data_2W9Z
# 
_entry.id   2W9Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.307 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2W9Z         
PDBE  EBI-38634    
WWPDB D_1290038634 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2W99 unspecified 'CRYSTAL STRUCTURE OF CDK4 IN COMPLEX WITH A D-TYPE CYCLIN'       
PDB 2W96 unspecified 'CRYSTAL STRUCTURE OF CDK4 IN COMPLEX WITH A D-TYPE CYCLIN'       
PDB 2W9F unspecified 'CRYSTAL STRUCTURE OF CDK4 IN COMPLEX WITH A D-TYPE CYCLIN'       
PDB 1LD2 unspecified 'THEORETICAL STRUCTURE OF HUMAN CYCLIN- DEPENDENT KINASE 4(CDK4)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2W9Z 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Day, P.J.'       1  
'Cleasby, A.'     2  
'Tickle, I.J.'    3  
'Reilly, M.O.'    4  
'Coyle, J.E.'     5  
'Holding, F.P.'   6  
'McMenamin, R.L.' 7  
'Yon, J.'         8  
'Chopra, R.'      9  
'Lengauer, C.'    10 
'Jhoti, H.'       11 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Cdk4 in Complex with a D-Type Cyclin.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            106 
_citation.page_first                4166 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19237565 
_citation.pdbx_database_id_DOI      10.1073/PNAS.0809645106 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Day, P.J.'       1  ? 
primary 'Cleasby, A.'     2  ? 
primary 'Tickle, I.J.'    3  ? 
primary 
;O'Reilly, M.
;
4  ? 
primary 'Coyle, J.E.'     5  ? 
primary 'Holding, F.P.'   6  ? 
primary 'Mcmenamin, R.L.' 7  ? 
primary 'Yon, J.'         8  ? 
primary 'Chopra, R.'      9  ? 
primary 'Lengauer, C.'    10 ? 
primary 'Jhoti, H.'       11 ? 
# 
_cell.entry_id           2W9Z 
_cell.length_a           57.198 
_cell.length_b           65.011 
_cell.length_c           188.699 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2W9Z 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'G1/S-SPECIFIC CYCLIN-D1'        29276.309 1   ?         ?   'RESIDUES 16-271' ? 
2 polymer man 'CELL DIVISION PROTEIN KINASE 4' 34544.625 1   2.7.11.22 YES ?                 ? 
3 water   nat water                            18.015    222 ?         ?   ?                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PRAD1 ONCOGENE, BCL-1 ONCOGENE, D-TYPE CYCLIN' 
2 'CYCLIN-DEPENDENT KINASE 4, PSK-J3, CDK4'       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPV
KKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEEN
KQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEAL
LESSLRQAQQNMDPKAA
;
;MAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPV
KKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEEN
KQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEAL
LESSLRQAQQNMDPKAA
;
A ? 
2 'polypeptide(L)' no no 
;MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRT
DREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLAR
IYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVS
LPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPEHHHHHH
;
;MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRT
DREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLAR
IYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVS
LPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPEHHHHHH
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   TYR n 
1 4   PRO n 
1 5   ASP n 
1 6   ALA n 
1 7   ASN n 
1 8   LEU n 
1 9   LEU n 
1 10  ASN n 
1 11  ASP n 
1 12  ARG n 
1 13  VAL n 
1 14  LEU n 
1 15  ARG n 
1 16  ALA n 
1 17  MET n 
1 18  LEU n 
1 19  LYS n 
1 20  ALA n 
1 21  GLU n 
1 22  GLU n 
1 23  THR n 
1 24  CYS n 
1 25  ALA n 
1 26  PRO n 
1 27  SER n 
1 28  VAL n 
1 29  SER n 
1 30  TYR n 
1 31  PHE n 
1 32  LYS n 
1 33  CYS n 
1 34  VAL n 
1 35  GLN n 
1 36  LYS n 
1 37  GLU n 
1 38  VAL n 
1 39  LEU n 
1 40  PRO n 
1 41  SER n 
1 42  MET n 
1 43  ARG n 
1 44  LYS n 
1 45  ILE n 
1 46  VAL n 
1 47  ALA n 
1 48  THR n 
1 49  TRP n 
1 50  MET n 
1 51  LEU n 
1 52  GLU n 
1 53  VAL n 
1 54  CYS n 
1 55  GLU n 
1 56  GLU n 
1 57  GLN n 
1 58  LYS n 
1 59  CYS n 
1 60  GLU n 
1 61  GLU n 
1 62  GLU n 
1 63  VAL n 
1 64  PHE n 
1 65  PRO n 
1 66  LEU n 
1 67  ALA n 
1 68  MET n 
1 69  ASN n 
1 70  TYR n 
1 71  LEU n 
1 72  ASP n 
1 73  ARG n 
1 74  PHE n 
1 75  LEU n 
1 76  SER n 
1 77  LEU n 
1 78  GLU n 
1 79  PRO n 
1 80  VAL n 
1 81  LYS n 
1 82  LYS n 
1 83  SER n 
1 84  ARG n 
1 85  LEU n 
1 86  GLN n 
1 87  LEU n 
1 88  LEU n 
1 89  GLY n 
1 90  ALA n 
1 91  THR n 
1 92  CYS n 
1 93  MET n 
1 94  PHE n 
1 95  VAL n 
1 96  ALA n 
1 97  SER n 
1 98  LYS n 
1 99  MET n 
1 100 LYS n 
1 101 GLU n 
1 102 THR n 
1 103 ILE n 
1 104 PRO n 
1 105 LEU n 
1 106 THR n 
1 107 ALA n 
1 108 GLU n 
1 109 LYS n 
1 110 LEU n 
1 111 CYS n 
1 112 ILE n 
1 113 TYR n 
1 114 THR n 
1 115 ASP n 
1 116 ASN n 
1 117 SER n 
1 118 ILE n 
1 119 ARG n 
1 120 PRO n 
1 121 GLU n 
1 122 GLU n 
1 123 LEU n 
1 124 LEU n 
1 125 GLN n 
1 126 MET n 
1 127 GLU n 
1 128 LEU n 
1 129 LEU n 
1 130 LEU n 
1 131 VAL n 
1 132 ASN n 
1 133 LYS n 
1 134 LEU n 
1 135 LYS n 
1 136 TRP n 
1 137 ASN n 
1 138 LEU n 
1 139 ALA n 
1 140 ALA n 
1 141 MET n 
1 142 THR n 
1 143 PRO n 
1 144 HIS n 
1 145 ASP n 
1 146 PHE n 
1 147 ILE n 
1 148 GLU n 
1 149 HIS n 
1 150 PHE n 
1 151 LEU n 
1 152 SER n 
1 153 LYS n 
1 154 MET n 
1 155 PRO n 
1 156 GLU n 
1 157 ALA n 
1 158 GLU n 
1 159 GLU n 
1 160 ASN n 
1 161 LYS n 
1 162 GLN n 
1 163 ILE n 
1 164 ILE n 
1 165 ARG n 
1 166 LYS n 
1 167 HIS n 
1 168 ALA n 
1 169 GLN n 
1 170 THR n 
1 171 PHE n 
1 172 VAL n 
1 173 ALA n 
1 174 LEU n 
1 175 CYS n 
1 176 ALA n 
1 177 THR n 
1 178 ASP n 
1 179 VAL n 
1 180 LYS n 
1 181 PHE n 
1 182 ILE n 
1 183 SER n 
1 184 ASN n 
1 185 PRO n 
1 186 PRO n 
1 187 SER n 
1 188 MET n 
1 189 VAL n 
1 190 ALA n 
1 191 ALA n 
1 192 GLY n 
1 193 SER n 
1 194 VAL n 
1 195 VAL n 
1 196 ALA n 
1 197 ALA n 
1 198 VAL n 
1 199 GLN n 
1 200 GLY n 
1 201 LEU n 
1 202 ASN n 
1 203 LEU n 
1 204 ARG n 
1 205 SER n 
1 206 PRO n 
1 207 ASN n 
1 208 ASN n 
1 209 PHE n 
1 210 LEU n 
1 211 SER n 
1 212 TYR n 
1 213 TYR n 
1 214 ARG n 
1 215 LEU n 
1 216 THR n 
1 217 ARG n 
1 218 PHE n 
1 219 LEU n 
1 220 SER n 
1 221 ARG n 
1 222 VAL n 
1 223 ILE n 
1 224 LYS n 
1 225 CYS n 
1 226 ASP n 
1 227 PRO n 
1 228 ASP n 
1 229 CYS n 
1 230 LEU n 
1 231 ARG n 
1 232 ALA n 
1 233 CYS n 
1 234 GLN n 
1 235 GLU n 
1 236 GLN n 
1 237 ILE n 
1 238 GLU n 
1 239 ALA n 
1 240 LEU n 
1 241 LEU n 
1 242 GLU n 
1 243 SER n 
1 244 SER n 
1 245 LEU n 
1 246 ARG n 
1 247 GLN n 
1 248 ALA n 
1 249 GLN n 
1 250 GLN n 
1 251 ASN n 
1 252 MET n 
1 253 ASP n 
1 254 PRO n 
1 255 LYS n 
1 256 ALA n 
1 257 ALA n 
2 1   MET n 
2 2   ALA n 
2 3   THR n 
2 4   SER n 
2 5   ARG n 
2 6   TYR n 
2 7   GLU n 
2 8   PRO n 
2 9   VAL n 
2 10  ALA n 
2 11  GLU n 
2 12  ILE n 
2 13  GLY n 
2 14  VAL n 
2 15  GLY n 
2 16  ALA n 
2 17  TYR n 
2 18  GLY n 
2 19  THR n 
2 20  VAL n 
2 21  TYR n 
2 22  LYS n 
2 23  ALA n 
2 24  ARG n 
2 25  ASP n 
2 26  PRO n 
2 27  HIS n 
2 28  SER n 
2 29  GLY n 
2 30  HIS n 
2 31  PHE n 
2 32  VAL n 
2 33  ALA n 
2 34  LEU n 
2 35  LYS n 
2 36  SER n 
2 37  VAL n 
2 38  ARG n 
2 39  VAL n 
2 40  PRO n 
2 41  ASN n 
2 42  GLY n 
2 43  GLU n 
2 44  GLU n 
2 45  GLY n 
2 46  LEU n 
2 47  PRO n 
2 48  ILE n 
2 49  SER n 
2 50  THR n 
2 51  VAL n 
2 52  ARG n 
2 53  GLU n 
2 54  VAL n 
2 55  ALA n 
2 56  LEU n 
2 57  LEU n 
2 58  ARG n 
2 59  ARG n 
2 60  LEU n 
2 61  GLU n 
2 62  ALA n 
2 63  PHE n 
2 64  GLU n 
2 65  HIS n 
2 66  PRO n 
2 67  ASN n 
2 68  VAL n 
2 69  VAL n 
2 70  ARG n 
2 71  LEU n 
2 72  MET n 
2 73  ASP n 
2 74  VAL n 
2 75  CYS n 
2 76  ALA n 
2 77  THR n 
2 78  SER n 
2 79  ARG n 
2 80  THR n 
2 81  ASP n 
2 82  ARG n 
2 83  GLU n 
2 84  ILE n 
2 85  LYS n 
2 86  VAL n 
2 87  THR n 
2 88  LEU n 
2 89  VAL n 
2 90  PHE n 
2 91  GLU n 
2 92  HIS n 
2 93  VAL n 
2 94  ASP n 
2 95  GLN n 
2 96  ASP n 
2 97  LEU n 
2 98  ARG n 
2 99  THR n 
2 100 TYR n 
2 101 LEU n 
2 102 ASP n 
2 103 LYS n 
2 104 ALA n 
2 105 PRO n 
2 106 PRO n 
2 107 PRO n 
2 108 GLY n 
2 109 LEU n 
2 110 PRO n 
2 111 ALA n 
2 112 GLU n 
2 113 THR n 
2 114 ILE n 
2 115 LYS n 
2 116 ASP n 
2 117 LEU n 
2 118 MET n 
2 119 ARG n 
2 120 GLN n 
2 121 PHE n 
2 122 LEU n 
2 123 ARG n 
2 124 GLY n 
2 125 LEU n 
2 126 ASP n 
2 127 PHE n 
2 128 LEU n 
2 129 HIS n 
2 130 ALA n 
2 131 ASN n 
2 132 CYS n 
2 133 ILE n 
2 134 VAL n 
2 135 HIS n 
2 136 ARG n 
2 137 ASP n 
2 138 LEU n 
2 139 LYS n 
2 140 PRO n 
2 141 GLU n 
2 142 ASN n 
2 143 ILE n 
2 144 LEU n 
2 145 VAL n 
2 146 THR n 
2 147 SER n 
2 148 GLY n 
2 149 GLY n 
2 150 THR n 
2 151 VAL n 
2 152 LYS n 
2 153 LEU n 
2 154 ALA n 
2 155 ASP n 
2 156 PHE n 
2 157 GLY n 
2 158 LEU n 
2 159 ALA n 
2 160 ARG n 
2 161 ILE n 
2 162 TYR n 
2 163 SER n 
2 164 TYR n 
2 165 GLN n 
2 166 MET n 
2 167 ALA n 
2 168 LEU n 
2 169 ALA n 
2 170 PRO n 
2 171 VAL n 
2 172 VAL n 
2 173 VAL n 
2 174 THR n 
2 175 LEU n 
2 176 TRP n 
2 177 TYR n 
2 178 ARG n 
2 179 ALA n 
2 180 PRO n 
2 181 GLU n 
2 182 VAL n 
2 183 LEU n 
2 184 LEU n 
2 185 GLN n 
2 186 SER n 
2 187 THR n 
2 188 TYR n 
2 189 ALA n 
2 190 THR n 
2 191 PRO n 
2 192 VAL n 
2 193 ASP n 
2 194 MET n 
2 195 TRP n 
2 196 SER n 
2 197 VAL n 
2 198 GLY n 
2 199 CYS n 
2 200 ILE n 
2 201 PHE n 
2 202 ALA n 
2 203 GLU n 
2 204 MET n 
2 205 PHE n 
2 206 ARG n 
2 207 ARG n 
2 208 LYS n 
2 209 PRO n 
2 210 LEU n 
2 211 PHE n 
2 212 CYS n 
2 213 GLY n 
2 214 ASN n 
2 215 SER n 
2 216 GLU n 
2 217 ALA n 
2 218 ASP n 
2 219 GLN n 
2 220 LEU n 
2 221 GLY n 
2 222 LYS n 
2 223 ILE n 
2 224 PHE n 
2 225 ASP n 
2 226 LEU n 
2 227 ILE n 
2 228 GLY n 
2 229 LEU n 
2 230 PRO n 
2 231 PRO n 
2 232 GLU n 
2 233 ASP n 
2 234 ASP n 
2 235 TRP n 
2 236 PRO n 
2 237 ARG n 
2 238 ASP n 
2 239 VAL n 
2 240 SER n 
2 241 LEU n 
2 242 PRO n 
2 243 ARG n 
2 244 GLY n 
2 245 ALA n 
2 246 PHE n 
2 247 PRO n 
2 248 PRO n 
2 249 ARG n 
2 250 GLY n 
2 251 PRO n 
2 252 ARG n 
2 253 PRO n 
2 254 VAL n 
2 255 GLN n 
2 256 SER n 
2 257 VAL n 
2 258 VAL n 
2 259 PRO n 
2 260 GLU n 
2 261 MET n 
2 262 GLU n 
2 263 GLU n 
2 264 SER n 
2 265 GLY n 
2 266 ALA n 
2 267 GLN n 
2 268 LEU n 
2 269 LEU n 
2 270 LEU n 
2 271 GLU n 
2 272 MET n 
2 273 LEU n 
2 274 THR n 
2 275 PHE n 
2 276 ASN n 
2 277 PRO n 
2 278 HIS n 
2 279 LYS n 
2 280 ARG n 
2 281 ILE n 
2 282 SER n 
2 283 ALA n 
2 284 PHE n 
2 285 ARG n 
2 286 ALA n 
2 287 LEU n 
2 288 GLN n 
2 289 HIS n 
2 290 SER n 
2 291 TYR n 
2 292 LEU n 
2 293 HIS n 
2 294 LYS n 
2 295 ASP n 
2 296 GLU n 
2 297 GLY n 
2 298 ASN n 
2 299 PRO n 
2 300 GLU n 
2 301 HIS n 
2 302 HIS n 
2 303 HIS n 
2 304 HIS n 
2 305 HIS n 
2 306 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? Sf21 ? ? ? 
? ? BACULOVIRUS ? ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? Sf21 ? ? ? 
? ? BACULOVIRUS ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2W9Z        1 ? ? 2W9Z   ? 
2 UNP CCND1_HUMAN 1 ? ? P24385 ? 
3 UNP CDK4_HUMAN  2 ? ? P11802 ? 
4 PDB 2W9Z        2 ? ? 2W9Z   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2W9Z A 1   ? 1   ? 2W9Z   15  ? 15  ? 15  15  
2 2 2W9Z A 2   ? 257 ? P24385 16  ? 271 ? 16  271 
3 3 2W9Z B 1   ? 44  ? P11802 1   ? 44  ? 1   44  
4 3 2W9Z B 45  ? 300 ? P11802 48  ? 303 ? 48  303 
5 4 2W9Z B 301 ? 306 ? 2W9Z   304 ? 309 ? 304 309 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 2W9Z GLU B 43  ? UNP P11802 GLY 43  'engineered mutation' 43  1 
3 2W9Z GLU B 44  ? UNP P11802 GLY 44  'engineered mutation' 44  2 
3 2W9Z ALA B 169 ? UNP P11802 THR 172 'engineered mutation' 172 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2W9Z 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.81 
_exptl_crystal.density_percent_sol   40 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2007-11-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.931 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             0.931 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2W9Z 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             94.50 
_reflns.d_resolution_high            2.45 
_reflns.number_obs                   26174 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.60 
_reflns.B_iso_Wilson_estimate        52.42 
_reflns.pdbx_redundancy              3.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.45 
_reflns_shell.d_res_low              2.58 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.42 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.60 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2W9Z 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     26174 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             94.49 
_refine.ls_d_res_high                            2.45 
_refine.ls_percent_reflns_obs                    97.8 
_refine.ls_R_factor_obs                          0.228 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.225 
_refine.ls_R_factor_R_free                       0.272 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  1291 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               63.60 
_refine.aniso_B[1][1]                            -10.45926 
_refine.aniso_B[2][2]                            5.46453 
_refine.aniso_B[3][3]                            4.99473 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. DISORDERED REGIONS WERE MODELLED STEREOCHEMICALLY WHERE POSSIBLE' 
_refine.pdbx_starting_model                      'PDB ENTRY 1BLX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4230 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             222 
_refine_hist.number_atoms_total               4452 
_refine_hist.d_res_high                       2.45 
_refine_hist.d_res_low                        94.49 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.d_res_high                       2.45 
_refine_ls_shell.d_res_low                        2.60 
_refine_ls_shell.number_reflns_R_work             3991 
_refine_ls_shell.R_factor_R_work                  0.2413 
_refine_ls_shell.percent_reflns_obs               97.82 
_refine_ls_shell.R_factor_R_free                  0.3066 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.98 
_refine_ls_shell.number_reflns_R_free             209 
_refine_ls_shell.number_reflns_all                4200 
_refine_ls_shell.R_factor_all                     0.2446 
# 
_struct.entry_id                  2W9Z 
_struct.title                     'Crystal Structure of CDK4 in complex with a D-type cyclin' 
_struct.pdbx_descriptor           'G1/S-SPECIFIC CYCLIN-D1, CELL DIVISION PROTEIN KINASE 4 (E.C.2.7.11.22)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2W9Z 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, CYCLIN DEPENDENT KINASE, TRANSFERASE ONCOLOGY, CELL CYCLE, DRUG DESIGN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 8   ? THR A 23  ? LEU A 22  THR A 37  1 ? 16 
HELX_P HELX_P2  2  SER A 29  ? VAL A 34  ? SER A 43  VAL A 48  1 ? 6  
HELX_P HELX_P3  3  LEU A 39  ? GLN A 57  ? LEU A 53  GLN A 71  1 ? 19 
HELX_P HELX_P4  4  GLU A 62  ? SER A 76  ? GLU A 76  SER A 90  1 ? 15 
HELX_P HELX_P5  5  LYS A 81  ? SER A 83  ? LYS A 95  SER A 97  5 ? 3  
HELX_P HELX_P6  6  ARG A 84  ? GLU A 101 ? ARG A 98  GLU A 115 1 ? 18 
HELX_P HELX_P7  7  THR A 106 ? THR A 114 ? THR A 120 THR A 128 1 ? 9  
HELX_P HELX_P8  8  ARG A 119 ? LEU A 134 ? ARG A 133 LEU A 148 1 ? 16 
HELX_P HELX_P9  9  THR A 142 ? LYS A 153 ? THR A 156 LYS A 167 1 ? 12 
HELX_P HELX_P10 10 ALA A 157 ? THR A 177 ? ALA A 171 THR A 191 1 ? 21 
HELX_P HELX_P11 11 VAL A 179 ? ASN A 184 ? VAL A 193 ASN A 198 1 ? 6  
HELX_P HELX_P12 12 PRO A 185 ? SER A 205 ? PRO A 199 SER A 219 1 ? 21 
HELX_P HELX_P13 13 PHE A 209 ? TYR A 213 ? PHE A 223 TYR A 227 5 ? 5  
HELX_P HELX_P14 14 ARG A 214 ? ILE A 223 ? ARG A 228 ILE A 237 1 ? 10 
HELX_P HELX_P15 15 ASP A 226 ? GLN A 250 ? ASP A 240 GLN A 264 1 ? 25 
HELX_P HELX_P16 16 PRO B 47  ? ARG B 59  ? PRO B 50  ARG B 62  1 ? 13 
HELX_P HELX_P17 17 LEU B 60  ? GLU B 64  ? LEU B 63  GLU B 67  5 ? 5  
HELX_P HELX_P18 18 LEU B 97  ? LYS B 103 ? LEU B 100 LYS B 106 1 ? 7  
HELX_P HELX_P19 19 ALA B 111 ? ASN B 131 ? ALA B 114 ASN B 134 1 ? 21 
HELX_P HELX_P20 20 LEU B 158 ? SER B 163 ? LEU B 161 SER B 166 1 ? 6  
HELX_P HELX_P21 21 TYR B 164 ? ALA B 169 ? TYR B 167 ALA B 172 1 ? 6  
HELX_P HELX_P22 22 ALA B 179 ? GLN B 185 ? ALA B 182 GLN B 188 1 ? 7  
HELX_P HELX_P23 23 THR B 190 ? PHE B 205 ? THR B 193 PHE B 208 1 ? 16 
HELX_P HELX_P24 24 SER B 215 ? GLY B 228 ? SER B 218 GLY B 231 1 ? 14 
HELX_P HELX_P25 25 GLU B 262 ? LEU B 273 ? GLU B 265 LEU B 276 1 ? 12 
HELX_P HELX_P26 26 SER B 282 ? LEU B 287 ? SER B 285 LEU B 290 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 2   B . ? ALA 2   B THR 3   B ? THR 3   B 1 0.90  
2 LEU 109 B . ? LEU 112 B PRO 110 B ? PRO 113 B 1 -2.86 
3 GLU 232 B . ? GLU 235 B ASP 233 B ? ASP 236 B 1 4.63  
4 ARG 243 B . ? ARG 246 B GLY 244 B ? GLY 247 B 1 4.16  
5 VAL 258 B . ? VAL 261 B PRO 259 B ? PRO 262 B 1 -2.56 
6 PRO 259 B . ? PRO 262 B GLU 260 B ? GLU 263 B 1 19.59 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
BA ? 5 ? 
BB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
BA 1 GLU B 7   ? GLY B 15  ? GLU B 7   GLY B 15  
BA 2 GLY B 18  ? ARG B 24  ? GLY B 18  ARG B 24  
BA 3 PHE B 31  ? PRO B 40  ? PHE B 31  PRO B 40  
BA 4 GLU B 83  ? GLU B 91  ? GLU B 86  GLU B 94  
BA 5 LEU B 71  ? ARG B 79  ? LEU B 74  ARG B 82  
BB 1 GLN B 95  ? ASP B 96  ? GLN B 98  ASP B 99  
BB 2 ILE B 143 ? VAL B 145 ? ILE B 146 VAL B 148 
BB 3 LYS B 152 ? LEU B 153 ? LYS B 155 LEU B 156 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
BA 1 2 N GLY B 15  ? N GLY B 15  O GLY B 18  ? O GLY B 18  
BA 2 3 N ALA B 23  ? N ALA B 23  O VAL B 32  ? O VAL B 32  
BA 3 4 N VAL B 39  ? N VAL B 39  O ILE B 84  ? O ILE B 87  
BA 4 5 O VAL B 89  ? O VAL B 92  N MET B 72  ? N MET B 75  
BB 1 2 N GLN B 95  ? N GLN B 98  O VAL B 145 ? O VAL B 148 
BB 2 3 N LEU B 144 ? N LEU B 147 O LYS B 152 ? O LYS B 155 
# 
_database_PDB_matrix.entry_id          2W9Z 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2W9Z 
_atom_sites.fract_transf_matrix[1][1]   0.017483 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015382 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005299 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 8   ? 38.548  38.031 34.585 1.00 94.99  ? 22   LEU A N   1 
ATOM   2    C CA  . LEU A 1 8   ? 38.701  36.580 34.582 1.00 94.88  ? 22   LEU A CA  1 
ATOM   3    C C   . LEU A 1 8   ? 37.530  35.928 33.853 1.00 97.76  ? 22   LEU A C   1 
ATOM   4    O O   . LEU A 1 8   ? 36.974  36.498 32.913 1.00 97.48  ? 22   LEU A O   1 
ATOM   5    C CB  . LEU A 1 8   ? 38.775  36.045 36.018 1.00 95.08  ? 22   LEU A CB  1 
ATOM   6    C CG  . LEU A 1 8   ? 39.793  36.689 36.964 1.00 100.03 ? 22   LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 8   ? 39.570  36.219 38.397 1.00 100.23 ? 22   LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 8   ? 41.221  36.397 36.515 1.00 102.68 ? 22   LEU A CD2 1 
ATOM   9    N N   . LEU A 1 9   ? 37.171  34.723 34.285 1.00 93.10  ? 23   LEU A N   1 
ATOM   10   C CA  . LEU A 1 9   ? 35.957  34.070 33.810 1.00 92.19  ? 23   LEU A CA  1 
ATOM   11   C C   . LEU A 1 9   ? 34.784  34.362 34.738 1.00 93.78  ? 23   LEU A C   1 
ATOM   12   O O   . LEU A 1 9   ? 33.626  34.290 34.325 1.00 93.88  ? 23   LEU A O   1 
ATOM   13   C CB  . LEU A 1 9   ? 36.157  32.558 33.689 1.00 92.35  ? 23   LEU A CB  1 
ATOM   14   C CG  . LEU A 1 9   ? 36.683  32.049 32.348 1.00 97.29  ? 23   LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 9   ? 36.457  30.547 32.224 1.00 97.43  ? 23   LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 9   ? 36.015  32.796 31.201 1.00 100.14 ? 23   LEU A CD2 1 
ATOM   17   N N   . ASN A 1 10  ? 35.093  34.640 36.003 1.00 87.69  ? 24   ASN A N   1 
ATOM   18   C CA  . ASN A 1 10  ? 34.076  35.012 36.979 1.00 86.11  ? 24   ASN A CA  1 
ATOM   19   C C   . ASN A 1 10  ? 33.127  36.044 36.389 1.00 85.90  ? 24   ASN A C   1 
ATOM   20   O O   . ASN A 1 10  ? 31.950  35.759 36.166 1.00 85.62  ? 24   ASN A O   1 
ATOM   21   C CB  . ASN A 1 10  ? 34.723  35.566 38.253 1.00 87.71  ? 24   ASN A CB  1 
ATOM   22   C CG  . ASN A 1 10  ? 35.215  34.472 39.182 1.00 114.18 ? 24   ASN A CG  1 
ATOM   23   O OD1 . ASN A 1 10  ? 35.648  34.743 40.305 1.00 110.57 ? 24   ASN A OD1 1 
ATOM   24   N ND2 . ASN A 1 10  ? 35.130  33.226 38.728 1.00 105.67 ? 24   ASN A ND2 1 
ATOM   25   N N   . ASP A 1 11  ? 33.666  37.213 36.059 1.00 79.01  ? 25   ASP A N   1 
ATOM   26   C CA  A ASP A 1 11  ? 32.863  38.301 35.511 0.50 77.91  ? 25   ASP A CA  1 
ATOM   27   C CA  B ASP A 1 11  ? 32.858  38.295 35.518 0.50 77.98  ? 25   ASP A CA  1 
ATOM   28   C C   . ASP A 1 11  ? 32.149  37.885 34.230 1.00 79.39  ? 25   ASP A C   1 
ATOM   29   O O   . ASP A 1 11  ? 30.932  38.036 34.109 1.00 79.06  ? 25   ASP A O   1 
ATOM   30   C CB  A ASP A 1 11  ? 33.732  39.533 35.250 0.50 79.77  ? 25   ASP A CB  1 
ATOM   31   C CB  B ASP A 1 11  ? 33.709  39.547 35.298 0.50 79.93  ? 25   ASP A CB  1 
ATOM   32   C CG  A ASP A 1 11  ? 34.794  39.285 34.198 0.50 89.46  ? 25   ASP A CG  1 
ATOM   33   C CG  B ASP A 1 11  ? 34.201  40.154 36.601 0.50 90.44  ? 25   ASP A CG  1 
ATOM   34   O OD1 A ASP A 1 11  ? 35.310  40.271 33.628 0.50 89.65  ? 25   ASP A OD1 1 
ATOM   35   O OD1 B ASP A 1 11  ? 33.718  39.733 37.673 0.50 90.69  ? 25   ASP A OD1 1 
ATOM   36   O OD2 A ASP A 1 11  ? 35.104  38.105 33.932 0.50 95.63  ? 25   ASP A OD2 1 
ATOM   37   O OD2 B ASP A 1 11  ? 35.063  41.057 36.552 0.50 96.93  ? 25   ASP A OD2 1 
ATOM   38   N N   . ARG A 1 12  ? 32.914  37.353 33.281 1.00 71.93  ? 26   ARG A N   1 
ATOM   39   C CA  . ARG A 1 12  ? 32.363  36.901 32.005 1.00 69.66  ? 26   ARG A CA  1 
ATOM   40   C C   . ARG A 1 12  ? 31.106  36.051 32.168 1.00 66.17  ? 26   ARG A C   1 
ATOM   41   O O   . ARG A 1 12  ? 30.076  36.321 31.548 1.00 64.87  ? 26   ARG A O   1 
ATOM   42   C CB  . ARG A 1 12  ? 33.415  36.129 31.205 1.00 72.29  ? 26   ARG A CB  1 
ATOM   43   C CG  . ARG A 1 12  ? 32.846  35.342 30.029 1.00 88.85  ? 26   ARG A CG  1 
ATOM   44   C CD  . ARG A 1 12  ? 33.954  34.801 29.136 1.00 106.71 ? 26   ARG A CD  1 
ATOM   45   N NE  . ARG A 1 12  ? 34.679  35.876 28.462 1.00 121.56 ? 26   ARG A NE  1 
ATOM   46   C CZ  . ARG A 1 12  ? 35.687  36.554 29.003 1.00 137.97 ? 26   ARG A CZ  1 
ATOM   47   N NH1 . ARG A 1 12  ? 36.099  36.270 30.232 1.00 125.42 ? 26   ARG A NH1 1 
ATOM   48   N NH2 . ARG A 1 12  ? 36.284  37.518 28.316 1.00 125.36 ? 26   ARG A NH2 1 
ATOM   49   N N   . VAL A 1 13  ? 31.209  35.007 32.982 1.00 58.35  ? 27   VAL A N   1 
ATOM   50   C CA  . VAL A 1 13  ? 30.067  34.148 33.271 1.00 56.66  ? 27   VAL A CA  1 
ATOM   51   C C   . VAL A 1 13  ? 29.055  34.877 34.154 1.00 56.18  ? 27   VAL A C   1 
ATOM   52   O O   . VAL A 1 13  ? 27.848  34.676 34.035 1.00 54.71  ? 27   VAL A O   1 
ATOM   53   C CB  . VAL A 1 13  ? 30.519  32.829 33.912 1.00 60.46  ? 27   VAL A CB  1 
ATOM   54   C CG1 . VAL A 1 13  ? 31.429  32.068 32.961 1.00 60.53  ? 27   VAL A CG1 1 
ATOM   55   C CG2 . VAL A 1 13  ? 31.235  33.103 35.226 1.00 60.19  ? 27   VAL A CG2 1 
ATOM   56   N N   . LEU A 1 14  ? 29.564  35.733 35.033 1.00 50.11  ? 28   LEU A N   1 
ATOM   57   C CA  . LEU A 1 14  ? 28.721  36.509 35.922 1.00 48.59  ? 28   LEU A CA  1 
ATOM   58   C C   . LEU A 1 14  ? 27.784  37.428 35.148 1.00 51.02  ? 28   LEU A C   1 
ATOM   59   O O   . LEU A 1 14  ? 26.588  37.501 35.444 1.00 50.94  ? 28   LEU A O   1 
ATOM   60   C CB  . LEU A 1 14  ? 29.572  37.328 36.888 1.00 48.31  ? 28   LEU A CB  1 
ATOM   61   C CG  . LEU A 1 14  ? 28.751  37.995 37.987 1.00 52.56  ? 28   LEU A CG  1 
ATOM   62   C CD1 . LEU A 1 14  ? 27.855  36.952 38.653 1.00 52.91  ? 28   LEU A CD1 1 
ATOM   63   C CD2 . LEU A 1 14  ? 29.661  38.675 39.003 1.00 53.44  ? 28   LEU A CD2 1 
ATOM   64   N N   . ARG A 1 15  ? 28.333  38.155 34.179 1.00 45.53  ? 29   ARG A N   1 
ATOM   65   C CA  . ARG A 1 15  ? 27.518  39.039 33.359 1.00 44.69  ? 29   ARG A CA  1 
ATOM   66   C C   . ARG A 1 15  ? 26.436  38.246 32.637 1.00 45.06  ? 29   ARG A C   1 
ATOM   67   O O   . ARG A 1 15  ? 25.299  38.703 32.506 1.00 43.57  ? 29   ARG A O   1 
ATOM   68   C CB  . ARG A 1 15  ? 28.384  39.788 32.347 1.00 47.82  ? 29   ARG A CB  1 
ATOM   69   C CG  . ARG A 1 15  ? 29.445  40.674 32.981 1.00 67.75  ? 29   ARG A CG  1 
ATOM   70   C CD  . ARG A 1 15  ? 30.182  41.500 31.932 1.00 86.48  ? 29   ARG A CD  1 
ATOM   71   N NE  . ARG A 1 15  ? 31.135  42.428 32.537 1.00 102.71 ? 29   ARG A NE  1 
ATOM   72   C CZ  . ARG A 1 15  ? 32.449  42.230 32.585 1.00 122.50 ? 29   ARG A CZ  1 
ATOM   73   N NH1 . ARG A 1 15  ? 32.978  41.137 32.050 1.00 111.09 ? 29   ARG A NH1 1 
ATOM   74   N NH2 . ARG A 1 15  ? 33.236  43.132 33.159 1.00 112.72 ? 29   ARG A NH2 1 
ATOM   75   N N   . ALA A 1 16  ? 26.810  37.065 32.153 1.00 39.99  ? 30   ALA A N   1 
ATOM   76   C CA  . ALA A 1 16  ? 25.894  36.202 31.423 1.00 39.36  ? 30   ALA A CA  1 
ATOM   77   C C   . ALA A 1 16  ? 24.773  35.732 32.341 1.00 42.30  ? 30   ALA A C   1 
ATOM   78   O O   . ALA A 1 16  ? 23.593  35.866 32.020 1.00 41.65  ? 30   ALA A O   1 
ATOM   79   C CB  . ALA A 1 16  ? 26.641  35.009 30.845 1.00 40.03  ? 30   ALA A CB  1 
ATOM   80   N N   . MET A 1 17  ? 25.155  35.229 33.506 1.00 38.41  ? 31   MET A N   1 
ATOM   81   C CA  . MET A 1 17  ? 24.197  34.784 34.502 1.00 39.06  ? 31   MET A CA  1 
ATOM   82   C C   . MET A 1 17  ? 23.276  35.906 34.995 1.00 41.51  ? 31   MET A C   1 
ATOM   83   O O   . MET A 1 17  ? 22.102  35.668 35.289 1.00 41.85  ? 31   MET A O   1 
ATOM   84   C CB  . MET A 1 17  ? 24.924  34.129 35.681 1.00 42.07  ? 31   MET A CB  1 
ATOM   85   C CG  . MET A 1 17  ? 25.769  32.917 35.294 1.00 46.53  ? 31   MET A CG  1 
ATOM   86   S SD  . MET A 1 17  ? 24.848  31.618 34.419 1.00 51.31  ? 31   MET A SD  1 
ATOM   87   C CE  . MET A 1 17  ? 25.158  32.039 32.679 1.00 48.34  ? 31   MET A CE  1 
ATOM   88   N N   . LEU A 1 18  ? 23.809  37.117 35.120 1.00 35.66  ? 32   LEU A N   1 
ATOM   89   C CA  . LEU A 1 18  ? 22.977  38.266 35.466 1.00 34.87  ? 32   LEU A CA  1 
ATOM   90   C C   . LEU A 1 18  ? 21.967  38.594 34.365 1.00 39.28  ? 32   LEU A C   1 
ATOM   91   O O   . LEU A 1 18  ? 20.873  39.076 34.647 1.00 39.04  ? 32   LEU A O   1 
ATOM   92   C CB  . LEU A 1 18  ? 23.837  39.489 35.795 1.00 34.66  ? 32   LEU A CB  1 
ATOM   93   C CG  . LEU A 1 18  ? 24.696  39.440 37.073 1.00 38.91  ? 32   LEU A CG  1 
ATOM   94   C CD1 . LEU A 1 18  ? 25.567  40.692 37.180 1.00 39.03  ? 32   LEU A CD1 1 
ATOM   95   C CD2 . LEU A 1 18  ? 23.847  39.274 38.337 1.00 38.62  ? 32   LEU A CD2 1 
ATOM   96   N N   . LYS A 1 19  ? 22.333  38.325 33.114 1.00 36.80  ? 33   LYS A N   1 
ATOM   97   C CA  . LYS A 1 19  ? 21.422  38.515 31.987 1.00 37.21  ? 33   LYS A CA  1 
ATOM   98   C C   . LYS A 1 19  ? 20.426  37.373 31.937 1.00 41.03  ? 33   LYS A C   1 
ATOM   99   O O   . LYS A 1 19  ? 19.227  37.592 31.799 1.00 40.82  ? 33   LYS A O   1 
ATOM   100  C CB  . LYS A 1 19  ? 22.184  38.540 30.660 1.00 41.19  ? 33   LYS A CB  1 
ATOM   101  C CG  . LYS A 1 19  ? 23.265  39.606 30.547 1.00 65.52  ? 33   LYS A CG  1 
ATOM   102  C CD  . LYS A 1 19  ? 24.098  39.385 29.287 1.00 77.61  ? 33   LYS A CD  1 
ATOM   103  C CE  . LYS A 1 19  ? 25.424  40.135 29.340 1.00 88.63  ? 33   LYS A CE  1 
ATOM   104  N NZ  . LYS A 1 19  ? 26.387  39.615 28.327 1.00 95.61  ? 33   LYS A NZ  1 
ATOM   105  N N   . ALA A 1 20  ? 20.942  36.149 32.004 1.00 37.77  ? 34   ALA A N   1 
ATOM   106  C CA  . ALA A 1 20  ? 20.112  34.954 31.973 1.00 37.75  ? 34   ALA A CA  1 
ATOM   107  C C   . ALA A 1 20  ? 19.007  35.069 33.016 1.00 43.57  ? 34   ALA A C   1 
ATOM   108  O O   . ALA A 1 20  ? 17.920  34.507 32.865 1.00 42.66  ? 34   ALA A O   1 
ATOM   109  C CB  . ALA A 1 20  ? 20.964  33.723 32.234 1.00 38.33  ? 34   ALA A CB  1 
ATOM   110  N N   . GLU A 1 21  ? 19.285  35.864 34.043 1.00 41.88  ? 35   GLU A N   1 
ATOM   111  C CA  . GLU A 1 21  ? 18.392  36.040 35.178 1.00 41.74  ? 35   GLU A CA  1 
ATOM   112  C C   . GLU A 1 21  ? 17.225  36.939 34.796 1.00 46.99  ? 35   GLU A C   1 
ATOM   113  O O   . GLU A 1 21  ? 16.102  36.753 35.268 1.00 46.48  ? 35   GLU A O   1 
ATOM   114  C CB  . GLU A 1 21  ? 19.170  36.669 36.335 1.00 42.70  ? 35   GLU A CB  1 
ATOM   115  C CG  . GLU A 1 21  ? 18.452  36.657 37.657 1.00 46.79  ? 35   GLU A CG  1 
ATOM   116  C CD  . GLU A 1 21  ? 19.299  37.227 38.769 1.00 57.08  ? 35   GLU A CD  1 
ATOM   117  O OE1 . GLU A 1 21  ? 20.122  38.119 38.495 1.00 37.06  ? 35   GLU A OE1 1 
ATOM   118  O OE2 . GLU A 1 21  ? 19.124  36.801 39.927 1.00 61.25  ? 35   GLU A OE2 1 
ATOM   119  N N   . GLU A 1 22  ? 17.507  37.933 33.962 1.00 44.61  ? 36   GLU A N   1 
ATOM   120  C CA  . GLU A 1 22  ? 16.476  38.849 33.489 1.00 45.03  ? 36   GLU A CA  1 
ATOM   121  C C   . GLU A 1 22  ? 15.464  38.122 32.616 1.00 48.61  ? 36   GLU A C   1 
ATOM   122  O O   . GLU A 1 22  ? 14.331  38.571 32.467 1.00 48.74  ? 36   GLU A O   1 
ATOM   123  C CB  . GLU A 1 22  ? 17.103  40.003 32.705 1.00 46.70  ? 36   GLU A CB  1 
ATOM   124  C CG  . GLU A 1 22  ? 17.966  40.934 33.544 1.00 59.11  ? 36   GLU A CG  1 
ATOM   125  C CD  . GLU A 1 22  ? 18.754  41.918 32.699 1.00 82.59  ? 36   GLU A CD  1 
ATOM   126  O OE1 . GLU A 1 22  ? 18.710  41.810 31.453 1.00 68.81  ? 36   GLU A OE1 1 
ATOM   127  O OE2 . GLU A 1 22  ? 19.433  42.789 33.284 1.00 82.94  ? 36   GLU A OE2 1 
ATOM   128  N N   . THR A 1 23  ? 15.873  36.992 32.050 1.00 44.26  ? 37   THR A N   1 
ATOM   129  C CA  . THR A 1 23  ? 14.986  36.207 31.201 1.00 43.74  ? 37   THR A CA  1 
ATOM   130  C C   . THR A 1 23  ? 14.109  35.267 32.026 1.00 46.06  ? 37   THR A C   1 
ATOM   131  O O   . THR A 1 23  ? 13.123  34.727 31.526 1.00 46.88  ? 37   THR A O   1 
ATOM   132  C CB  . THR A 1 23  ? 15.764  35.443 30.087 1.00 52.71  ? 37   THR A CB  1 
ATOM   133  O OG1 . THR A 1 23  ? 16.408  34.287 30.643 1.00 54.08  ? 37   THR A OG1 1 
ATOM   134  C CG2 . THR A 1 23  ? 16.821  36.346 29.449 1.00 50.44  ? 37   THR A CG2 1 
ATOM   135  N N   . CYS A 1 24  ? 14.485  35.050 33.280 1.00 40.00  ? 38   CYS A N   1 
ATOM   136  C CA  . CYS A 1 24  ? 13.735  34.156 34.153 1.00 38.46  ? 38   CYS A CA  1 
ATOM   137  C C   . CYS A 1 24  ? 12.960  34.900 35.223 1.00 39.14  ? 38   CYS A C   1 
ATOM   138  O O   . CYS A 1 24  ? 12.531  34.305 36.205 1.00 39.07  ? 38   CYS A O   1 
ATOM   139  C CB  . CYS A 1 24  ? 14.664  33.132 34.804 1.00 39.03  ? 38   CYS A CB  1 
ATOM   140  S SG  . CYS A 1 24  ? 15.362  31.951 33.640 1.00 43.22  ? 38   CYS A SG  1 
ATOM   141  N N   . ALA A 1 25  ? 12.768  36.200 35.025 1.00 34.16  ? 39   ALA A N   1 
ATOM   142  C CA  . ALA A 1 25  ? 12.123  37.039 36.030 1.00 33.29  ? 39   ALA A CA  1 
ATOM   143  C C   . ALA A 1 25  ? 10.602  36.913 36.018 1.00 37.23  ? 39   ALA A C   1 
ATOM   144  O O   . ALA A 1 25  ? 9.953   37.223 35.016 1.00 37.43  ? 39   ALA A O   1 
ATOM   145  C CB  . ALA A 1 25  ? 12.528  38.489 35.837 1.00 33.76  ? 39   ALA A CB  1 
ATOM   146  N N   . PRO A 1 26  ? 10.011  36.496 37.150 1.00 32.49  ? 40   PRO A N   1 
ATOM   147  C CA  . PRO A 1 26  ? 8.554   36.566 37.331 1.00 31.80  ? 40   PRO A CA  1 
ATOM   148  C C   . PRO A 1 26  ? 8.043   38.015 37.372 1.00 35.59  ? 40   PRO A C   1 
ATOM   149  O O   . PRO A 1 26  ? 8.803   38.948 37.638 1.00 34.81  ? 40   PRO A O   1 
ATOM   150  C CB  . PRO A 1 26  ? 8.325   35.888 38.696 1.00 33.48  ? 40   PRO A CB  1 
ATOM   151  C CG  . PRO A 1 26  ? 9.669   35.805 39.354 1.00 37.98  ? 40   PRO A CG  1 
ATOM   152  C CD  . PRO A 1 26  ? 10.684  35.776 38.246 1.00 33.82  ? 40   PRO A CD  1 
ATOM   153  N N   . SER A 1 27  ? 6.740   38.189 37.169 1.00 32.67  ? 41   SER A N   1 
ATOM   154  C CA  . SER A 1 27  ? 6.107   39.506 37.292 1.00 32.42  ? 41   SER A CA  1 
ATOM   155  C C   . SER A 1 27  ? 5.746   39.885 38.737 1.00 35.78  ? 41   SER A C   1 
ATOM   156  O O   . SER A 1 27  ? 5.196   39.077 39.489 1.00 36.03  ? 41   SER A O   1 
ATOM   157  C CB  . SER A 1 27  ? 4.868   39.582 36.401 1.00 35.69  ? 41   SER A CB  1 
ATOM   158  O OG  . SER A 1 27  ? 4.292   40.866 36.456 1.00 45.63  ? 41   SER A OG  1 
ATOM   159  N N   . VAL A 1 28  ? 6.042   41.127 39.114 1.00 31.09  ? 42   VAL A N   1 
ATOM   160  C CA  . VAL A 1 28  ? 5.715   41.632 40.446 1.00 30.05  ? 42   VAL A CA  1 
ATOM   161  C C   . VAL A 1 28  ? 4.212   41.882 40.615 1.00 33.39  ? 42   VAL A C   1 
ATOM   162  O O   . VAL A 1 28  ? 3.746   42.169 41.722 1.00 31.54  ? 42   VAL A O   1 
ATOM   163  C CB  . VAL A 1 28  ? 6.497   42.915 40.768 1.00 33.64  ? 42   VAL A CB  1 
ATOM   164  C CG1 . VAL A 1 28  ? 5.813   44.120 40.136 1.00 32.93  ? 42   VAL A CG1 1 
ATOM   165  C CG2 . VAL A 1 28  ? 6.602   43.105 42.272 1.00 33.66  ? 42   VAL A CG2 1 
ATOM   166  N N   . SER A 1 29  ? 3.461   41.773 39.522 1.00 30.90  ? 43   SER A N   1 
ATOM   167  C CA  . SER A 1 29  ? 2.038   42.100 39.546 1.00 31.55  ? 43   SER A CA  1 
ATOM   168  C C   . SER A 1 29  ? 1.108   40.996 39.053 1.00 35.26  ? 43   SER A C   1 
ATOM   169  O O   . SER A 1 29  ? -0.041  41.272 38.712 1.00 35.75  ? 43   SER A O   1 
ATOM   170  C CB  . SER A 1 29  ? 1.767   43.379 38.749 1.00 35.57  ? 43   SER A CB  1 
ATOM   171  O OG  . SER A 1 29  ? 2.202   43.235 37.412 1.00 44.15  ? 43   SER A OG  1 
ATOM   172  N N   . TYR A 1 30  ? 1.570   39.749 39.065 1.00 29.56  ? 44   TYR A N   1 
ATOM   173  C CA  . TYR A 1 30  ? 0.747   38.660 38.560 1.00 28.63  ? 44   TYR A CA  1 
ATOM   174  C C   . TYR A 1 30  ? -0.484  38.332 39.407 1.00 34.86  ? 44   TYR A C   1 
ATOM   175  O O   . TYR A 1 30  ? -1.444  37.739 38.913 1.00 35.14  ? 44   TYR A O   1 
ATOM   176  C CB  . TYR A 1 30  ? 1.579   37.414 38.264 1.00 28.52  ? 44   TYR A CB  1 
ATOM   177  C CG  . TYR A 1 30  ? 1.997   36.594 39.470 1.00 28.71  ? 44   TYR A CG  1 
ATOM   178  C CD1 . TYR A 1 30  ? 3.347   36.420 39.779 1.00 30.31  ? 44   TYR A CD1 1 
ATOM   179  C CD2 . TYR A 1 30  ? 1.058   35.911 40.233 1.00 28.92  ? 44   TYR A CD2 1 
ATOM   180  C CE1 . TYR A 1 30  ? 3.750   35.603 40.817 1.00 29.63  ? 44   TYR A CE1 1 
ATOM   181  C CE2 . TYR A 1 30  ? 1.452   35.085 41.278 1.00 30.12  ? 44   TYR A CE2 1 
ATOM   182  C CZ  . TYR A 1 30  ? 2.803   34.926 41.555 1.00 36.20  ? 44   TYR A CZ  1 
ATOM   183  O OH  . TYR A 1 30  ? 3.205   34.136 42.605 1.00 34.05  ? 44   TYR A OH  1 
ATOM   184  N N   . PHE A 1 31  ? -0.465  38.723 40.675 1.00 32.92  ? 45   PHE A N   1 
ATOM   185  C CA  . PHE A 1 31  ? -1.629  38.524 41.534 1.00 33.77  ? 45   PHE A CA  1 
ATOM   186  C C   . PHE A 1 31  ? -2.744  39.490 41.131 1.00 38.57  ? 45   PHE A C   1 
ATOM   187  O O   . PHE A 1 31  ? -3.931  39.195 41.296 1.00 36.18  ? 45   PHE A O   1 
ATOM   188  C CB  . PHE A 1 31  ? -1.267  38.718 43.012 1.00 35.90  ? 45   PHE A CB  1 
ATOM   189  C CG  . PHE A 1 31  ? -0.538  37.546 43.626 1.00 37.97  ? 45   PHE A CG  1 
ATOM   190  C CD1 . PHE A 1 31  ? 0.775   37.678 44.075 1.00 41.06  ? 45   PHE A CD1 1 
ATOM   191  C CD2 . PHE A 1 31  ? -1.171  36.324 43.787 1.00 40.48  ? 45   PHE A CD2 1 
ATOM   192  C CE1 . PHE A 1 31  ? 1.443   36.609 44.664 1.00 42.19  ? 45   PHE A CE1 1 
ATOM   193  C CE2 . PHE A 1 31  ? -0.502  35.244 44.368 1.00 43.60  ? 45   PHE A CE2 1 
ATOM   194  C CZ  . PHE A 1 31  ? 0.800   35.393 44.818 1.00 41.56  ? 45   PHE A CZ  1 
ATOM   195  N N   . LYS A 1 32  ? -2.348  40.626 40.561 1.00 37.53  ? 46   LYS A N   1 
ATOM   196  C CA  . LYS A 1 32  ? -3.297  41.659 40.155 1.00 38.42  ? 46   LYS A CA  1 
ATOM   197  C C   . LYS A 1 32  ? -3.750  41.479 38.716 1.00 44.96  ? 46   LYS A C   1 
ATOM   198  O O   . LYS A 1 32  ? -4.915  41.700 38.397 1.00 45.33  ? 46   LYS A O   1 
ATOM   199  C CB  . LYS A 1 32  ? -2.685  43.052 40.320 1.00 40.98  ? 46   LYS A CB  1 
ATOM   200  C CG  . LYS A 1 32  ? -3.519  44.170 39.698 1.00 50.15  ? 46   LYS A CG  1 
ATOM   201  C CD  . LYS A 1 32  ? -2.914  45.541 39.964 1.00 50.23  ? 46   LYS A CD  1 
ATOM   202  C CE  . LYS A 1 32  ? -1.518  45.656 39.376 1.00 53.14  ? 46   LYS A CE  1 
ATOM   203  N NZ  . LYS A 1 32  ? -0.850  46.941 39.734 1.00 52.43  ? 46   LYS A NZ  1 
ATOM   204  N N   . CYS A 1 33  ? -2.833  41.036 37.859 1.00 42.05  ? 47   CYS A N   1 
ATOM   205  C CA  . CYS A 1 33  ? -3.056  41.065 36.421 1.00 41.66  ? 47   CYS A CA  1 
ATOM   206  C C   . CYS A 1 33  ? -3.320  39.704 35.792 1.00 44.75  ? 47   CYS A C   1 
ATOM   207  O O   . CYS A 1 33  ? -3.817  39.629 34.669 1.00 44.21  ? 47   CYS A O   1 
ATOM   208  C CB  . CYS A 1 33  ? -1.871  41.725 35.717 1.00 42.19  ? 47   CYS A CB  1 
ATOM   209  S SG  . CYS A 1 33  ? -1.527  43.404 36.279 1.00 46.33  ? 47   CYS A SG  1 
ATOM   210  N N   . VAL A 1 34  ? -2.912  38.632 36.464 1.00 40.58  ? 48   VAL A N   1 
ATOM   211  C CA  . VAL A 1 34  ? -3.000  37.308 35.854 1.00 39.70  ? 48   VAL A CA  1 
ATOM   212  C C   . VAL A 1 34  ? -3.814  36.290 36.649 1.00 43.06  ? 48   VAL A C   1 
ATOM   213  O O   . VAL A 1 34  ? -4.545  35.490 36.073 1.00 42.95  ? 48   VAL A O   1 
ATOM   214  C CB  . VAL A 1 34  ? -1.619  36.771 35.408 1.00 42.70  ? 48   VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 34  ? -1.764  35.428 34.722 1.00 42.14  ? 48   VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 34  ? -0.937  37.770 34.478 1.00 42.22  ? 48   VAL A CG2 1 
ATOM   217  N N   . GLN A 1 35  ? -3.733  36.355 37.971 1.00 39.53  ? 49   GLN A N   1 
ATOM   218  C CA  . GLN A 1 35  ? -4.444  35.392 38.808 1.00 39.27  ? 49   GLN A CA  1 
ATOM   219  C C   . GLN A 1 35  ? -5.794  35.928 39.274 1.00 44.47  ? 49   GLN A C   1 
ATOM   220  O O   . GLN A 1 35  ? -5.897  37.071 39.714 1.00 43.54  ? 49   GLN A O   1 
ATOM   221  C CB  . GLN A 1 35  ? -3.586  34.989 40.010 1.00 39.75  ? 49   GLN A CB  1 
ATOM   222  C CG  . GLN A 1 35  ? -2.243  34.391 39.631 1.00 30.40  ? 49   GLN A CG  1 
ATOM   223  C CD  . GLN A 1 35  ? -2.379  33.216 38.693 1.00 36.40  ? 49   GLN A CD  1 
ATOM   224  O OE1 . GLN A 1 35  ? -3.303  32.412 38.806 1.00 32.14  ? 49   GLN A OE1 1 
ATOM   225  N NE2 . GLN A 1 35  ? -1.464  33.116 37.749 1.00 27.41  ? 49   GLN A NE2 1 
ATOM   226  N N   . LYS A 1 36  ? -6.831  35.102 39.162 1.00 42.50  ? 50   LYS A N   1 
ATOM   227  C CA  . LYS A 1 36  ? -8.153  35.481 39.653 1.00 42.60  ? 50   LYS A CA  1 
ATOM   228  C C   . LYS A 1 36  ? -8.473  34.817 40.986 1.00 46.18  ? 50   LYS A C   1 
ATOM   229  O O   . LYS A 1 36  ? -9.078  35.436 41.868 1.00 46.58  ? 50   LYS A O   1 
ATOM   230  C CB  . LYS A 1 36  ? -9.238  35.159 38.627 1.00 45.41  ? 50   LYS A CB  1 
ATOM   231  C CG  . LYS A 1 36  ? -8.961  35.691 37.225 1.00 67.05  ? 50   LYS A CG  1 
ATOM   232  C CD  . LYS A 1 36  ? -7.904  34.851 36.515 1.00 82.51  ? 50   LYS A CD  1 
ATOM   233  C CE  . LYS A 1 36  ? -7.863  35.152 35.022 1.00 97.18  ? 50   LYS A CE  1 
ATOM   234  N NZ  . LYS A 1 36  ? -9.160  34.845 34.355 1.00 108.09 ? 50   LYS A NZ  1 
ATOM   235  N N   . GLU A 1 37  ? -8.011  33.579 41.149 1.00 41.10  ? 51   GLU A N   1 
ATOM   236  C CA  . GLU A 1 37  ? -8.273  32.812 42.362 1.00 39.86  ? 51   GLU A CA  1 
ATOM   237  C C   . GLU A 1 37  ? -7.112  32.840 43.348 1.00 42.95  ? 51   GLU A C   1 
ATOM   238  O O   . GLU A 1 37  ? -7.316  32.952 44.558 1.00 42.66  ? 51   GLU A O   1 
ATOM   239  C CB  . GLU A 1 37  ? -8.601  31.363 42.013 1.00 41.08  ? 51   GLU A CB  1 
ATOM   240  C CG  . GLU A 1 37  ? -9.673  31.202 40.957 1.00 50.67  ? 51   GLU A CG  1 
ATOM   241  C CD  . GLU A 1 37  ? -10.338 29.841 41.015 1.00 74.38  ? 51   GLU A CD  1 
ATOM   242  O OE1 . GLU A 1 37  ? -10.229 29.167 42.063 1.00 58.57  ? 51   GLU A OE1 1 
ATOM   243  O OE2 . GLU A 1 37  ? -10.991 29.457 40.021 1.00 75.87  ? 51   GLU A OE2 1 
ATOM   244  N N   . VAL A 1 38  ? -5.894  32.699 42.829 1.00 38.60  ? 52   VAL A N   1 
ATOM   245  C CA  . VAL A 1 38  ? -4.722  32.516 43.678 1.00 37.08  ? 52   VAL A CA  1 
ATOM   246  C C   . VAL A 1 38  ? -4.239  33.812 44.327 1.00 39.68  ? 52   VAL A C   1 
ATOM   247  O O   . VAL A 1 38  ? -3.808  34.737 43.640 1.00 38.39  ? 52   VAL A O   1 
ATOM   248  C CB  . VAL A 1 38  ? -3.592  31.787 42.931 1.00 40.01  ? 52   VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 38  ? -2.353  31.694 43.806 1.00 39.56  ? 52   VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 38  ? -4.051  30.405 42.481 1.00 39.48  ? 52   VAL A CG2 1 
ATOM   251  N N   . LEU A 1 39  ? -4.270  33.841 45.658 1.00 36.15  ? 53   LEU A N   1 
ATOM   252  C CA  . LEU A 1 39  ? -3.829  34.991 46.436 1.00 35.76  ? 53   LEU A CA  1 
ATOM   253  C C   . LEU A 1 39  ? -2.504  34.703 47.132 1.00 39.09  ? 53   LEU A C   1 
ATOM   254  O O   . LEU A 1 39  ? -2.138  33.544 47.335 1.00 38.11  ? 53   LEU A O   1 
ATOM   255  C CB  . LEU A 1 39  ? -4.866  35.332 47.507 1.00 35.94  ? 53   LEU A CB  1 
ATOM   256  C CG  . LEU A 1 39  ? -6.341  35.331 47.110 1.00 40.70  ? 53   LEU A CG  1 
ATOM   257  C CD1 . LEU A 1 39  ? -7.186  35.756 48.312 1.00 40.73  ? 53   LEU A CD1 1 
ATOM   258  C CD2 . LEU A 1 39  ? -6.590  36.228 45.893 1.00 42.11  ? 53   LEU A CD2 1 
ATOM   259  N N   . PRO A 1 40  ? -1.826  35.763 47.610 1.00 35.05  ? 54   PRO A N   1 
ATOM   260  C CA  . PRO A 1 40  ? -0.526  35.597 48.270 1.00 34.12  ? 54   PRO A CA  1 
ATOM   261  C C   . PRO A 1 40  ? -0.566  34.581 49.402 1.00 36.94  ? 54   PRO A C   1 
ATOM   262  O O   . PRO A 1 40  ? 0.360   33.793 49.560 1.00 37.42  ? 54   PRO A O   1 
ATOM   263  C CB  . PRO A 1 40  ? -0.240  36.999 48.813 1.00 35.64  ? 54   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 40  ? -0.874  37.915 47.801 1.00 40.25  ? 54   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 40  ? -2.040  37.155 47.167 1.00 35.98  ? 54   PRO A CD  1 
ATOM   266  N N   . SER A 1 41  ? -1.646  34.597 50.177 1.00 32.76  ? 55   SER A N   1 
ATOM   267  C CA  . SER A 1 41  ? -1.784  33.717 51.341 1.00 31.63  ? 55   SER A CA  1 
ATOM   268  C C   . SER A 1 41  ? -1.730  32.245 50.948 1.00 33.76  ? 55   SER A C   1 
ATOM   269  O O   . SER A 1 41  ? -1.345  31.397 51.750 1.00 33.19  ? 55   SER A O   1 
ATOM   270  C CB  . SER A 1 41  ? -3.099  33.988 52.075 1.00 33.59  ? 55   SER A CB  1 
ATOM   271  O OG  . SER A 1 41  ? -4.216  33.624 51.277 1.00 38.31  ? 55   SER A OG  1 
ATOM   272  N N   . MET A 1 42  ? -2.170  31.950 49.733 1.00 29.44  ? 56   MET A N   1 
ATOM   273  C CA  . MET A 1 42  ? -2.203  30.581 49.240 1.00 30.48  ? 56   MET A CA  1 
ATOM   274  C C   . MET A 1 42  ? -0.835  30.131 48.721 1.00 34.63  ? 56   MET A C   1 
ATOM   275  O O   . MET A 1 42  ? -0.503  28.944 48.745 1.00 33.17  ? 56   MET A O   1 
ATOM   276  C CB  . MET A 1 42  ? -3.247  30.459 48.134 1.00 33.15  ? 56   MET A CB  1 
ATOM   277  C CG  . MET A 1 42  ? -4.615  30.926 48.568 1.00 37.58  ? 56   MET A CG  1 
ATOM   278  S SD  . MET A 1 42  ? -5.772  30.952 47.209 1.00 42.84  ? 56   MET A SD  1 
ATOM   279  C CE  . MET A 1 42  ? -7.250  31.574 48.045 1.00 39.47  ? 56   MET A CE  1 
ATOM   280  N N   . ARG A 1 43  ? -0.077  31.078 48.186 1.00 31.99  ? 57   ARG A N   1 
ATOM   281  C CA  . ARG A 1 43  ? 1.279   30.803 47.755 1.00 31.86  ? 57   ARG A CA  1 
ATOM   282  C C   . ARG A 1 43  ? 2.071   30.519 49.028 1.00 32.88  ? 57   ARG A C   1 
ATOM   283  O O   . ARG A 1 43  ? 2.933   29.638 49.072 1.00 30.03  ? 57   ARG A O   1 
ATOM   284  C CB  . ARG A 1 43  ? 1.847   32.022 47.007 1.00 33.50  ? 57   ARG A CB  1 
ATOM   285  C CG  . ARG A 1 43  ? 3.265   31.831 46.459 1.00 39.75  ? 57   ARG A CG  1 
ATOM   286  C CD  . ARG A 1 43  ? 3.935   33.165 46.158 1.00 40.24  ? 57   ARG A CD  1 
ATOM   287  N NE  . ARG A 1 43  ? 5.320   32.994 45.732 1.00 34.50  ? 57   ARG A NE  1 
ATOM   288  C CZ  . ARG A 1 43  ? 6.360   33.025 46.556 1.00 36.17  ? 57   ARG A CZ  1 
ATOM   289  N NH1 . ARG A 1 43  ? 6.168   33.248 47.842 1.00 16.95  ? 57   ARG A NH1 1 
ATOM   290  N NH2 . ARG A 1 43  ? 7.590   32.849 46.094 1.00 26.29  ? 57   ARG A NH2 1 
ATOM   291  N N   . LYS A 1 44  ? 1.712   31.231 50.087 1.00 29.86  ? 58   LYS A N   1 
ATOM   292  C CA  . LYS A 1 44  ? 2.353   31.038 51.380 1.00 29.92  ? 58   LYS A CA  1 
ATOM   293  C C   . LYS A 1 44  ? 2.155   29.598 51.839 1.00 34.18  ? 58   LYS A C   1 
ATOM   294  O O   . LYS A 1 44  ? 3.104   28.919 52.235 1.00 34.22  ? 58   LYS A O   1 
ATOM   295  C CB  . LYS A 1 44  ? 1.747   31.997 52.407 1.00 32.77  ? 58   LYS A CB  1 
ATOM   296  C CG  . LYS A 1 44  ? 2.375   31.921 53.789 1.00 49.09  ? 58   LYS A CG  1 
ATOM   297  C CD  . LYS A 1 44  ? 3.789   32.458 53.775 1.00 64.10  ? 58   LYS A CD  1 
ATOM   298  C CE  . LYS A 1 44  ? 4.428   32.373 55.152 1.00 83.55  ? 58   LYS A CE  1 
ATOM   299  N NZ  . LYS A 1 44  ? 4.704   30.969 55.564 1.00 95.08  ? 58   LYS A NZ  1 
ATOM   300  N N   . ILE A 1 45  ? 0.911   29.133 51.783 1.00 30.14  ? 59   ILE A N   1 
ATOM   301  C CA  . ILE A 1 45  ? 0.584   27.781 52.205 1.00 29.16  ? 59   ILE A CA  1 
ATOM   302  C C   . ILE A 1 45  ? 1.313   26.731 51.363 1.00 29.45  ? 59   ILE A C   1 
ATOM   303  O O   . ILE A 1 45  ? 1.910   25.801 51.906 1.00 27.34  ? 59   ILE A O   1 
ATOM   304  C CB  . ILE A 1 45  ? -0.936  27.544 52.214 1.00 32.73  ? 59   ILE A CB  1 
ATOM   305  C CG1 . ILE A 1 45  ? -1.628  28.552 53.129 1.00 33.72  ? 59   ILE A CG1 1 
ATOM   306  C CG2 . ILE A 1 45  ? -1.256  26.122 52.674 1.00 33.04  ? 59   ILE A CG2 1 
ATOM   307  C CD1 . ILE A 1 45  ? -3.142  28.524 53.011 1.00 39.79  ? 59   ILE A CD1 1 
ATOM   308  N N   . VAL A 1 46  ? 1.233   26.858 50.040 1.00 25.22  ? 60   VAL A N   1 
ATOM   309  C CA  . VAL A 1 46  ? 1.919   25.919 49.156 1.00 24.86  ? 60   VAL A CA  1 
ATOM   310  C C   . VAL A 1 46  ? 3.439   25.944 49.337 1.00 28.50  ? 60   VAL A C   1 
ATOM   311  O O   . VAL A 1 46  ? 4.066   24.892 49.458 1.00 28.65  ? 60   VAL A O   1 
ATOM   312  C CB  . VAL A 1 46  ? 1.523   26.076 47.683 1.00 29.21  ? 60   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 46  ? 2.055   24.904 46.876 1.00 28.95  ? 60   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 46  ? 0.020   26.152 47.542 1.00 29.66  ? 60   VAL A CG2 1 
ATOM   315  N N   . ALA A 1 47  ? 4.024   27.140 49.364 1.00 23.39  ? 61   ALA A N   1 
ATOM   316  C CA  . ALA A 1 47  ? 5.462   27.277 49.583 1.00 23.05  ? 61   ALA A CA  1 
ATOM   317  C C   . ALA A 1 47  ? 5.878   26.517 50.831 1.00 28.87  ? 61   ALA A C   1 
ATOM   318  O O   . ALA A 1 47  ? 6.847   25.749 50.809 1.00 30.04  ? 61   ALA A O   1 
ATOM   319  C CB  . ALA A 1 47  ? 5.863   28.744 49.697 1.00 23.36  ? 61   ALA A CB  1 
ATOM   320  N N   . THR A 1 48  ? 5.105   26.697 51.899 1.00 25.59  ? 62   THR A N   1 
ATOM   321  C CA  . THR A 1 48  ? 5.374   26.063 53.191 1.00 26.02  ? 62   THR A CA  1 
ATOM   322  C C   . THR A 1 48  ? 5.376   24.535 53.114 1.00 31.56  ? 62   THR A C   1 
ATOM   323  O O   . THR A 1 48  ? 6.215   23.873 53.730 1.00 30.92  ? 62   THR A O   1 
ATOM   324  C CB  . THR A 1 48  ? 4.381   26.562 54.247 1.00 32.02  ? 62   THR A CB  1 
ATOM   325  O OG1 . THR A 1 48  ? 4.490   27.984 54.349 1.00 37.78  ? 62   THR A OG1 1 
ATOM   326  C CG2 . THR A 1 48  ? 4.646   25.928 55.609 1.00 25.15  ? 62   THR A CG2 1 
ATOM   327  N N   . TRP A 1 49  ? 4.411   23.995 52.376 1.00 28.47  ? 63   TRP A N   1 
ATOM   328  C CA  . TRP A 1 49  ? 4.290   22.562 52.165 1.00 28.76  ? 63   TRP A CA  1 
ATOM   329  C C   . TRP A 1 49  ? 5.434   22.039 51.294 1.00 32.09  ? 63   TRP A C   1 
ATOM   330  O O   . TRP A 1 49  ? 5.932   20.930 51.507 1.00 32.72  ? 63   TRP A O   1 
ATOM   331  C CB  . TRP A 1 49  ? 2.943   22.252 51.497 1.00 28.06  ? 63   TRP A CB  1 
ATOM   332  C CG  . TRP A 1 49  ? 2.836   20.858 50.975 1.00 28.88  ? 63   TRP A CG  1 
ATOM   333  C CD1 . TRP A 1 49  ? 2.599   19.729 51.700 1.00 31.95  ? 63   TRP A CD1 1 
ATOM   334  C CD2 . TRP A 1 49  ? 2.997   20.437 49.613 1.00 29.14  ? 63   TRP A CD2 1 
ATOM   335  N NE1 . TRP A 1 49  ? 2.607   18.624 50.876 1.00 31.73  ? 63   TRP A NE1 1 
ATOM   336  C CE2 . TRP A 1 49  ? 2.847   19.032 49.587 1.00 33.32  ? 63   TRP A CE2 1 
ATOM   337  C CE3 . TRP A 1 49  ? 3.246   21.110 48.408 1.00 30.24  ? 63   TRP A CE3 1 
ATOM   338  C CZ2 . TRP A 1 49  ? 2.947   18.288 48.415 1.00 32.78  ? 63   TRP A CZ2 1 
ATOM   339  C CZ3 . TRP A 1 49  ? 3.371   20.374 47.253 1.00 31.86  ? 63   TRP A CZ3 1 
ATOM   340  C CH2 . TRP A 1 49  ? 3.206   18.975 47.259 1.00 32.73  ? 63   TRP A CH2 1 
ATOM   341  N N   . MET A 1 50  ? 5.810   22.821 50.284 1.00 25.93  ? 64   MET A N   1 
ATOM   342  C CA  . MET A 1 50  ? 6.934   22.484 49.417 1.00 24.86  ? 64   MET A CA  1 
ATOM   343  C C   . MET A 1 50  ? 8.263   22.414 50.167 1.00 28.71  ? 64   MET A C   1 
ATOM   344  O O   . MET A 1 50  ? 9.135   21.624 49.814 1.00 27.76  ? 64   MET A O   1 
ATOM   345  C CB  . MET A 1 50  ? 7.047   23.485 48.259 1.00 26.89  ? 64   MET A CB  1 
ATOM   346  C CG  . MET A 1 50  ? 5.969   23.351 47.193 1.00 29.63  ? 64   MET A CG  1 
ATOM   347  S SD  . MET A 1 50  ? 5.847   24.807 46.124 1.00 33.20  ? 64   MET A SD  1 
ATOM   348  C CE  . MET A 1 50  ? 7.275   24.589 45.062 1.00 29.01  ? 64   MET A CE  1 
ATOM   349  N N   . LEU A 1 51  ? 8.429   23.289 51.157 1.00 25.99  ? 65   LEU A N   1 
ATOM   350  C CA  . LEU A 1 51  ? 9.633   23.339 51.982 1.00 25.86  ? 65   LEU A CA  1 
ATOM   351  C C   . LEU A 1 51  ? 9.719   22.153 52.944 1.00 30.42  ? 65   LEU A C   1 
ATOM   352  O O   . LEU A 1 51  ? 10.790  21.572 53.150 1.00 30.27  ? 65   LEU A O   1 
ATOM   353  C CB  . LEU A 1 51  ? 9.679   24.658 52.763 1.00 26.04  ? 65   LEU A CB  1 
ATOM   354  C CG  . LEU A 1 51  ? 10.877  24.910 53.698 1.00 30.79  ? 65   LEU A CG  1 
ATOM   355  C CD1 . LEU A 1 51  ? 12.202  24.872 52.952 1.00 31.37  ? 65   LEU A CD1 1 
ATOM   356  C CD2 . LEU A 1 51  ? 10.725  26.237 54.423 1.00 30.46  ? 65   LEU A CD2 1 
ATOM   357  N N   . GLU A 1 52  ? 8.584   21.792 53.528 1.00 27.22  ? 66   GLU A N   1 
ATOM   358  C CA  . GLU A 1 52  ? 8.519   20.642 54.413 1.00 27.27  ? 66   GLU A CA  1 
ATOM   359  C C   . GLU A 1 52  ? 8.793   19.333 53.677 1.00 29.50  ? 66   GLU A C   1 
ATOM   360  O O   . GLU A 1 52  ? 9.400   18.422 54.225 1.00 29.41  ? 66   GLU A O   1 
ATOM   361  C CB  . GLU A 1 52  ? 7.180   20.610 55.147 1.00 29.09  ? 66   GLU A CB  1 
ATOM   362  C CG  . GLU A 1 52  ? 6.937   21.886 55.965 1.00 43.93  ? 66   GLU A CG  1 
ATOM   363  C CD  . GLU A 1 52  ? 5.624   21.877 56.730 1.00 66.43  ? 66   GLU A CD  1 
ATOM   364  O OE1 . GLU A 1 52  ? 4.721   21.097 56.359 1.00 68.22  ? 66   GLU A OE1 1 
ATOM   365  O OE2 . GLU A 1 52  ? 5.489   22.673 57.687 1.00 54.43  ? 66   GLU A OE2 1 
ATOM   366  N N   . VAL A 1 53  ? 8.412   19.273 52.410 1.00 25.49  ? 67   VAL A N   1 
ATOM   367  C CA  . VAL A 1 53  ? 8.703   18.115 51.577 1.00 24.87  ? 67   VAL A CA  1 
ATOM   368  C C   . VAL A 1 53  ? 10.198  18.046 51.259 1.00 30.93  ? 67   VAL A C   1 
ATOM   369  O O   . VAL A 1 53  ? 10.826  16.994 51.380 1.00 31.33  ? 67   VAL A O   1 
ATOM   370  C CB  . VAL A 1 53  ? 7.816   18.106 50.316 1.00 27.49  ? 67   VAL A CB  1 
ATOM   371  C CG1 . VAL A 1 53  ? 8.122   16.916 49.441 1.00 27.06  ? 67   VAL A CG1 1 
ATOM   372  C CG2 . VAL A 1 53  ? 6.353   18.120 50.705 1.00 27.05  ? 67   VAL A CG2 1 
ATOM   373  N N   . CYS A 1 54  ? 10.789  19.198 50.971 1.00 28.02  ? 68   CYS A N   1 
ATOM   374  C CA  . CYS A 1 54  ? 12.218  19.268 50.677 1.00 27.55  ? 68   CYS A CA  1 
ATOM   375  C C   . CYS A 1 54  ? 13.075  18.988 51.898 1.00 30.46  ? 68   CYS A C   1 
ATOM   376  O O   . CYS A 1 54  ? 14.143  18.398 51.789 1.00 30.56  ? 68   CYS A O   1 
ATOM   377  C CB  . CYS A 1 54  ? 12.582  20.619 50.046 1.00 27.69  ? 68   CYS A CB  1 
ATOM   378  S SG  . CYS A 1 54  ? 11.882  20.832 48.402 1.00 31.64  ? 68   CYS A SG  1 
ATOM   379  N N   . GLU A 1 55  ? 12.629  19.448 53.058 1.00 27.77  ? 69   GLU A N   1 
ATOM   380  C CA  . GLU A 1 55  ? 13.291  19.095 54.312 1.00 28.32  ? 69   GLU A CA  1 
ATOM   381  C C   . GLU A 1 55  ? 13.180  17.603 54.625 1.00 34.17  ? 69   GLU A C   1 
ATOM   382  O O   . GLU A 1 55  ? 14.178  16.934 54.884 1.00 33.77  ? 69   GLU A O   1 
ATOM   383  C CB  . GLU A 1 55  ? 12.732  19.916 55.470 1.00 29.78  ? 69   GLU A CB  1 
ATOM   384  C CG  . GLU A 1 55  ? 13.115  21.395 55.407 1.00 44.57  ? 69   GLU A CG  1 
ATOM   385  C CD  . GLU A 1 55  ? 12.533  22.216 56.554 1.00 70.18  ? 69   GLU A CD  1 
ATOM   386  O OE1 . GLU A 1 55  ? 11.639  21.712 57.276 1.00 56.67  ? 69   GLU A OE1 1 
ATOM   387  O OE2 . GLU A 1 55  ? 12.971  23.374 56.729 1.00 68.54  ? 69   GLU A OE2 1 
ATOM   388  N N   . GLU A 1 56  ? 11.965  17.077 54.558 1.00 32.46  ? 70   GLU A N   1 
ATOM   389  C CA  . GLU A 1 56  ? 11.717  15.693 54.920 1.00 33.36  ? 70   GLU A CA  1 
ATOM   390  C C   . GLU A 1 56  ? 12.486  14.776 53.984 1.00 37.90  ? 70   GLU A C   1 
ATOM   391  O O   . GLU A 1 56  ? 12.898  13.686 54.363 1.00 38.16  ? 70   GLU A O   1 
ATOM   392  C CB  . GLU A 1 56  ? 10.222  15.393 54.812 1.00 35.29  ? 70   GLU A CB  1 
ATOM   393  C CG  . GLU A 1 56  ? 9.763   14.203 55.630 1.00 51.64  ? 70   GLU A CG  1 
ATOM   394  C CD  . GLU A 1 56  ? 9.475   14.574 57.072 1.00 83.30  ? 70   GLU A CD  1 
ATOM   395  O OE1 . GLU A 1 56  ? 9.026   15.715 57.311 1.00 84.78  ? 70   GLU A OE1 1 
ATOM   396  O OE2 . GLU A 1 56  ? 9.681   13.722 57.964 1.00 79.90  ? 70   GLU A OE2 1 
ATOM   397  N N   . GLN A 1 57  ? 12.628  15.201 52.737 1.00 34.41  ? 71   GLN A N   1 
ATOM   398  C CA  . GLN A 1 57  ? 13.246  14.361 51.721 1.00 33.80  ? 71   GLN A CA  1 
ATOM   399  C C   . GLN A 1 57  ? 14.732  14.643 51.597 1.00 37.55  ? 71   GLN A C   1 
ATOM   400  O O   . GLN A 1 57  ? 15.403  14.082 50.733 1.00 38.06  ? 71   GLN A O   1 
ATOM   401  C CB  . GLN A 1 57  ? 12.563  14.549 50.363 1.00 34.46  ? 71   GLN A CB  1 
ATOM   402  C CG  . GLN A 1 57  ? 11.219  13.863 50.251 1.00 42.16  ? 71   GLN A CG  1 
ATOM   403  C CD  . GLN A 1 57  ? 11.319  12.355 50.410 1.00 52.29  ? 71   GLN A CD  1 
ATOM   404  O OE1 . GLN A 1 57  ? 12.045  11.687 49.671 1.00 48.44  ? 71   GLN A OE1 1 
ATOM   405  N NE2 . GLN A 1 57  ? 10.565  11.809 51.359 1.00 29.77  ? 71   GLN A NE2 1 
ATOM   406  N N   . LYS A 1 58  ? 15.235  15.515 52.459 1.00 33.72  ? 72   LYS A N   1 
ATOM   407  C CA  . LYS A 1 58  ? 16.642  15.895 52.431 1.00 34.07  ? 72   LYS A CA  1 
ATOM   408  C C   . LYS A 1 58  ? 17.124  16.221 51.023 1.00 37.57  ? 72   LYS A C   1 
ATOM   409  O O   . LYS A 1 58  ? 18.149  15.718 50.570 1.00 37.51  ? 72   LYS A O   1 
ATOM   410  C CB  . LYS A 1 58  ? 17.511  14.828 53.101 1.00 36.44  ? 72   LYS A CB  1 
ATOM   411  C CG  . LYS A 1 58  ? 17.463  14.918 54.612 1.00 51.66  ? 72   LYS A CG  1 
ATOM   412  C CD  . LYS A 1 58  ? 17.622  13.565 55.268 1.00 64.34  ? 72   LYS A CD  1 
ATOM   413  C CE  . LYS A 1 58  ? 17.249  13.643 56.738 1.00 76.57  ? 72   LYS A CE  1 
ATOM   414  N NZ  . LYS A 1 58  ? 17.479  12.354 57.441 1.00 86.96  ? 72   LYS A NZ  1 
ATOM   415  N N   . CYS A 1 59  ? 16.331  17.028 50.326 1.00 33.15  ? 73   CYS A N   1 
ATOM   416  C CA  . CYS A 1 59  ? 16.664  17.498 48.991 1.00 32.18  ? 73   CYS A CA  1 
ATOM   417  C C   . CYS A 1 59  ? 17.865  18.442 49.018 1.00 34.65  ? 73   CYS A C   1 
ATOM   418  O O   . CYS A 1 59  ? 18.177  19.061 50.036 1.00 33.06  ? 73   CYS A O   1 
ATOM   419  C CB  . CYS A 1 59  ? 15.458  18.230 48.375 1.00 32.38  ? 73   CYS A CB  1 
ATOM   420  S SG  . CYS A 1 59  ? 14.102  17.182 47.741 1.00 36.20  ? 73   CYS A SG  1 
