2440 0.2784 0.3026 0.0065  0.0147  -0.0396 125 LYS A CD  
1066 C CE  . LYS A 125 ? 0.3166 0.3541 0.3895 0.0129  0.0133  -0.0465 125 LYS A CE  
1067 N NZ  . LYS A 125 ? 0.2932 0.3271 0.3723 0.0188  0.0066  -0.0428 125 LYS A NZ  
1068 N N   . GLU A 126 ? 0.1453 0.1677 0.1720 -0.0075 0.0226  -0.0353 126 GLU A N   
1069 C CA  . GLU A 126 ? 0.1779 0.1992 0.2048 -0.0083 0.0242  -0.0398 126 GLU A CA  
1070 C C   . GLU A 126 ? 0.1930 0.2205 0.2115 -0.0148 0.0274  -0.0410 126 GLU A C   
1071 O O   . GLU A 126 ? 0.1933 0.2259 0.2135 -0.0172 0.0307  -0.0481 126 GLU A O   
1072 C CB  . GLU A 126 ? 0.1819 0.1928 0.2066 -0.0063 0.0211  -0.0356 126 GLU A CB  
1073 C CG  . GLU A 126 ? 0.2041 0.2127 0.2282 -0.0080 0.0227  -0.0401 126 GLU A CG  
1074 C CD  . GLU A 126 ? 0.2648 0.2734 0.2984 -0.0051 0.0243  -0.0486 126 GLU A CD  
1075 O OE1 . GLU A 126 ? 0.2571 0.2664 0.2992 -0.0004 0.0231  -0.0501 126 GLU A OE1 
1076 O OE2 . GLU A 126 ? 0.3034 0.3117 0.3367 -0.0074 0.0268  -0.0542 126 GLU A OE2 
1077 N N   . CYS A 127 ? 0.1714 0.1981 0.1810 -0.0177 0.0261  -0.0343 127 CYS A N   
1078 C CA  . CYS A 127 ? 0.1877 0.2195 0.1880 -0.0241 0.0278  -0.0340 127 CYS A CA  
1079 C C   . CYS A 127 ? 0.2489 0.2901 0.2497 -0.0287 0.0322  -0.0400 127 CYS A C   
1080 O O   . CYS A 127 ? 0.2241 0.2712 0.2202 -0.0341 0.0350  -0.0443 127 CYS A O   
1081 C CB  . CYS A 127 ? 0.1845 0.2123 0.1763 -0.0252 0.0248  -0.0253 127 CYS A CB  
1082 S SG  . CYS A 127 ? 0.2153 0.2362 0.2060 -0.0216 0.0207  -0.0197 127 CYS A SG  
1083 N N   . HIS A 128 ? 0.1683 0.2120 0.1744 -0.0272 0.0329  -0.0409 128 HIS A N   
1084 C CA  . HIS A 128 ? 0.1998 0.2543 0.2073 -0.0322 0.0376  -0.0474 128 HIS A CA  
1085 C C   . HIS A 128 ? 0.2057 0.2676 0.2235 -0.0308 0.0413  -0.0584 128 HIS A C   
1086 O O   . HIS A 128 ? 0.2576 0.3295 0.2735 -0.0370 0.0462  -0.0653 128 HIS A O   
1087 C CB  . HIS A 128 ? 0.2189 0.2754 0.2307 -0.0311 0.0372  -0.0460 128 HIS A CB  
1088 C CG  . HIS A 128 ? 0.2347 0.2839 0.2359 -0.0337 0.0346  -0.0366 128 HIS A CG  
1089 N ND1 . HIS A 128 ? 0.2412 0.2883 0.2448 -0.0320 0.0331  -0.0336 128 HIS A ND1 
1090 C CD2 . HIS A 128 ? 0.2223 0.2653 0.2110 -0.0374 0.0330  -0.0299 128 HIS A CD2 
1091 C CE1 . HIS A 128 ? 0.2582 0.2973 0.2512 -0.0348 0.0312  -0.0260 128 HIS A CE1 
1092 N NE2 . HIS A 128 ? 0.2536 0.2898 0.2379 -0.0375 0.0307  -0.0233 128 HIS A NE2 
1093 N N   . ARG A 129 ? 0.3814 0.2117 0.2580 -0.0202 0.1779  -0.0202 129 ARG A N   
1094 C CA  . ARG A 129 ? 0.3821 0.2049 0.2616 -0.0272 0.1846  -0.0285 129 ARG A CA  
1095 C C   . ARG A 129 ? 0.4855 0.2963 0.3152 -0.0251 0.1839  -0.0304 129 ARG A C   
1096 O O   . ARG A 129 ? 0.5254 0.3146 0.3398 -0.0268 0.2008  -0.0346 129 ARG A O   
1097 C CB  . ARG A 129 ? 0.3658 0.2138 0.2791 -0.0346 0.1671  -0.0340 129 ARG A CB  
1098 C CG  . ARG A 129 ? 0.5116 0.3552 0.4433 -0.0435 0.1746  -0.0427 129 ARG A CG  
1099 C CD  . ARG A 129 ? 0.4943 0.3643 0.4578 -0.0505 0.1556  -0.0469 129 ARG A CD  
1100 N NE  . ARG A 129 ? 0.5407 0.4294 0.4822 -0.0481 0.1361  -0.0467 129 ARG A NE  
1101 C CZ  . ARG A 129 ? 0.5814 0.4699 0.5018 -0.0489 0.1331  -0.0517 129 ARG A CZ  
1102 N NH1 . ARG A 129 ? 0.6262 0.4972 0.5411 -0.0527 0.1494  -0.0574 129 ARG A NH1 
1103 N NH2 . ARG A 129 ? 0.4998 0.4043 0.4063 -0.0454 0.1142  -0.0513 129 ARG A NH2 
1104 N N   . ARG A 130 ? 0.4803 0.3030 0.2854 -0.0213 0.1640  -0.0278 130 ARG A N   
1105 C CA  . ARG A 130 ? 0.5680 0.3787 0.3266 -0.0182 0.1578  -0.0300 130 ARG A CA  
1106 C C   . ARG A 130 ? 0.6864 0.4651 0.4006 -0.0116 0.1744  -0.0252 130 ARG A C   
1107 O O   . ARG A 130 ? 0.8256 0.5829 0.5011 -0.0100 0.1795  -0.0290 130 ARG A O   
1108 C CB  . ARG A 130 ? 0.5146 0.3444 0.2653 -0.0156 0.1309  -0.0283 130 ARG A CB  
1109 C CG  . ARG A 130 ? 0.5539 0.4138 0.3451 -0.0209 0.1153  -0.0320 130 ARG A CG  
1110 C CD  . ARG A 130 ? 0.6534 0.5164 0.4601 -0.0272 0.1189  -0.0410 130 ARG A CD  
1111 N N   . SER A 131 ? 0.6527 0.4277 0.3721 -0.0074 0.1827  -0.0167 131 SER A N   
1112 C CA  . SER A 131 ? 0.7420 0.4871 0.4226 -0.0006 0.2001  -0.0106 131 SER A CA  
1113 C C   . SER A 131 ? 0.7641 0.4822 0.4422 -0.0019 0.2293  -0.0139 131 SER A C   
1114 O O   . SER A 131 ? 0.9043 0.5917 0.5361 0.0025  0.2434  -0.0126 131 SER A O   
1115 C CB  . SER A 131 ? 0.7066 0.4583 0.4036 0.0041  0.2028  -0.0007 131 SER A CB  
1116 O OG  . SER A 131 ? 0.7777 0.5504 0.4727 0.0051  0.1777  0.0026  131 SER A OG  
1117 N N   . LEU A 138 ? 0.8612 0.5925 0.4122 0.0169  0.1294  0.0109  138 LEU A N   
1118 C CA  . LEU A 138 ? 0.7907 0.5556 0.3828 0.0124  0.1087  0.0083  138 LEU A CA  
1119 C C   . LEU A 138 ? 0.8308 0.6128 0.4452 0.0125  0.1019  0.0166  138 LEU A C   
1120 O O   . LEU A 138 ? 0.8907 0.6865 0.5392 0.0120  0.1148  0.0202  138 LEU A O   
1121 C CB  . LEU A 138 ? 0.7072 0.4921 0.3431 0.0073  0.1174  0.0023  138 LEU A CB  
1122 C CG  . LEU A 138 ? 0.6694 0.4844 0.3409 0.0028  0.0974  -0.0022 138 LEU A CG  
1123 C CD1 . LEU A 138 ? 0.6691 0.4954 0.3721 -0.0023 0.1063  -0.0091 138 LEU A CD1 
1124 C CD2 . LEU A 138 ? 0.6504 0.4878 0.3520 0.0021  0.0886  0.0038  138 LEU A CD2 
1125 N N   . HIS A 139 ? 0.7774 0.5576 0.3750 0.0133  0.0808  0.0192  139 HIS A N   
1126 C CA  . HIS A 139 ? 0.7085 0.5045 0.3271 0.0124  0.0729  0.0267  139 HIS A CA  
1127 C C   . HIS A 139 ? 0.6920 0.5221 0.3615 0.0077  0.0642  0.0244  139 HIS A C   
1128 O O   . HIS A 139 ? 0.7351 0.5746 0.4142 0.0052  0.0501  0.0183  139 HIS A O   
1129 C CB  . HIS A 139 ? 0.7887 0.5703 0.3771 0.0134  0.0513  0.0293  139 HIS A CB  
1130 C CG  . HIS A 139 ? 0.8572 0.6023 0.3905 0.0186  0.0576  0.0328  139 HIS A CG  
1131 N ND1 . HIS A 139 ? 0.9228 0.6583 0.4441 0.0212  0.0682  0.0424  139 HIS A ND1 
1132 C CD2 . HIS A 139 ? 0.8710 0.5858 0.3566 0.0223  0.0548  0.0280  139 HIS A CD2 
1133 C CE1 . HIS A 139 ? 0.9725 0.6714 0.4383 0.0261  0.0724  0.0440  139 HIS A CE1 
1134 N NE2 . HIS A 139 ? 0.9578 0.6428 0.3996 0.0269  0.0642  0.0350  139 HIS A NE2 
1135 N N   . ARG A 140 ? 0.6488 0.4965 0.3509 0.0074  0.0729  0.0294  140 ARG A N   
1136 C CA  . ARG A 140 ? 0.5676 0.4449 0.3130 0.0036  0.0639  0.0281  140 ARG A CA  
1137 C C   . ARG A 140 ? 0.5683 0.4593 0.3338 0.0036  0.0617  0.0354  140 ARG A C   
1138 O O   . ARG A 140 ? 0.6086 0.4912 0.3666 0.0072  0.0733  0.0417  140 ARG A O   
1139 C CB  . ARG A 140 ? 0.4931 0.3822 0.2685 0.0026  0.0759  0.0235  140 ARG A CB  
1140 C CG  . ARG A 140 ? 0.4955 0.3779 0.2819 0.0062  0.0978  0.0265  140 ARG A CG  
1141 C CD  . ARG A 140 ? 0.5853 0.4434 0.3468 0.0075  0.1135  0.0231  140 ARG A CD  
1142 N NE  . ARG A 140 ? 0.5917 0.4406 0.3688 0.0112  0.1361  0.0257  140 ARG A NE  
1143 C CZ  . ARG A 140 ? 0.6930 0.5186 0.4543 0.0125  0.1552  0.0237  140 ARG A CZ  
1144 N NH1 . ARG A 140 ? 0.7105 0.5212 0.4378 0.0104  0.1533  0.0184  140 ARG A NH1 
1145 N NH2 . ARG A 140 ? 0.7236 0.5400 0.5053 0.0164  0.1764  0.0265  140 ARG A NH2 
1146 N N   . ASP A 141 ? 0.4612 0.3732 0.2536 -0.0002 0.0475  0.0346  141 ASP A N   
1147 C CA  . ASP A 141 ? 0.5038 0.4312 0.3183 -0.0015 0.0428  0.0404  141 ASP A CA  
1148 C C   . ASP A 141 ? 0.4375 0.3908 0.2927 -0.0037 0.0407  0.0377  141 ASP A C   
1149 O O   . ASP A 141 ? 0.3910 0.3516 0.2539 -0.0072 0.0292  0.0337  141 ASP A O   
1150 C CB  . ASP A 141 ? 0.6258 0.5460 0.4249 -0.0048 0.0241  0.0424  141 ASP A CB  
1151 C CG  . ASP A 141 ? 0.6708 0.6124 0.5032 -0.0091 0.0148  0.0453  141 ASP A CG  
1152 O OD1 . ASP A 141 ? 0.5581 0.5153 0.4147 -0.0079 0.0240  0.0492  141 ASP A OD1 
1153 O OD2 . ASP A 141 ? 0.7289 0.6711 0.5655 -0.0135 -0.0017 0.0435  141 ASP A OD2 
1154 N N   . LEU A 142 ? 0.4236 0.3892 0.3052 -0.0008 0.0517  0.0401  142 LEU A N   
1155 C CA  A LEU A 142 ? 0.3804 0.3665 0.2979 -0.0012 0.0500  0.0365  142 LEU A CA  
1156 C CA  B LEU A 142 ? 0.3816 0.3676 0.2991 -0.0012 0.0501  0.0365  142 LEU A CA  
1157 C C   . LEU A 142 ? 0.3389 0.3446 0.2803 -0.0040 0.0406  0.0391  142 LEU A C   
1158 O O   . LEU A 142 ? 0.3439 0.3653 0.3140 -0.0029 0.0394  0.0364  142 LEU A O   
1159 C CB  A LEU A 142 ? 0.3843 0.3708 0.3225 0.0047  0.0641  0.0356  142 LEU A CB  
1160 C CB  B LEU A 142 ? 0.3861 0.3724 0.3242 0.0048  0.0644  0.0358  142 LEU A CB  
1161 C CG  A LEU A 142 ? 0.3733 0.3561 0.3179 0.0045  0.0672  0.0290  142 LEU A CG  
1162 C CG  B LEU A 142 ? 0.3876 0.3577 0.3157 0.0063  0.0751  0.0316  142 LEU A CG  
1163 C CD1 A LEU A 142 ? 0.3950 0.3719 0.3603 0.0104  0.0811  0.0289  142 LEU A CD1 
1164 C CD1 B LEU A 142 ? 0.3979 0.3655 0.3517 0.0125  0.0890  0.0323  142 LEU A CD1 
1165 C CD2 A LEU A 142 ? 0.4016 0.3688 0.3150 0.0014  0.0672  0.0260  142 LEU A CD2 
1166 C CD2 B LEU A 142 ? 0.4284 0.3765 0.3164 0.0057  0.0798  0.0327  142 LEU A CD2 
1167 N N   . LYS A 143 ? 0.2662 0.2692 0.1966 -0.0074 0.0324  0.0436  143 LYS A N   
1168 C CA  . LYS A 143 ? 0.2407 0.2622 0.1973 -0.0115 0.0235  0.0456  143 LYS A CA  
1169 C C   . LYS A 143 ? 0.2045 0.2345 0.1736 -0.0153 0.0156  0.0402  143 LYS A C   
1170 O O   . LYS A 143 ? 0.2005 0.2199 0.1533 -0.0160 0.0125  0.0363  143 LYS A O   
1171 C CB  . LYS A 143 ? 0.3137 0.3278 0.2584 -0.0158 0.0135  0.0504  143 LYS A CB  
1172 C CG  . LYS A 143 ? 0.4417 0.4390 0.3634 -0.0198 0.0002  0.0476  143 LYS A CG  
1173 C CD  . LYS A 143 ? 0.5378 0.5229 0.4462 -0.0234 -0.0110 0.0525  143 LYS A CD  
1174 C CE  . LYS A 143 ? 0.5962 0.5626 0.4866 -0.0265 -0.0270 0.0490  143 LYS A CE  
1175 N NZ  . LYS A 143 ? 0.6963 0.6456 0.5712 -0.0297 -0.0404 0.0534  143 LYS A NZ  
1176 N N   . PRO A 144 ? 0.1999 0.2489 0.1985 -0.0172 0.0132  0.0400  144 PRO A N   
1177 C CA  . PRO A 144 ? 0.1748 0.2299 0.1843 -0.0197 0.0079  0.0351  144 PRO A CA  
1178 C C   . PRO A 144 ? 0.1582 0.2021 0.1553 -0.0252 -0.0019 0.0343  144 PRO A C   
1179 O O   . PRO A 144 ? 0.1470 0.1882 0.1421 -0.0253 -0.0031 0.0305  144 PRO A O   
1180 C CB  . PRO A 144 ? 0.1990 0.2652 0.2304 -0.0175 0.0023  0.0345  144 PRO A CB  
1181 C CG  . PRO A 144 ? 0.2104 0.2804 0.2496 -0.0119 0.0072  0.0378  144 PRO A CG  
1182 C CD  . PRO A 144 ? 0.2328 0.2966 0.2563 -0.0144 0.0138  0.0425  144 PRO A CD  
1183 N N   . ALA A 145 ? 0.1828 0.2188 0.1733 -0.0288 -0.0098 0.0376  145 ALA A N   
1184 C CA  . ALA A 145 ? 0.1872 0.2101 0.1712 -0.0329 -0.0216 0.0362  145 ALA A CA  
1185 C C   . ALA A 145 ? 0.1983 0.2046 0.1556 -0.0290 -0.0225 0.0330  145 ALA A C   
1186 O O   . ALA A 145 ? 0.2477 0.2436 0.2025 -0.0304 -0.0321 0.0307  145 ALA A O   
1187 C CB  . ALA A 145 ? 0.2435 0.2586 0.2268 -0.0377 -0.0322 0.0404  145 ALA A CB  
1188 N N   . ASN A 146 ? 0.1833 0.1868 0.1237 -0.0240 -0.0125 0.0326  146 ASN A N   
1189 C CA  . ASN A 146 ? 0.1719 0.1613 0.0890 -0.0208 -0.0123 0.0290  146 ASN A CA  
1190 C C   . ASN A 146 ? 0.1448 0.1424 0.0691 -0.0185 -0.0033 0.0250  146 ASN A C   
1191 O O   . ASN A 146 ? 0.2042 0.1931 0.1126 -0.0160 0.0006  0.0221  146 ASN A O   
1192 C CB  . ASN A 146 ? 0.2461 0.2190 0.1333 -0.0176 -0.0081 0.0311  146 ASN A CB  
1193 C CG  . ASN A 146 ? 0.3803 0.3349 0.2410 -0.0154 -0.0130 0.0270  146 ASN A CG  
1194 O OD1 . ASN A 146 ? 0.3698 0.3201 0.2335 -0.0166 -0.0256 0.0241  146 ASN A OD1 
1195 N ND2 . ASN A 146 ? 0.3820 0.3254 0.2196 -0.0117 -0.0025 0.0262  146 ASN A ND2 
1196 N N   . VAL A 147 ? 0.1391 0.1523 0.0873 -0.0195 -0.0006 0.0247  147 VAL A N   
1197 C CA  . VAL A 147 ? 0.1277 0.1469 0.0832 -0.0177 0.0051  0.0210  147 VAL A CA  
1198 C C   . VAL A 147 ? 0.1499 0.1752 0.1197 -0.0200 -0.0004 0.0197  147 VAL A C   
1199 O O   . VAL A 147 ? 0.1478 0.1795 0.1320 -0.0226 -0.0031 0.0216  147 VAL A O   
1200 C CB  . VAL A 147 ? 0.0986 0.1270 0.0675 -0.0150 0.0141  0.0216  147 VAL A CB  
1201 C CG1 . VAL A 147 ? 0.1251 0.1566 0.1030 -0.0133 0.0160  0.0170  147 VAL A CG1 
1202 C CG2 . VAL A 147 ? 0.1435 0.1639 0.1022 -0.0118 0.0219  0.0232  147 VAL A CG2 
1203 N N   . PHE A 148 ? 0.1212 0.1439 0.0884 -0.0192 -0.0011 0.0165  148 PHE A N   
1204 C CA  . PHE A 148 ? 0.1055 0.1302 0.0845 -0.0204 -0.0053 0.0158  148 PHE A CA  
1205 C C   . PHE A 148 ? 0.1035 0.1344 0.0893 -0.0190 -0.0003 0.0140  148 PHE A C   
1206 O O   . PHE A 148 ? 0.1266 0.1582 0.1076 -0.0175 0.0041  0.0121  148 PHE A O   
1207 C CB  . PHE A 148 ? 0.1321 0.1468 0.1053 -0.0199 -0.0134 0.0144  148 PHE A CB  
1208 C CG  . PHE A 148 ? 0.1423 0.1471 0.1088 -0.0212 -0.0217 0.0162  148 PHE A CG  
1209 C CD1 . PHE A 148 ? 0.1601 0.1560 0.1048 -0.0200 -0.0220 0.0164  148 PHE A CD1 
1210 C CD2 . PHE A 148 ? 0.1665 0.1687 0.1488 -0.0241 -0.0286 0.0179  148 PHE A CD2 
1211 C CE1 . PHE A 148 ? 0.1747 0.1589 0.1099 -0.0211 -0.0307 0.0186  148 PHE A CE1 
1212 C CE2 . PHE A 148 ? 0.1872 0.1784 0.1648 -0.0261 -0.0383 0.0196  148 PHE A CE2 
1213 C CZ  . PHE A 148 ? 0.1982 0.1803 0.1505 -0.0245 -0.0401 0.0200  148 PHE A CZ  
1214 N N   . LEU A 149 ? 0.0977 0.1306 0.0950 -0.0198 -0.0009 0.0147  149 LEU A N   
1215 C CA  . LEU A 149 ? 0.1299 0.1657 0.1305 -0.0182 0.0033  0.0137  149 LEU A CA  
1216 C C   . LEU A 149 ? 0.0931 0.1255 0.0998 -0.0175 0.0013  0.0137  149 LEU A C   
1217 O O   . LEU A 149 ? 0.1266 0.1548 0.1425 -0.0183 -0.0020 0.0151  149 LEU A O   
1218 C CB  . LEU A 149 ? 0.1405 0.1786 0.1472 -0.0177 0.0055  0.0142  149 LEU A CB  
1219 C CG  . LEU A 149 ? 0.1517 0.1934 0.1581 -0.0164 0.0051  0.0136  149 LEU A CG  
1220 C CD1 . LEU A 149 ? 0.1832 0.2253 0.1948 -0.0150 0.0057  0.0133  149 LEU A CD1 
1221 C CD2 . LEU A 149 ? 0.1820 0.2239 0.1839 -0.0138 0.0066  0.0113  149 LEU A CD2 
1222 N N   . ASP A 150 ? 0.1069 0.1408 0.1120 -0.0158 0.0028  0.0123  150 ASP A N   
1223 C CA  . ASP A 150 ? 0.1184 0.1512 0.1336 -0.0140 0.0023  0.0130  150 ASP A CA  
1224 C C   . ASP A 150 ? 0.1167 0.1483 0.1353 -0.0131 0.0087  0.0153  150 ASP A C   
1225 O O   . ASP A 150 ? 0.1519 0.1827 0.1662 -0.0140 0.0117  0.0158  150 ASP A O   
1226 C CB  . ASP A 150 ? 0.1011 0.1373 0.1162 -0.0130 0.0001  0.0105  150 ASP A CB  
1227 C CG  . ASP A 150 ? 0.1280 0.1674 0.1387 -0.0136 0.0036  0.0095  150 ASP A CG  
1228 O OD1 . ASP A 150 ? 0.1296 0.1671 0.1349 -0.0137 0.0069  0.0104  150 ASP A OD1 
1229 O OD2 . ASP A 150 ? 0.1566 0.1996 0.1707 -0.0140 0.0019  0.0073  150 ASP A OD2 
1230 N N   . GLY A 151 ? 0.1391 0.1698 0.1653 -0.0107 0.0110  0.0166  151 GLY A N   
1231 C CA  . GLY A 151 ? 0.1634 0.1892 0.1892 -0.0092 0.0186  0.0194  151 GLY A CA  
1232 C C   . GLY A 151 ? 0.1515 0.1771 0.1641 -0.0082 0.0202  0.0189  151 GLY A C   
1233 O O   . GLY A 151 ? 0.1779 0.1967 0.1855 -0.0059 0.0259  0.0212  151 GLY A O   
1234 N N   . LYS A 152 ? 0.1258 0.1562 0.1325 -0.0099 0.0152  0.0158  152 LYS A N   
1235 C CA  A LYS A 152 ? 0.1187 0.1473 0.1172 -0.0097 0.0141  0.0147  152 LYS A CA  
1236 C CA  B LYS A 152 ? 0.1181 0.1466 0.1165 -0.0097 0.0141  0.0148  152 LYS A CA  
1237 C C   . LYS A 152 ? 0.1197 0.1467 0.1101 -0.0108 0.0109  0.0115  152 LYS A C   
1238 O O   . LYS A 152 ? 0.1417 0.1671 0.1310 -0.0118 0.0073  0.0091  152 LYS A O   
1239 C CB  A LYS A 152 ? 0.1477 0.1826 0.1556 -0.0108 0.0107  0.0136  152 LYS A CB  
1240 C CB  B LYS A 152 ? 0.1635 0.1980 0.1713 -0.0107 0.0109  0.0138  152 LYS A CB  
1241 C CG  A LYS A 152 ? 0.1921 0.2301 0.2140 -0.0084 0.0130  0.0166  152 LYS A CG  
1242 C CG  B LYS A 152 ? 0.1569 0.1931 0.1766 -0.0079 0.0141  0.0174  152 LYS A CG  
1243 C CD  A LYS A 152 ? 0.2604 0.3056 0.2926 -0.0090 0.0078  0.0145  152 LYS A CD  
1244 C CD  B LYS A 152 ? 0.2384 0.2828 0.2705 -0.0085 0.0094  0.0158  152 LYS A CD  
1245 C CE  A LYS A 152 ? 0.2742 0.3207 0.3220 -0.0050 0.0071  0.0161  152 LYS A CE  
1246 C CE  B LYS A 152 ? 0.2616 0.3088 0.2958 -0.0096 0.0040  0.0115  152 LYS A CE  
1247 N NZ  A LYS A 152 ? 0.2319 0.2806 0.2831 -0.0058 0.0014  0.0122  152 LYS A NZ  
1248 N NZ  B LYS A 152 ? 0.4205 0.4674 0.4631 -0.0072 0.0039  0.0126  152 LYS A NZ  
1249 N N   . GLN A 153 ? 0.1458 0.1728 0.1348 -0.0105 0.0118  0.0113  153 GLN A N   
1250 C CA  . GLN A 153 ? 0.1404 0.1672 0.1270 -0.0103 0.0098  0.0088  153 GLN A CA  
