data_2X4Y
# 
_entry.id   2X4Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2X4Y         
PDBE  EBI-42623    
WWPDB D_1290042623 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2X35 unspecified 'MOLECULAR BASIS OF HISTONE H3K36ME3 RECOGNITION BY THE PWWP DOMAIN OF BRPF1.' 
PDB 2D9E unspecified 'SOLUTION STRUCTURE OF THE BROMODOMAIN OF PEREGRIN'                            
PDB 2X4X unspecified 'MOLECULAR BASIS OF HISTONE H3K36ME3 RECOGNITION BY THE PWWP DOMAIN OF BRPF1.' 
PDB 2X4W unspecified 'MOLECULAR BASIS OF HISTONE H3K36ME3 RECOGNITION BY THE PWWP DOMAIN OF BRPF1.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2X4Y 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-02 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vezzoli, A.'     1 
'Bonadies, N.'    2 
'Allen, M.D.'     3 
'Freund, S.M.V.'  4 
'Santiveri, C.M.' 5 
'Kvinlaug, B.'    6 
'Huntly, B.J.P.'  7 
'Gottgens, B.'    8 
'Bycroft, M.'     9 
# 
_citation.id                        primary 
_citation.title                     'Molecular Basis of Histone H3K36Me3 Recognition by the Pwwp Domain of Brpf1.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                617 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20400950 
_citation.pdbx_database_id_DOI      10.1038/NSMB.1797 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vezzoli, A.'     1 
primary 'Bonadies, N.'    2 
primary 'Allen, M.D.'     3 
primary 'Freund, S.M.V.'  4 
primary 'Santiveri, C.M.' 5 
primary 'Kvinlaug, B.'    6 
primary 'Huntly, B.J.P.'  7 
primary 'Gottgens, B.'    8 
primary 'Bycroft, M.'     9 
# 
_cell.entry_id           2X4Y 
_cell.length_a           35.757 
_cell.length_b           97.906 
_cell.length_c           102.524 
_cell.angle_alpha        86.80 
_cell.angle_beta         80.96 
_cell.angle_gamma        87.24 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2X4Y 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man PEREGRIN       15249.579 8    ? ? 'BRPF1 PWWP DOMAIN, RESIDUES 1076-1205' ?                              
2 polymer     syn 'HISTONE H3.2' 2330.777  8    ? ? 'RESIDUES 23-43'                        'TRIMETHYLATED AT POSITION 36' 
3 non-polymer syn 'SULFATE ION'  96.063    7    ? ? ?                                       ?                              
4 water       nat water          18.015    1078 ? ? ?                                       ?                              
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'BROMODOMAIN AND PHD FINGER-CONTAINING PROTEIN 1, PROTEIN BR140' 
2 'HUMAN H3 HISTONE, H3/M, H3/O'                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GGSEDEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRT
WQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE
;
;GGSEDEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRT
WQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKVQGE
;
A,C,E,G,I,K,M,O ? 
2 'polypeptide(L)' no yes 'TKAARKSAPATGGV(M3L)KPHRYR' TKAARKSAPATGGVKKPHRYR B,D,F,H,J,L,N,P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   SER n 
1 4   GLU n 
1 5   ASP n 
1 6   GLU n 
1 7   ASP n 
1 8   SER n 
1 9   PRO n 
1 10  LEU n 
1 11  ASP n 
1 12  ALA n 
1 13  LEU n 
1 14  ASP n 
1 15  LEU n 
1 16  VAL n 
1 17  TRP n 
1 18  ALA n 
1 19  LYS n 
1 20  CYS n 
1 21  ARG n 
1 22  GLY n 
1 23  TYR n 
1 24  PRO n 
1 25  SER n 
1 26  TYR n 
1 27  PRO n 
1 28  ALA n 
1 29  LEU n 
1 30  ILE n 
1 31  ILE n 
1 32  ASP n 
1 33  PRO n 
1 34  LYS n 
1 35  MET n 
1 36  PRO n 
1 37  ARG n 
1 38  GLU n 
1 39  GLY n 
1 40  MET n 
1 41  PHE n 
1 42  HIS n 
1 43  HIS n 
1 44  GLY n 
1 45  VAL n 
1 46  PRO n 
1 47  ILE n 
1 48  PRO n 
1 49  VAL n 
1 50  PRO n 
1 51  PRO n 
1 52  LEU n 
1 53  GLU n 
1 54  VAL n 
1 55  LEU n 
1 56  LYS n 
1 57  LEU n 
1 58  GLY n 
1 59  GLU n 
1 60  GLN n 
1 61  MET n 
1 62  THR n 
1 63  GLN n 
1 64  GLU n 
1 65  ALA n 
1 66  ARG n 
1 67  GLU n 
1 68  HIS n 
1 69  LEU n 
1 70  TYR n 
1 71  LEU n 
1 72  VAL n 
1 73  LEU n 
1 74  PHE n 
1 75  PHE n 
1 76  ASP n 
1 77  ASN n 
1 78  LYS n 
1 79  ARG n 
1 80  THR n 
1 81  TRP n 
1 82  GLN n 
1 83  TRP n 
1 84  LEU n 
1 85  PRO n 
1 86  ARG n 
1 87  THR n 
1 88  LYS n 
1 89  LEU n 
1 90  VAL n 
1 91  PRO n 
1 92  LEU n 
1 93  GLY n 
1 94  VAL n 
1 95  ASN n 
1 96  GLN n 
1 97  ASP n 
1 98  LEU n 
1 99  ASP n 
1 100 LYS n 
1 101 GLU n 
1 102 LYS n 
1 103 MET n 
1 104 LEU n 
1 105 GLU n 
1 106 GLY n 
1 107 ARG n 
1 108 LYS n 
1 109 SER n 
1 110 ASN n 
1 111 ILE n 
1 112 ARG n 
1 113 LYS n 
1 114 SER n 
1 115 VAL n 
1 116 GLN n 
1 117 ILE n 
1 118 ALA n 
1 119 TYR n 
1 120 HIS n 
1 121 ARG n 
1 122 ALA n 
1 123 LEU n 
1 124 GLN n 
1 125 HIS n 
1 126 ARG n 
1 127 SER n 
1 128 LYS n 
1 129 VAL n 
1 130 GLN n 
1 131 GLY n 
1 132 GLU n 
2 1   THR n 
2 2   LYS n 
2 3   ALA n 
2 4   ALA n 
2 5   ARG n 
2 6   LYS n 
2 7   SER n 
2 8   ALA n 
2 9   PRO n 
2 10  ALA n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  VAL n 
2 15  M3L n 
2 16  LYS n 
2 17  PRO n 
2 18  HIS n 
2 19  ARG n 
2 20  TYR n 
2 21  ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              C41 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PRSETA 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP BRPF1_HUMAN 1 ? ? P55201 ? 
2 UNP H32_HUMAN   2 ? ? Q71DI3 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2X4Y A 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
2  2 2X4Y B 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
3  1 2X4Y C 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
4  2 2X4Y D 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
5  1 2X4Y E 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
6  2 2X4Y F 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
7  1 2X4Y G 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
8  2 2X4Y H 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
9  1 2X4Y I 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
10 2 2X4Y J 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
11 1 2X4Y K 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
12 2 2X4Y L 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
13 1 2X4Y M 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
14 2 2X4Y N 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
15 1 2X4Y O 3 ? 132 ? P55201 1076 ? 1205 ? 1076 1205 
16 2 2X4Y P 1 ? 21  ? Q71DI3 23   ? 43   ? 22   42   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  2X4Y GLY A 1 ? UNP P55201 ? ? 'expression tag' 1074 1  
1  2X4Y GLY A 2 ? UNP P55201 ? ? 'expression tag' 1075 2  
3  2X4Y GLY C 1 ? UNP P55201 ? ? 'expression tag' 1074 3  
3  2X4Y GLY C 2 ? UNP P55201 ? ? 'expression tag' 1075 4  
5  2X4Y GLY E 1 ? UNP P55201 ? ? 'expression tag' 1074 5  
5  2X4Y GLY E 2 ? UNP P55201 ? ? 'expression tag' 1075 6  
7  2X4Y GLY G 1 ? UNP P55201 ? ? 'expression tag' 1074 7  
7  2X4Y GLY G 2 ? UNP P55201 ? ? 'expression tag' 1075 8  
9  2X4Y GLY I 1 ? UNP P55201 ? ? 'expression tag' 1074 9  
9  2X4Y GLY I 2 ? UNP P55201 ? ? 'expression tag' 1075 10 
11 2X4Y GLY K 1 ? UNP P55201 ? ? 'expression tag' 1074 11 
11 2X4Y GLY K 2 ? UNP P55201 ? ? 'expression tag' 1075 12 
13 2X4Y GLY M 1 ? UNP P55201 ? ? 'expression tag' 1074 13 
13 2X4Y GLY M 2 ? UNP P55201 ? ? 'expression tag' 1075 14 
15 2X4Y GLY O 1 ? UNP P55201 ? ? 'expression tag' 1074 15 
15 2X4Y GLY O 2 ? UNP P55201 ? ? 'expression tag' 1075 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'     ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2X4Y 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_percent_sol   51.08 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '30% PEG4K, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5), 0.01M NACL.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             0.9 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2X4Y 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.85 
_reflns.d_resolution_high            1.70 
_reflns.number_obs                   1418928 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.2 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.40 
_reflns.B_iso_Wilson_estimate        23.91 
_reflns.pdbx_redundancy              2.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.79 
_reflns_shell.percent_possible_all   90.7 
_reflns_shell.Rmerge_I_obs           0.21 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        2.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2X4Y 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     141892 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.771 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    87.99 
_refine.ls_R_factor_obs                          0.1922 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1904 
_refine.ls_R_factor_R_free                       0.2267 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  6576 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               30.37 
_refine.aniso_B[1][1]                            1.8708 
_refine.aniso_B[2][2]                            -0.9367 
_refine.aniso_B[3][3]                            -0.9341 
_refine.aniso_B[1][2]                            1.4010 
_refine.aniso_B[1][3]                            -0.3066 
_refine.aniso_B[2][3]                            -0.6258 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.397 
_refine.solvent_model_param_bsol                 59.898 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'DISORDERED REGIONS WERE MODELED STEREOCHEMICALLY.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.26 
_refine.pdbx_overall_phase_error                 22.94 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8993 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             1078 
_refine_hist.number_atoms_total               10106 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        24.771 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.016  ? ? 9295  'X-RAY DIFFRACTION' ? 
f_angle_d          1.598  ? ? 12592 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.668 ? ? 3628  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.119  ? ? 1320  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.009  ? ? 1609  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.7000 1.7193  7621 0.2594 82.00 0.2913 . . 455 . . 
'X-RAY DIFFRACTION' . 1.7193 1.7395  7733 0.2543 82.00 0.3045 . . 474 . . 
'X-RAY DIFFRACTION' . 1.7395 1.7607  7726 0.2461 82.00 0.2842 . . 462 . . 
'X-RAY DIFFRACTION' . 1.7607 1.7830  7867 0.2397 81.00 0.2751 . . 443 . . 
'X-RAY DIFFRACTION' . 1.7830 1.8065  7854 0.2320 82.00 0.2888 . . 367 . . 
'X-RAY DIFFRACTION' . 1.8065 1.8312  7909 0.2197 83.00 0.2634 . . 390 . . 
'X-RAY DIFFRACTION' . 1.8312 1.8574  8094 0.2205 84.00 0.2769 . . 407 . . 
'X-RAY DIFFRACTION' . 1.8574 1.8851  8105 0.2046 84.00 0.2413 . . 411 . . 
'X-RAY DIFFRACTION' . 1.8851 1.9145  7904 0.1988 84.00 0.2370 . . 376 . . 
'X-RAY DIFFRACTION' . 1.9145 1.9459  8186 0.2039 85.00 0.2488 . . 421 . . 
'X-RAY DIFFRACTION' . 1.9459 1.9795  8259 0.2008 86.00 0.2133 . . 462 . . 
'X-RAY DIFFRACTION' . 1.9795 2.0154  8211 0.2079 86.00 0.2695 . . 376 . . 
'X-RAY DIFFRACTION' . 2.0154 2.0542  8290 0.2026 87.00 0.2588 . . 451 . . 
'X-RAY DIFFRACTION' . 2.0542 2.0961  8499 0.2044 88.00 0.2398 . . 414 . . 
'X-RAY DIFFRACTION' . 2.0961 2.1416  8323 0.2000 88.00 0.2388 . . 435 . . 
'X-RAY DIFFRACTION' . 2.1416 2.1914  8413 0.1859 88.00 0.2408 . . 456 . . 
'X-RAY DIFFRACTION' . 2.1914 2.2462  8631 0.1799 89.00 0.2153 . . 391 . . 
'X-RAY DIFFRACTION' . 2.2462 2.3069  8370 0.1770 89.00 0.2136 . . 431 . . 
'X-RAY DIFFRACTION' . 2.3069 2.3747  8787 0.1891 90.00 0.2251 . . 433 . . 
'X-RAY DIFFRACTION' . 2.3747 2.4513  8499 0.1964 90.00 0.2439 . . 442 . . 
'X-RAY DIFFRACTION' . 2.4513 2.5388  8697 0.1992 91.00 0.2574 . . 459 . . 
'X-RAY DIFFRACTION' . 2.5388 2.6404  8602 0.1985 90.00 0.2479 . . 469 . . 
'X-RAY DIFFRACTION' . 2.6404 2.7604  8740 0.1867 91.00 0.2220 . . 466 . . 
'X-RAY DIFFRACTION' . 2.7604 2.9057  8617 0.1979 91.00 0.2316 . . 481 . . 
'X-RAY DIFFRACTION' . 2.9057 3.0874  8867 0.2026 92.00 0.2550 . . 443 . . 
'X-RAY DIFFRACTION' . 3.0874 3.3253  9091 0.1888 95.00 0.2100 . . 443 . . 
'X-RAY DIFFRACTION' . 3.3253 3.6590  9132 0.1693 95.00 0.2024 . . 440 . . 
'X-RAY DIFFRACTION' . 3.6590 4.1863  9065 0.1548 96.00 0.1782 . . 513 . . 
'X-RAY DIFFRACTION' . 4.1863 5.2659  9168 0.1484 96.00 0.1828 . . 502 . . 
'X-RAY DIFFRACTION' . 5.2659 24.7738 8642 0.2042 90.00 0.2422 . . 439 . . 
# 
_struct.entry_id                  2X4Y 
_struct.title                     'Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.' 
_struct.pdbx_descriptor           'PEREGRIN, HISTONE H3.2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2X4Y 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
'TRANSCRIPTION, METAL-BINDING, ZINC-FINGER, CHROMATIN REGULATOR, TRANSCRIPTION REGULATION, NUCLEOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 1 ? 
J  N N 2 ? 
K  N N 1 ? 
L  N N 2 ? 
M  N N 1 ? 
N  N N 2 ? 
O  N N 1 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
EA N N 4 ? 
FA N N 4 ? 
GA N N 4 ? 
HA N N 4 ? 
IA N N 4 ? 
JA N N 4 ? 
KA N N 4 ? 
LA N N 4 ? 
MA N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 51  ? ARG A 66  ? PRO A 1124 ARG A 1139 1 ? 16 
HELX_P HELX_P2  2  ASN A 95  ? LEU A 104 ? ASN A 1168 LEU A 1177 1 ? 10 
HELX_P HELX_P3  3  LYS A 108 ? GLN A 130 ? LYS A 1181 GLN A 1203 1 ? 23 
HELX_P HELX_P4  4  ALA B 3   ? ALA B 8   ? ALA B 24   ALA B 29   1 ? 6  
HELX_P HELX_P5  5  PRO C 51  ? ARG C 66  ? PRO C 1124 ARG C 1139 1 ? 16 
HELX_P HELX_P6  6  ASN C 95  ? LEU C 104 ? ASN C 1168 LEU C 1177 1 ? 10 
HELX_P HELX_P7  7  LYS C 108 ? GLN C 130 ? LYS C 1181 GLN C 1203 1 ? 23 
HELX_P HELX_P8  8  PRO E 51  ? ARG E 66  ? PRO E 1124 ARG E 1139 1 ? 16 
HELX_P HELX_P9  9  ASN E 95  ? LEU E 104 ? ASN E 1168 LEU E 1177 1 ? 10 
HELX_P HELX_P10 10 LYS E 108 ? GLN E 130 ? LYS E 1181 GLN E 1203 1 ? 23 
HELX_P HELX_P11 11 PRO G 51  ? ARG G 66  ? PRO G 1124 ARG G 1139 1 ? 16 
HELX_P HELX_P12 12 ASN G 95  ? LEU G 104 ? ASN G 1168 LEU G 1177 1 ? 10 
HELX_P HELX_P13 13 LYS G 108 ? GLN G 130 ? LYS G 1181 GLN G 1203 1 ? 23 
HELX_P HELX_P14 14 PRO I 51  ? ARG I 66  ? PRO I 1124 ARG I 1139 1 ? 16 
HELX_P HELX_P15 15 ASN I 95  ? LEU I 104 ? ASN I 1168 LEU I 1177 1 ? 10 
HELX_P HELX_P16 16 LYS I 108 ? GLY I 131 ? LYS I 1181 GLY I 1204 1 ? 24 
HELX_P HELX_P17 17 PRO K 51  ? ARG K 66  ? PRO K 1124 ARG K 1139 1 ? 16 
HELX_P HELX_P18 18 PRO K 85  ? THR K 87  ? PRO K 1158 THR K 1160 5 ? 3  
HELX_P HELX_P19 19 ASN K 95  ? LEU K 104 ? ASN K 1168 LEU K 1177 1 ? 10 
HELX_P HELX_P20 20 LYS K 108 ? GLY K 131 ? LYS K 1181 GLY K 1204 1 ? 24 
HELX_P HELX_P21 21 PRO M 51  ? ARG M 66  ? PRO M 1124 ARG M 1139 1 ? 16 
HELX_P HELX_P22 22 PRO M 85  ? THR M 87  ? PRO M 1158 THR M 1160 5 ? 3  
HELX_P HELX_P23 23 ASN M 95  ? LEU M 104 ? ASN M 1168 LEU M 1177 1 ? 10 
HELX_P HELX_P24 24 LYS M 108 ? GLN M 130 ? LYS M 1181 GLN M 1203 1 ? 23 
HELX_P HELX_P25 25 PRO O 51  ? ARG O 66  ? PRO O 1124 ARG O 1139 1 ? 16 
HELX_P HELX_P26 26 PRO O 85  ? THR O 87  ? PRO O 1158 THR O 1160 5 ? 3  
HELX_P HELX_P27 27 ASN O 95  ? LEU O 104 ? ASN O 1168 LEU O 1177 1 ? 10 
HELX_P HELX_P28 28 LYS O 108 ? LYS O 128 ? LYS O 1181 LYS O 1201 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B VAL 14 C ? ? ? 1_555 B M3L 15 N ? ? B VAL 35 B M3L 36 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale2  covale ? ? B M3L 15 C ? ? ? 1_555 B LYS 16 N ? ? B M3L 36 B LYS 37 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale3  covale ? ? D VAL 14 C ? ? ? 1_555 D M3L 15 N ? ? D VAL 35 D M3L 36 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale4  covale ? ? D M3L 15 C ? ? ? 1_555 D LYS 16 N ? ? D M3L 36 D LYS 37 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale5  covale ? ? F VAL 14 C ? ? ? 1_555 F M3L 15 N ? ? F VAL 35 F M3L 36 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale6  covale ? ? F M3L 15 C ? ? ? 1_555 F LYS 16 N ? ? F M3L 36 F LYS 37 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale7  covale ? ? H VAL 14 C ? ? ? 1_555 H M3L 15 N ? ? H VAL 35 H M3L 36 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale8  covale ? ? H M3L 15 C ? ? ? 1_555 H LYS 16 N ? ? H M3L 36 H LYS 37 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale9  covale ? ? J VAL 14 C ? ? ? 1_555 J M3L 15 N ? ? J VAL 35 J M3L 36 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale10 covale ? ? J M3L 15 C ? ? ? 1_555 J LYS 16 N ? ? J M3L 36 J LYS 37 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale11 covale ? ? L VAL 14 C ? ? ? 1_555 L M3L 15 N ? ? L VAL 35 L M3L 36 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale12 covale ? ? L M3L 15 C ? ? ? 1_555 L LYS 16 N ? ? L M3L 36 L LYS 37 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale13 covale ? ? N VAL 14 C ? ? ? 1_555 N M3L 15 N ? ? N VAL 35 N M3L 36 1_555 ? ? ? ? ? ? ? 1.340 ? 
covale14 covale ? ? N M3L 15 C ? ? ? 1_555 N LYS 16 N ? ? N M3L 36 N LYS 37 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale15 covale ? ? P VAL 14 C ? ? ? 1_555 P M3L 15 N ? ? P VAL 35 P M3L 36 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale16 covale ? ? P M3L 15 C ? ? ? 1_555 P LYS 16 N ? ? P M3L 36 P LYS 37 1_555 ? ? ? ? ? ? ? 1.333 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
CA ? 5 ? 
CB ? 2 ? 
EA ? 5 ? 
EB ? 2 ? 
GA ? 5 ? 
GB ? 2 ? 
IA ? 5 ? 
IB ? 2 ? 
KA ? 5 ? 
KB ? 2 ? 
MA ? 5 ? 
MB ? 2 ? 
OA ? 5 ? 
OB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CA 4 5 ? anti-parallel 
CB 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EA 3 4 ? anti-parallel 
EA 4 5 ? anti-parallel 
EB 1 2 ? anti-parallel 
GA 1 2 ? anti-parallel 
GA 2 3 ? anti-parallel 
GA 3 4 ? anti-parallel 
GA 4 5 ? anti-parallel 
GB 1 2 ? anti-parallel 
IA 1 2 ? anti-parallel 
IA 2 3 ? anti-parallel 
IA 3 4 ? anti-parallel 
IA 4 5 ? anti-parallel 
IB 1 2 ? anti-parallel 
KA 1 2 ? anti-parallel 
KA 2 3 ? anti-parallel 
KA 3 4 ? anti-parallel 
KA 4 5 ? anti-parallel 
KB 1 2 ? anti-parallel 
MA 1 2 ? anti-parallel 
MA 2 3 ? anti-parallel 
MA 3 4 ? anti-parallel 
MA 4 5 ? anti-parallel 
MB 1 2 ? anti-parallel 
OA 1 2 ? anti-parallel 
OA 2 3 ? anti-parallel 
OA 3 4 ? anti-parallel 
OA 4 5 ? anti-parallel 
OB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TRP A 81 ? PRO A 85 ? TRP A 1154 PRO A 1158 
AA 2 LEU A 69 ? PHE A 74 ? LEU A 1142 PHE A 1147 
AA 3 TYR A 26 ? ILE A 31 ? TYR A 1099 ILE A 1104 
AA 4 LEU A 15 ? ALA A 18 ? LEU A 1088 ALA A 1091 
AA 5 LEU A 89 ? PRO A 91 ? LEU A 1162 PRO A 1164 
AB 1 MET A 40 ? HIS A 42 ? MET A 1113 HIS A 1115 
AB 2 VAL A 45 ? ILE A 47 ? VAL A 1118 ILE A 1120 
CA 1 TRP C 81 ? PRO C 85 ? TRP C 1154 PRO C 1158 
CA 2 LEU C 69 ? PHE C 74 ? LEU C 1142 PHE C 1147 
CA 3 TYR C 26 ? ILE C 31 ? TYR C 1099 ILE C 1104 
CA 4 LEU C 15 ? ALA C 18 ? LEU C 1088 ALA C 1091 
CA 5 LEU C 89 ? PRO C 91 ? LEU C 1162 PRO C 1164 
CB 1 PHE C 41 ? HIS C 42 ? PHE C 1114 HIS C 1115 
CB 2 VAL C 45 ? PRO C 46 ? VAL C 1118 PRO C 1119 
EA 1 TRP E 81 ? PRO E 85 ? TRP E 1154 PRO E 1158 
EA 2 LEU E 69 ? PHE E 74 ? LEU E 1142 PHE E 1147 
EA 3 TYR E 26 ? ILE E 31 ? TYR E 1099 ILE E 1104 
EA 4 LEU E 15 ? ALA E 18 ? LEU E 1088 ALA E 1091 
EA 5 LEU E 89 ? PRO E 91 ? LEU E 1162 PRO E 1164 
EB 1 MET E 40 ? HIS E 42 ? MET E 1113 HIS E 1115 
EB 2 VAL E 45 ? ILE E 47 ? VAL E 1118 ILE E 1120 
GA 1 TRP G 81 ? PRO G 85 ? TRP G 1154 PRO G 1158 
GA 2 LEU G 69 ? PHE G 74 ? LEU G 1142 PHE G 1147 
GA 3 TYR G 26 ? ILE G 31 ? TYR G 1099 ILE G 1104 
GA 4 LEU G 15 ? ALA G 18 ? LEU G 1088 ALA G 1091 
GA 5 LEU G 89 ? PRO G 91 ? LEU G 1162 PRO G 1164 
GB 1 MET G 40 ? HIS G 42 ? MET G 1113 HIS G 1115 
GB 2 VAL G 45 ? ILE G 47 ? VAL G 1118 ILE G 1120 
IA 1 TRP I 81 ? PRO I 85 ? TRP I 1154 PRO I 1158 
IA 2 LEU I 69 ? PHE I 74 ? LEU I 1142 PHE I 1147 
IA 3 TYR I 26 ? ILE I 31 ? TYR I 1099 ILE I 1104 
IA 4 LEU I 15 ? ALA I 18 ? LEU I 1088 ALA I 1091 
IA 5 LEU I 89 ? PRO I 91 ? LEU I 1162 PRO I 1164 
IB 1 MET I 40 ? HIS I 42 ? MET I 1113 HIS I 1115 
IB 2 VAL I 45 ? ILE I 47 ? VAL I 1118 ILE I 1120 
KA 1 TRP K 81 ? LEU K 84 ? TRP K 1154 LEU K 1157 
KA 2 TYR K 70 ? PHE K 74 ? TYR K 1143 PHE K 1147 
KA 3 TYR K 26 ? ILE K 31 ? TYR K 1099 ILE K 1104 
KA 4 LEU K 15 ? ALA K 18 ? LEU K 1088 ALA K 1091 
KA 5 LEU K 89 ? PRO K 91 ? LEU K 1162 PRO K 1164 
KB 1 MET K 40 ? HIS K 42 ? MET K 1113 HIS K 1115 
KB 2 VAL K 45 ? ILE K 47 ? VAL K 1118 ILE K 1120 
MA 1 TRP M 81 ? LEU M 84 ? TRP M 1154 LEU M 1157 
MA 2 TYR M 70 ? PHE M 74 ? TYR M 1143 PHE M 1147 
MA 3 TYR M 26 ? ILE M 31 ? TYR M 1099 ILE M 1104 
MA 4 LEU M 15 ? ALA M 18 ? LEU M 1088 ALA M 1091 
MA 5 LEU M 89 ? PRO M 91 ? LEU M 1162 PRO M 1164 
MB 1 MET M 40 ? HIS M 42 ? MET M 1113 HIS M 1115 
MB 2 VAL M 45 ? ILE M 47 ? VAL M 1118 ILE M 1120 
OA 1 TRP O 81 ? LEU O 84 ? TRP O 1154 LEU O 1157 
OA 2 TYR O 70 ? PHE O 74 ? TYR O 1143 PHE O 1147 
OA 3 TYR O 26 ? ILE O 31 ? TYR O 1099 ILE O 1104 
OA 4 LEU O 15 ? ALA O 18 ? LEU O 1088 ALA O 1091 
OA 5 LEU O 89 ? PRO O 91 ? LEU O 1162 PRO O 1164 
OB 1 MET O 40 ? HIS O 42 ? MET O 1113 HIS O 1115 
OB 2 VAL O 45 ? ILE O 47 ? VAL O 1118 ILE O 1120 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 84 ? N LEU A 1157 O TYR A 70 ? O TYR A 1143 
AA 2 3 N LEU A 73 ? N LEU A 1146 O LEU A 29 ? O LEU A 1102 
AA 3 4 N ALA A 28 ? N ALA A 1101 O VAL A 16 ? O VAL A 1089 
AA 4 5 N TRP A 17 ? N TRP A 1090 O VAL A 90 ? O VAL A 1163 
AB 1 2 N HIS A 42 ? N HIS A 1115 O VAL A 45 ? O VAL A 1118 
CA 1 2 N LEU C 84 ? N LEU C 1157 O TYR C 70 ? O TYR C 1143 
CA 2 3 N LEU C 73 ? N LEU C 1146 O LEU C 29 ? O LEU C 1102 
CA 3 4 N ALA C 28 ? N ALA C 1101 O VAL C 16 ? O VAL C 1089 
CA 4 5 N TRP C 17 ? N TRP C 1090 O VAL C 90 ? O VAL C 1163 
CB 1 2 N HIS C 42 ? N HIS C 1115 O VAL C 45 ? O VAL C 1118 
EA 1 2 N LEU E 84 ? N LEU E 1157 O TYR E 70 ? O TYR E 1143 
EA 2 3 N LEU E 73 ? N LEU E 1146 O LEU E 29 ? O LEU E 1102 
EA 3 4 N ALA E 28 ? N ALA E 1101 O VAL E 16 ? O VAL E 1089 
EA 4 5 N TRP E 17 ? N TRP E 1090 O VAL E 90 ? O VAL E 1163 
EB 1 2 N HIS E 42 ? N HIS E 1115 O VAL E 45 ? O VAL E 1118 
GA 1 2 N LEU G 84 ? N LEU G 1157 O TYR G 70 ? O TYR G 1143 
GA 2 3 N LEU G 73 ? N LEU G 1146 O LEU G 29 ? O LEU G 1102 
GA 3 4 N ALA G 28 ? N ALA G 1101 O VAL G 16 ? O VAL G 1089 
GA 4 5 N TRP G 17 ? N TRP G 1090 O VAL G 90 ? O VAL G 1163 
GB 1 2 N HIS G 42 ? N HIS G 1115 O VAL G 45 ? O VAL G 1118 
IA 1 2 N LEU I 84 ? N LEU I 1157 O TYR I 70 ? O TYR I 1143 
IA 2 3 N LEU I 73 ? N LEU I 1146 O LEU I 29 ? O LEU I 1102 
IA 3 4 N ALA I 28 ? N ALA I 1101 O VAL I 16 ? O VAL I 1089 
IA 4 5 N TRP I 17 ? N TRP I 1090 O VAL I 90 ? O VAL I 1163 
IB 1 2 N HIS I 42 ? N HIS I 1115 O VAL I 45 ? O VAL I 1118 
KA 1 2 N LEU K 84 ? N LEU K 1157 O TYR K 70 ? O TYR K 1143 
KA 2 3 N LEU K 73 ? N LEU K 1146 O LEU K 29 ? O LEU K 1102 
KA 3 4 N ALA K 28 ? N ALA K 1101 O VAL K 16 ? O VAL K 1089 
KA 4 5 N TRP K 17 ? N TRP K 1090 O VAL K 90 ? O VAL K 1163 
KB 1 2 N HIS K 42 ? N HIS K 1115 O VAL K 45 ? O VAL K 1118 
MA 1 2 N LEU M 84 ? N LEU M 1157 O TYR M 70 ? O TYR M 1143 
MA 2 3 N LEU M 73 ? N LEU M 1146 O LEU M 29 ? O LEU M 1102 
MA 3 4 N ALA M 28 ? N ALA M 1101 O VAL M 16 ? O VAL M 1089 
MA 4 5 N TRP M 17 ? N TRP M 1090 O VAL M 90 ? O VAL M 1163 
MB 1 2 N HIS M 42 ? N HIS M 1115 O VAL M 45 ? O VAL M 1118 
OA 1 2 N LEU O 84 ? N LEU O 1157 O TYR O 70 ? O TYR O 1143 
OA 2 3 N LEU O 73 ? N LEU O 1146 O LEU O 29 ? O LEU O 1102 
OA 3 4 N ALA O 28 ? N ALA O 1101 O VAL O 16 ? O VAL O 1089 
OA 4 5 N TRP O 17 ? N TRP O 1090 O VAL O 90 ? O VAL O 1163 
OB 1 2 N HIS O 42 ? N HIS O 1115 O VAL O 45 ? O VAL O 1118 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 A 2206' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 G 2204' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 2207' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 2208' 
AC5 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 C 2205' 
AC6 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 E 2206' 
AC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 D 1041' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 ARG A  37  ? ARG A 1110 . ? 1_555 ? 
2  AC1 9 LEU A  52  ? LEU A 1125 . ? 1_555 ? 
3  AC1 9 HOH X  .   ? HOH A 2148 . ? 1_555 ? 
4  AC1 9 HOH X  .   ? HOH A 2149 . ? 1_555 ? 
5  AC1 9 HOH X  .   ? HOH A 2150 . ? 1_555 ? 
6  AC1 9 ARG B  5   ? ARG B 26   . ? 1_555 ? 
7  AC1 9 ARG O  37  ? ARG O 1110 . ? 1_555 ? 
8  AC1 9 LEU O  52  ? LEU O 1125 . ? 1_555 ? 
9  AC1 9 ARG P  5   ? ARG P 26   . ? 1_555 ? 
10 AC2 6 TYR G  26  ? TYR G 1099 . ? 1_555 ? 
11 AC2 6 ASP G  76  ? ASP G 1149 . ? 1_555 ? 
12 AC2 6 ASN G  77  ? ASN G 1150 . ? 1_555 ? 
13 AC2 6 SER G  114 ? SER G 1187 . ? 1_555 ? 
14 AC2 6 HOH DA .   ? HOH G 2114 . ? 1_555 ? 
15 AC2 6 HOH DA .   ? HOH G 2140 . ? 1_555 ? 
16 AC3 6 TYR A  26  ? TYR A 1099 . ? 1_555 ? 
17 AC3 6 ASP A  76  ? ASP A 1149 . ? 1_555 ? 
18 AC3 6 ASN A  77  ? ASN A 1150 . ? 1_555 ? 
19 AC3 6 SER A  114 ? SER A 1187 . ? 1_555 ? 
20 AC3 6 HOH X  .   ? HOH A 2117 . ? 1_555 ? 
21 AC3 6 HOH X  .   ? HOH A 2152 . ? 1_555 ? 
22 AC4 6 LYS A  19  ? LYS A 1092 . ? 1_555 ? 
23 AC4 6 CYS A  20  ? CYS A 1093 . ? 1_555 ? 
24 AC4 6 ARG A  21  ? ARG A 1094 . ? 1_555 ? 
25 AC4 6 LYS A  88  ? LYS A 1161 . ? 1_555 ? 
26 AC4 6 HOH X  .   ? HOH A 2153 . ? 1_555 ? 
27 AC4 6 HOH X  .   ? HOH A 2154 . ? 1_555 ? 
28 AC5 8 TYR C  26  ? TYR C 1099 . ? 1_555 ? 
29 AC5 8 ASP C  76  ? ASP C 1149 . ? 1_555 ? 
30 AC5 8 ASN C  77  ? ASN C 1150 . ? 1_555 ? 
31 AC5 8 SER C  114 ? SER C 1187 . ? 1_555 ? 
32 AC5 8 HOH Z  .   ? HOH C 2109 . ? 1_555 ? 
33 AC5 8 HOH Z  .   ? HOH C 2110 . ? 1_555 ? 
34 AC5 8 HOH Z  .   ? HOH C 2111 . ? 1_555 ? 
35 AC5 8 HOH Z  .   ? HOH C 2113 . ? 1_555 ? 
36 AC6 9 ARG E  37  ? ARG E 1110 . ? 1_555 ? 
37 AC6 9 LEU E  52  ? LEU E 1125 . ? 1_555 ? 
38 AC6 9 HOH BA .   ? HOH E 2163 . ? 1_555 ? 
39 AC6 9 HOH BA .   ? HOH E 2164 . ? 1_555 ? 
40 AC6 9 HOH BA .   ? HOH E 2165 . ? 1_555 ? 
41 AC6 9 HOH BA .   ? HOH E 2166 . ? 1_555 ? 
42 AC6 9 ARG F  5   ? ARG F 26   . ? 1_555 ? 
43 AC6 9 ARG I  37  ? ARG I 1110 . ? 1_645 ? 
44 AC6 9 LEU I  52  ? LEU I 1125 . ? 1_645 ? 
45 AC7 7 HIS C  42  ? HIS C 1115 . ? 1_455 ? 
46 AC7 7 HIS C  43  ? HIS C 1116 . ? 1_455 ? 
47 AC7 7 ARG C  107 ? ARG C 1180 . ? 1_555 ? 
48 AC7 7 LYS C  108 ? LYS C 1181 . ? 1_555 ? 
49 AC7 7 ILE C  111 ? ILE C 1184 . ? 1_555 ? 
50 AC7 7 HIS D  18  ? HIS D 39   . ? 1_555 ? 
51 AC7 7 ARG D  19  ? ARG D 40   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2X4Y 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2X4Y 
_atom_sites.fract_transf_matrix[1][1]   0.027967 
_atom_sites.fract_transf_matrix[1][2]   -0.001348 
_atom_sites.fract_transf_matrix[1][3]   -0.004389 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010226 
_atom_sites.fract_transf_matrix[2][3]   -0.000501 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009888 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLU A  1 6   ? -26.823 -24.373 -31.083 1.00 54.44 ? 1079 GLU A N   1 
ATOM   2     C CA  . GLU A  1 6   ? -25.587 -23.626 -30.846 1.00 54.04 ? 1079 GLU A CA  1 
ATOM   3     C C   . GLU A  1 6   ? -25.832 -22.127 -30.851 1.00 48.76 ? 1079 GLU A C   1 
ATOM   4     O O   . GLU A  1 6   ? -24.916 -21.348 -30.645 1.00 49.64 ? 1079 GLU A O   1 
ATOM   5     C CB  . GLU A  1 6   ? -24.511 -23.953 -31.899 1.00 53.57 ? 1079 GLU A CB  1 
ATOM   6     C CG  . GLU A  1 6   ? -23.149 -23.308 -31.577 1.00 57.24 ? 1079 GLU A CG  1 
ATOM   7     C CD  . GLU A  1 6   ? -22.436 -22.711 -32.787 1.00 64.17 ? 1079 GLU A CD  1 
ATOM   8     O OE1 . GLU A  1 6   ? -21.660 -21.735 -32.604 1.00 60.58 ? 1079 GLU A OE1 1 
ATOM   9     O OE2 . GLU A  1 6   ? -22.645 -23.210 -33.919 1.00 69.27 ? 1079 GLU A OE2 1 
ATOM   10    N N   . ASP A  1 7   ? -27.071 -21.716 -31.094 1.00 52.33 ? 1080 ASP A N   1 
ATOM   11    C CA  . ASP A  1 7   ? -27.354 -20.299 -31.287 1.00 49.45 ? 1080 ASP A CA  1 
ATOM   12    C C   . ASP A  1 7   ? -28.460 -19.784 -30.365 1.00 47.47 ? 1080 ASP A C   1 
ATOM   13    O O   . ASP A  1 7   ? -28.669 -18.570 -30.251 1.00 49.07 ? 1080 ASP A O   1 
ATOM   14    C CB  . ASP A  1 7   ? -27.745 -20.043 -32.748 1.00 56.26 ? 1080 ASP A CB  1 
ATOM   15    C CG  . ASP A  1 7   ? -27.077 -18.802 -33.322 1.00 63.99 ? 1080 ASP A CG  1 
ATOM   16    O OD1 . ASP A  1 7   ? -27.800 -17.903 -33.826 1.00 64.16 ? 1080 ASP A OD1 1 
ATOM   17    O OD2 . ASP A  1 7   ? -25.823 -18.732 -33.263 1.00 68.29 ? 1080 ASP A OD2 1 
ATOM   18    N N   . SER A  1 8   ? -29.176 -20.710 -29.733 1.00 43.67 ? 1081 SER A N   1 
ATOM   19    C CA  . SER A  1 8   ? -30.270 -20.365 -28.831 1.00 48.10 ? 1081 SER A CA  1 
ATOM   20    C C   . SER A  1 8   ? -29.772 -19.521 -27.655 1.00 43.31 ? 1081 SER A C   1 
ATOM   21    O O   . SER A  1 8   ? -28.632 -19.699 -27.195 1.00 37.75 ? 1081 SER A O   1 
ATOM   22    C CB  . SER A  1 8   ? -30.893 -21.645 -28.301 1.00 44.80 ? 1081 SER A CB  1 
ATOM   23    O OG  . SER A  1 8   ? -29.866 -22.552 -27.927 1.00 55.74 ? 1081 SER A OG  1 
ATOM   24    N N   . PRO A  1 9   ? -30.620 -18.592 -27.168 1.00 44.80 ? 1082 PRO A N   1 
ATOM   25    C CA  . PRO A  1 9   ? -30.195 -17.674 -26.104 1.00 41.62 ? 1082 PRO A CA  1 
ATOM   26    C C   . PRO A  1 9   ? -30.025 -18.396 -24.766 1.00 39.39 ? 1082 PRO A C   1 
ATOM   27    O O   . PRO A  1 9   ? -30.709 -19.384 -24.468 1.00 36.59 ? 1082 PRO A O   1 
ATOM   28    C CB  . PRO A  1 9   ? -31.341 -16.647 -26.039 1.00 43.90 ? 1082 PRO A CB  1 
ATOM   29    C CG  . PRO A  1 9   ? -32.121 -16.836 -27.331 1.00 43.66 ? 1082 PRO A CG  1 
ATOM   30    C CD  . PRO A  1 9   ? -32.001 -18.304 -27.600 1.00 45.22 ? 1082 PRO A CD  1 
ATOM   31    N N   . LEU A  1 10  ? -29.064 -17.919 -23.979 1.00 27.81 ? 1083 LEU A N   1 
ATOM   32    C CA  . LEU A  1 10  ? -28.756 -18.567 -22.706 1.00 29.06 ? 1083 LEU A CA  1 
ATOM   33    C C   . LEU A  1 10  ? -29.420 -17.760 -21.599 1.00 27.46 ? 1083 LEU A C   1 
ATOM   34    O O   . LEU A  1 10  ? -29.784 -16.610 -21.795 1.00 29.55 ? 1083 LEU A O   1 
ATOM   35    C CB  . LEU A  1 10  ? -27.241 -18.579 -22.499 1.00 22.16 ? 1083 LEU A CB  1 
ATOM   36    C CG  . LEU A  1 10  ? -26.578 -19.394 -23.595 1.00 20.28 ? 1083 LEU A CG  1 
ATOM   37    C CD1 . LEU A  1 10  ? -25.013 -19.324 -23.402 1.00 23.88 ? 1083 LEU A CD1 1 
ATOM   38    C CD2 . LEU A  1 10  ? -27.038 -20.826 -23.589 1.00 26.68 ? 1083 LEU A CD2 1 
ATOM   39    N N   . ASP A  1 11  ? -29.573 -18.374 -20.431 1.00 25.23 ? 1084 ASP A N   1 
ATOM   40    C CA  . ASP A  1 11  ? -30.199 -17.715 -19.302 1.00 21.32 ? 1084 ASP A CA  1 
ATOM   41    C C   . ASP A  1 11  ? -29.220 -17.371 -18.201 1.00 18.94 ? 1084 ASP A C   1 
ATOM   42    O O   . ASP A  1 11  ? -28.217 -18.071 -18.032 1.00 17.66 ? 1084 ASP A O   1 
ATOM   43    C CB  . ASP A  1 11  ? -31.182 -18.707 -18.685 1.00 26.82 ? 1084 ASP A CB  1 
ATOM   44    C CG  . ASP A  1 11  ? -32.317 -19.038 -19.638 1.00 41.45 ? 1084 ASP A CG  1 
ATOM   45    O OD1 . ASP A  1 11  ? -32.819 -20.183 -19.607 1.00 44.68 ? 1084 ASP A OD1 1 
ATOM   46    O OD2 . ASP A  1 11  ? -32.676 -18.132 -20.428 1.00 43.01 ? 1084 ASP A OD2 1 
ATOM   47    N N   . ALA A  1 12  ? -29.553 -16.332 -17.441 1.00 19.06 ? 1085 ALA A N   1 
ATOM   48    C CA  . ALA A  1 12  ? -28.833 -16.016 -16.236 1.00 14.91 ? 1085 ALA A CA  1 
ATOM   49    C C   . ALA A  1 12  ? -28.787 -17.266 -15.354 1.00 18.64 ? 1085 ALA A C   1 
ATOM   50    O O   . ALA A  1 12  ? -29.760 -18.007 -15.219 1.00 17.93 ? 1085 ALA A O   1 
ATOM   51    C CB  . ALA A  1 12  ? -29.501 -14.920 -15.468 1.00 20.15 ? 1085 ALA A CB  1 
ATOM   52    N N   . LEU A  1 13  ? -27.650 -17.443 -14.719 1.00 14.44 ? 1086 LEU A N   1 
ATOM   53    C CA  . LEU A  1 13  ? -27.397 -18.535 -13.784 1.00 16.05 ? 1086 LEU A CA  1 
ATOM   54    C C   . LEU A  1 13  ? -27.129 -19.897 -14.387 1.00 15.02 ? 1086 LEU A C   1 
ATOM   55    O O   . LEU A  1 13  ? -26.984 -20.855 -13.637 1.00 17.53 ? 1086 LEU A O   1 
ATOM   56    C CB  . LEU A  1 13  ? -28.417 -18.601 -12.642 1.00 16.54 ? 1086 LEU A CB  1 
ATOM   57    C CG  . LEU A  1 13  ? -28.588 -17.288 -11.864 1.00 17.91 ? 1086 LEU A CG  1 
ATOM   58    C CD1 . LEU A  1 13  ? -29.616 -17.458 -10.738 1.00 24.25 ? 1086 LEU A CD1 1 
ATOM   59    C CD2 . LEU A  1 13  ? -27.319 -16.711 -11.272 1.00 19.96 ? 1086 LEU A CD2 1 
ATOM   60    N N   . ASP A  1 14  ? -27.000 -19.986 -15.712 1.00 15.12 ? 1087 ASP A N   1 
ATOM   61    C CA  . ASP A  1 14  ? -26.613 -21.205 -16.381 1.00 15.39 ? 1087 ASP A CA  1 
ATOM   62    C C   . ASP A  1 14  ? -25.075 -21.322 -16.191 1.00 15.30 ? 1087 ASP A C   1 
ATOM   63    O O   . ASP A  1 14  ? -24.359 -20.293 -16.146 1.00 15.85 ? 1087 ASP A O   1 
ATOM   64    C CB  . ASP A  1 14  ? -26.797 -21.078 -17.912 1.00 15.46 ? 1087 ASP A CB  1 
ATOM   65    C CG  . ASP A  1 14  ? -28.221 -21.249 -18.371 1.00 28.59 ? 1087 ASP A CG  1 
ATOM   66    O OD1 . ASP A  1 14  ? -29.050 -21.635 -17.537 1.00 26.83 ? 1087 ASP A OD1 1 
ATOM   67    O OD2 . ASP A  1 14  ? -28.477 -20.962 -19.563 1.00 26.92 ? 1087 ASP A OD2 1 
ATOM   68    N N   . LEU A  1 15  ? -24.610 -22.551 -16.107 1.00 13.11 ? 1088 LEU A N   1 
ATOM   69    C CA  . LEU A  1 15  ? -23.137 -22.798 -16.122 1.00 12.59 ? 1088 LEU A CA  1 
ATOM   70    C C   . LEU A  1 15  ? -22.735 -22.922 -17.571 1.00 9.91  ? 1088 LEU A C   1 
ATOM   71    O O   . LEU A  1 15  ? -23.374 -23.647 -18.379 1.00 12.96 ? 1088 LEU A O   1 
ATOM   72    C CB  . LEU A  1 15  ? -22.818 -24.162 -15.453 1.00 13.98 ? 1088 LEU A CB  1 
ATOM   73    C CG  . LEU A  1 15  ? -23.090 -24.313 -13.945 1.00 14.65 ? 1088 LEU A CG  1 
ATOM   74    C CD1 . LEU A  1 15  ? -22.743 -25.696 -13.404 1.00 17.44 ? 1088 LEU A CD1 1 
ATOM   75    C CD2 . LEU A  1 15  ? -22.454 -23.184 -13.156 1.00 16.28 ? 1088 LEU A CD2 1 
ATOM   76    N N   . VAL A  1 16  ? -21.539 -22.387 -17.897 1.00 11.95 ? 1089 VAL A N   1 
ATOM   77    C CA  . VAL A  1 16  ? -21.119 -22.410 -19.286 1.00 9.94  ? 1089 VAL A CA  1 
ATOM   78    C C   . VAL A  1 16  ? -19.609 -22.582 -19.354 1.00 12.71 ? 1089 VAL A C   1 
ATOM   79    O O   . VAL A  1 16  ? -18.960 -22.245 -18.428 1.00 14.44 ? 1089 VAL A O   1 
ATOM   80    C CB  . VAL A  1 16  ? -21.396 -21.087 -20.023 1.00 12.68 ? 1089 VAL A CB  1 
ATOM   81    C CG1 . VAL A  1 16  ? -22.953 -21.047 -20.374 1.00 15.20 ? 1089 VAL A CG1 1 
ATOM   82    C CG2 . VAL A  1 16  ? -20.910 -19.869 -19.242 1.00 11.38 ? 1089 VAL A CG2 1 
ATOM   83    N N   . TRP A  1 17  ? -19.160 -23.126 -20.467 1.00 12.20 ? 1090 TRP A N   1 
ATOM   84    C CA  . TRP A  1 17  ? -17.707 -23.025 -20.842 1.00 11.19 ? 1090 TRP A CA  1 
ATOM   85    C C   . TRP A  1 17  ? -17.571 -21.689 -21.534 1.00 13.40 ? 1090 TRP A C   1 
ATOM   86    O O   . TRP A  1 17  ? -18.294 -21.452 -22.505 1.00 16.25 ? 1090 TRP A O   1 
ATOM   87    C CB  . TRP A  1 17  ? -17.386 -24.117 -21.847 1.00 11.39 ? 1090 TRP A CB  1 
ATOM   88    C CG  . TRP A  1 17  ? -17.299 -25.471 -21.175 1.00 13.09 ? 1090 TRP A CG  1 
ATOM   89    C CD1 . TRP A  1 17  ? -18.245 -26.492 -21.212 1.00 11.81 ? 1090 TRP A CD1 1 
ATOM   90    C CD2 . TRP A  1 17  ? -16.226 -25.956 -20.398 1.00 12.37 ? 1090 TRP A CD2 1 
ATOM   91    N NE1 . TRP A  1 17  ? -17.822 -27.574 -20.457 1.00 14.04 ? 1090 TRP A NE1 1 
ATOM   92    C CE2 . TRP A  1 17  ? -16.553 -27.277 -19.995 1.00 13.78 ? 1090 TRP A CE2 1 
ATOM   93    C CE3 . TRP A  1 17  ? -14.984 -25.428 -20.032 1.00 14.30 ? 1090 TRP A CE3 1 
ATOM   94    C CZ2 . TRP A  1 17  ? -15.718 -28.051 -19.187 1.00 15.44 ? 1090 TRP A CZ2 1 
ATOM   95    C CZ3 . TRP A  1 17  ? -14.130 -26.230 -19.255 1.00 14.22 ? 1090 TRP A CZ3 1 
ATOM   96    C CH2 . TRP A  1 17  ? -14.497 -27.515 -18.851 1.00 14.43 ? 1090 TRP A CH2 1 
ATOM   97    N N   . ALA A  1 18  ? -16.680 -20.819 -21.052 1.00 12.50 ? 1091 ALA A N   1 
ATOM   98    C CA  . ALA A  1 18  ? -16.626 -19.450 -21.585 1.00 11.71 ? 1091 ALA A CA  1 
ATOM   99    C C   . ALA A  1 18  ? -15.237 -19.273 -22.140 1.00 14.80 ? 1091 ALA A C   1 
ATOM   100   O O   . ALA A  1 18  ? -14.256 -19.481 -21.428 1.00 15.25 ? 1091 ALA A O   1 
ATOM   101   C CB  . ALA A  1 18  ? -16.913 -18.436 -20.467 1.00 12.95 ? 1091 ALA A CB  1 
ATOM   102   N N   . LYS A  1 19  ? -15.153 -18.868 -23.424 1.00 15.67 ? 1092 LYS A N   1 
ATOM   103   C CA  . LYS A  1 19  ? -13.850 -18.783 -24.095 1.00 17.73 ? 1092 LYS A CA  1 
ATOM   104   C C   . LYS A  1 19  ? -13.402 -17.344 -24.246 1.00 20.13 ? 1092 LYS A C   1 
ATOM   105   O O   . LYS A  1 19  ? -14.098 -16.542 -24.903 1.00 18.56 ? 1092 LYS A O   1 
ATOM   106   C CB  . LYS A  1 19  ? -13.930 -19.498 -25.455 1.00 17.59 ? 1092 LYS A CB  1 
ATOM   107   C CG  . LYS A  1 19  ? -12.631 -19.281 -26.323 1.00 21.65 ? 1092 LYS A CG  1 
ATOM   108   C CD  . LYS A  1 19  ? -11.452 -20.102 -25.741 1.00 18.72 ? 1092 LYS A CD  1 
ATOM   109   C CE  . LYS A  1 19  ? -10.201 -20.034 -26.611 1.00 22.84 ? 1092 LYS A CE  1 
ATOM   110   N NZ  . LYS A  1 19  ? -9.652  -18.696 -26.506 1.00 23.82 ? 1092 LYS A NZ  1 
ATOM   111   N N   . CYS A  1 20  ? -12.258 -17.022 -23.610 1.00 19.04 ? 1093 CYS A N   1 
ATOM   112   C CA  . CYS A  1 20  ? -11.605 -15.686 -23.568 1.00 21.36 ? 1093 CYS A CA  1 
ATOM   113   C C   . CYS A  1 20  ? -10.358 -15.720 -24.429 1.00 21.43 ? 1093 CYS A C   1 
ATOM   114   O O   . CYS A  1 20  ? -9.699  -16.711 -24.496 1.00 20.46 ? 1093 CYS A O   1 
ATOM   115   C CB  . CYS A  1 20  ? -11.026 -15.452 -22.161 1.00 29.21 ? 1093 CYS A CB  1 
ATOM   116   S SG  . CYS A  1 20  ? -12.170 -14.873 -21.171 1.00 40.15 ? 1093 CYS A SG  1 
ATOM   117   N N   . ARG A  1 21  ? -9.999  -14.587 -25.039 1.00 25.38 ? 1094 ARG A N   1 
ATOM   118   C CA  . ARG A  1 21  ? -8.855  -14.597 -25.927 1.00 26.11 ? 1094 ARG A CA  1 
ATOM   119   C C   . ARG A  1 21  ? -7.625  -14.959 -25.124 1.00 22.50 ? 1094 ARG A C   1 
ATOM   120   O O   . ARG A  1 21  ? -7.431  -14.443 -24.019 1.00 23.92 ? 1094 ARG A O   1 
ATOM   121   C CB  A ARG A  1 21  ? -8.682  -13.202 -26.524 0.39 28.56 ? 1094 ARG A CB  1 
ATOM   122   C CB  B ARG A  1 21  ? -8.655  -13.216 -26.551 0.61 28.54 ? 1094 ARG A CB  1 
ATOM   123   C CG  A ARG A  1 21  ? -8.539  -12.123 -25.472 0.39 30.82 ? 1094 ARG A CG  1 
ATOM   124   C CG  B ARG A  1 21  ? -7.243  -12.998 -27.114 0.61 28.91 ? 1094 ARG A CG  1 
ATOM   125   C CD  A ARG A  1 21  ? -8.628  -10.738 -26.075 0.39 35.25 ? 1094 ARG A CD  1 
ATOM   126   C CD  B ARG A  1 21  ? -7.164  -11.619 -27.739 0.61 32.74 ? 1094 ARG A CD  1 
ATOM   127   N NE  A ARG A  1 21  ? -7.409  -10.381 -26.793 0.39 34.26 ? 1094 ARG A NE  1 
ATOM   128   N NE  B ARG A  1 21  ? -8.119  -10.725 -27.096 0.61 37.04 ? 1094 ARG A NE  1 
ATOM   129   C CZ  A ARG A  1 21  ? -6.631  -9.360  -26.463 0.39 38.07 ? 1094 ARG A CZ  1 
ATOM   130   C CZ  B ARG A  1 21  ? -7.794  -9.742  -26.265 0.61 36.83 ? 1094 ARG A CZ  1 
ATOM   131   N NH1 A ARG A  1 21  ? -5.548  -9.104  -27.180 0.39 38.69 ? 1094 ARG A NH1 1 
ATOM   132   N NH1 B ARG A  1 21  ? -8.746  -8.985  -25.728 0.61 37.65 ? 1094 ARG A NH1 1 
ATOM   133   N NH2 A ARG A  1 21  ? -6.935  -8.595  -25.417 0.39 35.63 ? 1094 ARG A NH2 1 
ATOM   134   N NH2 B ARG A  1 21  ? -6.523  -9.514  -25.968 0.61 38.98 ? 1094 ARG A NH2 1 
ATOM   135   N N   . GLY A  1 22  ? -6.821  -15.843 -25.678 1.00 23.78 ? 1095 GLY A N   1 
ATOM   136   C CA  . GLY A  1 22  ? -5.582  -16.263 -25.047 1.00 25.27 ? 1095 GLY A CA  1 
ATOM   137   C C   . GLY A  1 22  ? -5.702  -17.242 -23.889 1.00 28.19 ? 1095 GLY A C   1 
ATOM   138   O O   . GLY A  1 22  ? -4.688  -17.626 -23.287 1.00 31.41 ? 1095 GLY A O   1 
ATOM   139   N N   . TYR A  1 23  ? -6.930  -17.637 -23.560 1.00 21.82 ? 1096 TYR A N   1 
ATOM   140   C CA  . TYR A  1 23  ? -7.121  -18.687 -22.542 1.00 21.50 ? 1096 TYR A CA  1 
ATOM   141   C C   . TYR A  1 23  ? -7.977  -19.815 -23.140 1.00 20.35 ? 1096 TYR A C   1 
ATOM   142   O O   . TYR A  1 23  ? -8.713  -19.617 -24.082 1.00 21.70 ? 1096 TYR A O   1 
ATOM   143   C CB  . TYR A  1 23  ? -7.867  -18.135 -21.323 1.00 16.60 ? 1096 TYR A CB  1 
ATOM   144   C CG  . TYR A  1 23  ? -7.133  -17.084 -20.546 1.00 18.78 ? 1096 TYR A CG  1 
ATOM   145   C CD1 . TYR A  1 23  ? -6.103  -17.411 -19.666 1.00 29.89 ? 1096 TYR A CD1 1 
ATOM   146   C CD2 . TYR A  1 23  ? -7.468  -15.768 -20.715 1.00 22.31 ? 1096 TYR A CD2 1 
ATOM   147   C CE1 . TYR A  1 23  ? -5.460  -16.407 -18.937 1.00 23.99 ? 1096 TYR A CE1 1 
ATOM   148   C CE2 . TYR A  1 23  ? -6.854  -14.777 -19.992 1.00 25.30 ? 1096 TYR A CE2 1 
ATOM   149   C CZ  . TYR A  1 23  ? -5.839  -15.123 -19.117 1.00 24.14 ? 1096 TYR A CZ  1 
ATOM   150   O OH  . TYR A  1 23  ? -5.239  -14.069 -18.452 1.00 30.87 ? 1096 TYR A OH  1 
ATOM   151   N N   . PRO A  1 24  ? -7.864  -21.022 -22.598 1.00 20.67 ? 1097 PRO A N   1 