ATOM   421  N N   . GLU A 1 60  ? 18.487  18.601 47.860 1.00 32.03  ? 74   GLU A N   1 
ATOM   422  C CA  . GLU A 1 60  ? 19.437  19.681 47.641 1.00 31.97  ? 74   GLU A CA  1 
ATOM   423  C C   . GLU A 1 60  ? 18.820  20.993 48.108 1.00 34.43  ? 74   GLU A C   1 
ATOM   424  O O   . GLU A 1 60  ? 17.662  21.277 47.812 1.00 34.66  ? 74   GLU A O   1 
ATOM   425  C CB  . GLU A 1 60  ? 19.780  19.770 46.153 1.00 33.73  ? 74   GLU A CB  1 
ATOM   426  C CG  . GLU A 1 60  ? 21.235  20.078 45.896 1.00 49.66  ? 74   GLU A CG  1 
ATOM   427  C CD  . GLU A 1 60  ? 22.147  19.133 46.652 1.00 69.55  ? 74   GLU A CD  1 
ATOM   428  O OE1 . GLU A 1 60  ? 22.089  17.912 46.386 1.00 53.01  ? 74   GLU A OE1 1 
ATOM   429  O OE2 . GLU A 1 60  ? 22.895  19.610 47.534 1.00 63.93  ? 74   GLU A OE2 1 
ATOM   430  N N   . GLU A 1 61  ? 19.598  21.789 48.835 1.00 29.70  ? 75   GLU A N   1 
ATOM   431  C CA  . GLU A 1 61  ? 19.136  23.073 49.355 1.00 29.24  ? 75   GLU A CA  1 
ATOM   432  C C   . GLU A 1 61  ? 18.430  23.949 48.321 1.00 30.54  ? 75   GLU A C   1 
ATOM   433  O O   . GLU A 1 61  ? 17.519  24.693 48.647 1.00 30.29  ? 75   GLU A O   1 
ATOM   434  C CB  . GLU A 1 61  ? 20.304  23.852 49.975 1.00 31.14  ? 75   GLU A CB  1 
ATOM   435  C CG  . GLU A 1 61  ? 21.629  23.770 49.201 1.00 44.37  ? 75   GLU A CG  1 
ATOM   436  C CD  . GLU A 1 61  ? 22.483  22.560 49.597 1.00 69.82  ? 75   GLU A CD  1 
ATOM   437  O OE1 . GLU A 1 61  ? 21.935  21.581 50.159 1.00 56.87  ? 75   GLU A OE1 1 
ATOM   438  O OE2 . GLU A 1 61  ? 23.707  22.589 49.336 1.00 63.90  ? 75   GLU A OE2 1 
ATOM   439  N N   . GLU A 1 62  ? 18.829  23.810 47.065 1.00 25.90  ? 76   GLU A N   1 
ATOM   440  C CA  . GLU A 1 62  ? 18.415  24.707 46.002 1.00 24.31  ? 76   GLU A CA  1 
ATOM   441  C C   . GLU A 1 62  ? 17.155  24.228 45.274 1.00 25.89  ? 76   GLU A C   1 
ATOM   442  O O   . GLU A 1 62  ? 16.644  24.930 44.391 1.00 24.91  ? 76   GLU A O   1 
ATOM   443  C CB  . GLU A 1 62  ? 19.569  24.864 45.008 1.00 25.35  ? 76   GLU A CB  1 
ATOM   444  C CG  . GLU A 1 62  ? 20.113  23.544 44.545 1.00 35.10  ? 76   GLU A CG  1 
ATOM   445  C CD  . GLU A 1 62  ? 21.576  23.605 44.151 1.00 58.40  ? 76   GLU A CD  1 
ATOM   446  O OE1 . GLU A 1 62  ? 21.961  24.541 43.423 1.00 44.65  ? 76   GLU A OE1 1 
ATOM   447  O OE2 . GLU A 1 62  ? 22.331  22.685 44.539 1.00 56.20  ? 76   GLU A OE2 1 
ATOM   448  N N   . VAL A 1 63  ? 16.671  23.031 45.614 1.00 20.25  ? 77   VAL A N   1 
ATOM   449  C CA  . VAL A 1 63  ? 15.436  22.528 45.012 1.00 19.17  ? 77   VAL A CA  1 
ATOM   450  C C   . VAL A 1 63  ? 14.223  23.431 45.312 1.00 23.34  ? 77   VAL A C   1 
ATOM   451  O O   . VAL A 1 63  ? 13.543  23.890 44.393 1.00 22.92  ? 77   VAL A O   1 
ATOM   452  C CB  . VAL A 1 63  ? 15.185  21.046 45.361 1.00 21.84  ? 77   VAL A CB  1 
ATOM   453  C CG1 . VAL A 1 63  ? 13.798  20.595 44.905 1.00 20.45  ? 77   VAL A CG1 1 
ATOM   454  C CG2 . VAL A 1 63  ? 16.278  20.159 44.760 1.00 21.43  ? 77   VAL A CG2 1 
ATOM   455  N N   . PHE A 1 64  ? 14.034  23.782 46.581 1.00 20.70  ? 78   PHE A N   1 
ATOM   456  C CA  . PHE A 1 64  ? 12.878  24.575 47.004 1.00 20.53  ? 78   PHE A CA  1 
ATOM   457  C C   . PHE A 1 64  ? 12.879  25.997 46.441 1.00 24.88  ? 78   PHE A C   1 
ATOM   458  O O   . PHE A 1 64  ? 11.899  26.446 45.832 1.00 24.80  ? 78   PHE A O   1 
ATOM   459  C CB  . PHE A 1 64  ? 12.750  24.593 48.535 1.00 22.33  ? 78   PHE A CB  1 
ATOM   460  C CG  . PHE A 1 64  ? 11.762  25.606 49.051 1.00 23.56  ? 78   PHE A CG  1 
ATOM   461  C CD1 . PHE A 1 64  ? 10.421  25.536 48.688 1.00 25.40  ? 78   PHE A CD1 1 
ATOM   462  C CD2 . PHE A 1 64  ? 12.187  26.669 49.849 1.00 25.18  ? 78   PHE A CD2 1 
ATOM   463  C CE1 . PHE A 1 64  ? 9.513   26.489 49.139 1.00 26.01  ? 78   PHE A CE1 1 
ATOM   464  C CE2 . PHE A 1 64  ? 11.289  27.631 50.294 1.00 27.42  ? 78   PHE A CE2 1 
ATOM   465  C CZ  . PHE A 1 64  ? 9.942   27.530 49.946 1.00 25.37  ? 78   PHE A CZ  1 
ATOM   466  N N   . PRO A 1 65  ? 14.002  26.710 46.584 1.00 22.13  ? 79   PRO A N   1 
ATOM   467  C CA  . PRO A 1 65  ? 14.009  28.051 45.992 1.00 21.58  ? 79   PRO A CA  1 
ATOM   468  C C   . PRO A 1 65  ? 13.804  28.020 44.479 1.00 23.14  ? 79   PRO A C   1 
ATOM   469  O O   . PRO A 1 65  ? 13.082  28.842 43.923 1.00 22.26  ? 79   PRO A O   1 
ATOM   470  C CB  . PRO A 1 65  ? 15.403  28.564 46.343 1.00 23.89  ? 79   PRO A CB  1 
ATOM   471  C CG  . PRO A 1 65  ? 15.694  27.925 47.665 1.00 28.55  ? 79   PRO A CG  1 
ATOM   472  C CD  . PRO A 1 65  ? 15.060  26.554 47.599 1.00 24.61  ? 79   PRO A CD  1 
ATOM   473  N N   . LEU A 1 66  ? 14.422  27.048 43.819 1.00 19.40  ? 80   LEU A N   1 
ATOM   474  C CA  . LEU A 1 66  ? 14.285  26.890 42.378 1.00 18.76  ? 80   LEU A CA  1 
ATOM   475  C C   . LEU A 1 66  ? 12.860  26.520 41.943 1.00 23.65  ? 80   LEU A C   1 
ATOM   476  O O   . LEU A 1 66  ? 12.393  26.943 40.887 1.00 23.52  ? 80   LEU A O   1 
ATOM   477  C CB  . LEU A 1 66  ? 15.261  25.835 41.867 1.00 18.11  ? 80   LEU A CB  1 
ATOM   478  C CG  . LEU A 1 66  ? 15.198  25.659 40.350 1.00 21.56  ? 80   LEU A CG  1 
ATOM   479  C CD1 . LEU A 1 66  ? 15.735  26.917 39.651 1.00 21.02  ? 80   LEU A CD1 1 
ATOM   480  C CD2 . LEU A 1 66  ? 15.952  24.416 39.915 1.00 22.88  ? 80   LEU A CD2 1 
ATOM   481  N N   . ALA A 1 67  ? 12.203  25.670 42.722 1.00 19.43  ? 81   ALA A N   1 
ATOM   482  C CA  . ALA A 1 67  ? 10.826  25.305 42.427 1.00 18.59  ? 81   ALA A CA  1 
ATOM   483  C C   . ALA A 1 67  ? 9.901   26.511 42.624 1.00 21.19  ? 81   ALA A C   1 
ATOM   484  O O   . ALA A 1 67  ? 8.883   26.635 41.950 1.00 18.21  ? 81   ALA A O   1 
ATOM   485  C CB  . ALA A 1 67  ? 10.396  24.146 43.302 1.00 19.16  ? 81   ALA A CB  1 
ATOM   486  N N   . MET A 1 68  ? 10.268  27.406 43.542 1.00 19.88  ? 82   MET A N   1 
ATOM   487  C CA  . MET A 1 68  ? 9.492   28.634 43.762 1.00 19.66  ? 82   MET A CA  1 
ATOM   488  C C   . MET A 1 68  ? 9.680   29.658 42.656 1.00 25.53  ? 82   MET A C   1 
ATOM   489  O O   . MET A 1 68  ? 8.765   30.417 42.342 1.00 26.58  ? 82   MET A O   1 
ATOM   490  C CB  . MET A 1 68  ? 9.784   29.253 45.119 1.00 21.44  ? 82   MET A CB  1 
ATOM   491  C CG  . MET A 1 68  ? 9.251   28.456 46.305 1.00 24.54  ? 82   MET A CG  1 
ATOM   492  S SD  . MET A 1 68  ? 7.489   27.986 46.259 1.00 27.79  ? 82   MET A SD  1 
ATOM   493  C CE  . MET A 1 68  ? 6.642   29.567 46.068 1.00 24.65  ? 82   MET A CE  1 
ATOM   494  N N   . ASN A 1 69  ? 10.848  29.637 42.027 1.00 22.54  ? 83   ASN A N   1 
ATOM   495  C CA  . ASN A 1 69  ? 11.104  30.445 40.835 1.00 22.25  ? 83   ASN A CA  1 
ATOM   496  C C   . ASN A 1 69  ? 10.197  29.982 39.694 1.00 26.68  ? 83   ASN A C   1 
ATOM   497  O O   . ASN A 1 69  ? 9.574   30.789 39.000 1.00 27.17  ? 83   ASN A O   1 
ATOM   498  C CB  . ASN A 1 69  ? 12.566  30.279 40.421 1.00 22.48  ? 83   ASN A CB  1 
ATOM   499  C CG  . ASN A 1 69  ? 12.919  31.057 39.173 1.00 41.16  ? 83   ASN A CG  1 
ATOM   500  O OD1 . ASN A 1 69  ? 12.941  30.507 38.065 1.00 33.48  ? 83   ASN A OD1 1 
ATOM   501  N ND2 . ASN A 1 69  ? 13.277  32.325 39.352 1.00 32.64  ? 83   ASN A ND2 1 
ATOM   502  N N   . TYR A 1 70  ? 10.158  28.674 39.484 1.00 22.23  ? 84   TYR A N   1 
ATOM   503  C CA  . TYR A 1 70  ? 9.295   28.091 38.467 1.00 21.17  ? 84   TYR A CA  1 
ATOM   504  C C   . TYR A 1 70  ? 7.839   28.453 38.719 1.00 23.41  ? 84   TYR A C   1 
ATOM   505  O O   . TYR A 1 70  ? 7.137   28.846 37.800 1.00 22.55  ? 84   TYR A O   1 
ATOM   506  C CB  . TYR A 1 70  ? 9.425   26.570 38.458 1.00 21.13  ? 84   TYR A CB  1 
ATOM   507  C CG  . TYR A 1 70  ? 10.772  26.049 38.032 1.00 21.57  ? 84   TYR A CG  1 
ATOM   508  C CD1 . TYR A 1 70  ? 11.677  26.852 37.349 1.00 23.10  ? 84   TYR A CD1 1 
ATOM   509  C CD2 . TYR A 1 70  ? 11.120  24.721 38.272 1.00 22.23  ? 84   TYR A CD2 1 
ATOM   510  C CE1 . TYR A 1 70  ? 12.914  26.340 36.928 1.00 23.54  ? 84   TYR A CE1 1 
ATOM   511  C CE2 . TYR A 1 70  ? 12.338  24.206 37.857 1.00 22.98  ? 84   TYR A CE2 1 
ATOM   512  C CZ  . TYR A 1 70  ? 13.237  25.017 37.204 1.00 27.19  ? 84   TYR A CZ  1 
ATOM   513  O OH  . TYR A 1 70  ? 14.445  24.480 36.826 1.00 25.66  ? 84   TYR A OH  1 
ATOM   514  N N   . LEU A 1 71  ? 7.374   28.218 39.943 1.00 20.03  ? 85   LEU A N   1 
ATOM   515  C CA  . LEU A 1 71  ? 5.994   28.516 40.332 1.00 20.35  ? 85   LEU A CA  1 
ATOM   516  C C   . LEU A 1 71  ? 5.625   29.974 40.033 1.00 27.29  ? 85   LEU A C   1 
ATOM   517  O O   . LEU A 1 71  ? 4.686   30.247 39.288 1.00 27.36  ? 85   LEU A O   1 
ATOM   518  C CB  . LEU A 1 71  ? 5.780   28.214 41.818 1.00 20.09  ? 85   LEU A CB  1 
ATOM   519  C CG  . LEU A 1 71  ? 4.368   28.457 42.371 1.00 25.03  ? 85   LEU A CG  1 
ATOM   520  C CD1 . LEU A 1 71  ? 3.948   27.352 43.319 1.00 24.82  ? 85   LEU A CD1 1 
ATOM   521  C CD2 . LEU A 1 71  ? 4.259   29.812 43.070 1.00 28.16  ? 85   LEU A CD2 1 
ATOM   522  N N   . ASP A 1 72  ? 6.381   30.904 40.615 1.00 24.08  ? 86   ASP A N   1 
ATOM   523  C CA  . ASP A 1 72  ? 6.203   32.327 40.346 1.00 22.93  ? 86   ASP A CA  1 
ATOM   524  C C   . ASP A 1 72  ? 6.248   32.656 38.854 1.00 27.41  ? 86   ASP A C   1 
ATOM   525  O O   . ASP A 1 72  ? 5.501   33.511 38.389 1.00 27.99  ? 86   ASP A O   1 
ATOM   526  C CB  . ASP A 1 72  ? 7.248   33.155 41.092 1.00 23.10  ? 86   ASP A CB  1 
ATOM   527  C CG  . ASP A 1 72  ? 6.980   33.227 42.562 1.00 29.26  ? 86   ASP A CG  1 
ATOM   528  O OD1 . ASP A 1 72  ? 5.798   33.098 42.952 1.00 30.23  ? 86   ASP A OD1 1 
ATOM   529  O OD2 . ASP A 1 72  ? 7.945   33.423 43.335 1.00 33.77  ? 86   ASP A OD2 1 
ATOM   530  N N   . ARG A 1 73  ? 7.162   32.038 38.113 1.00 23.71  ? 87   ARG A N   1 
ATOM   531  C CA  . ARG A 1 73  ? 7.251   32.319 36.679 1.00 24.11  ? 87   ARG A CA  1 
ATOM   532  C C   . ARG A 1 73  ? 6.048   31.790 35.923 1.00 30.77  ? 87   ARG A C   1 
ATOM   533  O O   . ARG A 1 73  ? 5.653   32.355 34.907 1.00 31.69  ? 87   ARG A O   1 
ATOM   534  C CB  . ARG A 1 73  ? 8.534   31.762 36.070 1.00 23.24  ? 87   ARG A CB  1 
ATOM   535  C CG  . ARG A 1 73  ? 9.802   32.435 36.574 1.00 29.99  ? 87   ARG A CG  1 
ATOM   536  C CD  . ARG A 1 73  ? 11.027  31.571 36.315 1.00 24.87  ? 87   ARG A CD  1 
ATOM   537  N NE  . ARG A 1 73  ? 11.262  31.362 34.890 1.00 25.56  ? 87   ARG A NE  1 
ATOM   538  C CZ  . ARG A 1 73  ? 12.082  30.436 34.396 1.00 35.29  ? 87   ARG A CZ  1 
ATOM   539  N NH1 . ARG A 1 73  ? 12.718  29.594 35.194 1.00 28.63  ? 87   ARG A NH1 1 
ATOM   540  N NH2 . ARG A 1 73  ? 12.243  30.331 33.098 1.00 19.45  ? 87   ARG A NH2 1 
ATOM   541  N N   . PHE A 1 74  ? 5.483   30.688 36.405 1.00 28.40  ? 88   PHE A N   1 
ATOM   542  C CA  . PHE A 1 74  ? 4.315   30.099 35.765 1.00 28.06  ? 88   PHE A CA  1 
ATOM   543  C C   . PHE A 1 74  ? 3.077   30.940 36.048 1.00 32.28  ? 88   PHE A C   1 
ATOM   544  O O   . PHE A 1 74  ? 2.263   31.197 35.151 1.00 32.46  ? 88   PHE A O   1 
ATOM   545  C CB  . PHE A 1 74  ? 4.094   28.661 36.235 1.00 29.29  ? 88   PHE A CB  1 
ATOM   546  C CG  . PHE A 1 74  ? 3.041   27.929 35.450 1.00 30.07  ? 88   PHE A CG  1 
ATOM   547  C CD1 . PHE A 1 74  ? 3.356   27.325 34.248 1.00 32.19  ? 88   PHE A CD1 1 
ATOM   548  C CD2 . PHE A 1 74  ? 1.724   27.912 35.879 1.00 32.20  ? 88   PHE A CD2 1 
ATOM   549  C CE1 . PHE A 1 74  ? 2.395   26.669 33.514 1.00 32.86  ? 88   PHE A CE1 1 
ATOM   550  C CE2 . PHE A 1 74  ? 0.755   27.250 35.154 1.00 34.65  ? 88   PHE A CE2 1 
ATOM   551  C CZ  . PHE A 1 74  ? 1.094   26.631 33.961 1.00 32.43  ? 88   PHE A CZ  1 
ATOM   552  N N   . LEU A 1 75  ? 2.945   31.358 37.301 1.00 27.48  ? 89   LEU A N   1 
ATOM   553  C CA  . LEU A 1 75  ? 1.863   32.241 37.710 1.00 28.00  ? 89   LEU A CA  1 
ATOM   554  C C   . LEU A 1 75  ? 1.891   33.592 36.982 1.00 35.31  ? 89   LEU A C   1 
ATOM   555  O O   . LEU A 1 75  ? 0.856   34.256 36.850 1.00 35.25  ? 89   LEU A O   1 
ATOM   556  C CB  . LEU A 1 75  ? 1.887   32.446 39.225 1.00 27.60  ? 89   LEU A CB  1 
ATOM   557  C CG  . LEU A 1 75  ? 0.989   31.532 40.063 1.00 31.16  ? 89   LEU A CG  1 
ATOM   558  C CD1 . LEU A 1 75  ? 0.787   30.179 39.433 1.00 30.72  ? 89   LEU A CD1 1 
ATOM   559  C CD2 . LEU A 1 75  ? 1.504   31.405 41.490 1.00 32.61  ? 89   LEU A CD2 1 
ATOM   560  N N   . SER A 1 76  ? 3.071   33.977 36.493 1.00 32.89  ? 90   SER A N   1 
ATOM   561  C CA  . SER A 1 76  ? 3.240   35.229 35.756 1.00 32.43  ? 90   SER A CA  1 
ATOM   562  C C   . SER A 1 76  ? 2.676   35.152 34.345 1.00 38.39  ? 90   SER A C   1 
ATOM   563  O O   . SER A 1 76  ? 2.476   36.179 33.695 1.00 37.53  ? 90   SER A O   1 
ATOM   564  C CB  . SER A 1 76  ? 4.717   35.613 35.684 1.00 33.46  ? 90   SER A CB  1 
ATOM   565  O OG  . SER A 1 76  ? 5.186   36.079 36.931 1.00 38.90  ? 90   SER A OG  1 
ATOM   566  N N   . LEU A 1 77  ? 2.410   33.933 33.881 1.00 36.96  ? 91   LEU A N   1 
ATOM   567  C CA  . LEU A 1 77  ? 2.080   33.701 32.473 1.00 37.10  ? 91   LEU A CA  1 
ATOM   568  C C   . LEU A 1 77  ? 0.754   32.974 32.269 1.00 42.34  ? 91   LEU A C   1 
ATOM   569  O O   . LEU A 1 77  ? 0.199   32.982 31.173 1.00 42.41  ? 91   LEU A O   1 
ATOM   570  C CB  . LEU A 1 77  ? 3.196   32.900 31.795 1.00 37.10  ? 91   LEU A CB  1 
ATOM   571  C CG  . LEU A 1 77  ? 4.566   33.561 31.687 1.00 42.16  ? 91   LEU A CG  1 
ATOM   572  C CD1 . LEU A 1 77  ? 5.598   32.548 31.219 1.00 42.69  ? 91   LEU A CD1 1 
ATOM   573  C CD2 . LEU A 1 77  ? 4.493   34.724 30.716 1.00 44.52  ? 91   LEU A CD2 1 
ATOM   574  N N   . GLU A 1 78  ? 0.288   32.286 33.304 1.00 40.19  ? 92   GLU A N   1 
ATOM   575  C CA  . GLU A 1 78  ? -0.885  31.426 33.191 1.00 40.73  ? 92   GLU A CA  1 
ATOM   576  C C   . GLU A 1 78  ? -1.828  31.652 34.355 1.00 44.83  ? 92   GLU A C   1 
ATOM   577  O O   . GLU A 1 78  ? -1.419  31.600 35.515 1.00 44.41  ? 92   GLU A O   1 
ATOM   578  C CB  . GLU A 1 78  ? -0.459  29.954 33.189 1.00 42.48  ? 92   GLU A CB  1 
ATOM   579  C CG  . GLU A 1 78  ? -0.267  29.361 31.813 1.00 55.83  ? 92   GLU A CG  1 
ATOM   580  C CD  . GLU A 1 78  ? -1.571  28.914 31.192 1.00 79.56  ? 92   GLU A CD  1 
ATOM   581  O OE1 . GLU A 1 78  ? -2.488  28.538 31.951 1.00 80.69  ? 92   GLU A OE1 1 
ATOM   582  O OE2 . GLU A 1 78  ? -1.668  28.909 29.946 1.00 73.66  ? 92   GLU A OE2 1 
ATOM   583  N N   . PRO A 1 79  ? -3.118  31.869 34.064 1.00 41.36  ? 93   PRO A N   1 
ATOM   584  C CA  . PRO A 1 79  ? -4.040  31.889 35.205 1.00 40.58  ? 93   PRO A CA  1 
ATOM   585  C C   . PRO A 1 79  ? -4.220  30.471 35.728 1.00 43.32  ? 93   PRO A C   1 
ATOM   586  O O   . PRO A 1 79  ? -4.187  29.518 34.955 1.00 42.66  ? 93   PRO A O   1 
ATOM   587  C CB  . PRO A 1 79  ? -5.345  32.401 34.590 1.00 42.25  ? 93   PRO A CB  1 
ATOM   588  C CG  . PRO A 1 79  ? -4.914  33.187 33.387 1.00 46.67  ? 93   PRO A CG  1 
ATOM   589  C CD  . PRO A 1 79  ? -3.711  32.472 32.855 1.00 42.57  ? 93   PRO A CD  1 
ATOM   590  N N   . VAL A 1 80  ? -4.404  30.334 37.038 1.00 40.01  ? 94   VAL A N   1 
ATOM   591  C CA  . VAL A 1 80  ? -4.473  29.022 37.677 1.00 39.80  ? 94   VAL A CA  1 
ATOM   592  C C   . VAL A 1 80  ? -5.634  28.926 38.676 1.00 44.66  ? 94   VAL A C   1 
ATOM   593  O O   . VAL A 1 80  ? -5.803  29.800 39.528 1.00 45.22  ? 94   VAL A O   1 
ATOM   594  C CB  . VAL A 1 80  ? -3.123  28.692 38.364 1.00 43.73  ? 94   VAL A CB  1 
ATOM   595  C CG1 . VAL A 1 80  ? -3.254  27.500 39.295 1.00 43.31  ? 94   VAL A CG1 1 
ATOM   596  C CG2 . VAL A 1 80  ? -2.044  28.447 37.326 1.00 43.74  ? 94   VAL A CG2 1 
ATOM   597  N N   . LYS A 1 81  ? -6.399  27.839 38.603 1.00 40.59  ? 95   LYS A N   1 
ATOM   598  C CA  . LYS A 1 81  ? -7.440  27.560 39.595 1.00 39.89  ? 95   LYS A CA  1 
ATOM   599  C C   . LYS A 1 81  ? -6.772  27.201 40.914 1.00 42.13  ? 95   LYS A C   1 
ATOM   600  O O   . LYS A 1 81  ? -5.868  26.372 40.941 1.00 40.96  ? 95   LYS A O   1 
ATOM   601  C CB  . LYS A 1 81  ? -8.302  26.379 39.141 1.00 42.95  ? 95   LYS A CB  1 
ATOM   602  C CG  . LYS A 1 81  ? -8.574  26.331 37.643 1.00 55.77  ? 95   LYS A CG  1 
ATOM   603  C CD  . LYS A 1 81  ? -9.768  27.191 37.282 1.00 68.12  ? 95   LYS A CD  1 
ATOM   604  C CE  . LYS A 1 81  ? -9.651  27.736 35.866 1.00 81.40  ? 95   LYS A CE  1 
ATOM   605  N NZ  . LYS A 1 81  ? -10.541 28.916 35.670 1.00 90.00  ? 95   LYS A NZ  1 
ATOM   606  N N   . LYS A 1 82  ? -7.234  27.799 42.009 1.00 38.87  ? 96   LYS A N   1 
ATOM   607  C CA  . LYS A 1 82  ? -6.626  27.564 43.318 1.00 38.85  ? 96   LYS A CA  1 
ATOM   608  C C   . LYS A 1 82  ? -6.655  26.090 43.725 1.00 43.97  ? 96   LYS A C   1 
ATOM   609  O O   . LYS A 1 82  ? -5.910  25.669 44.613 1.00 43.76  ? 96   LYS A O   1 
ATOM   610  C CB  . LYS A 1 82  ? -7.301  28.412 44.391 1.00 41.00  ? 96   LYS A CB  1 
ATOM   611  C CG  . LYS A 1 82  ? -8.643  27.869 44.839 1.00 55.52  ? 96   LYS A CG  1 
ATOM   612  C CD  . LYS A 1 82  ? -9.437  28.924 45.585 1.00 67.79  ? 96   LYS A CD  1 
ATOM   613  C CE  . LYS A 1 82  ? -10.845 28.436 45.891 1.00 81.79  ? 96   LYS A CE  1 
ATOM   614  N NZ  . LYS A 1 82  ? -11.734 29.552 46.320 1.00 93.06  ? 96   LYS A NZ  1 
ATOM   615  N N   . SER A 1 83  ? -7.545  25.320 43.107 1.00 40.64  ? 97   SER A N   1 
ATOM   616  C CA  . SER A 1 83  ? -7.664  23.894 43.402 1.00 39.84  ? 97   SER A CA  1 
ATOM   617  C C   . SER A 1 83  ? -6.586  23.147 42.619 1.00 42.17  ? 97   SER A C   1 
ATOM   618  O O   . SER A 1 83  ? -6.389  21.942 42.779 1.00 41.81  ? 97   SER A O   1 
ATOM   619  C CB  . SER A 1 83  ? -9.038  23.386 42.970 1.00 42.80  ? 97   SER A CB  1 
ATOM   620  O OG  . SER A 1 83  ? -9.120  23.330 41.553 1.00 51.60  ? 97   SER A OG  1 
ATOM   621  N N   . ARG A 1 84  ? -5.883  23.891 41.778 1.00 37.48  ? 98   ARG A N   1 
ATOM   622  C CA  . ARG A 1 84  ? -4.919  23.321 40.849 1.00 36.89  ? 98   ARG A CA  1 
ATOM   623  C C   . ARG A 1 84  ? -3.496  23.749 41.269 1.00 38.90  ? 98   ARG A C   1 
ATOM   624  O O   . ARG A 1 84  ? -2.502  23.356 40.659 1.00 38.47  ? 98   ARG A O   1 
ATOM   625  C CB  . ARG A 1 84  ? -5.237  23.838 39.442 1.00 37.78  ? 98   ARG A CB  1 
ATOM   626  C CG  . ARG A 1 84  ? -4.977  22.852 38.321 1.00 52.57  ? 98   ARG A CG  1 
ATOM   627  C CD  . ARG A 1 84  ? -6.093  21.819 38.191 1.00 63.41  ? 98   ARG A CD  1 
ATOM   628  N NE  . ARG A 1 84  ? -5.838  20.818 37.149 1.00 74.71  ? 98   ARG A NE  1 
ATOM   629  C CZ  . ARG A 1 84  ? -5.226  21.048 35.986 1.00 88.47  ? 98   ARG A CZ  1 
ATOM   630  N NH1 . ARG A 1 84  ? -4.827  22.268 35.654 1.00 77.18  ? 98   ARG A NH1 1 
ATOM   631  N NH2 . ARG A 1 84  ? -5.040  20.050 35.131 1.00 73.57  ? 98   ARG A NH2 1 
ATOM   632  N N   . LEU A 1 85  ? -3.417  24.508 42.356 1.00 34.09  ? 99   LEU A N   1 
ATOM   633  C CA  . LEU A 1 85  ? -2.175  25.147 42.768 1.00 33.36  ? 99   LEU A CA  1 
ATOM   634  C C   . LEU A 1 85  ? -1.165  24.157 43.342 1.00 36.59  ? 99   LEU A C   1 
ATOM   635  O O   . LEU A 1 85  ? 0.021   24.196 42.992 1.00 35.25  ? 99   LEU A O   1 
ATOM   636  C CB  . LEU A 1 85  ? -2.455  26.264 43.783 1.00 32.94  ? 99   LEU A CB  1 
ATOM   637  C CG  . LEU A 1 85  ? -1.239  27.048 44.295 1.00 36.80  ? 99   LEU A CG  1 
ATOM   638  C CD1 . LEU A 1 85  ? -0.568  27.853 43.186 1.00 36.47  ? 99   LEU A CD1 1 
ATOM   639  C CD2 . LEU A 1 85  ? -1.604  27.938 45.474 1.00 36.43  ? 99   LEU A CD2 1 
ATOM   640  N N   . GLN A 1 86  ? -1.628  23.295 44.246 1.00 32.56  ? 100  GLN A N   1 
ATOM   641  C CA  . GLN A 1 86  ? -0.754  22.297 44.850 1.00 31.83  ? 100  GLN A CA  1 
ATOM   642  C C   . GLN A 1 86  ? -0.159  21.392 43.782 1.00 35.67  ? 100  GLN A C   1 
ATOM   643  O O   . GLN A 1 86  ? 0.978   20.942 43.906 1.00 37.31  ? 100  GLN A O   1 
ATOM   644  C CB  . GLN A 1 86  ? -1.490  21.463 45.899 1.00 33.02  ? 100  GLN A CB  1 
ATOM   645  C CG  . GLN A 1 86  ? -0.621  20.361 46.520 1.00 43.10  ? 100  GLN A CG  1 
ATOM   646  C CD  . GLN A 1 86  ? -1.318  19.607 47.643 1.00 52.25  ? 100  GLN A CD  1 
ATOM   647  O OE1 . GLN A 1 86  ? -2.459  19.162 47.493 1.00 48.44  ? 100  GLN A OE1 1 
ATOM   648  N NE2 . GLN A 1 86  ? -0.614  19.422 48.760 1.00 38.33  ? 100  GLN A NE2 1 
ATOM   649  N N   . LEU A 1 87  ? -0.913  21.146 42.718 1.00 29.24  ? 101  LEU A N   1 
ATOM   650  C CA  . LEU A 1 87  ? -0.390  20.343 41.627 1.00 27.96  ? 101  LEU A CA  1 
ATOM   651  C C   . LEU A 1 87  ? 0.775   21.067 40.955 1.00 30.40  ? 101  LEU A C   1 
ATOM   652  O O   . LEU A 1 87  ? 1.837   20.483 40.732 1.00 29.72  ? 101  LEU A O   1 
ATOM   653  C CB  . LEU A 1 87  ? -1.490  19.993 40.619 1.00 27.63  ? 101  LEU A CB  1 
ATOM   654  C CG  . LEU A 1 87  ? -1.030  19.367 39.297 1.00 31.79  ? 101  LEU A CG  1 
ATOM   655  C CD1 . LEU A 1 87  ? -0.447  17.976 39.486 1.00 31.65  ? 101  LEU A CD1 1 
ATOM   656  C CD2 . LEU A 1 87  ? -2.129  19.370 38.257 1.00 32.91  ? 101  LEU A CD2 1 
ATOM   657  N N   . LEU A 1 88  ? 0.571   22.343 40.645 1.00 25.97  ? 102  LEU A N   1 
ATOM   658  C CA  . LEU A 1 88  ? 1.640   23.190 40.112 1.00 25.08  ? 102  LEU A CA  1 
ATOM   659  C C   . LEU A 1 88  ? 2.923   23.115 40.955 1.00 29.07  ? 102  LEU A C   1 
ATOM   660  O O   . LEU A 1 88  ? 4.005   22.849 40.429 1.00 29.24  ? 102  LEU A O   1 
ATOM   661  C CB  . LEU A 1 88  ? 1.174   24.647 40.015 1.00 24.22  ? 102  LEU A CB  1 
ATOM   662  C CG  . LEU A 1 88  ? 2.202   25.650 39.480 1.00 27.23  ? 102  LEU A CG  1 
ATOM   663  C CD1 . LEU A 1 88  ? 2.658   25.254 38.079 1.00 26.34  ? 102  LEU A CD1 1 
ATOM   664  C CD2 . LEU A 1 88  ? 1.629   27.061 39.475 1.00 28.34  ? 102  LEU A CD2 1 
ATOM   665  N N   . GLY A 1 89  ? 2.798   23.399 42.248 1.00 24.47  ? 103  GLY A N   1 
ATOM   666  C CA  . GLY A 1 89  ? 3.913   23.377 43.172 1.00 24.62  ? 103  GLY A CA  1 
ATOM   667  C C   . GLY A 1 89  ? 4.630   22.037 43.224 1.00 29.92  ? 103  GLY A C   1 
ATOM   668  O O   . GLY A 1 89  ? 5.860   21.987 43.237 1.00 30.33  ? 103  GLY A O   1 
ATOM   669  N N   . ALA A 1 90  ? 3.864   20.953 43.313 1.00 26.45  ? 104  ALA A N   1 
ATOM   670  C CA  . ALA A 1 90  ? 4.424   19.604 43.269 1.00 26.20  ? 104  ALA A CA  1 
ATOM   671  C C   . ALA A 1 90  ? 5.179   19.356 41.968 1.00 28.28  ? 104  ALA A C   1 
ATOM   672  O O   . ALA A 1 90  ? 6.192   18.651 41.949 1.00 28.50  ? 104  ALA A O   1 
ATOM   673  C CB  . ALA A 1 90  ? 3.320   18.557 43.451 1.00 26.93  ? 104  ALA A CB  1 
ATOM   674  N N   . THR A 1 91  ? 4.695   19.958 40.888 1.00 22.65  ? 105  THR A N   1 
ATOM   675  C CA  . THR A 1 91  ? 5.303   19.785 39.571 1.00 22.14  ? 105  THR A CA  1 
ATOM   676  C C   . THR A 1 91  ? 6.611   20.561 39.490 1.00 26.29  ? 105  THR A C   1 
ATOM   677  O O   . THR A 1 91  ? 7.568   20.128 38.840 1.00 26.33  ? 105  THR A O   1 
ATOM   678  C CB  . THR A 1 91  ? 4.336   20.199 38.431 1.00 24.81  ? 105  THR A CB  1 
ATOM   679  O OG1 . THR A 1 91  ? 3.102   19.487 38.558 1.00 27.51  ? 105  THR A OG1 1 
ATOM   680  C CG2 . THR A 1 91  ? 4.936   19.886 37.085 1.00 20.22  ? 105  THR A CG2 1 
ATOM   681  N N   . CYS A 1 92  ? 6.643   21.704 40.165 1.00 23.12  ? 106  CYS A N   1 
ATOM   682  C CA  . CYS A 1 92  ? 7.824   22.569 40.189 1.00 23.30  ? 106  CYS A CA  1 
ATOM   683  C C   . CYS A 1 92  ? 8.953   21.931 41.003 1.00 26.57  ? 106  CYS A C   1 
ATOM   684  O O   . CYS A 1 92  ? 10.116  22.005 40.623 1.00 25.77  ? 106  CYS A O   1 
ATOM   685  C CB  . CYS A 1 92  ? 7.462   23.953 40.757 1.00 23.48  ? 106  CYS A CB  1 
ATOM   686  S SG  . CYS A 1 92  ? 6.345   24.929 39.707 1.00 27.32  ? 106  CYS A SG  1 
ATOM   687  N N   . MET A 1 93  ? 8.593   21.277 42.100 1.00 23.69  ? 107  MET A N   1 
ATOM   688  C CA  . MET A 1 93  ? 9.539   20.461 42.854 1.00 24.43  ? 107  MET A CA  1 
ATOM   689  C C   . MET A 1 93  ? 10.089  19.326 42.002 1.00 29.16  ? 107  MET A C   1 
ATOM   690  O O   . MET A 1 93  ? 11.299  19.135 41.906 1.00 28.95  ? 107  MET A O   1 
ATOM   691  C CB  . MET A 1 93  ? 8.877   19.895 44.115 1.00 26.86  ? 107  MET A CB  1 
ATOM   692  C CG  . MET A 1 93  ? 8.600   20.930 45.179 1.00 30.46  ? 107  MET A CG  1 
ATOM   693  S SD  . MET A 1 93  ? 8.140   20.166 46.742 1.00 35.53  ? 107  MET A SD  1 
ATOM   694  C CE  . MET A 1 93  ? 6.349   19.858 46.524 1.00 32.53  ? 107  MET A CE  1 
ATOM   695  N N   . PHE A 1 94  ? 9.191   18.642 41.308 1.00 26.80  ? 108  PHE A N   1 
ATOM   696  C CA  . PHE A 1 94  ? 9.559   17.561 40.399 1.00 26.88  ? 108  PHE A CA  1 
ATOM   697  C C   . PHE A 1 94  ? 10.614  18.028 39.417 1.00 30.43  ? 108  PHE A C   1 
ATOM   698  O O   . PHE A 1 94  ? 11.706  17.465 39.351 1.00 30.02  ? 108  PHE A O   1 
ATOM   699  C CB  . PHE A 1 94  ? 8.328   17.095 39.626 1.00 28.87  ? 108  PHE A CB  1 
ATOM   700  C CG  . PHE A 1 94  ? 8.508   15.786 38.920 1.00 30.61  ? 108  PHE A CG  1 
ATOM   701  C CD1 . PHE A 1 94  ? 9.086   14.706 39.569 1.00 33.68  ? 108  PHE A CD1 1 
ATOM   702  C CD2 . PHE A 1 94  ? 8.041   15.614 37.624 1.00 33.00  ? 108  PHE A CD2 1 
ATOM   703  C CE1 . PHE A 1 94  ? 9.202   13.483 38.940 1.00 34.34  ? 108  PHE A CE1 1 
ATOM   704  C CE2 . PHE A 1 94  ? 8.157   14.390 36.986 1.00 35.65  ? 108  PHE A CE2 1 
ATOM   705  C CZ  . PHE A 1 94  ? 8.734   13.323 37.649 1.00 33.65  ? 108  PHE A CZ  1 
ATOM   706  N N   . VAL A 1 95  ? 10.297  19.086 38.676 1.00 26.24  ? 109  VAL A N   1 
ATOM   707  C CA  . VAL A 1 95  ? 11.236  19.617 37.692 1.00 24.92  ? 109  VAL A CA  1 
ATOM   708  C C   . VAL A 1 95  ? 12.533  20.144 38.300 1.00 27.29  ? 109  VAL A C   1 
ATOM   709  O O   . VAL A 1 95  ? 13.617  19.868 37.792 1.00 26.75  ? 109  VAL A O   1 
ATOM   710  C CB  . VAL A 1 95  ? 10.587  20.655 36.779 1.00 28.30  ? 109  VAL A CB  1 
ATOM   711  C CG1 . VAL A 1 95  ? 11.621  21.181 35.780 1.00 28.48  ? 109  VAL A CG1 1 
ATOM   712  C CG2 . VAL A 1 95  ? 9.384   20.058 36.056 1.00 27.59  ? 109  VAL A CG2 1 
ATOM   713  N N   . ALA A 1 96  ? 12.421  20.947 39.352 1.00 23.27  ? 110  ALA A N   1 
ATOM   714  C CA  . ALA A 1 96  ? 13.606  21.477 40.020 1.00 23.18  ? 110  ALA A CA  1 
ATOM   715  C C   . ALA A 1 96  ? 14.508  20.349 40.518 1.00 27.60  ? 110  ALA A C   1 
ATOM   716  O O   . ALA A 1 96  ? 15.721  20.404 40.363 1.00 26.36  ? 110  ALA A O   1 
ATOM   717  C CB  . ALA A 1 96  ? 13.209  22.379 41.171 1.00 23.70  ? 110  ALA A CB  1 
ATOM   718  N N   . SER A 1 97  ? 13.899  19.333 41.125 1.00 25.97  ? 111  SER A N   1 
ATOM   719  C CA  . SER A 1 97  ? 14.619  18.158 41.628 1.00 25.51  ? 111  SER A CA  1 
ATOM   720  C C   . SER A 1 97  ? 15.385  17.444 40.514 1.00 28.38  ? 111  SER A C   1 
ATOM   721  O O   . SER A 1 97  ? 16.576  17.138 40.642 1.00 27.36  ? 111  SER A O   1 
ATOM   722  C CB  . SER A 1 97  ? 13.628  17.186 42.266 1.00 29.05  ? 111  SER A CB  1 
ATOM   723  O OG  . SER A 1 97  ? 14.288  16.177 43.004 1.00 40.06  ? 111  SER A OG  1 
ATOM   724  N N   . LYS A 1 98  ? 14.698  17.171 39.416 1.00 25.17  ? 112  LYS A N   1 
ATOM   725  C CA  . LYS A 1 98  ? 15.343  16.519 38.288 1.00 25.60  ? 112  LYS A CA  1 
ATOM   726  C C   . LYS A 1 98  ? 16.542  17.339 37.810 1.00 30.34  ? 112  LYS A C   1 
ATOM   727  O O   . LYS A 1 98  ? 17.560  16.781 37.388 1.00 30.52  ? 112  LYS A O   1 
ATOM   728  C CB  . LYS A 1 98  ? 14.343  16.282 37.152 1.00 27.96  ? 112  LYS A CB  1 
ATOM   729  C CG  . LYS A 1 98  ? 13.025  15.696 37.641 1.00 38.45  ? 112  LYS A CG  1 
ATOM   730  C CD  . LYS A 1 98  ? 12.465  14.640 36.710 1.00 41.12  ? 112  LYS A CD  1 
ATOM   731  C CE  . LYS A 1 98  ? 12.051  15.211 35.378 1.00 39.17  ? 112  LYS A CE  1 
ATOM   732  N NZ  . LYS A 1 98  ? 11.183  14.237 34.649 1.00 42.66  ? 112  LYS A NZ  1 
ATOM   733  N N   . MET A 1 99  ? 16.443  18.659 37.953 1.00 25.14  ? 113  MET A N   1 
ATOM   734  C CA  . MET A 1 99  ? 17.485  19.571 37.483 1.00 24.19  ? 113  MET A CA  1 
ATOM   735  C C   . MET A 1 99  ? 18.710  19.602 38.395 1.00 27.76  ? 113  MET A C   1 
ATOM   736  O O   . MET A 1 99  ? 19.828  19.824 37.933 1.00 27.80  ? 113  MET A O   1 
ATOM   737  C CB  . MET A 1 99  ? 16.933  20.993 37.319 1.00 25.81  ? 113  MET A CB  1 
ATOM   738  C CG  . MET A 1 99  ? 16.008  21.175 36.130 1.00 28.83  ? 113  MET A CG  1 
ATOM   739  S SD  . MET A 1 99  ? 16.872  21.094 34.541 1.00 32.72  ? 113  MET A SD  1 
ATOM   740  C CE  . MET A 1 99  ? 18.079  22.462 34.769 1.00 29.01  ? 113  MET A CE  1 
ATOM   741  N N   . LYS A 1 100 ? 18.495  19.373 39.685 1.00 23.02  ? 114  LYS A N   1 
ATOM   742  C CA  . LYS A 1 100 ? 19.514  19.646 40.691 1.00 22.60  ? 114  LYS A CA  1 
ATOM   743  C C   . LYS A 1 100 ? 20.042  18.407 41.425 1.00 28.59  ? 114  LYS A C   1 
ATOM   744  O O   . LYS A 1 100 ? 21.050  18.490 42.134 1.00 27.80  ? 114  LYS A O   1 
ATOM   745  C CB  . LYS A 1 100 ? 18.978  20.645 41.724 1.00 23.70  ? 114  LYS A CB  1 
ATOM   746  C CG  . LYS A 1 100 ? 18.821  22.051 41.200 1.00 31.34  ? 114  LYS A CG  1 
ATOM   747  C CD  . LYS A 1 100 ? 20.068  22.494 40.451 1.00 29.26  ? 114  LYS A CD  1 
ATOM   748  C CE  . LYS A 1 100 ? 19.915  23.906 39.922 1.00 32.84  ? 114  LYS A CE  1 
ATOM   749  N NZ  . LYS A 1 100 ? 20.757  24.159 38.722 1.00 37.05  ? 114  LYS A NZ  1 
ATOM   750  N N   . GLU A 1 101 ? 19.336  17.284 41.315 1.00 25.72  ? 115  GLU A N   1 
ATOM   751  C CA  . GLU A 1 101 ? 19.607  16.149 42.191 1.00 26.23  ? 115  GLU A CA  1 
ATOM   752  C C   . GLU A 1 101 ? 20.133  14.880 41.514 1.00 33.37  ? 115  GLU A C   1 
ATOM   753  O O   . GLU A 1 101 ? 19.603  14.423 40.492 1.00 34.08  ? 115  GLU A O   1 
ATOM   754  C CB  . GLU A 1 101 ? 18.386  15.831 43.057 1.00 27.39  ? 115  GLU A CB  1 
ATOM   755  C CG  . GLU A 1 101 ? 17.985  16.974 43.977 1.00 33.61  ? 115  GLU A CG  1 
ATOM   756  C CD  . GLU A 1 101 ? 17.160  16.514 45.158 1.00 45.97  ? 115  GLU A CD  1 
ATOM   757  O OE1 . GLU A 1 101 ? 16.010  16.075 44.958 1.00 44.97  ? 115  GLU A OE1 1 
ATOM   758  O OE2 . GLU A 1 101 ? 17.648  16.635 46.297 1.00 34.10  ? 115  GLU A OE2 1 
ATOM   759  N N   . THR A 1 102 ? 21.180  14.316 42.107 1.00 30.44  ? 116  THR A N   1 
ATOM   760  C CA  . THR A 1 102 ? 21.673  12.996 41.740 1.00 31.22  ? 116  THR A CA  1 
ATOM   761  C C   . THR A 1 102 ? 20.523  11.989 41.664 1.00 36.80  ? 116  THR A C   1 
ATOM   762  O O   . THR A 1 102 ? 20.439  11.194 40.730 1.00 37.77  ? 116  THR A O   1 
ATOM   763  C CB  . THR A 1 102 ? 22.718  12.512 42.771 1.00 38.20  ? 116  THR A CB  1 
ATOM   764  O OG1 . THR A 1 102 ? 23.676  13.551 43.024 1.00 37.39  ? 116  THR A OG1 1 
ATOM   765  C CG2 . THR A 1 102 ? 23.422  11.264 42.266 1.00 32.49  ? 116  THR A CG2 1 
ATOM   766  N N   . ILE A 1 103 ? 19.680  11.994 42.691 1.00 33.09  ? 117  ILE A N   1 
ATOM   767  C CA  . ILE A 1 103 ? 18.542  11.085 42.792 1.00 33.15  ? 117  ILE A CA  1 
ATOM   768  C C   . ILE A 1 103 ? 17.272  11.918 42.997 1.00 35.48  ? 117  ILE A C   1 
ATOM   769  O O   . ILE A 1 103 ? 17.004  12.398 44.100 1.00 35.38  ? 117  ILE A O   1 
ATOM   770  C CB  . ILE A 1 103 ? 18.741  10.095 43.976 1.00 36.87  ? 117  ILE A CB  1 
ATOM   771  C CG1 . ILE A 1 103 ? 19.973  9.208  43.740 1.00 37.65  ? 117  ILE A CG1 1 
ATOM   772  C CG2 . ILE A 1 103 ? 17.482  9.268  44.196 1.00 37.23  ? 117  ILE A CG2 1 
ATOM   773  C CD1 . ILE A 1 103 ? 20.592  8.659  45.013 1.00 43.67  ? 117  ILE A CD1 1 
ATOM   774  N N   . PRO A 1 104 ? 16.487  12.117 41.930 1.00 30.76  ? 118  PRO A N   1 
ATOM   775  C CA  . PRO A 1 104 ? 15.385  13.083 42.033 1.00 30.56  ? 118  PRO A CA  1 
ATOM   776  C C   . PRO A 1 104 ? 14.203  12.549 42.827 1.00 35.92  ? 118  PRO A C   1 
ATOM   777  O O   . PRO A 1 104 ? 14.140  11.362 43.149 1.00 36.78  ? 118  PRO A O   1 
ATOM   778  C CB  . PRO A 1 104 ? 14.960  13.302 40.572 1.00 31.73  ? 118  PRO A CB  1 
ATOM   779  C CG  . PRO A 1 104 ? 16.007  12.649 39.727 1.00 35.81  ? 118  PRO A CG  1 
ATOM   780  C CD  . PRO A 1 104 ? 16.637  11.588 40.564 1.00 31.62  ? 118  PRO A CD  1 
ATOM   781  N N   . LEU A 1 105 ? 13.279  13.445 43.158 1.00 31.66  ? 119  LEU A N   1 
ATOM   782  C CA  . LEU A 1 105 ? 11.986  13.058 43.704 1.00 30.50  ? 119  LEU A CA  1 
ATOM   783  C C   . LEU A 1 105 ? 11.244  12.250 42.662 1.00 34.38  ? 119  LEU A C   1 
ATOM   784  O O   . LEU A 1 105 ? 11.271  12.593 41.478 1.00 34.99  ? 119  LEU A O   1 
ATOM   785  C CB  . LEU A 1 105 ? 11.164  14.306 44.015 1.00 29.96  ? 119  LEU A CB  1 
ATOM   786  C CG  . LEU A 1 105 ? 11.748  15.288 45.020 1.00 32.66  ? 119  LEU A CG  1 
ATOM   787  C CD1 . LEU A 1 105 ? 11.043  16.639 44.904 1.00 32.56  ? 119  LEU A CD1 1 
ATOM   788  C CD2 . LEU A 1 105 ? 11.639  14.722 46.421 1.00 30.54  ? 119  LEU A CD2 1 
ATOM   789  N N   . THR A 1 106 ? 10.552  11.202 43.100 1.00 30.12  ? 120  THR A N   1 
ATOM   790  C CA  . THR A 1 106 ? 9.695   10.438 42.200 1.00 29.60  ? 120  THR A CA  1 
ATOM   791  C C   . THR A 1 106 ? 8.286   11.022 42.138 1.00 33.70  ? 120  THR A C   1 
ATOM   792  O O   . THR A 1 106 ? 7.799   11.606 43.112 1.00 33.23  ? 120  THR A O   1 
ATOM   793  C CB  . THR A 1 106 ? 9.661   8.939  42.555 1.00 35.21  ? 120  THR A CB  1 
ATOM   794  O OG1 . THR A 1 106 ? 9.176   8.773  43.890 1.00 37.40  ? 120  THR A OG1 1 
ATOM   795  C CG2 . THR A 1 106 ? 11.045  8.312  42.423 1.00 29.89  ? 120  THR A CG2 1 
ATOM   796  N N   . ALA A 1 107 ? 7.646   10.877 40.981 1.00 30.26  ? 121  ALA A N   1 
ATOM   797  C CA  . ALA A 1 107 ? 6.252   11.278 40.813 1.00 30.56  ? 121  ALA A CA  1 
ATOM   798  C C   . ALA A 1 107 ? 5.359   10.707 41.913 1.00 35.61  ? 121  ALA A C   1 
ATOM   799  O O   . ALA A 1 107 ? 4.495   11.409 42.446 1.00 35.62  ? 121  ALA A O   1 
ATOM   800  C CB  . ALA A 1 107 ? 5.745   10.841 39.449 1.00 31.37  ? 121  ALA A CB  1 
ATOM   801  N N   . GLU A 1 108 ? 5.573   9.438  42.259 1.00 32.07  ? 122  GLU A N   1 
ATOM   802  C CA  . GLU A 1 108 ? 4.742   8.779  43.265 1.00 31.83  ? 122  GLU A CA  1 
ATOM   803  C C   . GLU A 1 108 ? 5.004   9.337  44.642 1.00 33.74  ? 122  GLU A C   1 
ATOM   804  O O   . GLU A 1 108 ? 4.082   9.536  45.434 1.00 33.33  ? 122  GLU A O   1 
ATOM   805  C CB  . GLU A 1 108 ? 4.986   7.275  43.282 1.00 33.54  ? 122  GLU A CB  1 
ATOM   806  C CG  . GLU A 1 108 ? 4.035   6.518  44.195 1.00 47.07  ? 122  GLU A CG  1 
ATOM   807  C CD  . GLU A 1 108 ? 4.105   5.019  43.990 1.00 71.81  ? 122  GLU A CD  1 
ATOM   808  O OE1 . GLU A 1 108 ? 5.033   4.388  44.534 1.00 73.39  ? 122  GLU A OE1 1 
ATOM   809  O OE2 . GLU A 1 108 ? 3.225   4.473  43.294 1.00 68.14  ? 122  GLU A OE2 1 
ATOM   810  N N   . LYS A 1 109 ? 6.275   9.566  44.937 1.00 29.40  ? 123  LYS A N   1 
ATOM   811  C CA  . LYS A 1 109 ? 6.639   10.174 46.203 1.00 29.08  ? 123  LYS A CA  1 
ATOM   812  C C   . LYS A 1 109 ? 5.986   11.552 46.374 1.00 29.93  ? 123  LYS A C   1 
ATOM   813  O O   . LYS A 1 109 ? 5.437   11.853 47.424 1.00 28.35  ? 123  LYS A O   1 
ATOM   814  C CB  . LYS A 1 109 ? 8.159   10.252 46.352 1.00 32.54  ? 123  LYS A CB  1 
ATOM   815  C CG  . LYS A 1 109 ? 8.621   10.481 47.781 1.00 59.86  ? 123  LYS A CG  1 
ATOM   816  C CD  . LYS A 1 109 ? 10.044  9.981  47.979 1.00 78.92  ? 123  LYS A CD  1 
ATOM   817  C CE  . LYS A 1 109 ? 10.146  8.490  47.678 1.00 95.20  ? 123  LYS A CE  1 
ATOM   818  N NZ  . LYS A 1 109 ? 11.529  7.970  47.865 1.00 105.65 ? 123  LYS A NZ  1 
ATOM   819  N N   . LEU A 1 110 ? 6.013   12.375 45.333 1.00 26.23  ? 124  LEU A N   1 
ATOM   820  C CA  . LEU A 1 110 ? 5.370   13.675 45.417 1.00 26.59  ? 124  LEU A CA  1 
ATOM   821  C C   . LEU A 1 110 ? 3.864   13.524 45.692 1.00 31.79  ? 124  LEU A C   1 
ATOM   822  O O   . LEU A 1 110 ? 3.336   14.090 46.655 1.00 29.64  ? 124  LEU A O   1 
ATOM   823  C CB  . LEU A 1 110 ? 5.665   14.518 44.167 1.00 26.38  ? 124  LEU A CB  1 
ATOM   824  C CG  . LEU A 1 110 ? 7.062   15.158 44.186 1.00 30.88  ? 124  LEU A CG  1 
ATOM   825  C CD1 . LEU A 1 110 ? 7.593   15.494 42.793 1.00 30.25  ? 124  LEU A CD1 1 
ATOM   826  C CD2 . LEU A 1 110 ? 7.066   16.396 45.081 1.00 33.04  ? 124  LEU A CD2 1 
ATOM   827  N N   . CYS A 1 111 ? 3.219   12.640 44.937 1.00 30.88  ? 125  CYS A N   1 
ATOM   828  C CA  . CYS A 1 111 ? 1.791   12.362 45.109 1.00 31.48  ? 125  CYS A CA  1 
ATOM   829  C C   . CYS A 1 111 ? 1.431   11.919 46.525 1.00 32.16  ? 125  CYS A C   1 
ATOM   830  O O   . CYS A 1 111 ? 0.401   12.318 47.064 1.00 32.04  ? 125  CYS A O   1 
ATOM   831  C CB  . CYS A 1 111 ? 1.324   11.324 44.089 1.00 32.93  ? 125  CYS A CB  1 
ATOM   832  S SG  . CYS A 1 111 ? 1.507   11.872 42.372 1.00 37.83  ? 125  CYS A SG  1 
ATOM   833  N N   . ILE A 1 112 ? 2.283   11.094 47.118 1.00 26.17  ? 126  ILE A N   1 
ATOM   834  C CA  . ILE A 1 112 ? 2.069   10.608 48.474 1.00 25.30  ? 126  ILE A CA  1 
ATOM   835  C C   . ILE A 1 112 ? 2.079   11.774 49.443 1.00 32.14  ? 126  ILE A C   1 
ATOM   836  O O   . ILE A 1 112 ? 1.458   11.730 50.511 1.00 31.39  ? 126  ILE A O   1 
ATOM   837  C CB  . ILE A 1 112 ? 3.155   9.599  48.871 1.00 27.26  ? 126  ILE A CB  1 
ATOM   838  C CG1 . ILE A 1 112 ? 2.913   8.247  48.189 1.00 27.31  ? 126  ILE A CG1 1 
ATOM   839  C CG2 . ILE A 1 112 ? 3.240   9.492  50.381 1.00 26.52  ? 126  ILE A CG2 1 
ATOM   840  C CD1 . ILE A 1 112 ? 4.106   7.293  48.243 1.00 27.37  ? 126  ILE A CD1 1 
ATOM   841  N N   . TYR A 1 113 ? 2.869   12.785 49.096 1.00 30.78  ? 127  TYR A N   1 
ATOM   842  C CA  . TYR A 1 113 ? 3.024   13.968 49.927 1.00 30.61  ? 127  TYR A CA  1 
ATOM   843  C C   . TYR A 1 113 ? 1.812   14.887 49.869 1.00 34.90  ? 127  TYR A C   1 
ATOM   844  O O   . TYR A 1 113 ? 1.618   15.714 50.759 1.00 35.08  ? 127  TYR A O   1 
ATOM   845  C CB  . TYR A 1 113 ? 4.310   14.714 49.559 1.00 31.43  ? 127  TYR A CB  1 
ATOM   846  C CG  . TYR A 1 113 ? 5.497   14.261 50.376 1.00 32.25  ? 127  TYR A CG  1 
ATOM   847  C CD1 . TYR A 1 113 ? 5.534   14.480 51.747 1.00 33.75  ? 127  TYR A CD1 1 
ATOM   848  C CD2 . TYR A 1 113 ? 6.557   13.578 49.791 1.00 32.75  ? 127  TYR A CD2 1 
ATOM   849  C CE1 . TYR A 1 113 ? 6.603   14.060 52.510 1.00 34.01  ? 127  TYR A CE1 1 
ATOM   850  C CE2 . TYR A 1 113 ? 7.632   13.145 50.551 1.00 33.65  ? 127  TYR A CE2 1 
ATOM   851  C CZ  . TYR A 1 113 ? 7.647   13.392 51.915 1.00 41.56  ? 127  TYR A CZ  1 
ATOM   852  O OH  . TYR A 1 113 ? 8.709   12.982 52.693 1.00 41.85  ? 127  TYR A OH  1 
ATOM   853  N N   . THR A 1 114 ? 0.992   14.732 48.831 1.00 31.40  ? 128  THR A N   1 
ATOM   854  C CA  . THR A 1 114 ? -0.311  15.395 48.787 1.00 31.74  ? 128  THR A CA  1 
ATOM   855  C C   . THR A 1 114 ? -1.401  14.483 49.308 1.00 37.79  ? 128  THR A C   1 
ATOM   856  O O   . THR A 1 114 ? -2.564  14.663 48.960 1.00 37.22  ? 128  THR A O   1 
ATOM   857  C CB  . THR A 1 114 ? -0.706  15.814 47.374 1.00 33.33  ? 128  THR A CB  1 
ATOM   858  O OG1 . THR A 1 114 ? -1.140  14.655 46.651 1.00 30.90  ? 128  THR A OG1 1 
ATOM   859  C CG2 . THR A 1 114 ? 0.456   16.485 46.653 1.00 28.44  ? 128  THR A CG2 1 
ATOM   860  N N   . ASP A 1 115 ? -1.018  13.451 50.053 1.00 35.89  ? 129  ASP A N   1 
ATOM   861  C CA  . ASP A 1 115 ? -1.987  12.473 50.538 1.00 35.59  ? 129  ASP A CA  1 
ATOM   862  C C   . ASP A 1 115 ? -2.772  11.868 49.384 1.00 39.89  ? 129  ASP A C   1 
ATOM   863  O O   . ASP A 1 115 ? -3.952  11.568 49.515 1.00 40.22  ? 129  ASP A O   1 
ATOM   864  C CB  . ASP A 1 115 ? -2.942  13.125 51.527 1.00 37.04  ? 129  ASP A CB  1 
ATOM   865  C CG  . ASP A 1 115 ? -2.332  13.275 52.896 1.00 43.88  ? 129  ASP A CG  1 
ATOM   866  O OD1 . ASP A 1 115 ? -1.355  12.544 53.176 1.00 41.43  ? 129  ASP A OD1 1 
ATOM   867  O OD2 . ASP A 1 115 ? -2.849  14.089 53.698 1.00 49.83  ? 129  ASP A OD2 1 
ATOM   868  N N   . ASN A 1 116 ? -2.110  11.724 48.244 1.00 36.54  ? 130  ASN A N   1 
ATOM   869  C CA  . ASN A 1 116 ? -2.709  11.111 47.065 1.00 36.51  ? 130  ASN A CA  1 
ATOM   870  C C   . ASN A 1 116 ? -3.851  11.931 46.472 1.00 41.14  ? 130  ASN A C   1 
ATOM   871  O O   . ASN A 1 116 ? -4.625  11.448 45.646 1.00 41.37  ? 130  ASN A O   1 
ATOM   872  C CB  . ASN A 1 116 ? -3.088  9.653  47.339 1.00 34.72  ? 130  ASN A CB  1 
ATOM   873  C CG  . ASN A 1 116 ? -1.871  8.796  47.654 1.00 49.39  ? 130  ASN A CG  1 
ATOM   874  O OD1 . ASN A 1 116 ? -0.878  8.822  46.919 1.00 42.78  ? 130  ASN A OD1 1 
ATOM   875  N ND2 . ASN A 1 116 ? -1.894  8.128  48.800 1.00 37.25  ? 130  ASN A ND2 1 
ATOM   876  N N   . SER A 1 117 ? -3.863  13.213 46.817 1.00 37.44  ? 131  SER A N   1 
ATOM   877  C CA  . SER A 1 117 ? -4.752  14.200 46.212 1.00 36.79  ? 131  SER A CA  1 
ATOM   878  C C   . SER A 1 117 ? -4.536  14.294 44.699 1.00 38.58  ? 131  SER A C   1 
ATOM   879  O O   . SER A 1 117 ? -5.459  14.610 43.944 1.00 37.71  ? 131  SER A O   1 
ATOM   880  C CB  . SER A 1 117 ? -4.486  15.564 46.849 1.00 41.82  ? 131  SER A CB  1 
ATOM   881  O OG  . SER A 1 117 ? -5.596  16.426 46.700 1.00 57.99  ? 131  SER A OG  1 
ATOM   882  N N   . ILE A 1 118 ? -3.298  14.090 44.262 1.00 33.53  ? 132  ILE A N   1 
ATOM   883  C CA  . ILE A 1 118 ? -2.998  14.067 42.836 1.00 32.45  ? 132  ILE A CA  1 
ATOM   884  C C   . ILE A 1 118 ? -2.406  12.710 42.481 1.00 37.00  ? 132  ILE A C   1 
ATOM   885  O O   . ILE A 1 118 ? -1.998  11.956 43.365 1.00 37.51  ? 132  ILE A O   1 
ATOM   886  C CB  . ILE A 1 118 ? -2.093  15.256 42.411 1.00 35.21  ? 132  ILE A CB  1 
ATOM   887  C CG1 . ILE A 1 118 ? -0.629  14.820 42.316 1.00 35.90  ? 132  ILE A CG1 1 
ATOM   888  C CG2 . ILE A 1 118 ? -2.238  16.408 43.382 1.00 35.32  ? 132  ILE A CG2 1 
ATOM   889  C CD1 . ILE A 1 118 ? 0.362   15.977 42.278 1.00 39.85  ? 132  ILE A CD1 1 
ATOM   890  N N   . ARG A 1 119 ? -2.439  12.354 41.205 1.00 33.67  ? 133  ARG A N   1 
ATOM   891  C CA  . ARG A 1 119 ? -1.894  11.071 40.793 1.00 34.08  ? 133  ARG A CA  1 
ATOM   892  C C   . ARG A 1 119 ? -0.765  11.265 39.792 1.00 38.83  ? 133  ARG A C   1 
ATOM   893  O O   . ARG A 1 119 ? -0.679  12.301 39.133 1.00 38.96  ? 133  ARG A O   1 
ATOM   894  C CB  . ARG A 1 119 ? -2.996  10.137 40.256 1.00 35.22  ? 133  ARG A CB  1 
ATOM   895  C CG  . ARG A 1 119 ? -3.732  10.646 39.025 1.00 45.68  ? 133  ARG A CG  1 
ATOM   896  C CD  . ARG A 1 119 ? -4.787  9.655  38.530 1.00 53.74  ? 133  ARG A CD  1 
ATOM   897  N NE  . ARG A 1 119 ? -5.909  9.519  39.456 1.00 66.01  ? 133  ARG A NE  1 
ATOM   898  C CZ  . ARG A 1 119 ? -6.232  8.394  40.089 1.00 75.33  ? 133  ARG A CZ  1 
ATOM   899  N NH1 . ARG A 1 119 ? -5.534  7.288  39.883 1.00 63.61  ? 133  ARG A NH1 1 
ATOM   900  N NH2 . ARG A 1 119 ? -7.269  8.369  40.914 1.00 56.60  ? 133  ARG A NH2 1 
ATOM   901  N N   . PRO A 1 120 ? 0.154   10.292 39.712 1.00 35.61  ? 134  PRO A N   1 
ATOM   902  C CA  . PRO A 1 120 ? 1.360   10.452 38.892 1.00 35.63  ? 134  PRO A CA  1 
ATOM   903  C C   . PRO A 1 120 ? 1.080   10.984 37.495 1.00 41.30  ? 134  PRO A C   1 
ATOM   904  O O   . PRO A 1 120 ? 1.894   11.709 36.923 1.00 41.34  ? 134  PRO A O   1 
ATOM   905  C CB  . PRO A 1 120 ? 1.918   9.033  38.840 1.00 36.97  ? 134  PRO A CB  1 
ATOM   906  C CG  . PRO A 1 120 ? 1.549   8.460  40.196 1.00 40.79  ? 134  PRO A CG  1 
ATOM   907  C CD  . PRO A 1 120 ? 0.291   9.180  40.670 1.00 36.14  ? 134  PRO A CD  1 
ATOM   908  N N   . GLU A 1 121 ? -0.120  10.709 36.995 1.00 39.12  ? 135  GLU A N   1 
ATOM   909  C CA  . GLU A 1 121 ? -0.498  11.107 35.641 1.00 39.33  ? 135  GLU A CA  1 
ATOM   910  C C   . GLU A 1 121 ? -0.780  12.611 35.532 1.00 41.80  ? 135  GLU A C   1 
ATOM   911  O O   . GLU A 1 121 ? -0.391  13.256 34.556 1.00 41.13  ? 135  GLU A O   1 
ATOM   912  C CB  . GLU A 1 121 ? -1.702  10.291 35.160 1.00 41.04  ? 135  GLU A CB  1 
ATOM   913  C CG  . GLU A 1 121 ? -1.501  8.771  35.239 1.00 54.76  ? 135  GLU A CG  1 
ATOM   914  C CD  . GLU A 1 121 ? -1.555  8.225  36.660 1.00 77.63  ? 135  GLU A CD  1 
ATOM   915  O OE1 . GLU A 1 121 ? -2.528  8.531  37.379 1.00 84.91  ? 135  GLU A OE1 1 
ATOM   916  O OE2 . GLU A 1 121 ? -0.659  7.439  37.040 1.00 67.42  ? 135  GLU A OE2 1 
ATOM   917  N N   . GLU A 1 122 ? -1.452  13.167 36.534 1.00 37.53  ? 136  GLU A N   1 
ATOM   918  C CA  . GLU A 1 122 ? -1.634  14.610 36.603 1.00 37.13  ? 136  GLU A CA  1 
ATOM   919  C C   . GLU A 1 122 ? -0.260  15.292 36.648 1.00 40.14  ? 136  GLU A C   1 
ATOM   920  O O   . GLU A 1 122 ? 0.036   16.184 35.844 1.00 38.98  ? 136  GLU A O   1 
ATOM   921  C CB  . GLU A 1 122 ? -2.462  14.993 37.829 1.00 38.69  ? 136  GLU A CB  1 
ATOM   922  C CG  . GLU A 1 122 ? -3.860  14.364 37.893 1.00 52.66  ? 136  GLU A CG  1 
ATOM   923  C CD  . GLU A 1 122 ? -4.613  14.752 39.162 1.00 82.28  ? 136  GLU A CD  1 
ATOM   924  O OE1 . GLU A 1 122 ? -3.974  15.264 40.100 1.00 93.30  ? 136  GLU A OE1 1 
ATOM   925  O OE2 . GLU A 1 122 ? -5.843  14.564 39.226 1.00 77.85  ? 136  GLU A OE2 1 
ATOM   926  N N   . LEU A 1 123 ? 0.604   14.813 37.539 1.00 36.11  ? 137  LEU A N   1 
ATOM   927  C CA  . LEU A 1 123 ? 1.940   15.379 37.674 1.00 35.48  ? 137  LEU A CA  1 
ATOM   928  C C   . LEU A 1 123 ? 2.686   15.430 36.348 1.00 38.90  ? 137  LEU A C   1 
ATOM   929  O O   . LEU A 1 123 ? 3.306   16.439 36.020 1.00 38.26  ? 137  LEU A O   1 
ATOM   930  C CB  . LEU A 1 123 ? 2.767   14.596 38.694 1.00 35.46  ? 137  LEU A CB  1 
ATOM   931  C CG  . LEU A 1 123 ? 4.055   15.304 39.125 1.00 39.61  ? 137  LEU A CG  1 
ATOM   932  C CD1 . LEU A 1 123 ? 3.757   16.390 40.159 1.00 39.38  ? 137  LEU A CD1 1 
ATOM   933  C CD2 . LEU A 1 123 ? 5.088   14.318 39.638 1.00 41.16  ? 137  LEU A CD2 1 
ATOM   934  N N   . LEU A 1 124 ? 2.646   14.333 35.596 1.00 35.66  ? 138  LEU A N   1 
ATOM   935  C CA  . LEU A 1 124 ? 3.409   14.243 34.355 1.00 35.07  ? 138  LEU A CA  1 
ATOM   936  C C   . LEU A 1 124 ? 2.860   15.135 33.246 1.00 39.32  ? 138  LEU A C   1 
ATOM   937  O O   . LEU A 1 124 ? 3.614   15.596 32.396 1.00 38.99  ? 138  LEU A O   1 
ATOM   938  C CB  . LEU A 1 124 ? 3.511   12.797 33.872 1.00 35.00  ? 138  LEU A CB  1 
ATOM   939  C CG  . LEU A 1 124 ? 4.130   11.753 34.804 1.00 39.54  ? 138  LEU A CG  1 
ATOM   940  C CD1 . LEU A 1 124 ? 4.467   10.497 34.015 1.00 39.36  ? 138  LEU A CD1 1 
ATOM   941  C CD2 . LEU A 1 124 ? 5.364   12.289 35.525 1.00 41.76  ? 138  LEU A CD2 1 
ATOM   942  N N   . GLN A 1 125 ? 1.542   15.320 33.216 1.00 36.38  ? 139  GLN A N   1 
ATOM   943  C CA  . GLN A 1 125 ? 0.931   16.280 32.296 1.00 36.20  ? 139  GLN A CA  1 
ATOM   944  C C   . GLN A 1 125 ? 1.401   17.680 32.654 1.00 37.43  ? 139  GLN A C   1 
ATOM   945  O O   . GLN A 1 125 ? 1.754   18.471 31.781 1.00 37.42  ? 139  GLN A O   1 
ATOM   946  C CB  . GLN A 1 125 ? -0.597  16.252 32.406 1.00 38.13  ? 139  GLN A CB  1 
ATOM   947  C CG  . GLN A 1 125 ? -1.271  14.986 31.892 1.00 61.82  ? 139  GLN A CG  1 
ATOM   948  C CD  . GLN A 1 125 ? -2.776  15.004 32.119 1.00 87.95  ? 139  GLN A CD  1 
ATOM   949  O OE1 . GLN A 1 125 ? -3.377  13.988 32.477 1.00 84.21  ? 139  GLN A OE1 1 
ATOM   950  N NE2 . GLN A 1 125 ? -3.389  16.172 31.938 1.00 81.42  ? 139  GLN A NE2 1 
ATOM   951  N N   . MET A 1 126 ? 1.345   17.996 33.943 1.00 31.75  ? 140  MET A N   1 
ATOM   952  C CA  . MET A 1 126 ? 1.691   19.325 34.416 1.00 30.84  ? 140  MET A CA  1 
ATOM   953  C C   . MET A 1 126 ? 3.152   19.646 34.126 1.00 32.45  ? 140  MET A C   1 
ATOM   954  O O   . MET A 1 126 ? 3.477   20.785 33.800 1.00 31.54  ? 140  MET A O   1 
ATOM   955  C CB  . MET A 1 126 ? 1.362   19.476 35.902 1.00 33.79  ? 140  MET A CB  1 
ATOM   956  C CG  . MET A 1 126 ? 1.434   20.908 36.426 1.00 38.29  ? 140  MET A CG  1 
ATOM   957  S SD  . MET A 1 126 ? 0.333   22.067 35.565 1.00 43.15  ? 140  MET A SD  1 
ATOM   958  C CE  . MET A 1 126 ? -1.151  21.820 36.460 1.00 40.17  ? 140  MET A CE  1 
ATOM   959  N N   . GLU A 1 127 ? 4.015   18.629 34.149 1.00 28.86  ? 141  GLU A N   1 
ATOM   960  C CA  . GLU A 1 127 ? 5.425   18.824 33.794 1.00 28.70  ? 141  GLU A CA  1 
ATOM   961  C C   . GLU A 1 127 ? 5.590   19.394 32.393 1.00 34.78  ? 141  GLU A C   1 
ATOM   962  O O   . GLU A 1 127 ? 6.374   20.317 32.172 1.00 34.50  ? 141  GLU A O   1 
ATOM   963  C CB  . GLU A 1 127 ? 6.255   17.535 33.927 1.00 29.57  ? 141  GLU A CB  1 
ATOM   964  C CG  . GLU A 1 127 ? 7.694   17.704 33.416 1.00 32.24  ? 141  GLU A CG  1 
ATOM   965  C CD  . GLU A 1 127 ? 8.550   16.445 33.519 1.00 51.06  ? 141  GLU A CD  1 
ATOM   966  O OE1 . GLU A 1 127 ? 8.130   15.373 33.027 1.00 42.96  ? 141  GLU A OE1 1 
ATOM   967  O OE2 . GLU A 1 127 ? 9.699   16.557 34.000 1.00 39.90  ? 141  GLU A OE2 1 
ATOM   968  N N   . LEU A 1 128 ? 4.902   18.791 31.435 1.00 33.54  ? 142  LEU A N   1 
ATOM   969  C CA  . LEU A 1 128 ? 4.946   19.259 30.057 1.00 34.35  ? 142  LEU A CA  1 
ATOM   970  C C   . LEU A 1 128 ? 4.420   20.687 29.919 1.00 38.12  ? 142  LEU A C   1 
ATOM   971  O O   . LEU A 1 128 ? 5.001   21.506 29.206 1.00 37.37  ? 142  LEU A O   1 
ATOM   972  C CB  . LEU A 1 128 ? 4.172   18.299 29.151 1.00 35.16  ? 142  LEU A CB  1 
ATOM   973  C CG  . LEU A 1 128 ? 4.727   16.871 29.154 1.00 40.91  ? 142  LEU A CG  1 
ATOM   974  C CD1 . LEU A 1 128 ? 4.041   16.001 28.110 1.00 41.29  ? 142  LEU A CD1 1 
ATOM   975  C CD2 . LEU A 1 128 ? 6.233   16.890 28.927 1.00 44.47  ? 142  LEU A CD2 1 
ATOM   976  N N   . LEU A 1 129 ? 3.338   20.993 30.627 1.00 35.21  ? 143  LEU A N   1 
ATOM   977  C CA  . LEU A 1 129 ? 2.801   22.350 30.634 1.00 35.40  ? 143  LEU A CA  1 
ATOM   978  C C   . LEU A 1 129 ? 3.821   23.339 31.188 1.00 38.22  ? 143  LEU A C   1 
ATOM   979  O O   . LEU A 1 129 ? 4.164   24.334 30.537 1.00 38.48  ? 143  LEU A O   1 
ATOM   980  C CB  . LEU A 1 129 ? 1.517   22.416 31.467 1.00 35.86  ? 143  LEU A CB  1 
ATOM   981  C CG  . LEU A 1 129 ? 0.355   21.552 30.961 1.00 41.05  ? 143  LEU A CG  1 
ATOM   982  C CD1 . LEU A 1 129 ? -0.949  21.940 31.645 1.00 41.43  ? 143  LEU A CD1 1 
ATOM   983  C CD2 . LEU A 1 129 ? 0.224   21.657 29.441 1.00 42.02  ? 143  LEU A CD2 1 
ATOM   984  N N   . LEU A 1 130 ? 4.282   23.058 32.405 1.00 32.46  ? 144  LEU A N   1 
ATOM   985  C CA  . LEU A 1 130 ? 5.255   23.893 33.105 1.00 31.43  ? 144  LEU A CA  1 
ATOM   986  C C   . LEU A 1 130 ? 6.485   24.188 32.255 1.00 33.36  ? 144  LEU A C   1 
ATOM   987  O O   . LEU A 1 130 ? 6.885   25.337 32.069 1.00 33.36  ? 144  LEU A O   1 
ATOM   988  C CB  . LEU A 1 130 ? 5.700   23.184 34.388 1.00 31.37  ? 144  LEU A CB  1 
ATOM   989  C CG  . LEU A 1 130 ? 6.775   23.920 35.187 1.00 34.69  ? 144  LEU A CG  1 
ATOM   990  C CD1 . LEU A 1 130 ? 6.224   25.248 35.713 1.00 34.75  ? 144  LEU A CD1 1 
ATOM   991  C CD2 . LEU A 1 130 ? 7.304   23.053 36.305 1.00 33.50  ? 144  LEU A CD2 1 
ATOM   992  N N   . VAL A 1 131 ? 7.110   23.123 31.788 1.00 28.21  ? 145  VAL A N   1 
ATOM   993  C CA  . VAL A 1 131 ? 8.334   23.208 31.016 1.00 27.39  ? 145  VAL A CA  1 
ATOM   994  C C   . VAL A 1 131 ? 8.147   23.993 29.719 1.00 30.44  ? 145  VAL A C   1 
ATOM   995  O O   . VAL A 1 131 ? 9.009   24.781 29.313 1.00 29.39  ? 145  VAL A O   1 
ATOM   996  C CB  . VAL A 1 131 ? 8.882   21.794 30.779 1.00 31.25  ? 145  VAL A CB  1 
ATOM   997  C CG1 . VAL A 1 131 ? 9.449   21.663 29.403 1.00 31.46  ? 145  VAL A CG1 1 
ATOM   998  C CG2 . VAL A 1 131 ? 9.903   21.440 31.833 1.00 30.59  ? 145  VAL A CG2 1 
ATOM   999  N N   . ASN A 1 132 ? 7.006   23.784 29.075 1.00 27.45  ? 146  ASN A N   1 
ATOM   1000 C CA  . ASN A 1 132 ? 6.649   24.544 27.877 1.00 27.13  ? 146  ASN A CA  1 
ATOM   1001 C C   . ASN A 1 132 ? 6.420   26.032 28.135 1.00 30.22  ? 146  ASN A C   1 
ATOM   1002 O O   . ASN A 1 132 ? 6.954   26.857 27.413 1.00 30.47  ? 146  ASN A O   1 
ATOM   1003 C CB  . ASN A 1 132 ? 5.430   23.937 27.191 1.00 29.06  ? 146  ASN A CB  1 
ATOM   1004 C CG  . ASN A 1 132 ? 5.771   22.716 26.376 1.00 49.07  ? 146  ASN A CG  1 
ATOM   1005 O OD1 . ASN A 1 132 ? 6.942   22.402 26.158 1.00 41.10  ? 146  ASN A OD1 1 
ATOM   1006 N ND2 . ASN A 1 132 ? 4.743   22.037 25.886 1.00 44.10  ? 146  ASN A ND2 1 
ATOM   1007 N N   . LYS A 1 133 ? 5.617   26.378 29.138 1.00 26.82  ? 147  LYS A N   1 
ATOM   1008 C CA  . LYS A 1 133 ? 5.464   27.784 29.519 1.00 27.71  ? 147  LYS A CA  1 
ATOM   1009 C C   . LYS A 1 133 ? 6.817   28.476 29.674 1.00 31.95  ? 147  LYS A C   1 
ATOM   1010 O O   . LYS A 1 133 ? 7.017   29.586 29.184 1.00 32.48  ? 147  LYS A O   1 
ATOM   1011 C CB  . LYS A 1 133 ? 4.674   27.935 30.830 1.00 31.50  ? 147  LYS A CB  1 
ATOM   1012 C CG  . LYS A 1 133 ? 3.161   27.986 30.676 1.00 47.85  ? 147  LYS A CG  1 
ATOM   1013 C CD  . LYS A 1 133 ? 2.685   29.245 29.963 1.00 55.88  ? 147  LYS A CD  1 
ATOM   1014 C CE  . LYS A 1 133 ? 1.318   29.005 29.312 1.00 65.88  ? 147  LYS A CE  1 
ATOM   1015 N NZ  . LYS A 1 133 ? 0.763   30.194 28.601 1.00 72.26  ? 147  LYS A NZ  1 
ATOM   1016 N N   . LEU A 1 134 ? 7.736   27.820 30.376 1.00 27.53  ? 148  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 134 ? 9.023   28.422 30.703 1.00 26.97  ? 148  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 134 ? 10.016  28.279 29.554 1.00 31.71  ? 148  LEU A C   1 
ATOM   1019 O O   . LEU A 1 134 ? 11.182  28.644 29.680 1.00 31.29  ? 148  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 134 ? 9.593   27.816 31.996 1.00 26.48  ? 148  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 134 ? 8.684   27.862 33.234 1.00 29.57  ? 148  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 134 ? 9.402   27.362 34.460 1.00 28.42  ? 148  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 134 ? 8.159   29.271 33.462 1.00 31.42  ? 148  LEU A CD2 1 
ATOM   1024 N N   . LYS A 1 135 ? 9.553   27.711 28.448 1.00 29.58  ? 149  LYS A N   1 
ATOM   1025 C CA  . LYS A 1 135 ? 10.402  27.502 27.272 1.00 29.80  ? 149  LYS A CA  1 
ATOM   1026 C C   . LYS A 1 135 ? 11.650  26.689 27.589 1.00 33.96  ? 149  LYS A C   1 
ATOM   1027 O O   . LYS A 1 135 ? 12.697  26.869 26.963 1.00 33.40  ? 149  LYS A O   1 
ATOM   1028 C CB  . LYS A 1 135 ? 10.798  28.836 26.639 1.00 32.60  ? 149  LYS A CB  1 
ATOM   1029 C CG  . LYS A 1 135 ? 9.631   29.713 26.223 1.00 42.35  ? 149  LYS A CG  1 
ATOM   1030 C CD  . LYS A 1 135 ? 10.141  30.965 25.526 1.00 53.74  ? 149  LYS A CD  1 
ATOM   1031 C CE  . LYS A 1 135 ? 8.998   31.833 25.035 1.00 73.35  ? 149  LYS A CE  1 
ATOM   1032 N NZ  . LYS A 1 135 ? 9.501   33.053 24.342 1.00 87.41  ? 149  LYS A NZ  1 
ATOM   1033 N N   . TRP A 1 136 ? 11.523  25.773 28.544 1.00 31.52  ? 150  TRP A N   1 
ATOM   1034 C CA  . TRP A 1 136 ? 12.625  24.887 28.920 1.00 30.64  ? 150  TRP A CA  1 
ATOM   1035 C C   . TRP A 1 136 ? 13.830  25.688 29.416 1.00 33.39  ? 150  TRP A C   1 
ATOM   1036 O O   . TRP A 1 136 ? 14.952  25.194 29.442 1.00 33.70  ? 150  TRP A O   1 
ATOM   1037 C CB  . TRP A 1 136 ? 13.009  23.978 27.744 1.00 29.19  ? 150  TRP A CB  1 
ATOM   1038 C CG  . TRP A 1 136 ? 11.925  22.990 27.352 1.00 29.93  ? 150  TRP A CG  1 
ATOM   1039 C CD1 . TRP A 1 136 ? 10.642  23.280 26.968 1.00 32.89  ? 150  TRP A CD1 1 
ATOM   1040 C CD2 . TRP A 1 136 ? 12.042  21.559 27.299 1.00 29.82  ? 150  TRP A CD2 1 
ATOM   1041 N NE1 . TRP A 1 136 ? 9.951   22.116 26.696 1.00 31.98  ? 150  TRP A NE1 1 
ATOM   1042 C CE2 . TRP A 1 136 ? 10.795  21.048 26.867 1.00 33.40  ? 150  TRP A CE2 1 
ATOM   1043 C CE3 . TRP A 1 136 ? 13.083  20.660 27.560 1.00 31.00  ? 150  TRP A CE3 1 
ATOM   1044 C CZ2 . TRP A 1 136 ? 10.553  19.682 26.723 1.00 32.68  ? 150  TRP A CZ2 1 
ATOM   1045 C CZ3 . TRP A 1 136 ? 12.838  19.298 27.422 1.00 32.57  ? 150  TRP A CZ3 1 
ATOM   1046 C CH2 . TRP A 1 136 ? 11.584  18.824 27.003 1.00 33.05  ? 150  TRP A CH2 1 
ATOM   1047 N N   . ASN A 1 137 ? 13.593  26.936 29.798 1.00 28.76  ? 151  ASN A N   1 