1251 C C   . GLN A 153 ? 0.1522 0.1824 0.1438 -0.0122 0.0080  0.0064  153 GLN A C   
1252 O O   . GLN A 153 ? 0.1966 0.2243 0.1901 -0.0114 0.0068  0.0040  153 GLN A O   
1253 C CB  . GLN A 153 ? 0.1397 0.1582 0.1188 -0.0077 0.0073  0.0072  153 GLN A CB  
1254 C CG  . GLN A 153 ? 0.1664 0.1785 0.1354 -0.0051 0.0105  0.0093  153 GLN A CG  
1255 C CD  . GLN A 153 ? 0.1703 0.1708 0.1276 -0.0014 0.0060  0.0071  153 GLN A CD  
1256 O OE1 . GLN A 153 ? 0.2126 0.2062 0.1661 -0.0014 0.0010  0.0061  153 GLN A OE1 
1257 N NE2 . GLN A 153 ? 0.2122 0.2097 0.1645 0.0016  0.0065  0.0061  153 GLN A NE2 
1258 N N   . ASN A 154 ? 0.1256 0.1594 0.1200 -0.0141 0.0079  0.0067  154 ASN A N   
1259 C CA  . ASN A 154 ? 0.1110 0.1456 0.1062 -0.0158 0.0079  0.0045  154 ASN A CA  
1260 C C   . ASN A 154 ? 0.1151 0.1500 0.1071 -0.0155 0.0085  0.0056  154 ASN A C   
1261 O O   . ASN A 154 ? 0.1478 0.1841 0.1401 -0.0155 0.0076  0.0080  154 ASN A O   
1262 C CB  . ASN A 154 ? 0.1271 0.1642 0.1258 -0.0175 0.0063  0.0031  154 ASN A CB  
1263 C CG  . ASN A 154 ? 0.1197 0.1573 0.1239 -0.0182 0.0048  0.0025  154 ASN A CG  
1264 O OD1 . ASN A 154 ? 0.1155 0.1485 0.1201 -0.0188 0.0041  0.0010  154 ASN A OD1 
1265 N ND2 . ASN A 154 ? 0.1442 0.1859 0.1540 -0.0176 0.0034  0.0038  154 ASN A ND2 
1266 N N   . VAL A 155 ? 0.0821 0.1144 0.0725 -0.0155 0.0109  0.0041  155 VAL A N   
1267 C CA  . VAL A 155 ? 0.1084 0.1398 0.0949 -0.0149 0.0122  0.0057  155 VAL A CA  
1268 C C   . VAL A 155 ? 0.1227 0.1491 0.0988 -0.0161 0.0142  0.0048  155 VAL A C   
1269 O O   . VAL A 155 ? 0.1554 0.1782 0.1319 -0.0169 0.0175  0.0019  155 VAL A O   
1270 C CB  . VAL A 155 ? 0.1140 0.1442 0.1070 -0.0122 0.0151  0.0053  155 VAL A CB  
1271 C CG1 . VAL A 155 ? 0.1640 0.1947 0.1547 -0.0113 0.0169  0.0080  155 VAL A CG1 
1272 C CG2 . VAL A 155 ? 0.1169 0.1499 0.1171 -0.0101 0.0125  0.0052  155 VAL A CG2 
1273 N N   . LYS A 156 ? 0.1272 0.1512 0.0946 -0.0163 0.0110  0.0067  156 LYS A N   
1274 C CA  . LYS A 156 ? 0.1360 0.1517 0.0892 -0.0163 0.0106  0.0051  156 LYS A CA  
1275 C C   . LYS A 156 ? 0.1686 0.1769 0.1083 -0.0154 0.0113  0.0079  156 LYS A C   
1276 O O   . LYS A 156 ? 0.1742 0.1844 0.1163 -0.0159 0.0065  0.0110  156 LYS A O   
1277 C CB  . LYS A 156 ? 0.1737 0.1896 0.1276 -0.0163 0.0024  0.0038  156 LYS A CB  
1278 C CG  . LYS A 156 ? 0.2452 0.2675 0.2104 -0.0170 0.0028  0.0009  156 LYS A CG  
1279 C CD  . LYS A 156 ? 0.2653 0.2934 0.2437 -0.0162 -0.0022 0.0024  156 LYS A CD  
1280 C CE  . LYS A 156 ? 0.1746 0.2097 0.1647 -0.0168 -0.0008 0.0009  156 LYS A CE  
1281 N NZ  . LYS A 156 ? 0.2011 0.2380 0.1941 -0.0169 -0.0037 -0.0028 156 LYS A NZ  
1282 N N   . LEU A 157 ? 0.1020 0.1624 0.0956 -0.0213 0.0129  -0.0290 157 LEU A N   
1283 C CA  . LEU A 157 ? 0.1395 0.1928 0.1219 -0.0280 0.0065  -0.0257 157 LEU A CA  
1284 C C   . LEU A 157 ? 0.1681 0.2217 0.1522 -0.0350 -0.0038 -0.0184 157 LEU A C   
1285 O O   . LEU A 157 ? 0.1768 0.2295 0.1581 -0.0401 -0.0056 -0.0205 157 LEU A O   
1286 C CB  . LEU A 157 ? 0.1565 0.1985 0.1184 -0.0343 0.0100  -0.0346 157 LEU A CB  
1287 C CG  . LEU A 157 ? 0.1966 0.2298 0.1440 -0.0418 0.0043  -0.0322 157 LEU A CG  
1288 C CD1 . LEU A 157 ? 0.1961 0.2316 0.1498 -0.0361 0.0037  -0.0272 157 LEU A CD1 
1289 C CD2 . LEU A 157 ? 0.2600 0.2822 0.1876 -0.0479 0.0091  -0.0416 157 LEU A CD2 
1290 N N   . GLY A 158 ? 0.1391 0.1942 0.1288 -0.0351 -0.0108 -0.0097 158 GLY A N   
1291 C CA  . GLY A 158 ? 0.1823 0.2378 0.1760 -0.0409 -0.0213 -0.0019 158 GLY A CA  
1292 C C   . GLY A 158 ? 0.2805 0.3244 0.2539 -0.0521 -0.0275 -0.0035 158 GLY A C   
1293 O O   . GLY A 158 ? 0.3340 0.3696 0.2906 -0.0552 -0.0240 -0.0094 158 GLY A O   
1294 N N   . ASP A 159 ? 0.3427 0.3857 0.3177 -0.0581 -0.0369 0.0017  159 ASP A N   
1295 C CA  . ASP A 159 ? 0.3697 0.4013 0.3252 -0.0689 -0.0441 0.0010  159 ASP A CA  
1296 C C   . ASP A 159 ? 0.3952 0.4205 0.3418 -0.0713 -0.0481 0.0048  159 ASP A C   
1297 O O   . ASP A 159 ? 0.3739 0.4049 0.3341 -0.0659 -0.0500 0.0115  159 ASP A O   
1298 C CB  . ASP A 159 ? 0.3806 0.4130 0.3425 -0.0737 -0.0546 0.0072  159 ASP A CB  
1299 C CG  . ASP A 159 ? 0.4024 0.4416 0.3839 -0.0699 -0.0617 0.0183  159 ASP A CG  
1300 O OD1 . ASP A 159 ? 0.3905 0.4405 0.3916 -0.0610 -0.0568 0.0207  159 ASP A OD1 
1301 O OD2 . ASP A 159 ? 0.3867 0.4201 0.3640 -0.0759 -0.0723 0.0245  159 ASP A OD2 
1302 N N   . PHE A 160 ? 0.3708 0.3843 0.2946 -0.0794 -0.0494 0.0006  160 PHE A N   
1303 C CA  . PHE A 160 ? 0.4521 0.4586 0.3654 -0.0828 -0.0538 0.0044  160 PHE A CA  
1304 C C   . PHE A 160 ? 0.4335 0.4399 0.3539 -0.0861 -0.0668 0.0151  160 PHE A C   
1305 O O   . PHE A 160 ? 0.4392 0.4463 0.3645 -0.0845 -0.0705 0.0212  160 PHE A O   
1306 C CB  . PHE A 160 ? 0.4964 0.4897 0.3830 -0.0913 -0.0523 -0.0023 160 PHE A CB  
1307 C CG  . PHE A 160 ? 0.5473 0.5331 0.4219 -0.0945 -0.0551 0.0007  160 PHE A CG  
1308 C CD1 . PHE A 160 ? 0.6104 0.5871 0.4721 -0.1031 -0.0658 0.0059  160 PHE A CD1 
1309 C CD2 . PHE A 160 ? 0.5322 0.5198 0.4088 -0.0887 -0.0474 -0.0016 160 PHE A CD2 
1310 C CE1 . PHE A 160 ? 0.5882 0.5579 0.4388 -0.1061 -0.0685 0.0090  160 PHE A CE1 
1311 C CE2 . PHE A 160 ? 0.5851 0.5662 0.4517 -0.0916 -0.0500 0.0014  160 PHE A CE2 
1312 C CZ  . PHE A 160 ? 0.6077 0.5799 0.4612 -0.1004 -0.0605 0.0069  160 PHE A CZ  
1313 N N   . GLY A 161 ? 0.3300 0.3354 0.2516 -0.0908 -0.0740 0.0172  161 GLY A N   
1314 C CA  . GLY A 161 ? 0.3552 0.3585 0.2818 -0.0951 -0.0873 0.0268  161 GLY A CA  
1315 C C   . GLY A 161 ? 0.4640 0.4537 0.3672 -0.1061 -0.0950 0.0253  161 GLY A C   
1316 O O   . GLY A 161 ? 0.4466 0.4264 0.3298 -0.1110 -0.0948 0.0231  161 GLY A O   
1317 N N   . LEU A 162 ? 0.5135 0.5024 0.4191 -0.1099 -0.1017 0.0264  162 LEU A N   
1318 C CA  . LEU A 162 ? 0.5707 0.5466 0.4540 -0.1201 -0.1093 0.0245  162 LEU A CA  
1319 C C   . LEU A 162 ? 0.5112 0.4772 0.3828 -0.1260 -0.1194 0.0310  162 LEU A C   
1320 O O   . LEU A 162 ? 0.5452 0.4992 0.3918 -0.1328 -0.1197 0.0272  162 LEU A O   
1321 C CB  . LEU A 162 ? 0.5866 0.5644 0.4791 -0.1222 -0.1169 0.0264  162 LEU A CB  
1322 C CG  . LEU A 162 ? 0.6718 0.6566 0.5706 -0.1189 -0.1083 0.0189  162 LEU A CG  
1323 C CD1 . LEU A 162 ? 0.6746 0.6618 0.5851 -0.1209 -0.1174 0.0226  162 LEU A CD1 
1324 C CD2 . LEU A 162 ? 0.7095 0.6857 0.5836 -0.1237 -0.1006 0.0079  162 LEU A CD2 
1325 N N   . ALA A 163 ? 0.5840 0.5548 0.4739 -0.1235 -0.1276 0.0409  163 ALA A N   
1326 C CA  . ALA A 163 ? 0.6960 0.6581 0.5777 -0.1288 -0.1383 0.0480  163 ALA A CA  
1327 C C   . ALA A 163 ? 0.7562 0.7151 0.6258 -0.1280 -0.1314 0.0457  163 ALA A C   
1328 O O   . ALA A 163 ? 0.7397 0.6877 0.5919 -0.1345 -0.1376 0.0482  163 ALA A O   
1329 C CB  . ALA A 163 ? 0.6127 0.5822 0.5202 -0.1252 -0.1473 0.0587  163 ALA A CB  
1330 N N   . ARG A 164 ? 0.7020 0.6703 0.5812 -0.1200 -0.1188 0.0411  164 ARG A N   
1331 C CA  . ARG A 164 ? 0.7883 0.7552 0.6598 -0.1179 -0.1116 0.0388  164 ARG A CA  
1332 C C   . ARG A 164 ? 0.8961 0.8509 0.7384 -0.1244 -0.1064 0.0306  164 ARG A C   
1333 O O   . ARG A 164 ? 0.9066 0.8536 0.7343 -0.1279 -0.1070 0.0314  164 ARG A O   
1334 C CB  . ARG A 164 ? 0.7236 0.7037 0.6143 -0.1070 -0.1000 0.0359  164 ARG A CB  
1335 C CG  . ARG A 164 ? 0.8147 0.7962 0.7062 -0.1028 -0.0950 0.0365  164 ARG A CG  
1336 C CD  . ARG A 164 ? 0.8069 0.8020 0.7263 -0.0929 -0.0935 0.0415  164 ARG A CD  
1337 N NE  . ARG A 164 ? 0.8100 0.8145 0.7459 -0.0878 -0.0905 0.0405  164 ARG A NE  
1338 C CZ  . ARG A 164 ? 0.7275 0.7428 0.6883 -0.0814 -0.0927 0.0469  164 ARG A CZ  
1339 N NH1 . ARG A 164 ? 0.6022 0.6204 0.5749 -0.0793 -0.0983 0.0546  164 ARG A NH1 
1340 N NH2 . ARG A 164 ? 0.7433 0.7664 0.7173 -0.0772 -0.0894 0.0456  164 ARG A NH2 
1341 N N   . ILE A 165 ? 0.9050 0.8584 0.7395 -0.1261 -0.1012 0.0228  165 ILE A N   
1342 C CA  . ILE A 165 ? 0.8523 0.7934 0.6590 -0.1331 -0.0970 0.0149  165 ILE A CA  
1343 C C   . ILE A 165 ? 0.9049 0.8326 0.6923 -0.1430 -0.1091 0.0196  165 ILE A C   
1344 O O   . ILE A 165 ? 0.9394 0.8552 0.7018 -0.1493 -0.1073 0.0156  165 ILE A O   
1345 C CB  . ILE A 165 ? 0.8095 0.7518 0.6138 -0.1337 -0.0915 0.0065  165 ILE A CB  
1346 C CG1 . ILE A 165 ? 0.8276 0.7817 0.6484 -0.1244 -0.0790 0.0010  165 ILE A CG1 
1347 C CG2 . ILE A 165 ? 0.7569 0.6855 0.5319 -0.1420 -0.0885 -0.0012 165 ILE A CG2 
1348 C CD1 . ILE A 165 ? 0.8096 0.7663 0.6316 -0.1244 -0.0741 -0.0065 165 ILE A CD1 
1349 N N   . LEU A 166 ? 0.8788 0.8082 0.6781 -0.1440 -0.1216 0.0282  166 LEU A N   
1350 C CA  . LEU A 166 ? 0.9036 0.8204 0.6869 -0.1531 -0.1350 0.0332  166 LEU A CA  
1351 C C   . LEU A 166 ? 0.9107 0.8226 0.6896 -0.1550 -0.1407 0.0404  166 LEU A C   
1352 O O   . LEU A 166 ? 0.9559 0.8553 0.7100 -0.1617 -0.1417 0.0391  166 LEU A O   
1353 C CB  . LEU A 166 ? 0.9131 0.8342 0.7138 -0.1530 -0.1463 0.0393  166 LEU A CB  
1354 C CG  . LEU A 166 ? 0.9205 0.8303 0.7056 -0.1615 -0.1569 0.0390  166 LEU A CG  
1355 C CD1 . LEU A 166 ? 0.9409 0.8411 0.7205 -0.1675 -0.1725 0.0484  166 LEU A CD1 
1356 C CD2 . LEU A 166 ? 0.9263 0.8256 0.6825 -0.1672 -0.1499 0.0289  166 LEU A CD2 
1357 N N   . THR A 170 ? 0.9732 0.9243 0.8890 -0.1346 -0.1884 0.1010  170 THR A N   
1358 C CA  . THR A 170 ? 0.9079 0.8744 0.8453 -0.1237 -0.1762 0.0982  170 THR A CA  
1359 C C   . THR A 170 ? 0.8876 0.8546 0.8101 -0.1207 -0.1620 0.0891  170 THR A C   
1360 O O   . THR A 170 ? 0.8800 0.8560 0.8148 -0.1132 -0.1542 0.0882  170 THR A O   
1361 C CB  . THR A 170 ? 0.8276 0.8027 0.7815 -0.1191 -0.1734 0.0968  170 THR A CB  
1362 O OG1 . THR A 170 ? 0.8245 0.8001 0.7957 -0.1210 -0.1864 0.1057  170 THR A OG1 
1363 C CG2 . THR A 170 ? 0.7672 0.7575 0.7415 -0.1077 -0.1606 0.0938  170 THR A CG2 
1364 N N   . SER A 171 ? 0.8585 0.8156 0.7551 -0.1265 -0.1588 0.0822  171 SER A N   
1365 C CA  . SER A 171 ? 0.8784 0.8343 0.7598 -0.1246 -0.1455 0.0733  171 SER A CA  
1366 C C   . SER A 171 ? 0.8551 0.8068 0.7283 -0.1259 -0.1457 0.0754  171 SER A C   
1367 O O   . SER A 171 ? 0.8290 0.7840 0.7003 -0.1211 -0.1346 0.0700  171 SER A O   
1368 C CB  . SER A 171 ? 0.9265 0.8721 0.7822 -0.1311 -0.1425 0.0655  171 SER A CB  
1369 O OG  . SER A 171 ? 0.9998 0.9335 0.8412 -0.1406 -0.1554 0.0698  171 SER A OG  
1370 N N   . PHE A 172 ? 0.8238 0.7680 0.6930 -0.1323 -0.1585 0.0834  172 PHE A N   
1371 C CA  . PHE A 172 ? 0.7649 0.7060 0.6295 -0.1335 -0.1602 0.0869  172 PHE A CA  
1372 C C   . PHE A 172 ? 0.7735 0.7283 0.6671 -0.1246 -0.1590 0.0914  172 PHE A C   
1373 O O   . PHE A 172 ? 0.8464 0.8039 0.7413 -0.1210 -0.1534 0.0904  172 PHE A O   
1374 C CB  . PHE A 172 ? 0.8424 0.7704 0.6929 -0.1436 -0.1751 0.0943  172 PHE A CB  
1375 C CG  . PHE A 172 ? 0.8665 0.7942 0.7219 -0.1440 -0.1802 0.1009  172 PHE A CG  
1376 C CD1 . PHE A 172 ? 0.9002 0.8260 0.7441 -0.1432 -0.1720 0.0973  172 PHE A CD1 
1377 C CD2 . PHE A 172 ? 0.9311 0.8605 0.8037 -0.1452 -0.1933 0.1107  172 PHE A CD2 
1378 C CE1 . PHE A 172 ? 0.8871 0.8131 0.7364 -0.1435 -0.1768 0.1035  172 PHE A CE1 
1379 C CE2 . PHE A 172 ? 0.9404 0.8699 0.8183 -0.1457 -0.1983 0.1167  172 PHE A CE2 
1380 C CZ  . PHE A 172 ? 0.9253 0.8533 0.7916 -0.1448 -0.1901 0.1131  172 PHE A CZ  
1381 N N   . ALA A 173 ? 0.7680 0.7313 0.6852 -0.1208 -0.1640 0.0963  173 ALA A N   
1382 C CA  . ALA A 173 ? 0.7900 0.7664 0.7362 -0.1123 -0.1634 0.1009  173 ALA A CA  
1383 C C   . ALA A 173 ? 0.8177 0.8043 0.7715 -0.1024 -0.1485 0.0940  173 ALA A C   
1384 O O   . ALA A 173 ? 0.7451 0.7356 0.7059 -0.0985 -0.1463 0.0953  173 ALA A O   
1385 C CB  . ALA A 173 ? 0.7990 0.7827 0.7683 -0.1097 -0.1693 0.1061  173 ALA A CB  
1386 N N   . LYS A 174 ? 0.8561 0.8467 0.8089 -0.0983 -0.1386 0.0867  174 LYS A N   
1387 C CA  . LYS A 174 ? 0.8251 0.8249 0.7858 -0.0885 -0.1249 0.0800  174 LYS A CA  
1388 C C   . LYS A 174 ? 0.7513 0.7443 0.6898 -0.0900 -0.1155 0.0716  174 LYS A C   
1389 O O   . LYS A 174 ? 0.6640 0.6630 0.6083 -0.0823 -0.1055 0.0668  174 LYS A O   
1390 C CB  . LYS A 174 ? 0.7837 0.7937 0.7605 -0.0814 -0.1184 0.0771  174 LYS A CB  
1391 C CG  . LYS A 174 ? 0.7857 0.8091 0.7913 -0.0716 -0.1171 0.0816  174 LYS A CG  
1392 C CD  . LYS A 174 ? 0.7258 0.7518 0.7333 -0.0667 -0.1123 0.0803  174 LYS A CD  
1393 C CE  . LYS A 174 ? 0.7499 0.7850 0.7825 -0.0613 -0.1173 0.0880  174 LYS A CE  
1394 N NZ  . LYS A 174 ? 0.7288 0.7770 0.7826 -0.0495 -0.1083 0.0858  174 LYS A NZ  
1395 N N   . THR A 175 ? 0.7816 0.7616 0.6948 -0.0995 -0.1186 0.0696  175 THR A N   
1396 C CA  . THR A 175 ? 0.8176 0.7898 0.7095 -0.1020 -0.1110 0.0631  175 THR A CA  
1397 C C   . THR A 175 ? 0.8230 0.7951 0.7183 -0.1013 -0.1140 0.0680  175 THR A C   
1398 O O   . THR A 175 ? 0.8474 0.8188 0.7371 -0.0985 -0.1058 0.0634  175 THR A O   
1399 C CB  . THR A 175 ? 0.8582 0.8157 0.7216 -0.1130 -0.1146 0.0609  175 THR A CB  
1400 O OG1 . THR A 175 ? 0.8497 0.8075 0.7089 -0.1129 -0.1093 0.0543  175 THR A OG1 
1401 C CG2 . THR A 175 ? 0.8695 0.8178 0.7116 -0.1164 -0.1087 0.0566  175 THR A CG2 
1402 N N   . PHE A 176 ? 0.7700 0.7428 0.6758 -0.1038 -0.1262 0.0774  176 PHE A N   
1403 C CA  . PHE A 176 ? 0.7362 0.7097 0.6481 -0.1033 -0.1307 0.0831  176 PHE A CA  
1404 C C   . PHE A 176 ? 0.7238 0.7120 0.6637 -0.0920 -0.1262 0.0840  176 PHE A C   
1405 O O   . PHE A 176 ? 0.8201 0.8120 0.7618 -0.0859 -0.1171 0.0792  176 PHE A O   
1406 C CB  . PHE A 176 ? 0.6110 0.5780 0.5216 -0.1115 -0.1464 0.0929  176 PHE A CB  
1407 C CG  . PHE A 176 ? 0.6523 0.6149 0.5587 -0.1147 -0.1516 0.0978  176 PHE A CG  
1408 C CD1 . PHE A 176 ? 0.6496 0.6030 0.5331 -0.1187 -0.1464 0.0937  176 PHE A CD1 
1409 C CD2 . PHE A 176 ? 0.7202 0.6877 0.6460 -0.1139 -0.1617 0.1067  176 PHE A CD2 
1410 C CE1 . PHE A 176 ? 0.7091 0.6585 0.5889 -0.1217 -0.1511 0.0985  176 PHE A CE1 
1411 C CE2 . PHE A 176 ? 0.7677 0.7313 0.6901 -0.1170 -0.1668 0.1114  176 PHE A CE2 
1412 C CZ  . PHE A 176 ? 0.7769 0.7315 0.6761 -0.1209 -0.1616 0.1074  176 PHE A CZ  
1413 N N   . VAL A 177 ? 0.6162 0.6125 0.5781 -0.0889 -0.1324 0.0899  177 VAL A N   
1414 C CA  . VAL A 177 ? 0.5103 0.5201 0.4994 -0.0787 -0.1298 0.0921  177 VAL A CA  
1415 C C   . VAL A 177 ? 0.4699 0.4876 0.4642 -0.0685 -0.1153 0.0836  177 VAL A C   
1416 O O   . VAL A 177 ? 0.3670 0.3907 0.3719 -0.0618 -0.1113 0.0829  177 VAL A O   
1417 C CB  . VAL A 177 ? 0.4687 0.4860 0.4802 -0.0766 -0.1368 0.0987  177 VAL A CB  
1418 C CG1 . VAL A 177 ? 0.5003 0.5308 0.5393 -0.0665 -0.1344 0.1013  177 VAL A CG1 
1419 C CG2 . VAL A 177 ? 0.4543 0.4632 0.4617 -0.0866 -0.1519 0.1072  177 VAL A CG2 
1420 N N   . GLY A 178 ? 0.5089 0.5262 0.4959 -0.0675 -0.1079 0.0769  178 GLY A N   
1421 C CA  . GLY A 178 ? 0.4996 0.5242 0.4924 -0.0579 -0.0948 0.0689  178 GLY A CA  
1422 C C   . GLY A 178 ? 0.4545 0.4759 0.4371 -0.0555 -0.0869 0.0629  178 GLY A C   
1423 O O   . GLY A 178 ? 0.4979 0.5089 0.4611 -0.0629 -0.0889 0.0623  178 GLY A O   
1424 N N   . THR A 179 ? 0.3724 0.4025 0.3683 -0.0448 -0.0780 0.0585  179 THR A N   
1425 C CA  . THR A 179 ? 0.3766 0.4044 0.3653 -0.0411 -0.0697 0.0520  179 THR A CA  
1426 C C   . THR A 179 ? 0.3503 0.3754 0.3276 -0.0394 -0.0588 0.0421  179 THR A C   
1427 O O   . THR A 179 ? 0.3060 0.3380 0.2934 -0.0332 -0.0539 0.0392  179 THR A O   
1428 C CB  . THR A 179 ? 0.3785 0.4169 0.3888 -0.0299 -0.0668 0.0526  179 THR A CB  
1429 O OG1 . THR A 179 ? 0.3912 0.4327 0.4137 -0.0315 -0.0771 0.0618  179 THR A OG1 
1430 C CG2 . THR A 179 ? 0.3270 0.3625 0.3305 -0.0261 -0.0589 0.0461  179 THR A CG2 
1431 N N   . PRO A 180 ? 0.3703 0.3850 0.3266 -0.0450 -0.0550 0.0369  180 PRO A N   
1432 C CA  . PRO A 180 ? 0.3111 0.3212 0.2541 -0.0456 -0.0455 0.0275  180 PRO A CA  
1433 C C   . PRO A 180 ? 0.2680 0.2828 0.2190 -0.0352 -0.0347 0.0200  180 PRO A C   
1434 O O   . PRO A 180 ? 0.3192 0.3272 0.2583 -0.0360 -0.0283 0.0140  180 PRO A O   
1435 C CB  . PRO A 180 ? 0.4062 0.4029 0.3247 -0.0556 -0.0463 0.0259  180 PRO A CB  