ATOM   152   C CA  . PRO A  1 24  ? -8.724  -22.096 -23.101 1.00 17.12 ? 1097 PRO A CA  1 
ATOM   153   C C   . PRO A  1 24  ? -10.107 -21.889 -22.463 1.00 17.84 ? 1097 PRO A C   1 
ATOM   154   O O   . PRO A  1 24  ? -10.223 -21.103 -21.505 1.00 18.82 ? 1097 PRO A O   1 
ATOM   155   C CB  . PRO A  1 24  ? -8.081  -23.345 -22.512 1.00 21.76 ? 1097 PRO A CB  1 
ATOM   156   C CG  . PRO A  1 24  ? -7.526  -22.837 -21.239 1.00 21.16 ? 1097 PRO A CG  1 
ATOM   157   C CD  . PRO A  1 24  ? -6.902  -21.509 -21.597 1.00 25.29 ? 1097 PRO A CD  1 
ATOM   158   N N   . SER A  1 25  ? -11.097 -22.559 -23.020 1.00 18.21 ? 1098 SER A N   1 
ATOM   159   C CA  . SER A  1 25  ? -12.457 -22.457 -22.465 1.00 18.55 ? 1098 SER A CA  1 
ATOM   160   C C   . SER A  1 25  ? -12.429 -22.747 -20.981 1.00 12.89 ? 1098 SER A C   1 
ATOM   161   O O   . SER A  1 25  ? -11.758 -23.675 -20.531 1.00 13.66 ? 1098 SER A O   1 
ATOM   162   C CB  . SER A  1 25  ? -13.347 -23.526 -23.108 1.00 20.38 ? 1098 SER A CB  1 
ATOM   163   O OG  . SER A  1 25  ? -13.371 -23.405 -24.507 1.00 25.58 ? 1098 SER A OG  1 
ATOM   164   N N   . TYR A  1 26  ? -13.195 -21.973 -20.218 1.00 14.43 ? 1099 TYR A N   1 
ATOM   165   C CA  . TYR A  1 26  ? -13.058 -21.995 -18.760 1.00 14.05 ? 1099 TYR A CA  1 
ATOM   166   C C   . TYR A  1 26  ? -14.452 -21.953 -18.143 1.00 12.51 ? 1099 TYR A C   1 
ATOM   167   O O   . TYR A  1 26  ? -15.280 -21.186 -18.562 1.00 12.57 ? 1099 TYR A O   1 
ATOM   168   C CB  . TYR A  1 26  ? -12.291 -20.752 -18.311 1.00 15.29 ? 1099 TYR A CB  1 
ATOM   169   C CG  . TYR A  1 26  ? -11.623 -20.878 -16.982 1.00 15.01 ? 1099 TYR A CG  1 
ATOM   170   C CD1 . TYR A  1 26  ? -12.343 -20.664 -15.779 1.00 16.14 ? 1099 TYR A CD1 1 
ATOM   171   C CD2 . TYR A  1 26  ? -10.279 -21.261 -16.901 1.00 18.02 ? 1099 TYR A CD2 1 
ATOM   172   C CE1 . TYR A  1 26  ? -11.722 -20.786 -14.531 1.00 15.95 ? 1099 TYR A CE1 1 
ATOM   173   C CE2 . TYR A  1 26  ? -9.656  -21.438 -15.654 1.00 17.80 ? 1099 TYR A CE2 1 
ATOM   174   C CZ  . TYR A  1 26  ? -10.349 -21.157 -14.489 1.00 17.93 ? 1099 TYR A CZ  1 
ATOM   175   O OH  . TYR A  1 26  ? -9.776  -21.284 -13.258 1.00 17.73 ? 1099 TYR A OH  1 
ATOM   176   N N   . PRO A  1 27  ? -14.672 -22.742 -17.077 1.00 10.61 ? 1100 PRO A N   1 
ATOM   177   C CA  . PRO A  1 27  ? -16.025 -22.791 -16.488 1.00 12.24 ? 1100 PRO A CA  1 
ATOM   178   C C   . PRO A  1 27  ? -16.436 -21.444 -15.899 1.00 11.84 ? 1100 PRO A C   1 
ATOM   179   O O   . PRO A  1 27  ? -15.702 -20.727 -15.206 1.00 11.89 ? 1100 PRO A O   1 
ATOM   180   C CB  . PRO A  1 27  ? -15.852 -23.835 -15.349 1.00 10.67 ? 1100 PRO A CB  1 
ATOM   181   C CG  . PRO A  1 27  ? -14.798 -24.801 -15.930 1.00 12.93 ? 1100 PRO A CG  1 
ATOM   182   C CD  . PRO A  1 27  ? -13.785 -23.806 -16.566 1.00 11.72 ? 1100 PRO A CD  1 
ATOM   183   N N   . ALA A  1 28  ? -17.718 -21.106 -16.109 1.00 10.16 ? 1101 ALA A N   1 
ATOM   184   C CA  . ALA A  1 28  ? -18.181 -19.828 -15.574 1.00 11.38 ? 1101 ALA A CA  1 
ATOM   185   C C   . ALA A  1 28  ? -19.699 -19.919 -15.318 1.00 9.90  ? 1101 ALA A C   1 
ATOM   186   O O   . ALA A  1 28  ? -20.336 -20.899 -15.690 1.00 12.48 ? 1101 ALA A O   1 
ATOM   187   C CB  . ALA A  1 28  ? -17.944 -18.726 -16.565 1.00 14.01 ? 1101 ALA A CB  1 
ATOM   188   N N   . LEU A  1 29  ? -20.201 -18.839 -14.747 1.00 11.76 ? 1102 LEU A N   1 
ATOM   189   C CA  . LEU A  1 29  ? -21.652 -18.724 -14.425 1.00 10.41 ? 1102 LEU A CA  1 
ATOM   190   C C   . LEU A  1 29  ? -22.172 -17.511 -15.141 1.00 13.32 ? 1102 LEU A C   1 
ATOM   191   O O   . LEU A  1 29  ? -21.613 -16.439 -14.992 1.00 13.69 ? 1102 LEU A O   1 
ATOM   192   C CB  . LEU A  1 29  ? -21.800 -18.515 -12.909 1.00 12.20 ? 1102 LEU A CB  1 
ATOM   193   C CG  . LEU A  1 29  ? -23.224 -18.396 -12.300 1.00 15.53 ? 1102 LEU A CG  1 
ATOM   194   C CD1 . LEU A  1 29  ? -23.951 -19.664 -12.495 1.00 16.28 ? 1102 LEU A CD1 1 
ATOM   195   C CD2 . LEU A  1 29  ? -23.044 -18.103 -10.807 1.00 15.13 ? 1102 LEU A CD2 1 
ATOM   196   N N   . ILE A  1 30  ? -23.280 -17.657 -15.884 1.00 12.01 ? 1103 ILE A N   1 
ATOM   197   C CA  . ILE A  1 30  ? -23.867 -16.452 -16.481 1.00 11.68 ? 1103 ILE A CA  1 
ATOM   198   C C   . ILE A  1 30  ? -24.552 -15.629 -15.387 1.00 15.70 ? 1103 ILE A C   1 
ATOM   199   O O   . ILE A  1 30  ? -25.329 -16.187 -14.583 1.00 14.95 ? 1103 ILE A O   1 
ATOM   200   C CB  . ILE A  1 30  ? -24.887 -16.815 -17.559 1.00 13.74 ? 1103 ILE A CB  1 
ATOM   201   C CG1 . ILE A  1 30  ? -24.191 -17.605 -18.684 1.00 16.06 ? 1103 ILE A CG1 1 
ATOM   202   C CG2 . ILE A  1 30  ? -25.521 -15.498 -18.181 1.00 14.19 ? 1103 ILE A CG2 1 
ATOM   203   C CD1 . ILE A  1 30  ? -25.041 -17.882 -19.886 1.00 19.75 ? 1103 ILE A CD1 1 
ATOM   204   N N   . ILE A  1 31  ? -24.310 -14.324 -15.382 1.00 14.21 ? 1104 ILE A N   1 
ATOM   205   C CA  . ILE A  1 31  ? -24.861 -13.427 -14.351 1.00 13.12 ? 1104 ILE A CA  1 
ATOM   206   C C   . ILE A  1 31  ? -25.765 -12.415 -15.067 1.00 16.36 ? 1104 ILE A C   1 
ATOM   207   O O   . ILE A  1 31  ? -25.391 -11.881 -16.099 1.00 17.48 ? 1104 ILE A O   1 
ATOM   208   C CB  . ILE A  1 31  ? -23.765 -12.765 -13.542 1.00 15.33 ? 1104 ILE A CB  1 
ATOM   209   C CG1 . ILE A  1 31  ? -22.925 -13.810 -12.798 1.00 18.35 ? 1104 ILE A CG1 1 
ATOM   210   C CG2 . ILE A  1 31  ? -24.311 -11.765 -12.533 1.00 17.84 ? 1104 ILE A CG2 1 
ATOM   211   C CD1 . ILE A  1 31  ? -23.630 -14.479 -11.670 1.00 20.69 ? 1104 ILE A CD1 1 
ATOM   212   N N   . ASP A  1 32  ? -26.962 -12.147 -14.537 1.00 16.06 ? 1105 ASP A N   1 
ATOM   213   C CA  . ASP A  1 32  ? -27.788 -11.050 -15.130 1.00 18.16 ? 1105 ASP A CA  1 
ATOM   214   C C   . ASP A  1 32  ? -27.260 -9.647  -14.751 1.00 16.72 ? 1105 ASP A C   1 
ATOM   215   O O   . ASP A  1 32  ? -27.201 -9.275  -13.571 1.00 18.84 ? 1105 ASP A O   1 
ATOM   216   C CB  . ASP A  1 32  ? -29.223 -11.246 -14.625 1.00 20.66 ? 1105 ASP A CB  1 
ATOM   217   C CG  . ASP A  1 32  ? -30.215 -10.278 -15.233 1.00 25.42 ? 1105 ASP A CG  1 
ATOM   218   O OD1 . ASP A  1 32  ? -29.842 -9.375  -15.998 1.00 23.52 ? 1105 ASP A OD1 1 
ATOM   219   O OD2 . ASP A  1 32  ? -31.408 -10.431 -14.926 1.00 27.56 ? 1105 ASP A OD2 1 
ATOM   220   N N   . PRO A  1 33  ? -26.816 -8.861  -15.749 1.00 15.97 ? 1106 PRO A N   1 
ATOM   221   C CA  . PRO A  1 33  ? -26.314 -7.511  -15.413 1.00 17.38 ? 1106 PRO A CA  1 
ATOM   222   C C   . PRO A  1 33  ? -27.374 -6.671  -14.737 1.00 20.62 ? 1106 PRO A C   1 
ATOM   223   O O   . PRO A  1 33  ? -27.038 -5.723  -14.026 1.00 23.00 ? 1106 PRO A O   1 
ATOM   224   C CB  . PRO A  1 33  ? -26.045 -6.865  -16.777 1.00 21.15 ? 1106 PRO A CB  1 
ATOM   225   C CG  . PRO A  1 33  ? -26.227 -7.918  -17.799 1.00 20.02 ? 1106 PRO A CG  1 
ATOM   226   C CD  . PRO A  1 33  ? -26.799 -9.160  -17.188 1.00 15.66 ? 1106 PRO A CD  1 
ATOM   227   N N   . LYS A  1 34  ? -28.650 -6.991  -15.007 1.00 19.71 ? 1107 LYS A N   1 
ATOM   228   C CA  . LYS A  1 34  ? -29.770 -6.291  -14.374 1.00 23.70 ? 1107 LYS A CA  1 
ATOM   229   C C   . LYS A  1 34  ? -30.296 -6.901  -13.043 1.00 28.99 ? 1107 LYS A C   1 
ATOM   230   O O   . LYS A  1 34  ? -31.397 -6.542  -12.561 1.00 24.49 ? 1107 LYS A O   1 
ATOM   231   C CB  . LYS A  1 34  ? -30.916 -6.195  -15.397 1.00 25.16 ? 1107 LYS A CB  1 
ATOM   232   C CG  . LYS A  1 34  ? -30.496 -5.417  -16.650 1.00 27.20 ? 1107 LYS A CG  1 
ATOM   233   C CD  . LYS A  1 34  ? -29.693 -4.146  -16.247 1.00 35.44 ? 1107 LYS A CD  1 
ATOM   234   C CE  . LYS A  1 34  ? -29.835 -3.013  -17.268 1.00 45.25 ? 1107 LYS A CE  1 
ATOM   235   N NZ  . LYS A  1 34  ? -29.476 -1.666  -16.705 1.00 47.73 ? 1107 LYS A NZ  1 
ATOM   236   N N   . MET A  1 35  ? -29.525 -7.811  -12.443 1.00 21.27 ? 1108 MET A N   1 
ATOM   237   C CA  . MET A  1 35  ? -29.882 -8.345  -11.126 1.00 25.22 ? 1108 MET A CA  1 
ATOM   238   C C   . MET A  1 35  ? -29.959 -7.226  -10.091 1.00 25.99 ? 1108 MET A C   1 
ATOM   239   O O   . MET A  1 35  ? -29.321 -6.189  -10.229 1.00 24.19 ? 1108 MET A O   1 
ATOM   240   C CB  . MET A  1 35  ? -28.915 -9.446  -10.664 1.00 25.98 ? 1108 MET A CB  1 
ATOM   241   C CG  . MET A  1 35  ? -27.523 -8.958  -10.364 1.00 23.35 ? 1108 MET A CG  1 
ATOM   242   S SD  . MET A  1 35  ? -26.500 -10.346 -9.767  1.00 24.24 ? 1108 MET A SD  1 
ATOM   243   C CE  . MET A  1 35  ? -27.163 -10.598 -8.120  1.00 24.97 ? 1108 MET A CE  1 
ATOM   244   N N   . PRO A  1 36  ? -30.818 -7.402  -9.093  1.00 25.14 ? 1109 PRO A N   1 
ATOM   245   C CA  . PRO A  1 36  ? -30.934 -6.384  -8.033  1.00 28.90 ? 1109 PRO A CA  1 
ATOM   246   C C   . PRO A  1 36  ? -29.587 -5.990  -7.458  1.00 29.68 ? 1109 PRO A C   1 
ATOM   247   O O   . PRO A  1 36  ? -28.754 -6.851  -7.145  1.00 26.39 ? 1109 PRO A O   1 
ATOM   248   C CB  . PRO A  1 36  ? -31.759 -7.092  -6.954  1.00 32.75 ? 1109 PRO A CB  1 
ATOM   249   C CG  . PRO A  1 36  ? -32.561 -8.117  -7.728  1.00 30.70 ? 1109 PRO A CG  1 
ATOM   250   C CD  . PRO A  1 36  ? -31.731 -8.541  -8.894  1.00 28.64 ? 1109 PRO A CD  1 
ATOM   251   N N   . ARG A  1 37  ? -29.393 -4.684  -7.272  1.00 25.62 ? 1110 ARG A N   1 
ATOM   252   C CA  . ARG A  1 37  ? -28.157 -4.185  -6.701  1.00 28.69 ? 1110 ARG A CA  1 
ATOM   253   C C   . ARG A  1 37  ? -28.048 -4.569  -5.236  1.00 24.65 ? 1110 ARG A C   1 
ATOM   254   O O   . ARG A  1 37  ? -26.963 -4.545  -4.687  1.00 29.19 ? 1110 ARG A O   1 
ATOM   255   C CB  . ARG A  1 37  ? -28.062 -2.653  -6.883  1.00 27.43 ? 1110 ARG A CB  1 
ATOM   256   C CG  . ARG A  1 37  ? -28.339 -2.227  -8.337  1.00 30.04 ? 1110 ARG A CG  1 
ATOM   257   C CD  . ARG A  1 37  ? -27.304 -2.783  -9.316  1.00 26.89 ? 1110 ARG A CD  1 
ATOM   258   N NE  . ARG A  1 37  ? -25.956 -2.553  -8.799  1.00 24.30 ? 1110 ARG A NE  1 
ATOM   259   C CZ  . ARG A  1 37  ? -24.855 -3.187  -9.185  1.00 26.72 ? 1110 ARG A CZ  1 
ATOM   260   N NH1 . ARG A  1 37  ? -23.681 -2.865  -8.652  1.00 25.89 ? 1110 ARG A NH1 1 
ATOM   261   N NH2 . ARG A  1 37  ? -24.932 -4.138  -10.108 1.00 24.37 ? 1110 ARG A NH2 1 
ATOM   262   N N   . GLU A  1 38  ? -29.156 -4.953  -4.600  1.00 26.34 ? 1111 GLU A N   1 
ATOM   263   C CA  . GLU A  1 38  ? -29.081 -5.354  -3.202  1.00 32.21 ? 1111 GLU A CA  1 
ATOM   264   C C   . GLU A  1 38  ? -28.737 -6.843  -3.076  1.00 30.02 ? 1111 GLU A C   1 
ATOM   265   O O   . GLU A  1 38  ? -28.646 -7.414  -1.970  1.00 30.66 ? 1111 GLU A O   1 
ATOM   266   C CB  . GLU A  1 38  ? -30.399 -5.031  -2.487  1.00 38.63 ? 1111 GLU A CB  1 
ATOM   267   C CG  . GLU A  1 38  ? -31.640 -5.552  -3.216  1.00 41.94 ? 1111 GLU A CG  1 
ATOM   268   C CD  . GLU A  1 38  ? -32.199 -4.595  -4.307  1.00 47.62 ? 1111 GLU A CD  1 
ATOM   269   O OE1 . GLU A  1 38  ? -33.378 -4.799  -4.705  1.00 49.88 ? 1111 GLU A OE1 1 
ATOM   270   O OE2 . GLU A  1 38  ? -31.483 -3.655  -4.768  1.00 40.12 ? 1111 GLU A OE2 1 
ATOM   271   N N   . GLY A  1 39  ? -28.563 -7.479  -4.233  1.00 24.49 ? 1112 GLY A N   1 
ATOM   272   C CA  . GLY A  1 39  ? -28.202 -8.888  -4.262  1.00 25.94 ? 1112 GLY A CA  1 
ATOM   273   C C   . GLY A  1 39  ? -29.402 -9.822  -4.427  1.00 31.31 ? 1112 GLY A C   1 
ATOM   274   O O   . GLY A  1 39  ? -30.554 -9.390  -4.547  1.00 29.03 ? 1112 GLY A O   1 
ATOM   275   N N   . MET A  1 40  ? -29.138 -11.124 -4.443  1.00 25.22 ? 1113 MET A N   1 
ATOM   276   C CA  . MET A  1 40  ? -30.211 -12.104 -4.573  1.00 22.80 ? 1113 MET A CA  1 
ATOM   277   C C   . MET A  1 40  ? -29.699 -13.485 -4.224  1.00 26.57 ? 1113 MET A C   1 
ATOM   278   O O   . MET A  1 40  ? -28.506 -13.754 -4.335  1.00 24.56 ? 1113 MET A O   1 
ATOM   279   C CB  . MET A  1 40  ? -30.830 -12.164 -5.960  1.00 32.76 ? 1113 MET A CB  1 
ATOM   280   C CG  . MET A  1 40  ? -29.811 -12.269 -7.037  1.00 35.84 ? 1113 MET A CG  1 
ATOM   281   S SD  . MET A  1 40  ? -30.486 -13.047 -8.516  1.00 49.38 ? 1113 MET A SD  1 
ATOM   282   C CE  . MET A  1 40  ? -30.484 -14.741 -7.943  1.00 29.16 ? 1113 MET A CE  1 
ATOM   283   N N   . PHE A  1 41  ? -30.605 -14.324 -3.741  1.00 28.05 ? 1114 PHE A N   1 
ATOM   284   C CA  . PHE A  1 41  ? -30.319 -15.747 -3.482  1.00 24.47 ? 1114 PHE A CA  1 
ATOM   285   C C   . PHE A  1 41  ? -30.945 -16.626 -4.561  1.00 27.49 ? 1114 PHE A C   1 
ATOM   286   O O   . PHE A  1 41  ? -32.108 -16.410 -4.929  1.00 32.82 ? 1114 PHE A O   1 
ATOM   287   C CB  . PHE A  1 41  ? -30.892 -16.135 -2.120  1.00 29.50 ? 1114 PHE A CB  1 
ATOM   288   C CG  . PHE A  1 41  ? -30.231 -15.456 -0.972  1.00 29.35 ? 1114 PHE A CG  1 
ATOM   289   C CD1 . PHE A  1 41  ? -30.828 -14.367 -0.334  1.00 34.29 ? 1114 PHE A CD1 1 
ATOM   290   C CD2 . PHE A  1 41  ? -28.997 -15.894 -0.508  1.00 28.70 ? 1114 PHE A CD2 1 
ATOM   291   C CE1 . PHE A  1 41  ? -30.208 -13.736 0.734   1.00 34.78 ? 1114 PHE A CE1 1 
ATOM   292   C CE2 . PHE A  1 41  ? -28.370 -15.260 0.563   1.00 34.74 ? 1114 PHE A CE2 1 
ATOM   293   C CZ  . PHE A  1 41  ? -28.972 -14.173 1.180   1.00 38.54 ? 1114 PHE A CZ  1 
ATOM   294   N N   . HIS A  1 42  ? -30.220 -17.621 -5.068  1.00 22.66 ? 1115 HIS A N   1 
ATOM   295   C CA  . HIS A  1 42  ? -30.768 -18.560 -6.071  1.00 22.61 ? 1115 HIS A CA  1 
ATOM   296   C C   . HIS A  1 42  ? -30.956 -19.795 -5.224  1.00 22.68 ? 1115 HIS A C   1 
ATOM   297   O O   . HIS A  1 42  ? -29.970 -20.408 -4.855  1.00 22.11 ? 1115 HIS A O   1 
ATOM   298   C CB  . HIS A  1 42  ? -29.723 -18.821 -7.181  1.00 26.13 ? 1115 HIS A CB  1 
ATOM   299   C CG  . HIS A  1 42  ? -30.174 -19.738 -8.291  1.00 24.93 ? 1115 HIS A CG  1 
ATOM   300   N ND1 . HIS A  1 42  ? -31.503 -19.975 -8.573  1.00 28.21 ? 1115 HIS A ND1 1 
ATOM   301   C CD2 . HIS A  1 42  ? -29.467 -20.368 -9.270  1.00 20.80 ? 1115 HIS A CD2 1 
ATOM   302   C CE1 . HIS A  1 42  ? -31.591 -20.768 -9.628  1.00 23.94 ? 1115 HIS A CE1 1 
ATOM   303   N NE2 . HIS A  1 42  ? -30.372 -21.015 -10.071 1.00 32.73 ? 1115 HIS A NE2 1 
ATOM   304   N N   . HIS A  1 43  ? -32.207 -20.134 -4.862  1.00 21.82 ? 1116 HIS A N   1 
ATOM   305   C CA  . HIS A  1 43  ? -32.458 -21.224 -3.881  1.00 20.14 ? 1116 HIS A CA  1 
ATOM   306   C C   . HIS A  1 43  ? -31.516 -21.178 -2.694  1.00 23.90 ? 1116 HIS A C   1 
ATOM   307   O O   . HIS A  1 43  ? -30.903 -22.148 -2.308  1.00 23.80 ? 1116 HIS A O   1 
ATOM   308   C CB  . HIS A  1 43  ? -32.471 -22.584 -4.564  1.00 20.46 ? 1116 HIS A CB  1 
ATOM   309   C CG  . HIS A  1 43  ? -33.406 -22.647 -5.730  1.00 20.38 ? 1116 HIS A CG  1 
ATOM   310   N ND1 . HIS A  1 43  ? -34.780 -22.579 -5.579  1.00 23.47 ? 1116 HIS A ND1 1 
ATOM   311   C CD2 . HIS A  1 43  ? -33.175 -22.756 -7.061  1.00 23.77 ? 1116 HIS A CD2 1 
ATOM   312   C CE1 . HIS A  1 43  ? -35.347 -22.641 -6.773  1.00 23.58 ? 1116 HIS A CE1 1 
ATOM   313   N NE2 . HIS A  1 43  ? -34.405 -22.762 -7.690  1.00 28.66 ? 1116 HIS A NE2 1 
ATOM   314   N N   . GLY A  1 44  ? -31.415 -20.001 -2.102  1.00 21.28 ? 1117 GLY A N   1 
ATOM   315   C CA  . GLY A  1 44  ? -30.603 -19.820 -0.922  1.00 24.12 ? 1117 GLY A CA  1 
ATOM   316   C C   . GLY A  1 44  ? -29.119 -19.565 -1.127  1.00 25.62 ? 1117 GLY A C   1 
ATOM   317   O O   . GLY A  1 44  ? -28.417 -19.319 -0.172  1.00 24.13 ? 1117 GLY A O   1 
ATOM   318   N N   . VAL A  1 45  ? -28.646 -19.626 -2.368  1.00 21.25 ? 1118 VAL A N   1 
ATOM   319   C CA  . VAL A  1 45  ? -27.206 -19.439 -2.666  1.00 21.08 ? 1118 VAL A CA  1 
ATOM   320   C C   . VAL A  1 45  ? -27.002 -17.999 -3.123  1.00 21.24 ? 1118 VAL A C   1 
ATOM   321   O O   . VAL A  1 45  ? -27.624 -17.556 -4.094  1.00 20.82 ? 1118 VAL A O   1 
ATOM   322   C CB  . VAL A  1 45  ? -26.754 -20.404 -3.805  1.00 18.65 ? 1118 VAL A CB  1 
ATOM   323   C CG1 . VAL A  1 45  ? -25.306 -20.162 -4.189  1.00 23.73 ? 1118 VAL A CG1 1 
ATOM   324   C CG2 . VAL A  1 45  ? -26.958 -21.850 -3.405  1.00 23.66 ? 1118 VAL A CG2 1 
ATOM   325   N N   . PRO A  1 46  ? -26.190 -17.226 -2.397  1.00 21.50 ? 1119 PRO A N   1 
ATOM   326   C CA  . PRO A  1 46  ? -26.120 -15.807 -2.795  1.00 22.28 ? 1119 PRO A CA  1 
ATOM   327   C C   . PRO A  1 46  ? -25.286 -15.637 -4.075  1.00 23.22 ? 1119 PRO A C   1 
ATOM   328   O O   . PRO A  1 46  ? -24.201 -16.211 -4.200  1.00 24.71 ? 1119 PRO A O   1 
ATOM   329   C CB  . PRO A  1 46  ? -25.392 -15.135 -1.636  1.00 23.32 ? 1119 PRO A CB  1 
ATOM   330   C CG  . PRO A  1 46  ? -24.648 -16.268 -0.915  1.00 24.79 ? 1119 PRO A CG  1 
ATOM   331   C CD  . PRO A  1 46  ? -25.231 -17.588 -1.345  1.00 25.08 ? 1119 PRO A CD  1 
ATOM   332   N N   . ILE A  1 47  ? -25.766 -14.790 -4.974  1.00 18.82 ? 1120 ILE A N   1 
ATOM   333   C CA  . ILE A  1 47  ? -25.131 -14.645 -6.275  1.00 17.90 ? 1120 ILE A CA  1 
ATOM   334   C C   . ILE A  1 47  ? -24.379 -13.301 -6.257  1.00 17.59 ? 1120 ILE A C   1 
ATOM   335   O O   . ILE A  1 47  ? -24.961 -12.259 -5.907  1.00 19.01 ? 1120 ILE A O   1 
ATOM   336   C CB  . ILE A  1 47  ? -26.226 -14.637 -7.362  1.00 21.42 ? 1120 ILE A CB  1 
ATOM   337   C CG1 . ILE A  1 47  ? -26.983 -15.991 -7.392  1.00 18.14 ? 1120 ILE A CG1 1 
ATOM   338   C CG2 . ILE A  1 47  ? -25.625 -14.341 -8.722  1.00 20.08 ? 1120 ILE A CG2 1 
ATOM   339   C CD1 . ILE A  1 47  ? -26.054 -17.260 -7.474  1.00 19.71 ? 1120 ILE A CD1 1 
ATOM   340   N N   . PRO A  1 48  ? -23.056 -13.302 -6.625  1.00 18.31 ? 1121 PRO A N   1 
ATOM   341   C CA  . PRO A  1 48  ? -22.322 -12.041 -6.582  1.00 18.00 ? 1121 PRO A CA  1 
ATOM   342   C C   . PRO A  1 48  ? -22.892 -10.957 -7.472  1.00 18.70 ? 1121 PRO A C   1 
ATOM   343   O O   . PRO A  1 48  ? -23.240 -11.230 -8.610  1.00 19.70 ? 1121 PRO A O   1 
ATOM   344   C CB  . PRO A  1 48  ? -20.906 -12.419 -7.116  1.00 20.69 ? 1121 PRO A CB  1 
ATOM   345   C CG  . PRO A  1 48  ? -20.781 -13.934 -6.774  1.00 20.17 ? 1121 PRO A CG  1 
ATOM   346   C CD  . PRO A  1 48  ? -22.206 -14.461 -6.932  1.00 19.17 ? 1121 PRO A CD  1 
ATOM   347   N N   . VAL A  1 49  ? -22.938 -9.728  -6.961  1.00 19.74 ? 1122 VAL A N   1 
ATOM   348   C CA  . VAL A  1 49  ? -23.444 -8.581  -7.722  1.00 20.12 ? 1122 VAL A CA  1 
ATOM   349   C C   . VAL A  1 49  ? -22.310 -7.990  -8.545  1.00 21.73 ? 1122 VAL A C   1 
ATOM   350   O O   . VAL A  1 49  ? -21.245 -7.714  -8.001  1.00 22.25 ? 1122 VAL A O   1 
ATOM   351   C CB  . VAL A  1 49  ? -23.959 -7.519  -6.757  1.00 20.84 ? 1122 VAL A CB  1 
ATOM   352   C CG1 . VAL A  1 49  ? -24.364 -6.233  -7.516  1.00 20.86 ? 1122 VAL A CG1 1 
ATOM   353   C CG2 . VAL A  1 49  ? -25.116 -8.121  -5.957  1.00 22.35 ? 1122 VAL A CG2 1 
ATOM   354   N N   . PRO A  1 50  ? -22.534 -7.784  -9.853  1.00 21.08 ? 1123 PRO A N   1 
ATOM   355   C CA  . PRO A  1 50  ? -21.461 -7.199  -10.674 1.00 19.91 ? 1123 PRO A CA  1 
ATOM   356   C C   . PRO A  1 50  ? -21.219 -5.751  -10.232 1.00 23.75 ? 1123 PRO A C   1 
ATOM   357   O O   . PRO A  1 50  ? -22.174 -4.995  -10.015 1.00 23.43 ? 1123 PRO A O   1 
ATOM   358   C CB  . PRO A  1 50  ? -22.059 -7.114  -12.059 1.00 19.52 ? 1123 PRO A CB  1 
ATOM   359   C CG  . PRO A  1 50  ? -23.452 -7.696  -11.999 1.00 26.84 ? 1123 PRO A CG  1 
ATOM   360   C CD  . PRO A  1 50  ? -23.802 -7.986  -10.586 1.00 21.66 ? 1123 PRO A CD  1 
ATOM   361   N N   . PRO A  1 51  ? -19.952 -5.390  -10.100 1.00 23.91 ? 1124 PRO A N   1 
ATOM   362   C CA  . PRO A  1 51  ? -19.546 -4.027  -9.733  1.00 26.29 ? 1124 PRO A CA  1 
ATOM   363   C C   . PRO A  1 51  ? -19.958 -3.065  -10.845 1.00 23.49 ? 1124 PRO A C   1 
ATOM   364   O O   . PRO A  1 51  ? -20.024 -3.444  -12.035 1.00 22.58 ? 1124 PRO A O   1 
ATOM   365   C CB  . PRO A  1 51  ? -18.031 -4.130  -9.666  1.00 27.46 ? 1124 PRO A CB  1 
ATOM   366   C CG  . PRO A  1 51  ? -17.748 -5.598  -9.458  1.00 30.28 ? 1124 PRO A CG  1 
ATOM   367   C CD  . PRO A  1 51  ? -18.851 -6.366  -10.067 1.00 23.32 ? 1124 PRO A CD  1 
ATOM   368   N N   . LEU A  1 52  ? -20.221 -1.820  -10.467 1.00 26.30 ? 1125 LEU A N   1 
ATOM   369   C CA  . LEU A  1 52  ? -20.656 -0.818  -11.426 1.00 26.76 ? 1125 LEU A CA  1 
ATOM   370   C C   . LEU A  1 52  ? -19.678 -0.659  -12.565 1.00 25.25 ? 1125 LEU A C   1 
ATOM   371   O O   . LEU A  1 52  ? -20.072 -0.497  -13.744 1.00 25.29 ? 1125 LEU A O   1 
ATOM   372   C CB  . LEU A  1 52  ? -20.829 0.526   -10.696 1.00 27.25 ? 1125 LEU A CB  1 
ATOM   373   C CG  . LEU A  1 52  ? -22.044 0.535   -9.763  1.00 32.64 ? 1125 LEU A CG  1 
ATOM   374   C CD1 . LEU A  1 52  ? -22.089 1.863   -9.002  1.00 36.93 ? 1125 LEU A CD1 1 
ATOM   375   C CD2 . LEU A  1 52  ? -23.324 0.348   -10.565 1.00 32.93 ? 1125 LEU A CD2 1 
ATOM   376   N N   . GLU A  1 53  ? -18.402 -0.750  -12.230 1.00 27.39 ? 1126 GLU A N   1 
ATOM   377   C CA  . GLU A  1 53  ? -17.328 -0.650  -13.196 1.00 29.99 ? 1126 GLU A CA  1 
ATOM   378   C C   . GLU A  1 53  ? -17.406 -1.767  -14.256 1.00 28.34 ? 1126 GLU A C   1 
ATOM   379   O O   . GLU A  1 53  ? -17.176 -1.557  -15.451 1.00 26.79 ? 1126 GLU A O   1 
ATOM   380   C CB  . GLU A  1 53  ? -16.009 -0.737  -12.445 1.00 38.03 ? 1126 GLU A CB  1 
ATOM   381   C CG  . GLU A  1 53  ? -14.748 -0.685  -13.290 1.00 45.94 ? 1126 GLU A CG  1 
ATOM   382   C CD  . GLU A  1 53  ? -13.478 -0.624  -12.421 1.00 60.02 ? 1126 GLU A CD  1 
ATOM   383   O OE1 . GLU A  1 53  ? -12.386 -0.271  -12.941 1.00 71.58 ? 1126 GLU A OE1 1 
ATOM   384   O OE2 . GLU A  1 53  ? -13.575 -0.920  -11.208 1.00 61.30 ? 1126 GLU A OE2 1 
ATOM   385   N N   . VAL A  1 54  ? -17.771 -2.960  -13.802 1.00 25.81 ? 1127 VAL A N   1 
ATOM   386   C CA  . VAL A  1 54  ? -17.936 -4.077  -14.711 1.00 22.34 ? 1127 VAL A CA  1 
ATOM   387   C C   . VAL A  1 54  ? -19.109 -3.826  -15.677 1.00 22.23 ? 1127 VAL A C   1 
ATOM   388   O O   . VAL A  1 54  ? -19.023 -4.132  -16.892 1.00 23.45 ? 1127 VAL A O   1 
ATOM   389   C CB  . VAL A  1 54  ? -18.139 -5.389  -13.924 1.00 24.42 ? 1127 VAL A CB  1 
ATOM   390   C CG1 . VAL A  1 54  ? -18.641 -6.489  -14.886 1.00 20.05 ? 1127 VAL A CG1 1 
ATOM   391   C CG2 . VAL A  1 54  ? -16.855 -5.760  -13.203 1.00 26.00 ? 1127 VAL A CG2 1 
ATOM   392   N N   . LEU A  1 55  ? -20.210 -3.318  -15.145 1.00 22.64 ? 1128 LEU A N   1 
ATOM   393   C CA  . LEU A  1 55  ? -21.383 -2.978  -15.951 1.00 21.93 ? 1128 LEU A CA  1 
ATOM   394   C C   . LEU A  1 55  ? -21.040 -1.913  -17.008 1.00 23.22 ? 1128 LEU A C   1 
ATOM   395   O O   . LEU A  1 55  ? -21.447 -2.011  -18.156 1.00 24.05 ? 1128 LEU A O   1 
ATOM   396   C CB  . LEU A  1 55  ? -22.527 -2.529  -15.068 1.00 23.33 ? 1128 LEU A CB  1 
ATOM   397   C CG  . LEU A  1 55  ? -23.071 -3.599  -14.110 1.00 21.60 ? 1128 LEU A CG  1 
ATOM   398   C CD1 . LEU A  1 55  ? -24.234 -3.086  -13.307 1.00 25.45 ? 1128 LEU A CD1 1 
ATOM   399   C CD2 . LEU A  1 55  ? -23.453 -4.850  -14.977 1.00 20.72 ? 1128 LEU A CD2 1 
ATOM   400   N N   . LYS A  1 56  ? -20.208 -0.970  -16.609 1.00 26.14 ? 1129 LYS A N   1 
ATOM   401   C CA  . LYS A  1 56  ? -19.812 0.129   -17.511 1.00 31.46 ? 1129 LYS A CA  1 
ATOM   402   C C   . LYS A  1 56  ? -18.988 -0.410  -18.676 1.00 29.68 ? 1129 LYS A C   1 
ATOM   403   O O   . LYS A  1 56  ? -19.201 -0.005  -19.826 1.00 27.90 ? 1129 LYS A O   1 
ATOM   404   C CB  . LYS A  1 56  ? -19.065 1.230   -16.720 1.00 30.67 ? 1129 LYS A CB  1 
ATOM   405   C CG  . LYS A  1 56  ? -18.416 2.349   -17.567 1.00 40.10 ? 1129 LYS A CG  1 
ATOM   406   C CD  . LYS A  1 56  ? -17.927 3.456   -16.601 1.00 45.81 ? 1129 LYS A CD  1 
ATOM   407   C CE  . LYS A  1 56  ? -17.353 4.697   -17.286 1.00 45.02 ? 1129 LYS A CE  1 
ATOM   408   N NZ  . LYS A  1 56  ? -17.152 5.793   -16.264 1.00 47.50 ? 1129 LYS A NZ  1 
ATOM   409   N N   . LEU A  1 57  ? -18.072 -1.330  -18.391 1.00 24.10 ? 1130 LEU A N   1 
ATOM   410   C CA  . LEU A  1 57  ? -17.270 -1.954  -19.419 1.00 27.54 ? 1130 LEU A CA  1 
ATOM   411   C C   . LEU A  1 57  ? -18.182 -2.692  -20.401 1.00 25.80 ? 1130 LEU A C   1 
ATOM   412   O O   . LEU A  1 57  ? -17.931 -2.724  -21.618 1.00 26.76 ? 1130 LEU A O   1 
ATOM   413   C CB  . LEU A  1 57  ? -16.312 -2.928  -18.755 1.00 29.04 ? 1130 LEU A CB  1 
ATOM   414   C CG  . LEU A  1 57  ? -15.023 -3.277  -19.462 1.00 35.68 ? 1130 LEU A CG  1 
ATOM   415   C CD1 . LEU A  1 57  ? -14.742 -4.757  -19.240 1.00 33.96 ? 1130 LEU A CD1 1 
ATOM   416   C CD2 . LEU A  1 57  ? -15.098 -2.958  -20.919 1.00 35.39 ? 1130 LEU A CD2 1 
ATOM   417   N N   . GLY A  1 58  ? -19.251 -3.308  -19.884 1.00 22.53 ? 1131 GLY A N   1 
ATOM   418   C CA  . GLY A  1 58  ? -20.103 -4.088  -20.765 1.00 22.32 ? 1131 GLY A CA  1 
ATOM   419   C C   . GLY A  1 58  ? -20.835 -3.228  -21.769 1.00 25.52 ? 1131 GLY A C   1 
ATOM   420   O O   . GLY A  1 58  ? -20.966 -3.595  -22.926 1.00 24.95 ? 1131 GLY A O   1 
ATOM   421   N N   . GLU A  1 59  ? -21.310 -2.087  -21.297 1.00 24.63 ? 1132 GLU A N   1 
ATOM   422   C CA  . GLU A  1 59  ? -22.003 -1.116  -22.165 1.00 26.37 ? 1132 GLU A CA  1 
ATOM   423   C C   . GLU A  1 59  ? -21.004 -0.720  -23.250 1.00 27.60 ? 1132 GLU A C   1 
ATOM   424   O O   . GLU A  1 59  ? -21.299 -0.758  -24.447 1.00 29.23 ? 1132 GLU A O   1 
ATOM   425   C CB  . GLU A  1 59  ? -22.384 0.113   -21.342 1.00 28.50 ? 1132 GLU A CB  1 
ATOM   426   C CG  . GLU A  1 59  ? -22.700 1.344   -22.195 1.00 36.07 ? 1132 GLU A CG  1 
ATOM   427   C CD  . GLU A  1 59  ? -22.468 2.688   -21.457 1.00 52.72 ? 1132 GLU A CD  1 
ATOM   428   O OE1 . GLU A  1 59  ? -23.336 3.599   -21.584 1.00 57.74 ? 1132 GLU A OE1 1 
ATOM   429   O OE2 . GLU A  1 59  ? -21.417 2.833   -20.760 1.00 54.34 ? 1132 GLU A OE2 1 
ATOM   430   N N   . GLN A  1 60  ? -19.801 -0.376  -22.836 1.00 25.36 ? 1133 GLN A N   1 
ATOM   431   C CA  . GLN A  1 60  ? -18.783 0.013   -23.825 1.00 29.86 ? 1133 GLN A CA  1 
ATOM   432   C C   . GLN A  1 60  ? -18.455 -1.080  -24.828 1.00 28.96 ? 1133 GLN A C   1 
ATOM   433   O O   . GLN A  1 60  ? -18.421 -0.879  -26.058 1.00 26.57 ? 1133 GLN A O   1 
ATOM   434   C CB  . GLN A  1 60  ? -17.527 0.478   -23.103 1.00 30.69 ? 1133 GLN A CB  1 
ATOM   435   C CG  . GLN A  1 60  ? -17.787 1.682   -22.177 1.00 36.26 ? 1133 GLN A CG  1 
ATOM   436   C CD  . GLN A  1 60  ? -16.560 2.061   -21.342 1.00 40.89 ? 1133 GLN A CD  1 
ATOM   437   O OE1 . GLN A  1 60  ? -16.460 3.182   -20.818 1.00 44.14 ? 1133 GLN A OE1 1 
ATOM   438   N NE2 . GLN A  1 60  ? -15.623 1.127   -21.218 1.00 36.92 ? 1133 GLN A NE2 1 
ATOM   439   N N   . MET A  1 61  ? -18.206 -2.267  -24.321 1.00 25.78 ? 1134 MET A N   1 
ATOM   440   C CA  . MET A  1 61  ? -17.928 -3.381  -25.210 1.00 23.37 ? 1134 MET A CA  1 
ATOM   441   C C   . MET A  1 61  ? -19.079 -3.703  -26.157 1.00 24.22 ? 1134 MET A C   1 
ATOM   442   O O   . MET A  1 61  ? -18.874 -4.110  -27.284 1.00 25.19 ? 1134 MET A O   1 
ATOM   443   C CB  . MET A  1 61  ? -17.549 -4.601  -24.368 1.00 23.80 ? 1134 MET A CB  1 
ATOM   444   C CG  . MET A  1 61  ? -16.124 -4.511  -23.812 1.00 28.10 ? 1134 MET A CG  1 
ATOM   445   S SD  . MET A  1 61  ? -15.809 -5.873  -22.635 1.00 28.19 ? 1134 MET A SD  1 
ATOM   446   C CE  . MET A  1 61  ? -15.581 -7.235  -23.729 1.00 26.11 ? 1134 MET A CE  1 
ATOM   447   N N   . THR A  1 62  ? -20.315 -3.560  -25.693 1.00 21.61 ? 1135 THR A N   1 
ATOM   448   C CA  . THR A  1 62  ? -21.439 -3.982  -26.487 1.00 21.32 ? 1135 THR A CA  1 
ATOM   449   C C   . THR A  1 62  ? -21.587 -2.976  -27.638 1.00 25.75 ? 1135 THR A C   1 
ATOM   450   O O   . THR A  1 62  ? -21.883 -3.368  -28.768 1.00 25.15 ? 1135 THR A O   1 
ATOM   451   C CB  . THR A  1 62  ? -22.754 -3.990  -25.622 1.00 24.33 ? 1135 THR A CB  1 
ATOM   452   O OG1 . THR A  1 62  ? -22.680 -5.050  -24.658 1.00 24.32 ? 1135 THR A OG1 1 
ATOM   453   C CG2 . THR A  1 62  ? -24.005 -4.177  -26.508 1.00 26.12 ? 1135 THR A CG2 1 
ATOM   454   N N   . GLN A  1 63  ? -21.415 -1.701  -27.321 1.00 26.55 ? 1136 GLN A N   1 
ATOM   455   C CA  . GLN A  1 63  ? -21.589 -0.665  -28.358 1.00 27.53 ? 1136 GLN A CA  1 
ATOM   456   C C   . GLN A  1 63  ? -20.484 -0.760  -29.414 1.00 31.09 ? 1136 GLN A C   1 
ATOM   457   O O   . GLN A  1 63  ? -20.728 -0.477  -30.587 1.00 35.90 ? 1136 GLN A O   1 
ATOM   458   C CB  . GLN A  1 63  ? -21.697 0.739   -27.736 1.00 35.48 ? 1136 GLN A CB  1 
ATOM   459   C CG  . GLN A  1 63  ? -20.415 1.233   -27.093 1.00 38.60 ? 1136 GLN A CG  1 
ATOM   460   C CD  . GLN A  1 63  ? -20.489 2.708   -26.602 1.00 49.91 ? 1136 GLN A CD  1 
ATOM   461   O OE1 . GLN A  1 63  ? -19.636 3.541   -26.958 1.00 51.87 ? 1136 GLN A OE1 1 
ATOM   462   N NE2 . GLN A  1 63  ? -21.502 3.020   -25.781 1.00 42.92 ? 1136 GLN A NE2 1 
ATOM   463   N N   . GLU A  1 64  ? -19.287 -1.185  -29.028 1.00 30.34 ? 1137 GLU A N   1 
ATOM   464   C CA  . GLU A  1 64  ? -18.232 -1.375  -30.032 1.00 33.37 ? 1137 GLU A CA  1 
ATOM   465   C C   . GLU A  1 64  ? -18.353 -2.637  -30.876 1.00 34.84 ? 1137 GLU A C   1 
ATOM   466   O O   . GLU A  1 64  ? -18.026 -2.619  -32.063 1.00 31.67 ? 1137 GLU A O   1 
ATOM   467   C CB  . GLU A  1 64  ? -16.816 -1.272  -29.462 1.00 36.29 ? 1137 GLU A CB  1 
ATOM   468   C CG  . GLU A  1 64  ? -16.593 -1.877  -28.116 1.00 40.88 ? 1137 GLU A CG  1 
ATOM   469   C CD  . GLU A  1 64  ? -15.178 -1.625  -27.605 1.00 46.29 ? 1137 GLU A CD  1 
ATOM   470   O OE1 . GLU A  1 64  ? -14.525 -2.605  -27.162 1.00 53.70 ? 1137 GLU A OE1 1 
ATOM   471   O OE2 . GLU A  1 64  ? -14.719 -0.457  -27.666 1.00 48.75 ? 1137 GLU A OE2 1 
ATOM   472   N N   . ALA A  1 65  ? -18.819 -3.726  -30.274 1.00 26.58 ? 1138 ALA A N   1 
ATOM   473   C CA  . ALA A  1 65  ? -18.948 -4.979  -30.970 1.00 24.04 ? 1138 ALA A CA  1 
ATOM   474   C C   . ALA A  1 65  ? -20.224 -5.001  -31.801 1.00 25.02 ? 1138 ALA A C   1 
ATOM   475   O O   . ALA A  1 65  ? -20.356 -5.762  -32.786 1.00 28.08 ? 1138 ALA A O   1 
ATOM   476   C CB  . ALA A  1 65  ? -18.951 -6.123  -29.980 1.00 27.54 ? 1138 ALA A CB  1 
ATOM   477   N N   . ARG A  1 66  ? -21.150 -4.143  -31.412 1.00 24.32 ? 1139 ARG A N   1 
ATOM   478   C CA  . ARG A  1 66  ? -22.489 -4.183  -31.998 1.00 26.09 ? 1139 ARG A CA  1 
ATOM   479   C C   . ARG A  1 66  ? -22.955 -5.624  -32.020 1.00 24.61 ? 1139 ARG A C   1 
ATOM   480   O O   . ARG A  1 66  ? -23.457 -6.148  -33.036 1.00 22.96 ? 1139 ARG A O   1 
ATOM   481   C CB  . ARG A  1 66  ? -22.503 -3.547  -33.412 1.00 22.20 ? 1139 ARG A CB  1 
ATOM   482   C CG  . ARG A  1 66  ? -22.508 -1.984  -33.443 1.00 32.21 ? 1139 ARG A CG  1 
ATOM   483   C CD  . ARG A  1 66  ? -21.074 -1.432  -33.482 1.00 37.65 ? 1139 ARG A CD  1 
ATOM   484   N NE  . ARG A  1 66  ? -20.570 -1.443  -34.833 1.00 37.80 ? 1139 ARG A NE  1 
ATOM   485   C CZ  . ARG A  1 66  ? -20.258 -0.344  -35.529 1.00 37.25 ? 1139 ARG A CZ  1 
ATOM   486   N NH1 . ARG A  1 66  ? -19.836 -0.456  -36.769 1.00 42.05 ? 1139 ARG A NH1 1 
ATOM   487   N NH2 . ARG A  1 66  ? -20.339 0.861   -34.978 1.00 43.32 ? 1139 ARG A NH2 1 
ATOM   488   N N   . GLU A  1 67  ? -22.786 -6.287  -30.864 1.00 21.22 ? 1140 GLU A N   1 
ATOM   489   C CA  . GLU A  1 67  ? -23.306 -7.644  -30.691 1.00 22.14 ? 1140 GLU A CA  1 
ATOM   490   C C   . GLU A  1 67  ? -23.594 -7.822  -29.192 1.00 18.74 ? 1140 GLU A C   1 
ATOM   491   O O   . GLU A  1 67  ? -23.038 -7.159  -28.329 1.00 21.96 ? 1140 GLU A O   1 
ATOM   492   C CB  . GLU A  1 67  ? -22.399 -8.738  -31.284 1.00 32.47 ? 1140 GLU A CB  1 
ATOM   493   C CG  . GLU A  1 67  ? -21.266 -9.269  -30.413 1.00 35.82 ? 1140 GLU A CG  1 
ATOM   494   C CD  . GLU A  1 67  ? -20.380 -10.304 -31.162 1.00 36.57 ? 1140 GLU A CD  1 
ATOM   495   O OE1 . GLU A  1 67  ? -19.164 -10.049 -31.279 1.00 43.35 ? 1140 GLU A OE1 1 
ATOM   496   O OE2 . GLU A  1 67  ? -20.895 -11.342 -31.655 1.00 41.55 ? 1140 GLU A OE2 1 
ATOM   497   N N   . HIS A  1 68  ? -24.582 -8.645  -28.929 1.00 25.00 ? 1141 HIS A N   1 
ATOM   498   C CA  . HIS A  1 68  ? -25.028 -8.834  -27.553 1.00 20.30 ? 1141 HIS A CA  1 
ATOM   499   C C   . HIS A  1 68  ? -23.953 -9.621  -26.771 1.00 18.35 ? 1141 HIS A C   1 
ATOM   500   O O   . HIS A  1 68  ? -23.439 -10.627 -27.272 1.00 21.99 ? 1141 HIS A O   1 
ATOM   501   C CB  . HIS A  1 68  ? -26.348 -9.613  -27.560 1.00 21.57 ? 1141 HIS A CB  1 
ATOM   502   C CG  . HIS A  1 68  ? -26.781 -10.004 -26.190 1.00 22.22 ? 1141 HIS A CG  1 
ATOM   503   N ND1 . HIS A  1 68  ? -26.387 -11.193 -25.598 1.00 26.50 ? 1141 HIS A ND1 1 
ATOM   504   C CD2 . HIS A  1 68  ? -27.451 -9.303  -25.244 1.00 26.34 ? 1141 HIS A CD2 1 
ATOM   505   C CE1 . HIS A  1 68  ? -26.851 -11.225 -24.353 1.00 21.22 ? 1141 HIS A CE1 1 
ATOM   506   N NE2 . HIS A  1 68  ? -27.490 -10.084 -24.111 1.00 23.68 ? 1141 HIS A NE2 1 
ATOM   507   N N   . LEU A  1 69  ? -23.632 -9.134  -25.575 1.00 17.29 ? 1142 LEU A N   1 
ATOM   508   C CA  . LEU A  1 69  ? -22.678 -9.826  -24.746 1.00 19.09 ? 1142 LEU A CA  1 
ATOM   509   C C   . LEU A  1 69  ? -23.311 -10.312 -23.468 1.00 16.81 ? 1142 LEU A C   1 
ATOM   510   O O   . LEU A  1 69  ? -23.973 -9.557  -22.750 1.00 19.11 ? 1142 LEU A O   1 
ATOM   511   C CB  . LEU A  1 69  ? -21.510 -8.924  -24.420 1.00 19.44 ? 1142 LEU A CB  1 
ATOM   512   C CG  . LEU A  1 69  ? -20.838 -8.317  -25.673 1.00 17.73 ? 1142 LEU A CG  1 
ATOM   513   C CD1 . LEU A  1 69  ? -19.742 -7.285  -25.213 1.00 22.08 ? 1142 LEU A CD1 1 
ATOM   514   C CD2 . LEU A  1 69  ? -20.266 -9.406  -26.492 1.00 19.81 ? 1142 LEU A CD2 1 
ATOM   515   N N   . TYR A  1 70  ? -22.977 -11.571 -23.127 1.00 14.93 ? 1143 TYR A N   1 
ATOM   516   C CA  . TYR A  1 70  ? -23.331 -12.048 -21.814 1.00 13.29 ? 1143 TYR A CA  1 
ATOM   517   C C   . TYR A  1 70  ? -22.312 -11.733 -20.754 1.00 17.13 ? 1143 TYR A C   1 
ATOM   518   O O   . TYR A  1 70  ? -21.098 -11.734 -21.056 1.00 16.74 ? 1143 TYR A O   1 
ATOM   519   C CB  . TYR A  1 70  ? -23.488 -13.569 -21.877 1.00 12.42 ? 1143 TYR A CB  1 
ATOM   520   C CG  . TYR A  1 70  ? -24.662 -14.045 -22.715 1.00 12.94 ? 1143 TYR A CG  1 
ATOM   521   C CD1 . TYR A  1 70  ? -25.912 -14.268 -22.118 1.00 15.78 ? 1143 TYR A CD1 1 
ATOM   522   C CD2 . TYR A  1 70  ? -24.538 -14.274 -24.068 1.00 17.47 ? 1143 TYR A CD2 1 
ATOM   523   C CE1 . TYR A  1 70  ? -26.959 -14.761 -22.860 1.00 16.21 ? 1143 TYR A CE1 1 
ATOM   524   C CE2 . TYR A  1 70  ? -25.607 -14.734 -24.817 1.00 21.60 ? 1143 TYR A CE2 1 
ATOM   525   C CZ  . TYR A  1 70  ? -26.820 -14.975 -24.191 1.00 18.77 ? 1143 TYR A CZ  1 
ATOM   526   O OH  . TYR A  1 70  ? -27.903 -15.431 -24.953 1.00 22.34 ? 1143 TYR A OH  1 
ATOM   527   N N   . LEU A  1 71  ? -22.770 -11.411 -19.534 1.00 13.67 ? 1144 LEU A N   1 
ATOM   528   C CA  . LEU A  1 71  ? -21.836 -11.246 -18.428 1.00 12.76 ? 1144 LEU A CA  1 
ATOM   529   C C   . LEU A  1 71  ? -21.585 -12.608 -17.781 1.00 16.55 ? 1144 LEU A C   1 
ATOM   530   O O   . LEU A  1 71  ? -22.539 -13.271 -17.382 1.00 15.47 ? 1144 LEU A O   1 
ATOM   531   C CB  . LEU A  1 71  ? -22.425 -10.305 -17.402 1.00 12.73 ? 1144 LEU A CB  1 
ATOM   532   C CG  . LEU A  1 71  ? -21.580 -10.065 -16.148 1.00 16.32 ? 1144 LEU A CG  1 
ATOM   533   C CD1 . LEU A  1 71  ? -20.153 -9.500  -16.570 1.00 14.98 ? 1144 LEU A CD1 1 
ATOM   534   C CD2 . LEU A  1 71  ? -22.302 -9.083  -15.152 1.00 18.57 ? 1144 LEU A CD2 1 
ATOM   535   N N   . VAL A  1 72  ? -20.302 -12.976 -17.631 1.00 12.52 ? 1145 VAL A N   1 
ATOM   536   C CA  . VAL A  1 72  ? -20.017 -14.273 -16.994 1.00 13.25 ? 1145 VAL A CA  1 
ATOM   537   C C   . VAL A  1 72  ? -19.070 -14.019 -15.827 1.00 14.35 ? 1145 VAL A C   1 
ATOM   538   O O   . VAL A  1 72  ? -18.264 -13.043 -15.820 1.00 16.70 ? 1145 VAL A O   1 
ATOM   539   C CB  . VAL A  1 72  ? -19.429 -15.311 -17.973 1.00 13.18 ? 1145 VAL A CB  1 
ATOM   540   C CG1 . VAL A  1 72  ? -20.414 -15.547 -19.219 1.00 14.54 ? 1145 VAL A CG1 1 
ATOM   541   C CG2 . VAL A  1 72  ? -17.944 -14.902 -18.417 1.00 16.68 ? 1145 VAL A CG2 1 
ATOM   542   N N   . LEU A  1 73  ? -19.170 -14.889 -14.817 1.00 13.72 ? 1146 LEU A N   1 
ATOM   543   C CA  . LEU A  1 73  ? -18.299 -14.842 -13.660 1.00 14.15 ? 1146 LEU A CA  1 
ATOM   544   C C   . LEU A  1 73  ? -17.555 -16.167 -13.646 1.00 15.73 ? 1146 LEU A C   1 
ATOM   545   O O   . LEU A  1 73  ? -18.159 -17.209 -13.519 1.00 12.33 ? 1146 LEU A O   1 
ATOM   546   C CB  . LEU A  1 73  ? -19.116 -14.740 -12.353 1.00 13.79 ? 1146 LEU A CB  1 
ATOM   547   C CG  . LEU A  1 73  ? -18.282 -14.810 -11.077 1.00 15.56 ? 1146 LEU A CG  1 
ATOM   548   C CD1 . LEU A  1 73  ? -17.333 -13.574 -11.001 1.00 17.59 ? 1146 LEU A CD1 1 
ATOM   549   C CD2 . LEU A  1 73  ? -19.196 -14.828 -9.818  1.00 20.05 ? 1146 LEU A CD2 1 
ATOM   550   N N   . PHE A  1 74  ? -16.237 -16.152 -13.821 1.00 11.32 ? 1147 PHE A N   1 
ATOM   551   C CA  . PHE A  1 74  ? -15.517 -17.424 -13.811 1.00 13.35 ? 1147 PHE A CA  1 
ATOM   552   C C   . PHE A  1 74  ? -15.402 -18.087 -12.459 1.00 13.56 ? 1147 PHE A C   1 
ATOM   553   O O   . PHE A  1 74  ? -15.431 -17.431 -11.446 1.00 15.05 ? 1147 PHE A O   1 
ATOM   554   C CB  . PHE A  1 74  ? -14.082 -17.169 -14.347 1.00 14.09 ? 1147 PHE A CB  1 
ATOM   555   C CG  . PHE A  1 74  ? -14.048 -16.768 -15.836 1.00 12.22 ? 1147 PHE A CG  1 
ATOM   556   C CD1 . PHE A  1 74  ? -14.250 -17.704 -16.824 1.00 11.43 ? 1147 PHE A CD1 1 
ATOM   557   C CD2 . PHE A  1 74  ? -13.797 -15.446 -16.204 1.00 14.68 ? 1147 PHE A CD2 1 
ATOM   558   C CE1 . PHE A  1 74  ? -14.230 -17.384 -18.151 1.00 15.09 ? 1147 PHE A CE1 1 
ATOM   559   C CE2 . PHE A  1 74  ? -13.782 -15.118 -17.550 1.00 16.68 ? 1147 PHE A CE2 1 
ATOM   560   C CZ  . PHE A  1 74  ? -14.002 -16.063 -18.511 1.00 14.34 ? 1147 PHE A CZ  1 
ATOM   561   N N   . PHE A  1 75  ? -15.206 -19.399 -12.483 1.00 12.03 ? 1148 PHE A N   1 
ATOM   562   C CA  . PHE A  1 75  ? -14.960 -20.185 -11.224 1.00 12.69 ? 1148 PHE A CA  1 
ATOM   563   C C   . PHE A  1 75  ? -13.451 -20.271 -10.990 1.00 12.31 ? 1148 PHE A C   1 
ATOM   564   O O   . PHE A  1 75  ? -12.953 -21.270 -10.471 1.00 17.48 ? 1148 PHE A O   1 
ATOM   565   C CB  . PHE A  1 75  ? -15.538 -21.580 -11.370 1.00 12.64 ? 1148 PHE A CB  1 
ATOM   566   C CG  . PHE A  1 75  ? -17.088 -21.592 -11.182 1.00 12.61 ? 1148 PHE A CG  1 
ATOM   567   C CD1 . PHE A  1 75  ? -17.607 -21.528 -9.905  1.00 15.35 ? 1148 PHE A CD1 1 
ATOM   568   C CD2 . PHE A  1 75  ? -17.928 -21.637 -12.273 1.00 13.99 ? 1148 PHE A CD2 1 
ATOM   569   C CE1 . PHE A  1 75  ? -19.015 -21.471 -9.714  1.00 13.42 ? 1148 PHE A CE1 1 
ATOM   570   C CE2 . PHE A  1 75  ? -19.332 -21.604 -12.120 1.00 12.49 ? 1148 PHE A CE2 1 
ATOM   571   C CZ  . PHE A  1 75  ? -19.848 -21.541 -10.800 1.00 13.61 ? 1148 PHE A CZ  1 
ATOM   572   N N   . ASP A  1 76  ? -12.750 -19.225 -11.416 1.00 14.83 ? 1149 ASP A N   1 
ATOM   573   C CA  . ASP A  1 76  ? -11.319 -19.200 -11.084 1.00 15.95 ? 1149 ASP A CA  1 
ATOM   574   C C   . ASP A  1 76  ? -11.119 -18.774 -9.614  1.00 18.16 ? 1149 ASP A C   1 
ATOM   575   O O   . ASP A  1 76  ? -12.050 -18.481 -8.903  1.00 18.26 ? 1149 ASP A O   1 
ATOM   576   C CB  . ASP A  1 76  ? -10.580 -18.310 -12.099 1.00 15.02 ? 1149 ASP A CB  1 
ATOM   577   C CG  . ASP A  1 76  ? -11.080 -16.888 -12.153 1.00 22.62 ? 1149 ASP A CG  1 
ATOM   578   O OD1 . ASP A  1 76  ? -12.171 -16.542 -11.662 1.00 18.95 ? 1149 ASP A OD1 1 
ATOM   579   O OD2 . ASP A  1 76  ? -10.370 -16.037 -12.780 1.00 21.37 ? 1149 ASP A OD2 1 
ATOM   580   N N   . ASN A  1 77  ? -9.880  -18.842 -9.141  1.00 18.83 ? 1150 ASN A N   1 
ATOM   581   C CA  . ASN A  1 77  ? -9.586  -18.524 -7.744  1.00 22.01 ? 1150 ASN A CA  1 
ATOM   582   C C   . ASN A  1 77  ? -10.114 -17.149 -7.371  1.00 23.37 ? 1150 ASN A C   1 
ATOM   583   O O   . ASN A  1 77  ? -10.786 -16.992 -6.338  1.00 28.74 ? 1150 ASN A O   1 
ATOM   584   C CB  . ASN A  1 77  ? -8.057  -18.589 -7.487  1.00 25.02 ? 1150 ASN A CB  1 
ATOM   585   C CG  . ASN A  1 77  ? -7.534  -20.010 -7.404  1.00 31.16 ? 1150 ASN A CG  1 
ATOM   586   O OD1 . ASN A  1 77  ? -8.299  -20.953 -7.266  1.00 31.23 ? 1150 ASN A OD1 1 
ATOM   587   N ND2 . ASN A  1 77  ? -6.199  -20.174 -7.499  1.00 29.05 ? 1150 ASN A ND2 1 
ATOM   588   N N   . LYS A  1 78  ? -9.867  -16.177 -8.239  1.00 19.61 ? 1151 LYS A N   1 
ATOM   589   C CA  . LYS A  1 78  ? -10.194 -14.782 -7.956  1.00 24.18 ? 1151 LYS A CA  1 
ATOM   590   C C   . LYS A  1 78  ? -11.622 -14.399 -8.278  1.00 21.39 ? 1151 LYS A C   1 
ATOM   591   O O   . LYS A  1 78  ? -12.041 -13.289 -7.969  1.00 22.96 ? 1151 LYS A O   1 
ATOM   592   C CB  . LYS A  1 78  ? -9.296  -13.909 -8.805  1.00 25.46 ? 1151 LYS A CB  1 
ATOM   593   C CG  . LYS A  1 78  ? -7.810  -13.875 -8.360  1.00 34.04 ? 1151 LYS A CG  1 
ATOM   594   C CD  . LYS A  1 78  ? -6.989  -13.037 -9.383  1.00 36.72 ? 1151 LYS A CD  1 
ATOM   595   C CE  . LYS A  1 78  ? -7.106  -13.649 -10.798 1.00 42.55 ? 1151 LYS A CE  1 
ATOM   596   N NZ  . LYS A  1 78  ? -6.692  -12.792 -11.960 1.00 47.62 ? 1151 LYS A NZ  1 