ATOM   1048 C CA  . ASN A 1 137 ? 14.643  27.747 30.397 1.00 28.10  ? 151  ASN A CA  1 
ATOM   1049 C C   . ASN A 1 137 ? 14.717  27.458 31.890 1.00 30.09  ? 151  ASN A C   1 
ATOM   1050 O O   . ASN A 1 137 ? 14.219  28.228 32.714 1.00 28.43  ? 151  ASN A O   1 
ATOM   1051 C CB  . ASN A 1 137 ? 14.389  29.236 30.155 1.00 30.25  ? 151  ASN A CB  1 
ATOM   1052 C CG  . ASN A 1 137 ? 15.676  30.041 30.078 1.00 46.84  ? 151  ASN A CG  1 
ATOM   1053 O OD1 . ASN A 1 137 ? 16.756  29.564 30.447 1.00 37.34  ? 151  ASN A OD1 1 
ATOM   1054 N ND2 . ASN A 1 137 ? 15.574  31.252 29.558 1.00 38.38  ? 151  ASN A ND2 1 
ATOM   1055 N N   . LEU A 1 138 ? 15.361  26.344 32.223 1.00 26.74  ? 152  LEU A N   1 
ATOM   1056 C CA  . LEU A 1 138 ? 15.259  25.751 33.554 1.00 25.77  ? 152  LEU A CA  1 
ATOM   1057 C C   . LEU A 1 138 ? 16.556  25.839 34.334 1.00 30.08  ? 152  LEU A C   1 
ATOM   1058 O O   . LEU A 1 138 ? 16.584  25.560 35.523 1.00 28.27  ? 152  LEU A O   1 
ATOM   1059 C CB  . LEU A 1 138 ? 14.845  24.286 33.432 1.00 25.18  ? 152  LEU A CB  1 
ATOM   1060 C CG  . LEU A 1 138 ? 13.560  24.058 32.642 1.00 28.58  ? 152  LEU A CG  1 
ATOM   1061 C CD1 . LEU A 1 138 ? 13.237  22.573 32.560 1.00 28.26  ? 152  LEU A CD1 1 
ATOM   1062 C CD2 . LEU A 1 138 ? 12.409  24.843 33.264 1.00 28.60  ? 152  LEU A CD2 1 
ATOM   1063 N N   . ALA A 1 139 ? 17.631  26.217 33.652 1.00 29.78  ? 153  ALA A N   1 
ATOM   1064 C CA  . ALA A 1 139 ? 18.964  26.189 34.245 1.00 30.60  ? 153  ALA A CA  1 
ATOM   1065 C C   . ALA A 1 139 ? 19.407  27.576 34.685 1.00 37.57  ? 153  ALA A C   1 
ATOM   1066 O O   . ALA A 1 139 ? 20.593  27.895 34.678 1.00 36.61  ? 153  ALA A O   1 
ATOM   1067 C CB  . ALA A 1 139 ? 19.969  25.578 33.273 1.00 31.11  ? 153  ALA A CB  1 
ATOM   1068 N N   . ALA A 1 140 ? 18.427  28.402 35.039 1.00 37.77  ? 154  ALA A N   1 
ATOM   1069 C CA  . ALA A 1 140 ? 18.659  29.678 35.716 1.00 38.56  ? 154  ALA A CA  1 
ATOM   1070 C C   . ALA A 1 140 ? 19.607  29.460 36.880 1.00 39.84  ? 154  ALA A C   1 
ATOM   1071 O O   . ALA A 1 140 ? 19.497  28.462 37.592 1.00 39.23  ? 154  ALA A O   1 
ATOM   1072 C CB  . ALA A 1 140 ? 17.329  30.229 36.240 1.00 40.11  ? 154  ALA A CB  1 
ATOM   1073 N N   . MET A 1 141 ? 20.518  30.406 37.087 1.00 35.10  ? 155  MET A N   1 
ATOM   1074 C CA  A MET A 1 141 ? 21.461  30.341 38.204 0.50 34.43  ? 155  MET A CA  1 
ATOM   1075 C CA  B MET A 1 141 ? 21.449  30.330 38.203 0.50 34.15  ? 155  MET A CA  1 
ATOM   1076 C C   . MET A 1 141 ? 20.736  30.516 39.548 1.00 37.71  ? 155  MET A C   1 
ATOM   1077 O O   . MET A 1 141 ? 19.725  31.210 39.633 1.00 37.14  ? 155  MET A O   1 
ATOM   1078 C CB  A MET A 1 141 ? 22.579  31.377 38.023 0.50 36.51  ? 155  MET A CB  1 
ATOM   1079 C CB  B MET A 1 141 ? 22.598  31.323 38.019 0.50 36.01  ? 155  MET A CB  1 
ATOM   1080 C CG  A MET A 1 141 ? 23.727  31.288 39.032 0.50 39.93  ? 155  MET A CG  1 
ATOM   1081 C CG  B MET A 1 141 ? 22.194  32.797 37.985 0.50 39.11  ? 155  MET A CG  1 
ATOM   1082 S SD  A MET A 1 141 ? 25.167  32.311 38.564 0.50 43.92  ? 155  MET A SD  1 
ATOM   1083 S SD  B MET A 1 141 ? 20.957  33.255 36.740 0.50 42.21  ? 155  MET A SD  1 
ATOM   1084 C CE  A MET A 1 141 ? 26.094  32.338 40.054 0.50 40.26  ? 155  MET A CE  1 
ATOM   1085 C CE  B MET A 1 141 ? 19.467  33.306 37.767 0.50 38.54  ? 155  MET A CE  1 
ATOM   1086 N N   . THR A 1 142 ? 21.217  29.826 40.581 1.00 33.87  ? 156  THR A N   1 
ATOM   1087 C CA  . THR A 1 142 ? 20.524  29.802 41.874 1.00 33.31  ? 156  THR A CA  1 
ATOM   1088 C C   . THR A 1 142 ? 21.170  30.697 42.926 1.00 36.40  ? 156  THR A C   1 
ATOM   1089 O O   . THR A 1 142 ? 22.379  30.912 42.906 1.00 35.82  ? 156  THR A O   1 
ATOM   1090 C CB  . THR A 1 142 ? 20.367  28.354 42.402 1.00 39.18  ? 156  THR A CB  1 
ATOM   1091 O OG1 . THR A 1 142 ? 21.646  27.835 42.788 1.00 37.43  ? 156  THR A OG1 1 
ATOM   1092 C CG2 . THR A 1 142 ? 19.779  27.447 41.322 1.00 36.93  ? 156  THR A CG2 1 
ATOM   1093 N N   . PRO A 1 143 ? 20.370  31.189 43.893 1.00 32.40  ? 157  PRO A N   1 
ATOM   1094 C CA  . PRO A 1 143 ? 20.924  31.935 45.038 1.00 31.88  ? 157  PRO A CA  1 
ATOM   1095 C C   . PRO A 1 143 ? 22.123  31.227 45.667 1.00 36.56  ? 157  PRO A C   1 
ATOM   1096 O O   . PRO A 1 143 ? 23.112  31.871 46.017 1.00 36.27  ? 157  PRO A O   1 
ATOM   1097 C CB  . PRO A 1 143 ? 19.756  31.988 46.027 1.00 33.07  ? 157  PRO A CB  1 
ATOM   1098 C CG  . PRO A 1 143 ? 18.531  31.856 45.175 1.00 36.71  ? 157  PRO A CG  1 
ATOM   1099 C CD  . PRO A 1 143 ? 18.915  30.978 44.016 1.00 32.40  ? 157  PRO A CD  1 
ATOM   1100 N N   . HIS A 1 144 ? 22.029  29.906 45.809 1.00 34.48  ? 158  HIS A N   1 
ATOM   1101 C CA  . HIS A 1 144 ? 23.167  29.073 46.208 1.00 35.26  ? 158  HIS A CA  1 
ATOM   1102 C C   . HIS A 1 144 ? 24.373  29.282 45.286 1.00 39.31  ? 158  HIS A C   1 
ATOM   1103 O O   . HIS A 1 144 ? 25.518  29.305 45.737 1.00 39.02  ? 158  HIS A O   1 
ATOM   1104 C CB  . HIS A 1 144 ? 22.781  27.590 46.207 1.00 36.59  ? 158  HIS A CB  1 
ATOM   1105 C CG  . HIS A 1 144 ? 23.959  26.666 46.228 1.00 40.75  ? 158  HIS A CG  1 
ATOM   1106 N ND1 . HIS A 1 144 ? 24.525  26.205 47.400 1.00 42.81  ? 158  HIS A ND1 1 
ATOM   1107 C CD2 . HIS A 1 144 ? 24.716  26.163 45.224 1.00 42.78  ? 158  HIS A CD2 1 
ATOM   1108 C CE1 . HIS A 1 144 ? 25.567  25.446 47.114 1.00 42.24  ? 158  HIS A CE1 1 
ATOM   1109 N NE2 . HIS A 1 144 ? 25.708  25.405 45.800 1.00 42.60  ? 158  HIS A NE2 1 
ATOM   1110 N N   . ASP A 1 145 ? 24.110  29.391 43.989 1.00 35.50  ? 159  ASP A N   1 
ATOM   1111 C CA  . ASP A 1 145 ? 25.146  29.729 43.020 1.00 34.91  ? 159  ASP A CA  1 
ATOM   1112 C C   . ASP A 1 145 ? 25.834  31.054 43.360 1.00 35.51  ? 159  ASP A C   1 
ATOM   1113 O O   . ASP A 1 145 ? 27.056  31.121 43.464 1.00 35.43  ? 159  ASP A O   1 
ATOM   1114 C CB  . ASP A 1 145 ? 24.563  29.775 41.602 1.00 37.02  ? 159  ASP A CB  1 
ATOM   1115 C CG  . ASP A 1 145 ? 24.409  28.391 40.988 1.00 49.86  ? 159  ASP A CG  1 
ATOM   1116 O OD1 . ASP A 1 145 ? 25.177  27.482 41.372 1.00 51.48  ? 159  ASP A OD1 1 
ATOM   1117 O OD2 . ASP A 1 145 ? 23.538  28.214 40.108 1.00 54.78  ? 159  ASP A OD2 1 
ATOM   1118 N N   . PHE A 1 146 ? 25.042  32.099 43.556 1.00 28.96  ? 160  PHE A N   1 
ATOM   1119 C CA  . PHE A 1 146 ? 25.584  33.419 43.861 1.00 27.66  ? 160  PHE A CA  1 
ATOM   1120 C C   . PHE A 1 146 ? 26.358  33.476 45.184 1.00 31.43  ? 160  PHE A C   1 
ATOM   1121 O O   . PHE A 1 146 ? 27.494  33.944 45.224 1.00 30.32  ? 160  PHE A O   1 
ATOM   1122 C CB  . PHE A 1 146 ? 24.478  34.466 43.809 1.00 28.66  ? 160  PHE A CB  1 
ATOM   1123 C CG  . PHE A 1 146 ? 23.921  34.676 42.430 1.00 29.40  ? 160  PHE A CG  1 
ATOM   1124 C CD1 . PHE A 1 146 ? 22.751  34.036 42.033 1.00 31.44  ? 160  PHE A CD1 1 
ATOM   1125 C CD2 . PHE A 1 146 ? 24.585  35.491 41.516 1.00 30.95  ? 160  PHE A CD2 1 
ATOM   1126 C CE1 . PHE A 1 146 ? 22.241  34.217 40.758 1.00 32.23  ? 160  PHE A CE1 1 
ATOM   1127 C CE2 . PHE A 1 146 ? 24.079  35.686 40.240 1.00 33.72  ? 160  PHE A CE2 1 
ATOM   1128 C CZ  . PHE A 1 146 ? 22.910  35.033 39.853 1.00 31.89  ? 160  PHE A CZ  1 
ATOM   1129 N N   . ILE A 1 147 ? 25.746  32.947 46.243 1.00 28.10  ? 161  ILE A N   1 
ATOM   1130 C CA  . ILE A 1 147 ? 26.379  32.777 47.549 1.00 27.21  ? 161  ILE A CA  1 
ATOM   1131 C C   . ILE A 1 147 ? 27.799  32.211 47.452 1.00 34.52  ? 161  ILE A C   1 
ATOM   1132 O O   . ILE A 1 147 ? 28.736  32.761 48.028 1.00 33.29  ? 161  ILE A O   1 
ATOM   1133 C CB  . ILE A 1 147 ? 25.485  31.920 48.466 1.00 29.23  ? 161  ILE A CB  1 
ATOM   1134 C CG1 . ILE A 1 147 ? 24.195  32.673 48.803 1.00 29.08  ? 161  ILE A CG1 1 
ATOM   1135 C CG2 . ILE A 1 147 ? 26.225  31.520 49.737 1.00 29.44  ? 161  ILE A CG2 1 
ATOM   1136 C CD1 . ILE A 1 147 ? 23.140  31.820 49.517 1.00 26.31  ? 161  ILE A CD1 1 
ATOM   1137 N N   . GLU A 1 148 ? 27.951  31.103 46.733 1.00 34.02  ? 162  GLU A N   1 
ATOM   1138 C CA  . GLU A 1 148 ? 29.269  30.520 46.498 1.00 34.54  ? 162  GLU A CA  1 
ATOM   1139 C C   . GLU A 1 148 ? 30.218  31.484 45.783 1.00 39.47  ? 162  GLU A C   1 
ATOM   1140 O O   . GLU A 1 148 ? 31.400  31.561 46.116 1.00 39.78  ? 162  GLU A O   1 
ATOM   1141 C CB  . GLU A 1 148 ? 29.151  29.210 45.708 1.00 35.90  ? 162  GLU A CB  1 
ATOM   1142 C CG  . GLU A 1 148 ? 28.418  28.112 46.462 1.00 43.05  ? 162  GLU A CG  1 
ATOM   1143 C CD  . GLU A 1 148 ? 28.960  27.924 47.861 1.00 56.70  ? 162  GLU A CD  1 
ATOM   1144 O OE1 . GLU A 1 148 ? 30.194  28.004 48.034 1.00 48.69  ? 162  GLU A OE1 1 
ATOM   1145 O OE2 . GLU A 1 148 ? 28.156  27.710 48.791 1.00 50.12  ? 162  GLU A OE2 1 
ATOM   1146 N N   . HIS A 1 149 ? 29.704  32.202 44.791 1.00 35.85  ? 163  HIS A N   1 
ATOM   1147 C CA  . HIS A 1 149 ? 30.497  33.204 44.085 1.00 35.78  ? 163  HIS A CA  1 
ATOM   1148 C C   . HIS A 1 149 ? 30.966  34.315 45.023 1.00 37.66  ? 163  HIS A C   1 
ATOM   1149 O O   . HIS A 1 149 ? 32.156  34.624 45.087 1.00 38.25  ? 163  HIS A O   1 
ATOM   1150 C CB  . HIS A 1 149 ? 29.709  33.793 42.912 1.00 37.25  ? 163  HIS A CB  1 
ATOM   1151 C CG  . HIS A 1 149 ? 30.505  34.736 42.066 1.00 41.61  ? 163  HIS A CG  1 
ATOM   1152 N ND1 . HIS A 1 149 ? 31.546  34.319 41.263 1.00 43.95  ? 163  HIS A ND1 1 
ATOM   1153 C CD2 . HIS A 1 149 ? 30.426  36.081 41.911 1.00 43.73  ? 163  HIS A CD2 1 
ATOM   1154 C CE1 . HIS A 1 149 ? 32.074  35.366 40.651 1.00 43.24  ? 163  HIS A CE1 1 
ATOM   1155 N NE2 . HIS A 1 149 ? 31.413  36.446 41.028 1.00 43.47  ? 163  HIS A NE2 1 
ATOM   1156 N N   . PHE A 1 150 ? 30.029  34.912 45.753 1.00 31.68  ? 164  PHE A N   1 
ATOM   1157 C CA  . PHE A 1 150 ? 30.373  35.917 46.754 1.00 30.67  ? 164  PHE A CA  1 
ATOM   1158 C C   . PHE A 1 150 ? 31.426  35.380 47.719 1.00 33.59  ? 164  PHE A C   1 
ATOM   1159 O O   . PHE A 1 150 ? 32.405  36.049 48.027 1.00 33.71  ? 164  PHE A O   1 
ATOM   1160 C CB  . PHE A 1 150 ? 29.134  36.341 47.547 1.00 32.04  ? 164  PHE A CB  1 
ATOM   1161 C CG  . PHE A 1 150 ? 28.014  36.853 46.691 1.00 33.58  ? 164  PHE A CG  1 
ATOM   1162 C CD1 . PHE A 1 150 ? 28.264  37.322 45.411 1.00 36.51  ? 164  PHE A CD1 1 
ATOM   1163 C CD2 . PHE A 1 150 ? 26.708  36.854 47.161 1.00 34.92  ? 164  PHE A CD2 1 
ATOM   1164 C CE1 . PHE A 1 150 ? 27.237  37.777 44.618 1.00 37.31  ? 164  PHE A CE1 1 
ATOM   1165 C CE2 . PHE A 1 150 ? 25.679  37.318 46.379 1.00 37.57  ? 164  PHE A CE2 1 
ATOM   1166 C CZ  . PHE A 1 150 ? 25.942  37.783 45.104 1.00 36.12  ? 164  PHE A CZ  1 
ATOM   1167 N N   . LEU A 1 151 ? 31.180  34.193 48.248 1.00 29.43  ? 165  LEU A N   1 
ATOM   1168 C CA  . LEU A 1 151 ? 32.091  33.600 49.203 1.00 29.45  ? 165  LEU A CA  1 
ATOM   1169 C C   . LEU A 1 151 ? 33.501  33.436 48.640 1.00 36.18  ? 165  LEU A C   1 
ATOM   1170 O O   . LEU A 1 151 ? 34.481  33.680 49.337 1.00 35.57  ? 165  LEU A O   1 
ATOM   1171 C CB  . LEU A 1 151 ? 31.533  32.286 49.739 1.00 29.08  ? 165  LEU A CB  1 
ATOM   1172 C CG  . LEU A 1 151 ? 30.928  32.401 51.143 1.00 33.20  ? 165  LEU A CG  1 
ATOM   1173 C CD1 . LEU A 1 151 ? 30.329  33.789 51.391 1.00 32.46  ? 165  LEU A CD1 1 
ATOM   1174 C CD2 . LEU A 1 151 ? 29.917  31.297 51.408 1.00 33.13  ? 165  LEU A CD2 1 
ATOM   1175 N N   . SER A 1 152 ? 33.599  33.139 47.350 1.00 34.77  ? 166  SER A N   1 
ATOM   1176 C CA  . SER A 1 152 ? 34.902  32.939 46.728 1.00 35.54  ? 166  SER A CA  1 
ATOM   1177 C C   . SER A 1 152 ? 35.715  34.231 46.668 1.00 43.16  ? 166  SER A C   1 
ATOM   1178 O O   . SER A 1 152 ? 36.939  34.198 46.539 1.00 43.39  ? 166  SER A O   1 
ATOM   1179 C CB  . SER A 1 152 ? 34.754  32.343 45.326 1.00 37.60  ? 166  SER A CB  1 
ATOM   1180 O OG  . SER A 1 152 ? 34.438  33.335 44.368 1.00 44.74  ? 166  SER A OG  1 
ATOM   1181 N N   . LYS A 1 153 ? 35.031  35.368 46.724 1.00 40.68  ? 167  LYS A N   1 
ATOM   1182 C CA  . LYS A 1 153 ? 35.709  36.653 46.640 1.00 40.52  ? 167  LYS A CA  1 
ATOM   1183 C C   . LYS A 1 153 ? 36.104  37.173 48.011 1.00 45.93  ? 167  LYS A C   1 
ATOM   1184 O O   . LYS A 1 153 ? 36.735  38.219 48.126 1.00 45.45  ? 167  LYS A O   1 
ATOM   1185 C CB  . LYS A 1 153 ? 34.845  37.672 45.896 1.00 42.33  ? 167  LYS A CB  1 
ATOM   1186 C CG  . LYS A 1 153 ? 34.609  37.317 44.433 1.00 50.59  ? 167  LYS A CG  1 
ATOM   1187 C CD  . LYS A 1 153 ? 33.878  38.435 43.702 1.00 61.31  ? 167  LYS A CD  1 
ATOM   1188 C CE  . LYS A 1 153 ? 33.958  38.254 42.189 1.00 71.20  ? 167  LYS A CE  1 
ATOM   1189 N NZ  . LYS A 1 153 ? 33.321  39.377 41.439 1.00 77.59  ? 167  LYS A NZ  1 
ATOM   1190 N N   . MET A 1 154 ? 35.795  36.400 49.045 1.00 44.30  ? 168  MET A N   1 
ATOM   1191 C CA  . MET A 1 154 ? 35.966  36.861 50.417 1.00 44.81  ? 168  MET A CA  1 
ATOM   1192 C C   . MET A 1 154 ? 37.111  36.190 51.154 1.00 50.97  ? 168  MET A C   1 
ATOM   1193 O O   . MET A 1 154 ? 37.224  34.963 51.179 1.00 49.73  ? 168  MET A O   1 
ATOM   1194 C CB  . MET A 1 154 ? 34.671  36.703 51.214 1.00 47.15  ? 168  MET A CB  1 
ATOM   1195 C CG  . MET A 1 154 ? 33.522  37.531 50.680 1.00 51.24  ? 168  MET A CG  1 
ATOM   1196 S SD  . MET A 1 154 ? 31.987  37.262 51.588 1.00 55.97  ? 168  MET A SD  1 
ATOM   1197 C CE  . MET A 1 154 ? 30.815  37.951 50.445 1.00 52.57  ? 168  MET A CE  1 
ATOM   1198 N N   . PRO A 1 155 ? 37.980  37.004 51.772 1.00 50.38  ? 169  PRO A N   1 
ATOM   1199 C CA  . PRO A 1 155 ? 38.976  36.510 52.720 1.00 50.85  ? 169  PRO A CA  1 
ATOM   1200 C C   . PRO A 1 155 ? 38.238  36.087 53.981 1.00 55.81  ? 169  PRO A C   1 
ATOM   1201 O O   . PRO A 1 155 ? 37.607  36.912 54.652 1.00 56.60  ? 169  PRO A O   1 
ATOM   1202 C CB  . PRO A 1 155 ? 39.806  37.759 53.011 1.00 52.60  ? 169  PRO A CB  1 
ATOM   1203 C CG  . PRO A 1 155 ? 38.801  38.870 52.945 1.00 56.78  ? 169  PRO A CG  1 
ATOM   1204 C CD  . PRO A 1 155 ? 37.778  38.461 51.903 1.00 52.29  ? 169  PRO A CD  1 
ATOM   1205 N N   . GLU A 1 156 ? 38.256  34.792 54.260 1.00 50.89  ? 170  GLU A N   1 
ATOM   1206 C CA  . GLU A 1 156 ? 37.552  34.258 55.412 1.00 49.63  ? 170  GLU A CA  1 
ATOM   1207 C C   . GLU A 1 156 ? 37.826  32.757 55.460 1.00 51.42  ? 170  GLU A C   1 
ATOM   1208 O O   . GLU A 1 156 ? 37.711  32.063 54.446 1.00 50.11  ? 170  GLU A O   1 
ATOM   1209 C CB  . GLU A 1 156 ? 36.052  34.527 55.282 1.00 50.68  ? 170  GLU A CB  1 
ATOM   1210 C CG  . GLU A 1 156 ? 35.350  34.869 56.590 1.00 57.75  ? 170  GLU A CG  1 
ATOM   1211 C CD  . GLU A 1 156 ? 34.972  36.342 56.708 1.00 71.17  ? 170  GLU A CD  1 
ATOM   1212 O OE1 . GLU A 1 156 ? 34.953  37.063 55.683 1.00 49.59  ? 170  GLU A OE1 1 
ATOM   1213 O OE2 . GLU A 1 156 ? 34.626  36.763 57.830 1.00 66.82  ? 170  GLU A OE2 1 
ATOM   1214 N N   . ALA A 1 157 ? 38.287  32.283 56.613 1.00 46.89  ? 171  ALA A N   1 
ATOM   1215 C CA  . ALA A 1 157 ? 38.588  30.869 56.783 1.00 46.11  ? 171  ALA A CA  1 
ATOM   1216 C C   . ALA A 1 157 ? 37.397  30.024 56.344 1.00 49.85  ? 171  ALA A C   1 
ATOM   1217 O O   . ALA A 1 157 ? 36.247  30.440 56.493 1.00 48.80  ? 171  ALA A O   1 
ATOM   1218 C CB  . ALA A 1 157 ? 38.944  30.575 58.230 1.00 46.46  ? 171  ALA A CB  1 
ATOM   1219 N N   . GLU A 1 158 ? 37.679  28.828 55.831 1.00 46.81  ? 172  GLU A N   1 
ATOM   1220 C CA  . GLU A 1 158 ? 36.627  27.876 55.477 1.00 46.60  ? 172  GLU A CA  1 
ATOM   1221 C C   . GLU A 1 158 ? 35.566  27.629 56.553 1.00 49.19  ? 172  GLU A C   1 
ATOM   1222 O O   . GLU A 1 158 ? 34.376  27.596 56.253 1.00 48.17  ? 172  GLU A O   1 
ATOM   1223 C CB  . GLU A 1 158 ? 37.214  26.558 54.974 1.00 48.01  ? 172  GLU A CB  1 
ATOM   1224 C CG  . GLU A 1 158 ? 37.279  26.469 53.459 1.00 57.92  ? 172  GLU A CG  1 
ATOM   1225 C CD  . GLU A 1 158 ? 35.917  26.666 52.809 1.00 69.58  ? 172  GLU A CD  1 
ATOM   1226 O OE1 . GLU A 1 158 ? 34.927  26.079 53.303 1.00 37.92  ? 172  GLU A OE1 1 
ATOM   1227 O OE2 . GLU A 1 158 ? 35.841  27.401 51.799 1.00 64.52  ? 172  GLU A OE2 1 
ATOM   1228 N N   . GLU A 1 159 ? 35.988  27.471 57.802 1.00 45.72  ? 173  GLU A N   1 
ATOM   1229 C CA  . GLU A 1 159 ? 35.031  27.268 58.890 1.00 45.66  ? 173  GLU A CA  1 
ATOM   1230 C C   . GLU A 1 159 ? 34.045  28.427 58.969 1.00 48.55  ? 173  GLU A C   1 
ATOM   1231 O O   . GLU A 1 159 ? 32.905  28.252 59.402 1.00 48.32  ? 173  GLU A O   1 
ATOM   1232 C CB  . GLU A 1 159 ? 35.745  27.106 60.238 1.00 47.06  ? 173  GLU A CB  1 
ATOM   1233 C CG  . GLU A 1 159 ? 37.017  26.278 60.165 1.00 61.47  ? 173  GLU A CG  1 
ATOM   1234 C CD  . GLU A 1 159 ? 38.161  27.037 59.515 1.00 87.66  ? 173  GLU A CD  1 
ATOM   1235 O OE1 . GLU A 1 159 ? 38.259  28.264 59.734 1.00 90.08  ? 173  GLU A OE1 1 
ATOM   1236 O OE2 . GLU A 1 159 ? 38.964  26.404 58.796 1.00 79.39  ? 173  GLU A OE2 1 
ATOM   1237 N N   . ASN A 1 160 ? 34.507  29.614 58.584 1.00 44.18  ? 174  ASN A N   1 
ATOM   1238 C CA  . ASN A 1 160 ? 33.687  30.829 58.631 1.00 43.17  ? 174  ASN A CA  1 
ATOM   1239 C C   . ASN A 1 160 ? 32.680  30.869 57.485 1.00 42.97  ? 174  ASN A C   1 
ATOM   1240 O O   . ASN A 1 160 ? 31.532  31.264 57.668 1.00 41.61  ? 174  ASN A O   1 
ATOM   1241 C CB  . ASN A 1 160 ? 34.574  32.076 58.571 1.00 45.74  ? 174  ASN A CB  1 
ATOM   1242 C CG  . ASN A 1 160 ? 35.140  32.463 59.927 1.00 72.84  ? 174  ASN A CG  1 
ATOM   1243 O OD1 . ASN A 1 160 ? 34.616  32.068 60.975 1.00 64.46  ? 174  ASN A OD1 1 
ATOM   1244 N ND2 . ASN A 1 160 ? 36.191  33.277 59.913 1.00 66.69  ? 174  ASN A ND2 1 
ATOM   1245 N N   . LYS A 1 161 ? 33.132  30.466 56.302 1.00 37.74  ? 175  LYS A N   1 
ATOM   1246 C CA  . LYS A 1 161 ? 32.271  30.378 55.131 1.00 36.61  ? 175  LYS A CA  1 
ATOM   1247 C C   . LYS A 1 161 ? 31.188  29.329 55.334 1.00 41.02  ? 175  LYS A C   1 
ATOM   1248 O O   . LYS A 1 161 ? 30.040  29.514 54.925 1.00 41.12  ? 175  LYS A O   1 
ATOM   1249 C CB  . LYS A 1 161 ? 33.101  30.054 53.897 1.00 37.92  ? 175  LYS A CB  1 
ATOM   1250 C CG  . LYS A 1 161 ? 34.230  31.043 53.643 1.00 42.73  ? 175  LYS A CG  1 
ATOM   1251 C CD  . LYS A 1 161 ? 34.694  30.969 52.196 1.00 48.59  ? 175  LYS A CD  1 
ATOM   1252 C CE  . LYS A 1 161 ? 35.892  31.864 51.950 1.00 49.96  ? 175  LYS A CE  1 
ATOM   1253 N NZ  . LYS A 1 161 ? 36.403  31.702 50.569 1.00 51.46  ? 175  LYS A NZ  1 
ATOM   1254 N N   . GLN A 1 162 ? 31.545  28.254 56.025 1.00 37.46  ? 176  GLN A N   1 
ATOM   1255 C CA  . GLN A 1 162 ? 30.598  27.192 56.330 1.00 37.69  ? 176  GLN A CA  1 
ATOM   1256 C C   . GLN A 1 162 ? 29.442  27.680 57.190 1.00 41.06  ? 176  GLN A C   1 
ATOM   1257 O O   . GLN A 1 162 ? 28.309  27.228 57.037 1.00 41.51  ? 176  GLN A O   1 
ATOM   1258 C CB  . GLN A 1 162 ? 31.310  26.015 57.009 1.00 39.38  ? 176  GLN A CB  1 
ATOM   1259 C CG  . GLN A 1 162 ? 32.200  25.219 56.067 1.00 58.89  ? 176  GLN A CG  1 
ATOM   1260 C CD  . GLN A 1 162 ? 31.493  24.862 54.768 1.00 82.09  ? 176  GLN A CD  1 
ATOM   1261 O OE1 . GLN A 1 162 ? 30.349  24.407 54.773 1.00 74.65  ? 176  GLN A OE1 1 
ATOM   1262 N NE2 . GLN A 1 162 ? 32.163  25.099 53.647 1.00 80.25  ? 176  GLN A NE2 1 
ATOM   1263 N N   . ILE A 1 163 ? 29.733  28.585 58.115 1.00 36.36  ? 177  ILE A N   1 
ATOM   1264 C CA  . ILE A 1 163 ? 28.703  29.121 58.998 1.00 35.29  ? 177  ILE A CA  1 
ATOM   1265 C C   . ILE A 1 163 ? 27.857  30.160 58.264 1.00 37.80  ? 177  ILE A C   1 
ATOM   1266 O O   . ILE A 1 163 ? 26.650  30.260 58.485 1.00 37.25  ? 177  ILE A O   1 
ATOM   1267 C CB  . ILE A 1 163 ? 29.316  29.687 60.295 1.00 38.03  ? 177  ILE A CB  1 
ATOM   1268 C CG1 . ILE A 1 163 ? 30.072  28.585 61.041 1.00 39.08  ? 177  ILE A CG1 1 
ATOM   1269 C CG2 . ILE A 1 163 ? 28.232  30.263 61.182 1.00 37.91  ? 177  ILE A CG2 1 
ATOM   1270 C CD1 . ILE A 1 163 ? 31.138  29.097 62.005 1.00 47.37  ? 177  ILE A CD1 1 
ATOM   1271 N N   . ILE A 1 164 ? 28.507  30.941 57.402 1.00 32.74  ? 178  ILE A N   1 
ATOM   1272 C CA  . ILE A 1 164 ? 27.814  31.910 56.562 1.00 31.88  ? 178  ILE A CA  1 
ATOM   1273 C C   . ILE A 1 164 ? 26.871  31.164 55.616 1.00 36.09  ? 178  ILE A C   1 
ATOM   1274 O O   . ILE A 1 164 ? 25.695  31.510 55.492 1.00 36.58  ? 178  ILE A O   1 
ATOM   1275 C CB  . ILE A 1 164 ? 28.824  32.787 55.778 1.00 34.50  ? 178  ILE A CB  1 
ATOM   1276 C CG1 . ILE A 1 164 ? 29.664  33.638 56.738 1.00 34.53  ? 178  ILE A CG1 1 
ATOM   1277 C CG2 . ILE A 1 164 ? 28.108  33.670 54.753 1.00 34.27  ? 178  ILE A CG2 1 
ATOM   1278 C CD1 . ILE A 1 164 ? 30.875  34.260 56.082 1.00 36.63  ? 178  ILE A CD1 1 
ATOM   1279 N N   . ARG A 1 165 ? 27.387  30.112 54.990 1.00 31.72  ? 179  ARG A N   1 
ATOM   1280 C CA  . ARG A 1 165 ? 26.596  29.290 54.088 1.00 31.96  ? 179  ARG A CA  1 
ATOM   1281 C C   . ARG A 1 165 ? 25.298  28.805 54.721 1.00 36.48  ? 179  ARG A C   1 
ATOM   1282 O O   . ARG A 1 165 ? 24.218  28.985 54.159 1.00 35.25  ? 179  ARG A O   1 
ATOM   1283 C CB  . ARG A 1 165 ? 27.418  28.105 53.568 1.00 30.85  ? 179  ARG A CB  1 
ATOM   1284 C CG  . ARG A 1 165 ? 28.119  28.409 52.268 1.00 36.12  ? 179  ARG A CG  1 
ATOM   1285 C CD  . ARG A 1 165 ? 28.703  27.169 51.647 1.00 38.94  ? 179  ARG A CD  1 
ATOM   1286 N NE  . ARG A 1 165 ? 30.076  26.961 52.075 1.00 37.49  ? 179  ARG A NE  1 
ATOM   1287 C CZ  . ARG A 1 165 ? 31.139  27.316 51.369 1.00 47.86  ? 179  ARG A CZ  1 
ATOM   1288 N NH1 . ARG A 1 165 ? 30.992  27.896 50.186 1.00 42.80  ? 179  ARG A NH1 1 
ATOM   1289 N NH2 . ARG A 1 165 ? 32.352  27.094 51.850 1.00 29.63  ? 179  ARG A NH2 1 
ATOM   1290 N N   . LYS A 1 166 ? 25.422  28.224 55.909 1.00 34.20  ? 180  LYS A N   1 
ATOM   1291 C CA  . LYS A 1 166 ? 24.296  27.680 56.658 1.00 34.59  ? 180  LYS A CA  1 
ATOM   1292 C C   . LYS A 1 166 ? 23.224  28.730 56.919 1.00 39.96  ? 180  LYS A C   1 
ATOM   1293 O O   . LYS A 1 166 ? 22.057  28.521 56.623 1.00 40.54  ? 180  LYS A O   1 
ATOM   1294 C CB  . LYS A 1 166 ? 24.804  27.115 57.991 1.00 37.78  ? 180  LYS A CB  1 
ATOM   1295 C CG  . LYS A 1 166 ? 23.983  25.968 58.561 1.00 60.60  ? 180  LYS A CG  1 
ATOM   1296 C CD  . LYS A 1 166 ? 24.729  25.275 59.697 1.00 73.57  ? 180  LYS A CD  1 
ATOM   1297 C CE  . LYS A 1 166 ? 24.097  23.935 60.052 1.00 85.89  ? 180  LYS A CE  1 
ATOM   1298 N NZ  . LYS A 1 166 ? 24.192  22.956 58.933 1.00 94.01  ? 180  LYS A NZ  1 
ATOM   1299 N N   . HIS A 1 167 ? 23.622  29.860 57.486 1.00 37.91  ? 181  HIS A N   1 
ATOM   1300 C CA  . HIS A 1 167 ? 22.686  30.942 57.768 1.00 38.51  ? 181  HIS A CA  1 
ATOM   1301 C C   . HIS A 1 167 ? 22.050  31.556 56.512 1.00 40.45  ? 181  HIS A C   1 
ATOM   1302 O O   . HIS A 1 167 ? 20.829  31.711 56.445 1.00 40.01  ? 181  HIS A O   1 
ATOM   1303 C CB  . HIS A 1 167 ? 23.358  32.022 58.617 1.00 40.19  ? 181  HIS A CB  1 
ATOM   1304 C CG  . HIS A 1 167 ? 23.720  31.563 59.994 1.00 44.47  ? 181  HIS A CG  1 
ATOM   1305 N ND1 . HIS A 1 167 ? 24.949  31.019 60.299 1.00 46.82  ? 181  HIS A ND1 1 
ATOM   1306 C CD2 . HIS A 1 167 ? 23.001  31.534 61.141 1.00 46.99  ? 181  HIS A CD2 1 
ATOM   1307 C CE1 . HIS A 1 167 ? 24.978  30.690 61.579 1.00 46.48  ? 181  HIS A CE1 1 
ATOM   1308 N NE2 . HIS A 1 167 ? 23.807  30.991 62.112 1.00 46.82  ? 181  HIS A NE2 1 
ATOM   1309 N N   . ALA A 1 168 ? 22.877  31.905 55.526 1.00 34.33  ? 182  ALA A N   1 
ATOM   1310 C CA  . ALA A 1 168 ? 22.376  32.451 54.263 1.00 33.19  ? 182  ALA A CA  1 
ATOM   1311 C C   . ALA A 1 168 ? 21.291  31.578 53.612 1.00 35.33  ? 182  ALA A C   1 
ATOM   1312 O O   . ALA A 1 168 ? 20.253  32.082 53.179 1.00 33.27  ? 182  ALA A O   1 
ATOM   1313 C CB  . ALA A 1 168 ? 23.524  32.706 53.283 1.00 33.49  ? 182  ALA A CB  1 
ATOM   1314 N N   . GLN A 1 169 ? 21.530  30.271 53.552 1.00 32.40  ? 183  GLN A N   1 
ATOM   1315 C CA  . GLN A 1 169 ? 20.553  29.347 52.978 1.00 32.09  ? 183  GLN A CA  1 
ATOM   1316 C C   . GLN A 1 169 ? 19.225  29.317 53.741 1.00 35.80  ? 183  GLN A C   1 
ATOM   1317 O O   . GLN A 1 169 ? 18.163  29.151 53.148 1.00 35.14  ? 183  GLN A O   1 
ATOM   1318 C CB  . GLN A 1 169 ? 21.147  27.951 52.801 1.00 33.02  ? 183  GLN A CB  1 
ATOM   1319 C CG  . GLN A 1 169 ? 22.047  27.850 51.569 1.00 58.35  ? 183  GLN A CG  1 
ATOM   1320 C CD  . GLN A 1 169 ? 22.909  26.598 51.553 1.00 86.61  ? 183  GLN A CD  1 
ATOM   1321 O OE1 . GLN A 1 169 ? 24.037  26.613 51.055 1.00 82.70  ? 183  GLN A OE1 1 
ATOM   1322 N NE2 . GLN A 1 169 ? 22.377  25.506 52.088 1.00 82.82  ? 183  GLN A NE2 1 
ATOM   1323 N N   . THR A 1 170 ? 19.292  29.532 55.049 1.00 32.00  ? 184  THR A N   1 
ATOM   1324 C CA  . THR A 1 170 ? 18.098  29.711 55.864 1.00 31.18  ? 184  THR A CA  1 
ATOM   1325 C C   . THR A 1 170 ? 17.322  30.952 55.434 1.00 34.57  ? 184  THR A C   1 
ATOM   1326 O O   . THR A 1 170 ? 16.103  30.918 55.291 1.00 33.64  ? 184  THR A O   1 
ATOM   1327 C CB  . THR A 1 170 ? 18.469  29.763 57.349 1.00 38.67  ? 184  THR A CB  1 
ATOM   1328 O OG1 . THR A 1 170 ? 19.196  28.578 57.689 1.00 38.61  ? 184  THR A OG1 1 
ATOM   1329 C CG2 . THR A 1 170 ? 17.225  29.852 58.215 1.00 38.25  ? 184  THR A CG2 1 
ATOM   1330 N N   . PHE A 1 171 ? 18.041  32.043 55.196 1.00 32.18  ? 185  PHE A N   1 
ATOM   1331 C CA  . PHE A 1 171 ? 17.421  33.288 54.753 1.00 31.95  ? 185  PHE A CA  1 
ATOM   1332 C C   . PHE A 1 171 ? 16.816  33.140 53.361 1.00 33.00  ? 185  PHE A C   1 
ATOM   1333 O O   . PHE A 1 171 ? 15.759  33.699 53.080 1.00 33.20  ? 185  PHE A O   1 
ATOM   1334 C CB  . PHE A 1 171 ? 18.447  34.428 54.749 1.00 34.47  ? 185  PHE A CB  1 
ATOM   1335 C CG  . PHE A 1 171 ? 18.859  34.893 56.120 1.00 37.07  ? 185  PHE A CG  1 
ATOM   1336 C CD1 . PHE A 1 171 ? 20.192  34.839 56.515 1.00 40.95  ? 185  PHE A CD1 1 
ATOM   1337 C CD2 . PHE A 1 171 ? 17.936  35.467 56.981 1.00 40.87  ? 185  PHE A CD2 1 
ATOM   1338 C CE1 . PHE A 1 171 ? 20.595  35.299 57.770 1.00 42.16  ? 185  PHE A CE1 1 
ATOM   1339 C CE2 . PHE A 1 171 ? 18.329  35.943 58.243 1.00 44.27  ? 185  PHE A CE2 1 
ATOM   1340 C CZ  . PHE A 1 171 ? 19.662  35.848 58.637 1.00 42.04  ? 185  PHE A CZ  1 
ATOM   1341 N N   . VAL A 1 172 ? 17.534  32.454 52.474 1.00 26.96  ? 186  VAL A N   1 
ATOM   1342 C CA  . VAL A 1 172 ? 17.071  32.216 51.112 1.00 25.77  ? 186  VAL A CA  1 
ATOM   1343 C C   . VAL A 1 172 ? 15.749  31.465 51.104 1.00 29.29  ? 186  VAL A C   1 
ATOM   1344 O O   . VAL A 1 172 ? 14.815  31.847 50.398 1.00 29.04  ? 186  VAL A O   1 
ATOM   1345 C CB  . VAL A 1 172 ? 18.131  31.472 50.258 1.00 29.11  ? 186  VAL A CB  1 
ATOM   1346 C CG1 . VAL A 1 172 ? 17.499  30.928 48.980 1.00 29.21  ? 186  VAL A CG1 1 
ATOM   1347 C CG2 . VAL A 1 172 ? 19.287  32.395 49.917 1.00 28.35  ? 186  VAL A CG2 1 
ATOM   1348 N N   . ALA A 1 173 ? 15.691  30.379 51.867 1.00 25.46  ? 187  ALA A N   1 
ATOM   1349 C CA  . ALA A 1 173 ? 14.479  29.577 51.983 1.00 25.79  ? 187  ALA A CA  1 
ATOM   1350 C C   . ALA A 1 173 ? 13.354  30.392 52.605 1.00 30.36  ? 187  ALA A C   1 
ATOM   1351 O O   . ALA A 1 173 ? 12.211  30.327 52.165 1.00 29.94  ? 187  ALA A O   1 
ATOM   1352 C CB  . ALA A 1 173 ? 14.746  28.313 52.809 1.00 26.52  ? 187  ALA A CB  1 
ATOM   1353 N N   . LEU A 1 174 ? 13.699  31.206 53.594 1.00 28.47  ? 188  LEU A N   1 
ATOM   1354 C CA  . LEU A 1 174 ? 12.729  32.081 54.243 1.00 28.61  ? 188  LEU A CA  1 
ATOM   1355 C C   . LEU A 1 174 ? 12.113  33.039 53.231 1.00 32.22  ? 188  LEU A C   1 
ATOM   1356 O O   . LEU A 1 174 ? 10.902  33.237 53.225 1.00 32.14  ? 188  LEU A O   1 
ATOM   1357 C CB  . LEU A 1 174 ? 13.401  32.878 55.358 1.00 29.03  ? 188  LEU A CB  1 
ATOM   1358 C CG  . LEU A 1 174 ? 12.617  33.152 56.641 1.00 34.62  ? 188  LEU A CG  1 
ATOM   1359 C CD1 . LEU A 1 174 ? 13.200  34.360 57.351 1.00 34.79  ? 188  LEU A CD1 1 
ATOM   1360 C CD2 . LEU A 1 174 ? 11.126  33.331 56.385 1.00 37.83  ? 188  LEU A CD2 1 
ATOM   1361 N N   . CYS A 1 175 ? 12.949  33.637 52.385 1.00 28.56  ? 189  CYS A N   1 
ATOM   1362 C CA  . CYS A 1 175 ? 12.465  34.533 51.330 1.00 28.63  ? 189  CYS A CA  1 
ATOM   1363 C C   . CYS A 1 175 ? 11.523  33.855 50.340 1.00 28.18  ? 189  CYS A C   1 
ATOM   1364 O O   . CYS A 1 175 ? 10.569  34.466 49.863 1.00 26.35  ? 189  CYS A O   1 
ATOM   1365 C CB  . CYS A 1 175 ? 13.633  35.153 50.548 1.00 30.00  ? 189  CYS A CB  1 
ATOM   1366 S SG  . CYS A 1 175 ? 14.591  36.392 51.456 1.00 34.62  ? 189  CYS A SG  1 
ATOM   1367 N N   . ALA A 1 176 ? 11.862  32.637 49.941 1.00 23.80  ? 190  ALA A N   1 
ATOM   1368 C CA  . ALA A 1 176 ? 11.091  31.938 48.922 1.00 23.37  ? 190  ALA A CA  1 
ATOM   1369 C C   . ALA A 1 176 ? 9.639   31.710 49.346 1.00 28.70  ? 190  ALA A C   1 
ATOM   1370 O O   . ALA A 1 176 ? 8.760   31.570 48.506 1.00 28.01  ? 190  ALA A O   1 
ATOM   1371 C CB  . ALA A 1 176 ? 11.773  30.612 48.526 1.00 23.73  ? 190  ALA A CB  1 
ATOM   1372 N N   . THR A 1 177 ? 9.386   31.686 50.649 1.00 27.97  ? 191  THR A N   1 
ATOM   1373 C CA  . THR A 1 177 ? 8.017   31.531 51.143 1.00 28.83  ? 191  THR A CA  1 
ATOM   1374 C C   . THR A 1 177 ? 7.215   32.831 51.117 1.00 35.64  ? 191  THR A C   1 
ATOM   1375 O O   . THR A 1 177 ? 5.991   32.807 51.275 1.00 35.72  ? 191  THR A O   1 
ATOM   1376 C CB  . THR A 1 177 ? 7.974   30.882 52.541 1.00 33.08  ? 191  THR A CB  1 
ATOM   1377 O OG1 . THR A 1 177 ? 8.402   31.832 53.519 1.00 32.78  ? 191  THR A OG1 1 
ATOM   1378 C CG2 . THR A 1 177 ? 8.892   29.666 52.603 1.00 31.58  ? 191  THR A CG2 1 
ATOM   1379 N N   . ASP A 1 178 ? 7.897   33.952 50.880 1.00 33.28  ? 192  ASP A N   1 
ATOM   1380 C CA  . ASP A 1 178 ? 7.288   35.274 50.999 1.00 33.39  ? 192  ASP A CA  1 
ATOM   1381 C C   . ASP A 1 178 ? 7.201   36.027 49.668 1.00 40.04  ? 192  ASP A C   1 
ATOM   1382 O O   . ASP A 1 178 ? 7.995   35.793 48.756 1.00 39.46  ? 192  ASP A O   1 
ATOM   1383 C CB  . ASP A 1 178 ? 8.045   36.101 52.041 1.00 35.50  ? 192  ASP A CB  1 
ATOM   1384 C CG  . ASP A 1 178 ? 7.355   37.421 52.373 1.00 50.80  ? 192  ASP A CG  1 
ATOM   1385 O OD1 . ASP A 1 178 ? 6.137   37.556 52.140 1.00 53.76  ? 192  ASP A OD1 1 
ATOM   1386 O OD2 . ASP A 1 178 ? 8.026   38.320 52.911 1.00 57.76  ? 192  ASP A OD2 1 
ATOM   1387 N N   . VAL A 1 179 ? 6.216   36.918 49.568 1.00 39.90  ? 193  VAL A N   1 
ATOM   1388 C CA  . VAL A 1 179 ? 6.003   37.775 48.397 1.00 41.85  ? 193  VAL A CA  1 
ATOM   1389 C C   . VAL A 1 179 ? 7.214   38.479 47.775 1.00 49.61  ? 193  VAL A C   1 
ATOM   1390 O O   . VAL A 1 179 ? 7.218   38.725 46.575 1.00 51.17  ? 193  VAL A O   1 
ATOM   1391 C CB  . VAL A 1 179 ? 4.856   38.761 48.639 1.00 46.36  ? 193  VAL A CB  1 
ATOM   1392 C CG1 . VAL A 1 179 ? 3.552   38.220 48.052 1.00 45.91  ? 193  VAL A CG1 1 
ATOM   1393 C CG2 . VAL A 1 179 ? 4.698   39.002 50.137 1.00 46.29  ? 193  VAL A CG2 1 
ATOM   1394 N N   . LYS A 1 180 ? 8.221   38.820 48.580 1.00 47.30  ? 194  LYS A N   1 
ATOM   1395 C CA  . LYS A 1 180 ? 9.476   39.417 48.091 1.00 47.25  ? 194  LYS A CA  1 
ATOM   1396 C C   . LYS A 1 180 ? 10.203  38.562 47.050 1.00 52.91  ? 194  LYS A C   1 
ATOM   1397 O O   . LYS A 1 180 ? 10.818  39.081 46.120 1.00 53.47  ? 194  LYS A O   1 
ATOM   1398 C CB  . LYS A 1 180 ? 10.438  39.626 49.258 1.00 49.63  ? 194  LYS A CB  1 
ATOM   1399 C CG  . LYS A 1 180 ? 11.167  38.347 49.683 1.00 53.97  ? 194  LYS A CG  1 
ATOM   1400 C CD  . LYS A 1 180 ? 11.856  38.510 51.030 1.00 55.65  ? 194  LYS A CD  1 
ATOM   1401 C CE  . LYS A 1 180 ? 12.778  39.717 51.034 1.00 53.33  ? 194  LYS A CE  1 
ATOM   1402 N NZ  . LYS A 1 180 ? 13.623  39.761 49.812 1.00 52.65  ? 194  LYS A NZ  1 
ATOM   1403 N N   . PHE A 1 181 ? 10.238  37.257 47.273 1.00 50.41  ? 195  PHE A N   1 
ATOM   1404 C CA  . PHE A 1 181 ? 10.933  36.358 46.356 1.00 50.11  ? 195  PHE A CA  1 
ATOM   1405 C C   . PHE A 1 181 ? 10.533  36.640 44.913 1.00 52.56  ? 195  PHE A C   1 
ATOM   1406 O O   . PHE A 1 181 ? 11.262  36.293 43.981 1.00 53.19  ? 195  PHE A O   1 
ATOM   1407 C CB  . PHE A 1 181 ? 10.635  34.895 46.695 1.00 51.57  ? 195  PHE A CB  1 
ATOM   1408 C CG  . PHE A 1 181 ? 11.658  33.927 46.160 1.00 52.69  ? 195  PHE A CG  1 
ATOM   1409 C CD1 . PHE A 1 181 ? 12.978  33.985 46.591 1.00 55.29  ? 195  PHE A CD1 1 
ATOM   1410 C CD2 . PHE A 1 181 ? 11.294  32.935 45.257 1.00 54.26  ? 195  PHE A CD2 1 
ATOM   1411 C CE1 . PHE A 1 181 ? 13.917  33.078 46.129 1.00 56.11  ? 195  PHE A CE1 1 
ATOM   1412 C CE2 . PHE A 1 181 ? 12.229  32.028 44.781 1.00 56.81  ? 195  PHE A CE2 1 
ATOM   1413 C CZ  . PHE A 1 181 ? 13.542  32.101 45.214 1.00 55.08  ? 195  PHE A CZ  1 
ATOM   1414 N N   . ILE A 1 182 ? 9.382   37.285 44.734 1.00 45.62  ? 196  ILE A N   1 
ATOM   1415 C CA  . ILE A 1 182 ? 8.868   37.516 43.394 1.00 43.99  ? 196  ILE A CA  1 
ATOM   1416 C C   . ILE A 1 182 ? 9.558   38.681 42.699 1.00 47.58  ? 196  ILE A C   1 
ATOM   1417 O O   . ILE A 1 182 ? 10.071  38.533 41.598 1.00 47.02  ? 196  ILE A O   1 
ATOM   1418 C CB  . ILE A 1 182 ? 7.337   37.642 43.371 1.00 46.02  ? 196  ILE A CB  1 
ATOM   1419 C CG1 . ILE A 1 182 ? 6.716   36.729 44.432 1.00 45.44  ? 196  ILE A CG1 1 
ATOM   1420 C CG2 . ILE A 1 182 ? 6.811   37.316 41.985 1.00 46.03  ? 196  ILE A CG2 1 
ATOM   1421 C CD1 . ILE A 1 182 ? 5.212   36.709 44.425 1.00 45.26  ? 196  ILE A CD1 1 
ATOM   1422 N N   . SER A 1 183 ? 9.584   39.833 43.357 1.00 44.88  ? 197  SER A N   1 
ATOM   1423 C CA  . SER A 1 183 ? 10.213  41.026 42.789 1.00 44.87  ? 197  SER A CA  1 
ATOM   1424 C C   . SER A 1 183 ? 11.749  40.958 42.791 1.00 47.26  ? 197  SER A C   1 
ATOM   1425 O O   . SER A 1 183 ? 12.389  41.378 41.827 1.00 47.77  ? 197  SER A O   1 
ATOM   1426 C CB  . SER A 1 183 ? 9.735   42.280 43.524 1.00 48.11  ? 197  SER A CB  1 
ATOM   1427 O OG  . SER A 1 183 ? 9.599   42.025 44.912 1.00 54.72  ? 197  SER A OG  1 
ATOM   1428 N N   . ASN A 1 184 ? 12.331  40.394 43.849 1.00 40.16  ? 198  ASN A N   1 
ATOM   1429 C CA  . ASN A 1 184 ? 13.785  40.308 43.962 1.00 37.93  ? 198  ASN A CA  1 
ATOM   1430 C C   . ASN A 1 184 ? 14.403  39.133 43.205 1.00 37.26  ? 198  ASN A C   1 
ATOM   1431 O O   . ASN A 1 184 ? 14.024  37.977 43.403 1.00 36.93  ? 198  ASN A O   1 
ATOM   1432 C CB  . ASN A 1 184 ? 14.213  40.276 45.429 1.00 37.93  ? 198  ASN A CB  1 
ATOM   1433 C CG  . ASN A 1 184 ? 14.017  41.606 46.122 1.00 57.40  ? 198  ASN A CG  1 
ATOM   1434 O OD1 . ASN A 1 184 ? 14.703  42.581 45.822 1.00 60.00  ? 198  ASN A OD1 1 
ATOM   1435 N ND2 . ASN A 1 184 ? 13.091  41.650 47.067 1.00 43.84  ? 198  ASN A ND2 1 
ATOM   1436 N N   . PRO A 1 185 ? 15.436  39.411 42.393 1.00 30.75  ? 199  PRO A N   1 
ATOM   1437 C CA  . PRO A 1 185 ? 16.145  38.378 41.625 1.00 30.07  ? 199  PRO A CA  1 
ATOM   1438 C C   . PRO A 1 185 ? 17.045  37.543 42.535 1.00 33.19  ? 199  PRO A C   1 
ATOM   1439 O O   . PRO A 1 185 ? 17.584  38.052 43.509 1.00 33.75  ? 199  PRO A O   1 
ATOM   1440 C CB  . PRO A 1 185 ? 17.007  39.194 40.646 1.00 31.25  ? 199  PRO A CB  1 
ATOM   1441 C CG  . PRO A 1 185 ? 16.559  40.616 40.788 1.00 35.11  ? 199  PRO A CG  1 
ATOM   1442 C CD  . PRO A 1 185 ? 16.002  40.744 42.156 1.00 30.87  ? 199  PRO A CD  1 
ATOM   1443 N N   . PRO A 1 186 ? 17.242  36.259 42.204 1.00 28.73  ? 200  PRO A N   1 
ATOM   1444 C CA  . PRO A 1 186 ? 18.051  35.366 43.049 1.00 28.28  ? 200  PRO A CA  1 
ATOM   1445 C C   . PRO A 1 186 ? 19.404  35.981 43.449 1.00 31.66  ? 200  PRO A C   1 
ATOM   1446 O O   . PRO A 1 186 ? 19.896  35.755 44.552 1.00 31.47  ? 200  PRO A O   1 
ATOM   1447 C CB  . PRO A 1 186 ? 18.271  34.136 42.154 1.00 29.69  ? 200  PRO A CB  1 
ATOM   1448 C CG  . PRO A 1 186 ? 17.129  34.159 41.181 1.00 34.35  ? 200  PRO A CG  1 
ATOM   1449 C CD  . PRO A 1 186 ? 16.817  35.612 40.946 1.00 29.92  ? 200  PRO A CD  1 
ATOM   1450 N N   . SER A 1 187 ? 19.973  36.788 42.560 1.00 27.60  ? 201  SER A N   1 
ATOM   1451 C CA  . SER A 1 187 ? 21.279  37.392 42.788 1.00 27.57  ? 201  SER A CA  1 
ATOM   1452 C C   . SER A 1 187 ? 21.213  38.372 43.939 1.00 32.35  ? 201  SER A C   1 
ATOM   1453 O O   . SER A 1 187 ? 22.141  38.473 44.743 1.00 32.52  ? 201  SER A O   1 
ATOM   1454 C CB  . SER A 1 187 ? 21.765  38.108 41.527 1.00 30.41  ? 201  SER A CB  1 
ATOM   1455 O OG  . SER A 1 187 ? 20.984  39.254 41.246 1.00 36.35  ? 201  SER A OG  1 
ATOM   1456 N N   . MET A 1 188 ? 20.086  39.068 44.027 1.00 29.02  ? 202  MET A N   1 
ATOM   1457 C CA  . MET A 1 188 ? 19.829  40.006 45.107 1.00 29.32  ? 202  MET A CA  1 
ATOM   1458 C C   . MET A 1 188 ? 19.342  39.346 46.403 1.00 29.11  ? 202  MET A C   1 
ATOM   1459 O O   . MET A 1 188 ? 19.701  39.783 47.493 1.00 27.09  ? 202  MET A O   1 
ATOM   1460 C CB  . MET A 1 188 ? 18.841  41.063 44.633 1.00 33.17  ? 202  MET A CB  1 
ATOM   1461 C CG  . MET A 1 188 ? 18.178  41.840 45.731 1.00 39.31  ? 202  MET A CG  1 
ATOM   1462 S SD  . MET A 1 188 ? 18.138  43.561 45.264 1.00 46.37  ? 202  MET A SD  1 
ATOM   1463 C CE  . MET A 1 188 ? 18.062  43.413 43.457 1.00 42.78  ? 202  MET A CE  1 
ATOM   1464 N N   . VAL A 1 189 ? 18.474  38.339 46.288 1.00 24.25  ? 203  VAL A N   1 
ATOM   1465 C CA  . VAL A 1 189 ? 18.061  37.569 47.458 1.00 23.01  ? 203  VAL A CA  1 
ATOM   1466 C C   . VAL A 1 189 ? 19.304  36.939 48.100 1.00 25.47  ? 203  VAL A C   1 
ATOM   1467 O O   . VAL A 1 189 ? 19.449  36.932 49.327 1.00 23.96  ? 203  VAL A O   1 
ATOM   1468 C CB  . VAL A 1 189 ? 16.968  36.498 47.108 1.00 25.51  ? 203  VAL A CB  1 
ATOM   1469 C CG1 . VAL A 1 189 ? 16.878  35.438 48.201 1.00 24.54  ? 203  VAL A CG1 1 
ATOM   1470 C CG2 . VAL A 1 189 ? 15.609  37.162 46.883 1.00 24.71  ? 203  VAL A CG2 1 
ATOM   1471 N N   . ALA A 1 190 ? 20.200  36.427 47.258 1.00 21.72  ? 204  ALA A N   1 
ATOM   1472 C CA  . ALA A 1 190 ? 21.460  35.847 47.722 1.00 21.62  ? 204  ALA A CA  1 
ATOM   1473 C C   . ALA A 1 190 ? 22.368  36.874 48.406 1.00 28.73  ? 204  ALA A C   1 
ATOM   1474 O O   . ALA A 1 190 ? 22.938  36.599 49.463 1.00 29.03  ? 204  ALA A O   1 
ATOM   1475 C CB  . ALA A 1 190 ? 22.186  35.188 46.567 1.00 22.01  ? 204  ALA A CB  1 
ATOM   1476 N N   . ALA A 1 191 ? 22.488  38.053 47.798 1.00 26.55  ? 205  ALA A N   1 
ATOM   1477 C CA  . ALA A 1 191 ? 23.320  39.136 48.326 1.00 27.22  ? 205  ALA A CA  1 
ATOM   1478 C C   . ALA A 1 191 ? 22.842  39.607 49.695 1.00 32.26  ? 205  ALA A C   1 
ATOM   1479 O O   . ALA A 1 191 ? 23.627  39.714 50.646 1.00 33.49  ? 205  ALA A O   1 
ATOM   1480 C CB  . ALA A 1 191 ? 23.344  40.317 47.334 1.00 27.94  ? 205  ALA A CB  1 
ATOM   1481 N N   . GLY A 1 192 ? 21.550  39.897 49.793 1.00 27.48  ? 206  GLY A N   1 
ATOM   1482 C CA  . GLY A 1 192 ? 20.935  40.281 51.051 1.00 26.57  ? 206  GLY A CA  1 
ATOM   1483 C C   . GLY A 1 192 ? 21.109  39.248 52.146 1.00 29.88  ? 206  GLY A C   1 
ATOM   1484 O O   . GLY A 1 192 ? 21.325  39.596 53.307 1.00 31.02  ? 206  GLY A O   1 
ATOM   1485 N N   . SER A 1 193 ? 20.955  37.976 51.795 1.00 24.94  ? 207  SER A N   1 
ATOM   1486 C CA  . SER A 1 193 ? 21.097  36.897 52.767 1.00 24.55  ? 207  SER A CA  1 
ATOM   1487 C C   . SER A 1 193 ? 22.522  36.803 53.291 1.00 29.90  ? 207  SER A C   1 
ATOM   1488 O O   . SER A 1 193 ? 22.736  36.524 54.473 1.00 30.19  ? 207  SER A O   1 
ATOM   1489 C CB  . SER A 1 193 ? 20.679  35.557 52.155 1.00 26.51  ? 207  SER A CB  1 
ATOM   1490 O OG  . SER A 1 193 ? 19.322  35.599 51.754 1.00 32.12  ? 207  SER A OG  1 
ATOM   1491 N N   . VAL A 1 194 ? 23.496  36.978 52.401 1.00 25.68  ? 208  VAL A N   1 
ATOM   1492 C CA  . VAL A 1 194 ? 24.893  36.962 52.805 1.00 25.64  ? 208  VAL A CA  1 
ATOM   1493 C C   . VAL A 1 194 ? 25.201  38.142 53.725 1.00 31.61  ? 208  VAL A C   1 
ATOM   1494 O O   . VAL A 1 194 ? 25.776  37.972 54.803 1.00 31.40  ? 208  VAL A O   1 
ATOM   1495 C CB  . VAL A 1 194 ? 25.830  36.921 51.598 1.00 29.01  ? 208  VAL A CB  1 
ATOM   1496 C CG1 . VAL A 1 194 ? 27.271  37.134 52.031 1.00 28.15  ? 208  VAL A CG1 1 
ATOM   1497 C CG2 . VAL A 1 194 ? 25.663  35.606 50.852 1.00 28.96  ? 208  VAL A CG2 1 
ATOM   1498 N N   . VAL A 1 195 ? 24.757  39.330 53.333 1.00 28.84  ? 209  VAL A N   1 
ATOM   1499 C CA  . VAL A 1 195 ? 24.936  40.501 54.185 1.00 28.55  ? 209  VAL A CA  1 
ATOM   1500 C C   . VAL A 1 195 ? 24.284  40.346 55.554 1.00 32.04  ? 209  VAL A C   1 
ATOM   1501 O O   . VAL A 1 195 ? 24.835  40.796 56.555 1.00 32.06  ? 209  VAL A O   1 
ATOM   1502 C CB  . VAL A 1 195 ? 24.495  41.796 53.492 1.00 32.55  ? 209  VAL A CB  1 
ATOM   1503 C CG1 . VAL A 1 195 ? 24.711  42.993 54.415 1.00 32.52  ? 209  VAL A CG1 1 
ATOM   1504 C CG2 . VAL A 1 195 ? 25.245  41.978 52.195 1.00 32.36  ? 209  VAL A CG2 1 
ATOM   1505 N N   . ALA A 1 196 ? 23.082  39.778 55.600 1.00 28.40  ? 210  ALA A N   1 
ATOM   1506 C CA  . ALA A 1 196 ? 22.416  39.565 56.883 1.00 28.28  ? 210  ALA A CA  1 
ATOM   1507 C C   . ALA A 1 196 ? 23.195  38.550 57.715 1.00 34.03  ? 210  ALA A C   1 
ATOM   1508 O O   . ALA A 1 196 ? 23.333  38.695 58.925 1.00 34.02  ? 210  ALA A O   1 
ATOM   1509 C CB  . ALA A 1 196 ? 21.001  39.101 56.678 1.00 28.90  ? 210  ALA A CB  1 
ATOM   1510 N N   . ALA A 1 197 ? 23.742  37.541 57.051 1.00 31.43  ? 211  ALA A N   1 
ATOM   1511 C CA  . ALA A 1 197 ? 24.535  36.535 57.734 1.00 31.56  ? 211  ALA A CA  1 
ATOM   1512 C C   . ALA A 1 197 ? 25.858  37.103 58.256 1.00 36.25  ? 211  ALA A C   1 
ATOM   1513 O O   . ALA A 1 197 ? 26.097  37.133 59.459 1.00 35.77  ? 211  ALA A O   1 
ATOM   1514 C CB  . ALA A 1 197 ? 24.774  35.334 56.822 1.00 32.16  ? 211  ALA A CB  1 
ATOM   1515 N N   . VAL A 1 198 ? 26.706  37.571 57.348 1.00 33.54  ? 212  VAL A N   1 
ATOM   1516 C CA  . VAL A 1 198 ? 28.024  38.064 57.721 1.00 33.76  ? 212  VAL A CA  1 
ATOM   1517 C C   . VAL A 1 198 ? 27.920  39.143 58.794 1.00 40.47  ? 212  VAL A C   1 
ATOM   1518 O O   . VAL A 1 198 ? 28.678  39.157 59.763 1.00 41.80  ? 212  VAL A O   1 
ATOM   1519 C CB  . VAL A 1 198 ? 28.797  38.567 56.490 1.00 37.11  ? 212  VAL A CB  1 
ATOM   1520 C CG1 . VAL A 1 198 ? 30.182  39.095 56.899 1.00 36.85  ? 212  VAL A CG1 1 
ATOM   1521 C CG2 . VAL A 1 198 ? 28.912  37.464 55.459 1.00 36.58  ? 212  VAL A CG2 1 
ATOM   1522 N N   . GLN A 1 199 ? 26.949  40.027 58.626 1.00 36.91  ? 213  GLN A N   1 
ATOM   1523 C CA  . GLN A 1 199 ? 26.731  41.134 59.542 1.00 36.87  ? 213  GLN A CA  1 
ATOM   1524 C C   . GLN A 1 199 ? 26.371  40.663 60.961 1.00 42.98  ? 213  GLN A C   1 
ATOM   1525 O O   . GLN A 1 199 ? 26.894  41.189 61.948 1.00 43.23  ? 213  GLN A O   1 
ATOM   1526 C CB  . GLN A 1 199 ? 25.652  42.058 58.967 1.00 37.85  ? 213  GLN A CB  1 
ATOM   1527 C CG  . GLN A 1 199 ? 25.331  43.275 59.802 1.00 56.24  ? 213  GLN A CG  1 
ATOM   1528 C CD  . GLN A 1 199 ? 24.453  44.267 59.060 1.00 70.91  ? 213  GLN A CD  1 
ATOM   1529 O OE1 . GLN A 1 199 ? 24.823  44.766 57.994 1.00 63.10  ? 213  GLN A OE1 1 
ATOM   1530 N NE2 . GLN A 1 199 ? 23.286  44.565 59.626 1.00 61.99  ? 213  GLN A NE2 1 
ATOM   1531 N N   . GLY A 1 200 ? 25.502  39.660 61.064 1.00 39.64  ? 214  GLY A N   1 
ATOM   1532 C CA  . GLY A 1 200 ? 25.101  39.123 62.353 1.00 39.05  ? 214  GLY A CA  1 
ATOM   1533 C C   . GLY A 1 200 ? 26.222  38.361 63.033 1.00 42.96  ? 214  GLY A C   1 
ATOM   1534 O O   . GLY A 1 200 ? 26.470  38.524 64.223 1.00 42.63  ? 214  GLY A O   1 
ATOM   1535 N N   . LEU A 1 201 ? 26.891  37.508 62.269 1.00 40.25  ? 215  LEU A N   1 
ATOM   1536 C CA  . LEU A 1 201 ? 28.041  36.763 62.761 1.00 40.21  ? 215  LEU A CA  1 
ATOM   1537 C C   . LEU A 1 201 ? 29.141  37.666 63.322 1.00 46.16  ? 215  LEU A C   1 
ATOM   1538 O O   . LEU A 1 201 ? 29.649  37.417 64.414 1.00 46.22  ? 215  LEU A O   1 
ATOM   1539 C CB  . LEU A 1 201 ? 28.594  35.842 61.670 1.00 39.86  ? 215  LEU A CB  1 
ATOM   1540 C CG  . LEU A 1 201 ? 27.658  34.688 61.307 1.00 44.16  ? 215  LEU A CG  1 
ATOM   1541 C CD1 . LEU A 1 201 ? 28.087  33.997 60.018 1.00 44.03  ? 215  LEU A CD1 1 
ATOM   1542 C CD2 . LEU A 1 201 ? 27.528  33.685 62.461 1.00 44.30  ? 215  LEU A CD2 1 
ATOM   1543 N N   . ASN A 1 202 ? 29.502  38.717 62.589 1.00 43.33  ? 216  ASN A N   1 
ATOM   1544 C CA  . ASN A 1 202 ? 30.539  39.630 63.065 1.00 43.38  ? 216  ASN A CA  1 
ATOM   1545 C C   . ASN A 1 202 ? 30.108  40.430 64.296 1.00 48.55  ? 216  ASN A C   1 
ATOM   1546 O O   . ASN A 1 202 ? 30.944  40.850 65.096 1.00 47.34  ? 216  ASN A O   1 
ATOM   1547 C CB  . ASN A 1 202 ? 31.004  40.578 61.962 1.00 42.88  ? 216  ASN A CB  1 
ATOM   1548 C CG  . ASN A 1 202 ? 31.838  41.731 62.505 1.00 57.63  ? 216  ASN A CG  1 
ATOM   1549 O OD1 . ASN A 1 202 ? 31.312  42.807 62.803 1.00 48.33  ? 216  ASN A OD1 1 
ATOM   1550 N ND2 . ASN A 1 202 ? 33.130  41.487 62.699 1.00 48.18  ? 216  ASN A ND2 1 
ATOM   1551 N N   . LEU A 1 203 ? 28.805  40.667 64.422 1.00 46.80  ? 217  LEU A N   1 
ATOM   1552 C CA  . LEU A 1 203 ? 28.249  41.359 65.585 1.00 47.05  ? 217  LEU A CA  1 
ATOM   1553 C C   . LEU A 1 203 ? 28.471  40.530 66.853 1.00 52.50  ? 217  LEU A C   1 
ATOM   1554 O O   . LEU A 1 203 ? 28.823  41.065 67.907 1.00 52.54  ? 217  LEU A O   1 
ATOM   1555 C CB  . LEU A 1 203 ? 26.753  41.604 65.377 1.00 46.96  ? 217  LEU A CB  1 
ATOM   1556 C CG  . LEU A 1 203 ? 26.094  42.804 66.059 1.00 51.80  ? 217  LEU A CG  1 
ATOM   1557 C CD1 . LEU A 1 203 ? 26.780  44.107 65.662 1.00 52.02  ? 217  LEU A CD1 1 
ATOM   1558 C CD2 . LEU A 1 203 ? 24.615  42.855 65.701 1.00 54.01  ? 217  LEU A CD2 1 
ATOM   1559 N N   . ARG A 1 204 ? 28.298  39.217 66.731 1.00 49.50  ? 218  ARG A N   1 
ATOM   1560 C CA  . ARG A 1 204 ? 28.496  38.304 67.853 1.00 49.55  ? 218  ARG A CA  1 
ATOM   1561 C C   . ARG A 1 204 ? 29.971  37.971 68.020 1.00 53.32  ? 218  ARG A C   1 
ATOM   1562 O O   . ARG A 1 204 ? 30.415  37.592 69.099 1.00 53.14  ? 218  ARG A O   1 
ATOM   1563 C CB  . ARG A 1 204 ? 27.717  37.006 67.628 1.00 51.17  ? 218  ARG A CB  1 
ATOM   1564 C CG  . ARG A 1 204 ? 26.211  37.164 67.610 1.00 63.93  ? 218  ARG A CG  1 
ATOM   1565 C CD  . ARG A 1 204 ? 25.542  35.817 67.432 1.00 81.04  ? 218  ARG A CD  1 
ATOM   1566 N NE  . ARG A 1 204 ? 24.087  35.920 67.445 1.00 97.61  ? 218  ARG A NE  1 
ATOM   1567 C CZ  . ARG A 1 204 ? 23.343  35.842 68.543 1.00 114.85 ? 218  ARG A CZ  1 
ATOM   1568 N NH1 . ARG A 1 204 ? 23.919  35.668 69.727 1.00 102.20 ? 218  ARG A NH1 1 
ATOM   1569 N NH2 . ARG A 1 204 ? 22.022  35.941 68.458 1.00 103.06 ? 218  ARG A NH2 1 
ATOM   1570 N N   . SER A 1 205 ? 30.720  38.086 66.931 1.00 49.83  ? 219  SER A N   1 
ATOM   1571 C CA  . SER A 1 205 ? 32.137  37.752 66.941 1.00 49.36  ? 219  SER A CA  1 
ATOM   1572 C C   . SER A 1 205 ? 32.964  38.810 66.220 1.00 53.84  ? 219  SER A C   1 
ATOM   1573 O O   . SER A 1 205 ? 33.476  38.570 65.129 1.00 52.81  ? 219  SER A O   1 
ATOM   1574 C CB  . SER A 1 205 ? 32.363  36.377 66.305 1.00 51.58  ? 219  SER A CB  1 
ATOM   1575 O OG  . SER A 1 205 ? 33.742  36.136 66.099 1.00 57.81  ? 219  SER A OG  1 
ATOM   1576 N N   . PRO A 1 206 ? 33.118  39.994 66.837 1.00 52.14  ? 220  PRO A N   1 
ATOM   1577 C CA  . PRO A 1 206 ? 33.928  41.051 66.215 1.00 52.59  ? 220  PRO A CA  1 
ATOM   1578 C C   . PRO A 1 206 ? 35.326  40.527 65.914 1.00 58.53  ? 220  PRO A C   1 
ATOM   1579 O O   . PRO A 1 206 ? 35.772  39.544 66.513 1.00 58.51  ? 220  PRO A O   1 
ATOM   1580 C CB  . PRO A 1 206 ? 33.995  42.137 67.301 1.00 54.11  ? 220  PRO A CB  1 
ATOM   1581 C CG  . PRO A 1 206 ? 33.022  41.716 68.373 1.00 58.11  ? 220  PRO A CG  1 
ATOM   1582 C CD  . PRO A 1 206 ? 32.923  40.233 68.276 1.00 53.55  ? 220  PRO A CD  1 
ATOM   1583 N N   . ASN A 1 207 ? 36.012  41.164 64.972 1.00 55.98  ? 221  ASN A N   1 
ATOM   1584 C CA  . ASN A 1 207 ? 37.372  40.751 64.634 1.00 56.59  ? 221  ASN A CA  1 
ATOM   1585 C C   . ASN A 1 207 ? 37.438  39.393 63.940 1.00 60.94  ? 221  ASN A C   1 
ATOM   1586 O O   . ASN A 1 207 ? 38.517  38.822 63.798 1.00 60.26  ? 221  ASN A O   1 
ATOM   1587 C CB  . ASN A 1 207 ? 38.260  40.719 65.887 1.00 58.82  ? 221  ASN A CB  1 
ATOM   1588 C CG  . ASN A 1 207 ? 38.746  42.097 66.298 1.00 84.42  ? 221  ASN A CG  1 
ATOM   1589 O OD1 . ASN A 1 207 ? 39.203  42.884 65.464 1.00 80.90  ? 221  ASN A OD1 1 
ATOM   1590 N ND2 . ASN A 1 207 ? 38.664  42.390 67.591 1.00 74.81  ? 221  ASN A ND2 1 
ATOM   1591 N N   . ASN A 1 208 ? 36.291  38.868 63.520 1.00 58.51  ? 222  ASN A N   1 
ATOM   1592 C CA  . ASN A 1 208 ? 36.268  37.554 62.881 1.00 58.29  ? 222  ASN A CA  1 
ATOM   1593 C C   . ASN A 1 208 ? 35.643  37.544 61.492 1.00 60.35  ? 222  ASN A C   1 
ATOM   1594 O O   . ASN A 1 208 ? 36.199  36.954 60.564 1.00 60.99  ? 222  ASN A O   1 
ATOM   1595 C CB  . ASN A 1 208 ? 35.603  36.508 63.778 1.00 60.46  ? 222  ASN A CB  1 
ATOM   1596 C CG  . ASN A 1 208 ? 35.922  35.091 63.348 1.00 88.09  ? 222  ASN A CG  1 
ATOM   1597 O OD1 . ASN A 1 208 ? 36.451  34.868 62.259 1.00 83.53  ? 222  ASN A OD1 1 
ATOM   1598 N ND2 . ASN A 1 208 ? 35.623  34.125 64.212 1.00 81.59  ? 222  ASN A ND2 1 
ATOM   1599 N N   . PHE A 1 209 ? 34.484  38.176 61.351 1.00 54.35  ? 223  PHE A N   1 
ATOM   1600 C CA  . PHE A 1 209 ? 33.775  38.168 60.072 1.00 52.93  ? 223  PHE A CA  1 
ATOM   1601 C C   . PHE A 1 209 ? 33.813  39.549 59.433 1.00 55.26  ? 223  PHE A C   1 
ATOM   1602 O O   . PHE A 1 209 ? 32.790  40.231 59.347 1.00 54.13  ? 223  PHE A O   1 
ATOM   1603 C CB  . PHE A 1 209 ? 32.328  37.713 60.264 1.00 54.22  ? 223  PHE A CB  1 
ATOM   1604 C CG  . PHE A 1 209 ? 32.196  36.308 60.781 1.00 55.27  ? 223  PHE A CG  1 
ATOM   1605 C CD1 . PHE A 1 209 ? 32.072  36.064 62.139 1.00 57.86  ? 223  PHE A CD1 1 
ATOM   1606 C CD2 . PHE A 1 209 ? 32.173  35.231 59.907 1.00 56.97  ? 223  PHE A CD2 1 
ATOM   1607 C CE1 . PHE A 1 209 ? 31.935  34.772 62.615 1.00 58.40  ? 223  PHE A CE1 1 
ATOM   1608 C CE2 . PHE A 1 209 ? 32.036  33.938 60.377 1.00 59.39  ? 223  PHE A CE2 1 
ATOM   1609 C CZ  . PHE A 1 209 ? 31.919  33.709 61.734 1.00 57.41  ? 223  PHE A CZ  1 
ATOM   1610 N N   . LEU A 1 210 ? 34.992  39.942 58.955 1.00 51.16  ? 224  LEU A N   1 
ATOM   1611 C CA  . LEU A 1 210 ? 35.244  41.340 58.626 1.00 50.41  ? 224  LEU A CA  1 
ATOM   1612 C C   . LEU A 1 210 ? 35.089  41.717 57.171 1.00 51.34  ? 224  LEU A C   1 
ATOM   1613 O O   . LEU A 1 210 ? 35.264  42.880 56.809 1.00 51.58  ? 224  LEU A O   1 
ATOM   1614 C CB  . LEU A 1 210 ? 36.576  41.821 59.195 1.00 50.92  ? 224  LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 210 ? 37.662  40.762 59.365 1.00 56.30  ? 224  LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 210 ? 38.629  40.757 58.181 1.00 56.87  ? 224  LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 210 ? 38.387  40.943 60.693 1.00 58.55  ? 224  LEU A CD2 1 
ATOM   1618 N N   . SER A 1 211 ? 34.695  40.751 56.349 1.00 45.09  ? 225  SER A N   1 
ATOM   1619 C CA  . SER A 1 211 ? 34.209  41.062 55.009 1.00 43.42  ? 225  SER A CA  1 
ATOM   1620 C C   . SER A 1 211 ? 32.848  41.740 55.152 1.00 43.53  ? 225  SER A C   1 
ATOM   1621 O O   . SER A 1 211 ? 32.233  42.141 54.166 1.00 41.88  ? 225  SER A O   1 
ATOM   1622 C CB  . SER A 1 211 ? 34.089  39.784 54.172 1.00 47.31  ? 225  SER A CB  1 
ATOM   1623 O OG  . SER A 1 211 ? 35.306  39.052 54.175 1.00 57.26  ? 225  SER A OG  1 
ATOM   1624 N N   . TYR A 1 212 ? 32.400  41.872 56.399 1.00 39.44  ? 226  TYR A N   1 
ATOM   1625 C CA  . TYR A 1 212 ? 31.132  42.516 56.727 1.00 39.38  ? 226  TYR A CA  1 
ATOM   1626 C C   . TYR A 1 212 ? 31.113  44.004 56.399 1.00 43.41  ? 226  TYR A C   1 
ATOM   1627 O O   . TYR A 1 212 ? 30.053  44.568 56.123 1.00 42.75  ? 226  TYR A O   1 
ATOM   1628 C CB  . TYR A 1 212 ? 30.831  42.356 58.211 1.00 40.91  ? 226  TYR A CB  1 
ATOM   1629 C CG  . TYR A 1 212 ? 31.456  43.437 59.066 1.00 43.21  ? 226  TYR A CG  1 
ATOM   1630 C CD1 . TYR A 1 212 ? 32.731  43.284 59.605 1.00 45.17  ? 226  TYR A CD1 1 
ATOM   1631 C CD2 . TYR A 1 212 ? 30.773  44.620 59.331 1.00 43.96  ? 226  TYR A CD2 1 
ATOM   1632 C CE1 . TYR A 1 212 ? 33.296  44.274 60.394 1.00 45.14  ? 226  TYR A CE1 1 
ATOM   1633 C CE2 . TYR A 1 212 ? 31.336  45.615 60.110 1.00 44.51  ? 226  TYR A CE2 1 
ATOM   1634 C CZ  . TYR A 1 212 ? 32.594  45.438 60.635 1.00 52.24  ? 226  TYR A CZ  1 
ATOM   1635 O OH  . TYR A 1 212 ? 33.144  46.434 61.409 1.00 57.65  ? 226  TYR A OH  1 
ATOM   1636 N N   . TYR A 1 213 ? 32.271  44.652 56.489 1.00 39.93  ? 227  TYR A N   1 
ATOM   1637 C CA  . TYR A 1 213 ? 32.331  46.104 56.367 1.00 39.31  ? 227  TYR A CA  1 
ATOM   1638 C C   . TYR A 1 213 ? 31.952  46.626 54.979 1.00 41.70  ? 227  TYR A C   1 
ATOM   1639 O O   . TYR A 1 213 ? 32.651  46.380 53.999 1.00 41.23  ? 227  TYR A O   1 
ATOM   1640 C CB  . TYR A 1 213 ? 33.696  46.642 56.807 1.00 40.91  ? 227  TYR A CB  1 
ATOM   1641 C CG  . TYR A 1 213 ? 33.767  48.155 56.783 1.00 43.22  ? 227  TYR A CG  1 
ATOM   1642 C CD1 . TYR A 1 213 ? 34.477  48.821 55.787 1.00 45.18  ? 227  TYR A CD1 1 
ATOM   1643 C CD2 . TYR A 1 213 ? 33.049  48.921 57.704 1.00 43.68  ? 227  TYR A CD2 1 
ATOM   1644 C CE1 . TYR A 1 213 ? 34.502  50.206 55.731 1.00 46.49  ? 227  TYR A CE1 1 
ATOM   1645 C CE2 . TYR A 1 213 ? 33.067  50.310 57.653 1.00 44.37  ? 227  TYR A CE2 1 
ATOM   1646 C CZ  . TYR A 1 213 ? 33.808  50.945 56.673 1.00 52.11  ? 227  TYR A CZ  1 
ATOM   1647 O OH  . TYR A 1 213 ? 33.854  52.321 56.624 1.00 52.22  ? 227  TYR A OH  1 
ATOM   1648 N N   . ARG A 1 214 ? 30.853  47.373 54.909 1.00 38.25  ? 228  ARG A N   1 
ATOM   1649 C CA  . ARG A 1 214 ? 30.388  47.948 53.646 1.00 38.10  ? 228  ARG A CA  1 
ATOM   1650 C C   . ARG A 1 214 ? 30.126  46.858 52.610 1.00 39.52  ? 228  ARG A C   1 
ATOM   1651 O O   . ARG A 1 214 ? 30.216  47.093 51.403 1.00 39.27  ? 228  ARG A O   1 
ATOM   1652 C CB  . ARG A 1 214 ? 31.401  48.967 53.102 1.00 40.46  ? 228  ARG A CB  1 
ATOM   1653 C CG  . ARG A 1 214 ? 31.354  50.338 53.776 1.00 54.83  ? 228  ARG A CG  1 
ATOM   1654 C CD  . ARG A 1 214 ? 30.068  51.070 53.424 1.00 69.99  ? 228  ARG A CD  1 
ATOM   1655 N NE  . ARG A 1 214 ? 30.261  52.514 53.332 1.00 84.02  ? 228  ARG A NE  1 
ATOM   1656 C CZ  . ARG A 1 214 ? 29.512  53.317 52.582 1.00 101.75 ? 228  ARG A CZ  1 
ATOM   1657 N NH1 . ARG A 1 214 ? 29.755  54.620 52.551 1.00 91.72  ? 228  ARG A NH1 1 
ATOM   1658 N NH2 . ARG A 1 214 ? 28.528  52.815 51.850 1.00 89.26  ? 228  ARG A NH2 1 
ATOM   1659 N N   . LEU A 1 215 ? 29.729  45.686 53.093 1.00 34.41  ? 229  LEU A N   1 
ATOM   1660 C CA  . LEU A 1 215 ? 29.508  44.526 52.234 1.00 33.33  ? 229  LEU A CA  1 
ATOM   1661 C C   . LEU A 1 215 ? 28.374  44.760 51.244 1.00 35.84  ? 229  LEU A C   1 
ATOM   1662 O O   . LEU A 1 215 ? 28.394  44.236 50.134 1.00 35.35  ? 229  LEU A O   1 
ATOM   1663 C CB  . LEU A 1 215 ? 29.241  43.277 53.077 1.00 33.11  ? 229  LEU A CB  1 
ATOM   1664 C CG  . LEU A 1 215 ? 29.253  41.935 52.342 1.00 37.18  ? 229  LEU A CG  1 
ATOM   1665 C CD1 . LEU A 1 215 ? 30.560  41.721 51.589 1.00 36.94  ? 229  LEU A CD1 1 
ATOM   1666 C CD2 . LEU A 1 215 ? 29.019  40.813 53.330 1.00 39.04  ? 229  LEU A CD2 1 
ATOM   1667 N N   . THR A 1 216 ? 27.408  45.581 51.639 1.00 32.15  ? 230  THR A N   1 
ATOM   1668 C CA  . THR A 1 216 ? 26.298  45.932 50.766 1.00 32.13  ? 230  THR A CA  1 
ATOM   1669 C C   . THR A 1 216 ? 26.813  46.630 49.512 1.00 38.36  ? 230  THR A C   1 
ATOM   1670 O O   . THR A 1 216 ? 26.405  46.319 48.395 1.00 38.65  ? 230  THR A O   1 
ATOM   1671 C CB  . THR A 1 216 ? 25.262  46.808 51.503 1.00 36.64  ? 230  THR A CB  1 
ATOM   1672 O OG1 . THR A 1 216 ? 24.691  46.073 52.590 1.00 37.58  ? 230  THR A OG1 1 
ATOM   1673 C CG2 . THR A 1 216 ? 24.157  47.231 50.565 1.00 33.02  ? 230  THR A CG2 1 
ATOM   1674 N N   . ARG A 1 217 ? 27.690  47.606 49.703 1.00 36.19  ? 231  ARG A N   1 