1436 C CG  . PRO A 180 ? 0.4170 0.4119 0.3365 -0.0597 -0.0560 0.0347  180 PRO A CG  
1437 C CD  . PRO A 180 ? 0.3781 0.3850 0.3229 -0.0509 -0.0589 0.0397  180 PRO A CD  
1438 N N   . TYR A 181 ? 0.2368 0.2624 0.2075 -0.0257 -0.0325 0.0203  181 TYR A N   
1439 C CA  . TYR A 181 ? 0.2097 0.2401 0.1896 -0.0149 -0.0233 0.0138  181 TYR A CA  
1440 C C   . TYR A 181 ? 0.2491 0.2733 0.2161 -0.0147 -0.0133 0.0035  181 TYR A C   
1441 O O   . TYR A 181 ? 0.2366 0.2601 0.2054 -0.0086 -0.0066 -0.0021 181 TYR A O   
1442 C CB  . TYR A 181 ? 0.2177 0.2601 0.2187 -0.0053 -0.0225 0.0158  181 TYR A CB  
1443 C CG  . TYR A 181 ? 0.2291 0.2788 0.2470 -0.0026 -0.0304 0.0247  181 TYR A CG  
1444 C CD1 . TYR A 181 ? 0.2677 0.3218 0.2941 -0.0056 -0.0379 0.0322  181 TYR A CD1 
1445 C CD2 . TYR A 181 ? 0.2089 0.2611 0.2353 0.0029  -0.0306 0.0257  181 TYR A CD2 
1446 C CE1 . TYR A 181 ? 0.2822 0.3428 0.3251 -0.0033 -0.0451 0.0404  181 TYR A CE1 
1447 C CE2 . TYR A 181 ? 0.2403 0.2994 0.2829 0.0052  -0.0379 0.0337  181 TYR A CE2 
1448 C CZ  . TYR A 181 ? 0.2486 0.3118 0.2995 0.0020  -0.0451 0.0409  181 TYR A CZ  
1449 O OH  . TYR A 181 ? 0.3127 0.3826 0.3809 0.0042  -0.0524 0.0488  181 TYR A OH  
1450 N N   . TYR A 182 ? 0.2386 0.2582 0.1936 -0.0214 -0.0126 0.0009  182 TYR A N   
1451 C CA  . TYR A 182 ? 0.2709 0.2860 0.2166 -0.0207 -0.0031 -0.0090 182 TYR A CA  
1452 C C   . TYR A 182 ? 0.3037 0.3063 0.2273 -0.0298 -0.0008 -0.0135 182 TYR A C   
1453 O O   . TYR A 182 ? 0.3132 0.3111 0.2279 -0.0308 0.0066  -0.0217 182 TYR A O   
1454 C CB  . TYR A 182 ? 0.2476 0.2666 0.1958 -0.0209 -0.0022 -0.0104 182 TYR A CB  
1455 C CG  . TYR A 182 ? 0.2413 0.2719 0.2099 -0.0104 -0.0005 -0.0090 182 TYR A CG  
1456 C CD1 . TYR A 182 ? 0.2230 0.2606 0.2072 -0.0022 -0.0018 -0.0051 182 TYR A CD1 
1457 C CD2 . TYR A 182 ? 0.2070 0.2415 0.1794 -0.0088 0.0023  -0.0114 182 TYR A CD2 
1458 C CE1 . TYR A 182 ? 0.1955 0.2433 0.1975 0.0074  0.0002  -0.0038 182 TYR A CE1 
1459 C CE2 . TYR A 182 ? 0.2234 0.2682 0.2136 0.0006  0.0042  -0.0098 182 TYR A CE2 
1460 C CZ  . TYR A 182 ? 0.1943 0.2455 0.1988 0.0088  0.0034  -0.0061 182 TYR A CZ  
1461 O OH  . TYR A 182 ? 0.1982 0.2593 0.2197 0.0183  0.0058  -0.0047 182 TYR A OH  
1462 N N   A MET A 183 ? 0.3111 0.3081 0.2259 -0.0366 -0.0070 -0.0081 183 MET A N   
1463 N N   B MET A 183 ? 0.3109 0.3080 0.2259 -0.0366 -0.0070 -0.0080 183 MET A N   
1464 C CA  A MET A 183 ? 0.3497 0.3344 0.2423 -0.0459 -0.0051 -0.0115 183 MET A CA  
1465 C CA  B MET A 183 ? 0.3558 0.3406 0.2488 -0.0458 -0.0052 -0.0112 183 MET A CA  
1466 C C   A MET A 183 ? 0.3178 0.2977 0.2070 -0.0423 0.0039  -0.0185 183 MET A C   
1467 C C   B MET A 183 ? 0.3221 0.3026 0.2123 -0.0417 0.0043  -0.0188 183 MET A C   
1468 O O   A MET A 183 ? 0.3138 0.2970 0.2133 -0.0363 0.0040  -0.0166 183 MET A O   
1469 O O   B MET A 183 ? 0.2726 0.2571 0.1746 -0.0345 0.0052  -0.0177 183 MET A O   
1470 C CB  A MET A 183 ? 0.3900 0.3694 0.2730 -0.0547 -0.0148 -0.0031 183 MET A CB  
1471 C CB  B MET A 183 ? 0.4194 0.3993 0.3041 -0.0536 -0.0147 -0.0028 183 MET A CB  
1472 C CG  A MET A 183 ? 0.4449 0.4113 0.3053 -0.0632 -0.0122 -0.0061 183 MET A CG  
1473 C CG  B MET A 183 ? 0.4317 0.4139 0.3254 -0.0492 -0.0163 0.0012  183 MET A CG  
1474 S SD  A MET A 183 ? 0.4892 0.4467 0.3305 -0.0766 -0.0232 0.0011  183 MET A SD  
1475 S SD  B MET A 183 ? 0.7289 0.7051 0.6130 -0.0589 -0.0280 0.0114  183 MET A SD  
1476 C CE  A MET A 183 ? 0.6215 0.5776 0.4553 -0.0804 -0.0214 -0.0042 183 MET A CE  
1477 C CE  B MET A 183 ? 0.4367 0.3979 0.2905 -0.0713 -0.0260 0.0073  183 MET A CE  
1478 N N   . SER A 184 ? 0.3187 0.2909 0.1942 -0.0460 0.0113  -0.0267 184 SER A N   
1479 C CA  . SER A 184 ? 0.3407 0.3077 0.2133 -0.0428 0.0207  -0.0344 184 SER A CA  
1480 C C   . SER A 184 ? 0.3230 0.2821 0.1852 -0.0477 0.0195  -0.0316 184 SER A C   
1481 O O   . SER A 184 ? 0.3395 0.2944 0.1907 -0.0560 0.0124  -0.0252 184 SER A O   
1482 C CB  . SER A 184 ? 0.3741 0.3345 0.2349 -0.0464 0.0285  -0.0438 184 SER A CB  
1483 O OG  . SER A 184 ? 0.3644 0.3161 0.2052 -0.0580 0.0257  -0.0427 184 SER A OG  
1484 N N   . PRO A 185 ? 0.4001 0.2816 0.1763 -0.0182 0.0160  0.0477  185 PRO A N   
1485 C CA  . PRO A 185 ? 0.3997 0.2670 0.1548 -0.0160 0.0266  0.0619  185 PRO A CA  
1486 C C   . PRO A 185 ? 0.4350 0.2910 0.1434 -0.0176 0.0329  0.0611  185 PRO A C   
1487 O O   . PRO A 185 ? 0.5064 0.3523 0.1819 -0.0141 0.0312  0.0747  185 PRO A O   
1488 C CB  . PRO A 185 ? 0.4581 0.3221 0.2438 -0.0169 0.0456  0.0604  185 PRO A CB  
1489 C CG  . PRO A 185 ? 0.4017 0.2796 0.2248 -0.0175 0.0387  0.0496  185 PRO A CG  
1490 C CD  . PRO A 185 ? 0.3852 0.2722 0.1981 -0.0201 0.0254  0.0401  185 PRO A CD  
1491 N N   . GLU A 186 ? 0.4625 0.3204 0.1680 -0.0227 0.0401  0.0453  186 GLU A N   
1492 C CA  . GLU A 186 ? 0.5300 0.3778 0.1930 -0.0249 0.0488  0.0413  186 GLU A CA  
1493 C C   . GLU A 186 ? 0.5610 0.4123 0.1897 -0.0218 0.0275  0.0385  186 GLU A C   
1494 O O   . GLU A 186 ? 0.5991 0.4391 0.1805 -0.0199 0.0296  0.0431  186 GLU A O   
1495 C CB  . GLU A 186 ? 0.5280 0.3772 0.2049 -0.0322 0.0637  0.0237  186 GLU A CB  
1496 C CG  . GLU A 186 ? 0.4549 0.3216 0.1586 -0.0354 0.0502  0.0072  186 GLU A CG  
1497 C CD  . GLU A 186 ? 0.4204 0.2961 0.1719 -0.0358 0.0487  0.0067  186 GLU A CD  
1498 O OE1 . GLU A 186 ? 0.4502 0.3201 0.2160 -0.0331 0.0554  0.0172  186 GLU A OE1 
1499 O OE2 . GLU A 186 ? 0.3621 0.2510 0.1376 -0.0383 0.0407  -0.0045 186 GLU A OE2 
1500 N N   . GLN A 187 ? 0.5053 0.3714 0.1578 -0.0206 0.0071  0.0310  187 GLN A N   
1501 C CA  . GLN A 187 ? 0.5785 0.4477 0.2075 -0.0165 -0.0159 0.0270  187 GLN A CA  
1502 C C   . GLN A 187 ? 0.5941 0.4539 0.2014 -0.0101 -0.0284 0.0462  187 GLN A C   
1503 O O   . GLN A 187 ? 0.6100 0.4645 0.1802 -0.0058 -0.0444 0.0473  187 GLN A O   
1504 C CB  . GLN A 187 ? 0.5372 0.4236 0.2055 -0.0165 -0.0324 0.0141  187 GLN A CB  
1505 C CG  . GLN A 187 ? 0.6020 0.4989 0.2923 -0.0225 -0.0230 -0.0042 187 GLN A CG  
1506 C CD  . GLN A 187 ? 0.7160 0.6106 0.3731 -0.0245 -0.0198 -0.0177 187 GLN A CD  
1507 O OE1 . GLN A 187 ? 0.7761 0.6674 0.3994 -0.0197 -0.0347 -0.0196 187 GLN A OE1 
1508 N NE2 . GLN A 187 ? 0.6593 0.5553 0.3272 -0.0317 -0.0011 -0.0283 187 GLN A NE2 
1509 N N   A MET A 188 ? 0.5980 0.4557 0.2293 -0.0093 -0.0221 0.0611  188 MET A N   
1510 N N   B MET A 188 ? 0.5924 0.4509 0.2258 -0.0094 -0.0226 0.0605  188 MET A N   
1511 C CA  A MET A 188 ? 0.6533 0.5025 0.2708 -0.0041 -0.0323 0.0811  188 MET A CA  
1512 C CA  B MET A 188 ? 0.6594 0.5087 0.2795 -0.0045 -0.0300 0.0813  188 MET A CA  
1513 C C   A MET A 188 ? 0.7490 0.5804 0.3152 -0.0020 -0.0200 0.0951  188 MET A C   
1514 C C   B MET A 188 ? 0.7529 0.5854 0.3160 -0.0024 -0.0212 0.0913  188 MET A C   
1515 O O   A MET A 188 ? 0.7788 0.6015 0.3151 0.0030  -0.0338 0.1096  188 MET A O   
1516 O O   B MET A 188 ? 0.7856 0.6110 0.3115 0.0024  -0.0386 0.0987  188 MET A O   
1517 C CB  A MET A 188 ? 0.6529 0.5072 0.3170 -0.0039 -0.0289 0.0914  188 MET A CB  
1518 C CB  B MET A 188 ? 0.6719 0.5219 0.3298 -0.0050 -0.0161 0.0929  188 MET A CB  
1519 C CG  A MET A 188 ? 0.6595 0.5265 0.3613 -0.0030 -0.0492 0.0859  188 MET A CG  
1520 C CG  B MET A 188 ? 0.6568 0.5199 0.3638 -0.0046 -0.0286 0.0913  188 MET A CG  
1521 S SD  A MET A 188 ? 0.6491 0.5191 0.3929 -0.0012 -0.0519 0.1017  188 MET A SD  
1522 S SD  B MET A 188 ? 0.7919 0.6550 0.5375 -0.0037 -0.0132 0.1052  188 MET A SD  
1523 C CE  A MET A 188 ? 0.4470 0.3268 0.2199 -0.0001 -0.0783 0.0935  188 MET A CE  
1524 C CE  B MET A 188 ? 0.7552 0.6002 0.4605 0.0001  -0.0061 0.1283  188 MET A CE  
1525 N N   . ASN A 189 ? 0.7967 0.6217 0.3536 -0.0059 0.0064  0.0914  189 ASN A N   
1526 C CA  . ASN A 189 ? 0.8580 0.6649 0.3640 -0.0042 0.0227  0.1030  189 ASN A CA  
1527 C C   . ASN A 189 ? 0.9273 0.7301 0.3783 -0.0034 0.0141  0.0916  189 ASN A C   
1528 O O   . ASN A 189 ? 1.0317 0.8207 0.4290 0.0014  0.0116  0.1044  189 ASN A O   
1529 C CB  . ASN A 189 ? 0.9055 0.7051 0.4273 -0.0087 0.0559  0.1020  189 ASN A CB  
1530 C CG  . ASN A 189 ? 0.9335 0.7367 0.5103 -0.0081 0.0638  0.1116  189 ASN A CG  
1531 O OD1 . ASN A 189 ? 0.9592 0.7647 0.5493 -0.0036 0.0515  0.1270  189 ASN A OD1 
1532 N ND2 . ASN A 189 ? 0.9480 0.7522 0.5601 -0.0124 0.0832  0.1011  189 ASN A ND2 
1533 N N   . ARG A 190 ? 0.9190 0.7343 0.3839 -0.0077 0.0093  0.0673  190 ARG A N   
1534 C CA  . ARG A 190 ? 0.9637 0.7788 0.3849 -0.0069 0.0000  0.0516  190 ARG A CA  
1535 C C   . ARG A 190 ? 0.9533 0.7871 0.4107 -0.0114 -0.0080 0.0253  190 ARG A C   
1536 O O   . ARG A 190 ? 0.9075 0.7474 0.4003 -0.0183 0.0100  0.0156  190 ARG A O   
1537 C CB  . ARG A 190 ? 1.0132 0.8121 0.3856 -0.0090 0.0270  0.0527  190 ARG A CB  
1538 N N   . MET A 191 ? 0.9468 0.7894 0.3987 -0.0069 -0.0358 0.0142  191 MET A N   
1539 C CA  . MET A 191 ? 0.9273 0.7883 0.4155 -0.0100 -0.0444 -0.0102 191 MET A CA  
1540 C C   . MET A 191 ? 0.9532 0.8150 0.4191 -0.0150 -0.0289 -0.0295 191 MET A C   
1541 O O   . MET A 191 ? 1.0280 0.8916 0.4618 -0.0115 -0.0425 -0.0437 191 MET A O   
1542 C CB  . MET A 191 ? 0.8737 0.7427 0.3671 -0.0027 -0.0785 -0.0174 191 MET A CB  
1543 N N   . TYR A 193 ? 0.8240 0.7353 0.4318 -0.0418 0.0041  -0.0983 193 TYR A N   
1544 C CA  . TYR A 193 ? 0.7725 0.7013 0.4468 -0.0472 0.0047  -0.1063 193 TYR A CA  
1545 C C   . TYR A 193 ? 0.6764 0.5972 0.3745 -0.0544 0.0272  -0.0962 193 TYR A C   
1546 O O   . TYR A 193 ? 0.6423 0.5503 0.3228 -0.0602 0.0490  -0.0978 193 TYR A O   
1547 C CB  . TYR A 193 ? 0.8072 0.7524 0.5038 -0.0521 0.0042  -0.1322 193 TYR A CB  
1548 C CG  . TYR A 193 ? 0.8096 0.7753 0.5779 -0.0563 0.0016  -0.1387 193 TYR A CG  
1549 C CD1 . TYR A 193 ? 0.8127 0.7826 0.6172 -0.0670 0.0205  -0.1449 193 TYR A CD1 
1550 C CD2 . TYR A 193 ? 0.8127 0.7927 0.6145 -0.0495 -0.0191 -0.1375 193 TYR A CD2 
1551 C CE1 . TYR A 193 ? 0.7863 0.7754 0.6555 -0.0702 0.0178  -0.1474 193 TYR A CE1 
1552 C CE2 . TYR A 193 ? 0.8000 0.7984 0.6659 -0.0523 -0.0192 -0.1403 193 TYR A CE2 
1553 C CZ  . TYR A 193 ? 0.8193 0.8228 0.7171 -0.0624 -0.0011 -0.1442 193 TYR A CZ  
1554 O OH  . TYR A 193 ? 0.8195 0.8420 0.7794 -0.0638 -0.0010 -0.1436 193 TYR A OH  
1555 N N   . ASN A 194 ? 0.6095 0.5370 0.3483 -0.0534 0.0216  -0.0866 194 ASN A N   
1556 C CA  . ASN A 194 ? 0.4693 0.3907 0.2350 -0.0586 0.0380  -0.0784 194 ASN A CA  
1557 C C   . ASN A 194 ? 0.4135 0.3496 0.2295 -0.0578 0.0281  -0.0753 194 ASN A C   
1558 O O   . ASN A 194 ? 0.4129 0.3504 0.2300 -0.0512 0.0162  -0.0639 194 ASN A O   
1559 C CB  . ASN A 194 ? 0.5775 0.4799 0.3126 -0.0547 0.0466  -0.0598 194 ASN A CB  
1560 C CG  . ASN A 194 ? 0.5576 0.4521 0.3214 -0.0590 0.0633  -0.0541 194 ASN A CG  
1561 O OD1 . ASN A 194 ? 0.5032 0.4069 0.3097 -0.0638 0.0638  -0.0609 194 ASN A OD1 
1562 N ND2 . ASN A 194 ? 0.5821 0.4594 0.3253 -0.0567 0.0761  -0.0410 194 ASN A ND2 
1563 N N   . GLU A 195 ? 0.3669 0.3143 0.2253 -0.0648 0.0337  -0.0845 195 GLU A N   
1564 C CA  . GLU A 195 ? 0.2984 0.2618 0.2034 -0.0633 0.0260  -0.0798 195 GLU A CA  
1565 C C   . GLU A 195 ? 0.3038 0.2591 0.2137 -0.0603 0.0281  -0.0637 195 GLU A C   
1566 O O   . GLU A 195 ? 0.2349 0.2002 0.1665 -0.0554 0.0198  -0.0562 195 GLU A O   
1567 C CB  . GLU A 195 ? 0.3222 0.3011 0.2711 -0.0703 0.0336  -0.0893 195 GLU A CB  
1568 C CG  . GLU A 195 ? 0.3690 0.3596 0.3208 -0.0729 0.0302  -0.1081 195 GLU A CG  
1569 C CD  . GLU A 195 ? 0.4241 0.4305 0.4210 -0.0800 0.0407  -0.1186 195 GLU A CD  
1570 O OE1 . GLU A 195 ? 0.3970 0.4045 0.4183 -0.0811 0.0510  -0.1105 195 GLU A OE1 
1571 O OE2 . GLU A 195 ? 0.4230 0.4420 0.4309 -0.0824 0.0382  -0.1359 195 GLU A OE2 
1572 N N   . LYS A 196 ? 0.2732 0.2104 0.1635 -0.0623 0.0403  -0.0592 196 LYS A N   
1573 C CA  . LYS A 196 ? 0.2496 0.1797 0.1456 -0.0584 0.0414  -0.0466 196 LYS A CA  
1574 C C   . LYS A 196 ? 0.2307 0.1596 0.1052 -0.0499 0.0298  -0.0367 196 LYS A C   
1575 O O   . LYS A 196 ? 0.2375 0.1668 0.1235 -0.0459 0.0267  -0.0282 196 LYS A O   
1576 C CB  . LYS A 196 ? 0.2474 0.1588 0.1362 -0.0615 0.0582  -0.0456 196 LYS A CB  
1577 C CG  . LYS A 196 ? 0.2968 0.2128 0.2203 -0.0688 0.0693  -0.0514 196 LYS A CG  
1578 C CD  . LYS A 196 ? 0.2657 0.2047 0.2217 -0.0611 0.0630  -0.0459 196 LYS A CD  
1579 C CE  . LYS A 196 ? 0.2355 0.1835 0.2204 -0.0596 0.0725  -0.0528 196 LYS A CE  
1580 N NZ  . LYS A 196 ? 0.2546 0.1890 0.2409 -0.0588 0.0846  -0.0531 196 LYS A NZ  
1581 N N   . SER A 197 ? 0.3113 0.2393 0.1560 -0.0471 0.0227  -0.0378 197 SER A N   
1582 C CA  . SER A 197 ? 0.2911 0.2193 0.1221 -0.0396 0.0091  -0.0277 197 SER A CA  
1583 C C   . SER A 197 ? 0.2554 0.1984 0.1176 -0.0367 -0.0038 -0.0289 197 SER A C   
1584 O O   . SER A 197 ? 0.2618 0.2053 0.1302 -0.0319 -0.0103 -0.0195 197 SER A O   
1585 C CB  . SER A 197 ? 0.2956 0.2187 0.0882 -0.0368 0.0015  -0.0287 197 SER A CB  
1586 O OG  . SER A 197 ? 0.3878 0.2956 0.1481 -0.0389 0.0162  -0.0252 197 SER A OG  
1587 N N   . ASP A 198 ? 0.2293 0.1846 0.1153 -0.0396 -0.0059 -0.0398 198 ASP A N   
1588 C CA  . ASP A 198 ? 0.1901 0.1593 0.1111 -0.0366 -0.0139 -0.0395 198 ASP A CA  
1589 C C   . ASP A 198 ? 0.1801 0.1497 0.1201 -0.0362 -0.0066 -0.0301 198 ASP A C   
1590 O O   . ASP A 198 ? 0.1928 0.1674 0.1475 -0.0318 -0.0119 -0.0249 198 ASP A O   
1591 C CB  . ASP A 198 ? 0.1947 0.1788 0.1441 -0.0390 -0.0141 -0.0507 198 ASP A CB  
1592 C CG  . ASP A 198 ? 0.2847 0.2722 0.2226 -0.0369 -0.0260 -0.0626 198 ASP A CG  
1593 O OD1 . ASP A 198 ? 0.3425 0.3229 0.2563 -0.0317 -0.0380 -0.0598 198 ASP A OD1 
1594 O OD2 . ASP A 198 ? 0.3386 0.3369 0.2935 -0.0399 -0.0244 -0.0751 198 ASP A OD2 
1595 N N   . ILE A 199 ? 0.1757 0.1401 0.1161 -0.0404 0.0054  -0.0290 199 ILE A N   
1596 C CA  . ILE A 199 ? 0.1701 0.1363 0.1248 -0.0378 0.0106  -0.0211 199 ILE A CA  
1597 C C   . ILE A 199 ? 0.1723 0.1286 0.1133 -0.0341 0.0073  -0.0141 199 ILE A C   
1598 O O   . ILE A 199 ? 0.1575 0.1191 0.1098 -0.0296 0.0056  -0.0091 199 ILE A O   
1599 C CB  . ILE A 199 ? 0.1730 0.1375 0.1327 -0.0404 0.0223  -0.0232 199 ILE A CB  
1600 C CG1 . ILE A 199 ? 0.1828 0.1588 0.1606 -0.0432 0.0258  -0.0316 199 ILE A CG1 
1601 C CG2 . ILE A 199 ? 0.1811 0.1502 0.1508 -0.0331 0.0233  -0.0185 199 ILE A CG2 
1602 C CD1 . ILE A 199 ? 0.1983 0.1888 0.1993 -0.0369 0.0200  -0.0311 199 ILE A CD1 
1603 N N   . TRP A 200 ? 0.1746 0.1192 0.0894 -0.0340 0.0074  -0.0133 200 TRP A N   
1604 C CA  . TRP A 200 ? 0.1681 0.1084 0.0758 -0.0288 0.0047  -0.0037 200 TRP A CA  
1605 C C   . TRP A 200 ? 0.1835 0.1326 0.1010 -0.0246 -0.0069 -0.0010 200 TRP A C   
1606 O O   . TRP A 200 ? 0.1708 0.1224 0.1005 -0.0213 -0.0077 0.0036  200 TRP A O   
1607 C CB  . TRP A 200 ? 0.2120 0.1409 0.0924 -0.0284 0.0072  0.0013  200 TRP A CB  
1608 C CG  . TRP A 200 ? 0.2257 0.1516 0.1024 -0.0233 0.0020  0.0121  200 TRP A CG  
1609 C CD1 . TRP A 200 ? 0.2327 0.1621 0.1075 -0.0200 -0.0113 0.0162  200 TRP A CD1 
1610 C CD2 . TRP A 200 ? 0.2438 0.1629 0.1246 -0.0211 0.0094  0.0195  200 TRP A CD2 
1611 N NE1 . TRP A 200 ? 0.2551 0.1808 0.1324 -0.0168 -0.0126 0.0263  200 TRP A NE1 
1612 C CE2 . TRP A 200 ? 0.2410 0.1612 0.1224 -0.0172 0.0003  0.0285  200 TRP A CE2 
1613 C CE3 . TRP A 200 ? 0.2248 0.1375 0.1158 -0.0216 0.0219  0.0175  200 TRP A CE3 
1614 C CZ2 . TRP A 200 ? 0.2504 0.1675 0.1424 -0.0142 0.0043  0.0364  200 TRP A CZ2 
1615 C CZ3 . TRP A 200 ? 0.2081 0.1177 0.1097 -0.0173 0.0256  0.0242  200 TRP A CZ3 
1616 C CH2 . TRP A 200 ? 0.2283 0.1411 0.1308 -0.0140 0.0172  0.0338  200 TRP A CH2 
1617 N N   . SER A 201 ? 0.2062 0.1595 0.1209 -0.0245 -0.0154 -0.0053 201 SER A N   
1618 C CA  . SER A 201 ? 0.1918 0.1517 0.1218 -0.0203 -0.0265 -0.0040 201 SER A CA  
1619 C C   . SER A 201 ? 0.1739 0.1430 0.1325 -0.0195 -0.0228 -0.0043 201 SER A C   
1620 O O   . SER A 201 ? 0.1650 0.1361 0.1370 -0.0159 -0.0249 0.0002  201 SER A O   
1621 C CB  . SER A 201 ? 0.2095 0.1720 0.1354 -0.0195 -0.0378 -0.0113 201 SER A CB  