ATOM   597   N N   . ARG A  1 79  ? -12.327 -15.286 -8.972  1.00 20.55 ? 1152 ARG A N   1 
ATOM   598   C CA  . ARG A  1 79  ? -13.675 -15.020 -9.459  1.00 16.30 ? 1152 ARG A CA  1 
ATOM   599   C C   . ARG A  1 79  ? -13.740 -13.748 -10.302 1.00 13.31 ? 1152 ARG A C   1 
ATOM   600   O O   . ARG A  1 79  ? -14.322 -12.747 -9.891  1.00 18.77 ? 1152 ARG A O   1 
ATOM   601   C CB  . ARG A  1 79  ? -14.699 -14.946 -8.331  1.00 21.74 ? 1152 ARG A CB  1 
ATOM   602   C CG  . ARG A  1 79  ? -14.749 -16.171 -7.438  1.00 23.02 ? 1152 ARG A CG  1 
ATOM   603   C CD  . ARG A  1 79  ? -15.116 -17.487 -8.168  1.00 18.83 ? 1152 ARG A CD  1 
ATOM   604   N NE  . ARG A  1 79  ? -16.528 -17.578 -8.616  1.00 17.15 ? 1152 ARG A NE  1 
ATOM   605   C CZ  . ARG A  1 79  ? -17.551 -17.881 -7.801  1.00 21.80 ? 1152 ARG A CZ  1 
ATOM   606   N NH1 . ARG A  1 79  ? -17.350 -18.029 -6.489  1.00 22.94 ? 1152 ARG A NH1 1 
ATOM   607   N NH2 . ARG A  1 79  ? -18.789 -17.989 -8.295  1.00 19.57 ? 1152 ARG A NH2 1 
ATOM   608   N N   . THR A  1 80  ? -13.171 -13.808 -11.482 1.00 16.09 ? 1153 THR A N   1 
ATOM   609   C CA  . THR A  1 80  ? -13.153 -12.627 -12.366 1.00 17.54 ? 1153 THR A CA  1 
ATOM   610   C C   . THR A  1 80  ? -14.345 -12.636 -13.342 1.00 18.99 ? 1153 THR A C   1 
ATOM   611   O O   . THR A  1 80  ? -14.998 -13.687 -13.591 1.00 15.55 ? 1153 THR A O   1 
ATOM   612   C CB  . THR A  1 80  ? -11.837 -12.609 -13.197 1.00 17.51 ? 1153 THR A CB  1 
ATOM   613   O OG1 . THR A  1 80  ? -11.696 -13.834 -13.905 1.00 16.92 ? 1153 THR A OG1 1 
ATOM   614   C CG2 . THR A  1 80  ? -10.640 -12.449 -12.283 1.00 21.77 ? 1153 THR A CG2 1 
ATOM   615   N N   . TRP A  1 81  ? -14.542 -11.477 -13.979 1.00 16.66 ? 1154 TRP A N   1 
ATOM   616   C CA  . TRP A  1 81  ? -15.693 -11.233 -14.861 1.00 17.08 ? 1154 TRP A CA  1 
ATOM   617   C C   . TRP A  1 81  ? -15.274 -11.067 -16.303 1.00 20.21 ? 1154 TRP A C   1 
ATOM   618   O O   . TRP A  1 81  ? -14.137 -10.678 -16.601 1.00 21.06 ? 1154 TRP A O   1 
ATOM   619   C CB  . TRP A  1 81  ? -16.386 -9.931  -14.418 1.00 17.50 ? 1154 TRP A CB  1 
ATOM   620   C CG  . TRP A  1 81  ? -16.906 -9.887  -13.011 1.00 17.21 ? 1154 TRP A CG  1 
ATOM   621   C CD1 . TRP A  1 81  ? -16.244 -9.436  -11.920 1.00 18.14 ? 1154 TRP A CD1 1 
ATOM   622   C CD2 . TRP A  1 81  ? -18.230 -10.260 -12.554 1.00 16.13 ? 1154 TRP A CD2 1 
ATOM   623   N NE1 . TRP A  1 81  ? -17.058 -9.479  -10.801 1.00 19.72 ? 1154 TRP A NE1 1 
ATOM   624   C CE2 . TRP A  1 81  ? -18.291 -9.944  -11.179 1.00 15.93 ? 1154 TRP A CE2 1 
ATOM   625   C CE3 . TRP A  1 81  ? -19.373 -10.754 -13.194 1.00 16.41 ? 1154 TRP A CE3 1 
ATOM   626   C CZ2 . TRP A  1 81  ? -19.436 -10.180 -10.402 1.00 20.02 ? 1154 TRP A CZ2 1 
ATOM   627   C CZ3 . TRP A  1 81  ? -20.503 -10.970 -12.461 1.00 14.27 ? 1154 TRP A CZ3 1 
ATOM   628   C CH2 . TRP A  1 81  ? -20.536 -10.679 -11.056 1.00 16.20 ? 1154 TRP A CH2 1 
ATOM   629   N N   . GLN A  1 82  ? -16.175 -11.391 -17.210 1.00 18.16 ? 1155 GLN A N   1 
ATOM   630   C CA  . GLN A  1 82  ? -15.952 -11.063 -18.629 1.00 18.57 ? 1155 GLN A CA  1 
ATOM   631   C C   . GLN A  1 82  ? -17.266 -10.889 -19.325 1.00 20.58 ? 1155 GLN A C   1 
ATOM   632   O O   . GLN A  1 82  ? -18.320 -11.355 -18.832 1.00 17.69 ? 1155 GLN A O   1 
ATOM   633   C CB  . GLN A  1 82  ? -15.170 -12.157 -19.319 1.00 21.73 ? 1155 GLN A CB  1 
ATOM   634   C CG  . GLN A  1 82  ? -13.718 -11.756 -19.515 1.00 30.64 ? 1155 GLN A CG  1 
ATOM   635   C CD  . GLN A  1 82  ? -13.579 -10.577 -20.453 1.00 33.32 ? 1155 GLN A CD  1 
ATOM   636   O OE1 . GLN A  1 82  ? -14.504 -10.245 -21.209 1.00 33.00 ? 1155 GLN A OE1 1 
ATOM   637   N NE2 . GLN A  1 82  ? -12.415 -9.940  -20.427 1.00 34.95 ? 1155 GLN A NE2 1 
ATOM   638   N N   . TRP A  1 83  ? -17.208 -10.211 -20.466 1.00 17.50 ? 1156 TRP A N   1 
ATOM   639   C CA  . TRP A  1 83  ? -18.394 -10.057 -21.308 1.00 17.02 ? 1156 TRP A CA  1 
ATOM   640   C C   . TRP A  1 83  ? -18.097 -10.754 -22.616 1.00 20.22 ? 1156 TRP A C   1 
ATOM   641   O O   . TRP A  1 83  ? -17.089 -10.458 -23.298 1.00 18.45 ? 1156 TRP A O   1 
ATOM   642   C CB  . TRP A  1 83  ? -18.602 -8.564  -21.616 1.00 15.54 ? 1156 TRP A CB  1 
ATOM   643   C CG  . TRP A  1 83  ? -19.000 -7.765  -20.447 1.00 16.78 ? 1156 TRP A CG  1 
ATOM   644   C CD1 . TRP A  1 83  ? -18.209 -7.101  -19.569 1.00 16.89 ? 1156 TRP A CD1 1 
ATOM   645   C CD2 . TRP A  1 83  ? -20.332 -7.585  -20.006 1.00 15.95 ? 1156 TRP A CD2 1 
ATOM   646   N NE1 . TRP A  1 83  ? -18.945 -6.463  -18.640 1.00 21.12 ? 1156 TRP A NE1 1 
ATOM   647   C CE2 . TRP A  1 83  ? -20.269 -6.743  -18.872 1.00 16.65 ? 1156 TRP A CE2 1 
ATOM   648   C CE3 . TRP A  1 83  ? -21.570 -7.977  -20.514 1.00 18.94 ? 1156 TRP A CE3 1 
ATOM   649   C CZ2 . TRP A  1 83  ? -21.385 -6.313  -18.207 1.00 23.88 ? 1156 TRP A CZ2 1 
ATOM   650   C CZ3 . TRP A  1 83  ? -22.695 -7.560  -19.824 1.00 19.11 ? 1156 TRP A CZ3 1 
ATOM   651   C CH2 . TRP A  1 83  ? -22.583 -6.720  -18.697 1.00 16.04 ? 1156 TRP A CH2 1 
ATOM   652   N N   . LEU A  1 84  ? -18.950 -11.692 -22.997 1.00 13.71 ? 1157 LEU A N   1 
ATOM   653   C CA  . LEU A  1 84  ? -18.688 -12.554 -24.167 1.00 12.90 ? 1157 LEU A CA  1 
ATOM   654   C C   . LEU A  1 84  ? -19.918 -12.771 -24.976 1.00 18.78 ? 1157 LEU A C   1 
ATOM   655   O O   . LEU A  1 84  ? -20.981 -12.958 -24.403 1.00 16.73 ? 1157 LEU A O   1 
ATOM   656   C CB  . LEU A  1 84  ? -18.171 -13.974 -23.705 1.00 14.61 ? 1157 LEU A CB  1 
ATOM   657   C CG  . LEU A  1 84  ? -16.835 -13.938 -22.999 1.00 15.81 ? 1157 LEU A CG  1 
ATOM   658   C CD1 . LEU A  1 84  ? -16.533 -15.363 -22.397 1.00 19.05 ? 1157 LEU A CD1 1 
ATOM   659   C CD2 . LEU A  1 84  ? -15.702 -13.536 -23.980 1.00 18.94 ? 1157 LEU A CD2 1 
ATOM   660   N N   . PRO A  1 85  ? -19.802 -12.831 -26.311 1.00 17.82 ? 1158 PRO A N   1 
ATOM   661   C CA  . PRO A  1 85  ? -20.988 -13.144 -27.125 1.00 16.86 ? 1158 PRO A CA  1 
ATOM   662   C C   . PRO A  1 85  ? -21.335 -14.622 -27.062 1.00 18.12 ? 1158 PRO A C   1 
ATOM   663   O O   . PRO A  1 85  ? -20.556 -15.507 -26.651 1.00 18.57 ? 1158 PRO A O   1 
ATOM   664   C CB  . PRO A  1 85  ? -20.523 -12.806 -28.560 1.00 20.78 ? 1158 PRO A CB  1 
ATOM   665   C CG  . PRO A  1 85  ? -19.036 -13.183 -28.513 1.00 21.22 ? 1158 PRO A CG  1 
ATOM   666   C CD  . PRO A  1 85  ? -18.577 -12.684 -27.145 1.00 19.56 ? 1158 PRO A CD  1 
ATOM   667   N N   . ARG A  1 86  ? -22.541 -14.930 -27.548 1.00 20.75 ? 1159 ARG A N   1 
ATOM   668   C CA  . ARG A  1 86  ? -23.011 -16.305 -27.592 1.00 20.59 ? 1159 ARG A CA  1 
ATOM   669   C C   . ARG A  1 86  ? -22.078 -17.309 -28.226 1.00 23.36 ? 1159 ARG A C   1 
ATOM   670   O O   . ARG A  1 86  ? -21.992 -18.450 -27.782 1.00 19.80 ? 1159 ARG A O   1 
ATOM   671   C CB  . ARG A  1 86  ? -24.386 -16.340 -28.298 1.00 23.17 ? 1159 ARG A CB  1 
ATOM   672   C CG  . ARG A  1 86  ? -24.958 -17.703 -28.455 1.00 25.05 ? 1159 ARG A CG  1 
ATOM   673   C CD  . ARG A  1 86  ? -25.538 -18.163 -27.113 1.00 22.37 ? 1159 ARG A CD  1 
ATOM   674   N NE  . ARG A  1 86  ? -26.012 -19.537 -27.163 1.00 23.23 ? 1159 ARG A NE  1 
ATOM   675   C CZ  . ARG A  1 86  ? -25.280 -20.647 -27.110 1.00 24.47 ? 1159 ARG A CZ  1 
ATOM   676   N NH1 . ARG A  1 86  ? -25.898 -21.823 -27.159 1.00 29.56 ? 1159 ARG A NH1 1 
ATOM   677   N NH2 . ARG A  1 86  ? -23.945 -20.618 -27.044 1.00 24.38 ? 1159 ARG A NH2 1 
ATOM   678   N N   . THR A  1 87  ? -21.387 -16.903 -29.292 1.00 20.01 ? 1160 THR A N   1 
ATOM   679   C CA  . THR A  1 87  ? -20.469 -17.800 -29.965 1.00 22.39 ? 1160 THR A CA  1 
ATOM   680   C C   . THR A  1 87  ? -19.252 -18.241 -29.138 1.00 22.68 ? 1160 THR A C   1 
ATOM   681   O O   . THR A  1 87  ? -18.497 -19.107 -29.583 1.00 23.80 ? 1160 THR A O   1 
ATOM   682   C CB  . THR A  1 87  ? -19.887 -17.128 -31.263 1.00 23.47 ? 1160 THR A CB  1 
ATOM   683   O OG1 . THR A  1 87  ? -19.368 -15.852 -30.900 1.00 27.27 ? 1160 THR A OG1 1 
ATOM   684   C CG2 . THR A  1 87  ? -20.967 -16.917 -32.284 1.00 33.31 ? 1160 THR A CG2 1 
ATOM   685   N N   . LYS A  1 88  ? -19.064 -17.646 -27.965 1.00 16.10 ? 1161 LYS A N   1 
ATOM   686   C CA  . LYS A  1 88  ? -17.901 -17.984 -27.136 1.00 15.61 ? 1161 LYS A CA  1 
ATOM   687   C C   . LYS A  1 88  ? -18.343 -18.727 -25.877 1.00 17.60 ? 1161 LYS A C   1 
ATOM   688   O O   . LYS A  1 88  ? -17.551 -18.901 -24.963 1.00 17.39 ? 1161 LYS A O   1 
ATOM   689   C CB  . LYS A  1 88  ? -17.167 -16.741 -26.721 1.00 17.73 ? 1161 LYS A CB  1 
ATOM   690   C CG  . LYS A  1 88  ? -16.596 -15.959 -27.925 1.00 22.45 ? 1161 LYS A CG  1 
ATOM   691   C CD  . LYS A  1 88  ? -15.470 -16.744 -28.519 1.00 26.24 ? 1161 LYS A CD  1 
ATOM   692   C CE  . LYS A  1 88  ? -14.773 -15.963 -29.665 1.00 32.67 ? 1161 LYS A CE  1 
ATOM   693   N NZ  . LYS A  1 88  ? -13.646 -16.824 -30.165 1.00 37.47 ? 1161 LYS A NZ  1 
ATOM   694   N N   . LEU A  1 89  ? -19.629 -19.100 -25.853 1.00 14.12 ? 1162 LEU A N   1 
ATOM   695   C CA  . LEU A  1 89  ? -20.238 -19.840 -24.704 1.00 17.21 ? 1162 LEU A CA  1 
ATOM   696   C C   . LEU A  1 89  ? -20.807 -21.178 -25.088 1.00 18.76 ? 1162 LEU A C   1 
ATOM   697   O O   . LEU A  1 89  ? -21.403 -21.325 -26.182 1.00 20.74 ? 1162 LEU A O   1 
ATOM   698   C CB  . LEU A  1 89  ? -21.384 -19.007 -24.085 1.00 15.18 ? 1162 LEU A CB  1 
ATOM   699   C CG  . LEU A  1 89  ? -21.013 -17.586 -23.677 1.00 17.59 ? 1162 LEU A CG  1 
ATOM   700   C CD1 . LEU A  1 89  ? -22.212 -16.815 -23.047 1.00 18.26 ? 1162 LEU A CD1 1 
ATOM   701   C CD2 . LEU A  1 89  ? -19.824 -17.564 -22.694 1.00 15.75 ? 1162 LEU A CD2 1 
ATOM   702   N N   . VAL A  1 90  ? -20.607 -22.192 -24.253 1.00 16.67 ? 1163 VAL A N   1 
ATOM   703   C CA  . VAL A  1 90  ? -21.242 -23.501 -24.496 1.00 16.66 ? 1163 VAL A CA  1 
ATOM   704   C C   . VAL A  1 90  ? -21.760 -24.001 -23.169 1.00 14.80 ? 1163 VAL A C   1 
ATOM   705   O O   . VAL A  1 90  ? -21.049 -23.953 -22.197 1.00 15.17 ? 1163 VAL A O   1 
ATOM   706   C CB  . VAL A  1 90  ? -20.213 -24.537 -25.014 1.00 18.05 ? 1163 VAL A CB  1 
ATOM   707   C CG1 . VAL A  1 90  ? -20.879 -25.893 -25.231 1.00 20.67 ? 1163 VAL A CG1 1 
ATOM   708   C CG2 . VAL A  1 90  ? -19.624 -24.026 -26.357 1.00 24.59 ? 1163 VAL A CG2 1 
ATOM   709   N N   . PRO A  1 91  ? -23.019 -24.473 -23.100 1.00 16.09 ? 1164 PRO A N   1 
ATOM   710   C CA  . PRO A  1 91  ? -23.447 -25.014 -21.791 1.00 13.93 ? 1164 PRO A CA  1 
ATOM   711   C C   . PRO A  1 91  ? -22.517 -26.095 -21.207 1.00 13.98 ? 1164 PRO A C   1 
ATOM   712   O O   . PRO A  1 91  ? -22.079 -26.997 -21.918 1.00 15.10 ? 1164 PRO A O   1 
ATOM   713   C CB  . PRO A  1 91  ? -24.824 -25.657 -22.092 1.00 18.64 ? 1164 PRO A CB  1 
ATOM   714   C CG  . PRO A  1 91  ? -25.337 -24.777 -23.219 1.00 21.99 ? 1164 PRO A CG  1 
ATOM   715   C CD  . PRO A  1 91  ? -24.100 -24.463 -24.098 1.00 20.24 ? 1164 PRO A CD  1 
ATOM   716   N N   . LEU A  1 92  ? -22.301 -25.995 -19.879 1.00 13.68 ? 1165 LEU A N   1 
ATOM   717   C CA  . LEU A  1 92  ? -21.415 -26.841 -19.126 1.00 13.80 ? 1165 LEU A CA  1 
ATOM   718   C C   . LEU A  1 92  ? -22.233 -27.756 -18.236 1.00 14.98 ? 1165 LEU A C   1 
ATOM   719   O O   . LEU A  1 92  ? -23.284 -27.316 -17.690 1.00 15.69 ? 1165 LEU A O   1 
ATOM   720   C CB  . LEU A  1 92  ? -20.496 -25.909 -18.252 1.00 12.74 ? 1165 LEU A CB  1 
ATOM   721   C CG  . LEU A  1 92  ? -19.453 -26.691 -17.415 1.00 10.96 ? 1165 LEU A CG  1 
ATOM   722   C CD1 . LEU A  1 92  ? -18.222 -25.744 -17.241 1.00 14.94 ? 1165 LEU A CD1 1 
ATOM   723   C CD2 . LEU A  1 92  ? -20.000 -26.994 -16.007 1.00 12.71 ? 1165 LEU A CD2 1 
ATOM   724   N N   . GLY A  1 93  ? -21.760 -28.977 -18.079 1.00 12.09 ? 1166 GLY A N   1 
ATOM   725   C CA  . GLY A  1 93  ? -22.345 -29.996 -17.187 1.00 12.33 ? 1166 GLY A CA  1 
ATOM   726   C C   . GLY A  1 93  ? -23.614 -30.599 -17.792 1.00 17.68 ? 1166 GLY A C   1 
ATOM   727   O O   . GLY A  1 93  ? -24.423 -31.191 -17.063 1.00 19.29 ? 1166 GLY A O   1 
ATOM   728   N N   . VAL A  1 94  ? -23.757 -30.540 -19.107 1.00 17.61 ? 1167 VAL A N   1 
ATOM   729   C CA  . VAL A  1 94  ? -24.953 -31.152 -19.713 1.00 19.51 ? 1167 VAL A CA  1 
ATOM   730   C C   . VAL A  1 94  ? -24.608 -32.346 -20.590 1.00 20.05 ? 1167 VAL A C   1 
ATOM   731   O O   . VAL A  1 94  ? -25.411 -33.272 -20.794 1.00 21.90 ? 1167 VAL A O   1 
ATOM   732   C CB  A VAL A  1 94  ? -25.666 -30.169 -20.666 0.36 20.08 ? 1167 VAL A CB  1 
ATOM   733   C CB  B VAL A  1 94  ? -25.869 -30.150 -20.372 0.64 20.07 ? 1167 VAL A CB  1 
ATOM   734   C CG1 A VAL A  1 94  ? -27.084 -30.681 -20.998 0.36 19.71 ? 1167 VAL A CG1 1 
ATOM   735   C CG1 B VAL A  1 94  ? -26.543 -29.282 -19.303 0.64 20.68 ? 1167 VAL A CG1 1 
ATOM   736   C CG2 A VAL A  1 94  ? -25.708 -28.744 -20.115 0.36 18.13 ? 1167 VAL A CG2 1 
ATOM   737   C CG2 B VAL A  1 94  ? -25.144 -29.323 -21.394 0.64 18.73 ? 1167 VAL A CG2 1 
ATOM   738   N N   . ASN A  1 95  ? -23.401 -32.312 -21.149 1.00 18.70 ? 1168 ASN A N   1 
ATOM   739   C CA  . ASN A  1 95  ? -22.992 -33.372 -22.072 1.00 18.55 ? 1168 ASN A CA  1 
ATOM   740   C C   . ASN A  1 95  ? -21.593 -33.727 -21.590 1.00 18.05 ? 1168 ASN A C   1 
ATOM   741   O O   . ASN A  1 95  ? -20.699 -32.885 -21.683 1.00 18.47 ? 1168 ASN A O   1 
ATOM   742   C CB  . ASN A  1 95  ? -22.979 -32.790 -23.478 1.00 21.35 ? 1168 ASN A CB  1 
ATOM   743   C CG  . ASN A  1 95  ? -22.389 -33.733 -24.551 1.00 22.84 ? 1168 ASN A CG  1 
ATOM   744   O OD1 . ASN A  1 95  ? -21.553 -34.607 -24.298 1.00 20.96 ? 1168 ASN A OD1 1 
ATOM   745   N ND2 . ASN A  1 95  ? -22.834 -33.501 -25.803 1.00 30.11 ? 1168 ASN A ND2 1 
ATOM   746   N N   . GLN A  1 96  ? -21.446 -34.922 -21.048 1.00 17.00 ? 1169 GLN A N   1 
ATOM   747   C CA  . GLN A  1 96  ? -20.197 -35.335 -20.359 1.00 17.82 ? 1169 GLN A CA  1 
ATOM   748   C C   . GLN A  1 96  ? -19.058 -35.391 -21.325 1.00 15.35 ? 1169 GLN A C   1 
ATOM   749   O O   . GLN A  1 96  ? -17.918 -35.119 -20.962 1.00 15.84 ? 1169 GLN A O   1 
ATOM   750   C CB  . GLN A  1 96  ? -20.368 -36.703 -19.733 1.00 32.73 ? 1169 GLN A CB  1 
ATOM   751   C CG  . GLN A  1 96  ? -20.855 -36.656 -18.304 1.00 35.50 ? 1169 GLN A CG  1 
ATOM   752   C CD  . GLN A  1 96  ? -20.027 -37.543 -17.377 1.00 46.99 ? 1169 GLN A CD  1 
ATOM   753   O OE1 . GLN A  1 96  ? -20.127 -38.780 -17.408 1.00 47.94 ? 1169 GLN A OE1 1 
ATOM   754   N NE2 . GLN A  1 96  ? -19.197 -36.910 -16.548 1.00 45.20 ? 1169 GLN A NE2 1 
ATOM   755   N N   . ASP A  1 97  ? -19.322 -35.817 -22.541 1.00 16.19 ? 1170 ASP A N   1 
ATOM   756   C CA  . ASP A  1 97  ? -18.218 -35.905 -23.487 1.00 17.38 ? 1170 ASP A CA  1 
ATOM   757   C C   . ASP A  1 97  ? -17.728 -34.574 -23.959 1.00 16.97 ? 1170 ASP A C   1 
ATOM   758   O O   . ASP A  1 97  ? -16.514 -34.380 -24.122 1.00 16.51 ? 1170 ASP A O   1 
ATOM   759   C CB  . ASP A  1 97  ? -18.546 -36.889 -24.639 1.00 19.25 ? 1170 ASP A CB  1 
ATOM   760   C CG  . ASP A  1 97  ? -18.607 -38.292 -24.134 1.00 24.21 ? 1170 ASP A CG  1 
ATOM   761   O OD1 . ASP A  1 97  ? -19.727 -38.848 -24.109 1.00 28.03 ? 1170 ASP A OD1 1 
ATOM   762   O OD2 . ASP A  1 97  ? -17.555 -38.813 -23.700 1.00 26.91 ? 1170 ASP A OD2 1 
ATOM   763   N N   . LEU A  1 98  ? -18.644 -33.615 -24.128 1.00 15.69 ? 1171 LEU A N   1 
ATOM   764   C CA  . LEU A  1 98  ? -18.212 -32.258 -24.439 1.00 14.77 ? 1171 LEU A CA  1 
ATOM   765   C C   . LEU A  1 98  ? -17.394 -31.680 -23.307 1.00 14.22 ? 1171 LEU A C   1 
ATOM   766   O O   . LEU A  1 98  ? -16.349 -31.064 -23.526 1.00 17.65 ? 1171 LEU A O   1 
ATOM   767   C CB  . LEU A  1 98  ? -19.419 -31.398 -24.704 1.00 14.37 ? 1171 LEU A CB  1 
ATOM   768   C CG  . LEU A  1 98  ? -19.199 -29.934 -25.046 1.00 15.55 ? 1171 LEU A CG  1 
ATOM   769   C CD1 . LEU A  1 98  ? -20.392 -29.471 -25.908 1.00 24.25 ? 1171 LEU A CD1 1 
ATOM   770   C CD2 . LEU A  1 98  ? -19.162 -29.102 -23.796 1.00 16.55 ? 1171 LEU A CD2 1 
ATOM   771   N N   . ASP A  1 99  ? -17.840 -31.914 -22.062 1.00 15.64 ? 1172 ASP A N   1 
ATOM   772   C CA  . ASP A  1 99  ? -17.100 -31.369 -20.933 1.00 13.16 ? 1172 ASP A CA  1 
ATOM   773   C C   . ASP A  1 99  ? -15.678 -31.972 -20.880 1.00 13.02 ? 1172 ASP A C   1 
ATOM   774   O O   . ASP A  1 99  ? -14.717 -31.265 -20.569 1.00 16.21 ? 1172 ASP A O   1 
ATOM   775   C CB  . ASP A  1 99  ? -17.787 -31.703 -19.613 1.00 14.63 ? 1172 ASP A CB  1 
ATOM   776   C CG  . ASP A  1 99  ? -19.116 -30.940 -19.391 1.00 12.98 ? 1172 ASP A CG  1 
ATOM   777   O OD1 . ASP A  1 99  ? -19.835 -31.357 -18.430 1.00 15.86 ? 1172 ASP A OD1 1 
ATOM   778   O OD2 . ASP A  1 99  ? -19.426 -29.939 -20.074 1.00 13.70 ? 1172 ASP A OD2 1 
ATOM   779   N N   . LYS A  1 100 ? -15.571 -33.281 -21.112 1.00 13.56 ? 1173 LYS A N   1 
ATOM   780   C CA  . LYS A  1 100 ? -14.258 -33.943 -21.054 1.00 16.58 ? 1173 LYS A CA  1 
ATOM   781   C C   . LYS A  1 100 ? -13.374 -33.421 -22.171 1.00 17.47 ? 1173 LYS A C   1 
ATOM   782   O O   . LYS A  1 100 ? -12.165 -33.281 -21.996 1.00 17.63 ? 1173 LYS A O   1 
ATOM   783   C CB  . LYS A  1 100 ? -14.424 -35.476 -21.136 1.00 15.35 ? 1173 LYS A CB  1 
ATOM   784   C CG  . LYS A  1 100 ? -14.857 -36.020 -19.754 1.00 22.10 ? 1173 LYS A CG  1 
ATOM   785   C CD  . LYS A  1 100 ? -15.169 -37.477 -19.759 1.00 29.01 ? 1173 LYS A CD  1 
ATOM   786   C CE  . LYS A  1 100 ? -15.627 -37.925 -18.380 1.00 33.51 ? 1173 LYS A CE  1 
ATOM   787   N NZ  . LYS A  1 100 ? -16.316 -39.242 -18.534 1.00 46.13 ? 1173 LYS A NZ  1 
ATOM   788   N N   . GLU A  1 101 ? -13.946 -33.167 -23.335 1.00 14.88 ? 1174 GLU A N   1 
ATOM   789   C CA  . GLU A  1 101 ? -13.156 -32.552 -24.426 1.00 16.49 ? 1174 GLU A CA  1 
ATOM   790   C C   . GLU A  1 101 ? -12.655 -31.179 -24.032 1.00 22.66 ? 1174 GLU A C   1 
ATOM   791   O O   . GLU A  1 101 ? -11.466 -30.808 -24.256 1.00 18.02 ? 1174 GLU A O   1 
ATOM   792   C CB  . GLU A  1 101 ? -13.939 -32.449 -25.724 1.00 18.33 ? 1174 GLU A CB  1 
ATOM   793   C CG  . GLU A  1 101 ? -13.137 -31.656 -26.813 1.00 23.22 ? 1174 GLU A CG  1 
ATOM   794   C CD  . GLU A  1 101 ? -13.861 -31.564 -28.129 1.00 29.99 ? 1174 GLU A CD  1 
ATOM   795   O OE1 . GLU A  1 101 ? -15.083 -31.783 -28.117 1.00 27.24 ? 1174 GLU A OE1 1 
ATOM   796   O OE2 . GLU A  1 101 ? -13.248 -31.190 -29.153 1.00 27.94 ? 1174 GLU A OE2 1 
ATOM   797   N N   . LYS A  1 102 ? -13.560 -30.389 -23.464 1.00 14.02 ? 1175 LYS A N   1 
ATOM   798   C CA  . LYS A  1 102 ? -13.143 -29.043 -23.061 1.00 17.54 ? 1175 LYS A CA  1 
ATOM   799   C C   . LYS A  1 102 ? -12.067 -29.083 -22.015 1.00 16.99 ? 1175 LYS A C   1 
ATOM   800   O O   . LYS A  1 102 ? -11.162 -28.231 -22.027 1.00 18.51 ? 1175 LYS A O   1 
ATOM   801   C CB  . LYS A  1 102 ? -14.290 -28.181 -22.531 1.00 15.76 ? 1175 LYS A CB  1 
ATOM   802   C CG  . LYS A  1 102 ? -15.379 -27.963 -23.559 1.00 16.76 ? 1175 LYS A CG  1 
ATOM   803   C CD  . LYS A  1 102 ? -15.146 -26.824 -24.504 1.00 26.89 ? 1175 LYS A CD  1 
ATOM   804   C CE  . LYS A  1 102 ? -16.382 -26.766 -25.441 1.00 28.14 ? 1175 LYS A CE  1 
ATOM   805   N NZ  . LYS A  1 102 ? -16.040 -26.323 -26.806 1.00 34.62 ? 1175 LYS A NZ  1 
ATOM   806   N N   . MET A  1 103 ? -12.129 -30.060 -21.114 1.00 15.50 ? 1176 MET A N   1 
ATOM   807   C CA  . MET A  1 103 ? -11.155 -30.087 -20.029 1.00 17.95 ? 1176 MET A CA  1 
ATOM   808   C C   . MET A  1 103 ? -9.736  -30.341 -20.551 1.00 19.47 ? 1176 MET A C   1 
ATOM   809   O O   . MET A  1 103 ? -8.786  -30.080 -19.814 1.00 20.42 ? 1176 MET A O   1 
ATOM   810   C CB  . MET A  1 103 ? -11.549 -31.033 -18.864 1.00 20.51 ? 1176 MET A CB  1 
ATOM   811   C CG  . MET A  1 103 ? -12.330 -30.200 -17.757 1.00 19.02 ? 1176 MET A CG  1 
ATOM   812   S SD  . MET A  1 103 ? -12.944 -31.234 -16.571 1.00 35.02 ? 1176 MET A SD  1 
ATOM   813   C CE  . MET A  1 103 ? -13.872 -32.419 -17.560 1.00 24.00 ? 1176 MET A CE  1 
ATOM   814   N N   . LEU A  1 104 ? -9.625  -30.904 -21.764 1.00 18.74 ? 1177 LEU A N   1 
ATOM   815   C CA  . LEU A  1 104 ? -8.331  -31.203 -22.411 1.00 18.55 ? 1177 LEU A CA  1 
ATOM   816   C C   . LEU A  1 104 ? -7.776  -30.121 -23.317 1.00 21.78 ? 1177 LEU A C   1 
ATOM   817   O O   . LEU A  1 104 ? -6.720  -30.321 -23.985 1.00 22.26 ? 1177 LEU A O   1 
ATOM   818   C CB  . LEU A  1 104 ? -8.461  -32.514 -23.223 1.00 17.36 ? 1177 LEU A CB  1 
ATOM   819   C CG  . LEU A  1 104 ? -8.764  -33.712 -22.359 1.00 19.05 ? 1177 LEU A CG  1 
ATOM   820   C CD1 . LEU A  1 104 ? -8.927  -34.977 -23.226 1.00 20.03 ? 1177 LEU A CD1 1 
ATOM   821   C CD2 . LEU A  1 104 ? -7.708  -33.922 -21.332 1.00 28.14 ? 1177 LEU A CD2 1 
ATOM   822   N N   . GLU A  1 105 ? -8.451  -28.998 -23.384 1.00 19.36 ? 1178 GLU A N   1 
ATOM   823   C CA  . GLU A  1 105 ? -8.099  -27.962 -24.339 1.00 22.91 ? 1178 GLU A CA  1 
ATOM   824   C C   . GLU A  1 105 ? -6.796  -27.238 -23.988 1.00 25.59 ? 1178 GLU A C   1 
ATOM   825   O O   . GLU A  1 105 ? -6.069  -26.860 -24.904 1.00 28.75 ? 1178 GLU A O   1 
ATOM   826   C CB  . GLU A  1 105 ? -9.258  -26.978 -24.523 1.00 24.28 ? 1178 GLU A CB  1 
ATOM   827   C CG  . GLU A  1 105 ? -9.059  -25.850 -25.470 1.00 28.78 ? 1178 GLU A CG  1 
ATOM   828   C CD  . GLU A  1 105 ? -10.238 -24.875 -25.423 1.00 27.06 ? 1178 GLU A CD  1 
ATOM   829   O OE1 . GLU A  1 105 ? -11.374 -25.366 -25.310 1.00 25.31 ? 1178 GLU A OE1 1 
ATOM   830   O OE2 . GLU A  1 105 ? -10.059 -23.648 -25.588 1.00 30.71 ? 1178 GLU A OE2 1 
ATOM   831   N N   . GLY A  1 106 ? -6.506  -27.045 -22.701 1.00 20.32 ? 1179 GLY A N   1 
ATOM   832   C CA  . GLY A  1 106 ? -5.351  -26.240 -22.308 1.00 23.62 ? 1179 GLY A CA  1 
ATOM   833   C C   . GLY A  1 106 ? -4.060  -26.835 -22.859 1.00 22.70 ? 1179 GLY A C   1 
ATOM   834   O O   . GLY A  1 106 ? -3.925  -28.051 -22.939 1.00 21.47 ? 1179 GLY A O   1 
ATOM   835   N N   . ARG A  1 107 ? -3.117  -25.958 -23.199 1.00 32.17 ? 1180 ARG A N   1 
ATOM   836   C CA  . ARG A  1 107 ? -1.847  -26.363 -23.802 1.00 34.07 ? 1180 ARG A CA  1 
ATOM   837   C C   . ARG A  1 107 ? -0.877  -26.968 -22.793 1.00 35.24 ? 1180 ARG A C   1 
ATOM   838   O O   . ARG A  1 107 ? -0.107  -27.848 -23.133 1.00 38.04 ? 1180 ARG A O   1 
ATOM   839   C CB  . ARG A  1 107 ? -1.187  -25.125 -24.414 1.00 33.61 ? 1180 ARG A CB  1 
ATOM   840   C CG  . ARG A  1 107 ? -0.962  -24.021 -23.374 1.00 44.05 ? 1180 ARG A CG  1 
ATOM   841   C CD  . ARG A  1 107 ? 0.087   -22.993 -23.846 1.00 51.92 ? 1180 ARG A CD  1 
ATOM   842   N NE  . ARG A  1 107 ? 0.338   -21.962 -22.831 1.00 55.07 ? 1180 ARG A NE  1 
ATOM   843   C CZ  . ARG A  1 107 ? -0.253  -20.769 -22.817 1.00 56.06 ? 1180 ARG A CZ  1 
ATOM   844   N NH1 . ARG A  1 107 ? 0.033   -19.884 -21.859 1.00 58.85 ? 1180 ARG A NH1 1 
ATOM   845   N NH2 . ARG A  1 107 ? -1.128  -20.458 -23.773 1.00 56.67 ? 1180 ARG A NH2 1 
ATOM   846   N N   . LYS A  1 108 ? -0.895  -26.476 -21.559 1.00 26.37 ? 1181 LYS A N   1 
ATOM   847   C CA  . LYS A  1 108 ? -0.025  -26.987 -20.515 1.00 29.96 ? 1181 LYS A CA  1 
ATOM   848   C C   . LYS A  1 108 ? -0.784  -27.666 -19.382 1.00 28.74 ? 1181 LYS A C   1 
ATOM   849   O O   . LYS A  1 108 ? -1.958  -27.343 -19.126 1.00 25.06 ? 1181 LYS A O   1 
ATOM   850   C CB  . LYS A  1 108 ? 0.830   -25.836 -19.972 1.00 35.07 ? 1181 LYS A CB  1 
ATOM   851   C CG  . LYS A  1 108 ? 1.722   -25.200 -21.039 1.00 37.48 ? 1181 LYS A CG  1 
ATOM   852   C CD  . LYS A  1 108 ? 2.350   -23.889 -20.554 1.00 46.66 ? 1181 LYS A CD  1 
ATOM   853   C CE  . LYS A  1 108 ? 3.208   -23.243 -21.674 1.00 55.00 ? 1181 LYS A CE  1 
ATOM   854   N NZ  . LYS A  1 108 ? 3.820   -21.883 -21.376 1.00 51.66 ? 1181 LYS A NZ  1 
ATOM   855   N N   . SER A  1 109 ? -0.108  -28.577 -18.690 1.00 28.81 ? 1182 SER A N   1 
ATOM   856   C CA  . SER A  1 109 ? -0.730  -29.362 -17.647 1.00 28.68 ? 1182 SER A CA  1 
ATOM   857   C C   . SER A  1 109 ? -1.297  -28.470 -16.513 1.00 31.34 ? 1182 SER A C   1 
ATOM   858   O O   . SER A  1 109 ? -2.414  -28.740 -15.987 1.00 27.13 ? 1182 SER A O   1 
ATOM   859   C CB  . SER A  1 109 ? 0.283   -30.382 -17.111 1.00 34.48 ? 1182 SER A CB  1 
ATOM   860   O OG  . SER A  1 109 ? -0.341  -31.290 -16.229 1.00 45.91 ? 1182 SER A OG  1 
ATOM   861   N N   . ASN A  1 110 ? -0.575  -27.410 -16.125 1.00 27.45 ? 1183 ASN A N   1 
ATOM   862   C CA  . ASN A  1 110 ? -1.066  -26.524 -15.066 1.00 32.92 ? 1183 ASN A CA  1 
ATOM   863   C C   . ASN A  1 110 ? -2.372  -25.794 -15.399 1.00 28.18 ? 1183 ASN A C   1 
ATOM   864   O O   . ASN A  1 110 ? -3.263  -25.654 -14.559 1.00 26.07 ? 1183 ASN A O   1 
ATOM   865   C CB  . ASN A  1 110 ? 0.001   -25.502 -14.596 1.00 33.61 ? 1183 ASN A CB  1 
ATOM   866   C CG  . ASN A  1 110 ? 0.184   -24.337 -15.572 1.00 38.43 ? 1183 ASN A CG  1 
ATOM   867   O OD1 . ASN A  1 110 ? 0.312   -24.523 -16.796 1.00 37.25 ? 1183 ASN A OD1 1 
ATOM   868   N ND2 . ASN A  1 110 ? 0.216   -23.122 -15.030 1.00 47.90 ? 1183 ASN A ND2 1 
ATOM   869   N N   . ILE A  1 111 ? -2.450  -25.287 -16.616 1.00 25.57 ? 1184 ILE A N   1 
ATOM   870   C CA  . ILE A  1 111 ? -3.640  -24.681 -17.149 1.00 22.94 ? 1184 ILE A CA  1 
ATOM   871   C C   . ILE A  1 111 ? -4.795  -25.689 -17.171 1.00 20.53 ? 1184 ILE A C   1 
ATOM   872   O O   . ILE A  1 111 ? -5.904  -25.339 -16.777 1.00 19.52 ? 1184 ILE A O   1 
ATOM   873   C CB  . ILE A  1 111 ? -3.360  -24.198 -18.566 1.00 30.96 ? 1184 ILE A CB  1 
ATOM   874   C CG1 . ILE A  1 111 ? -2.184  -23.212 -18.489 1.00 34.49 ? 1184 ILE A CG1 1 
ATOM   875   C CG2 . ILE A  1 111 ? -4.569  -23.505 -19.127 1.00 28.86 ? 1184 ILE A CG2 1 
ATOM   876   C CD1 . ILE A  1 111 ? -1.579  -22.873 -19.870 1.00 42.41 ? 1184 ILE A CD1 1 
ATOM   877   N N   . ARG A  1 112 ? -4.541  -26.906 -17.651 1.00 21.86 ? 1185 ARG A N   1 
ATOM   878   C CA  . ARG A  1 112 ? -5.590  -27.905 -17.659 1.00 16.05 ? 1185 ARG A CA  1 
ATOM   879   C C   . ARG A  1 112 ? -6.034  -28.192 -16.240 1.00 21.27 ? 1185 ARG A C   1 
ATOM   880   O O   . ARG A  1 112 ? -7.208  -28.396 -15.991 1.00 16.76 ? 1185 ARG A O   1 
ATOM   881   C CB  . ARG A  1 112 ? -5.146  -29.200 -18.343 1.00 18.54 ? 1185 ARG A CB  1 
ATOM   882   C CG  . ARG A  1 112 ? -4.924  -29.021 -19.867 1.00 22.84 ? 1185 ARG A CG  1 
ATOM   883   C CD  . ARG A  1 112 ? -4.776  -30.414 -20.544 1.00 20.65 ? 1185 ARG A CD  1 
ATOM   884   N NE  . ARG A  1 112 ? -3.540  -31.103 -20.135 1.00 24.08 ? 1185 ARG A NE  1 
ATOM   885   C CZ  . ARG A  1 112 ? -2.329  -30.919 -20.679 1.00 29.38 ? 1185 ARG A CZ  1 
ATOM   886   N NH1 . ARG A  1 112 ? -2.132  -30.064 -21.659 1.00 27.10 ? 1185 ARG A NH1 1 
ATOM   887   N NH2 . ARG A  1 112 ? -1.291  -31.608 -20.220 1.00 32.31 ? 1185 ARG A NH2 1 
ATOM   888   N N   . LYS A  1 113 ? -5.095  -28.309 -15.312 1.00 17.97 ? 1186 LYS A N   1 
ATOM   889   C CA  . LYS A  1 113 ? -5.503  -28.560 -13.909 1.00 22.97 ? 1186 LYS A CA  1 
ATOM   890   C C   . LYS A  1 113 ? -6.351  -27.417 -13.305 1.00 17.28 ? 1186 LYS A C   1 
ATOM   891   O O   . LYS A  1 113 ? -7.348  -27.717 -12.557 1.00 20.33 ? 1186 LYS A O   1 
ATOM   892   C CB  . LYS A  1 113 ? -4.266  -28.891 -13.041 1.00 21.98 ? 1186 LYS A CB  1 
ATOM   893   C CG  . LYS A  1 113 ? -4.588  -29.810 -11.868 1.00 24.78 ? 1186 LYS A CG  1 
ATOM   894   C CD  . LYS A  1 113 ? -3.468  -29.824 -10.799 1.00 27.39 ? 1186 LYS A CD  1 
ATOM   895   C CE  . LYS A  1 113 ? -3.308  -28.471 -10.179 1.00 26.44 ? 1186 LYS A CE  1 
ATOM   896   N NZ  . LYS A  1 113 ? -2.574  -28.638 -8.856  1.00 21.89 ? 1186 LYS A NZ  1 
ATOM   897   N N   . SER A  1 114 ? -6.061  -26.158 -13.664 1.00 16.25 ? 1187 SER A N   1 
ATOM   898   C CA  . SER A  1 114 ? -6.812  -24.985 -13.226 1.00 20.63 ? 1187 SER A CA  1 
ATOM   899   C C   . SER A  1 114 ? -8.263  -25.122 -13.752 1.00 15.81 ? 1187 SER A C   1 
ATOM   900   O O   . SER A  1 114 ? -9.247  -24.823 -13.047 1.00 16.59 ? 1187 SER A O   1 
ATOM   901   C CB  . SER A  1 114 ? -6.224  -23.709 -13.846 1.00 22.60 ? 1187 SER A CB  1 
ATOM   902   O OG  . SER A  1 114 ? -6.993  -22.579 -13.478 1.00 31.72 ? 1187 SER A OG  1 
ATOM   903   N N   . VAL A  1 115 ? -8.340  -25.517 -15.028 1.00 14.49 ? 1188 VAL A N   1 
ATOM   904   C CA  . VAL A  1 115 ? -9.667  -25.698 -15.660 1.00 13.00 ? 1188 VAL A CA  1 
ATOM   905   C C   . VAL A  1 115 ? -10.424 -26.792 -14.950 1.00 15.23 ? 1188 VAL A C   1 
ATOM   906   O O   . VAL A  1 115 ? -11.664 -26.651 -14.671 1.00 14.11 ? 1188 VAL A O   1 
ATOM   907   C CB  . VAL A  1 115 ? -9.515  -25.983 -17.177 1.00 13.94 ? 1188 VAL A CB  1 
ATOM   908   C CG1 . VAL A  1 115 ? -10.837 -26.487 -17.799 1.00 13.70 ? 1188 VAL A CG1 1 
ATOM   909   C CG2 . VAL A  1 115 ? -9.084  -24.688 -17.845 1.00 15.14 ? 1188 VAL A CG2 1 
ATOM   910   N N   . GLN A  1 116 ? -9.764  -27.930 -14.739 1.00 13.01 ? 1189 GLN A N   1 
ATOM   911   C CA  . GLN A  1 116 ? -10.419 -29.071 -14.055 1.00 13.54 ? 1189 GLN A CA  1 
ATOM   912   C C   . GLN A  1 116 ? -10.917 -28.660 -12.681 1.00 14.76 ? 1189 GLN A C   1 
ATOM   913   O O   . GLN A  1 116 ? -12.045 -29.016 -12.285 1.00 13.23 ? 1189 GLN A O   1 
ATOM   914   C CB  . GLN A  1 116 ? -9.513  -30.277 -13.908 1.00 15.38 ? 1189 GLN A CB  1 
ATOM   915   C CG  . GLN A  1 116 ? -9.148  -30.990 -15.162 1.00 21.19 ? 1189 GLN A CG  1 
ATOM   916   C CD  . GLN A  1 116 ? -8.094  -32.066 -14.796 1.00 26.49 ? 1189 GLN A CD  1 
ATOM   917   O OE1 . GLN A  1 116 ? -8.381  -32.977 -14.009 1.00 32.77 ? 1189 GLN A OE1 1 
ATOM   918   N NE2 . GLN A  1 116 ? -6.873  -31.893 -15.289 1.00 32.47 ? 1189 GLN A NE2 1 
ATOM   919   N N   . ILE A  1 117 ? -10.092 -27.984 -11.877 1.00 12.87 ? 1190 ILE A N   1 
ATOM   920   C CA  . ILE A  1 117 ? -10.564 -27.495 -10.550 1.00 12.39 ? 1190 ILE A CA  1 
ATOM   921   C C   . ILE A  1 117 ? -11.782 -26.591 -10.681 1.00 14.06 ? 1190 ILE A C   1 
ATOM   922   O O   . ILE A  1 117 ? -12.779 -26.757 -9.967  1.00 13.67 ? 1190 ILE A O   1 
ATOM   923   C CB  . ILE A  1 117 ? -9.454  -26.753 -9.770  1.00 14.69 ? 1190 ILE A CB  1 
ATOM   924   C CG1 . ILE A  1 117 ? -8.480  -27.840 -9.304  1.00 14.78 ? 1190 ILE A CG1 1 
ATOM   925   C CG2 . ILE A  1 117 ? -10.018 -25.934 -8.608  1.00 17.65 ? 1190 ILE A CG2 1 
ATOM   926   C CD1 . ILE A  1 117 ? -7.094  -27.240 -8.882  1.00 16.51 ? 1190 ILE A CD1 1 
ATOM   927   N N   . ALA A  1 118 ? -11.743 -25.670 -11.660 1.00 10.55 ? 1191 ALA A N   1 
ATOM   928   C CA  . ALA A  1 118 ? -12.850 -24.776 -11.853 1.00 13.18 ? 1191 ALA A CA  1 
ATOM   929   C C   . ALA A  1 118 ? -14.106 -25.584 -12.236 1.00 10.40 ? 1191 ALA A C   1 
ATOM   930   O O   . ALA A  1 118 ? -15.237 -25.185 -11.852 1.00 12.70 ? 1191 ALA A O   1 
ATOM   931   C CB  . ALA A  1 118 ? -12.527 -23.777 -12.976 1.00 12.70 ? 1191 ALA A CB  1 
ATOM   932   N N   . TYR A  1 119 ? -13.934 -26.646 -13.015 1.00 10.86 ? 1192 TYR A N   1 
ATOM   933   C CA  . TYR A  1 119 ? -15.129 -27.414 -13.450 1.00 10.34 ? 1192 TYR A CA  1 
ATOM   934   C C   . TYR A  1 119 ? -15.762 -28.046 -12.225 1.00 12.53 ? 1192 TYR A C   1 
ATOM   935   O O   . TYR A  1 119 ? -17.003 -28.056 -12.091 1.00 11.48 ? 1192 TYR A O   1 
ATOM   936   C CB  . TYR A  1 119 ? -14.690 -28.469 -14.387 1.00 11.89 ? 1192 TYR A CB  1 
ATOM   937   C CG  . TYR A  1 119 ? -15.747 -29.454 -14.817 1.00 12.48 ? 1192 TYR A CG  1 
ATOM   938   C CD1 . TYR A  1 119 ? -16.653 -29.083 -15.807 1.00 12.37 ? 1192 TYR A CD1 1 
ATOM   939   C CD2 . TYR A  1 119 ? -15.809 -30.740 -14.270 1.00 14.14 ? 1192 TYR A CD2 1 
ATOM   940   C CE1 . TYR A  1 119 ? -17.633 -29.952 -16.224 1.00 15.13 ? 1192 TYR A CE1 1 
ATOM   941   C CE2 . TYR A  1 119 ? -16.773 -31.608 -14.701 1.00 19.36 ? 1192 TYR A CE2 1 
ATOM   942   C CZ  . TYR A  1 119 ? -17.683 -31.200 -15.665 1.00 18.66 ? 1192 TYR A CZ  1 
ATOM   943   O OH  . TYR A  1 119 ? -18.650 -32.116 -16.080 1.00 19.26 ? 1192 TYR A OH  1 
ATOM   944   N N   . HIS A  1 120 ? -14.925 -28.654 -11.395 1.00 14.24 ? 1193 HIS A N   1 
ATOM   945   C CA  . HIS A  1 120 ? -15.488 -29.237 -10.174 1.00 13.83 ? 1193 HIS A CA  1 
ATOM   946   C C   . HIS A  1 120 ? -16.050 -28.204 -9.211  1.00 14.13 ? 1193 HIS A C   1 
ATOM   947   O O   . HIS A  1 120 ? -17.096 -28.497 -8.537  1.00 12.87 ? 1193 HIS A O   1 
ATOM   948   C CB  . HIS A  1 120 ? -14.471 -30.145 -9.455  1.00 11.76 ? 1193 HIS A CB  1 
ATOM   949   C CG  . HIS A  1 120 ? -14.143 -31.335 -10.278 1.00 15.92 ? 1193 HIS A CG  1 
ATOM   950   N ND1 . HIS A  1 120 ? -15.096 -32.243 -10.684 1.00 16.21 ? 1193 HIS A ND1 1 
ATOM   951   C CD2 . HIS A  1 120 ? -12.986 -31.688 -10.898 1.00 17.48 ? 1193 HIS A CD2 1 
ATOM   952   C CE1 . HIS A  1 120 ? -14.520 -33.150 -11.462 1.00 23.47 ? 1193 HIS A CE1 1 
ATOM   953   N NE2 . HIS A  1 120 ? -13.235 -32.838 -11.584 1.00 19.28 ? 1193 HIS A NE2 1 
ATOM   954   N N   . ARG A  1 121 ? -15.483 -27.007 -9.190  1.00 11.66 ? 1194 ARG A N   1 
ATOM   955   C CA  . ARG A  1 121 ? -16.115 -25.902 -8.446  1.00 12.94 ? 1194 ARG A CA  1 
ATOM   956   C C   . ARG A  1 121 ? -17.509 -25.526 -9.024  1.00 13.09 ? 1194 ARG A C   1 
ATOM   957   O O   . ARG A  1 121 ? -18.468 -25.334 -8.243  1.00 13.91 ? 1194 ARG A O   1 
ATOM   958   C CB  . ARG A  1 121 ? -15.238 -24.695 -8.412  1.00 17.01 ? 1194 ARG A CB  1 
ATOM   959   C CG  . ARG A  1 121 ? -13.980 -24.916 -7.571  1.00 17.96 ? 1194 ARG A CG  1 
ATOM   960   C CD  . ARG A  1 121 ? -13.154 -23.640 -7.830  1.00 23.52 ? 1194 ARG A CD  1 
ATOM   961   N NE  . ARG A  1 121 ? -11.953 -23.597 -7.043  1.00 29.13 ? 1194 ARG A NE  1 
ATOM   962   C CZ  . ARG A  1 121 ? -10.927 -22.802 -7.333  1.00 31.48 ? 1194 ARG A CZ  1 
ATOM   963   N NH1 . ARG A  1 121 ? -9.835  -22.840 -6.575  1.00 26.13 ? 1194 ARG A NH1 1 
ATOM   964   N NH2 . ARG A  1 121 ? -10.982 -22.024 -8.420  1.00 24.87 ? 1194 ARG A NH2 1 
ATOM   965   N N   . ALA A  1 122 ? -17.590 -25.469 -10.366 1.00 11.26 ? 1195 ALA A N   1 
ATOM   966   C CA  . ALA A  1 122 ? -18.858 -25.158 -11.033 1.00 11.31 ? 1195 ALA A CA  1 
ATOM   967   C C   . ALA A  1 122 ? -19.915 -26.221 -10.620 1.00 11.78 ? 1195 ALA A C   1 
ATOM   968   O O   . ALA A  1 122 ? -21.083 -25.861 -10.371 1.00 13.44 ? 1195 ALA A O   1 
ATOM   969   C CB  . ALA A  1 122 ? -18.677 -25.196 -12.604 1.00 12.17 ? 1195 ALA A CB  1 
ATOM   970   N N   . LEU A  1 123 ? -19.559 -27.493 -10.647 1.00 11.00 ? 1196 LEU A N   1 
ATOM   971   C CA  . LEU A  1 123 ? -20.569 -28.551 -10.344 1.00 12.21 ? 1196 LEU A CA  1 
ATOM   972   C C   . LEU A  1 123 ? -20.912 -28.512 -8.875  1.00 15.41 ? 1196 LEU A C   1 
ATOM   973   O O   . LEU A  1 123 ? -22.022 -28.849 -8.499  1.00 14.85 ? 1196 LEU A O   1 
ATOM   974   C CB  . LEU A  1 123 ? -20.073 -29.933 -10.760 1.00 11.82 ? 1196 LEU A CB  1 
ATOM   975   C CG  . LEU A  1 123 ? -19.811 -30.169 -12.260 1.00 14.99 ? 1196 LEU A CG  1 
ATOM   976   C CD1 . LEU A  1 123 ? -19.560 -31.657 -12.534 1.00 17.89 ? 1196 LEU A CD1 1 
ATOM   977   C CD2 . LEU A  1 123 ? -20.889 -29.542 -13.136 1.00 20.22 ? 1196 LEU A CD2 1 
ATOM   978   N N   . GLN A  1 124 ? -19.975 -28.105 -8.012  1.00 14.02 ? 1197 GLN A N   1 
ATOM   979   C CA  . GLN A  1 124 ? -20.392 -27.945 -6.604  1.00 14.38 ? 1197 GLN A CA  1 
ATOM   980   C C   . GLN A  1 124 ? -21.390 -26.799 -6.414  1.00 14.13 ? 1197 GLN A C   1 
ATOM   981   O O   . GLN A  1 124 ? -22.325 -26.872 -5.560  1.00 16.19 ? 1197 GLN A O   1 
ATOM   982   C CB  . GLN A  1 124 ? -19.177 -27.638 -5.692  1.00 13.12 ? 1197 GLN A CB  1 
ATOM   983   C CG  . GLN A  1 124 ? -18.398 -28.888 -5.465  1.00 14.93 ? 1197 GLN A CG  1 
ATOM   984   C CD  . GLN A  1 124 ? -17.064 -28.566 -4.785  1.00 21.46 ? 1197 GLN A CD  1 
ATOM   985   O OE1 . GLN A  1 124 ? -17.026 -28.287 -3.584  1.00 19.85 ? 1197 GLN A OE1 1 
ATOM   986   N NE2 . GLN A  1 124 ? -15.979 -28.516 -5.575  1.00 16.55 ? 1197 GLN A NE2 1 
ATOM   987   N N   . HIS A  1 125 ? -21.212 -25.743 -7.189  1.00 11.89 ? 1198 HIS A N   1 
ATOM   988   C CA  . HIS A  1 125 ? -22.164 -24.638 -7.148  1.00 16.16 ? 1198 HIS A CA  1 
ATOM   989   C C   . HIS A  1 125 ? -23.538 -25.172 -7.583  1.00 12.53 ? 1198 HIS A C   1 
ATOM   990   O O   . HIS A  1 125 ? -24.574 -24.929 -6.874  1.00 14.59 ? 1198 HIS A O   1 
ATOM   991   C CB  . HIS A  1 125 ? -21.753 -23.524 -8.070  1.00 13.74 ? 1198 HIS A CB  1 
ATOM   992   C CG  . HIS A  1 125 ? -22.818 -22.487 -8.276  1.00 12.37 ? 1198 HIS A CG  1 
ATOM   993   N ND1 . HIS A  1 125 ? -22.930 -21.373 -7.479  1.00 18.05 ? 1198 HIS A ND1 1 
ATOM   994   C CD2 . HIS A  1 125 ? -23.800 -22.411 -9.202  1.00 15.72 ? 1198 HIS A CD2 1 
ATOM   995   C CE1 . HIS A  1 125 ? -23.968 -20.661 -7.893  1.00 19.77 ? 1198 HIS A CE1 1 
ATOM   996   N NE2 . HIS A  1 125 ? -24.486 -21.259 -8.944  1.00 16.36 ? 1198 HIS A NE2 1 
ATOM   997   N N   . ARG A  1 126 ? -23.551 -25.923 -8.688  1.00 10.70 ? 1199 ARG A N   1 
ATOM   998   C CA  . ARG A  1 126 ? -24.835 -26.494 -9.133  1.00 15.04 ? 1199 ARG A CA  1 
ATOM   999   C C   . ARG A  1 126 ? -25.465 -27.349 -8.042  1.00 14.97 ? 1199 ARG A C   1 
ATOM   1000  O O   . ARG A  1 126 ? -26.702 -27.263 -7.803  1.00 15.97 ? 1199 ARG A O   1 
ATOM   1001  C CB  A ARG A  1 126 ? -24.595 -27.334 -10.388 0.30 15.85 ? 1199 ARG A CB  1 
ATOM   1002  C CB  B ARG A  1 126 ? -24.663 -27.342 -10.373 0.70 15.78 ? 1199 ARG A CB  1 
ATOM   1003  C CG  A ARG A  1 126 ? -25.749 -28.221 -10.833 0.30 17.82 ? 1199 ARG A CG  1 
ATOM   1004  C CG  B ARG A  1 126 ? -25.988 -27.819 -10.981 0.70 18.02 ? 1199 ARG A CG  1 
ATOM   1005  C CD  A ARG A  1 126 ? -25.400 -28.916 -12.163 0.30 16.53 ? 1199 ARG A CD  1 
ATOM   1006  C CD  B ARG A  1 126 ? -25.674 -28.518 -12.308 0.70 16.73 ? 1199 ARG A CD  1 
ATOM   1007  N NE  A ARG A  1 126 ? -25.462 -28.027 -13.329 0.30 21.14 ? 1199 ARG A NE  1 
ATOM   1008  N NE  B ARG A  1 126 ? -24.985 -29.786 -12.129 0.70 16.50 ? 1199 ARG A NE  1 
ATOM   1009  C CZ  A ARG A  1 126 ? -25.240 -28.434 -14.586 0.30 19.60 ? 1199 ARG A CZ  1 
ATOM   1010  C CZ  B ARG A  1 126 ? -24.585 -30.568 -13.129 0.70 17.20 ? 1199 ARG A CZ  1 
ATOM   1011  N NH1 A ARG A  1 126 ? -25.315 -27.591 -15.611 0.30 14.00 ? 1199 ARG A NH1 1 
ATOM   1012  N NH1 B ARG A  1 126 ? -24.016 -31.697 -12.881 0.70 17.97 ? 1199 ARG A NH1 1 
ATOM   1013  N NH2 A ARG A  1 126 ? -24.954 -29.699 -14.809 0.30 19.98 ? 1199 ARG A NH2 1 
ATOM   1014  N NH2 B ARG A  1 126 ? -24.771 -30.203 -14.377 0.70 20.81 ? 1199 ARG A NH2 1 
ATOM   1015  N N   . SER A  1 127 ? -24.665 -28.216 -7.408  1.00 12.21 ? 1200 SER A N   1 
ATOM   1016  C CA  . SER A  1 127 ? -25.191 -29.072 -6.345  1.00 15.89 ? 1200 SER A CA  1 
ATOM   1017  C C   . SER A  1 127 ? -25.787 -28.272 -5.194  1.00 17.79 ? 1200 SER A C   1 
ATOM   1018  O O   . SER A  1 127 ? -26.857 -28.646 -4.662  1.00 17.48 ? 1200 SER A O   1 
ATOM   1019  C CB  . SER A  1 127 ? -24.075 -30.013 -5.848  1.00 19.88 ? 1200 SER A CB  1 
ATOM   1020  O OG  . SER A  1 127 ? -24.492 -30.790 -4.754  1.00 32.09 ? 1200 SER A OG  1 
ATOM   1021  N N   . LYS A  1 128 ? -25.120 -27.192 -4.794  1.00 13.29 ? 1201 LYS A N   1 
ATOM   1022  C CA  . LYS A  1 128 ? -25.632 -26.319 -3.716  1.00 15.50 ? 1201 LYS A CA  1 
ATOM   1023  C C   . LYS A  1 128 ? -26.968 -25.725 -4.106  1.00 17.28 ? 1201 LYS A C   1 
ATOM   1024  O O   . LYS A  1 128 ? -27.913 -25.778 -3.302  1.00 18.82 ? 1201 LYS A O   1 
ATOM   1025  C CB  . LYS A  1 128 ? -24.688 -25.166 -3.376  1.00 17.05 ? 1201 LYS A CB  1 
ATOM   1026  C CG  . LYS A  1 128 ? -23.398 -25.631 -2.752  1.00 29.55 ? 1201 LYS A CG  1 
ATOM   1027  C CD  . LYS A  1 128 ? -22.581 -24.413 -2.262  1.00 34.83 ? 1201 LYS A CD  1 
ATOM   1028  C CE  . LYS A  1 128 ? -21.357 -24.914 -1.482  1.00 48.39 ? 1201 LYS A CE  1 
ATOM   1029  N NZ  . LYS A  1 128 ? -20.299 -23.878 -1.205  1.00 53.48 ? 1201 LYS A NZ  1 
ATOM   1030  N N   . VAL A  1 129 ? -27.055 -25.196 -5.329  1.00 13.56 ? 1202 VAL A N   1 
ATOM   1031  C CA  . VAL A  1 129 ? -28.307 -24.604 -5.826  1.00 16.27 ? 1202 VAL A CA  1 
ATOM   1032  C C   . VAL A  1 129 ? -29.427 -25.660 -5.844  1.00 18.65 ? 1202 VAL A C   1 
ATOM   1033  O O   . VAL A  1 129 ? -30.594 -25.312 -5.483  1.00 20.36 ? 1202 VAL A O   1 
ATOM   1034  C CB  . VAL A  1 129 ? -28.150 -23.949 -7.221  1.00 16.13 ? 1202 VAL A CB  1 
ATOM   1035  C CG1 . VAL A  1 129 ? -29.541 -23.561 -7.760  1.00 20.67 ? 1202 VAL A CG1 1 
ATOM   1036  C CG2 . VAL A  1 129 ? -27.321 -22.755 -7.027  1.00 16.02 ? 1202 VAL A CG2 1 
ATOM   1037  N N   . GLN A  1 130 ? -29.076 -26.933 -6.146  1.00 15.21 ? 1203 GLN A N   1 
ATOM   1038  C CA  . GLN A  1 130 ? -30.065 -28.000 -6.332  1.00 18.42 ? 1203 GLN A CA  1 
ATOM   1039  C C   . GLN A  1 130 ? -30.459 -28.582 -5.019  1.00 19.33 ? 1203 GLN A C   1 
ATOM   1040  O O   . GLN A  1 130 ? -31.307 -29.475 -4.995  1.00 21.37 ? 1203 GLN A O   1 