ATOM   1675 C CA  . ARG A 1 217 ? 28.343  48.252 48.574 1.00 35.59  ? 231  ARG A CA  1 
ATOM   1676 C C   . ARG A 1 217 ? 29.102  47.221 47.737 1.00 37.37  ? 231  ARG A C   1 
ATOM   1677 O O   . ARG A 1 217 ? 28.855  47.076 46.539 1.00 36.01  ? 231  ARG A O   1 
ATOM   1678 C CB  . ARG A 1 217 ? 29.297  49.340 49.065 1.00 35.92  ? 231  ARG A CB  1 
ATOM   1679 C CG  . ARG A 1 217 ? 29.797  50.253 47.962 1.00 44.54  ? 231  ARG A CG  1 
ATOM   1680 C CD  . ARG A 1 217 ? 30.779  51.243 48.528 1.00 51.27  ? 231  ARG A CD  1 
ATOM   1681 N NE  . ARG A 1 217 ? 31.883  50.553 49.183 1.00 56.07  ? 231  ARG A NE  1 
ATOM   1682 C CZ  . ARG A 1 217 ? 32.727  51.130 50.028 1.00 68.67  ? 231  ARG A CZ  1 
ATOM   1683 N NH1 . ARG A 1 217 ? 32.584  52.413 50.341 1.00 56.30  ? 231  ARG A NH1 1 
ATOM   1684 N NH2 . ARG A 1 217 ? 33.704  50.418 50.571 1.00 51.80  ? 231  ARG A NH2 1 
ATOM   1685 N N   . PHE A 1 218 ? 29.996  46.479 48.386 1.00 33.09  ? 232  PHE A N   1 
ATOM   1686 C CA  . PHE A 1 218 ? 30.783  45.463 47.695 1.00 33.01  ? 232  PHE A CA  1 
ATOM   1687 C C   . PHE A 1 218 ? 29.934  44.518 46.849 1.00 37.89  ? 232  PHE A C   1 
ATOM   1688 O O   . PHE A 1 218 ? 30.193  44.332 45.656 1.00 38.63  ? 232  PHE A O   1 
ATOM   1689 C CB  . PHE A 1 218 ? 31.618  44.658 48.687 1.00 34.78  ? 232  PHE A CB  1 
ATOM   1690 C CG  . PHE A 1 218 ? 32.489  43.619 48.040 1.00 36.66  ? 232  PHE A CG  1 
ATOM   1691 C CD1 . PHE A 1 218 ? 33.781  43.929 47.633 1.00 40.26  ? 232  PHE A CD1 1 
ATOM   1692 C CD2 . PHE A 1 218 ? 32.028  42.326 47.856 1.00 39.29  ? 232  PHE A CD2 1 
ATOM   1693 C CE1 . PHE A 1 218 ? 34.593  42.969 47.045 1.00 41.51  ? 232  PHE A CE1 1 
ATOM   1694 C CE2 . PHE A 1 218 ? 32.833  41.357 47.274 1.00 42.56  ? 232  PHE A CE2 1 
ATOM   1695 C CZ  . PHE A 1 218 ? 34.116  41.681 46.856 1.00 40.99  ? 232  PHE A CZ  1 
ATOM   1696 N N   . LEU A 1 219 ? 28.918  43.916 47.457 1.00 33.78  ? 233  LEU A N   1 
ATOM   1697 C CA  . LEU A 1 219 ? 28.113  42.928 46.748 1.00 33.41  ? 233  LEU A CA  1 
ATOM   1698 C C   . LEU A 1 219 ? 27.187  43.510 45.673 1.00 39.45  ? 233  LEU A C   1 
ATOM   1699 O O   . LEU A 1 219 ? 26.890  42.852 44.680 1.00 39.15  ? 233  LEU A O   1 
ATOM   1700 C CB  . LEU A 1 219 ? 27.346  42.036 47.725 1.00 32.63  ? 233  LEU A CB  1 
ATOM   1701 C CG  . LEU A 1 219 ? 28.169  41.034 48.541 1.00 35.37  ? 233  LEU A CG  1 
ATOM   1702 C CD1 . LEU A 1 219 ? 27.259  40.215 49.434 1.00 34.52  ? 233  LEU A CD1 1 
ATOM   1703 C CD2 . LEU A 1 219 ? 29.015  40.135 47.652 1.00 35.48  ? 233  LEU A CD2 1 
ATOM   1704 N N   . SER A 1 220 ? 26.752  44.752 45.846 1.00 37.79  ? 234  SER A N   1 
ATOM   1705 C CA  . SER A 1 220 ? 25.870  45.360 44.854 1.00 38.75  ? 234  SER A CA  1 
ATOM   1706 C C   . SER A 1 220 ? 26.624  45.750 43.578 1.00 45.16  ? 234  SER A C   1 
ATOM   1707 O O   . SER A 1 220 ? 26.046  45.815 42.492 1.00 45.27  ? 234  SER A O   1 
ATOM   1708 C CB  . SER A 1 220 ? 25.094  46.541 45.447 1.00 42.22  ? 234  SER A CB  1 
ATOM   1709 O OG  . SER A 1 220 ? 25.966  47.568 45.871 1.00 51.96  ? 234  SER A OG  1 
ATOM   1710 N N   . ARG A 1 221 ? 27.928  45.960 43.704 1.00 42.78  ? 235  ARG A N   1 
ATOM   1711 C CA  . ARG A 1 221 ? 28.777  46.063 42.529 1.00 43.60  ? 235  ARG A CA  1 
ATOM   1712 C C   . ARG A 1 221 ? 28.860  44.712 41.810 1.00 48.27  ? 235  ARG A C   1 
ATOM   1713 O O   . ARG A 1 221 ? 28.569  44.617 40.619 1.00 47.67  ? 235  ARG A O   1 
ATOM   1714 C CB  . ARG A 1 221 ? 30.173  46.558 42.912 1.00 44.80  ? 235  ARG A CB  1 
ATOM   1715 C CG  . ARG A 1 221 ? 30.192  47.981 43.451 1.00 55.83  ? 235  ARG A CG  1 
ATOM   1716 C CD  . ARG A 1 221 ? 31.596  48.394 43.882 1.00 67.81  ? 235  ARG A CD  1 
ATOM   1717 N NE  . ARG A 1 221 ? 31.633  49.772 44.361 1.00 77.32  ? 235  ARG A NE  1 
ATOM   1718 C CZ  . ARG A 1 221 ? 32.716  50.358 44.855 1.00 98.02  ? 235  ARG A CZ  1 
ATOM   1719 N NH1 . ARG A 1 221 ? 33.855  49.684 44.939 1.00 91.59  ? 235  ARG A NH1 1 
ATOM   1720 N NH2 . ARG A 1 221 ? 32.659  51.617 45.267 1.00 87.88  ? 235  ARG A NH2 1 
ATOM   1721 N N   . VAL A 1 222 ? 29.221  43.664 42.547 1.00 45.67  ? 236  VAL A N   1 
ATOM   1722 C CA  . VAL A 1 222 ? 29.280  42.309 41.992 1.00 45.55  ? 236  VAL A CA  1 
ATOM   1723 C C   . VAL A 1 222 ? 27.971  41.950 41.286 1.00 50.90  ? 236  VAL A C   1 
ATOM   1724 O O   . VAL A 1 222 ? 27.967  41.295 40.240 1.00 50.13  ? 236  VAL A O   1 
ATOM   1725 C CB  . VAL A 1 222 ? 29.596  41.268 43.084 1.00 48.62  ? 236  VAL A CB  1 
ATOM   1726 C CG1 . VAL A 1 222 ? 29.624  39.872 42.494 1.00 48.40  ? 236  VAL A CG1 1 
ATOM   1727 C CG2 . VAL A 1 222 ? 30.900  41.588 43.772 1.00 48.33  ? 236  VAL A CG2 1 
ATOM   1728 N N   . ILE A 1 223 ? 26.869  42.393 41.879 1.00 48.37  ? 237  ILE A N   1 
ATOM   1729 C CA  . ILE A 1 223 ? 25.521  41.999 41.486 1.00 48.38  ? 237  ILE A CA  1 
ATOM   1730 C C   . ILE A 1 223 ? 24.988  42.978 40.437 1.00 52.35  ? 237  ILE A C   1 
ATOM   1731 O O   . ILE A 1 223 ? 23.910  42.777 39.873 1.00 51.45  ? 237  ILE A O   1 
ATOM   1732 C CB  . ILE A 1 223 ? 24.609  42.028 42.733 1.00 51.75  ? 237  ILE A CB  1 
ATOM   1733 C CG1 . ILE A 1 223 ? 23.645  40.856 42.773 1.00 51.79  ? 237  ILE A CG1 1 
ATOM   1734 C CG2 . ILE A 1 223 ? 23.783  43.283 42.751 1.00 53.64  ? 237  ILE A CG2 1 
ATOM   1735 C CD1 . ILE A 1 223 ? 22.512  41.115 43.751 1.00 53.42  ? 237  ILE A CD1 1 
ATOM   1736 N N   . LYS A 1 224 ? 25.715  44.075 40.241 1.00 50.01  ? 238  LYS A N   1 
ATOM   1737 C CA  . LYS A 1 224 ? 25.271  45.163 39.369 1.00 50.57  ? 238  LYS A CA  1 
ATOM   1738 C C   . LYS A 1 224 ? 23.875  45.664 39.741 1.00 56.07  ? 238  LYS A C   1 
ATOM   1739 O O   . LYS A 1 224 ? 22.960  45.658 38.916 1.00 55.87  ? 238  LYS A O   1 
ATOM   1740 C CB  . LYS A 1 224 ? 25.320  44.748 37.895 1.00 52.57  ? 238  LYS A CB  1 
ATOM   1741 C CG  . LYS A 1 224 ? 26.726  44.664 37.319 1.00 65.46  ? 238  LYS A CG  1 
ATOM   1742 C CD  . LYS A 1 224 ? 27.504  43.492 37.906 1.00 75.64  ? 238  LYS A CD  1 
ATOM   1743 C CE  . LYS A 1 224 ? 28.984  43.555 37.538 1.00 82.51  ? 238  LYS A CE  1 
ATOM   1744 N NZ  . LYS A 1 224 ? 29.755  42.387 38.061 1.00 87.24  ? 238  LYS A NZ  1 
ATOM   1745 N N   . CYS A 1 225 ? 23.721  46.111 40.983 1.00 52.99  ? 239  CYS A N   1 
ATOM   1746 C CA  . CYS A 1 225 ? 22.424  46.571 41.470 1.00 52.70  ? 239  CYS A CA  1 
ATOM   1747 C C   . CYS A 1 225 ? 22.557  47.849 42.291 1.00 55.19  ? 239  CYS A C   1 
ATOM   1748 O O   . CYS A 1 225 ? 23.656  48.237 42.692 1.00 54.32  ? 239  CYS A O   1 
ATOM   1749 C CB  . CYS A 1 225 ? 21.756  45.492 42.328 1.00 53.03  ? 239  CYS A CB  1 
ATOM   1750 S SG  . CYS A 1 225 ? 22.247  45.541 44.072 1.00 56.87  ? 239  CYS A SG  1 
ATOM   1751 N N   . ASP A 1 226 ? 21.420  48.484 42.546 1.00 51.23  ? 240  ASP A N   1 
ATOM   1752 C CA  . ASP A 1 226 ? 21.361  49.634 43.434 1.00 51.09  ? 240  ASP A CA  1 
ATOM   1753 C C   . ASP A 1 226 ? 21.582  49.134 44.855 1.00 54.57  ? 240  ASP A C   1 
ATOM   1754 O O   . ASP A 1 226 ? 20.913  48.202 45.303 1.00 54.30  ? 240  ASP A O   1 
ATOM   1755 C CB  . ASP A 1 226 ? 19.986  50.306 43.331 1.00 52.93  ? 240  ASP A CB  1 
ATOM   1756 C CG  . ASP A 1 226 ? 20.010  51.753 43.778 1.00 63.90  ? 240  ASP A CG  1 
ATOM   1757 O OD1 . ASP A 1 226 ? 21.092  52.371 43.714 1.00 64.80  ? 240  ASP A OD1 1 
ATOM   1758 O OD2 . ASP A 1 226 ? 18.944  52.280 44.163 1.00 69.82  ? 240  ASP A OD2 1 
ATOM   1759 N N   . PRO A 1 227 ? 22.539  49.736 45.574 1.00 50.60  ? 241  PRO A N   1 
ATOM   1760 C CA  . PRO A 1 227 ? 22.854  49.299 46.939 1.00 50.17  ? 241  PRO A CA  1 
ATOM   1761 C C   . PRO A 1 227 ? 21.711  49.587 47.898 1.00 53.99  ? 241  PRO A C   1 
ATOM   1762 O O   . PRO A 1 227 ? 21.517  48.867 48.881 1.00 53.73  ? 241  PRO A O   1 
ATOM   1763 C CB  . PRO A 1 227 ? 24.093  50.130 47.311 1.00 51.97  ? 241  PRO A CB  1 
ATOM   1764 C CG  . PRO A 1 227 ? 24.251  51.160 46.217 1.00 56.63  ? 241  PRO A CG  1 
ATOM   1765 C CD  . PRO A 1 227 ? 23.602  50.576 45.000 1.00 52.39  ? 241  PRO A CD  1 
ATOM   1766 N N   . ASP A 1 228 ? 20.937  50.626 47.592 1.00 50.34  ? 242  ASP A N   1 
ATOM   1767 C CA  . ASP A 1 228 ? 19.760  50.961 48.386 1.00 49.90  ? 242  ASP A CA  1 
ATOM   1768 C C   . ASP A 1 228 ? 18.700  49.876 48.242 1.00 52.80  ? 242  ASP A C   1 
ATOM   1769 O O   . ASP A 1 228 ? 17.935  49.611 49.168 1.00 52.45  ? 242  ASP A O   1 
ATOM   1770 C CB  . ASP A 1 228 ? 19.189  52.312 47.949 1.00 52.14  ? 242  ASP A CB  1 
ATOM   1771 C CG  . ASP A 1 228 ? 20.086  53.475 48.328 1.00 63.95  ? 242  ASP A CG  1 
ATOM   1772 O OD1 . ASP A 1 228 ? 20.545  53.520 49.491 1.00 64.25  ? 242  ASP A OD1 1 
ATOM   1773 O OD2 . ASP A 1 228 ? 20.321  54.349 47.467 1.00 70.49  ? 242  ASP A OD2 1 
ATOM   1774 N N   . CYS A 1 229 ? 18.659  49.248 47.073 1.00 48.91  ? 243  CYS A N   1 
ATOM   1775 C CA  . CYS A 1 229 ? 17.749  48.135 46.845 1.00 49.23  ? 243  CYS A CA  1 
ATOM   1776 C C   . CYS A 1 229 ? 18.179  46.915 47.661 1.00 51.29  ? 243  CYS A C   1 
ATOM   1777 O O   . CYS A 1 229 ? 17.360  46.273 48.323 1.00 50.84  ? 243  CYS A O   1 
ATOM   1778 C CB  . CYS A 1 229 ? 17.688  47.797 45.354 1.00 50.35  ? 243  CYS A CB  1 
ATOM   1779 S SG  . CYS A 1 229 ? 17.256  49.217 44.305 1.00 54.75  ? 243  CYS A SG  1 
ATOM   1780 N N   . LEU A 1 230 ? 19.479  46.641 47.648 1.00 46.35  ? 244  LEU A N   1 
ATOM   1781 C CA  . LEU A 1 230 ? 20.060  45.559 48.436 1.00 45.30  ? 244  LEU A CA  1 
ATOM   1782 C C   . LEU A 1 230 ? 19.784  45.745 49.924 1.00 47.31  ? 244  LEU A C   1 
ATOM   1783 O O   . LEU A 1 230 ? 19.268  44.842 50.586 1.00 46.00  ? 244  LEU A O   1 
ATOM   1784 C CB  . LEU A 1 230 ? 21.571  45.472 48.183 1.00 45.09  ? 244  LEU A CB  1 
ATOM   1785 C CG  . LEU A 1 230 ? 22.305  44.286 48.812 1.00 49.35  ? 244  LEU A CG  1 
ATOM   1786 C CD1 . LEU A 1 230 ? 21.430  43.042 48.705 1.00 49.65  ? 244  LEU A CD1 1 
ATOM   1787 C CD2 . LEU A 1 230 ? 23.638  44.057 48.099 1.00 50.84  ? 244  LEU A CD2 1 
ATOM   1788 N N   . ARG A 1 231 ? 20.134  46.921 50.440 1.00 43.35  ? 245  ARG A N   1 
ATOM   1789 C CA  . ARG A 1 231 ? 19.904  47.243 51.842 1.00 43.06  ? 245  ARG A CA  1 
ATOM   1790 C C   . ARG A 1 231 ? 18.429  47.115 52.195 1.00 45.40  ? 245  ARG A C   1 
ATOM   1791 O O   . ARG A 1 231 ? 18.075  46.513 53.207 1.00 45.23  ? 245  ARG A O   1 
ATOM   1792 C CB  . ARG A 1 231 ? 20.393  48.656 52.159 1.00 44.33  ? 245  ARG A CB  1 
ATOM   1793 C CG  . ARG A 1 231 ? 20.041  49.137 53.563 1.00 53.10  ? 245  ARG A CG  1 
ATOM   1794 C CD  . ARG A 1 231 ? 20.645  50.506 53.850 1.00 63.33  ? 245  ARG A CD  1 
ATOM   1795 N NE  . ARG A 1 231 ? 22.077  50.541 53.559 1.00 73.45  ? 245  ARG A NE  1 
ATOM   1796 C CZ  . ARG A 1 231 ? 22.609  51.113 52.483 1.00 86.79  ? 245  ARG A CZ  1 
ATOM   1797 N NH1 . ARG A 1 231 ? 21.831  51.717 51.595 1.00 73.68  ? 245  ARG A NH1 1 
ATOM   1798 N NH2 . ARG A 1 231 ? 23.923  51.093 52.299 1.00 73.85  ? 245  ARG A NH2 1 
ATOM   1799 N N   . ALA A 1 232 ? 17.579  47.723 51.376 1.00 40.80  ? 246  ALA A N   1 
ATOM   1800 C CA  . ALA A 1 232 ? 16.140  47.540 51.496 1.00 40.21  ? 246  ALA A CA  1 
ATOM   1801 C C   . ALA A 1 232 ? 15.810  46.049 51.525 1.00 43.42  ? 246  ALA A C   1 
ATOM   1802 O O   . ALA A 1 232 ? 15.100  45.585 52.413 1.00 43.28  ? 246  ALA A O   1 
ATOM   1803 C CB  . ALA A 1 232 ? 15.424  48.227 50.340 1.00 40.84  ? 246  ALA A CB  1 
ATOM   1804 N N   . CYS A 1 233 ? 16.357  45.296 50.572 1.00 38.91  ? 247  CYS A N   1 
ATOM   1805 C CA  . CYS A 1 233 ? 16.205  43.840 50.561 1.00 38.24  ? 247  CYS A CA  1 
ATOM   1806 C C   . CYS A 1 233 ? 16.645  43.158 51.867 1.00 41.05  ? 247  CYS A C   1 
ATOM   1807 O O   . CYS A 1 233 ? 15.882  42.390 52.462 1.00 40.78  ? 247  CYS A O   1 
ATOM   1808 C CB  . CYS A 1 233 ? 16.948  43.224 49.374 1.00 38.33  ? 247  CYS A CB  1 
ATOM   1809 S SG  . CYS A 1 233 ? 16.847  41.410 49.292 1.00 42.18  ? 247  CYS A SG  1 
ATOM   1810 N N   . GLN A 1 234 ? 17.885  43.402 52.286 1.00 35.81  ? 248  GLN A N   1 
ATOM   1811 C CA  . GLN A 1 234 ? 18.397  42.814 53.523 1.00 35.61  ? 248  GLN A CA  1 
ATOM   1812 C C   . GLN A 1 234 ? 17.537  43.171 54.731 1.00 39.48  ? 248  GLN A C   1 
ATOM   1813 O O   . GLN A 1 234 ? 17.378  42.376 55.657 1.00 38.73  ? 248  GLN A O   1 
ATOM   1814 C CB  . GLN A 1 234 ? 19.829  43.274 53.793 1.00 36.93  ? 248  GLN A CB  1 
ATOM   1815 C CG  . GLN A 1 234 ? 20.327  42.880 55.166 1.00 48.32  ? 248  GLN A CG  1 
ATOM   1816 C CD  . GLN A 1 234 ? 21.429  43.785 55.667 1.00 69.37  ? 248  GLN A CD  1 
ATOM   1817 O OE1 . GLN A 1 234 ? 21.680  43.867 56.868 1.00 64.77  ? 248  GLN A OE1 1 
ATOM   1818 N NE2 . GLN A 1 234 ? 22.086  44.482 54.748 1.00 63.98  ? 248  GLN A NE2 1 
ATOM   1819 N N   . GLU A 1 235 ? 17.041  44.398 54.751 1.00 36.67  ? 249  GLU A N   1 
ATOM   1820 C CA  . GLU A 1 235 ? 16.176  44.836 55.832 1.00 37.03  ? 249  GLU A CA  1 
ATOM   1821 C C   . GLU A 1 235 ? 14.842  44.095 55.805 1.00 40.20  ? 249  GLU A C   1 
ATOM   1822 O O   . GLU A 1 235 ? 14.302  43.756 56.858 1.00 40.32  ? 249  GLU A O   1 
ATOM   1823 C CB  . GLU A 1 235 ? 15.986  46.358 55.789 1.00 38.78  ? 249  GLU A CB  1 
ATOM   1824 C CG  . GLU A 1 235 ? 17.308  47.111 55.878 1.00 52.69  ? 249  GLU A CG  1 
ATOM   1825 C CD  . GLU A 1 235 ? 17.137  48.595 56.135 1.00 78.50  ? 249  GLU A CD  1 
ATOM   1826 O OE1 . GLU A 1 235 ? 16.041  49.129 55.856 1.00 72.37  ? 249  GLU A OE1 1 
ATOM   1827 O OE2 . GLU A 1 235 ? 18.113  49.228 56.596 1.00 74.58  ? 249  GLU A OE2 1 
ATOM   1828 N N   . GLN A 1 236 ? 14.353  43.787 54.604 1.00 35.54  ? 250  GLN A N   1 
ATOM   1829 C CA  . GLN A 1 236 ? 13.150  42.970 54.456 1.00 35.76  ? 250  GLN A CA  1 
ATOM   1830 C C   . GLN A 1 236 ? 13.382  41.528 54.903 1.00 40.33  ? 250  GLN A C   1 
ATOM   1831 O O   . GLN A 1 236 ? 12.502  40.906 55.503 1.00 39.76  ? 250  GLN A O   1 
ATOM   1832 C CB  . GLN A 1 236 ? 12.631  43.000 53.016 1.00 37.37  ? 250  GLN A CB  1 
ATOM   1833 C CG  . GLN A 1 236 ? 11.962  44.299 52.610 1.00 54.14  ? 250  GLN A CG  1 
ATOM   1834 C CD  . GLN A 1 236 ? 10.691  44.560 53.387 1.00 82.95  ? 250  GLN A CD  1 
ATOM   1835 O OE1 . GLN A 1 236 ? 10.074  43.635 53.917 1.00 81.93  ? 250  GLN A OE1 1 
ATOM   1836 N NE2 . GLN A 1 236 ? 10.297  45.825 53.471 1.00 77.89  ? 250  GLN A NE2 1 
ATOM   1837 N N   . ILE A 1 237 ? 14.574  41.002 54.623 1.00 37.15  ? 251  ILE A N   1 
ATOM   1838 C CA  . ILE A 1 237 ? 14.937  39.658 55.069 1.00 36.65  ? 251  ILE A CA  1 
ATOM   1839 C C   . ILE A 1 237 ? 14.927  39.579 56.592 1.00 42.62  ? 251  ILE A C   1 
ATOM   1840 O O   . ILE A 1 237 ? 14.380  38.645 57.176 1.00 42.07  ? 251  ILE A O   1 
ATOM   1841 C CB  . ILE A 1 237 ? 16.302  39.228 54.505 1.00 39.12  ? 251  ILE A CB  1 
ATOM   1842 C CG1 . ILE A 1 237 ? 16.168  38.782 53.053 1.00 38.97  ? 251  ILE A CG1 1 
ATOM   1843 C CG2 . ILE A 1 237 ? 16.930  38.131 55.360 1.00 39.31  ? 251  ILE A CG2 1 
ATOM   1844 C CD1 . ILE A 1 237 ? 17.498  38.556 52.374 1.00 45.57  ? 251  ILE A CD1 1 
ATOM   1845 N N   . GLU A 1 238 ? 15.551  40.559 57.234 1.00 41.65  ? 252  GLU A N   1 
ATOM   1846 C CA  . GLU A 1 238 ? 15.654  40.570 58.690 1.00 42.64  ? 252  GLU A CA  1 
ATOM   1847 C C   . GLU A 1 238 ? 14.310  40.773 59.402 1.00 49.64  ? 252  GLU A C   1 
ATOM   1848 O O   . GLU A 1 238 ? 14.076  40.213 60.473 1.00 49.34  ? 252  GLU A O   1 
ATOM   1849 C CB  . GLU A 1 238 ? 16.699  41.589 59.140 1.00 43.94  ? 252  GLU A CB  1 
ATOM   1850 C CG  . GLU A 1 238 ? 18.118  41.167 58.779 1.00 54.84  ? 252  GLU A CG  1 
ATOM   1851 C CD  . GLU A 1 238 ? 19.114  42.308 58.836 1.00 74.60  ? 252  GLU A CD  1 
ATOM   1852 O OE1 . GLU A 1 238 ? 18.739  43.402 59.311 1.00 79.08  ? 252  GLU A OE1 1 
ATOM   1853 O OE2 . GLU A 1 238 ? 20.270  42.113 58.392 1.00 59.42  ? 252  GLU A OE2 1 
ATOM   1854 N N   . ALA A 1 239 ? 13.411  41.531 58.783 1.00 47.88  ? 253  ALA A N   1 
ATOM   1855 C CA  . ALA A 1 239 ? 12.035  41.605 59.260 1.00 48.43  ? 253  ALA A CA  1 
ATOM   1856 C C   . ALA A 1 239 ? 11.348  40.236 59.200 1.00 55.71  ? 253  ALA A C   1 
ATOM   1857 O O   . ALA A 1 239 ? 10.693  39.832 60.157 1.00 55.98  ? 253  ALA A O   1 
ATOM   1858 C CB  . ALA A 1 239 ? 11.247  42.636 58.466 1.00 49.05  ? 253  ALA A CB  1 
ATOM   1859 N N   . LEU A 1 240 ? 11.495  39.530 58.077 1.00 54.19  ? 254  LEU A N   1 
ATOM   1860 C CA  . LEU A 1 240 ? 10.952  38.174 57.932 1.00 54.78  ? 254  LEU A CA  1 
ATOM   1861 C C   . LEU A 1 240 ? 11.379  37.257 59.065 1.00 61.88  ? 254  LEU A C   1 
ATOM   1862 O O   . LEU A 1 240 ? 10.570  36.501 59.597 1.00 61.40  ? 254  LEU A O   1 
ATOM   1863 C CB  . LEU A 1 240 ? 11.388  37.543 56.608 1.00 54.66  ? 254  LEU A CB  1 
ATOM   1864 C CG  . LEU A 1 240 ? 10.371  37.412 55.475 1.00 59.07  ? 254  LEU A CG  1 
ATOM   1865 C CD1 . LEU A 1 240 ? 9.812   38.773 55.091 1.00 59.52  ? 254  LEU A CD1 1 
ATOM   1866 C CD2 . LEU A 1 240 ? 11.015  36.737 54.276 1.00 60.14  ? 254  LEU A CD2 1 
ATOM   1867 N N   . LEU A 1 241 ? 12.673  37.267 59.371 1.00 61.47  ? 255  LEU A N   1 
ATOM   1868 C CA  . LEU A 1 241 ? 13.224  36.386 60.394 1.00 62.57  ? 255  LEU A CA  1 
ATOM   1869 C C   . LEU A 1 241 ? 12.650  36.711 61.763 1.00 70.64  ? 255  LEU A C   1 
ATOM   1870 O O   . LEU A 1 241 ? 12.595  35.848 62.638 1.00 70.22  ? 255  LEU A O   1 
ATOM   1871 C CB  . LEU A 1 241 ? 14.749  36.474 60.426 1.00 62.43  ? 255  LEU A CB  1 
ATOM   1872 C CG  . LEU A 1 241 ? 15.438  35.533 61.414 1.00 66.88  ? 255  LEU A CG  1 
ATOM   1873 C CD1 . LEU A 1 241 ? 15.319  34.090 60.957 1.00 66.84  ? 255  LEU A CD1 1 
ATOM   1874 C CD2 . LEU A 1 241 ? 16.894  35.923 61.625 1.00 69.17  ? 255  LEU A CD2 1 
ATOM   1875 N N   . GLU A 1 242 ? 12.238  37.963 61.945 1.00 70.79  ? 256  GLU A N   1 
ATOM   1876 C CA  . GLU A 1 242 ? 11.562  38.382 63.168 1.00 72.51  ? 256  GLU A CA  1 
ATOM   1877 C C   . GLU A 1 242 ? 10.098  37.948 63.164 1.00 81.14  ? 256  GLU A C   1 
ATOM   1878 O O   . GLU A 1 242 ? 9.594   37.443 64.166 1.00 80.46  ? 256  GLU A O   1 
ATOM   1879 C CB  . GLU A 1 242 ? 11.668  39.897 63.355 1.00 73.93  ? 256  GLU A CB  1 
ATOM   1880 C CG  . GLU A 1 242 ? 13.075  40.385 63.655 1.00 86.19  ? 256  GLU A CG  1 
ATOM   1881 C CD  . GLU A 1 242 ? 13.159  41.897 63.797 1.00 110.11 ? 256  GLU A CD  1 
ATOM   1882 O OE1 . GLU A 1 242 ? 12.109  42.570 63.686 1.00 98.85  ? 256  GLU A OE1 1 
ATOM   1883 O OE2 . GLU A 1 242 ? 14.277  42.412 64.020 1.00 107.24 ? 256  GLU A OE2 1 
ATOM   1884 N N   . SER A 1 243 ? 9.426   38.152 62.034 1.00 81.74  ? 257  SER A N   1 
ATOM   1885 C CA  . SER A 1 243 ? 8.064   37.658 61.834 1.00 83.61  ? 257  SER A CA  1 
ATOM   1886 C C   . SER A 1 243 ? 7.971   36.151 62.055 1.00 92.61  ? 257  SER A C   1 
ATOM   1887 O O   . SER A 1 243 ? 6.875   35.595 62.123 1.00 92.00  ? 257  SER A O   1 
ATOM   1888 C CB  . SER A 1 243 ? 7.572   37.990 60.422 1.00 87.47  ? 257  SER A CB  1 
ATOM   1889 O OG  . SER A 1 243 ? 7.507   39.388 60.205 1.00 97.76  ? 257  SER A OG  1 
ATOM   1890 N N   . SER A 1 244 ? 9.122   35.490 62.123 1.00 93.68  ? 258  SER A N   1 
ATOM   1891 C CA  . SER A 1 244 ? 9.164   34.055 62.382 1.00 95.87  ? 258  SER A CA  1 
ATOM   1892 C C   . SER A 1 244 ? 9.195   33.752 63.876 1.00 105.84 ? 258  SER A C   1 
ATOM   1893 O O   . SER A 1 244 ? 9.477   32.625 64.286 1.00 105.35 ? 258  SER A O   1 
ATOM   1894 C CB  . SER A 1 244 ? 10.358  33.411 61.682 1.00 99.62  ? 258  SER A CB  1 
ATOM   1895 O OG  . SER A 1 244 ? 10.239  33.530 60.276 1.00 109.04 ? 258  SER A OG  1 
ATOM   1896 N N   . LEU A 1 245 ? 8.946   34.776 64.687 1.00 107.29 ? 259  LEU A N   1 
ATOM   1897 C CA  . LEU A 1 245 ? 8.654   34.579 66.102 1.00 109.36 ? 259  LEU A CA  1 
ATOM   1898 C C   . LEU A 1 245 ? 7.206   34.111 66.227 1.00 117.90 ? 259  LEU A C   1 
ATOM   1899 O O   . LEU A 1 245 ? 6.877   33.285 67.078 1.00 117.59 ? 259  LEU A O   1 
ATOM   1900 C CB  . LEU A 1 245 ? 8.843   35.888 66.878 1.00 109.61 ? 259  LEU A CB  1 
ATOM   1901 C CG  . LEU A 1 245 ? 10.239  36.517 66.901 1.00 114.63 ? 259  LEU A CG  1 
ATOM   1902 C CD1 . LEU A 1 245 ? 10.204  37.875 67.597 1.00 114.90 ? 259  LEU A CD1 1 
ATOM   1903 C CD2 . LEU A 1 245 ? 11.236  35.589 67.582 1.00 117.33 ? 259  LEU A CD2 1 
ATOM   1904 N N   . ARG A 1 246 ? 6.353   34.630 65.350 1.00 118.07 ? 260  ARG A N   1 
ATOM   1905 C CA  . ARG A 1 246 ? 4.941   34.269 65.336 1.00 119.78 ? 260  ARG A CA  1 
ATOM   1906 C C   . ARG A 1 246 ? 4.731   32.781 65.065 1.00 127.96 ? 260  ARG A C   1 
ATOM   1907 O O   . ARG A 1 246 ? 4.153   32.066 65.883 1.00 127.58 ? 260  ARG A O   1 
ATOM   1908 C CB  . ARG A 1 246 ? 4.188   35.101 64.294 1.00 120.60 ? 260  ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 246 ? 4.183   36.597 64.572 1.00 132.47 ? 260  ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 246 ? 3.450   37.363 63.479 1.00 143.16 ? 260  ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 246 ? 3.378   38.794 63.766 1.00 152.07 ? 260  ARG A NE  1 
ATOM   1912 C CZ  . ARG A 1 246 ? 2.855   39.697 62.942 1.00 165.41 ? 260  ARG A CZ  1 
ATOM   1913 N NH1 . ARG A 1 246 ? 2.359   39.321 61.771 1.00 152.52 ? 260  ARG A NH1 1 
ATOM   1914 N NH2 . ARG A 1 246 ? 2.832   40.978 63.286 1.00 151.27 ? 260  ARG A NH2 1 
ATOM   1915 N N   . GLN A 1 247 ? 5.196   32.323 63.908 1.00 127.90 ? 261  GLN A N   1 
ATOM   1916 C CA  . GLN A 1 247 ? 4.961   30.948 63.478 1.00 129.37 ? 261  GLN A CA  1 
ATOM   1917 C C   . GLN A 1 247 ? 5.561   29.913 64.425 1.00 136.68 ? 261  GLN A C   1 
ATOM   1918 O O   . GLN A 1 247 ? 4.986   28.842 64.631 1.00 136.33 ? 261  GLN A O   1 
ATOM   1919 C CB  . GLN A 1 247 ? 5.493   30.730 62.059 1.00 130.89 ? 261  GLN A CB  1 
ATOM   1920 C CG  . GLN A 1 247 ? 4.786   31.554 60.994 1.00 149.81 ? 261  GLN A CG  1 
ATOM   1921 C CD  . GLN A 1 247 ? 5.329   31.292 59.602 1.00 172.06 ? 261  GLN A CD  1 
ATOM   1922 O OE1 . GLN A 1 247 ? 6.283   30.535 59.428 1.00 168.53 ? 261  GLN A OE1 1 
ATOM   1923 N NE2 . GLN A 1 247 ? 4.721   31.920 58.602 1.00 164.63 ? 261  GLN A NE2 1 
ATOM   1924 N N   . ALA A 1 248 ? 6.719   30.233 64.992 1.00 135.75 ? 262  ALA A N   1 
ATOM   1925 C CA  . ALA A 1 248 ? 7.443   29.290 65.838 1.00 136.75 ? 262  ALA A CA  1 
ATOM   1926 C C   . ALA A 1 248 ? 6.718   28.989 67.148 1.00 143.32 ? 262  ALA A C   1 
ATOM   1927 O O   . ALA A 1 248 ? 6.900   27.922 67.735 1.00 142.97 ? 262  ALA A O   1 
ATOM   1928 C CB  . ALA A 1 248 ? 8.853   29.796 66.112 1.00 137.49 ? 262  ALA A CB  1 
ATOM   1929 N N   . GLN A 1 249 ? 5.885   29.924 67.592 1.00 141.90 ? 263  GLN A N   1 
ATOM   1930 C CA  . GLN A 1 249 ? 5.236   29.807 68.894 1.00 142.68 ? 263  GLN A CA  1 
ATOM   1931 C C   . GLN A 1 249 ? 3.751   29.462 68.804 1.00 148.93 ? 263  GLN A C   1 
ATOM   1932 O O   . GLN A 1 249 ? 3.318   28.421 69.300 1.00 148.50 ? 263  GLN A O   1 
ATOM   1933 C CB  . GLN A 1 249 ? 5.433   31.089 69.707 1.00 143.99 ? 263  GLN A CB  1 
ATOM   1934 C CG  . GLN A 1 249 ? 6.887   31.505 69.871 1.00 158.37 ? 263  GLN A CG  1 
ATOM   1935 C CD  . GLN A 1 249 ? 7.718   30.461 70.592 1.00 176.88 ? 263  GLN A CD  1 
ATOM   1936 O OE1 . GLN A 1 249 ? 7.183   29.521 71.179 1.00 172.04 ? 263  GLN A OE1 1 
ATOM   1937 N NE2 . GLN A 1 249 ? 9.035   30.624 70.554 1.00 169.13 ? 263  GLN A NE2 1 
ATOM   1938 N N   . GLN A 1 250 ? 2.981   30.327 68.148 1.00 147.30 ? 264  GLN A N   1 
ATOM   1939 C CA  . GLN A 1 250 ? 1.526   30.190 68.093 1.00 147.95 ? 264  GLN A CA  1 
ATOM   1940 C C   . GLN A 1 250 ? 1.041   28.864 67.509 1.00 153.75 ? 264  GLN A C   1 
ATOM   1941 O O   . GLN A 1 250 ? -0.064  28.788 66.971 1.00 153.38 ? 264  GLN A O   1 
ATOM   1942 C CB  . GLN A 1 250 ? 0.907   31.352 67.317 1.00 149.33 ? 264  GLN A CB  1 
ATOM   1943 C CG  . GLN A 1 250 ? 1.109   32.712 67.960 1.00 166.04 ? 264  GLN A CG  1 
ATOM   1944 C CD  . GLN A 1 250 ? 0.488   33.832 67.151 1.00 186.85 ? 264  GLN A CD  1 
ATOM   1945 O OE1 . GLN A 1 250 ? -0.017  33.611 66.050 1.00 182.95 ? 264  GLN A OE1 1 
ATOM   1946 N NE2 . GLN A 1 250 ? 0.523   35.044 67.692 1.00 179.02 ? 264  GLN A NE2 1 
ATOM   1947 N N   . ASN A 1 251 ? 1.854   27.820 67.636 1.00 151.71 ? 265  ASN A N   1 
ATOM   1948 C CA  . ASN A 1 251 ? 1.483   26.498 67.143 1.00 152.15 ? 265  ASN A CA  1 
ATOM   1949 C C   . ASN A 1 251 ? 0.552   25.776 68.112 1.00 157.08 ? 265  ASN A C   1 
ATOM   1950 O O   . ASN A 1 251 ? 0.435   24.551 68.080 1.00 156.66 ? 265  ASN A O   1 
ATOM   1951 C CB  . ASN A 1 251 ? 2.729   25.654 66.866 1.00 153.66 ? 265  ASN A CB  1 
ATOM   1952 C CG  . ASN A 1 251 ? 3.535   26.172 65.688 1.00 179.21 ? 265  ASN A CG  1 
ATOM   1953 O OD1 . ASN A 1 251 ? 2.975   26.607 64.680 1.00 173.42 ? 265  ASN A OD1 1 
ATOM   1954 N ND2 . ASN A 1 251 ? 4.856   26.126 65.810 1.00 171.97 ? 265  ASN A ND2 1 
ATOM   1955 N N   . MET A 1 252 ? -0.110  26.546 68.971 1.00 154.41 ? 266  MET A N   1 
ATOM   1956 C CA  . MET A 1 252 ? -1.099  25.998 69.893 1.00 154.54 ? 266  MET A CA  1 
ATOM   1957 C C   . MET A 1 252 ? -2.514  26.251 69.384 1.00 158.63 ? 266  MET A C   1 
ATOM   1958 O O   . MET A 1 252 ? -2.986  25.571 68.472 1.00 158.25 ? 266  MET A O   1 
ATOM   1959 C CB  . MET A 1 252 ? -0.928  26.602 71.290 1.00 156.96 ? 266  MET A CB  1 
ATOM   1960 C CG  . MET A 1 252 ? -1.945  26.106 72.307 1.00 160.68 ? 266  MET A CG  1 
ATOM   1961 S SD  . MET A 1 252 ? -1.802  24.336 72.630 1.00 164.92 ? 266  MET A SD  1 
ATOM   1962 C CE  . MET A 1 252 ? -3.264  24.052 73.630 1.00 161.63 ? 266  MET A CE  1 
ATOM   1963 N N   . ASP A 1 253 ? -3.187  27.231 69.978 1.00 155.25 ? 267  ASP A N   1 
ATOM   1964 C CA  . ASP A 1 253 ? -4.525  27.609 69.541 1.00 187.70 ? 267  ASP A CA  1 
ATOM   1965 C C   . ASP A 1 253 ? -4.488  28.256 68.161 1.00 220.85 ? 267  ASP A C   1 
ATOM   1966 O O   . ASP A 1 253 ? -3.816  27.764 67.254 1.00 183.13 ? 267  ASP A O   1 
ATOM   1967 C CB  . ASP A 1 253 ? -5.175  28.556 70.552 1.00 189.49 ? 267  ASP A CB  1 
ATOM   1968 C CG  . ASP A 1 253 ? -5.535  27.862 71.849 1.00 199.20 ? 267  ASP A CG  1 
ATOM   1969 O OD1 . ASP A 1 253 ? -5.529  26.614 71.879 1.00 199.59 ? 267  ASP A OD1 1 
ATOM   1970 O OD2 . ASP A 1 253 ? -5.836  28.565 72.836 1.00 205.23 ? 267  ASP A OD2 1 
ATOM   1971 N N   . ALA B 2 2   ? 4.445   20.155 14.073 1.00 111.93 ? 2    ALA B N   1 
ATOM   1972 C CA  . ALA B 2 2   ? 3.222   20.815 14.516 1.00 111.71 ? 2    ALA B CA  1 
ATOM   1973 C C   . ALA B 2 2   ? 2.741   20.268 15.859 1.00 115.39 ? 2    ALA B C   1 
ATOM   1974 O O   . ALA B 2 2   ? 2.874   19.075 16.140 1.00 115.05 ? 2    ALA B O   1 
ATOM   1975 C CB  . ALA B 2 2   ? 2.133   20.681 13.459 1.00 112.45 ? 2    ALA B CB  1 
ATOM   1976 N N   . THR B 2 3   ? 2.158   21.143 16.673 1.00 111.55 ? 3    THR B N   1 
ATOM   1977 C CA  . THR B 2 3   ? 1.975   22.539 16.287 1.00 111.12 ? 3    THR B CA  1 
ATOM   1978 C C   . THR B 2 3   ? 2.894   23.491 17.048 1.00 113.76 ? 3    THR B C   1 
ATOM   1979 O O   . THR B 2 3   ? 3.451   23.144 18.091 1.00 113.35 ? 3    THR B O   1 
ATOM   1980 C CB  . THR B 2 3   ? 0.497   22.974 16.398 1.00 120.00 ? 3    THR B CB  1 
ATOM   1981 O OG1 . THR B 2 3   ? 0.377   24.364 16.066 1.00 118.63 ? 3    THR B OG1 1 
ATOM   1982 C CG2 . THR B 2 3   ? -0.024  22.744 17.811 1.00 119.32 ? 3    THR B CG2 1 
ATOM   1983 N N   . SER B 2 4   ? 3.039   24.699 16.513 1.00 109.15 ? 4    SER B N   1 
ATOM   1984 C CA  . SER B 2 4   ? 3.832   25.738 17.151 1.00 108.38 ? 4    SER B CA  1 
ATOM   1985 C C   . SER B 2 4   ? 3.456   27.094 16.564 1.00 110.88 ? 4    SER B C   1 
ATOM   1986 O O   . SER B 2 4   ? 3.204   27.210 15.363 1.00 110.66 ? 4    SER B O   1 
ATOM   1987 C CB  . SER B 2 4   ? 5.326   25.472 16.951 1.00 111.87 ? 4    SER B CB  1 
ATOM   1988 O OG  . SER B 2 4   ? 5.703   24.228 17.516 1.00 120.44 ? 4    SER B OG  1 
ATOM   1989 N N   . ARG B 2 5   ? 3.403   28.113 17.417 1.00 105.89 ? 5    ARG B N   1 
ATOM   1990 C CA  . ARG B 2 5   ? 3.055   29.463 16.986 1.00 104.76 ? 5    ARG B CA  1 
ATOM   1991 C C   . ARG B 2 5   ? 3.826   29.906 15.745 1.00 105.79 ? 5    ARG B C   1 
ATOM   1992 O O   . ARG B 2 5   ? 3.433   30.853 15.064 1.00 105.34 ? 5    ARG B O   1 
ATOM   1993 C CB  . ARG B 2 5   ? 3.233   30.460 18.134 1.00 105.53 ? 5    ARG B CB  1 
ATOM   1994 C CG  . ARG B 2 5   ? 4.261   30.037 19.175 1.00 116.88 ? 5    ARG B CG  1 
ATOM   1995 C CD  . ARG B 2 5   ? 4.035   30.761 20.496 1.00 129.12 ? 5    ARG B CD  1 
ATOM   1996 N NE  . ARG B 2 5   ? 4.590   30.025 21.631 1.00 140.08 ? 5    ARG B NE  1 
ATOM   1997 C CZ  . ARG B 2 5   ? 5.749   30.311 22.217 1.00 155.60 ? 5    ARG B CZ  1 
ATOM   1998 N NH1 . ARG B 2 5   ? 6.172   29.586 23.245 1.00 142.35 ? 5    ARG B NH1 1 
ATOM   1999 N NH2 . ARG B 2 5   ? 6.483   31.327 21.782 1.00 143.84 ? 5    ARG B NH2 1 
ATOM   2000 N N   . TYR B 2 6   ? 4.905   29.192 15.440 1.00 100.11 ? 6    TYR B N   1 
ATOM   2001 C CA  . TYR B 2 6   ? 5.694   29.462 14.244 1.00 98.78  ? 6    TYR B CA  1 
ATOM   2002 C C   . TYR B 2 6   ? 5.031   28.853 13.015 1.00 100.38 ? 6    TYR B C   1 
ATOM   2003 O O   . TYR B 2 6   ? 4.375   27.816 13.105 1.00 99.90  ? 6    TYR B O   1 
ATOM   2004 C CB  . TYR B 2 6   ? 7.110   28.904 14.405 1.00 99.66  ? 6    TYR B CB  1 
ATOM   2005 C CG  . TYR B 2 6   ? 7.789   29.354 15.676 1.00 100.95 ? 6    TYR B CG  1 
ATOM   2006 C CD1 . TYR B 2 6   ? 8.779   30.325 15.650 1.00 102.76 ? 6    TYR B CD1 1 
ATOM   2007 C CD2 . TYR B 2 6   ? 7.412   28.833 16.907 1.00 101.55 ? 6    TYR B CD2 1 
ATOM   2008 C CE1 . TYR B 2 6   ? 9.386   30.755 16.813 1.00 103.17 ? 6    TYR B CE1 1 
ATOM   2009 C CE2 . TYR B 2 6   ? 8.014   29.257 18.075 1.00 102.31 ? 6    TYR B CE2 1 
ATOM   2010 C CZ  . TYR B 2 6   ? 8.999   30.218 18.023 1.00 108.46 ? 6    TYR B CZ  1 
ATOM   2011 O OH  . TYR B 2 6   ? 9.599   30.646 19.184 1.00 107.77 ? 6    TYR B OH  1 
ATOM   2012 N N   . GLU B 2 7   ? 5.202   29.507 11.870 1.00 95.15  ? 7    GLU B N   1 
ATOM   2013 C CA  . GLU B 2 7   ? 4.660   29.006 10.612 1.00 93.92  ? 7    GLU B CA  1 
ATOM   2014 C C   . GLU B 2 7   ? 5.775   28.624 9.645  1.00 94.73  ? 7    GLU B C   1 
ATOM   2015 O O   . GLU B 2 7   ? 6.375   29.485 9.001  1.00 94.49  ? 7    GLU B O   1 
ATOM   2016 C CB  . GLU B 2 7   ? 3.736   30.043 9.970  1.00 95.38  ? 7    GLU B CB  1 
ATOM   2017 C CG  . GLU B 2 7   ? 2.419   30.248 10.707 1.00 106.93 ? 7    GLU B CG  1 
ATOM   2018 C CD  . GLU B 2 7   ? 1.532   29.018 10.672 1.00 129.59 ? 7    GLU B CD  1 
ATOM   2019 O OE1 . GLU B 2 7   ? 1.965   27.987 10.114 1.00 126.73 ? 7    GLU B OE1 1 
ATOM   2020 O OE2 . GLU B 2 7   ? 0.399   29.081 11.198 1.00 123.07 ? 7    GLU B OE2 1 
ATOM   2021 N N   . PRO B 2 8   ? 6.072   27.319 9.542  1.00 88.79  ? 8    PRO B N   1 
ATOM   2022 C CA  . PRO B 2 8   ? 7.093   26.826 8.611  1.00 87.68  ? 8    PRO B CA  1 
ATOM   2023 C C   . PRO B 2 8   ? 6.882   27.396 7.215  1.00 89.49  ? 8    PRO B C   1 
ATOM   2024 O O   . PRO B 2 8   ? 5.754   27.700 6.824  1.00 88.85  ? 8    PRO B O   1 
ATOM   2025 C CB  . PRO B 2 8   ? 6.871   25.311 8.613  1.00 89.43  ? 8    PRO B CB  1 
ATOM   2026 C CG  . PRO B 2 8   ? 5.468   25.127 9.077  1.00 94.12  ? 8    PRO B CG  1 
ATOM   2027 C CD  . PRO B 2 8   ? 5.210   26.235 10.043 1.00 89.92  ? 8    PRO B CD  1 
ATOM   2028 N N   . VAL B 2 9   ? 7.969   27.532 6.465  1.00 84.69  ? 9    VAL B N   1 
ATOM   2029 C CA  . VAL B 2 9   ? 7.919   28.215 5.178  1.00 83.84  ? 9    VAL B CA  1 
ATOM   2030 C C   . VAL B 2 9   ? 8.763   27.535 4.102  1.00 86.05  ? 9    VAL B C   1 
ATOM   2031 O O   . VAL B 2 9   ? 8.532   27.729 2.910  1.00 85.74  ? 9    VAL B O   1 
ATOM   2032 C CB  . VAL B 2 9   ? 8.273   29.709 5.324  1.00 87.74  ? 9    VAL B CB  1 
ATOM   2033 C CG1 . VAL B 2 9   ? 8.121   30.427 3.994  1.00 87.62  ? 9    VAL B CG1 1 
ATOM   2034 C CG2 . VAL B 2 9   ? 7.404   30.359 6.395  1.00 87.48  ? 9    VAL B CG2 1 
ATOM   2035 N N   . ALA B 2 10  ? 9.739   26.738 4.524  1.00 81.26  ? 10   ALA B N   1 
ATOM   2036 C CA  . ALA B 2 10  ? 10.585  26.010 3.585  1.00 80.34  ? 10   ALA B CA  1 
ATOM   2037 C C   . ALA B 2 10  ? 11.376  24.911 4.281  1.00 82.44  ? 10   ALA B C   1 
ATOM   2038 O O   . ALA B 2 10  ? 11.396  24.829 5.507  1.00 82.00  ? 10   ALA B O   1 
ATOM   2039 C CB  . ALA B 2 10  ? 11.529  26.964 2.870  1.00 81.03  ? 10   ALA B CB  1 
ATOM   2040 N N   . GLU B 2 11  ? 12.011  24.057 3.486  1.00 77.51  ? 11   GLU B N   1 
ATOM   2041 C CA  . GLU B 2 11  ? 12.913  23.044 4.011  1.00 76.58  ? 11   GLU B CA  1 
ATOM   2042 C C   . GLU B 2 11  ? 14.344  23.489 3.751  1.00 79.97  ? 11   GLU B C   1 
ATOM   2043 O O   . GLU B 2 11  ? 14.650  24.021 2.682  1.00 79.46  ? 11   GLU B O   1 
ATOM   2044 C CB  . GLU B 2 11  ? 12.649  21.697 3.341  1.00 77.80  ? 11   GLU B CB  1 
ATOM   2045 C CG  . GLU B 2 11  ? 13.591  20.591 3.774  1.00 87.48  ? 11   GLU B CG  1 
ATOM   2046 C CD  . GLU B 2 11  ? 13.290  19.273 3.089  1.00 102.12 ? 11   GLU B CD  1 
ATOM   2047 O OE1 . GLU B 2 11  ? 12.096  18.992 2.845  1.00 93.53  ? 11   GLU B OE1 1 
ATOM   2048 O OE2 . GLU B 2 11  ? 14.247  18.519 2.804  1.00 89.11  ? 11   GLU B OE2 1 
ATOM   2049 N N   . ILE B 2 12  ? 15.215  23.306 4.737  1.00 76.23  ? 12   ILE B N   1 
ATOM   2050 C CA  . ILE B 2 12  ? 16.582  23.796 4.618  1.00 75.94  ? 12   ILE B CA  1 
ATOM   2051 C C   . ILE B 2 12  ? 17.626  22.679 4.549  1.00 78.45  ? 12   ILE B C   1 
ATOM   2052 O O   . ILE B 2 12  ? 18.747  22.895 4.088  1.00 77.90  ? 12   ILE B O   1 
ATOM   2053 C CB  . ILE B 2 12  ? 16.896  24.882 5.675  1.00 79.40  ? 12   ILE B CB  1 
ATOM   2054 C CG1 . ILE B 2 12  ? 18.400  25.150 5.778  1.00 79.91  ? 12   ILE B CG1 1 
ATOM   2055 C CG2 . ILE B 2 12  ? 16.264  24.540 7.015  1.00 80.78  ? 12   ILE B CG2 1 
ATOM   2056 C CD1 . ILE B 2 12  ? 18.888  26.273 4.875  1.00 88.53  ? 12   ILE B CD1 1 
ATOM   2057 N N   . GLY B 2 13  ? 17.230  21.469 4.930  1.00 74.13  ? 13   GLY B N   1 
ATOM   2058 C CA  . GLY B 2 13  ? 18.090  20.305 4.805  1.00 73.40  ? 13   GLY B CA  1 
ATOM   2059 C C   . GLY B 2 13  ? 17.553  19.092 5.540  1.00 76.12  ? 13   GLY B C   1 
ATOM   2060 O O   . GLY B 2 13  ? 16.567  19.186 6.275  1.00 75.60  ? 13   GLY B O   1 
ATOM   2061 N N   . VAL B 2 14  ? 18.190  17.944 5.324  1.00 71.87  ? 14   VAL B N   1 
ATOM   2062 C CA  . VAL B 2 14  ? 17.869  16.741 6.088  1.00 71.50  ? 14   VAL B CA  1 
ATOM   2063 C C   . VAL B 2 14  ? 19.131  16.006 6.531  1.00 74.29  ? 14   VAL B C   1 
ATOM   2064 O O   . VAL B 2 14  ? 19.650  15.156 5.807  1.00 74.56  ? 14   VAL B O   1 
ATOM   2065 C CB  . VAL B 2 14  ? 16.899  15.809 5.330  1.00 75.54  ? 14   VAL B CB  1 
ATOM   2066 C CG1 . VAL B 2 14  ? 15.553  16.489 5.131  1.00 75.41  ? 14   VAL B CG1 1 
ATOM   2067 C CG2 . VAL B 2 14  ? 17.495  15.388 3.995  1.00 75.40  ? 14   VAL B CG2 1 
ATOM   2068 N N   . GLY B 2 15  ? 19.614  16.331 7.726  1.00 68.87  ? 15   GLY B N   1 
ATOM   2069 C CA  . GLY B 2 15  ? 20.816  15.728 8.270  1.00 67.64  ? 15   GLY B CA  1 
ATOM   2070 C C   . GLY B 2 15  ? 20.518  14.661 9.302  1.00 69.14  ? 15   GLY B C   1 
ATOM   2071 O O   . GLY B 2 15  ? 19.383  14.194 9.420  1.00 68.20  ? 15   GLY B O   1 
ATOM   2072 N N   . ALA B 2 16  ? 21.540  14.289 10.067 1.00 64.49  ? 16   ALA B N   1 
ATOM   2073 C CA  . ALA B 2 16  ? 21.405  13.267 11.103 1.00 63.61  ? 16   ALA B CA  1 
ATOM   2074 C C   . ALA B 2 16  ? 20.302  13.590 12.115 1.00 64.61  ? 16   ALA B C   1 
ATOM   2075 O O   . ALA B 2 16  ? 19.692  12.687 12.695 1.00 63.63  ? 16   ALA B O   1 
ATOM   2076 C CB  . ALA B 2 16  ? 22.736  13.055 11.815 1.00 64.43  ? 16   ALA B CB  1 
ATOM   2077 N N   . TYR B 2 17  ? 20.047  14.878 12.319 1.00 59.24  ? 17   TYR B N   1 
ATOM   2078 C CA  . TYR B 2 17  ? 19.028  15.307 13.267 1.00 58.19  ? 17   TYR B CA  1 
ATOM   2079 C C   . TYR B 2 17  ? 17.669  15.495 12.610 1.00 60.97  ? 17   TYR B C   1 
ATOM   2080 O O   . TYR B 2 17  ? 16.744  16.047 13.206 1.00 59.68  ? 17   TYR B O   1 
ATOM   2081 C CB  . TYR B 2 17  ? 19.482  16.558 14.018 1.00 58.93  ? 17   TYR B CB  1 
ATOM   2082 C CG  . TYR B 2 17  ? 20.712  16.298 14.852 1.00 59.75  ? 17   TYR B CG  1 
ATOM   2083 C CD1 . TYR B 2 17  ? 20.717  15.287 15.802 1.00 61.66  ? 17   TYR B CD1 1 
ATOM   2084 C CD2 . TYR B 2 17  ? 21.893  16.988 14.625 1.00 60.22  ? 17   TYR B CD2 1 
ATOM   2085 C CE1 . TYR B 2 17  ? 21.846  15.007 16.541 1.00 61.97  ? 17   TYR B CE1 1 
ATOM   2086 C CE2 . TYR B 2 17  ? 23.029  16.718 15.363 1.00 60.83  ? 17   TYR B CE2 1 
ATOM   2087 C CZ  . TYR B 2 17  ? 22.997  15.725 16.320 1.00 66.44  ? 17   TYR B CZ  1 
ATOM   2088 O OH  . TYR B 2 17  ? 24.117  15.446 17.061 1.00 66.29  ? 17   TYR B OH  1 
ATOM   2089 N N   . GLY B 2 18  ? 17.539  14.971 11.397 1.00 58.11  ? 18   GLY B N   1 
ATOM   2090 C CA  . GLY B 2 18  ? 16.260  14.893 10.722 1.00 58.31  ? 18   GLY B CA  1 
ATOM   2091 C C   . GLY B 2 18  ? 16.028  16.027 9.747  1.00 63.46  ? 18   GLY B C   1 
ATOM   2092 O O   . GLY B 2 18  ? 16.970  16.574 9.172  1.00 62.43  ? 18   GLY B O   1 
ATOM   2093 N N   . THR B 2 19  ? 14.759  16.383 9.571  1.00 61.70  ? 19   THR B N   1 
ATOM   2094 C CA  . THR B 2 19  ? 14.379  17.437 8.641  1.00 62.24  ? 19   THR B CA  1 
ATOM   2095 C C   . THR B 2 19  ? 14.277  18.810 9.299  1.00 66.42  ? 19   THR B C   1 
ATOM   2096 O O   . THR B 2 19  ? 13.441  19.033 10.176 1.00 66.03  ? 19   THR B O   1 
ATOM   2097 C CB  . THR B 2 19  ? 13.105  17.070 7.866  1.00 72.04  ? 19   THR B CB  1 
ATOM   2098 O OG1 . THR B 2 19  ? 13.418  16.063 6.897  1.00 74.22  ? 19   THR B OG1 1 
ATOM   2099 C CG2 . THR B 2 19  ? 12.536  18.290 7.163  1.00 70.25  ? 19   THR B CG2 1 
ATOM   2100 N N   . VAL B 2 20  ? 15.129  19.725 8.848  1.00 63.16  ? 20   VAL B N   1 
ATOM   2101 C CA  . VAL B 2 20  ? 15.185  21.081 9.377  1.00 63.20  ? 20   VAL B CA  1 
ATOM   2102 C C   . VAL B 2 20  ? 14.337  22.010 8.517  1.00 68.23  ? 20   VAL B C   1 
ATOM   2103 O O   . VAL B 2 20  ? 14.632  22.217 7.343  1.00 68.08  ? 20   VAL B O   1 
ATOM   2104 C CB  . VAL B 2 20  ? 16.647  21.583 9.435  1.00 66.91  ? 20   VAL B CB  1 
ATOM   2105 C CG1 . VAL B 2 20  ? 16.715  22.996 9.995  1.00 66.70  ? 20   VAL B CG1 1 
ATOM   2106 C CG2 . VAL B 2 20  ? 17.520  20.625 10.240 1.00 66.59  ? 20   VAL B CG2 1 
ATOM   2107 N N   . TYR B 2 21  ? 13.293  22.577 9.107  1.00 65.73  ? 21   TYR B N   1 
ATOM   2108 C CA  . TYR B 2 21  ? 12.443  23.520 8.397  1.00 66.20  ? 21   TYR B CA  1 
ATOM   2109 C C   . TYR B 2 21  ? 12.811  24.957 8.724  1.00 71.14  ? 21   TYR B C   1 
ATOM   2110 O O   . TYR B 2 21  ? 13.603  25.221 9.627  1.00 70.55  ? 21   TYR B O   1 
ATOM   2111 C CB  . TYR B 2 21  ? 10.972  23.277 8.724  1.00 68.02  ? 21   TYR B CB  1 
ATOM   2112 C CG  . TYR B 2 21  ? 10.461  21.946 8.240  1.00 71.51  ? 21   TYR B CG  1 
ATOM   2113 C CD1 . TYR B 2 21  ? 10.820  21.454 6.991  1.00 73.94  ? 21   TYR B CD1 1 
ATOM   2114 C CD2 . TYR B 2 21  ? 9.620   21.174 9.032  1.00 72.84  ? 21   TYR B CD2 1 
ATOM   2115 C CE1 . TYR B 2 21  ? 10.352  20.229 6.541  1.00 75.41  ? 21   TYR B CE1 1 
ATOM   2116 C CE2 . TYR B 2 21  ? 9.149   19.946 8.593  1.00 74.04  ? 21   TYR B CE2 1 
ATOM   2117 C CZ  . TYR B 2 21  ? 9.523   19.476 7.350  1.00 82.49  ? 21   TYR B CZ  1 
ATOM   2118 O OH  . TYR B 2 21  ? 9.058   18.257 6.910  1.00 84.23  ? 21   TYR B OH  1 
ATOM   2119 N N   . LYS B 2 22  ? 12.233  25.884 7.973  1.00 68.71  ? 22   LYS B N   1 
ATOM   2120 C CA  . LYS B 2 22  ? 12.431  27.303 8.218  1.00 68.57  ? 22   LYS B CA  1 
ATOM   2121 C C   . LYS B 2 22  ? 11.066  27.949 8.384  1.00 73.55  ? 22   LYS B C   1 
ATOM   2122 O O   . LYS B 2 22  ? 10.253  27.931 7.468  1.00 73.10  ? 22   LYS B O   1 
ATOM   2123 C CB  . LYS B 2 22  ? 13.198  27.935 7.058  1.00 70.45  ? 22   LYS B CB  1 
ATOM   2124 C CG  . LYS B 2 22  ? 13.397  29.435 7.166  1.00 82.60  ? 22   LYS B CG  1 
ATOM   2125 C CD  . LYS B 2 22  ? 14.321  29.921 6.060  1.00 92.12  ? 22   LYS B CD  1 
ATOM   2126 C CE  . LYS B 2 22  ? 14.306  31.435 5.925  1.00 100.68 ? 22   LYS B CE  1 
ATOM   2127 N NZ  . LYS B 2 22  ? 15.087  31.882 4.736  1.00 106.24 ? 22   LYS B NZ  1 
ATOM   2128 N N   . ALA B 2 23  ? 10.782  28.409 9.598  1.00 71.43  ? 23   ALA B N   1 
ATOM   2129 C CA  . ALA B 2 23  ? 9.496   29.015 9.919  1.00 71.84  ? 23   ALA B CA  1 
ATOM   2130 C C   . ALA B 2 23  ? 9.672   30.500 10.190 1.00 78.16  ? 23   ALA B C   1 
ATOM   2131 O O   . ALA B 2 23  ? 10.795  30.994 10.287 1.00 77.21  ? 23   ALA B O   1 
ATOM   2132 C CB  . ALA B 2 23  ? 8.877   28.330 11.130 1.00 72.38  ? 23   ALA B CB  1 
ATOM   2133 N N   . ARG B 2 24  ? 8.556   31.212 10.301 1.00 77.48  ? 24   ARG B N   1 
ATOM   2134 C CA  . ARG B 2 24  ? 8.594   32.613 10.686 1.00 78.76  ? 24   ARG B CA  1 
ATOM   2135 C C   . ARG B 2 24  ? 7.930   32.809 12.043 1.00 85.37  ? 24   ARG B C   1 
ATOM   2136 O O   . ARG B 2 24  ? 6.926   32.165 12.352 1.00 84.56  ? 24   ARG B O   1 
ATOM   2137 C CB  . ARG B 2 24  ? 7.922   33.495 9.629  1.00 80.47  ? 24   ARG B CB  1 
ATOM   2138 C CG  . ARG B 2 24  ? 6.404   33.370 9.576  1.00 95.49  ? 24   ARG B CG  1 
ATOM   2139 C CD  . ARG B 2 24  ? 5.779   34.564 8.867  1.00 109.51 ? 24   ARG B CD  1 
ATOM   2140 N NE  . ARG B 2 24  ? 6.113   35.820 9.534  1.00 122.68 ? 24   ARG B NE  1 
ATOM   2141 C CZ  . ARG B 2 24  ? 5.734   37.020 9.107  1.00 140.00 ? 24   ARG B CZ  1 
ATOM   2142 N NH1 . ARG B 2 24  ? 5.004   37.136 8.005  1.00 129.07 ? 24   ARG B NH1 1 
ATOM   2143 N NH2 . ARG B 2 24  ? 6.088   38.107 9.782  1.00 127.69 ? 24   ARG B NH2 1 
ATOM   2144 N N   . ASP B 2 25  ? 8.534   33.661 12.867 1.00 84.38  ? 25   ASP B N   1 
ATOM   2145 C CA  . ASP B 2 25  ? 7.974   34.022 14.164 1.00 85.26  ? 25   ASP B CA  1 
ATOM   2146 C C   . ASP B 2 25  ? 7.007   35.190 13.996 1.00 92.17  ? 25   ASP B C   1 
ATOM   2147 O O   . ASP B 2 25  ? 7.420   36.346 13.896 1.00 91.80  ? 25   ASP B O   1 
ATOM   2148 C CB  . ASP B 2 25  ? 9.097   34.401 15.134 1.00 86.90  ? 25   ASP B CB  1 
ATOM   2149 C CG  . ASP B 2 25  ? 8.591   34.657 16.540 1.00 94.35  ? 25   ASP B CG  1 
ATOM   2150 O OD1 . ASP B 2 25  ? 7.362   34.586 16.752 1.00 94.37  ? 25   ASP B OD1 1 
ATOM   2151 O OD2 . ASP B 2 25  ? 9.425   34.927 17.430 1.00 99.29  ? 25   ASP B OD2 1 
ATOM   2152 N N   . PRO B 2 26  ? 5.701   34.893 13.944 1.00 91.18  ? 26   PRO B N   1 
ATOM   2153 C CA  . PRO B 2 26  ? 4.641   35.864 13.648 1.00 91.87  ? 26   PRO B CA  1 
ATOM   2154 C C   . PRO B 2 26  ? 4.733   37.142 14.479 1.00 97.68  ? 26   PRO B C   1 
ATOM   2155 O O   . PRO B 2 26  ? 5.007   38.219 13.946 1.00 97.14  ? 26   PRO B O   1 
ATOM   2156 C CB  . PRO B 2 26  ? 3.366   35.091 13.987 1.00 93.59  ? 26   PRO B CB  1 
ATOM   2157 C CG  . PRO B 2 26  ? 3.716   33.671 13.692 1.00 97.87  ? 26   PRO B CG  1 
ATOM   2158 C CD  . PRO B 2 26  ? 5.179   33.518 14.044 1.00 93.21  ? 26   PRO B CD  1 
ATOM   2159 N N   . HIS B 2 27  ? 4.495   37.016 15.781 1.00 95.77  ? 27   HIS B N   1 
ATOM   2160 C CA  . HIS B 2 27  ? 4.486   38.169 16.675 1.00 96.24  ? 27   HIS B CA  1 
ATOM   2161 C C   . HIS B 2 27  ? 5.880   38.772 16.816 1.00 100.08 ? 27   HIS B C   1 
ATOM   2162 O O   . HIS B 2 27  ? 6.087   39.718 17.580 1.00 99.74  ? 27   HIS B O   1 
ATOM   2163 C CB  . HIS B 2 27  ? 3.971   37.766 18.055 1.00 97.42  ? 27   HIS B CB  1 
ATOM   2164 C CG  . HIS B 2 27  ? 5.044   37.264 18.971 1.00 101.15 ? 27   HIS B CG  1 
ATOM   2165 N ND1 . HIS B 2 27  ? 5.797   36.145 18.692 1.00 103.06 ? 27   HIS B ND1 1 
ATOM   2166 C CD2 . HIS B 2 27  ? 5.509   37.750 20.147 1.00 103.12 ? 27   HIS B CD2 1 
ATOM   2167 C CE1 . HIS B 2 27  ? 6.671   35.952 19.665 1.00 102.58 ? 27   HIS B CE1 1 
ATOM   2168 N NE2 . HIS B 2 27  ? 6.516   36.910 20.560 1.00 102.94 ? 27   HIS B NE2 1 
ATOM   2169 N N   . SER B 2 28  ? 6.842   38.197 16.101 1.00 96.31  ? 28   SER B N   1 
ATOM   2170 C CA  . SER B 2 28  ? 8.214   38.690 16.133 1.00 95.77  ? 28   SER B CA  1 
ATOM   2171 C C   . SER B 2 28  ? 8.680   39.099 14.741 1.00 97.99  ? 28   SER B C   1 
ATOM   2172 O O   . SER B 2 28  ? 9.605   39.897 14.598 1.00 97.35  ? 28   SER B O   1 
ATOM   2173 C CB  . SER B 2 28  ? 9.151   37.629 16.711 1.00 99.78  ? 28   SER B CB  1 
ATOM   2174 O OG  . SER B 2 28  ? 10.499  38.063 16.668 1.00 109.56 ? 28   SER B OG  1 
ATOM   2175 N N   . GLY B 2 29  ? 8.019   38.565 13.718 1.00 93.51  ? 29   GLY B N   1 
ATOM   2176 C CA  . GLY B 2 29  ? 8.367   38.852 12.340 1.00 92.83  ? 29   GLY B CA  1 
ATOM   2177 C C   . GLY B 2 29  ? 9.829   38.561 12.071 1.00 95.66  ? 29   GLY B C   1 
ATOM   2178 O O   . GLY B 2 29  ? 10.578  39.435 11.634 1.00 95.51  ? 29   GLY B O   1 
ATOM   2179 N N   . HIS B 2 30  ? 10.246  37.338 12.379 1.00 91.06  ? 30   HIS B N   1 
ATOM   2180 C CA  . HIS B 2 30  ? 11.615  36.905 12.125 1.00 90.16  ? 30   HIS B CA  1 
ATOM   2181 C C   . HIS B 2 30  ? 11.635  35.446 11.698 1.00 90.11  ? 30   HIS B C   1 
ATOM   2182 O O   . HIS B 2 30  ? 10.653  34.728 11.872 1.00 89.63  ? 30   HIS B O   1 
ATOM   2183 C CB  . HIS B 2 30  ? 12.481  37.087 13.373 1.00 91.51  ? 30   HIS B CB  1 
ATOM   2184 C CG  . HIS B 2 30  ? 12.689  38.518 13.762 1.00 95.44  ? 30   HIS B CG  1 
ATOM   2185 N ND1 . HIS B 2 30  ? 13.389  39.407 12.978 1.00 97.45  ? 30   HIS B ND1 1 
ATOM   2186 C CD2 . HIS B 2 30  ? 12.293  39.208 14.858 1.00 97.62  ? 30   HIS B CD2 1 
ATOM   2187 C CE1 . HIS B 2 30  ? 13.415  40.588 13.573 1.00 97.09  ? 30   HIS B CE1 1 
ATOM   2188 N NE2 . HIS B 2 30  ? 12.755  40.495 14.712 1.00 97.48  ? 30   HIS B NE2 1 
ATOM   2189 N N   . PHE B 2 31  ? 12.769  35.006 11.165 1.00 83.92  ? 31   PHE B N   1 
ATOM   2190 C CA  . PHE B 2 31  ? 12.916  33.629 10.713 1.00 82.51  ? 31   PHE B CA  1 
ATOM   2191 C C   . PHE B 2 31  ? 13.378  32.686 11.815 1.00 82.37  ? 31   PHE B C   1 
ATOM   2192 O O   . PHE B 2 31  ? 14.088  33.083 12.742 1.00 81.94  ? 31   PHE B O   1 
ATOM   2193 C CB  . PHE B 2 31  ? 13.860  33.548 9.513  1.00 84.61  ? 31   PHE B CB  1 
ATOM   2194 C CG  . PHE B 2 31  ? 13.304  34.167 8.267  1.00 86.56  ? 31   PHE B CG  1 
ATOM   2195 C CD1 . PHE B 2 31  ? 12.348  33.504 7.517  1.00 89.65  ? 31   PHE B CD1 1 
ATOM   2196 C CD2 . PHE B 2 31  ? 13.711  35.428 7.864  1.00 89.10  ? 31   PHE B CD2 1 
ATOM   2197 C CE1 . PHE B 2 31  ? 11.822  34.079 6.379  1.00 90.58  ? 31   PHE B CE1 1 
ATOM   2198 C CE2 . PHE B 2 31  ? 13.189  36.007 6.724  1.00 91.88  ? 31   PHE B CE2 1 
ATOM   2199 C CZ  . PHE B 2 31  ? 12.243  35.332 5.982  1.00 89.77  ? 31   PHE B CZ  1 
ATOM   2200 N N   . VAL B 2 32  ? 12.988  31.423 11.681 1.00 75.48  ? 32   VAL B N   1 
ATOM   2201 C CA  . VAL B 2 32  ? 13.317  30.396 12.657 1.00 73.35  ? 32   VAL B CA  1 
ATOM   2202 C C   . VAL B 2 32  ? 13.814  29.142 11.943 1.00 72.59  ? 32   VAL B C   1 
ATOM   2203 O O   . VAL B 2 32  ? 13.597  28.978 10.742 1.00 71.94  ? 32   VAL B O   1 
ATOM   2204 C CB  . VAL B 2 32  ? 12.107  30.102 13.561 1.00 77.29  ? 32   VAL B CB  1 
ATOM   2205 C CG1 . VAL B 2 32  ? 12.117  28.660 14.019 1.00 77.30  ? 32   VAL B CG1 1 
ATOM   2206 C CG2 . VAL B 2 32  ? 12.097  31.047 14.754 1.00 77.07  ? 32   VAL B CG2 1 
ATOM   2207 N N   . ALA B 2 33  ? 14.525  28.286 12.672 1.00 65.55  ? 33   ALA B N   1 
ATOM   2208 C CA  . ALA B 2 33  ? 15.018  27.027 12.121 1.00 63.33  ? 33   ALA B CA  1 
ATOM   2209 C C   . ALA B 2 33  ? 14.663  25.838 13.011 1.00 63.21  ? 33   ALA B C   1 
ATOM   2210 O O   . ALA B 2 33  ? 15.485  25.383 13.806 1.00 63.44  ? 33   ALA B O   1 
ATOM   2211 C CB  . ALA B 2 33  ? 16.519  27.097 11.899 1.00 63.86  ? 33   ALA B CB  1 
ATOM   2212 N N   . LEU B 2 34  ? 13.453  25.312 12.838 1.00 56.04  ? 34   LEU B N   1 
ATOM   2213 C CA  . LEU B 2 34  ? 12.972  24.178 13.622 1.00 54.09  ? 34   LEU B CA  1 
ATOM   2214 C C   . LEU B 2 34  ? 13.676  22.861 13.287 1.00 55.82  ? 34   LEU B C   1 
ATOM   2215 O O   . LEU B 2 34  ? 13.877  22.535 12.120 1.00 56.18  ? 34   LEU B O   1 
ATOM   2216 C CB  . LEU B 2 34  ? 11.471  24.000 13.414 1.00 53.72  ? 34   LEU B CB  1 
ATOM   2217 C CG  . LEU B 2 34  ? 10.640  25.276 13.324 1.00 57.77  ? 34   LEU B CG  1 
ATOM   2218 C CD1 . LEU B 2 34  ? 9.197   24.925 13.028 1.00 57.78  ? 34   LEU B CD1 1 
ATOM   2219 C CD2 . LEU B 2 34  ? 10.745  26.065 14.611 1.00 59.67  ? 34   LEU B CD2 1 
ATOM   2220 N N   . LYS B 2 35  ? 14.080  22.132 14.324 1.00 49.59  ? 35   LYS B N   1 
ATOM   2221 C CA  . LYS B 2 35  ? 14.418  20.716 14.212 1.00 47.91  ? 35   LYS B CA  1 
ATOM   2222 C C   . LYS B 2 35  ? 13.454  19.956 15.103 1.00 50.15  ? 35   LYS B C   1 
ATOM   2223 O O   . LYS B 2 35  ? 12.690  20.560 15.857 1.00 49.66  ? 35   LYS B O   1 
ATOM   2224 C CB  . LYS B 2 35  ? 15.843  20.461 14.695 1.00 50.01  ? 35   LYS B CB  1 
ATOM   2225 C CG  . LYS B 2 35  ? 16.901  20.848 13.696 1.00 61.82  ? 35   LYS B CG  1 
ATOM   2226 C CD  . LYS B 2 35  ? 18.210  21.160 14.380 1.00 68.27  ? 35   LYS B CD  1 
ATOM   2227 C CE  . LYS B 2 35  ? 18.975  22.190 13.579 1.00 79.96  ? 35   LYS B CE  1 
ATOM   2228 N NZ  . LYS B 2 35  ? 19.702  21.572 12.437 1.00 92.70  ? 35   LYS B NZ  1 
ATOM   2229 N N   . SER B 2 36  ? 13.492  18.633 15.044 1.00 45.97  ? 36   SER B N   1 
ATOM   2230 C CA  . SER B 2 36  ? 12.645  17.851 15.938 1.00 45.49  ? 36   SER B CA  1 
ATOM   2231 C C   . SER B 2 36  ? 13.317  16.601 16.490 1.00 46.99  ? 36   SER B C   1 
ATOM   2232 O O   . SER B 2 36  ? 14.283  16.093 15.916 1.00 45.49  ? 36   SER B O   1 
ATOM   2233 C CB  . SER B 2 36  ? 11.300  17.526 15.293 1.00 49.30  ? 36   SER B CB  1 
ATOM   2234 O OG  . SER B 2 36  ? 10.288  17.448 16.280 1.00 58.96  ? 36   SER B OG  1 
ATOM   2235 N N   . VAL B 2 37  ? 12.833  16.148 17.641 1.00 43.03  ? 37   VAL B N   1 
ATOM   2236 C CA  . VAL B 2 37  ? 13.450  15.025 18.338 1.00 42.34  ? 37   VAL B CA  1 
ATOM   2237 C C   . VAL B 2 37  ? 12.395  14.163 18.996 1.00 46.20  ? 37   VAL B C   1 
ATOM   2238 O O   . VAL B 2 37  ? 11.457  14.675 19.608 1.00 45.82  ? 37   VAL B O   1 
ATOM   2239 C CB  . VAL B 2 37  ? 14.494  15.495 19.376 1.00 45.59  ? 37   VAL B CB  1 
ATOM   2240 C CG1 . VAL B 2 37  ? 13.820  16.287 20.485 1.00 45.24  ? 37   VAL B CG1 1 
ATOM   2241 C CG2 . VAL B 2 37  ? 15.243  14.305 19.953 1.00 45.13  ? 37   VAL B CG2 1 
ATOM   2242 N N   . ARG B 2 38  ? 12.537  12.851 18.837 1.00 43.03  ? 38   ARG B N   1 
ATOM   2243 C CA  . ARG B 2 38  ? 11.726  11.898 19.587 1.00 42.79  ? 38   ARG B CA  1 
ATOM   2244 C C   . ARG B 2 38  ? 12.493  11.538 20.856 1.00 43.70  ? 38   ARG B C   1 
ATOM   2245 O O   . ARG B 2 38  ? 13.659  11.140 20.798 1.00 42.07  ? 38   ARG B O   1 
ATOM   2246 C CB  . ARG B 2 38  ? 11.441  10.638 18.755 1.00 46.05  ? 38   ARG B CB  1 
ATOM   2247 C CG  . ARG B 2 38  ? 10.808  10.897 17.383 1.00 64.76  ? 38   ARG B CG  1 
ATOM   2248 C CD  . ARG B 2 38  ? 9.436   11.561 17.510 1.00 86.75  ? 38   ARG B CD  1 
ATOM   2249 N NE  . ARG B 2 38  ? 8.355   10.592 17.687 1.00 105.04 ? 38   ARG B NE  1 
ATOM   2250 C CZ  . ARG B 2 38  ? 7.423   10.337 16.773 1.00 123.70 ? 38   ARG B CZ  1 
ATOM   2251 N NH1 . ARG B 2 38  ? 7.427   10.991 15.618 1.00 111.59 ? 38   ARG B NH1 1 
ATOM   2252 N NH2 . ARG B 2 38  ? 6.476   9.438  17.017 1.00 111.65 ? 38   ARG B NH2 1 
ATOM   2253 N N   . VAL B 2 39  ? 11.872  11.798 22.001 1.00 39.52  ? 39   VAL B N   1 
ATOM   2254 C CA  . VAL B 2 39  ? 12.489  11.509 23.291 1.00 38.54  ? 39   VAL B CA  1 
ATOM   2255 C C   . VAL B 2 39  ? 11.679  10.471 24.037 1.00 42.59  ? 39   VAL B C   1 
ATOM   2256 O O   . VAL B 2 39  ? 10.447  10.441 23.955 1.00 41.62  ? 39   VAL B O   1 
ATOM   2257 C CB  . VAL B 2 39  ? 12.696  12.777 24.144 1.00 41.17  ? 39   VAL B CB  1 
ATOM   2258 C CG1 . VAL B 2 39  ? 13.505  13.804 23.382 1.00 40.56  ? 39   VAL B CG1 1 
ATOM   2259 C CG2 . VAL B 2 39  ? 11.369  13.346 24.578 1.00 40.72  ? 39   VAL B CG2 1 
ATOM   2260 N N   . PRO B 2 40  ? 12.370  9.587  24.762 1.00 40.73  ? 40   PRO B N   1 
ATOM   2261 C CA  . PRO B 2 40  ? 11.704  8.483  25.455 1.00 41.02  ? 40   PRO B CA  1 
ATOM   2262 C C   . PRO B 2 40  ? 10.904  8.991  26.640 1.00 47.94  ? 40   PRO B C   1 
ATOM   2263 O O   . PRO B 2 40  ? 11.407  9.768  27.457 1.00 47.83  ? 40   PRO B O   1 
ATOM   2264 C CB  . PRO B 2 40  ? 12.867  7.599  25.915 1.00 42.59  ? 40   PRO B CB  1 
ATOM   2265 C CG  . PRO B 2 40  ? 14.066  8.507  25.947 1.00 47.02  ? 40   PRO B CG  1 
ATOM   2266 C CD  . PRO B 2 40  ? 13.840  9.514  24.857 1.00 42.64  ? 40   PRO B CD  1 
ATOM   2267 N N   . ASN B 2 41  ? 9.625   8.632  26.659 1.00 45.98  ? 41   ASN B N   1 
ATOM   2268 C CA  . ASN B 2 41  ? 8.744   8.919  27.781 1.00 46.35  ? 41   ASN B CA  1 
ATOM   2269 C C   . ASN B 2 41  ? 8.861   7.786  28.803 1.00 53.58  ? 41   ASN B C   1 
ATOM   2270 O O   . ASN B 2 41  ? 8.961   6.615  28.436 1.00 54.40  ? 41   ASN B O   1 
ATOM   2271 C CB  . ASN B 2 41  ? 7.301   9.021  27.278 1.00 45.08  ? 41   ASN B CB  1 
ATOM   2272 C CG  . ASN B 2 41  ? 6.365   9.635  28.299 1.00 61.85  ? 41   ASN B CG  1 
ATOM   2273 O OD1 . ASN B 2 41  ? 6.785   10.037 29.386 1.00 54.55  ? 41   ASN B OD1 1 
ATOM   2274 N ND2 . ASN B 2 41  ? 5.089   9.737  27.940 1.00 51.87  ? 41   ASN B ND2 1 
ATOM   2275 N N   . GLY B 2 42  ? 8.865   8.131  30.084 1.00 51.01  ? 42   GLY B N   1 
ATOM   2276 C CA  . GLY B 2 42  ? 8.914   7.134  31.136 1.00 50.96  ? 42   GLY B CA  1 
ATOM   2277 C C   . GLY B 2 42  ? 7.803   7.317  32.150 1.00 54.86  ? 42   GLY B C   1 
ATOM   2278 O O   . GLY B 2 42  ? 6.864   8.078  31.928 1.00 54.67  ? 42   GLY B O   1 
ATOM   2279 N N   . GLU B 2 43  ? 7.905   6.608  33.266 1.00 51.07  ? 43   GLU B N   1 
ATOM   2280 C CA  . GLU B 2 43  ? 6.933   6.750  34.336 1.00 51.09  ? 43   GLU B CA  1 
ATOM   2281 C C   . GLU B 2 43  ? 7.381   7.906  35.224 1.00 54.11  ? 43   GLU B C   1 
ATOM   2282 O O   . GLU B 2 43  ? 6.683   8.324  36.150 1.00 53.07  ? 43   GLU B O   1 
ATOM   2283 C CB  . GLU B 2 43  ? 6.841   5.449  35.134 1.00 52.86  ? 43   GLU B CB  1 
ATOM   2284 C CG  . GLU B 2 43  ? 5.446   5.162  35.663 1.00 69.65  ? 43   GLU B CG  1 
ATOM   2285 C CD  . GLU B 2 43  ? 5.035   3.717  35.455 1.00 103.92 ? 43   GLU B CD  1 
ATOM   2286 O OE1 . GLU B 2 43  ? 5.905   2.828  35.575 1.00 107.22 ? 43   GLU B OE1 1 
ATOM   2287 O OE2 . GLU B 2 43  ? 3.847   3.474  35.150 1.00 103.64 ? 43   GLU B OE2 1 
ATOM   2288 N N   . GLU B 2 44  ? 8.535   8.458  34.874 1.00 50.09  ? 44   GLU B N   1 
ATOM   2289 C CA  . GLU B 2 44  ? 9.110   9.587  35.585 1.00 48.85  ? 44   GLU B CA  1 
ATOM   2290 C C   . GLU B 2 44  ? 9.096   10.807 34.662 1.00 49.13  ? 44   GLU B C   1 
ATOM   2291 O O   . GLU B 2 44  ? 9.661   11.853 34.983 1.00 48.96  ? 44   GLU B O   1 
ATOM   2292 C CB  . GLU B 2 44  ? 10.542  9.252  35.988 1.00 50.25  ? 44   GLU B CB  1 
ATOM   2293 C CG  . GLU B 2 44  ? 10.919  9.749  37.361 1.00 61.89  ? 44   GLU B CG  1 
ATOM   2294 C CD  . GLU B 2 44  ? 10.052  9.161  38.449 1.00 76.59  ? 44   GLU B CD  1 
ATOM   2295 O OE1 . GLU B 2 44  ? 9.493   8.066  38.243 1.00 64.44  ? 44   GLU B OE1 1 
ATOM   2296 O OE2 . GLU B 2 44  ? 9.944   9.788  39.520 1.00 73.25  ? 44   GLU B OE2 1 
ATOM   2297 N N   . GLY B 2 45  ? 8.482   10.645 33.494 1.00 42.28  ? 48   GLY B N   1 
ATOM   2298 C CA  . GLY B 2 45  ? 8.246   11.741 32.577 1.00 40.77  ? 48   GLY B CA  1 
ATOM   2299 C C   . GLY B 2 45  ? 9.418   12.024 31.663 1.00 42.48  ? 48   GLY B C   1 
ATOM   2300 O O   . GLY B 2 45  ? 10.131  11.120 31.233 1.00 42.04  ? 48   GLY B O   1 
ATOM   2301 N N   . LEU B 2 46  ? 9.600   13.299 31.352 1.00 37.62  ? 49   LEU B N   1 
ATOM   2302 C CA  . LEU B 2 46  ? 10.710  13.748 30.534 1.00 36.48  ? 49   LEU B CA  1 