1622 O OG  . SER A 201 ? 0.2893 0.2416 0.1818 -0.0192 -0.0418 -0.0092 201 SER A OG  
1623 N N   . LEU A 202 ? 0.1570 0.1312 0.1254 -0.0230 -0.0164 -0.0091 202 LEU A N   
1624 C CA  . LEU A 202 ? 0.1537 0.1351 0.1443 -0.0219 -0.0116 -0.0068 202 LEU A CA  
1625 C C   . LEU A 202 ? 0.1402 0.1172 0.1250 -0.0196 -0.0065 -0.0008 202 LEU A C   
1626 O O   . LEU A 202 ? 0.1435 0.1246 0.1397 -0.0161 -0.0049 0.0030  202 LEU A O   
1627 C CB  . LEU A 202 ? 0.1452 0.1339 0.1453 -0.0224 -0.0049 -0.0094 202 LEU A CB  
1628 C CG  . LEU A 202 ? 0.1446 0.1398 0.1603 -0.0179 -0.0008 -0.0055 202 LEU A CG  
1629 C CD1 . LEU A 202 ? 0.1661 0.1673 0.2045 -0.0149 -0.0032 -0.0032 202 LEU A CD1 
1630 C CD2 . LEU A 202 ? 0.1716 0.1701 0.1946 -0.0178 0.0032  -0.0090 202 LEU A CD2 
1631 N N   . GLY A 203 ? 0.1338 0.1030 0.1028 -0.0209 -0.0030 -0.0008 203 GLY A N   
1632 C CA  . GLY A 203 ? 0.1363 0.1040 0.1034 -0.0169 0.0001  0.0016  203 GLY A CA  
1633 C C   . GLY A 203 ? 0.1379 0.1047 0.1083 -0.0141 -0.0033 0.0066  203 GLY A C   
1634 O O   . GLY A 203 ? 0.1287 0.0995 0.1067 -0.0105 -0.0009 0.0072  203 GLY A O   
1635 N N   . CYS A 204 ? 0.1262 0.0902 0.0909 -0.0142 -0.0097 0.0085  204 CYS A N   
1636 C CA  . CYS A 204 ? 0.1461 0.1105 0.1191 -0.0112 -0.0150 0.0125  204 CYS A CA  
1637 C C   . CYS A 204 ? 0.1497 0.1210 0.1430 -0.0091 -0.0150 0.0118  204 CYS A C   
1638 O O   . CYS A 204 ? 0.1330 0.1059 0.1380 -0.0068 -0.0127 0.0133  204 CYS A O   
1639 C CB  . CYS A 204 ? 0.1653 0.1243 0.1279 -0.0115 -0.0249 0.0152  204 CYS A CB  
1640 S SG  . CYS A 204 ? 0.1920 0.1407 0.1308 -0.0127 -0.0223 0.0204  204 CYS A SG  
1641 N N   . LEU A 205 ? 0.1257 0.1012 0.1261 -0.0098 -0.0163 0.0090  205 LEU A N   
1642 C CA  . LEU A 205 ? 0.1339 0.1151 0.1579 -0.0072 -0.0143 0.0093  205 LEU A CA  
1643 C C   . LEU A 205 ? 0.1260 0.1104 0.1517 -0.0057 -0.0030 0.0117  205 LEU A C   
1644 O O   . LEU A 205 ? 0.1277 0.1132 0.1654 -0.0028 0.0018  0.0137  205 LEU A O   
1645 C CB  . LEU A 205 ? 0.1372 0.1238 0.1742 -0.0079 -0.0171 0.0055  205 LEU A CB  
1646 C CG  . LEU A 205 ? 0.1742 0.1670 0.2408 -0.0047 -0.0115 0.0073  205 LEU A CG  
1647 C CD1 . LEU A 205 ? 0.2403 0.2406 0.3252 -0.0053 -0.0136 0.0032  205 LEU A CD1 
1648 C CD2 . LEU A 205 ? 0.2426 0.2322 0.3290 -0.0013 -0.0154 0.0078  205 LEU A CD2 
1649 N N   . LEU A 206 ? 0.1017 0.0867 0.1154 -0.0074 0.0010  0.0110  206 LEU A N   
1650 C CA  . LEU A 206 ? 0.1050 0.0919 0.1156 -0.0051 0.0089  0.0131  206 LEU A CA  
1651 C C   . LEU A 206 ? 0.1282 0.1127 0.1315 -0.0024 0.0110  0.0121  206 LEU A C   
1652 O O   . LEU A 206 ? 0.1278 0.1145 0.1322 0.0010  0.0175  0.0131  206 LEU A O   
1653 C CB  . LEU A 206 ? 0.1061 0.0938 0.1080 -0.0065 0.0087  0.0102  206 LEU A CB  
1654 C CG  . LEU A 206 ? 0.1021 0.0951 0.1163 -0.0083 0.0073  0.0098  206 LEU A CG  
1655 C CD1 . LEU A 206 ? 0.1251 0.1174 0.1330 -0.0097 0.0061  0.0059  206 LEU A CD1 
1656 C CD2 . LEU A 206 ? 0.1189 0.1176 0.1505 -0.0052 0.0127  0.0160  206 LEU A CD2 
1657 N N   . TYR A 207 ? 0.1258 0.1060 0.1229 -0.0038 0.0063  0.0099  207 TYR A N   
1658 C CA  . TYR A 207 ? 0.1148 0.0945 0.1130 -0.0014 0.0075  0.0081  207 TYR A CA  
1659 C C   . TYR A 207 ? 0.1085 0.0910 0.1228 0.0001  0.0092  0.0093  207 TYR A C   
1660 O O   . TYR A 207 ? 0.1153 0.1009 0.1334 0.0028  0.0152  0.0067  207 TYR A O   
1661 C CB  . TYR A 207 ? 0.1053 0.0799 0.1000 -0.0031 0.0028  0.0082  207 TYR A CB  
1662 C CG  . TYR A 207 ? 0.1187 0.0947 0.1221 -0.0005 0.0040  0.0059  207 TYR A CG  
1663 C CD1 . TYR A 207 ? 0.1032 0.0821 0.1227 0.0000  0.0025  0.0072  207 TYR A CD1 
1664 C CD2 . TYR A 207 ? 0.1304 0.1053 0.1319 0.0017  0.0062  0.0013  207 TYR A CD2 
1665 C CE1 . TYR A 207 ? 0.1263 0.1086 0.1601 0.0019  0.0038  0.0039  207 TYR A CE1 
1666 C CE2 . TYR A 207 ? 0.1097 0.0879 0.1257 0.0047  0.0069  -0.0026 207 TYR A CE2 
1667 C CZ  . TYR A 207 ? 0.1206 0.1034 0.1527 0.0046  0.0061  -0.0012 207 TYR A CZ  
1668 O OH  . TYR A 207 ? 0.1402 0.1284 0.1926 0.0071  0.0070  -0.0061 207 TYR A OH  
1669 N N   . GLU A 208 ? 0.1102 0.0912 0.1355 -0.0015 0.0035  0.0119  208 GLU A N   
1670 C CA  . GLU A 208 ? 0.1121 0.0935 0.1594 -0.0006 0.0041  0.0123  208 GLU A CA  
1671 C C   . GLU A 208 ? 0.1133 0.0979 0.1695 0.0020  0.0156  0.0125  208 GLU A C   
1672 O O   . GLU A 208 ? 0.1393 0.1244 0.2097 0.0033  0.0224  0.0110  208 GLU A O   
1673 C CB  . GLU A 208 ? 0.1100 0.0874 0.1689 -0.0020 -0.0076 0.0139  208 GLU A CB  
1674 C CG  . GLU A 208 ? 0.1428 0.1184 0.2308 -0.0014 -0.0092 0.0135  208 GLU A CG  
1675 C CD  . GLU A 208 ? 0.1788 0.1487 0.2782 -0.0020 -0.0249 0.0144  208 GLU A CD  
1676 O OE1 . GLU A 208 ? 0.1895 0.1574 0.2696 -0.0026 -0.0341 0.0153  208 GLU A OE1 
1677 O OE2 . GLU A 208 ? 0.2216 0.1883 0.3497 -0.0017 -0.0285 0.0136  208 GLU A OE2 
1678 N N   . LEU A 209 ? 0.1028 0.0894 0.1524 0.0026  0.0190  0.0149  209 LEU A N   
1679 C CA  . LEU A 209 ? 0.0964 0.0854 0.1512 0.0057  0.0317  0.0181  209 LEU A CA  
1680 C C   . LEU A 209 ? 0.1353 0.1254 0.1727 0.0084  0.0405  0.0162  209 LEU A C   
1681 O O   . LEU A 209 ? 0.1730 0.1634 0.2150 0.0113  0.0526  0.0174  209 LEU A O   
1682 C CB  . LEU A 209 ? 0.1234 0.1154 0.1755 0.0057  0.0328  0.0223  209 LEU A CB  
1683 C CG  . LEU A 209 ? 0.1571 0.1507 0.2335 0.0047  0.0272  0.0227  209 LEU A CG  
1684 C CD1 . LEU A 209 ? 0.1620 0.1607 0.2390 0.0040  0.0289  0.0260  209 LEU A CD1 
1685 C CD2 . LEU A 209 ? 0.1599 0.1524 0.2672 0.0077  0.0339  0.0244  209 LEU A CD2 
1686 N N   . CYS A 210 ? 0.1301 0.1202 0.1484 0.0081  0.0349  0.0122  210 CYS A N   
1687 C CA  . CYS A 210 ? 0.1234 0.1152 0.1258 0.0117  0.0400  0.0075  210 CYS A CA  
1688 C C   . CYS A 210 ? 0.1247 0.1183 0.1397 0.0119  0.0417  0.0008  210 CYS A C   
1689 O O   . CYS A 210 ? 0.1391 0.1351 0.1514 0.0150  0.0512  -0.0032 210 CYS A O   
1690 C CB  . CYS A 210 ? 0.1254 0.1160 0.1106 0.0119  0.0322  0.0040  210 CYS A CB  
1691 S SG  . CYS A 210 ? 0.1463 0.1353 0.1189 0.0113  0.0306  0.0101  210 CYS A SG  
1692 N N   . ALA A 211 ? 0.1290 0.1216 0.1579 0.0086  0.0326  -0.0003 211 ALA A N   
1693 C CA  . ALA A 211 ? 0.1054 0.1008 0.1518 0.0082  0.0319  -0.0061 211 ALA A CA  
1694 C C   . ALA A 211 ? 0.1067 0.1009 0.1810 0.0057  0.0344  -0.0048 211 ALA A C   
1695 O O   . ALA A 211 ? 0.1245 0.1218 0.2188 0.0050  0.0368  -0.0104 211 ALA A O   
1696 C CB  . ALA A 211 ? 0.1248 0.1191 0.1738 0.0064  0.0214  -0.0060 211 ALA A CB  
1697 N N   . LEU A 212 ? 0.1143 0.1042 0.1947 0.0046  0.0335  0.0013  212 LEU A N   
1698 C CA  . LEU A 212 ? 0.1193 0.1054 0.2310 0.0027  0.0326  0.0024  212 LEU A CA  
1699 C C   . LEU A 212 ? 0.1502 0.1340 0.2779 -0.0006 0.0179  0.0031  212 LEU A C   
1700 O O   . LEU A 212 ? 0.1959 0.1765 0.3541 -0.0026 0.0146  0.0025  212 LEU A O   
1701 C CB  . LEU A 212 ? 0.1271 0.1143 0.2558 0.0037  0.0481  -0.0023 212 LEU A CB  
1702 C CG  . LEU A 212 ? 0.1579 0.1456 0.2685 0.0077  0.0639  0.0001  212 LEU A CG  
1703 C CD1 . LEU A 212 ? 0.2046 0.1917 0.3299 0.0087  0.0819  -0.0045 212 LEU A CD1 
1704 C CD2 . LEU A 212 ? 0.1408 0.1250 0.2564 0.0085  0.0626  0.0080  212 LEU A CD2 
1705 N N   . MET A 213 ? 0.1545 0.1388 0.2625 -0.0011 0.0095  0.0050  213 MET A N   
1706 C CA  . MET A 213 ? 0.1557 0.1365 0.2705 -0.0035 -0.0043 0.0091  213 MET A CA  
1707 C C   . MET A 213 ? 0.1573 0.1357 0.2422 -0.0033 -0.0096 0.0130  213 MET A C   
1708 O O   . MET A 213 ? 0.1444 0.1253 0.2103 -0.0018 -0.0028 0.0106  213 MET A O   
1709 C CB  . MET A 213 ? 0.1754 0.1607 0.3090 -0.0044 -0.0038 0.0064  213 MET A CB  
1710 C CG  . MET A 213 ? 0.2171 0.2090 0.3367 -0.0019 0.0037  0.0011  213 MET A CG  
1711 S SD  . MET A 213 ? 0.4288 0.4289 0.5810 -0.0024 0.0042  -0.0044 213 MET A SD  
1712 C CE  . MET A 213 ? 0.2521 0.2547 0.4355 -0.0046 0.0119  -0.0112 213 MET A CE  
1713 N N   . PRO A 214 ? 0.1678 0.1402 0.2483 -0.0047 -0.0219 0.0186  214 PRO A N   
1714 C CA  . PRO A 214 ? 0.1830 0.1520 0.2347 -0.0050 -0.0244 0.0216  214 PRO A CA  
1715 C C   . PRO A 214 ? 0.1475 0.1175 0.1942 -0.0045 -0.0199 0.0226  214 PRO A C   
1716 O O   . PRO A 214 ? 0.1495 0.1232 0.2173 -0.0041 -0.0190 0.0222  214 PRO A O   
1717 C CB  . PRO A 214 ? 0.1881 0.1498 0.2355 -0.0059 -0.0388 0.0272  214 PRO A CB  
1718 C CG  . PRO A 214 ? 0.2424 0.2035 0.3196 -0.0063 -0.0455 0.0290  214 PRO A CG  
1719 C CD  . PRO A 214 ? 0.2230 0.1905 0.3237 -0.0060 -0.0343 0.0222  214 PRO A CD  
1720 N N   . PRO A 215 ? 0.1558 0.1419 0.1035 0.0053  0.0093  -0.0007 215 PRO A N   
1721 C CA  . PRO A 215 ? 0.1571 0.1321 0.1038 0.0035  0.0061  0.0036  215 PRO A CA  
1722 C C   . PRO A 215 ? 0.1927 0.1632 0.1347 0.0049  0.0030  0.0078  215 PRO A C   
1723 O O   . PRO A 215 ? 0.1878 0.1463 0.1264 0.0050  -0.0006 0.0105  215 PRO A O   
1724 C CB  . PRO A 215 ? 0.1834 0.1621 0.1358 -0.0022 0.0088  0.0045  215 PRO A CB  
1725 C CG  . PRO A 215 ? 0.1531 0.1444 0.1093 -0.0031 0.0132  0.0017  215 PRO A CG  
1726 C CD  . PRO A 215 ? 0.1476 0.1422 0.1021 0.0009  0.0136  -0.0021 215 PRO A CD  
1727 N N   . PHE A 216 ? 0.1864 0.1662 0.1279 0.0057  0.0044  0.0084  216 PHE A N   
1728 C CA  . PHE A 216 ? 0.1878 0.1638 0.1241 0.0070  0.0011  0.0132  216 PHE A CA  
1729 C C   . PHE A 216 ? 0.2236 0.2061 0.1570 0.0138  0.0004  0.0112  216 PHE A C   
1730 O O   . PHE A 216 ? 0.2262 0.2232 0.1622 0.0137  0.0043  0.0082  216 PHE A O   
1731 C CB  . PHE A 216 ? 0.1992 0.1829 0.1377 0.0007  0.0031  0.0166  216 PHE A CB  
1732 C CG  . PHE A 216 ? 0.1658 0.1484 0.1089 -0.0060 0.0048  0.0166  216 PHE A CG  
1733 C CD1 . PHE A 216 ? 0.1951 0.1659 0.1349 -0.0092 0.0017  0.0202  216 PHE A CD1 
1734 C CD2 . PHE A 216 ? 0.1877 0.1815 0.1384 -0.0088 0.0094  0.0125  216 PHE A CD2 
1735 C CE1 . PHE A 216 ? 0.1878 0.1597 0.1317 -0.0149 0.0032  0.0194  216 PHE A CE1 
1736 C CE2 . PHE A 216 ? 0.1962 0.1898 0.1515 -0.0138 0.0104  0.0119  216 PHE A CE2 
1737 C CZ  . PHE A 216 ? 0.1878 0.1714 0.1398 -0.0167 0.0073  0.0152  216 PHE A CZ  
1738 N N   . THR A 217 ? 0.2585 0.2306 0.1865 0.0198  -0.0045 0.0122  217 THR A N   
1739 C CA  . THR A 217 ? 0.2962 0.2749 0.2214 0.0274  -0.0060 0.0097  217 THR A CA  
1740 C C   . THR A 217 ? 0.2935 0.2662 0.2130 0.0303  -0.0104 0.0161  217 THR A C   
1741 O O   . THR A 217 ? 0.2797 0.2379 0.1959 0.0276  -0.0136 0.0217  217 THR A O   
1742 C CB  . THR A 217 ? 0.2868 0.2605 0.2108 0.0336  -0.0086 0.0042  217 THR A CB  
1743 O OG1 . THR A 217 ? 0.3448 0.3002 0.2656 0.0352  -0.0136 0.0072  217 THR A OG1 
1744 C CG2 . THR A 217 ? 0.4646 0.4436 0.3931 0.0299  -0.0046 -0.0013 217 THR A CG2 
1745 N N   . ALA A 218 ? 0.3244 0.3082 0.2420 0.0355  -0.0107 0.0153  218 ALA A N   
1746 C CA  . ALA A 218 ? 0.3844 0.3633 0.2962 0.0390  -0.0154 0.0219  218 ALA A CA  
1747 C C   . ALA A 218 ? 0.3402 0.3337 0.2505 0.0469  -0.0156 0.0189  218 ALA A C   
1748 O O   . ALA A 218 ? 0.3508 0.3611 0.2650 0.0471  -0.0109 0.0119  218 ALA A O   
1749 C CB  . ALA A 218 ? 0.4892 0.4705 0.4009 0.0304  -0.0138 0.0288  218 ALA A CB  
1750 N N   . PHE A 219 ? 0.3764 0.3636 0.2808 0.0532  -0.0213 0.0240  219 PHE A N   
1751 C CA  . PHE A 219 ? 0.3671 0.3689 0.2697 0.0615  -0.0224 0.0215  219 PHE A CA  
1752 C C   . PHE A 219 ? 0.4408 0.4563 0.3423 0.0577  -0.0206 0.0274  219 PHE A C   
1753 O O   . PHE A 219 ? 0.4460 0.4785 0.3468 0.0630  -0.0200 0.0254  219 PHE A O   
1754 C CB  . PHE A 219 ? 0.4401 0.4275 0.3371 0.0729  -0.0305 0.0224  219 PHE A CB  
1755 C CG  . PHE A 219 ? 0.5432 0.5225 0.4421 0.0776  -0.0320 0.0145  219 PHE A CG  
1756 C CD1 . PHE A 219 ? 0.6283 0.5842 0.5255 0.0776  -0.0363 0.0170  219 PHE A CD1 
1757 C CD2 . PHE A 219 ? 0.6026 0.5989 0.5050 0.0811  -0.0289 0.0042  219 PHE A CD2 
1758 C CE1 . PHE A 219 ? 0.6751 0.6256 0.5747 0.0812  -0.0375 0.0092  219 PHE A CE1 
1759 C CE2 . PHE A 219 ? 0.6425 0.6334 0.5468 0.0844  -0.0304 -0.0033 219 PHE A CE2 
1760 C CZ  . PHE A 219 ? 0.6578 0.6262 0.5611 0.0846  -0.0347 -0.0009 219 PHE A CZ  
1761 N N   . SER A 220 ? 0.3782 0.3879 0.2798 0.0482  -0.0196 0.0343  220 SER A N   
1762 C CA  . SER A 220 ? 0.4008 0.4247 0.3021 0.0426  -0.0177 0.0398  220 SER A CA  
1763 C C   . SER A 220 ? 0.3935 0.4223 0.3004 0.0300  -0.0122 0.0402  220 SER A C   
1764 O O   . SER A 220 ? 0.3452 0.3615 0.2542 0.0260  -0.0116 0.0387  220 SER A O   
1765 C CB  . SER A 220 ? 0.4222 0.4326 0.3147 0.0451  -0.0251 0.0503  220 SER A CB  
1766 O OG  . SER A 220 ? 0.4230 0.4124 0.3123 0.0383  -0.0278 0.0562  220 SER A OG  
1767 N N   A GLN A 221 ? 0.3273 0.3757 0.2371 0.0240  -0.0082 0.0416  221 GLN A N   
1768 N N   B GLN A 221 ? 0.3303 0.3785 0.2401 0.0238  -0.0082 0.0416  221 GLN A N   
1769 C CA  A GLN A 221 ? 0.3191 0.3755 0.2353 0.0124  -0.0030 0.0410  221 GLN A CA  
1770 C CA  B GLN A 221 ? 0.3102 0.3656 0.2266 0.0123  -0.0029 0.0406  221 GLN A CA  
1771 C C   A GLN A 221 ? 0.2828 0.3218 0.1947 0.0056  -0.0070 0.0484  221 GLN A C   
1772 C C   B GLN A 221 ? 0.2846 0.3250 0.1967 0.0049  -0.0067 0.0486  221 GLN A C   
1773 O O   A GLN A 221 ? 0.2766 0.3114 0.1928 -0.0011 -0.0046 0.0463  221 GLN A O   
1774 O O   B GLN A 221 ? 0.2705 0.3097 0.1873 -0.0031 -0.0039 0.0468  221 GLN A O   
1775 C CB  A GLN A 221 ? 0.3533 0.4355 0.2732 0.0075  0.0015  0.0409  221 GLN A CB  
1776 C CB  B GLN A 221 ? 0.3513 0.4343 0.2734 0.0075  0.0032  0.0380  221 GLN A CB  
1777 C CG  A GLN A 221 ? 0.3855 0.4774 0.3124 -0.0046 0.0063  0.0401  221 GLN A CG  
1778 C CG  B GLN A 221 ? 0.2917 0.3900 0.2191 0.0117  0.0089  0.0283  221 GLN A CG  
1779 C CD  A GLN A 221 ? 0.4004 0.5000 0.3368 -0.0070 0.0131  0.0305  221 GLN A CD  
1780 C CD  B GLN A 221 ? 0.2540 0.3797 0.1906 0.0063  0.0150  0.0244  221 GLN A CD  
1781 O OE1 A GLN A 221 ? 0.4613 0.5513 0.3978 -0.0013 0.0132  0.0258  221 GLN A OE1 
1782 O OE1 B GLN A 221 ? 0.2531 0.3866 0.1992 -0.0030 0.0176  0.0234  221 GLN A OE1 
1783 N NE2 A GLN A 221 ? 0.4153 0.5319 0.3640 -0.0154 0.0172  0.0265  221 GLN A NE2 
1784 N NE2 B GLN A 221 ? 0.2856 0.4269 0.2234 0.0122  0.0159  0.0211  221 GLN A NE2 
1785 N N   . LYS A 222 ? 0.3269 0.3559 0.2299 0.0075  -0.0133 0.0572  222 LYS A N   
1786 C CA  . LYS A 222 ? 0.3200 0.3319 0.2169 0.0002  -0.0174 0.0649  222 LYS A CA  
1787 C C   . LYS A 222 ? 0.3095 0.2998 0.2057 0.0013  -0.0189 0.0624  222 LYS A C   
1788 O O   . LYS A 222 ? 0.2968 0.2822 0.1943 -0.0075 -0.0176 0.0627  222 LYS A O   
1789 C CB  . LYS A 222 ? 0.4737 0.4746 0.3595 0.0037  -0.0247 0.0749  222 LYS A CB  
1790 C CG  . LYS A 222 ? 0.5330 0.5141 0.4103 -0.0044 -0.0293 0.0833  222 LYS A CG  
1791 C CD  . LYS A 222 ? 0.6649 0.6265 0.5301 0.0022  -0.0377 0.0926  222 LYS A CD  
1792 C CE  . LYS A 222 ? 0.7476 0.6873 0.6030 -0.0069 -0.0421 0.1010  222 LYS A CE  
1793 N NZ  . LYS A 222 ? 0.7912 0.7453 0.6447 -0.0204 -0.0407 0.1067  222 LYS A NZ  
1794 N N   . GLU A 223 ? 0.3141 0.2935 0.2087 0.0120  -0.0216 0.0593  223 GLU A N   
1795 C CA  . GLU A 223 ? 0.3468 0.3074 0.2412 0.0137  -0.0230 0.0563  223 GLU A CA  
1796 C C   . GLU A 223 ? 0.3012 0.2710 0.2049 0.0082  -0.0167 0.0490  223 GLU A C   
1797 O O   . GLU A 223 ? 0.3335 0.2926 0.2375 0.0029  -0.0166 0.0490  223 GLU A O   
1798 C CB  . GLU A 223 ? 0.4562 0.4082 0.3488 0.0263  -0.0266 0.0526  223 GLU A CB  
1799 C CG  . GLU A 223 ? 0.6283 0.5640 0.5219 0.0279  -0.0275 0.0483  223 GLU A CG  
1800 C CD  . GLU A 223 ? 0.7165 0.6497 0.6106 0.0396  -0.0300 0.0422  223 GLU A CD  
1801 O OE1 . GLU A 223 ? 0.7320 0.6773 0.6258 0.0468  -0.0306 0.0406  223 GLU A OE1 
1802 O OE2 . GLU A 223 ? 0.7060 0.6266 0.6009 0.0414  -0.0312 0.0385  223 GLU A OE2 
1803 N N   . LEU A 224 ? 0.2633 0.2528 0.1739 0.0097  -0.0115 0.0428  224 LEU A N   
1804 C CA  . LEU A 224 ? 0.2461 0.2442 0.1654 0.0052  -0.0057 0.0361  224 LEU A CA  
1805 C C   . LEU A 224 ? 0.2534 0.2553 0.1759 -0.0057 -0.0034 0.0382  224 LEU A C   
1806 O O   . LEU A 224 ? 0.2513 0.2471 0.1769 -0.0094 -0.0022 0.0358  224 LEU A O   
1807 C CB  . LEU A 224 ? 0.2999 0.3187 0.2250 0.0076  -0.0004 0.0297  224 LEU A CB  