ATOM   1041  C CB  . GLN A  1 130 ? -29.588 -29.092 -7.274  1.00 17.32 ? 1203 GLN A CB  1 
ATOM   1042  C CG  . GLN A  1 130 ? -29.491 -28.505 -8.680  1.00 18.43 ? 1203 GLN A CG  1 
ATOM   1043  C CD  . GLN A  1 130 ? -29.130 -29.508 -9.770  1.00 23.88 ? 1203 GLN A CD  1 
ATOM   1044  O OE1 . GLN A  1 130 ? -29.581 -29.370 -10.909 1.00 36.80 ? 1203 GLN A OE1 1 
ATOM   1045  N NE2 . GLN A  1 130 ? -28.284 -30.433 -9.468  1.00 23.55 ? 1203 GLN A NE2 1 
ATOM   1046  N N   . GLY A  1 131 ? -29.819 -28.102 -3.978  1.00 16.75 ? 1204 GLY A N   1 
ATOM   1047  C CA  . GLY A  1 131 ? -30.240 -28.478 -2.613  1.00 22.50 ? 1204 GLY A CA  1 
ATOM   1048  C C   . GLY A  1 131 ? -29.531 -29.697 -2.059  1.00 30.25 ? 1204 GLY A C   1 
ATOM   1049  O O   . GLY A  1 131 ? -30.007 -30.338 -1.119  1.00 26.20 ? 1204 GLY A O   1 
ATOM   1050  N N   . GLU A  1 132 ? -28.396 -30.053 -2.642  1.00 24.80 ? 1205 GLU A N   1 
ATOM   1051  C CA  . GLU A  1 132 ? -27.647 -31.178 -2.103  1.00 31.86 ? 1205 GLU A CA  1 
ATOM   1052  C C   . GLU A  1 132 ? -26.890 -30.688 -0.885  1.00 40.70 ? 1205 GLU A C   1 
ATOM   1053  O O   . GLU A  1 132 ? -26.579 -31.513 -0.014  1.00 47.56 ? 1205 GLU A O   1 
ATOM   1054  C CB  . GLU A  1 132 ? -26.706 -31.771 -3.136  1.00 31.16 ? 1205 GLU A CB  1 
ATOM   1055  C CG  . GLU A  1 132 ? -27.399 -32.679 -4.096  1.00 38.95 ? 1205 GLU A CG  1 
ATOM   1056  C CD  . GLU A  1 132 ? -26.499 -33.809 -4.532  1.00 48.77 ? 1205 GLU A CD  1 
ATOM   1057  O OE1 . GLU A  1 132 ? -27.002 -34.952 -4.708  1.00 49.07 ? 1205 GLU A OE1 1 
ATOM   1058  O OE2 . GLU A  1 132 ? -25.281 -33.542 -4.675  1.00 49.62 ? 1205 GLU A OE2 1 
ATOM   1059  O OXT . GLU A  1 132 ? -26.603 -29.471 -0.740  1.00 39.78 ? 1205 GLU A OXT 1 
ATOM   1060  N N   . ALA B  2 3   ? -28.110 -10.809 4.299   1.00 50.69 ? 24   ALA B N   1 
ATOM   1061  C CA  . ALA B  2 3   ? -28.237 -9.806  3.243   1.00 46.44 ? 24   ALA B CA  1 
ATOM   1062  C C   . ALA B  2 3   ? -27.493 -10.339 2.033   1.00 41.93 ? 24   ALA B C   1 
ATOM   1063  O O   . ALA B  2 3   ? -26.282 -10.616 2.101   1.00 41.65 ? 24   ALA B O   1 
ATOM   1064  C CB  . ALA B  2 3   ? -27.651 -8.489  3.679   1.00 46.84 ? 24   ALA B CB  1 
ATOM   1065  N N   . ALA B  2 4   ? -28.216 -10.472 0.929   1.00 38.29 ? 25   ALA B N   1 
ATOM   1066  C CA  . ALA B  2 4   ? -27.710 -11.257 -0.196  1.00 38.31 ? 25   ALA B CA  1 
ATOM   1067  C C   . ALA B  2 4   ? -26.376 -10.729 -0.704  1.00 34.50 ? 25   ALA B C   1 
ATOM   1068  O O   . ALA B  2 4   ? -25.438 -11.495 -0.934  1.00 30.38 ? 25   ALA B O   1 
ATOM   1069  C CB  . ALA B  2 4   ? -28.721 -11.286 -1.319  1.00 34.98 ? 25   ALA B CB  1 
ATOM   1070  N N   . ARG B  2 5   ? -26.291 -9.423  -0.894  1.00 33.00 ? 26   ARG B N   1 
ATOM   1071  C CA  . ARG B  2 5   ? -25.093 -8.872  -1.523  1.00 33.41 ? 26   ARG B CA  1 
ATOM   1072  C C   . ARG B  2 5   ? -23.831 -9.136  -0.711  1.00 34.01 ? 26   ARG B C   1 
ATOM   1073  O O   . ARG B  2 5   ? -22.809 -9.587  -1.247  1.00 33.91 ? 26   ARG B O   1 
ATOM   1074  C CB  . ARG B  2 5   ? -25.231 -7.381  -1.828  1.00 28.22 ? 26   ARG B CB  1 
ATOM   1075  C CG  . ARG B  2 5   ? -24.015 -6.849  -2.590  1.00 30.69 ? 26   ARG B CG  1 
ATOM   1076  C CD  . ARG B  2 5   ? -24.347 -5.497  -3.208  1.00 33.34 ? 26   ARG B CD  1 
ATOM   1077  N NE  . ARG B  2 5   ? -23.194 -4.909  -3.870  1.00 34.76 ? 26   ARG B NE  1 
ATOM   1078  C CZ  . ARG B  2 5   ? -23.294 -3.820  -4.623  1.00 30.52 ? 26   ARG B CZ  1 
ATOM   1079  N NH1 . ARG B  2 5   ? -22.227 -3.312  -5.231  1.00 33.98 ? 26   ARG B NH1 1 
ATOM   1080  N NH2 . ARG B  2 5   ? -24.495 -3.280  -4.797  1.00 30.94 ? 26   ARG B NH2 1 
ATOM   1081  N N   . LYS B  2 6   ? -23.908 -8.851  0.583   1.00 32.85 ? 27   LYS B N   1 
ATOM   1082  C CA  . LYS B  2 6   ? -22.786 -9.041  1.474   1.00 32.05 ? 27   LYS B CA  1 
ATOM   1083  C C   . LYS B  2 6   ? -22.447 -10.520 1.624   1.00 35.59 ? 27   LYS B C   1 
ATOM   1084  O O   . LYS B  2 6   ? -21.276 -10.869 1.740   1.00 36.72 ? 27   LYS B O   1 
ATOM   1085  C CB  . LYS B  2 6   ? -23.121 -8.424  2.844   1.00 37.90 ? 27   LYS B CB  1 
ATOM   1086  C CG  . LYS B  2 6   ? -21.937 -8.186  3.757   1.00 43.14 ? 27   LYS B CG  1 
ATOM   1087  C CD  . LYS B  2 6   ? -22.289 -7.256  4.955   1.00 47.55 ? 27   LYS B CD  1 
ATOM   1088  C CE  . LYS B  2 6   ? -22.821 -5.870  4.524   1.00 48.44 ? 27   LYS B CE  1 
ATOM   1089  N NZ  . LYS B  2 6   ? -21.784 -4.971  3.904   1.00 43.08 ? 27   LYS B NZ  1 
ATOM   1090  N N   . SER B  2 7   ? -23.439 -11.408 1.590   1.00 32.47 ? 28   SER B N   1 
ATOM   1091  C CA  . SER B  2 7   ? -23.104 -12.822 1.838   1.00 30.62 ? 28   SER B CA  1 
ATOM   1092  C C   . SER B  2 7   ? -22.508 -13.571 0.605   1.00 30.43 ? 28   SER B C   1 
ATOM   1093  O O   . SER B  2 7   ? -21.934 -14.651 0.729   1.00 24.80 ? 28   SER B O   1 
ATOM   1094  C CB  . SER B  2 7   ? -24.253 -13.575 2.520   1.00 38.90 ? 28   SER B CB  1 
ATOM   1095  O OG  . SER B  2 7   ? -25.351 -13.773 1.679   1.00 41.61 ? 28   SER B OG  1 
ATOM   1096  N N   . ALA B  2 8   ? -22.611 -12.972 -0.564  1.00 23.99 ? 29   ALA B N   1 
ATOM   1097  C CA  . ALA B  2 8   ? -22.021 -13.560 -1.778  1.00 22.38 ? 29   ALA B CA  1 
ATOM   1098  C C   . ALA B  2 8   ? -20.501 -13.589 -1.721  1.00 23.15 ? 29   ALA B C   1 
ATOM   1099  O O   . ALA B  2 8   ? -19.890 -12.693 -1.132  1.00 28.96 ? 29   ALA B O   1 
ATOM   1100  C CB  . ALA B  2 8   ? -22.464 -12.749 -3.049  1.00 21.86 ? 29   ALA B CB  1 
ATOM   1101  N N   . PRO B  2 9   ? -19.881 -14.570 -2.421  1.00 24.06 ? 30   PRO B N   1 
ATOM   1102  C CA  . PRO B  2 9   ? -18.414 -14.636 -2.547  1.00 23.28 ? 30   PRO B CA  1 
ATOM   1103  C C   . PRO B  2 9   ? -17.847 -13.345 -3.156  1.00 25.76 ? 30   PRO B C   1 
ATOM   1104  O O   . PRO B  2 9   ? -18.430 -12.769 -4.055  1.00 23.27 ? 30   PRO B O   1 
ATOM   1105  C CB  . PRO B  2 9   ? -18.192 -15.778 -3.536  1.00 23.22 ? 30   PRO B CB  1 
ATOM   1106  C CG  . PRO B  2 9   ? -19.416 -16.589 -3.511  1.00 32.71 ? 30   PRO B CG  1 
ATOM   1107  C CD  . PRO B  2 9   ? -20.558 -15.688 -3.106  1.00 23.27 ? 30   PRO B CD  1 
ATOM   1108  N N   . ALA B  2 10  ? -16.683 -12.923 -2.672  1.00 22.87 ? 31   ALA B N   1 
ATOM   1109  C CA  . ALA B  2 10  ? -15.960 -11.799 -3.218  1.00 25.24 ? 31   ALA B CA  1 
ATOM   1110  C C   . ALA B  2 10  ? -15.618 -12.103 -4.641  1.00 24.60 ? 31   ALA B C   1 
ATOM   1111  O O   . ALA B  2 10  ? -15.459 -13.279 -5.010  1.00 24.92 ? 31   ALA B O   1 
ATOM   1112  C CB  . ALA B  2 10  ? -14.684 -11.606 -2.433  1.00 32.07 ? 31   ALA B CB  1 
ATOM   1113  N N   . THR B  2 11  ? -15.563 -11.055 -5.449  1.00 22.99 ? 32   THR B N   1 
ATOM   1114  C CA  . THR B  2 11  ? -15.154 -11.227 -6.841  1.00 19.57 ? 32   THR B CA  1 
ATOM   1115  C C   . THR B  2 11  ? -14.041 -10.284 -7.145  1.00 24.51 ? 32   THR B C   1 
ATOM   1116  O O   . THR B  2 11  ? -13.750 -9.356  -6.347  1.00 27.46 ? 32   THR B O   1 
ATOM   1117  C CB  . THR B  2 11  ? -16.287 -11.005 -7.832  1.00 20.68 ? 32   THR B CB  1 
ATOM   1118  O OG1 . THR B  2 11  ? -16.767 -9.648  -7.709  1.00 23.26 ? 32   THR B OG1 1 
ATOM   1119  C CG2 . THR B  2 11  ? -17.387 -11.981 -7.559  1.00 21.81 ? 32   THR B CG2 1 
ATOM   1120  N N   . GLY B  2 12  ? -13.438 -10.522 -8.297  1.00 22.11 ? 33   GLY B N   1 
ATOM   1121  C CA  . GLY B  2 12  ? -12.269 -9.806  -8.759  1.00 26.71 ? 33   GLY B CA  1 
ATOM   1122  C C   . GLY B  2 12  ? -12.860 -8.790  -9.731  1.00 23.64 ? 33   GLY B C   1 
ATOM   1123  O O   . GLY B  2 12  ? -14.046 -8.403  -9.684  1.00 33.97 ? 33   GLY B O   1 
ATOM   1124  N N   . GLY B  2 13  ? -12.019 -8.324  -10.600 1.00 31.40 ? 34   GLY B N   1 
ATOM   1125  C CA  . GLY B  2 13  ? -12.466 -7.368  -11.554 1.00 30.39 ? 34   GLY B CA  1 
ATOM   1126  C C   . GLY B  2 13  ? -12.629 -8.133  -12.812 1.00 27.21 ? 34   GLY B C   1 
ATOM   1127  O O   . GLY B  2 13  ? -12.811 -9.362  -12.820 1.00 23.10 ? 34   GLY B O   1 
ATOM   1128  N N   . VAL B  2 14  ? -12.570 -7.387  -13.886 1.00 26.90 ? 35   VAL B N   1 
ATOM   1129  C CA  . VAL B  2 14  ? -12.648 -7.924  -15.216 1.00 23.52 ? 35   VAL B CA  1 
ATOM   1130  C C   . VAL B  2 14  ? -11.391 -8.726  -15.488 1.00 27.90 ? 35   VAL B C   1 
ATOM   1131  O O   . VAL B  2 14  ? -10.279 -8.297  -15.117 1.00 30.74 ? 35   VAL B O   1 
ATOM   1132  C CB  . VAL B  2 14  ? -12.793 -6.778  -16.217 1.00 28.37 ? 35   VAL B CB  1 
ATOM   1133  C CG1 . VAL B  2 14  ? -12.785 -7.327  -17.609 1.00 28.22 ? 35   VAL B CG1 1 
ATOM   1134  C CG2 . VAL B  2 14  ? -14.117 -6.056  -15.925 1.00 29.01 ? 35   VAL B CG2 1 
HETATM 1135  N N   . M3L B  2 15  ? -11.561 -9.911  -16.058 1.00 20.48 ? 36   M3L B N   1 
HETATM 1136  C CA  . M3L B  2 15  ? -10.412 -10.766 -16.314 1.00 23.09 ? 36   M3L B CA  1 
HETATM 1137  C CB  . M3L B  2 15  ? -10.843 -12.160 -16.763 1.00 20.61 ? 36   M3L B CB  1 
HETATM 1138  C CG  . M3L B  2 15  ? -9.717  -13.161 -16.878 1.00 22.57 ? 36   M3L B CG  1 
HETATM 1139  C CD  . M3L B  2 15  ? -10.150 -14.630 -16.996 1.00 19.04 ? 36   M3L B CD  1 
HETATM 1140  C CE  . M3L B  2 15  ? -9.076  -15.672 -16.963 1.00 23.53 ? 36   M3L B CE  1 
HETATM 1141  N NZ  . M3L B  2 15  ? -9.492  -17.071 -17.133 1.00 20.41 ? 36   M3L B NZ  1 
HETATM 1142  C C   . M3L B  2 15  ? -9.502  -10.135 -17.382 1.00 23.32 ? 36   M3L B C   1 
HETATM 1143  O O   . M3L B  2 15  ? -9.981  -9.835  -18.400 1.00 25.51 ? 36   M3L B O   1 
HETATM 1144  C CM1 . M3L B  2 15  ? -10.171 -17.345 -18.375 1.00 15.84 ? 36   M3L B CM1 1 
HETATM 1145  C CM2 . M3L B  2 15  ? -10.317 -17.465 -15.982 1.00 16.40 ? 36   M3L B CM2 1 
HETATM 1146  C CM3 . M3L B  2 15  ? -8.278  -17.845 -17.009 1.00 18.94 ? 36   M3L B CM3 1 
ATOM   1147  N N   . LYS B  2 16  ? -8.209  -9.970  -17.092 1.00 25.88 ? 37   LYS B N   1 
ATOM   1148  C CA  . LYS B  2 16  ? -7.255  -9.443  -18.060 1.00 29.36 ? 37   LYS B CA  1 
ATOM   1149  C C   . LYS B  2 16  ? -6.614  -10.515 -18.973 1.00 26.41 ? 37   LYS B C   1 
ATOM   1150  O O   . LYS B  2 16  ? -6.426  -11.647 -18.599 1.00 22.81 ? 37   LYS B O   1 
ATOM   1151  C CB  . LYS B  2 16  ? -6.150  -8.680  -17.294 1.00 32.06 ? 37   LYS B CB  1 
ATOM   1152  C CG  . LYS B  2 16  ? -6.637  -7.412  -16.555 1.00 37.11 ? 37   LYS B CG  1 
ATOM   1153  C CD  . LYS B  2 16  ? -5.605  -6.972  -15.536 1.00 41.12 ? 37   LYS B CD  1 
ATOM   1154  C CE  . LYS B  2 16  ? -5.936  -5.592  -14.996 1.00 47.00 ? 37   LYS B CE  1 
ATOM   1155  N NZ  . LYS B  2 16  ? -4.893  -5.159  -14.010 1.00 53.82 ? 37   LYS B NZ  1 
ATOM   1156  N N   . PRO B  2 17  ? -6.261  -10.148 -20.183 1.00 26.55 ? 38   PRO B N   1 
ATOM   1157  C CA  . PRO B  2 17  ? -5.551  -11.068 -21.044 1.00 27.90 ? 38   PRO B CA  1 
ATOM   1158  C C   . PRO B  2 17  ? -4.245  -11.417 -20.347 1.00 23.08 ? 38   PRO B C   1 
ATOM   1159  O O   . PRO B  2 17  ? -3.774  -10.686 -19.456 1.00 25.45 ? 38   PRO B O   1 
ATOM   1160  C CB  . PRO B  2 17  ? -5.239  -10.216 -22.272 1.00 35.51 ? 38   PRO B CB  1 
ATOM   1161  C CG  . PRO B  2 17  ? -6.097  -9.022  -22.143 1.00 36.55 ? 38   PRO B CG  1 
ATOM   1162  C CD  . PRO B  2 17  ? -6.300  -8.772  -20.721 1.00 33.64 ? 38   PRO B CD  1 
ATOM   1163  N N   . HIS B  2 18  ? -3.654  -12.511 -20.758 1.00 24.64 ? 39   HIS B N   1 
ATOM   1164  C CA  . HIS B  2 18  ? -2.421  -12.981 -20.147 1.00 27.54 ? 39   HIS B CA  1 
ATOM   1165  C C   . HIS B  2 18  ? -1.319  -12.025 -20.595 1.00 27.44 ? 39   HIS B C   1 
ATOM   1166  O O   . HIS B  2 18  ? -1.138  -11.877 -21.784 1.00 30.96 ? 39   HIS B O   1 
ATOM   1167  C CB  . HIS B  2 18  ? -2.151  -14.410 -20.670 1.00 34.92 ? 39   HIS B CB  1 
ATOM   1168  C CG  . HIS B  2 18  ? -0.900  -15.047 -20.135 1.00 39.23 ? 39   HIS B CG  1 
ATOM   1169  N ND1 . HIS B  2 18  ? -0.638  -16.397 -20.269 1.00 47.92 ? 39   HIS B ND1 1 
ATOM   1170  C CD2 . HIS B  2 18  ? 0.159   -14.526 -19.465 1.00 41.95 ? 39   HIS B CD2 1 
ATOM   1171  C CE1 . HIS B  2 18  ? 0.525   -16.677 -19.704 1.00 47.69 ? 39   HIS B CE1 1 
ATOM   1172  N NE2 . HIS B  2 18  ? 1.033   -15.558 -19.212 1.00 39.34 ? 39   HIS B NE2 1 
ATOM   1173  N N   . ARG B  2 19  ? -0.612  -11.391 -19.668 1.00 23.69 ? 40   ARG B N   1 
ATOM   1174  C CA  . ARG B  2 19  ? 0.421   -10.398 -20.016 1.00 28.73 ? 40   ARG B CA  1 
ATOM   1175  C C   . ARG B  2 19  ? 1.774   -10.674 -19.373 1.00 28.11 ? 40   ARG B C   1 
ATOM   1176  O O   . ARG B  2 19  ? 1.849   -11.111 -18.226 1.00 27.92 ? 40   ARG B O   1 
ATOM   1177  C CB  . ARG B  2 19  ? 0.002   -8.997  -19.589 1.00 26.63 ? 40   ARG B CB  1 
ATOM   1178  C CG  . ARG B  2 19  ? -1.143  -8.411  -20.429 1.00 30.48 ? 40   ARG B CG  1 
ATOM   1179  C CD  . ARG B  2 19  ? -1.620  -7.070  -19.856 1.00 37.31 ? 40   ARG B CD  1 
ATOM   1180  N NE  . ARG B  2 19  ? -2.833  -6.590  -20.544 1.00 43.79 ? 40   ARG B NE  1 
ATOM   1181  C CZ  . ARG B  2 19  ? -3.779  -5.821  -19.990 1.00 40.49 ? 40   ARG B CZ  1 
ATOM   1182  N NH1 . ARG B  2 19  ? -4.832  -5.448  -20.720 1.00 42.51 ? 40   ARG B NH1 1 
ATOM   1183  N NH2 . ARG B  2 19  ? -3.683  -5.419  -18.727 1.00 44.43 ? 40   ARG B NH2 1 
ATOM   1184  N N   . TYR B  2 20  ? 2.835   -10.381 -20.120 1.00 22.53 ? 41   TYR B N   1 
ATOM   1185  C CA  . TYR B  2 20  ? 4.210   -10.513 -19.626 1.00 20.21 ? 41   TYR B CA  1 
ATOM   1186  C C   . TYR B  2 20  ? 4.940   -9.165  -19.883 1.00 24.73 ? 41   TYR B C   1 
ATOM   1187  O O   . TYR B  2 20  ? 5.388   -8.484  -18.904 1.00 25.13 ? 41   TYR B O   1 
ATOM   1188  C CB  . TYR B  2 20  ? 4.893   -11.697 -20.336 1.00 20.63 ? 41   TYR B CB  1 
ATOM   1189  C CG  . TYR B  2 20  ? 6.343   -11.824 -19.927 1.00 22.13 ? 41   TYR B CG  1 
ATOM   1190  C CD1 . TYR B  2 20  ? 7.320   -11.166 -20.640 1.00 21.03 ? 41   TYR B CD1 1 
ATOM   1191  C CD2 . TYR B  2 20  ? 6.720   -12.573 -18.820 1.00 17.08 ? 41   TYR B CD2 1 
ATOM   1192  C CE1 . TYR B  2 20  ? 8.671   -11.243 -20.259 1.00 16.85 ? 41   TYR B CE1 1 
ATOM   1193  C CE2 . TYR B  2 20  ? 8.067   -12.662 -18.428 1.00 15.17 ? 41   TYR B CE2 1 
ATOM   1194  C CZ  . TYR B  2 20  ? 9.025   -12.028 -19.188 1.00 14.53 ? 41   TYR B CZ  1 
ATOM   1195  O OH  . TYR B  2 20  ? 10.368  -12.060 -18.831 1.00 17.65 ? 41   TYR B OH  1 
ATOM   1196  N N   . ASP C  1 7   ? -12.202 -12.318 18.687  1.00 46.56 ? 1080 ASP C N   1 
ATOM   1197  C CA  . ASP C  1 7   ? -10.840 -12.148 18.168  1.00 46.41 ? 1080 ASP C CA  1 
ATOM   1198  C C   . ASP C  1 7   ? -9.865  -13.260 18.614  1.00 45.74 ? 1080 ASP C C   1 
ATOM   1199  O O   . ASP C  1 7   ? -10.191 -14.453 18.640  1.00 44.57 ? 1080 ASP C O   1 
ATOM   1200  C CB  . ASP C  1 7   ? -10.261 -10.789 18.587  1.00 50.73 ? 1080 ASP C CB  1 
ATOM   1201  C CG  . ASP C  1 7   ? -10.994 -9.613  17.958  1.00 55.02 ? 1080 ASP C CG  1 
ATOM   1202  O OD1 . ASP C  1 7   ? -10.336 -8.580  17.681  1.00 59.60 ? 1080 ASP C OD1 1 
ATOM   1203  O OD2 . ASP C  1 7   ? -12.221 -9.731  17.746  1.00 55.02 ? 1080 ASP C OD2 1 
ATOM   1204  N N   . SER C  1 8   ? -8.664  -12.832 18.969  1.00 44.86 ? 1081 SER C N   1 
ATOM   1205  C CA  . SER C  1 8   ? -7.579  -13.718 19.348  1.00 41.47 ? 1081 SER C CA  1 
ATOM   1206  C C   . SER C  1 8   ? -7.829  -14.313 20.735  1.00 38.17 ? 1081 SER C C   1 
ATOM   1207  O O   . SER C  1 8   ? -8.681  -13.810 21.496  1.00 36.90 ? 1081 SER C O   1 
ATOM   1208  C CB  . SER C  1 8   ? -6.299  -12.906 19.390  1.00 44.30 ? 1081 SER C CB  1 
ATOM   1209  O OG  . SER C  1 8   ? -6.550  -11.692 20.085  1.00 43.44 ? 1081 SER C OG  1 
ATOM   1210  N N   . PRO C  1 9   ? -7.079  -15.380 21.071  1.00 36.18 ? 1082 PRO C N   1 
ATOM   1211  C CA  . PRO C  1 9   ? -7.236  -16.048 22.357  1.00 29.65 ? 1082 PRO C CA  1 
ATOM   1212  C C   . PRO C  1 9   ? -6.886  -15.091 23.502  1.00 33.78 ? 1082 PRO C C   1 
ATOM   1213  O O   . PRO C  1 9   ? -6.084  -14.157 23.346  1.00 29.10 ? 1082 PRO C O   1 
ATOM   1214  C CB  . PRO C  1 9   ? -6.222  -17.200 22.290  1.00 31.97 ? 1082 PRO C CB  1 
ATOM   1215  C CG  . PRO C  1 9   ? -5.822  -17.312 20.902  1.00 32.00 ? 1082 PRO C CG  1 
ATOM   1216  C CD  . PRO C  1 9   ? -6.008  -15.990 20.270  1.00 38.40 ? 1082 PRO C CD  1 
ATOM   1217  N N   . LEU C  1 10  ? -7.518  -15.363 24.637  1.00 27.89 ? 1083 LEU C N   1 
ATOM   1218  C CA  . LEU C  1 10  ? -7.428  -14.594 25.874  1.00 23.33 ? 1083 LEU C CA  1 
ATOM   1219  C C   . LEU C  1 10  ? -6.669  -15.419 26.878  1.00 18.87 ? 1083 LEU C C   1 
ATOM   1220  O O   . LEU C  1 10  ? -6.552  -16.630 26.699  1.00 20.23 ? 1083 LEU C O   1 
ATOM   1221  C CB  . LEU C  1 10  ? -8.857  -14.408 26.381  1.00 21.71 ? 1083 LEU C CB  1 
ATOM   1222  C CG  . LEU C  1 10  ? -9.681  -13.589 25.392  1.00 25.57 ? 1083 LEU C CG  1 
ATOM   1223  C CD1 . LEU C  1 10  ? -11.067 -13.346 25.923  1.00 31.15 ? 1083 LEU C CD1 1 
ATOM   1224  C CD2 . LEU C  1 10  ? -9.009  -12.266 25.065  1.00 30.80 ? 1083 LEU C CD2 1 
ATOM   1225  N N   . ASP C  1 11  ? -6.172  -14.785 27.943  1.00 22.46 ? 1084 ASP C N   1 
ATOM   1226  C CA  . ASP C  1 11  ? -5.284  -15.457 28.875  1.00 19.23 ? 1084 ASP C CA  1 
ATOM   1227  C C   . ASP C  1 11  ? -5.938  -15.628 30.228  1.00 18.56 ? 1084 ASP C C   1 
ATOM   1228  O O   . ASP C  1 11  ? -6.746  -14.804 30.602  1.00 18.24 ? 1084 ASP C O   1 
ATOM   1229  C CB  . ASP C  1 11  ? -4.008  -14.651 29.081  1.00 21.37 ? 1084 ASP C CB  1 
ATOM   1230  C CG  . ASP C  1 11  ? -3.195  -14.554 27.804  1.00 29.73 ? 1084 ASP C CG  1 
ATOM   1231  O OD1 . ASP C  1 11  ? -2.723  -13.455 27.475  1.00 38.02 ? 1084 ASP C OD1 1 
ATOM   1232  O OD2 . ASP C  1 11  ? -3.035  -15.591 27.151  1.00 31.01 ? 1084 ASP C OD2 1 
ATOM   1233  N N   . ALA C  1 12  ? -5.501  -16.639 30.970  1.00 18.83 ? 1085 ALA C N   1 
ATOM   1234  C CA  . ALA C  1 12  ? -5.948  -16.821 32.349  1.00 20.85 ? 1085 ALA C CA  1 
ATOM   1235  C C   . ALA C  1 12  ? -5.625  -15.595 33.133  1.00 21.31 ? 1085 ALA C C   1 
ATOM   1236  O O   . ALA C  1 12  ? -4.549  -14.979 32.961  1.00 19.75 ? 1085 ALA C O   1 
ATOM   1237  C CB  . ALA C  1 12  ? -5.254  -18.024 33.006  1.00 23.30 ? 1085 ALA C CB  1 
ATOM   1238  N N   . LEU C  1 13  ? -6.568  -15.248 34.013  1.00 14.99 ? 1086 LEU C N   1 
ATOM   1239  C CA  . LEU C  1 13  ? -6.450  -14.069 34.878  1.00 15.03 ? 1086 LEU C CA  1 
ATOM   1240  C C   . LEU C  1 13  ? -6.693  -12.716 34.203  1.00 16.67 ? 1086 LEU C C   1 
ATOM   1241  O O   . LEU C  1 13  ? -6.546  -11.675 34.850  1.00 19.35 ? 1086 LEU C O   1 
ATOM   1242  C CB  . LEU C  1 13  ? -5.124  -14.066 35.656  1.00 19.88 ? 1086 LEU C CB  1 
ATOM   1243  C CG  . LEU C  1 13  ? -4.800  -15.355 36.395  1.00 22.71 ? 1086 LEU C CG  1 
ATOM   1244  C CD1 . LEU C  1 13  ? -3.520  -15.259 37.166  1.00 26.84 ? 1086 LEU C CD1 1 
ATOM   1245  C CD2 . LEU C  1 13  ? -5.986  -15.798 37.306  1.00 23.12 ? 1086 LEU C CD2 1 
ATOM   1246  N N   . ASP C  1 14  ? -7.103  -12.729 32.933  1.00 17.17 ? 1087 ASP C N   1 
ATOM   1247  C CA  . ASP C  1 14  ? -7.608  -11.543 32.252  1.00 16.80 ? 1087 ASP C CA  1 
ATOM   1248  C C   . ASP C  1 14  ? -9.024  -11.244 32.792  1.00 15.47 ? 1087 ASP C C   1 
ATOM   1249  O O   . ASP C  1 14  ? -9.793  -12.177 33.105  1.00 16.95 ? 1087 ASP C O   1 
ATOM   1250  C CB  . ASP C  1 14  ? -7.803  -11.828 30.772  1.00 18.67 ? 1087 ASP C CB  1 
ATOM   1251  C CG  . ASP C  1 14  ? -6.512  -11.716 29.949  1.00 26.59 ? 1087 ASP C CG  1 
ATOM   1252  O OD1 . ASP C  1 14  ? -5.479  -11.344 30.524  1.00 26.86 ? 1087 ASP C OD1 1 
ATOM   1253  O OD2 . ASP C  1 14  ? -6.563  -12.022 28.718  1.00 25.87 ? 1087 ASP C OD2 1 
ATOM   1254  N N   . LEU C  1 15  ? -9.342  -9.965  32.905  1.00 13.11 ? 1088 LEU C N   1 
ATOM   1255  C CA  . LEU C  1 15  ? -10.714 -9.556  33.283  1.00 13.47 ? 1088 LEU C CA  1 
ATOM   1256  C C   . LEU C  1 15  ? -11.525 -9.456  32.008  1.00 17.34 ? 1088 LEU C C   1 
ATOM   1257  O O   . LEU C  1 15  ? -11.039 -8.970  30.979  1.00 14.84 ? 1088 LEU C O   1 
ATOM   1258  C CB  . LEU C  1 15  ? -10.696 -8.162  33.943  1.00 16.48 ? 1088 LEU C CB  1 
ATOM   1259  C CG  . LEU C  1 15  ? -9.991  -8.070  35.292  1.00 16.84 ? 1088 LEU C CG  1 
ATOM   1260  C CD1 . LEU C  1 15  ? -9.922  -6.606  35.828  1.00 19.62 ? 1088 LEU C CD1 1 
ATOM   1261  C CD2 . LEU C  1 15  ? -10.716 -8.959  36.288  1.00 19.46 ? 1088 LEU C CD2 1 
ATOM   1262  N N   . VAL C  1 16  ? -12.780 -9.905  32.052  1.00 14.36 ? 1089 VAL C N   1 
ATOM   1263  C CA  . VAL C  1 16  ? -13.581 -9.899  30.861  1.00 14.03 ? 1089 VAL C CA  1 
ATOM   1264  C C   . VAL C  1 16  ? -15.030 -9.569  31.192  1.00 14.61 ? 1089 VAL C C   1 
ATOM   1265  O O   . VAL C  1 16  ? -15.447 -9.747  32.328  1.00 16.28 ? 1089 VAL C O   1 
ATOM   1266  C CB  . VAL C  1 16  ? -13.585 -11.324 30.153  1.00 16.03 ? 1089 VAL C CB  1 
ATOM   1267  C CG1 . VAL C  1 16  ? -12.200 -11.687 29.657  1.00 19.99 ? 1089 VAL C CG1 1 
ATOM   1268  C CG2 . VAL C  1 16  ? -13.965 -12.454 31.141  1.00 16.22 ? 1089 VAL C CG2 1 
ATOM   1269  N N   . TRP C  1 17  ? -15.749 -9.124  30.175  1.00 15.09 ? 1090 TRP C N   1 
ATOM   1270  C CA  . TRP C  1 17  ? -17.232 -9.099  30.148  1.00 15.96 ? 1090 TRP C CA  1 
ATOM   1271  C C   . TRP C  1 17  ? -17.651 -10.450 29.602  1.00 17.82 ? 1090 TRP C C   1 
ATOM   1272  O O   . TRP C  1 17  ? -17.227 -10.821 28.490  1.00 21.29 ? 1090 TRP C O   1 
ATOM   1273  C CB  . TRP C  1 17  ? -17.717 -8.025  29.175  1.00 17.65 ? 1090 TRP C CB  1 
ATOM   1274  C CG  . TRP C  1 17  ? -17.478 -6.642  29.686  1.00 20.27 ? 1090 TRP C CG  1 
ATOM   1275  C CD1 . TRP C  1 17  ? -16.440 -5.785  29.358  1.00 18.24 ? 1090 TRP C CD1 1 
ATOM   1276  C CD2 . TRP C  1 17  ? -18.250 -5.976  30.671  1.00 14.47 ? 1090 TRP C CD2 1 
ATOM   1277  N NE1 . TRP C  1 17  ? -16.564 -4.618  30.066  1.00 17.16 ? 1090 TRP C NE1 1 
ATOM   1278  C CE2 . TRP C  1 17  ? -17.651 -4.716  30.898  1.00 19.15 ? 1090 TRP C CE2 1 
ATOM   1279  C CE3 . TRP C  1 17  ? -19.423 -6.307  31.374  1.00 18.88 ? 1090 TRP C CE3 1 
ATOM   1280  C CZ2 . TRP C  1 17  ? -18.191 -3.761  31.804  1.00 18.97 ? 1090 TRP C CZ2 1 
ATOM   1281  C CZ3 . TRP C  1 17  ? -19.972 -5.328  32.275  1.00 19.86 ? 1090 TRP C CZ3 1 
ATOM   1282  C CH2 . TRP C  1 17  ? -19.346 -4.098  32.475  1.00 18.67 ? 1090 TRP C CH2 1 
ATOM   1283  N N   . ALA C  1 18  ? -18.428 -11.194 30.376  1.00 17.96 ? 1091 ALA C N   1 
ATOM   1284  C CA  . ALA C  1 18  ? -18.749 -12.581 30.015  1.00 17.19 ? 1091 ALA C CA  1 
ATOM   1285  C C   . ALA C  1 18  ? -20.249 -12.676 29.826  1.00 22.25 ? 1091 ALA C C   1 
ATOM   1286  O O   . ALA C  1 18  ? -21.002 -12.312 30.753  1.00 18.85 ? 1091 ALA C O   1 
ATOM   1287  C CB  . ALA C  1 18  ? -18.300 -13.503 31.099  1.00 16.69 ? 1091 ALA C CB  1 
ATOM   1288  N N   . LYS C  1 19  ? -20.682 -13.149 28.646  1.00 19.39 ? 1092 LYS C N   1 
ATOM   1289  C CA  . LYS C  1 19  ? -22.114 -13.143 28.278  1.00 24.80 ? 1092 LYS C CA  1 
ATOM   1290  C C   . LYS C  1 19  ? -22.774 -14.499 28.296  1.00 28.14 ? 1092 LYS C C   1 
ATOM   1291  O O   . LYS C  1 19  ? -22.415 -15.393 27.538  1.00 25.21 ? 1092 LYS C O   1 
ATOM   1292  C CB  . LYS C  1 19  ? -22.347 -12.495 26.903  1.00 23.96 ? 1092 LYS C CB  1 
ATOM   1293  C CG  . LYS C  1 19  ? -23.836 -12.546 26.459  1.00 26.57 ? 1092 LYS C CG  1 
ATOM   1294  C CD  . LYS C  1 19  ? -24.628 -11.338 27.000  1.00 29.53 ? 1092 LYS C CD  1 
ATOM   1295  C CE  . LYS C  1 19  ? -26.118 -11.393 26.560  1.00 32.81 ? 1092 LYS C CE  1 
ATOM   1296  N NZ  . LYS C  1 19  ? -26.754 -12.650 27.013  1.00 31.77 ? 1092 LYS C NZ  1 
ATOM   1297  N N   . CYS C  1 20  ? -23.701 -14.655 29.235  1.00 25.82 ? 1093 CYS C N   1 
ATOM   1298  C CA  . CYS C  1 20  ? -24.535 -15.838 29.344  1.00 32.28 ? 1093 CYS C CA  1 
ATOM   1299  C C   . CYS C  1 20  ? -25.897 -15.524 28.758  1.00 32.48 ? 1093 CYS C C   1 
ATOM   1300  O O   . CYS C  1 20  ? -26.334 -14.366 28.736  1.00 28.78 ? 1093 CYS C O   1 
ATOM   1301  C CB  . CYS C  1 20  ? -24.773 -16.150 30.812  1.00 33.39 ? 1093 CYS C CB  1 
ATOM   1302  S SG  . CYS C  1 20  ? -23.401 -16.863 31.696  1.00 44.90 ? 1093 CYS C SG  1 
ATOM   1303  N N   . ARG C  1 21  ? -26.590 -16.562 28.296  1.00 35.42 ? 1094 ARG C N   1 
ATOM   1304  C CA  . ARG C  1 21  ? -27.971 -16.393 27.821  1.00 36.28 ? 1094 ARG C CA  1 
ATOM   1305  C C   . ARG C  1 21  ? -28.904 -15.759 28.862  1.00 29.57 ? 1094 ARG C C   1 
ATOM   1306  O O   . ARG C  1 21  ? -28.960 -16.222 29.989  1.00 31.31 ? 1094 ARG C O   1 
ATOM   1307  C CB  . ARG C  1 21  ? -28.551 -17.737 27.381  1.00 44.55 ? 1094 ARG C CB  1 
ATOM   1308  C CG  . ARG C  1 21  ? -29.735 -17.595 26.441  1.00 45.71 ? 1094 ARG C CG  1 
ATOM   1309  C CD  . ARG C  1 21  ? -30.361 -18.952 26.137  1.00 51.05 ? 1094 ARG C CD  1 
ATOM   1310  N NE  . ARG C  1 21  ? -29.354 -20.013 26.113  1.00 55.77 ? 1094 ARG C NE  1 
ATOM   1311  C CZ  . ARG C  1 21  ? -29.072 -20.813 27.146  1.00 61.80 ? 1094 ARG C CZ  1 
ATOM   1312  N NH1 . ARG C  1 21  ? -28.137 -21.756 27.025  1.00 66.18 ? 1094 ARG C NH1 1 
ATOM   1313  N NH2 . ARG C  1 21  ? -29.722 -20.675 28.302  1.00 55.96 ? 1094 ARG C NH2 1 
ATOM   1314  N N   . GLY C  1 22  ? -29.643 -14.727 28.448  1.00 34.89 ? 1095 GLY C N   1 
ATOM   1315  C CA  . GLY C  1 22  ? -30.682 -14.123 29.266  1.00 37.74 ? 1095 GLY C CA  1 
ATOM   1316  C C   . GLY C  1 22  ? -30.161 -13.009 30.157  1.00 38.51 ? 1095 GLY C C   1 
ATOM   1317  O O   . GLY C  1 22  ? -30.889 -12.083 30.550  1.00 38.25 ? 1095 GLY C O   1 
ATOM   1318  N N   . TYR C  1 23  ? -28.872 -13.090 30.467  1.00 35.50 ? 1096 TYR C N   1 
ATOM   1319  C CA  . TYR C  1 23  ? -28.254 -12.086 31.320  1.00 35.18 ? 1096 TYR C CA  1 
ATOM   1320  C C   . TYR C  1 23  ? -27.466 -11.111 30.482  1.00 31.24 ? 1096 TYR C C   1 
ATOM   1321  O O   . TYR C  1 23  ? -26.996 -11.470 29.427  1.00 32.26 ? 1096 TYR C O   1 
ATOM   1322  C CB  . TYR C  1 23  ? -27.281 -12.743 32.265  1.00 29.50 ? 1096 TYR C CB  1 
ATOM   1323  C CG  . TYR C  1 23  ? -27.833 -13.693 33.294  1.00 29.26 ? 1096 TYR C CG  1 
ATOM   1324  C CD1 . TYR C  1 23  ? -28.624 -13.230 34.343  1.00 37.60 ? 1096 TYR C CD1 1 
ATOM   1325  C CD2 . TYR C  1 23  ? -27.482 -15.025 33.278  1.00 32.42 ? 1096 TYR C CD2 1 
ATOM   1326  C CE1 . TYR C  1 23  ? -29.070 -14.088 35.318  1.00 34.87 ? 1096 TYR C CE1 1 
ATOM   1327  C CE2 . TYR C  1 23  ? -27.927 -15.896 34.240  1.00 36.69 ? 1096 TYR C CE2 1 
ATOM   1328  C CZ  . TYR C  1 23  ? -28.735 -15.419 35.266  1.00 39.18 ? 1096 TYR C CZ  1 
ATOM   1329  O OH  . TYR C  1 23  ? -29.186 -16.289 36.259  1.00 43.89 ? 1096 TYR C OH  1 
ATOM   1330  N N   . PRO C  1 24  ? -27.314 -9.862  30.953  1.00 30.46 ? 1097 PRO C N   1 
ATOM   1331  C CA  . PRO C  1 24  ? -26.454 -8.919  30.237  1.00 31.22 ? 1097 PRO C CA  1 
ATOM   1332  C C   . PRO C  1 24  ? -25.009 -9.386  30.472  1.00 25.94 ? 1097 PRO C C   1 
ATOM   1333  O O   . PRO C  1 24  ? -24.795 -10.204 31.365  1.00 24.03 ? 1097 PRO C O   1 
ATOM   1334  C CB  . PRO C  1 24  ? -26.678 -7.584  30.980  1.00 30.29 ? 1097 PRO C CB  1 
ATOM   1335  C CG  . PRO C  1 24  ? -27.407 -7.913  32.180  1.00 33.89 ? 1097 PRO C CG  1 
ATOM   1336  C CD  . PRO C  1 24  ? -27.641 -9.377  32.300  1.00 36.63 ? 1097 PRO C CD  1 
ATOM   1337  N N   . SER C  1 25  ? -24.076 -8.849  29.691  1.00 26.95 ? 1098 SER C N   1 
ATOM   1338  C CA  . SER C  1 25  ? -22.661 -9.160  29.902  1.00 23.63 ? 1098 SER C CA  1 
ATOM   1339  C C   . SER C  1 25  ? -22.299 -8.811  31.333  1.00 23.50 ? 1098 SER C C   1 
ATOM   1340  O O   . SER C  1 25  ? -22.717 -7.751  31.793  1.00 22.46 ? 1098 SER C O   1 
ATOM   1341  C CB  . SER C  1 25  ? -21.860 -8.243  29.003  1.00 24.03 ? 1098 SER C CB  1 
ATOM   1342  O OG  . SER C  1 25  ? -22.192 -8.407  27.642  1.00 34.37 ? 1098 SER C OG  1 
ATOM   1343  N N   . TYR C  1 26  ? -21.480 -9.651  31.987  1.00 18.52 ? 1099 TYR C N   1 
ATOM   1344  C CA  . TYR C  1 26  ? -21.200 -9.523  33.410  1.00 18.15 ? 1099 TYR C CA  1 
ATOM   1345  C C   . TYR C  1 26  ? -19.672 -9.643  33.651  1.00 17.97 ? 1099 TYR C C   1 
ATOM   1346  O O   . TYR C  1 26  ? -19.026 -10.533 33.108  1.00 17.13 ? 1099 TYR C O   1 
ATOM   1347  C CB  . TYR C  1 26  ? -21.908 -10.637 34.152  1.00 21.12 ? 1099 TYR C CB  1 
ATOM   1348  C CG  . TYR C  1 26  ? -22.240 -10.314 35.576  1.00 20.59 ? 1099 TYR C CG  1 
ATOM   1349  C CD1 . TYR C  1 26  ? -21.300 -10.473 36.557  1.00 20.34 ? 1099 TYR C CD1 1 
ATOM   1350  C CD2 . TYR C  1 26  ? -23.506 -9.840  35.925  1.00 22.69 ? 1099 TYR C CD2 1 
ATOM   1351  C CE1 . TYR C  1 26  ? -21.578 -10.189 37.881  1.00 20.07 ? 1099 TYR C CE1 1 
ATOM   1352  C CE2 . TYR C  1 26  ? -23.804 -9.554  37.260  1.00 23.16 ? 1099 TYR C CE2 1 
ATOM   1353  C CZ  . TYR C  1 26  ? -22.844 -9.750  38.216  1.00 21.78 ? 1099 TYR C CZ  1 
ATOM   1354  O OH  . TYR C  1 26  ? -23.083 -9.466  39.542  1.00 24.16 ? 1099 TYR C OH  1 
ATOM   1355  N N   . PRO C  1 27  ? -19.116 -8.759  34.494  1.00 17.60 ? 1100 PRO C N   1 
ATOM   1356  C CA  . PRO C  1 27  ? -17.688 -8.833  34.813  1.00 16.19 ? 1100 PRO C CA  1 
ATOM   1357  C C   . PRO C  1 27  ? -17.273 -10.135 35.381  1.00 15.08 ? 1100 PRO C C   1 
ATOM   1358  O O   . PRO C  1 27  ? -17.897 -10.716 36.270  1.00 16.00 ? 1100 PRO C O   1 
ATOM   1359  C CB  . PRO C  1 27  ? -17.506 -7.707  35.846  1.00 15.05 ? 1100 PRO C CB  1 
ATOM   1360  C CG  . PRO C  1 27  ? -18.516 -6.642  35.360  1.00 17.63 ? 1100 PRO C CG  1 
ATOM   1361  C CD  . PRO C  1 27  ? -19.730 -7.522  35.028  1.00 17.12 ? 1100 PRO C CD  1 
ATOM   1362  N N   . ALA C  1 28  ? -16.098 -10.620 34.916  1.00 13.58 ? 1101 ALA C N   1 
ATOM   1363  C CA  . ALA C  1 28  ? -15.614 -11.925 35.355  1.00 12.74 ? 1101 ALA C CA  1 
ATOM   1364  C C   . ALA C  1 28  ? -14.110 -12.005 35.207  1.00 16.19 ? 1101 ALA C C   1 
ATOM   1365  O O   . ALA C  1 28  ? -13.504 -11.134 34.570  1.00 15.23 ? 1101 ALA C O   1 
ATOM   1366  C CB  . ALA C  1 28  ? -16.240 -13.115 34.509  1.00 15.38 ? 1101 ALA C CB  1 
ATOM   1367  N N   . LEU C  1 29  ? -13.560 -13.098 35.743  1.00 15.19 ? 1102 LEU C N   1 
ATOM   1368  C CA  . LEU C  1 29  ? -12.120 -13.360 35.680  1.00 15.54 ? 1102 LEU C CA  1 
ATOM   1369  C C   . LEU C  1 29  ? -11.893 -14.698 34.964  1.00 18.06 ? 1102 LEU C C   1 
ATOM   1370  O O   . LEU C  1 29  ? -12.510 -15.709 35.331  1.00 18.11 ? 1102 LEU C O   1 
ATOM   1371  C CB  . LEU C  1 29  ? -11.568 -13.384 37.117  1.00 19.37 ? 1102 LEU C CB  1 
ATOM   1372  C CG  . LEU C  1 29  ? -10.057 -13.587 37.347  1.00 19.11 ? 1102 LEU C CG  1 
ATOM   1373  C CD1 . LEU C  1 29  ? -9.253  -12.410 36.798  1.00 19.13 ? 1102 LEU C CD1 1 
ATOM   1374  C CD2 . LEU C  1 29  ? -9.835  -13.718 38.872  1.00 21.56 ? 1102 LEU C CD2 1 
ATOM   1375  N N   . ILE C  1 30  ? -11.026 -14.753 33.939  1.00 15.55 ? 1103 ILE C N   1 
ATOM   1376  C CA  . ILE C  1 30  ? -10.712 -16.065 33.338  1.00 16.31 ? 1103 ILE C CA  1 
ATOM   1377  C C   . ILE C  1 30  ? -9.761  -16.827 34.259  1.00 16.85 ? 1103 ILE C C   1 
ATOM   1378  O O   . ILE C  1 30  ? -8.795  -16.291 34.768  1.00 17.82 ? 1103 ILE C O   1 
ATOM   1379  C CB  . ILE C  1 30  ? -10.032 -15.901 31.984  1.00 14.57 ? 1103 ILE C CB  1 
ATOM   1380  C CG1 . ILE C  1 30  ? -10.854 -14.982 31.071  1.00 18.26 ? 1103 ILE C CG1 1 
ATOM   1381  C CG2 . ILE C  1 30  ? -9.775  -17.271 31.361  1.00 14.64 ? 1103 ILE C CG2 1 
ATOM   1382  C CD1 . ILE C  1 30  ? -10.242 -14.877 29.679  1.00 21.24 ? 1103 ILE C CD1 1 
ATOM   1383  N N   . ILE C  1 31  ? -10.093 -18.076 34.522  1.00 16.80 ? 1104 ILE C N   1 
ATOM   1384  C CA  . ILE C  1 31  ? -9.347  -18.916 35.471  1.00 18.43 ? 1104 ILE C CA  1 
ATOM   1385  C C   . ILE C  1 31  ? -8.812  -20.102 34.674  1.00 21.80 ? 1104 ILE C C   1 
ATOM   1386  O O   . ILE C  1 31  ? -9.505  -20.619 33.801  1.00 22.45 ? 1104 ILE C O   1 
ATOM   1387  C CB  . ILE C  1 31  ? -10.283 -19.440 36.580  1.00 20.16 ? 1104 ILE C CB  1 
ATOM   1388  C CG1 . ILE C  1 31  ? -10.893 -18.273 37.391  1.00 23.61 ? 1104 ILE C CG1 1 
ATOM   1389  C CG2 . ILE C  1 31  ? -9.532  -20.474 37.486  1.00 25.30 ? 1104 ILE C CG2 1 
ATOM   1390  C CD1 . ILE C  1 31  ? -9.914  -17.533 38.193  1.00 23.17 ? 1104 ILE C CD1 1 
ATOM   1391  N N   . ASP C  1 32  ? -7.568  -20.483 34.952  1.00 20.81 ? 1105 ASP C N   1 
ATOM   1392  C CA  . ASP C  1 32  ? -6.967  -21.666 34.281  1.00 24.12 ? 1105 ASP C CA  1 
ATOM   1393  C C   . ASP C  1 32  ? -7.505  -22.945 34.921  1.00 22.35 ? 1105 ASP C C   1 
ATOM   1394  O O   . ASP C  1 32  ? -7.288  -23.161 36.104  1.00 25.64 ? 1105 ASP C O   1 
ATOM   1395  C CB  . ASP C  1 32  ? -5.452  -21.597 34.468  1.00 26.48 ? 1105 ASP C CB  1 
ATOM   1396  C CG  . ASP C  1 32  ? -4.726  -22.809 33.915  1.00 32.19 ? 1105 ASP C CG  1 
ATOM   1397  O OD1 . ASP C  1 32  ? -5.366  -23.649 33.265  1.00 30.02 ? 1105 ASP C OD1 1 
ATOM   1398  O OD2 . ASP C  1 32  ? -3.497  -22.906 34.138  1.00 39.48 ? 1105 ASP C OD2 1 
ATOM   1399  N N   . PRO C  1 33  ? -8.236  -23.753 34.169  1.00 23.26 ? 1106 PRO C N   1 
ATOM   1400  C CA  . PRO C  1 33  ? -8.811  -24.998 34.689  1.00 27.78 ? 1106 PRO C CA  1 
ATOM   1401  C C   . PRO C  1 33  ? -7.754  -25.912 35.255  1.00 30.00 ? 1106 PRO C C   1 
ATOM   1402  O O   . PRO C  1 33  ? -8.106  -26.812 36.042  1.00 29.50 ? 1106 PRO C O   1 
ATOM   1403  C CB  . PRO C  1 33  ? -9.415  -25.679 33.447  1.00 28.17 ? 1106 PRO C CB  1 
ATOM   1404  C CG  . PRO C  1 33  ? -9.636  -24.636 32.489  1.00 32.16 ? 1106 PRO C CG  1 
ATOM   1405  C CD  . PRO C  1 33  ? -8.676  -23.471 32.801  1.00 26.38 ? 1106 PRO C CD  1 
ATOM   1406  N N   . LYS C  1 34  ? -6.502  -25.696 34.857  1.00 31.88 ? 1107 LYS C N   1 
ATOM   1407  C CA  . LYS C  1 34  ? -5.401  -26.564 35.259  1.00 30.95 ? 1107 LYS C CA  1 
ATOM   1408  C C   . LYS C  1 34  ? -4.558  -25.957 36.351  1.00 31.89 ? 1107 LYS C C   1 
ATOM   1409  O O   . LYS C  1 34  ? -3.453  -26.430 36.633  1.00 32.33 ? 1107 LYS C O   1 
ATOM   1410  C CB  . LYS C  1 34  ? -4.500  -26.838 34.053  1.00 32.00 ? 1107 LYS C CB  1 
ATOM   1411  C CG  . LYS C  1 34  ? -5.178  -27.681 32.969  1.00 38.83 ? 1107 LYS C CG  1 
ATOM   1412  C CD  . LYS C  1 34  ? -4.537  -29.059 32.839  1.00 50.08 ? 1107 LYS C CD  1 
ATOM   1413  C CE  . LYS C  1 34  ? -4.683  -29.921 34.096  1.00 50.57 ? 1107 LYS C CE  1 
ATOM   1414  N NZ  . LYS C  1 34  ? -3.710  -31.045 33.978  1.00 43.88 ? 1107 LYS C NZ  1 
ATOM   1415  N N   . MET C  1 35  ? -5.036  -24.884 36.963  1.00 25.61 ? 1108 MET C N   1 
ATOM   1416  C CA  . MET C  1 35  ? -4.265  -24.276 38.037  1.00 29.20 ? 1108 MET C CA  1 
ATOM   1417  C C   . MET C  1 35  ? -4.063  -25.323 39.144  1.00 33.36 ? 1108 MET C C   1 
ATOM   1418  O O   . MET C  1 35  ? -4.827  -26.280 39.218  1.00 31.97 ? 1108 MET C O   1 
ATOM   1419  C CB  . MET C  1 35  ? -4.931  -23.015 38.597  1.00 30.99 ? 1108 MET C CB  1 
ATOM   1420  C CG  . MET C  1 35  ? -6.259  -23.244 39.303  1.00 33.02 ? 1108 MET C CG  1 
ATOM   1421  S SD  . MET C  1 35  ? -6.996  -21.690 39.878  1.00 31.51 ? 1108 MET C SD  1 
ATOM   1422  C CE  . MET C  1 35  ? -5.862  -21.189 41.130  1.00 28.78 ? 1108 MET C CE  1 
ATOM   1423  N N   . PRO C  1 36  ? -3.004  -25.160 39.955  1.00 34.27 ? 1109 PRO C N   1 
ATOM   1424  C CA  . PRO C  1 36  ? -2.642  -26.064 41.065  1.00 31.39 ? 1109 PRO C CA  1 
ATOM   1425  C C   . PRO C  1 36  ? -3.810  -26.173 42.008  1.00 33.12 ? 1109 PRO C C   1 
ATOM   1426  O O   . PRO C  1 36  ? -4.308  -25.148 42.394  1.00 29.72 ? 1109 PRO C O   1 
ATOM   1427  C CB  . PRO C  1 36  ? -1.559  -25.289 41.801  1.00 34.13 ? 1109 PRO C CB  1 
ATOM   1428  C CG  . PRO C  1 36  ? -0.910  -24.456 40.727  1.00 42.05 ? 1109 PRO C CG  1 
ATOM   1429  C CD  . PRO C  1 36  ? -2.015  -24.088 39.765  1.00 32.81 ? 1109 PRO C CD  1 
ATOM   1430  N N   . ARG C  1 37  ? -4.214  -27.378 42.384  1.00 33.56 ? 1110 ARG C N   1 
ATOM   1431  C CA  . ARG C  1 37  ? -5.382  -27.584 43.231  1.00 34.69 ? 1110 ARG C CA  1 
ATOM   1432  C C   . ARG C  1 37  ? -5.190  -26.978 44.620  1.00 34.59 ? 1110 ARG C C   1 
ATOM   1433  O O   . ARG C  1 37  ? -6.163  -26.693 45.325  1.00 31.86 ? 1110 ARG C O   1 
ATOM   1434  C CB  . ARG C  1 37  ? -5.687  -29.082 43.309  1.00 35.17 ? 1110 ARG C CB  1 
ATOM   1435  C CG  . ARG C  1 37  ? -5.932  -29.703 41.923  1.00 35.56 ? 1110 ARG C CG  1 
ATOM   1436  C CD  . ARG C  1 37  ? -7.101  -29.038 41.229  1.00 35.31 ? 1110 ARG C CD  1 
ATOM   1437  N NE  . ARG C  1 37  ? -8.317  -29.148 42.031  1.00 35.06 ? 1110 ARG C NE  1 
ATOM   1438  C CZ  . ARG C  1 37  ? -9.484  -28.612 41.708  1.00 38.23 ? 1110 ARG C CZ  1 
ATOM   1439  N NH1 . ARG C  1 37  ? -10.538 -28.766 42.511  1.00 37.49 ? 1110 ARG C NH1 1 
ATOM   1440  N NH2 . ARG C  1 37  ? -9.593  -27.894 40.596  1.00 34.68 ? 1110 ARG C NH2 1 
ATOM   1441  N N   . GLU C  1 38  ? -3.935  -26.762 44.995  1.00 32.94 ? 1111 GLU C N   1 
ATOM   1442  C CA  . GLU C  1 38  ? -3.604  -26.131 46.268  1.00 41.20 ? 1111 GLU C CA  1 
ATOM   1443  C C   . GLU C  1 38  ? -3.796  -24.601 46.206  1.00 38.17 ? 1111 GLU C C   1 
ATOM   1444  O O   . GLU C  1 38  ? -3.674  -23.888 47.208  1.00 41.97 ? 1111 GLU C O   1 
ATOM   1445  C CB  . GLU C  1 38  ? -2.152  -26.471 46.678  1.00 47.26 ? 1111 GLU C CB  1 
ATOM   1446  C CG  . GLU C  1 38  ? -1.778  -27.997 46.739  1.00 45.21 ? 1111 GLU C CG  1 
ATOM   1447  C CD  . GLU C  1 38  ? -1.313  -28.603 45.382  1.00 48.29 ? 1111 GLU C CD  1 
ATOM   1448  O OE1 . GLU C  1 38  ? -0.818  -29.768 45.367  1.00 46.47 ? 1111 GLU C OE1 1 
ATOM   1449  O OE2 . GLU C  1 38  ? -1.452  -27.929 44.328  1.00 44.91 ? 1111 GLU C OE2 1 
ATOM   1450  N N   . GLY C  1 39  ? -4.091  -24.088 45.025  1.00 32.22 ? 1112 GLY C N   1 
ATOM   1451  C CA  . GLY C  1 39  ? -4.231  -22.651 44.874  1.00 35.64 ? 1112 GLY C CA  1 
ATOM   1452  C C   . GLY C  1 39  ? -3.018  -21.974 44.246  1.00 41.42 ? 1112 GLY C C   1 
ATOM   1453  O O   . GLY C  1 39  ? -2.035  -22.634 43.881  1.00 40.62 ? 1112 GLY C O   1 
ATOM   1454  N N   . MET C  1 40  ? -3.100  -20.655 44.083  1.00 35.59 ? 1113 MET C N   1 
ATOM   1455  C CA  . MET C  1 40  ? -1.952  -19.874 43.615  1.00 36.14 ? 1113 MET C CA  1 
ATOM   1456  C C   . MET C  1 40  ? -2.199  -18.434 43.943  1.00 35.46 ? 1113 MET C C   1 
ATOM   1457  O O   . MET C  1 40  ? -3.327  -18.045 44.194  1.00 32.48 ? 1113 MET C O   1 
ATOM   1458  C CB  . MET C  1 40  ? -1.790  -19.992 42.101  1.00 36.28 ? 1113 MET C CB  1 
ATOM   1459  C CG  . MET C  1 40  ? -3.111  -19.827 41.372  1.00 38.70 ? 1113 MET C CG  1 
ATOM   1460  S SD  . MET C  1 40  ? -3.026  -19.004 39.755  1.00 51.12 ? 1113 MET C SD  1 
ATOM   1461  C CE  . MET C  1 40  ? -2.129  -17.565 40.233  1.00 36.84 ? 1113 MET C CE  1 
ATOM   1462  N N   . PHE C  1 41  ? -1.151  -17.631 43.914  1.00 33.18 ? 1114 PHE C N   1 
ATOM   1463  C CA  . PHE C  1 41  ? -1.331  -16.194 44.053  1.00 35.40 ? 1114 PHE C CA  1 
ATOM   1464  C C   . PHE C  1 41  ? -0.979  -15.463 42.771  1.00 37.73 ? 1114 PHE C C   1 
ATOM   1465  O O   . PHE C  1 41  ? 0.000   -15.802 42.109  1.00 37.81 ? 1114 PHE C O   1 
ATOM   1466  C CB  . PHE C  1 41  ? -0.498  -15.663 45.222  1.00 41.29 ? 1114 PHE C CB  1 
ATOM   1467  C CG  . PHE C  1 41  ? -0.943  -16.186 46.552  1.00 41.26 ? 1114 PHE C CG  1 
ATOM   1468  C CD1 . PHE C  1 41  ? -0.524  -17.435 47.002  1.00 47.42 ? 1114 PHE C CD1 1 
ATOM   1469  C CD2 . PHE C  1 41  ? -1.801  -15.443 47.343  1.00 39.44 ? 1114 PHE C CD2 1 
ATOM   1470  C CE1 . PHE C  1 41  ? -0.947  -17.922 48.222  1.00 43.60 ? 1114 PHE C CE1 1 
ATOM   1471  C CE2 . PHE C  1 41  ? -2.228  -15.926 48.560  1.00 45.39 ? 1114 PHE C CE2 1 
ATOM   1472  C CZ  . PHE C  1 41  ? -1.797  -17.165 49.002  1.00 45.83 ? 1114 PHE C CZ  1 
ATOM   1473  N N   . HIS C  1 42  ? -1.780  -14.457 42.418  1.00 32.14 ? 1115 HIS C N   1 
ATOM   1474  C CA  . HIS C  1 42  ? -1.413  -13.551 41.342  1.00 30.26 ? 1115 HIS C CA  1 
ATOM   1475  C C   . HIS C  1 42  ? -0.851  -12.258 41.950  1.00 32.59 ? 1115 HIS C C   1 
ATOM   1476  O O   . HIS C  1 42  ? -1.597  -11.420 42.417  1.00 31.00 ? 1115 HIS C O   1 
ATOM   1477  C CB  . HIS C  1 42  ? -2.627  -13.264 40.433  1.00 26.44 ? 1115 HIS C CB  1 
ATOM   1478  C CG  . HIS C  1 42  ? -2.267  -12.579 39.152  1.00 28.86 ? 1115 HIS C CG  1 
ATOM   1479  N ND1 . HIS C  1 42  ? -3.188  -11.912 38.368  1.00 25.90 ? 1115 HIS C ND1 1 
ATOM   1480  C CD2 . HIS C  1 42  ? -1.071  -12.439 38.531  1.00 33.89 ? 1115 HIS C CD2 1 
ATOM   1481  C CE1 . HIS C  1 42  ? -2.577  -11.408 37.307  1.00 31.33 ? 1115 HIS C CE1 1 
ATOM   1482  N NE2 . HIS C  1 42  ? -1.292  -11.715 37.381  1.00 31.36 ? 1115 HIS C NE2 1 
ATOM   1483  N N   . HIS C  1 43  ? 0.475   -12.083 41.935  1.00 34.78 ? 1116 HIS C N   1 
ATOM   1484  C CA  . HIS C  1 43  ? 1.069   -10.937 42.613  1.00 34.84 ? 1116 HIS C CA  1 
ATOM   1485  C C   . HIS C  1 43  ? 0.466   -10.764 44.015  1.00 35.27 ? 1116 HIS C C   1 