ATOM   2303 C C   . LEU B 2 46  ? 12.045  13.183 31.020 1.00 40.91  ? 49   LEU B C   1 
ATOM   2304 O O   . LEU B 2 46  ? 12.353  13.206 32.212 1.00 40.33  ? 49   LEU B O   1 
ATOM   2305 C CB  . LEU B 2 46  ? 10.755  15.277 30.519 1.00 36.07  ? 49   LEU B CB  1 
ATOM   2306 C CG  . LEU B 2 46  ? 9.676   16.023 29.729 1.00 39.96  ? 49   LEU B CG  1 
ATOM   2307 C CD1 . LEU B 2 46  ? 9.755   17.515 30.004 1.00 39.39  ? 49   LEU B CD1 1 
ATOM   2308 C CD2 . LEU B 2 46  ? 9.840   15.751 28.237 1.00 41.91  ? 49   LEU B CD2 1 
ATOM   2309 N N   . PRO B 2 47  ? 12.879  12.714 30.084 1.00 37.91  ? 50   PRO B N   1 
ATOM   2310 C CA  . PRO B 2 47  ? 14.222  12.239 30.426 1.00 37.64  ? 50   PRO B CA  1 
ATOM   2311 C C   . PRO B 2 47  ? 15.117  13.349 30.980 1.00 41.82  ? 50   PRO B C   1 
ATOM   2312 O O   . PRO B 2 47  ? 15.392  14.339 30.307 1.00 40.16  ? 50   PRO B O   1 
ATOM   2313 C CB  . PRO B 2 47  ? 14.765  11.715 29.087 1.00 39.32  ? 50   PRO B CB  1 
ATOM   2314 C CG  . PRO B 2 47  ? 13.846  12.277 28.031 1.00 43.73  ? 50   PRO B CG  1 
ATOM   2315 C CD  . PRO B 2 47  ? 12.517  12.385 28.695 1.00 39.26  ? 50   PRO B CD  1 
ATOM   2316 N N   . ILE B 2 48  ? 15.626  13.119 32.187 1.00 39.97  ? 51   ILE B N   1 
ATOM   2317 C CA  . ILE B 2 48  ? 16.448  14.076 32.928 1.00 40.48  ? 51   ILE B CA  1 
ATOM   2318 C C   . ILE B 2 48  ? 17.574  14.730 32.137 1.00 43.47  ? 51   ILE B C   1 
ATOM   2319 O O   . ILE B 2 48  ? 17.779  15.941 32.220 1.00 42.77  ? 51   ILE B O   1 
ATOM   2320 C CB  . ILE B 2 48  ? 17.032  13.411 34.188 1.00 44.51  ? 51   ILE B CB  1 
ATOM   2321 C CG1 . ILE B 2 48  ? 16.198  12.184 34.569 1.00 45.96  ? 51   ILE B CG1 1 
ATOM   2322 C CG2 . ILE B 2 48  ? 17.130  14.410 35.332 1.00 45.78  ? 51   ILE B CG2 1 
ATOM   2323 C CD1 . ILE B 2 48  ? 14.702  12.473 34.722 1.00 56.54  ? 51   ILE B CD1 1 
ATOM   2324 N N   . SER B 2 49  ? 18.411  13.905 31.525 1.00 40.25  ? 52   SER B N   1 
ATOM   2325 C CA  . SER B 2 49  ? 19.614  14.404 30.881 1.00 40.51  ? 52   SER B CA  1 
ATOM   2326 C C   . SER B 2 49  ? 19.249  15.220 29.651 1.00 43.33  ? 52   SER B C   1 
ATOM   2327 O O   . SER B 2 49  ? 19.908  16.211 29.333 1.00 43.39  ? 52   SER B O   1 
ATOM   2328 C CB  . SER B 2 49  ? 20.574  13.258 30.535 1.00 45.57  ? 52   SER B CB  1 
ATOM   2329 O OG  . SER B 2 49  ? 19.871  12.138 30.026 1.00 58.45  ? 52   SER B OG  1 
ATOM   2330 N N   . THR B 2 50  ? 18.146  14.843 29.018 1.00 38.40  ? 53   THR B N   1 
ATOM   2331 C CA  . THR B 2 50  ? 17.583  15.612 27.918 1.00 38.40  ? 53   THR B CA  1 
ATOM   2332 C C   . THR B 2 50  ? 17.067  16.977 28.385 1.00 41.81  ? 53   THR B C   1 
ATOM   2333 O O   . THR B 2 50  ? 17.539  18.021 27.930 1.00 41.53  ? 53   THR B O   1 
ATOM   2334 C CB  . THR B 2 50  ? 16.492  14.804 27.192 1.00 49.58  ? 53   THR B CB  1 
ATOM   2335 O OG1 . THR B 2 50  ? 17.102  13.893 26.264 1.00 49.67  ? 53   THR B OG1 1 
ATOM   2336 C CG2 . THR B 2 50  ? 15.533  15.726 26.463 1.00 48.82  ? 53   THR B CG2 1 
ATOM   2337 N N   . VAL B 2 51  ? 16.119  16.974 29.314 1.00 38.08  ? 54   VAL B N   1 
ATOM   2338 C CA  . VAL B 2 51  ? 15.624  18.226 29.860 1.00 37.83  ? 54   VAL B CA  1 
ATOM   2339 C C   . VAL B 2 51  ? 16.749  19.097 30.417 1.00 40.51  ? 54   VAL B C   1 
ATOM   2340 O O   . VAL B 2 51  ? 16.761  20.309 30.212 1.00 39.27  ? 54   VAL B O   1 
ATOM   2341 C CB  . VAL B 2 51  ? 14.433  18.029 30.824 1.00 41.67  ? 54   VAL B CB  1 
ATOM   2342 C CG1 . VAL B 2 51  ? 14.586  16.757 31.616 1.00 41.53  ? 54   VAL B CG1 1 
ATOM   2343 C CG2 . VAL B 2 51  ? 14.264  19.244 31.738 1.00 41.38  ? 54   VAL B CG2 1 
ATOM   2344 N N   . ARG B 2 52  ? 17.755  18.454 31.006 1.00 37.08  ? 55   ARG B N   1 
ATOM   2345 C CA  . ARG B 2 52  ? 18.955  19.153 31.469 1.00 36.65  ? 55   ARG B CA  1 
ATOM   2346 C C   . ARG B 2 52  ? 19.796  19.696 30.311 1.00 38.60  ? 55   ARG B C   1 
ATOM   2347 O O   . ARG B 2 52  ? 20.213  20.855 30.321 1.00 37.32  ? 55   ARG B O   1 
ATOM   2348 C CB  . ARG B 2 52  ? 19.814  18.233 32.348 1.00 38.61  ? 55   ARG B CB  1 
ATOM   2349 C CG  . ARG B 2 52  ? 19.414  18.194 33.820 1.00 48.49  ? 55   ARG B CG  1 
ATOM   2350 C CD  . ARG B 2 52  ? 20.597  17.804 34.721 1.00 57.09  ? 55   ARG B CD  1 
ATOM   2351 N NE  . ARG B 2 52  ? 20.843  16.363 34.756 1.00 63.38  ? 55   ARG B NE  1 
ATOM   2352 C CZ  . ARG B 2 52  ? 20.480  15.561 35.754 1.00 76.12  ? 55   ARG B CZ  1 
ATOM   2353 N NH1 . ARG B 2 52  ? 19.856  16.059 36.812 1.00 63.89  ? 55   ARG B NH1 1 
ATOM   2354 N NH2 . ARG B 2 52  ? 20.746  14.261 35.698 1.00 61.73  ? 55   ARG B NH2 1 
ATOM   2355 N N   . GLU B 2 53  ? 20.095  18.831 29.347 1.00 34.92  ? 56   GLU B N   1 
ATOM   2356 C CA  . GLU B 2 53  ? 20.846  19.231 28.164 1.00 34.82  ? 56   GLU B CA  1 
ATOM   2357 C C   . GLU B 2 53  ? 20.183  20.416 27.472 1.00 36.87  ? 56   GLU B C   1 
ATOM   2358 O O   . GLU B 2 53  ? 20.801  21.465 27.301 1.00 36.40  ? 56   GLU B O   1 
ATOM   2359 C CB  . GLU B 2 53  ? 20.984  18.057 27.192 1.00 36.76  ? 56   GLU B CB  1 
ATOM   2360 C CG  . GLU B 2 53  ? 21.983  16.989 27.631 1.00 54.15  ? 56   GLU B CG  1 
ATOM   2361 C CD  . GLU B 2 53  ? 21.698  15.633 26.998 1.00 92.02  ? 56   GLU B CD  1 
ATOM   2362 O OE1 . GLU B 2 53  ? 21.136  15.599 25.882 1.00 104.45 ? 56   GLU B OE1 1 
ATOM   2363 O OE2 . GLU B 2 53  ? 22.028  14.601 27.619 1.00 89.73  ? 56   GLU B OE2 1 
ATOM   2364 N N   . VAL B 2 54  ? 18.920  20.259 27.088 1.00 32.46  ? 57   VAL B N   1 
ATOM   2365 C CA  . VAL B 2 54  ? 18.185  21.368 26.480 1.00 32.06  ? 57   VAL B CA  1 
ATOM   2366 C C   . VAL B 2 54  ? 18.295  22.656 27.286 1.00 34.84  ? 57   VAL B C   1 
ATOM   2367 O O   . VAL B 2 54  ? 18.569  23.721 26.728 1.00 33.50  ? 57   VAL B O   1 
ATOM   2368 C CB  . VAL B 2 54  ? 16.717  21.030 26.220 1.00 35.55  ? 57   VAL B CB  1 
ATOM   2369 C CG1 . VAL B 2 54  ? 15.973  22.281 25.785 1.00 35.11  ? 57   VAL B CG1 1 
ATOM   2370 C CG2 . VAL B 2 54  ? 16.601  19.923 25.175 1.00 35.30  ? 57   VAL B CG2 1 
ATOM   2371 N N   . ALA B 2 55  ? 18.090  22.554 28.597 1.00 31.61  ? 58   ALA B N   1 
ATOM   2372 C CA  . ALA B 2 55  ? 18.015  23.740 29.442 1.00 31.71  ? 58   ALA B CA  1 
ATOM   2373 C C   . ALA B 2 55  ? 19.323  24.520 29.426 1.00 37.07  ? 58   ALA B C   1 
ATOM   2374 O O   . ALA B 2 55  ? 19.326  25.746 29.425 1.00 36.13  ? 58   ALA B O   1 
ATOM   2375 C CB  . ALA B 2 55  ? 17.616  23.370 30.852 1.00 32.25  ? 58   ALA B CB  1 
ATOM   2376 N N   . LEU B 2 56  ? 20.435  23.802 29.346 1.00 35.99  ? 59   LEU B N   1 
ATOM   2377 C CA  . LEU B 2 56  ? 21.737  24.442 29.229 1.00 36.70  ? 59   LEU B CA  1 
ATOM   2378 C C   . LEU B 2 56  ? 21.947  25.080 27.863 1.00 41.70  ? 59   LEU B C   1 
ATOM   2379 O O   . LEU B 2 56  ? 22.636  26.089 27.741 1.00 41.41  ? 59   LEU B O   1 
ATOM   2380 C CB  . LEU B 2 56  ? 22.854  23.459 29.571 1.00 37.01  ? 59   LEU B CB  1 
ATOM   2381 C CG  . LEU B 2 56  ? 22.828  23.142 31.069 1.00 42.02  ? 59   LEU B CG  1 
ATOM   2382 C CD1 . LEU B 2 56  ? 23.705  21.957 31.436 1.00 41.97  ? 59   LEU B CD1 1 
ATOM   2383 C CD2 . LEU B 2 56  ? 23.193  24.389 31.878 1.00 43.74  ? 59   LEU B CD2 1 
ATOM   2384 N N   . LEU B 2 57  ? 21.324  24.505 26.839 1.00 38.92  ? 60   LEU B N   1 
ATOM   2385 C CA  . LEU B 2 57  ? 21.304  25.122 25.514 1.00 38.33  ? 60   LEU B CA  1 
ATOM   2386 C C   . LEU B 2 57  ? 20.512  26.432 25.522 1.00 41.56  ? 60   LEU B C   1 
ATOM   2387 O O   . LEU B 2 57  ? 20.977  27.443 24.994 1.00 40.64  ? 60   LEU B O   1 
ATOM   2388 C CB  . LEU B 2 57  ? 20.746  24.150 24.468 1.00 38.03  ? 60   LEU B CB  1 
ATOM   2389 C CG  . LEU B 2 57  ? 21.629  22.927 24.222 1.00 42.32  ? 60   LEU B CG  1 
ATOM   2390 C CD1 . LEU B 2 57  ? 20.994  21.962 23.233 1.00 42.17  ? 60   LEU B CD1 1 
ATOM   2391 C CD2 . LEU B 2 57  ? 23.013  23.364 23.758 1.00 44.17  ? 60   LEU B CD2 1 
ATOM   2392 N N   . ARG B 2 58  ? 19.322  26.409 26.125 1.00 37.77  ? 61   ARG B N   1 
ATOM   2393 C CA  . ARG B 2 58  ? 18.502  27.613 26.270 1.00 37.07  ? 61   ARG B CA  1 
ATOM   2394 C C   . ARG B 2 58  ? 19.253  28.700 27.033 1.00 42.41  ? 61   ARG B C   1 
ATOM   2395 O O   . ARG B 2 58  ? 19.209  29.870 26.666 1.00 41.80  ? 61   ARG B O   1 
ATOM   2396 C CB  . ARG B 2 58  ? 17.181  27.298 26.978 1.00 33.65  ? 61   ARG B CB  1 
ATOM   2397 C CG  . ARG B 2 58  ? 16.186  26.510 26.146 1.00 36.18  ? 61   ARG B CG  1 
ATOM   2398 C CD  . ARG B 2 58  ? 15.462  27.384 25.119 1.00 35.18  ? 61   ARG B CD  1 
ATOM   2399 N NE  . ARG B 2 58  ? 14.611  28.393 25.743 1.00 32.88  ? 61   ARG B NE  1 
ATOM   2400 C CZ  . ARG B 2 58  ? 14.834  29.702 25.673 1.00 41.93  ? 61   ARG B CZ  1 
ATOM   2401 N NH1 . ARG B 2 58  ? 15.869  30.161 24.987 1.00 29.83  ? 61   ARG B NH1 1 
ATOM   2402 N NH2 . ARG B 2 58  ? 14.021  30.552 26.285 1.00 26.72  ? 61   ARG B NH2 1 
ATOM   2403 N N   . ARG B 2 59  ? 19.887  28.317 28.135 1.00 40.93  ? 62   ARG B N   1 
ATOM   2404 C CA  . ARG B 2 59  ? 20.796  29.217 28.828 1.00 41.56  ? 62   ARG B CA  1 
ATOM   2405 C C   . ARG B 2 59  ? 22.196  29.035 28.279 1.00 48.57  ? 62   ARG B C   1 
ATOM   2406 O O   . ARG B 2 59  ? 22.946  28.143 28.699 1.00 50.97  ? 62   ARG B O   1 
ATOM   2407 C CB  . ARG B 2 59  ? 20.792  28.974 30.330 1.00 41.15  ? 62   ARG B CB  1 
ATOM   2408 C CG  . ARG B 2 59  ? 21.828  29.817 31.060 1.00 48.88  ? 62   ARG B CG  1 
ATOM   2409 C CD  . ARG B 2 59  ? 23.029  28.985 31.472 1.00 55.80  ? 62   ARG B CD  1 
ATOM   2410 N NE  . ARG B 2 59  ? 22.940  28.628 32.881 1.00 61.03  ? 62   ARG B NE  1 
ATOM   2411 C CZ  . ARG B 2 59  ? 23.826  27.880 33.525 1.00 71.24  ? 62   ARG B CZ  1 
ATOM   2412 N NH1 . ARG B 2 59  ? 24.872  27.381 32.879 1.00 47.02  ? 62   ARG B NH1 1 
ATOM   2413 N NH2 . ARG B 2 59  ? 23.655  27.628 34.818 1.00 63.34  ? 62   ARG B NH2 1 
ATOM   2414 N N   . LEU B 2 60  ? 22.534  29.888 27.327 1.00 43.37  ? 63   LEU B N   1 
ATOM   2415 C CA  . LEU B 2 60  ? 23.789  29.805 26.601 1.00 42.36  ? 63   LEU B CA  1 
ATOM   2416 C C   . LEU B 2 60  ? 23.622  30.947 25.620 1.00 45.16  ? 63   LEU B C   1 
ATOM   2417 O O   . LEU B 2 60  ? 24.571  31.618 25.244 1.00 44.74  ? 63   LEU B O   1 
ATOM   2418 C CB  . LEU B 2 60  ? 23.881  28.459 25.882 1.00 42.28  ? 63   LEU B CB  1 
ATOM   2419 C CG  . LEU B 2 60  ? 25.265  27.838 25.670 1.00 46.97  ? 63   LEU B CG  1 
ATOM   2420 C CD1 . LEU B 2 60  ? 25.788  28.117 24.268 1.00 47.18  ? 63   LEU B CD1 1 
ATOM   2421 C CD2 . LEU B 2 60  ? 26.248  28.340 26.718 1.00 48.29  ? 63   LEU B CD2 1 
ATOM   2422 N N   . GLU B 2 61  ? 22.357  31.253 25.366 1.00 42.01  ? 64   GLU B N   1 
ATOM   2423 C CA  . GLU B 2 61  ? 21.935  32.491 24.724 1.00 42.38  ? 64   GLU B CA  1 
ATOM   2424 C C   . GLU B 2 61  ? 22.422  33.700 25.533 1.00 48.59  ? 64   GLU B C   1 
ATOM   2425 O O   . GLU B 2 61  ? 22.846  34.712 24.974 1.00 48.67  ? 64   GLU B O   1 
ATOM   2426 C CB  . GLU B 2 61  ? 20.407  32.507 24.690 1.00 43.42  ? 64   GLU B CB  1 
ATOM   2427 C CG  . GLU B 2 61  ? 19.792  33.082 23.445 1.00 50.06  ? 64   GLU B CG  1 
ATOM   2428 C CD  . GLU B 2 61  ? 18.281  33.073 23.511 1.00 65.73  ? 64   GLU B CD  1 
ATOM   2429 O OE1 . GLU B 2 61  ? 17.732  33.117 24.634 1.00 61.49  ? 64   GLU B OE1 1 
ATOM   2430 O OE2 . GLU B 2 61  ? 17.642  33.024 22.442 1.00 59.91  ? 64   GLU B OE2 1 
ATOM   2431 N N   . ALA B 2 62  ? 22.336  33.594 26.854 1.00 46.25  ? 65   ALA B N   1 
ATOM   2432 C CA  . ALA B 2 62  ? 22.647  34.712 27.737 1.00 46.16  ? 65   ALA B CA  1 
ATOM   2433 C C   . ALA B 2 62  ? 24.080  35.209 27.559 1.00 50.54  ? 65   ALA B C   1 
ATOM   2434 O O   . ALA B 2 62  ? 24.400  36.348 27.912 1.00 50.38  ? 65   ALA B O   1 
ATOM   2435 C CB  . ALA B 2 62  ? 22.390  34.328 29.182 1.00 46.71  ? 65   ALA B CB  1 
ATOM   2436 N N   . PHE B 2 63  ? 24.938  34.350 27.013 1.00 46.50  ? 66   PHE B N   1 
ATOM   2437 C CA  . PHE B 2 63  ? 26.339  34.698 26.807 1.00 45.78  ? 66   PHE B CA  1 
ATOM   2438 C C   . PHE B 2 63  ? 26.504  35.622 25.610 1.00 51.04  ? 66   PHE B C   1 
ATOM   2439 O O   . PHE B 2 63  ? 27.455  36.401 25.543 1.00 51.16  ? 66   PHE B O   1 
ATOM   2440 C CB  . PHE B 2 63  ? 27.196  33.442 26.629 1.00 47.06  ? 66   PHE B CB  1 
ATOM   2441 C CG  . PHE B 2 63  ? 27.474  32.704 27.912 1.00 48.09  ? 66   PHE B CG  1 
ATOM   2442 C CD1 . PHE B 2 63  ? 26.616  31.711 28.359 1.00 50.40  ? 66   PHE B CD1 1 
ATOM   2443 C CD2 . PHE B 2 63  ? 28.608  32.987 28.658 1.00 49.78  ? 66   PHE B CD2 1 
ATOM   2444 C CE1 . PHE B 2 63  ? 26.878  31.019 29.523 1.00 51.02  ? 66   PHE B CE1 1 
ATOM   2445 C CE2 . PHE B 2 63  ? 28.879  32.295 29.827 1.00 52.23  ? 66   PHE B CE2 1 
ATOM   2446 C CZ  . PHE B 2 63  ? 28.011  31.309 30.258 1.00 50.21  ? 66   PHE B CZ  1 
ATOM   2447 N N   . GLU B 2 64  ? 25.569  35.540 24.668 1.00 48.23  ? 67   GLU B N   1 
ATOM   2448 C CA  . GLU B 2 64  ? 25.602  36.392 23.484 1.00 48.48  ? 67   GLU B CA  1 
ATOM   2449 C C   . GLU B 2 64  ? 26.879  36.244 22.666 1.00 53.35  ? 67   GLU B C   1 
ATOM   2450 O O   . GLU B 2 64  ? 27.336  37.207 22.053 1.00 53.92  ? 67   GLU B O   1 
ATOM   2451 C CB  . GLU B 2 64  ? 25.411  37.859 23.870 1.00 49.84  ? 67   GLU B CB  1 
ATOM   2452 C CG  . GLU B 2 64  ? 23.961  38.301 23.941 1.00 61.29  ? 67   GLU B CG  1 
ATOM   2453 C CD  . GLU B 2 64  ? 23.800  39.663 24.584 1.00 78.32  ? 67   GLU B CD  1 
ATOM   2454 O OE1 . GLU B 2 64  ? 24.477  39.923 25.600 1.00 53.33  ? 67   GLU B OE1 1 
ATOM   2455 O OE2 . GLU B 2 64  ? 22.983  40.465 24.086 1.00 80.85  ? 67   GLU B OE2 1 
ATOM   2456 N N   . HIS B 2 65  ? 27.463  35.051 22.654 1.00 49.63  ? 68   HIS B N   1 
ATOM   2457 C CA  . HIS B 2 65  ? 28.622  34.816 21.803 1.00 49.28  ? 68   HIS B CA  1 
ATOM   2458 C C   . HIS B 2 65  ? 28.200  34.861 20.337 1.00 53.29  ? 68   HIS B C   1 
ATOM   2459 O O   . HIS B 2 65  ? 27.158  34.318 19.962 1.00 53.47  ? 68   HIS B O   1 
ATOM   2460 C CB  . HIS B 2 65  ? 29.284  33.480 22.124 1.00 49.93  ? 68   HIS B CB  1 
ATOM   2461 C CG  . HIS B 2 65  ? 30.721  33.407 21.708 1.00 53.18  ? 68   HIS B CG  1 
ATOM   2462 N ND1 . HIS B 2 65  ? 31.113  33.018 20.446 1.00 54.85  ? 68   HIS B ND1 1 
ATOM   2463 C CD2 . HIS B 2 65  ? 31.859  33.692 22.385 1.00 54.60  ? 68   HIS B CD2 1 
ATOM   2464 C CE1 . HIS B 2 65  ? 32.432  33.052 20.367 1.00 54.08  ? 68   HIS B CE1 1 
ATOM   2465 N NE2 . HIS B 2 65  ? 32.908  33.455 21.530 1.00 54.38  ? 68   HIS B NE2 1 
ATOM   2466 N N   . PRO B 2 66  ? 29.002  35.528 19.492 1.00 48.92  ? 69   PRO B N   1 
ATOM   2467 C CA  . PRO B 2 66  ? 28.718  35.767 18.070 1.00 48.09  ? 69   PRO B CA  1 
ATOM   2468 C C   . PRO B 2 66  ? 28.774  34.503 17.210 1.00 49.55  ? 69   PRO B C   1 
ATOM   2469 O O   . PRO B 2 66  ? 27.980  34.341 16.281 1.00 47.71  ? 69   PRO B O   1 
ATOM   2470 C CB  . PRO B 2 66  ? 29.836  36.729 17.653 1.00 49.88  ? 69   PRO B CB  1 
ATOM   2471 C CG  . PRO B 2 66  ? 30.974  36.385 18.554 1.00 54.65  ? 69   PRO B CG  1 
ATOM   2472 C CD  . PRO B 2 66  ? 30.361  35.963 19.870 1.00 50.41  ? 69   PRO B CD  1 
ATOM   2473 N N   . ASN B 2 67  ? 29.676  33.591 17.564 1.00 45.49  ? 70   ASN B N   1 
ATOM   2474 C CA  . ASN B 2 67  ? 30.039  32.481 16.691 1.00 44.94  ? 70   ASN B CA  1 
ATOM   2475 C C   . ASN B 2 67  ? 29.268  31.198 16.963 1.00 49.47  ? 70   ASN B C   1 
ATOM   2476 O O   . ASN B 2 67  ? 29.752  30.104 16.676 1.00 48.94  ? 70   ASN B O   1 
ATOM   2477 C CB  . ASN B 2 67  ? 31.543  32.226 16.770 1.00 43.43  ? 70   ASN B CB  1 
ATOM   2478 C CG  . ASN B 2 67  ? 32.354  33.466 16.453 1.00 68.68  ? 70   ASN B CG  1 
ATOM   2479 O OD1 . ASN B 2 67  ? 31.984  34.253 15.582 1.00 62.00  ? 70   ASN B OD1 1 
ATOM   2480 N ND2 . ASN B 2 67  ? 33.446  33.666 17.182 1.00 64.02  ? 70   ASN B ND2 1 
ATOM   2481 N N   . VAL B 2 68  ? 28.041  31.342 17.453 1.00 46.79  ? 71   VAL B N   1 
ATOM   2482 C CA  . VAL B 2 68  ? 27.209  30.193 17.811 1.00 46.37  ? 71   VAL B CA  1 
ATOM   2483 C C   . VAL B 2 68  ? 25.735  30.583 17.714 1.00 49.64  ? 71   VAL B C   1 
ATOM   2484 O O   . VAL B 2 68  ? 25.349  31.658 18.168 1.00 49.60  ? 71   VAL B O   1 
ATOM   2485 C CB  . VAL B 2 68  ? 27.568  29.675 19.229 1.00 50.25  ? 71   VAL B CB  1 
ATOM   2486 C CG1 . VAL B 2 68  ? 26.377  29.007 19.874 1.00 50.33  ? 71   VAL B CG1 1 
ATOM   2487 C CG2 . VAL B 2 68  ? 28.752  28.713 19.172 1.00 49.88  ? 71   VAL B CG2 1 
ATOM   2488 N N   . VAL B 2 69  ? 24.927  29.743 17.068 1.00 45.24  ? 72   VAL B N   1 
ATOM   2489 C CA  . VAL B 2 69  ? 23.488  29.992 16.982 1.00 44.63  ? 72   VAL B CA  1 
ATOM   2490 C C   . VAL B 2 69  ? 22.812  29.868 18.347 1.00 47.19  ? 72   VAL B C   1 
ATOM   2491 O O   . VAL B 2 69  ? 23.332  29.218 19.249 1.00 46.31  ? 72   VAL B O   1 
ATOM   2492 C CB  . VAL B 2 69  ? 22.793  29.106 15.922 1.00 48.85  ? 72   VAL B CB  1 
ATOM   2493 C CG1 . VAL B 2 69  ? 23.265  29.467 14.524 1.00 48.85  ? 72   VAL B CG1 1 
ATOM   2494 C CG2 . VAL B 2 69  ? 23.025  27.628 16.210 1.00 48.69  ? 72   VAL B CG2 1 
ATOM   2495 N N   . ARG B 2 70  ? 21.641  30.482 18.477 1.00 43.06  ? 73   ARG B N   1 
ATOM   2496 C CA  . ARG B 2 70  ? 20.899  30.485 19.729 1.00 42.75  ? 73   ARG B CA  1 
ATOM   2497 C C   . ARG B 2 70  ? 19.748  29.491 19.683 1.00 46.05  ? 73   ARG B C   1 
ATOM   2498 O O   . ARG B 2 70  ? 19.043  29.400 18.679 1.00 46.22  ? 73   ARG B O   1 
ATOM   2499 C CB  . ARG B 2 70  ? 20.307  31.874 19.976 1.00 43.53  ? 73   ARG B CB  1 
ATOM   2500 C CG  . ARG B 2 70  ? 21.315  32.995 20.166 1.00 54.38  ? 73   ARG B CG  1 
ATOM   2501 C CD  . ARG B 2 70  ? 20.620  34.341 20.001 1.00 64.73  ? 73   ARG B CD  1 
ATOM   2502 N NE  . ARG B 2 70  ? 19.284  34.333 20.596 1.00 74.81  ? 73   ARG B NE  1 
ATOM   2503 C CZ  . ARG B 2 70  ? 18.356  35.260 20.377 1.00 90.80  ? 73   ARG B CZ  1 
ATOM   2504 N NH1 . ARG B 2 70  ? 17.171  35.166 20.966 1.00 75.77  ? 73   ARG B NH1 1 
ATOM   2505 N NH2 . ARG B 2 70  ? 18.607  36.279 19.565 1.00 81.72  ? 73   ARG B NH2 1 
ATOM   2506 N N   . LEU B 2 71  ? 19.518  28.796 20.794 1.00 41.19  ? 74   LEU B N   1 
ATOM   2507 C CA  . LEU B 2 71  ? 18.265  28.068 20.988 1.00 39.88  ? 74   LEU B CA  1 
ATOM   2508 C C   . LEU B 2 71  ? 17.275  29.014 21.643 1.00 44.43  ? 74   LEU B C   1 
ATOM   2509 O O   . LEU B 2 71  ? 17.393  29.347 22.821 1.00 44.38  ? 74   LEU B O   1 
ATOM   2510 C CB  . LEU B 2 71  ? 18.461  26.818 21.856 1.00 39.21  ? 74   LEU B CB  1 
ATOM   2511 C CG  . LEU B 2 71  ? 17.221  25.932 22.019 1.00 42.59  ? 74   LEU B CG  1 
ATOM   2512 C CD1 . LEU B 2 71  ? 16.788  25.341 20.688 1.00 42.09  ? 74   LEU B CD1 1 
ATOM   2513 C CD2 . LEU B 2 71  ? 17.468  24.837 23.025 1.00 43.82  ? 74   LEU B CD2 1 
ATOM   2514 N N   . MET B 2 72  ? 16.298  29.450 20.866 1.00 41.83  ? 75   MET B N   1 
ATOM   2515 C CA  . MET B 2 72  ? 15.449  30.552 21.266 1.00 41.61  ? 75   MET B CA  1 
ATOM   2516 C C   . MET B 2 72  ? 14.158  30.081 21.902 1.00 43.00  ? 75   MET B C   1 
ATOM   2517 O O   . MET B 2 72  ? 13.485  30.850 22.587 1.00 42.90  ? 75   MET B O   1 
ATOM   2518 C CB  . MET B 2 72  ? 15.155  31.447 20.062 1.00 44.61  ? 75   MET B CB  1 
ATOM   2519 C CG  . MET B 2 72  ? 16.401  31.862 19.294 1.00 49.27  ? 75   MET B CG  1 
ATOM   2520 S SD  . MET B 2 72  ? 16.073  33.235 18.180 1.00 54.66  ? 75   MET B SD  1 
ATOM   2521 C CE  . MET B 2 72  ? 14.472  32.731 17.507 1.00 51.30  ? 75   MET B CE  1 
ATOM   2522 N N   . ASP B 2 73  ? 13.821  28.810 21.704 1.00 37.39  ? 76   ASP B N   1 
ATOM   2523 C CA  . ASP B 2 73  ? 12.551  28.295 22.207 1.00 36.20  ? 76   ASP B CA  1 
ATOM   2524 C C   . ASP B 2 73  ? 12.469  26.784 22.020 1.00 39.58  ? 76   ASP B C   1 
ATOM   2525 O O   . ASP B 2 73  ? 13.107  26.223 21.131 1.00 38.35  ? 76   ASP B O   1 
ATOM   2526 C CB  . ASP B 2 73  ? 11.391  28.993 21.488 1.00 37.71  ? 76   ASP B CB  1 
ATOM   2527 C CG  . ASP B 2 73  ? 10.055  28.790 22.181 1.00 49.57  ? 76   ASP B CG  1 
ATOM   2528 O OD1 . ASP B 2 73  ? 10.027  28.221 23.289 1.00 50.66  ? 76   ASP B OD1 1 
ATOM   2529 O OD2 . ASP B 2 73  ? 9.024   29.204 21.614 1.00 56.43  ? 76   ASP B OD2 1 
ATOM   2530 N N   . VAL B 2 74  ? 11.709  26.127 22.887 1.00 37.27  ? 77   VAL B N   1 
ATOM   2531 C CA  . VAL B 2 74  ? 11.561  24.676 22.837 1.00 37.60  ? 77   VAL B CA  1 
ATOM   2532 C C   . VAL B 2 74  ? 10.131  24.326 23.207 1.00 43.71  ? 77   VAL B C   1 
ATOM   2533 O O   . VAL B 2 74  ? 9.536   24.961 24.079 1.00 42.31  ? 77   VAL B O   1 
ATOM   2534 C CB  . VAL B 2 74  ? 12.561  23.968 23.785 1.00 40.96  ? 77   VAL B CB  1 
ATOM   2535 C CG1 . VAL B 2 74  ? 12.338  22.464 23.777 1.00 40.52  ? 77   VAL B CG1 1 
ATOM   2536 C CG2 . VAL B 2 74  ? 13.993  24.307 23.413 1.00 40.64  ? 77   VAL B CG2 1 
ATOM   2537 N N   . CYS B 2 75  ? 9.589   23.301 22.561 1.00 43.19  ? 78   CYS B N   1 
ATOM   2538 C CA  . CYS B 2 75  ? 8.195   22.941 22.774 1.00 44.52  ? 78   CYS B CA  1 
ATOM   2539 C C   . CYS B 2 75  ? 7.960   21.448 22.603 1.00 50.24  ? 78   CYS B C   1 
ATOM   2540 O O   . CYS B 2 75  ? 8.307   20.869 21.570 1.00 49.85  ? 78   CYS B O   1 
ATOM   2541 C CB  . CYS B 2 75  ? 7.286   23.730 21.821 1.00 45.32  ? 78   CYS B CB  1 
ATOM   2542 S SG  . CYS B 2 75  ? 5.514   23.629 22.201 1.00 49.59  ? 78   CYS B SG  1 
ATOM   2543 N N   . ALA B 2 76  ? 7.380   20.832 23.630 1.00 48.08  ? 79   ALA B N   1 
ATOM   2544 C CA  . ALA B 2 76  ? 6.851   19.476 23.522 1.00 48.22  ? 79   ALA B CA  1 
ATOM   2545 C C   . ALA B 2 76  ? 5.470   19.523 22.869 1.00 53.32  ? 79   ALA B C   1 
ATOM   2546 O O   . ALA B 2 76  ? 4.509   20.010 23.462 1.00 52.50  ? 79   ALA B O   1 
ATOM   2547 C CB  . ALA B 2 76  ? 6.772   18.824 24.895 1.00 48.71  ? 79   ALA B CB  1 
ATOM   2548 N N   . THR B 2 77  ? 5.382   19.017 21.644 1.00 51.66  ? 80   THR B N   1 
ATOM   2549 C CA  . THR B 2 77  ? 4.146   19.086 20.865 1.00 52.17  ? 80   THR B CA  1 
ATOM   2550 C C   . THR B 2 77  ? 3.253   17.861 21.045 1.00 58.09  ? 80   THR B C   1 
ATOM   2551 O O   . THR B 2 77  ? 2.036   17.989 21.159 1.00 57.44  ? 80   THR B O   1 
ATOM   2552 C CB  . THR B 2 77  ? 4.429   19.359 19.375 1.00 56.02  ? 80   THR B CB  1 
ATOM   2553 O OG1 . THR B 2 77  ? 5.325   18.363 18.862 1.00 52.62  ? 80   THR B OG1 1 
ATOM   2554 C CG2 . THR B 2 77  ? 5.043   20.744 19.194 1.00 53.22  ? 80   THR B CG2 1 
ATOM   2555 N N   . SER B 2 78  ? 3.862   16.679 21.092 1.00 56.52  ? 81   SER B N   1 
ATOM   2556 C CA  . SER B 2 78  ? 3.104   15.438 21.217 1.00 57.29  ? 81   SER B CA  1 
ATOM   2557 C C   . SER B 2 78  ? 3.527   14.566 22.401 1.00 62.49  ? 81   SER B C   1 
ATOM   2558 O O   . SER B 2 78  ? 4.714   14.308 22.612 1.00 61.47  ? 81   SER B O   1 
ATOM   2559 C CB  . SER B 2 78  ? 3.187   14.628 19.919 1.00 61.46  ? 81   SER B CB  1 
ATOM   2560 O OG  . SER B 2 78  ? 2.842   13.269 20.141 1.00 71.33  ? 81   SER B OG  1 
ATOM   2561 N N   . ARG B 2 79  ? 2.536   14.060 23.128 1.00 60.75  ? 82   ARG B N   1 
ATOM   2562 C CA  . ARG B 2 79  ? 2.778   13.083 24.181 1.00 61.20  ? 82   ARG B CA  1 
ATOM   2563 C C   . ARG B 2 79  ? 2.130   11.748 23.836 1.00 67.50  ? 82   ARG B C   1 
ATOM   2564 O O   . ARG B 2 79  ? 0.941   11.686 23.524 1.00 67.23  ? 82   ARG B O   1 
ATOM   2565 C CB  . ARG B 2 79  ? 2.221   13.579 25.517 1.00 60.39  ? 82   ARG B CB  1 
ATOM   2566 C CG  . ARG B 2 79  ? 2.535   12.664 26.686 1.00 71.65  ? 82   ARG B CG  1 
ATOM   2567 C CD  . ARG B 2 79  ? 1.863   13.141 27.964 1.00 85.36  ? 82   ARG B CD  1 
ATOM   2568 N NE  . ARG B 2 79  ? 2.313   12.390 29.133 1.00 95.50  ? 82   ARG B NE  1 
ATOM   2569 C CZ  . ARG B 2 79  ? 1.757   12.478 30.338 1.00 110.66 ? 82   ARG B CZ  1 
ATOM   2570 N NH1 . ARG B 2 79  ? 0.721   13.282 30.535 1.00 98.53  ? 82   ARG B NH1 1 
ATOM   2571 N NH2 . ARG B 2 79  ? 2.231   11.756 31.344 1.00 97.58  ? 82   ARG B NH2 1 
ATOM   2572 N N   . THR B 2 80  ? 2.910   10.676 23.924 1.00 65.35  ? 83   THR B N   1 
ATOM   2573 C CA  . THR B 2 80  ? 2.357   9.329  23.853 1.00 65.73  ? 83   THR B CA  1 
ATOM   2574 C C   . THR B 2 80  ? 2.348   8.704  25.250 1.00 69.93  ? 83   THR B C   1 
ATOM   2575 O O   . THR B 2 80  ? 1.634   9.163  26.149 1.00 69.42  ? 83   THR B O   1 
ATOM   2576 C CB  . THR B 2 80  ? 3.135   8.457  22.841 1.00 75.25  ? 83   THR B CB  1 
ATOM   2577 O OG1 . THR B 2 80  ? 3.034   9.040  21.537 1.00 77.44  ? 83   THR B OG1 1 
ATOM   2578 C CG2 . THR B 2 80  ? 2.572   7.047  22.794 1.00 73.80  ? 83   THR B CG2 1 
ATOM   2579 N N   . ASP B 2 81  ? 3.144   7.652  25.413 1.00 65.93  ? 84   ASP B N   1 
ATOM   2580 C CA  . ASP B 2 81  ? 3.355   7.004  26.700 1.00 65.34  ? 84   ASP B CA  1 
ATOM   2581 C C   . ASP B 2 81  ? 4.710   6.333  26.601 1.00 66.92  ? 84   ASP B C   1 
ATOM   2582 O O   . ASP B 2 81  ? 5.304   5.935  27.604 1.00 66.70  ? 84   ASP B O   1 
ATOM   2583 C CB  . ASP B 2 81  ? 2.272   5.954  26.965 1.00 67.56  ? 84   ASP B CB  1 
ATOM   2584 C CG  . ASP B 2 81  ? 0.973   6.566  27.463 1.00 82.02  ? 84   ASP B CG  1 
ATOM   2585 O OD1 . ASP B 2 81  ? 0.980   7.757  27.843 1.00 83.45  ? 84   ASP B OD1 1 
ATOM   2586 O OD2 . ASP B 2 81  ? -0.051  5.849  27.496 1.00 88.76  ? 84   ASP B OD2 1 
ATOM   2587 N N   . ARG B 2 82  ? 5.205   6.252  25.371 1.00 61.15  ? 85   ARG B N   1 
ATOM   2588 C CA  . ARG B 2 82  ? 6.514   5.688  25.099 1.00 59.83  ? 85   ARG B CA  1 
ATOM   2589 C C   . ARG B 2 82  ? 7.451   6.778  24.581 1.00 60.39  ? 85   ARG B C   1 
ATOM   2590 O O   . ARG B 2 82  ? 8.657   6.743  24.835 1.00 59.96  ? 85   ARG B O   1 
ATOM   2591 C CB  . ARG B 2 82  ? 6.386   4.564  24.072 1.00 61.41  ? 85   ARG B CB  1 
ATOM   2592 C CG  . ARG B 2 82  ? 7.483   3.522  24.145 1.00 76.34  ? 85   ARG B CG  1 
ATOM   2593 C CD  . ARG B 2 82  ? 6.954   2.158  23.735 1.00 92.45  ? 85   ARG B CD  1 
ATOM   2594 N NE  . ARG B 2 82  ? 7.911   1.092  24.012 1.00 107.42 ? 85   ARG B NE  1 
ATOM   2595 C CZ  . ARG B 2 82  ? 7.571   -0.170 24.254 1.00 125.35 ? 85   ARG B CZ  1 
ATOM   2596 N NH1 . ARG B 2 82  ? 8.509   -1.078 24.497 1.00 114.07 ? 85   ARG B NH1 1 
ATOM   2597 N NH2 . ARG B 2 82  ? 6.292   -0.524 24.273 1.00 112.63 ? 85   ARG B NH2 1 
ATOM   2598 N N   . GLU B 2 83  ? 6.884   7.760  23.882 1.00 53.96  ? 86   GLU B N   1 
ATOM   2599 C CA  . GLU B 2 83  ? 7.671   8.852  23.321 1.00 52.58  ? 86   GLU B CA  1 
ATOM   2600 C C   . GLU B 2 83  ? 7.032   10.225 23.490 1.00 53.52  ? 86   GLU B C   1 
ATOM   2601 O O   . GLU B 2 83  ? 5.811   10.376 23.411 1.00 52.78  ? 86   GLU B O   1 
ATOM   2602 C CB  . GLU B 2 83  ? 7.950   8.614  21.841 1.00 54.06  ? 86   GLU B CB  1 
ATOM   2603 C CG  . GLU B 2 83  ? 8.872   7.449  21.550 1.00 66.37  ? 86   GLU B CG  1 
ATOM   2604 C CD  . GLU B 2 83  ? 9.191   7.325  20.075 1.00 84.04  ? 86   GLU B CD  1 
ATOM   2605 O OE1 . GLU B 2 83  ? 8.631   8.104  19.274 1.00 71.98  ? 86   GLU B OE1 1 
ATOM   2606 O OE2 . GLU B 2 83  ? 10.009  6.454  19.718 1.00 80.77  ? 86   GLU B OE2 1 
ATOM   2607 N N   . ILE B 2 84  ? 7.878   11.229 23.692 1.00 48.11  ? 87   ILE B N   1 
ATOM   2608 C CA  . ILE B 2 84  ? 7.446   12.620 23.631 1.00 46.94  ? 87   ILE B CA  1 
ATOM   2609 C C   . ILE B 2 84  ? 8.167   13.305 22.474 1.00 49.53  ? 87   ILE B C   1 
ATOM   2610 O O   . ILE B 2 84  ? 9.350   13.045 22.234 1.00 49.14  ? 87   ILE B O   1 
ATOM   2611 C CB  . ILE B 2 84  ? 7.689   13.353 24.977 1.00 49.50  ? 87   ILE B CB  1 
ATOM   2612 C CG1 . ILE B 2 84  ? 6.961   12.629 26.113 1.00 49.50  ? 87   ILE B CG1 1 
ATOM   2613 C CG2 . ILE B 2 84  ? 7.236   14.815 24.883 1.00 49.85  ? 87   ILE B CG2 1 
ATOM   2614 C CD1 . ILE B 2 84  ? 7.037   13.334 27.452 1.00 54.47  ? 87   ILE B CD1 1 
ATOM   2615 N N   . LYS B 2 85  ? 7.445   14.129 21.716 1.00 45.07  ? 88   LYS B N   1 
ATOM   2616 C CA  . LYS B 2 85  ? 8.083   14.874 20.635 1.00 44.40  ? 88   LYS B CA  1 
ATOM   2617 C C   . LYS B 2 85  ? 8.318   16.339 20.966 1.00 46.38  ? 88   LYS B C   1 
ATOM   2618 O O   . LYS B 2 85  ? 7.448   17.024 21.512 1.00 45.48  ? 88   LYS B O   1 
ATOM   2619 C CB  . LYS B 2 85  ? 7.360   14.717 19.296 1.00 47.44  ? 88   LYS B CB  1 
ATOM   2620 C CG  . LYS B 2 85  ? 8.269   15.038 18.107 1.00 66.80  ? 88   LYS B CG  1 
ATOM   2621 C CD  . LYS B 2 85  ? 7.490   15.335 16.838 1.00 80.69  ? 88   LYS B CD  1 
ATOM   2622 C CE  . LYS B 2 85  ? 6.826   14.087 16.280 1.00 94.60  ? 88   LYS B CE  1 
ATOM   2623 N NZ  . LYS B 2 85  ? 6.110   14.373 15.004 1.00 104.89 ? 88   LYS B NZ  1 
ATOM   2624 N N   . VAL B 2 86  ? 9.500   16.814 20.598 1.00 42.09  ? 89   VAL B N   1 
ATOM   2625 C CA  . VAL B 2 86  ? 9.979   18.122 21.013 1.00 41.51  ? 89   VAL B CA  1 
ATOM   2626 C C   . VAL B 2 86  ? 10.523  18.849 19.798 1.00 45.30  ? 89   VAL B C   1 
ATOM   2627 O O   . VAL B 2 86  ? 11.384  18.326 19.091 1.00 45.15  ? 89   VAL B O   1 
ATOM   2628 C CB  . VAL B 2 86  ? 11.088  17.983 22.083 1.00 44.68  ? 89   VAL B CB  1 
ATOM   2629 C CG1 . VAL B 2 86  ? 11.668  19.348 22.438 1.00 44.35  ? 89   VAL B CG1 1 
ATOM   2630 C CG2 . VAL B 2 86  ? 10.565  17.251 23.316 1.00 44.15  ? 89   VAL B CG2 1 
ATOM   2631 N N   . THR B 2 87  ? 10.037  20.059 19.560 1.00 41.63  ? 90   THR B N   1 
ATOM   2632 C CA  . THR B 2 87  ? 10.605  20.872 18.498 1.00 41.59  ? 90   THR B CA  1 
ATOM   2633 C C   . THR B 2 87  ? 11.579  21.907 19.043 1.00 44.65  ? 90   THR B C   1 
ATOM   2634 O O   . THR B 2 87  ? 11.310  22.562 20.045 1.00 44.75  ? 90   THR B O   1 
ATOM   2635 C CB  . THR B 2 87  ? 9.525   21.483 17.581 1.00 53.43  ? 90   THR B CB  1 
ATOM   2636 O OG1 . THR B 2 87  ? 10.148  22.337 16.618 1.00 55.06  ? 90   THR B OG1 1 
ATOM   2637 C CG2 . THR B 2 87  ? 8.530   22.291 18.379 1.00 55.09  ? 90   THR B CG2 1 
ATOM   2638 N N   . LEU B 2 88  ? 12.728  22.020 18.389 1.00 40.43  ? 91   LEU B N   1 
ATOM   2639 C CA  . LEU B 2 88  ? 13.767  22.954 18.793 1.00 39.67  ? 91   LEU B CA  1 
ATOM   2640 C C   . LEU B 2 88  ? 13.761  24.164 17.866 1.00 43.48  ? 91   LEU B C   1 
ATOM   2641 O O   . LEU B 2 88  ? 13.957  24.032 16.659 1.00 42.01  ? 91   LEU B O   1 
ATOM   2642 C CB  . LEU B 2 88  ? 15.136  22.264 18.739 1.00 39.50  ? 91   LEU B CB  1 
ATOM   2643 C CG  . LEU B 2 88  ? 15.223  20.922 19.471 1.00 43.79  ? 91   LEU B CG  1 
ATOM   2644 C CD1 . LEU B 2 88  ? 16.565  20.242 19.213 1.00 43.65  ? 91   LEU B CD1 1 
ATOM   2645 C CD2 . LEU B 2 88  ? 14.989  21.129 20.965 1.00 45.14  ? 91   LEU B CD2 1 
ATOM   2646 N N   . VAL B 2 89  ? 13.547  25.344 18.442 1.00 41.04  ? 92   VAL B N   1 
ATOM   2647 C CA  . VAL B 2 89  ? 13.514  26.588 17.684 1.00 40.55  ? 92   VAL B CA  1 
ATOM   2648 C C   . VAL B 2 89  ? 14.861  27.287 17.747 1.00 44.79  ? 92   VAL B C   1 
ATOM   2649 O O   . VAL B 2 89  ? 15.199  27.912 18.743 1.00 44.34  ? 92   VAL B O   1 
ATOM   2650 C CB  . VAL B 2 89  ? 12.411  27.517 18.190 1.00 44.15  ? 92   VAL B CB  1 
ATOM   2651 C CG1 . VAL B 2 89  ? 12.343  28.767 17.330 1.00 43.92  ? 92   VAL B CG1 1 
ATOM   2652 C CG2 . VAL B 2 89  ? 11.074  26.787 18.234 1.00 43.82  ? 92   VAL B CG2 1 
ATOM   2653 N N   . PHE B 2 90  ? 15.626  27.183 16.671 1.00 42.40  ? 93   PHE B N   1 
ATOM   2654 C CA  . PHE B 2 90  ? 16.937  27.801 16.613 1.00 42.36  ? 93   PHE B CA  1 
ATOM   2655 C C   . PHE B 2 90  ? 16.919  29.127 15.873 1.00 47.29  ? 93   PHE B C   1 
ATOM   2656 O O   . PHE B 2 90  ? 15.951  29.461 15.199 1.00 46.24  ? 93   PHE B O   1 
ATOM   2657 C CB  . PHE B 2 90  ? 17.935  26.851 15.955 1.00 43.95  ? 93   PHE B CB  1 
ATOM   2658 C CG  . PHE B 2 90  ? 18.482  25.806 16.885 1.00 45.34  ? 93   PHE B CG  1 
ATOM   2659 C CD1 . PHE B 2 90  ? 17.919  24.541 16.935 1.00 47.94  ? 93   PHE B CD1 1 
ATOM   2660 C CD2 . PHE B 2 90  ? 19.566  26.089 17.707 1.00 47.14  ? 93   PHE B CD2 1 
ATOM   2661 C CE1 . PHE B 2 90  ? 18.434  23.576 17.774 1.00 48.87  ? 93   PHE B CE1 1 
ATOM   2662 C CE2 . PHE B 2 90  ? 20.078  25.128 18.556 1.00 49.85  ? 93   PHE B CE2 1 
ATOM   2663 C CZ  . PHE B 2 90  ? 19.515  23.869 18.589 1.00 47.92  ? 93   PHE B CZ  1 
ATOM   2664 N N   . GLU B 2 91  ? 17.985  29.898 16.048 1.00 46.54  ? 94   GLU B N   1 
ATOM   2665 C CA  . GLU B 2 91  ? 18.210  31.118 15.281 1.00 47.57  ? 94   GLU B CA  1 
ATOM   2666 C C   . GLU B 2 91  ? 18.531  30.744 13.836 1.00 55.78  ? 94   GLU B C   1 
ATOM   2667 O O   . GLU B 2 91  ? 19.355  29.862 13.589 1.00 55.00  ? 94   GLU B O   1 
ATOM   2668 C CB  . GLU B 2 91  ? 19.386  31.887 15.886 1.00 48.55  ? 94   GLU B CB  1 
ATOM   2669 C CG  . GLU B 2 91  ? 19.803  33.124 15.124 1.00 55.66  ? 94   GLU B CG  1 
ATOM   2670 C CD  . GLU B 2 91  ? 21.144  33.653 15.580 1.00 70.46  ? 94   GLU B CD  1 
ATOM   2671 O OE1 . GLU B 2 91  ? 21.641  34.618 14.963 1.00 67.07  ? 94   GLU B OE1 1 
ATOM   2672 O OE2 . GLU B 2 91  ? 21.709  33.092 16.545 1.00 57.39  ? 94   GLU B OE2 1 
ATOM   2673 N N   . HIS B 2 92  ? 17.898  31.421 12.882 1.00 56.49  ? 95   HIS B N   1 
ATOM   2674 C CA  . HIS B 2 92  ? 18.108  31.092 11.471 1.00 58.06  ? 95   HIS B CA  1 
ATOM   2675 C C   . HIS B 2 92  ? 19.232  31.848 10.761 1.00 63.91  ? 95   HIS B C   1 
ATOM   2676 O O   . HIS B 2 92  ? 19.286  33.077 10.783 1.00 63.54  ? 95   HIS B O   1 
ATOM   2677 C CB  . HIS B 2 92  ? 16.819  31.196 10.665 1.00 59.43  ? 95   HIS B CB  1 
ATOM   2678 C CG  . HIS B 2 92  ? 17.002  30.858 9.218  1.00 63.41  ? 95   HIS B CG  1 
ATOM   2679 N ND1 . HIS B 2 92  ? 17.383  29.604 8.794  1.00 65.47  ? 95   HIS B ND1 1 
ATOM   2680 C CD2 . HIS B 2 92  ? 16.928  31.627 8.106  1.00 65.31  ? 95   HIS B CD2 1 
ATOM   2681 C CE1 . HIS B 2 92  ? 17.504  29.606 7.478  1.00 64.92  ? 95   HIS B CE1 1 
ATOM   2682 N NE2 . HIS B 2 92  ? 17.238  30.821 7.037  1.00 65.16  ? 95   HIS B NE2 1 
ATOM   2683 N N   . VAL B 2 93  ? 20.099  31.096 10.089 1.00 62.12  ? 96   VAL B N   1 
ATOM   2684 C CA  . VAL B 2 93  ? 21.183  31.670 9.294  1.00 62.74  ? 96   VAL B CA  1 
ATOM   2685 C C   . VAL B 2 93  ? 21.154  31.120 7.865  1.00 68.03  ? 96   VAL B C   1 
ATOM   2686 O O   . VAL B 2 93  ? 21.194  29.907 7.657  1.00 67.09  ? 96   VAL B O   1 
ATOM   2687 C CB  . VAL B 2 93  ? 22.547  31.445 9.962  1.00 66.85  ? 96   VAL B CB  1 
ATOM   2688 C CG1 . VAL B 2 93  ? 23.670  31.787 8.999  1.00 66.85  ? 96   VAL B CG1 1 
ATOM   2689 C CG2 . VAL B 2 93  ? 22.660  32.271 11.235 1.00 66.63  ? 96   VAL B CG2 1 
ATOM   2690 N N   . ASP B 2 94  ? 21.135  32.021 6.886  1.00 66.32  ? 97   ASP B N   1 
ATOM   2691 C CA  . ASP B 2 94  ? 20.814  31.666 5.500  1.00 66.81  ? 97   ASP B CA  1 
ATOM   2692 C C   . ASP B 2 94  ? 21.595  30.554 4.803  1.00 71.16  ? 97   ASP B C   1 
ATOM   2693 O O   . ASP B 2 94  ? 21.008  29.555 4.388  1.00 71.17  ? 97   ASP B O   1 
ATOM   2694 C CB  . ASP B 2 94  ? 20.686  32.901 4.613  1.00 68.96  ? 97   ASP B CB  1 
ATOM   2695 C CG  . ASP B 2 94  ? 19.244  33.301 4.393  1.00 81.79  ? 97   ASP B CG  1 
ATOM   2696 O OD1 . ASP B 2 94  ? 18.442  32.414 4.026  1.00 82.96  ? 97   ASP B OD1 1 
ATOM   2697 O OD2 . ASP B 2 94  ? 18.910  34.489 4.590  1.00 88.49  ? 97   ASP B OD2 1 
ATOM   2698 N N   . GLN B 2 95  ? 22.896  30.744 4.615  1.00 67.64  ? 98   GLN B N   1 
ATOM   2699 C CA  . GLN B 2 95  ? 23.698  29.742 3.923  1.00 67.57  ? 98   GLN B CA  1 
ATOM   2700 C C   . GLN B 2 95  ? 24.692  29.047 4.849  1.00 71.28  ? 98   GLN B C   1 
ATOM   2701 O O   . GLN B 2 95  ? 25.270  29.677 5.736  1.00 70.23  ? 98   GLN B O   1 
ATOM   2702 C CB  . GLN B 2 95  ? 24.446  30.370 2.747  1.00 69.02  ? 98   GLN B CB  1 
ATOM   2703 C CG  . GLN B 2 95  ? 25.751  31.044 3.135  1.00 85.24  ? 98   GLN B CG  1 
ATOM   2704 C CD  . GLN B 2 95  ? 26.489  31.605 1.937  1.00 107.43 ? 98   GLN B CD  1 
ATOM   2705 O OE1 . GLN B 2 95  ? 27.692  31.855 1.994  1.00 102.44 ? 98   GLN B OE1 1 
ATOM   2706 N NE2 . GLN B 2 95  ? 25.768  31.801 0.838  1.00 101.74 ? 98   GLN B NE2 1 
ATOM   2707 N N   . ASP B 2 96  ? 24.911  27.754 4.612  1.00 68.08  ? 99   ASP B N   1 
ATOM   2708 C CA  . ASP B 2 96  ? 25.921  26.998 5.346  1.00 68.05  ? 99   ASP B CA  1 
ATOM   2709 C C   . ASP B 2 96  ? 27.301  27.168 4.720  1.00 71.25  ? 99   ASP B C   1 
ATOM   2710 O O   . ASP B 2 96  ? 27.429  27.729 3.636  1.00 70.82  ? 99   ASP B O   1 
ATOM   2711 C CB  . ASP B 2 96  ? 25.555  25.515 5.404  1.00 70.29  ? 99   ASP B CB  1 
ATOM   2712 C CG  . ASP B 2 96  ? 25.305  24.919 4.031  1.00 82.05  ? 99   ASP B CG  1 
ATOM   2713 O OD1 . ASP B 2 96  ? 24.163  25.023 3.535  1.00 83.66  ? 99   ASP B OD1 1 
ATOM   2714 O OD2 . ASP B 2 96  ? 26.233  24.295 3.477  1.00 86.35  ? 99   ASP B OD2 1 
ATOM   2715 N N   . LEU B 2 97  ? 28.326  26.670 5.405  1.00 67.49  ? 100  LEU B N   1 
ATOM   2716 C CA  . LEU B 2 97  ? 29.709  26.822 4.956  1.00 67.12  ? 100  LEU B CA  1 
ATOM   2717 C C   . LEU B 2 97  ? 29.958  26.163 3.605  1.00 73.22  ? 100  LEU B C   1 
ATOM   2718 O O   . LEU B 2 97  ? 30.853  26.573 2.861  1.00 72.70  ? 100  LEU B O   1 
ATOM   2719 C CB  . LEU B 2 97  ? 30.673  26.243 5.986  1.00 66.66  ? 100  LEU B CB  1 
ATOM   2720 C CG  . LEU B 2 97  ? 32.146  26.311 5.583  1.00 70.52  ? 100  LEU B CG  1 
ATOM   2721 C CD1 . LEU B 2 97  ? 32.633  27.752 5.555  1.00 70.32  ? 100  LEU B CD1 1 
ATOM   2722 C CD2 . LEU B 2 97  ? 33.010  25.452 6.493  1.00 71.88  ? 100  LEU B CD2 1 
ATOM   2723 N N   . ARG B 2 98  ? 29.218  25.093 3.327  1.00 71.27  ? 101  ARG B N   1 
ATOM   2724 C CA  . ARG B 2 98  ? 29.274  24.443 2.023  1.00 71.64  ? 101  ARG B CA  1 
ATOM   2725 C C   . ARG B 2 98  ? 28.799  25.401 0.936  1.00 76.78  ? 101  ARG B C   1 
ATOM   2726 O O   . ARG B 2 98  ? 29.599  25.891 0.138  1.00 76.11  ? 101  ARG B O   1 
ATOM   2727 C CB  . ARG B 2 98  ? 28.427  23.168 2.013  1.00 71.40  ? 101  ARG B CB  1 
ATOM   2728 C CG  . ARG B 2 98  ? 27.918  22.786 0.632  1.00 80.01  ? 101  ARG B CG  1 
ATOM   2729 C CD  . ARG B 2 98  ? 27.858  21.284 0.466  1.00 89.46  ? 101  ARG B CD  1 
ATOM   2730 N NE  . ARG B 2 98  ? 29.083  20.650 0.946  1.00 98.32  ? 101  ARG B NE  1 
ATOM   2731 C CZ  . ARG B 2 98  ? 29.128  19.781 1.951  1.00 109.57 ? 101  ARG B CZ  1 
ATOM   2732 N NH1 . ARG B 2 98  ? 28.006  19.415 2.553  1.00 94.65  ? 101  ARG B NH1 1 
ATOM   2733 N NH2 . ARG B 2 98  ? 30.286  19.255 2.333  1.00 92.98  ? 101  ARG B NH2 1 
ATOM   2734 N N   . THR B 2 99  ? 27.499  25.687 0.943  1.00 74.55  ? 102  THR B N   1 
ATOM   2735 C CA  . THR B 2 99  ? 26.894  26.684 0.062  1.00 74.95  ? 102  THR B CA  1 
ATOM   2736 C C   . THR B 2 99  ? 27.759  27.934 -0.093 1.00 80.54  ? 102  THR B C   1 
ATOM   2737 O O   . THR B 2 99  ? 27.627  28.675 -1.067 1.00 80.07  ? 102  THR B O   1 
ATOM   2738 C CB  . THR B 2 99  ? 25.479  27.056 0.548  1.00 83.50  ? 102  THR B CB  1 
ATOM   2739 O OG1 . THR B 2 99  ? 24.564  26.000 0.233  1.00 83.46  ? 102  THR B OG1 1 
ATOM   2740 C CG2 . THR B 2 99  ? 25.010  28.355 -0.093 1.00 82.25  ? 102  THR B CG2 1 
ATOM   2741 N N   . TYR B 2 100 ? 28.648  28.155 0.869  1.00 78.68  ? 103  TYR B N   1 
ATOM   2742 C CA  . TYR B 2 100 ? 29.538  29.309 0.856  1.00 79.40  ? 103  TYR B CA  1 
ATOM   2743 C C   . TYR B 2 100 ? 30.873  28.971 0.205  1.00 85.89  ? 103  TYR B C   1 
ATOM   2744 O O   . TYR B 2 100 ? 31.569  29.854 -0.295 1.00 85.67  ? 103  TYR B O   1 
ATOM   2745 C CB  . TYR B 2 100 ? 29.766  29.820 2.282  1.00 80.35  ? 103  TYR B CB  1 
ATOM   2746 C CG  . TYR B 2 100 ? 30.793  30.923 2.382  1.00 81.65  ? 103  TYR B CG  1 
ATOM   2747 C CD1 . TYR B 2 100 ? 30.405  32.255 2.463  1.00 83.57  ? 103  TYR B CD1 1 
ATOM   2748 C CD2 . TYR B 2 100 ? 32.150  30.634 2.398  1.00 82.19  ? 103  TYR B CD2 1 
ATOM   2749 C CE1 . TYR B 2 100 ? 31.341  33.268 2.558  1.00 84.13  ? 103  TYR B CE1 1 
ATOM   2750 C CE2 . TYR B 2 100 ? 33.094  31.639 2.492  1.00 82.93  ? 103  TYR B CE2 1 
ATOM   2751 C CZ  . TYR B 2 100 ? 32.684  32.955 2.571  1.00 90.18  ? 103  TYR B CZ  1 
ATOM   2752 O OH  . TYR B 2 100 ? 33.620  33.961 2.664  1.00 90.99  ? 103  TYR B OH  1 
ATOM   2753 N N   . LEU B 2 101 ? 31.245  27.696 0.249  1.00 84.27  ? 104  LEU B N   1 
ATOM   2754 C CA  . LEU B 2 101 ? 32.451  27.234 -0.432 1.00 84.87  ? 104  LEU B CA  1 
ATOM   2755 C C   . LEU B 2 101 ? 32.132  26.800 -1.860 1.00 90.39  ? 104  LEU B C   1 
ATOM   2756 O O   . LEU B 2 101 ? 32.984  26.870 -2.747 1.00 89.73  ? 104  LEU B O   1 
ATOM   2757 C CB  . LEU B 2 101 ? 33.117  26.092 0.340  1.00 84.91  ? 104  LEU B CB  1 
ATOM   2758 C CG  . LEU B 2 101 ? 33.650  26.445 1.730  1.00 89.61  ? 104  LEU B CG  1 
ATOM   2759 C CD1 . LEU B 2 101 ? 34.831  25.560 2.100  1.00 89.64  ? 104  LEU B CD1 1 
ATOM   2760 C CD2 . LEU B 2 101 ? 34.027  27.914 1.806  1.00 92.39  ? 104  LEU B CD2 1 
ATOM   2761 N N   . ASP B 2 102 ? 30.898  26.348 -2.071 1.00 88.21  ? 105  ASP B N   1 
ATOM   2762 C CA  . ASP B 2 102 ? 30.409  26.037 -3.408 1.00 88.53  ? 105  ASP B CA  1 
ATOM   2763 C C   . ASP B 2 102 ? 30.298  27.310 -4.242 1.00 94.52  ? 105  ASP B C   1 
ATOM   2764 O O   . ASP B 2 102 ? 31.097  27.530 -5.152 1.00 94.20  ? 105  ASP B O   1 
ATOM   2765 C CB  . ASP B 2 102 ? 29.056  25.321 -3.341 1.00 90.05  ? 105  ASP B CB  1 
ATOM   2766 C CG  . ASP B 2 102 ? 29.187  23.860 -2.948 1.00 97.44  ? 105  ASP B CG  1 
ATOM   2767 O OD1 . ASP B 2 102 ? 30.318  23.332 -2.979 1.00 97.17  ? 105  ASP B OD1 1 
ATOM   2768 O OD2 . ASP B 2 102 ? 28.154  23.236 -2.625 1.00 103.05 ? 105  ASP B OD2 1 
ATOM   2769 N N   . LYS B 2 103 ? 29.352  28.179 -3.889 1.00 92.50  ? 106  LYS B N   1 
ATOM   2770 C CA  . LYS B 2 103 ? 29.207  29.462 -4.574 1.00 92.90  ? 106  LYS B CA  1 
ATOM   2771 C C   . LYS B 2 103 ? 30.464  30.323 -4.436 1.00 98.29  ? 106  LYS B C   1 
ATOM   2772 O O   . LYS B 2 103 ? 30.385  31.531 -4.213 1.00 97.70  ? 106  LYS B O   1 
ATOM   2773 C CB  . LYS B 2 103 ? 27.971  30.229 -4.081 1.00 95.20  ? 106  LYS B CB  1 
ATOM   2774 C CG  . LYS B 2 103 ? 28.133  30.909 -2.727 1.00 106.18 ? 106  LYS B CG  1 
ATOM   2775 C CD  . LYS B 2 103 ? 27.233  32.134 -2.607 1.00 114.05 ? 106  LYS B CD  1 
ATOM   2776 C CE  . LYS B 2 103 ? 25.760  31.754 -2.624 1.00 123.64 ? 106  LYS B CE  1 
ATOM   2777 N NZ  . LYS B 2 103 ? 24.871  32.945 -2.513 1.00 131.26 ? 106  LYS B NZ  1 
ATOM   2778 N N   . ALA B 2 104 ? 31.623  29.694 -4.582 1.00 96.36  ? 107  ALA B N   1 
ATOM   2779 C CA  . ALA B 2 104 ? 32.888  30.408 -4.541 1.00 97.08  ? 107  ALA B CA  1 
ATOM   2780 C C   . ALA B 2 104 ? 33.403  30.706 -5.945 1.00 103.39 ? 107  ALA B C   1 
ATOM   2781 O O   . ALA B 2 104 ? 34.044  29.862 -6.576 1.00 102.89 ? 107  ALA B O   1 
ATOM   2782 C CB  . ALA B 2 104 ? 33.920  29.621 -3.749 1.00 97.79  ? 107  ALA B CB  1 
ATOM   2783 N N   . PRO B 2 105 ? 33.075  31.896 -6.474 1.00 101.85 ? 108  PRO B N   1 
ATOM   2784 C CA  . PRO B 2 105 ? 33.846  32.399 -7.615 1.00 102.24 ? 108  PRO B CA  1 
ATOM   2785 C C   . PRO B 2 105 ? 35.300  32.703 -7.234 1.00 107.27 ? 108  PRO B C   1 
ATOM   2786 O O   . PRO B 2 105 ? 35.994  33.437 -7.940 1.00 107.13 ? 108  PRO B O   1 
ATOM   2787 C CB  . PRO B 2 105 ? 33.111  33.688 -7.997 1.00 103.96 ? 108  PRO B CB  1 
ATOM   2788 C CG  . PRO B 2 105 ? 32.399  34.104 -6.760 1.00 108.26 ? 108  PRO B CG  1 
ATOM   2789 C CD  . PRO B 2 105 ? 32.001  32.826 -6.085 1.00 103.72 ? 108  PRO B CD  1 
ATOM   2790 N N   . PRO B 2 106 ? 35.760  32.185 -6.079 1.00 104.08 ? 109  PRO B N   1 
ATOM   2791 C CA  . PRO B 2 106 ? 37.204  32.117 -5.848 1.00 103.90 ? 109  PRO B CA  1 
ATOM   2792 C C   . PRO B 2 106 ? 37.834  30.833 -6.385 1.00 107.26 ? 109  PRO B C   1 
ATOM   2793 O O   . PRO B 2 106 ? 38.001  29.858 -5.649 1.00 106.84 ? 109  PRO B O   1 
ATOM   2794 C CB  . PRO B 2 106 ? 37.305  32.135 -4.319 1.00 105.73 ? 109  PRO B CB  1 
ATOM   2795 C CG  . PRO B 2 106 ? 36.043  32.835 -3.850 1.00 110.25 ? 109  PRO B CG  1 
ATOM   2796 C CD  . PRO B 2 106 ? 35.106  32.981 -5.026 1.00 105.71 ? 109  PRO B CD  1 
ATOM   2797 N N   . PRO B 2 107 ? 38.173  30.808 -7.684 1.00 103.17 ? 110  PRO B N   1 
ATOM   2798 C CA  . PRO B 2 107 ? 39.080  29.713 -8.022 1.00 102.71 ? 110  PRO B CA  1 
ATOM   2799 C C   . PRO B 2 107 ? 40.443  29.894 -7.355 1.00 105.75 ? 110  PRO B C   1 
ATOM   2800 O O   . PRO B 2 107 ? 41.324  30.568 -7.891 1.00 104.87 ? 110  PRO B O   1 
ATOM   2801 C CB  . PRO B 2 107 ? 39.197  29.831 -9.537 1.00 104.48 ? 110  PRO B CB  1 
ATOM   2802 C CG  . PRO B 2 107 ? 37.842  30.309 -9.957 1.00 108.94 ? 110  PRO B CG  1 
ATOM   2803 C CD  . PRO B 2 107 ? 37.279  31.127 -8.812 1.00 104.54 ? 110  PRO B CD  1 
ATOM   2804 N N   . GLY B 2 108 ? 40.563  29.376 -6.135 1.00 102.16 ? 111  GLY B N   1 
ATOM   2805 C CA  . GLY B 2 108 ? 41.837  29.243 -5.451 1.00 101.77 ? 111  GLY B CA  1 
ATOM   2806 C C   . GLY B 2 108 ? 42.171  30.306 -4.416 1.00 104.99 ? 111  GLY B C   1 
ATOM   2807 O O   . GLY B 2 108 ? 43.317  30.756 -4.348 1.00 104.78 ? 111  GLY B O   1 
ATOM   2808 N N   . LEU B 2 109 ? 41.204  30.669 -3.574 1.00 100.49 ? 112  LEU B N   1 
ATOM   2809 C CA  . LEU B 2 109 ? 41.454  31.652 -2.517 1.00 99.63  ? 112  LEU B CA  1 
ATOM   2810 C C   . LEU B 2 109 ? 40.236  31.989 -1.647 1.00 100.70 ? 112  LEU B C   1 
ATOM   2811 O O   . LEU B 2 109 ? 39.155  31.422 -1.828 1.00 100.17 ? 112  LEU B O   1 
ATOM   2812 C CB  . LEU B 2 109 ? 42.087  32.922 -3.100 1.00 99.80  ? 112  LEU B CB  1 
ATOM   2813 C CG  . LEU B 2 109 ? 41.585  33.441 -4.450 1.00 104.58 ? 112  LEU B CG  1 
ATOM   2814 C CD1 . LEU B 2 109 ? 40.126  33.877 -4.375 1.00 104.75 ? 112  LEU B CD1 1 
ATOM   2815 C CD2 . LEU B 2 109 ? 42.471  34.581 -4.932 1.00 107.16 ? 112  LEU B CD2 1 
ATOM   2816 N N   . PRO B 2 110 ? 40.412  32.890 -0.660 1.00 94.81  ? 113  PRO B N   1 
ATOM   2817 C CA  . PRO B 2 110 ? 41.645  33.572 -0.251 1.00 93.74  ? 113  PRO B CA  1 
ATOM   2818 C C   . PRO B 2 110 ? 42.265  32.927 0.977  1.00 96.41  ? 113  PRO B C   1 
ATOM   2819 O O   . PRO B 2 110 ? 41.832  31.862 1.407  1.00 96.53  ? 113  PRO B O   1 
ATOM   2820 C CB  . PRO B 2 110 ? 41.163  34.982 0.082  1.00 95.47  ? 113  PRO B CB  1 
ATOM   2821 C CG  . PRO B 2 110 ? 39.988  35.184 -0.799 1.00 100.11 ? 113  PRO B CG  1 
ATOM   2822 C CD  . PRO B 2 110 ? 39.318  33.842 -0.921 1.00 95.97  ? 113  PRO B CD  1 
ATOM   2823 N N   . ALA B 2 111 ? 43.273  33.580 1.547  1.00 91.53  ? 114  ALA B N   1 
ATOM   2824 C CA  . ALA B 2 111 ? 43.994  33.027 2.690  1.00 90.70  ? 114  ALA B CA  1 
ATOM   2825 C C   . ALA B 2 111 ? 43.830  33.874 3.949  1.00 93.14  ? 114  ALA B C   1 
ATOM   2826 O O   . ALA B 2 111 ? 44.236  33.469 5.039  1.00 92.50  ? 114  ALA B O   1 
ATOM   2827 C CB  . ALA B 2 111 ? 45.464  32.848 2.357  1.00 91.39  ? 114  ALA B CB  1 
ATOM   2828 N N   . GLU B 2 112 ? 43.274  35.069 3.783  1.00 88.55  ? 115  GLU B N   1 
ATOM   2829 C CA  . GLU B 2 112 ? 42.901  35.904 4.919  1.00 87.62  ? 115  GLU B CA  1 
ATOM   2830 C C   . GLU B 2 112 ? 41.426  35.692 5.231  1.00 89.32  ? 115  GLU B C   1 
ATOM   2831 O O   . GLU B 2 112 ? 40.986  35.888 6.364  1.00 89.03  ? 115  GLU B O   1 
ATOM   2832 C CB  . GLU B 2 112 ? 43.180  37.379 4.623  1.00 89.00  ? 115  GLU B CB  1 
ATOM   2833 C CG  . GLU B 2 112 ? 44.657  37.718 4.572  1.00 99.62  ? 115  GLU B CG  1 
ATOM   2834 C CD  . GLU B 2 112 ? 45.372  37.365 5.862  1.00 121.50 ? 115  GLU B CD  1 
ATOM   2835 O OE1 . GLU B 2 112 ? 44.858  37.718 6.944  1.00 116.67 ? 115  GLU B OE1 1 
ATOM   2836 O OE2 . GLU B 2 112 ? 46.449  36.738 5.794  1.00 116.67 ? 115  GLU B OE2 1 
ATOM   2837 N N   . THR B 2 113 ? 40.672  35.291 4.212  1.00 83.95  ? 116  THR B N   1 
ATOM   2838 C CA  . THR B 2 113 ? 39.294  34.855 4.389  1.00 82.91  ? 116  THR B CA  1 
ATOM   2839 C C   . THR B 2 113 ? 39.262  33.446 4.974  1.00 85.73  ? 116  THR B C   1 
ATOM   2840 O O   . THR B 2 113 ? 38.234  32.995 5.479  1.00 85.73  ? 116  THR B O   1 
ATOM   2841 C CB  . THR B 2 113 ? 38.504  34.947 3.069  1.00 88.23  ? 116  THR B CB  1 
ATOM   2842 O OG1 . THR B 2 113 ? 38.121  36.307 2.834  1.00 87.23  ? 116  THR B OG1 1 
ATOM   2843 C CG2 . THR B 2 113 ? 37.260  34.077 3.116  1.00 86.53  ? 116  THR B CG2 1 
ATOM   2844 N N   . ILE B 2 114 ? 40.407  32.773 4.945  1.00 81.08  ? 117  ILE B N   1 
ATOM   2845 C CA  . ILE B 2 114 ? 40.525  31.437 5.519  1.00 80.30  ? 117  ILE B CA  1 
ATOM   2846 C C   . ILE B 2 114 ? 41.067  31.467 6.947  1.00 82.30  ? 117  ILE B C   1 
ATOM   2847 O O   . ILE B 2 114 ? 40.624  30.703 7.804  1.00 81.70  ? 117  ILE B O   1 
ATOM   2848 C CB  . ILE B 2 114 ? 41.341  30.492 4.609  1.00 83.44  ? 117  ILE B CB  1 
ATOM   2849 C CG1 . ILE B 2 114 ? 40.447  29.914 3.509  1.00 83.92  ? 117  ILE B CG1 1 
ATOM   2850 C CG2 . ILE B 2 114 ? 41.965  29.366 5.424  1.00 84.04  ? 117  ILE B CG2 1 
ATOM   2851 C CD1 . ILE B 2 114 ? 41.113  28.836 2.685  1.00 91.54  ? 117  ILE B CD1 1 
ATOM   2852 N N   . LYS B 2 115 ? 42.017  32.362 7.203  1.00 77.49  ? 118  LYS B N   1 
ATOM   2853 C CA  . LYS B 2 115 ? 42.587  32.506 8.537  1.00 76.64  ? 118  LYS B CA  1 
ATOM   2854 C C   . LYS B 2 115 ? 41.598  33.134 9.516  1.00 79.53  ? 118  LYS B C   1 
ATOM   2855 O O   . LYS B 2 115 ? 41.520  32.736 10.679 1.00 79.10  ? 118  LYS B O   1 
ATOM   2856 C CB  . LYS B 2 115 ? 43.882  33.319 8.488  1.00 78.89  ? 118  LYS B CB  1 
ATOM   2857 C CG  . LYS B 2 115 ? 45.031  32.602 7.797  1.00 90.21  ? 118  LYS B CG  1 
ATOM   2858 C CD  . LYS B 2 115 ? 46.295  33.445 7.794  1.00 97.20  ? 118  LYS B CD  1 
ATOM   2859 C CE  . LYS B 2 115 ? 47.418  32.744 7.049  1.00 106.00 ? 118  LYS B CE  1 
ATOM   2860 N NZ  . LYS B 2 115 ? 48.630  33.600 6.935  1.00 115.41 ? 118  LYS B NZ  1 
ATOM   2861 N N   . ASP B 2 116 ? 40.830  34.106 9.037  1.00 75.08  ? 119  ASP B N   1 
ATOM   2862 C CA  . ASP B 2 116 ? 39.829  34.759 9.870  1.00 74.20  ? 119  ASP B CA  1 
ATOM   2863 C C   . ASP B 2 116 ? 38.582  33.891 10.013 1.00 75.41  ? 119  ASP B C   1 
ATOM   2864 O O   . ASP B 2 116 ? 37.842  34.004 10.989 1.00 75.29  ? 119  ASP B O   1 
ATOM   2865 C CB  . ASP B 2 116 ? 39.446  36.120 9.287  1.00 76.16  ? 119  ASP B CB  1 
ATOM   2866 C CG  . ASP B 2 116 ? 38.451  36.859 10.154 1.00 86.61  ? 119  ASP B CG  1 
ATOM   2867 O OD1 . ASP B 2 116 ? 38.822  37.246 11.283 1.00 88.27  ? 119  ASP B OD1 1 
ATOM   2868 O OD2 . ASP B 2 116 ? 37.300  37.045 9.709  1.00 90.25  ? 119  ASP B OD2 1 
ATOM   2869 N N   . LEU B 2 117 ? 38.339  33.047 9.019  1.00 69.24  ? 120  LEU B N   1 
ATOM   2870 C CA  . LEU B 2 117 ? 37.182  32.166 9.040  1.00 67.85  ? 120  LEU B CA  1 
ATOM   2871 C C   . LEU B 2 117 ? 37.418  31.063 10.070 1.00 69.88  ? 120  LEU B C   1 
ATOM   2872 O O   . LEU B 2 117 ? 36.497  30.628 10.754 1.00 69.39  ? 120  LEU B O   1 
ATOM   2873 C CB  . LEU B 2 117 ? 36.966  31.556 7.653  1.00 67.73  ? 120  LEU B CB  1 
ATOM   2874 C CG  . LEU B 2 117 ? 35.525  31.431 7.158  1.00 72.24  ? 120  LEU B CG  1 
ATOM   2875 C CD1 . LEU B 2 117 ? 34.911  32.806 6.953  1.00 72.32  ? 120  LEU B CD1 1 
ATOM   2876 C CD2 . LEU B 2 117 ? 35.471  30.628 5.871  1.00 74.31  ? 120  LEU B CD2 1 
ATOM   2877 N N   . MET B 2 118 ? 38.666  30.622 10.179 1.00 65.12  ? 121  MET B N   1 
ATOM   2878 C CA  . MET B 2 118 ? 39.050  29.629 11.175 1.00 64.35  ? 121  MET B CA  1 
ATOM   2879 C C   . MET B 2 118 ? 39.077  30.264 12.561 1.00 67.18  ? 121  MET B C   1 
ATOM   2880 O O   . MET B 2 118 ? 38.740  29.630 13.557 1.00 66.84  ? 121  MET B O   1 
ATOM   2881 C CB  . MET B 2 118 ? 40.438  29.068 10.850 1.00 66.51  ? 121  MET B CB  1 
ATOM   2882 C CG  . MET B 2 118 ? 40.476  28.146 9.648  1.00 69.80  ? 121  MET B CG  1 
ATOM   2883 S SD  . MET B 2 118 ? 39.743  26.546 10.003 1.00 73.61  ? 121  MET B SD  1 
ATOM   2884 C CE  . MET B 2 118 ? 40.829  25.959 11.290 1.00 70.06  ? 121  MET B CE  1 
ATOM   2885 N N   . ARG B 2 119 ? 39.517  31.515 12.611 1.00 62.50  ? 122  ARG B N   1 
ATOM   2886 C CA  . ARG B 2 119 ? 39.653  32.242 13.860 1.00 61.47  ? 122  ARG B CA  1 
ATOM   2887 C C   . ARG B 2 119 ? 38.305  32.330 14.572 1.00 63.79  ? 122  ARG B C   1 
ATOM   2888 O O   . ARG B 2 119 ? 38.229  32.216 15.796 1.00 63.58  ? 122  ARG B O   1 
ATOM   2889 C CB  . ARG B 2 119 ? 40.216  33.634 13.578 1.00 61.31  ? 122  ARG B CB  1 
ATOM   2890 C CG  . ARG B 2 119 ? 41.104  34.190 14.668 1.00 70.83  ? 122  ARG B CG  1 
ATOM   2891 C CD  . ARG B 2 119 ? 42.406  34.693 14.073 1.00 79.93  ? 122  ARG B CD  1 
ATOM   2892 N NE  . ARG B 2 119 ? 42.211  35.281 12.750 1.00 88.42  ? 122  ARG B NE  1 
ATOM   2893 C CZ  . ARG B 2 119 ? 43.185  35.462 11.863 1.00 98.64  ? 122  ARG B CZ  1 
ATOM   2894 N NH1 . ARG B 2 119 ? 42.917  36.006 10.683 1.00 81.52  ? 122  ARG B NH1 1 
ATOM   2895 N NH2 . ARG B 2 119 ? 44.426  35.092 12.153 1.00 83.26  ? 122  ARG B NH2 1 
ATOM   2896 N N   . GLN B 2 120 ? 37.239  32.494 13.795 1.00 58.67  ? 123  GLN B N   1 
ATOM   2897 C CA  . GLN B 2 120 ? 35.884  32.482 14.335 1.00 57.92  ? 123  GLN B CA  1 
ATOM   2898 C C   . GLN B 2 120 ? 35.449  31.069 14.719 1.00 62.64  ? 123  GLN B C   1 
ATOM   2899 O O   . GLN B 2 120 ? 34.997  30.833 15.841 1.00 63.01  ? 123  GLN B O   1 
ATOM   2900 C CB  . GLN B 2 120 ? 34.906  33.088 13.329 1.00 58.63  ? 123  GLN B CB  1 
ATOM   2901 C CG  . GLN B 2 120 ? 35.085  34.581 13.140 1.00 63.58  ? 123  GLN B CG  1 
ATOM   2902 C CD  . GLN B 2 120 ? 34.284  35.122 11.981 1.00 74.06  ? 123  GLN B CD  1 
ATOM   2903 O OE1 . GLN B 2 120 ? 34.826  35.760 11.083 1.00 70.24  ? 123  GLN B OE1 1 
ATOM   2904 N NE2 . GLN B 2 120 ? 32.987  34.868 11.991 1.00 61.81  ? 123  GLN B NE2 1 
ATOM   2905 N N   . PHE B 2 121 ? 35.530  30.159 13.753 1.00 58.56  ? 124  PHE B N   1 
ATOM   2906 C CA  . PHE B 2 121 ? 35.355  28.726 13.976 1.00 57.86  ? 124  PHE B CA  1 
ATOM   2907 C C   . PHE B 2 121 ? 35.886  28.287 15.340 1.00 59.42  ? 124  PHE B C   1 
ATOM   2908 O O   . PHE B 2 121 ? 35.155  27.727 16.156 1.00 58.26  ? 124  PHE B O   1 
ATOM   2909 C CB  . PHE B 2 121 ? 36.089  27.959 12.874 1.00 59.97  ? 124  PHE B CB  1 
ATOM   2910 C CG  . PHE B 2 121 ? 35.830  26.482 12.881 1.00 62.12  ? 124  PHE B CG  1 
ATOM   2911 C CD1 . PHE B 2 121 ? 34.640  25.975 13.372 1.00 65.42  ? 124  PHE B CD1 1 
ATOM   2912 C CD2 . PHE B 2 121 ? 36.771  25.599 12.369 1.00 64.83  ? 124  PHE B CD2 1 
ATOM   2913 C CE1 . PHE B 2 121 ? 34.397  24.612 13.368 1.00 66.61  ? 124  PHE B CE1 1 
ATOM   2914 C CE2 . PHE B 2 121 ? 36.534  24.235 12.360 1.00 67.74  ? 124  PHE B CE2 1 
ATOM   2915 C CZ  . PHE B 2 121 ? 35.345  23.741 12.858 1.00 65.88  ? 124  PHE B CZ  1 
ATOM   2916 N N   . LEU B 2 122 ? 37.159  28.573 15.587 1.00 55.18  ? 125  LEU B N   1 
ATOM   2917 C CA  . LEU B 2 122 ? 37.814  28.167 16.824 1.00 54.69  ? 125  LEU B CA  1 
ATOM   2918 C C   . LEU B 2 122 ? 37.252  28.886 18.052 1.00 59.09  ? 125  LEU B C   1 
ATOM   2919 O O   . LEU B 2 122 ? 37.068  28.275 19.108 1.00 58.37  ? 125  LEU B O   1 
ATOM   2920 C CB  . LEU B 2 122 ? 39.326  28.373 16.725 1.00 54.35  ? 125  LEU B CB  1 
ATOM   2921 C CG  . LEU B 2 122 ? 40.090  27.381 15.845 1.00 58.44  ? 125  LEU B CG  1 
ATOM   2922 C CD1 . LEU B 2 122 ? 41.577  27.701 15.843 1.00 58.51  ? 125  LEU B CD1 1 
ATOM   2923 C CD2 . LEU B 2 122 ? 39.852  25.951 16.299 1.00 59.91  ? 125  LEU B CD2 1 
ATOM   2924 N N   . ARG B 2 123 ? 36.991  30.183 17.911 1.00 55.65  ? 126  ARG B N   1 
ATOM   2925 C CA  . ARG B 2 123 ? 36.371  30.969 18.975 1.00 55.17  ? 126  ARG B CA  1 
ATOM   2926 C C   . ARG B 2 123 ? 35.075  30.329 19.487 1.00 57.82  ? 126  ARG B C   1 
ATOM   2927 O O   . ARG B 2 123 ? 34.956  30.005 20.675 1.00 56.81  ? 126  ARG B O   1 
ATOM   2928 C CB  . ARG B 2 123 ? 36.091  32.396 18.497 1.00 55.32  ? 126  ARG B CB  1 
ATOM   2929 C CG  . ARG B 2 123 ? 37.328  33.244 18.254 1.00 64.55  ? 126  ARG B CG  1 
ATOM   2930 C CD  . ARG B 2 123 ? 36.949  34.558 17.574 1.00 72.98  ? 126  ARG B CD  1 