1808 C CG  . LEU A 224 ? 0.2755 0.3022 0.2092 0.0035  0.0056  0.0228  224 LEU A CG  
1809 C CD1 . LEU A 224 ? 0.3093 0.3221 0.2427 0.0073  0.0041  0.0194  224 LEU A CD1 
1810 C CD2 . LEU A 224 ? 0.3108 0.3581 0.2491 0.0043  0.0111  0.0171  224 LEU A CD2 
1811 N N   . ALA A 225 ? 0.2532 0.2666 0.1749 -0.0109 -0.0029 0.0423  225 ALA A N   
1812 C CA  . ALA A 225 ? 0.2521 0.2724 0.1770 -0.0218 -0.0009 0.0433  225 ALA A CA  
1813 C C   . ALA A 225 ? 0.2462 0.2474 0.1653 -0.0262 -0.0048 0.0475  225 ALA A C   
1814 O O   . ALA A 225 ? 0.2508 0.2540 0.1742 -0.0329 -0.0027 0.0449  225 ALA A O   
1815 C CB  . ALA A 225 ? 0.3060 0.3420 0.2298 -0.0270 -0.0005 0.0476  225 ALA A CB  
1816 N N   . GLY A 226 ? 0.2795 0.2624 0.1887 -0.0221 -0.0106 0.0535  226 GLY A N   
1817 C CA  . GLY A 226 ? 0.2892 0.2522 0.1917 -0.0261 -0.0142 0.0572  226 GLY A CA  
1818 C C   . GLY A 226 ? 0.3015 0.2580 0.2090 -0.0248 -0.0123 0.0510  226 GLY A C   
1819 O O   . GLY A 226 ? 0.3254 0.2780 0.2328 -0.0320 -0.0117 0.0508  226 GLY A O   
1820 N N   . LYS A 227 ? 0.2559 0.2127 0.1674 -0.0160 -0.0112 0.0460  227 LYS A N   
1821 C CA  . LYS A 227 ? 0.2548 0.2063 0.1708 -0.0144 -0.0096 0.0405  227 LYS A CA  
1822 C C   . LYS A 227 ? 0.2723 0.2383 0.1973 -0.0202 -0.0045 0.0357  227 LYS A C   
1823 O O   . LYS A 227 ? 0.2851 0.2465 0.2121 -0.0237 -0.0039 0.0339  227 LYS A O   
1824 C CB  . LYS A 227 ? 0.2402 0.1904 0.1577 -0.0044 -0.0098 0.0360  227 LYS A CB  
1825 C CG  . LYS A 227 ? 0.3020 0.2356 0.2119 0.0027  -0.0154 0.0387  227 LYS A CG  
1826 C CD  . LYS A 227 ? 0.3477 0.2821 0.2605 0.0113  -0.0153 0.0323  227 LYS A CD  
1827 C CE  . LYS A 227 ? 0.4391 0.3574 0.3457 0.0190  -0.0210 0.0334  227 LYS A CE  
1828 N NZ  . LYS A 227 ? 0.5009 0.4222 0.4109 0.0263  -0.0208 0.0259  227 LYS A NZ  
1829 N N   . ILE A 228 ? 0.2236 0.2075 0.1545 -0.0208 -0.0008 0.0333  228 ILE A N   
1830 C CA  . ILE A 228 ? 0.2340 0.2320 0.1743 -0.0256 0.0041  0.0283  228 ILE A CA  
1831 C C   . ILE A 228 ? 0.3236 0.3229 0.2640 -0.0349 0.0037  0.0300  228 ILE A C   
1832 O O   . ILE A 228 ? 0.2810 0.2815 0.2266 -0.0375 0.0053  0.0263  228 ILE A O   
1833 C CB  . ILE A 228 ? 0.2318 0.2491 0.1779 -0.0256 0.0083  0.0254  228 ILE A CB  
1834 C CG1 . ILE A 228 ? 0.2275 0.2459 0.1743 -0.0174 0.0097  0.0217  228 ILE A CG1 
1835 C CG2 . ILE A 228 ? 0.2571 0.2884 0.2131 -0.0316 0.0128  0.0204  228 ILE A CG2 
1836 C CD1 . ILE A 228 ? 0.2361 0.2730 0.1866 -0.0170 0.0136  0.0191  228 ILE A CD1 
1837 N N   . ARG A 229 ? 0.2891 0.2885 0.2232 -0.0399 0.0013  0.0356  229 ARG A N   
1838 C CA  . ARG A 229 ? 0.2644 0.2665 0.1971 -0.0500 0.0007  0.0371  229 ARG A CA  
1839 C C   . ARG A 229 ? 0.2863 0.2724 0.2144 -0.0517 -0.0016 0.0377  229 ARG A C   
1840 O O   . ARG A 229 ? 0.3344 0.3257 0.2648 -0.0590 -0.0006 0.0355  229 ARG A O   
1841 C CB  . ARG A 229 ? 0.3534 0.3580 0.2786 -0.0557 -0.0018 0.0439  229 ARG A CB  
1842 C CG  . ARG A 229 ? 0.4101 0.4376 0.3418 -0.0584 0.0015  0.0422  229 ARG A CG  
1843 C CD  . ARG A 229 ? 0.4738 0.5054 0.3978 -0.0663 -0.0012 0.0492  229 ARG A CD  
1844 N NE  . ARG A 229 ? 0.5897 0.6029 0.5019 -0.0612 -0.0064 0.0573  229 ARG A NE  
1845 C CZ  . ARG A 229 ? 0.5721 0.5897 0.4818 -0.0561 -0.0075 0.0609  229 ARG A CZ  
1846 N NH1 . ARG A 229 ? 0.5722 0.6128 0.4902 -0.0563 -0.0032 0.0572  229 ARG A NH1 
1847 N NH2 . ARG A 229 ? 0.5638 0.5631 0.4629 -0.0506 -0.0130 0.0680  229 ARG A NH2 
1848 N N   . GLU A 230 ? 0.2584 0.2263 0.1805 -0.0453 -0.0046 0.0400  230 GLU A N   
1849 C CA  . GLU A 230 ? 0.3117 0.2649 0.2298 -0.0467 -0.0063 0.0399  230 GLU A CA  
1850 C C   . GLU A 230 ? 0.3201 0.2779 0.2470 -0.0441 -0.0034 0.0334  230 GLU A C   
1851 O O   . GLU A 230 ? 0.3013 0.2551 0.2277 -0.0479 -0.0035 0.0319  230 GLU A O   
1852 C CB  . GLU A 230 ? 0.3611 0.2937 0.2705 -0.0407 -0.0105 0.0438  230 GLU A CB  
1853 C CG  . GLU A 230 ? 0.4892 0.4062 0.3935 -0.0435 -0.0122 0.0440  230 GLU A CG  
1854 C CD  . GLU A 230 ? 0.6403 0.5568 0.5386 -0.0551 -0.0127 0.0469  230 GLU A CD  
1855 O OE1 . GLU A 230 ? 0.6172 0.5328 0.5089 -0.0597 -0.0147 0.0525  230 GLU A OE1 
1856 O OE2 . GLU A 230 ? 0.6876 0.6055 0.5876 -0.0600 -0.0112 0.0435  230 GLU A OE2 
1857 N N   . GLY A 231 ? 0.2682 0.2345 0.2024 -0.0379 -0.0009 0.0295  231 GLY A N   
1858 C CA  . GLY A 231 ? 0.2230 0.1945 0.1655 -0.0358 0.0018  0.0240  231 GLY A CA  
1859 C C   . GLY A 231 ? 0.2080 0.1667 0.1487 -0.0315 0.0002  0.0230  231 GLY A C   
1860 O O   . GLY A 231 ? 0.2066 0.1683 0.1527 -0.0314 0.0017  0.0195  231 GLY A O   
1861 N N   . LYS A 232 ? 0.2110 0.1560 0.1444 -0.0280 -0.0029 0.0259  232 LYS A N   
1862 C CA  . LYS A 232 ? 0.1986 0.1324 0.1305 -0.0243 -0.0044 0.0244  232 LYS A CA  
1863 C C   . LYS A 232 ? 0.1987 0.1324 0.1323 -0.0160 -0.0045 0.0219  232 LYS A C   
1864 O O   . LYS A 232 ? 0.2055 0.1420 0.1376 -0.0124 -0.0049 0.0228  232 LYS A O   
1865 C CB  . LYS A 232 ? 0.2571 0.1749 0.1801 -0.0265 -0.0079 0.0280  232 LYS A CB  
1866 C CG  . LYS A 232 ? 0.3378 0.2558 0.2579 -0.0359 -0.0076 0.0298  232 LYS A CG  
1867 C CD  . LYS A 232 ? 0.4263 0.3269 0.3364 -0.0390 -0.0108 0.0335  232 LYS A CD  
1868 C CE  . LYS A 232 ? 0.5434 0.4460 0.4491 -0.0498 -0.0104 0.0353  232 LYS A CE  
1869 N NZ  . LYS A 232 ? 0.5599 0.4772 0.4731 -0.0536 -0.0072 0.0306  232 LYS A NZ  
1870 N N   . PHE A 233 ? 0.1807 0.1125 0.1170 -0.0135 -0.0042 0.0184  233 PHE A N   
1871 C CA  . PHE A 233 ? 0.1559 0.0898 0.0939 -0.0070 -0.0040 0.0151  233 PHE A CA  
1872 C C   . PHE A 233 ? 0.1842 0.1128 0.1230 -0.0061 -0.0049 0.0124  233 PHE A C   
1873 O O   . PHE A 233 ? 0.1835 0.1101 0.1233 -0.0103 -0.0047 0.0129  233 PHE A O   
1874 C CB  . PHE A 233 ? 0.1386 0.0860 0.0826 -0.0067 -0.0003 0.0124  233 PHE A CB  
1875 C CG  . PHE A 233 ? 0.1470 0.1007 0.0967 -0.0115 0.0022  0.0118  233 PHE A CG  
1876 C CD1 . PHE A 233 ? 0.1695 0.1228 0.1225 -0.0116 0.0026  0.0098  233 PHE A CD1 
1877 C CD2 . PHE A 233 ? 0.1679 0.1289 0.1199 -0.0158 0.0037  0.0131  233 PHE A CD2 
1878 C CE1 . PHE A 233 ? 0.1718 0.1309 0.1302 -0.0149 0.0043  0.0091  233 PHE A CE1 
1879 C CE2 . PHE A 233 ? 0.1673 0.1351 0.1253 -0.0195 0.0056  0.0115  233 PHE A CE2 
1880 C CZ  . PHE A 233 ? 0.1718 0.1380 0.1329 -0.0185 0.0057  0.0095  233 PHE A CZ  
1881 N N   . ARG A 234 ? 0.1719 0.1000 0.1104 -0.0008 -0.0059 0.0093  234 ARG A N   
1882 C CA  . ARG A 234 ? 0.1583 0.0839 0.0981 -0.0003 -0.0067 0.0063  234 ARG A CA  
1883 C C   . ARG A 234 ? 0.1697 0.1040 0.1148 -0.0030 -0.0040 0.0049  234 ARG A C   
1884 O O   . ARG A 234 ? 0.1784 0.1206 0.1263 -0.0031 -0.0015 0.0047  234 ARG A O   
1885 C CB  . ARG A 234 ? 0.1885 0.1139 0.1269 0.0055  -0.0085 0.0022  234 ARG A CB  
1886 C CG  . ARG A 234 ? 0.1986 0.1146 0.1320 0.0098  -0.0120 0.0032  234 ARG A CG  
1887 C CD  . ARG A 234 ? 0.2480 0.1640 0.1811 0.0157  -0.0144 -0.0023 234 ARG A CD  
1888 N NE  . ARG A 234 ? 0.2604 0.1750 0.1958 0.0136  -0.0147 -0.0055 234 ARG A NE  
1889 C CZ  . ARG A 234 ? 0.3195 0.2232 0.2535 0.0120  -0.0165 -0.0050 234 ARG A CZ  
1890 N NH1 . ARG A 234 ? 0.3213 0.2129 0.2507 0.0121  -0.0184 -0.0009 234 ARG A NH1 
1891 N NH2 . ARG A 234 ? 0.3336 0.2389 0.2704 0.0098  -0.0164 -0.0084 234 ARG A NH2 
1892 N N   . ARG A 235 ? 0.1545 0.0873 0.1011 -0.0050 -0.0044 0.0041  235 ARG A N   
1893 C CA  . ARG A 235 ? 0.1388 0.0790 0.0898 -0.0064 -0.0026 0.0030  235 ARG A CA  
1894 C C   . ARG A 235 ? 0.1400 0.0852 0.0910 -0.0034 -0.0021 0.0000  235 ARG A C   
1895 O O   . ARG A 235 ? 0.1687 0.1124 0.1171 -0.0003 -0.0038 -0.0027 235 ARG A O   
1896 C CB  . ARG A 235 ? 0.1481 0.0872 0.1002 -0.0088 -0.0035 0.0026  235 ARG A CB  
1897 C CG  . ARG A 235 ? 0.1568 0.1027 0.1132 -0.0104 -0.0022 0.0030  235 ARG A CG  
1898 C CD  . ARG A 235 ? 0.1466 0.0937 0.1036 -0.0118 -0.0034 0.0018  235 ARG A CD  
1899 N NE  . ARG A 235 ? 0.1520 0.1049 0.1126 -0.0131 -0.0028 0.0032  235 ARG A NE  
1900 C CZ  . ARG A 235 ? 0.1636 0.1201 0.1251 -0.0124 -0.0026 0.0030  235 ARG A CZ  
1901 N NH1 . ARG A 235 ? 0.1495 0.1063 0.1085 -0.0109 -0.0025 0.0007  235 ARG A NH1 
1902 N NH2 . ARG A 235 ? 0.1593 0.1192 0.1235 -0.0134 -0.0027 0.0050  235 ARG A NH2 
1903 N N   . ILE A 236 ? 0.1635 0.1149 0.1174 -0.0043 0.0001  -0.0002 236 ILE A N   
1904 C CA  . ILE A 236 ? 0.1435 0.0998 0.0966 -0.0032 0.0007  -0.0033 236 ILE A CA  
1905 C C   . ILE A 236 ? 0.1483 0.1041 0.1005 -0.0038 -0.0015 -0.0052 236 ILE A C   
1906 O O   . ILE A 236 ? 0.1523 0.1050 0.1057 -0.0055 -0.0027 -0.0037 236 ILE A O   
1907 C CB  . ILE A 236 ? 0.1287 0.0893 0.0844 -0.0050 0.0034  -0.0027 236 ILE A CB  
1908 C CG1 . ILE A 236 ? 0.1379 0.0972 0.0970 -0.0074 0.0029  -0.0001 236 ILE A CG1 
1909 C CG2 . ILE A 236 ? 0.1549 0.1180 0.1123 -0.0047 0.0059  -0.0021 236 ILE A CG2 
1910 C CD1 . ILE A 236 ? 0.1227 0.0842 0.0844 -0.0085 0.0049  0.0005  236 ILE A CD1 
1911 N N   . PRO A 237 ? 0.1502 0.1108 0.1003 -0.0029 -0.0018 -0.0091 237 PRO A N   
1912 C CA  . PRO A 237 ? 0.1473 0.1098 0.0970 -0.0040 -0.0039 -0.0118 237 PRO A CA  
1913 C C   . PRO A 237 ? 0.1649 0.1281 0.1170 -0.0080 -0.0041 -0.0090 237 PRO A C   
1914 O O   . PRO A 237 ? 0.1495 0.1131 0.1030 -0.0096 -0.0026 -0.0058 237 PRO A O   
1915 C CB  . PRO A 237 ? 0.1588 0.1296 0.1080 -0.0036 -0.0034 -0.0153 237 PRO A CB  
1916 C CG  . PRO A 237 ? 0.1615 0.1330 0.1103 -0.0002 -0.0020 -0.0155 237 PRO A CG  
1917 C CD  . PRO A 237 ? 0.1706 0.1366 0.1187 -0.0011 -0.0003 -0.0119 237 PRO A CD  
1918 N N   . TYR A 238 ? 0.1406 0.1044 0.0934 -0.0092 -0.0059 -0.0105 238 TYR A N   
1919 C CA  . TYR A 238 ? 0.1418 0.1074 0.0969 -0.0126 -0.0063 -0.0078 238 TYR A CA  
1920 C C   . TYR A 238 ? 0.1382 0.1100 0.0929 -0.0156 -0.0062 -0.0068 238 TYR A C   
1921 O O   . TYR A 238 ? 0.1980 0.1712 0.1545 -0.0179 -0.0066 -0.0034 238 TYR A O   
1922 C CB  . TYR A 238 ? 0.1710 0.1369 0.1271 -0.0137 -0.0079 -0.0104 238 TYR A CB  
1923 C CG  . TYR A 238 ? 0.1494 0.1068 0.1052 -0.0120 -0.0079 -0.0097 238 TYR A CG  
1924 C CD1 . TYR A 238 ? 0.1598 0.1122 0.1137 -0.0089 -0.0092 -0.0133 238 TYR A CD1 
1925 C CD2 . TYR A 238 ? 0.1398 0.0940 0.0966 -0.0136 -0.0069 -0.0057 238 TYR A CD2 
1926 C CE1 . TYR A 238 ? 0.1963 0.1391 0.1487 -0.0080 -0.0095 -0.0118 238 TYR A CE1 
1927 C CE2 . TYR A 238 ? 0.1472 0.0936 0.1025 -0.0135 -0.0069 -0.0049 238 TYR A CE2 
1928 C CZ  . TYR A 238 ? 0.1724 0.1122 0.1251 -0.0109 -0.0082 -0.0075 238 TYR A CZ  
1929 O OH  . TYR A 238 ? 0.1864 0.1168 0.1364 -0.0112 -0.0086 -0.0060 238 TYR A OH  
1930 N N   . ARG A 239 ? 0.1651 0.1406 0.1168 -0.0157 -0.0059 -0.0098 239 ARG A N   
1931 C CA  . ARG A 239 ? 0.2064 0.1861 0.1560 -0.0194 -0.0057 -0.0085 239 ARG A CA  
1932 C C   . ARG A 239 ? 0.2011 0.1755 0.1519 -0.0192 -0.0041 -0.0032 239 ARG A C   
1933 O O   . ARG A 239 ? 0.2341 0.2089 0.1839 -0.0220 -0.0045 -0.0001 239 ARG A O   
1934 C CB  . ARG A 239 ? 0.2379 0.2235 0.1864 -0.0200 -0.0045 -0.0122 239 ARG A CB  
1935 C CG  . ARG A 239 ? 0.2494 0.2324 0.1981 -0.0169 -0.0021 -0.0125 239 ARG A CG  
1936 C CD  . ARG A 239 ? 0.4226 0.4141 0.3728 -0.0167 -0.0010 -0.0166 239 ARG A CD  
1937 N NE  . ARG A 239 ? 0.4508 0.4501 0.4000 -0.0220 -0.0012 -0.0181 239 ARG A NE  
1938 C CZ  . ARG A 239 ? 0.5483 0.5482 0.4942 -0.0269 0.0002  -0.0165 239 ARG A CZ  
1939 N NH1 . ARG A 239 ? 0.5465 0.5539 0.4906 -0.0325 -0.0001 -0.0178 239 ARG A NH1 
1940 N NH2 . ARG A 239 ? 0.5134 0.5063 0.4573 -0.0266 0.0020  -0.0140 239 ARG A NH2 
1941 N N   . TYR A 240 ? 0.1560 0.1256 0.1089 -0.0159 -0.0026 -0.0023 240 TYR A N   
1942 C CA  . TYR A 240 ? 0.1409 0.1066 0.0963 -0.0153 -0.0011 0.0013  240 TYR A CA  
1943 C C   . TYR A 240 ? 0.1612 0.1252 0.1208 -0.0148 -0.0022 0.0048  240 TYR A C   
1944 O O   . TYR A 240 ? 0.1597 0.1237 0.1205 -0.0143 -0.0029 0.0042  240 TYR A O   
1945 C CB  . TYR A 240 ? 0.1272 0.0913 0.0831 -0.0129 0.0014  -0.0002 240 TYR A CB  
1946 C CG  . TYR A 240 ? 0.1159 0.0835 0.0674 -0.0133 0.0028  -0.0041 240 TYR A CG  
1947 C CD1 . TYR A 240 ? 0.1507 0.1208 0.1001 -0.0110 0.0024  -0.0079 240 TYR A CD1 
1948 C CD2 . TYR A 240 ? 0.1489 0.1172 0.0977 -0.0160 0.0042  -0.0042 240 TYR A CD2 
1949 C CE1 . TYR A 240 ? 0.1747 0.1508 0.1249 -0.0111 0.0036  -0.0106 240 TYR A CE1 
1950 C CE2 . TYR A 240 ? 0.1859 0.1591 0.1321 -0.0172 0.0058  -0.0080 240 TYR A CE2 
1951 C CZ  . TYR A 240 ? 0.1848 0.1633 0.1341 -0.0146 0.0054  -0.0107 240 TYR A CZ  
1952 O OH  . TYR A 240 ? 0.2090 0.1950 0.1595 -0.0155 0.0066  -0.0138 240 TYR A OH  
1953 N N   . SER A 241 ? 0.1429 0.1055 0.1045 -0.0150 -0.0023 0.0081  241 SER A N   
1954 C CA  . SER A 241 ? 0.1579 0.1210 0.1237 -0.0143 -0.0037 0.0111  241 SER A CA  
1955 C C   . SER A 241 ? 0.1295 0.0922 0.0986 -0.0125 -0.0026 0.0102  241 SER A C   
1956 O O   . SER A 241 ? 0.1492 0.1103 0.1187 -0.0115 -0.0007 0.0086  241 SER A O   
1957 C CB  . SER A 241 ? 0.1577 0.1184 0.1252 -0.0136 -0.0043 0.0145  241 SER A CB  
1958 O OG  . SER A 241 ? 0.1742 0.1315 0.1441 -0.0117 -0.0021 0.0136  241 SER A OG  
1959 N N   . ASP A 242 ? 0.1345 0.0999 0.1060 -0.0128 -0.0039 0.0112  242 ASP A N   
1960 C CA  . ASP A 242 ? 0.1456 0.1119 0.1198 -0.0123 -0.0031 0.0105  242 ASP A CA  
1961 C C   . ASP A 242 ? 0.1351 0.1013 0.1135 -0.0103 -0.0020 0.0107  242 ASP A C   
1962 O O   . ASP A 242 ? 0.1429 0.1099 0.1230 -0.0103 -0.0006 0.0091  242 ASP A O   
1963 C CB  . ASP A 242 ? 0.1294 0.1004 0.1050 -0.0136 -0.0044 0.0111  242 ASP A CB  
1964 C CG  . ASP A 242 ? 0.1501 0.1210 0.1223 -0.0162 -0.0046 0.0096  242 ASP A CG  
1965 O OD1 . ASP A 242 ? 0.1643 0.1309 0.1334 -0.0163 -0.0041 0.0079  242 ASP A OD1 
1966 O OD2 . ASP A 242 ? 0.1933 0.1690 0.1662 -0.0180 -0.0053 0.0097  242 ASP A OD2 
1967 N N   . GLU A 243 ? 0.1355 0.1007 0.1157 -0.0087 -0.0028 0.0125  243 GLU A N   
1968 C CA  . GLU A 243 ? 0.1380 0.1025 0.1230 -0.0064 -0.0019 0.0119  243 GLU A CA  
1969 C C   . GLU A 243 ? 0.1337 0.0959 0.1180 -0.0068 0.0011  0.0096  243 GLU A C   
1970 O O   . GLU A 243 ? 0.1376 0.1022 0.1261 -0.0062 0.0027  0.0075  243 GLU A O   
1971 C CB  . GLU A 243 ? 0.1282 0.0897 0.1145 -0.0044 -0.0038 0.0148  243 GLU A CB  
1972 C CG  . GLU A 243 ? 0.1869 0.1528 0.1757 -0.0029 -0.0068 0.0169  243 GLU A CG  
1973 C CD  . GLU A 243 ? 0.2650 0.2336 0.2492 -0.0056 -0.0083 0.0188  243 GLU A CD  
1974 O OE1 . GLU A 243 ? 0.1891 0.1553 0.1684 -0.0083 -0.0078 0.0189  243 GLU A OE1 
1975 O OE2 . GLU A 243 ? 0.2912 0.2659 0.2772 -0.0052 -0.0100 0.0196  243 GLU A OE2 
1976 N N   . LEU A 244 ? 0.1467 0.1060 0.1257 -0.0082 0.0018  0.0096  244 LEU A N   
1977 C CA  . LEU A 244 ? 0.1531 0.1122 0.1307 -0.0086 0.0047  0.0071  244 LEU A CA  
1978 C C   . LEU A 244 ? 0.1187 0.0807 0.0960 -0.0089 0.0055  0.0054  244 LEU A C   
1979 O O   . LEU A 244 ? 0.1194 0.0838 0.0989 -0.0089 0.0078  0.0037  244 LEU A O   
1980 C CB  . LEU A 244 ? 0.1215 0.0786 0.0928 -0.0102 0.0050  0.0067  244 LEU A CB  
1981 C CG  . LEU A 244 ? 0.1521 0.1109 0.1213 -0.0107 0.0082  0.0035  244 LEU A CG  
1982 C CD1 . LEU A 244 ? 0.1740 0.1325 0.1477 -0.0103 0.0110  0.0023  244 LEU A CD1 
1983 C CD2 . LEU A 244 ? 0.1554 0.1141 0.1180 -0.0128 0.0084  0.0022  244 LEU A CD2 
1984 N N   . ASN A 245 ? 0.1318 0.0935 0.1062 -0.0096 0.0037  0.0060  245 ASN A N   
1985 C CA  . ASN A 245 ? 0.1419 0.1041 0.1151 -0.0101 0.0040  0.0053  245 ASN A CA  
1986 C C   . ASN A 245 ? 0.1316 0.0973 0.1094 -0.0109 0.0047  0.0051  245 ASN A C   
1987 O O   . ASN A 245 ? 0.1452 0.1127 0.1229 -0.0117 0.0060  0.0043  245 ASN A O   
1988 C CB  . ASN A 245 ? 0.1426 0.1025 0.1122 -0.0110 0.0019  0.0057  245 ASN A CB  
1989 C CG  . ASN A 245 ? 0.1272 0.0851 0.0945 -0.0119 0.0018  0.0056  245 ASN A CG  
1990 O OD1 . ASN A 245 ? 0.1716 0.1280 0.1362 -0.0107 0.0024  0.0048  245 ASN A OD1 
1991 N ND2 . ASN A 245 ? 0.1394 0.0977 0.1074 -0.0141 0.0011  0.0064  245 ASN A ND2 
1992 N N   A GLU A 246 ? 0.1133 0.0812 0.0950 -0.0107 0.0036  0.0057  246 GLU A N   