ATOM   1486  O O   . HIS C  1 43  ? 0.050   -9.664  44.377  1.00 38.67 ? 1116 HIS C O   1 
ATOM   1487  C CB  . HIS C  1 43  ? 0.879   -9.639  41.821  1.00 35.14 ? 1116 HIS C CB  1 
ATOM   1488  C CG  . HIS C  1 43  ? 1.417   -9.691  40.420  1.00 39.77 ? 1116 HIS C CG  1 
ATOM   1489  N ND1 . HIS C  1 43  ? 2.752   -9.899  40.139  1.00 45.35 ? 1116 HIS C ND1 1 
ATOM   1490  C CD2 . HIS C  1 43  ? 0.801   -9.551  39.224  1.00 35.96 ? 1116 HIS C CD2 1 
ATOM   1491  C CE1 . HIS C  1 43  ? 2.932   -9.890  38.830  1.00 39.48 ? 1116 HIS C CE1 1 
ATOM   1492  N NE2 . HIS C  1 43  ? 1.763   -9.682  38.252  1.00 43.62 ? 1116 HIS C NE2 1 
ATOM   1493  N N   . GLY C  1 44  ? 0.422   -11.844 44.793  1.00 36.36 ? 1117 GLY C N   1 
ATOM   1494  C CA  . GLY C  1 44  ? -0.009  -11.777 46.180  1.00 37.84 ? 1117 GLY C CA  1 
ATOM   1495  C C   . GLY C  1 44  ? -1.507  -11.950 46.414  1.00 40.43 ? 1117 GLY C C   1 
ATOM   1496  O O   . GLY C  1 44  ? -1.946  -12.113 47.543  1.00 43.67 ? 1117 GLY C O   1 
ATOM   1497  N N   . VAL C  1 45  ? -2.292  -11.909 45.350  1.00 33.97 ? 1118 VAL C N   1 
ATOM   1498  C CA  . VAL C  1 45  ? -3.737  -12.037 45.478  1.00 31.00 ? 1118 VAL C CA  1 
ATOM   1499  C C   . VAL C  1 45  ? -4.120  -13.493 45.230  1.00 31.84 ? 1118 VAL C C   1 
ATOM   1500  O O   . VAL C  1 45  ? -3.807  -14.038 44.179  1.00 26.77 ? 1118 VAL C O   1 
ATOM   1501  C CB  . VAL C  1 45  ? -4.469  -11.180 44.409  1.00 30.07 ? 1118 VAL C CB  1 
ATOM   1502  C CG1 . VAL C  1 45  ? -6.002  -11.364 44.505  1.00 28.73 ? 1118 VAL C CG1 1 
ATOM   1503  C CG2 . VAL C  1 45  ? -4.080  -9.700  44.474  1.00 32.00 ? 1118 VAL C CG2 1 
ATOM   1504  N N   . PRO C  1 46  ? -4.842  -14.123 46.174  1.00 34.69 ? 1119 PRO C N   1 
ATOM   1505  C CA  . PRO C  1 46  ? -5.203  -15.536 46.042  1.00 31.65 ? 1119 PRO C CA  1 
ATOM   1506  C C   . PRO C  1 46  ? -6.303  -15.779 45.023  1.00 31.76 ? 1119 PRO C C   1 
ATOM   1507  O O   . PRO C  1 46  ? -7.341  -15.121 45.075  1.00 30.37 ? 1119 PRO C O   1 
ATOM   1508  C CB  . PRO C  1 46  ? -5.729  -15.922 47.441  1.00 36.61 ? 1119 PRO C CB  1 
ATOM   1509  C CG  . PRO C  1 46  ? -5.936  -14.679 48.168  1.00 35.24 ? 1119 PRO C CG  1 
ATOM   1510  C CD  . PRO C  1 46  ? -5.417  -13.506 47.382  1.00 37.05 ? 1119 PRO C CD  1 
ATOM   1511  N N   . ILE C  1 47  ? -6.080  -16.720 44.109  1.00 26.59 ? 1120 ILE C N   1 
ATOM   1512  C CA  . ILE C  1 47  ? -7.050  -17.016 43.071  1.00 25.48 ? 1120 ILE C CA  1 
ATOM   1513  C C   . ILE C  1 47  ? -7.880  -18.251 43.387  1.00 24.62 ? 1120 ILE C C   1 
ATOM   1514  O O   . ILE C  1 47  ? -7.328  -19.299 43.674  1.00 25.66 ? 1120 ILE C O   1 
ATOM   1515  C CB  . ILE C  1 47  ? -6.336  -17.217 41.712  1.00 25.93 ? 1120 ILE C CB  1 
ATOM   1516  C CG1 . ILE C  1 47  ? -5.489  -15.974 41.365  1.00 26.79 ? 1120 ILE C CG1 1 
ATOM   1517  C CG2 . ILE C  1 47  ? -7.344  -17.458 40.628  1.00 29.70 ? 1120 ILE C CG2 1 
ATOM   1518  C CD1 . ILE C  1 47  ? -6.219  -14.605 41.425  1.00 26.87 ? 1120 ILE C CD1 1 
ATOM   1519  N N   . PRO C  1 48  ? -9.217  -18.139 43.353  1.00 25.13 ? 1121 PRO C N   1 
ATOM   1520  C CA  . PRO C  1 48  ? -10.044 -19.279 43.751  1.00 22.02 ? 1121 PRO C CA  1 
ATOM   1521  C C   . PRO C  1 48  ? -9.817  -20.478 42.849  1.00 25.85 ? 1121 PRO C C   1 
ATOM   1522  O O   . PRO C  1 48  ? -9.691  -20.302 41.640  1.00 25.34 ? 1121 PRO C O   1 
ATOM   1523  C CB  . PRO C  1 48  ? -11.480 -18.744 43.517  1.00 23.89 ? 1121 PRO C CB  1 
ATOM   1524  C CG  . PRO C  1 48  ? -11.358 -17.292 43.733  1.00 26.44 ? 1121 PRO C CG  1 
ATOM   1525  C CD  . PRO C  1 48  ? -10.013 -16.920 43.148  1.00 25.86 ? 1121 PRO C CD  1 
ATOM   1526  N N   . VAL C  1 49  ? -9.798  -21.677 43.436  1.00 25.82 ? 1122 VAL C N   1 
ATOM   1527  C CA  . VAL C  1 49  ? -9.703  -22.952 42.714  1.00 24.63 ? 1122 VAL C CA  1 
ATOM   1528  C C   . VAL C  1 49  ? -11.056 -23.511 42.284  1.00 25.60 ? 1122 VAL C C   1 
ATOM   1529  O O   . VAL C  1 49  ? -11.984 -23.601 43.097  1.00 28.63 ? 1122 VAL C O   1 
ATOM   1530  C CB  . VAL C  1 49  ? -8.953  -23.963 43.615  1.00 27.42 ? 1122 VAL C CB  1 
ATOM   1531  C CG1 . VAL C  1 49  ? -9.098  -25.378 43.050  1.00 31.63 ? 1122 VAL C CG1 1 
ATOM   1532  C CG2 . VAL C  1 49  ? -7.481  -23.540 43.753  1.00 27.56 ? 1122 VAL C CG2 1 
ATOM   1533  N N   . PRO C  1 50  ? -11.207 -23.865 40.995  1.00 28.41 ? 1123 PRO C N   1 
ATOM   1534  C CA  . PRO C  1 50  ? -12.468 -24.396 40.467  1.00 26.44 ? 1123 PRO C CA  1 
ATOM   1535  C C   . PRO C  1 50  ? -12.740 -25.761 41.096  1.00 32.98 ? 1123 PRO C C   1 
ATOM   1536  O O   . PRO C  1 50  ? -11.831 -26.578 41.164  1.00 29.56 ? 1123 PRO C O   1 
ATOM   1537  C CB  . PRO C  1 50  ? -12.181 -24.643 38.983  1.00 26.45 ? 1123 PRO C CB  1 
ATOM   1538  C CG  . PRO C  1 50  ? -10.779 -24.192 38.732  1.00 30.49 ? 1123 PRO C CG  1 
ATOM   1539  C CD  . PRO C  1 50  ? -10.134 -23.767 39.990  1.00 30.21 ? 1123 PRO C CD  1 
ATOM   1540  N N   . PRO C  1 51  ? -13.968 -25.993 41.546  1.00 29.14 ? 1124 PRO C N   1 
ATOM   1541  C CA  . PRO C  1 51  ? -14.359 -27.293 42.103  1.00 33.92 ? 1124 PRO C CA  1 
ATOM   1542  C C   . PRO C  1 51  ? -14.268 -28.402 41.064  1.00 38.29 ? 1124 PRO C C   1 
ATOM   1543  O O   . PRO C  1 51  ? -14.539 -28.156 39.872  1.00 32.41 ? 1124 PRO C O   1 
ATOM   1544  C CB  . PRO C  1 51  ? -15.828 -27.084 42.433  1.00 34.54 ? 1124 PRO C CB  1 
ATOM   1545  C CG  . PRO C  1 51  ? -15.952 -25.653 42.703  1.00 37.37 ? 1124 PRO C CG  1 
ATOM   1546  C CD  . PRO C  1 51  ? -14.974 -24.951 41.791  1.00 33.90 ? 1124 PRO C CD  1 
ATOM   1547  N N   . LEU C  1 52  ? -13.954 -29.620 41.511  1.00 36.80 ? 1125 LEU C N   1 
ATOM   1548  C CA  . LEU C  1 52  ? -13.883 -30.766 40.608  1.00 34.47 ? 1125 LEU C CA  1 
ATOM   1549  C C   . LEU C  1 52  ? -15.133 -30.875 39.757  1.00 32.43 ? 1125 LEU C C   1 
ATOM   1550  O O   . LEU C  1 52  ? -15.061 -31.228 38.582  1.00 38.48 ? 1125 LEU C O   1 
ATOM   1551  C CB  . LEU C  1 52  ? -13.637 -32.055 41.415  1.00 40.88 ? 1125 LEU C CB  1 
ATOM   1552  C CG  . LEU C  1 52  ? -12.423 -31.965 42.357  1.00 43.75 ? 1125 LEU C CG  1 
ATOM   1553  C CD1 . LEU C  1 52  ? -12.240 -33.202 43.231  1.00 49.04 ? 1125 LEU C CD1 1 
ATOM   1554  C CD2 . LEU C  1 52  ? -11.161 -31.708 41.549  1.00 43.52 ? 1125 LEU C CD2 1 
ATOM   1555  N N   . GLU C  1 53  ? -16.288 -30.571 40.339  1.00 36.63 ? 1126 GLU C N   1 
ATOM   1556  C CA  . GLU C  1 53  ? -17.547 -30.725 39.638  1.00 35.94 ? 1126 GLU C CA  1 
ATOM   1557  C C   . GLU C  1 53  ? -17.623 -29.725 38.477  1.00 33.53 ? 1126 GLU C C   1 
ATOM   1558  O O   . GLU C  1 53  ? -18.068 -30.063 37.387  1.00 34.90 ? 1126 GLU C O   1 
ATOM   1559  C CB  . GLU C  1 53  ? -18.738 -30.580 40.605  1.00 39.35 ? 1126 GLU C CB  1 
ATOM   1560  C CG  . GLU C  1 53  ? -18.585 -29.511 41.732  1.00 46.88 ? 1126 GLU C CG  1 
ATOM   1561  C CD  . GLU C  1 53  ? -17.838 -29.983 42.998  1.00 47.21 ? 1126 GLU C CD  1 
ATOM   1562  O OE1 . GLU C  1 53  ? -18.240 -29.587 44.116  1.00 52.70 ? 1126 GLU C OE1 1 
ATOM   1563  O OE2 . GLU C  1 53  ? -16.841 -30.722 42.892  1.00 45.30 ? 1126 GLU C OE2 1 
ATOM   1564  N N   . VAL C  1 54  ? -17.148 -28.509 38.710  1.00 36.87 ? 1127 VAL C N   1 
ATOM   1565  C CA  . VAL C  1 54  ? -17.123 -27.482 37.671  1.00 32.27 ? 1127 VAL C CA  1 
ATOM   1566  C C   . VAL C  1 54  ? -16.262 -27.932 36.481  1.00 30.67 ? 1127 VAL C C   1 
ATOM   1567  O O   . VAL C  1 54  ? -16.651 -27.798 35.310  1.00 27.22 ? 1127 VAL C O   1 
ATOM   1568  C CB  . VAL C  1 54  ? -16.619 -26.119 38.260  1.00 33.43 ? 1127 VAL C CB  1 
ATOM   1569  C CG1 . VAL C  1 54  ? -16.337 -25.110 37.136  1.00 28.36 ? 1127 VAL C CG1 1 
ATOM   1570  C CG2 . VAL C  1 54  ? -17.684 -25.545 39.200  1.00 30.87 ? 1127 VAL C CG2 1 
ATOM   1571  N N   . LEU C  1 55  ? -15.102 -28.476 36.801  1.00 30.13 ? 1128 LEU C N   1 
ATOM   1572  C CA  . LEU C  1 55  ? -14.210 -29.009 35.778  1.00 35.51 ? 1128 LEU C CA  1 
ATOM   1573  C C   . LEU C  1 55  ? -14.868 -30.127 34.981  1.00 36.97 ? 1128 LEU C C   1 
ATOM   1574  O O   . LEU C  1 55  ? -14.771 -30.160 33.753  1.00 33.22 ? 1128 LEU C O   1 
ATOM   1575  C CB  . LEU C  1 55  ? -12.913 -29.486 36.405  1.00 30.96 ? 1128 LEU C CB  1 
ATOM   1576  C CG  . LEU C  1 55  ? -12.208 -28.371 37.155  1.00 28.01 ? 1128 LEU C CG  1 
ATOM   1577  C CD1 . LEU C  1 55  ? -10.876 -28.887 37.751  1.00 31.18 ? 1128 LEU C CD1 1 
ATOM   1578  C CD2 . LEU C  1 55  ? -11.983 -27.204 36.185  1.00 31.33 ? 1128 LEU C CD2 1 
ATOM   1579  N N   . LYS C  1 56  ? -15.601 -30.995 35.678  1.00 39.46 ? 1129 LYS C N   1 
ATOM   1580  C CA  . LYS C  1 56  ? -16.281 -32.097 35.029  1.00 37.60 ? 1129 LYS C CA  1 
ATOM   1581  C C   . LYS C  1 56  ? -17.303 -31.576 34.032  1.00 37.41 ? 1129 LYS C C   1 
ATOM   1582  O O   . LYS C  1 56  ? -17.412 -32.091 32.912  1.00 38.10 ? 1129 LYS C O   1 
ATOM   1583  C CB  . LYS C  1 56  ? -16.940 -32.999 36.090  1.00 40.40 ? 1129 LYS C CB  1 
ATOM   1584  C CG  . LYS C  1 56  ? -17.664 -34.202 35.513  1.00 49.72 ? 1129 LYS C CG  1 
ATOM   1585  C CD  . LYS C  1 56  ? -18.516 -34.919 36.565  1.00 55.39 ? 1129 LYS C CD  1 
ATOM   1586  C CE  . LYS C  1 56  ? -19.080 -36.231 36.020  1.00 56.49 ? 1129 LYS C CE  1 
ATOM   1587  N NZ  . LYS C  1 56  ? -19.988 -36.892 37.010  1.00 63.83 ? 1129 LYS C NZ  1 
ATOM   1588  N N   . LEU C  1 57  ? -18.041 -30.541 34.423  1.00 32.49 ? 1130 LEU C N   1 
ATOM   1589  C CA  . LEU C  1 57  ? -19.012 -29.889 33.550  1.00 33.72 ? 1130 LEU C CA  1 
ATOM   1590  C C   . LEU C  1 57  ? -18.328 -29.335 32.322  1.00 32.85 ? 1130 LEU C C   1 
ATOM   1591  O O   . LEU C  1 57  ? -18.881 -29.378 31.237  1.00 29.90 ? 1130 LEU C O   1 
ATOM   1592  C CB  . LEU C  1 57  ? -19.641 -28.702 34.264  1.00 33.91 ? 1130 LEU C CB  1 
ATOM   1593  C CG  . LEU C  1 57  ? -21.102 -28.306 34.042  1.00 42.63 ? 1130 LEU C CG  1 
ATOM   1594  C CD1 . LEU C  1 57  ? -21.269 -26.797 34.339  1.00 37.92 ? 1130 LEU C CD1 1 
ATOM   1595  C CD2 . LEU C  1 57  ? -21.647 -28.646 32.659  1.00 40.76 ? 1130 LEU C CD2 1 
ATOM   1596  N N   . GLY C  1 58  ? -17.142 -28.765 32.521  1.00 31.11 ? 1131 GLY C N   1 
ATOM   1597  C CA  . GLY C  1 58  ? -16.430 -28.102 31.428  1.00 31.42 ? 1131 GLY C CA  1 
ATOM   1598  C C   . GLY C  1 58  ? -16.087 -29.104 30.323  1.00 30.82 ? 1131 GLY C C   1 
ATOM   1599  O O   . GLY C  1 58  ? -16.268 -28.834 29.127  1.00 30.64 ? 1131 GLY C O   1 
ATOM   1600  N N   . GLU C  1 59  ? -15.561 -30.246 30.742  1.00 32.53 ? 1132 GLU C N   1 
ATOM   1601  C CA  . GLU C  1 59  ? -15.295 -31.348 29.815  1.00 35.20 ? 1132 GLU C CA  1 
ATOM   1602  C C   . GLU C  1 59  ? -16.519 -31.731 28.996  1.00 34.86 ? 1132 GLU C C   1 
ATOM   1603  O O   . GLU C  1 59  ? -16.432 -31.852 27.779  1.00 35.53 ? 1132 GLU C O   1 
ATOM   1604  C CB  . GLU C  1 59  ? -14.778 -32.548 30.570  1.00 41.70 ? 1132 GLU C CB  1 
ATOM   1605  C CG  . GLU C  1 59  ? -14.133 -33.551 29.649  1.00 46.77 ? 1132 GLU C CG  1 
ATOM   1606  C CD  . GLU C  1 59  ? -13.308 -34.562 30.397  1.00 56.52 ? 1132 GLU C CD  1 
ATOM   1607  O OE1 . GLU C  1 59  ? -13.570 -35.777 30.231  1.00 60.37 ? 1132 GLU C OE1 1 
ATOM   1608  O OE2 . GLU C  1 59  ? -12.407 -34.133 31.154  1.00 63.67 ? 1132 GLU C OE2 1 
ATOM   1609  N N   . GLN C  1 60  ? -17.665 -31.902 29.657  1.00 35.02 ? 1133 GLN C N   1 
ATOM   1610  C CA  . GLN C  1 60  ? -18.898 -32.285 28.961  1.00 35.65 ? 1133 GLN C CA  1 
ATOM   1611  C C   . GLN C  1 60  ? -19.354 -31.205 28.019  1.00 36.79 ? 1133 GLN C C   1 
ATOM   1612  O O   . GLN C  1 60  ? -19.803 -31.471 26.903  1.00 37.03 ? 1133 GLN C O   1 
ATOM   1613  C CB  . GLN C  1 60  ? -20.045 -32.539 29.944  1.00 39.84 ? 1133 GLN C CB  1 
ATOM   1614  C CG  . GLN C  1 60  ? -19.834 -33.606 31.010  1.00 41.66 ? 1133 GLN C CG  1 
ATOM   1615  C CD  . GLN C  1 60  ? -20.786 -33.395 32.207  1.00 48.49 ? 1133 GLN C CD  1 
ATOM   1616  O OE1 . GLN C  1 60  ? -20.406 -33.582 33.367  1.00 51.56 ? 1133 GLN C OE1 1 
ATOM   1617  N NE2 . GLN C  1 60  ? -22.019 -32.970 31.917  1.00 46.80 ? 1133 GLN C NE2 1 
ATOM   1618  N N   . MET C  1 61  ? -19.282 -29.957 28.479  1.00 28.30 ? 1134 MET C N   1 
ATOM   1619  C CA  . MET C  1 61  ? -19.752 -28.895 27.657  1.00 27.31 ? 1134 MET C CA  1 
ATOM   1620  C C   . MET C  1 61  ? -18.779 -28.708 26.500  1.00 26.83 ? 1134 MET C C   1 
ATOM   1621  O O   . MET C  1 61  ? -19.183 -28.305 25.453  1.00 27.27 ? 1134 MET C O   1 
ATOM   1622  C CB  . MET C  1 61  ? -19.880 -27.588 28.444  1.00 28.75 ? 1134 MET C CB  1 
ATOM   1623  C CG  . MET C  1 61  ? -20.828 -27.664 29.628  1.00 29.24 ? 1134 MET C CG  1 
ATOM   1624  S SD  . MET C  1 61  ? -20.868 -26.042 30.486  1.00 32.73 ? 1134 MET C SD  1 
ATOM   1625  C CE  . MET C  1 61  ? -21.570 -24.929 29.291  1.00 30.07 ? 1134 MET C CE  1 
ATOM   1626  N N   . THR C  1 62  ? -17.505 -28.958 26.715  1.00 29.99 ? 1135 THR C N   1 
ATOM   1627  C CA  . THR C  1 62  ? -16.546 -28.709 25.649  1.00 29.63 ? 1135 THR C CA  1 
ATOM   1628  C C   . THR C  1 62  ? -16.782 -29.748 24.541  1.00 31.19 ? 1135 THR C C   1 
ATOM   1629  O O   . THR C  1 62  ? -16.872 -29.396 23.357  1.00 31.81 ? 1135 THR C O   1 
ATOM   1630  C CB  . THR C  1 62  ? -15.120 -28.775 26.178  1.00 30.22 ? 1135 THR C CB  1 
ATOM   1631  O OG1 . THR C  1 62  ? -14.893 -27.609 26.976  1.00 29.74 ? 1135 THR C OG1 1 
ATOM   1632  C CG2 . THR C  1 62  ? -14.103 -28.780 25.017  1.00 32.93 ? 1135 THR C CG2 1 
ATOM   1633  N N   . GLN C  1 63  ? -16.955 -30.994 24.966  1.00 34.64 ? 1136 GLN C N   1 
ATOM   1634  C CA  . GLN C  1 63  ? -17.208 -32.118 24.035  1.00 35.53 ? 1136 GLN C CA  1 
ATOM   1635  C C   . GLN C  1 63  ? -18.489 -31.901 23.232  1.00 40.19 ? 1136 GLN C C   1 
ATOM   1636  O O   . GLN C  1 63  ? -18.513 -32.126 22.014  1.00 45.78 ? 1136 GLN C O   1 
ATOM   1637  C CB  . GLN C  1 63  ? -17.278 -33.435 24.786  1.00 41.86 ? 1136 GLN C CB  1 
ATOM   1638  C CG  . GLN C  1 63  ? -15.934 -33.901 25.375  1.00 51.14 ? 1136 GLN C CG  1 
ATOM   1639  C CD  . GLN C  1 63  ? -16.027 -35.254 26.103  1.00 57.07 ? 1136 GLN C CD  1 
ATOM   1640  O OE1 . GLN C  1 63  ? -15.556 -35.405 27.236  1.00 58.92 ? 1136 GLN C OE1 1 
ATOM   1641  N NE2 . GLN C  1 63  ? -16.643 -36.238 25.447  1.00 61.05 ? 1136 GLN C NE2 1 
ATOM   1642  N N   . GLU C  1 64  ? -19.555 -31.454 23.892  1.00 33.98 ? 1137 GLU C N   1 
ATOM   1643  C CA  . GLU C  1 64  ? -20.810 -31.245 23.183  1.00 37.58 ? 1137 GLU C CA  1 
ATOM   1644  C C   . GLU C  1 64  ? -20.804 -30.020 22.254  1.00 39.67 ? 1137 GLU C C   1 
ATOM   1645  O O   . GLU C  1 64  ? -21.434 -30.035 21.196  1.00 39.89 ? 1137 GLU C O   1 
ATOM   1646  C CB  . GLU C  1 64  ? -22.011 -31.251 24.157  1.00 35.86 ? 1137 GLU C CB  1 
ATOM   1647  C CG  . GLU C  1 64  ? -22.262 -29.928 24.862  1.00 44.99 ? 1137 GLU C CG  1 
ATOM   1648  C CD  . GLU C  1 64  ? -23.169 -30.077 26.084  1.00 51.75 ? 1137 GLU C CD  1 
ATOM   1649  O OE1 . GLU C  1 64  ? -23.416 -29.046 26.784  1.00 50.09 ? 1137 GLU C OE1 1 
ATOM   1650  O OE2 . GLU C  1 64  ? -23.623 -31.229 26.335  1.00 52.85 ? 1137 GLU C OE2 1 
ATOM   1651  N N   . ALA C  1 65  ? -20.090 -28.959 22.629  1.00 33.09 ? 1138 ALA C N   1 
ATOM   1652  C CA  . ALA C  1 65  ? -20.020 -27.769 21.796  1.00 30.64 ? 1138 ALA C CA  1 
ATOM   1653  C C   . ALA C  1 65  ? -18.986 -27.923 20.674  1.00 29.86 ? 1138 ALA C C   1 
ATOM   1654  O O   . ALA C  1 65  ? -19.075 -27.226 19.676  1.00 35.70 ? 1138 ALA C O   1 
ATOM   1655  C CB  . ALA C  1 65  ? -19.677 -26.533 22.638  1.00 33.25 ? 1138 ALA C CB  1 
ATOM   1656  N N   . ARG C  1 66  ? -18.003 -28.792 20.873  1.00 31.11 ? 1139 ARG C N   1 
ATOM   1657  C CA  . ARG C  1 66  ? -16.851 -28.876 19.952  1.00 30.75 ? 1139 ARG C CA  1 
ATOM   1658  C C   . ARG C  1 66  ? -16.211 -27.490 19.756  1.00 30.71 ? 1139 ARG C C   1 
ATOM   1659  O O   . ARG C  1 66  ? -15.882 -27.038 18.658  1.00 24.44 ? 1139 ARG C O   1 
ATOM   1660  C CB  . ARG C  1 66  ? -17.298 -29.484 18.619  1.00 33.49 ? 1139 ARG C CB  1 
ATOM   1661  C CG  . ARG C  1 66  ? -16.835 -30.926 18.371  1.00 40.50 ? 1139 ARG C CG  1 
ATOM   1662  C CD  . ARG C  1 66  ? -17.626 -32.030 19.098  1.00 40.89 ? 1139 ARG C CD  1 
ATOM   1663  N NE  . ARG C  1 66  ? -19.072 -31.798 19.137  1.00 43.43 ? 1139 ARG C NE  1 
ATOM   1664  C CZ  . ARG C  1 66  ? -19.977 -32.446 18.406  1.00 42.80 ? 1139 ARG C CZ  1 
ATOM   1665  N NH1 . ARG C  1 66  ? -21.273 -32.127 18.528  1.00 47.97 ? 1139 ARG C NH1 1 
ATOM   1666  N NH2 . ARG C  1 66  ? -19.606 -33.392 17.545  1.00 35.21 ? 1139 ARG C NH2 1 
ATOM   1667  N N   . GLU C  1 67  ? -16.044 -26.775 20.854  1.00 27.43 ? 1140 GLU C N   1 
ATOM   1668  C CA  . GLU C  1 67  ? -15.393 -25.481 20.760  1.00 29.32 ? 1140 GLU C CA  1 
ATOM   1669  C C   . GLU C  1 67  ? -14.680 -25.211 22.072  1.00 25.96 ? 1140 GLU C C   1 
ATOM   1670  O O   . GLU C  1 67  ? -15.009 -25.790 23.122  1.00 24.15 ? 1140 GLU C O   1 
ATOM   1671  C CB  . GLU C  1 67  ? -16.337 -24.334 20.329  1.00 34.57 ? 1140 GLU C CB  1 
ATOM   1672  C CG  . GLU C  1 67  ? -17.543 -24.110 21.150  1.00 36.80 ? 1140 GLU C CG  1 
ATOM   1673  C CD  . GLU C  1 67  ? -18.325 -22.836 20.737  1.00 42.26 ? 1140 GLU C CD  1 
ATOM   1674  O OE1 . GLU C  1 67  ? -19.543 -22.803 20.987  1.00 44.41 ? 1140 GLU C OE1 1 
ATOM   1675  O OE2 . GLU C  1 67  ? -17.742 -21.871 20.173  1.00 45.45 ? 1140 GLU C OE2 1 
ATOM   1676  N N   . HIS C  1 68  ? -13.639 -24.400 21.996  1.00 22.02 ? 1141 HIS C N   1 
ATOM   1677  C CA  . HIS C  1 68  ? -12.868 -24.164 23.191  1.00 23.42 ? 1141 HIS C CA  1 
ATOM   1678  C C   . HIS C  1 68  ? -13.684 -23.297 24.164  1.00 18.53 ? 1141 HIS C C   1 
ATOM   1679  O O   . HIS C  1 68  ? -14.179 -22.258 23.752  1.00 23.01 ? 1141 HIS C O   1 
ATOM   1680  C CB  . HIS C  1 68  ? -11.585 -23.410 22.847  1.00 21.04 ? 1141 HIS C CB  1 
ATOM   1681  C CG  . HIS C  1 68  ? -10.735 -23.151 24.037  1.00 25.93 ? 1141 HIS C CG  1 
ATOM   1682  N ND1 . HIS C  1 68  ? -9.884  -24.097 24.552  1.00 28.28 ? 1141 HIS C ND1 1 
ATOM   1683  C CD2 . HIS C  1 68  ? -10.650 -22.074 24.859  1.00 28.38 ? 1141 HIS C CD2 1 
ATOM   1684  C CE1 . HIS C  1 68  ? -9.277  -23.606 25.621  1.00 31.47 ? 1141 HIS C CE1 1 
ATOM   1685  N NE2 . HIS C  1 68  ? -9.715  -22.377 25.820  1.00 29.62 ? 1141 HIS C NE2 1 
ATOM   1686  N N   . LEU C  1 69  ? -13.791 -23.753 25.407  1.00 22.05 ? 1142 LEU C N   1 
ATOM   1687  C CA  . LEU C  1 69  ? -14.439 -22.981 26.471  1.00 24.19 ? 1142 LEU C CA  1 
ATOM   1688  C C   . LEU C  1 69  ? -13.476 -22.465 27.511  1.00 19.42 ? 1142 LEU C C   1 
ATOM   1689  O O   . LEU C  1 69  ? -12.634 -23.190 28.020  1.00 21.77 ? 1142 LEU C O   1 
ATOM   1690  C CB  . LEU C  1 69  ? -15.549 -23.791 27.149  1.00 23.85 ? 1142 LEU C CB  1 
ATOM   1691  C CG  . LEU C  1 69  ? -16.625 -24.381 26.212  1.00 25.00 ? 1142 LEU C CG  1 
ATOM   1692  C CD1 . LEU C  1 69  ? -17.717 -25.123 26.989  1.00 27.28 ? 1142 LEU C CD1 1 
ATOM   1693  C CD2 . LEU C  1 69  ? -17.228 -23.352 25.293  1.00 23.81 ? 1142 LEU C CD2 1 
ATOM   1694  N N   . TYR C  1 70  ? -13.645 -21.172 27.834  1.00 17.90 ? 1143 TYR C N   1 
ATOM   1695  C CA  . TYR C  1 70  ? -12.869 -20.555 28.886  1.00 18.46 ? 1143 TYR C CA  1 
ATOM   1696  C C   . TYR C  1 70  ? -13.673 -20.763 30.171  1.00 20.62 ? 1143 TYR C C   1 
ATOM   1697  O O   . TYR C  1 70  ? -14.890 -20.710 30.116  1.00 20.73 ? 1143 TYR C O   1 
ATOM   1698  C CB  . TYR C  1 70  ? -12.797 -19.062 28.582  1.00 15.37 ? 1143 TYR C CB  1 
ATOM   1699  C CG  . TYR C  1 70  ? -11.877 -18.723 27.425  1.00 19.72 ? 1143 TYR C CG  1 
ATOM   1700  C CD1 . TYR C  1 70  ? -10.534 -18.479 27.631  1.00 18.05 ? 1143 TYR C CD1 1 
ATOM   1701  C CD2 . TYR C  1 70  ? -12.354 -18.682 26.134  1.00 21.21 ? 1143 TYR C CD2 1 
ATOM   1702  C CE1 . TYR C  1 70  ? -9.702  -18.188 26.579  1.00 21.81 ? 1143 TYR C CE1 1 
ATOM   1703  C CE2 . TYR C  1 70  ? -11.532 -18.390 25.098  1.00 21.65 ? 1143 TYR C CE2 1 
ATOM   1704  C CZ  . TYR C  1 70  ? -10.199 -18.131 25.336  1.00 22.32 ? 1143 TYR C CZ  1 
ATOM   1705  O OH  . TYR C  1 70  ? -9.385  -17.815 24.272  1.00 24.82 ? 1143 TYR C OH  1 
ATOM   1706  N N   . LEU C  1 71  ? -12.997 -21.020 31.278  1.00 18.49 ? 1144 LEU C N   1 
ATOM   1707  C CA  . LEU C  1 71  ? -13.673 -21.045 32.584  1.00 17.97 ? 1144 LEU C CA  1 
ATOM   1708  C C   . LEU C  1 71  ? -13.677 -19.612 33.126  1.00 19.93 ? 1144 LEU C C   1 
ATOM   1709  O O   . LEU C  1 71  ? -12.637 -18.988 33.163  1.00 18.69 ? 1144 LEU C O   1 
ATOM   1710  C CB  . LEU C  1 71  ? -12.894 -21.922 33.530  1.00 16.94 ? 1144 LEU C CB  1 
ATOM   1711  C CG  . LEU C  1 71  ? -13.397 -21.979 34.976  1.00 19.74 ? 1144 LEU C CG  1 
ATOM   1712  C CD1 . LEU C  1 71  ? -14.897 -22.329 34.939  1.00 19.32 ? 1144 LEU C CD1 1 
ATOM   1713  C CD2 . LEU C  1 71  ? -12.587 -22.979 35.740  1.00 22.89 ? 1144 LEU C CD2 1 
ATOM   1714  N N   . VAL C  1 72  ? -14.843 -19.083 33.500  1.00 14.17 ? 1145 VAL C N   1 
ATOM   1715  C CA  . VAL C  1 72  ? -14.830 -17.729 34.075  1.00 12.88 ? 1145 VAL C CA  1 
ATOM   1716  C C   . VAL C  1 72  ? -15.415 -17.798 35.477  1.00 22.29 ? 1145 VAL C C   1 
ATOM   1717  O O   . VAL C  1 72  ? -16.260 -18.637 35.766  1.00 21.51 ? 1145 VAL C O   1 
ATOM   1718  C CB  . VAL C  1 72  ? -15.535 -16.661 33.231  1.00 16.67 ? 1145 VAL C CB  1 
ATOM   1719  C CG1 . VAL C  1 72  ? -14.921 -16.622 31.817  1.00 19.44 ? 1145 VAL C CG1 1 
ATOM   1720  C CG2 . VAL C  1 72  ? -17.097 -16.877 33.193  1.00 16.20 ? 1145 VAL C CG2 1 
ATOM   1721  N N   . LEU C  1 73  ? -14.951 -16.887 36.331  1.00 18.19 ? 1146 LEU C N   1 
ATOM   1722  C CA  . LEU C  1 73  ? -15.497 -16.747 37.686  1.00 22.09 ? 1146 LEU C CA  1 
ATOM   1723  C C   . LEU C  1 73  ? -16.068 -15.331 37.758  1.00 18.19 ? 1146 LEU C C   1 
ATOM   1724  O O   . LEU C  1 73  ? -15.356 -14.369 37.560  1.00 16.76 ? 1146 LEU C O   1 
ATOM   1725  C CB  . LEU C  1 73  ? -14.387 -16.866 38.684  1.00 19.68 ? 1146 LEU C CB  1 
ATOM   1726  C CG  . LEU C  1 73  ? -14.825 -16.640 40.143  1.00 21.13 ? 1146 LEU C CG  1 
ATOM   1727  C CD1 . LEU C  1 73  ? -15.815 -17.791 40.571  1.00 21.94 ? 1146 LEU C CD1 1 
ATOM   1728  C CD2 . LEU C  1 73  ? -13.610 -16.610 41.043  1.00 19.10 ? 1146 LEU C CD2 1 
ATOM   1729  N N   . PHE C  1 74  ? -17.380 -15.216 37.948  1.00 16.82 ? 1147 PHE C N   1 
ATOM   1730  C CA  . PHE C  1 74  ? -17.987 -13.912 37.947  1.00 17.20 ? 1147 PHE C CA  1 
ATOM   1731  C C   . PHE C  1 74  ? -17.693 -13.158 39.251  1.00 14.70 ? 1147 PHE C C   1 
ATOM   1732  O O   . PHE C  1 74  ? -17.456 -13.757 40.258  1.00 18.36 ? 1147 PHE C O   1 
ATOM   1733  C CB  . PHE C  1 74  ? -19.507 -14.081 37.820  1.00 18.32 ? 1147 PHE C CB  1 
ATOM   1734  C CG  . PHE C  1 74  ? -19.939 -14.574 36.492  1.00 18.00 ? 1147 PHE C CG  1 
ATOM   1735  C CD1 . PHE C  1 74  ? -19.962 -13.718 35.411  1.00 17.22 ? 1147 PHE C CD1 1 
ATOM   1736  C CD2 . PHE C  1 74  ? -20.339 -15.886 36.333  1.00 20.81 ? 1147 PHE C CD2 1 
ATOM   1737  C CE1 . PHE C  1 74  ? -20.344 -14.149 34.166  1.00 17.80 ? 1147 PHE C CE1 1 
ATOM   1738  C CE2 . PHE C  1 74  ? -20.736 -16.324 35.086  1.00 18.55 ? 1147 PHE C CE2 1 
ATOM   1739  C CZ  . PHE C  1 74  ? -20.743 -15.467 34.016  1.00 21.72 ? 1147 PHE C CZ  1 
ATOM   1740  N N   . PHE C  1 75  ? -17.710 -11.837 39.169  1.00 15.78 ? 1148 PHE C N   1 
ATOM   1741  C CA  . PHE C  1 75  ? -17.541 -10.973 40.336  1.00 16.16 ? 1148 PHE C CA  1 
ATOM   1742  C C   . PHE C  1 75  ? -18.907 -10.674 40.924  1.00 16.10 ? 1148 PHE C C   1 
ATOM   1743  O O   . PHE C  1 75  ? -19.132 -9.587  41.483  1.00 17.37 ? 1148 PHE C O   1 
ATOM   1744  C CB  . PHE C  1 75  ? -16.915 -9.681  39.891  1.00 15.94 ? 1148 PHE C CB  1 
ATOM   1745  C CG  . PHE C  1 75  ? -15.423 -9.802  39.661  1.00 16.17 ? 1148 PHE C CG  1 
ATOM   1746  C CD1 . PHE C  1 75  ? -14.558 -9.801  40.739  1.00 18.49 ? 1148 PHE C CD1 1 
ATOM   1747  C CD2 . PHE C  1 75  ? -14.900 -9.932  38.379  1.00 15.99 ? 1148 PHE C CD2 1 
ATOM   1748  C CE1 . PHE C  1 75  ? -13.172 -9.933  40.556  1.00 20.01 ? 1148 PHE C CE1 1 
ATOM   1749  C CE2 . PHE C  1 75  ? -13.514 -10.039 38.199  1.00 16.29 ? 1148 PHE C CE2 1 
ATOM   1750  C CZ  . PHE C  1 75  ? -12.659 -10.054 39.273  1.00 17.19 ? 1148 PHE C CZ  1 
ATOM   1751  N N   . ASP C  1 76  ? -19.805 -11.645 40.817  1.00 16.63 ? 1149 ASP C N   1 
ATOM   1752  C CA  . ASP C  1 76  ? -21.115 -11.504 41.460  1.00 24.10 ? 1149 ASP C CA  1 
ATOM   1753  C C   . ASP C  1 76  ? -21.054 -11.820 42.941  1.00 25.20 ? 1149 ASP C C   1 
ATOM   1754  O O   . ASP C  1 76  ? -20.056 -12.303 43.462  1.00 22.20 ? 1149 ASP C O   1 
ATOM   1755  C CB  . ASP C  1 76  ? -22.200 -12.341 40.751  1.00 22.22 ? 1149 ASP C CB  1 
ATOM   1756  C CG  . ASP C  1 76  ? -21.871 -13.840 40.664  1.00 24.25 ? 1149 ASP C CG  1 
ATOM   1757  O OD1 . ASP C  1 76  ? -20.747 -14.253 40.936  1.00 21.96 ? 1149 ASP C OD1 1 
ATOM   1758  O OD2 . ASP C  1 76  ? -22.771 -14.649 40.315  1.00 28.60 ? 1149 ASP C OD2 1 
ATOM   1759  N N   . ASN C  1 77  ? -22.151 -11.547 43.652  1.00 26.86 ? 1150 ASN C N   1 
ATOM   1760  C CA  . ASN C  1 77  ? -22.126 -11.752 45.097  1.00 30.61 ? 1150 ASN C CA  1 
ATOM   1761  C C   . ASN C  1 77  ? -21.605 -13.118 45.510  1.00 31.27 ? 1150 ASN C C   1 
ATOM   1762  O O   . ASN C  1 77  ? -20.693 -13.229 46.342  1.00 32.22 ? 1150 ASN C O   1 
ATOM   1763  C CB  . ASN C  1 77  ? -23.527 -11.515 45.674  1.00 32.61 ? 1150 ASN C CB  1 
ATOM   1764  C CG  . ASN C  1 77  ? -23.859 -10.061 45.742  1.00 39.88 ? 1150 ASN C CG  1 
ATOM   1765  O OD1 . ASN C  1 77  ? -22.960 -9.221  45.630  1.00 39.79 ? 1150 ASN C OD1 1 
ATOM   1766  N ND2 . ASN C  1 77  ? -25.138 -9.735  45.926  1.00 40.44 ? 1150 ASN C ND2 1 
ATOM   1767  N N   . LYS C  1 78  ? -22.150 -14.162 44.894  1.00 27.97 ? 1151 LYS C N   1 
ATOM   1768  C CA  . LYS C  1 78  ? -21.787 -15.520 45.269  1.00 29.59 ? 1151 LYS C CA  1 
ATOM   1769  C C   . LYS C  1 78  ? -20.561 -16.091 44.554  1.00 29.82 ? 1151 LYS C C   1 
ATOM   1770  O O   . LYS C  1 78  ? -20.150 -17.219 44.829  1.00 26.73 ? 1151 LYS C O   1 
ATOM   1771  C CB  . LYS C  1 78  ? -23.008 -16.427 45.065  1.00 34.66 ? 1151 LYS C CB  1 
ATOM   1772  C CG  . LYS C  1 78  ? -24.235 -15.871 45.814  1.00 37.52 ? 1151 LYS C CG  1 
ATOM   1773  C CD  . LYS C  1 78  ? -25.443 -16.776 45.715  1.00 46.38 ? 1151 LYS C CD  1 
ATOM   1774  C CE  . LYS C  1 78  ? -25.725 -17.139 44.264  1.00 51.27 ? 1151 LYS C CE  1 
ATOM   1775  N NZ  . LYS C  1 78  ? -26.691 -18.280 44.146  1.00 57.26 ? 1151 LYS C NZ  1 
ATOM   1776  N N   . ARG C  1 79  ? -19.973 -15.316 43.646  1.00 25.82 ? 1152 ARG C N   1 
ATOM   1777  C CA  . ARG C  1 79  ? -18.791 -15.766 42.887  1.00 19.63 ? 1152 ARG C CA  1 
ATOM   1778  C C   . ARG C  1 79  ? -19.073 -17.058 42.096  1.00 21.50 ? 1152 ARG C C   1 
ATOM   1779  O O   . ARG C  1 79  ? -18.482 -18.080 42.369  1.00 26.71 ? 1152 ARG C O   1 
ATOM   1780  C CB  . ARG C  1 79  ? -17.542 -15.929 43.771  1.00 23.46 ? 1152 ARG C CB  1 
ATOM   1781  C CG  . ARG C  1 79  ? -17.074 -14.663 44.498  1.00 26.78 ? 1152 ARG C CG  1 
ATOM   1782  C CD  . ARG C  1 79  ? -16.851 -13.483 43.559  1.00 23.46 ? 1152 ARG C CD  1 
ATOM   1783  N NE  . ARG C  1 79  ? -15.613 -13.530 42.744  1.00 20.85 ? 1152 ARG C NE  1 
ATOM   1784  C CZ  . ARG C  1 79  ? -14.397 -13.236 43.186  1.00 25.95 ? 1152 ARG C CZ  1 
ATOM   1785  N NH1 . ARG C  1 79  ? -14.203 -12.911 44.459  1.00 25.71 ? 1152 ARG C NH1 1 
ATOM   1786  N NH2 . ARG C  1 79  ? -13.359 -13.259 42.352  1.00 23.88 ? 1152 ARG C NH2 1 
ATOM   1787  N N   . THR C  1 80  ? -19.961 -16.971 41.114  1.00 23.53 ? 1153 THR C N   1 
ATOM   1788  C CA  . THR C  1 80  ? -20.356 -18.159 40.379  1.00 22.80 ? 1153 THR C CA  1 
ATOM   1789  C C   . THR C  1 80  ? -19.449 -18.456 39.174  1.00 22.42 ? 1153 THR C C   1 
ATOM   1790  O O   . THR C  1 80  ? -18.769 -17.557 38.635  1.00 20.58 ? 1153 THR C O   1 
ATOM   1791  C CB  . THR C  1 80  ? -21.818 -18.065 39.946  1.00 23.22 ? 1153 THR C CB  1 
ATOM   1792  O OG1 . THR C  1 80  ? -22.035 -16.903 39.143  1.00 24.55 ? 1153 THR C OG1 1 
ATOM   1793  C CG2 . THR C  1 80  ? -22.721 -17.994 41.203  1.00 29.56 ? 1153 THR C CG2 1 
ATOM   1794  N N   . TRP C  1 81  ? -19.494 -19.697 38.727  1.00 22.12 ? 1154 TRP C N   1 
ATOM   1795  C CA  . TRP C  1 81  ? -18.676 -20.143 37.571  1.00 25.87 ? 1154 TRP C CA  1 
ATOM   1796  C C   . TRP C  1 81  ? -19.478 -20.401 36.290  1.00 26.11 ? 1154 TRP C C   1 
ATOM   1797  O O   . TRP C  1 81  ? -20.671 -20.733 36.312  1.00 25.33 ? 1154 TRP C O   1 
ATOM   1798  C CB  . TRP C  1 81  ? -17.973 -21.464 37.883  1.00 25.56 ? 1154 TRP C CB  1 
ATOM   1799  C CG  . TRP C  1 81  ? -17.132 -21.484 39.110  1.00 23.49 ? 1154 TRP C CG  1 
ATOM   1800  C CD1 . TRP C  1 81  ? -17.523 -21.807 40.381  1.00 26.91 ? 1154 TRP C CD1 1 
ATOM   1801  C CD2 . TRP C  1 81  ? -15.731 -21.262 39.164  1.00 21.62 ? 1154 TRP C CD2 1 
ATOM   1802  N NE1 . TRP C  1 81  ? -16.450 -21.753 41.233  1.00 24.94 ? 1154 TRP C NE1 1 
ATOM   1803  C CE2 . TRP C  1 81  ? -15.332 -21.406 40.510  1.00 24.82 ? 1154 TRP C CE2 1 
ATOM   1804  C CE3 . TRP C  1 81  ? -14.772 -20.893 38.207  1.00 22.96 ? 1154 TRP C CE3 1 
ATOM   1805  C CZ2 . TRP C  1 81  ? -14.018 -21.225 40.918  1.00 25.62 ? 1154 TRP C CZ2 1 
ATOM   1806  C CZ3 . TRP C  1 81  ? -13.476 -20.722 38.614  1.00 19.37 ? 1154 TRP C CZ3 1 
ATOM   1807  C CH2 . TRP C  1 81  ? -13.098 -20.891 39.949  1.00 24.58 ? 1154 TRP C CH2 1 
ATOM   1808  N N   . GLN C  1 82  ? -18.819 -20.297 35.136  1.00 24.58 ? 1155 GLN C N   1 
ATOM   1809  C CA  . GLN C  1 82  ? -19.504 -20.678 33.890  1.00 19.50 ? 1155 GLN C CA  1 
ATOM   1810  C C   . GLN C  1 82  ? -18.416 -20.963 32.831  1.00 26.52 ? 1155 GLN C C   1 
ATOM   1811  O O   . GLN C  1 82  ? -17.275 -20.547 32.995  1.00 21.42 ? 1155 GLN C O   1 
ATOM   1812  C CB  . GLN C  1 82  ? -20.494 -19.605 33.427  1.00 27.79 ? 1155 GLN C CB  1 
ATOM   1813  C CG  . GLN C  1 82  ? -21.481 -20.051 32.328  1.00 34.03 ? 1155 GLN C CG  1 
ATOM   1814  C CD  . GLN C  1 82  ? -22.123 -21.432 32.572  1.00 35.03 ? 1155 GLN C CD  1 
ATOM   1815  O OE1 . GLN C  1 82  ? -21.480 -22.475 32.428  1.00 30.38 ? 1155 GLN C OE1 1 
ATOM   1816  N NE2 . GLN C  1 82  ? -23.423 -21.432 32.943  1.00 40.53 ? 1155 GLN C NE2 1 
ATOM   1817  N N   . TRP C  1 83  ? -18.763 -21.734 31.802  1.00 25.29 ? 1156 TRP C N   1 
ATOM   1818  C CA  . TRP C  1 83  ? -17.837 -22.041 30.714  1.00 21.44 ? 1156 TRP C CA  1 
ATOM   1819  C C   . TRP C  1 83  ? -18.367 -21.381 29.478  1.00 23.14 ? 1156 TRP C C   1 
ATOM   1820  O O   . TRP C  1 83  ? -19.537 -21.560 29.114  1.00 23.79 ? 1156 TRP C O   1 
ATOM   1821  C CB  . TRP C  1 83  ? -17.737 -23.558 30.468  1.00 22.45 ? 1156 TRP C CB  1 
ATOM   1822  C CG  . TRP C  1 83  ? -17.116 -24.332 31.566  1.00 23.00 ? 1156 TRP C CG  1 
ATOM   1823  C CD1 . TRP C  1 83  ? -17.759 -24.896 32.639  1.00 22.69 ? 1156 TRP C CD1 1 
ATOM   1824  C CD2 . TRP C  1 83  ? -15.744 -24.630 31.709  1.00 20.52 ? 1156 TRP C CD2 1 
ATOM   1825  N NE1 . TRP C  1 83  ? -16.848 -25.552 33.429  1.00 23.23 ? 1156 TRP C NE1 1 
ATOM   1826  C CE2 . TRP C  1 83  ? -15.600 -25.392 32.887  1.00 24.41 ? 1156 TRP C CE2 1 
ATOM   1827  C CE3 . TRP C  1 83  ? -14.611 -24.351 30.942  1.00 18.51 ? 1156 TRP C CE3 1 
ATOM   1828  C CZ2 . TRP C  1 83  ? -14.374 -25.875 33.316  1.00 25.33 ? 1156 TRP C CZ2 1 
ATOM   1829  C CZ3 . TRP C  1 83  ? -13.387 -24.853 31.359  1.00 22.73 ? 1156 TRP C CZ3 1 
ATOM   1830  C CH2 . TRP C  1 83  ? -13.277 -25.600 32.537  1.00 25.45 ? 1156 TRP C CH2 1 
ATOM   1831  N N   . LEU C  1 84  ? -17.535 -20.579 28.825  1.00 19.96 ? 1157 LEU C N   1 
ATOM   1832  C CA  . LEU C  1 84  ? -17.990 -19.780 27.703  1.00 19.60 ? 1157 LEU C CA  1 
ATOM   1833  C C   . LEU C  1 84  ? -16.978 -19.776 26.560  1.00 20.53 ? 1157 LEU C C   1 
ATOM   1834  O O   . LEU C  1 84  ? -15.773 -19.716 26.797  1.00 20.74 ? 1157 LEU C O   1 
ATOM   1835  C CB  . LEU C  1 84  ? -18.191 -18.323 28.155  1.00 17.21 ? 1157 LEU C CB  1 
ATOM   1836  C CG  . LEU C  1 84  ? -19.366 -18.125 29.131  1.00 20.31 ? 1157 LEU C CG  1 
ATOM   1837  C CD1 . LEU C  1 84  ? -19.379 -16.715 29.670  1.00 20.56 ? 1157 LEU C CD1 1 
ATOM   1838  C CD2 . LEU C  1 84  ? -20.738 -18.500 28.526  1.00 22.95 ? 1157 LEU C CD2 1 
ATOM   1839  N N   . PRO C  1 85  ? -17.468 -19.822 25.323  1.00 21.23 ? 1158 PRO C N   1 
ATOM   1840  C CA  . PRO C  1 85  ? -16.561 -19.660 24.185  1.00 22.22 ? 1158 PRO C CA  1 
ATOM   1841  C C   . PRO C  1 85  ? -16.116 -18.231 24.002  1.00 23.76 ? 1158 PRO C C   1 
ATOM   1842  O O   . PRO C  1 85  ? -16.704 -17.271 24.523  1.00 22.84 ? 1158 PRO C O   1 
ATOM   1843  C CB  . PRO C  1 85  ? -17.414 -20.040 22.968  1.00 23.65 ? 1158 PRO C CB  1 
ATOM   1844  C CG  . PRO C  1 85  ? -18.795 -20.147 23.421  1.00 29.23 ? 1158 PRO C CG  1 
ATOM   1845  C CD  . PRO C  1 85  ? -18.883 -19.994 24.925  1.00 25.15 ? 1158 PRO C CD  1 
ATOM   1846  N N   . ARG C  1 86  ? -15.105 -18.098 23.151  1.00 25.65 ? 1159 ARG C N   1 
ATOM   1847  C CA  . ARG C  1 86  ? -14.470 -16.830 22.893  1.00 23.18 ? 1159 ARG C CA  1 
ATOM   1848  C C   . ARG C  1 86  ? -15.454 -15.760 22.456  1.00 21.58 ? 1159 ARG C C   1 
ATOM   1849  O O   . ARG C  1 86  ? -15.324 -14.585 22.813  1.00 21.46 ? 1159 ARG C O   1 
ATOM   1850  C CB  . ARG C  1 86  ? -13.392 -17.045 21.814  1.00 26.09 ? 1159 ARG C CB  1 
ATOM   1851  C CG  . ARG C  1 86  ? -12.659 -15.774 21.465  1.00 25.13 ? 1159 ARG C CG  1 
ATOM   1852  C CD  . ARG C  1 86  ? -11.829 -15.252 22.675  1.00 27.48 ? 1159 ARG C CD  1 
ATOM   1853  N NE  . ARG C  1 86  ? -11.180 -13.976 22.357  1.00 29.16 ? 1159 ARG C NE  1 
ATOM   1854  C CZ  . ARG C  1 86  ? -11.779 -12.781 22.367  1.00 28.96 ? 1159 ARG C CZ  1 
ATOM   1855  N NH1 . ARG C  1 86  ? -11.097 -11.696 22.057  1.00 30.72 ? 1159 ARG C NH1 1 
ATOM   1856  N NH2 . ARG C  1 86  ? -13.066 -12.654 22.665  1.00 25.79 ? 1159 ARG C NH2 1 
ATOM   1857  N N   . THR C  1 87  ? -16.459 -16.168 21.665  1.00 21.28 ? 1160 THR C N   1 
ATOM   1858  C CA  . THR C  1 87  ? -17.486 -15.279 21.134  1.00 24.70 ? 1160 THR C CA  1 
ATOM   1859  C C   . THR C  1 87  ? -18.318 -14.575 22.222  1.00 24.65 ? 1160 THR C C   1 
ATOM   1860  O O   . THR C  1 87  ? -18.976 -13.578 21.952  1.00 25.56 ? 1160 THR C O   1 
ATOM   1861  C CB  . THR C  1 87  ? -18.516 -16.096 20.240  1.00 27.27 ? 1160 THR C CB  1 
ATOM   1862  O OG1 . THR C  1 87  ? -18.946 -17.272 20.942  1.00 28.57 ? 1160 THR C OG1 1 
ATOM   1863  C CG2 . THR C  1 87  ? -17.872 -16.549 18.955  1.00 37.81 ? 1160 THR C CG2 1 
ATOM   1864  N N   . LYS C  1 88  ? -18.264 -15.090 23.438  1.00 20.18 ? 1161 LYS C N   1 
ATOM   1865  C CA  . LYS C  1 88  ? -19.081 -14.538 24.519  1.00 22.31 ? 1161 LYS C CA  1 
ATOM   1866  C C   . LYS C  1 88  ? -18.261 -13.723 25.509  1.00 23.00 ? 1161 LYS C C   1 
ATOM   1867  O O   . LYS C  1 88  ? -18.801 -13.310 26.558  1.00 21.08 ? 1161 LYS C O   1 
ATOM   1868  C CB  . LYS C  1 88  ? -19.761 -15.668 25.285  1.00 20.70 ? 1161 LYS C CB  1 
ATOM   1869  C CG  . LYS C  1 88  ? -20.715 -16.541 24.410  1.00 24.51 ? 1161 LYS C CG  1 
ATOM   1870  C CD  . LYS C  1 88  ? -21.765 -15.714 23.813  1.00 25.54 ? 1161 LYS C CD  1 
ATOM   1871  C CE  . LYS C  1 88  ? -22.640 -16.589 22.880  1.00 35.91 ? 1161 LYS C CE  1 
ATOM   1872  N NZ  . LYS C  1 88  ? -23.814 -15.787 22.467  1.00 36.55 ? 1161 LYS C NZ  1 
ATOM   1873  N N   . LEU C  1 89  ? -16.979 -13.503 25.202  1.00 19.57 ? 1162 LEU C N   1 
ATOM   1874  C CA  . LEU C  1 89  ? -16.088 -12.730 26.118  1.00 18.49 ? 1162 LEU C CA  1 
ATOM   1875  C C   . LEU C  1 89  ? -15.573 -11.538 25.382  1.00 23.94 ? 1162 LEU C C   1 
ATOM   1876  O O   . LEU C  1 89  ? -15.380 -11.611 24.178  1.00 22.20 ? 1162 LEU C O   1 
ATOM   1877  C CB  . LEU C  1 89  ? -14.861 -13.563 26.510  1.00 16.66 ? 1162 LEU C CB  1 
ATOM   1878  C CG  . LEU C  1 89  ? -15.188 -14.940 27.104  1.00 21.52 ? 1162 LEU C CG  1 
ATOM   1879  C CD1 . LEU C  1 89  ? -13.985 -15.792 27.493  1.00 24.99 ? 1162 LEU C CD1 1 
ATOM   1880  C CD2 . LEU C  1 89  ? -16.164 -14.825 28.318  1.00 21.11 ? 1162 LEU C CD2 1 
ATOM   1881  N N   . VAL C  1 90  ? -15.390 -10.431 26.120  1.00 18.55 ? 1163 VAL C N   1 
ATOM   1882  C CA  . VAL C  1 90  ? -14.790 -9.190  25.647  1.00 19.12 ? 1163 VAL C CA  1 
ATOM   1883  C C   . VAL C  1 90  ? -13.885 -8.704  26.774  1.00 18.92 ? 1163 VAL C C   1 
ATOM   1884  O O   . VAL C  1 90  ? -14.287 -8.678  27.905  1.00 18.82 ? 1163 VAL C O   1 
ATOM   1885  C CB  . VAL C  1 90  ? -15.900 -8.138  25.376  1.00 24.95 ? 1163 VAL C CB  1 
ATOM   1886  C CG1 . VAL C  1 90  ? -15.322 -6.797  24.990  1.00 23.42 ? 1163 VAL C CG1 1 
ATOM   1887  C CG2 . VAL C  1 90  ? -16.796 -8.617  24.249  1.00 26.90 ? 1163 VAL C CG2 1 
ATOM   1888  N N   . PRO C  1 91  ? -12.628 -8.347  26.469  1.00 18.43 ? 1164 PRO C N   1 
ATOM   1889  C CA  . PRO C  1 91  ? -11.796 -7.780  27.534  1.00 18.40 ? 1164 PRO C CA  1 
ATOM   1890  C C   . PRO C  1 91  ? -12.393 -6.592  28.279  1.00 17.08 ? 1164 PRO C C   1 
ATOM   1891  O O   . PRO C  1 91  ? -12.975 -5.679  27.692  1.00 19.85 ? 1164 PRO C O   1 
ATOM   1892  C CB  . PRO C  1 91  ? -10.538 -7.327  26.782  1.00 19.80 ? 1164 PRO C CB  1 
ATOM   1893  C CG  . PRO C  1 91  ? -10.462 -8.285  25.592  1.00 23.36 ? 1164 PRO C CG  1 
ATOM   1894  C CD  . PRO C  1 91  ? -11.920 -8.416  25.170  1.00 23.48 ? 1164 PRO C CD  1 
ATOM   1895  N N   . LEU C  1 92  ? -12.259 -6.621  29.594  1.00 16.60 ? 1165 LEU C N   1 
ATOM   1896  C CA  . LEU C  1 92  ? -12.859 -5.606  30.464  1.00 16.58 ? 1165 LEU C CA  1 
ATOM   1897  C C   . LEU C  1 92  ? -11.742 -4.687  31.023  1.00 20.18 ? 1165 LEU C C   1 
ATOM   1898  O O   . LEU C  1 92  ? -10.642 -5.157  31.310  1.00 18.08 ? 1165 LEU C O   1 
ATOM   1899  C CB  . LEU C  1 92  ? -13.618 -6.358  31.603  1.00 15.13 ? 1165 LEU C CB  1 
ATOM   1900  C CG  . LEU C  1 92  ? -14.240 -5.452  32.667  1.00 17.92 ? 1165 LEU C CG  1 
ATOM   1901  C CD1 . LEU C  1 92  ? -15.540 -6.175  33.258  1.00 18.29 ? 1165 LEU C CD1 1 
ATOM   1902  C CD2 . LEU C  1 92  ? -13.256 -5.051  33.783  1.00 18.49 ? 1165 LEU C CD2 1 
ATOM   1903  N N   . GLY C  1 93  ? -12.036 -3.395  31.129  1.00 17.48 ? 1166 GLY C N   1 
ATOM   1904  C CA  . GLY C  1 93  ? -11.180 -2.428  31.819  1.00 20.49 ? 1166 GLY C CA  1 
ATOM   1905  C C   . GLY C  1 93  ? -10.103 -1.891  30.891  1.00 23.83 ? 1166 GLY C C   1 
ATOM   1906  O O   . GLY C  1 93  ? -9.140  -1.251  31.350  1.00 26.54 ? 1166 GLY C O   1 
ATOM   1907  N N   . VAL C  1 94  ? -10.226 -2.187  29.609  1.00 22.52 ? 1167 VAL C N   1 
ATOM   1908  C CA  . VAL C  1 94  ? -9.215  -1.717  28.633  1.00 22.86 ? 1167 VAL C CA  1 
ATOM   1909  C C   . VAL C  1 94  ? -9.719  -0.593  27.730  1.00 28.00 ? 1167 VAL C C   1 
ATOM   1910  O O   . VAL C  1 94  ? -8.935  0.118   27.150  1.00 26.99 ? 1167 VAL C O   1 
ATOM   1911  C CB  . VAL C  1 94  ? -8.652  -2.819  27.789  1.00 26.49 ? 1167 VAL C CB  1 
ATOM   1912  C CG1 . VAL C  1 94  ? -7.958  -3.831  28.680  1.00 30.14 ? 1167 VAL C CG1 1 
ATOM   1913  C CG2 . VAL C  1 94  ? -9.714  -3.461  27.009  1.00 25.47 ? 1167 VAL C CG2 1 
ATOM   1914  N N   . ASN C  1 95  ? -11.032 -0.446  27.630  1.00 21.62 ? 1168 ASN C N   1 
ATOM   1915  C CA  . ASN C  1 95  ? -11.631 0.583   26.779  1.00 25.87 ? 1168 ASN C CA  1 
ATOM   1916  C C   . ASN C  1 95  ? -12.801 1.166   27.544  1.00 26.33 ? 1168 ASN C C   1 
ATOM   1917  O O   . ASN C  1 95  ? -13.798 0.474   27.727  1.00 25.71 ? 1168 ASN C O   1 
ATOM   1918  C CB  . ASN C  1 95  ? -12.142 -0.057  25.491  1.00 25.62 ? 1168 ASN C CB  1 
ATOM   1919  C CG  . ASN C  1 95  ? -12.674 0.971   24.483  1.00 31.30 ? 1168 ASN C CG  1 
ATOM   1920  O OD1 . ASN C  1 95  ? -13.532 1.807   24.805  1.00 29.73 ? 1168 ASN C OD1 1 
ATOM   1921  N ND2 . ASN C  1 95  ? -12.176 0.893   23.249  1.00 38.41 ? 1168 ASN C ND2 1 
ATOM   1922  N N   . GLN C  1 96  ? -12.673 2.413   27.993  1.00 25.68 ? 1169 GLN C N   1 
ATOM   1923  C CA  . GLN C  1 96  ? -13.639 3.018   28.927  1.00 26.05 ? 1169 GLN C CA  1 
ATOM   1924  C C   . GLN C  1 96  ? -15.007 3.126   28.295  1.00 26.78 ? 1169 GLN C C   1 
ATOM   1925  O O   . GLN C  1 96  ? -16.030 2.938   28.955  1.00 24.53 ? 1169 GLN C O   1 
ATOM   1926  C CB  . GLN C  1 96  ? -13.211 4.413   29.383  1.00 35.10 ? 1169 GLN C CB  1 
ATOM   1927  C CG  . GLN C  1 96  ? -12.088 4.399   30.420  1.00 40.93 ? 1169 GLN C CG  1 
ATOM   1928  C CD  . GLN C  1 96  ? -12.193 5.551   31.421  1.00 49.26 ? 1169 GLN C CD  1 
ATOM   1929  O OE1 . GLN C  1 96  ? -13.131 6.363   31.367  1.00 47.55 ? 1169 GLN C OE1 1 