ATOM   2931 N NE  . ARG B 2 123 ? 38.105  35.270 17.035 1.00 76.45  ? 126  ARG B NE  1 
ATOM   2932 C CZ  . ARG B 2 123 ? 38.023  36.258 16.149 1.00 88.73  ? 126  ARG B CZ  1 
ATOM   2933 N NH1 . ARG B 2 123 ? 36.839  36.648 15.696 1.00 70.21  ? 126  ARG B NH1 1 
ATOM   2934 N NH2 . ARG B 2 123 ? 39.125  36.853 15.711 1.00 79.69  ? 126  ARG B NH2 1 
ATOM   2935 N N   . GLY B 2 124 ? 34.099  30.176 18.597 1.00 53.57  ? 127  GLY B N   1 
ATOM   2936 C CA  . GLY B 2 124 ? 32.818  29.600 18.960 1.00 53.36  ? 127  GLY B CA  1 
ATOM   2937 C C   . GLY B 2 124 ? 32.973  28.211 19.544 1.00 57.62  ? 127  GLY B C   1 
ATOM   2938 O O   . GLY B 2 124 ? 32.103  27.721 20.265 1.00 57.46  ? 127  GLY B O   1 
ATOM   2939 N N   . LEU B 2 125 ? 34.107  27.587 19.249 1.00 54.07  ? 128  LEU B N   1 
ATOM   2940 C CA  . LEU B 2 125 ? 34.361  26.202 19.630 1.00 53.77  ? 128  LEU B CA  1 
ATOM   2941 C C   . LEU B 2 125 ? 35.063  26.177 20.986 1.00 56.91  ? 128  LEU B C   1 
ATOM   2942 O O   . LEU B 2 125 ? 34.874  25.263 21.791 1.00 56.09  ? 128  LEU B O   1 
ATOM   2943 C CB  . LEU B 2 125 ? 35.239  25.549 18.560 1.00 53.97  ? 128  LEU B CB  1 
ATOM   2944 C CG  . LEU B 2 125 ? 35.065  24.057 18.293 1.00 58.46  ? 128  LEU B CG  1 
ATOM   2945 C CD1 . LEU B 2 125 ? 36.153  23.269 18.993 1.00 58.61  ? 128  LEU B CD1 1 
ATOM   2946 C CD2 . LEU B 2 125 ? 33.686  23.618 18.755 1.00 60.11  ? 128  LEU B CD2 1 
ATOM   2947 N N   . ASP B 2 126 ? 35.869  27.205 21.227 1.00 53.14  ? 129  ASP B N   1 
ATOM   2948 C CA  . ASP B 2 126 ? 36.480  27.441 22.527 1.00 52.51  ? 129  ASP B CA  1 
ATOM   2949 C C   . ASP B 2 126 ? 35.414  27.901 23.519 1.00 55.76  ? 129  ASP B C   1 
ATOM   2950 O O   . ASP B 2 126 ? 35.546  27.701 24.727 1.00 55.48  ? 129  ASP B O   1 
ATOM   2951 C CB  . ASP B 2 126 ? 37.556  28.520 22.396 1.00 54.08  ? 129  ASP B CB  1 
ATOM   2952 C CG  . ASP B 2 126 ? 38.357  28.701 23.662 1.00 61.63  ? 129  ASP B CG  1 
ATOM   2953 O OD1 . ASP B 2 126 ? 38.461  27.728 24.443 1.00 63.10  ? 129  ASP B OD1 1 
ATOM   2954 O OD2 . ASP B 2 126 ? 38.911  29.804 23.856 1.00 64.12  ? 129  ASP B OD2 1 
ATOM   2955 N N   . PHE B 2 127 ? 34.368  28.538 23.000 1.00 51.08  ? 130  PHE B N   1 
ATOM   2956 C CA  . PHE B 2 127 ? 33.240  28.962 23.820 1.00 50.08  ? 130  PHE B CA  1 
ATOM   2957 C C   . PHE B 2 127 ? 32.451  27.764 24.332 1.00 53.44  ? 130  PHE B C   1 
ATOM   2958 O O   . PHE B 2 127 ? 32.264  27.608 25.539 1.00 53.77  ? 130  PHE B O   1 
ATOM   2959 C CB  . PHE B 2 127 ? 32.324  29.906 23.032 1.00 51.53  ? 130  PHE B CB  1 
ATOM   2960 C CG  . PHE B 2 127 ? 31.080  30.307 23.776 1.00 52.57  ? 130  PHE B CG  1 
ATOM   2961 C CD1 . PHE B 2 127 ? 31.158  31.096 24.916 1.00 55.30  ? 130  PHE B CD1 1 
ATOM   2962 C CD2 . PHE B 2 127 ? 29.834  29.900 23.336 1.00 53.96  ? 130  PHE B CD2 1 
ATOM   2963 C CE1 . PHE B 2 127 ? 30.016  31.471 25.598 1.00 55.73  ? 130  PHE B CE1 1 
ATOM   2964 C CE2 . PHE B 2 127 ? 28.690  30.271 24.016 1.00 56.67  ? 130  PHE B CE2 1 
ATOM   2965 C CZ  . PHE B 2 127 ? 28.783  31.051 25.153 1.00 54.70  ? 130  PHE B CZ  1 
ATOM   2966 N N   . LEU B 2 128 ? 31.996  26.917 23.413 1.00 49.16  ? 131  LEU B N   1 
ATOM   2967 C CA  . LEU B 2 128 ? 31.246  25.714 23.769 1.00 48.85  ? 131  LEU B CA  1 
ATOM   2968 C C   . LEU B 2 128 ? 32.042  24.794 24.690 1.00 52.52  ? 131  LEU B C   1 
ATOM   2969 O O   . LEU B 2 128 ? 31.508  24.237 25.646 1.00 51.72  ? 131  LEU B O   1 
ATOM   2970 C CB  . LEU B 2 128 ? 30.842  24.945 22.511 1.00 48.95  ? 131  LEU B CB  1 
ATOM   2971 C CG  . LEU B 2 128 ? 29.531  25.330 21.822 1.00 53.84  ? 131  LEU B CG  1 
ATOM   2972 C CD1 . LEU B 2 128 ? 29.285  26.814 21.955 1.00 53.81  ? 131  LEU B CD1 1 
ATOM   2973 C CD2 . LEU B 2 128 ? 29.590  24.924 20.346 1.00 57.21  ? 131  LEU B CD2 1 
ATOM   2974 N N   . HIS B 2 129 ? 33.313  24.598 24.368 1.00 49.24  ? 132  HIS B N   1 
ATOM   2975 C CA  . HIS B 2 129 ? 34.169  23.740 25.171 1.00 49.25  ? 132  HIS B CA  1 
ATOM   2976 C C   . HIS B 2 129 ? 34.360  24.243 26.606 1.00 52.75  ? 132  HIS B C   1 
ATOM   2977 O O   . HIS B 2 129 ? 34.452  23.452 27.545 1.00 52.18  ? 132  HIS B O   1 
ATOM   2978 C CB  . HIS B 2 129 ? 35.508  23.525 24.468 1.00 50.15  ? 132  HIS B CB  1 
ATOM   2979 C CG  . HIS B 2 129 ? 35.415  22.627 23.275 1.00 53.63  ? 132  HIS B CG  1 
ATOM   2980 N ND1 . HIS B 2 129 ? 36.462  22.436 22.399 1.00 55.23  ? 132  HIS B ND1 1 
ATOM   2981 C CD2 . HIS B 2 129 ? 34.396  21.860 22.817 1.00 55.14  ? 132  HIS B CD2 1 
ATOM   2982 C CE1 . HIS B 2 129 ? 36.094  21.582 21.461 1.00 54.49  ? 132  HIS B CE1 1 
ATOM   2983 N NE2 . HIS B 2 129 ? 34.843  21.222 21.687 1.00 54.70  ? 132  HIS B NE2 1 
ATOM   2984 N N   . ALA B 2 130 ? 34.365  25.562 26.772 1.00 48.96  ? 133  ALA B N   1 
ATOM   2985 C CA  . ALA B 2 130 ? 34.495  26.172 28.089 1.00 48.53  ? 133  ALA B CA  1 
ATOM   2986 C C   . ALA B 2 130 ? 33.203  26.055 28.890 1.00 52.68  ? 133  ALA B C   1 
ATOM   2987 O O   . ALA B 2 130 ? 33.194  26.279 30.100 1.00 52.67  ? 133  ALA B O   1 
ATOM   2988 C CB  . ALA B 2 130 ? 34.915  27.631 27.962 1.00 49.18  ? 133  ALA B CB  1 
ATOM   2989 N N   . ASN B 2 131 ? 32.112  25.716 28.207 1.00 48.71  ? 134  ASN B N   1 
ATOM   2990 C CA  . ASN B 2 131 ? 30.839  25.448 28.868 1.00 48.12  ? 134  ASN B CA  1 
ATOM   2991 C C   . ASN B 2 131 ? 30.544  23.955 28.882 1.00 52.47  ? 134  ASN B C   1 
ATOM   2992 O O   . ASN B 2 131 ? 29.402  23.538 29.045 1.00 51.38  ? 134  ASN B O   1 
ATOM   2993 C CB  . ASN B 2 131 ? 29.697  26.202 28.179 1.00 46.68  ? 134  ASN B CB  1 
ATOM   2994 C CG  . ASN B 2 131 ? 29.766  27.699 28.410 1.00 66.49  ? 134  ASN B CG  1 
ATOM   2995 O OD1 . ASN B 2 131 ? 30.792  28.332 28.170 1.00 59.23  ? 134  ASN B OD1 1 
ATOM   2996 N ND2 . ASN B 2 131 ? 28.670  28.272 28.888 1.00 60.74  ? 134  ASN B ND2 1 
ATOM   2997 N N   . CYS B 2 132 ? 31.584  23.153 28.691 1.00 50.89  ? 135  CYS B N   1 
ATOM   2998 C CA  . CYS B 2 132 ? 31.438  21.704 28.668 1.00 51.83  ? 135  CYS B CA  1 
ATOM   2999 C C   . CYS B 2 132 ? 30.401  21.222 27.658 1.00 56.23  ? 135  CYS B C   1 
ATOM   3000 O O   . CYS B 2 132 ? 29.750  20.195 27.855 1.00 56.24  ? 135  CYS B O   1 
ATOM   3001 C CB  . CYS B 2 132 ? 31.120  21.178 30.061 1.00 52.71  ? 135  CYS B CB  1 
ATOM   3002 S SG  . CYS B 2 132 ? 32.355  21.670 31.276 1.00 56.96  ? 135  CYS B SG  1 
ATOM   3003 N N   . ILE B 2 133 ? 30.260  21.967 26.568 1.00 52.56  ? 136  ILE B N   1 
ATOM   3004 C CA  . ILE B 2 133 ? 29.480  21.504 25.432 1.00 51.88  ? 136  ILE B CA  1 
ATOM   3005 C C   . ILE B 2 133 ? 30.387  20.952 24.333 1.00 55.34  ? 136  ILE B C   1 
ATOM   3006 O O   . ILE B 2 133 ? 31.469  21.484 24.078 1.00 54.42  ? 136  ILE B O   1 
ATOM   3007 C CB  . ILE B 2 133 ? 28.533  22.590 24.918 1.00 54.62  ? 136  ILE B CB  1 
ATOM   3008 C CG1 . ILE B 2 133 ? 27.572  23.012 26.037 1.00 55.13  ? 136  ILE B CG1 1 
ATOM   3009 C CG2 . ILE B 2 133 ? 27.784  22.099 23.688 1.00 54.16  ? 136  ILE B CG2 1 
ATOM   3010 C CD1 . ILE B 2 133 ? 26.545  24.053 25.620 1.00 61.19  ? 136  ILE B CD1 1 
ATOM   3011 N N   . VAL B 2 134 ? 29.988  19.812 23.778 1.00 51.90  ? 137  VAL B N   1 
ATOM   3012 C CA  . VAL B 2 134 ? 30.686  19.201 22.648 1.00 51.48  ? 137  VAL B CA  1 
ATOM   3013 C C   . VAL B 2 134 ? 29.740  19.195 21.451 1.00 54.46  ? 137  VAL B C   1 
ATOM   3014 O O   . VAL B 2 134 ? 28.535  18.969 21.612 1.00 53.80  ? 137  VAL B O   1 
ATOM   3015 C CB  . VAL B 2 134 ? 31.138  17.759 22.981 1.00 55.00  ? 137  VAL B CB  1 
ATOM   3016 C CG1 . VAL B 2 134 ? 31.945  17.179 21.837 1.00 54.64  ? 137  VAL B CG1 1 
ATOM   3017 C CG2 . VAL B 2 134 ? 31.941  17.732 24.269 1.00 54.90  ? 137  VAL B CG2 1 
ATOM   3018 N N   . HIS B 2 135 ? 30.279  19.437 20.257 1.00 50.16  ? 138  HIS B N   1 
ATOM   3019 C CA  . HIS B 2 135 ? 29.477  19.322 19.041 1.00 49.60  ? 138  HIS B CA  1 
ATOM   3020 C C   . HIS B 2 135 ? 29.419  17.877 18.558 1.00 54.60  ? 138  HIS B C   1 
ATOM   3021 O O   . HIS B 2 135 ? 28.343  17.280 18.504 1.00 53.48  ? 138  HIS B O   1 
ATOM   3022 C CB  . HIS B 2 135 ? 30.002  20.232 17.930 1.00 49.77  ? 138  HIS B CB  1 
ATOM   3023 C CG  . HIS B 2 135 ? 29.008  20.473 16.835 1.00 52.42  ? 138  HIS B CG  1 
ATOM   3024 N ND1 . HIS B 2 135 ? 28.230  19.468 16.302 1.00 53.69  ? 138  HIS B ND1 1 
ATOM   3025 C CD2 . HIS B 2 135 ? 28.633  21.612 16.205 1.00 53.47  ? 138  HIS B CD2 1 
ATOM   3026 C CE1 . HIS B 2 135 ? 27.427  19.975 15.385 1.00 52.75  ? 138  HIS B CE1 1 
ATOM   3027 N NE2 . HIS B 2 135 ? 27.650  21.274 15.307 1.00 53.02  ? 138  HIS B NE2 1 
ATOM   3028 N N   . ARG B 2 136 ? 30.579  17.338 18.184 1.00 52.89  ? 139  ARG B N   1 
ATOM   3029 C CA  . ARG B 2 136 ? 30.709  15.927 17.815 1.00 53.62  ? 139  ARG B CA  1 
ATOM   3030 C C   . ARG B 2 136 ? 30.271  15.596 16.388 1.00 58.07  ? 139  ARG B C   1 
ATOM   3031 O O   . ARG B 2 136 ? 30.569  14.512 15.883 1.00 57.78  ? 139  ARG B O   1 
ATOM   3032 C CB  . ARG B 2 136 ? 29.945  15.033 18.787 1.00 55.29  ? 139  ARG B CB  1 
ATOM   3033 C CG  . ARG B 2 136 ? 30.600  14.846 20.129 1.00 69.71  ? 139  ARG B CG  1 
ATOM   3034 C CD  . ARG B 2 136 ? 29.852  13.778 20.889 1.00 88.44  ? 139  ARG B CD  1 
ATOM   3035 N NE  . ARG B 2 136 ? 29.873  12.498 20.182 1.00 104.48 ? 139  ARG B NE  1 
ATOM   3036 C CZ  . ARG B 2 136 ? 28.899  11.593 20.235 1.00 122.61 ? 139  ARG B CZ  1 
ATOM   3037 N NH1 . ARG B 2 136 ? 27.802  11.829 20.941 1.00 111.98 ? 139  ARG B NH1 1 
ATOM   3038 N NH2 . ARG B 2 136 ? 29.010  10.457 19.558 1.00 109.76 ? 139  ARG B NH2 1 
ATOM   3039 N N   . ASP B 2 137 ? 29.495  16.485 15.775 1.00 54.34  ? 140  ASP B N   1 
ATOM   3040 C CA  . ASP B 2 137 ? 29.045  16.270 14.405 1.00 54.09  ? 140  ASP B CA  1 
ATOM   3041 C C   . ASP B 2 137 ? 29.334  17.492 13.554 1.00 56.84  ? 140  ASP B C   1 
ATOM   3042 O O   . ASP B 2 137 ? 28.566  17.838 12.662 1.00 55.31  ? 140  ASP B O   1 
ATOM   3043 C CB  . ASP B 2 137 ? 27.553  15.929 14.355 1.00 55.98  ? 140  ASP B CB  1 
ATOM   3044 C CG  . ASP B 2 137 ? 27.172  15.185 13.085 1.00 64.62  ? 140  ASP B CG  1 
ATOM   3045 O OD1 . ASP B 2 137 ? 28.089  14.639 12.433 1.00 64.82  ? 140  ASP B OD1 1 
ATOM   3046 O OD2 . ASP B 2 137 ? 25.964  15.125 12.755 1.00 68.56  ? 140  ASP B OD2 1 
ATOM   3047 N N   . LEU B 2 138 ? 30.466  18.124 13.828 1.00 54.12  ? 141  LEU B N   1 
ATOM   3048 C CA  . LEU B 2 138 ? 30.847  19.356 13.155 1.00 54.51  ? 141  LEU B CA  1 
ATOM   3049 C C   . LEU B 2 138 ? 31.034  19.120 11.653 1.00 60.67  ? 141  LEU B C   1 
ATOM   3050 O O   . LEU B 2 138 ? 31.973  18.441 11.234 1.00 60.48  ? 141  LEU B O   1 
ATOM   3051 C CB  . LEU B 2 138 ? 32.133  19.888 13.779 1.00 54.51  ? 141  LEU B CB  1 
ATOM   3052 C CG  . LEU B 2 138 ? 32.262  21.399 13.911 1.00 59.63  ? 141  LEU B CG  1 
ATOM   3053 C CD1 . LEU B 2 138 ? 30.909  21.996 14.258 1.00 59.83  ? 141  LEU B CD1 1 
ATOM   3054 C CD2 . LEU B 2 138 ? 33.283  21.712 14.995 1.00 62.80  ? 141  LEU B CD2 1 
ATOM   3055 N N   . LYS B 2 139 ? 30.105  19.645 10.857 1.00 58.68  ? 142  LYS B N   1 
ATOM   3056 C CA  . LYS B 2 139 ? 30.140  19.508 9.401  1.00 58.53  ? 142  LYS B CA  1 
ATOM   3057 C C   . LYS B 2 139 ? 30.204  20.885 8.761  1.00 63.90  ? 142  LYS B C   1 
ATOM   3058 O O   . LYS B 2 139 ? 30.000  21.899 9.426  1.00 63.79  ? 142  LYS B O   1 
ATOM   3059 C CB  . LYS B 2 139 ? 28.873  18.810 8.897  1.00 60.23  ? 142  LYS B CB  1 
ATOM   3060 C CG  . LYS B 2 139 ? 28.654  17.419 9.439  1.00 69.32  ? 142  LYS B CG  1 
ATOM   3061 C CD  . LYS B 2 139 ? 27.239  16.944 9.152  1.00 75.61  ? 142  LYS B CD  1 
ATOM   3062 C CE  . LYS B 2 139 ? 27.003  15.562 9.734  1.00 88.66  ? 142  LYS B CE  1 
ATOM   3063 N NZ  . LYS B 2 139 ? 25.634  15.055 9.456  1.00 99.68  ? 142  LYS B NZ  1 
ATOM   3064 N N   . PRO B 2 140 ? 30.427  20.931 7.438  1.00 61.26  ? 143  PRO B N   1 
ATOM   3065 C CA  . PRO B 2 140 ? 30.276  22.196 6.715  1.00 60.78  ? 143  PRO B CA  1 
ATOM   3066 C C   . PRO B 2 140 ? 28.811  22.624 6.618  1.00 63.49  ? 143  PRO B C   1 
ATOM   3067 O O   . PRO B 2 140 ? 28.514  23.810 6.480  1.00 63.05  ? 143  PRO B O   1 
ATOM   3068 C CB  . PRO B 2 140 ? 30.840  21.863 5.335  1.00 62.50  ? 143  PRO B CB  1 
ATOM   3069 C CG  . PRO B 2 140 ? 31.904  20.835 5.610  1.00 66.90  ? 143  PRO B CG  1 
ATOM   3070 C CD  . PRO B 2 140 ? 31.519  20.108 6.883  1.00 62.67  ? 143  PRO B CD  1 
ATOM   3071 N N   . GLU B 2 141 ? 27.898  21.662 6.712  1.00 59.48  ? 144  GLU B N   1 
ATOM   3072 C CA  . GLU B 2 141 ? 26.467  21.967 6.739  1.00 59.32  ? 144  GLU B CA  1 
ATOM   3073 C C   . GLU B 2 141 ? 26.026  22.468 8.113  1.00 63.52  ? 144  GLU B C   1 
ATOM   3074 O O   . GLU B 2 141 ? 24.938  23.024 8.258  1.00 63.22  ? 144  GLU B O   1 
ATOM   3075 C CB  . GLU B 2 141 ? 25.633  20.738 6.365  1.00 60.66  ? 144  GLU B CB  1 
ATOM   3076 C CG  . GLU B 2 141 ? 25.987  20.102 5.034  1.00 71.75  ? 144  GLU B CG  1 
ATOM   3077 C CD  . GLU B 2 141 ? 27.130  19.116 5.149  1.00 95.52  ? 144  GLU B CD  1 
ATOM   3078 O OE1 . GLU B 2 141 ? 28.161  19.460 5.764  1.00 88.17  ? 144  GLU B OE1 1 
ATOM   3079 O OE2 . GLU B 2 141 ? 27.015  18.011 4.580  1.00 94.17  ? 144  GLU B OE2 1 
ATOM   3080 N N   . ASN B 2 142 ? 26.842  22.198 9.128  1.00 59.93  ? 145  ASN B N   1 
ATOM   3081 C CA  . ASN B 2 142 ? 26.559  22.649 10.489 1.00 59.22  ? 145  ASN B CA  1 
ATOM   3082 C C   . ASN B 2 142 ? 27.033  24.082 10.701 1.00 61.81  ? 145  ASN B C   1 
ATOM   3083 O O   . ASN B 2 142 ? 26.471  24.813 11.507 1.00 61.73  ? 145  ASN B O   1 
ATOM   3084 C CB  . ASN B 2 142 ? 27.221  21.720 11.514 1.00 58.28  ? 145  ASN B CB  1 
ATOM   3085 C CG  . ASN B 2 142 ? 26.396  20.482 11.793 1.00 81.37  ? 145  ASN B CG  1 
ATOM   3086 O OD1 . ASN B 2 142 ? 25.203  20.433 11.495 1.00 77.01  ? 145  ASN B OD1 1 
ATOM   3087 N ND2 . ASN B 2 142 ? 27.021  19.481 12.390 1.00 74.31  ? 145  ASN B ND2 1 
ATOM   3088 N N   . ILE B 2 143 ? 28.070  24.471 9.969  1.00 57.15  ? 146  ILE B N   1 
ATOM   3089 C CA  . ILE B 2 143 ? 28.656  25.798 10.088 1.00 56.54  ? 146  ILE B CA  1 
ATOM   3090 C C   . ILE B 2 143 ? 27.925  26.796 9.204  1.00 61.50  ? 146  ILE B C   1 
ATOM   3091 O O   . ILE B 2 143 ? 27.923  26.662 7.986  1.00 61.75  ? 146  ILE B O   1 
ATOM   3092 C CB  . ILE B 2 143 ? 30.141  25.754 9.737  1.00 59.32  ? 146  ILE B CB  1 
ATOM   3093 C CG1 . ILE B 2 143 ? 30.804  24.561 10.425 1.00 59.07  ? 146  ILE B CG1 1 
ATOM   3094 C CG2 . ILE B 2 143 ? 30.816  27.070 10.099 1.00 60.62  ? 146  ILE B CG2 1 
ATOM   3095 C CD1 . ILE B 2 143 ? 32.255  24.392 10.084 1.00 64.44  ? 146  ILE B CD1 1 
ATOM   3096 N N   . LEU B 2 144 ? 27.335  27.816 9.815  1.00 58.26  ? 147  LEU B N   1 
ATOM   3097 C CA  . LEU B 2 144 ? 26.537  28.783 9.072  1.00 57.98  ? 147  LEU B CA  1 
ATOM   3098 C C   . LEU B 2 144 ? 27.219  30.135 8.918  1.00 64.04  ? 147  LEU B C   1 
ATOM   3099 O O   . LEU B 2 144 ? 28.328  30.345 9.406  1.00 63.01  ? 147  LEU B O   1 
ATOM   3100 C CB  . LEU B 2 144 ? 25.170  28.953 9.725  1.00 57.70  ? 147  LEU B CB  1 
ATOM   3101 C CG  . LEU B 2 144 ? 24.528  27.625 10.108 1.00 62.18  ? 147  LEU B CG  1 
ATOM   3102 C CD1 . LEU B 2 144 ? 23.027  27.770 10.291 1.00 62.06  ? 147  LEU B CD1 1 
ATOM   3103 C CD2 . LEU B 2 144 ? 24.860  26.570 9.061  1.00 64.95  ? 147  LEU B CD2 1 
ATOM   3104 N N   . VAL B 2 145 ? 26.554  31.036 8.198  1.00 63.45  ? 148  VAL B N   1 
ATOM   3105 C CA  . VAL B 2 145 ? 27.020  32.409 8.017  1.00 64.35  ? 148  VAL B CA  1 
ATOM   3106 C C   . VAL B 2 145 ? 26.099  33.212 7.097  1.00 71.41  ? 148  VAL B C   1 
ATOM   3107 O O   . VAL B 2 145 ? 26.069  32.989 5.888  1.00 71.17  ? 148  VAL B O   1 
ATOM   3108 C CB  . VAL B 2 145 ? 28.494  32.467 7.558  1.00 67.87  ? 148  VAL B CB  1 
ATOM   3109 C CG1 . VAL B 2 145 ? 28.833  31.279 6.675  1.00 67.46  ? 148  VAL B CG1 1 
ATOM   3110 C CG2 . VAL B 2 145 ? 28.772  33.779 6.834  1.00 67.63  ? 148  VAL B CG2 1 
ATOM   3111 N N   . THR B 2 146 ? 25.319  34.119 7.681  1.00 70.15  ? 149  THR B N   1 
ATOM   3112 C CA  . THR B 2 146 ? 24.468  35.009 6.893  1.00 70.68  ? 149  THR B CA  1 
ATOM   3113 C C   . THR B 2 146 ? 25.348  36.119 6.318  1.00 74.84  ? 149  THR B C   1 
ATOM   3114 O O   . THR B 2 146 ? 26.549  36.183 6.603  1.00 74.68  ? 149  THR B O   1 
ATOM   3115 C CB  . THR B 2 146 ? 23.295  35.591 7.742  1.00 80.28  ? 149  THR B CB  1 
ATOM   3116 O OG1 . THR B 2 146 ? 22.124  35.744 6.925  1.00 76.97  ? 149  THR B OG1 1 
ATOM   3117 C CG2 . THR B 2 146 ? 23.676  36.948 8.321  1.00 80.29  ? 149  THR B CG2 1 
ATOM   3118 N N   . SER B 2 147 ? 24.755  36.982 5.500  1.00 71.02  ? 150  SER B N   1 
ATOM   3119 C CA  . SER B 2 147 ? 25.495  38.078 4.889  1.00 70.54  ? 150  SER B CA  1 
ATOM   3120 C C   . SER B 2 147 ? 26.230  38.889 5.950  1.00 73.89  ? 150  SER B C   1 
ATOM   3121 O O   . SER B 2 147 ? 25.608  39.536 6.793  1.00 73.87  ? 150  SER B O   1 
ATOM   3122 C CB  . SER B 2 147 ? 24.551  38.973 4.089  1.00 74.03  ? 150  SER B CB  1 
ATOM   3123 O OG  . SER B 2 147 ? 23.409  39.314 4.853  1.00 83.11  ? 150  SER B OG  1 
ATOM   3124 N N   . GLY B 2 148 ? 27.556  38.831 5.921  1.00 69.43  ? 151  GLY B N   1 
ATOM   3125 C CA  . GLY B 2 148 ? 28.380  39.528 6.889  1.00 68.76  ? 151  GLY B CA  1 
ATOM   3126 C C   . GLY B 2 148 ? 29.678  38.789 7.148  1.00 71.80  ? 151  GLY B C   1 
ATOM   3127 O O   . GLY B 2 148 ? 30.658  39.375 7.612  1.00 71.32  ? 151  GLY B O   1 
ATOM   3128 N N   . GLY B 2 149 ? 29.696  37.501 6.818  1.00 67.58  ? 152  GLY B N   1 
ATOM   3129 C CA  . GLY B 2 149 ? 30.865  36.672 7.041  1.00 67.04  ? 152  GLY B CA  1 
ATOM   3130 C C   . GLY B 2 149 ? 31.001  36.376 8.518  1.00 69.41  ? 152  GLY B C   1 
ATOM   3131 O O   . GLY B 2 149 ? 32.088  36.452 9.093  1.00 67.87  ? 152  GLY B O   1 
ATOM   3132 N N   . THR B 2 150 ? 29.881  35.982 9.114  1.00 66.09  ? 153  THR B N   1 
ATOM   3133 C CA  . THR B 2 150 ? 29.748  35.899 10.562 1.00 65.41  ? 153  THR B CA  1 
ATOM   3134 C C   . THR B 2 150 ? 30.144  34.564 11.194 1.00 66.63  ? 153  THR B C   1 
ATOM   3135 O O   . THR B 2 150 ? 30.775  34.545 12.245 1.00 67.24  ? 153  THR B O   1 
ATOM   3136 C CB  . THR B 2 150 ? 28.355  36.373 11.008 1.00 77.54  ? 153  THR B CB  1 
ATOM   3137 O OG1 . THR B 2 150 ? 27.424  36.211 9.924  1.00 79.99  ? 153  THR B OG1 1 
ATOM   3138 C CG2 . THR B 2 150 ? 28.402  37.842 11.424 1.00 75.73  ? 153  THR B CG2 1 
ATOM   3139 N N   . VAL B 2 151 ? 29.774  33.457 10.556 1.00 60.16  ? 154  VAL B N   1 
ATOM   3140 C CA  . VAL B 2 151 ? 29.987  32.112 11.109 1.00 58.72  ? 154  VAL B CA  1 
ATOM   3141 C C   . VAL B 2 151 ? 29.274  31.838 12.440 1.00 59.00  ? 154  VAL B C   1 
ATOM   3142 O O   . VAL B 2 151 ? 29.740  32.234 13.508 1.00 58.38  ? 154  VAL B O   1 
ATOM   3143 C CB  . VAL B 2 151 ? 31.478  31.661 11.109 1.00 62.92  ? 154  VAL B CB  1 
ATOM   3144 C CG1 . VAL B 2 151 ? 32.172  32.053 9.816  1.00 62.78  ? 154  VAL B CG1 1 
ATOM   3145 C CG2 . VAL B 2 151 ? 32.230  32.198 12.312 1.00 62.92  ? 154  VAL B CG2 1 
ATOM   3146 N N   . LYS B 2 152 ? 28.104  31.215 12.351 1.00 52.98  ? 155  LYS B N   1 
ATOM   3147 C CA  . LYS B 2 152 ? 27.420  30.664 13.516 1.00 51.68  ? 155  LYS B CA  1 
ATOM   3148 C C   . LYS B 2 152 ? 27.602  29.146 13.506 1.00 53.84  ? 155  LYS B C   1 
ATOM   3149 O O   . LYS B 2 152 ? 27.181  28.478 12.565 1.00 53.07  ? 155  LYS B O   1 
ATOM   3150 C CB  . LYS B 2 152 ? 25.916  30.968 13.453 1.00 53.43  ? 155  LYS B CB  1 
ATOM   3151 C CG  . LYS B 2 152 ? 25.547  32.418 13.190 1.00 56.82  ? 155  LYS B CG  1 
ATOM   3152 C CD  . LYS B 2 152 ? 25.968  33.308 14.334 1.00 62.07  ? 155  LYS B CD  1 
ATOM   3153 C CE  . LYS B 2 152 ? 25.307  34.671 14.247 1.00 66.66  ? 155  LYS B CE  1 
ATOM   3154 N NZ  . LYS B 2 152 ? 25.535  35.456 15.495 1.00 73.49  ? 155  LYS B NZ  1 
ATOM   3155 N N   . LEU B 2 153 ? 28.224  28.601 14.547 1.00 49.35  ? 156  LEU B N   1 
ATOM   3156 C CA  . LEU B 2 153 ? 28.250  27.155 14.727 1.00 48.40  ? 156  LEU B CA  1 
ATOM   3157 C C   . LEU B 2 153 ? 26.855  26.699 15.134 1.00 49.97  ? 156  LEU B C   1 
ATOM   3158 O O   . LEU B 2 153 ? 26.214  27.329 15.967 1.00 50.26  ? 156  LEU B O   1 
ATOM   3159 C CB  . LEU B 2 153 ? 29.277  26.756 15.790 1.00 48.54  ? 156  LEU B CB  1 
ATOM   3160 C CG  . LEU B 2 153 ? 30.741  27.064 15.462 1.00 53.74  ? 156  LEU B CG  1 
ATOM   3161 C CD1 . LEU B 2 153 ? 31.652  26.629 16.603 1.00 53.94  ? 156  LEU B CD1 1 
ATOM   3162 C CD2 . LEU B 2 153 ? 31.162  26.405 14.147 1.00 56.53  ? 156  LEU B CD2 1 
ATOM   3163 N N   . ALA B 2 154 ? 26.367  25.636 14.507 1.00 44.62  ? 157  ALA B N   1 
ATOM   3164 C CA  . ALA B 2 154 ? 25.021  25.150 14.770 1.00 43.72  ? 157  ALA B CA  1 
ATOM   3165 C C   . ALA B 2 154 ? 24.992  23.658 15.112 1.00 47.13  ? 157  ALA B C   1 
ATOM   3166 O O   . ALA B 2 154 ? 25.933  22.924 14.818 1.00 45.85  ? 157  ALA B O   1 
ATOM   3167 C CB  . ALA B 2 154 ? 24.124  25.444 13.586 1.00 44.36  ? 157  ALA B CB  1 
ATOM   3168 N N   . ASP B 2 155 ? 23.925  23.230 15.779 1.00 44.74  ? 158  ASP B N   1 
ATOM   3169 C CA  . ASP B 2 155 ? 23.711  21.814 16.087 1.00 45.12  ? 158  ASP B CA  1 
ATOM   3170 C C   . ASP B 2 155 ? 24.715  21.196 17.054 1.00 49.23  ? 158  ASP B C   1 
ATOM   3171 O O   . ASP B 2 155 ? 24.868  19.975 17.098 1.00 49.20  ? 158  ASP B O   1 
ATOM   3172 C CB  . ASP B 2 155 ? 23.624  20.983 14.807 1.00 47.36  ? 158  ASP B CB  1 
ATOM   3173 C CG  . ASP B 2 155 ? 22.289  21.135 14.116 1.00 56.33  ? 158  ASP B CG  1 
ATOM   3174 O OD1 . ASP B 2 155 ? 21.394  21.755 14.725 1.00 56.90  ? 158  ASP B OD1 1 
ATOM   3175 O OD2 . ASP B 2 155 ? 22.133  20.635 12.981 1.00 60.62  ? 158  ASP B OD2 1 
ATOM   3176 N N   . PHE B 2 156 ? 25.374  22.039 17.842 1.00 45.74  ? 159  PHE B N   1 
ATOM   3177 C CA  . PHE B 2 156 ? 26.266  21.581 18.902 1.00 45.56  ? 159  PHE B CA  1 
ATOM   3178 C C   . PHE B 2 156 ? 25.467  21.002 20.064 1.00 47.60  ? 159  PHE B C   1 
ATOM   3179 O O   . PHE B 2 156 ? 24.301  21.341 20.250 1.00 46.69  ? 159  PHE B O   1 
ATOM   3180 C CB  . PHE B 2 156 ? 27.122  22.749 19.395 1.00 47.90  ? 159  PHE B CB  1 
ATOM   3181 C CG  . PHE B 2 156 ? 26.353  24.026 19.565 1.00 50.21  ? 159  PHE B CG  1 
ATOM   3182 C CD1 . PHE B 2 156 ? 26.552  25.091 18.700 1.00 54.02  ? 159  PHE B CD1 1 
ATOM   3183 C CD2 . PHE B 2 156 ? 25.399  24.150 20.562 1.00 52.65  ? 159  PHE B CD2 1 
ATOM   3184 C CE1 . PHE B 2 156 ? 25.826  26.267 18.843 1.00 55.09  ? 159  PHE B CE1 1 
ATOM   3185 C CE2 . PHE B 2 156 ? 24.667  25.322 20.704 1.00 55.62  ? 159  PHE B CE2 1 
ATOM   3186 C CZ  . PHE B 2 156 ? 24.883  26.379 19.846 1.00 53.73  ? 159  PHE B CZ  1 
ATOM   3187 N N   . GLY B 2 157 ? 26.096  20.112 20.825 1.00 43.77  ? 160  GLY B N   1 
ATOM   3188 C CA  . GLY B 2 157 ? 25.543  19.576 22.060 1.00 43.04  ? 160  GLY B CA  1 
ATOM   3189 C C   . GLY B 2 157 ? 24.179  18.923 21.944 1.00 46.08  ? 160  GLY B C   1 
ATOM   3190 O O   . GLY B 2 157 ? 23.381  18.984 22.879 1.00 46.05  ? 160  GLY B O   1 
ATOM   3191 N N   . LEU B 2 158 ? 23.935  18.235 20.832 1.00 42.00  ? 161  LEU B N   1 
ATOM   3192 C CA  . LEU B 2 158 ? 22.627  17.626 20.576 1.00 41.11  ? 161  LEU B CA  1 
ATOM   3193 C C   . LEU B 2 158 ? 22.696  16.103 20.490 1.00 43.00  ? 161  LEU B C   1 
ATOM   3194 O O   . LEU B 2 158 ? 21.676  15.429 20.349 1.00 41.64  ? 161  LEU B O   1 
ATOM   3195 C CB  . LEU B 2 158 ? 22.016  18.196 19.290 1.00 40.99  ? 161  LEU B CB  1 
ATOM   3196 C CG  . LEU B 2 158 ? 21.319  19.557 19.373 1.00 45.15  ? 161  LEU B CG  1 
ATOM   3197 C CD1 . LEU B 2 158 ? 20.842  19.993 17.992 1.00 45.26  ? 161  LEU B CD1 1 
ATOM   3198 C CD2 . LEU B 2 158 ? 20.140  19.466 20.329 1.00 47.31  ? 161  LEU B CD2 1 
ATOM   3199 N N   . ALA B 2 159 ? 23.904  15.564 20.591 1.00 40.05  ? 162  ALA B N   1 
ATOM   3200 C CA  . ALA B 2 159 ? 24.109  14.126 20.433 1.00 40.49  ? 162  ALA B CA  1 
ATOM   3201 C C   . ALA B 2 159 ? 23.384  13.299 21.496 1.00 43.98  ? 162  ALA B C   1 
ATOM   3202 O O   . ALA B 2 159 ? 22.726  12.309 21.177 1.00 44.08  ? 162  ALA B O   1 
ATOM   3203 C CB  . ALA B 2 159 ? 25.590  13.797 20.411 1.00 41.34  ? 162  ALA B CB  1 
ATOM   3204 N N   . ARG B 2 160 ? 23.480  13.721 22.754 1.00 39.45  ? 163  ARG B N   1 
ATOM   3205 C CA  . ARG B 2 160 ? 22.805  13.007 23.840 1.00 38.13  ? 163  ARG B CA  1 
ATOM   3206 C C   . ARG B 2 160 ? 21.293  13.164 23.787 1.00 40.06  ? 163  ARG B C   1 
ATOM   3207 O O   . ARG B 2 160 ? 20.560  12.187 23.953 1.00 39.36  ? 163  ARG B O   1 
ATOM   3208 C CB  . ARG B 2 160 ? 23.373  13.393 25.214 1.00 35.57  ? 163  ARG B CB  1 
ATOM   3209 C CG  . ARG B 2 160 ? 24.758  12.809 25.491 1.00 39.21  ? 163  ARG B CG  1 
ATOM   3210 C CD  . ARG B 2 160 ? 25.521  13.576 26.575 1.00 41.06  ? 163  ARG B CD  1 
ATOM   3211 N NE  . ARG B 2 160 ? 24.933  13.456 27.915 1.00 41.45  ? 163  ARG B NE  1 
ATOM   3212 C CZ  . ARG B 2 160 ? 25.162  12.447 28.756 1.00 47.88  ? 163  ARG B CZ  1 
ATOM   3213 N NH1 . ARG B 2 160 ? 24.609  12.441 29.967 1.00 25.93  ? 163  ARG B NH1 1 
ATOM   3214 N NH2 . ARG B 2 160 ? 25.929  11.431 28.382 1.00 33.53  ? 163  ARG B NH2 1 
ATOM   3215 N N   . ILE B 2 161 ? 20.826  14.376 23.494 1.00 36.09  ? 164  ILE B N   1 
ATOM   3216 C CA  . ILE B 2 161 ? 19.396  14.606 23.287 1.00 36.10  ? 164  ILE B CA  1 
ATOM   3217 C C   . ILE B 2 161 ? 18.849  13.683 22.196 1.00 42.01  ? 164  ILE B C   1 
ATOM   3218 O O   . ILE B 2 161 ? 17.706  13.245 22.261 1.00 40.83  ? 164  ILE B O   1 
ATOM   3219 C CB  . ILE B 2 161 ? 19.099  16.072 22.946 1.00 38.93  ? 164  ILE B CB  1 
ATOM   3220 C CG1 . ILE B 2 161 ? 19.469  16.986 24.118 1.00 39.04  ? 164  ILE B CG1 1 
ATOM   3221 C CG2 . ILE B 2 161 ? 17.631  16.225 22.552 1.00 39.27  ? 164  ILE B CG2 1 
ATOM   3222 C CD1 . ILE B 2 161 ? 19.792  18.409 23.714 1.00 42.08  ? 164  ILE B CD1 1 
ATOM   3223 N N   . TYR B 2 162 ? 19.685  13.387 21.203 1.00 41.51  ? 165  TYR B N   1 
ATOM   3224 C CA  . TYR B 2 162 ? 19.293  12.553 20.069 1.00 42.70  ? 165  TYR B CA  1 
ATOM   3225 C C   . TYR B 2 162 ? 19.587  11.057 20.183 1.00 49.84  ? 165  TYR B C   1 
ATOM   3226 O O   . TYR B 2 162 ? 19.091  10.271 19.370 1.00 50.42  ? 165  TYR B O   1 
ATOM   3227 C CB  . TYR B 2 162 ? 19.864  13.105 18.760 1.00 43.35  ? 165  TYR B CB  1 
ATOM   3228 C CG  . TYR B 2 162 ? 18.983  14.164 18.153 1.00 43.80  ? 165  TYR B CG  1 
ATOM   3229 C CD1 . TYR B 2 162 ? 19.150  15.503 18.483 1.00 44.84  ? 165  TYR B CD1 1 
ATOM   3230 C CD2 . TYR B 2 162 ? 17.930  13.815 17.310 1.00 44.49  ? 165  TYR B CD2 1 
ATOM   3231 C CE1 . TYR B 2 162 ? 18.312  16.470 17.973 1.00 45.52  ? 165  TYR B CE1 1 
ATOM   3232 C CE2 . TYR B 2 162 ? 17.098  14.778 16.775 1.00 45.55  ? 165  TYR B CE2 1 
ATOM   3233 C CZ  . TYR B 2 162 ? 17.287  16.108 17.115 1.00 51.58  ? 165  TYR B CZ  1 
ATOM   3234 O OH  . TYR B 2 162 ? 16.456  17.077 16.594 1.00 49.42  ? 165  TYR B OH  1 
ATOM   3235 N N   . SER B 2 163 ? 20.409  10.681 21.162 1.00 47.23  ? 166  SER B N   1 
ATOM   3236 C CA  . SER B 2 163 ? 20.755  9.279  21.427 1.00 47.39  ? 166  SER B CA  1 
ATOM   3237 C C   . SER B 2 163 ? 19.636  8.289  21.165 1.00 51.45  ? 166  SER B C   1 
ATOM   3238 O O   . SER B 2 163 ? 19.815  7.330  20.420 1.00 51.23  ? 166  SER B O   1 
ATOM   3239 C CB  . SER B 2 163 ? 21.244  9.099  22.867 1.00 51.43  ? 166  SER B CB  1 
ATOM   3240 O OG  . SER B 2 163 ? 22.651  9.185  22.933 1.00 63.19  ? 166  SER B OG  1 
ATOM   3241 N N   . TYR B 2 164 ? 18.502  8.499  21.825 1.00 48.84  ? 167  TYR B N   1 
ATOM   3242 C CA  . TYR B 2 164 ? 17.339  7.634  21.657 1.00 49.35  ? 167  TYR B CA  1 
ATOM   3243 C C   . TYR B 2 164 ? 16.989  7.479  20.187 1.00 54.78  ? 167  TYR B C   1 
ATOM   3244 O O   . TYR B 2 164 ? 17.002  6.374  19.658 1.00 54.46  ? 167  TYR B O   1 
ATOM   3245 C CB  . TYR B 2 164 ? 16.135  8.197  22.417 1.00 50.68  ? 167  TYR B CB  1 
ATOM   3246 C CG  . TYR B 2 164 ? 14.856  7.404  22.230 1.00 52.42  ? 167  TYR B CG  1 
ATOM   3247 C CD1 . TYR B 2 164 ? 14.671  6.189  22.879 1.00 54.47  ? 167  TYR B CD1 1 
ATOM   3248 C CD2 . TYR B 2 164 ? 13.826  7.882  21.426 1.00 52.87  ? 167  TYR B CD2 1 
ATOM   3249 C CE1 . TYR B 2 164 ? 13.506  5.464  22.724 1.00 55.44  ? 167  TYR B CE1 1 
ATOM   3250 C CE2 . TYR B 2 164 ? 12.651  7.170  21.274 1.00 53.66  ? 167  TYR B CE2 1 
ATOM   3251 C CZ  . TYR B 2 164 ? 12.498  5.958  21.924 1.00 61.53  ? 167  TYR B CZ  1 
ATOM   3252 O OH  . TYR B 2 164 ? 11.335  5.235  21.782 1.00 61.90  ? 167  TYR B OH  1 
ATOM   3253 N N   . GLN B 2 165 ? 16.732  8.602  19.522 1.00 53.23  ? 168  GLN B N   1 
ATOM   3254 C CA  . GLN B 2 165 ? 16.256  8.592  18.140 1.00 53.86  ? 168  GLN B CA  1 
ATOM   3255 C C   . GLN B 2 165 ? 17.218  7.920  17.159 1.00 59.61  ? 168  GLN B C   1 
ATOM   3256 O O   . GLN B 2 165 ? 16.809  7.118  16.324 1.00 58.36  ? 168  GLN B O   1 
ATOM   3257 C CB  . GLN B 2 165 ? 15.941  10.013 17.669 1.00 54.94  ? 168  GLN B CB  1 
ATOM   3258 C CG  . GLN B 2 165 ? 14.933  10.063 16.530 1.00 65.68  ? 168  GLN B CG  1 
ATOM   3259 C CD  . GLN B 2 165 ? 14.809  11.439 15.908 1.00 76.85  ? 168  GLN B CD  1 
ATOM   3260 O OE1 . GLN B 2 165 ? 15.668  11.858 15.132 1.00 70.70  ? 168  GLN B OE1 1 
ATOM   3261 N NE2 . GLN B 2 165 ? 13.715  12.132 16.211 1.00 65.33  ? 168  GLN B NE2 1 
ATOM   3262 N N   . MET B 2 166 ? 18.491  8.282  17.235 1.00 58.82  ? 169  MET B N   1 
ATOM   3263 C CA  . MET B 2 166 ? 19.475  7.751  16.305 1.00 60.14  ? 169  MET B CA  1 
ATOM   3264 C C   . MET B 2 166 ? 19.689  6.251  16.518 1.00 67.07  ? 169  MET B C   1 
ATOM   3265 O O   . MET B 2 166 ? 20.489  5.617  15.818 1.00 66.56  ? 169  MET B O   1 
ATOM   3266 C CB  . MET B 2 166 ? 20.790  8.515  16.440 1.00 62.61  ? 169  MET B CB  1 
ATOM   3267 C CG  . MET B 2 166 ? 20.644  10.021 16.266 1.00 66.51  ? 169  MET B CG  1 
ATOM   3268 S SD  . MET B 2 166 ? 22.190  10.914 16.552 1.00 71.13  ? 169  MET B SD  1 
ATOM   3269 C CE  . MET B 2 166 ? 22.529  10.479 18.275 1.00 67.75  ? 169  MET B CE  1 
ATOM   3270 N N   . ALA B 2 167 ? 18.936  5.684  17.460 1.00 65.42  ? 170  ALA B N   1 
ATOM   3271 C CA  . ALA B 2 167 ? 19.047  4.265  17.784 1.00 65.68  ? 170  ALA B CA  1 
ATOM   3272 C C   . ALA B 2 167 ? 17.814  3.457  17.385 1.00 69.74  ? 170  ALA B C   1 
ATOM   3273 O O   . ALA B 2 167 ? 17.923  2.269  17.084 1.00 69.15  ? 170  ALA B O   1 
ATOM   3274 C CB  . ALA B 2 167 ? 19.363  4.071  19.260 1.00 66.51  ? 170  ALA B CB  1 
ATOM   3275 N N   . LEU B 2 168 ? 16.644  4.091  17.405 1.00 67.08  ? 171  LEU B N   1 
ATOM   3276 C CA  . LEU B 2 168 ? 15.433  3.458  16.886 1.00 67.55  ? 171  LEU B CA  1 
ATOM   3277 C C   . LEU B 2 168 ? 15.529  3.302  15.381 1.00 72.57  ? 171  LEU B C   1 
ATOM   3278 O O   . LEU B 2 168 ? 15.167  2.262  14.828 1.00 72.08  ? 171  LEU B O   1 
ATOM   3279 C CB  . LEU B 2 168 ? 14.191  4.282  17.214 1.00 67.72  ? 171  LEU B CB  1 
ATOM   3280 C CG  . LEU B 2 168 ? 13.463  3.974  18.520 1.00 72.73  ? 171  LEU B CG  1 
ATOM   3281 C CD1 . LEU B 2 168 ? 12.001  4.370  18.367 1.00 72.85  ? 171  LEU B CD1 1 
ATOM   3282 C CD2 . LEU B 2 168 ? 13.578  2.494  18.861 1.00 75.63  ? 171  LEU B CD2 1 
ATOM   3283 N N   . ALA B 2 169 ? 15.962  4.373  14.723 1.00 69.96  ? 172  ALA B N   1 
ATOM   3284 C CA  . ALA B 2 169 ? 16.164  4.365  13.282 1.00 70.25  ? 172  ALA B CA  1 
ATOM   3285 C C   . ALA B 2 169 ? 17.391  5.184  12.934 1.00 74.51  ? 172  ALA B C   1 
ATOM   3286 O O   . ALA B 2 169 ? 17.308  6.401  12.788 1.00 73.73  ? 172  ALA B O   1 
ATOM   3287 C CB  . ALA B 2 169 ? 14.944  4.928  12.571 1.00 71.10  ? 172  ALA B CB  1 
ATOM   3288 N N   . PRO B 2 170 ? 18.556  4.527  12.826 1.00 72.01  ? 173  PRO B N   1 
ATOM   3289 C CA  . PRO B 2 170 ? 19.732  5.272  12.367 1.00 72.11  ? 173  PRO B CA  1 
ATOM   3290 C C   . PRO B 2 170 ? 19.462  5.870  10.993 1.00 76.41  ? 173  PRO B C   1 
ATOM   3291 O O   . PRO B 2 170 ? 18.457  5.554  10.357 1.00 76.05  ? 173  PRO B O   1 
ATOM   3292 C CB  . PRO B 2 170 ? 20.817  4.192  12.259 1.00 73.89  ? 173  PRO B CB  1 
ATOM   3293 C CG  . PRO B 2 170 ? 20.353  3.086  13.145 1.00 78.29  ? 173  PRO B CG  1 
ATOM   3294 C CD  . PRO B 2 170 ? 18.859  3.104  13.058 1.00 73.71  ? 173  PRO B CD  1 
ATOM   3295 N N   . VAL B 2 171 ? 20.357  6.736  10.539 1.00 73.39  ? 174  VAL B N   1 
ATOM   3296 C CA  . VAL B 2 171 ? 20.255  7.285  9.196  1.00 73.62  ? 174  VAL B CA  1 
ATOM   3297 C C   . VAL B 2 171 ? 21.636  7.620  8.671  1.00 79.26  ? 174  VAL B C   1 
ATOM   3298 O O   . VAL B 2 171 ? 22.601  7.647  9.435  1.00 79.46  ? 174  VAL B O   1 
ATOM   3299 C CB  . VAL B 2 171 ? 19.345  8.528  9.155  1.00 77.25  ? 174  VAL B CB  1 
ATOM   3300 C CG1 . VAL B 2 171 ? 17.900  8.140  9.380  1.00 77.05  ? 174  VAL B CG1 1 
ATOM   3301 C CG2 . VAL B 2 171 ? 19.793  9.553  10.183 1.00 77.01  ? 174  VAL B CG2 1 
ATOM   3302 N N   . VAL B 2 172 ? 21.735  7.754  7.351  1.00 76.10  ? 175  VAL B N   1 
ATOM   3303 C CA  . VAL B 2 172 ? 22.793  8.534  6.722  1.00 75.95  ? 175  VAL B CA  1 
ATOM   3304 C C   . VAL B 2 172 ? 24.175  8.264  7.303  1.00 79.12  ? 175  VAL B C   1 
ATOM   3305 O O   . VAL B 2 172 ? 24.446  7.189  7.845  1.00 78.80  ? 175  VAL B O   1 
ATOM   3306 C CB  . VAL B 2 172 ? 22.478  10.041 6.837  1.00 80.10  ? 175  VAL B CB  1 
ATOM   3307 C CG1 . VAL B 2 172 ? 23.217  10.840 5.767  1.00 80.01  ? 175  VAL B CG1 1 
ATOM   3308 C CG2 . VAL B 2 172 ? 20.978  10.282 6.775  1.00 80.01  ? 175  VAL B CG2 1 
ATOM   3309 N N   . VAL B 2 173 ? 25.037  9.263  7.144  1.00 74.73  ? 176  VAL B N   1 
ATOM   3310 C CA  . VAL B 2 173 ? 26.300  9.396  7.860  1.00 74.18  ? 176  VAL B CA  1 
ATOM   3311 C C   . VAL B 2 173 ? 27.119  10.400 7.070  1.00 76.74  ? 176  VAL B C   1 
ATOM   3312 O O   . VAL B 2 173 ? 26.580  11.119 6.229  1.00 76.10  ? 176  VAL B O   1 
ATOM   3313 C CB  . VAL B 2 173 ? 27.056  8.057  8.035  1.00 78.21  ? 176  VAL B CB  1 
ATOM   3314 C CG1 . VAL B 2 173 ? 27.895  7.740  6.805  1.00 78.03  ? 176  VAL B CG1 1 
ATOM   3315 C CG2 . VAL B 2 173 ? 27.925  8.093  9.291  1.00 78.00  ? 176  VAL B CG2 1 
ATOM   3316 N N   . THR B 2 174 ? 28.418  10.428 7.335  1.00 72.76  ? 177  THR B N   1 
ATOM   3317 C CA  . THR B 2 174 ? 29.357  11.257 6.595  1.00 72.44  ? 177  THR B CA  1 
ATOM   3318 C C   . THR B 2 174 ? 30.643  11.267 7.397  1.00 75.29  ? 177  THR B C   1 
ATOM   3319 O O   . THR B 2 174 ? 31.249  12.314 7.618  1.00 75.31  ? 177  THR B O   1 
ATOM   3320 C CB  . THR B 2 174 ? 28.820  12.678 6.374  1.00 83.91  ? 177  THR B CB  1 
ATOM   3321 O OG1 . THR B 2 174 ? 29.817  13.476 5.723  1.00 85.03  ? 177  THR B OG1 1 
ATOM   3322 C CG2 . THR B 2 174 ? 28.442  13.315 7.701  1.00 83.08  ? 177  THR B CG2 1 
ATOM   3323 N N   . LEU B 2 175 ? 31.060  10.081 7.825  1.00 70.84  ? 178  LEU B N   1 
ATOM   3324 C CA  . LEU B 2 175 ? 32.194  9.930  8.724  1.00 70.57  ? 178  LEU B CA  1 
ATOM   3325 C C   . LEU B 2 175 ? 33.446  10.704 8.325  1.00 73.97  ? 178  LEU B C   1 
ATOM   3326 O O   . LEU B 2 175 ? 34.466  10.620 9.004  1.00 72.78  ? 178  LEU B O   1 
ATOM   3327 C CB  . LEU B 2 175 ? 32.531  8.451  8.893  1.00 70.91  ? 178  LEU B CB  1 
ATOM   3328 C CG  . LEU B 2 175 ? 31.427  7.585  9.503  1.00 76.27  ? 178  LEU B CG  1 
ATOM   3329 C CD1 . LEU B 2 175 ? 31.861  6.126  9.551  1.00 76.44  ? 178  LEU B CD1 1 
ATOM   3330 C CD2 . LEU B 2 175 ? 31.067  8.089  10.899 1.00 79.77  ? 178  LEU B CD2 1 
ATOM   3331 N N   . TRP B 2 176 ? 33.366  11.467 7.239  1.00 71.49  ? 179  TRP B N   1 
ATOM   3332 C CA  . TRP B 2 176 ? 34.530  12.167 6.708  1.00 71.46  ? 179  TRP B CA  1 
ATOM   3333 C C   . TRP B 2 176 ? 35.173  13.070 7.755  1.00 74.75  ? 179  TRP B C   1 
ATOM   3334 O O   . TRP B 2 176 ? 36.320  13.489 7.600  1.00 74.34  ? 179  TRP B O   1 
ATOM   3335 C CB  . TRP B 2 176 ? 34.162  12.981 5.463  1.00 70.57  ? 179  TRP B CB  1 
ATOM   3336 C CG  . TRP B 2 176 ? 33.454  12.190 4.389  1.00 71.65  ? 179  TRP B CG  1 
ATOM   3337 C CD1 . TRP B 2 176 ? 33.486  10.835 4.203  1.00 74.71  ? 179  TRP B CD1 1 
ATOM   3338 C CD2 . TRP B 2 176 ? 32.601  12.713 3.361  1.00 71.79  ? 179  TRP B CD2 1 
ATOM   3339 N NE1 . TRP B 2 176 ? 32.706  10.485 3.124  1.00 74.00  ? 179  TRP B NE1 1 
ATOM   3340 C CE2 . TRP B 2 176 ? 32.147  11.618 2.596  1.00 75.46  ? 179  TRP B CE2 1 
ATOM   3341 C CE3 . TRP B 2 176 ? 32.176  14.002 3.016  1.00 73.11  ? 179  TRP B CE3 1 
ATOM   3342 C CZ2 . TRP B 2 176 ? 31.296  11.774 1.501  1.00 74.82  ? 179  TRP B CZ2 1 
ATOM   3343 C CZ3 . TRP B 2 176 ? 31.326  14.154 1.932  1.00 74.66  ? 179  TRP B CZ3 1 
ATOM   3344 C CH2 . TRP B 2 176 ? 30.897  13.046 1.187  1.00 75.23  ? 179  TRP B CH2 1 
ATOM   3345 N N   . TYR B 2 177 ? 34.450  13.336 8.841  1.00 70.85  ? 180  TYR B N   1 
ATOM   3346 C CA  . TYR B 2 177 ? 34.945  14.251 9.870  1.00 70.06  ? 180  TYR B CA  1 
ATOM   3347 C C   . TYR B 2 177 ? 35.152  13.625 11.248 1.00 72.45  ? 180  TYR B C   1 
ATOM   3348 O O   . TYR B 2 177 ? 35.890  14.169 12.070 1.00 71.30  ? 180  TYR B O   1 
ATOM   3349 C CB  . TYR B 2 177 ? 34.053  15.486 9.969  1.00 70.93  ? 180  TYR B CB  1 
ATOM   3350 C CG  . TYR B 2 177 ? 33.767  16.123 8.631  1.00 72.10  ? 180  TYR B CG  1 
ATOM   3351 C CD1 . TYR B 2 177 ? 34.707  16.940 8.012  1.00 74.02  ? 180  TYR B CD1 1 
ATOM   3352 C CD2 . TYR B 2 177 ? 32.570  15.882 7.967  1.00 72.61  ? 180  TYR B CD2 1 
ATOM   3353 C CE1 . TYR B 2 177 ? 34.449  17.519 6.777  1.00 74.40  ? 180  TYR B CE1 1 
ATOM   3354 C CE2 . TYR B 2 177 ? 32.306  16.454 6.731  1.00 73.24  ? 180  TYR B CE2 1 
ATOM   3355 C CZ  . TYR B 2 177 ? 33.247  17.273 6.144  1.00 79.03  ? 180  TYR B CZ  1 
ATOM   3356 O OH  . TYR B 2 177 ? 32.980  17.843 4.921  1.00 78.76  ? 180  TYR B OH  1 
ATOM   3357 N N   . ARG B 2 178 ? 34.515  12.480 11.489 1.00 68.80  ? 181  ARG B N   1 
ATOM   3358 C CA  . ARG B 2 178 ? 34.651  11.770 12.760 1.00 68.30  ? 181  ARG B CA  1 
ATOM   3359 C C   . ARG B 2 178 ? 36.107  11.524 13.121 1.00 73.24  ? 181  ARG B C   1 
ATOM   3360 O O   . ARG B 2 178 ? 36.897  11.088 12.285 1.00 72.98  ? 181  ARG B O   1 
ATOM   3361 C CB  . ARG B 2 178 ? 33.893  10.441 12.739 1.00 67.23  ? 181  ARG B CB  1 
ATOM   3362 C CG  . ARG B 2 178 ? 32.441  10.539 13.187 1.00 75.62  ? 181  ARG B CG  1 
ATOM   3363 C CD  . ARG B 2 178 ? 31.563  11.110 12.093 1.00 84.92  ? 181  ARG B CD  1 
ATOM   3364 N NE  . ARG B 2 178 ? 30.245  11.496 12.589 1.00 93.25  ? 181  ARG B NE  1 
ATOM   3365 C CZ  . ARG B 2 178 ? 29.319  10.637 13.001 1.00 107.88 ? 181  ARG B CZ  1 
ATOM   3366 N NH1 . ARG B 2 178 ? 29.576  9.337  13.009 1.00 94.00  ? 181  ARG B NH1 1 
ATOM   3367 N NH2 . ARG B 2 178 ? 28.141  11.079 13.420 1.00 97.06  ? 181  ARG B NH2 1 
ATOM   3368 N N   . ALA B 2 179 ? 36.454  11.788 14.378 1.00 70.61  ? 182  ALA B N   1 
ATOM   3369 C CA  . ALA B 2 179 ? 37.815  11.570 14.854 1.00 70.65  ? 182  ALA B CA  1 
ATOM   3370 C C   . ALA B 2 179 ? 38.146  10.083 14.917 1.00 75.22  ? 182  ALA B C   1 
ATOM   3371 O O   . ALA B 2 179 ? 37.257  9.231  14.874 1.00 74.22  ? 182  ALA B O   1 
ATOM   3372 C CB  . ALA B 2 179 ? 38.026  12.231 16.211 1.00 71.30  ? 182  ALA B CB  1 
ATOM   3373 N N   . PRO B 2 180 ? 39.441  9.754  15.014 1.00 72.97  ? 183  PRO B N   1 
ATOM   3374 C CA  . PRO B 2 180 ? 39.859  8.348  15.022 1.00 73.17  ? 183  PRO B CA  1 
ATOM   3375 C C   . PRO B 2 180 ? 39.508  7.603  16.314 1.00 78.84  ? 183  PRO B C   1 
ATOM   3376 O O   . PRO B 2 180 ? 39.603  6.376  16.369 1.00 78.82  ? 183  PRO B O   1 
ATOM   3377 C CB  . PRO B 2 180 ? 41.378  8.427  14.829 1.00 74.66  ? 183  PRO B CB  1 
ATOM   3378 C CG  . PRO B 2 180 ? 41.753  9.831  15.175 1.00 79.01  ? 183  PRO B CG  1 
ATOM   3379 C CD  . PRO B 2 180 ? 40.575  10.670 14.807 1.00 74.49  ? 183  PRO B CD  1 
ATOM   3380 N N   . GLU B 2 181 ? 39.082  8.334  17.344 1.00 76.00  ? 184  GLU B N   1 
ATOM   3381 C CA  . GLU B 2 181 ? 38.662  7.696  18.590 1.00 76.16  ? 184  GLU B CA  1 
ATOM   3382 C C   . GLU B 2 181 ? 37.196  7.294  18.544 1.00 80.29  ? 184  GLU B C   1 
ATOM   3383 O O   . GLU B 2 181 ? 36.821  6.226  19.025 1.00 79.82  ? 184  GLU B O   1 
ATOM   3384 C CB  . GLU B 2 181 ? 38.900  8.604  19.797 1.00 77.62  ? 184  GLU B CB  1 
ATOM   3385 C CG  . GLU B 2 181 ? 40.228  9.324  19.790 1.00 86.85  ? 184  GLU B CG  1 
ATOM   3386 C CD  . GLU B 2 181 ? 40.147  10.649 19.074 1.00 98.21  ? 184  GLU B CD  1 
ATOM   3387 O OE1 . GLU B 2 181 ? 39.147  11.369 19.278 1.00 83.75  ? 184  GLU B OE1 1 
ATOM   3388 O OE2 . GLU B 2 181 ? 41.082  10.969 18.315 1.00 88.56  ? 184  GLU B OE2 1 
ATOM   3389 N N   . VAL B 2 182 ? 36.362  8.182  18.015 1.00 77.09  ? 185  VAL B N   1 
ATOM   3390 C CA  . VAL B 2 182 ? 34.943  7.895  17.865 1.00 76.99  ? 185  VAL B CA  1 
ATOM   3391 C C   . VAL B 2 182 ? 34.737  6.667  16.983 1.00 82.09  ? 185  VAL B C   1 
ATOM   3392 O O   . VAL B 2 182 ? 33.839  5.859  17.225 1.00 81.83  ? 185  VAL B O   1 
ATOM   3393 C CB  . VAL B 2 182 ? 34.189  9.112  17.317 1.00 80.57  ? 185  VAL B CB  1 
ATOM   3394 C CG1 . VAL B 2 182 ? 32.692  8.855  17.308 1.00 80.31  ? 185  VAL B CG1 1 
ATOM   3395 C CG2 . VAL B 2 182 ? 34.527  10.347 18.131 1.00 80.34  ? 185  VAL B CG2 1 
ATOM   3396 N N   . LEU B 2 183 ? 35.579  6.532  15.963 1.00 79.37  ? 186  LEU B N   1 
ATOM   3397 C CA  . LEU B 2 183 ? 35.516  5.388  15.061 1.00 79.47  ? 186  LEU B CA  1 
ATOM   3398 C C   . LEU B 2 183 ? 35.965  4.125  15.789 1.00 83.69  ? 186  LEU B C   1 
ATOM   3399 O O   . LEU B 2 183 ? 35.190  3.184  15.966 1.00 82.81  ? 186  LEU B O   1 
ATOM   3400 C CB  . LEU B 2 183 ? 36.402  5.635  13.836 1.00 79.56  ? 186  LEU B CB  1 
ATOM   3401 C CG  . LEU B 2 183 ? 36.088  6.875  12.990 1.00 84.40  ? 186  LEU B CG  1 
ATOM   3402 C CD1 . LEU B 2 183 ? 37.278  7.247  12.116 1.00 84.68  ? 186  LEU B CD1 1 
ATOM   3403 C CD2 . LEU B 2 183 ? 34.841  6.667  12.135 1.00 86.37  ? 186  LEU B CD2 1 
ATOM   3404 N N   . LEU B 2 184 ? 37.224  4.125  16.213 1.00 80.99  ? 187  LEU B N   1 
ATOM   3405 C CA  . LEU B 2 184 ? 37.795  3.034  16.997 1.00 81.32  ? 187  LEU B CA  1 
ATOM   3406 C C   . LEU B 2 184 ? 36.921  2.627  18.184 1.00 86.73  ? 187  LEU B C   1 
ATOM   3407 O O   . LEU B 2 184 ? 36.820  1.444  18.516 1.00 86.47  ? 187  LEU B O   1 
ATOM   3408 C CB  . LEU B 2 184 ? 39.170  3.450  17.525 1.00 81.36  ? 187  LEU B CB  1 
ATOM   3409 C CG  . LEU B 2 184 ? 40.429  3.126  16.719 1.00 85.95  ? 187  LEU B CG  1 
ATOM   3410 C CD1 . LEU B 2 184 ? 40.106  2.956  15.247 1.00 86.11  ? 187  LEU B CD1 1 
ATOM   3411 C CD2 . LEU B 2 184 ? 41.459  4.231  16.916 1.00 88.11  ? 187  LEU B CD2 1 
ATOM   3412 N N   . GLN B 2 185 ? 36.292  3.615  18.817 1.00 83.94  ? 188  GLN B N   1 
ATOM   3413 C CA  . GLN B 2 185 ? 35.775  3.464  20.177 1.00 83.69  ? 188  GLN B CA  1 
ATOM   3414 C C   . GLN B 2 185 ? 34.444  4.197  20.345 1.00 88.17  ? 188  GLN B C   1 
ATOM   3415 O O   . GLN B 2 185 ? 33.395  3.678  19.962 1.00 87.89  ? 188  GLN B O   1 
ATOM   3416 C CB  . GLN B 2 185 ? 36.820  4.004  21.160 1.00 84.80  ? 188  GLN B CB  1 
ATOM   3417 C CG  . GLN B 2 185 ? 36.363  4.211  22.588 1.00 95.57  ? 188  GLN B CG  1 
ATOM   3418 C CD  . GLN B 2 185 ? 37.351  5.054  23.372 1.00 112.64 ? 188  GLN B CD  1 
ATOM   3419 O OE1 . GLN B 2 185 ? 36.972  5.808  24.268 1.00 107.12 ? 188  GLN B OE1 1 
ATOM   3420 N NE2 . GLN B 2 185 ? 38.626  4.958  23.009 1.00 104.59 ? 188  GLN B NE2 1 
ATOM   3421 N N   . SER B 2 186 ? 34.506  5.393  20.928 1.00 85.14  ? 189  SER B N   1 
ATOM   3422 C CA  . SER B 2 186 ? 33.371  6.314  21.055 1.00 85.06  ? 189  SER B CA  1 
ATOM   3423 C C   . SER B 2 186 ? 33.698  7.338  22.138 1.00 88.31  ? 189  SER B C   1 
ATOM   3424 O O   . SER B 2 186 ? 32.875  7.623  23.007 1.00 87.86  ? 189  SER B O   1 
ATOM   3425 C CB  . SER B 2 186 ? 32.077  5.579  21.418 1.00 89.02  ? 189  SER B CB  1 
ATOM   3426 O OG  . SER B 2 186 ? 30.972  6.468  21.423 1.00 97.76  ? 189  SER B OG  1 
ATOM   3427 N N   . THR B 2 187 ? 34.903  7.895  22.060 1.00 84.31  ? 190  THR B N   1 
ATOM   3428 C CA  . THR B 2 187 ? 35.459  8.745  23.111 1.00 83.69  ? 190  THR B CA  1 
ATOM   3429 C C   . THR B 2 187 ? 34.600  9.942  23.526 1.00 86.69  ? 190  THR B C   1 
ATOM   3430 O O   . THR B 2 187 ? 34.780  10.493 24.612 1.00 86.31  ? 190  THR B O   1 
ATOM   3431 C CB  . THR B 2 187 ? 36.909  9.150  22.787 1.00 91.00  ? 190  THR B CB  1 
ATOM   3432 O OG1 . THR B 2 187 ? 37.764  8.008  22.922 1.00 91.20  ? 190  THR B OG1 1 
ATOM   3433 C CG2 . THR B 2 187 ? 37.389  10.257 23.711 1.00 89.26  ? 190  THR B CG2 1 
ATOM   3434 N N   . TYR B 2 188 ? 33.696  10.371 22.650 1.00 82.48  ? 191  TYR B N   1 
ATOM   3435 C CA  . TYR B 2 188 ? 32.760  11.456 22.961 1.00 81.70  ? 191  TYR B CA  1 
ATOM   3436 C C   . TYR B 2 188 ? 33.402  12.722 23.538 1.00 83.24  ? 191  TYR B C   1 
ATOM   3437 O O   . TYR B 2 188 ? 32.740  13.750 23.663 1.00 83.10  ? 191  TYR B O   1 
ATOM   3438 C CB  . TYR B 2 188 ? 31.632  10.968 23.880 1.00 83.13  ? 191  TYR B CB  1 
ATOM   3439 C CG  . TYR B 2 188 ? 30.522  11.982 24.084 1.00 85.51  ? 191  TYR B CG  1 
ATOM   3440 C CD1 . TYR B 2 188 ? 29.435  12.034 23.221 1.00 87.49  ? 191  TYR B CD1 1 
ATOM   3441 C CD2 . TYR B 2 188 ? 30.555  12.880 25.147 1.00 86.57  ? 191  TYR B CD2 1 
ATOM   3442 C CE1 . TYR B 2 188 ? 28.426  12.972 23.389 1.00 88.05  ? 191  TYR B CE1 1 
ATOM   3443 C CE2 . TYR B 2 188 ? 29.544  13.820 25.326 1.00 87.57  ? 191  TYR B CE2 1 
ATOM   3444 C CZ  . TYR B 2 188 ? 28.483  13.859 24.443 1.00 94.66  ? 191  TYR B CZ  1 
ATOM   3445 O OH  . TYR B 2 188 ? 27.475  14.783 24.610 1.00 94.99  ? 191  TYR B OH  1 
ATOM   3446 N N   . ALA B 2 189 ? 34.691  12.658 23.863 1.00 77.56  ? 192  ALA B N   1 
ATOM   3447 C CA  . ALA B 2 189 ? 35.372  13.767 24.522 1.00 76.34  ? 192  ALA B CA  1 
ATOM   3448 C C   . ALA B 2 189 ? 35.382  15.050 23.689 1.00 78.35  ? 192  ALA B C   1 
ATOM   3449 O O   . ALA B 2 189 ? 34.771  15.122 22.624 1.00 78.28  ? 192  ALA B O   1 
ATOM   3450 C CB  . ALA B 2 189 ? 36.783  13.369 24.917 1.00 77.03  ? 192  ALA B CB  1 
ATOM   3451 N N   . THR B 2 190 ? 36.064  16.069 24.196 1.00 72.82  ? 193  THR B N   1 
ATOM   3452 C CA  . THR B 2 190 ? 36.088  17.373 23.548 1.00 71.49  ? 193  THR B CA  1 
ATOM   3453 C C   . THR B 2 190 ? 37.094  17.457 22.397 1.00 73.80  ? 193  THR B C   1 
ATOM   3454 O O   . THR B 2 190 ? 36.921  18.252 21.473 1.00 72.88  ? 193  THR B O   1 
ATOM   3455 C CB  . THR B 2 190 ? 36.307  18.500 24.573 1.00 75.68  ? 193  THR B CB  1 
ATOM   3456 O OG1 . THR B 2 190 ? 35.712  19.709 24.092 1.00 73.69  ? 193  THR B OG1 1 
ATOM   3457 C CG2 . THR B 2 190 ? 37.790  18.737 24.793 1.00 73.72  ? 193  THR B CG2 1 
ATOM   3458 N N   . PRO B 2 191 ? 38.167  16.648 22.445 1.00 69.81  ? 194  PRO B N   1 
ATOM   3459 C CA  . PRO B 2 191 ? 39.163  16.730 21.369 1.00 69.19  ? 194  PRO B CA  1 
ATOM   3460 C C   . PRO B 2 191 ? 38.677  16.195 20.019 1.00 70.96  ? 194  PRO B C   1 
ATOM   3461 O O   . PRO B 2 191 ? 39.347  16.373 19.001 1.00 70.26  ? 194  PRO B O   1 
ATOM   3462 C CB  . PRO B 2 191 ? 40.311  15.869 21.896 1.00 71.06  ? 194  PRO B CB  1 
ATOM   3463 C CG  . PRO B 2 191 ? 40.225  16.012 23.364 1.00 75.73  ? 194  PRO B CG  1 
ATOM   3464 C CD  . PRO B 2 191 ? 38.759  16.123 23.690 1.00 71.33  ? 194  PRO B CD  1 
ATOM   3465 N N   . VAL B 2 192 ? 37.514  15.552 20.009 1.00 66.09  ? 195  VAL B N   1 
ATOM   3466 C CA  . VAL B 2 192 ? 36.942  15.049 18.765 1.00 65.14  ? 195  VAL B CA  1 
ATOM   3467 C C   . VAL B 2 192 ? 36.538  16.197 17.849 1.00 67.58  ? 195  VAL B C   1 
ATOM   3468 O O   . VAL B 2 192 ? 36.631  16.091 16.627 1.00 66.97  ? 195  VAL B O   1 
ATOM   3469 C CB  . VAL B 2 192 ? 35.762  14.087 19.010 1.00 68.65  ? 195  VAL B CB  1 
ATOM   3470 C CG1 . VAL B 2 192 ? 36.168  12.971 19.959 1.00 68.47  ? 195  VAL B CG1 1 
ATOM   3471 C CG2 . VAL B 2 192 ? 34.541  14.844 19.516 1.00 68.27  ? 195  VAL B CG2 1 
ATOM   3472 N N   . ASP B 2 193 ? 36.078  17.289 18.449 1.00 63.34  ? 196  ASP B N   1 
ATOM   3473 C CA  . ASP B 2 193 ? 35.723  18.482 17.693 1.00 62.67  ? 196  ASP B CA  1 
ATOM   3474 C C   . ASP B 2 193 ? 36.938  19.077 16.987 1.00 65.90  ? 196  ASP B C   1 
ATOM   3475 O O   . ASP B 2 193 ? 36.835  19.565 15.863 1.00 64.57  ? 196  ASP B O   1 
ATOM   3476 C CB  . ASP B 2 193 ? 35.074  19.527 18.607 1.00 64.22  ? 196  ASP B CB  1 
ATOM   3477 C CG  . ASP B 2 193 ? 33.666  19.143 19.027 1.00 72.61  ? 196  ASP B CG  1 
ATOM   3478 O OD1 . ASP B 2 193 ? 33.027  18.331 18.320 1.00 71.79  ? 196  ASP B OD1 1 
ATOM   3479 O OD2 . ASP B 2 193 ? 33.194  19.671 20.058 1.00 79.42  ? 196  ASP B OD2 1 
ATOM   3480 N N   . MET B 2 194 ? 38.088  19.036 17.651 1.00 63.45  ? 197  MET B N   1 
ATOM   3481 C CA  . MET B 2 194 ? 39.305  19.608 17.086 1.00 63.94  ? 197  MET B CA  1 
ATOM   3482 C C   . MET B 2 194 ? 39.828  18.826 15.883 1.00 68.95  ? 197  MET B C   1 
ATOM   3483 O O   . MET B 2 194 ? 40.422  19.404 14.971 1.00 69.03  ? 197  MET B O   1 
ATOM   3484 C CB  . MET B 2 194 ? 40.394  19.765 18.149 1.00 66.30  ? 197  MET B CB  1 
ATOM   3485 C CG  . MET B 2 194 ? 40.107  20.864 19.153 1.00 70.00  ? 197  MET B CG  1 
ATOM   3486 S SD  . MET B 2 194 ? 39.874  22.472 18.368 1.00 74.11  ? 197  MET B SD  1 
ATOM   3487 C CE  . MET B 2 194 ? 41.551  22.902 17.966 1.00 70.69  ? 197  MET B CE  1 
ATOM   3488 N N   . TRP B 2 195 ? 39.609  17.515 15.885 1.00 65.38  ? 198  TRP B N   1 
ATOM   3489 C CA  . TRP B 2 195 ? 39.926  16.692 14.724 1.00 65.01  ? 198  TRP B CA  1 
ATOM   3490 C C   . TRP B 2 195 ? 39.031  17.063 13.546 1.00 66.79  ? 198  TRP B C   1 
ATOM   3491 O O   . TRP B 2 195 ? 39.500  17.186 12.415 1.00 65.98  ? 198  TRP B O   1 
ATOM   3492 C CB  . TRP B 2 195 ? 39.773  15.206 15.046 1.00 64.06  ? 198  TRP B CB  1 
ATOM   3493 C CG  . TRP B 2 195 ? 40.078  14.323 13.875 1.00 65.25  ? 198  TRP B CG  1 
ATOM   3494 C CD1 . TRP B 2 195 ? 39.202  13.900 12.920 1.00 68.21  ? 198  TRP B CD1 1 
ATOM   3495 C CD2 . TRP B 2 195 ? 41.357  13.789 13.513 1.00 65.17  ? 198  TRP B CD2 1 
ATOM   3496 N NE1 . TRP B 2 195 ? 39.852  13.118 11.995 1.00 67.78  ? 198  TRP B NE1 1 
ATOM   3497 C CE2 . TRP B 2 195 ? 41.179  13.039 12.334 1.00 69.18  ? 198  TRP B CE2 1 
ATOM   3498 C CE3 . TRP B 2 195 ? 42.639  13.873 14.071 1.00 66.46  ? 198  TRP B CE3 1 
ATOM   3499 C CZ2 . TRP B 2 195 ? 42.229  12.374 11.704 1.00 68.44  ? 198  TRP B CZ2 1 
ATOM   3500 C CZ3 . TRP B 2 195 ? 43.679  13.204 13.451 1.00 67.85  ? 198  TRP B CZ3 1 
ATOM   3501 C CH2 . TRP B 2 195 ? 43.467  12.460 12.284 1.00 68.51  ? 198  TRP B CH2 1 
ATOM   3502 N N   . SER B 2 196 ? 37.741  17.228 13.817 1.00 62.39  ? 199  SER B N   1 
ATOM   3503 C CA  . SER B 2 196 ? 36.803  17.695 12.803 1.00 62.09  ? 199  SER B CA  1 
ATOM   3504 C C   . SER B 2 196 ? 37.191  19.084 12.288 1.00 66.24  ? 199  SER B C   1 
ATOM   3505 O O   . SER B 2 196 ? 36.886  19.438 11.149 1.00 65.67  ? 199  SER B O   1 
ATOM   3506 C CB  . SER B 2 196 ? 35.374  17.723 13.359 1.00 64.98  ? 199  SER B CB  1 
ATOM   3507 O OG  . SER B 2 196 ? 34.977  16.444 13.820 1.00 72.28  ? 199  SER B OG  1 
ATOM   3508 N N   . VAL B 2 197 ? 37.861  19.866 13.132 1.00 63.08  ? 200  VAL B N   1 
ATOM   3509 C CA  . VAL B 2 197 ? 38.263  21.222 12.769 1.00 63.23  ? 200  VAL B CA  1 
ATOM   3510 C C   . VAL B 2 197 ? 39.451  21.246 11.815 1.00 67.25  ? 200  VAL B C   1 
ATOM   3511 O O   . VAL B 2 197 ? 39.580  22.158 11.000 1.00 67.42  ? 200  VAL B O   1 
ATOM   3512 C CB  . VAL B 2 197 ? 38.541  22.089 14.003 1.00 67.49  ? 200  VAL B CB  1 
ATOM   3513 C CG1 . VAL B 2 197 ? 39.142  23.423 13.582 1.00 67.40  ? 200  VAL B CG1 1 
ATOM   3514 C CG2 . VAL B 2 197 ? 37.265  22.302 14.801 1.00 67.43  ? 200  VAL B CG2 1 
ATOM   3515 N N   . GLY B 2 198 ? 40.351  20.281 11.962 1.00 63.26  ? 201  GLY B N   1 
ATOM   3516 C CA  . GLY B 2 198 ? 41.463  20.126 11.043 1.00 62.74  ? 201  GLY B CA  1 
ATOM   3517 C C   . GLY B 2 198 ? 40.990  19.756 9.647  1.00 64.90  ? 201  GLY B C   1 
ATOM   3518 O O   . GLY B 2 198 ? 41.342  20.415 8.666  1.00 64.45  ? 201  GLY B O   1 
ATOM   3519 N N   . CYS B 2 199 ? 40.190  18.696 9.569  1.00 59.75  ? 202  CYS B N   1 
ATOM   3520 C CA  . CYS B 2 199 ? 39.586  18.261 8.317  1.00 58.80  ? 202  CYS B CA  1 
ATOM   3521 C C   . CYS B 2 199 ? 38.990  19.436 7.569  1.00 61.94  ? 202  CYS B C   1 
ATOM   3522 O O   . CYS B 2 199 ? 39.166  19.570 6.356  1.00 61.78  ? 202  CYS B O   1 
ATOM   3523 C CB  . CYS B 2 199 ? 38.493  17.224 8.585  1.00 59.01  ? 202  CYS B CB  1 
ATOM   3524 S SG  . CYS B 2 199 ? 39.099  15.676 9.290  1.00 62.93  ? 202  CYS B SG  1 
ATOM   3525 N N   . ILE B 2 200 ? 38.271  20.276 8.306  1.00 57.96  ? 203  ILE B N   1 
ATOM   3526 C CA  . ILE B 2 200 ? 37.607  21.447 7.741  1.00 57.17  ? 203  ILE B CA  1 
ATOM   3527 C C   . ILE B 2 200 ? 38.635  22.498 7.338  1.00 59.96  ? 203  ILE B C   1 
ATOM   3528 O O   . ILE B 2 200 ? 38.486  23.173 6.323  1.00 58.69  ? 203  ILE B O   1 
ATOM   3529 C CB  . ILE B 2 200 ? 36.575  22.027 8.729  1.00 60.01  ? 203  ILE B CB  1 
ATOM   3530 C CG1 . ILE B 2 200 ? 35.367  21.097 8.848  1.00 60.16  ? 203  ILE B CG1 1 
ATOM   3531 C CG2 . ILE B 2 200 ? 36.130  23.408 8.282  1.00 60.80  ? 203  ILE B CG2 1 
ATOM   3532 C CD1 . ILE B 2 200 ? 34.419  21.190 7.677  1.00 67.92  ? 203  ILE B CD1 1 
ATOM   3533 N N   . PHE B 2 201 ? 39.667  22.645 8.158  1.00 57.01  ? 204  PHE B N   1 
ATOM   3534 C CA  . PHE B 2 201 ? 40.771  23.538 7.848  1.00 57.12  ? 204  PHE B CA  1 
ATOM   3535 C C   . PHE B 2 201 ? 41.295  23.198 6.451  1.00 64.51  ? 204  PHE B C   1 
ATOM   3536 O O   . PHE B 2 201 ? 41.274  24.034 5.541  1.00 64.61  ? 204  PHE B O   1 
ATOM   3537 C CB  . PHE B 2 201 ? 41.877  23.363 8.891  1.00 58.26  ? 204  PHE B CB  1 
ATOM   3538 C CG  . PHE B 2 201 ? 43.026  24.313 8.726  1.00 59.26  ? 204  PHE B CG  1 
ATOM   3539 C CD1 . PHE B 2 201 ? 42.889  25.466 7.971  1.00 61.86  ? 204  PHE B CD1 1 
ATOM   3540 C CD2 . PHE B 2 201 ? 44.245  24.056 9.341  1.00 61.05  ? 204  PHE B CD2 1 
ATOM   3541 C CE1 . PHE B 2 201 ? 43.947  26.347 7.830  1.00 62.69  ? 204  PHE B CE1 1 
ATOM   3542 C CE2 . PHE B 2 201 ? 45.309  24.928 9.202  1.00 63.69  ? 204  PHE B CE2 1 
ATOM   3543 C CZ  . PHE B 2 201 ? 45.162  26.075 8.441  1.00 61.78  ? 204  PHE B CZ  1 
ATOM   3544 N N   . ALA B 2 202 ? 41.675  21.937 6.268  1.00 62.45  ? 205  ALA B N   1 
ATOM   3545 C CA  . ALA B 2 202 ? 42.219  21.464 4.998  1.00 62.92  ? 205  ALA B CA  1 
ATOM   3546 C C   . ALA B 2 202 ? 41.227  21.540 3.833  1.00 67.84  ? 205  ALA B C   1 
ATOM   3547 O O   . ALA B 2 202 ? 41.526  22.118 2.790  1.00 67.59  ? 205  ALA B O   1 
ATOM   3548 C CB  . ALA B 2 202 ? 42.754  20.051 5.150  1.00 63.65  ? 205  ALA B CB  1 
ATOM   3549 N N   . GLU B 2 203 ? 40.066  20.915 3.993  1.00 64.82  ? 206  GLU B N   1 
ATOM   3550 C CA  . GLU B 2 203 ? 39.039  20.942 2.957  1.00 64.79  ? 206  GLU B CA  1 
ATOM   3551 C C   . GLU B 2 203 ? 38.754  22.356 2.452  1.00 72.08  ? 206  GLU B C   1 
ATOM   3552 O O   . GLU B 2 203 ? 38.162  22.537 1.385  1.00 71.94  ? 206  GLU B O   1 
ATOM   3553 C CB  . GLU B 2 203 ? 37.749  20.307 3.469  1.00 65.61  ? 206  GLU B CB  1 
ATOM   3554 C CG  . GLU B 2 203 ? 36.536  20.621 2.621  1.00 69.28  ? 206  GLU B CG  1 
ATOM   3555 C CD  . GLU B 2 203 ? 35.329  19.813 3.023  1.00 74.67  ? 206  GLU B CD  1 
ATOM   3556 O OE1 . GLU B 2 203 ? 35.442  18.994 3.959  1.00 66.48  ? 206  GLU B OE1 1 
ATOM   3557 O OE2 . GLU B 2 203 ? 34.269  19.987 2.392  1.00 63.41  ? 206  GLU B OE2 1 
ATOM   3558 N N   . MET B 2 204 ? 39.170  23.355 3.223  1.00 71.24  ? 207  MET B N   1 