1993 N N   B GLU A 246 ? 0.1159 0.0838 0.0977 -0.0107 0.0036  0.0057  246 GLU A N   
1994 C CA  A GLU A 246 ? 0.1335 0.1070 0.1201 -0.0116 0.0040  0.0045  246 GLU A CA  
1995 C CA  B GLU A 246 ? 0.1291 0.1027 0.1156 -0.0117 0.0040  0.0044  246 GLU A CA  
1996 C C   A GLU A 246 ? 0.1374 0.1143 0.1285 -0.0111 0.0064  0.0023  246 GLU A C   
1997 C C   B GLU A 246 ? 0.1347 0.1118 0.1259 -0.0111 0.0064  0.0023  246 GLU A C   
1998 O O   A GLU A 246 ? 0.1503 0.1322 0.1428 -0.0132 0.0075  0.0008  246 GLU A O   
1999 O O   B GLU A 246 ? 0.1405 0.1227 0.1334 -0.0132 0.0075  0.0007  246 GLU A O   
2000 C CB  A GLU A 246 ? 0.1528 0.1291 0.1433 -0.0102 0.0021  0.0049  246 GLU A CB  
2001 C CB  B GLU A 246 ? 0.1273 0.1042 0.1175 -0.0107 0.0021  0.0047  246 GLU A CB  
2002 C CG  A GLU A 246 ? 0.1679 0.1522 0.1639 -0.0109 0.0021  0.0024  246 GLU A CG  
2003 C CG  B GLU A 246 ? 0.1448 0.1296 0.1392 -0.0123 0.0021  0.0024  246 GLU A CG  
2004 C CD  A GLU A 246 ? 0.1938 0.1820 0.1935 -0.0086 -0.0001 0.0025  246 GLU A CD  
2005 C CD  B GLU A 246 ? 0.1746 0.1643 0.1766 -0.0102 0.0031  -0.0003 246 GLU A CD  
2006 O OE1 A GLU A 246 ? 0.2655 0.2512 0.2683 -0.0049 -0.0011 0.0035  246 GLU A OE1 
2007 O OE1 B GLU A 246 ? 0.2026 0.1881 0.2065 -0.0074 0.0037  0.0001  246 GLU A OE1 
2008 O OE2 A GLU A 246 ? 0.2844 0.2781 0.2834 -0.0107 -0.0010 0.0017  246 GLU A OE2 
2009 O OE2 B GLU A 246 ? 0.2607 0.2590 0.2669 -0.0118 0.0033  -0.0034 246 GLU A OE2 
2010 N N   . ILE A 247 ? 0.1313 0.1060 0.1243 -0.0090 0.0073  0.0020  247 ILE A N   
2011 C CA  . ILE A 247 ? 0.1194 0.0978 0.1177 -0.0087 0.0100  -0.0009 247 ILE A CA  
2012 C C   . ILE A 247 ? 0.1083 0.0887 0.1035 -0.0105 0.0126  -0.0019 247 ILE A C   
2013 O O   . ILE A 247 ? 0.1249 0.1123 0.1241 -0.0120 0.0145  -0.0042 247 ILE A O   
2014 C CB  . ILE A 247 ? 0.1327 0.1067 0.1337 -0.0064 0.0105  -0.0012 247 ILE A CB  
2015 C CG1 . ILE A 247 ? 0.1751 0.1540 0.1833 -0.0063 0.0134  -0.0052 247 ILE A CG1 
2016 C CG2 . ILE A 247 ? 0.1334 0.1012 0.1276 -0.0069 0.0112  0.0004  247 ILE A CG2 
2017 C CD1 . ILE A 247 ? 0.2188 0.1919 0.2303 -0.0040 0.0137  -0.0058 247 ILE A CD1 
2018 N N   . ILE A 248 ? 0.1047 0.0806 0.0932 -0.0103 0.0124  -0.0005 248 ILE A N   
2019 C CA  . ILE A 248 ? 0.1095 0.0880 0.0946 -0.0111 0.0142  -0.0013 248 ILE A CA  
2020 C C   . ILE A 248 ? 0.1064 0.0880 0.0910 -0.0131 0.0133  -0.0003 248 ILE A C   
2021 O O   . ILE A 248 ? 0.1229 0.1106 0.1088 -0.0146 0.0151  -0.0014 248 ILE A O   
2022 C CB  . ILE A 248 ? 0.1351 0.1091 0.1132 -0.0099 0.0135  -0.0007 248 ILE A CB  
2023 C CG1 . ILE A 248 ? 0.1314 0.1039 0.1090 -0.0095 0.0150  -0.0020 248 ILE A CG1 
2024 C CG2 . ILE A 248 ? 0.1710 0.1479 0.1454 -0.0096 0.0144  -0.0013 248 ILE A CG2 
2025 C CD1 . ILE A 248 ? 0.1648 0.1348 0.1355 -0.0091 0.0141  -0.0023 248 ILE A CD1 
2026 N N   . THR A 249 ? 0.1051 0.0829 0.0874 -0.0138 0.0105  0.0016  249 THR A N   
2027 C CA  . THR A 249 ? 0.1318 0.1110 0.1121 -0.0168 0.0095  0.0028  249 THR A CA  
2028 C C   . THR A 249 ? 0.1163 0.1050 0.1029 -0.0196 0.0109  0.0007  249 THR A C   
2029 O O   . THR A 249 ? 0.1397 0.1326 0.1250 -0.0227 0.0114  0.0010  249 THR A O   
2030 C CB  . THR A 249 ? 0.1403 0.1139 0.1170 -0.0177 0.0068  0.0045  249 THR A CB  
2031 O OG1 . THR A 249 ? 0.1530 0.1192 0.1242 -0.0155 0.0056  0.0056  249 THR A OG1 
2032 C CG2 . THR A 249 ? 0.1559 0.1302 0.1297 -0.0220 0.0059  0.0056  249 THR A CG2 
2033 N N   . ARG A 250 ? 0.1110 0.1035 0.1043 -0.0184 0.0113  -0.0016 250 ARG A N   
2034 C CA  . ARG A 250 ? 0.1206 0.1238 0.1214 -0.0205 0.0125  -0.0051 250 ARG A CA  
2035 C C   . ARG A 250 ? 0.1137 0.1232 0.1174 -0.0214 0.0157  -0.0072 250 ARG A C   
2036 O O   . ARG A 250 ? 0.1309 0.1504 0.1379 -0.0252 0.0168  -0.0092 250 ARG A O   
2037 C CB  . ARG A 250 ? 0.1232 0.1283 0.1313 -0.0175 0.0120  -0.0076 250 ARG A CB  
2038 C CG  . ARG A 250 ? 0.1969 0.1999 0.2036 -0.0169 0.0090  -0.0063 250 ARG A CG  
2039 C CD  . ARG A 250 ? 0.2748 0.2839 0.2794 -0.0218 0.0081  -0.0069 250 ARG A CD  
2040 N NE  . ARG A 250 ? 0.3178 0.3398 0.3300 -0.0237 0.0087  -0.0118 250 ARG A NE  
2041 C CZ  . ARG A 250 ? 0.3591 0.3894 0.3701 -0.0291 0.0081  -0.0135 250 ARG A CZ  
2042 N NH1 . ARG A 250 ? 0.2584 0.2834 0.2605 -0.0330 0.0071  -0.0101 250 ARG A NH1 
2043 N NH2 . ARG A 250 ? 0.3138 0.3580 0.3325 -0.0309 0.0086  -0.0190 250 ARG A NH2 
2044 N N   . MET A 251 ? 0.1037 0.1089 0.1061 -0.0187 0.0175  -0.0071 251 MET A N   
2045 C CA  . MET A 251 ? 0.1195 0.1318 0.1242 -0.0198 0.0210  -0.0094 251 MET A CA  
2046 C C   . MET A 251 ? 0.1310 0.1466 0.1303 -0.0224 0.0209  -0.0070 251 MET A C   
2047 O O   . MET A 251 ? 0.1307 0.1553 0.1323 -0.0244 0.0228  -0.0091 251 MET A O   
2048 C CB  . MET A 251 ? 0.1227 0.1300 0.1256 -0.0170 0.0230  -0.0099 251 MET A CB  
2049 C CG  . MET A 251 ? 0.1031 0.1060 0.1107 -0.0147 0.0232  -0.0117 251 MET A CG  
2050 S SD  . MET A 251 ? 0.1561 0.1538 0.1596 -0.0136 0.0260  -0.0125 251 MET A SD  
2051 C CE  . MET A 251 ? 0.1838 0.1717 0.1898 -0.0112 0.0242  -0.0119 251 MET A CE  
2052 N N   . LEU A 252 ? 0.1118 0.1189 0.1033 -0.0221 0.0178  -0.0030 252 LEU A N   
2053 C CA  . LEU A 252 ? 0.1427 0.1495 0.1278 -0.0239 0.0167  0.0001  252 LEU A CA  
2054 C C   . LEU A 252 ? 0.1170 0.1263 0.1009 -0.0290 0.0148  0.0017  252 LEU A C   
2055 O O   . LEU A 252 ? 0.1644 0.1686 0.1410 -0.0307 0.0127  0.0055  252 LEU A O   
2056 C CB  . LEU A 252 ? 0.1513 0.1466 0.1283 -0.0202 0.0144  0.0030  252 LEU A CB  
2057 C CG  . LEU A 252 ? 0.1322 0.1274 0.1089 -0.0162 0.0163  0.0010  252 LEU A CG  
2058 C CD1 . LEU A 252 ? 0.1516 0.1372 0.1213 -0.0127 0.0137  0.0026  252 LEU A CD1 
2059 C CD2 . LEU A 252 ? 0.1593 0.1645 0.1370 -0.0168 0.0194  -0.0004 252 LEU A CD2 
2060 N N   . ASN A 253 ? 0.1319 0.1284 0.1157 -0.0267 0.0302  -0.0057 253 ASN A N   
2061 C CA  . ASN A 253 ? 0.1222 0.1206 0.1083 -0.0287 0.0321  -0.0068 253 ASN A CA  
2062 C C   . ASN A 253 ? 0.1465 0.1460 0.1275 -0.0336 0.0331  -0.0074 253 ASN A C   
2063 O O   . ASN A 253 ? 0.1835 0.1818 0.1600 -0.0364 0.0342  -0.0084 253 ASN A O   
2064 C CB  . ASN A 253 ? 0.1390 0.1381 0.1316 -0.0281 0.0360  -0.0094 253 ASN A CB  
2065 C CG  . ASN A 253 ? 0.1872 0.1893 0.1851 -0.0288 0.0371  -0.0092 253 ASN A CG  
2066 O OD1 . ASN A 253 ? 0.2041 0.2077 0.2005 -0.0321 0.0392  -0.0103 253 ASN A OD1 
2067 N ND2 . ASN A 253 ? 0.1917 0.1948 0.1957 -0.0264 0.0355  -0.0076 253 ASN A ND2 
2068 N N   . LEU A 254 ? 0.1613 0.1627 0.1421 -0.0353 0.0325  -0.0063 254 LEU A N   
2069 C CA  . LEU A 254 ? 0.1874 0.1901 0.1630 -0.0407 0.0331  -0.0064 254 LEU A CA  
2070 C C   . LEU A 254 ? 0.2175 0.2194 0.1916 -0.0445 0.0386  -0.0104 254 LEU A C   
2071 O O   . LEU A 254 ? 0.2688 0.2698 0.2359 -0.0499 0.0397  -0.0111 254 LEU A O   
2072 C CB  . LEU A 254 ? 0.1765 0.1815 0.1528 -0.0418 0.0315  -0.0044 254 LEU A CB  
2073 C CG  . LEU A 254 ? 0.2067 0.2117 0.1829 -0.0394 0.0271  -0.0002 254 LEU A CG  
2074 C CD1 . LEU A 254 ? 0.2290 0.2352 0.2060 -0.0406 0.0260  0.0016  254 LEU A CD1 
2075 C CD2 . LEU A 254 ? 0.2331 0.2389 0.2051 -0.0414 0.0248  0.0025  254 LEU A CD2 
2076 N N   . LYS A 255 ? 0.1934 0.1953 0.1742 -0.0421 0.0423  -0.0128 255 LYS A N   
2077 C CA  . LYS A 255 ? 0.1974 0.1982 0.1788 -0.0447 0.0491  -0.0167 255 LYS A CA  
2078 C C   . LYS A 255 ? 0.2336 0.2305 0.2138 -0.0436 0.0513  -0.0186 255 LYS A C   
2079 O O   . LYS A 255 ? 0.2059 0.2029 0.1921 -0.0388 0.0500  -0.0179 255 LYS A O   
2080 C CB  . LYS A 255 ? 0.1941 0.1982 0.1860 -0.0422 0.0525  -0.0174 255 LYS A CB  
2081 C CG  . LYS A 255 ? 0.2935 0.3014 0.2872 -0.0434 0.0504  -0.0153 255 LYS A CG  
2082 C CD  . LYS A 255 ? 0.3782 0.3862 0.3651 -0.0495 0.0535  -0.0168 255 LYS A CD  
2083 C CE  . LYS A 255 ? 0.4959 0.5081 0.4858 -0.0508 0.0521  -0.0147 255 LYS A CE  
2084 N NZ  . LYS A 255 ? 0.5537 0.5662 0.5366 -0.0573 0.0551  -0.0160 255 LYS A NZ  
2085 N N   . ASP A 256 ? 0.2002 0.1934 0.1720 -0.0487 0.0547  -0.0209 256 ASP A N   
2086 C CA  . ASP A 256 ? 0.2152 0.2038 0.1847 -0.0484 0.0571  -0.0227 256 ASP A CA  
2087 C C   . ASP A 256 ? 0.2267 0.2153 0.2066 -0.0437 0.0623  -0.0250 256 ASP A C   
2088 O O   . ASP A 256 ? 0.2033 0.1904 0.1862 -0.0403 0.0616  -0.0248 256 ASP A O   
2089 C CB  . ASP A 256 ? 0.2116 0.1950 0.1688 -0.0558 0.0606  -0.0250 256 ASP A CB  
2090 C CG  . ASP A 256 ? 0.3406 0.3225 0.2951 -0.0603 0.0679  -0.0284 256 ASP A CG  
2091 O OD1 . ASP A 256 ? 0.4024 0.3788 0.3452 -0.0672 0.0716  -0.0305 256 ASP A OD1 
2092 O OD2 . ASP A 256 ? 0.3258 0.3118 0.2893 -0.0574 0.0701  -0.0287 256 ASP A OD2 
2093 N N   . TYR A 257 ? 0.2182 0.2092 0.2047 -0.0435 0.0674  -0.0266 257 TYR A N   
2094 C CA  . TYR A 257 ? 0.2154 0.2075 0.2140 -0.0390 0.0730  -0.0282 257 TYR A CA  
2095 C C   . TYR A 257 ? 0.2402 0.2373 0.2506 -0.0331 0.0679  -0.0248 257 TYR A C   
2096 O O   . TYR A 257 ? 0.2695 0.2683 0.2912 -0.0292 0.0711  -0.0252 257 TYR A O   
2097 C CB  . TYR A 257 ? 0.2310 0.2246 0.2343 -0.0406 0.0811  -0.0308 257 TYR A CB  
2098 C CG  . TYR A 257 ? 0.2646 0.2637 0.2701 -0.0420 0.0783  -0.0285 257 TYR A CG  
2099 C CD1 . TYR A 257 ? 0.2726 0.2703 0.2674 -0.0482 0.0793  -0.0295 257 TYR A CD1 
2100 C CD2 . TYR A 257 ? 0.2584 0.2640 0.2761 -0.0379 0.0746  -0.0252 257 TYR A CD2 
2101 C CE1 . TYR A 257 ? 0.2715 0.2743 0.2682 -0.0496 0.0769  -0.0274 257 TYR A CE1 
2102 C CE2 . TYR A 257 ? 0.2617 0.2719 0.2808 -0.0396 0.0722  -0.0231 257 TYR A CE2 
2103 C CZ  . TYR A 257 ? 0.2869 0.2957 0.2957 -0.0451 0.0734  -0.0242 257 TYR A CZ  
2104 O OH  . TYR A 257 ? 0.3123 0.3257 0.3225 -0.0469 0.0708  -0.0219 257 TYR A OH  
2105 N N   . HIS A 258 ? 0.1783 0.1774 0.1860 -0.0326 0.0602  -0.0214 258 HIS A N   
2106 C CA  . HIS A 258 ? 0.1721 0.1742 0.1877 -0.0282 0.0553  -0.0183 258 HIS A CA  
2107 C C   . HIS A 258 ? 0.1852 0.1841 0.1964 -0.0263 0.0515  -0.0173 258 HIS A C   
2108 O O   . HIS A 258 ? 0.2031 0.2034 0.2204 -0.0229 0.0487  -0.0152 258 HIS A O   
2109 C CB  . HIS A 258 ? 0.1807 0.1857 0.1957 -0.0285 0.0500  -0.0152 258 HIS A CB  
2110 C CG  . HIS A 258 ? 0.1985 0.2081 0.2209 -0.0296 0.0526  -0.0149 258 HIS A CG  
2111 N ND1 . HIS A 258 ? 0.2016 0.2144 0.2358 -0.0285 0.0582  -0.0160 258 HIS A ND1 
2112 C CD2 . HIS A 258 ? 0.1947 0.2065 0.2152 -0.0318 0.0503  -0.0133 258 HIS A CD2 
2113 C CE1 . HIS A 258 ? 0.1827 0.2000 0.2220 -0.0300 0.0592  -0.0149 258 HIS A CE1 
2114 N NE2 . HIS A 258 ? 0.1789 0.1954 0.2095 -0.0323 0.0543  -0.0134 258 HIS A NE2 
2115 N N   . ARG A 259 ? 0.1507 0.1455 0.1513 -0.0290 0.0513  -0.0184 259 ARG A N   
2116 C CA  . ARG A 259 ? 0.1396 0.1318 0.1365 -0.0275 0.0480  -0.0172 259 ARG A CA  
2117 C C   . ARG A 259 ? 0.1639 0.1545 0.1663 -0.0255 0.0522  -0.0191 259 ARG A C   
2118 O O   . ARG A 259 ? 0.1784 0.1677 0.1833 -0.0266 0.0588  -0.0223 259 ARG A O   
2119 C CB  . ARG A 259 ? 0.1621 0.1513 0.1475 -0.0316 0.0464  -0.0171 259 ARG A CB  
2120 C CG  . ARG A 259 ? 0.1528 0.1443 0.1340 -0.0334 0.0424  -0.0148 259 ARG A CG  
2121 C CD  . ARG A 259 ? 0.1498 0.1397 0.1212 -0.0384 0.0411  -0.0142 259 ARG A CD  
2122 N NE  . ARG A 259 ? 0.1877 0.1803 0.1564 -0.0412 0.0392  -0.0126 259 ARG A NE  
2123 C CZ  . ARG A 259 ? 0.1858 0.1779 0.1467 -0.0473 0.0397  -0.0126 259 ARG A CZ  
2124 N NH1 . ARG A 259 ? 0.1920 0.1802 0.1460 -0.0518 0.0421  -0.0144 259 ARG A NH1 
2125 N NH2 . ARG A 259 ? 0.1986 0.1937 0.1581 -0.0496 0.0376  -0.0107 259 ARG A NH2 
2126 N N   . PRO A 260 ? 0.1353 0.1257 0.1398 -0.0224 0.0490  -0.0173 260 PRO A N   
2127 C CA  . PRO A 260 ? 0.1810 0.1687 0.1914 -0.0200 0.0514  -0.0191 260 PRO A CA  
2128 C C   . PRO A 260 ? 0.1540 0.1362 0.1559 -0.0230 0.0555  -0.0219 260 PRO A C   
2129 O O   . PRO A 260 ? 0.1609 0.1418 0.1520 -0.0265 0.0536  -0.0209 260 PRO A O   
2130 C CB  . PRO A 260 ? 0.1487 0.1363 0.1607 -0.0168 0.0451  -0.0161 260 PRO A CB  
2131 C CG  . PRO A 260 ? 0.1890 0.1778 0.1919 -0.0185 0.0414  -0.0135 260 PRO A CG  
2132 C CD  . PRO A 260 ? 0.1613 0.1520 0.1621 -0.0209 0.0424  -0.0139 260 PRO A CD  
2133 N N   . SER A 261 ? 0.1464 0.1248 0.1532 -0.0219 0.0608  -0.0252 261 SER A N   
2134 C CA  . SER A 261 ? 0.1716 0.1427 0.1699 -0.0246 0.0645  -0.0281 261 SER A CA  
2135 C C   . SER A 261 ? 0.1512 0.1202 0.1475 -0.0230 0.0593  -0.0260 261 SER A C   
2136 O O   . SER A 261 ? 0.1654 0.1382 0.1684 -0.0193 0.0538  -0.0229 261 SER A O   
2137 C CB  . SER A 261 ? 0.2048 0.1714 0.2101 -0.0228 0.0724  -0.0322 261 SER A CB  
2138 O OG  . SER A 261 ? 0.2011 0.1697 0.2210 -0.0169 0.0704  -0.0306 261 SER A OG  
2139 N N   . VAL A 262 ? 0.1738 0.1362 0.1603 -0.0263 0.0610  -0.0277 262 VAL A N   
2140 C CA  . VAL A 262 ? 0.1745 0.1344 0.1595 -0.0250 0.0567  -0.0260 262 VAL A CA  
2141 C C   . VAL A 262 ? 0.1825 0.1424 0.1811 -0.0191 0.0561  -0.0259 262 VAL A C   
2142 O O   . VAL A 262 ? 0.1819 0.1443 0.1840 -0.0165 0.0501  -0.0226 262 VAL A O   
2143 C CB  . VAL A 262 ? 0.2286 0.1798 0.2018 -0.0298 0.0597  -0.0285 262 VAL A CB  
2144 C CG1 . VAL A 262 ? 0.3004 0.2474 0.2755 -0.0275 0.0571  -0.0278 262 VAL A CG1 
2145 C CG2 . VAL A 262 ? 0.2569 0.2092 0.2167 -0.0361 0.0569  -0.0260 262 VAL A CG2 
2146 N N   . GLU A 263 ? 0.1893 0.1465 0.1959 -0.0173 0.0625  -0.0291 263 GLU A N   
2147 C CA  . GLU A 263 ? 0.1988 0.1563 0.2203 -0.0118 0.0622  -0.0283 263 GLU A CA  
2148 C C   . GLU A 263 ? 0.2031 0.1689 0.2345 -0.0087 0.0559  -0.0240 263 GLU A C   
2149 O O   . GLU A 263 ? 0.2002 0.1671 0.2379 -0.0060 0.0506  -0.0210 263 GLU A O   
2150 C CB  . GLU A 263 ? 0.2300 0.1837 0.2596 -0.0102 0.0713  -0.0321 263 GLU A CB  
2151 C CG  . GLU A 263 ? 0.3427 0.2852 0.3622 -0.0129 0.0778  -0.0368 263 GLU A CG  
2152 C CD  . GLU A 263 ? 0.3682 0.3072 0.3697 -0.0199 0.0806  -0.0394 263 GLU A CD  
2153 O OE1 . GLU A 263 ? 0.4270 0.3565 0.4159 -0.0238 0.0831  -0.0421 263 GLU A OE1 
2154 O OE2 . GLU A 263 ? 0.3065 0.2516 0.3061 -0.0218 0.0801  -0.0386 263 GLU A OE2 
2155 N N   . GLU A 264 ? 0.1536 0.1247 0.1852 -0.0098 0.0563  -0.0235 264 GLU A N   
2156 C CA  . GLU A 264 ? 0.1386 0.1163 0.1775 -0.0078 0.0505  -0.0196 264 GLU A CA  
2157 C C   . GLU A 264 ? 0.1514 0.1299 0.1826 -0.0083 0.0431  -0.0165 264 GLU A C   
2158 O O   . GLU A 264 ? 0.1803 0.1609 0.2169 -0.0063 0.0376  -0.0133 264 GLU A O   
2159 C CB  . GLU A 264 ? 0.1459 0.1282 0.1854 -0.0094 0.0529  -0.0200 264 GLU A CB  
2160 C CG  . GLU A 264 ? 0.1681 0.1514 0.2195 -0.0079 0.0598  -0.0220 264 GLU A CG  
2161 C CD  . GLU A 264 ? 0.3140 0.3009 0.3638 -0.0104 0.0635  -0.0231 264 GLU A CD  
2162 O OE1 . GLU A 264 ? 0.3364 0.3269 0.3986 -0.0087 0.0671  -0.0228 264 GLU A OE1 
2163 O OE2 . GLU A 264 ? 0.2331 0.2196 0.2701 -0.0142 0.0627  -0.0237 264 GLU A OE2 
2164 N N   . ILE A 265 ? 0.1304 0.1069 0.1487 -0.0113 0.0429  -0.0170 265 ILE A N   
2165 C CA  . ILE A 265 ? 0.1268 0.1041 0.1387 -0.0114 0.0370  -0.0138 265 ILE A CA  
2166 C C   . ILE A 265 ? 0.1220 0.0965 0.1374 -0.0091 0.0338  -0.0125 265 ILE A C   
2167 O O   . ILE A 265 ? 0.1270 0.1028 0.1441 -0.0075 0.0286  -0.0095 265 ILE A O   
2168 C CB  . ILE A 265 ? 0.1245 0.1008 0.1239 -0.0152 0.0377  -0.0137 265 ILE A CB  
2169 C CG1 . ILE A 265 ? 0.1272 0.1069 0.1231 -0.0175 0.0392  -0.0136 265 ILE A CG1 
2170 C CG2 . ILE A 265 ? 0.1274 0.1042 0.1216 -0.0147 0.0326  -0.0101 265 ILE A CG2 
2171 C CD1 . ILE A 265 ? 0.1827 0.1616 0.1675 -0.0222 0.0404  -0.0133 265 ILE A CD1 
2172 N N   . LEU A 266 ? 0.1387 0.1086 0.1546 -0.0094 0.0369  -0.0148 266 LEU A N   
2173 C CA  . LEU A 266 ? 0.1421 0.1089 0.1603 -0.0078 0.0338  -0.0134 266 LEU A CA  
2174 C C   . LEU A 266 ? 0.1538 0.1221 0.1856 -0.0043 0.0311  -0.0115 266 LEU A C   
2175 O O   . LEU A 266 ? 0.1655 0.1324 0.1992 -0.0032 0.0265  -0.0090 266 LEU A O   
2176 C CB  . LEU A 266 ? 0.1643 0.1244 0.1786 -0.0094 0.0380  -0.0165 266 LEU A CB  
2177 C CG  . LEU A 266 ? 0.1592 0.1175 0.1590 -0.0140 0.0388  -0.0171 266 LEU A CG  
2178 C CD1 . LEU A 266 ? 0.2084 0.1586 0.2031 -0.0165 0.0438  -0.0207 266 LEU A CD1 