ATOM   1930  N NE2 . GLN C  1 96  ? -11.233 5.617   32.352  1.00 50.54 ? 1169 GLN C NE2 1 
ATOM   1931  N N   . ASP C  1 97  ? -15.035 3.439   27.012  1.00 25.01 ? 1170 ASP C N   1 
ATOM   1932  C CA  . ASP C  1 97  ? -16.339 3.537   26.351  1.00 27.82 ? 1170 ASP C CA  1 
ATOM   1933  C C   . ASP C  1 97  ? -17.058 2.212   26.115  1.00 24.68 ? 1170 ASP C C   1 
ATOM   1934  O O   . ASP C  1 97  ? -18.277 2.117   26.254  1.00 23.39 ? 1170 ASP C O   1 
ATOM   1935  C CB  . ASP C  1 97  ? -16.229 4.423   25.110  1.00 25.49 ? 1170 ASP C CB  1 
ATOM   1936  C CG  . ASP C  1 97  ? -15.742 5.807   25.475  1.00 33.73 ? 1170 ASP C CG  1 
ATOM   1937  O OD1 . ASP C  1 97  ? -14.626 6.190   25.049  1.00 40.27 ? 1170 ASP C OD1 1 
ATOM   1938  O OD2 . ASP C  1 97  ? -16.454 6.474   26.254  1.00 32.75 ? 1170 ASP C OD2 1 
ATOM   1939  N N   . LEU C  1 98  ? -16.304 1.151   25.835  1.00 22.16 ? 1171 LEU C N   1 
ATOM   1940  C CA  . LEU C  1 98  ? -16.876 -0.180  25.780  1.00 22.00 ? 1171 LEU C CA  1 
ATOM   1941  C C   . LEU C  1 98  ? -17.406 -0.586  27.152  1.00 23.26 ? 1171 LEU C C   1 
ATOM   1942  O O   . LEU C  1 98  ? -18.523 -1.083  27.281  1.00 21.59 ? 1171 LEU C O   1 
ATOM   1943  C CB  . LEU C  1 98  ? -15.847 -1.185  25.234  1.00 24.25 ? 1171 LEU C CB  1 
ATOM   1944  C CG  . LEU C  1 98  ? -16.324 -2.627  25.048  1.00 24.35 ? 1171 LEU C CG  1 
ATOM   1945  C CD1 . LEU C  1 98  ? -15.531 -3.321  23.911  1.00 32.90 ? 1171 LEU C CD1 1 
ATOM   1946  C CD2 . LEU C  1 98  ? -16.190 -3.395  26.387  1.00 26.05 ? 1171 LEU C CD2 1 
ATOM   1947  N N   . ASP C  1 99  ? -16.609 -0.340  28.195  1.00 20.10 ? 1172 ASP C N   1 
ATOM   1948  C CA  . ASP C  1 99  ? -17.047 -0.649  29.549  1.00 21.00 ? 1172 ASP C CA  1 
ATOM   1949  C C   . ASP C  1 99  ? -18.377 0.065   29.919  1.00 22.08 ? 1172 ASP C C   1 
ATOM   1950  O O   . ASP C  1 99  ? -19.273 -0.533  30.524  1.00 24.12 ? 1172 ASP C O   1 
ATOM   1951  C CB  . ASP C  1 99  ? -15.949 -0.289  30.575  1.00 21.49 ? 1172 ASP C CB  1 
ATOM   1952  C CG  . ASP C  1 99  ? -14.780 -1.274  30.576  1.00 20.29 ? 1172 ASP C CG  1 
ATOM   1953  O OD1 . ASP C  1 99  ? -13.771 -0.972  31.264  1.00 24.33 ? 1172 ASP C OD1 1 
ATOM   1954  O OD2 . ASP C  1 99  ? -14.808 -2.320  29.909  1.00 20.64 ? 1172 ASP C OD2 1 
ATOM   1955  N N   . LYS C  1 100 ? -18.485 1.338   29.550  1.00 23.58 ? 1173 LYS C N   1 
ATOM   1956  C CA  . LYS C  1 100 ? -19.687 2.097   29.867  1.00 25.87 ? 1173 LYS C CA  1 
ATOM   1957  C C   . LYS C  1 100 ? -20.868 1.615   29.042  1.00 29.49 ? 1173 LYS C C   1 
ATOM   1958  O O   . LYS C  1 100 ? -21.980 1.495   29.571  1.00 30.46 ? 1173 LYS C O   1 
ATOM   1959  C CB  . LYS C  1 100 ? -19.459 3.589   29.716  1.00 24.53 ? 1173 LYS C CB  1 
ATOM   1960  C CG  . LYS C  1 100 ? -18.418 4.099   30.759  1.00 25.50 ? 1173 LYS C CG  1 
ATOM   1961  C CD  . LYS C  1 100 ? -18.191 5.585   30.668  1.00 31.90 ? 1173 LYS C CD  1 
ATOM   1962  C CE  . LYS C  1 100 ? -17.109 6.027   31.649  1.00 39.03 ? 1173 LYS C CE  1 
ATOM   1963  N NZ  . LYS C  1 100 ? -16.999 7.491   31.630  1.00 42.15 ? 1173 LYS C NZ  1 
ATOM   1964  N N   . GLU C  1 101 ? -20.638 1.343   27.763  1.00 23.70 ? 1174 GLU C N   1 
ATOM   1965  C CA  . GLU C  1 101 ? -21.687 0.685   26.969  1.00 24.99 ? 1174 GLU C CA  1 
ATOM   1966  C C   . GLU C  1 101 ? -22.152 -0.615  27.626  1.00 29.31 ? 1174 GLU C C   1 
ATOM   1967  O O   . GLU C  1 101 ? -23.347 -0.875  27.838  1.00 29.38 ? 1174 GLU C O   1 
ATOM   1968  C CB  . GLU C  1 101 ? -21.200 0.425   25.544  1.00 26.88 ? 1174 GLU C CB  1 
ATOM   1969  C CG  . GLU C  1 101 ? -22.252 -0.332  24.709  1.00 29.91 ? 1174 GLU C CG  1 
ATOM   1970  C CD  . GLU C  1 101 ? -21.772 -0.775  23.307  1.00 35.45 ? 1174 GLU C CD  1 
ATOM   1971  O OE1 . GLU C  1 101 ? -20.564 -0.713  22.984  1.00 35.79 ? 1174 GLU C OE1 1 
ATOM   1972  O OE2 . GLU C  1 101 ? -22.634 -1.203  22.527  1.00 41.76 ? 1174 GLU C OE2 1 
ATOM   1973  N N   . LYS C  1 102 ? -21.202 -1.450  28.014  1.00 26.41 ? 1175 LYS C N   1 
ATOM   1974  C CA  . LYS C  1 102 ? -21.572 -2.691  28.652  1.00 25.32 ? 1175 LYS C CA  1 
ATOM   1975  C C   . LYS C  1 102 ? -22.362 -2.520  29.960  1.00 26.89 ? 1175 LYS C C   1 
ATOM   1976  O O   . LYS C  1 102 ? -23.301 -3.270  30.229  1.00 28.12 ? 1175 LYS C O   1 
ATOM   1977  C CB  . LYS C  1 102 ? -20.324 -3.557  28.855  1.00 26.11 ? 1175 LYS C CB  1 
ATOM   1978  C CG  . LYS C  1 102 ? -19.737 -4.081  27.516  1.00 23.39 ? 1175 LYS C CG  1 
ATOM   1979  C CD  . LYS C  1 102 ? -20.285 -5.412  27.135  1.00 27.13 ? 1175 LYS C CD  1 
ATOM   1980  C CE  . LYS C  1 102 ? -19.886 -5.748  25.708  1.00 34.80 ? 1175 LYS C CE  1 
ATOM   1981  N NZ  . LYS C  1 102 ? -20.307 -7.156  25.420  1.00 38.47 ? 1175 LYS C NZ  1 
ATOM   1982  N N   . MET C  1 103 ? -21.989 -1.543  30.773  1.00 23.26 ? 1176 MET C N   1 
ATOM   1983  C CA  . MET C  1 103 ? -22.647 -1.361  32.055  1.00 30.59 ? 1176 MET C CA  1 
ATOM   1984  C C   . MET C  1 103 ? -24.109 -0.929  31.893  1.00 31.20 ? 1176 MET C C   1 
ATOM   1985  O O   . MET C  1 103 ? -24.884 -1.086  32.822  1.00 31.54 ? 1176 MET C O   1 
ATOM   1986  C CB  . MET C  1 103 ? -21.862 -0.395  32.948  1.00 31.63 ? 1176 MET C CB  1 
ATOM   1987  C CG  . MET C  1 103 ? -20.773 -1.209  33.727  1.00 25.75 ? 1176 MET C CG  1 
ATOM   1988  S SD  . MET C  1 103 ? -20.048 -0.226  34.921  1.00 42.16 ? 1176 MET C SD  1 
ATOM   1989  C CE  . MET C  1 103 ? -19.491 1.087   33.865  1.00 29.38 ? 1176 MET C CE  1 
ATOM   1990  N N   . LEU C  1 104 ? -24.466 -0.445  30.697  1.00 33.01 ? 1177 LEU C N   1 
ATOM   1991  C CA  . LEU C  1 104 ? -25.835 0.032   30.408  1.00 33.13 ? 1177 LEU C CA  1 
ATOM   1992  C C   . LEU C  1 104 ? -26.684 -1.000  29.722  1.00 34.22 ? 1177 LEU C C   1 
ATOM   1993  O O   . LEU C  1 104 ? -27.754 -0.677  29.213  1.00 39.92 ? 1177 LEU C O   1 
ATOM   1994  C CB  . LEU C  1 104 ? -25.809 1.241   29.477  1.00 30.87 ? 1177 LEU C CB  1 
ATOM   1995  C CG  . LEU C  1 104 ? -25.195 2.465   30.100  1.00 31.19 ? 1177 LEU C CG  1 
ATOM   1996  C CD1 . LEU C  1 104 ? -25.098 3.535   29.036  1.00 34.83 ? 1177 LEU C CD1 1 
ATOM   1997  C CD2 . LEU C  1 104 ? -26.066 2.914   31.266  1.00 38.60 ? 1177 LEU C CD2 1 
ATOM   1998  N N   . GLU C  1 105 ? -26.242 -2.241  29.700  1.00 33.46 ? 1178 GLU C N   1 
ATOM   1999  C CA  . GLU C  1 105 ? -26.913 -3.226  28.872  1.00 34.09 ? 1178 GLU C CA  1 
ATOM   2000  C C   . GLU C  1 105 ? -28.158 -3.782  29.552  1.00 33.42 ? 1178 GLU C C   1 
ATOM   2001  O O   . GLU C  1 105 ? -29.161 -4.049  28.888  1.00 38.42 ? 1178 GLU C O   1 
ATOM   2002  C CB  . GLU C  1 105 ? -25.919 -4.334  28.542  1.00 36.76 ? 1178 GLU C CB  1 
ATOM   2003  C CG  . GLU C  1 105 ? -26.335 -5.387  27.561  1.00 36.46 ? 1178 GLU C CG  1 
ATOM   2004  C CD  . GLU C  1 105 ? -25.257 -6.483  27.463  1.00 40.29 ? 1178 GLU C CD  1 
ATOM   2005  O OE1 . GLU C  1 105 ? -24.113 -6.154  27.056  1.00 36.78 ? 1178 GLU C OE1 1 
ATOM   2006  O OE2 . GLU C  1 105 ? -25.559 -7.653  27.791  1.00 43.11 ? 1178 GLU C OE2 1 
ATOM   2007  N N   . GLY C  1 106 ? -28.095 -3.972  30.864  1.00 28.84 ? 1179 GLY C N   1 
ATOM   2008  C CA  . GLY C  1 106 ? -29.162 -4.606  31.607  1.00 32.46 ? 1179 GLY C CA  1 
ATOM   2009  C C   . GLY C  1 106 ? -30.449 -3.827  31.443  1.00 36.94 ? 1179 GLY C C   1 
ATOM   2010  O O   . GLY C  1 106 ? -30.431 -2.590  31.296  1.00 35.29 ? 1179 GLY C O   1 
ATOM   2011  N N   . ARG C  1 107 ? -31.559 -4.556  31.444  1.00 40.11 ? 1180 ARG C N   1 
ATOM   2012  C CA  . ARG C  1 107 ? -32.871 -3.989  31.120  1.00 41.85 ? 1180 ARG C CA  1 
ATOM   2013  C C   . ARG C  1 107 ? -33.485 -3.294  32.329  1.00 46.40 ? 1180 ARG C C   1 
ATOM   2014  O O   . ARG C  1 107 ? -34.033 -2.187  32.190  1.00 49.92 ? 1180 ARG C O   1 
ATOM   2015  C CB  . ARG C  1 107 ? -33.798 -5.091  30.587  1.00 47.23 ? 1180 ARG C CB  1 
ATOM   2016  C CG  . ARG C  1 107 ? -35.234 -5.014  31.095  1.00 58.65 ? 1180 ARG C CG  1 
ATOM   2017  C CD  . ARG C  1 107 ? -35.885 -6.401  31.252  1.00 59.24 ? 1180 ARG C CD  1 
ATOM   2018  N NE  . ARG C  1 107 ? -35.489 -7.325  30.184  1.00 64.03 ? 1180 ARG C NE  1 
ATOM   2019  C CZ  . ARG C  1 107 ? -35.034 -8.564  30.379  1.00 65.53 ? 1180 ARG C CZ  1 
ATOM   2020  N NH1 . ARG C  1 107 ? -34.695 -9.316  29.333  1.00 65.03 ? 1180 ARG C NH1 1 
ATOM   2021  N NH2 . ARG C  1 107 ? -34.944 -9.065  31.611  1.00 61.88 ? 1180 ARG C NH2 1 
ATOM   2022  N N   . LYS C  1 108 ? -33.358 -3.931  33.501  1.00 41.21 ? 1181 LYS C N   1 
ATOM   2023  C CA  . LYS C  1 108 ? -33.828 -3.393  34.808  1.00 40.87 ? 1181 LYS C CA  1 
ATOM   2024  C C   . LYS C  1 108 ? -32.733 -2.625  35.593  1.00 41.13 ? 1181 LYS C C   1 
ATOM   2025  O O   . LYS C  1 108 ? -31.527 -2.896  35.463  1.00 32.39 ? 1181 LYS C O   1 
ATOM   2026  C CB  . LYS C  1 108 ? -34.295 -4.540  35.727  1.00 36.37 ? 1181 LYS C CB  1 
ATOM   2027  C CG  . LYS C  1 108 ? -35.376 -5.479  35.150  1.00 44.08 ? 1181 LYS C CG  1 
ATOM   2028  C CD  . LYS C  1 108 ? -36.040 -6.368  36.210  1.00 42.87 ? 1181 LYS C CD  1 
ATOM   2029  C CE  . LYS C  1 108 ? -37.195 -7.192  35.589  1.00 48.64 ? 1181 LYS C CE  1 
ATOM   2030  N NZ  . LYS C  1 108 ? -38.401 -6.358  35.199  1.00 53.21 ? 1181 LYS C NZ  1 
ATOM   2031  N N   . SER C  1 109 ? -33.159 -1.718  36.465  1.00 40.91 ? 1182 SER C N   1 
ATOM   2032  C CA  . SER C  1 109 ? -32.222 -0.997  37.326  1.00 34.44 ? 1182 SER C CA  1 
ATOM   2033  C C   . SER C  1 109 ? -31.442 -1.904  38.260  1.00 30.71 ? 1182 SER C C   1 
ATOM   2034  O O   . SER C  1 109 ? -30.243 -1.682  38.456  1.00 33.08 ? 1182 SER C O   1 
ATOM   2035  C CB  . SER C  1 109 ? -32.937 0.067   38.159  1.00 40.46 ? 1182 SER C CB  1 
ATOM   2036  O OG  . SER C  1 109 ? -31.989 0.905   38.796  1.00 46.94 ? 1182 SER C OG  1 
ATOM   2037  N N   . ASN C  1 110 ? -32.079 -2.884  38.892  1.00 32.40 ? 1183 ASN C N   1 
ATOM   2038  C CA  . ASN C  1 110 ? -31.321 -3.692  39.833  1.00 32.60 ? 1183 ASN C CA  1 
ATOM   2039  C C   . ASN C  1 110 ? -30.302 -4.566  39.114  1.00 28.01 ? 1183 ASN C C   1 
ATOM   2040  O O   . ASN C  1 110 ? -29.254 -4.884  39.677  1.00 27.84 ? 1183 ASN C O   1 
ATOM   2041  C CB  . ASN C  1 110 ? -32.209 -4.524  40.751  1.00 35.92 ? 1183 ASN C CB  1 
ATOM   2042  C CG  . ASN C  1 110 ? -33.164 -5.401  39.983  1.00 38.67 ? 1183 ASN C CG  1 
ATOM   2043  O OD1 . ASN C  1 110 ? -33.287 -5.271  38.762  1.00 40.13 ? 1183 ASN C OD1 1 
ATOM   2044  N ND2 . ASN C  1 110 ? -33.869 -6.280  40.695  1.00 38.17 ? 1183 ASN C ND2 1 
ATOM   2045  N N   . ILE C  1 111 ? -30.623 -4.968  37.885  1.00 28.74 ? 1184 ILE C N   1 
ATOM   2046  C CA  . ILE C  1 111 ? -29.690 -5.780  37.098  1.00 30.28 ? 1184 ILE C CA  1 
ATOM   2047  C C   . ILE C  1 111 ? -28.466 -4.930  36.774  1.00 25.13 ? 1184 ILE C C   1 
ATOM   2048  O O   . ILE C  1 111 ? -27.354 -5.369  36.977  1.00 25.58 ? 1184 ILE C O   1 
ATOM   2049  C CB  . ILE C  1 111 ? -30.304 -6.239  35.793  1.00 29.85 ? 1184 ILE C CB  1 
ATOM   2050  C CG1 . ILE C  1 111 ? -31.489 -7.151  36.077  1.00 38.05 ? 1184 ILE C CG1 1 
ATOM   2051  C CG2 . ILE C  1 111 ? -29.291 -7.034  35.009  1.00 29.20 ? 1184 ILE C CG2 1 
ATOM   2052  C CD1 . ILE C  1 111 ? -32.215 -7.556  34.799  1.00 39.34 ? 1184 ILE C CD1 1 
ATOM   2053  N N   . ARG C  1 112 ? -28.697 -3.693  36.323  1.00 24.77 ? 1185 ARG C N   1 
ATOM   2054  C CA  . ARG C  1 112 ? -27.593 -2.788  35.976  1.00 23.34 ? 1185 ARG C CA  1 
ATOM   2055  C C   . ARG C  1 112 ? -26.810 -2.519  37.266  1.00 25.30 ? 1185 ARG C C   1 
ATOM   2056  O O   . ARG C  1 112 ? -25.579 -2.416  37.216  1.00 22.49 ? 1185 ARG C O   1 
ATOM   2057  C CB  . ARG C  1 112 ? -28.054 -1.489  35.309  1.00 28.43 ? 1185 ARG C CB  1 
ATOM   2058  C CG  . ARG C  1 112 ? -28.649 -1.687  33.912  1.00 27.65 ? 1185 ARG C CG  1 
ATOM   2059  C CD  . ARG C  1 112 ? -28.909 -0.367  33.157  1.00 35.51 ? 1185 ARG C CD  1 
ATOM   2060  N NE  . ARG C  1 112 ? -29.876 0.459   33.887  1.00 38.48 ? 1185 ARG C NE  1 
ATOM   2061  C CZ  . ARG C  1 112 ? -31.192 0.427   33.676  1.00 44.88 ? 1185 ARG C CZ  1 
ATOM   2062  N NH1 . ARG C  1 112 ? -31.695 -0.368  32.737  1.00 38.37 ? 1185 ARG C NH1 1 
ATOM   2063  N NH2 . ARG C  1 112 ? -32.009 1.201   34.393  1.00 41.30 ? 1185 ARG C NH2 1 
ATOM   2064  N N   . LYS C  1 113 ? -27.489 -2.389  38.412  1.00 22.89 ? 1186 LYS C N   1 
ATOM   2065  C CA  . LYS C  1 113 ? -26.738 -2.114  39.664  1.00 24.77 ? 1186 LYS C CA  1 
ATOM   2066  C C   . LYS C  1 113 ? -25.793 -3.267  40.045  1.00 24.03 ? 1186 LYS C C   1 
ATOM   2067  O O   . LYS C  1 113 ? -24.635 -3.026  40.499  1.00 22.68 ? 1186 LYS C O   1 
ATOM   2068  C CB  . LYS C  1 113 ? -27.655 -1.787  40.888  1.00 24.55 ? 1186 LYS C CB  1 
ATOM   2069  C CG  . LYS C  1 113 ? -26.901 -1.108  42.035  1.00 25.40 ? 1186 LYS C CG  1 
ATOM   2070  C CD  . LYS C  1 113 ? -27.772 -0.863  43.302  1.00 28.55 ? 1186 LYS C CD  1 
ATOM   2071  C CE  . LYS C  1 113 ? -27.664 -2.084  44.255  1.00 28.80 ? 1186 LYS C CE  1 
ATOM   2072  N NZ  . LYS C  1 113 ? -28.143 -1.844  45.648  1.00 32.96 ? 1186 LYS C NZ  1 
ATOM   2073  N N   . SER C  1 114 ? -26.267 -4.508  39.869  1.00 20.74 ? 1187 SER C N   1 
ATOM   2074  C CA  . SER C  1 114 ? -25.487 -5.704  40.197  1.00 18.48 ? 1187 SER C CA  1 
ATOM   2075  C C   . SER C  1 114 ? -24.244 -5.684  39.274  1.00 20.04 ? 1187 SER C C   1 
ATOM   2076  O O   . SER C  1 114 ? -23.123 -6.011  39.719  1.00 20.75 ? 1187 SER C O   1 
ATOM   2077  C CB  . SER C  1 114 ? -26.316 -6.938  39.861  1.00 24.63 ? 1187 SER C CB  1 
ATOM   2078  O OG  . SER C  1 114 ? -25.608 -8.131  40.123  1.00 33.63 ? 1187 SER C OG  1 
ATOM   2079  N N   . VAL C  1 115 ? -24.469 -5.330  38.002  1.00 20.49 ? 1188 VAL C N   1 
ATOM   2080  C CA  . VAL C  1 115 ? -23.396 -5.300  36.991  1.00 17.23 ? 1188 VAL C CA  1 
ATOM   2081  C C   . VAL C  1 115 ? -22.373 -4.240  37.379  1.00 20.65 ? 1188 VAL C C   1 
ATOM   2082  O O   . VAL C  1 115 ? -21.165 -4.456  37.278  1.00 18.14 ? 1188 VAL C O   1 
ATOM   2083  C CB  . VAL C  1 115 ? -23.926 -5.027  35.556  1.00 20.40 ? 1188 VAL C CB  1 
ATOM   2084  C CG1 . VAL C  1 115 ? -22.767 -4.703  34.579  1.00 19.57 ? 1188 VAL C CG1 1 
ATOM   2085  C CG2 . VAL C  1 115 ? -24.644 -6.248  34.994  1.00 19.35 ? 1188 VAL C CG2 1 
ATOM   2086  N N   . GLN C  1 116 ? -22.859 -3.070  37.813  1.00 17.10 ? 1189 GLN C N   1 
ATOM   2087  C CA  . GLN C  1 116 ? -21.941 -1.962  38.160  1.00 18.18 ? 1189 GLN C CA  1 
ATOM   2088  C C   . GLN C  1 116 ? -21.116 -2.301  39.361  1.00 18.18 ? 1189 GLN C C   1 
ATOM   2089  O O   . GLN C  1 116 ? -19.898 -2.054  39.414  1.00 17.84 ? 1189 GLN C O   1 
ATOM   2090  C CB  . GLN C  1 116 ? -22.718 -0.674  38.450  1.00 21.68 ? 1189 GLN C CB  1 
ATOM   2091  C CG  . GLN C  1 116 ? -23.441 -0.140  37.253  1.00 25.47 ? 1189 GLN C CG  1 
ATOM   2092  C CD  . GLN C  1 116 ? -24.170 1.172   37.630  1.00 34.58 ? 1189 GLN C CD  1 
ATOM   2093  O OE1 . GLN C  1 116 ? -23.677 1.974   38.428  1.00 36.11 ? 1189 GLN C OE1 1 
ATOM   2094  N NE2 . GLN C  1 116 ? -25.340 1.372   37.057  1.00 40.14 ? 1189 GLN C NE2 1 
ATOM   2095  N N   . ILE C  1 117 ? -21.754 -2.890  40.343  1.00 16.39 ? 1190 ILE C N   1 
ATOM   2096  C CA  . ILE C  1 117 ? -21.019 -3.288  41.523  1.00 17.14 ? 1190 ILE C CA  1 
ATOM   2097  C C   . ILE C  1 117 ? -19.909 -4.318  41.162  1.00 15.53 ? 1190 ILE C C   1 
ATOM   2098  O O   . ILE C  1 117 ? -18.756 -4.307  41.729  1.00 17.01 ? 1190 ILE C O   1 
ATOM   2099  C CB  . ILE C  1 117 ? -22.005 -3.890  42.548  1.00 19.01 ? 1190 ILE C CB  1 
ATOM   2100  C CG1 . ILE C  1 117 ? -22.731 -2.717  43.259  1.00 19.76 ? 1190 ILE C CG1 1 
ATOM   2101  C CG2 . ILE C  1 117 ? -21.253 -4.763  43.500  1.00 20.14 ? 1190 ILE C CG2 1 
ATOM   2102  C CD1 . ILE C  1 117 ? -23.921 -3.200  44.200  1.00 22.97 ? 1190 ILE C CD1 1 
ATOM   2103  N N   . ALA C  1 118 ? -20.283 -5.254  40.268  1.00 15.02 ? 1191 ALA C N   1 
ATOM   2104  C CA  . ALA C  1 118 ? -19.372 -6.335  39.902  1.00 17.68 ? 1191 ALA C CA  1 
ATOM   2105  C C   . ALA C  1 118 ? -18.199 -5.690  39.159  1.00 13.21 ? 1191 ALA C C   1 
ATOM   2106  O O   . ALA C  1 118 ? -17.061 -6.139  39.280  1.00 16.99 ? 1191 ALA C O   1 
ATOM   2107  C CB  . ALA C  1 118 ? -20.108 -7.347  38.982  1.00 18.60 ? 1191 ALA C CB  1 
ATOM   2108  N N   . TYR C  1 119 ? -18.490 -4.668  38.382  1.00 14.30 ? 1192 TYR C N   1 
ATOM   2109  C CA  . TYR C  1 119 ? -17.461 -3.989  37.561  1.00 14.63 ? 1192 TYR C CA  1 
ATOM   2110  C C   . TYR C  1 119 ? -16.488 -3.300  38.498  1.00 16.90 ? 1192 TYR C C   1 
ATOM   2111  O O   . TYR C  1 119 ? -15.280 -3.386  38.302  1.00 17.11 ? 1192 TYR C O   1 
ATOM   2112  C CB  . TYR C  1 119 ? -18.096 -2.942  36.629  1.00 16.46 ? 1192 TYR C CB  1 
ATOM   2113  C CG  . TYR C  1 119 ? -17.098 -2.125  35.837  1.00 17.59 ? 1192 TYR C CG  1 
ATOM   2114  C CD1 . TYR C  1 119 ? -16.538 -2.622  34.661  1.00 19.72 ? 1192 TYR C CD1 1 
ATOM   2115  C CD2 . TYR C  1 119 ? -16.755 -0.843  36.241  1.00 19.59 ? 1192 TYR C CD2 1 
ATOM   2116  C CE1 . TYR C  1 119 ? -15.644 -1.853  33.909  1.00 20.99 ? 1192 TYR C CE1 1 
ATOM   2117  C CE2 . TYR C  1 119 ? -15.877 -0.071  35.496  1.00 19.62 ? 1192 TYR C CE2 1 
ATOM   2118  C CZ  . TYR C  1 119 ? -15.321 -0.604  34.359  1.00 21.63 ? 1192 TYR C CZ  1 
ATOM   2119  O OH  . TYR C  1 119 ? -14.447 0.183   33.670  1.00 24.07 ? 1192 TYR C OH  1 
ATOM   2120  N N   . HIS C  1 120 ? -17.000 -2.581  39.512  1.00 14.42 ? 1193 HIS C N   1 
ATOM   2121  C CA  . HIS C  1 120 ? -16.071 -1.943  40.447  1.00 12.75 ? 1193 HIS C CA  1 
ATOM   2122  C C   . HIS C  1 120 ? -15.289 -2.948  41.244  1.00 16.13 ? 1193 HIS C C   1 
ATOM   2123  O O   . HIS C  1 120 ? -14.126 -2.701  41.605  1.00 18.11 ? 1193 HIS C O   1 
ATOM   2124  C CB  . HIS C  1 120 ? -16.807 -0.865  41.308  1.00 15.71 ? 1193 HIS C CB  1 
ATOM   2125  C CG  . HIS C  1 120 ? -17.350 0.248   40.474  1.00 18.38 ? 1193 HIS C CG  1 
ATOM   2126  N ND1 . HIS C  1 120 ? -16.557 1.069   39.707  1.00 18.98 ? 1193 HIS C ND1 1 
ATOM   2127  C CD2 . HIS C  1 120 ? -18.630 0.592   40.198  1.00 20.70 ? 1193 HIS C CD2 1 
ATOM   2128  C CE1 . HIS C  1 120 ? -17.320 1.919   39.040  1.00 25.23 ? 1193 HIS C CE1 1 
ATOM   2129  N NE2 . HIS C  1 120 ? -18.587 1.632   39.305  1.00 22.08 ? 1193 HIS C NE2 1 
ATOM   2130  N N   . ARG C  1 121 ? -15.899 -4.089  41.558  1.00 15.77 ? 1194 ARG C N   1 
ATOM   2131  C CA  . ARG C  1 121 ? -15.136 -5.148  42.224  1.00 16.69 ? 1194 ARG C CA  1 
ATOM   2132  C C   . ARG C  1 121 ? -13.998 -5.662  41.305  1.00 16.68 ? 1194 ARG C C   1 
ATOM   2133  O O   . ARG C  1 121 ? -12.895 -5.918  41.771  1.00 16.39 ? 1194 ARG C O   1 
ATOM   2134  C CB  . ARG C  1 121 ? -16.024 -6.292  42.590  1.00 19.95 ? 1194 ARG C CB  1 
ATOM   2135  C CG  . ARG C  1 121 ? -16.909 -5.985  43.857  1.00 21.96 ? 1194 ARG C CG  1 
ATOM   2136  C CD  . ARG C  1 121 ? -17.897 -7.170  43.863  1.00 29.93 ? 1194 ARG C CD  1 
ATOM   2137  N NE  . ARG C  1 121 ? -18.912 -7.101  44.897  1.00 34.37 ? 1194 ARG C NE  1 
ATOM   2138  C CZ  . ARG C  1 121 ? -20.101 -7.713  44.831  1.00 33.81 ? 1194 ARG C CZ  1 
ATOM   2139  N NH1 . ARG C  1 121 ? -20.927 -7.578  45.854  1.00 29.76 ? 1194 ARG C NH1 1 
ATOM   2140  N NH2 . ARG C  1 121 ? -20.474 -8.443  43.756  1.00 26.81 ? 1194 ARG C NH2 1 
ATOM   2141  N N   . ALA C  1 122 ? -14.321 -5.832  40.033  1.00 15.67 ? 1195 ALA C N   1 
ATOM   2142  C CA  . ALA C  1 122 ? -13.316 -6.298  39.066  1.00 15.13 ? 1195 ALA C CA  1 
ATOM   2143  C C   . ALA C  1 122 ? -12.156 -5.291  39.042  1.00 15.89 ? 1195 ALA C C   1 
ATOM   2144  O O   . ALA C  1 122 ? -11.016 -5.714  39.066  1.00 16.15 ? 1195 ALA C O   1 
ATOM   2145  C CB  . ALA C  1 122 ? -13.917 -6.471  37.673  1.00 15.06 ? 1195 ALA C CB  1 
ATOM   2146  N N   . LEU C  1 123 ? -12.450 -3.974  38.988  1.00 15.32 ? 1196 LEU C N   1 
ATOM   2147  C CA  . LEU C  1 123 ? -11.367 -3.001  38.981  1.00 17.92 ? 1196 LEU C CA  1 
ATOM   2148  C C   . LEU C  1 123 ? -10.600 -2.945  40.288  1.00 19.07 ? 1196 LEU C C   1 
ATOM   2149  O O   . LEU C  1 123 ? -9.389  -2.679  40.258  1.00 20.12 ? 1196 LEU C O   1 
ATOM   2150  C CB  . LEU C  1 123 ? -11.803 -1.603  38.574  1.00 16.22 ? 1196 LEU C CB  1 
ATOM   2151  C CG  . LEU C  1 123 ? -12.446 -1.450  37.190  1.00 19.21 ? 1196 LEU C CG  1 
ATOM   2152  C CD1 . LEU C  1 123 ? -12.514 0.041   36.852  1.00 22.76 ? 1196 LEU C CD1 1 
ATOM   2153  C CD2 . LEU C  1 123 ? -11.738 -2.280  36.127  1.00 23.21 ? 1196 LEU C CD2 1 
ATOM   2154  N N   . GLN C  1 124 ? -11.250 -3.233  41.417  1.00 16.65 ? 1197 GLN C N   1 
ATOM   2155  C CA  . GLN C  1 124 ? -10.465 -3.339  42.631  1.00 18.05 ? 1197 GLN C CA  1 
ATOM   2156  C C   . GLN C  1 124 ? -9.508  -4.542  42.600  1.00 20.39 ? 1197 GLN C C   1 
ATOM   2157  O O   . GLN C  1 124 ? -8.392  -4.461  43.116  1.00 23.65 ? 1197 GLN C O   1 
ATOM   2158  C CB  . GLN C  1 124 ? -11.368 -3.449  43.837  1.00 18.30 ? 1197 GLN C CB  1 
ATOM   2159  C CG  . GLN C  1 124 ? -12.109 -2.140  44.100  1.00 16.95 ? 1197 GLN C CG  1 
ATOM   2160  C CD  . GLN C  1 124 ? -13.141 -2.336  45.162  1.00 21.95 ? 1197 GLN C CD  1 
ATOM   2161  O OE1 . GLN C  1 124 ? -12.807 -2.531  46.331  1.00 23.75 ? 1197 GLN C OE1 1 
ATOM   2162  N NE2 . GLN C  1 124 ? -14.389 -2.338  44.765  1.00 17.72 ? 1197 GLN C NE2 1 
ATOM   2163  N N   . HIS C  1 125 ? -9.941  -5.622  41.968  1.00 18.26 ? 1198 HIS C N   1 
ATOM   2164  C CA  . HIS C  1 125 ? -9.104  -6.799  41.883  1.00 17.89 ? 1198 HIS C CA  1 
ATOM   2165  C C   . HIS C  1 125 ? -7.902  -6.443  41.044  1.00 20.16 ? 1198 HIS C C   1 
ATOM   2166  O O   . HIS C  1 125 ? -6.764  -6.736  41.422  1.00 24.92 ? 1198 HIS C O   1 
ATOM   2167  C CB  . HIS C  1 125 ? -9.882  -7.991  41.272  1.00 19.34 ? 1198 HIS C CB  1 
ATOM   2168  C CG  . HIS C  1 125 ? -9.009  -9.133  40.857  1.00 20.07 ? 1198 HIS C CG  1 
ATOM   2169  N ND1 . HIS C  1 125 ? -8.799  -10.246 41.636  1.00 24.10 ? 1198 HIS C ND1 1 
ATOM   2170  C CD2 . HIS C  1 125 ? -8.373  -9.369  39.681  1.00 21.94 ? 1198 HIS C CD2 1 
ATOM   2171  C CE1 . HIS C  1 125 ? -7.996  -11.082 40.992  1.00 23.54 ? 1198 HIS C CE1 1 
ATOM   2172  N NE2 . HIS C  1 125 ? -7.763  -10.593 39.784  1.00 21.38 ? 1198 HIS C NE2 1 
ATOM   2173  N N   . ARG C  1 126 ? -8.139  -5.729  39.970  1.00 17.53 ? 1199 ARG C N   1 
ATOM   2174  C CA  . ARG C  1 126 ? -7.050  -5.314  39.103  1.00 22.30 ? 1199 ARG C CA  1 
ATOM   2175  C C   . ARG C  1 126 ? -6.075  -4.444  39.853  1.00 26.04 ? 1199 ARG C C   1 
ATOM   2176  O O   . ARG C  1 126 ? -4.847  -4.584  39.710  1.00 25.23 ? 1199 ARG C O   1 
ATOM   2177  C CB  . ARG C  1 126 ? -7.585  -4.546  37.964  1.00 20.26 ? 1199 ARG C CB  1 
ATOM   2178  C CG  . ARG C  1 126 ? -6.458  -4.156  36.984  1.00 31.13 ? 1199 ARG C CG  1 
ATOM   2179  C CD  . ARG C  1 126 ? -7.050  -3.560  35.760  1.00 27.73 ? 1199 ARG C CD  1 
ATOM   2180  N NE  . ARG C  1 126 ? -7.519  -2.215  36.028  1.00 27.39 ? 1199 ARG C NE  1 
ATOM   2181  C CZ  . ARG C  1 126 ? -8.113  -1.472  35.115  1.00 29.24 ? 1199 ARG C CZ  1 
ATOM   2182  N NH1 . ARG C  1 126 ? -8.511  -0.250  35.396  1.00 30.26 ? 1199 ARG C NH1 1 
ATOM   2183  N NH2 . ARG C  1 126 ? -8.289  -1.977  33.907  1.00 35.71 ? 1199 ARG C NH2 1 
ATOM   2184  N N   . SER C  1 127 ? -6.609  -3.504  40.624  1.00 23.64 ? 1200 SER C N   1 
ATOM   2185  C CA  . SER C  1 127 ? -5.691  -2.691  41.418  1.00 25.12 ? 1200 SER C CA  1 
ATOM   2186  C C   . SER C  1 127 ? -4.825  -3.520  42.352  1.00 26.62 ? 1200 SER C C   1 
ATOM   2187  O O   . SER C  1 127 ? -3.618  -3.257  42.438  1.00 30.05 ? 1200 SER C O   1 
ATOM   2188  C CB  . SER C  1 127 ? -6.427  -1.589  42.171  1.00 25.20 ? 1200 SER C CB  1 
ATOM   2189  O OG  . SER C  1 127 ? -6.896  -0.649  41.238  1.00 33.27 ? 1200 SER C OG  1 
ATOM   2190  N N   . LYS C  1 128 ? -5.410  -4.483  43.078  1.00 25.32 ? 1201 LYS C N   1 
ATOM   2191  C CA  . LYS C  1 128 ? -4.625  -5.266  44.037  1.00 27.73 ? 1201 LYS C CA  1 
ATOM   2192  C C   . LYS C  1 128 ? -3.536  -6.026  43.321  1.00 33.15 ? 1201 LYS C C   1 
ATOM   2193  O O   . LYS C  1 128 ? -2.366  -6.004  43.746  1.00 31.15 ? 1201 LYS C O   1 
ATOM   2194  C CB  . LYS C  1 128 ? -5.491  -6.228  44.843  1.00 30.34 ? 1201 LYS C CB  1 
ATOM   2195  C CG  . LYS C  1 128 ? -6.410  -5.535  45.796  1.00 34.72 ? 1201 LYS C CG  1 
ATOM   2196  C CD  . LYS C  1 128 ? -7.222  -6.530  46.594  1.00 46.98 ? 1201 LYS C CD  1 
ATOM   2197  C CE  . LYS C  1 128 ? -7.957  -5.825  47.726  1.00 52.56 ? 1201 LYS C CE  1 
ATOM   2198  N NZ  . LYS C  1 128 ? -8.772  -6.783  48.552  1.00 61.17 ? 1201 LYS C NZ  1 
ATOM   2199  N N   . VAL C  1 129 ? -3.907  -6.706  42.241  1.00 27.24 ? 1202 VAL C N   1 
ATOM   2200  C CA  . VAL C  1 129 ? -2.936  -7.491  41.479  1.00 27.73 ? 1202 VAL C CA  1 
ATOM   2201  C C   . VAL C  1 129 ? -1.842  -6.601  40.909  1.00 31.65 ? 1202 VAL C C   1 
ATOM   2202  O O   . VAL C  1 129 ? -0.688  -7.018  40.778  1.00 34.32 ? 1202 VAL C O   1 
ATOM   2203  C CB  . VAL C  1 129 ? -3.575  -8.224  40.275  1.00 27.54 ? 1202 VAL C CB  1 
ATOM   2204  C CG1 . VAL C  1 129 ? -2.487  -8.727  39.354  1.00 30.67 ? 1202 VAL C CG1 1 
ATOM   2205  C CG2 . VAL C  1 129 ? -4.460  -9.328  40.753  1.00 22.64 ? 1202 VAL C CG2 1 
ATOM   2206  N N   . GLN C  1 130 ? -2.193  -5.370  40.572  1.00 32.66 ? 1203 GLN C N   1 
ATOM   2207  C CA  . GLN C  1 130 ? -1.183  -4.422  40.151  1.00 37.09 ? 1203 GLN C CA  1 
ATOM   2208  C C   . GLN C  1 130 ? -0.614  -3.647  41.330  1.00 37.20 ? 1203 GLN C C   1 
ATOM   2209  O O   . GLN C  1 130 ? 0.058   -2.638  41.131  1.00 46.45 ? 1203 GLN C O   1 
ATOM   2210  C CB  . GLN C  1 130 ? -1.766  -3.468  39.119  1.00 34.83 ? 1203 GLN C CB  1 
ATOM   2211  C CG  . GLN C  1 130 ? -2.316  -4.159  37.917  1.00 39.68 ? 1203 GLN C CG  1 
ATOM   2212  C CD  . GLN C  1 130 ? -2.955  -3.194  36.915  1.00 40.75 ? 1203 GLN C CD  1 
ATOM   2213  O OE1 . GLN C  1 130 ? -3.149  -3.538  35.741  1.00 45.57 ? 1203 GLN C OE1 1 
ATOM   2214  N NE2 . GLN C  1 130 ? -3.308  -1.990  37.384  1.00 39.24 ? 1203 GLN C NE2 1 
ATOM   2215  N N   . GLY C  1 131 ? -0.873  -4.120  42.554  1.00 37.73 ? 1204 GLY C N   1 
ATOM   2216  C CA  . GLY C  1 131 ? -0.406  -3.438  43.761  1.00 41.26 ? 1204 GLY C CA  1 
ATOM   2217  C C   . GLY C  1 131 ? -0.823  -1.967  43.837  1.00 46.66 ? 1204 GLY C C   1 
ATOM   2218  O O   . GLY C  1 131 ? -0.049  -1.098  44.284  1.00 54.11 ? 1204 GLY C O   1 
ATOM   2219  N N   . LYS D  2 6   ? -3.236  -15.263 53.337  1.00 54.28 ? 27   LYS D N   1 
ATOM   2220  C CA  . LYS D  2 6   ? -4.399  -14.760 52.606  1.00 52.16 ? 27   LYS D CA  1 
ATOM   2221  C C   . LYS D  2 6   ? -5.033  -15.905 51.815  1.00 52.61 ? 27   LYS D C   1 
ATOM   2222  O O   . LYS D  2 6   ? -4.428  -16.435 50.873  1.00 48.95 ? 27   LYS D O   1 
ATOM   2223  C CB  . LYS D  2 6   ? -3.974  -13.623 51.670  1.00 51.79 ? 27   LYS D CB  1 
ATOM   2224  C CG  . LYS D  2 6   ? -5.087  -12.648 51.230  1.00 55.59 ? 27   LYS D CG  1 
ATOM   2225  C CD  . LYS D  2 6   ? -4.564  -11.679 50.141  1.00 52.08 ? 27   LYS D CD  1 
ATOM   2226  C CE  . LYS D  2 6   ? -5.699  -10.908 49.412  1.00 56.81 ? 27   LYS D CE  1 
ATOM   2227  N NZ  . LYS D  2 6   ? -5.183  -9.928  48.369  1.00 47.94 ? 27   LYS D NZ  1 
ATOM   2228  N N   . SER D  2 7   ? -6.251  -16.292 52.193  1.00 50.81 ? 28   SER D N   1 
ATOM   2229  C CA  . SER D  2 7   ? -6.924  -17.394 51.506  1.00 48.66 ? 28   SER D CA  1 
ATOM   2230  C C   . SER D  2 7   ? -8.001  -16.936 50.502  1.00 44.67 ? 28   SER D C   1 
ATOM   2231  O O   . SER D  2 7   ? -8.734  -15.976 50.747  1.00 43.78 ? 28   SER D O   1 
ATOM   2232  C CB  . SER D  2 7   ? -7.501  -18.389 52.518  1.00 49.09 ? 28   SER D CB  1 
ATOM   2233  O OG  . SER D  2 7   ? -8.643  -17.854 53.164  1.00 52.39 ? 28   SER D OG  1 
ATOM   2234  N N   . ALA D  2 8   ? -8.094  -17.648 49.379  1.00 40.60 ? 29   ALA D N   1 
ATOM   2235  C CA  . ALA D  2 8   ? -9.023  -17.314 48.308  1.00 36.23 ? 29   ALA D CA  1 
ATOM   2236  C C   . ALA D  2 8   ? -10.444 -17.148 48.810  1.00 41.05 ? 29   ALA D C   1 
ATOM   2237  O O   . ALA D  2 8   ? -10.868 -17.863 49.711  1.00 40.80 ? 29   ALA D O   1 
ATOM   2238  C CB  . ALA D  2 8   ? -9.001  -18.395 47.232  1.00 33.76 ? 29   ALA D CB  1 
ATOM   2239  N N   . PRO D  2 9   ? -11.200 -16.228 48.198  1.00 35.76 ? 30   PRO D N   1 
ATOM   2240  C CA  . PRO D  2 9   ? -12.641 -16.149 48.484  1.00 35.97 ? 30   PRO D CA  1 
ATOM   2241  C C   . PRO D  2 9   ? -13.315 -17.473 48.193  1.00 32.79 ? 30   PRO D C   1 
ATOM   2242  O O   . PRO D  2 9   ? -12.902 -18.179 47.275  1.00 35.00 ? 30   PRO D O   1 
ATOM   2243  C CB  . PRO D  2 9   ? -13.146 -15.130 47.472  1.00 35.31 ? 30   PRO D CB  1 
ATOM   2244  C CG  . PRO D  2 9   ? -11.934 -14.336 47.058  1.00 39.86 ? 30   PRO D CG  1 
ATOM   2245  C CD  . PRO D  2 9   ? -10.738 -15.199 47.249  1.00 38.44 ? 30   PRO D CD  1 
ATOM   2246  N N   . ALA D  2 10  ? -14.345 -17.794 48.963  1.00 35.94 ? 31   ALA D N   1 
ATOM   2247  C CA  . ALA D  2 10  ? -15.258 -18.877 48.657  1.00 33.71 ? 31   ALA D CA  1 
ATOM   2248  C C   . ALA D  2 10  ? -15.985 -18.575 47.361  1.00 30.86 ? 31   ALA D C   1 
ATOM   2249  O O   . ALA D  2 10  ? -16.230 -17.397 47.045  1.00 33.23 ? 31   ALA D O   1 
ATOM   2250  C CB  . ALA D  2 10  ? -16.289 -19.006 49.781  1.00 39.15 ? 31   ALA D CB  1 
ATOM   2251  N N   . THR D  2 11  ? -16.358 -19.626 46.630  1.00 29.89 ? 32   THR D N   1 
ATOM   2252  C CA  . THR D  2 11  ? -17.102 -19.447 45.395  1.00 30.17 ? 32   THR D CA  1 
ATOM   2253  C C   . THR D  2 11  ? -18.369 -20.268 45.423  1.00 30.90 ? 32   THR D C   1 
ATOM   2254  O O   . THR D  2 11  ? -18.512 -21.145 46.255  1.00 33.62 ? 32   THR D O   1 
ATOM   2255  C CB  . THR D  2 11  ? -16.267 -19.828 44.162  1.00 29.02 ? 32   THR D CB  1 
ATOM   2256  O OG1 . THR D  2 11  ? -15.970 -21.235 44.155  1.00 29.66 ? 32   THR D OG1 1 
ATOM   2257  C CG2 . THR D  2 11  ? -14.966 -19.034 44.177  1.00 30.30 ? 32   THR D CG2 1 
ATOM   2258  N N   . GLY D  2 12  ? -19.289 -19.929 44.530  1.00 27.33 ? 33   GLY D N   1 
ATOM   2259  C CA  . GLY D  2 12  ? -20.548 -20.620 44.403  1.00 31.78 ? 33   GLY D CA  1 
ATOM   2260  C C   . GLY D  2 12  ? -20.265 -21.827 43.526  1.00 32.09 ? 33   GLY D C   1 
ATOM   2261  O O   . GLY D  2 12  ? -19.147 -22.402 43.508  1.00 40.23 ? 33   GLY D O   1 
ATOM   2262  N N   . GLY D  2 13  ? -21.264 -22.231 42.782  1.00 34.88 ? 34   GLY D N   1 
ATOM   2263  C CA  . GLY D  2 13  ? -21.027 -23.304 41.853  1.00 32.94 ? 34   GLY D CA  1 
ATOM   2264  C C   . GLY D  2 13  ? -21.279 -22.668 40.520  1.00 31.90 ? 34   GLY D C   1 
ATOM   2265  O O   . GLY D  2 13  ? -20.992 -21.488 40.310  1.00 29.97 ? 34   GLY D O   1 
ATOM   2266  N N   . VAL D  2 14  ? -21.896 -23.425 39.643  1.00 31.30 ? 35   VAL D N   1 
ATOM   2267  C CA  . VAL D  2 14  ? -22.165 -22.956 38.314  1.00 28.05 ? 35   VAL D CA  1 
ATOM   2268  C C   . VAL D  2 14  ? -23.377 -22.077 38.332  1.00 36.05 ? 35   VAL D C   1 
ATOM   2269  O O   . VAL D  2 14  ? -24.414 -22.427 38.917  1.00 31.26 ? 35   VAL D O   1 
ATOM   2270  C CB  . VAL D  2 14  ? -22.445 -24.150 37.413  1.00 29.91 ? 35   VAL D CB  1 
ATOM   2271  C CG1 . VAL D  2 14  ? -22.818 -23.707 36.034  1.00 30.59 ? 35   VAL D CG1 1 
ATOM   2272  C CG2 . VAL D  2 14  ? -21.234 -25.080 37.409  1.00 37.01 ? 35   VAL D CG2 1 
HETATM 2273  N N   . M3L D  2 15  ? -23.247 -20.931 37.675  1.00 28.11 ? 36   M3L D N   1 
HETATM 2274  C CA  . M3L D  2 15  ? -24.336 -20.018 37.519  1.00 31.66 ? 36   M3L D CA  1 
HETATM 2275  C CB  . M3L D  2 15  ? -23.935 -18.797 36.720  1.00 30.20 ? 36   M3L D CB  1 
HETATM 2276  C CG  . M3L D  2 15  ? -24.819 -17.602 36.943  1.00 32.98 ? 36   M3L D CG  1 
HETATM 2277  C CD  . M3L D  2 15  ? -24.306 -16.282 36.398  1.00 27.87 ? 36   M3L D CD  1 
HETATM 2278  C CE  . M3L D  2 15  ? -25.230 -15.103 36.586  1.00 29.38 ? 36   M3L D CE  1 
HETATM 2279  N NZ  . M3L D  2 15  ? -24.665 -13.817 36.247  1.00 30.16 ? 36   M3L D NZ  1 
HETATM 2280  C C   . M3L D  2 15  ? -25.580 -20.609 36.884  1.00 34.74 ? 36   M3L D C   1 
HETATM 2281  O O   . M3L D  2 15  ? -25.495 -21.154 35.819  1.00 33.54 ? 36   M3L D O   1 
HETATM 2282  C CM1 . M3L D  2 15  ? -24.309 -13.883 34.836  1.00 29.01 ? 36   M3L D CM1 1 
HETATM 2283  C CM2 . M3L D  2 15  ? -23.517 -13.545 37.112  1.00 24.22 ? 36   M3L D CM2 1 
HETATM 2284  C CM3 . M3L D  2 15  ? -25.644 -12.765 36.435  1.00 27.76 ? 36   M3L D CM3 1 
ATOM   2285  N N   . LYS D  2 16  ? -26.723 -20.431 37.547  1.00 32.02 ? 37   LYS D N   1 
ATOM   2286  C CA  . LYS D  2 16  ? -27.986 -20.965 37.059  1.00 36.12 ? 37   LYS D CA  1 
ATOM   2287  C C   . LYS D  2 16  ? -28.472 -20.121 35.908  1.00 38.62 ? 37   LYS D C   1 
ATOM   2288  O O   . LYS D  2 16  ? -28.064 -18.975 35.747  1.00 36.40 ? 37   LYS D O   1 
ATOM   2289  C CB  . LYS D  2 16  ? -29.085 -20.908 38.143  1.00 41.34 ? 37   LYS D CB  1 
ATOM   2290  C CG  . LYS D  2 16  ? -28.624 -20.884 39.576  1.00 45.58 ? 37   LYS D CG  1 
ATOM   2291  C CD  . LYS D  2 16  ? -29.812 -20.579 40.507  1.00 50.96 ? 37   LYS D CD  1 
ATOM   2292  C CE  . LYS D  2 16  ? -29.338 -20.155 41.918  1.00 55.65 ? 37   LYS D CE  1 
ATOM   2293  N NZ  . LYS D  2 16  ? -30.408 -20.230 42.963  1.00 50.54 ? 37   LYS D NZ  1 
ATOM   2294  N N   . PRO D  2 17  ? -29.407 -20.665 35.130  1.00 37.52 ? 38   PRO D N   1 
ATOM   2295  C CA  . PRO D  2 17  ? -29.933 -19.939 33.975  1.00 35.73 ? 38   PRO D CA  1 
ATOM   2296  C C   . PRO D  2 17  ? -30.813 -18.743 34.342  1.00 35.53 ? 38   PRO D C   1 
ATOM   2297  O O   . PRO D  2 17  ? -31.432 -18.717 35.407  1.00 39.91 ? 38   PRO D O   1 
ATOM   2298  C CB  . PRO D  2 17  ? -30.738 -21.017 33.222  1.00 38.25 ? 38   PRO D CB  1 
ATOM   2299  C CG  . PRO D  2 17  ? -30.123 -22.331 33.687  1.00 38.69 ? 38   PRO D CG  1 
ATOM   2300  C CD  . PRO D  2 17  ? -29.757 -22.098 35.118  1.00 38.57 ? 38   PRO D CD  1 
ATOM   2301  N N   . HIS D  2 18  ? -30.865 -17.753 33.452  1.00 33.68 ? 39   HIS D N   1 
ATOM   2302  C CA  . HIS D  2 18  ? -31.665 -16.563 33.691  1.00 36.99 ? 39   HIS D CA  1 
ATOM   2303  C C   . HIS D  2 18  ? -33.088 -16.989 34.132  1.00 45.58 ? 39   HIS D C   1 
ATOM   2304  O O   . HIS D  2 18  ? -33.690 -17.873 33.531  1.00 41.15 ? 39   HIS D O   1 
ATOM   2305  C CB  . HIS D  2 18  ? -31.678 -15.737 32.416  1.00 39.36 ? 39   HIS D CB  1 
ATOM   2306  C CG  . HIS D  2 18  ? -32.433 -14.446 32.500  1.00 46.14 ? 39   HIS D CG  1 
ATOM   2307  N ND1 . HIS D  2 18  ? -33.440 -14.119 31.613  1.00 48.34 ? 39   HIS D ND1 1 
ATOM   2308  C CD2 . HIS D  2 18  ? -32.289 -13.376 33.316  1.00 43.52 ? 39   HIS D CD2 1 
ATOM   2309  C CE1 . HIS D  2 18  ? -33.894 -12.910 31.893  1.00 50.86 ? 39   HIS D CE1 1 
ATOM   2310  N NE2 . HIS D  2 18  ? -33.208 -12.436 32.919  1.00 49.01 ? 39   HIS D NE2 1 
ATOM   2311  N N   . ARG D  2 19  ? -33.578 -16.387 35.219  1.00 44.77 ? 40   ARG D N   1 
ATOM   2312  C CA  . ARG D  2 19  ? -34.953 -16.590 35.699  1.00 44.37 ? 40   ARG D CA  1 
ATOM   2313  C C   . ARG D  2 19  ? -35.282 -18.040 36.034  1.00 49.53 ? 40   ARG D C   1 
ATOM   2314  O O   . ARG D  2 19  ? -36.234 -18.311 36.775  1.00 49.46 ? 40   ARG D O   1 
ATOM   2315  C CB  . ARG D  2 19  ? -35.976 -16.028 34.705  1.00 39.95 ? 40   ARG D CB  1 
ATOM   2316  C CG  . ARG D  2 19  ? -36.040 -14.497 34.658  1.00 38.02 ? 40   ARG D CG  1 
ATOM   2317  C CD  . ARG D  2 19  ? -37.191 -13.996 33.758  1.00 39.04 ? 40   ARG D CD  1 
ATOM   2318  N NE  . ARG D  2 19  ? -37.371 -12.543 33.860  1.00 38.84 ? 40   ARG D NE  1 
ATOM   2319  C CZ  . ARG D  2 19  ? -38.335 -11.827 33.252  1.00 39.75 ? 40   ARG D CZ  1 
ATOM   2320  N NH1 . ARG D  2 19  ? -38.377 -10.505 33.421  1.00 40.88 ? 40   ARG D NH1 1 
ATOM   2321  N NH2 . ARG D  2 19  ? -39.235 -12.403 32.446  1.00 25.05 ? 40   ARG D NH2 1 
ATOM   2322  N N   . ASP E  1 7   ? -17.862 -24.419 11.058  1.00 52.84 ? 1080 ASP E N   1 
ATOM   2323  C CA  . ASP E  1 7   ? -19.286 -24.643 10.833  1.00 50.89 ? 1080 ASP E CA  1 
ATOM   2324  C C   . ASP E  1 7   ? -19.749 -25.818 11.693  1.00 48.34 ? 1080 ASP E C   1 
ATOM   2325  O O   . ASP E  1 7   ? -19.491 -25.868 12.908  1.00 49.62 ? 1080 ASP E O   1 
ATOM   2326  C CB  . ASP E  1 7   ? -19.579 -24.953 9.360   1.00 48.99 ? 1080 ASP E CB  1 
ATOM   2327  C CG  . ASP E  1 7   ? -18.360 -24.807 8.475   1.00 48.62 ? 1080 ASP E CG  1 
ATOM   2328  O OD1 . ASP E  1 7   ? -18.527 -24.701 7.235   1.00 53.38 ? 1080 ASP E OD1 1 
ATOM   2329  O OD2 . ASP E  1 7   ? -17.235 -24.813 9.018   1.00 47.57 ? 1080 ASP E OD2 1 
ATOM   2330  N N   . SER E  1 8   ? -20.405 -26.768 11.040  1.00 44.03 ? 1081 SER E N   1 
ATOM   2331  C CA  . SER E  1 8   ? -21.021 -27.911 11.709  1.00 47.77 ? 1081 SER E CA  1 
ATOM   2332  C C   . SER E  1 8   ? -19.988 -28.723 12.457  1.00 44.53 ? 1081 SER E C   1 
ATOM   2333  O O   . SER E  1 8   ? -18.964 -29.060 11.880  1.00 40.87 ? 1081 SER E O   1 
ATOM   2334  C CB  . SER E  1 8   ? -21.643 -28.835 10.667  1.00 47.89 ? 1081 SER E CB  1 
ATOM   2335  O OG  . SER E  1 8   ? -20.682 -29.260 9.697   1.00 49.87 ? 1081 SER E OG  1 
ATOM   2336  N N   . PRO E  1 9   ? -20.260 -29.045 13.729  1.00 42.68 ? 1082 PRO E N   1 
ATOM   2337  C CA  . PRO E  1 9   ? -19.393 -29.982 14.460  1.00 42.95 ? 1082 PRO E CA  1 
ATOM   2338  C C   . PRO E  1 9   ? -19.423 -31.366 13.788  1.00 41.66 ? 1082 PRO E C   1 
ATOM   2339  O O   . PRO E  1 9   ? -20.460 -31.757 13.256  1.00 37.88 ? 1082 PRO E O   1 
ATOM   2340  C CB  . PRO E  1 9   ? -20.001 -30.001 15.876  1.00 39.74 ? 1082 PRO E CB  1 
ATOM   2341  C CG  . PRO E  1 9   ? -20.695 -28.688 15.991  1.00 47.10 ? 1082 PRO E CG  1 
ATOM   2342  C CD  . PRO E  1 9   ? -21.255 -28.415 14.613  1.00 48.16 ? 1082 PRO E CD  1 
ATOM   2343  N N   . LEU E  1 10  ? -18.271 -32.047 13.788  1.00 29.23 ? 1083 LEU E N   1 
ATOM   2344  C CA  . LEU E  1 10  ? -18.059 -33.322 13.134  1.00 26.21 ? 1083 LEU E CA  1 
ATOM   2345  C C   . LEU E  1 10  ? -17.940 -34.388 14.206  1.00 27.11 ? 1083 LEU E C   1 
ATOM   2346  O O   . LEU E  1 10  ? -17.630 -34.084 15.383  1.00 27.46 ? 1083 LEU E O   1 
ATOM   2347  C CB  . LEU E  1 10  ? -16.711 -33.294 12.411  1.00 25.60 ? 1083 LEU E CB  1 
ATOM   2348  C CG  . LEU E  1 10  ? -16.549 -32.117 11.463  1.00 26.61 ? 1083 LEU E CG  1 
ATOM   2349  C CD1 . LEU E  1 10  ? -15.186 -32.154 10.821  1.00 29.29 ? 1083 LEU E CD1 1 
ATOM   2350  C CD2 . LEU E  1 10  ? -17.595 -32.221 10.369  1.00 33.58 ? 1083 LEU E CD2 1 
ATOM   2351  N N   . ASP E  1 11  ? -18.140 -35.638 13.809  1.00 25.02 ? 1084 ASP E N   1 
ATOM   2352  C CA  . ASP E  1 11  ? -18.149 -36.727 14.773  1.00 27.20 ? 1084 ASP E CA  1 
ATOM   2353  C C   . ASP E  1 11  ? -16.967 -37.659 14.668  1.00 25.36 ? 1084 ASP E C   1 
ATOM   2354  O O   . ASP E  1 11  ? -16.364 -37.833 13.601  1.00 19.15 ? 1084 ASP E O   1 
ATOM   2355  C CB  . ASP E  1 11  ? -19.435 -37.537 14.627  1.00 31.22 ? 1084 ASP E CB  1 
ATOM   2356  C CG  . ASP E  1 11  ? -20.684 -36.685 14.866  1.00 35.84 ? 1084 ASP E CG  1 
ATOM   2357  O OD1 . ASP E  1 11  ? -21.704 -36.906 14.181  1.00 41.79 ? 1084 ASP E OD1 1 
ATOM   2358  O OD2 . ASP E  1 11  ? -20.638 -35.772 15.723  1.00 36.19 ? 1084 ASP E OD2 1 
ATOM   2359  N N   . ALA E  1 12  ? -16.671 -38.332 15.772  1.00 21.18 ? 1085 ALA E N   1 
ATOM   2360  C CA  . ALA E  1 12  ? -15.687 -39.391 15.755  1.00 21.42 ? 1085 ALA E CA  1 
ATOM   2361  C C   . ALA E  1 12  ? -16.039 -40.405 14.691  1.00 21.63 ? 1085 ALA E C   1 
ATOM   2362  O O   . ALA E  1 12  ? -17.201 -40.789 14.540  1.00 22.73 ? 1085 ALA E O   1 
ATOM   2363  C CB  . ALA E  1 12  ? -15.616 -40.106 17.129  1.00 27.16 ? 1085 ALA E CB  1 
ATOM   2364  N N   . LEU E  1 13  ? -15.010 -40.824 13.971  1.00 17.76 ? 1086 LEU E N   1 
ATOM   2365  C CA  . LEU E  1 13  ? -15.078 -41.834 12.903  1.00 17.03 ? 1086 LEU E CA  1 
ATOM   2366  C C   . LEU E  1 13  ? -15.649 -41.305 11.572  1.00 18.89 ? 1086 LEU E C   1 
ATOM   2367  O O   . LEU E  1 13  ? -15.841 -42.091 10.657  1.00 20.99 ? 1086 LEU E O   1 
ATOM   2368  C CB  . LEU E  1 13  ? -15.788 -43.124 13.368  1.00 22.63 ? 1086 LEU E CB  1 
ATOM   2369  C CG  . LEU E  1 13  ? -15.175 -43.620 14.679  1.00 23.75 ? 1086 LEU E CG  1 
ATOM   2370  C CD1 . LEU E  1 13  ? -15.879 -44.876 15.140  1.00 30.32 ? 1086 LEU E CD1 1 
ATOM   2371  C CD2 . LEU E  1 13  ? -13.647 -43.883 14.507  1.00 24.56 ? 1086 LEU E CD2 1 
ATOM   2372  N N   . ASP E  1 14  ? -15.838 -39.997 11.463  1.00 18.28 ? 1087 ASP E N   1 
ATOM   2373  C CA  . ASP E  1 14  ? -16.129 -39.354 10.185  1.00 17.21 ? 1087 ASP E CA  1 
ATOM   2374  C C   . ASP E  1 14  ? -14.850 -39.383 9.354   1.00 19.12 ? 1087 ASP E C   1 