ATOM   3559 C CA  . MET B 2 204 ? 38.933  24.748 2.858  1.00 72.32  ? 207  MET B CA  1 
ATOM   3560 C C   . MET B 2 204 ? 39.681  25.159 1.595  1.00 77.68  ? 207  MET B C   1 
ATOM   3561 O O   . MET B 2 204 ? 39.083  25.723 0.677  1.00 77.60  ? 207  MET B O   1 
ATOM   3562 C CB  . MET B 2 204 ? 39.257  25.687 4.022  1.00 75.00  ? 207  MET B CB  1 
ATOM   3563 C CG  . MET B 2 204 ? 38.166  25.724 5.086  1.00 79.21  ? 207  MET B CG  1 
ATOM   3564 S SD  . MET B 2 204 ? 38.567  26.745 6.523  1.00 83.97  ? 207  MET B SD  1 
ATOM   3565 C CE  . MET B 2 204 ? 38.118  28.349 5.953  1.00 80.60  ? 207  MET B CE  1 
ATOM   3566 N N   . PHE B 2 205 ? 40.984  24.883 1.550  1.00 74.73  ? 208  PHE B N   1 
ATOM   3567 C CA  . PHE B 2 205 ? 41.752  25.057 0.317  1.00 74.76  ? 208  PHE B CA  1 
ATOM   3568 C C   . PHE B 2 205 ? 42.056  23.804 -0.494 1.00 78.06  ? 208  PHE B C   1 
ATOM   3569 O O   . PHE B 2 205 ? 43.126  23.674 -1.088 1.00 77.41  ? 208  PHE B O   1 
ATOM   3570 C CB  . PHE B 2 205 ? 42.974  25.973 0.454  1.00 76.74  ? 208  PHE B CB  1 
ATOM   3571 C CG  . PHE B 2 205 ? 43.528  26.071 1.846  1.00 78.50  ? 208  PHE B CG  1 
ATOM   3572 C CD1 . PHE B 2 205 ? 44.177  27.225 2.250  1.00 81.93  ? 208  PHE B CD1 1 
ATOM   3573 C CD2 . PHE B 2 205 ? 43.441  25.013 2.734  1.00 80.94  ? 208  PHE B CD2 1 
ATOM   3574 C CE1 . PHE B 2 205 ? 44.707  27.337 3.520  1.00 82.98  ? 208  PHE B CE1 1 
ATOM   3575 C CE2 . PHE B 2 205 ? 43.955  25.126 4.016  1.00 83.99  ? 208  PHE B CE2 1 
ATOM   3576 C CZ  . PHE B 2 205 ? 44.582  26.294 4.409  1.00 82.08  ? 208  PHE B CZ  1 
ATOM   3577 N N   . ARG B 2 206 ? 41.137  22.850 -0.430 1.00 74.66  ? 209  ARG B N   1 
ATOM   3578 C CA  . ARG B 2 206 ? 40.893  21.935 -1.532 1.00 74.55  ? 209  ARG B CA  1 
ATOM   3579 C C   . ARG B 2 206 ? 39.601  22.456 -2.120 1.00 79.64  ? 209  ARG B C   1 
ATOM   3580 O O   . ARG B 2 206 ? 39.364  23.662 -2.173 1.00 79.26  ? 209  ARG B O   1 
ATOM   3581 C CB  . ARG B 2 206 ? 40.605  20.534 -1.001 1.00 73.99  ? 209  ARG B CB  1 
ATOM   3582 C CG  . ARG B 2 206 ? 41.793  19.807 -0.422 1.00 81.46  ? 209  ARG B CG  1 
ATOM   3583 C CD  . ARG B 2 206 ? 41.321  18.646 0.436  1.00 85.92  ? 209  ARG B CD  1 
ATOM   3584 N NE  . ARG B 2 206 ? 42.058  17.430 0.136  1.00 89.40  ? 209  ARG B NE  1 
ATOM   3585 C CZ  . ARG B 2 206 ? 41.578  16.430 -0.592 1.00 100.09 ? 209  ARG B CZ  1 
ATOM   3586 N NH1 . ARG B 2 206 ? 40.346  16.495 -1.085 1.00 88.01  ? 209  ARG B NH1 1 
ATOM   3587 N NH2 . ARG B 2 206 ? 42.332  15.362 -0.815 1.00 84.15  ? 209  ARG B NH2 1 
ATOM   3588 N N   . ARG B 2 207 ? 38.743  21.526 -2.504 1.00 77.33  ? 210  ARG B N   1 
ATOM   3589 C CA  . ARG B 2 207 ? 37.316  21.763 -2.456 1.00 77.93  ? 210  ARG B CA  1 
ATOM   3590 C C   . ARG B 2 207 ? 36.525  20.478 -2.466 1.00 82.71  ? 210  ARG B C   1 
ATOM   3591 O O   . ARG B 2 207 ? 35.905  20.125 -3.468 1.00 82.51  ? 210  ARG B O   1 
ATOM   3592 C CB  . ARG B 2 207 ? 36.833  22.776 -3.490 1.00 79.48  ? 210  ARG B CB  1 
ATOM   3593 C CG  . ARG B 2 207 ? 36.731  24.188 -2.924 1.00 92.32  ? 210  ARG B CG  1 
ATOM   3594 C CD  . ARG B 2 207 ? 35.700  25.017 -3.667 1.00 104.49 ? 210  ARG B CD  1 
ATOM   3595 N NE  . ARG B 2 207 ? 36.099  25.269 -5.047 1.00 113.83 ? 210  ARG B NE  1 
ATOM   3596 C CZ  . ARG B 2 207 ? 35.369  25.951 -5.923 1.00 128.64 ? 210  ARG B CZ  1 
ATOM   3597 N NH1 . ARG B 2 207 ? 34.194  26.451 -5.565 1.00 114.90 ? 210  ARG B NH1 1 
ATOM   3598 N NH2 . ARG B 2 207 ? 35.812  26.130 -7.158 1.00 117.86 ? 210  ARG B NH2 1 
ATOM   3599 N N   . LYS B 2 208 ? 36.781  19.691 -1.426 1.00 79.69  ? 211  LYS B N   1 
ATOM   3600 C CA  . LYS B 2 208 ? 35.884  18.651 -0.927 1.00 79.64  ? 211  LYS B CA  1 
ATOM   3601 C C   . LYS B 2 208 ? 36.647  17.771 0.056  1.00 82.45  ? 211  LYS B C   1 
ATOM   3602 O O   . LYS B 2 208 ? 37.864  17.909 0.198  1.00 81.96  ? 211  LYS B O   1 
ATOM   3603 C CB  . LYS B 2 208 ? 35.222  17.845 -2.053 1.00 82.57  ? 211  LYS B CB  1 
ATOM   3604 C CG  . LYS B 2 208 ? 33.917  18.469 -2.554 1.00 97.36  ? 211  LYS B CG  1 
ATOM   3605 C CD  . LYS B 2 208 ? 33.391  17.781 -3.805 1.00 107.33 ? 211  LYS B CD  1 
ATOM   3606 C CE  . LYS B 2 208 ? 32.299  16.777 -3.470 1.00 116.47 ? 211  LYS B CE  1 
ATOM   3607 N NZ  . LYS B 2 208 ? 32.728  15.797 -2.437 1.00 123.42 ? 211  LYS B NZ  1 
ATOM   3608 N N   . PRO B 2 209 ? 35.923  16.949 0.832  1.00 78.33  ? 212  PRO B N   1 
ATOM   3609 C CA  . PRO B 2 209 ? 36.409  16.108 1.927  1.00 78.16  ? 212  PRO B CA  1 
ATOM   3610 C C   . PRO B 2 209 ? 37.858  15.648 1.771  1.00 81.89  ? 212  PRO B C   1 
ATOM   3611 O O   . PRO B 2 209 ? 38.215  14.999 0.787  1.00 81.52  ? 212  PRO B O   1 
ATOM   3612 C CB  . PRO B 2 209 ? 35.461  14.909 1.879  1.00 79.99  ? 212  PRO B CB  1 
ATOM   3613 C CG  . PRO B 2 209 ? 34.173  15.461 1.296  1.00 84.42  ? 212  PRO B CG  1 
ATOM   3614 C CD  . PRO B 2 209 ? 34.475  16.782 0.625  1.00 79.84  ? 212  PRO B CD  1 
ATOM   3615 N N   . LEU B 2 210 ? 38.689  16.009 2.743  1.00 78.25  ? 213  LEU B N   1 
ATOM   3616 C CA  . LEU B 2 210 ? 40.067  15.542 2.798  1.00 78.19  ? 213  LEU B CA  1 
ATOM   3617 C C   . LEU B 2 210 ? 40.119  14.041 3.086  1.00 82.63  ? 213  LEU B C   1 
ATOM   3618 O O   . LEU B 2 210 ? 41.063  13.359 2.694  1.00 82.40  ? 213  LEU B O   1 
ATOM   3619 C CB  . LEU B 2 210 ? 40.838  16.317 3.872  1.00 78.24  ? 213  LEU B CB  1 
ATOM   3620 C CG  . LEU B 2 210 ? 42.332  16.028 4.034  1.00 83.24  ? 213  LEU B CG  1 
ATOM   3621 C CD1 . LEU B 2 210 ? 42.992  17.102 4.877  1.00 83.55  ? 213  LEU B CD1 1 
ATOM   3622 C CD2 . LEU B 2 210 ? 42.560  14.665 4.663  1.00 85.96  ? 213  LEU B CD2 1 
ATOM   3623 N N   . PHE B 2 211 ? 39.093  13.534 3.762  1.00 79.66  ? 214  PHE B N   1 
ATOM   3624 C CA  . PHE B 2 211 ? 39.041  12.135 4.185  1.00 79.61  ? 214  PHE B CA  1 
ATOM   3625 C C   . PHE B 2 211 ? 37.690  11.533 3.809  1.00 84.71  ? 214  PHE B C   1 
ATOM   3626 O O   . PHE B 2 211 ? 36.903  11.172 4.681  1.00 84.65  ? 214  PHE B O   1 
ATOM   3627 C CB  . PHE B 2 211 ? 39.210  12.039 5.706  1.00 81.26  ? 214  PHE B CB  1 
ATOM   3628 C CG  . PHE B 2 211 ? 40.635  12.122 6.169  1.00 82.75  ? 214  PHE B CG  1 
ATOM   3629 C CD1 . PHE B 2 211 ? 41.618  11.358 5.561  1.00 85.85  ? 214  PHE B CD1 1 
ATOM   3630 C CD2 . PHE B 2 211 ? 40.987  12.934 7.238  1.00 84.63  ? 214  PHE B CD2 1 
ATOM   3631 C CE1 . PHE B 2 211 ? 42.932  11.418 5.993  1.00 86.75  ? 214  PHE B CE1 1 
ATOM   3632 C CE2 . PHE B 2 211 ? 42.296  12.999 7.676  1.00 87.44  ? 214  PHE B CE2 1 
ATOM   3633 C CZ  . PHE B 2 211 ? 43.271  12.238 7.054  1.00 85.71  ? 214  PHE B CZ  1 
ATOM   3634 N N   . CYS B 2 212 ? 37.438  11.392 2.514  1.00 81.92  ? 215  CYS B N   1 
ATOM   3635 C CA  . CYS B 2 212 ? 36.102  11.067 2.024  1.00 82.06  ? 215  CYS B CA  1 
ATOM   3636 C C   . CYS B 2 212 ? 35.859  9.557  1.939  1.00 86.70  ? 215  CYS B C   1 
ATOM   3637 O O   . CYS B 2 212 ? 35.840  8.994  0.846  1.00 86.78  ? 215  CYS B O   1 
ATOM   3638 C CB  . CYS B 2 212 ? 35.901  11.712 0.650  1.00 82.44  ? 215  CYS B CB  1 
ATOM   3639 S SG  . CYS B 2 212 ? 34.216  12.260 0.274  1.00 86.37  ? 215  CYS B SG  1 
ATOM   3640 N N   . GLY B 2 213 ? 35.616  8.916  3.082  1.00 83.41  ? 216  GLY B N   1 
ATOM   3641 C CA  . GLY B 2 213 ? 35.503  7.467  3.165  1.00 83.30  ? 216  GLY B CA  1 
ATOM   3642 C C   . GLY B 2 213 ? 34.092  6.922  3.323  1.00 87.71  ? 216  GLY B C   1 
ATOM   3643 O O   . GLY B 2 213 ? 33.138  7.471  2.769  1.00 87.25  ? 216  GLY B O   1 
ATOM   3644 N N   . ASN B 2 214 ? 33.968  5.802  4.032  1.00 85.08  ? 217  ASN B N   1 
ATOM   3645 C CA  . ASN B 2 214 ? 32.661  5.205  4.310  1.00 85.48  ? 217  ASN B CA  1 
ATOM   3646 C C   . ASN B 2 214 ? 32.676  4.288  5.535  1.00 90.30  ? 217  ASN B C   1 
ATOM   3647 O O   . ASN B 2 214 ? 32.050  4.589  6.554  1.00 90.45  ? 217  ASN B O   1 
ATOM   3648 C CB  . ASN B 2 214 ? 32.133  4.447  3.091  1.00 87.37  ? 217  ASN B CB  1 
ATOM   3649 C CG  . ASN B 2 214 ? 30.746  3.873  3.320  1.00 113.95 ? 217  ASN B CG  1 
ATOM   3650 O OD1 . ASN B 2 214 ? 30.552  3.007  4.175  1.00 108.93 ? 217  ASN B OD1 1 
ATOM   3651 N ND2 . ASN B 2 214 ? 29.769  4.369  2.567  1.00 106.38 ? 217  ASN B ND2 1 
ATOM   3652 N N   . SER B 2 215 ? 33.353  3.150  5.423  1.00 86.85  ? 218  SER B N   1 
ATOM   3653 C CA  . SER B 2 215 ? 33.528  2.270  6.573  1.00 86.49  ? 218  SER B CA  1 
ATOM   3654 C C   . SER B 2 215 ? 34.332  2.976  7.660  1.00 90.29  ? 218  SER B C   1 
ATOM   3655 O O   . SER B 2 215 ? 35.166  3.840  7.374  1.00 89.87  ? 218  SER B O   1 
ATOM   3656 C CB  . SER B 2 215 ? 34.216  0.964  6.168  1.00 89.63  ? 218  SER B CB  1 
ATOM   3657 O OG  . SER B 2 215 ? 34.778  0.314  7.295  1.00 97.67  ? 218  SER B OG  1 
ATOM   3658 N N   . GLU B 2 216 ? 34.051  2.625  8.910  1.00 86.43  ? 219  GLU B N   1 
ATOM   3659 C CA  . GLU B 2 216 ? 34.776  3.176  10.046 1.00 86.07  ? 219  GLU B CA  1 
ATOM   3660 C C   . GLU B 2 216 ? 36.246  2.790  9.943  1.00 88.68  ? 219  GLU B C   1 
ATOM   3661 O O   . GLU B 2 216 ? 37.134  3.552  10.333 1.00 88.37  ? 219  GLU B O   1 
ATOM   3662 C CB  . GLU B 2 216 ? 34.177  2.661  11.359 1.00 87.60  ? 219  GLU B CB  1 
ATOM   3663 C CG  . GLU B 2 216 ? 32.724  3.077  11.593 1.00 99.22  ? 219  GLU B CG  1 
ATOM   3664 C CD  . GLU B 2 216 ? 31.786  2.588  10.503 1.00 122.28 ? 219  GLU B CD  1 
ATOM   3665 O OE1 . GLU B 2 216 ? 32.135  1.607  9.812  1.00 121.29 ? 219  GLU B OE1 1 
ATOM   3666 O OE2 . GLU B 2 216 ? 30.706  3.193  10.329 1.00 115.57 ? 219  GLU B OE2 1 
ATOM   3667 N N   . ALA B 2 217 ? 36.492  1.598  9.408  1.00 84.00  ? 220  ALA B N   1 
ATOM   3668 C CA  . ALA B 2 217 ? 37.842  1.172  9.067  1.00 83.16  ? 220  ALA B CA  1 
ATOM   3669 C C   . ALA B 2 217 ? 38.256  1.848  7.764  1.00 85.29  ? 220  ALA B C   1 
ATOM   3670 O O   . ALA B 2 217 ? 39.396  2.289  7.611  1.00 84.82  ? 220  ALA B O   1 
ATOM   3671 C CB  . ALA B 2 217 ? 37.892  -0.342 8.920  1.00 83.88  ? 220  ALA B CB  1 
ATOM   3672 N N   . ASP B 2 218 ? 37.311  1.925  6.833  1.00 80.63  ? 221  ASP B N   1 
ATOM   3673 C CA  . ASP B 2 218 ? 37.488  2.668  5.590  1.00 80.13  ? 221  ASP B CA  1 
ATOM   3674 C C   . ASP B 2 218 ? 38.061  4.042  5.922  1.00 82.66  ? 221  ASP B C   1 
ATOM   3675 O O   . ASP B 2 218 ? 39.173  4.386  5.512  1.00 81.74  ? 221  ASP B O   1 
ATOM   3676 C CB  . ASP B 2 218 ? 36.126  2.848  4.915  1.00 82.11  ? 221  ASP B CB  1 
ATOM   3677 C CG  . ASP B 2 218 ? 36.180  2.660  3.412  1.00 92.36  ? 221  ASP B CG  1 
ATOM   3678 O OD1 . ASP B 2 218 ? 37.265  2.845  2.822  1.00 92.66  ? 221  ASP B OD1 1 
ATOM   3679 O OD2 . ASP B 2 218 ? 35.126  2.333  2.823  1.00 98.02  ? 221  ASP B OD2 1 
ATOM   3680 N N   . GLN B 2 219 ? 37.297  4.804  6.700  1.00 78.51  ? 222  GLN B N   1 
ATOM   3681 C CA  . GLN B 2 219 ? 37.701  6.134  7.135  1.00 77.96  ? 222  GLN B CA  1 
ATOM   3682 C C   . GLN B 2 219 ? 39.056  6.105  7.836  1.00 81.95  ? 222  GLN B C   1 
ATOM   3683 O O   . GLN B 2 219 ? 39.851  7.040  7.716  1.00 81.03  ? 222  GLN B O   1 
ATOM   3684 C CB  . GLN B 2 219 ? 36.643  6.719  8.068  1.00 79.09  ? 222  GLN B CB  1 
ATOM   3685 C CG  . GLN B 2 219 ? 36.914  8.151  8.500  1.00 90.16  ? 222  GLN B CG  1 
ATOM   3686 C CD  . GLN B 2 219 ? 36.544  9.163  7.434  1.00 102.82 ? 222  GLN B CD  1 
ATOM   3687 O OE1 . GLN B 2 219 ? 37.274  10.126 7.201  1.00 97.09  ? 222  GLN B OE1 1 
ATOM   3688 N NE2 . GLN B 2 219 ? 35.395  8.962  6.796  1.00 91.48  ? 222  GLN B NE2 1 
ATOM   3689 N N   . LEU B 2 220 ? 39.320  5.021  8.559  1.00 79.23  ? 223  LEU B N   1 
ATOM   3690 C CA  . LEU B 2 220 ? 40.574  4.879  9.294  1.00 79.39  ? 223  LEU B CA  1 
ATOM   3691 C C   . LEU B 2 220 ? 41.804  4.854  8.393  1.00 82.93  ? 223  LEU B C   1 
ATOM   3692 O O   . LEU B 2 220 ? 42.580  5.810  8.370  1.00 82.50  ? 223  LEU B O   1 
ATOM   3693 C CB  . LEU B 2 220 ? 40.545  3.643  10.194 1.00 79.65  ? 223  LEU B CB  1 
ATOM   3694 C CG  . LEU B 2 220 ? 39.715  3.793  11.471 1.00 84.53  ? 223  LEU B CG  1 
ATOM   3695 C CD1 . LEU B 2 220 ? 39.707  2.500  12.266 1.00 84.75  ? 223  LEU B CD1 1 
ATOM   3696 C CD2 . LEU B 2 220 ? 40.251  4.938  12.319 1.00 86.81  ? 223  LEU B CD2 1 
ATOM   3697 N N   . GLY B 2 221 ? 41.998  3.750  7.679  1.00 79.33  ? 224  GLY B N   1 
ATOM   3698 C CA  . GLY B 2 221 ? 43.132  3.600  6.784  1.00 79.09  ? 224  GLY B CA  1 
ATOM   3699 C C   . GLY B 2 221 ? 43.273  4.809  5.883  1.00 82.78  ? 224  GLY B C   1 
ATOM   3700 O O   . GLY B 2 221 ? 44.379  5.282  5.615  1.00 82.00  ? 224  GLY B O   1 
ATOM   3701 N N   . LYS B 2 222 ? 42.130  5.335  5.458  1.00 79.43  ? 225  LYS B N   1 
ATOM   3702 C CA  . LYS B 2 222 ? 42.069  6.566  4.682  1.00 79.11  ? 225  LYS B CA  1 
ATOM   3703 C C   . LYS B 2 222 ? 42.761  7.692  5.450  1.00 83.87  ? 225  LYS B C   1 
ATOM   3704 O O   . LYS B 2 222 ? 43.426  8.547  4.862  1.00 83.46  ? 225  LYS B O   1 
ATOM   3705 C CB  . LYS B 2 222 ? 40.606  6.925  4.421  1.00 80.93  ? 225  LYS B CB  1 
ATOM   3706 C CG  . LYS B 2 222 ? 40.291  7.227  2.972  1.00 88.60  ? 225  LYS B CG  1 
ATOM   3707 C CD  . LYS B 2 222 ? 38.902  6.729  2.616  1.00 92.46  ? 225  LYS B CD  1 
ATOM   3708 C CE  . LYS B 2 222 ? 38.684  6.718  1.116  1.00 95.63  ? 225  LYS B CE  1 
ATOM   3709 N NZ  . LYS B 2 222 ? 37.450  5.976  0.747  1.00 100.81 ? 225  LYS B NZ  1 
ATOM   3710 N N   . ILE B 2 223 ? 42.616  7.667  6.772  1.00 81.16  ? 226  ILE B N   1 
ATOM   3711 C CA  . ILE B 2 223 ? 43.291  8.620  7.646  1.00 81.48  ? 226  ILE B CA  1 
ATOM   3712 C C   . ILE B 2 223 ? 44.765  8.255  7.817  1.00 87.91  ? 226  ILE B C   1 
ATOM   3713 O O   . ILE B 2 223 ? 45.646  9.104  7.674  1.00 87.40  ? 226  ILE B O   1 
ATOM   3714 C CB  . ILE B 2 223 ? 42.578  8.729  9.015  1.00 84.16  ? 226  ILE B CB  1 
ATOM   3715 C CG1 . ILE B 2 223 ? 41.269  9.508  8.876  1.00 84.18  ? 226  ILE B CG1 1 
ATOM   3716 C CG2 . ILE B 2 223 ? 43.492  9.368  10.049 1.00 84.32  ? 226  ILE B CG2 1 
ATOM   3717 C CD1 . ILE B 2 223 ? 40.386  9.431  10.091 1.00 89.39  ? 226  ILE B CD1 1 
ATOM   3718 N N   . PHE B 2 224 ? 45.026  6.987  8.117  1.00 86.72  ? 227  PHE B N   1 
ATOM   3719 C CA  . PHE B 2 224 ? 46.394  6.512  8.301  1.00 87.63  ? 227  PHE B CA  1 
ATOM   3720 C C   . PHE B 2 224 ? 47.233  6.737  7.051  1.00 93.22  ? 227  PHE B C   1 
ATOM   3721 O O   . PHE B 2 224 ? 48.446  6.928  7.133  1.00 92.33  ? 227  PHE B O   1 
ATOM   3722 C CB  . PHE B 2 224 ? 46.406  5.036  8.699  1.00 89.62  ? 227  PHE B CB  1 
ATOM   3723 C CG  . PHE B 2 224 ? 45.783  4.769  10.037 1.00 91.39  ? 227  PHE B CG  1 
ATOM   3724 C CD1 . PHE B 2 224 ? 46.494  4.997  11.202 1.00 94.73  ? 227  PHE B CD1 1 
ATOM   3725 C CD2 . PHE B 2 224 ? 44.474  4.328  10.132 1.00 93.94  ? 227  PHE B CD2 1 
ATOM   3726 C CE1 . PHE B 2 224 ? 45.917  4.768  12.438 1.00 95.75  ? 227  PHE B CE1 1 
ATOM   3727 C CE2 . PHE B 2 224 ? 43.891  4.100  11.365 1.00 96.90  ? 227  PHE B CE2 1 
ATOM   3728 C CZ  . PHE B 2 224 ? 44.616  4.320  12.520 1.00 94.98  ? 227  PHE B CZ  1 
ATOM   3729 N N   . ASP B 2 225 ? 46.577  6.713  5.895  1.00 91.76  ? 228  ASP B N   1 
ATOM   3730 C CA  . ASP B 2 225 ? 47.231  7.068  4.640  1.00 92.45  ? 228  ASP B CA  1 
ATOM   3731 C C   . ASP B 2 225 ? 47.922  8.415  4.807  1.00 98.08  ? 228  ASP B C   1 
ATOM   3732 O O   . ASP B 2 225 ? 49.089  8.582  4.451  1.00 97.55  ? 228  ASP B O   1 
ATOM   3733 C CB  . ASP B 2 225 ? 46.205  7.159  3.504  1.00 94.31  ? 228  ASP B CB  1 
ATOM   3734 C CG  . ASP B 2 225 ? 45.594  5.812  3.151  1.00 105.67 ? 228  ASP B CG  1 
ATOM   3735 O OD1 . ASP B 2 225 ? 45.933  4.805  3.808  1.00 106.78 ? 228  ASP B OD1 1 
ATOM   3736 O OD2 . ASP B 2 225 ? 44.774  5.760  2.210  1.00 111.55 ? 228  ASP B OD2 1 
ATOM   3737 N N   . LEU B 2 226 ? 47.199  9.363  5.393  1.00 96.15  ? 229  LEU B N   1 
ATOM   3738 C CA  . LEU B 2 226 ? 47.673  10.733 5.508  1.00 96.75  ? 229  LEU B CA  1 
ATOM   3739 C C   . LEU B 2 226 ? 48.588  10.903 6.717  1.00 103.37 ? 229  LEU B C   1 
ATOM   3740 O O   . LEU B 2 226 ? 49.755  11.267 6.576  1.00 102.80 ? 229  LEU B O   1 
ATOM   3741 C CB  . LEU B 2 226 ? 46.482  11.690 5.604  1.00 96.66  ? 229  LEU B CB  1 
ATOM   3742 C CG  . LEU B 2 226 ? 46.716  13.151 5.219  1.00 101.18 ? 229  LEU B CG  1 
ATOM   3743 C CD1 . LEU B 2 226 ? 45.509  14.001 5.583  1.00 101.23 ? 229  LEU B CD1 1 
ATOM   3744 C CD2 . LEU B 2 226 ? 47.980  13.700 5.857  1.00 103.63 ? 229  LEU B CD2 1 
ATOM   3745 N N   . ILE B 2 227 ? 48.054  10.616 7.901  1.00 102.31 ? 230  ILE B N   1 
ATOM   3746 C CA  . ILE B 2 227 ? 48.772  10.841 9.153  1.00 103.23 ? 230  ILE B CA  1 
ATOM   3747 C C   . ILE B 2 227 ? 49.788  9.739  9.446  1.00 109.97 ? 230  ILE B C   1 
ATOM   3748 O O   . ILE B 2 227 ? 50.653  9.893  10.309 1.00 109.18 ? 230  ILE B O   1 
ATOM   3749 C CB  . ILE B 2 227 ? 47.797  11.029 10.331 1.00 106.30 ? 230  ILE B CB  1 
ATOM   3750 C CG1 . ILE B 2 227 ? 48.521  11.629 11.539 1.00 106.93 ? 230  ILE B CG1 1 
ATOM   3751 C CG2 . ILE B 2 227 ? 47.146  9.706  10.699 1.00 106.74 ? 230  ILE B CG2 1 
ATOM   3752 C CD1 . ILE B 2 227 ? 49.091  13.011 11.293 1.00 114.88 ? 230  ILE B CD1 1 
ATOM   3753 N N   . GLY B 2 228 ? 49.686  8.633  8.716  1.00 109.16 ? 231  GLY B N   1 
ATOM   3754 C CA  . GLY B 2 228 ? 50.561  7.492  8.915  1.00 110.15 ? 231  GLY B CA  1 
ATOM   3755 C C   . GLY B 2 228 ? 50.147  6.678  10.124 1.00 116.87 ? 231  GLY B C   1 
ATOM   3756 O O   . GLY B 2 228 ? 49.775  7.233  11.157 1.00 116.27 ? 231  GLY B O   1 
ATOM   3757 N N   . LEU B 2 229 ? 50.194  5.356  9.990  1.00 116.01 ? 232  LEU B N   1 
ATOM   3758 C CA  . LEU B 2 229 ? 49.838  4.463  11.087 1.00 117.15 ? 232  LEU B CA  1 
ATOM   3759 C C   . LEU B 2 229 ? 50.698  4.756  12.311 1.00 124.49 ? 232  LEU B C   1 
ATOM   3760 O O   . LEU B 2 229 ? 51.904  4.986  12.197 1.00 124.07 ? 232  LEU B O   1 
ATOM   3761 C CB  . LEU B 2 229 ? 49.997  3.001  10.664 1.00 117.18 ? 232  LEU B CB  1 
ATOM   3762 C CG  . LEU B 2 229 ? 49.323  1.945  11.543 1.00 121.85 ? 232  LEU B CG  1 
ATOM   3763 C CD1 . LEU B 2 229 ? 49.452  0.565  10.913 1.00 121.95 ? 232  LEU B CD1 1 
ATOM   3764 C CD2 . LEU B 2 229 ? 49.904  1.949  12.947 1.00 124.52 ? 232  LEU B CD2 1 
ATOM   3765 N N   . PRO B 2 230 ? 50.084  4.739  13.504 1.00 123.63 ? 233  PRO B N   1 
ATOM   3766 C CA  . PRO B 2 230 ? 50.747  5.069  14.769 1.00 124.42 ? 233  PRO B CA  1 
ATOM   3767 C C   . PRO B 2 230 ? 51.390  3.856  15.420 1.00 131.36 ? 233  PRO B C   1 
ATOM   3768 O O   . PRO B 2 230 ? 50.741  2.830  15.631 1.00 130.81 ? 233  PRO B O   1 
ATOM   3769 C CB  . PRO B 2 230 ? 49.597  5.574  15.643 1.00 126.02 ? 233  PRO B CB  1 
ATOM   3770 C CG  . PRO B 2 230 ? 48.587  6.075  14.684 1.00 130.12 ? 233  PRO B CG  1 
ATOM   3771 C CD  . PRO B 2 230 ? 48.677  5.171  13.491 1.00 125.47 ? 233  PRO B CD  1 
ATOM   3772 N N   . PRO B 2 231 ? 52.688  3.957  15.739 1.00 130.57 ? 234  PRO B N   1 
ATOM   3773 C CA  . PRO B 2 231 ? 53.294  2.900  16.549 1.00 131.41 ? 234  PRO B CA  1 
ATOM   3774 C C   . PRO B 2 231 ? 52.846  3.052  17.995 1.00 137.88 ? 234  PRO B C   1 
ATOM   3775 O O   . PRO B 2 231 ? 52.762  4.167  18.511 1.00 137.51 ? 234  PRO B O   1 
ATOM   3776 C CB  . PRO B 2 231 ? 54.788  3.196  16.430 1.00 133.05 ? 234  PRO B CB  1 
ATOM   3777 C CG  . PRO B 2 231 ? 54.856  4.683  16.279 1.00 137.14 ? 234  PRO B CG  1 
ATOM   3778 C CD  . PRO B 2 231 ? 53.572  5.130  15.615 1.00 132.43 ? 234  PRO B CD  1 
ATOM   3779 N N   . GLU B 2 232 ? 52.521  1.935  18.635 1.00 136.37 ? 235  GLU B N   1 
ATOM   3780 C CA  . GLU B 2 232 ? 52.132  1.947  20.039 1.00 137.14 ? 235  GLU B CA  1 
ATOM   3781 C C   . GLU B 2 232 ? 53.198  2.660  20.874 1.00 142.76 ? 235  GLU B C   1 
ATOM   3782 O O   . GLU B 2 232 ? 54.288  2.949  20.378 1.00 142.40 ? 235  GLU B O   1 
ATOM   3783 C CB  . GLU B 2 232 ? 51.910  0.517  20.538 1.00 138.63 ? 235  GLU B CB  1 
ATOM   3784 C CG  . GLU B 2 232 ? 50.785  -0.223 19.820 1.00 150.23 ? 235  GLU B CG  1 
ATOM   3785 C CD  . GLU B 2 232 ? 51.057  -0.409 18.337 1.00 173.41 ? 235  GLU B CD  1 
ATOM   3786 O OE1 . GLU B 2 232 ? 52.240  -0.362 17.937 1.00 168.62 ? 235  GLU B OE1 1 
ATOM   3787 O OE2 . GLU B 2 232 ? 50.090  -0.598 17.570 1.00 169.21 ? 235  GLU B OE2 1 
ATOM   3788 N N   . ASP B 2 233 ? 52.897  2.927  22.141 1.00 140.59 ? 236  ASP B N   1 
ATOM   3789 C CA  . ASP B 2 233 ? 51.658  2.484  22.767 1.00 141.05 ? 236  ASP B CA  1 
ATOM   3790 C C   . ASP B 2 233 ? 50.462  3.344  22.369 1.00 145.98 ? 236  ASP B C   1 
ATOM   3791 O O   . ASP B 2 233 ? 49.333  3.074  22.783 1.00 145.63 ? 236  ASP B O   1 
ATOM   3792 C CB  . ASP B 2 233 ? 51.811  2.484  24.290 1.00 143.04 ? 236  ASP B CB  1 
ATOM   3793 C CG  . ASP B 2 233 ? 53.069  1.770  24.752 1.00 153.81 ? 236  ASP B CG  1 
ATOM   3794 O OD1 . ASP B 2 233 ? 53.445  0.758  24.125 1.00 154.47 ? 236  ASP B OD1 1 
ATOM   3795 O OD2 . ASP B 2 233 ? 53.673  2.215  25.752 1.00 159.77 ? 236  ASP B OD2 1 
ATOM   3796 N N   . ASP B 2 234 ? 50.698  4.344  21.524 1.00 143.29 ? 237  ASP B N   1 
ATOM   3797 C CA  . ASP B 2 234 ? 49.658  5.301  21.145 1.00 143.47 ? 237  ASP B CA  1 
ATOM   3798 C C   . ASP B 2 234 ? 48.381  4.669  20.590 1.00 148.16 ? 237  ASP B C   1 
ATOM   3799 O O   . ASP B 2 234 ? 47.542  5.361  20.013 1.00 147.58 ? 237  ASP B O   1 
ATOM   3800 C CB  . ASP B 2 234 ? 50.208  6.339  20.163 1.00 145.32 ? 237  ASP B CB  1 
ATOM   3801 C CG  . ASP B 2 234 ? 51.144  7.332  20.826 1.00 155.57 ? 237  ASP B CG  1 
ATOM   3802 O OD1 . ASP B 2 234 ? 51.187  7.367  22.073 1.00 156.36 ? 237  ASP B OD1 1 
ATOM   3803 O OD2 . ASP B 2 234 ? 51.826  8.087  20.102 1.00 161.06 ? 237  ASP B OD2 1 
ATOM   3804 N N   . TRP B 2 235 ? 48.226  3.363  20.783 1.00 145.57 ? 238  TRP B N   1 
ATOM   3805 C CA  . TRP B 2 235 ? 47.022  2.661  20.359 1.00 145.81 ? 238  TRP B CA  1 
ATOM   3806 C C   . TRP B 2 235 ? 46.074  2.440  21.536 1.00 150.02 ? 238  TRP B C   1 
ATOM   3807 O O   . TRP B 2 235 ? 46.498  2.424  22.691 1.00 149.53 ? 238  TRP B O   1 
ATOM   3808 C CB  . TRP B 2 235 ? 47.381  1.324  19.710 1.00 144.71 ? 238  TRP B CB  1 
ATOM   3809 C CG  . TRP B 2 235 ? 46.201  0.642  19.098 1.00 145.90 ? 238  TRP B CG  1 
ATOM   3810 C CD1 . TRP B 2 235 ? 45.544  -0.452 19.583 1.00 148.74 ? 238  TRP B CD1 1 
ATOM   3811 C CD2 . TRP B 2 235 ? 45.489  1.048  17.920 1.00 145.63 ? 238  TRP B CD2 1 
ATOM   3812 N NE1 . TRP B 2 235 ? 44.482  -0.765 18.770 1.00 148.29 ? 238  TRP B NE1 1 
ATOM   3813 C CE2 . TRP B 2 235 ? 44.425  0.139  17.743 1.00 149.65 ? 238  TRP B CE2 1 
ATOM   3814 C CE3 . TRP B 2 235 ? 45.658  2.083  16.992 1.00 146.89 ? 238  TRP B CE3 1 
ATOM   3815 C CZ2 . TRP B 2 235 ? 43.547  0.218  16.669 1.00 148.91 ? 238  TRP B CZ2 1 
ATOM   3816 C CZ3 . TRP B 2 235 ? 44.771  2.174  15.939 1.00 148.32 ? 238  TRP B CZ3 1 
ATOM   3817 C CH2 . TRP B 2 235 ? 43.721  1.254  15.793 1.00 148.96 ? 238  TRP B CH2 1 
ATOM   3818 N N   . PRO B 2 236 ? 44.774  2.263  21.252 1.00 146.91 ? 239  PRO B N   1 
ATOM   3819 C CA  . PRO B 2 236 ? 43.748  2.081  22.287 1.00 146.79 ? 239  PRO B CA  1 
ATOM   3820 C C   . PRO B 2 236 ? 42.871  0.846  22.073 1.00 150.74 ? 239  PRO B C   1 
ATOM   3821 O O   . PRO B 2 236 ? 43.172  -0.006 21.238 1.00 150.37 ? 239  PRO B O   1 
ATOM   3822 C CB  . PRO B 2 236 ? 42.903  3.359  22.178 1.00 148.53 ? 239  PRO B CB  1 
ATOM   3823 C CG  . PRO B 2 236 ? 43.258  3.963  20.854 1.00 152.93 ? 239  PRO B CG  1 
ATOM   3824 C CD  . PRO B 2 236 ? 44.678  3.582  20.608 1.00 148.47 ? 239  PRO B CD  1 
ATOM   3825 N N   . ARG B 2 237 ? 41.790  0.754  22.843 1.00 147.21 ? 240  ARG B N   1 
ATOM   3826 C CA  . ARG B 2 237 ? 40.890  -0.392 22.774 1.00 175.03 ? 240  ARG B CA  1 
ATOM   3827 C C   . ARG B 2 237 ? 39.455  0.044  22.498 1.00 203.31 ? 240  ARG B C   1 
ATOM   3828 O O   . ARG B 2 237 ? 39.155  1.237  22.471 1.00 164.61 ? 240  ARG B O   1 
ATOM   3829 C CB  . ARG B 2 237 ? 40.951  -1.197 24.074 1.00 175.09 ? 240  ARG B CB  1 
ATOM   3830 C CG  . ARG B 2 237 ? 42.331  -1.748 24.394 1.00 185.12 ? 240  ARG B CG  1 
ATOM   3831 C CD  . ARG B 2 237 ? 42.355  -2.440 25.747 1.00 194.97 ? 240  ARG B CD  1 
ATOM   3832 N NE  . ARG B 2 237 ? 43.651  -3.054 26.024 1.00 203.41 ? 240  ARG B NE  1 
ATOM   3833 C CZ  . ARG B 2 237 ? 43.955  -3.681 27.156 1.00 217.46 ? 240  ARG B CZ  1 
ATOM   3834 N NH1 . ARG B 2 237 ? 45.160  -4.211 27.318 1.00 204.83 ? 240  ARG B NH1 1 
ATOM   3835 N NH2 . ARG B 2 237 ? 43.058  -3.777 28.126 1.00 204.07 ? 240  ARG B NH2 1 
ATOM   3836 N N   . PRO B 2 242 ? 37.218  -3.491 16.447 1.00 145.26 ? 245  PRO B N   1 
ATOM   3837 C CA  . PRO B 2 242 ? 38.227  -2.681 17.123 1.00 145.05 ? 245  PRO B CA  1 
ATOM   3838 C C   . PRO B 2 242 ? 39.542  -3.414 16.842 1.00 148.58 ? 245  PRO B C   1 
ATOM   3839 O O   . PRO B 2 242 ? 40.168  -3.989 17.746 1.00 148.27 ? 245  PRO B O   1 
ATOM   3840 C CB  . PRO B 2 242 ? 37.848  -2.874 18.593 1.00 146.86 ? 245  PRO B CB  1 
ATOM   3841 C CG  . PRO B 2 242 ? 37.554  -4.334 18.628 1.00 151.34 ? 245  PRO B CG  1 
ATOM   3842 C CD  . PRO B 2 242 ? 36.761  -4.580 17.330 1.00 146.85 ? 245  PRO B CD  1 
ATOM   3843 N N   . ARG B 2 243 ? 39.836  -3.566 15.562 1.00 144.67 ? 246  ARG B N   1 
ATOM   3844 C CA  . ARG B 2 243 ? 41.113  -4.051 15.185 1.00 144.25 ? 246  ARG B CA  1 
ATOM   3845 C C   . ARG B 2 243 ? 42.181  -3.190 15.805 1.00 146.99 ? 246  ARG B C   1 
ATOM   3846 O O   . ARG B 2 243 ? 41.913  -2.047 16.140 1.00 146.40 ? 246  ARG B O   1 
ATOM   3847 C CB  . ARG B 2 243 ? 41.182  -4.170 13.658 1.00 145.13 ? 246  ARG B CB  1 
ATOM   3848 C CG  . ARG B 2 243 ? 40.281  -5.216 13.001 1.00 157.20 ? 246  ARG B CG  1 
ATOM   3849 C CD  . ARG B 2 243 ? 40.607  -5.251 11.551 1.00 168.52 ? 246  ARG B CD  1 
ATOM   3850 N NE  . ARG B 2 243 ? 39.897  -6.274 10.793 1.00 177.92 ? 246  ARG B NE  1 
ATOM   3851 C CZ  . ARG B 2 243 ? 40.405  -7.472 10.514 1.00 191.89 ? 246  ARG B CZ  1 
ATOM   3852 N NH1 . ARG B 2 243 ? 39.696  -8.335 9.812  1.00 179.09 ? 246  ARG B NH1 1 
ATOM   3853 N NH2 . ARG B 2 243 ? 41.605  -7.832 10.978 1.00 178.33 ? 246  ARG B NH2 1 
ATOM   3854 N N   . GLY B 2 244 ? 43.401  -3.672 15.696 1.00 142.88 ? 247  GLY B N   1 
ATOM   3855 C CA  . GLY B 2 244 ? 43.645  -4.887 14.946 1.00 142.40 ? 247  GLY B CA  1 
ATOM   3856 C C   . GLY B 2 244 ? 44.597  -4.345 13.929 1.00 145.46 ? 247  GLY B C   1 
ATOM   3857 O O   . GLY B 2 244 ? 44.701  -3.136 13.902 1.00 145.00 ? 247  GLY B O   1 
ATOM   3858 N N   . ALA B 2 245 ? 45.455  -5.129 13.294 1.00 141.38 ? 248  ALA B N   1 
ATOM   3859 C CA  . ALA B 2 245 ? 46.483  -4.455 12.505 1.00 140.85 ? 248  ALA B CA  1 
ATOM   3860 C C   . ALA B 2 245 ? 46.532  -4.776 11.014 1.00 143.80 ? 248  ALA B C   1 
ATOM   3861 O O   . ALA B 2 245 ? 46.094  -5.821 10.543 1.00 143.29 ? 248  ALA B O   1 
ATOM   3862 C CB  . ALA B 2 245 ? 47.865  -4.481 13.164 1.00 141.59 ? 248  ALA B CB  1 
ATOM   3863 N N   . PHE B 2 246 ? 47.244  -3.933 10.300 1.00 139.70 ? 249  PHE B N   1 
ATOM   3864 C CA  . PHE B 2 246 ? 46.779  -3.532 8.999  1.00 139.13 ? 249  PHE B CA  1 
ATOM   3865 C C   . PHE B 2 246 ? 47.896  -3.123 8.055  1.00 141.64 ? 249  PHE B C   1 
ATOM   3866 O O   . PHE B 2 246 ? 49.000  -3.683 8.109  1.00 141.23 ? 249  PHE B O   1 
ATOM   3867 C CB  . PHE B 2 246 ? 45.734  -2.434 9.177  1.00 141.00 ? 249  PHE B CB  1 
ATOM   3868 C CG  . PHE B 2 246 ? 44.339  -2.923 8.993  1.00 142.69 ? 249  PHE B CG  1 
ATOM   3869 C CD1 . PHE B 2 246 ? 44.006  -4.179 9.422  1.00 145.84 ? 249  PHE B CD1 1 
ATOM   3870 C CD2 . PHE B 2 246 ? 43.463  -2.259 8.157  1.00 144.97 ? 249  PHE B CD2 1 
ATOM   3871 C CE1 . PHE B 2 246 ? 42.745  -4.656 9.237  1.00 146.80 ? 249  PHE B CE1 1 
ATOM   3872 C CE2 . PHE B 2 246 ? 42.204  -2.778 7.884  1.00 147.81 ? 249  PHE B CE2 1 
ATOM   3873 C CZ  . PHE B 2 246 ? 41.861  -3.989 8.375  1.00 145.87 ? 249  PHE B CZ  1 
ATOM   3874 N N   . PRO B 2 247 ? 47.559  -2.310 7.045  1.00 137.06 ? 250  PRO B N   1 
ATOM   3875 C CA  . PRO B 2 247 ? 48.690  -1.770 6.290  1.00 136.43 ? 250  PRO B CA  1 
ATOM   3876 C C   . PRO B 2 247 ? 49.529  -0.837 7.178  1.00 138.86 ? 250  PRO B C   1 
ATOM   3877 O O   . PRO B 2 247 ? 49.176  0.337  7.444  1.00 138.17 ? 250  PRO B O   1 
ATOM   3878 C CB  . PRO B 2 247 ? 48.037  -1.000 5.125  1.00 138.24 ? 250  PRO B CB  1 
ATOM   3879 C CG  . PRO B 2 247 ? 46.616  -1.480 5.043  1.00 142.80 ? 250  PRO B CG  1 
ATOM   3880 C CD  . PRO B 2 247 ? 46.371  -2.498 6.198  1.00 138.43 ? 250  PRO B CD  1 
ATOM   3881 N N   . PRO B 2 248 ? 50.724  -1.321 7.536  1.00 134.64 ? 251  PRO B N   1 
ATOM   3882 C CA  . PRO B 2 248 ? 51.810  -0.515 8.108  1.00 134.12 ? 251  PRO B CA  1 
ATOM   3883 C C   . PRO B 2 248 ? 52.094  0.711  7.240  1.00 136.84 ? 251  PRO B C   1 
ATOM   3884 O O   . PRO B 2 248 ? 52.787  0.604  6.225  1.00 136.31 ? 251  PRO B O   1 
ATOM   3885 C CB  . PRO B 2 248 ? 53.013  -1.453 8.030  1.00 135.94 ? 251  PRO B CB  1 
ATOM   3886 C CG  . PRO B 2 248 ? 52.702  -2.350 6.855  1.00 140.48 ? 251  PRO B CG  1 
ATOM   3887 C CD  . PRO B 2 248 ? 51.215  -2.391 6.645  1.00 136.11 ? 251  PRO B CD  1 
ATOM   3888 N N   . ARG B 2 249 ? 51.601  1.878  7.655  1.00 132.64 ? 252  ARG B N   1 
ATOM   3889 C CA  . ARG B 2 249 ? 51.848  3.114  6.903  1.00 132.10 ? 252  ARG B CA  1 
ATOM   3890 C C   . ARG B 2 249 ? 52.857  4.074  7.524  1.00 134.89 ? 252  ARG B C   1 
ATOM   3891 O O   . ARG B 2 249 ? 53.222  3.937  8.688  1.00 134.30 ? 252  ARG B O   1 
ATOM   3892 C CB  . ARG B 2 249 ? 50.549  3.860  6.555  1.00 132.48 ? 252  ARG B CB  1 
ATOM   3893 C CG  . ARG B 2 249 ? 49.279  2.996  6.509  1.00 143.05 ? 252  ARG B CG  1 
ATOM   3894 C CD  . ARG B 2 249 ? 48.242  3.572  5.529  1.00 154.43 ? 252  ARG B CD  1 
ATOM   3895 N NE  . ARG B 2 249 ? 48.718  3.614  4.145  1.00 164.96 ? 252  ARG B NE  1 
ATOM   3896 C CZ  . ARG B 2 249 ? 48.594  2.615  3.276  1.00 180.46 ? 252  ARG B CZ  1 
ATOM   3897 N NH1 . ARG B 2 249 ? 49.022  2.762  2.028  1.00 167.57 ? 252  ARG B NH1 1 
ATOM   3898 N NH2 . ARG B 2 249 ? 48.063  1.461  3.663  1.00 168.75 ? 252  ARG B NH2 1 
ATOM   3899 N N   . GLY B 2 250 ? 53.220  5.104  6.761  1.00 130.78 ? 253  GLY B N   1 
ATOM   3900 C CA  . GLY B 2 250 ? 54.128  6.141  7.215  1.00 130.22 ? 253  GLY B CA  1 
ATOM   3901 C C   . GLY B 2 250 ? 53.533  7.533  7.086  1.00 133.13 ? 253  GLY B C   1 
ATOM   3902 O O   . GLY B 2 250 ? 52.576  7.745  6.347  1.00 132.44 ? 253  GLY B O   1 
ATOM   3903 N N   . PRO B 2 251 ? 54.087  8.504  7.826  1.00 129.30 ? 254  PRO B N   1 
ATOM   3904 C CA  . PRO B 2 251 ? 53.702  9.917  7.857  1.00 128.79 ? 254  PRO B CA  1 
ATOM   3905 C C   . PRO B 2 251 ? 53.956  10.593 6.513  1.00 131.31 ? 254  PRO B C   1 
ATOM   3906 O O   . PRO B 2 251 ? 55.025  11.154 6.292  1.00 130.87 ? 254  PRO B O   1 
ATOM   3907 C CB  . PRO B 2 251 ? 54.648  10.497 8.911  1.00 130.67 ? 254  PRO B CB  1 
ATOM   3908 C CG  . PRO B 2 251 ? 55.879  9.670  8.778  1.00 135.35 ? 254  PRO B CG  1 
ATOM   3909 C CD  . PRO B 2 251 ? 55.412  8.280  8.432  1.00 130.96 ? 254  PRO B CD  1 
ATOM   3910 N N   . ARG B 2 252 ? 52.986  10.525 5.609  1.00 126.70 ? 255  ARG B N   1 
ATOM   3911 C CA  . ARG B 2 252 ? 53.052  11.318 4.391  1.00 125.86 ? 255  ARG B CA  1 
ATOM   3912 C C   . ARG B 2 252 ? 53.247  12.779 4.775  1.00 128.20 ? 255  ARG B C   1 
ATOM   3913 O O   . ARG B 2 252 ? 52.744  13.234 5.807  1.00 127.83 ? 255  ARG B O   1 
ATOM   3914 C CB  . ARG B 2 252 ? 51.761  11.167 3.588  1.00 126.12 ? 255  ARG B CB  1 
ATOM   3915 C CG  . ARG B 2 252 ? 51.514  9.758  3.091  1.00 137.72 ? 255  ARG B CG  1 
ATOM   3916 C CD  . ARG B 2 252 ? 50.283  9.667  2.201  1.00 147.96 ? 255  ARG B CD  1 
ATOM   3917 N NE  . ARG B 2 252 ? 50.093  8.292  1.750  1.00 155.59 ? 255  ARG B NE  1 
ATOM   3918 C CZ  . ARG B 2 252 ? 49.028  7.851  1.091  1.00 167.57 ? 255  ARG B CZ  1 
ATOM   3919 N NH1 . ARG B 2 252 ? 48.034  8.678  0.800  1.00 152.69 ? 255  ARG B NH1 1 
ATOM   3920 N NH2 . ARG B 2 252 ? 48.958  6.578  0.726  1.00 153.77 ? 255  ARG B NH2 1 
ATOM   3921 N N   . PRO B 2 253 ? 54.042  13.513 3.988  1.00 123.54 ? 256  PRO B N   1 
ATOM   3922 C CA  . PRO B 2 253 ? 54.129  14.948 4.247  1.00 122.96 ? 256  PRO B CA  1 
ATOM   3923 C C   . PRO B 2 253 ? 52.730  15.515 4.184  1.00 126.19 ? 256  PRO B C   1 
ATOM   3924 O O   . PRO B 2 253 ? 51.835  14.917 3.588  1.00 125.92 ? 256  PRO B O   1 
ATOM   3925 C CB  . PRO B 2 253 ? 54.927  15.476 3.047  1.00 124.66 ? 256  PRO B CB  1 
ATOM   3926 C CG  . PRO B 2 253 ? 55.630  14.297 2.502  1.00 129.17 ? 256  PRO B CG  1 
ATOM   3927 C CD  . PRO B 2 253 ? 54.757  13.126 2.764  1.00 124.85 ? 256  PRO B CD  1 
ATOM   3928 N N   . VAL B 2 254 ? 52.594  16.768 4.582  1.00 122.04 ? 257  VAL B N   1 
ATOM   3929 C CA  . VAL B 2 254 ? 51.396  17.506 4.239  1.00 121.48 ? 257  VAL B CA  1 
ATOM   3930 C C   . VAL B 2 254 ? 51.309  17.514 2.724  1.00 123.52 ? 257  VAL B C   1 
ATOM   3931 O O   . VAL B 2 254 ? 52.144  16.922 2.042  1.00 122.33 ? 257  VAL B O   1 
ATOM   3932 C CB  . VAL B 2 254 ? 51.463  18.935 4.794  1.00 125.78 ? 257  VAL B CB  1 
ATOM   3933 C CG1 . VAL B 2 254 ? 50.068  19.521 4.946  1.00 125.71 ? 257  VAL B CG1 1 
ATOM   3934 C CG2 . VAL B 2 254 ? 52.217  18.951 6.118  1.00 125.66 ? 257  VAL B CG2 1 
ATOM   3935 N N   . GLN B 2 255 ? 50.352  18.273 2.207  1.00 119.87 ? 258  GLN B N   1 
ATOM   3936 C CA  . GLN B 2 255 ? 50.437  18.803 0.851  1.00 119.62 ? 258  GLN B CA  1 
ATOM   3937 C C   . GLN B 2 255 ? 50.905  17.827 -0.232 1.00 122.69 ? 258  GLN B C   1 
ATOM   3938 O O   . GLN B 2 255 ? 51.808  18.150 -1.010 1.00 122.25 ? 258  GLN B O   1 
ATOM   3939 C CB  . GLN B 2 255 ? 51.347  20.030 0.829  1.00 121.00 ? 258  GLN B CB  1 
ATOM   3940 C CG  . GLN B 2 255 ? 52.348  20.108 1.967  1.00 137.77 ? 258  GLN B CG  1 
ATOM   3941 C CD  . GLN B 2 255 ? 53.739  20.303 1.440  1.00 156.05 ? 258  GLN B CD  1 
ATOM   3942 O OE1 . GLN B 2 255 ? 54.490  21.170 1.889  1.00 150.42 ? 258  GLN B OE1 1 
ATOM   3943 N NE2 . GLN B 2 255 ? 54.063  19.545 0.411  1.00 147.74 ? 258  GLN B NE2 1 
ATOM   3944 N N   . SER B 2 256 ? 50.396  16.602 -0.188 1.00 116.90 ? 259  SER B N   1 
ATOM   3945 C CA  . SER B 2 256 ? 50.155  15.842 -1.404 1.00 115.55 ? 259  SER B CA  1 
ATOM   3946 C C   . SER B 2 256 ? 48.638  15.685 -1.369 1.00 116.21 ? 259  SER B C   1 
ATOM   3947 O O   . SER B 2 256 ? 48.053  14.897 -2.109 1.00 117.80 ? 259  SER B O   1 
ATOM   3948 C CB  . SER B 2 256 ? 50.851  14.478 -1.360 1.00 120.59 ? 259  SER B CB  1 
ATOM   3949 O OG  . SER B 2 256 ? 49.914  13.417 -1.349 1.00 132.86 ? 259  SER B OG  1 
ATOM   3950 N N   . VAL B 2 257 ? 48.046  16.365 -0.386 1.00 109.44 ? 260  VAL B N   1 
ATOM   3951 C CA  . VAL B 2 257 ? 46.618  16.666 -0.330 1.00 107.76 ? 260  VAL B CA  1 
ATOM   3952 C C   . VAL B 2 257 ? 46.450  18.185 -0.169 1.00 112.21 ? 260  VAL B C   1 
ATOM   3953 O O   . VAL B 2 257 ? 45.329  18.692 -0.166 1.00 110.16 ? 260  VAL B O   1 
ATOM   3954 C CB  . VAL B 2 257 ? 45.912  15.884 0.805  1.00 109.64 ? 260  VAL B CB  1 
ATOM   3955 C CG1 . VAL B 2 257 ? 44.441  16.284 0.929  1.00 108.97 ? 260  VAL B CG1 1 
ATOM   3956 C CG2 . VAL B 2 257 ? 46.033  14.392 0.571  1.00 108.92 ? 260  VAL B CG2 1 
ATOM   3957 N N   . VAL B 2 258 ? 47.559  18.887 0.067  1.00 110.28 ? 261  VAL B N   1 
ATOM   3958 C CA  . VAL B 2 258 ? 47.633  20.324 -0.216 1.00 110.92 ? 261  VAL B CA  1 
ATOM   3959 C C   . VAL B 2 258 ? 48.813  20.589 -1.162 1.00 117.18 ? 261  VAL B C   1 
ATOM   3960 O O   . VAL B 2 258 ? 49.391  19.646 -1.703 1.00 117.21 ? 261  VAL B O   1 
ATOM   3961 C CB  . VAL B 2 258 ? 47.703  21.192 1.064  1.00 114.87 ? 261  VAL B CB  1 
ATOM   3962 C CG1 . VAL B 2 258 ? 47.201  20.429 2.268  1.00 114.64 ? 261  VAL B CG1 1 
ATOM   3963 C CG2 . VAL B 2 258 ? 49.095  21.728 1.305  1.00 114.75 ? 261  VAL B CG2 1 
ATOM   3964 N N   . PRO B 2 259 ? 49.136  21.871 -1.444 1.00 114.72 ? 262  PRO B N   1 
ATOM   3965 C CA  . PRO B 2 259 ? 48.673  23.239 -1.155 1.00 114.30 ? 262  PRO B CA  1 
ATOM   3966 C C   . PRO B 2 259 ? 47.226  23.497 -1.574 1.00 116.96 ? 262  PRO B C   1 
ATOM   3967 O O   . PRO B 2 259 ? 46.559  22.597 -2.089 1.00 116.80 ? 262  PRO B O   1 
ATOM   3968 C CB  . PRO B 2 259 ? 49.638  24.103 -1.982 1.00 116.18 ? 262  PRO B CB  1 
ATOM   3969 C CG  . PRO B 2 259 ? 50.899  23.316 -1.997 1.00 121.06 ? 262  PRO B CG  1 
ATOM   3970 C CD  . PRO B 2 259 ? 50.433  21.881 -2.146 1.00 116.72 ? 262  PRO B CD  1 
ATOM   3971 N N   . GLU B 2 260 ? 46.751  24.734 -1.414 1.00 112.25 ? 263  GLU B N   1 
ATOM   3972 C CA  . GLU B 2 260 ? 47.584  25.932 -1.265 1.00 111.54 ? 263  GLU B CA  1 
ATOM   3973 C C   . GLU B 2 260 ? 48.451  26.128 -0.004 1.00 113.79 ? 263  GLU B C   1 
ATOM   3974 O O   . GLU B 2 260 ? 49.304  27.015 0.022  1.00 113.33 ? 263  GLU B O   1 
ATOM   3975 C CB  . GLU B 2 260 ? 46.762  27.192 -1.550 1.00 112.95 ? 263  GLU B CB  1 
ATOM   3976 C CG  . GLU B 2 260 ? 47.582  28.477 -1.609 1.00 122.65 ? 263  GLU B CG  1 
ATOM   3977 C CD  . GLU B 2 260 ? 46.782  29.696 -1.197 1.00 141.37 ? 263  GLU B CD  1 
ATOM   3978 O OE1 . GLU B 2 260 ? 47.386  30.641 -0.644 1.00 136.81 ? 263  GLU B OE1 1 
ATOM   3979 O OE2 . GLU B 2 260 ? 45.545  29.687 -1.375 1.00 137.19 ? 263  GLU B OE2 1 
ATOM   3980 N N   . MET B 2 261 ? 48.256  25.308 1.025  1.00 109.00 ? 264  MET B N   1 
ATOM   3981 C CA  . MET B 2 261 ? 48.772  25.615 2.369  1.00 108.20 ? 264  MET B CA  1 
ATOM   3982 C C   . MET B 2 261 ? 50.243  26.020 2.530  1.00 111.92 ? 264  MET B C   1 
ATOM   3983 O O   . MET B 2 261 ? 51.126  25.458 1.884  1.00 111.35 ? 264  MET B O   1 
ATOM   3984 C CB  . MET B 2 261 ? 48.391  24.524 3.366  1.00 110.26 ? 264  MET B CB  1 
ATOM   3985 C CG  . MET B 2 261 ? 46.974  24.664 3.893  1.00 113.54 ? 264  MET B CG  1 
ATOM   3986 S SD  . MET B 2 261 ? 46.573  23.452 5.154  1.00 117.41 ? 264  MET B SD  1 
ATOM   3987 C CE  . MET B 2 261 ? 48.151  23.235 5.895  1.00 113.91 ? 264  MET B CE  1 
ATOM   3988 N N   . GLU B 2 262 ? 50.498  26.945 3.457  1.00 108.61 ? 265  GLU B N   1 
ATOM   3989 C CA  . GLU B 2 262 ? 51.838  27.495 3.680  1.00 108.55 ? 265  GLU B CA  1 
ATOM   3990 C C   . GLU B 2 262 ? 52.535  26.883 4.897  1.00 112.34 ? 265  GLU B C   1 
ATOM   3991 O O   . GLU B 2 262 ? 52.031  25.934 5.495  1.00 112.01 ? 265  GLU B O   1 
ATOM   3992 C CB  . GLU B 2 262 ? 51.776  29.016 3.838  1.00 110.03 ? 265  GLU B CB  1 
ATOM   3993 C CG  . GLU B 2 262 ? 51.733  29.499 5.285  1.00 121.52 ? 265  GLU B CG  1 
ATOM   3994 C CD  . GLU B 2 262 ? 51.105  30.877 5.418  1.00 141.86 ? 265  GLU B CD  1 
ATOM   3995 O OE1 . GLU B 2 262 ? 49.880  30.997 5.198  1.00 132.34 ? 265  GLU B OE1 1 
ATOM   3996 O OE2 . GLU B 2 262 ? 51.823  31.833 5.781  1.00 136.33 ? 265  GLU B OE2 1 
ATOM   3997 N N   . GLU B 2 263 ? 53.655  27.485 5.296  1.00 108.70 ? 266  GLU B N   1 
ATOM   3998 C CA  . GLU B 2 263 ? 54.542  26.932 6.323  1.00 108.28 ? 266  GLU B CA  1 
ATOM   3999 C C   . GLU B 2 263 ? 53.806  26.416 7.557  1.00 110.36 ? 266  GLU B C   1 
ATOM   4000 O O   . GLU B 2 263 ? 53.595  25.212 7.710  1.00 110.12 ? 266  GLU B O   1 
ATOM   4001 C CB  . GLU B 2 263 ? 55.563  27.986 6.763  1.00 109.87 ? 266  GLU B CB  1 
ATOM   4002 C CG  . GLU B 2 263 ? 56.012  28.922 5.655  1.00 122.61 ? 266  GLU B CG  1 
ATOM   4003 C CD  . GLU B 2 263 ? 56.880  28.231 4.627  1.00 145.96 ? 266  GLU B CD  1 
ATOM   4004 O OE1 . GLU B 2 263 ? 57.490  27.195 4.963  1.00 140.42 ? 266  GLU B OE1 1 
ATOM   4005 O OE2 . GLU B 2 263 ? 56.963  28.733 3.487  1.00 141.22 ? 266  GLU B OE2 1 
ATOM   4006 N N   . SER B 2 264 ? 53.463  27.337 8.454  1.00 104.97 ? 267  SER B N   1 
ATOM   4007 C CA  . SER B 2 264 ? 52.825  26.994 9.719  1.00 103.64 ? 267  SER B CA  1 
ATOM   4008 C C   . SER B 2 264 ? 51.471  26.334 9.504  1.00 104.22 ? 267  SER B C   1 
ATOM   4009 O O   . SER B 2 264 ? 51.136  25.361 10.178 1.00 103.70 ? 267  SER B O   1 
ATOM   4010 C CB  . SER B 2 264 ? 52.665  28.242 10.588 1.00 107.31 ? 267  SER B CB  1 
ATOM   4011 O OG  . SER B 2 264 ? 53.890  28.943 10.702 1.00 116.13 ? 267  SER B OG  1 
ATOM   4012 N N   . GLY B 2 265 ? 50.690  26.881 8.576  1.00 98.34  ? 268  GLY B N   1 
ATOM   4013 C CA  . GLY B 2 265 ? 49.367  26.372 8.265  1.00 97.15  ? 268  GLY B CA  1 
ATOM   4014 C C   . GLY B 2 265 ? 49.350  24.865 8.123  1.00 98.84  ? 268  GLY B C   1 
ATOM   4015 O O   . GLY B 2 265 ? 48.366  24.210 8.468  1.00 98.39  ? 268  GLY B O   1 
ATOM   4016 N N   . ALA B 2 266 ? 50.468  24.315 7.658  1.00 93.70  ? 269  ALA B N   1 
ATOM   4017 C CA  . ALA B 2 266 ? 50.614  22.873 7.498  1.00 92.50  ? 269  ALA B CA  1 
ATOM   4018 C C   . ALA B 2 266 ? 50.972  22.207 8.816  1.00 93.60  ? 269  ALA B C   1 
ATOM   4019 O O   . ALA B 2 266 ? 50.547  21.085 9.095  1.00 92.65  ? 269  ALA B O   1 
ATOM   4020 C CB  . ALA B 2 266 ? 51.665  22.562 6.445  1.00 93.25  ? 269  ALA B CB  1 
ATOM   4021 N N   . GLN B 2 267 ? 51.762  22.906 9.623  1.00 88.73  ? 270  GLN B N   1 
ATOM   4022 C CA  . GLN B 2 267 ? 52.187  22.386 10.914 1.00 87.90  ? 270  GLN B CA  1 
ATOM   4023 C C   . GLN B 2 267 ? 51.039  22.382 11.919 1.00 89.51  ? 270  GLN B C   1 
ATOM   4024 O O   . GLN B 2 267 ? 50.972  21.517 12.793 1.00 89.16  ? 270  GLN B O   1 
ATOM   4025 C CB  . GLN B 2 267 ? 53.372  23.193 11.449 1.00 89.43  ? 270  GLN B CB  1 
ATOM   4026 C CG  . GLN B 2 267 ? 54.628  23.080 10.596 1.00 111.20 ? 270  GLN B CG  1 
ATOM   4027 C CD  . GLN B 2 267 ? 55.767  23.939 11.109 1.00 135.91 ? 270  GLN B CD  1 
ATOM   4028 O OE1 . GLN B 2 267 ? 55.606  24.698 12.065 1.00 133.22 ? 270  GLN B OE1 1 
ATOM   4029 N NE2 . GLN B 2 267 ? 56.928  23.824 10.471 1.00 128.23 ? 270  GLN B NE2 1 
ATOM   4030 N N   . LEU B 2 268 ? 50.120  23.330 11.765 1.00 83.96  ? 271  LEU B N   1 
ATOM   4031 C CA  . LEU B 2 268 ? 48.960  23.430 12.645 1.00 82.66  ? 271  LEU B CA  1 
ATOM   4032 C C   . LEU B 2 268 ? 47.926  22.360 12.317 1.00 83.69  ? 271  LEU B C   1 
ATOM   4033 O O   . LEU B 2 268 ? 47.390  21.709 13.209 1.00 82.90  ? 271  LEU B O   1 
ATOM   4034 C CB  . LEU B 2 268 ? 48.329  24.821 12.538 1.00 82.70  ? 271  LEU B CB  1 
ATOM   4035 C CG  . LEU B 2 268 ? 47.046  25.059 13.336 1.00 87.34  ? 271  LEU B CG  1 
ATOM   4036 C CD1 . LEU B 2 268 ? 47.283  24.808 14.816 1.00 87.57  ? 271  LEU B CD1 1 
ATOM   4037 C CD2 . LEU B 2 268 ? 46.524  26.468 13.104 1.00 89.23  ? 271  LEU B CD2 1 
ATOM   4038 N N   . LEU B 2 269 ? 47.641  22.193 11.032 1.00 78.74  ? 272  LEU B N   1 
ATOM   4039 C CA  . LEU B 2 269 ? 46.709  21.165 10.582 1.00 77.77  ? 272  LEU B CA  1 
ATOM   4040 C C   . LEU B 2 269 ? 47.129  19.782 11.079 1.00 79.33  ? 272  LEU B C   1 
ATOM   4041 O O   . LEU B 2 269 ? 46.296  18.890 11.241 1.00 78.31  ? 272  LEU B O   1 
ATOM   4042 C CB  . LEU B 2 269 ? 46.604  21.173 9.056  1.00 77.81  ? 272  LEU B CB  1 
ATOM   4043 C CG  . LEU B 2 269 ? 45.560  20.236 8.451  1.00 82.40  ? 272  LEU B CG  1 
ATOM   4044 C CD1 . LEU B 2 269 ? 44.219  20.438 9.137  1.00 82.56  ? 272  LEU B CD1 1 
ATOM   4045 C CD2 . LEU B 2 269 ? 45.440  20.486 6.961  1.00 84.96  ? 272  LEU B CD2 1 
ATOM   4046 N N   . LEU B 2 270 ? 48.427  19.611 11.315 1.00 74.81  ? 273  LEU B N   1 
ATOM   4047 C CA  . LEU B 2 270 ? 48.945  18.367 11.878 1.00 74.03  ? 273  LEU B CA  1 
ATOM   4048 C C   . LEU B 2 270 ? 48.581  18.228 13.352 1.00 75.54  ? 273  LEU B C   1 
ATOM   4049 O O   . LEU B 2 270 ? 48.059  17.195 13.775 1.00 74.92  ? 273  LEU B O   1 
ATOM   4050 C CB  . LEU B 2 270 ? 50.462  18.271 11.691 1.00 74.20  ? 273  LEU B CB  1 
ATOM   4051 C CG  . LEU B 2 270 ? 50.938  17.746 10.333 1.00 79.09  ? 273  LEU B CG  1 
ATOM   4052 C CD1 . LEU B 2 270 ? 52.448  17.544 10.324 1.00 79.21  ? 273  LEU B CD1 1 
ATOM   4053 C CD2 . LEU B 2 270 ? 50.214  16.450 9.974  1.00 81.54  ? 273  LEU B CD2 1 
ATOM   4054 N N   . GLU B 2 271 ? 48.861  19.273 14.125 1.00 70.36  ? 274  GLU B N   1 
ATOM   4055 C CA  . GLU B 2 271 ? 48.458  19.327 15.526 1.00 69.43  ? 274  GLU B CA  1 
ATOM   4056 C C   . GLU B 2 271 ? 46.974  19.012 15.694 1.00 71.61  ? 274  GLU B C   1 
ATOM   4057 O O   . GLU B 2 271 ? 46.580  18.343 16.648 1.00 70.74  ? 274  GLU B O   1 
ATOM   4058 C CB  . GLU B 2 271 ? 48.776  20.700 16.123 1.00 70.77  ? 274  GLU B CB  1 
ATOM   4059 C CG  . GLU B 2 271 ? 50.252  20.932 16.404 1.00 80.11  ? 274  GLU B CG  1 
ATOM   4060 C CD  . GLU B 2 271 ? 50.588  22.400 16.565 1.00 98.89  ? 274  GLU B CD  1 
ATOM   4061 O OE1 . GLU B 2 271 ? 50.081  23.215 15.765 1.00 94.07  ? 274  GLU B OE1 1 
ATOM   4062 O OE2 . GLU B 2 271 ? 51.382  22.735 17.469 1.00 91.53  ? 274  GLU B OE2 1 
ATOM   4063 N N   . MET B 2 272 ? 46.159  19.489 14.757 1.00 67.68  ? 275  MET B N   1 
ATOM   4064 C CA  . MET B 2 272 ? 44.726  19.216 14.772 1.00 67.29  ? 275  MET B CA  1 
ATOM   4065 C C   . MET B 2 272 ? 44.440  17.786 14.346 1.00 72.13  ? 275  MET B C   1 
ATOM   4066 O O   . MET B 2 272 ? 43.451  17.188 14.770 1.00 71.40  ? 275  MET B O   1 
ATOM   4067 C CB  . MET B 2 272 ? 43.976  20.184 13.856 1.00 69.39  ? 275  MET B CB  1 
ATOM   4068 C CG  . MET B 2 272 ? 44.249  21.644 14.149 1.00 72.87  ? 275  MET B CG  1 
ATOM   4069 S SD  . MET B 2 272 ? 43.198  22.767 13.206 1.00 76.92  ? 275  MET B SD  1 
ATOM   4070 C CE  . MET B 2 272 ? 43.849  24.352 13.766 1.00 73.44  ? 275  MET B CE  1 
ATOM   4071 N N   . LEU B 2 273 ? 45.288  17.250 13.475 1.00 70.19  ? 276  LEU B N   1 
ATOM   4072 C CA  . LEU B 2 273 ? 45.147  15.861 13.056 1.00 70.54  ? 276  LEU B CA  1 
ATOM   4073 C C   . LEU B 2 273 ? 46.179  14.941 13.704 1.00 75.28  ? 276  LEU B C   1 
ATOM   4074 O O   . LEU B 2 273 ? 46.883  14.196 13.022 1.00 75.28  ? 276  LEU B O   1 
ATOM   4075 C CB  . LEU B 2 273 ? 45.145  15.733 11.532 1.00 70.55  ? 276  LEU B CB  1 
ATOM   4076 C CG  . LEU B 2 273 ? 44.022  16.511 10.840 1.00 75.12  ? 276  LEU B CG  1 
ATOM   4077 C CD1 . LEU B 2 273 ? 43.728  15.957 9.458  1.00 75.30  ? 276  LEU B CD1 1 
ATOM   4078 C CD2 . LEU B 2 273 ? 42.769  16.526 11.691 1.00 77.71  ? 276  LEU B CD2 1 
ATOM   4079 N N   . THR B 2 274 ? 46.273  15.025 15.028 1.00 71.75  ? 277  THR B N   1 
ATOM   4080 C CA  . THR B 2 274 ? 47.001  14.043 15.821 1.00 71.48  ? 277  THR B CA  1 
ATOM   4081 C C   . THR B 2 274 ? 46.050  12.905 16.196 1.00 75.69  ? 277  THR B C   1 
ATOM   4082 O O   . THR B 2 274 ? 44.891  13.146 16.536 1.00 75.25  ? 277  THR B O   1 
ATOM   4083 C CB  . THR B 2 274 ? 47.613  14.691 17.081 1.00 78.31  ? 277  THR B CB  1 
ATOM   4084 O OG1 . THR B 2 274 ? 48.630  15.628 16.699 1.00 75.04  ? 277  THR B OG1 1 
ATOM   4085 C CG2 . THR B 2 274 ? 48.209  13.627 17.997 1.00 76.84  ? 277  THR B CG2 1 
ATOM   4086 N N   . PHE B 2 275 ? 46.527  11.668 16.095 1.00 72.53  ? 278  PHE B N   1 
ATOM   4087 C CA  . PHE B 2 275 ? 45.726  10.507 16.476 1.00 72.45  ? 278  PHE B CA  1 
ATOM   4088 C C   . PHE B 2 275 ? 45.463  10.507 17.980 1.00 76.78  ? 278  PHE B C   1 
ATOM   4089 O O   . PHE B 2 275 ? 44.373  10.151 18.435 1.00 75.86  ? 278  PHE B O   1 
ATOM   4090 C CB  . PHE B 2 275 ? 46.435  9.208  16.076 1.00 74.08  ? 278  PHE B CB  1 
ATOM   4091 C CG  . PHE B 2 275 ? 45.603  7.972  16.288 1.00 75.53  ? 278  PHE B CG  1 
ATOM   4092 C CD1 . PHE B 2 275 ? 44.272  7.939  15.903 1.00 78.62  ? 278  PHE B CD1 1 
ATOM   4093 C CD2 . PHE B 2 275 ? 46.149  6.846  16.876 1.00 77.62  ? 278  PHE B CD2 1 
ATOM   4094 C CE1 . PHE B 2 275 ? 43.505  6.802  16.103 1.00 79.42  ? 278  PHE B CE1 1 
ATOM   4095 C CE2 . PHE B 2 275 ? 45.387  5.708  17.071 1.00 80.29  ? 278  PHE B CE2 1 
ATOM   4096 C CZ  . PHE B 2 275 ? 44.064  5.689  16.685 1.00 78.28  ? 278  PHE B CZ  1 
ATOM   4097 N N   . ASN B 2 276 ? 46.472  10.932 18.736 1.00 74.06  ? 279  ASN B N   1 
ATOM   4098 C CA  . ASN B 2 276 ? 46.425  10.948 20.195 1.00 74.05  ? 279  ASN B CA  1 
ATOM   4099 C C   . ASN B 2 276 ? 45.628  12.147 20.720 1.00 77.41  ? 279  ASN B C   1 
ATOM   4100 O O   . ASN B 2 276 ? 46.136  13.270 20.775 1.00 76.73  ? 279  ASN B O   1 
ATOM   4101 C CB  . ASN B 2 276 ? 47.854  10.990 20.746 1.00 76.16  ? 279  ASN B CB  1 
ATOM   4102 C CG  . ASN B 2 276 ? 47.924  10.658 22.219 1.00 104.59 ? 279  ASN B CG  1 
ATOM   4103 O OD1 . ASN B 2 276 ? 46.917  10.686 22.927 1.00 100.39 ? 279  ASN B OD1 1 
ATOM   4104 N ND2 . ASN B 2 276 ? 49.123  10.335 22.691 1.00 98.01  ? 279  ASN B ND2 1 
ATOM   4105 N N   . PRO B 2 277 ? 44.375  11.909 21.143 1.00 73.55  ? 280  PRO B N   1 
ATOM   4106 C CA  . PRO B 2 277 ? 43.439  12.927 21.639 1.00 73.18  ? 280  PRO B CA  1 
ATOM   4107 C C   . PRO B 2 277 ? 44.074  13.889 22.643 1.00 76.66  ? 280  PRO B C   1 
ATOM   4108 O O   . PRO B 2 277 ? 43.660  15.043 22.759 1.00 75.90  ? 280  PRO B O   1 
ATOM   4109 C CB  . PRO B 2 277 ? 42.347  12.097 22.320 1.00 74.81  ? 280  PRO B CB  1 
ATOM   4110 C CG  . PRO B 2 277 ? 42.401  10.776 21.644 1.00 79.22  ? 280  PRO B CG  1 
ATOM   4111 C CD  . PRO B 2 277 ? 43.844  10.545 21.304 1.00 74.90  ? 280  PRO B CD  1 
ATOM   4112 N N   . HIS B 2 278 ? 45.088  13.414 23.356 1.00 73.44  ? 281  HIS B N   1 
ATOM   4113 C CA  . HIS B 2 278 ? 45.750  14.227 24.371 1.00 73.47  ? 281  HIS B CA  1 
ATOM   4114 C C   . HIS B 2 278 ? 46.786  15.162 23.764 1.00 77.00  ? 281  HIS B C   1 
ATOM   4115 O O   . HIS B 2 278 ? 46.766  16.369 24.013 1.00 76.85  ? 281  HIS B O   1 
ATOM   4116 C CB  . HIS B 2 278 ? 46.389  13.338 25.437 1.00 74.47  ? 281  HIS B CB  1 
ATOM   4117 C CG  . HIS B 2 278 ? 45.427  12.380 26.068 1.00 78.09  ? 281  HIS B CG  1 
ATOM   4118 N ND1 . HIS B 2 278 ? 45.451  11.026 25.813 1.00 79.97  ? 281  HIS B ND1 1 
ATOM   4119 C CD2 . HIS B 2 278 ? 44.381  12.589 26.902 1.00 79.94  ? 281  HIS B CD2 1 
ATOM   4120 C CE1 . HIS B 2 278 ? 44.472  10.438 26.479 1.00 79.43  ? 281  HIS B CE1 1 
ATOM   4121 N NE2 . HIS B 2 278 ? 43.808  11.365 27.147 1.00 79.76  ? 281  HIS B NE2 1 
ATOM   4122 N N   . LYS B 2 279 ? 47.687  14.605 22.963 1.00 72.83  ? 282  LYS B N   1 
ATOM   4123 C CA  . LYS B 2 279 ? 48.690  15.413 22.283 1.00 72.20  ? 282  LYS B CA  1 
ATOM   4124 C C   . LYS B 2 279 ? 48.054  16.312 21.218 1.00 75.00  ? 282  LYS B C   1 
ATOM   4125 O O   . LYS B 2 279 ? 48.705  17.218 20.694 1.00 75.11  ? 282  LYS B O   1 
ATOM   4126 C CB  . LYS B 2 279 ? 49.777  14.528 21.671 1.00 74.72  ? 282  LYS B CB  1 
ATOM   4127 C CG  . LYS B 2 279 ? 50.584  13.733 22.691 1.00 91.26  ? 282  LYS B CG  1 
ATOM   4128 C CD  . LYS B 2 279 ? 51.687  12.928 22.018 1.00 102.68 ? 282  LYS B CD  1 
ATOM   4129 C CE  . LYS B 2 279 ? 52.554  12.205 23.037 1.00 114.52 ? 282  LYS B CE  1 
ATOM   4130 N NZ  . LYS B 2 279 ? 53.634  11.410 22.386 1.00 123.48 ? 282  LYS B NZ  1 
ATOM   4131 N N   . ARG B 2 280 ? 46.778  16.073 20.919 1.00 69.52  ? 283  ARG B N   1 
ATOM   4132 C CA  . ARG B 2 280 ? 46.037  16.931 19.995 1.00 68.21  ? 283  ARG B CA  1 
ATOM   4133 C C   . ARG B 2 280 ? 45.888  18.357 20.525 1.00 71.48  ? 283  ARG B C   1 
ATOM   4134 O O   . ARG B 2 280 ? 45.834  18.578 21.735 1.00 71.45  ? 283  ARG B O   1 
ATOM   4135 C CB  . ARG B 2 280 ? 44.659  16.344 19.687 1.00 65.19  ? 283  ARG B CB  1 
ATOM   4136 C CG  . ARG B 2 280 ? 43.846  17.180 18.704 1.00 65.44  ? 283  ARG B CG  1 
ATOM   4137 C CD  . ARG B 2 280 ? 42.574  16.454 18.325 1.00 58.35  ? 283  ARG B CD  1 
ATOM   4138 N NE  . ARG B 2 280 ? 42.853  15.039 18.136 1.00 58.15  ? 283  ARG B NE  1 
ATOM   4139 C CZ  . ARG B 2 280 ? 41.930  14.087 18.080 1.00 67.44  ? 283  ARG B CZ  1 
ATOM   4140 N NH1 . ARG B 2 280 ? 42.299  12.828 17.905 1.00 56.90  ? 283  ARG B NH1 1 
ATOM   4141 N NH2 . ARG B 2 280 ? 40.644  14.386 18.201 1.00 48.05  ? 283  ARG B NH2 1 
ATOM   4142 N N   . ILE B 2 281 ? 45.763  19.312 19.608 1.00 67.06  ? 284  ILE B N   1 
ATOM   4143 C CA  . ILE B 2 281 ? 45.696  20.727 19.962 1.00 66.42  ? 284  ILE B CA  1 
ATOM   4144 C C   . ILE B 2 281 ? 44.302  21.159 20.410 1.00 69.59  ? 284  ILE B C   1 
ATOM   4145 O O   . ILE B 2 281 ? 43.289  20.650 19.921 1.00 69.10  ? 284  ILE B O   1 
ATOM   4146 C CB  . ILE B 2 281 ? 46.222  21.629 18.819 1.00 69.38  ? 284  ILE B CB  1 
ATOM   4147 C CG1 . ILE B 2 281 ? 46.533  23.032 19.347 1.00 69.88  ? 284  ILE B CG1 1 
ATOM   4148 C CG2 . ILE B 2 281 ? 45.207  21.710 17.686 1.00 69.60  ? 284  ILE B CG2 1 
ATOM   4149 C CD1 . ILE B 2 281 ? 47.045  23.984 18.289 1.00 76.41  ? 284  ILE B CD1 1 
ATOM   4150 N N   . SER B 2 282 ? 44.265  22.116 21.332 1.00 65.51  ? 285  SER B N   1 
ATOM   4151 C CA  . SER B 2 282 ? 43.009  22.676 21.817 1.00 65.15  ? 285  SER B CA  1 
ATOM   4152 C C   . SER B 2 282 ? 42.582  23.848 20.939 1.00 69.80  ? 285  SER B C   1 
ATOM   4153 O O   . SER B 2 282 ? 43.419  24.509 20.323 1.00 69.12  ? 285  SER B O   1 
ATOM   4154 C CB  . SER B 2 282 ? 43.166  23.154 23.262 1.00 67.29  ? 285  SER B CB  1 
ATOM   4155 O OG  . SER B 2 282 ? 43.948  24.337 23.324 1.00 73.28  ? 285  SER B OG  1 
ATOM   4156 N N   . ALA B 2 283 ? 41.278  24.099 20.888 1.00 67.10  ? 286  ALA B N   1 
ATOM   4157 C CA  . ALA B 2 283 ? 40.748  25.247 20.166 1.00 67.11  ? 286  ALA B CA  1 
ATOM   4158 C C   . ALA B 2 283 ? 41.433  26.517 20.648 1.00 72.76  ? 286  ALA B C   1 
ATOM   4159 O O   . ALA B 2 283 ? 41.635  27.456 19.880 1.00 72.11  ? 286  ALA B O   1 
ATOM   4160 C CB  . ALA B 2 283 ? 39.244  25.351 20.361 1.00 67.64  ? 286  ALA B CB  1 
ATOM   4161 N N   . PHE B 2 284 ? 41.822  26.527 21.918 1.00 70.93  ? 287  PHE B N   1 
ATOM   4162 C CA  . PHE B 2 284 ? 42.436  27.711 22.496 1.00 71.68  ? 287  PHE B CA  1 
ATOM   4163 C C   . PHE B 2 284 ? 43.902  27.877 22.107 1.00 77.75  ? 287  PHE B C   1 
ATOM   4164 O O   . PHE B 2 284 ? 44.320  28.957 21.691 1.00 77.53  ? 287  PHE B O   1 
ATOM   4165 C CB  . PHE B 2 284 ? 42.279  27.736 24.016 1.00 73.47  ? 287  PHE B CB  1 
ATOM   4166 C CG  . PHE B 2 284 ? 42.683  29.041 24.634 1.00 75.01  ? 287  PHE B CG  1 
ATOM   4167 C CD1 . PHE B 2 284 ? 42.074  30.222 24.238 1.00 78.11  ? 287  PHE B CD1 1 
ATOM   4168 C CD2 . PHE B 2 284 ? 43.710  29.099 25.563 1.00 77.18  ? 287  PHE B CD2 1 
ATOM   4169 C CE1 . PHE B 2 284 ? 42.454  31.432 24.779 1.00 79.04  ? 287  PHE B CE1 1 
ATOM   4170 C CE2 . PHE B 2 284 ? 44.097  30.308 26.110 1.00 80.15  ? 287  PHE B CE2 1 
ATOM   4171 C CZ  . PHE B 2 284 ? 43.468  31.477 25.716 1.00 78.31  ? 287  PHE B CZ  1 
ATOM   4172 N N   . ARG B 2 285 ? 44.688  26.820 22.280 1.00 75.95  ? 288  ARG B N   1 
ATOM   4173 C CA  . ARG B 2 285 ? 46.090  26.852 21.880 1.00 76.74  ? 288  ARG B CA  1 
ATOM   4174 C C   . ARG B 2 285 ? 46.224  26.910 20.359 1.00 82.43  ? 288  ARG B C   1 
ATOM   4175 O O   . ARG B 2 285 ? 47.191  27.460 19.827 1.00 82.18  ? 288  ARG B O   1 
ATOM   4176 C CB  . ARG B 2 285 ? 46.849  25.659 22.463 1.00 77.71  ? 288  ARG B CB  1 
ATOM   4177 C CG  . ARG B 2 285 ? 47.021  25.746 23.970 1.00 91.56  ? 288  ARG B CG  1 
ATOM   4178 C CD  . ARG B 2 285 ? 47.432  24.419 24.582 1.00 109.03 ? 288  ARG B CD  1 
ATOM   4179 N NE  . ARG B 2 285 ? 47.136  24.383 26.012 1.00 123.41 ? 288  ARG B NE  1 
ATOM   4180 C CZ  . ARG B 2 285 ? 47.406  23.357 26.813 1.00 139.71 ? 288  ARG B CZ  1 
ATOM   4181 N NH1 . ARG B 2 285 ? 47.094  23.418 28.101 1.00 127.13 ? 288  ARG B NH1 1 
ATOM   4182 N NH2 . ARG B 2 285 ? 47.994  22.271 26.328 1.00 127.44 ? 288  ARG B NH2 1 
ATOM   4183 N N   . ALA B 2 286 ? 45.221  26.380 19.666 1.00 79.81  ? 289  ALA B N   1 
ATOM   4184 C CA  . ALA B 2 286 ? 45.141  26.513 18.219 1.00 79.87  ? 289  ALA B CA  1 
ATOM   4185 C C   . ALA B 2 286 ? 44.792  27.950 17.860 1.00 84.65  ? 289  ALA B C   1 
ATOM   4186 O O   . ALA B 2 286 ? 45.479  28.585 17.064 1.00 84.26  ? 289  ALA B O   1 