2179 C CD2 . LEU A 266 ? 0.1516 0.1120 0.1455 -0.0146 0.0327  -0.0130 266 LEU A CD2 
2180 N N   . GLU A 267 ? 0.1322 0.1035 0.1734 -0.0030 0.0336  -0.0120 267 GLU A N   
2181 C CA  . GLU A 267 ? 0.1673 0.1413 0.2226 -0.0003 0.0304  -0.0090 267 GLU A CA  
2182 C C   . GLU A 267 ? 0.1507 0.1279 0.2038 -0.0009 0.0233  -0.0051 267 GLU A C   
2183 O O   . GLU A 267 ? 0.1508 0.1297 0.2132 0.0001  0.0188  -0.0016 267 GLU A O   
2184 C CB  . GLU A 267 ? 0.2205 0.1971 0.2879 0.0011  0.0359  -0.0102 267 GLU A CB  
2185 C CG  . GLU A 267 ? 0.3415 0.3135 0.4132 0.0024  0.0438  -0.0139 267 GLU A CG  
2186 C CD  . GLU A 267 ? 0.5602 0.5351 0.6424 0.0036  0.0506  -0.0154 267 GLU A CD  
2187 O OE1 . GLU A 267 ? 0.5325 0.5133 0.6164 0.0027  0.0489  -0.0138 267 GLU A OE1 
2188 O OE2 . GLU A 267 ? 0.5976 0.5686 0.6863 0.0053  0.0579  -0.0181 267 GLU A OE2 
2189 N N   . ASN A 268 ? 0.1541 0.1317 0.1947 -0.0029 0.0224  -0.0055 268 ASN A N   
2190 C CA  . ASN A 268 ? 0.1342 0.1131 0.1710 -0.0035 0.0170  -0.0025 268 ASN A CA  
2191 C C   . ASN A 268 ? 0.1371 0.1136 0.1731 -0.0033 0.0109  0.0006  268 ASN A C   
2192 O O   . ASN A 268 ? 0.1375 0.1115 0.1688 -0.0033 0.0107  0.0004  268 ASN A O   
2193 C CB  . ASN A 268 ? 0.1309 0.1101 0.1552 -0.0051 0.0180  -0.0033 268 ASN A CB  
2194 C CG  . ASN A 268 ? 0.1608 0.1404 0.1815 -0.0057 0.0142  -0.0011 268 ASN A CG  
2195 O OD1 . ASN A 268 ? 0.1541 0.1311 0.1707 -0.0057 0.0098  0.0012  268 ASN A OD1 
2196 N ND2 . ASN A 268 ? 0.1644 0.1464 0.1856 -0.0064 0.0161  -0.0018 268 ASN A ND2 
2197 N N   . PRO A 269 ? 0.1303 0.1073 0.1705 -0.0037 0.0058  0.0039  269 PRO A N   
2198 C CA  . PRO A 269 ? 0.1730 0.1472 0.2116 -0.0044 -0.0003 0.0071  269 PRO A CA  
2199 C C   . PRO A 269 ? 0.1438 0.1146 0.1678 -0.0053 -0.0014 0.0071  269 PRO A C   
2200 O O   . PRO A 269 ? 0.1774 0.1456 0.1993 -0.0058 -0.0051 0.0091  269 PRO A O   
2201 C CB  . PRO A 269 ? 0.1909 0.1656 0.2333 -0.0060 -0.0056 0.0106  269 PRO A CB  
2202 C CG  . PRO A 269 ? 0.1923 0.1717 0.2461 -0.0050 -0.0021 0.0097  269 PRO A CG  
2203 C CD  . PRO A 269 ? 0.1613 0.1415 0.2094 -0.0041 0.0050  0.0051  269 PRO A CD  
2204 N N   . LEU A 270 ? 0.1340 0.1053 0.1488 -0.0056 0.0019  0.0053  270 LEU A N   
2205 C CA  . LEU A 270 ? 0.1268 0.0959 0.1297 -0.0060 0.0021  0.0057  270 LEU A CA  
2206 C C   . LEU A 270 ? 0.1314 0.1002 0.1334 -0.0056 0.0032  0.0053  270 LEU A C   
2207 O O   . LEU A 270 ? 0.1571 0.1241 0.1519 -0.0061 0.0017  0.0069  270 LEU A O   
2208 C CB  . LEU A 270 ? 0.1534 0.1240 0.1496 -0.0059 0.0060  0.0043  270 LEU A CB  
2209 C CG  . LEU A 270 ? 0.1692 0.1384 0.1610 -0.0065 0.0052  0.0049  270 LEU A CG  
2210 C CD1 . LEU A 270 ? 0.2520 0.2161 0.2337 -0.0069 0.0029  0.0068  270 LEU A CD1 
2211 C CD2 . LEU A 270 ? 0.1919 0.1637 0.1812 -0.0063 0.0096  0.0035  270 LEU A CD2 
2212 N N   . ILE A 271 ? 0.1200 0.0901 0.1286 -0.0051 0.0063  0.0031  271 ILE A N   
2213 C CA  . ILE A 271 ? 0.1336 0.1025 0.1393 -0.0056 0.0081  0.0023  271 ILE A CA  
2214 C C   . ILE A 271 ? 0.1243 0.0905 0.1356 -0.0051 0.0051  0.0034  271 ILE A C   
2215 O O   . ILE A 271 ? 0.1456 0.1114 0.1675 -0.0039 0.0051  0.0030  271 ILE A O   
2216 C CB  . ILE A 271 ? 0.1190 0.0888 0.1258 -0.0061 0.0136  -0.0010 271 ILE A CB  
2217 C CG1 . ILE A 271 ? 0.1481 0.1206 0.1476 -0.0073 0.0158  -0.0012 271 ILE A CG1 
2218 C CG2 . ILE A 271 ? 0.1463 0.1131 0.1504 -0.0073 0.0151  -0.0020 271 ILE A CG2 
2219 C CD1 . ILE A 271 ? 0.1825 0.1556 0.1813 -0.0090 0.0209  -0.0041 271 ILE A CD1 
2220 N N   . LEU A 272 ? 0.1141 0.0787 0.1188 -0.0060 0.0026  0.0054  272 LEU A N   
2221 C CA  . LEU A 272 ? 0.1201 0.0818 0.1288 -0.0059 -0.0012 0.0071  272 LEU A CA  
2222 C C   . LEU A 272 ? 0.1358 0.0955 0.1399 -0.0070 0.0000  0.0067  272 LEU A C   
2223 O O   . LEU A 272 ? 0.1300 0.0910 0.1269 -0.0083 0.0031  0.0057  272 LEU A O   
2224 C CB  . LEU A 272 ? 0.1151 0.0760 0.1197 -0.0068 -0.0066 0.0106  272 LEU A CB  
2225 C CG  . LEU A 272 ? 0.1406 0.1022 0.1481 -0.0068 -0.0087 0.0115  272 LEU A CG  
2226 C CD1 . LEU A 272 ? 0.1979 0.1568 0.1968 -0.0087 -0.0132 0.0145  272 LEU A CD1 
2227 C CD2 . LEU A 272 ? 0.1523 0.1143 0.1739 -0.0059 -0.0105 0.0122  272 LEU A CD2 
2228 N N   . GLU A 273 ? 0.1250 0.0815 0.1334 -0.0070 -0.0027 0.0078  273 GLU A N   
2229 C CA  . GLU A 273 ? 0.1302 0.0836 0.1341 -0.0084 -0.0020 0.0075  273 GLU A CA  
2230 C C   . GLU A 273 ? 0.1207 0.0763 0.1132 -0.0106 -0.0026 0.0094  273 GLU A C   
2231 O O   . GLU A 273 ? 0.1201 0.0754 0.1070 -0.0124 -0.0001 0.0085  273 GLU A O   
2232 C CB  . GLU A 273 ? 0.1394 0.0889 0.1492 -0.0081 -0.0060 0.0094  273 GLU A CB  
2233 C CG  . GLU A 273 ? 0.1354 0.0798 0.1433 -0.0093 -0.0042 0.0078  273 GLU A CG  
2234 C CD  . GLU A 273 ? 0.1413 0.0860 0.1375 -0.0124 -0.0057 0.0097  273 GLU A CD  
2235 O OE1 . GLU A 273 ? 0.1655 0.1064 0.1570 -0.0144 -0.0032 0.0079  273 GLU A OE1 
2236 O OE2 . GLU A 273 ? 0.1589 0.1071 0.1502 -0.0131 -0.0090 0.0130  273 GLU A OE2 
2237 N N   . HIS A 274 ? 0.1376 0.0951 0.1263 -0.0106 -0.0058 0.0124  274 HIS A N   
2238 C CA  . HIS A 274 ? 0.1518 0.1117 0.1313 -0.0121 -0.0058 0.0150  274 HIS A CA  
2239 C C   . HIS A 274 ? 0.1516 0.1153 0.1268 -0.0123 -0.0015 0.0143  274 HIS A C   
2240 O O   . HIS A 274 ? 0.1542 0.1205 0.1238 -0.0137 -0.0009 0.0168  274 HIS A O   
2241 C CB  . HIS A 274 ? 0.1336 0.0935 0.1092 -0.0121 -0.0090 0.0180  274 HIS A CB  
2242 C CG  . HIS A 274 ? 0.1548 0.1156 0.1288 -0.0108 -0.0078 0.0175  274 HIS A CG  
2243 N ND1 . HIS A 274 ? 0.1379 0.0972 0.1179 -0.0100 -0.0094 0.0162  274 HIS A ND1 
2244 C CD2 . HIS A 274 ? 0.1537 0.1163 0.1210 -0.0104 -0.0052 0.0184  274 HIS A CD2 
2245 C CE1 . HIS A 274 ? 0.1479 0.1076 0.1237 -0.0096 -0.0082 0.0161  274 HIS A CE1 
2246 N NE2 . HIS A 274 ? 0.1541 0.1152 0.1221 -0.0096 -0.0053 0.0172  274 HIS A NE2 
2247 N N   . HIS A 275 ? 0.1299 0.0944 0.1086 -0.0112 0.0013  0.0115  275 HIS A N   
2248 C CA  . HIS A 275 ? 0.1180 0.0860 0.0933 -0.0119 0.0050  0.0110  275 HIS A CA  
2249 C C   . HIS A 275 ? 0.1304 0.0975 0.1038 -0.0145 0.0071  0.0097  275 HIS A C   
2250 O O   . HIS A 275 ? 0.1360 0.1060 0.1056 -0.0163 0.0093  0.0104  275 HIS A O   
2251 C CB  . HIS A 275 ? 0.1187 0.0877 0.0975 -0.0103 0.0070  0.0087  275 HIS A CB  
2252 C CG  . HIS A 275 ? 0.1284 0.0973 0.1068 -0.0086 0.0051  0.0100  275 HIS A CG  
2253 N ND1 . HIS A 275 ? 0.1373 0.1043 0.1213 -0.0075 0.0032  0.0088  275 HIS A ND1 
2254 C CD2 . HIS A 275 ? 0.1257 0.0953 0.0980 -0.0081 0.0050  0.0125  275 HIS A CD2 
2255 C CE1 . HIS A 275 ? 0.1320 0.0980 0.1121 -0.0072 0.0015  0.0104  275 HIS A CE1 
2256 N NE2 . HIS A 275 ? 0.1273 0.0942 0.0999 -0.0073 0.0030  0.0123  275 HIS A NE2 
2257 N N   . HIS A 276 ? 0.1395 0.1018 0.1152 -0.0152 0.0063  0.0080  276 HIS A N   
2258 C CA  . HIS A 276 ? 0.1405 0.0994 0.1126 -0.0184 0.0085  0.0062  276 HIS A CA  
2259 C C   . HIS A 276 ? 0.1251 0.0844 0.0904 -0.0216 0.0059  0.0100  276 HIS A C   
2260 O O   . HIS A 276 ? 0.1351 0.0976 0.0996 -0.0208 0.0030  0.0138  276 HIS A O   
2261 C CB  . HIS A 276 ? 0.1377 0.0900 0.1155 -0.0175 0.0096  0.0026  276 HIS A CB  
2262 C CG  . HIS A 276 ? 0.1032 0.0555 0.0888 -0.0147 0.0128  -0.0007 276 HIS A CG  
2263 N ND1 . HIS A 276 ? 0.1239 0.0794 0.1167 -0.0115 0.0108  0.0003  276 HIS A ND1 
2264 C CD2 . HIS A 276 ? 0.1223 0.0715 0.1095 -0.0151 0.0179  -0.0048 276 HIS A CD2 
2265 C CE1 . HIS A 276 ? 0.1337 0.0890 0.1333 -0.0099 0.0142  -0.0026 276 HIS A CE1 
2266 N NE2 . HIS A 276 ? 0.1246 0.0762 0.1212 -0.0118 0.0190  -0.0059 276 HIS A NE2 
2267 N N   . HIS A 277 ? 0.1389 0.0946 0.0987 -0.0257 0.0070  0.0092  277 HIS A N   
2268 C CA  . HIS A 277 ? 0.1750 0.1312 0.1283 -0.0296 0.0042  0.0134  277 HIS A CA  
2269 C C   . HIS A 277 ? 0.1614 0.1139 0.1161 -0.0290 0.0006  0.0145  277 HIS A C   
2270 O O   . HIS A 277 ? 0.1700 0.1170 0.1297 -0.0268 0.0009  0.0112  277 HIS A O   
2271 C CB  . HIS A 277 ? 0.1496 0.1015 0.0951 -0.0353 0.0057  0.0123  277 HIS A CB  
2272 C CG  . HIS A 277 ? 0.1518 0.0931 0.0955 -0.0367 0.0069  0.0079  277 HIS A CG  
2273 N ND1 . HIS A 277 ? 0.2190 0.1552 0.1583 -0.0396 0.0040  0.0095  277 HIS A ND1 
2274 C CD2 . HIS A 277 ? 0.1786 0.1132 0.1248 -0.0353 0.0114  0.0021  277 HIS A CD2 
2275 C CE1 . HIS A 277 ? 0.2104 0.1364 0.1493 -0.0398 0.0066  0.0046  277 HIS A CE1 
2276 N NE2 . HIS A 277 ? 0.2282 0.1531 0.1715 -0.0370 0.0115  0.0001  277 HIS A NE2 
2277 N N   . HIS A 278 ? 0.1407 0.0968 0.0917 -0.0310 -0.0026 0.0196  278 HIS A N   
2278 C CA  . HIS A 278 ? 0.1557 0.1083 0.1062 -0.0318 -0.0064 0.0214  278 HIS A CA  
2279 C C   . HIS A 278 ? 0.2028 0.1579 0.1468 -0.0368 -0.0089 0.0257  278 HIS A C   
2280 O O   . HIS A 278 ? 0.2115 0.1767 0.1573 -0.0365 -0.0101 0.0280  278 HIS A O   
2281 C CB  . HIS A 278 ? 0.1762 0.1323 0.1311 -0.0282 -0.0088 0.0237  278 HIS A CB  
2282 C CG  . HIS A 278 ? 0.1495 0.1045 0.1112 -0.0239 -0.0075 0.0201  278 HIS A CG  
2283 N ND1 . HIS A 278 ? 0.1340 0.0932 0.0973 -0.0217 -0.0046 0.0190  278 HIS A ND1 
2284 C CD2 . HIS A 278 ? 0.1721 0.1224 0.1401 -0.0217 -0.0090 0.0180  278 HIS A CD2 
2285 C CE1 . HIS A 278 ? 0.1320 0.0892 0.1017 -0.0186 -0.0046 0.0164  278 HIS A CE1 
2286 N NE2 . HIS A 278 ? 0.1774 0.1295 0.1505 -0.0185 -0.0073 0.0160  278 HIS A NE2 
2287 N N   . HIS A 279 ? 0.2283 0.1754 0.1670 -0.0410 -0.0100 0.0253  279 HIS A N   
2288 C CA  . HIS A 279 ? 0.2480 0.1979 0.1803 -0.0466 -0.0130 0.0291  279 HIS A CA  
2289 C C   . HIS A 279 ? 0.4138 0.3633 0.3455 -0.0479 -0.0177 0.0325  279 HIS A C   
2290 O O   . HIS A 279 ? 0.3595 0.3128 0.2879 -0.0526 -0.0212 0.0359  279 HIS A O   
2291 C CB  . HIS A 279 ? 0.3199 0.2613 0.2434 -0.0525 -0.0110 0.0272  279 HIS A CB  
2292 C CG  . HIS A 279 ? 0.3304 0.2771 0.2532 -0.0532 -0.0084 0.0259  279 HIS A CG  
2293 N ND1 . HIS A 279 ? 0.3021 0.2473 0.2285 -0.0496 -0.0035 0.0219  279 HIS A ND1 
2294 C CD2 . HIS A 279 ? 0.3848 0.3384 0.3050 -0.0574 -0.0106 0.0286  279 HIS A CD2 
2295 C CE1 . HIS A 279 ? 0.2718 0.2226 0.1966 -0.0514 -0.0027 0.0219  279 HIS A CE1 
2296 N NE2 . HIS A 279 ? 0.3843 0.3401 0.3058 -0.0562 -0.0071 0.0260  279 HIS A NE2 
2297 O OXT . HIS A 279 ? 0.4538 0.3999 0.3892 -0.0447 -0.0186 0.0322  279 HIS A OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   TYR 8   8   8   TYR TYR A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  TRP 36  36  36  TRP TRP A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  CYS 89  89  89  CYS CYS A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 MET 117 117 117 MET MET A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 THR 121 121 121 THR THR A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 HIS 128 128 128 HIS HIS A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 ARG 130 130 130 ARG ARG A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 ASP 132 132 ?   ?   ?   A . n 
A 1 133 GLY 133 133 ?   ?   ?   A . n 
A 1 134 GLY 134 134 ?   ?   ?   A . n 
A 1 135 HIS 135 135 ?   ?   ?   A . n 
A 1 136 THR 136 136 ?   ?   ?   A . n 
A 1 137 VAL 137 137 ?   ?   ?   A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ASN 167 167 ?   ?   ?   A . n 
A 1 168 HIS 168 168 ?   ?   ?   A . n 
A 1 169 ASP 169 169 ?   ?   ?   A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 PHE 172 172 172 PHE PHE A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 LYS 174 174 174 LYS LYS A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 VAL 177 177 177 VAL VAL A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 MET 183 183 183 MET MET A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 MET 188 188 188 MET MET A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 ARG 190 190 190 ARG ARG A . n 
A 1 191 MET 191 191 191 MET MET A . n 
A 1 192 SER 192 192 ?   ?   ?   A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 TRP 200 200 200 TRP TRP A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 CYS 210 210 210 CYS CYS A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 MET 213 213 213 MET MET A . n 
A 1 214 PRO 214 214 214 PRO PRO A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 ARG 229 229 229 ARG ARG A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 ARG 235 235 235 ARG ARG A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 ARG 239 239 239 ARG ARG A . n 
A 1 240 TYR 240 240 240 TYR TYR A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 ILE 247 247 247 ILE ILE A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 MET 251 251 251 MET MET A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 HIS 258 258 258 HIS HIS A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 PRO 260 260 260 PRO PRO A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 GLU 267 267 267 GLU GLU A . n 
A 1 268 ASN 268 268 268 ASN ASN A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 HIS 274 274 274 HIS HIS A . n 
A 1 275 HIS 275 275 275 HIS HIS A . n 
A 1 276 HIS 276 276 276 HIS HIS A . n 
A 1 277 HIS 277 277 277 HIS HIS A . n 
A 1 278 HIS 278 278 278 HIS HIS A . n 
A 1 279 HIS 279 279 279 HIS HIS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ADP 1   1280 1280 ADP ADP A . 
C 3 MG  1   1281 1281 MG  MG  A . 
D 4 EDO 1   1282 1282 EDO EDO A . 
E 4 EDO 1   1283 1283 EDO EDO A . 
F 4 EDO 1   1284 1284 EDO EDO A . 
G 4 EDO 1   1285 1285 EDO EDO A . 
H 5 HOH 1   2001 2001 HOH HOH A . 
H 5 HOH 2   2002 2002 HOH HOH A . 
H 5 HOH 3   2003 2003 HOH HOH A . 
H 5 HOH 4   2004 2004 HOH HOH A . 
H 5 HOH 5   2005 2005 HOH HOH A . 
H 5 HOH 6   2006 2006 HOH HOH A . 
H 5 HOH 7   2007 2007 HOH HOH A . 
H 5 HOH 8   2008 2008 HOH HOH A . 
H 5 HOH 9   2009 2009 HOH HOH A . 
H 5 HOH 10  2010 2010 HOH HOH A . 
H 5 HOH 11  2011 2011 HOH HOH A . 
H 5 HOH 12  2012 2012 HOH HOH A . 
H 5 HOH 13  2013 2013 HOH HOH A . 
H 5 HOH 14  2014 2014 HOH HOH A . 
H 5 HOH 15  2015 2015 HOH HOH A . 
H 5 HOH 16  2016 2016 HOH HOH A . 
H 5 HOH 17  2017 2017 HOH HOH A . 
H 5 HOH 18  2018 2018 HOH HOH A . 
H 5 HOH 19  2019 2019 HOH HOH A . 
H 5 HOH 20  2020 2020 HOH HOH A . 
H 5 HOH 21  2021 2021 HOH HOH A . 
H 5 HOH 22  2022 2022 HOH HOH A . 
H 5 HOH 23  2023 2023 HOH HOH A . 
H 5 HOH 24  2024 2024 HOH HOH A . 
H 5 HOH 25  2025 2025 HOH HOH A . 
H 5 HOH 26  2026 2026 HOH HOH A . 
H 5 HOH 27  2027 2027 HOH HOH A . 
H 5 HOH 28  2028 2028 HOH HOH A . 
H 5 HOH 29  2029 2029 HOH HOH A . 
H 5 HOH 30  2030 2030 HOH HOH A . 
H 5 HOH 31  2031 2031 HOH HOH A . 
H 5 HOH 32  2032 2032 HOH HOH A . 
H 5 HOH 33  2033 2033 HOH HOH A . 
H 5 HOH 34  2034 2034 HOH HOH A . 
H 5 HOH 35  2035 2035 HOH HOH A . 
H 5 HOH 36  2036 2036 HOH HOH A . 
H 5 HOH 37  2037 2037 HOH HOH A . 
H 5 HOH 38  2038 2038 HOH HOH A . 
H 5 HOH 39  2039 2039 HOH HOH A . 
H 5 HOH 40  2040 2040 HOH HOH A . 
H 5 HOH 41  2041 2041 HOH HOH A . 
H 5 HOH 42  2042 2042 HOH HOH A . 
H 5 HOH 43  2043 2043 HOH HOH A . 
H 5 HOH 44  2044 2044 HOH HOH A . 
H 5 HOH 45  2045 2045 HOH HOH A . 
H 5 HOH 46  2046 2046 HOH HOH A . 
H 5 HOH 47  2047 2047 HOH HOH A . 
H 5 HOH 48  2048 2048 HOH HOH A . 
H 5 HOH 49  2049 2049 HOH HOH A . 
H 5 HOH 50  2050 2050 HOH HOH A . 
H 5 HOH 51  2051 2051 HOH HOH A . 
H 5 HOH 52  2052 2052 HOH HOH A . 
H 5 HOH 53  2053 2053 HOH HOH A . 
H 5 HOH 54  2054 2054 HOH HOH A . 
H 5 HOH 55  2055 2055 HOH HOH A . 
H 5 HOH 56  2056 2056 HOH HOH A . 
H 5 HOH 57  2057 2057 HOH HOH A . 
H 5 HOH 58  2058 2058 HOH HOH A . 
H 5 HOH 59  2059 2059 HOH HOH A . 
H 5 HOH 60  2060 2060 HOH HOH A . 
H 5 HOH 61  2061 2061 HOH HOH A . 
H 5 HOH 62  2062 2062 HOH HOH A . 
H 5 HOH 63  2063 2063 HOH HOH A . 
H 5 HOH 64  2064 2064 HOH HOH A . 
H 5 HOH 65  2065 2065 HOH HOH A . 
H 5 HOH 66  2066 2066 HOH HOH A . 
H 5 HOH 67  2067 2067 HOH HOH A . 
H 5 HOH 68  2068 2068 HOH HOH A . 
H 5 HOH 69  2069 2069 HOH HOH A . 
H 5 HOH 70  2070 2070 HOH HOH A . 
H 5 HOH 71  2071 2071 HOH HOH A . 
H 5 HOH 72  2072 2072 HOH HOH A . 
H 5 HOH 73  2073 2073 HOH HOH A . 
H 5 HOH 74  2074 2074 HOH HOH A . 