ATOM   2375  O O   . ASP E  1 14  ? -13.741 -39.236 9.902   1.00 17.19 ? 1087 ASP E O   1 
ATOM   2376  C CB  . ASP E  1 14  ? -16.529 -37.880 10.344  1.00 19.01 ? 1087 ASP E CB  1 
ATOM   2377  C CG  . ASP E  1 14  ? -17.980 -37.667 10.858  1.00 25.95 ? 1087 ASP E CG  1 
ATOM   2378  O OD1 . ASP E  1 14  ? -18.692 -38.661 11.055  1.00 28.82 ? 1087 ASP E OD1 1 
ATOM   2379  O OD2 . ASP E  1 14  ? -18.382 -36.513 11.069  1.00 28.82 ? 1087 ASP E OD2 1 
ATOM   2380  N N   . LEU E  1 15  ? -15.006 -39.528 8.037   1.00 17.89 ? 1088 LEU E N   1 
ATOM   2381  C CA  . LEU E  1 15  ? -13.880 -39.381 7.100   1.00 16.85 ? 1088 LEU E CA  1 
ATOM   2382  C C   . LEU E  1 15  ? -13.807 -37.907 6.734   1.00 15.68 ? 1088 LEU E C   1 
ATOM   2383  O O   . LEU E  1 15  ? -14.824 -37.253 6.457   1.00 14.24 ? 1088 LEU E O   1 
ATOM   2384  C CB  . LEU E  1 15  ? -14.147 -40.189 5.837   1.00 15.93 ? 1088 LEU E CB  1 
ATOM   2385  C CG  . LEU E  1 15  ? -14.245 -41.709 6.065   1.00 18.19 ? 1088 LEU E CG  1 
ATOM   2386  C CD1 . LEU E  1 15  ? -14.663 -42.406 4.761   1.00 19.19 ? 1088 LEU E CD1 1 
ATOM   2387  C CD2 . LEU E  1 15  ? -12.894 -42.208 6.515   1.00 19.30 ? 1088 LEU E CD2 1 
ATOM   2388  N N   . VAL E  1 16  ? -12.577 -37.365 6.677   1.00 11.86 ? 1089 VAL E N   1 
ATOM   2389  C CA  . VAL E  1 16  ? -12.463 -35.981 6.367   1.00 9.92  ? 1089 VAL E CA  1 
ATOM   2390  C C   . VAL E  1 16  ? -11.241 -35.732 5.479   1.00 13.37 ? 1089 VAL E C   1 
ATOM   2391  O O   . VAL E  1 16  ? -10.356 -36.570 5.423   1.00 14.93 ? 1089 VAL E O   1 
ATOM   2392  C CB  . VAL E  1 16  ? -12.233 -35.116 7.651   1.00 13.84 ? 1089 VAL E CB  1 
ATOM   2393  C CG1 . VAL E  1 16  ? -13.535 -35.130 8.524   1.00 14.09 ? 1089 VAL E CG1 1 
ATOM   2394  C CG2 . VAL E  1 16  ? -11.036 -35.609 8.496   1.00 16.20 ? 1089 VAL E CG2 1 
ATOM   2395  N N   . TRP E  1 17  ? -11.279 -34.603 4.783   1.00 11.98 ? 1090 TRP E N   1 
ATOM   2396  C CA  . TRP E  1 17  ? -10.035 -34.036 4.204   1.00 11.99 ? 1090 TRP E CA  1 
ATOM   2397  C C   . TRP E  1 17  ? -9.412  -33.168 5.283   1.00 12.33 ? 1090 TRP E C   1 
ATOM   2398  O O   . TRP E  1 17  ? -10.059 -32.271 5.852   1.00 14.14 ? 1090 TRP E O   1 
ATOM   2399  C CB  . TRP E  1 17  ? -10.411 -33.138 3.006   1.00 11.32 ? 1090 TRP E CB  1 
ATOM   2400  C CG  . TRP E  1 17  ? -10.894 -33.920 1.814   1.00 11.36 ? 1090 TRP E CG  1 
ATOM   2401  C CD1 . TRP E  1 17  ? -12.231 -34.141 1.434   1.00 14.23 ? 1090 TRP E CD1 1 
ATOM   2402  C CD2 . TRP E  1 17  ? -10.105 -34.618 0.915   1.00 11.25 ? 1090 TRP E CD2 1 
ATOM   2403  N NE1 . TRP E  1 17  ? -12.271 -34.887 0.302   1.00 12.00 ? 1090 TRP E NE1 1 
ATOM   2404  C CE2 . TRP E  1 17  ? -10.956 -35.189 -0.052  1.00 10.48 ? 1090 TRP E CE2 1 
ATOM   2405  C CE3 . TRP E  1 17  ? -8.690  -34.726 0.734   1.00 11.64 ? 1090 TRP E CE3 1 
ATOM   2406  C CZ2 . TRP E  1 17  ? -10.479 -36.005 -1.093  1.00 12.72 ? 1090 TRP E CZ2 1 
ATOM   2407  C CZ3 . TRP E  1 17  ? -8.235  -35.493 -0.315  1.00 13.63 ? 1090 TRP E CZ3 1 
ATOM   2408  C CH2 . TRP E  1 17  ? -9.104  -36.106 -1.245  1.00 16.26 ? 1090 TRP E CH2 1 
ATOM   2409  N N   . ALA E  1 18  ? -8.119  -33.392 5.569   1.00 12.40 ? 1091 ALA E N   1 
ATOM   2410  C CA  . ALA E  1 18  ? -7.535  -32.736 6.731   1.00 11.41 ? 1091 ALA E CA  1 
ATOM   2411  C C   . ALA E  1 18  ? -6.323  -31.975 6.190   1.00 15.76 ? 1091 ALA E C   1 
ATOM   2412  O O   . ALA E  1 18  ? -5.495  -32.562 5.513   1.00 14.72 ? 1091 ALA E O   1 
ATOM   2413  C CB  . ALA E  1 18  ? -7.145  -33.798 7.799   1.00 15.44 ? 1091 ALA E CB  1 
ATOM   2414  N N   . LYS E  1 19  ? -6.285  -30.674 6.477   1.00 14.08 ? 1092 LYS E N   1 
ATOM   2415  C CA  . LYS E  1 19  ? -5.245  -29.843 5.857   1.00 15.17 ? 1092 LYS E CA  1 
ATOM   2416  C C   . LYS E  1 19  ? -4.238  -29.439 6.880   1.00 17.84 ? 1092 LYS E C   1 
ATOM   2417  O O   . LYS E  1 19  ? -4.548  -28.679 7.821   1.00 20.30 ? 1092 LYS E O   1 
ATOM   2418  C CB  . LYS E  1 19  ? -5.906  -28.586 5.330   1.00 18.09 ? 1092 LYS E CB  1 
ATOM   2419  C CG  . LYS E  1 19  ? -4.937  -27.569 4.651   1.00 16.96 ? 1092 LYS E CG  1 
ATOM   2420  C CD  . LYS E  1 19  ? -4.374  -28.165 3.427   1.00 17.22 ? 1092 LYS E CD  1 
ATOM   2421  C CE  . LYS E  1 19  ? -3.553  -27.141 2.662   1.00 19.80 ? 1092 LYS E CE  1 
ATOM   2422  N NZ  . LYS E  1 19  ? -2.243  -26.859 3.366   1.00 20.67 ? 1092 LYS E NZ  1 
ATOM   2423  N N   . CYS E  1 20  ? -3.001  -29.831 6.618   1.00 17.40 ? 1093 CYS E N   1 
ATOM   2424  C CA  . CYS E  1 20  ? -1.862  -29.423 7.463   1.00 16.74 ? 1093 CYS E CA  1 
ATOM   2425  C C   . CYS E  1 20  ? -1.058  -28.415 6.699   1.00 24.79 ? 1093 CYS E C   1 
ATOM   2426  O O   . CYS E  1 20  ? -0.960  -28.492 5.487   1.00 22.75 ? 1093 CYS E O   1 
ATOM   2427  C CB  . CYS E  1 20  ? -0.983  -30.605 7.671   1.00 22.53 ? 1093 CYS E CB  1 
ATOM   2428  S SG  . CYS E  1 20  ? -1.632  -31.778 8.874   1.00 30.94 ? 1093 CYS E SG  1 
ATOM   2429  N N   . ARG E  1 21  ? -0.418  -27.509 7.421   1.00 22.12 ? 1094 ARG E N   1 
ATOM   2430  C CA  . ARG E  1 21  ? 0.450   -26.532 6.787   1.00 23.91 ? 1094 ARG E CA  1 
ATOM   2431  C C   . ARG E  1 21  ? 1.490   -27.148 5.860   1.00 20.05 ? 1094 ARG E C   1 
ATOM   2432  O O   . ARG E  1 21  ? 2.180   -28.096 6.221   1.00 25.59 ? 1094 ARG E O   1 
ATOM   2433  C CB  . ARG E  1 21  ? 1.132   -25.662 7.874   1.00 27.87 ? 1094 ARG E CB  1 
ATOM   2434  C CG  . ARG E  1 21  ? 1.549   -24.311 7.356   1.00 34.69 ? 1094 ARG E CG  1 
ATOM   2435  C CD  . ARG E  1 21  ? 2.859   -24.441 6.605   1.00 40.96 ? 1094 ARG E CD  1 
ATOM   2436  N NE  . ARG E  1 21  ? 3.752   -25.431 7.219   1.00 46.79 ? 1094 ARG E NE  1 
ATOM   2437  C CZ  . ARG E  1 21  ? 4.954   -25.755 6.737   1.00 43.45 ? 1094 ARG E CZ  1 
ATOM   2438  N NH1 . ARG E  1 21  ? 5.696   -26.689 7.347   1.00 46.41 ? 1094 ARG E NH1 1 
ATOM   2439  N NH2 . ARG E  1 21  ? 5.405   -25.164 5.633   1.00 42.21 ? 1094 ARG E NH2 1 
ATOM   2440  N N   . GLY E  1 22  ? 1.593   -26.564 4.659   1.00 24.73 ? 1095 GLY E N   1 
ATOM   2441  C CA  . GLY E  1 22  ? 2.564   -27.022 3.680   1.00 25.90 ? 1095 GLY E CA  1 
ATOM   2442  C C   . GLY E  1 22  ? 2.266   -28.320 2.940   1.00 29.40 ? 1095 GLY E C   1 
ATOM   2443  O O   . GLY E  1 22  ? 2.964   -28.643 1.999   1.00 27.98 ? 1095 GLY E O   1 
ATOM   2444  N N   . TYR E  1 23  ? 1.254   -29.069 3.371   1.00 19.36 ? 1096 TYR E N   1 
ATOM   2445  C CA  . TYR E  1 23  ? 0.883   -30.307 2.704   1.00 17.09 ? 1096 TYR E CA  1 
ATOM   2446  C C   . TYR E  1 23  ? -0.463  -30.107 2.013   1.00 15.99 ? 1096 TYR E C   1 
ATOM   2447  O O   . TYR E  1 23  ? -1.223  -29.248 2.404   1.00 18.50 ? 1096 TYR E O   1 
ATOM   2448  C CB  . TYR E  1 23  ? 0.665   -31.401 3.733   1.00 17.54 ? 1096 TYR E CB  1 
ATOM   2449  C CG  . TYR E  1 23  ? 1.869   -31.935 4.405   1.00 19.35 ? 1096 TYR E CG  1 
ATOM   2450  C CD1 . TYR E  1 23  ? 2.815   -32.663 3.714   1.00 25.84 ? 1096 TYR E CD1 1 
ATOM   2451  C CD2 . TYR E  1 23  ? 2.054   -31.693 5.759   1.00 22.79 ? 1096 TYR E CD2 1 
ATOM   2452  C CE1 . TYR E  1 23  ? 3.933   -33.195 4.398   1.00 27.12 ? 1096 TYR E CE1 1 
ATOM   2453  C CE2 . TYR E  1 23  ? 3.139   -32.227 6.450   1.00 25.32 ? 1096 TYR E CE2 1 
ATOM   2454  C CZ  . TYR E  1 23  ? 4.062   -32.964 5.768   1.00 23.26 ? 1096 TYR E CZ  1 
ATOM   2455  O OH  . TYR E  1 23  ? 5.164   -33.448 6.472   1.00 28.44 ? 1096 TYR E OH  1 
ATOM   2456  N N   . PRO E  1 24  ? -0.750  -30.922 0.974   1.00 13.34 ? 1097 PRO E N   1 
ATOM   2457  C CA  . PRO E  1 24  ? -2.086  -30.780 0.365   1.00 15.20 ? 1097 PRO E CA  1 
ATOM   2458  C C   . PRO E  1 24  ? -3.112  -31.361 1.337   1.00 14.91 ? 1097 PRO E C   1 
ATOM   2459  O O   . PRO E  1 24  ? -2.761  -32.161 2.199   1.00 13.75 ? 1097 PRO E O   1 
ATOM   2460  C CB  . PRO E  1 24  ? -1.977  -31.644 -0.876  1.00 15.65 ? 1097 PRO E CB  1 
ATOM   2461  C CG  . PRO E  1 24  ? -1.038  -32.699 -0.510  1.00 17.50 ? 1097 PRO E CG  1 
ATOM   2462  C CD  . PRO E  1 24  ? -0.030  -32.088 0.450   1.00 16.61 ? 1097 PRO E CD  1 
ATOM   2463  N N   . SER E  1 25  ? -4.379  -31.016 1.151   1.00 13.76 ? 1098 SER E N   1 
ATOM   2464  C CA  . SER E  1 25  ? -5.410  -31.675 1.946   1.00 13.28 ? 1098 SER E CA  1 
ATOM   2465  C C   . SER E  1 25  ? -5.304  -33.190 1.819   1.00 10.76 ? 1098 SER E C   1 
ATOM   2466  O O   . SER E  1 25  ? -5.162  -33.712 0.706   1.00 12.05 ? 1098 SER E O   1 
ATOM   2467  C CB  . SER E  1 25  ? -6.804  -31.248 1.412   1.00 15.09 ? 1098 SER E CB  1 
ATOM   2468  O OG  . SER E  1 25  ? -6.971  -29.844 1.393   1.00 20.83 ? 1098 SER E OG  1 
ATOM   2469  N N   . TYR E  1 26  ? -5.463  -33.923 2.949   1.00 11.59 ? 1099 TYR E N   1 
ATOM   2470  C CA  . TYR E  1 26  ? -5.144  -35.320 2.931   1.00 11.44 ? 1099 TYR E CA  1 
ATOM   2471  C C   . TYR E  1 26  ? -6.261  -36.142 3.649   1.00 11.55 ? 1099 TYR E C   1 
ATOM   2472  O O   . TYR E  1 26  ? -6.729  -35.713 4.718   1.00 11.99 ? 1099 TYR E O   1 
ATOM   2473  C CB  . TYR E  1 26  ? -3.811  -35.513 3.682   1.00 13.43 ? 1099 TYR E CB  1 
ATOM   2474  C CG  . TYR E  1 26  ? -3.092  -36.759 3.246   1.00 12.16 ? 1099 TYR E CG  1 
ATOM   2475  C CD1 . TYR E  1 26  ? -3.387  -37.969 3.788   1.00 14.84 ? 1099 TYR E CD1 1 
ATOM   2476  C CD2 . TYR E  1 26  ? -2.049  -36.681 2.312   1.00 16.31 ? 1099 TYR E CD2 1 
ATOM   2477  C CE1 . TYR E  1 26  ? -2.723  -39.105 3.376   1.00 16.63 ? 1099 TYR E CE1 1 
ATOM   2478  C CE2 . TYR E  1 26  ? -1.371  -37.812 1.886   1.00 16.14 ? 1099 TYR E CE2 1 
ATOM   2479  C CZ  . TYR E  1 26  ? -1.705  -39.015 2.442   1.00 18.76 ? 1099 TYR E CZ  1 
ATOM   2480  O OH  . TYR E  1 26  ? -1.041  -40.184 2.072   1.00 23.40 ? 1099 TYR E OH  1 
ATOM   2481  N N   . PRO E  1 27  ? -6.651  -37.294 3.111   1.00 11.40 ? 1100 PRO E N   1 
ATOM   2482  C CA  . PRO E  1 27  ? -7.724  -38.103 3.759   1.00 11.90 ? 1100 PRO E CA  1 
ATOM   2483  C C   . PRO E  1 27  ? -7.363  -38.608 5.152   1.00 15.30 ? 1100 PRO E C   1 
ATOM   2484  O O   . PRO E  1 27  ? -6.225  -39.053 5.390   1.00 13.45 ? 1100 PRO E O   1 
ATOM   2485  C CB  . PRO E  1 27  ? -7.869  -39.318 2.809   1.00 11.14 ? 1100 PRO E CB  1 
ATOM   2486  C CG  . PRO E  1 27  ? -7.500  -38.686 1.398   1.00 13.21 ? 1100 PRO E CG  1 
ATOM   2487  C CD  . PRO E  1 27  ? -6.266  -37.859 1.800   1.00 12.45 ? 1100 PRO E CD  1 
ATOM   2488  N N   . ALA E  1 28  ? -8.320  -38.555 6.082   1.00 11.80 ? 1101 ALA E N   1 
ATOM   2489  C CA  . ALA E  1 28  ? -8.039  -38.951 7.460   1.00 12.41 ? 1101 ALA E CA  1 
ATOM   2490  C C   . ALA E  1 28  ? -9.342  -39.353 8.078   1.00 13.81 ? 1101 ALA E C   1 
ATOM   2491  O O   . ALA E  1 28  ? -10.414 -39.154 7.501   1.00 14.01 ? 1101 ALA E O   1 
ATOM   2492  C CB  . ALA E  1 28  ? -7.406  -37.795 8.272   1.00 12.54 ? 1101 ALA E CB  1 
ATOM   2493  N N   . LEU E  1 29  ? -9.228  -39.926 9.267   1.00 14.31 ? 1102 LEU E N   1 
ATOM   2494  C CA  . LEU E  1 29  ? -10.386 -40.422 10.050  1.00 13.33 ? 1102 LEU E CA  1 
ATOM   2495  C C   . LEU E  1 29  ? -10.320 -39.704 11.408  1.00 15.23 ? 1102 LEU E C   1 
ATOM   2496  O O   . LEU E  1 29  ? -9.258  -39.592 12.004  1.00 16.97 ? 1102 LEU E O   1 
ATOM   2497  C CB  . LEU E  1 29  ? -10.143 -41.918 10.290  1.00 14.83 ? 1102 LEU E CB  1 
ATOM   2498  C CG  . LEU E  1 29  ? -11.147 -42.674 11.156  1.00 20.82 ? 1102 LEU E CG  1 
ATOM   2499  C CD1 . LEU E  1 29  ? -12.508 -42.648 10.483  1.00 18.73 ? 1102 LEU E CD1 1 
ATOM   2500  C CD2 . LEU E  1 29  ? -10.657 -44.127 11.271  1.00 21.21 ? 1102 LEU E CD2 1 
ATOM   2501  N N   . ILE E  1 30  ? -11.446 -39.130 11.830  1.00 13.78 ? 1103 ILE E N   1 
ATOM   2502  C CA  . ILE E  1 30  ? -11.508 -38.421 13.124  1.00 11.86 ? 1103 ILE E CA  1 
ATOM   2503  C C   . ILE E  1 30  ? -11.575 -39.523 14.189  1.00 16.01 ? 1103 ILE E C   1 
ATOM   2504  O O   . ILE E  1 30  ? -12.355 -40.484 14.031  1.00 20.75 ? 1103 ILE E O   1 
ATOM   2505  C CB  . ILE E  1 30  ? -12.787 -37.581 13.215  1.00 16.90 ? 1103 ILE E CB  1 
ATOM   2506  C CG1 . ILE E  1 30  ? -12.802 -36.490 12.127  1.00 17.07 ? 1103 ILE E CG1 1 
ATOM   2507  C CG2 . ILE E  1 30  ? -12.903 -36.962 14.630  1.00 13.95 ? 1103 ILE E CG2 1 
ATOM   2508  C CD1 . ILE E  1 30  ? -13.798 -35.461 12.322  1.00 22.45 ? 1103 ILE E CD1 1 
ATOM   2509  N N   . ILE E  1 31  ? -10.725 -39.419 15.216  1.00 15.04 ? 1104 ILE E N   1 
ATOM   2510  C CA  . ILE E  1 31  ? -10.666 -40.433 16.264  1.00 16.65 ? 1104 ILE E CA  1 
ATOM   2511  C C   . ILE E  1 31  ? -11.090 -39.768 17.577  1.00 18.53 ? 1104 ILE E C   1 
ATOM   2512  O O   . ILE E  1 31  ? -10.728 -38.651 17.844  1.00 19.56 ? 1104 ILE E O   1 
ATOM   2513  C CB  . ILE E  1 31  ? -9.225  -40.933 16.380  1.00 19.53 ? 1104 ILE E CB  1 
ATOM   2514  C CG1 . ILE E  1 31  ? -8.739  -41.512 15.050  1.00 18.50 ? 1104 ILE E CG1 1 
ATOM   2515  C CG2 . ILE E  1 31  ? -9.093  -41.982 17.536  1.00 17.30 ? 1104 ILE E CG2 1 
ATOM   2516  C CD1 . ILE E  1 31  ? -9.329  -42.785 14.629  1.00 20.31 ? 1104 ILE E CD1 1 
ATOM   2517  N N   . ASP E  1 32  ? -11.868 -40.467 18.411  1.00 19.74 ? 1105 ASP E N   1 
ATOM   2518  C CA  . ASP E  1 32  ? -12.241 -39.905 19.714  1.00 24.12 ? 1105 ASP E CA  1 
ATOM   2519  C C   . ASP E  1 32  ? -11.057 -40.062 20.664  1.00 22.01 ? 1105 ASP E C   1 
ATOM   2520  O O   . ASP E  1 32  ? -10.629 -41.184 20.904  1.00 24.42 ? 1105 ASP E O   1 
ATOM   2521  C CB  . ASP E  1 32  ? -13.425 -40.728 20.235  1.00 25.33 ? 1105 ASP E CB  1 
ATOM   2522  C CG  . ASP E  1 32  ? -13.913 -40.282 21.596  1.00 29.96 ? 1105 ASP E CG  1 
ATOM   2523  O OD1 . ASP E  1 32  ? -13.259 -39.429 22.223  1.00 28.51 ? 1105 ASP E OD1 1 
ATOM   2524  O OD2 . ASP E  1 32  ? -14.997 -40.766 22.016  1.00 34.69 ? 1105 ASP E OD2 1 
ATOM   2525  N N   . PRO E  1 33  ? -10.521 -38.953 21.214  1.00 21.21 ? 1106 PRO E N   1 
ATOM   2526  C CA  . PRO E  1 33  ? -9.329  -39.115 22.056  1.00 24.03 ? 1106 PRO E CA  1 
ATOM   2527  C C   . PRO E  1 33  ? -9.694  -39.868 23.325  1.00 26.03 ? 1106 PRO E C   1 
ATOM   2528  O O   . PRO E  1 33  ? -8.817  -40.423 23.942  1.00 29.32 ? 1106 PRO E O   1 
ATOM   2529  C CB  . PRO E  1 33  ? -8.915  -37.691 22.444  1.00 21.67 ? 1106 PRO E CB  1 
ATOM   2530  C CG  . PRO E  1 33  ? -9.770  -36.758 21.684  1.00 24.96 ? 1106 PRO E CG  1 
ATOM   2531  C CD  . PRO E  1 33  ? -10.825 -37.545 20.907  1.00 20.76 ? 1106 PRO E CD  1 
ATOM   2532  N N   . LYS E  1 34  ? -10.967 -39.881 23.674  1.00 24.44 ? 1107 LYS E N   1 
ATOM   2533  C CA  . LYS E  1 34  ? -11.399 -40.615 24.885  1.00 30.00 ? 1107 LYS E CA  1 
ATOM   2534  C C   . LYS E  1 34  ? -11.946 -42.001 24.608  1.00 30.42 ? 1107 LYS E C   1 
ATOM   2535  O O   . LYS E  1 34  ? -12.563 -42.624 25.478  1.00 32.04 ? 1107 LYS E O   1 
ATOM   2536  C CB  . LYS E  1 34  ? -12.427 -39.796 25.672  1.00 37.61 ? 1107 LYS E CB  1 
ATOM   2537  C CG  . LYS E  1 34  ? -11.856 -38.554 26.340  1.00 38.87 ? 1107 LYS E CG  1 
ATOM   2538  C CD  . LYS E  1 34  ? -12.875 -37.957 27.309  1.00 48.52 ? 1107 LYS E CD  1 
ATOM   2539  C CE  . LYS E  1 34  ? -12.529 -36.518 27.668  1.00 54.57 ? 1107 LYS E CE  1 
ATOM   2540  N NZ  . LYS E  1 34  ? -12.992 -35.555 26.611  1.00 54.23 ? 1107 LYS E NZ  1 
ATOM   2541  N N   . MET E  1 35  ? -11.742 -42.505 23.395  1.00 23.93 ? 1108 MET E N   1 
ATOM   2542  C CA  . MET E  1 35  ? -12.017 -43.901 23.144  1.00 25.61 ? 1108 MET E CA  1 
ATOM   2543  C C   . MET E  1 35  ? -11.351 -44.793 24.202  1.00 30.82 ? 1108 MET E C   1 
ATOM   2544  O O   . MET E  1 35  ? -10.318 -44.433 24.769  1.00 28.77 ? 1108 MET E O   1 
ATOM   2545  C CB  . MET E  1 35  ? -11.597 -44.317 21.737  1.00 24.70 ? 1108 MET E CB  1 
ATOM   2546  C CG  . MET E  1 35  ? -10.078 -44.419 21.479  1.00 21.72 ? 1108 MET E CG  1 
ATOM   2547  S SD  . MET E  1 35  ? -9.866  -44.989 19.783  1.00 28.67 ? 1108 MET E SD  1 
ATOM   2548  C CE  . MET E  1 35  ? -10.282 -46.715 19.864  1.00 30.39 ? 1108 MET E CE  1 
ATOM   2549  N N   . PRO E  1 36  ? -11.967 -45.944 24.483  1.00 30.46 ? 1109 PRO E N   1 
ATOM   2550  C CA  . PRO E  1 36  ? -11.476 -46.892 25.492  1.00 31.37 ? 1109 PRO E CA  1 
ATOM   2551  C C   . PRO E  1 36  ? -10.034 -47.287 25.195  1.00 32.70 ? 1109 PRO E C   1 
ATOM   2552  O O   . PRO E  1 36  ? -9.674  -47.610 24.042  1.00 30.81 ? 1109 PRO E O   1 
ATOM   2553  C CB  . PRO E  1 36  ? -12.417 -48.093 25.322  1.00 33.25 ? 1109 PRO E CB  1 
ATOM   2554  C CG  . PRO E  1 36  ? -13.641 -47.495 24.785  1.00 33.71 ? 1109 PRO E CG  1 
ATOM   2555  C CD  . PRO E  1 36  ? -13.175 -46.436 23.818  1.00 29.43 ? 1109 PRO E CD  1 
ATOM   2556  N N   . ARG E  1 37  ? -9.200  -47.238 26.229  1.00 30.83 ? 1110 ARG E N   1 
ATOM   2557  C CA  . ARG E  1 37  ? -7.777  -47.555 26.093  1.00 33.35 ? 1110 ARG E CA  1 
ATOM   2558  C C   . ARG E  1 37  ? -7.517  -49.007 25.693  1.00 34.70 ? 1110 ARG E C   1 
ATOM   2559  O O   . ARG E  1 37  ? -6.419  -49.368 25.244  1.00 32.69 ? 1110 ARG E O   1 
ATOM   2560  C CB  . ARG E  1 37  ? -7.049  -47.214 27.403  1.00 35.07 ? 1110 ARG E CB  1 
ATOM   2561  C CG  . ARG E  1 37  ? -7.217  -45.778 27.818  1.00 29.22 ? 1110 ARG E CG  1 
ATOM   2562  C CD  . ARG E  1 37  ? -6.777  -44.840 26.703  1.00 29.03 ? 1110 ARG E CD  1 
ATOM   2563  N NE  . ARG E  1 37  ? -5.353  -44.974 26.402  1.00 26.29 ? 1110 ARG E NE  1 
ATOM   2564  C CZ  . ARG E  1 37  ? -4.776  -44.498 25.302  1.00 27.22 ? 1110 ARG E CZ  1 
ATOM   2565  N NH1 . ARG E  1 37  ? -3.465  -44.648 25.100  1.00 26.21 ? 1110 ARG E NH1 1 
ATOM   2566  N NH2 . ARG E  1 37  ? -5.510  -43.835 24.421  1.00 29.68 ? 1110 ARG E NH2 1 
ATOM   2567  N N   . GLU E  1 38  ? -8.549  -49.827 25.834  1.00 33.38 ? 1111 GLU E N   1 
ATOM   2568  C CA  . GLU E  1 38  ? -8.486  -51.227 25.440  1.00 37.53 ? 1111 GLU E CA  1 
ATOM   2569  C C   . GLU E  1 38  ? -8.886  -51.424 23.984  1.00 35.08 ? 1111 GLU E C   1 
ATOM   2570  O O   . GLU E  1 38  ? -8.847  -52.551 23.465  1.00 38.28 ? 1111 GLU E O   1 
ATOM   2571  C CB  . GLU E  1 38  ? -9.386  -52.076 26.347  1.00 42.07 ? 1111 GLU E CB  1 
ATOM   2572  C CG  . GLU E  1 38  ? -10.559 -51.309 26.943  1.00 42.73 ? 1111 GLU E CG  1 
ATOM   2573  C CD  . GLU E  1 38  ? -10.152 -50.438 28.131  1.00 44.76 ? 1111 GLU E CD  1 
ATOM   2574  O OE1 . GLU E  1 38  ? -10.942 -49.559 28.516  1.00 45.96 ? 1111 GLU E OE1 1 
ATOM   2575  O OE2 . GLU E  1 38  ? -9.039  -50.628 28.692  1.00 50.40 ? 1111 GLU E OE2 1 
ATOM   2576  N N   . GLY E  1 39  ? -9.247  -50.327 23.315  1.00 36.47 ? 1112 GLY E N   1 
ATOM   2577  C CA  . GLY E  1 39  ? -9.644  -50.405 21.917  1.00 33.51 ? 1112 GLY E CA  1 
ATOM   2578  C C   . GLY E  1 39  ? -11.140 -50.587 21.751  1.00 36.03 ? 1112 GLY E C   1 
ATOM   2579  O O   . GLY E  1 39  ? -11.881 -50.733 22.744  1.00 34.86 ? 1112 GLY E O   1 
ATOM   2580  N N   . MET E  1 40  ? -11.588 -50.537 20.498  1.00 31.95 ? 1113 MET E N   1 
ATOM   2581  C CA  . MET E  1 40  ? -13.009 -50.688 20.167  1.00 36.78 ? 1113 MET E CA  1 
ATOM   2582  C C   . MET E  1 40  ? -13.124 -51.166 18.736  1.00 34.00 ? 1113 MET E C   1 
ATOM   2583  O O   . MET E  1 40  ? -12.172 -51.087 17.960  1.00 35.76 ? 1113 MET E O   1 
ATOM   2584  C CB  . MET E  1 40  ? -13.786 -49.388 20.340  1.00 37.24 ? 1113 MET E CB  1 
ATOM   2585  C CG  . MET E  1 40  ? -13.309 -48.266 19.441  1.00 44.01 ? 1113 MET E CG  1 
ATOM   2586  S SD  . MET E  1 40  ? -14.464 -46.887 19.381  1.00 55.24 ? 1113 MET E SD  1 
ATOM   2587  C CE  . MET E  1 40  ? -15.589 -47.521 18.144  1.00 39.16 ? 1113 MET E CE  1 
ATOM   2588  N N   . PHE E  1 41  ? -14.270 -51.725 18.403  1.00 33.06 ? 1114 PHE E N   1 
ATOM   2589  C CA  . PHE E  1 41  ? -14.524 -52.200 17.045  1.00 31.84 ? 1114 PHE E CA  1 
ATOM   2590  C C   . PHE E  1 41  ? -15.689 -51.374 16.591  1.00 35.72 ? 1114 PHE E C   1 
ATOM   2591  O O   . PHE E  1 41  ? -16.665 -51.240 17.342  1.00 41.37 ? 1114 PHE E O   1 
ATOM   2592  C CB  . PHE E  1 41  ? -14.966 -53.672 17.048  1.00 36.73 ? 1114 PHE E CB  1 
ATOM   2593  C CG  . PHE E  1 41  ? -13.863 -54.648 17.309  1.00 35.35 ? 1114 PHE E CG  1 
ATOM   2594  C CD1 . PHE E  1 41  ? -13.768 -55.299 18.532  1.00 37.55 ? 1114 PHE E CD1 1 
ATOM   2595  C CD2 . PHE E  1 41  ? -12.933 -54.938 16.328  1.00 37.40 ? 1114 PHE E CD2 1 
ATOM   2596  C CE1 . PHE E  1 41  ? -12.741 -56.203 18.767  1.00 42.12 ? 1114 PHE E CE1 1 
ATOM   2597  C CE2 . PHE E  1 41  ? -11.899 -55.848 16.557  1.00 39.91 ? 1114 PHE E CE2 1 
ATOM   2598  C CZ  . PHE E  1 41  ? -11.808 -56.487 17.781  1.00 36.87 ? 1114 PHE E CZ  1 
ATOM   2599  N N   . HIS E  1 42  ? -15.609 -50.802 15.390  1.00 28.59 ? 1115 HIS E N   1 
ATOM   2600  C CA  . HIS E  1 42  ? -16.687 -49.983 14.873  1.00 32.31 ? 1115 HIS E CA  1 
ATOM   2601  C C   . HIS E  1 42  ? -17.327 -50.844 13.793  1.00 35.07 ? 1115 HIS E C   1 
ATOM   2602  O O   . HIS E  1 42  ? -16.748 -50.988 12.722  1.00 33.59 ? 1115 HIS E O   1 
ATOM   2603  C CB  . HIS E  1 42  ? -16.138 -48.714 14.209  1.00 31.34 ? 1115 HIS E CB  1 
ATOM   2604  C CG  . HIS E  1 42  ? -17.205 -47.763 13.752  1.00 34.20 ? 1115 HIS E CG  1 
ATOM   2605  N ND1 . HIS E  1 42  ? -18.269 -47.398 14.554  1.00 36.79 ? 1115 HIS E ND1 1 
ATOM   2606  C CD2 . HIS E  1 42  ? -17.345 -47.059 12.597  1.00 33.00 ? 1115 HIS E CD2 1 
ATOM   2607  C CE1 . HIS E  1 42  ? -19.037 -46.540 13.901  1.00 37.79 ? 1115 HIS E CE1 1 
ATOM   2608  N NE2 . HIS E  1 42  ? -18.498 -46.318 12.708  1.00 38.24 ? 1115 HIS E NE2 1 
ATOM   2609  N N   . HIS E  1 43  ? -18.500 -51.417 14.063  1.00 34.19 ? 1116 HIS E N   1 
ATOM   2610  C CA  . HIS E  1 43  ? -19.057 -52.440 13.170  1.00 35.01 ? 1116 HIS E CA  1 
ATOM   2611  C C   . HIS E  1 43  ? -17.977 -53.401 12.725  1.00 38.55 ? 1116 HIS E C   1 
ATOM   2612  O O   . HIS E  1 43  ? -17.744 -53.605 11.533  1.00 37.36 ? 1116 HIS E O   1 
ATOM   2613  C CB  . HIS E  1 43  ? -19.717 -51.782 11.965  1.00 37.22 ? 1116 HIS E CB  1 
ATOM   2614  C CG  . HIS E  1 43  ? -20.695 -50.720 12.337  1.00 40.96 ? 1116 HIS E CG  1 
ATOM   2615  N ND1 . HIS E  1 43  ? -21.975 -51.006 12.762  1.00 44.48 ? 1116 HIS E ND1 1 
ATOM   2616  C CD2 . HIS E  1 43  ? -20.578 -49.372 12.376  1.00 38.57 ? 1116 HIS E CD2 1 
ATOM   2617  C CE1 . HIS E  1 43  ? -22.609 -49.879 13.030  1.00 40.33 ? 1116 HIS E CE1 1 
ATOM   2618  N NE2 . HIS E  1 43  ? -21.787 -48.871 12.795  1.00 44.51 ? 1116 HIS E NE2 1 
ATOM   2619  N N   . GLY E  1 44  ? -17.289 -53.985 13.698  1.00 36.52 ? 1117 GLY E N   1 
ATOM   2620  C CA  . GLY E  1 44  ? -16.310 -54.997 13.406  1.00 33.26 ? 1117 GLY E CA  1 
ATOM   2621  C C   . GLY E  1 44  ? -14.973 -54.536 12.876  1.00 39.80 ? 1117 GLY E C   1 
ATOM   2622  O O   . GLY E  1 44  ? -14.077 -55.366 12.626  1.00 35.68 ? 1117 GLY E O   1 
ATOM   2623  N N   . VAL E  1 45  ? -14.804 -53.228 12.714  1.00 32.73 ? 1118 VAL E N   1 
ATOM   2624  C CA  . VAL E  1 45  ? -13.521 -52.728 12.204  1.00 28.63 ? 1118 VAL E CA  1 
ATOM   2625  C C   . VAL E  1 45  ? -12.739 -52.171 13.392  1.00 28.30 ? 1118 VAL E C   1 
ATOM   2626  O O   . VAL E  1 45  ? -13.224 -51.317 14.067  1.00 29.45 ? 1118 VAL E O   1 
ATOM   2627  C CB  . VAL E  1 45  ? -13.755 -51.601 11.145  1.00 34.52 ? 1118 VAL E CB  1 
ATOM   2628  C CG1 . VAL E  1 45  ? -12.436 -51.015 10.658  1.00 30.83 ? 1118 VAL E CG1 1 
ATOM   2629  C CG2 . VAL E  1 45  ? -14.576 -52.126 9.961   1.00 33.55 ? 1118 VAL E CG2 1 
ATOM   2630  N N   . PRO E  1 46  ? -11.533 -52.684 13.662  1.00 30.34 ? 1119 PRO E N   1 
ATOM   2631  C CA  . PRO E  1 46  ? -10.797 -52.205 14.844  1.00 32.37 ? 1119 PRO E CA  1 
ATOM   2632  C C   . PRO E  1 46  ? -10.139 -50.851 14.668  1.00 30.40 ? 1119 PRO E C   1 
ATOM   2633  O O   . PRO E  1 46  ? -9.253  -50.706 13.807  1.00 31.96 ? 1119 PRO E O   1 
ATOM   2634  C CB  . PRO E  1 46  ? -9.681  -53.235 14.995  1.00 34.01 ? 1119 PRO E CB  1 
ATOM   2635  C CG  . PRO E  1 46  ? -9.481  -53.732 13.620  1.00 31.65 ? 1119 PRO E CG  1 
ATOM   2636  C CD  . PRO E  1 46  ? -10.862 -53.848 13.055  1.00 28.46 ? 1119 PRO E CD  1 
ATOM   2637  N N   . ILE E  1 47  ? -10.472 -49.927 15.565  1.00 26.14 ? 1120 ILE E N   1 
ATOM   2638  C CA  . ILE E  1 47  ? -9.982  -48.556 15.466  1.00 27.57 ? 1120 ILE E CA  1 
ATOM   2639  C C   . ILE E  1 47  ? -8.731  -48.367 16.295  1.00 27.50 ? 1120 ILE E C   1 
ATOM   2640  O O   . ILE E  1 47  ? -8.731  -48.714 17.495  1.00 24.96 ? 1120 ILE E O   1 
ATOM   2641  C CB  . ILE E  1 47  ? -11.007 -47.597 15.998  1.00 29.32 ? 1120 ILE E CB  1 
ATOM   2642  C CG1 . ILE E  1 47  ? -12.367 -47.830 15.329  1.00 28.70 ? 1120 ILE E CG1 1 
ATOM   2643  C CG2 . ILE E  1 47  ? -10.501 -46.159 15.844  1.00 25.41 ? 1120 ILE E CG2 1 
ATOM   2644  C CD1 . ILE E  1 47  ? -12.351 -47.639 13.822  1.00 29.97 ? 1120 ILE E CD1 1 
ATOM   2645  N N   . PRO E  1 48  ? -7.671  -47.818 15.683  1.00 22.84 ? 1121 PRO E N   1 
ATOM   2646  C CA  . PRO E  1 48  ? -6.408  -47.621 16.392  1.00 23.77 ? 1121 PRO E CA  1 
ATOM   2647  C C   . PRO E  1 48  ? -6.571  -46.706 17.584  1.00 26.03 ? 1121 PRO E C   1 
ATOM   2648  O O   . PRO E  1 48  ? -7.232  -45.662 17.524  1.00 21.75 ? 1121 PRO E O   1 
ATOM   2649  C CB  . PRO E  1 48  ? -5.475  -47.001 15.319  1.00 24.35 ? 1121 PRO E CB  1 
ATOM   2650  C CG  . PRO E  1 48  ? -6.014  -47.457 14.051  1.00 22.49 ? 1121 PRO E CG  1 
ATOM   2651  C CD  . PRO E  1 48  ? -7.536  -47.442 14.269  1.00 25.23 ? 1121 PRO E CD  1 
ATOM   2652  N N   . VAL E  1 49  ? -5.958  -47.125 18.693  1.00 22.72 ? 1122 VAL E N   1 
ATOM   2653  C CA  . VAL E  1 49  ? -5.946  -46.322 19.903  1.00 23.75 ? 1122 VAL E CA  1 
ATOM   2654  C C   . VAL E  1 49  ? -4.839  -45.282 19.918  1.00 23.04 ? 1122 VAL E C   1 
ATOM   2655  O O   . VAL E  1 49  ? -3.666  -45.567 19.642  1.00 23.88 ? 1122 VAL E O   1 
ATOM   2656  C CB  . VAL E  1 49  ? -5.825  -47.268 21.176  1.00 24.11 ? 1122 VAL E CB  1 
ATOM   2657  C CG1 . VAL E  1 49  ? -5.719  -46.418 22.446  1.00 27.83 ? 1122 VAL E CG1 1 
ATOM   2658  C CG2 . VAL E  1 49  ? -7.038  -48.175 21.253  1.00 30.71 ? 1122 VAL E CG2 1 
ATOM   2659  N N   . PRO E  1 50  ? -5.192  -44.040 20.227  1.00 24.05 ? 1123 PRO E N   1 
ATOM   2660  C CA  . PRO E  1 50  ? -4.168  -42.992 20.204  1.00 24.60 ? 1123 PRO E CA  1 
ATOM   2661  C C   . PRO E  1 50  ? -3.083  -43.179 21.284  1.00 28.12 ? 1123 PRO E C   1 
ATOM   2662  O O   . PRO E  1 50  ? -3.407  -43.404 22.461  1.00 25.77 ? 1123 PRO E O   1 
ATOM   2663  C CB  . PRO E  1 50  ? -4.971  -41.736 20.525  1.00 23.61 ? 1123 PRO E CB  1 
ATOM   2664  C CG  . PRO E  1 50  ? -6.389  -42.059 20.376  1.00 26.10 ? 1123 PRO E CG  1 
ATOM   2665  C CD  . PRO E  1 50  ? -6.555  -43.531 20.377  1.00 23.74 ? 1123 PRO E CD  1 
ATOM   2666  N N   . PRO E  1 51  ? -1.810  -43.086 20.910  1.00 24.87 ? 1124 PRO E N   1 
ATOM   2667  C CA  . PRO E  1 51  ? -0.780  -43.197 21.951  1.00 25.76 ? 1124 PRO E CA  1 
ATOM   2668  C C   . PRO E  1 51  ? -0.908  -42.092 23.013  1.00 26.72 ? 1124 PRO E C   1 
ATOM   2669  O O   . PRO E  1 51  ? -1.406  -41.019 22.744  1.00 23.83 ? 1124 PRO E O   1 
ATOM   2670  C CB  . PRO E  1 51  ? 0.529   -43.030 21.179  1.00 26.61 ? 1124 PRO E CB  1 
ATOM   2671  C CG  . PRO E  1 51  ? 0.177   -43.400 19.732  1.00 32.02 ? 1124 PRO E CG  1 
ATOM   2672  C CD  . PRO E  1 51  ? -1.257  -43.056 19.532  1.00 26.27 ? 1124 PRO E CD  1 
ATOM   2673  N N   . LEU E  1 52  ? -0.438  -42.351 24.228  1.00 29.18 ? 1125 LEU E N   1 
ATOM   2674  C CA  . LEU E  1 52  ? -0.429  -41.318 25.268  1.00 26.69 ? 1125 LEU E CA  1 
ATOM   2675  C C   . LEU E  1 52  ? 0.321   -40.077 24.852  1.00 28.38 ? 1125 LEU E C   1 
ATOM   2676  O O   . LEU E  1 52  ? -0.033  -38.979 25.252  1.00 28.95 ? 1125 LEU E O   1 
ATOM   2677  C CB  . LEU E  1 52  ? 0.241   -41.877 26.517  1.00 30.31 ? 1125 LEU E CB  1 
ATOM   2678  C CG  . LEU E  1 52  ? -0.529  -43.051 27.105  1.00 32.15 ? 1125 LEU E CG  1 
ATOM   2679  C CD1 . LEU E  1 52  ? 0.294   -43.703 28.241  1.00 35.53 ? 1125 LEU E CD1 1 
ATOM   2680  C CD2 . LEU E  1 52  ? -1.885  -42.606 27.591  1.00 30.13 ? 1125 LEU E CD2 1 
ATOM   2681  N N   . GLU E  1 53  ? 1.391   -40.251 24.086  1.00 26.46 ? 1126 GLU E N   1 
ATOM   2682  C CA  . GLU E  1 53  ? 2.169   -39.104 23.678  1.00 31.26 ? 1126 GLU E CA  1 
ATOM   2683  C C   . GLU E  1 53  ? 1.357   -38.201 22.740  1.00 32.36 ? 1126 GLU E C   1 
ATOM   2684  O O   . GLU E  1 53  ? 1.471   -36.979 22.790  1.00 29.80 ? 1126 GLU E O   1 
ATOM   2685  C CB  . GLU E  1 53  ? 3.455   -39.562 23.004  1.00 35.37 ? 1126 GLU E CB  1 
ATOM   2686  C CG  . GLU E  1 53  ? 4.421   -38.415 22.739  1.00 49.87 ? 1126 GLU E CG  1 
ATOM   2687  C CD  . GLU E  1 53  ? 5.393   -38.712 21.610  1.00 56.03 ? 1126 GLU E CD  1 
ATOM   2688  O OE1 . GLU E  1 53  ? 6.591   -38.359 21.765  1.00 59.44 ? 1126 GLU E OE1 1 
ATOM   2689  O OE2 . GLU E  1 53  ? 4.952   -39.292 20.577  1.00 52.48 ? 1126 GLU E OE2 1 
ATOM   2690  N N   . VAL E  1 54  ? 0.562   -38.814 21.861  1.00 29.02 ? 1127 VAL E N   1 
ATOM   2691  C CA  . VAL E  1 54  ? -0.334  -38.063 20.959  1.00 25.33 ? 1127 VAL E CA  1 
ATOM   2692  C C   . VAL E  1 54  ? -1.391  -37.275 21.775  1.00 25.23 ? 1127 VAL E C   1 
ATOM   2693  O O   . VAL E  1 54  ? -1.673  -36.097 21.489  1.00 24.72 ? 1127 VAL E O   1 
ATOM   2694  C CB  . VAL E  1 54  ? -1.029  -39.026 19.914  1.00 24.96 ? 1127 VAL E CB  1 
ATOM   2695  C CG1 . VAL E  1 54  ? -2.167  -38.324 19.184  1.00 24.30 ? 1127 VAL E CG1 1 
ATOM   2696  C CG2 . VAL E  1 54  ? -0.029  -39.639 18.944  1.00 28.15 ? 1127 VAL E CG2 1 
ATOM   2697  N N   . LEU E  1 55  ? -1.961  -37.907 22.787  1.00 25.63 ? 1128 LEU E N   1 
ATOM   2698  C CA  . LEU E  1 55  ? -2.943  -37.249 23.636  1.00 24.64 ? 1128 LEU E CA  1 
ATOM   2699  C C   . LEU E  1 55  ? -2.339  -36.086 24.417  1.00 24.78 ? 1128 LEU E C   1 
ATOM   2700  O O   . LEU E  1 55  ? -2.976  -35.060 24.609  1.00 27.22 ? 1128 LEU E O   1 
ATOM   2701  C CB  . LEU E  1 55  ? -3.514  -38.254 24.648  1.00 26.31 ? 1128 LEU E CB  1 
ATOM   2702  C CG  . LEU E  1 55  ? -4.360  -39.376 24.029  1.00 30.53 ? 1128 LEU E CG  1 
ATOM   2703  C CD1 . LEU E  1 55  ? -4.943  -40.264 25.103  1.00 28.62 ? 1128 LEU E CD1 1 
ATOM   2704  C CD2 . LEU E  1 55  ? -5.486  -38.780 23.196  1.00 29.04 ? 1128 LEU E CD2 1 
ATOM   2705  N N   . LYS E  1 56  ? -1.106  -36.272 24.880  1.00 29.25 ? 1129 LYS E N   1 
ATOM   2706  C CA  . LYS E  1 56  ? -0.422  -35.232 25.638  1.00 30.66 ? 1129 LYS E CA  1 
ATOM   2707  C C   . LYS E  1 56  ? -0.185  -34.014 24.750  1.00 30.53 ? 1129 LYS E C   1 
ATOM   2708  O O   . LYS E  1 56  ? -0.447  -32.893 25.150  1.00 29.08 ? 1129 LYS E O   1 
ATOM   2709  C CB  . LYS E  1 56  ? 0.902   -35.757 26.202  1.00 31.73 ? 1129 LYS E CB  1 
ATOM   2710  C CG  . LYS E  1 56  ? 1.724   -34.743 27.020  1.00 39.59 ? 1129 LYS E CG  1 
ATOM   2711  C CD  . LYS E  1 56  ? 3.142   -35.296 27.275  1.00 41.13 ? 1129 LYS E CD  1 
ATOM   2712  C CE  . LYS E  1 56  ? 4.164   -34.155 27.459  1.00 52.19 ? 1129 LYS E CE  1 
ATOM   2713  N NZ  . LYS E  1 56  ? 5.588   -34.620 27.411  1.00 55.80 ? 1129 LYS E NZ  1 
ATOM   2714  N N   . LEU E  1 57  ? 0.319   -34.253 23.542  1.00 25.15 ? 1130 LEU E N   1 
ATOM   2715  C CA  . LEU E  1 57  ? 0.457   -33.211 22.534  1.00 26.41 ? 1130 LEU E CA  1 
ATOM   2716  C C   . LEU E  1 57  ? -0.854  -32.461 22.294  1.00 23.67 ? 1130 LEU E C   1 
ATOM   2717  O O   . LEU E  1 57  ? -0.893  -31.219 22.138  1.00 24.38 ? 1130 LEU E O   1 
ATOM   2718  C CB  . LEU E  1 57  ? 0.884   -33.904 21.247  1.00 26.77 ? 1130 LEU E CB  1 
ATOM   2719  C CG  . LEU E  1 57  ? 1.744   -33.186 20.223  1.00 34.95 ? 1130 LEU E CG  1 
ATOM   2720  C CD1 . LEU E  1 57  ? 1.208   -33.455 18.817  1.00 29.04 ? 1130 LEU E CD1 1 
ATOM   2721  C CD2 . LEU E  1 57  ? 1.952   -31.699 20.491  1.00 29.96 ? 1130 LEU E CD2 1 
ATOM   2722  N N   . GLY E  1 58  ? -1.947  -33.212 22.266  1.00 23.66 ? 1131 GLY E N   1 
ATOM   2723  C CA  . GLY E  1 58  ? -3.251  -32.616 22.002  1.00 23.07 ? 1131 GLY E CA  1 
ATOM   2724  C C   . GLY E  1 58  ? -3.597  -31.618 23.105  1.00 25.16 ? 1131 GLY E C   1 
ATOM   2725  O O   . GLY E  1 58  ? -4.115  -30.521 22.868  1.00 23.20 ? 1131 GLY E O   1 
ATOM   2726  N N   . GLU E  1 59  ? -3.318  -32.011 24.335  1.00 25.75 ? 1132 GLU E N   1 
ATOM   2727  C CA  . GLU E  1 59  ? -3.627  -31.118 25.463  1.00 27.72 ? 1132 GLU E CA  1 
ATOM   2728  C C   . GLU E  1 59  ? -2.797  -29.828 25.349  1.00 27.98 ? 1132 GLU E C   1 
ATOM   2729  O O   . GLU E  1 59  ? -3.315  -28.702 25.463  1.00 27.53 ? 1132 GLU E O   1 
ATOM   2730  C CB  . GLU E  1 59  ? -3.392  -31.878 26.770  1.00 31.69 ? 1132 GLU E CB  1 
ATOM   2731  C CG  . GLU E  1 59  ? -3.707  -31.065 28.003  1.00 40.23 ? 1132 GLU E CG  1 
ATOM   2732  C CD  . GLU E  1 59  ? -3.724  -31.914 29.258  1.00 50.31 ? 1132 GLU E CD  1 
ATOM   2733  O OE1 . GLU E  1 59  ? -3.844  -31.335 30.374  1.00 52.84 ? 1132 GLU E OE1 1 
ATOM   2734  O OE2 . GLU E  1 59  ? -3.617  -33.157 29.115  1.00 53.19 ? 1132 GLU E OE2 1 
ATOM   2735  N N   . GLN E  1 60  ? -1.515  -29.974 25.048  1.00 25.43 ? 1133 GLN E N   1 
ATOM   2736  C CA  . GLN E  1 60  ? -0.677  -28.790 24.822  1.00 29.96 ? 1133 GLN E CA  1 
ATOM   2737  C C   . GLN E  1 60  ? -1.149  -27.910 23.675  1.00 24.07 ? 1133 GLN E C   1 
ATOM   2738  O O   . GLN E  1 60  ? -1.252  -26.683 23.806  1.00 26.81 ? 1133 GLN E O   1 
ATOM   2739  C CB  . GLN E  1 60  ? 0.782   -29.189 24.580  1.00 31.91 ? 1133 GLN E CB  1 
ATOM   2740  C CG  . GLN E  1 60  ? 1.299   -30.163 25.628  1.00 38.58 ? 1133 GLN E CG  1 
ATOM   2741  C CD  . GLN E  1 60  ? 2.739   -30.581 25.406  1.00 46.04 ? 1133 GLN E CD  1 
ATOM   2742  O OE1 . GLN E  1 60  ? 3.409   -31.060 26.333  1.00 47.87 ? 1133 GLN E OE1 1 
ATOM   2743  N NE2 . GLN E  1 60  ? 3.228   -30.409 24.177  1.00 46.98 ? 1133 GLN E NE2 1 
ATOM   2744  N N   . MET E  1 61  ? -1.451  -28.520 22.519  1.00 24.25 ? 1134 MET E N   1 
ATOM   2745  C CA  . MET E  1 61  ? -1.841  -27.742 21.363  1.00 20.17 ? 1134 MET E CA  1 
ATOM   2746  C C   . MET E  1 61  ? -3.170  -27.055 21.571  1.00 20.91 ? 1134 MET E C   1 
ATOM   2747  O O   . MET E  1 61  ? -3.388  -25.973 21.057  1.00 24.70 ? 1134 MET E O   1 
ATOM   2748  C CB  . MET E  1 61  ? -1.923  -28.642 20.087  1.00 20.44 ? 1134 MET E CB  1 
ATOM   2749  C CG  . MET E  1 61  ? -0.580  -29.172 19.626  1.00 22.63 ? 1134 MET E CG  1 
ATOM   2750  S SD  . MET E  1 61  ? -0.750  -30.304 18.196  1.00 23.84 ? 1134 MET E SD  1 
ATOM   2751  C CE  . MET E  1 61  ? -1.291  -29.178 16.924  1.00 24.54 ? 1134 MET E CE  1 
ATOM   2752  N N   . THR E  1 62  ? -4.064  -27.681 22.328  1.00 21.84 ? 1135 THR E N   1 
ATOM   2753  C CA  . THR E  1 62  ? -5.381  -27.086 22.517  1.00 19.77 ? 1135 THR E CA  1 
ATOM   2754  C C   . THR E  1 62  ? -5.245  -25.869 23.464  1.00 27.28 ? 1135 THR E C   1 
ATOM   2755  O O   . THR E  1 62  ? -5.926  -24.897 23.307  1.00 28.21 ? 1135 THR E O   1 
ATOM   2756  C CB  . THR E  1 62  ? -6.375  -28.105 23.141  1.00 24.22 ? 1135 THR E CB  1 
ATOM   2757  O OG1 . THR E  1 62  ? -6.598  -29.181 22.222  1.00 23.74 ? 1135 THR E OG1 1 
ATOM   2758  C CG2 . THR E  1 62  ? -7.702  -27.446 23.423  1.00 23.91 ? 1135 THR E CG2 1 
ATOM   2759  N N   . GLN E  1 63  ? -4.382  -25.994 24.465  1.00 26.66 ? 1136 GLN E N   1 
ATOM   2760  C CA  . GLN E  1 63  ? -4.129  -24.915 25.433  1.00 29.87 ? 1136 GLN E CA  1 
ATOM   2761  C C   . GLN E  1 63  ? -3.484  -23.741 24.690  1.00 34.78 ? 1136 GLN E C   1 
ATOM   2762  O O   . GLN E  1 63  ? -3.883  -22.590 24.883  1.00 34.12 ? 1136 GLN E O   1 
ATOM   2763  C CB  . GLN E  1 63  ? -3.189  -25.428 26.540  1.00 34.86 ? 1136 GLN E CB  1 
ATOM   2764  C CG  . GLN E  1 63  ? -2.750  -24.393 27.595  1.00 44.68 ? 1136 GLN E CG  1 
ATOM   2765  C CD  . GLN E  1 63  ? -1.306  -24.666 28.108  1.00 55.25 ? 1136 GLN E CD  1 
ATOM   2766  O OE1 . GLN E  1 63  ? -0.549  -25.441 27.493  1.00 51.57 ? 1136 GLN E OE1 1 
ATOM   2767  N NE2 . GLN E  1 63  ? -0.929  -24.023 29.226  1.00 53.91 ? 1136 GLN E NE2 1 
ATOM   2768  N N   . GLU E  1 64  ? -2.530  -24.028 23.809  1.00 27.89 ? 1137 GLU E N   1 
ATOM   2769  C CA  . GLU E  1 64  ? -1.864  -22.966 23.053  1.00 31.74 ? 1137 GLU E CA  1 
ATOM   2770  C C   . GLU E  1 64  ? -2.793  -22.267 22.058  1.00 34.09 ? 1137 GLU E C   1 
ATOM   2771  O O   . GLU E  1 64  ? -2.794  -21.034 21.935  1.00 34.47 ? 1137 GLU E O   1 
ATOM   2772  C CB  . GLU E  1 64  ? -0.583  -23.457 22.351  1.00 32.29 ? 1137 GLU E CB  1 
ATOM   2773  C CG  . GLU E  1 64  ? 0.105   -22.324 21.586  1.00 38.69 ? 1137 GLU E CG  1 
ATOM   2774  C CD  . GLU E  1 64  ? 0.868   -22.737 20.330  1.00 53.13 ? 1137 GLU E CD  1 
ATOM   2775  O OE1 . GLU E  1 64  ? 1.077   -21.858 19.440  1.00 54.49 ? 1137 GLU E OE1 1 
ATOM   2776  O OE2 . GLU E  1 64  ? 1.270   -23.921 20.229  1.00 61.80 ? 1137 GLU E OE2 1 
ATOM   2777  N N   . ALA E  1 65  ? -3.600  -23.047 21.353  1.00 27.39 ? 1138 ALA E N   1 
ATOM   2778  C CA  . ALA E  1 65  ? -4.507  -22.484 20.364  1.00 30.41 ? 1138 ALA E CA  1 
ATOM   2779  C C   . ALA E  1 65  ? -5.780  -21.885 21.007  1.00 25.11 ? 1138 ALA E C   1 
ATOM   2780  O O   . ALA E  1 65  ? -6.363  -20.966 20.470  1.00 27.16 ? 1138 ALA E O   1 
ATOM   2781  C CB  . ALA E  1 65  ? -4.891  -23.558 19.294  1.00 24.51 ? 1138 ALA E CB  1 
ATOM   2782  N N   . ARG E  1 66  ? -6.192  -22.427 22.138  1.00 26.70 ? 1139 ARG E N   1 
ATOM   2783  C CA  . ARG E  1 66  ? -7.505  -22.061 22.703  1.00 22.49 ? 1139 ARG E CA  1 
ATOM   2784  C C   . ARG E  1 66  ? -8.557  -22.225 21.622  1.00 26.30 ? 1139 ARG E C   1 
ATOM   2785  O O   . ARG E  1 66  ? -9.389  -21.359 21.353  1.00 25.86 ? 1139 ARG E O   1 
ATOM   2786  C CB  . ARG E  1 66  ? -7.467  -20.644 23.308  1.00 22.95 ? 1139 ARG E CB  1 
ATOM   2787  C CG  . ARG E  1 66  ? -6.931  -20.724 24.728  1.00 27.76 ? 1139 ARG E CG  1 
ATOM   2788  C CD  . ARG E  1 66  ? -6.077  -19.573 25.124  1.00 28.40 ? 1139 ARG E CD  1 
ATOM   2789  N NE  . ARG E  1 66  ? -4.779  -19.650 24.463  1.00 32.04 ? 1139 ARG E NE  1 
ATOM   2790  C CZ  . ARG E  1 66  ? -3.912  -18.664 24.512  1.00 30.07 ? 1139 ARG E CZ  1 
ATOM   2791  N NH1 . ARG E  1 66  ? -2.735  -18.769 23.890  1.00 32.73 ? 1139 ARG E NH1 1 
ATOM   2792  N NH2 . ARG E  1 66  ? -4.253  -17.553 25.169  1.00 26.85 ? 1139 ARG E NH2 1 
ATOM   2793  N N   . GLU E  1 67  ? -8.484  -23.388 20.974  1.00 22.46 ? 1140 GLU E N   1 
ATOM   2794  C CA  . GLU E  1 67  ? -9.428  -23.697 19.905  1.00 24.78 ? 1140 GLU E CA  1 
ATOM   2795  C C   . GLU E  1 67  ? -9.615  -25.201 20.035  1.00 20.92 ? 1140 GLU E C   1 
ATOM   2796  O O   . GLU E  1 67  ? -8.698  -25.942 20.393  1.00 24.08 ? 1140 GLU E O   1 
ATOM   2797  C CB  . GLU E  1 67  ? -8.829  -23.342 18.543  1.00 27.41 ? 1140 GLU E CB  1 
ATOM   2798  C CG  . GLU E  1 67  ? -9.786  -23.176 17.381  1.00 31.54 ? 1140 GLU E CG  1 
ATOM   2799  C CD  . GLU E  1 67  ? -9.041  -22.776 16.097  1.00 39.14 ? 1140 GLU E CD  1 
ATOM   2800  O OE1 . GLU E  1 67  ? -7.781  -22.738 16.107  1.00 33.25 ? 1140 GLU E OE1 1 
ATOM   2801  O OE2 . GLU E  1 67  ? -9.723  -22.510 15.085  1.00 44.10 ? 1140 GLU E OE2 1 
ATOM   2802  N N   . HIS E  1 68  ? -10.829 -25.666 19.762  1.00 20.74 ? 1141 HIS E N   1 
ATOM   2803  C CA  . HIS E  1 68  ? -11.113 -27.070 19.827  1.00 20.11 ? 1141 HIS E CA  1 
ATOM   2804  C C   . HIS E  1 68  ? -10.384 -27.786 18.697  1.00 18.58 ? 1141 HIS E C   1 
ATOM   2805  O O   . HIS E  1 68  ? -10.502 -27.382 17.545  1.00 21.16 ? 1141 HIS E O   1 
ATOM   2806  C CB  . HIS E  1 68  ? -12.633 -27.319 19.661  1.00 23.22 ? 1141 HIS E CB  1 
ATOM   2807  C CG  . HIS E  1 68  ? -13.003 -28.759 19.756  1.00 25.13 ? 1141 HIS E CG  1 
ATOM   2808  N ND1 . HIS E  1 68  ? -12.931 -29.474 20.936  1.00 27.84 ? 1141 HIS E ND1 1 
ATOM   2809  C CD2 . HIS E  1 68  ? -13.374 -29.648 18.800  1.00 27.20 ? 1141 HIS E CD2 1 
ATOM   2810  C CE1 . HIS E  1 68  ? -13.240 -30.738 20.704  1.00 27.82 ? 1141 HIS E CE1 1 
ATOM   2811  N NE2 . HIS E  1 68  ? -13.517 -30.867 19.419  1.00 27.07 ? 1141 HIS E NE2 1 
ATOM   2812  N N   . LEU E  1 69  ? -9.676  -28.850 19.045  1.00 19.46 ? 1142 LEU E N   1 
ATOM   2813  C CA  . LEU E  1 69  ? -8.955  -29.576 18.009  1.00 18.50 ? 1142 LEU E CA  1 
ATOM   2814  C C   . LEU E  1 69  ? -9.465  -30.979 17.950  1.00 19.61 ? 1142 LEU E C   1 
ATOM   2815  O O   . LEU E  1 69  ? -9.604  -31.677 18.973  1.00 20.84 ? 1142 LEU E O   1 
ATOM   2816  C CB  . LEU E  1 69  ? -7.441  -29.573 18.282  1.00 17.57 ? 1142 LEU E CB  1 
ATOM   2817  C CG  . LEU E  1 69  ? -6.825  -28.196 18.512  1.00 21.39 ? 1142 LEU E CG  1 
ATOM   2818  C CD1 . LEU E  1 69  ? -5.367  -28.347 19.033  1.00 19.37 ? 1142 LEU E CD1 1 
ATOM   2819  C CD2 . LEU E  1 69  ? -6.870  -27.361 17.272  1.00 22.50 ? 1142 LEU E CD2 1 