ATOM   4187 C CB  . ALA B 2 286 ? 44.096  25.559 17.655 1.00 80.54  ? 289  ALA B CB  1 
ATOM   4188 N N   . LEU B 2 287 ? 43.769  28.484 18.518 1.00 81.97  ? 290  LEU B N   1 
ATOM   4189 C CA  . LEU B 2 287 ? 43.258  29.811 18.196 1.00 82.20  ? 290  LEU B CA  1 
ATOM   4190 C C   . LEU B 2 287 ? 44.302  30.900 18.424 1.00 87.28  ? 290  LEU B C   1 
ATOM   4191 O O   . LEU B 2 287 ? 43.986  32.086 18.410 1.00 87.12  ? 290  LEU B O   1 
ATOM   4192 C CB  . LEU B 2 287 ? 42.001  30.113 19.012 1.00 82.24  ? 290  LEU B CB  1 
ATOM   4193 C CG  . LEU B 2 287 ? 40.864  30.809 18.262 1.00 87.04  ? 290  LEU B CG  1 
ATOM   4194 C CD1 . LEU B 2 287 ? 39.762  31.233 19.217 1.00 87.37  ? 290  LEU B CD1 1 
ATOM   4195 C CD2 . LEU B 2 287 ? 41.365  31.986 17.443 1.00 89.26  ? 290  LEU B CD2 1 
ATOM   4196 N N   . GLN B 2 288 ? 45.546  30.494 18.644 1.00 84.86  ? 291  GLN B N   1 
ATOM   4197 C CA  . GLN B 2 288 ? 46.632  31.446 18.812 1.00 85.51  ? 291  GLN B CA  1 
ATOM   4198 C C   . GLN B 2 288 ? 47.971  30.859 18.380 1.00 90.54  ? 291  GLN B C   1 
ATOM   4199 O O   . GLN B 2 288 ? 49.016  31.156 18.963 1.00 89.86  ? 291  GLN B O   1 
ATOM   4200 C CB  . GLN B 2 288 ? 46.687  31.952 20.253 1.00 87.15  ? 291  GLN B CB  1 
ATOM   4201 C CG  . GLN B 2 288 ? 45.550  32.904 20.594 1.00 109.15 ? 291  GLN B CG  1 
ATOM   4202 C CD  . GLN B 2 288 ? 45.498  33.260 22.065 1.00 131.07 ? 291  GLN B CD  1 
ATOM   4203 O OE1 . GLN B 2 288 ? 46.400  32.919 22.830 1.00 127.16 ? 291  GLN B OE1 1 
ATOM   4204 N NE2 . GLN B 2 288 ? 44.435  33.946 22.469 1.00 123.50 ? 291  GLN B NE2 1 
ATOM   4205 N N   . HIS B 2 289 ? 47.920  30.024 17.346 1.00 87.92  ? 292  HIS B N   1 
ATOM   4206 C CA  . HIS B 2 289 ? 49.116  29.479 16.723 1.00 87.84  ? 292  HIS B CA  1 
ATOM   4207 C C   . HIS B 2 289 ? 49.741  30.506 15.784 1.00 91.41  ? 292  HIS B C   1 
ATOM   4208 O O   . HIS B 2 289 ? 49.104  31.496 15.418 1.00 91.18  ? 292  HIS B O   1 
ATOM   4209 C CB  . HIS B 2 289 ? 48.774  28.208 15.946 1.00 88.73  ? 292  HIS B CB  1 
ATOM   4210 C CG  . HIS B 2 289 ? 49.952  27.579 15.270 1.00 92.29  ? 292  HIS B CG  1 
ATOM   4211 N ND1 . HIS B 2 289 ? 49.872  26.998 14.023 1.00 94.12  ? 292  HIS B ND1 1 
ATOM   4212 C CD2 . HIS B 2 289 ? 51.239  27.444 15.667 1.00 94.14  ? 292  HIS B CD2 1 
ATOM   4213 C CE1 . HIS B 2 289 ? 51.059  26.529 13.682 1.00 93.58  ? 292  HIS B CE1 1 
ATOM   4214 N NE2 . HIS B 2 289 ? 51.906  26.788 14.661 1.00 93.92  ? 292  HIS B NE2 1 
ATOM   4215 N N   . SER B 2 290 ? 50.988  30.261 15.398 1.00 87.42  ? 293  SER B N   1 
ATOM   4216 C CA  . SER B 2 290 ? 51.717  31.156 14.508 1.00 87.02  ? 293  SER B CA  1 
ATOM   4217 C C   . SER B 2 290 ? 50.881  31.525 13.287 1.00 89.93  ? 293  SER B C   1 
ATOM   4218 O O   . SER B 2 290 ? 50.938  32.653 12.802 1.00 89.52  ? 293  SER B O   1 
ATOM   4219 C CB  . SER B 2 290 ? 53.019  30.493 14.054 1.00 91.17  ? 293  SER B CB  1 
ATOM   4220 O OG  . SER B 2 290 ? 53.690  29.879 15.142 1.00 100.83 ? 293  SER B OG  1 
ATOM   4221 N N   . TYR B 2 291 ? 50.059  30.581 12.840 1.00 85.73  ? 294  TYR B N   1 
ATOM   4222 C CA  . TYR B 2 291 ? 49.354  30.698 11.569 1.00 84.99  ? 294  TYR B CA  1 
ATOM   4223 C C   . TYR B 2 291 ? 48.084  31.543 11.659 1.00 88.03  ? 294  TYR B C   1 
ATOM   4224 O O   . TYR B 2 291 ? 47.450  31.831 10.644 1.00 87.28  ? 294  TYR B O   1 
ATOM   4225 C CB  . TYR B 2 291 ? 49.024  29.302 11.034 1.00 86.08  ? 294  TYR B CB  1 
ATOM   4226 C CG  . TYR B 2 291 ? 48.288  29.295 9.714  1.00 87.89  ? 294  TYR B CG  1 
ATOM   4227 C CD1 . TYR B 2 291 ? 48.972  29.449 8.514  1.00 89.99  ? 294  TYR B CD1 1 
ATOM   4228 C CD2 . TYR B 2 291 ? 46.915  29.100 9.664  1.00 88.65  ? 294  TYR B CD2 1 
ATOM   4229 C CE1 . TYR B 2 291 ? 48.303  29.434 7.301  1.00 90.84  ? 294  TYR B CE1 1 
ATOM   4230 C CE2 . TYR B 2 291 ? 46.237  29.080 8.457  1.00 89.58  ? 294  TYR B CE2 1 
ATOM   4231 C CZ  . TYR B 2 291 ? 46.936  29.250 7.279  1.00 97.01  ? 294  TYR B CZ  1 
ATOM   4232 O OH  . TYR B 2 291 ? 46.266  29.236 6.076  1.00 97.83  ? 294  TYR B OH  1 
ATOM   4233 N N   . LEU B 2 292 ? 47.733  31.965 12.870 1.00 84.18  ? 295  LEU B N   1 
ATOM   4234 C CA  . LEU B 2 292 ? 46.461  32.645 13.096 1.00 99.98  ? 295  LEU B CA  1 
ATOM   4235 C C   . LEU B 2 292 ? 46.606  33.859 14.010 1.00 115.80 ? 295  LEU B C   1 
ATOM   4236 O O   . LEU B 2 292 ? 47.447  34.728 13.784 1.00 73.22  ? 295  LEU B O   1 
ATOM   4237 C CB  . LEU B 2 292 ? 45.450  31.667 13.693 1.00 99.91  ? 295  LEU B CB  1 
ATOM   4238 C CG  . LEU B 2 292 ? 45.328  30.320 12.981 1.00 104.52 ? 295  LEU B CG  1 
ATOM   4239 C CD1 . LEU B 2 292 ? 44.808  29.259 13.935 1.00 104.68 ? 295  LEU B CD1 1 
ATOM   4240 C CD2 . LEU B 2 292 ? 44.416  30.442 11.770 1.00 106.85 ? 295  LEU B CD2 1 
HETATM 4241 O O   . HOH C 3 .   ? 37.336  42.182 34.711 1.00 72.75  ? 2001 HOH A O   1 
HETATM 4242 O O   . HOH C 3 .   ? 28.826  37.352 29.435 1.00 58.37  ? 2002 HOH A O   1 
HETATM 4243 O O   . HOH C 3 .   ? 31.547  34.322 27.638 1.00 72.96  ? 2003 HOH A O   1 
HETATM 4244 O O   . HOH C 3 .   ? 35.701  41.260 28.068 1.00 66.57  ? 2004 HOH A O   1 
HETATM 4245 O O   . HOH C 3 .   ? 32.758  31.326 29.189 0.50 30.74  ? 2005 HOH A O   1 
HETATM 4246 O O   . HOH C 3 .   ? 20.093  40.474 36.930 1.00 43.46  ? 2006 HOH A O   1 
HETATM 4247 O O   . HOH C 3 .   ? 13.610  37.072 39.355 1.00 44.83  ? 2007 HOH A O   1 
HETATM 4248 O O   . HOH C 3 .   ? 16.518  33.102 37.489 1.00 44.53  ? 2008 HOH A O   1 
HETATM 4249 O O   . HOH C 3 .   ? 15.037  42.655 30.066 1.00 53.57  ? 2009 HOH A O   1 
HETATM 4250 O O   . HOH C 3 .   ? 15.035  35.555 37.881 1.00 45.37  ? 2010 HOH A O   1 
HETATM 4251 O O   . HOH C 3 .   ? 16.236  43.437 32.730 1.00 58.72  ? 2011 HOH A O   1 
HETATM 4252 O O   . HOH C 3 .   ? 21.893  42.467 33.909 1.00 50.69  ? 2012 HOH A O   1 
HETATM 4253 O O   . HOH C 3 .   ? -4.747  44.090 34.563 1.00 55.22  ? 2013 HOH A O   1 
HETATM 4254 O O   . HOH C 3 .   ? -6.429  28.707 51.123 1.00 56.96  ? 2014 HOH A O   1 
HETATM 4255 O O   . HOH C 3 .   ? -3.149  28.703 56.802 1.00 68.57  ? 2015 HOH A O   1 
HETATM 4256 O O   . HOH C 3 .   ? 1.561   40.719 35.305 1.00 35.10  ? 2016 HOH A O   1 
HETATM 4257 O O   . HOH C 3 .   ? 4.177   40.995 43.917 1.00 36.46  ? 2017 HOH A O   1 
HETATM 4258 O O   . HOH C 3 .   ? 1.131   40.822 42.230 1.00 38.34  ? 2018 HOH A O   1 
HETATM 4259 O O   . HOH C 3 .   ? 4.127   45.301 36.530 1.00 87.35  ? 2019 HOH A O   1 
HETATM 4260 O O   . HOH C 3 .   ? 4.807   17.272 54.045 1.00 59.81  ? 2020 HOH A O   1 
HETATM 4261 O O   . HOH C 3 .   ? 4.711   16.224 56.389 0.50 41.72  ? 2021 HOH A O   1 
HETATM 4262 O O   . HOH C 3 .   ? 15.456  22.422 51.420 1.00 40.68  ? 2022 HOH A O   1 
HETATM 4263 O O   . HOH C 3 .   ? -7.498  40.221 41.983 1.00 76.85  ? 2023 HOH A O   1 
HETATM 4264 O O   . HOH C 3 .   ? -6.310  42.025 34.167 1.00 59.81  ? 2024 HOH A O   1 
HETATM 4265 O O   . HOH C 3 .   ? 32.203  27.331 40.917 1.00 74.04  ? 2025 HOH A O   1 
HETATM 4266 O O   . HOH C 3 .   ? 43.602  37.613 52.174 1.00 49.56  ? 2026 HOH A O   1 
HETATM 4267 O O   . HOH C 3 .   ? -10.349 26.139 41.761 1.00 44.88  ? 2027 HOH A O   1 
HETATM 4268 O O   . HOH C 3 .   ? -10.078 33.178 47.174 1.00 70.98  ? 2028 HOH A O   1 
HETATM 4269 O O   . HOH C 3 .   ? 8.499   35.733 30.435 1.00 55.28  ? 2029 HOH A O   1 
HETATM 4270 O O   . HOH C 3 .   ? -1.031  32.425 54.670 1.00 45.92  ? 2030 HOH A O   1 
HETATM 4271 O O   . HOH C 3 .   ? -6.036  31.975 51.055 1.00 73.37  ? 2031 HOH A O   1 
HETATM 4272 O O   . HOH C 3 .   ? -5.258  31.306 53.100 1.00 52.37  ? 2032 HOH A O   1 
HETATM 4273 O O   . HOH C 3 .   ? -5.281  21.534 46.929 1.00 59.80  ? 2033 HOH A O   1 
HETATM 4274 O O   . HOH C 3 .   ? -5.735  18.656 41.205 0.50 25.72  ? 2034 HOH A O   1 
HETATM 4275 O O   . HOH C 3 .   ? 1.386   24.613 54.100 1.00 52.32  ? 2035 HOH A O   1 
HETATM 4276 O O   . HOH C 3 .   ? 1.558   28.692 56.126 0.50 27.49  ? 2036 HOH A O   1 
HETATM 4277 O O   . HOH C 3 .   ? 16.897  8.247  39.017 1.00 64.35  ? 2037 HOH A O   1 
HETATM 4278 O O   . HOH C 3 .   ? 14.303  8.793  40.103 1.00 60.95  ? 2038 HOH A O   1 
HETATM 4279 O O   . HOH C 3 .   ? 2.859   22.350 55.269 1.00 48.50  ? 2039 HOH A O   1 
HETATM 4280 O O   . HOH C 3 .   ? 3.678   18.978 55.820 1.00 52.00  ? 2040 HOH A O   1 
HETATM 4281 O O   . HOH C 3 .   ? 16.540  20.198 52.391 1.00 46.40  ? 2041 HOH A O   1 
HETATM 4282 O O   . HOH C 3 .   ? -0.846  18.311 52.255 0.50 40.03  ? 2042 HOH A O   1 
HETATM 4283 O O   . HOH C 3 .   ? 16.821  13.232 48.029 1.00 58.76  ? 2043 HOH A O   1 
HETATM 4284 O O   . HOH C 3 .   ? 0.202   16.828 28.781 1.00 55.67  ? 2044 HOH A O   1 
HETATM 4285 O O   . HOH C 3 .   ? 15.356  22.277 48.748 1.00 36.78  ? 2045 HOH A O   1 
HETATM 4286 O O   . HOH C 3 .   ? 16.319  25.507 50.415 1.00 33.79  ? 2046 HOH A O   1 
HETATM 4287 O O   . HOH C 3 .   ? 24.729  23.766 43.009 1.00 49.85  ? 2047 HOH A O   1 
HETATM 4288 O O   . HOH C 3 .   ? 17.595  27.348 44.098 1.00 28.64  ? 2048 HOH A O   1 
HETATM 4289 O O   . HOH C 3 .   ? 31.838  29.864 42.780 1.00 50.97  ? 2049 HOH A O   1 
HETATM 4290 O O   . HOH C 3 .   ? 30.292  31.418 39.348 1.00 71.61  ? 2050 HOH A O   1 
HETATM 4291 O O   . HOH C 3 .   ? 16.630  29.398 42.236 1.00 51.90  ? 2051 HOH A O   1 
HETATM 4292 O O   . HOH C 3 .   ? 40.636  36.015 48.740 1.00 66.97  ? 2052 HOH A O   1 
HETATM 4293 O O   . HOH C 3 .   ? 41.707  34.565 51.901 1.00 64.39  ? 2053 HOH A O   1 
HETATM 4294 O O   . HOH C 3 .   ? 42.713  38.417 55.441 1.00 47.32  ? 2054 HOH A O   1 
HETATM 4295 O O   . HOH C 3 .   ? 12.866  33.855 41.507 1.00 32.83  ? 2055 HOH A O   1 
HETATM 4296 O O   . HOH C 3 .   ? 33.319  23.981 58.616 1.00 67.84  ? 2056 HOH A O   1 
HETATM 4297 O O   . HOH C 3 .   ? 30.490  20.907 49.395 1.00 86.40  ? 2057 HOH A O   1 
HETATM 4298 O O   . HOH C 3 .   ? 29.182  19.381 54.091 1.00 66.27  ? 2058 HOH A O   1 
HETATM 4299 O O   . HOH C 3 .   ? 18.924  25.453 54.549 1.00 53.65  ? 2059 HOH A O   1 
HETATM 4300 O O   . HOH C 3 .   ? 10.298  33.927 42.510 1.00 36.92  ? 2060 HOH A O   1 
HETATM 4301 O O   . HOH C 3 .   ? 7.383   34.192 33.684 1.00 35.17  ? 2061 HOH A O   1 
HETATM 4302 O O   . HOH C 3 .   ? 10.118  33.086 32.530 1.00 35.50  ? 2062 HOH A O   1 
HETATM 4303 O O   . HOH C 3 .   ? 1.502   33.817 28.287 1.00 54.67  ? 2063 HOH A O   1 
HETATM 4304 O O   . HOH C 3 .   ? -3.044  26.351 34.399 1.00 61.50  ? 2064 HOH A O   1 
HETATM 4305 O O   . HOH C 3 .   ? -5.781  32.305 39.863 1.00 51.08  ? 2065 HOH A O   1 
HETATM 4306 O O   . HOH C 3 .   ? -4.336  23.507 45.543 1.00 42.25  ? 2066 HOH A O   1 
HETATM 4307 O O   . HOH C 3 .   ? -4.320  26.160 48.198 1.00 70.43  ? 2067 HOH A O   1 
HETATM 4308 O O   . HOH C 3 .   ? -6.723  25.803 48.331 1.00 54.56  ? 2068 HOH A O   1 
HETATM 4309 O O   . HOH C 3 .   ? -8.445  19.341 42.794 1.00 49.60  ? 2069 HOH A O   1 
HETATM 4310 O O   . HOH C 3 .   ? -3.919  20.337 43.193 1.00 31.51  ? 2070 HOH A O   1 
HETATM 4311 O O   . HOH C 3 .   ? -5.921  18.482 38.934 0.50 27.12  ? 2071 HOH A O   1 
HETATM 4312 O O   . HOH C 3 .   ? -3.068  24.416 35.850 1.00 66.00  ? 2072 HOH A O   1 
HETATM 4313 O O   . HOH C 3 .   ? -8.182  21.775 35.072 1.00 77.69  ? 2073 HOH A O   1 
HETATM 4314 O O   . HOH C 3 .   ? -3.940  18.806 45.379 1.00 44.26  ? 2074 HOH A O   1 
HETATM 4315 O O   . HOH C 3 .   ? 32.234  56.171 55.897 1.00 53.86  ? 2075 HOH A O   1 
HETATM 4316 O O   . HOH C 3 .   ? 29.381  51.660 58.155 1.00 74.07  ? 2076 HOH A O   1 
HETATM 4317 O O   . HOH C 3 .   ? 15.617  52.690 49.655 1.00 65.20  ? 2077 HOH A O   1 
HETATM 4318 O O   . HOH C 3 .   ? 21.290  21.777 36.833 1.00 52.57  ? 2078 HOH A O   1 
HETATM 4319 O O   . HOH C 3 .   ? 20.217  14.010 45.932 1.00 38.19  ? 2079 HOH A O   1 
HETATM 4320 O O   . HOH C 3 .   ? 19.403  9.083  39.611 1.00 47.83  ? 2080 HOH A O   1 
HETATM 4321 O O   . HOH C 3 .   ? 12.754  10.523 45.816 1.00 67.76  ? 2081 HOH A O   1 
HETATM 4322 O O   . HOH C 3 .   ? 15.073  8.740  42.617 1.00 67.52  ? 2082 HOH A O   1 
HETATM 4323 O O   . HOH C 3 .   ? 12.275  11.560 38.964 1.00 53.81  ? 2083 HOH A O   1 
HETATM 4324 O O   . HOH C 3 .   ? 8.611   6.110  44.132 1.00 43.52  ? 2084 HOH A O   1 
HETATM 4325 O O   . HOH C 3 .   ? 6.858   7.258  40.441 1.00 29.07  ? 2085 HOH A O   1 
HETATM 4326 O O   . HOH C 3 .   ? 0.143   10.712 52.119 1.00 42.45  ? 2086 HOH A O   1 
HETATM 4327 O O   . HOH C 3 .   ? 2.547   16.450 53.268 1.00 78.06  ? 2087 HOH A O   1 
HETATM 4328 O O   . HOH C 3 .   ? -3.926  17.203 49.725 1.00 54.52  ? 2088 HOH A O   1 
HETATM 4329 O O   . HOH C 3 .   ? -5.420  15.487 52.877 1.00 69.96  ? 2089 HOH A O   1 
HETATM 4330 O O   . HOH C 3 .   ? -3.226  17.073 52.400 1.00 85.24  ? 2090 HOH A O   1 
HETATM 4331 O O   . HOH C 3 .   ? -1.607  9.385  44.805 1.00 48.51  ? 2091 HOH A O   1 
HETATM 4332 O O   . HOH C 3 .   ? -6.255  16.770 42.811 0.50 34.16  ? 2092 HOH A O   1 
HETATM 4333 O O   . HOH C 3 .   ? -8.338  14.713 44.721 1.00 67.37  ? 2093 HOH A O   1 
HETATM 4334 O O   . HOH C 3 .   ? -5.869  6.283  37.086 1.00 52.60  ? 2094 HOH A O   1 
HETATM 4335 O O   . HOH C 3 .   ? -6.767  12.440 41.081 1.00 47.61  ? 2095 HOH A O   1 
HETATM 4336 O O   . HOH C 3 .   ? -2.596  17.926 30.693 1.00 56.89  ? 2096 HOH A O   1 
HETATM 4337 O O   . HOH C 3 .   ? 6.156   14.681 31.903 1.00 33.35  ? 2097 HOH A O   1 
HETATM 4338 O O   . HOH C 3 .   ? 2.171   25.271 28.621 1.00 54.39  ? 2098 HOH A O   1 
HETATM 4339 O O   . HOH C 3 .   ? 5.375   30.813 27.539 1.00 35.78  ? 2099 HOH A O   1 
HETATM 4340 O O   . HOH C 3 .   ? 7.810   34.225 28.256 1.00 53.80  ? 2100 HOH A O   1 
HETATM 4341 O O   . HOH C 3 .   ? 11.144  31.931 30.260 1.00 50.69  ? 2101 HOH A O   1 
HETATM 4342 O O   . HOH C 3 .   ? 17.912  27.370 31.164 1.00 29.59  ? 2102 HOH A O   1 
HETATM 4343 O O   . HOH C 3 .   ? 18.934  31.129 31.273 1.00 46.97  ? 2103 HOH A O   1 
HETATM 4344 O O   . HOH C 3 .   ? 18.600  26.124 37.770 1.00 26.60  ? 2104 HOH A O   1 
HETATM 4345 O O   . HOH C 3 .   ? 27.127  21.812 46.106 1.00 59.34  ? 2105 HOH A O   1 
HETATM 4346 O O   . HOH C 3 .   ? 27.575  26.561 42.631 1.00 52.22  ? 2106 HOH A O   1 
HETATM 4347 O O   . HOH C 3 .   ? 29.095  30.080 41.492 1.00 52.72  ? 2107 HOH A O   1 
HETATM 4348 O O   . HOH C 3 .   ? 32.752  29.587 47.225 1.00 39.77  ? 2108 HOH A O   1 
HETATM 4349 O O   . HOH C 3 .   ? 33.328  31.848 41.797 1.00 64.78  ? 2109 HOH A O   1 
HETATM 4350 O O   . HOH C 3 .   ? 38.335  33.188 48.885 1.00 79.99  ? 2110 HOH A O   1 
HETATM 4351 O O   . HOH C 3 .   ? 38.407  39.376 46.415 1.00 55.85  ? 2111 HOH A O   1 
HETATM 4352 O O   . HOH C 3 .   ? 40.918  35.765 54.711 0.50 52.94  ? 2112 HOH A O   1 
HETATM 4353 O O   . HOH C 3 .   ? 39.847  31.250 52.557 1.00 66.13  ? 2113 HOH A O   1 
HETATM 4354 O O   . HOH C 3 .   ? 40.901  34.266 56.443 1.00 72.44  ? 2114 HOH A O   1 
HETATM 4355 O O   . HOH C 3 .   ? 40.674  28.859 54.994 1.00 77.91  ? 2115 HOH A O   1 
HETATM 4356 O O   . HOH C 3 .   ? 35.049  27.739 49.490 1.00 46.10  ? 2116 HOH A O   1 
HETATM 4357 O O   . HOH C 3 .   ? 31.989  25.310 60.460 1.00 59.63  ? 2117 HOH A O   1 
HETATM 4358 O O   . HOH C 3 .   ? 40.626  27.959 57.453 1.00 58.79  ? 2118 HOH A O   1 
HETATM 4359 O O   . HOH C 3 .   ? 27.519  23.241 53.109 1.00 62.74  ? 2119 HOH A O   1 
HETATM 4360 O O   . HOH C 3 .   ? 33.966  23.130 54.238 1.00 67.49  ? 2120 HOH A O   1 
HETATM 4361 O O   . HOH C 3 .   ? 32.116  22.795 51.132 1.00 68.39  ? 2121 HOH A O   1 
HETATM 4362 O O   . HOH C 3 .   ? 27.189  24.728 55.562 1.00 54.05  ? 2122 HOH A O   1 
HETATM 4363 O O   . HOH C 3 .   ? 21.309  25.649 56.097 1.00 56.93  ? 2123 HOH A O   1 
HETATM 4364 O O   . HOH C 3 .   ? 19.453  31.264 61.028 1.00 60.79  ? 2124 HOH A O   1 
HETATM 4365 O O   . HOH C 3 .   ? 17.702  27.759 50.779 1.00 35.14  ? 2125 HOH A O   1 
HETATM 4366 O O   . HOH C 3 .   ? 4.236   33.326 49.747 1.00 38.05  ? 2126 HOH A O   1 
HETATM 4367 O O   . HOH C 3 .   ? 5.126   35.114 53.849 1.00 56.45  ? 2127 HOH A O   1 
HETATM 4368 O O   . HOH C 3 .   ? 12.285  36.586 41.485 1.00 41.31  ? 2128 HOH A O   1 
HETATM 4369 O O   . HOH C 3 .   ? 12.178  44.204 40.740 1.00 52.48  ? 2129 HOH A O   1 
HETATM 4370 O O   . HOH C 3 .   ? 14.049  35.476 43.894 1.00 37.35  ? 2130 HOH A O   1 
HETATM 4371 O O   . HOH C 3 .   ? 20.661  41.598 40.886 1.00 31.30  ? 2131 HOH A O   1 
HETATM 4372 O O   . HOH C 3 .   ? 28.420  43.457 61.963 1.00 50.17  ? 2132 HOH A O   1 
HETATM 4373 O O   . HOH C 3 .   ? 30.138  34.742 64.889 1.00 46.90  ? 2133 HOH A O   1 
HETATM 4374 O O   . HOH C 3 .   ? 27.391  45.340 56.311 1.00 54.29  ? 2134 HOH A O   1 
HETATM 4375 O O   . HOH C 3 .   ? 33.432  53.769 54.411 1.00 51.61  ? 2135 HOH A O   1 
HETATM 4376 O O   . HOH C 3 .   ? 29.185  48.590 57.090 1.00 43.49  ? 2136 HOH A O   1 
HETATM 4377 O O   . HOH C 3 .   ? 25.988  53.492 54.525 0.50 44.15  ? 2137 HOH A O   1 
HETATM 4378 O O   . HOH C 3 .   ? 26.912  55.171 56.003 1.00 65.83  ? 2138 HOH A O   1 
HETATM 4379 O O   . HOH C 3 .   ? 32.949  47.729 48.734 1.00 37.61  ? 2139 HOH A O   1 
HETATM 4380 O O   . HOH C 3 .   ? 27.393  49.671 52.278 1.00 34.41  ? 2140 HOH A O   1 
HETATM 4381 O O   . HOH C 3 .   ? 34.296  53.588 52.113 1.00 36.04  ? 2141 HOH A O   1 
HETATM 4382 O O   . HOH C 3 .   ? 32.612  42.965 41.778 1.00 87.59  ? 2142 HOH A O   1 
HETATM 4383 O O   . HOH C 3 .   ? 21.540  42.655 37.370 1.00 58.98  ? 2143 HOH A O   1 
HETATM 4384 O O   . HOH C 3 .   ? 19.864  45.879 39.054 1.00 58.05  ? 2144 HOH A O   1 
HETATM 4385 O O   . HOH C 3 .   ? 24.288  49.708 38.320 1.00 47.70  ? 2145 HOH A O   1 
HETATM 4386 O O   . HOH C 3 .   ? 16.972  50.991 51.815 1.00 57.46  ? 2146 HOH A O   1 
HETATM 4387 O O   . HOH C 3 .   ? 15.119  46.104 47.118 1.00 60.07  ? 2147 HOH A O   1 
HETATM 4388 O O   . HOH C 3 .   ? 15.187  45.119 59.719 1.00 52.99  ? 2148 HOH A O   1 
HETATM 4389 O O   . HOH C 3 .   ? 12.660  47.635 53.136 1.00 47.04  ? 2149 HOH A O   1 
HETATM 4390 O O   . HOH C 3 .   ? 9.912   41.481 55.766 1.00 50.82  ? 2150 HOH A O   1 
HETATM 4391 O O   . HOH C 3 .   ? 8.968   47.868 53.524 1.00 56.33  ? 2151 HOH A O   1 
HETATM 4392 O O   . HOH C 3 .   ? 12.169  33.877 65.144 1.00 51.73  ? 2152 HOH A O   1 
HETATM 4393 O O   . HOH D 3 .   ? 7.831   19.607 12.798 1.00 74.54  ? 2001 HOH B O   1 
HETATM 4394 O O   . HOH D 3 .   ? 1.627   23.106 20.039 1.00 56.15  ? 2002 HOH B O   1 
HETATM 4395 O O   . HOH D 3 .   ? 14.587  17.332 12.764 1.00 47.49  ? 2003 HOH B O   1 
HETATM 4396 O O   . HOH D 3 .   ? 13.106  14.525 10.902 1.00 66.07  ? 2004 HOH B O   1 
HETATM 4397 O O   . HOH D 3 .   ? 5.439   33.116 17.116 1.00 70.89  ? 2005 HOH B O   1 
HETATM 4398 O O   . HOH D 3 .   ? 2.858   38.023 20.983 1.00 57.90  ? 2006 HOH B O   1 
HETATM 4399 O O   . HOH D 3 .   ? 13.326  42.757 16.487 1.00 57.13  ? 2007 HOH B O   1 
HETATM 4400 O O   . HOH D 3 .   ? 20.821  20.573 10.198 1.00 60.93  ? 2008 HOH B O   1 
HETATM 4401 O O   . HOH D 3 .   ? 21.227  23.617 10.144 1.00 56.91  ? 2009 HOH B O   1 
HETATM 4402 O O   . HOH D 3 .   ? 2.617   7.327  34.293 1.00 65.76  ? 2010 HOH B O   1 
HETATM 4403 O O   . HOH D 3 .   ? 25.165  21.113 34.604 1.00 65.39  ? 2011 HOH B O   1 
HETATM 4404 O O   . HOH D 3 .   ? 14.079  14.520 13.749 1.00 67.03  ? 2012 HOH B O   1 
HETATM 4405 O O   . HOH D 3 .   ? 4.865   11.604 16.184 1.00 79.16  ? 2013 HOH B O   1 
HETATM 4406 O O   . HOH D 3 .   ? 16.246  10.995 21.038 1.00 44.89  ? 2014 HOH B O   1 
HETATM 4407 O O   . HOH D 3 .   ? 13.235  7.730  29.576 1.00 51.02  ? 2015 HOH B O   1 
HETATM 4408 O O   . HOH D 3 .   ? 7.994   3.821  28.006 1.00 79.58  ? 2016 HOH B O   1 
HETATM 4409 O O   . HOH D 3 .   ? 4.062   7.931  31.713 1.00 45.88  ? 2017 HOH B O   1 
HETATM 4410 O O   . HOH D 3 .   ? 2.047   0.969  35.486 1.00 67.11  ? 2018 HOH B O   1 
HETATM 4411 O O   . HOH D 3 .   ? 26.339  22.845 33.102 1.00 50.46  ? 2019 HOH B O   1 
HETATM 4412 O O   . HOH D 3 .   ? 12.357  6.413  34.631 1.00 51.07  ? 2020 HOH B O   1 
HETATM 4413 O O   . HOH D 3 .   ? 11.851  9.155  30.674 1.00 47.32  ? 2021 HOH B O   1 
HETATM 4414 O O   . HOH D 3 .   ? 17.996  32.302 27.532 1.00 49.43  ? 2022 HOH B O   1 
HETATM 4415 O O   . HOH D 3 .   ? 12.676  31.841 28.559 0.50 15.79  ? 2023 HOH B O   1 
HETATM 4416 O O   . HOH D 3 .   ? 25.964  25.265 34.548 1.00 55.78  ? 2024 HOH B O   1 
HETATM 4417 O O   . HOH D 3 .   ? 26.642  29.105 36.232 0.50 32.28  ? 2025 HOH B O   1 
HETATM 4418 O O   . HOH D 3 .   ? 26.252  26.746 30.174 1.00 56.15  ? 2026 HOH B O   1 
HETATM 4419 O O   . HOH D 3 .   ? 25.951  32.703 23.239 1.00 39.06  ? 2027 HOH B O   1 
HETATM 4420 O O   . HOH D 3 .   ? 20.043  37.343 24.735 1.00 58.48  ? 2028 HOH B O   1 
HETATM 4421 O O   . HOH D 3 .   ? 30.063  36.880 26.272 1.00 55.65  ? 2029 HOH B O   1 
HETATM 4422 O O   . HOH D 3 .   ? 25.789  38.528 19.179 1.00 58.06  ? 2030 HOH B O   1 
HETATM 4423 O O   . HOH D 3 .   ? 18.909  39.093 22.805 1.00 69.47  ? 2031 HOH B O   1 
HETATM 4424 O O   . HOH D 3 .   ? 26.059  21.274 29.204 1.00 52.86  ? 2032 HOH B O   1 
HETATM 4425 O O   . HOH D 3 .   ? 33.969  36.302 16.247 1.00 53.52  ? 2033 HOH B O   1 
HETATM 4426 O O   . HOH D 3 .   ? 14.165  33.439 22.824 1.00 43.60  ? 2034 HOH B O   1 
HETATM 4427 O O   . HOH D 3 .   ? 7.535   26.904 24.478 1.00 57.23  ? 2035 HOH B O   1 
HETATM 4428 O O   . HOH D 3 .   ? 26.277  17.312 28.965 1.00 71.24  ? 2036 HOH B O   1 
HETATM 4429 O O   . HOH D 3 .   ? 1.287   18.640 25.420 0.50 36.90  ? 2037 HOH B O   1 
HETATM 4430 O O   . HOH D 3 .   ? 7.515   18.256 17.500 1.00 58.31  ? 2038 HOH B O   1 
HETATM 4431 O O   . HOH D 3 .   ? 4.941   5.709  30.425 1.00 54.26  ? 2039 HOH B O   1 
HETATM 4432 O O   . HOH D 3 .   ? 10.648  6.386  16.775 1.00 50.34  ? 2040 HOH B O   1 
HETATM 4433 O O   . HOH D 3 .   ? 24.027  34.175 17.654 1.00 51.63  ? 2041 HOH B O   1 
HETATM 4434 O O   . HOH D 3 .   ? 39.292  22.605 22.965 1.00 49.90  ? 2042 HOH B O   1 
HETATM 4435 O O   . HOH D 3 .   ? 32.904  29.149 31.320 0.50 42.73  ? 2043 HOH B O   1 
HETATM 4436 O O   . HOH D 3 .   ? 26.998  23.838 30.427 1.00 67.18  ? 2044 HOH B O   1 
HETATM 4437 O O   . HOH D 3 .   ? 27.477  18.275 24.750 1.00 46.74  ? 2045 HOH B O   1 
HETATM 4438 O O   . HOH D 3 .   ? 25.954  17.742 18.206 1.00 34.35  ? 2046 HOH B O   1 
HETATM 4439 O O   . HOH D 3 .   ? 24.115  16.760 9.602  1.00 47.13  ? 2047 HOH B O   1 
HETATM 4440 O O   . HOH D 3 .   ? 21.008  39.668 4.777  1.00 59.26  ? 2048 HOH B O   1 
HETATM 4441 O O   . HOH D 3 .   ? 25.874  37.936 15.700 1.00 61.41  ? 2049 HOH B O   1 
HETATM 4442 O O   . HOH D 3 .   ? 23.445  16.409 24.017 1.00 55.85  ? 2050 HOH B O   1 
HETATM 4443 O O   . HOH D 3 .   ? 23.747  20.057 25.790 1.00 59.54  ? 2051 HOH B O   1 
HETATM 4444 O O   . HOH D 3 .   ? 26.494  16.506 21.160 1.00 37.82  ? 2052 HOH B O   1 
HETATM 4445 O O   . HOH D 3 .   ? 27.438  10.961 26.507 1.00 40.87  ? 2053 HOH B O   1 
HETATM 4446 O O   . HOH D 3 .   ? 27.106  14.566 30.815 1.00 69.86  ? 2054 HOH B O   1 
HETATM 4447 O O   . HOH D 3 .   ? 18.536  10.661 23.938 1.00 34.92  ? 2055 HOH B O   1 
HETATM 4448 O O   . HOH D 3 .   ? 11.668  13.697 15.236 1.00 66.98  ? 2056 HOH B O   1 
HETATM 4449 O O   . HOH D 3 .   ? 20.390  1.300  16.667 1.00 58.96  ? 2057 HOH B O   1 
HETATM 4450 O O   . HOH D 3 .   ? 25.634  11.711 2.930  1.00 67.47  ? 2058 HOH B O   1 
HETATM 4451 O O   . HOH D 3 .   ? 24.191  10.621 9.967  1.00 50.00  ? 2059 HOH B O   1 
HETATM 4452 O O   . HOH D 3 .   ? 27.179  9.992  3.191  1.00 66.68  ? 2060 HOH B O   1 
HETATM 4453 O O   . HOH D 3 .   ? 31.342  2.903  19.094 1.00 73.10  ? 2061 HOH B O   1 
HETATM 4454 O O   . HOH D 3 .   ? 38.696  13.271 22.384 1.00 59.88  ? 2062 HOH B O   1 
HETATM 4455 O O   . HOH D 3 .   ? 38.422  12.266 10.177 1.00 41.45  ? 2063 HOH B O   1 
HETATM 4456 O O   . HOH D 3 .   ? 32.616  16.928 15.218 1.00 45.26  ? 2064 HOH B O   1 
HETATM 4457 O O   . HOH D 3 .   ? 39.478  10.486 0.433  1.00 62.56  ? 2065 HOH B O   1 
HETATM 4458 O O   . HOH D 3 .   ? 49.337  12.059 14.551 1.00 57.44  ? 2066 HOH B O   1 
HETATM 4459 O O   . HOH D 3 .   ? 50.875  21.210 27.993 1.00 65.45  ? 2067 HOH B O   1 
HETATM 4460 O O   . HOH D 3 .   ? 47.557  35.563 19.241 1.00 72.70  ? 2068 HOH B O   1 
HETATM 4461 O O   . HOH D 3 .   ? 53.429  33.602 14.379 1.00 65.52  ? 2069 HOH B O   1 
HETATM 4462 O O   . HOH D 3 .   ? 46.684  38.453 13.774 1.00 67.46  ? 2070 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   15  ?   ?   ?   A . n 
A 1 2   ALA 2   16  ?   ?   ?   A . n 
A 1 3   TYR 3   17  ?   ?   ?   A . n 
A 1 4   PRO 4   18  ?   ?   ?   A . n 
A 1 5   ASP 5   19  ?   ?   ?   A . n 
A 1 6   ALA 6   20  ?   ?   ?   A . n 
A 1 7   ASN 7   21  ?   ?   ?   A . n 
A 1 8   LEU 8   22  22  LEU LEU A . n 
A 1 9   LEU 9   23  23  LEU LEU A . n 
A 1 10  ASN 10  24  24  ASN ASN A . n 
A 1 11  ASP 11  25  25  ASP ASP A . n 
A 1 12  ARG 12  26  26  ARG ARG A . n 
A 1 13  VAL 13  27  27  VAL VAL A . n 
A 1 14  LEU 14  28  28  LEU LEU A . n 
A 1 15  ARG 15  29  29  ARG ARG A . n 
A 1 16  ALA 16  30  30  ALA ALA A . n 
A 1 17  MET 17  31  31  MET MET A . n 
A 1 18  LEU 18  32  32  LEU LEU A . n 
A 1 19  LYS 19  33  33  LYS LYS A . n 
A 1 20  ALA 20  34  34  ALA ALA A . n 
A 1 21  GLU 21  35  35  GLU GLU A . n 
A 1 22  GLU 22  36  36  GLU GLU A . n 
A 1 23  THR 23  37  37  THR THR A . n 
A 1 24  CYS 24  38  38  CYS CYS A . n 
A 1 25  ALA 25  39  39  ALA ALA A . n 
A 1 26  PRO 26  40  40  PRO PRO A . n 
A 1 27  SER 27  41  41  SER SER A . n 
A 1 28  VAL 28  42  42  VAL VAL A . n 
A 1 29  SER 29  43  43  SER SER A . n 
A 1 30  TYR 30  44  44  TYR TYR A . n 
A 1 31  PHE 31  45  45  PHE PHE A . n 
A 1 32  LYS 32  46  46  LYS LYS A . n 
A 1 33  CYS 33  47  47  CYS CYS A . n 
A 1 34  VAL 34  48  48  VAL VAL A . n 
A 1 35  GLN 35  49  49  GLN GLN A . n 
A 1 36  LYS 36  50  50  LYS LYS A . n 
A 1 37  GLU 37  51  51  GLU GLU A . n 
A 1 38  VAL 38  52  52  VAL VAL A . n 
A 1 39  LEU 39  53  53  LEU LEU A . n 
A 1 40  PRO 40  54  54  PRO PRO A . n 
A 1 41  SER 41  55  55  SER SER A . n 
A 1 42  MET 42  56  56  MET MET A . n 
A 1 43  ARG 43  57  57  ARG ARG A . n 
A 1 44  LYS 44  58  58  LYS LYS A . n 
A 1 45  ILE 45  59  59  ILE ILE A . n 
A 1 46  VAL 46  60  60  VAL VAL A . n 
A 1 47  ALA 47  61  61  ALA ALA A . n 
A 1 48  THR 48  62  62  THR THR A . n 
A 1 49  TRP 49  63  63  TRP TRP A . n 
A 1 50  MET 50  64  64  MET MET A . n 
A 1 51  LEU 51  65  65  LEU LEU A . n 
A 1 52  GLU 52  66  66  GLU GLU A . n 
A 1 53  VAL 53  67  67  VAL VAL A . n 
A 1 54  CYS 54  68  68  CYS CYS A . n 
A 1 55  GLU 55  69  69  GLU GLU A . n 
A 1 56  GLU 56  70  70  GLU GLU A . n 
A 1 57  GLN 57  71  71  GLN GLN A . n 
A 1 58  LYS 58  72  72  LYS LYS A . n 
A 1 59  CYS 59  73  73  CYS CYS A . n 
A 1 60  GLU 60  74  74  GLU GLU A . n 
A 1 61  GLU 61  75  75  GLU GLU A . n 
A 1 62  GLU 62  76  76  GLU GLU A . n 
A 1 63  VAL 63  77  77  VAL VAL A . n 
A 1 64  PHE 64  78  78  PHE PHE A . n 
A 1 65  PRO 65  79  79  PRO PRO A . n 
A 1 66  LEU 66  80  80  LEU LEU A . n 
A 1 67  ALA 67  81  81  ALA ALA A . n 
A 1 68  MET 68  82  82  MET MET A . n 
A 1 69  ASN 69  83  83  ASN ASN A . n 
A 1 70  TYR 70  84  84  TYR TYR A . n 
A 1 71  LEU 71  85  85  LEU LEU A . n 
A 1 72  ASP 72  86  86  ASP ASP A . n 
A 1 73  ARG 73  87  87  ARG ARG A . n 
A 1 74  PHE 74  88  88  PHE PHE A . n 
A 1 75  LEU 75  89  89  LEU LEU A . n 
A 1 76  SER 76  90  90  SER SER A . n 
A 1 77  LEU 77  91  91  LEU LEU A . n 
A 1 78  GLU 78  92  92  GLU GLU A . n 
A 1 79  PRO 79  93  93  PRO PRO A . n 
A 1 80  VAL 80  94  94  VAL VAL A . n 
A 1 81  LYS 81  95  95  LYS LYS A . n 
A 1 82  LYS 82  96  96  LYS LYS A . n 
A 1 83  SER 83  97  97  SER SER A . n 
A 1 84  ARG 84  98  98  ARG ARG A . n 
A 1 85  LEU 85  99  99  LEU LEU A . n 
A 1 86  GLN 86  100 100 GLN GLN A . n 
A 1 87  LEU 87  101 101 LEU LEU A . n 
A 1 88  LEU 88  102 102 LEU LEU A . n 
A 1 89  GLY 89  103 103 GLY GLY A . n 
A 1 90  ALA 90  104 104 ALA ALA A . n 
A 1 91  THR 91  105 105 THR THR A . n 
A 1 92  CYS 92  106 106 CYS CYS A . n 
A 1 93  MET 93  107 107 MET MET A . n 
A 1 94  PHE 94  108 108 PHE PHE A . n 
A 1 95  VAL 95  109 109 VAL VAL A . n 
A 1 96  ALA 96  110 110 ALA ALA A . n 
A 1 97  SER 97  111 111 SER SER A . n 
A 1 98  LYS 98  112 112 LYS LYS A . n 
A 1 99  MET 99  113 113 MET MET A . n 
A 1 100 LYS 100 114 114 LYS LYS A . n 
A 1 101 GLU 101 115 115 GLU GLU A . n 
A 1 102 THR 102 116 116 THR THR A . n 
A 1 103 ILE 103 117 117 ILE ILE A . n 
A 1 104 PRO 104 118 118 PRO PRO A . n 
A 1 105 LEU 105 119 119 LEU LEU A . n 
A 1 106 THR 106 120 120 THR THR A . n 
A 1 107 ALA 107 121 121 ALA ALA A . n 
A 1 108 GLU 108 122 122 GLU GLU A . n 
A 1 109 LYS 109 123 123 LYS LYS A . n 
A 1 110 LEU 110 124 124 LEU LEU A . n 
A 1 111 CYS 111 125 125 CYS CYS A . n 
A 1 112 ILE 112 126 126 ILE ILE A . n 
A 1 113 TYR 113 127 127 TYR TYR A . n 
A 1 114 THR 114 128 128 THR THR A . n 
A 1 115 ASP 115 129 129 ASP ASP A . n 
A 1 116 ASN 116 130 130 ASN ASN A . n 
A 1 117 SER 117 131 131 SER SER A . n 
A 1 118 ILE 118 132 132 ILE ILE A . n 
A 1 119 ARG 119 133 133 ARG ARG A . n 
A 1 120 PRO 120 134 134 PRO PRO A . n 
A 1 121 GLU 121 135 135 GLU GLU A . n 
A 1 122 GLU 122 136 136 GLU GLU A . n 
A 1 123 LEU 123 137 137 LEU LEU A . n 
A 1 124 LEU 124 138 138 LEU LEU A . n 
A 1 125 GLN 125 139 139 GLN GLN A . n 
A 1 126 MET 126 140 140 MET MET A . n 
A 1 127 GLU 127 141 141 GLU GLU A . n 
A 1 128 LEU 128 142 142 LEU LEU A . n 
A 1 129 LEU 129 143 143 LEU LEU A . n 
A 1 130 LEU 130 144 144 LEU LEU A . n 
A 1 131 VAL 131 145 145 VAL VAL A . n 
A 1 132 ASN 132 146 146 ASN ASN A . n 
A 1 133 LYS 133 147 147 LYS LYS A . n 
A 1 134 LEU 134 148 148 LEU LEU A . n 
A 1 135 LYS 135 149 149 LYS LYS A . n 
A 1 136 TRP 136 150 150 TRP TRP A . n 
A 1 137 ASN 137 151 151 ASN ASN A . n 
A 1 138 LEU 138 152 152 LEU LEU A . n 
A 1 139 ALA 139 153 153 ALA ALA A . n 
A 1 140 ALA 140 154 154 ALA ALA A . n 
A 1 141 MET 141 155 155 MET MET A . n 
A 1 142 THR 142 156 156 THR THR A . n 
A 1 143 PRO 143 157 157 PRO PRO A . n 
A 1 144 HIS 144 158 158 HIS HIS A . n 
A 1 145 ASP 145 159 159 ASP ASP A . n 
A 1 146 PHE 146 160 160 PHE PHE A . n 
A 1 147 ILE 147 161 161 ILE ILE A . n 
A 1 148 GLU 148 162 162 GLU GLU A . n 
A 1 149 HIS 149 163 163 HIS HIS A . n 
A 1 150 PHE 150 164 164 PHE PHE A . n 
A 1 151 LEU 151 165 165 LEU LEU A . n 
A 1 152 SER 152 166 166 SER SER A . n 
A 1 153 LYS 153 167 167 LYS LYS A . n 
A 1 154 MET 154 168 168 MET MET A . n 
A 1 155 PRO 155 169 169 PRO PRO A . n 
A 1 156 GLU 156 170 170 GLU GLU A . n 
A 1 157 ALA 157 171 171 ALA ALA A . n 
A 1 158 GLU 158 172 172 GLU GLU A . n 
A 1 159 GLU 159 173 173 GLU GLU A . n 
A 1 160 ASN 160 174 174 ASN ASN A . n 
A 1 161 LYS 161 175 175 LYS LYS A . n 
A 1 162 GLN 162 176 176 GLN GLN A . n 
A 1 163 ILE 163 177 177 ILE ILE A . n 
A 1 164 ILE 164 178 178 ILE ILE A . n 
A 1 165 ARG 165 179 179 ARG ARG A . n 
A 1 166 LYS 166 180 180 LYS LYS A . n 
A 1 167 HIS 167 181 181 HIS HIS A . n 
A 1 168 ALA 168 182 182 ALA ALA A . n 
A 1 169 GLN 169 183 183 GLN GLN A . n 
A 1 170 THR 170 184 184 THR THR A . n 
A 1 171 PHE 171 185 185 PHE PHE A . n 
A 1 172 VAL 172 186 186 VAL VAL A . n 
A 1 173 ALA 173 187 187 ALA ALA A . n 
A 1 174 LEU 174 188 188 LEU LEU A . n 
A 1 175 CYS 175 189 189 CYS CYS A . n 
A 1 176 ALA 176 190 190 ALA ALA A . n 
A 1 177 THR 177 191 191 THR THR A . n 
A 1 178 ASP 178 192 192 ASP ASP A . n 
A 1 179 VAL 179 193 193 VAL VAL A . n 
A 1 180 LYS 180 194 194 LYS LYS A . n 
A 1 181 PHE 181 195 195 PHE PHE A . n 
A 1 182 ILE 182 196 196 ILE ILE A . n 
A 1 183 SER 183 197 197 SER SER A . n 
A 1 184 ASN 184 198 198 ASN ASN A . n 
A 1 185 PRO 185 199 199 PRO PRO A . n 
A 1 186 PRO 186 200 200 PRO PRO A . n 
A 1 187 SER 187 201 201 SER SER A . n 
A 1 188 MET 188 202 202 MET MET A . n 
A 1 189 VAL 189 203 203 VAL VAL A . n 
A 1 190 ALA 190 204 204 ALA ALA A . n 
A 1 191 ALA 191 205 205 ALA ALA A . n 
A 1 192 GLY 192 206 206 GLY GLY A . n 
A 1 193 SER 193 207 207 SER SER A . n 
A 1 194 VAL 194 208 208 VAL VAL A . n 
A 1 195 VAL 195 209 209 VAL VAL A . n 
A 1 196 ALA 196 210 210 ALA ALA A . n 
A 1 197 ALA 197 211 211 ALA ALA A . n 
A 1 198 VAL 198 212 212 VAL VAL A . n 
A 1 199 GLN 199 213 213 GLN GLN A . n 
A 1 200 GLY 200 214 214 GLY GLY A . n 
A 1 201 LEU 201 215 215 LEU LEU A . n 
A 1 202 ASN 202 216 216 ASN ASN A . n 
A 1 203 LEU 203 217 217 LEU LEU A . n 
A 1 204 ARG 204 218 218 ARG ARG A . n 
A 1 205 SER 205 219 219 SER SER A . n 
A 1 206 PRO 206 220 220 PRO PRO A . n 
A 1 207 ASN 207 221 221 ASN ASN A . n 
A 1 208 ASN 208 222 222 ASN ASN A . n 
A 1 209 PHE 209 223 223 PHE PHE A . n 
A 1 210 LEU 210 224 224 LEU LEU A . n 
A 1 211 SER 211 225 225 SER SER A . n 
A 1 212 TYR 212 226 226 TYR TYR A . n 
A 1 213 TYR 213 227 227 TYR TYR A . n 
A 1 214 ARG 214 228 228 ARG ARG A . n 
A 1 215 LEU 215 229 229 LEU LEU A . n 
A 1 216 THR 216 230 230 THR THR A . n 
A 1 217 ARG 217 231 231 ARG ARG A . n 
A 1 218 PHE 218 232 232 PHE PHE A . n 
A 1 219 LEU 219 233 233 LEU LEU A . n 
A 1 220 SER 220 234 234 SER SER A . n 
A 1 221 ARG 221 235 235 ARG ARG A . n 
A 1 222 VAL 222 236 236 VAL VAL A . n 
A 1 223 ILE 223 237 237 ILE ILE A . n 
A 1 224 LYS 224 238 238 LYS LYS A . n 
A 1 225 CYS 225 239 239 CYS CYS A . n 
A 1 226 ASP 226 240 240 ASP ASP A . n 
A 1 227 PRO 227 241 241 PRO PRO A . n 
A 1 228 ASP 228 242 242 ASP ASP A . n 
A 1 229 CYS 229 243 243 CYS CYS A . n 
A 1 230 LEU 230 244 244 LEU LEU A . n 
A 1 231 ARG 231 245 245 ARG ARG A . n 
A 1 232 ALA 232 246 246 ALA ALA A . n 
A 1 233 CYS 233 247 247 CYS CYS A . n 
A 1 234 GLN 234 248 248 GLN GLN A . n 
A 1 235 GLU 235 249 249 GLU GLU A . n 
A 1 236 GLN 236 250 250 GLN GLN A . n 
A 1 237 ILE 237 251 251 ILE ILE A . n 
A 1 238 GLU 238 252 252 GLU GLU A . n 
A 1 239 ALA 239 253 253 ALA ALA A . n 
A 1 240 LEU 240 254 254 LEU LEU A . n 
A 1 241 LEU 241 255 255 LEU LEU A . n 
A 1 242 GLU 242 256 256 GLU GLU A . n 
A 1 243 SER 243 257 257 SER SER A . n 
A 1 244 SER 244 258 258 SER SER A . n 
A 1 245 LEU 245 259 259 LEU LEU A . n 
A 1 246 ARG 246 260 260 ARG ARG A . n 
A 1 247 GLN 247 261 261 GLN GLN A . n 
A 1 248 ALA 248 262 262 ALA ALA A . n 
A 1 249 GLN 249 263 263 GLN GLN A . n 
A 1 250 GLN 250 264 264 GLN GLN A . n 
A 1 251 ASN 251 265 265 ASN ASN A . n 
A 1 252 MET 252 266 266 MET MET A . n 
A 1 253 ASP 253 267 267 ASP ASP A . n 
A 1 254 PRO 254 268 ?   ?   ?   A . n 
A 1 255 LYS 255 269 ?   ?   ?   A . n 
A 1 256 ALA 256 270 ?   ?   ?   A . n 
A 1 257 ALA 257 271 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   ALA 2   2   2   ALA ALA B . n 
B 2 3   THR 3   3   3   THR THR B . n 
B 2 4   SER 4   4   4   SER SER B . n 
B 2 5   ARG 5   5   5   ARG ARG B . n 
B 2 6   TYR 6   6   6   TYR TYR B . n 
B 2 7   GLU 7   7   7   GLU GLU B . n 
B 2 8   PRO 8   8   8   PRO PRO B . n 
B 2 9   VAL 9   9   9   VAL VAL B . n 
B 2 10  ALA 10  10  10  ALA ALA B . n 
B 2 11  GLU 11  11  11  GLU GLU B . n 
B 2 12  ILE 12  12  12  ILE ILE B . n 
B 2 13  GLY 13  13  13  GLY GLY B . n 
B 2 14  VAL 14  14  14  VAL VAL B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  ALA 16  16  16  ALA ALA B . n 
B 2 17  TYR 17  17  17  TYR TYR B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  THR 19  19  19  THR THR B . n 
B 2 20  VAL 20  20  20  VAL VAL B . n 
B 2 21  TYR 21  21  21  TYR TYR B . n 
B 2 22  LYS 22  22  22  LYS LYS B . n 
B 2 23  ALA 23  23  23  ALA ALA B . n 
B 2 24  ARG 24  24  24  ARG ARG B . n 
B 2 25  ASP 25  25  25  ASP ASP B . n 
B 2 26  PRO 26  26  26  PRO PRO B . n 
B 2 27  HIS 27  27  27  HIS HIS B . n 
B 2 28  SER 28  28  28  SER SER B . n 
B 2 29  GLY 29  29  29  GLY GLY B . n 
B 2 30  HIS 30  30  30  HIS HIS B . n 
B 2 31  PHE 31  31  31  PHE PHE B . n 
B 2 32  VAL 32  32  32  VAL VAL B . n 
B 2 33  ALA 33  33  33  ALA ALA B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  LYS 35  35  35  LYS LYS B . n 
B 2 36  SER 36  36  36  SER SER B . n 
B 2 37  VAL 37  37  37  VAL VAL B . n 
B 2 38  ARG 38  38  38  ARG ARG B . n 
B 2 39  VAL 39  39  39  VAL VAL B . n 
B 2 40  PRO 40  40  40  PRO PRO B . n 
B 2 41  ASN 41  41  41  ASN ASN B . n 
B 2 42  GLY 42  42  42  GLY GLY B . n 
B 2 43  GLU 43  43  43  GLU GLU B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  GLY 45  48  48  GLY GLY B . n 
B 2 46  LEU 46  49  49  LEU LEU B . n 
B 2 47  PRO 47  50  50  PRO PRO B . n 
B 2 48  ILE 48  51  51  ILE ILE B . n 
B 2 49  SER 49  52  52  SER SER B . n 
B 2 50  THR 50  53  53  THR THR B . n 
B 2 51  VAL 51  54  54  VAL VAL B . n 
B 2 52  ARG 52  55  55  ARG ARG B . n 
B 2 53  GLU 53  56  56  GLU GLU B . n 
B 2 54  VAL 54  57  57  VAL VAL B . n 
B 2 55  ALA 55  58  58  ALA ALA B . n 
B 2 56  LEU 56  59  59  LEU LEU B . n 
B 2 57  LEU 57  60  60  LEU LEU B . n 
B 2 58  ARG 58  61  61  ARG ARG B . n 
B 2 59  ARG 59  62  62  ARG ARG B . n 
B 2 60  LEU 60  63  63  LEU LEU B . n 
B 2 61  GLU 61  64  64  GLU GLU B . n 
B 2 62  ALA 62  65  65  ALA ALA B . n 
B 2 63  PHE 63  66  66  PHE PHE B . n 
B 2 64  GLU 64  67  67  GLU GLU B . n 
B 2 65  HIS 65  68  68  HIS HIS B . n 
B 2 66  PRO 66  69  69  PRO PRO B . n 
B 2 67  ASN 67  70  70  ASN ASN B . n 
B 2 68  VAL 68  71  71  VAL VAL B . n 
B 2 69  VAL 69  72  72  VAL VAL B . n 
B 2 70  ARG 70  73  73  ARG ARG B . n 
B 2 71  LEU 71  74  74  LEU LEU B . n 
B 2 72  MET 72  75  75  MET MET B . n 
B 2 73  ASP 73  76  76  ASP ASP B . n 
B 2 74  VAL 74  77  77  VAL VAL B . n 
B 2 75  CYS 75  78  78  CYS CYS B . n 
B 2 76  ALA 76  79  79  ALA ALA B . n 
B 2 77  THR 77  80  80  THR THR B . n 
B 2 78  SER 78  81  81  SER SER B . n 
B 2 79  ARG 79  82  82  ARG ARG B . n 
B 2 80  THR 80  83  83  THR THR B . n 
B 2 81  ASP 81  84  84  ASP ASP B . n 
B 2 82  ARG 82  85  85  ARG ARG B . n 
B 2 83  GLU 83  86  86  GLU GLU B . n 
B 2 84  ILE 84  87  87  ILE ILE B . n 
B 2 85  LYS 85  88  88  LYS LYS B . n 
B 2 86  VAL 86  89  89  VAL VAL B . n 
B 2 87  THR 87  90  90  THR THR B . n 
B 2 88  LEU 88  91  91  LEU LEU B . n 
B 2 89  VAL 89  92  92  VAL VAL B . n 
B 2 90  PHE 90  93  93  PHE PHE B . n 
B 2 91  GLU 91  94  94  GLU GLU B . n 
B 2 92  HIS 92  95  95  HIS HIS B . n 
B 2 93  VAL 93  96  96  VAL VAL B . n 
B 2 94  ASP 94  97  97  ASP ASP B . n 
B 2 95  GLN 95  98  98  GLN GLN B . n 
B 2 96  ASP 96  99  99  ASP ASP B . n 
B 2 97  LEU 97  100 100 LEU LEU B . n 
B 2 98  ARG 98  101 101 ARG ARG B . n 
B 2 99  THR 99  102 102 THR THR B . n 
B 2 100 TYR 100 103 103 TYR TYR B . n 
B 2 101 LEU 101 104 104 LEU LEU B . n 
B 2 102 ASP 102 105 105 ASP ASP B . n 
B 2 103 LYS 103 106 106 LYS LYS B . n 
B 2 104 ALA 104 107 107 ALA ALA B . n 
B 2 105 PRO 105 108 108 PRO PRO B . n 
B 2 106 PRO 106 109 109 PRO PRO B . n 
B 2 107 PRO 107 110 110 PRO PRO B . n 
B 2 108 GLY 108 111 111 GLY GLY B . n 
B 2 109 LEU 109 112 112 LEU LEU B . n 
B 2 110 PRO 110 113 113 PRO PRO B . n 
B 2 111 ALA 111 114 114 ALA ALA B . n 
B 2 112 GLU 112 115 115 GLU GLU B . n 
B 2 113 THR 113 116 116 THR THR B . n 
B 2 114 ILE 114 117 117 ILE ILE B . n 
B 2 115 LYS 115 118 118 LYS LYS B . n 
B 2 116 ASP 116 119 119 ASP ASP B . n 
B 2 117 LEU 117 120 120 LEU LEU B . n 
B 2 118 MET 118 121 121 MET MET B . n 
B 2 119 ARG 119 122 122 ARG ARG B . n 
B 2 120 GLN 120 123 123 GLN GLN B . n 
B 2 121 PHE 121 124 124 PHE PHE B . n 
B 2 122 LEU 122 125 125 LEU LEU B . n 
B 2 123 ARG 123 126 126 ARG ARG B . n 
B 2 124 GLY 124 127 127 GLY GLY B . n 
B 2 125 LEU 125 128 128 LEU LEU B . n 
B 2 126 ASP 126 129 129 ASP ASP B . n 
B 2 127 PHE 127 130 130 PHE PHE B . n 
B 2 128 LEU 128 131 131 LEU LEU B . n 
B 2 129 HIS 129 132 132 HIS HIS B . n 
B 2 130 ALA 130 133 133 ALA ALA B . n 
B 2 131 ASN 131 134 134 ASN ASN B . n 
B 2 132 CYS 132 135 135 CYS CYS B . n 
B 2 133 ILE 133 136 136 ILE ILE B . n 
B 2 134 VAL 134 137 137 VAL VAL B . n 
B 2 135 HIS 135 138 138 HIS HIS B . n 
B 2 136 ARG 136 139 139 ARG ARG B . n 
B 2 137 ASP 137 140 140 ASP ASP B . n 
B 2 138 LEU 138 141 141 LEU LEU B . n 
B 2 139 LYS 139 142 142 LYS LYS B . n 
B 2 140 PRO 140 143 143 PRO PRO B . n 
B 2 141 GLU 141 144 144 GLU GLU B . n 
B 2 142 ASN 142 145 145 ASN ASN B . n 
B 2 143 ILE 143 146 146 ILE ILE B . n 
B 2 144 LEU 144 147 147 LEU LEU B . n 
B 2 145 VAL 145 148 148 VAL VAL B . n 
B 2 146 THR 146 149 149 THR THR B . n 
B 2 147 SER 147 150 150 SER SER B . n 
B 2 148 GLY 148 151 151 GLY GLY B . n 
B 2 149 GLY 149 152 152 GLY GLY B . n 
B 2 150 THR 150 153 153 THR THR B . n 
B 2 151 VAL 151 154 154 VAL VAL B . n 
B 2 152 LYS 152 155 155 LYS LYS B . n 
B 2 153 LEU 153 156 156 LEU LEU B . n 
B 2 154 ALA 154 157 157 ALA ALA B . n 
B 2 155 ASP 155 158 158 ASP ASP B . n 
B 2 156 PHE 156 159 159 PHE PHE B . n 
B 2 157 GLY 157 160 160 GLY GLY B . n 
B 2 158 LEU 158 161 161 LEU LEU B . n 
B 2 159 ALA 159 162 162 ALA ALA B . n 
B 2 160 ARG 160 163 163 ARG ARG B . n 
B 2 161 ILE 161 164 164 ILE ILE B . n 
B 2 162 TYR 162 165 165 TYR TYR B . n 
B 2 163 SER 163 166 166 SER SER B . n 
B 2 164 TYR 164 167 167 TYR TYR B . n 
B 2 165 GLN 165 168 168 GLN GLN B . n 
B 2 166 MET 166 169 169 MET MET B . n 
B 2 167 ALA 167 170 170 ALA ALA B . n 
B 2 168 LEU 168 171 171 LEU LEU B . n 
B 2 169 ALA 169 172 172 ALA ALA B . n 
B 2 170 PRO 170 173 173 PRO PRO B . n 
B 2 171 VAL 171 174 174 VAL VAL B . n 
B 2 172 VAL 172 175 175 VAL VAL B . n 
B 2 173 VAL 173 176 176 VAL VAL B . n 
B 2 174 THR 174 177 177 THR THR B . n 
B 2 175 LEU 175 178 178 LEU LEU B . n 
B 2 176 TRP 176 179 179 TRP TRP B . n 
B 2 177 TYR 177 180 180 TYR TYR B . n 
B 2 178 ARG 178 181 181 ARG ARG B . n 
B 2 179 ALA 179 182 182 ALA ALA B . n 
B 2 180 PRO 180 183 183 PRO PRO B . n 
B 2 181 GLU 181 184 184 GLU GLU B . n 
B 2 182 VAL 182 185 185 VAL VAL B . n 
B 2 183 LEU 183 186 186 LEU LEU B . n 
B 2 184 LEU 184 187 187 LEU LEU B . n 
B 2 185 GLN 185 188 188 GLN GLN B . n 
B 2 186 SER 186 189 189 SER SER B . n 
B 2 187 THR 187 190 190 THR THR B . n 
B 2 188 TYR 188 191 191 TYR TYR B . n 
B 2 189 ALA 189 192 192 ALA ALA B . n 
B 2 190 THR 190 193 193 THR THR B . n 
B 2 191 PRO 191 194 194 PRO PRO B . n 
B 2 192 VAL 192 195 195 VAL VAL B . n 
B 2 193 ASP 193 196 196 ASP ASP B . n 
B 2 194 MET 194 197 197 MET MET B . n 
B 2 195 TRP 195 198 198 TRP TRP B . n 
B 2 196 SER 196 199 199 SER SER B . n 
B 2 197 VAL 197 200 200 VAL VAL B . n 
B 2 198 GLY 198 201 201 GLY GLY B . n 
B 2 199 CYS 199 202 202 CYS CYS B . n 
B 2 200 ILE 200 203 203 ILE ILE B . n 
B 2 201 PHE 201 204 204 PHE PHE B . n 
B 2 202 ALA 202 205 205 ALA ALA B . n 
B 2 203 GLU 203 206 206 GLU GLU B . n 
B 2 204 MET 204 207 207 MET MET B . n 
B 2 205 PHE 205 208 208 PHE PHE B . n 
B 2 206 ARG 206 209 209 ARG ARG B . n 
B 2 207 ARG 207 210 210 ARG ARG B . n 
B 2 208 LYS 208 211 211 LYS LYS B . n 
B 2 209 PRO 209 212 212 PRO PRO B . n 
B 2 210 LEU 210 213 213 LEU LEU B . n 
B 2 211 PHE 211 214 214 PHE PHE B . n 
B 2 212 CYS 212 215 215 CYS CYS B . n 
B 2 213 GLY 213 216 216 GLY GLY B . n 
B 2 214 ASN 214 217 217 ASN ASN B . n 
B 2 215 SER 215 218 218 SER SER B . n 
B 2 216 GLU 216 219 219 GLU GLU B . n 
B 2 217 ALA 217 220 220 ALA ALA B . n 
B 2 218 ASP 218 221 221 ASP ASP B . n 
B 2 219 GLN 219 222 222 GLN GLN B . n 
B 2 220 LEU 220 223 223 LEU LEU B . n 
B 2 221 GLY 221 224 224 GLY GLY B . n 
B 2 222 LYS 222 225 225 LYS LYS B . n 
B 2 223 ILE 223 226 226 ILE ILE B . n 
B 2 224 PHE 224 227 227 PHE PHE B . n 
B 2 225 ASP 225 228 228 ASP ASP B . n 
B 2 226 LEU 226 229 229 LEU LEU B . n 
B 2 227 ILE 227 230 230 ILE ILE B . n 
B 2 228 GLY 228 231 231 GLY GLY B . n 
B 2 229 LEU 229 232 232 LEU LEU B . n 
B 2 230 PRO 230 233 233 PRO PRO B . n 
B 2 231 PRO 231 234 234 PRO PRO B . n 
B 2 232 GLU 232 235 235 GLU GLU B . n 
B 2 233 ASP 233 236 236 ASP ASP B . n 
B 2 234 ASP 234 237 237 ASP ASP B . n 
B 2 235 TRP 235 238 238 TRP TRP B . n 
B 2 236 PRO 236 239 239 PRO PRO B . n 
B 2 237 ARG 237 240 240 ARG ARG B . n 
B 2 238 ASP 238 241 ?   ?   ?   B . n 
B 2 239 VAL 239 242 ?   ?   ?   B . n 
B 2 240 SER 240 243 ?   ?   ?   B . n 
B 2 241 LEU 241 244 ?   ?   ?   B . n 
B 2 242 PRO 242 245 245 PRO PRO B . n 
B 2 243 ARG 243 246 246 ARG ARG B . n 
B 2 244 GLY 244 247 247 GLY GLY B . n 
B 2 245 ALA 245 248 248 ALA ALA B . n 
B 2 246 PHE 246 249 249 PHE PHE B . n 
B 2 247 PRO 247 250 250 PRO PRO B . n 
B 2 248 PRO 248 251 251 PRO PRO B . n 
B 2 249 ARG 249 252 252 ARG ARG B . n 
B 2 250 GLY 250 253 253 GLY GLY B . n 
B 2 251 PRO 251 254 254 PRO PRO B . n 
B 2 252 ARG 252 255 255 ARG ARG B . n 
B 2 253 PRO 253 256 256 PRO PRO B . n 
B 2 254 VAL 254 257 257 VAL VAL B . n 
B 2 255 GLN 255 258 258 GLN GLN B . n 
B 2 256 SER 256 259 259 SER SER B . n 
B 2 257 VAL 257 260 260 VAL VAL B . n 
B 2 258 VAL 258 261 261 VAL VAL B . n 
B 2 259 PRO 259 262 262 PRO PRO B . n 
B 2 260 GLU 260 263 263 GLU GLU B . n 
B 2 261 MET 261 264 264 MET MET B . n 
B 2 262 GLU 262 265 265 GLU GLU B . n 
B 2 263 GLU 263 266 266 GLU GLU B . n 
B 2 264 SER 264 267 267 SER SER B . n 
B 2 265 GLY 265 268 268 GLY GLY B . n 
B 2 266 ALA 266 269 269 ALA ALA B . n 
B 2 267 GLN 267 270 270 GLN GLN B . n 
B 2 268 LEU 268 271 271 LEU LEU B . n 
B 2 269 LEU 269 272 272 LEU LEU B . n 
B 2 270 LEU 270 273 273 LEU LEU B . n 
B 2 271 GLU 271 274 274 GLU GLU B . n 
B 2 272 MET 272 275 275 MET MET B . n 
B 2 273 LEU 273 276 276 LEU LEU B . n 
B 2 274 THR 274 277 277 THR THR B . n 
B 2 275 PHE 275 278 278 PHE PHE B . n 
B 2 276 ASN 276 279 279 ASN ASN B . n 
B 2 277 PRO 277 280 280 PRO PRO B . n 
B 2 278 HIS 278 281 281 HIS HIS B . n 
B 2 279 LYS 279 282 282 LYS LYS B . n 
B 2 280 ARG 280 283 283 ARG ARG B . n 
B 2 281 ILE 281 284 284 ILE ILE B . n 
B 2 282 SER 282 285 285 SER SER B . n 
B 2 283 ALA 283 286 286 ALA ALA B . n 
B 2 284 PHE 284 287 287 PHE PHE B . n 
B 2 285 ARG 285 288 288 ARG ARG B . n 
B 2 286 ALA 286 289 289 ALA ALA B . n 
B 2 287 LEU 287 290 290 LEU LEU B . n 
B 2 288 GLN 288 291 291 GLN GLN B . n 
B 2 289 HIS 289 292 292 HIS HIS B . n 
B 2 290 SER 290 293 293 SER SER B . n 
B 2 291 TYR 291 294 294 TYR TYR B . n 
B 2 292 LEU 292 295 295 LEU LEU B . n 
B 2 293 HIS 293 296 ?   ?   ?   B . n 
B 2 294 LYS 294 297 ?   ?   ?   B . n 
B 2 295 ASP 295 298 ?   ?   ?   B . n 
B 2 296 GLU 296 299 ?   ?   ?   B . n 
B 2 297 GLY 297 300 ?   ?   ?   B . n 
B 2 298 ASN 298 301 ?   ?   ?   B . n 
B 2 299 PRO 299 302 ?   ?   ?   B . n 
B 2 300 GLU 300 303 ?   ?   ?   B . n 
B 2 301 HIS 301 304 ?   ?   ?   B . n 
B 2 302 HIS 302 305 ?   ?   ?   B . n 
B 2 303 HIS 303 306 ?   ?   ?   B . n 
B 2 304 HIS 304 307 ?   ?   ?   B . n 
B 2 305 HIS 305 308 ?   ?   ?   B . n 
B 2 306 HIS 306 309 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
C 3 HOH 101 2101 2101 HOH HOH A . 
C 3 HOH 102 2102 2102 HOH HOH A . 
C 3 HOH 103 2103 2103 HOH HOH A . 
C 3 HOH 104 2104 2104 HOH HOH A . 
C 3 HOH 105 2105 2105 HOH HOH A . 
C 3 HOH 106 2106 2106 HOH HOH A . 
C 3 HOH 107 2107 2107 HOH HOH A . 
C 3 HOH 108 2108 2108 HOH HOH A . 
C 3 HOH 109 2109 2109 HOH HOH A . 
C 3 HOH 110 2110 2110 HOH HOH A . 
C 3 HOH 111 2111 2111 HOH HOH A . 
C 3 HOH 112 2112 2112 HOH HOH A . 
C 3 HOH 113 2113 2113 HOH HOH A . 
C 3 HOH 114 2114 2114 HOH HOH A . 
C 3 HOH 115 2115 2115 HOH HOH A . 
C 3 HOH 116 2116 2116 HOH HOH A . 
C 3 HOH 117 2117 2117 HOH HOH A . 
C 3 HOH 118 2118 2118 HOH HOH A . 
C 3 HOH 119 2119 2119 HOH HOH A . 
C 3 HOH 120 2120 2120 HOH HOH A . 
C 3 HOH 121 2121 2121 HOH HOH A . 
C 3 HOH 122 2122 2122 HOH HOH A . 
C 3 HOH 123 2123 2123 HOH HOH A . 
C 3 HOH 124 2124 2124 HOH HOH A . 
C 3 HOH 125 2125 2125 HOH HOH A . 
C 3 HOH 126 2126 2126 HOH HOH A . 
C 3 HOH 127 2127 2127 HOH HOH A . 
C 3 HOH 128 2128 2128 HOH HOH A . 
C 3 HOH 129 2129 2129 HOH HOH A . 
C 3 HOH 130 2130 2130 HOH HOH A . 
C 3 HOH 131 2131 2131 HOH HOH A . 
C 3 HOH 132 2132 2132 HOH HOH A . 
C 3 HOH 133 2133 2133 HOH HOH A . 
C 3 HOH 134 2134 2134 HOH HOH A . 
C 3 HOH 135 2135 2135 HOH HOH A . 
C 3 HOH 136 2136 2136 HOH HOH A . 
C 3 HOH 137 2137 2137 HOH HOH A . 
C 3 HOH 138 2138 2138 HOH HOH A . 
C 3 HOH 139 2139 2139 HOH HOH A . 
C 3 HOH 140 2140 2140 HOH HOH A . 
C 3 HOH 141 2141 2141 HOH HOH A . 
C 3 HOH 142 2142 2142 HOH HOH A . 
C 3 HOH 143 2143 2143 HOH HOH A . 
C 3 HOH 144 2144 2144 HOH HOH A . 
C 3 HOH 145 2145 2145 HOH HOH A . 
C 3 HOH 146 2146 2146 HOH HOH A . 
C 3 HOH 147 2147 2147 HOH HOH A . 
C 3 HOH 148 2148 2148 HOH HOH A . 
C 3 HOH 149 2149 2149 HOH HOH A . 
C 3 HOH 150 2150 2150 HOH HOH A . 
C 3 HOH 151 2151 2151 HOH HOH A . 
C 3 HOH 152 2152 2152 HOH HOH A . 
D 3 HOH 1   2001 2001 HOH HOH B . 
D 3 HOH 2   2002 2002 HOH HOH B . 
D 3 HOH 3   2003 2003 HOH HOH B . 
D 3 HOH 4   2004 2004 HOH HOH B . 
D 3 HOH 5   2005 2005 HOH HOH B . 
D 3 HOH 6   2006 2006 HOH HOH B . 
D 3 HOH 7   2007 2007 HOH HOH B . 
D 3 HOH 8   2008 2008 HOH HOH B . 
D 3 HOH 9   2009 2009 HOH HOH B . 
D 3 HOH 10  2010 2010 HOH HOH B . 
D 3 HOH 11  2011 2011 HOH HOH B . 
D 3 HOH 12  2012 2012 HOH HOH B . 
D 3 HOH 13  2013 2013 HOH HOH B . 
D 3 HOH 14  2014 2014 HOH HOH B . 
D 3 HOH 15  2015 2015 HOH HOH B . 
D 3 HOH 16  2016 2016 HOH HOH B . 
D 3 HOH 17  2017 2017 HOH HOH B . 
D 3 HOH 18  2018 2018 HOH HOH B . 
D 3 HOH 19  2019 2019 HOH HOH B . 
D 3 HOH 20  2020 2020 HOH HOH B . 
D 3 HOH 21  2021 2021 HOH HOH B . 
D 3 HOH 22  2022 2022 HOH HOH B . 
D 3 HOH 23  2023 2023 HOH HOH B . 
D 3 HOH 24  2024 2024 HOH HOH B . 
D 3 HOH 25  2025 2025 HOH HOH B . 
D 3 HOH 26  2026 2026 HOH HOH B . 
D 3 HOH 27  2027 2027 HOH HOH B . 
D 3 HOH 28  2028 2028 HOH HOH B . 
D 3 HOH 29  2029 2029 HOH HOH B . 
D 3 HOH 30  2030 2030 HOH HOH B . 
D 3 HOH 31  2031 2031 HOH HOH B . 
D 3 HOH 32  2032 2032 HOH HOH B . 
D 3 HOH 33  2033 2033 HOH HOH B . 
D 3 HOH 34  2034 2034 HOH HOH B . 
D 3 HOH 35  2035 2035 HOH HOH B . 
D 3 HOH 36  2036 2036 HOH HOH B . 
D 3 HOH 37  2037 2037 HOH HOH B . 
D 3 HOH 38  2038 2038 HOH HOH B . 
D 3 HOH 39  2039 2039 HOH HOH B . 
D 3 HOH 40  2040 2040 HOH HOH B . 
D 3 HOH 41  2041 2041 HOH HOH B . 
D 3 HOH 42  2042 2042 HOH HOH B . 
D 3 HOH 43  2043 2043 HOH HOH B . 
D 3 HOH 44  2044 2044 HOH HOH B . 
D 3 HOH 45  2045 2045 HOH HOH B . 
D 3 HOH 46  2046 2046 HOH HOH B . 
D 3 HOH 47  2047 2047 HOH HOH B . 
D 3 HOH 48  2048 2048 HOH HOH B . 
D 3 HOH 49  2049 2049 HOH HOH B . 
D 3 HOH 50  2050 2050 HOH HOH B . 
D 3 HOH 51  2051 2051 HOH HOH B . 
D 3 HOH 52  2052 2052 HOH HOH B . 
D 3 HOH 53  2053 2053 HOH HOH B . 
D 3 HOH 54  2054 2054 HOH HOH B . 
D 3 HOH 55  2055 2055 HOH HOH B . 
D 3 HOH 56  2056 2056 HOH HOH B . 
D 3 HOH 57  2057 2057 HOH HOH B . 
D 3 HOH 58  2058 2058 HOH HOH B . 
D 3 HOH 59  2059 2059 HOH HOH B . 
D 3 HOH 60  2060 2060 HOH HOH B . 
D 3 HOH 61  2061 2061 HOH HOH B . 
D 3 HOH 62  2062 2062 HOH HOH B . 
D 3 HOH 63  2063 2063 HOH HOH B . 
D 3 HOH 64  2064 2064 HOH HOH B . 
D 3 HOH 65  2065 2065 HOH HOH B . 
D 3 HOH 66  2066 2066 HOH HOH B . 
D 3 HOH 67  2067 2067 HOH HOH B . 
D 3 HOH 68  2068 2068 HOH HOH B . 
D 3 HOH 69  2069 2069 HOH HOH B . 
D 3 HOH 70  2070 2070 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2620  ? 
1 MORE         -16.7 ? 
1 'SSA (A^2)'  30690 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-03-10 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-04-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' Other                       
5 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen       
2 4 'Structure model' pdbx_database_proc   
3 4 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'     
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER-TNT refinement       2.1.1 ? 1 
MOSFLM     'data reduction' .     ? 2 
SCALA      'data scaling'   .     ? 3 
PHASER     phasing          .     ? 4 
# 
_pdbx_entry_details.entry_id             2W9Z 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN B, GLY 43 TO GLU
ENGINEERED RESIDUE IN CHAIN B, GLY 44 TO GLU
ENGINEERED RESIDUE IN CHAIN B, THR 172 TO ALA
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;RESIDUES 15-271 ARE EXPRESSED
MUTATIONS G43E G44E T172A DELETION 45 46 47
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C B PRO 108 ? ? N B PRO 109 ? ? CD B PRO 109 ? ? 104.69 128.40 -23.71 2.10 Y 
2 1 C B LEU 112 ? ? N B PRO 113 ? ? CD B PRO 113 ? ? 101.84 120.60 -18.76 2.20 Y 
3 1 C B LEU 232 ? ? N B PRO 233 ? ? CD B PRO 233 ? ? 115.20 128.40 -13.20 2.10 Y 
4 1 C B TRP 238 ? ? N B PRO 239 ? ? CD B PRO 239 ? ? 92.15  128.40 -36.25 2.10 Y 
5 1 C B PRO 250 ? ? N B PRO 251 ? ? CD B PRO 251 ? ? 113.43 128.40 -14.97 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 170 ? ? -177.94 127.33  
2  1 PHE A 223 ? ? -110.00 71.19   
3  1 GLN A 264 ? ? -57.75  27.12   
4  1 MET A 266 ? ? -101.22 -103.19 
5  1 ARG B 5   ? ? -47.90  -16.40  
6  1 PRO B 8   ? ? -49.45  151.42  
7  1 HIS B 27  ? ? -67.61  1.70    
8  1 LEU B 63  ? ? 177.37  -24.76  
9  1 THR B 83  ? ? -105.30 -114.58 
10 1 ASP B 84  ? ? -155.03 -13.31  
11 1 ARG B 101 ? ? -62.89  -70.03  
12 1 LYS B 106 ? ? -61.04  42.52   
13 1 PRO B 108 ? ? -65.75  15.95   
14 1 PRO B 110 ? ? -66.39  88.46   
15 1 LEU B 112 ? ? 178.76  -179.92 
16 1 ARG B 139 ? ? 80.62   -18.22  
17 1 VAL B 148 ? ? 177.53  106.19  
18 1 VAL B 154 ? ? 61.26   96.52   
19 1 MET B 169 ? ? -67.03  1.94    
20 1 PRO B 173 ? ? -58.39  170.16  
21 1 VAL B 175 ? ? 45.46   -155.55 
22 1 VAL B 176 ? ? 162.76  -163.54 
23 1 THR B 177 ? ? 166.61  46.87   
24 1 LEU B 178 ? ? -48.29  2.32    
25 1 GLN B 188 ? ? -142.63 -99.61  
26 1 SER B 189 ? ? 162.01  47.21   
27 1 TYR B 191 ? ? 50.05   -8.58   
28 1 ALA B 192 ? ? -61.36  -175.67 
29 1 GLU B 206 ? ? -49.53  -17.41  
30 1 ARG B 209 ? ? -104.56 -140.18 
31 1 ARG B 210 ? ? -160.15 61.06   
32 1 LYS B 211 ? ? 167.36  165.91  
33 1 PRO B 212 ? ? -28.93  120.74  
34 1 ASN B 217 ? ? -157.79 -68.89  
35 1 LEU B 223 ? ? -62.96  -72.81  
36 1 GLU B 235 ? ? -53.23  170.31  
37 1 ASP B 237 ? ? -54.32  14.50   
38 1 PRO B 239 ? ? -127.96 -169.03 
39 1 PHE B 249 ? ? -153.23 -156.80 
40 1 PRO B 251 ? ? -51.65  101.49  
41 1 PRO B 254 ? ? -64.84  87.37   
42 1 PRO B 256 ? ? -56.51  170.69  
43 1 VAL B 257 ? ? -58.69  -172.79 
44 1 PRO B 262 ? ? -57.71  -176.43 
45 1 GLU B 265 ? ? -101.37 -169.15 
46 1 GLU B 266 ? ? -45.55  -81.64  
47 1 LEU B 276 ? ? -104.51 51.26   
48 1 LEU B 290 ? ? -62.44  11.19   
49 1 GLN B 291 ? ? -152.12 34.85   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 PHE B 208 ? ? ARG B 209 ? ? 149.70  
2 1 ARG B 209 ? ? ARG B 210 ? ? 149.29  
3 1 ALA B 248 ? ? PHE B 249 ? ? -140.44 
4 1 GLN B 258 ? ? SER B 259 ? ? 147.09  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2015 ? 6.00 . 
2 1 O ? A HOH 2025 ? 6.71 . 
3 1 O ? A HOH 2057 ? 6.20 . 
4 1 O ? B HOH 2011 ? 6.42 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 15  ? A MET 1   
2  1 Y 1 A ALA 16  ? A ALA 2   
3  1 Y 1 A TYR 17  ? A TYR 3   
4  1 Y 1 A PRO 18  ? A PRO 4   
5  1 Y 1 A ASP 19  ? A ASP 5   
6  1 Y 1 A ALA 20  ? A ALA 6   
7  1 Y 1 A ASN 21  ? A ASN 7   
8  1 Y 1 A PRO 268 ? A PRO 254 
9  1 Y 1 A LYS 269 ? A LYS 255 
10 1 Y 1 A ALA 270 ? A ALA 256 
11 1 Y 1 A ALA 271 ? A ALA 257 
12 1 Y 1 B MET 1   ? B MET 1   
13 1 Y 1 B ASP 241 ? B ASP 238 
14 1 Y 1 B VAL 242 ? B VAL 239 
15 1 Y 1 B SER 243 ? B SER 240 
16 1 Y 1 B LEU 244 ? B LEU 241 
17 1 Y 1 B HIS 296 ? B HIS 293 
18 1 Y 1 B LYS 297 ? B LYS 294 
19 1 Y 1 B ASP 298 ? B ASP 295 
20 1 Y 1 B GLU 299 ? B GLU 296 
21 1 Y 1 B GLY 300 ? B GLY 297 
22 1 Y 1 B ASN 301 ? B ASN 298 
23 1 Y 1 B PRO 302 ? B PRO 299 
24 1 Y 1 B GLU 303 ? B GLU 300 
25 1 Y 1 B HIS 304 ? B HIS 301 
26 1 Y 1 B HIS 305 ? B HIS 302 
27 1 Y 1 B HIS 306 ? B HIS 303 
28 1 Y 1 B HIS 307 ? B HIS 304 
29 1 Y 1 B HIS 308 ? B HIS 305 
30 1 Y 1 B HIS 309 ? B HIS 306 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#