H 5 HOH 75  2075 2075 HOH HOH A . 
H 5 HOH 76  2076 2076 HOH HOH A . 
H 5 HOH 77  2077 2077 HOH HOH A . 
H 5 HOH 78  2078 2078 HOH HOH A . 
H 5 HOH 79  2079 2079 HOH HOH A . 
H 5 HOH 80  2080 2080 HOH HOH A . 
H 5 HOH 81  2081 2081 HOH HOH A . 
H 5 HOH 82  2082 2082 HOH HOH A . 
H 5 HOH 83  2083 2083 HOH HOH A . 
H 5 HOH 84  2084 2084 HOH HOH A . 
H 5 HOH 85  2085 2085 HOH HOH A . 
H 5 HOH 86  2086 2086 HOH HOH A . 
H 5 HOH 87  2087 2087 HOH HOH A . 
H 5 HOH 88  2088 2088 HOH HOH A . 
H 5 HOH 89  2089 2089 HOH HOH A . 
H 5 HOH 90  2090 2090 HOH HOH A . 
H 5 HOH 91  2091 2091 HOH HOH A . 
H 5 HOH 92  2092 2092 HOH HOH A . 
H 5 HOH 93  2093 2093 HOH HOH A . 
H 5 HOH 94  2094 2094 HOH HOH A . 
H 5 HOH 95  2095 2095 HOH HOH A . 
H 5 HOH 96  2096 2096 HOH HOH A . 
H 5 HOH 97  2097 2097 HOH HOH A . 
H 5 HOH 98  2098 2098 HOH HOH A . 
H 5 HOH 99  2099 2099 HOH HOH A . 
H 5 HOH 100 2100 2100 HOH HOH A . 
H 5 HOH 101 2101 2101 HOH HOH A . 
H 5 HOH 102 2102 2102 HOH HOH A . 
H 5 HOH 103 2103 2103 HOH HOH A . 
H 5 HOH 104 2104 2104 HOH HOH A . 
H 5 HOH 105 2105 2105 HOH HOH A . 
H 5 HOH 106 2106 2106 HOH HOH A . 
H 5 HOH 107 2107 2107 HOH HOH A . 
H 5 HOH 108 2108 2108 HOH HOH A . 
H 5 HOH 109 2109 2109 HOH HOH A . 
H 5 HOH 110 2110 2110 HOH HOH A . 
H 5 HOH 111 2111 2111 HOH HOH A . 
H 5 HOH 112 2112 2112 HOH HOH A . 
H 5 HOH 113 2113 2113 HOH HOH A . 
H 5 HOH 114 2114 2114 HOH HOH A . 
H 5 HOH 115 2115 2115 HOH HOH A . 
H 5 HOH 116 2116 2116 HOH HOH A . 
H 5 HOH 117 2117 2117 HOH HOH A . 
H 5 HOH 118 2118 2118 HOH HOH A . 
H 5 HOH 119 2119 2119 HOH HOH A . 
H 5 HOH 120 2120 2120 HOH HOH A . 
H 5 HOH 121 2121 2121 HOH HOH A . 
H 5 HOH 122 2122 2122 HOH HOH A . 
H 5 HOH 123 2123 2123 HOH HOH A . 
H 5 HOH 124 2124 2124 HOH HOH A . 
H 5 HOH 125 2125 2125 HOH HOH A . 
H 5 HOH 126 2126 2126 HOH HOH A . 
H 5 HOH 127 2127 2127 HOH HOH A . 
H 5 HOH 128 2128 2128 HOH HOH A . 
H 5 HOH 129 2129 2129 HOH HOH A . 
H 5 HOH 130 2130 2130 HOH HOH A . 
H 5 HOH 131 2131 2131 HOH HOH A . 
H 5 HOH 132 2132 2132 HOH HOH A . 
H 5 HOH 133 2133 2133 HOH HOH A . 
H 5 HOH 134 2134 2134 HOH HOH A . 
H 5 HOH 135 2135 2135 HOH HOH A . 
H 5 HOH 136 2136 2136 HOH HOH A . 
H 5 HOH 137 2137 2137 HOH HOH A . 
H 5 HOH 138 2138 2138 HOH HOH A . 
H 5 HOH 139 2139 2139 HOH HOH A . 
H 5 HOH 140 2140 2140 HOH HOH A . 
H 5 HOH 141 2141 2141 HOH HOH A . 
H 5 HOH 142 2142 2142 HOH HOH A . 
H 5 HOH 143 2143 2143 HOH HOH A . 
H 5 HOH 144 2144 2144 HOH HOH A . 
H 5 HOH 145 2145 2145 HOH HOH A . 
H 5 HOH 146 2146 2146 HOH HOH A . 
H 5 HOH 147 2147 2147 HOH HOH A . 
H 5 HOH 148 2148 2148 HOH HOH A . 
H 5 HOH 149 2149 2149 HOH HOH A . 
H 5 HOH 150 2150 2150 HOH HOH A . 
H 5 HOH 151 2151 2151 HOH HOH A . 
H 5 HOH 152 2152 2152 HOH HOH A . 
H 5 HOH 153 2153 2153 HOH HOH A . 
H 5 HOH 154 2154 2154 HOH HOH A . 
H 5 HOH 155 2155 2155 HOH HOH A . 
H 5 HOH 156 2156 2156 HOH HOH A . 
H 5 HOH 157 2157 2157 HOH HOH A . 
H 5 HOH 158 2158 2158 HOH HOH A . 
H 5 HOH 159 2159 2159 HOH HOH A . 
H 5 HOH 160 2160 2160 HOH HOH A . 
H 5 HOH 161 2161 2161 HOH HOH A . 
H 5 HOH 162 2162 2162 HOH HOH A . 
H 5 HOH 163 2163 2163 HOH HOH A . 
H 5 HOH 164 2164 2164 HOH HOH A . 
H 5 HOH 165 2165 2165 HOH HOH A . 
H 5 HOH 166 2166 2166 HOH HOH A . 
H 5 HOH 167 2167 2167 HOH HOH A . 
H 5 HOH 168 2168 2168 HOH HOH A . 
H 5 HOH 169 2169 2169 HOH HOH A . 
H 5 HOH 170 2170 2170 HOH HOH A . 
H 5 HOH 171 2171 2171 HOH HOH A . 
H 5 HOH 172 2172 2172 HOH HOH A . 
H 5 HOH 173 2173 2173 HOH HOH A . 
H 5 HOH 174 2174 2174 HOH HOH A . 
H 5 HOH 175 2175 2175 HOH HOH A . 
H 5 HOH 176 2176 2176 HOH HOH A . 
H 5 HOH 177 2177 2177 HOH HOH A . 
H 5 HOH 178 2178 2178 HOH HOH A . 
H 5 HOH 179 2179 2179 HOH HOH A . 
H 5 HOH 180 2180 2180 HOH HOH A . 
H 5 HOH 181 2181 2181 HOH HOH A . 
H 5 HOH 182 2182 2182 HOH HOH A . 
H 5 HOH 183 2183 2183 HOH HOH A . 
H 5 HOH 184 2184 2184 HOH HOH A . 
H 5 HOH 185 2185 2185 HOH HOH A . 
H 5 HOH 186 2186 2186 HOH HOH A . 
H 5 HOH 187 2187 2187 HOH HOH A . 
H 5 HOH 188 2188 2188 HOH HOH A . 
H 5 HOH 189 2189 2189 HOH HOH A . 
H 5 HOH 190 2190 2190 HOH HOH A . 
H 5 HOH 191 2191 2191 HOH HOH A . 
H 5 HOH 192 2192 2192 HOH HOH A . 
H 5 HOH 193 2193 2193 HOH HOH A . 
H 5 HOH 194 2194 2194 HOH HOH A . 
H 5 HOH 195 2195 2195 HOH HOH A . 
H 5 HOH 196 2196 2196 HOH HOH A . 
H 5 HOH 197 2197 2197 HOH HOH A . 
H 5 HOH 198 2198 2198 HOH HOH A . 
H 5 HOH 199 2199 2199 HOH HOH A . 
H 5 HOH 200 2200 2200 HOH HOH A . 
H 5 HOH 201 2201 2201 HOH HOH A . 
H 5 HOH 202 2202 2202 HOH HOH A . 
H 5 HOH 203 2203 2203 HOH HOH A . 
H 5 HOH 204 2204 2204 HOH HOH A . 
H 5 HOH 205 2205 2205 HOH HOH A . 
H 5 HOH 206 2206 2206 HOH HOH A . 
H 5 HOH 207 2207 2207 HOH HOH A . 
H 5 HOH 208 2208 2208 HOH HOH A . 
H 5 HOH 209 2209 2209 HOH HOH A . 
H 5 HOH 210 2210 2210 HOH HOH A . 
H 5 HOH 211 2211 2211 HOH HOH A . 
H 5 HOH 212 2212 2212 HOH HOH A . 
H 5 HOH 213 2213 2213 HOH HOH A . 
H 5 HOH 214 2214 2214 HOH HOH A . 
H 5 HOH 215 2215 2215 HOH HOH A . 
H 5 HOH 216 2216 2216 HOH HOH A . 
H 5 HOH 217 2217 2217 HOH HOH A . 
H 5 HOH 218 2218 2218 HOH HOH A . 
H 5 HOH 219 2219 2219 HOH HOH A . 
H 5 HOH 220 2220 2220 HOH HOH A . 
H 5 HOH 221 2221 2221 HOH HOH A . 
H 5 HOH 222 2222 2222 HOH HOH A . 
H 5 HOH 223 2223 2223 HOH HOH A . 
H 5 HOH 224 2224 2224 HOH HOH A . 
H 5 HOH 225 2225 2225 HOH HOH A . 
H 5 HOH 226 2226 2226 HOH HOH A . 
H 5 HOH 227 2227 2227 HOH HOH A . 
H 5 HOH 228 2228 2228 HOH HOH A . 
H 5 HOH 229 2229 2229 HOH HOH A . 
H 5 HOH 230 2230 2230 HOH HOH A . 
H 5 HOH 231 2231 2231 HOH HOH A . 
H 5 HOH 232 2232 2232 HOH HOH A . 
H 5 HOH 233 2233 2233 HOH HOH A . 
H 5 HOH 234 2234 2234 HOH HOH A . 
H 5 HOH 235 2235 2235 HOH HOH A . 
H 5 HOH 236 2236 2236 HOH HOH A . 
H 5 HOH 237 2237 2237 HOH HOH A . 
H 5 HOH 238 2238 2238 HOH HOH A . 
H 5 HOH 239 2239 2239 HOH HOH A . 
H 5 HOH 240 2240 2240 HOH HOH A . 
H 5 HOH 241 2241 2241 HOH HOH A . 
H 5 HOH 242 2242 2242 HOH HOH A . 
H 5 HOH 243 2243 2243 HOH HOH A . 
H 5 HOH 244 2244 2244 HOH HOH A . 
H 5 HOH 245 2245 2245 HOH HOH A . 
H 5 HOH 246 2246 2246 HOH HOH A . 
H 5 HOH 247 2247 2247 HOH HOH A . 
H 5 HOH 248 2248 2248 HOH HOH A . 
H 5 HOH 249 2249 2249 HOH HOH A . 
H 5 HOH 250 2250 2250 HOH HOH A . 
H 5 HOH 251 2251 2251 HOH HOH A . 
H 5 HOH 252 2252 2252 HOH HOH A . 
H 5 HOH 253 2253 2253 HOH HOH A . 
H 5 HOH 254 2254 2254 HOH HOH A . 
H 5 HOH 255 2255 2255 HOH HOH A . 
H 5 HOH 256 2256 2256 HOH HOH A . 
H 5 HOH 257 2257 2257 HOH HOH A . 
H 5 HOH 258 2258 2258 HOH HOH A . 
H 5 HOH 259 2259 2259 HOH HOH A . 
H 5 HOH 260 2260 2260 HOH HOH A . 
H 5 HOH 261 2261 2261 HOH HOH A . 
H 5 HOH 262 2262 2262 HOH HOH A . 
H 5 HOH 263 2263 2263 HOH HOH A . 
H 5 HOH 264 2264 2264 HOH HOH A . 
H 5 HOH 265 2265 2265 HOH HOH A . 
H 5 HOH 266 2266 2266 HOH HOH A . 
H 5 HOH 267 2267 2267 HOH HOH A . 
H 5 HOH 268 2268 2268 HOH HOH A . 
H 5 HOH 269 2269 2269 HOH HOH A . 
H 5 HOH 270 2270 2270 HOH HOH A . 
H 5 HOH 271 2271 2271 HOH HOH A . 
H 5 HOH 272 2272 2272 HOH HOH A . 
H 5 HOH 273 2273 2273 HOH HOH A . 
H 5 HOH 274 2274 2274 HOH HOH A . 
H 5 HOH 275 2275 2275 HOH HOH A . 
H 5 HOH 276 2276 2276 HOH HOH A . 
H 5 HOH 277 2277 2277 HOH HOH A . 
H 5 HOH 278 2278 2278 HOH HOH A . 
H 5 HOH 279 2279 2279 HOH HOH A . 
H 5 HOH 280 2280 2280 HOH HOH A . 
H 5 HOH 281 2281 2281 HOH HOH A . 
H 5 HOH 282 2282 2282 HOH HOH A . 
H 5 HOH 283 2283 2283 HOH HOH A . 
H 5 HOH 284 2284 2284 HOH HOH A . 
H 5 HOH 285 2285 2285 HOH HOH A . 
H 5 HOH 286 2286 2286 HOH HOH A . 
H 5 HOH 287 2287 2287 HOH HOH A . 
H 5 HOH 288 2288 2288 HOH HOH A . 
H 5 HOH 289 2289 2289 HOH HOH A . 
H 5 HOH 290 2290 2290 HOH HOH A . 
H 5 HOH 291 2291 2291 HOH HOH A . 
H 5 HOH 292 2292 2292 HOH HOH A . 
H 5 HOH 293 2293 2293 HOH HOH A . 
H 5 HOH 294 2294 2294 HOH HOH A . 
H 5 HOH 295 2295 2295 HOH HOH A . 
H 5 HOH 296 2296 2296 HOH HOH A . 
H 5 HOH 297 2297 2297 HOH HOH A . 
H 5 HOH 298 2298 2298 HOH HOH A . 
H 5 HOH 299 2299 2299 HOH HOH A . 
H 5 HOH 300 2300 2300 HOH HOH A . 
H 5 HOH 301 2301 2301 HOH HOH A . 
H 5 HOH 302 2302 2302 HOH HOH A . 
H 5 HOH 303 2303 2303 HOH HOH A . 
H 5 HOH 304 2304 2304 HOH HOH A . 
H 5 HOH 305 2305 2305 HOH HOH A . 
H 5 HOH 306 2306 2306 HOH HOH A . 
H 5 HOH 307 2307 2307 HOH HOH A . 
H 5 HOH 308 2308 2308 HOH HOH A . 
H 5 HOH 309 2309 2309 HOH HOH A . 
H 5 HOH 310 2310 2310 HOH HOH A . 
H 5 HOH 311 2311 2311 HOH HOH A . 
H 5 HOH 312 2312 2312 HOH HOH A . 
H 5 HOH 313 2313 2313 HOH HOH A . 
H 5 HOH 314 2314 2314 HOH HOH A . 
H 5 HOH 315 2315 2315 HOH HOH A . 
H 5 HOH 316 2316 2316 HOH HOH A . 
H 5 HOH 317 2317 2317 HOH HOH A . 
H 5 HOH 318 2318 2318 HOH HOH A . 
H 5 HOH 319 2319 2319 HOH HOH A . 
H 5 HOH 320 2320 2320 HOH HOH A . 
H 5 HOH 321 2321 2321 HOH HOH A . 
H 5 HOH 322 2322 2322 HOH HOH A . 
H 5 HOH 323 2323 2323 HOH HOH A . 
H 5 HOH 324 2324 2324 HOH HOH A . 
H 5 HOH 325 2325 2325 HOH HOH A . 
H 5 HOH 326 2326 2326 HOH HOH A . 
H 5 HOH 327 2327 2327 HOH HOH A . 
H 5 HOH 328 2328 2328 HOH HOH A . 
H 5 HOH 329 2329 2329 HOH HOH A . 
H 5 HOH 330 2330 2330 HOH HOH A . 
H 5 HOH 331 2331 2331 HOH HOH A . 
H 5 HOH 332 2332 2332 HOH HOH A . 
H 5 HOH 333 2333 2333 HOH HOH A . 
H 5 HOH 334 2334 2334 HOH HOH A . 
H 5 HOH 335 2335 2335 HOH HOH A . 
H 5 HOH 336 2336 2336 HOH HOH A . 
H 5 HOH 337 2337 2337 HOH HOH A . 
H 5 HOH 338 2338 2338 HOH HOH A . 
H 5 HOH 339 2339 2339 HOH HOH A . 
H 5 HOH 340 2340 2340 HOH HOH A . 
H 5 HOH 341 2341 2341 HOH HOH A . 
H 5 HOH 342 2342 2342 HOH HOH A . 
H 5 HOH 343 2343 2343 HOH HOH A . 
H 5 HOH 344 2344 2344 HOH HOH A . 
H 5 HOH 345 2345 2345 HOH HOH A . 
H 5 HOH 346 2346 2346 HOH HOH A . 
H 5 HOH 347 2347 2347 HOH HOH A . 
H 5 HOH 348 2348 2348 HOH HOH A . 
H 5 HOH 349 2349 2349 HOH HOH A . 
H 5 HOH 350 2350 2350 HOH HOH A . 
H 5 HOH 351 2351 2351 HOH HOH A . 
H 5 HOH 352 2352 2352 HOH HOH A . 
H 5 HOH 353 2353 2353 HOH HOH A . 
H 5 HOH 354 2354 2354 HOH HOH A . 
H 5 HOH 355 2355 2355 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2B ? B ADP . ? A ADP 1280 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2221 ? 1_555 101.7 ? 
2  O2B ? B ADP . ? A ADP 1280 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O1A ? B ADP . ? A ADP 1280 ? 1_555 86.9  ? 
3  O   ? H HOH . ? A HOH 2221 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O1A ? B ADP . ? A ADP 1280 ? 1_555 87.8  ? 
4  O2B ? B ADP . ? A ADP 1280 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2347 ? 1_555 83.8  ? 
5  O   ? H HOH . ? A HOH 2221 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2347 ? 1_555 164.8 ? 
6  O1A ? B ADP . ? A ADP 1280 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2347 ? 1_555 78.2  ? 
7  O2B ? B ADP . ? A ADP 1280 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2220 ? 1_555 91.1  ? 
8  O   ? H HOH . ? A HOH 2221 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2220 ? 1_555 95.3  ? 
9  O1A ? B ADP . ? A ADP 1280 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2220 ? 1_555 176.6 ? 
10 O   ? H HOH . ? A HOH 2347 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2220 ? 1_555 98.8  ? 
11 O2B ? B ADP . ? A ADP 1280 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2207 ? 1_555 162.7 ? 
12 O   ? H HOH . ? A HOH 2221 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2207 ? 1_555 93.8  ? 
13 O1A ? B ADP . ? A ADP 1280 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2207 ? 1_555 86.1  ? 
14 O   ? H HOH . ? A HOH 2347 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2207 ? 1_555 79.3  ? 
15 O   ? H HOH . ? A HOH 2220 ? 1_555 MG ? C MG . ? A MG 1281 ? 1_555 O   ? H HOH . ? A HOH 2207 ? 1_555 95.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-12-23 
2 'Structure model' 1 1 2011-07-07 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -32.7213 0.3635  16.2181 0.0422 0.0685 0.0673 -0.0300 0.0320  -0.0377 1.6560  0.6198  0.2259  
0.6071  0.0247  0.0654  -0.1456 0.2028 -0.2518 -0.0670 0.1025  -0.0319 -0.0195 -0.0995 0.0356  
'X-RAY DIFFRACTION' 2 ? refined -22.7973 3.3028  1.1060  0.1689 0.2915 0.0843 -0.0152 -0.0575 -0.0304 -0.0260 0.9910  0.2414  
0.0484  -0.3232 0.0916  -0.2556 0.0070 0.1698  -0.1442 0.1689  -0.1885 0.0345  -0.0228 0.0085  
'X-RAY DIFFRACTION' 3 ? refined -19.0359 8.2337  19.8479 0.0189 0.0354 0.0251 -0.0081 0.0109  -0.0059 1.1018  0.8453  1.2668  
0.6365  0.1068  0.4339  -0.0090 0.0721 0.0237  -0.0086 -0.0324 0.0802  0.0131  -0.1696 0.0922  
'X-RAY DIFFRACTION' 4 ? refined -14.6256 9.0048  18.3151 0.0902 0.0847 0.0096 -0.0133 0.0211  0.0101  0.8649  2.7448  -1.4255 
-0.3405 0.1767  0.1495  0.0458  0.1834 0.0222  -0.4654 0.0028  -0.0619 0.0453  -0.0404 0.0184  
'X-RAY DIFFRACTION' 5 ? refined -18.6231 19.4386 7.5994  0.2105 0.2039 0.1201 -0.0819 -0.0755 0.0364  0.3074  0.6846  -0.1826 
-0.0529 0.1695  -0.0225 -0.1692 0.1730 0.0769  -0.4240 0.2673  0.2999  0.0197  -0.0954 -0.0145 
'X-RAY DIFFRACTION' 6 ? refined -7.1340  21.6359 14.9434 0.1103 0.0542 0.0115 -0.0200 -0.0188 0.0074  2.7771  3.2275  -0.9638 
-0.4011 -0.0733 0.5440  0.0048  0.3756 0.0060  -0.5145 0.0321  0.1654  -0.1405 -0.0981 -0.0586 
'X-RAY DIFFRACTION' 7 ? refined -5.9830  28.6325 21.6295 0.0629 0.0268 0.0161 -0.0072 0.0053  0.0079  0.9011  -0.0812 1.0777  
0.3851  0.0682  0.4707  -0.0715 0.1138 0.0658  0.0055  0.0012  -0.0488 -0.1850 -0.0345 -0.0101 
'X-RAY DIFFRACTION' 8 ? refined -0.6010  12.0891 23.3782 0.0472 0.0221 0.0471 -0.0132 0.0335  -0.0116 0.4121  0.9248  0.5395  
0.4800  -0.0506 -0.5070 -0.0562 0.0613 -0.1114 -0.0809 0.0665  -0.2017 0.0888  0.0063  0.0364  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 3-36'    
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 37-63'   
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 64-128'  
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 129-156' 
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 157-184' 
'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 185-214' 
'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 215-252' 
'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 253-279' 
# 
_software.name             PHENIX 
_software.classification   refinement 
_software.version          '(PHENIX.REFINE)' 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_entry_details.entry_id             2W5A 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'C-TERMINAL LEHHHHHH AFFINITY TAG FROM VECTOR SEQUENCE' 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 80  ? ? 39.79   48.74  
2 1 PHE A 176 ? ? -84.48  -75.36 
3 1 ARG A 190 ? ? -171.91 124.70 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2018 ? 7.07 . 
2 1 O ? A HOH 2020 ? 6.63 . 
3 1 O ? A HOH 2028 ? 6.69 . 
4 1 O ? A HOH 2055 ? 6.95 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 77  ? CG  ? A ARG 77  CG  
2  1 Y 1 A ARG 77  ? CD  ? A ARG 77  CD  
3  1 Y 1 A ARG 77  ? NE  ? A ARG 77  NE  
4  1 Y 1 A ARG 77  ? CZ  ? A ARG 77  CZ  
5  1 Y 1 A ARG 77  ? NH1 ? A ARG 77  NH1 
6  1 Y 1 A ARG 77  ? NH2 ? A ARG 77  NH2 
7  1 Y 1 A ASN 79  ? CG  ? A ASN 79  CG  
8  1 Y 1 A ASN 79  ? OD1 ? A ASN 79  OD1 
9  1 Y 1 A ASN 79  ? ND2 ? A ASN 79  ND2 
10 1 Y 1 A LYS 103 ? CD  ? A LYS 103 CD  
11 1 Y 1 A LYS 103 ? CE  ? A LYS 103 CE  
12 1 Y 1 A LYS 103 ? NZ  ? A LYS 103 NZ  
13 1 Y 1 A ARG 105 ? NE  ? A ARG 105 NE  
14 1 Y 1 A ARG 105 ? CZ  ? A ARG 105 CZ  
15 1 Y 1 A ARG 105 ? NH1 ? A ARG 105 NH1 
16 1 Y 1 A ARG 105 ? NH2 ? A ARG 105 NH2 
17 1 Y 1 A ARG 130 ? NE  ? A ARG 130 NE  
18 1 Y 1 A ARG 130 ? CZ  ? A ARG 130 CZ  
19 1 Y 1 A ARG 130 ? NH1 ? A ARG 130 NH1 
20 1 Y 1 A ARG 130 ? NH2 ? A ARG 130 NH2 
21 1 Y 1 A ARG 190 ? CG  ? A ARG 190 CG  
22 1 Y 1 A ARG 190 ? CD  ? A ARG 190 CD  
23 1 Y 1 A ARG 190 ? NE  ? A ARG 190 NE  
24 1 Y 1 A ARG 190 ? CZ  ? A ARG 190 CZ  
25 1 Y 1 A ARG 190 ? NH1 ? A ARG 190 NH1 
26 1 Y 1 A ARG 190 ? NH2 ? A ARG 190 NH2 
27 1 Y 1 A MET 191 ? CG  ? A MET 191 CG  
28 1 Y 1 A MET 191 ? SD  ? A MET 191 SD  
29 1 Y 1 A MET 191 ? CE  ? A MET 191 CE  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A ASP 132 ? A ASP 132 
4  1 Y 1 A GLY 133 ? A GLY 133 
5  1 Y 1 A GLY 134 ? A GLY 134 
6  1 Y 1 A HIS 135 ? A HIS 135 
7  1 Y 1 A THR 136 ? A THR 136 
8  1 Y 1 A VAL 137 ? A VAL 137 
9  1 Y 1 A ASN 167 ? A ASN 167 
10 1 Y 1 A HIS 168 ? A HIS 168 
11 1 Y 1 A ASP 169 ? A ASP 169 
12 1 Y 1 A SER 192 ? A SER 192 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-5'-DIPHOSPHATE" ADP 
3 'MAGNESIUM ION'            MG  
4 1,2-ETHANEDIOL             EDO 
5 water                      HOH 
#