ATOM   2820  N N   . TYR E  1 70  ? -9.718  -31.412 16.728  1.00 15.61 ? 1143 TYR E N   1 
ATOM   2821  C CA  . TYR E  1 70  ? -10.006 -32.817 16.457  1.00 15.41 ? 1143 TYR E CA  1 
ATOM   2822  C C   . TYR E  1 70  ? -8.758  -33.630 16.279  1.00 15.33 ? 1143 TYR E C   1 
ATOM   2823  O O   . TYR E  1 70  ? -7.762  -33.162 15.682  1.00 15.19 ? 1143 TYR E O   1 
ATOM   2824  C CB  . TYR E  1 70  ? -10.795 -32.918 15.167  1.00 16.57 ? 1143 TYR E CB  1 
ATOM   2825  C CG  . TYR E  1 70  ? -12.138 -32.245 15.245  1.00 18.17 ? 1143 TYR E CG  1 
ATOM   2826  C CD1 . TYR E  1 70  ? -13.274 -32.963 15.623  1.00 21.44 ? 1143 TYR E CD1 1 
ATOM   2827  C CD2 . TYR E  1 70  ? -12.270 -30.896 14.968  1.00 18.45 ? 1143 TYR E CD2 1 
ATOM   2828  C CE1 . TYR E  1 70  ? -14.497 -32.375 15.679  1.00 21.78 ? 1143 TYR E CE1 1 
ATOM   2829  C CE2 . TYR E  1 70  ? -13.517 -30.286 15.032  1.00 22.87 ? 1143 TYR E CE2 1 
ATOM   2830  C CZ  . TYR E  1 70  ? -14.620 -31.034 15.399  1.00 26.32 ? 1143 TYR E CZ  1 
ATOM   2831  O OH  . TYR E  1 70  ? -15.850 -30.428 15.458  1.00 30.02 ? 1143 TYR E OH  1 
ATOM   2832  N N   . LEU E  1 71  ? -8.793  -34.865 16.774  1.00 14.71 ? 1144 LEU E N   1 
ATOM   2833  C CA  . LEU E  1 71  ? -7.696  -35.796 16.542  1.00 14.97 ? 1144 LEU E CA  1 
ATOM   2834  C C   . LEU E  1 71  ? -7.958  -36.548 15.236  1.00 15.34 ? 1144 LEU E C   1 
ATOM   2835  O O   . LEU E  1 71  ? -9.042  -37.114 15.034  1.00 16.52 ? 1144 LEU E O   1 
ATOM   2836  C CB  . LEU E  1 71  ? -7.591  -36.820 17.662  1.00 13.04 ? 1144 LEU E CB  1 
ATOM   2837  C CG  . LEU E  1 71  ? -6.475  -37.847 17.546  1.00 18.64 ? 1144 LEU E CG  1 
ATOM   2838  C CD1 . LEU E  1 71  ? -5.148  -37.182 17.445  1.00 18.53 ? 1144 LEU E CD1 1 
ATOM   2839  C CD2 . LEU E  1 71  ? -6.599  -38.697 18.832  1.00 23.86 ? 1144 LEU E CD2 1 
ATOM   2840  N N   . VAL E  1 72  ? -6.999  -36.489 14.319  1.00 11.95 ? 1145 VAL E N   1 
ATOM   2841  C CA  . VAL E  1 72  ? -7.160  -37.215 13.082  1.00 13.28 ? 1145 VAL E CA  1 
ATOM   2842  C C   . VAL E  1 72  ? -6.053  -38.223 12.869  1.00 15.98 ? 1145 VAL E C   1 
ATOM   2843  O O   . VAL E  1 72  ? -4.899  -38.026 13.268  1.00 16.10 ? 1145 VAL E O   1 
ATOM   2844  C CB  . VAL E  1 72  ? -7.273  -36.275 11.806  1.00 14.06 ? 1145 VAL E CB  1 
ATOM   2845  C CG1 . VAL E  1 72  ? -8.392  -35.193 12.002  1.00 15.01 ? 1145 VAL E CG1 1 
ATOM   2846  C CG2 . VAL E  1 72  ? -5.902  -35.634 11.395  1.00 14.32 ? 1145 VAL E CG2 1 
ATOM   2847  N N   . LEU E  1 73  ? -6.429  -39.292 12.199  1.00 14.74 ? 1146 LEU E N   1 
ATOM   2848  C CA  . LEU E  1 73  ? -5.480  -40.323 11.830  1.00 14.44 ? 1146 LEU E CA  1 
ATOM   2849  C C   . LEU E  1 73  ? -5.472  -40.407 10.303  1.00 14.43 ? 1146 LEU E C   1 
ATOM   2850  O O   . LEU E  1 73  ? -6.488  -40.697 9.692   1.00 13.91 ? 1146 LEU E O   1 
ATOM   2851  C CB  . LEU E  1 73  ? -5.935  -41.677 12.442  1.00 16.68 ? 1146 LEU E CB  1 
ATOM   2852  C CG  . LEU E  1 73  ? -5.044  -42.827 12.011  1.00 19.25 ? 1146 LEU E CG  1 
ATOM   2853  C CD1 . LEU E  1 73  ? -3.637  -42.700 12.634  1.00 16.65 ? 1146 LEU E CD1 1 
ATOM   2854  C CD2 . LEU E  1 73  ? -5.684  -44.155 12.412  1.00 21.95 ? 1146 LEU E CD2 1 
ATOM   2855  N N   . PHE E  1 74  ? -4.353  -40.075 9.693   1.00 13.28 ? 1147 PHE E N   1 
ATOM   2856  C CA  . PHE E  1 74  ? -4.302  -40.041 8.217   1.00 13.32 ? 1147 PHE E CA  1 
ATOM   2857  C C   . PHE E  1 74  ? -4.303  -41.411 7.626   1.00 15.33 ? 1147 PHE E C   1 
ATOM   2858  O O   . PHE E  1 74  ? -3.778  -42.366 8.227   1.00 17.12 ? 1147 PHE E O   1 
ATOM   2859  C CB  . PHE E  1 74  ? -3.025  -39.279 7.732   1.00 12.02 ? 1147 PHE E CB  1 
ATOM   2860  C CG  . PHE E  1 74  ? -3.072  -37.798 8.055   1.00 12.92 ? 1147 PHE E CG  1 
ATOM   2861  C CD1 . PHE E  1 74  ? -3.822  -36.948 7.268   1.00 11.52 ? 1147 PHE E CD1 1 
ATOM   2862  C CD2 . PHE E  1 74  ? -2.307  -37.264 9.093   1.00 15.23 ? 1147 PHE E CD2 1 
ATOM   2863  C CE1 . PHE E  1 74  ? -3.873  -35.585 7.563   1.00 13.43 ? 1147 PHE E CE1 1 
ATOM   2864  C CE2 . PHE E  1 74  ? -2.318  -35.929 9.390   1.00 14.65 ? 1147 PHE E CE2 1 
ATOM   2865  C CZ  . PHE E  1 74  ? -3.105  -35.064 8.637   1.00 15.73 ? 1147 PHE E CZ  1 
ATOM   2866  N N   . PHE E  1 75  ? -4.866  -41.505 6.423   1.00 11.80 ? 1148 PHE E N   1 
ATOM   2867  C CA  . PHE E  1 75  ? -4.806  -42.747 5.643   1.00 13.65 ? 1148 PHE E CA  1 
ATOM   2868  C C   . PHE E  1 75  ? -3.495  -42.797 4.823   1.00 16.22 ? 1148 PHE E C   1 
ATOM   2869  O O   . PHE E  1 75  ? -3.461  -43.367 3.714   1.00 19.46 ? 1148 PHE E O   1 
ATOM   2870  C CB  . PHE E  1 75  ? -6.015  -42.816 4.719   1.00 16.34 ? 1148 PHE E CB  1 
ATOM   2871  C CG  . PHE E  1 75  ? -7.257  -43.239 5.440   1.00 16.79 ? 1148 PHE E CG  1 
ATOM   2872  C CD1 . PHE E  1 75  ? -7.413  -44.559 5.771   1.00 16.97 ? 1148 PHE E CD1 1 
ATOM   2873  C CD2 . PHE E  1 75  ? -8.239  -42.321 5.779   1.00 16.07 ? 1148 PHE E CD2 1 
ATOM   2874  C CE1 . PHE E  1 75  ? -8.571  -44.940 6.470   1.00 15.93 ? 1148 PHE E CE1 1 
ATOM   2875  C CE2 . PHE E  1 75  ? -9.384  -42.709 6.463   1.00 15.97 ? 1148 PHE E CE2 1 
ATOM   2876  C CZ  . PHE E  1 75  ? -9.514  -44.017 6.828   1.00 17.28 ? 1148 PHE E CZ  1 
ATOM   2877  N N   . ASP E  1 76  ? -2.428  -42.232 5.376   1.00 15.99 ? 1149 ASP E N   1 
ATOM   2878  C CA  . ASP E  1 76  ? -1.127  -42.324 4.724   1.00 17.91 ? 1149 ASP E CA  1 
ATOM   2879  C C   . ASP E  1 76  ? -0.482  -43.718 5.009   1.00 20.09 ? 1149 ASP E C   1 
ATOM   2880  O O   . ASP E  1 76  ? -1.025  -44.500 5.760   1.00 18.55 ? 1149 ASP E O   1 
ATOM   2881  C CB  . ASP E  1 76  ? -0.235  -41.170 5.119   1.00 18.48 ? 1149 ASP E CB  1 
ATOM   2882  C CG  . ASP E  1 76  ? 0.001   -41.047 6.603   1.00 22.46 ? 1149 ASP E CG  1 
ATOM   2883  O OD1 . ASP E  1 76  ? -0.718  -41.672 7.392   1.00 20.16 ? 1149 ASP E OD1 1 
ATOM   2884  O OD2 . ASP E  1 76  ? 0.936   -40.304 6.964   1.00 26.19 ? 1149 ASP E OD2 1 
ATOM   2885  N N   . ASN E  1 77  ? 0.664   -43.984 4.394   1.00 21.95 ? 1150 ASN E N   1 
ATOM   2886  C CA  . ASN E  1 77  ? 1.281   -45.327 4.515   1.00 24.83 ? 1150 ASN E CA  1 
ATOM   2887  C C   . ASN E  1 77  ? 1.537   -45.678 5.975   1.00 23.78 ? 1150 ASN E C   1 
ATOM   2888  O O   . ASN E  1 77  ? 1.264   -46.798 6.437   1.00 31.55 ? 1150 ASN E O   1 
ATOM   2889  C CB  . ASN E  1 77  ? 2.622   -45.359 3.767   1.00 28.77 ? 1150 ASN E CB  1 
ATOM   2890  C CG  . ASN E  1 77  ? 2.451   -45.449 2.265   1.00 37.88 ? 1150 ASN E CG  1 
ATOM   2891  O OD1 . ASN E  1 77  ? 1.358   -45.719 1.772   1.00 39.52 ? 1150 ASN E OD1 1 
ATOM   2892  N ND2 . ASN E  1 77  ? 3.545   -45.229 1.522   1.00 45.55 ? 1150 ASN E ND2 1 
ATOM   2893  N N   . LYS E  1 78  ? 2.074   -44.716 6.702   1.00 26.44 ? 1151 LYS E N   1 
ATOM   2894  C CA  . LYS E  1 78  ? 2.444   -44.956 8.095   1.00 27.51 ? 1151 LYS E CA  1 
ATOM   2895  C C   . LYS E  1 78  ? 1.313   -44.761 9.100   1.00 29.09 ? 1151 LYS E C   1 
ATOM   2896  O O   . LYS E  1 78  ? 1.480   -45.086 10.293  1.00 26.17 ? 1151 LYS E O   1 
ATOM   2897  C CB  . LYS E  1 78  ? 3.594   -44.040 8.452   1.00 34.93 ? 1151 LYS E CB  1 
ATOM   2898  C CG  . LYS E  1 78  ? 4.901   -44.510 7.888   1.00 39.77 ? 1151 LYS E CG  1 
ATOM   2899  C CD  . LYS E  1 78  ? 5.157   -45.974 8.281   1.00 44.07 ? 1151 LYS E CD  1 
ATOM   2900  C CE  . LYS E  1 78  ? 6.575   -46.379 7.833   1.00 58.37 ? 1151 LYS E CE  1 
ATOM   2901  N NZ  . LYS E  1 78  ? 6.957   -47.786 8.155   1.00 60.89 ? 1151 LYS E NZ  1 
ATOM   2902  N N   . ARG E  1 79  ? 0.186   -44.191 8.652   1.00 20.97 ? 1152 ARG E N   1 
ATOM   2903  C CA  . ARG E  1 79  ? -0.961  -43.921 9.544   1.00 18.74 ? 1152 ARG E CA  1 
ATOM   2904  C C   . ARG E  1 79  ? -0.545  -42.961 10.683  1.00 22.09 ? 1152 ARG E C   1 
ATOM   2905  O O   . ARG E  1 79  ? -0.518  -43.344 11.859  1.00 24.42 ? 1152 ARG E O   1 
ATOM   2906  C CB  . ARG E  1 79  ? -1.554  -45.204 10.111  1.00 23.55 ? 1152 ARG E CB  1 
ATOM   2907  C CG  . ARG E  1 79  ? -2.101  -46.204 9.043   1.00 25.02 ? 1152 ARG E CG  1 
ATOM   2908  C CD  . ARG E  1 79  ? -3.159  -45.571 8.091   1.00 23.31 ? 1152 ARG E CD  1 
ATOM   2909  N NE  . ARG E  1 79  ? -4.466  -45.313 8.670   1.00 20.68 ? 1152 ARG E NE  1 
ATOM   2910  C CZ  . ARG E  1 79  ? -5.348  -46.278 8.941   1.00 27.56 ? 1152 ARG E CZ  1 
ATOM   2911  N NH1 . ARG E  1 79  ? -5.013  -47.559 8.719   1.00 30.13 ? 1152 ARG E NH1 1 
ATOM   2912  N NH2 . ARG E  1 79  ? -6.545  -45.989 9.446   1.00 25.44 ? 1152 ARG E NH2 1 
ATOM   2913  N N   . THR E  1 80  ? -0.228  -41.720 10.311  1.00 17.81 ? 1153 THR E N   1 
ATOM   2914  C CA  . THR E  1 80  ? 0.230   -40.720 11.270  1.00 17.53 ? 1153 THR E CA  1 
ATOM   2915  C C   . THR E  1 80  ? -0.904  -39.886 11.865  1.00 19.14 ? 1153 THR E C   1 
ATOM   2916  O O   . THR E  1 80  ? -2.009  -39.818 11.330  1.00 16.58 ? 1153 THR E O   1 
ATOM   2917  C CB  . THR E  1 80  ? 1.261   -39.743 10.664  1.00 20.39 ? 1153 THR E CB  1 
ATOM   2918  O OG1 . THR E  1 80  ? 0.707   -39.113 9.493   1.00 19.89 ? 1153 THR E OG1 1 
ATOM   2919  C CG2 . THR E  1 80  ? 2.539   -40.450 10.291  1.00 23.56 ? 1153 THR E CG2 1 
ATOM   2920  N N   . TRP E  1 81  ? -0.606  -39.225 12.980  1.00 16.42 ? 1154 TRP E N   1 
ATOM   2921  C CA  . TRP E  1 81  ? -1.645  -38.502 13.727  1.00 19.90 ? 1154 TRP E CA  1 
ATOM   2922  C C   . TRP E  1 81  ? -1.451  -37.024 13.652  1.00 19.15 ? 1154 TRP E C   1 
ATOM   2923  O O   . TRP E  1 81  ? -0.335  -36.537 13.530  1.00 21.60 ? 1154 TRP E O   1 
ATOM   2924  C CB  . TRP E  1 81  ? -1.599  -38.893 15.203  1.00 17.56 ? 1154 TRP E CB  1 
ATOM   2925  C CG  . TRP E  1 81  ? -1.787  -40.334 15.547  1.00 19.12 ? 1154 TRP E CG  1 
ATOM   2926  C CD1 . TRP E  1 81  ? -0.799  -41.305 15.663  1.00 17.64 ? 1154 TRP E CD1 1 
ATOM   2927  C CD2 . TRP E  1 81  ? -3.024  -40.987 15.849  1.00 16.58 ? 1154 TRP E CD2 1 
ATOM   2928  N NE1 . TRP E  1 81  ? -1.357  -42.492 16.065  1.00 21.70 ? 1154 TRP E NE1 1 
ATOM   2929  C CE2 . TRP E  1 81  ? -2.707  -42.336 16.211  1.00 19.44 ? 1154 TRP E CE2 1 
ATOM   2930  C CE3 . TRP E  1 81  ? -4.357  -40.560 15.930  1.00 17.48 ? 1154 TRP E CE3 1 
ATOM   2931  C CZ2 . TRP E  1 81  ? -3.670  -43.249 16.548  1.00 19.89 ? 1154 TRP E CZ2 1 
ATOM   2932  C CZ3 . TRP E  1 81  ? -5.316  -41.474 16.298  1.00 18.04 ? 1154 TRP E CZ3 1 
ATOM   2933  C CH2 . TRP E  1 81  ? -4.969  -42.819 16.617  1.00 18.98 ? 1154 TRP E CH2 1 
ATOM   2934  N N   . GLN E  1 82  ? -2.547  -36.268 13.693  1.00 16.55 ? 1155 GLN E N   1 
ATOM   2935  C CA  . GLN E  1 82  ? -2.390  -34.826 13.927  1.00 19.42 ? 1155 GLN E CA  1 
ATOM   2936  C C   . GLN E  1 82  ? -3.612  -34.270 14.662  1.00 18.92 ? 1155 GLN E C   1 
ATOM   2937  O O   . GLN E  1 82  ? -4.671  -34.886 14.632  1.00 18.46 ? 1155 GLN E O   1 
ATOM   2938  C CB  . GLN E  1 82  ? -2.161  -34.094 12.599  1.00 19.79 ? 1155 GLN E CB  1 
ATOM   2939  C CG  . GLN E  1 82  ? -1.648  -32.678 12.760  1.00 29.26 ? 1155 GLN E CG  1 
ATOM   2940  C CD  . GLN E  1 82  ? -0.543  -32.526 13.798  1.00 28.69 ? 1155 GLN E CD  1 
ATOM   2941  O OE1 . GLN E  1 82  ? -0.817  -32.241 14.926  1.00 27.28 ? 1155 GLN E OE1 1 
ATOM   2942  N NE2 . GLN E  1 82  ? 0.701   -32.752 13.407  1.00 33.66 ? 1155 GLN E NE2 1 
ATOM   2943  N N   . TRP E  1 83  ? -3.459  -33.102 15.294  1.00 18.23 ? 1156 TRP E N   1 
ATOM   2944  C CA  . TRP E  1 83  ? -4.611  -32.397 15.876  1.00 19.48 ? 1156 TRP E CA  1 
ATOM   2945  C C   . TRP E  1 83  ? -4.932  -31.155 15.053  1.00 18.77 ? 1156 TRP E C   1 
ATOM   2946  O O   . TRP E  1 83  ? -4.029  -30.374 14.750  1.00 18.10 ? 1156 TRP E O   1 
ATOM   2947  C CB  . TRP E  1 83  ? -4.253  -31.932 17.282  1.00 17.88 ? 1156 TRP E CB  1 
ATOM   2948  C CG  . TRP E  1 83  ? -4.034  -33.060 18.244  1.00 18.00 ? 1156 TRP E CG  1 
ATOM   2949  C CD1 . TRP E  1 83  ? -2.883  -33.747 18.492  1.00 18.43 ? 1156 TRP E CD1 1 
ATOM   2950  C CD2 . TRP E  1 83  ? -5.030  -33.626 19.069  1.00 15.77 ? 1156 TRP E CD2 1 
ATOM   2951  N NE1 . TRP E  1 83  ? -3.112  -34.741 19.427  1.00 19.23 ? 1156 TRP E NE1 1 
ATOM   2952  C CE2 . TRP E  1 83  ? -4.425  -34.676 19.799  1.00 20.07 ? 1156 TRP E CE2 1 
ATOM   2953  C CE3 . TRP E  1 83  ? -6.384  -33.335 19.287  1.00 18.34 ? 1156 TRP E CE3 1 
ATOM   2954  C CZ2 . TRP E  1 83  ? -5.115  -35.409 20.756  1.00 20.70 ? 1156 TRP E CZ2 1 
ATOM   2955  C CZ3 . TRP E  1 83  ? -7.081  -34.093 20.248  1.00 20.33 ? 1156 TRP E CZ3 1 
ATOM   2956  C CH2 . TRP E  1 83  ? -6.439  -35.118 20.949  1.00 21.71 ? 1156 TRP E CH2 1 
ATOM   2957  N N   . LEU E  1 84  ? -6.202  -30.968 14.674  1.00 13.61 ? 1157 LEU E N   1 
ATOM   2958  C CA  . LEU E  1 84  ? -6.532  -29.889 13.757  1.00 13.17 ? 1157 LEU E CA  1 
ATOM   2959  C C   . LEU E  1 84  ? -7.846  -29.264 14.150  1.00 15.22 ? 1157 LEU E C   1 
ATOM   2960  O O   . LEU E  1 84  ? -8.756  -29.978 14.562  1.00 17.18 ? 1157 LEU E O   1 
ATOM   2961  C CB  . LEU E  1 84  ? -6.694  -30.432 12.329  1.00 15.70 ? 1157 LEU E CB  1 
ATOM   2962  C CG  . LEU E  1 84  ? -5.389  -30.910 11.641  1.00 17.28 ? 1157 LEU E CG  1 
ATOM   2963  C CD1 . LEU E  1 84  ? -5.755  -31.571 10.284  1.00 18.28 ? 1157 LEU E CD1 1 
ATOM   2964  C CD2 . LEU E  1 84  ? -4.458  -29.786 11.388  1.00 18.68 ? 1157 LEU E CD2 1 
ATOM   2965  N N   . PRO E  1 85  ? -7.973  -27.934 13.963  1.00 17.51 ? 1158 PRO E N   1 
ATOM   2966  C CA  . PRO E  1 85  ? -9.269  -27.286 14.237  1.00 18.66 ? 1158 PRO E CA  1 
ATOM   2967  C C   . PRO E  1 85  ? -10.273 -27.522 13.099  1.00 17.54 ? 1158 PRO E C   1 
ATOM   2968  O O   . PRO E  1 85  ? -9.919  -27.963 11.997  1.00 18.05 ? 1158 PRO E O   1 
ATOM   2969  C CB  . PRO E  1 85  ? -8.922  -25.790 14.284  1.00 20.85 ? 1158 PRO E CB  1 
ATOM   2970  C CG  . PRO E  1 85  ? -7.723  -25.635 13.345  1.00 19.80 ? 1158 PRO E CG  1 
ATOM   2971  C CD  . PRO E  1 85  ? -6.945  -26.991 13.467  1.00 15.99 ? 1158 PRO E CD  1 
ATOM   2972  N N   . ARG E  1 86  ? -11.546 -27.196 13.376  1.00 18.17 ? 1159 ARG E N   1 
ATOM   2973  C CA  . ARG E  1 86  ? -12.620 -27.405 12.443  1.00 19.36 ? 1159 ARG E CA  1 
ATOM   2974  C C   . ARG E  1 86  ? -12.369 -26.732 11.098  1.00 19.70 ? 1159 ARG E C   1 
ATOM   2975  O O   . ARG E  1 86  ? -12.749 -27.268 10.070  1.00 18.01 ? 1159 ARG E O   1 
ATOM   2976  C CB  . ARG E  1 86  ? -13.922 -26.849 13.053  1.00 21.89 ? 1159 ARG E CB  1 
ATOM   2977  C CG  . ARG E  1 86  ? -15.108 -26.944 12.125  1.00 26.16 ? 1159 ARG E CG  1 
ATOM   2978  C CD  . ARG E  1 86  ? -15.490 -28.416 11.964  1.00 26.51 ? 1159 ARG E CD  1 
ATOM   2979  N NE  . ARG E  1 86  ? -16.612 -28.625 11.044  1.00 25.65 ? 1159 ARG E NE  1 
ATOM   2980  C CZ  . ARG E  1 86  ? -16.550 -28.640 9.721   1.00 31.67 ? 1159 ARG E CZ  1 
ATOM   2981  N NH1 . ARG E  1 86  ? -17.661 -28.844 9.026   1.00 33.87 ? 1159 ARG E NH1 1 
ATOM   2982  N NH2 . ARG E  1 86  ? -15.400 -28.421 9.079   1.00 27.02 ? 1159 ARG E NH2 1 
ATOM   2983  N N   . THR E  1 87  ? -11.708 -25.565 11.125  1.00 18.37 ? 1160 THR E N   1 
ATOM   2984  C CA  . THR E  1 87  ? -11.430 -24.841 9.900   1.00 18.40 ? 1160 THR E CA  1 
ATOM   2985  C C   . THR E  1 87  ? -10.515 -25.567 8.902   1.00 21.32 ? 1160 THR E C   1 
ATOM   2986  O O   . THR E  1 87  ? -10.405 -25.130 7.740   1.00 20.52 ? 1160 THR E O   1 
ATOM   2987  C CB  . THR E  1 87  ? -10.742 -23.474 10.238  1.00 22.37 ? 1160 THR E CB  1 
ATOM   2988  O OG1 . THR E  1 87  ? -9.596  -23.716 11.072  1.00 24.37 ? 1160 THR E OG1 1 
ATOM   2989  C CG2 . THR E  1 87  ? -11.719 -22.646 11.038  1.00 25.54 ? 1160 THR E CG2 1 
ATOM   2990  N N   . LYS E  1 88  ? -9.852  -26.634 9.362   1.00 17.20 ? 1161 LYS E N   1 
ATOM   2991  C CA  . LYS E  1 88  ? -8.886  -27.362 8.538   1.00 17.59 ? 1161 LYS E CA  1 
ATOM   2992  C C   . LYS E  1 88  ? -9.405  -28.711 8.146   1.00 15.89 ? 1161 LYS E C   1 
ATOM   2993  O O   . LYS E  1 88  ? -8.648  -29.552 7.600   1.00 15.68 ? 1161 LYS E O   1 
ATOM   2994  C CB  . LYS E  1 88  ? -7.500  -27.561 9.241   1.00 17.78 ? 1161 LYS E CB  1 
ATOM   2995  C CG  . LYS E  1 88  ? -6.803  -26.206 9.676   1.00 20.84 ? 1161 LYS E CG  1 
ATOM   2996  C CD  . LYS E  1 88  ? -6.417  -25.362 8.473   1.00 22.09 ? 1161 LYS E CD  1 
ATOM   2997  C CE  . LYS E  1 88  ? -5.795  -24.036 8.980   1.00 28.11 ? 1161 LYS E CE  1 
ATOM   2998  N NZ  . LYS E  1 88  ? -5.772  -23.023 7.890   1.00 35.60 ? 1161 LYS E NZ  1 
ATOM   2999  N N   . LEU E  1 89  ? -10.707 -28.944 8.382   1.00 16.10 ? 1162 LEU E N   1 
ATOM   3000  C CA  . LEU E  1 89  ? -11.311 -30.217 7.996   1.00 17.66 ? 1162 LEU E CA  1 
ATOM   3001  C C   . LEU E  1 89  ? -12.531 -30.005 7.141   1.00 15.74 ? 1162 LEU E C   1 
ATOM   3002  O O   . LEU E  1 89  ? -13.312 -29.045 7.341   1.00 19.93 ? 1162 LEU E O   1 
ATOM   3003  C CB  . LEU E  1 89  ? -11.752 -30.995 9.244   1.00 15.15 ? 1162 LEU E CB  1 
ATOM   3004  C CG  . LEU E  1 89  ? -10.718 -31.086 10.374  1.00 16.61 ? 1162 LEU E CG  1 
ATOM   3005  C CD1 . LEU E  1 89  ? -11.379 -31.678 11.610  1.00 22.50 ? 1162 LEU E CD1 1 
ATOM   3006  C CD2 . LEU E  1 89  ? -9.578  -32.035 9.957   1.00 16.47 ? 1162 LEU E CD2 1 
ATOM   3007  N N   . VAL E  1 90  ? -12.686 -30.874 6.170   1.00 15.03 ? 1163 VAL E N   1 
ATOM   3008  C CA  . VAL E  1 90  ? -13.867 -30.901 5.294   1.00 18.18 ? 1163 VAL E CA  1 
ATOM   3009  C C   . VAL E  1 90  ? -14.348 -32.371 5.185   1.00 14.86 ? 1163 VAL E C   1 
ATOM   3010  O O   . VAL E  1 90  ? -13.587 -33.273 4.974   1.00 14.50 ? 1163 VAL E O   1 
ATOM   3011  C CB  . VAL E  1 90  ? -13.530 -30.293 3.871   1.00 18.71 ? 1163 VAL E CB  1 
ATOM   3012  C CG1 . VAL E  1 90  ? -14.703 -30.457 2.932   1.00 20.07 ? 1163 VAL E CG1 1 
ATOM   3013  C CG2 . VAL E  1 90  ? -13.186 -28.775 4.005   1.00 20.59 ? 1163 VAL E CG2 1 
ATOM   3014  N N   . PRO E  1 91  ? -15.658 -32.643 5.340   1.00 15.82 ? 1164 PRO E N   1 
ATOM   3015  C CA  . PRO E  1 91  ? -16.077 -34.023 5.134   1.00 14.83 ? 1164 PRO E CA  1 
ATOM   3016  C C   . PRO E  1 91  ? -15.702 -34.626 3.796   1.00 15.83 ? 1164 PRO E C   1 
ATOM   3017  O O   . PRO E  1 91  ? -15.806 -33.982 2.744   1.00 16.69 ? 1164 PRO E O   1 
ATOM   3018  C CB  . PRO E  1 91  ? -17.635 -33.899 5.206   1.00 17.90 ? 1164 PRO E CB  1 
ATOM   3019  C CG  . PRO E  1 91  ? -17.830 -32.772 6.161   1.00 21.92 ? 1164 PRO E CG  1 
ATOM   3020  C CD  . PRO E  1 91  ? -16.792 -31.766 5.664   1.00 22.75 ? 1164 PRO E CD  1 
ATOM   3021  N N   . LEU E  1 92  ? -15.322 -35.887 3.822   1.00 14.31 ? 1165 LEU E N   1 
ATOM   3022  C CA  . LEU E  1 92  ? -14.809 -36.584 2.668   1.00 13.42 ? 1165 LEU E CA  1 
ATOM   3023  C C   . LEU E  1 92  ? -15.784 -37.654 2.246   1.00 17.85 ? 1165 LEU E C   1 
ATOM   3024  O O   . LEU E  1 92  ? -16.301 -38.406 3.093   1.00 17.47 ? 1165 LEU E O   1 
ATOM   3025  C CB  . LEU E  1 92  ? -13.438 -37.260 3.045   1.00 14.13 ? 1165 LEU E CB  1 
ATOM   3026  C CG  . LEU E  1 92  ? -12.774 -38.044 1.926   1.00 12.92 ? 1165 LEU E CG  1 
ATOM   3027  C CD1 . LEU E  1 92  ? -11.205 -38.007 2.200   1.00 15.60 ? 1165 LEU E CD1 1 
ATOM   3028  C CD2 . LEU E  1 92  ? -13.197 -39.512 1.843   1.00 13.85 ? 1165 LEU E CD2 1 
ATOM   3029  N N   . GLY E  1 93  ? -16.005 -37.780 0.954   1.00 16.24 ? 1166 GLY E N   1 
ATOM   3030  C CA  . GLY E  1 93  ? -16.725 -38.918 0.404   1.00 20.26 ? 1166 GLY E CA  1 
ATOM   3031  C C   . GLY E  1 93  ? -18.225 -38.632 0.419   1.00 21.70 ? 1166 GLY E C   1 
ATOM   3032  O O   . GLY E  1 93  ? -19.029 -39.562 0.207   1.00 24.05 ? 1166 GLY E O   1 
ATOM   3033  N N   . VAL E  1 94  ? -18.562 -37.376 0.634   1.00 20.17 ? 1167 VAL E N   1 
ATOM   3034  C CA  . VAL E  1 94  ? -19.961 -36.881 0.603   1.00 19.94 ? 1167 VAL E CA  1 
ATOM   3035  C C   . VAL E  1 94  ? -20.345 -36.202 -0.713  1.00 26.21 ? 1167 VAL E C   1 
ATOM   3036  O O   . VAL E  1 94  ? -21.517 -36.206 -1.140  1.00 23.40 ? 1167 VAL E O   1 
ATOM   3037  C CB  . VAL E  1 94  ? -20.155 -35.857 1.706   1.00 24.74 ? 1167 VAL E CB  1 
ATOM   3038  C CG1 . VAL E  1 94  ? -21.593 -35.319 1.673   1.00 32.77 ? 1167 VAL E CG1 1 
ATOM   3039  C CG2 . VAL E  1 94  ? -19.883 -36.488 3.032   1.00 31.82 ? 1167 VAL E CG2 1 
ATOM   3040  N N   . ASN E  1 95  ? -19.374 -35.569 -1.346  1.00 21.75 ? 1168 ASN E N   1 
ATOM   3041  C CA  . ASN E  1 95  ? -19.628 -34.878 -2.600  1.00 18.38 ? 1168 ASN E CA  1 
ATOM   3042  C C   . ASN E  1 95  ? -18.482 -35.157 -3.523  1.00 18.41 ? 1168 ASN E C   1 
ATOM   3043  O O   . ASN E  1 95  ? -17.345 -34.805 -3.167  1.00 17.50 ? 1168 ASN E O   1 
ATOM   3044  C CB  . ASN E  1 95  ? -19.799 -33.386 -2.403  1.00 21.45 ? 1168 ASN E CB  1 
ATOM   3045  C CG  . ASN E  1 95  ? -20.080 -32.690 -3.715  1.00 23.30 ? 1168 ASN E CG  1 
ATOM   3046  O OD1 . ASN E  1 95  ? -19.190 -32.515 -4.569  1.00 21.80 ? 1168 ASN E OD1 1 
ATOM   3047  N ND2 . ASN E  1 95  ? -21.364 -32.397 -3.948  1.00 29.76 ? 1168 ASN E ND2 1 
ATOM   3048  N N   . GLN E  1 96  ? -18.777 -35.780 -4.660  1.00 16.39 ? 1169 GLN E N   1 
ATOM   3049  C CA  . GLN E  1 96  ? -17.767 -36.276 -5.576  1.00 18.67 ? 1169 GLN E CA  1 
ATOM   3050  C C   . GLN E  1 96  ? -16.971 -35.151 -6.196  1.00 14.67 ? 1169 GLN E C   1 
ATOM   3051  O O   . GLN E  1 96  ? -15.751 -35.291 -6.370  1.00 17.39 ? 1169 GLN E O   1 
ATOM   3052  C CB  . GLN E  1 96  ? -18.351 -37.171 -6.681  1.00 27.72 ? 1169 GLN E CB  1 
ATOM   3053  C CG  . GLN E  1 96  ? -18.566 -38.605 -6.218  1.00 39.13 ? 1169 GLN E CG  1 
ATOM   3054  C CD  . GLN E  1 96  ? -18.062 -39.618 -7.234  1.00 44.98 ? 1169 GLN E CD  1 
ATOM   3055  O OE1 . GLN E  1 96  ? -17.244 -40.474 -6.910  1.00 46.14 ? 1169 GLN E OE1 1 
ATOM   3056  N NE2 . GLN E  1 96  ? -18.520 -39.494 -8.478  1.00 47.95 ? 1169 GLN E NE2 1 
ATOM   3057  N N   . ASP E  1 97  ? -17.629 -34.031 -6.475  1.00 15.26 ? 1170 ASP E N   1 
ATOM   3058  C CA  . ASP E  1 97  ? -16.909 -32.913 -7.083  1.00 17.06 ? 1170 ASP E CA  1 
ATOM   3059  C C   . ASP E  1 97  ? -15.996 -32.245 -6.097  1.00 15.64 ? 1170 ASP E C   1 
ATOM   3060  O O   . ASP E  1 97  ? -14.899 -31.839 -6.445  1.00 16.56 ? 1170 ASP E O   1 
ATOM   3061  C CB  . ASP E  1 97  ? -17.885 -31.942 -7.741  1.00 18.00 ? 1170 ASP E CB  1 
ATOM   3062  C CG  . ASP E  1 97  ? -18.496 -32.595 -8.949  1.00 22.43 ? 1170 ASP E CG  1 
ATOM   3063  O OD1 . ASP E  1 97  ? -19.733 -32.834 -8.939  1.00 22.07 ? 1170 ASP E OD1 1 
ATOM   3064  O OD2 . ASP E  1 97  ? -17.737 -32.942 -9.884  1.00 23.58 ? 1170 ASP E OD2 1 
ATOM   3065  N N   . LEU E  1 98  ? -16.454 -32.138 -4.863  1.00 13.21 ? 1171 LEU E N   1 
ATOM   3066  C CA  . LEU E  1 98  ? -15.577 -31.624 -3.823  1.00 14.10 ? 1171 LEU E CA  1 
ATOM   3067  C C   . LEU E  1 98  ? -14.331 -32.554 -3.675  1.00 14.03 ? 1171 LEU E C   1 
ATOM   3068  O O   . LEU E  1 98  ? -13.166 -32.069 -3.601  1.00 15.68 ? 1171 LEU E O   1 
ATOM   3069  C CB  . LEU E  1 98  ? -16.321 -31.518 -2.490  1.00 15.26 ? 1171 LEU E CB  1 
ATOM   3070  C CG  . LEU E  1 98  ? -15.409 -30.916 -1.401  1.00 19.08 ? 1171 LEU E CG  1 
ATOM   3071  C CD1 . LEU E  1 98  ? -16.263 -30.154 -0.447  1.00 31.27 ? 1171 LEU E CD1 1 
ATOM   3072  C CD2 . LEU E  1 98  ? -14.701 -32.058 -0.687  1.00 18.03 ? 1171 LEU E CD2 1 
ATOM   3073  N N   . ASP E  1 99  ? -14.573 -33.857 -3.546  1.00 14.05 ? 1172 ASP E N   1 
ATOM   3074  C CA  . ASP E  1 99  ? -13.509 -34.814 -3.437  1.00 13.64 ? 1172 ASP E CA  1 
ATOM   3075  C C   . ASP E  1 99  ? -12.514 -34.707 -4.640  1.00 15.95 ? 1172 ASP E C   1 
ATOM   3076  O O   . ASP E  1 99  ? -11.312 -34.712 -4.444  1.00 15.38 ? 1172 ASP E O   1 
ATOM   3077  C CB  . ASP E  1 99  ? -14.025 -36.260 -3.354  1.00 15.62 ? 1172 ASP E CB  1 
ATOM   3078  C CG  . ASP E  1 99  ? -14.720 -36.566 -2.033  1.00 15.49 ? 1172 ASP E CG  1 
ATOM   3079  O OD1 . ASP E  1 99  ? -15.391 -37.633 -2.057  1.00 17.96 ? 1172 ASP E OD1 1 
ATOM   3080  O OD2 . ASP E  1 99  ? -14.572 -35.786 -1.090  1.00 15.62 ? 1172 ASP E OD2 1 
ATOM   3081  N N   . LYS E  1 100 ? -13.047 -34.606 -5.856  1.00 13.74 ? 1173 LYS E N   1 
ATOM   3082  C CA  . LYS E  1 100 ? -12.184 -34.421 -7.026  1.00 18.52 ? 1173 LYS E CA  1 
ATOM   3083  C C   . LYS E  1 100 ? -11.413 -33.114 -6.978  1.00 17.21 ? 1173 LYS E C   1 
ATOM   3084  O O   . LYS E  1 100 ? -10.170 -33.098 -7.327  1.00 17.18 ? 1173 LYS E O   1 
ATOM   3085  C CB  . LYS E  1 100 ? -12.980 -34.620 -8.335  1.00 17.16 ? 1173 LYS E CB  1 
ATOM   3086  C CG  . LYS E  1 100 ? -13.420 -36.058 -8.517  1.00 19.94 ? 1173 LYS E CG  1 
ATOM   3087  C CD  . LYS E  1 100 ? -14.349 -36.235 -9.731  1.00 25.77 ? 1173 LYS E CD  1 
ATOM   3088  C CE  . LYS E  1 100 ? -14.683 -37.719 -9.958  1.00 33.67 ? 1173 LYS E CE  1 
ATOM   3089  N NZ  . LYS E  1 100 ? -15.446 -37.867 -11.223 1.00 41.27 ? 1173 LYS E NZ  1 
ATOM   3090  N N   . GLU E  1 101 ? -12.058 -32.033 -6.531  1.00 13.92 ? 1174 GLU E N   1 
ATOM   3091  C CA  . GLU E  1 101 ? -11.328 -30.777 -6.386  1.00 16.92 ? 1174 GLU E CA  1 
ATOM   3092  C C   . GLU E  1 101 ? -10.141 -30.959 -5.434  1.00 16.71 ? 1174 GLU E C   1 
ATOM   3093  O O   . GLU E  1 101 ? -8.989  -30.565 -5.725  1.00 15.13 ? 1174 GLU E O   1 
ATOM   3094  C CB  . GLU E  1 101 ? -12.209 -29.681 -5.819  1.00 16.17 ? 1174 GLU E CB  1 
ATOM   3095  C CG  . GLU E  1 101 ? -11.469 -28.356 -5.579  1.00 22.99 ? 1174 GLU E CG  1 
ATOM   3096  C CD  . GLU E  1 101 ? -12.310 -27.218 -5.033  1.00 28.17 ? 1174 GLU E CD  1 
ATOM   3097  O OE1 . GLU E  1 101 ? -13.521 -27.396 -4.709  1.00 22.07 ? 1174 GLU E OE1 1 
ATOM   3098  O OE2 . GLU E  1 101 ? -11.755 -26.098 -4.924  1.00 26.43 ? 1174 GLU E OE2 1 
ATOM   3099  N N   . LYS E  1 102 ? -10.427 -31.570 -4.274  1.00 12.56 ? 1175 LYS E N   1 
ATOM   3100  C CA  . LYS E  1 102 ? -9.321  -31.775 -3.304  1.00 17.38 ? 1175 LYS E CA  1 
ATOM   3101  C C   . LYS E  1 102 ? -8.179  -32.602 -3.886  1.00 15.43 ? 1175 LYS E C   1 
ATOM   3102  O O   . LYS E  1 102 ? -6.967  -32.330 -3.596  1.00 17.34 ? 1175 LYS E O   1 
ATOM   3103  C CB  . LYS E  1 102 ? -9.851  -32.448 -2.020  1.00 13.01 ? 1175 LYS E CB  1 
ATOM   3104  C CG  . LYS E  1 102 ? -10.840 -31.655 -1.306  1.00 15.61 ? 1175 LYS E CG  1 
ATOM   3105  C CD  . LYS E  1 102 ? -10.307 -30.544 -0.429  1.00 23.19 ? 1175 LYS E CD  1 
ATOM   3106  C CE  . LYS E  1 102 ? -11.499 -29.634 -0.004  1.00 28.71 ? 1175 LYS E CE  1 
ATOM   3107  N NZ  . LYS E  1 102 ? -11.189 -28.265 0.444   1.00 27.62 ? 1175 LYS E NZ  1 
ATOM   3108  N N   . MET E  1 103 ? -8.499  -33.639 -4.664  1.00 13.60 ? 1176 MET E N   1 
ATOM   3109  C CA  . MET E  1 103 ? -7.489  -34.564 -5.155  1.00 17.54 ? 1176 MET E CA  1 
ATOM   3110  C C   . MET E  1 103 ? -6.553  -33.881 -6.119  1.00 19.73 ? 1176 MET E C   1 
ATOM   3111  O O   . MET E  1 103 ? -5.481  -34.402 -6.344  1.00 19.60 ? 1176 MET E O   1 
ATOM   3112  C CB  . MET E  1 103 ? -8.107  -35.831 -5.771  1.00 18.29 ? 1176 MET E CB  1 
ATOM   3113  C CG  . MET E  1 103 ? -8.436  -36.838 -4.611  1.00 21.25 ? 1176 MET E CG  1 
ATOM   3114  S SD  . MET E  1 103 ? -8.919  -38.371 -5.180  1.00 30.60 ? 1176 MET E SD  1 
ATOM   3115  C CE  . MET E  1 103 ? -10.620 -38.003 -5.633  1.00 22.66 ? 1176 MET E CE  1 
ATOM   3116  N N   . LEU E  1 104 ? -6.964  -32.739 -6.654  1.00 17.37 ? 1177 LEU E N   1 
ATOM   3117  C CA  . LEU E  1 104 ? -6.132  -31.943 -7.577  1.00 18.09 ? 1177 LEU E CA  1 
ATOM   3118  C C   . LEU E  1 104 ? -5.186  -30.904 -6.923  1.00 20.87 ? 1177 LEU E C   1 
ATOM   3119  O O   . LEU E  1 104 ? -4.540  -30.099 -7.624  1.00 22.12 ? 1177 LEU E O   1 
ATOM   3120  C CB  . LEU E  1 104 ? -7.019  -31.263 -8.627  1.00 17.39 ? 1177 LEU E CB  1 
ATOM   3121  C CG  . LEU E  1 104 ? -7.689  -32.253 -9.566  1.00 20.86 ? 1177 LEU E CG  1 
ATOM   3122  C CD1 . LEU E  1 104 ? -8.823  -31.600 -10.313 1.00 23.37 ? 1177 LEU E CD1 1 
ATOM   3123  C CD2 . LEU E  1 104 ? -6.711  -32.940 -10.551 1.00 28.18 ? 1177 LEU E CD2 1 
ATOM   3124  N N   . GLU E  1 105 ? -5.174  -30.820 -5.611  1.00 14.46 ? 1178 GLU E N   1 
ATOM   3125  C CA  . GLU E  1 105 ? -4.444  -29.746 -4.958  1.00 15.01 ? 1178 GLU E CA  1 
ATOM   3126  C C   . GLU E  1 105 ? -2.940  -29.958 -5.193  1.00 18.98 ? 1178 GLU E C   1 
ATOM   3127  O O   . GLU E  1 105 ? -2.193  -28.998 -5.354  1.00 21.79 ? 1178 GLU E O   1 
ATOM   3128  C CB  . GLU E  1 105 ? -4.627  -29.713 -3.445  1.00 23.73 ? 1178 GLU E CB  1 
ATOM   3129  C CG  . GLU E  1 105 ? -5.969  -29.269 -2.930  1.00 25.79 ? 1178 GLU E CG  1 
ATOM   3130  C CD  . GLU E  1 105 ? -5.951  -29.051 -1.378  1.00 22.08 ? 1178 GLU E CD  1 
ATOM   3131  O OE1 . GLU E  1 105 ? -7.044  -28.914 -0.778  1.00 31.33 ? 1178 GLU E OE1 1 
ATOM   3132  O OE2 . GLU E  1 105 ? -4.863  -28.922 -0.765  1.00 25.66 ? 1178 GLU E OE2 1 
ATOM   3133  N N   . GLY E  1 106 ? -2.502  -31.203 -5.118  1.00 17.89 ? 1179 GLY E N   1 
ATOM   3134  C CA  . GLY E  1 106 ? -1.055  -31.439 -5.240  1.00 16.33 ? 1179 GLY E CA  1 
ATOM   3135  C C   . GLY E  1 106 ? -0.465  -30.893 -6.529  1.00 19.30 ? 1179 GLY E C   1 
ATOM   3136  O O   . GLY E  1 106 ? -1.064  -30.972 -7.599  1.00 17.28 ? 1179 GLY E O   1 
ATOM   3137  N N   . ARG E  1 107 ? 0.770   -30.391 -6.431  1.00 18.06 ? 1180 ARG E N   1 
ATOM   3138  C CA  . ARG E  1 107 ? 1.390   -29.737 -7.607  1.00 18.20 ? 1180 ARG E CA  1 
ATOM   3139  C C   . ARG E  1 107 ? 2.494   -30.530 -8.273  1.00 25.97 ? 1180 ARG E C   1 
ATOM   3140  O O   . ARG E  1 107 ? 3.224   -30.013 -9.117  1.00 23.61 ? 1180 ARG E O   1 
ATOM   3141  C CB  . ARG E  1 107 ? 1.944   -28.388 -7.169  1.00 20.35 ? 1180 ARG E CB  1 
ATOM   3142  C CG  . ARG E  1 107 ? 0.920   -27.472 -6.588  1.00 23.45 ? 1180 ARG E CG  1 
ATOM   3143  C CD  . ARG E  1 107 ? 1.521   -26.070 -6.326  1.00 19.60 ? 1180 ARG E CD  1 
ATOM   3144  N NE  . ARG E  1 107 ? 2.493   -26.035 -5.226  1.00 20.98 ? 1180 ARG E NE  1 
ATOM   3145  C CZ  . ARG E  1 107 ? 2.171   -26.143 -3.942  1.00 21.57 ? 1180 ARG E CZ  1 
ATOM   3146  N NH1 . ARG E  1 107 ? 3.105   -26.064 -3.012  1.00 21.61 ? 1180 ARG E NH1 1 
ATOM   3147  N NH2 . ARG E  1 107 ? 0.884   -26.279 -3.584  1.00 24.13 ? 1180 ARG E NH2 1 
ATOM   3148  N N   . LYS E  1 108 ? 2.609   -31.789 -7.890  1.00 23.01 ? 1181 LYS E N   1 
ATOM   3149  C CA  . LYS E  1 108 ? 3.432   -32.782 -8.571  1.00 27.09 ? 1181 LYS E CA  1 
ATOM   3150  C C   . LYS E  1 108 ? 2.672   -34.114 -8.662  1.00 25.16 ? 1181 LYS E C   1 
ATOM   3151  O O   . LYS E  1 108 ? 1.922   -34.488 -7.713  1.00 21.44 ? 1181 LYS E O   1 
ATOM   3152  C CB  . LYS E  1 108 ? 4.668   -32.976 -7.717  1.00 27.68 ? 1181 LYS E CB  1 
ATOM   3153  C CG  . LYS E  1 108 ? 5.856   -33.448 -8.486  1.00 37.91 ? 1181 LYS E CG  1 
ATOM   3154  C CD  . LYS E  1 108 ? 7.089   -33.443 -7.595  1.00 36.72 ? 1181 LYS E CD  1 
ATOM   3155  C CE  . LYS E  1 108 ? 8.094   -34.426 -8.196  1.00 46.65 ? 1181 LYS E CE  1 
ATOM   3156  N NZ  . LYS E  1 108 ? 9.407   -34.370 -7.511  1.00 50.43 ? 1181 LYS E NZ  1 
ATOM   3157  N N   . SER E  1 109 ? 2.849   -34.848 -9.757  1.00 23.61 ? 1182 SER E N   1 
ATOM   3158  C CA  . SER E  1 109 ? 2.189   -36.138 -9.891  1.00 27.28 ? 1182 SER E CA  1 
ATOM   3159  C C   . SER E  1 109 ? 2.313   -37.061 -8.660  1.00 25.25 ? 1182 SER E C   1 
ATOM   3160  O O   . SER E  1 109 ? 1.297   -37.661 -8.264  1.00 26.37 ? 1182 SER E O   1 
ATOM   3161  C CB  . SER E  1 109 ? 2.632   -36.889 -11.167 1.00 33.34 ? 1182 SER E CB  1 
ATOM   3162  O OG  . SER E  1 109 ? 1.746   -37.964 -11.448 1.00 44.78 ? 1182 SER E OG  1 
ATOM   3163  N N   . ASN E  1 110 ? 3.516   -37.200 -8.078  1.00 22.16 ? 1183 ASN E N   1 
ATOM   3164  C CA  . ASN E  1 110 ? 3.711   -38.103 -6.934  1.00 26.49 ? 1183 ASN E CA  1 
ATOM   3165  C C   . ASN E  1 110 ? 2.926   -37.677 -5.704  1.00 23.14 ? 1183 ASN E C   1 
ATOM   3166  O O   . ASN E  1 110 ? 2.477   -38.519 -4.910  1.00 23.25 ? 1183 ASN E O   1 
ATOM   3167  C CB  . ASN E  1 110 ? 5.202   -38.274 -6.535  1.00 30.35 ? 1183 ASN E CB  1 
ATOM   3168  C CG  . ASN E  1 110 ? 5.849   -36.962 -6.060  1.00 36.46 ? 1183 ASN E CG  1 
ATOM   3169  O OD1 . ASN E  1 110 ? 5.461   -35.870 -6.488  1.00 38.52 ? 1183 ASN E OD1 1 
ATOM   3170  N ND2 . ASN E  1 110 ? 6.842   -37.067 -5.173  1.00 40.42 ? 1183 ASN E ND2 1 
ATOM   3171  N N   . ILE E  1 111 ? 2.788   -36.370 -5.537  1.00 18.30 ? 1184 ILE E N   1 
ATOM   3172  C CA  . ILE E  1 111 ? 2.113   -35.864 -4.366  1.00 18.72 ? 1184 ILE E CA  1 
ATOM   3173  C C   . ILE E  1 111 ? 0.623   -36.173 -4.597  1.00 18.29 ? 1184 ILE E C   1 
ATOM   3174  O O   . ILE E  1 111 ? -0.048  -36.682 -3.692  1.00 15.98 ? 1184 ILE E O   1 
ATOM   3175  C CB  . ILE E  1 111 ? 2.334   -34.342 -4.184  1.00 18.55 ? 1184 ILE E CB  1 
ATOM   3176  C CG1 . ILE E  1 111 ? 3.824   -34.042 -3.804  1.00 20.69 ? 1184 ILE E CG1 1 
ATOM   3177  C CG2 . ILE E  1 111 ? 1.382   -33.804 -3.078  1.00 18.49 ? 1184 ILE E CG2 1 
ATOM   3178  C CD1 . ILE E  1 111 ? 4.087   -32.637 -3.423  1.00 22.28 ? 1184 ILE E CD1 1 
ATOM   3179  N N   . ARG E  1 112 ? 0.134   -35.906 -5.797  1.00 16.28 ? 1185 ARG E N   1 
ATOM   3180  C CA  . ARG E  1 112 ? -1.325  -36.196 -6.074  1.00 16.42 ? 1185 ARG E CA  1 
ATOM   3181  C C   . ARG E  1 112 ? -1.594  -37.697 -5.947  1.00 20.29 ? 1185 ARG E C   1 
ATOM   3182  O O   . ARG E  1 112 ? -2.678  -38.123 -5.465  1.00 16.49 ? 1185 ARG E O   1 
ATOM   3183  C CB  . ARG E  1 112 ? -1.720  -35.706 -7.460  1.00 16.61 ? 1185 ARG E CB  1 
ATOM   3184  C CG  . ARG E  1 112 ? -1.757  -34.190 -7.541  1.00 17.11 ? 1185 ARG E CG  1 
ATOM   3185  C CD  . ARG E  1 112 ? -2.365  -33.758 -8.853  1.00 20.91 ? 1185 ARG E CD  1 
ATOM   3186  N NE  . ARG E  1 112 ? -1.580  -34.153 -10.004 1.00 26.24 ? 1185 ARG E NE  1 
ATOM   3187  C CZ  . ARG E  1 112 ? -0.618  -33.408 -10.569 1.00 28.01 ? 1185 ARG E CZ  1 
ATOM   3188  N NH1 . ARG E  1 112 ? -0.296  -32.222 -10.095 1.00 23.18 ? 1185 ARG E NH1 1 
ATOM   3189  N NH2 . ARG E  1 112 ? 0.025   -33.873 -11.631 1.00 30.40 ? 1185 ARG E NH2 1 
ATOM   3190  N N   . LYS E  1 113 ? -0.617  -38.510 -6.362  1.00 18.68 ? 1186 LYS E N   1 
ATOM   3191  C CA  . LYS E  1 113 ? -0.783  -39.969 -6.332  1.00 20.60 ? 1186 LYS E CA  1 
ATOM   3192  C C   . LYS E  1 113 ? -0.970  -40.465 -4.891  1.00 18.32 ? 1186 LYS E C   1 
ATOM   3193  O O   . LYS E  1 113 ? -1.873  -41.287 -4.614  1.00 19.04 ? 1186 LYS E O   1 
ATOM   3194  C CB  . LYS E  1 113 ? 0.461   -40.637 -6.943  1.00 24.15 ? 1186 LYS E CB  1 
ATOM   3195  C CG  . LYS E  1 113 ? 0.308   -42.105 -7.191  1.00 30.52 ? 1186 LYS E CG  1 
ATOM   3196  C CD  . LYS E  1 113 ? 1.410   -42.584 -8.188  1.00 29.07 ? 1186 LYS E CD  1 
ATOM   3197  C CE  . LYS E  1 113 ? 2.731   -42.890 -7.529  1.00 32.67 ? 1186 LYS E CE  1 
ATOM   3198  N NZ  . LYS E  1 113 ? 2.640   -44.015 -6.572  1.00 28.91 ? 1186 LYS E NZ  1 
ATOM   3199  N N   . SER E  1 114 ? -0.170  -39.909 -3.984  1.00 15.53 ? 1187 SER E N   1 
ATOM   3200  C CA  . SER E  1 114 ? -0.206  -40.314 -2.575  1.00 17.22 ? 1187 SER E CA  1 
ATOM   3201  C C   . SER E  1 114 ? -1.584  -39.976 -2.016  1.00 16.86 ? 1187 SER E C   1 
ATOM   3202  O O   . SER E  1 114 ? -2.174  -40.739 -1.240  1.00 16.85 ? 1187 SER E O   1 
ATOM   3203  C CB  . SER E  1 114 ? 0.884   -39.610 -1.777  1.00 24.34 ? 1187 SER E CB  1 
ATOM   3204  O OG  . SER E  1 114 ? 0.727   -39.848 -0.399  1.00 31.79 ? 1187 SER E OG  1 
ATOM   3205  N N   . VAL E  1 115 ? -2.049  -38.768 -2.373  1.00 15.62 ? 1188 VAL E N   1 
ATOM   3206  C CA  . VAL E  1 115 ? -3.391  -38.349 -1.964  1.00 14.55 ? 1188 VAL E CA  1 
ATOM   3207  C C   . VAL E  1 115 ? -4.485  -39.265 -2.467  1.00 15.93 ? 1188 VAL E C   1 
ATOM   3208  O O   . VAL E  1 115 ? -5.388  -39.624 -1.702  1.00 13.06 ? 1188 VAL E O   1 
ATOM   3209  C CB  . VAL E  1 115 ? -3.652  -36.876 -2.310  1.00 12.09 ? 1188 VAL E CB  1 
ATOM   3210  C CG1 . VAL E  1 115 ? -5.160  -36.508 -2.032  1.00 15.17 ? 1188 VAL E CG1 1 
ATOM   3211  C CG2 . VAL E  1 115 ? -2.713  -35.977 -1.474  1.00 14.68 ? 1188 VAL E CG2 1 
ATOM   3212  N N   . GLN E  1 116 ? -4.428  -39.599 -3.756  1.00 16.43 ? 1189 GLN E N   1 
ATOM   3213  C CA  . GLN E  1 116 ? -5.435  -40.439 -4.379  1.00 15.69 ? 1189 GLN E CA  1 
ATOM   3214  C C   . GLN E  1 116 ? -5.426  -41.830 -3.755  1.00 13.63 ? 1189 GLN E C   1 
ATOM   3215  O O   . GLN E  1 116 ? -6.499  -42.410 -3.510  1.00 15.35 ? 1189 GLN E O   1 
ATOM   3216  C CB  . GLN E  1 116 ? -5.174  -40.553 -5.899  1.00 17.51 ? 1189 GLN E CB  1 
ATOM   3217  C CG  . GLN E  1 116 ? -5.330  -39.283 -6.665  1.00 25.69 ? 1189 GLN E CG  1 
ATOM   3218  C CD  . GLN E  1 116 ? -4.940  -39.518 -8.128  1.00 29.38 ? 1189 GLN E CD  1 
ATOM   3219  O OE1 . GLN E  1 116 ? -5.440  -40.432 -8.769  1.00 36.12 ? 1189 GLN E OE1 1 
ATOM   3220  N NE2 . GLN E  1 116 ? -4.010  -38.743 -8.623  1.00 35.51 ? 1189 GLN E NE2 1 
ATOM   3221  N N   . ILE E  1 117 ? -4.246  -42.333 -3.447  1.00 13.93 ? 1190 ILE E N   1 
ATOM   3222  C CA  . ILE E  1 117 ? -4.170  -43.672 -2.806  1.00 13.09 ? 1190 ILE E CA  1 
ATOM   3223  C C   . ILE E  1 117 ? -4.797  -43.609 -1.423  1.00 14.68 ? 1190 ILE E C   1 
ATOM   3224  O O   . ILE E  1 117 ? -5.617  -44.477 -1.064  1.00 15.85 ? 1190 ILE E O   1 
ATOM   3225  C CB  . ILE E  1 117 ? -2.742  -44.111 -2.694  1.00 15.01 ? 1190 ILE E CB  1 
ATOM   3226  C CG1 . ILE E  1 117 ? -2.316  -44.623 -4.071  1.00 17.58 ? 1190 ILE E CG1 1 
ATOM   3227  C CG2 . ILE E  1 117 ? -2.612  -45.260 -1.703  1.00 19.44 ? 1190 ILE E CG2 1 
ATOM   3228  C CD1 . ILE E  1 117 ? -0.794  -44.756 -4.211  1.00 22.32 ? 1190 ILE E CD1 1 
ATOM   3229  N N   . ALA E  1 118 ? -4.553  -42.486 -0.712  1.00 13.71 ? 1191 ALA E N   1 
ATOM   3230  C CA  . ALA E  1 118 ? -5.118  -42.372 0.623   1.00 12.72 ? 1191 ALA E CA  1 
ATOM   3231  C C   . ALA E  1 118 ? -6.628  -42.278 0.511   1.00 13.75 ? 1191 ALA E C   1 
ATOM   3232  O O   . ALA E  1 118 ? -7.326  -42.788 1.379   1.00 14.15 ? 1191 ALA E O   1 
ATOM   3233  C CB  . ALA E  1 118 ? -4.548  -41.179 1.377   1.00 14.26 ? 1191 ALA E CB  1 
ATOM   3234  N N   . TYR E  1 119 ? -7.106  -41.585 -0.521  1.00 11.36 ? 1192 TYR E N   1 
ATOM   3235  C CA  . TYR E  1 119 ? -8.561  -41.424 -0.711  1.00 12.13 ? 1192 TYR E CA  1 
ATOM   3236  C C   . TYR E  1 119 ? -9.192  -42.767 -0.919  1.00 15.32 ? 1192 TYR E C   1 
ATOM   3237  O O   . TYR E  1 119 ? -10.272 -43.049 -0.348  1.00 14.94 ? 1192 TYR E O   1 
ATOM   3238  C CB  . TYR E  1 119 ? -8.848  -40.467 -1.870  1.00 13.67 ? 1192 TYR E CB  1 
ATOM   3239  C CG  . TYR E  1 119 ? -10.326 -40.321 -2.246  1.00 12.54 ? 1192 TYR E CG  1 
ATOM   3240  C CD1 . TYR E  1 119 ? -11.155 -39.466 -1.536  1.00 12.31 ? 1192 TYR E CD1 1 
ATOM   3241  C CD2 . TYR E  1 119 ? -10.829 -40.985 -3.363  1.00 16.43 ? 1192 TYR E CD2 1 
ATOM   3242  C CE1 . TYR E  1 119 ? -12.495 -39.323 -1.883  1.00 14.58 ? 1192 TYR E CE1 1 
ATOM   3243  C CE2 . TYR E  1 119 ? -12.162 -40.810 -3.728  1.00 18.03 ? 1192 TYR E CE2 1 
ATOM   3244  C CZ  . TYR E  1 119 ? -12.956 -39.997 -2.975  1.00 14.96 ? 1192 TYR E CZ  1 
ATOM   3245  O OH  . TYR E  1 119 ? -14.272 -39.822 -3.327  1.00 21.08 ? 1192 TYR E OH  1 
ATOM   3246  N N   . HIS E  1 120 ? -8.610  -43.568 -1.803  1.00 15.42 ? 1193 HIS E N   1 
ATOM   3247  C CA  . HIS E  1 120 ? -9.175  -44.896 -2.014  1.00 16.42 ? 1193 HIS E CA  1 
ATOM   3248  C C   . HIS E  1 120 ? -9.081  -45.796 -0.797  1.00 17.97 ? 1193 HIS E C   1 
ATOM   3249  O O   . HIS E  1 120 ? -9.994  -46.603 -0.559  1.00 19.68 ? 1193 HIS E O   1 
ATOM   3250  C CB  . HIS E  1 120 ? -8.601  -45.515 -3.292  1.00 14.96 ? 1193 HIS E CB  1 
ATOM   3251  C CG  . HIS E  1 120 ? -9.023  -44.753 -4.499  1.00 16.00 ? 1193 HIS E CG  1 
ATOM   3252  N ND1 . HIS E  1 120 ? -10.340 -44.664 -4.891  1.00 19.97 ? 1193 HIS E ND1 1 
ATOM   3253  C CD2 . HIS E  1 120 ? -8.305  -44.044 -5.407  1.00 19.04 ? 1193 HIS E CD2 1 
ATOM   3254  C CE1 . HIS E  1 120 ? -10.420 -43.904 -5.969  1.00 26.31 ? 1193 HIS E CE1 1 
ATOM   3255  N NE2 . HIS E  1 120 ? -9.194  -43.526 -6.297  1.00 18.59 ? 1193 HIS E NE2 1 
ATOM   3256  N N   . ARG E  1 121 ? -8.031  -45.618 -0.004  1.00 15.41 ? 1194 ARG E N   1 
ATOM   3257  C CA  . ARG E  1 121 ? -7.987  -46.354 1.257   1.00 16.63 ? 1194 ARG E CA  1 
ATOM   3258  C C   . ARG E  1 121 ? -9.112  -45.905 2.179   1.00 19.48 ? 1194 ARG E C   1 
ATOM   3259  O O   . ARG E  1 121 ? -9.738  -46.748 2.898   1.00 16.45 ? 1194 ARG E O   1 
ATOM   3260  C CB  . ARG E  1 121 ? -6.644  -46.163 1.935   1.00 19.09 ? 1194 ARG E CB  1 
ATOM   3261  C CG  . ARG E  1 121 ? -5.533  -46.907 1.255   1.00 22.20 ? 1194 ARG E CG  1 
ATOM   3262  C CD  . ARG E  1 121 ? -4.321  -46.219 1.706   1.00 28.95 ? 1194 ARG E CD  1 
ATOM   3263  N NE  . ARG E  1 121 ? -3.089  -46.882 1.374   1.00 32.38 ? 1194 ARG E NE  1 
ATOM   3264  C CZ  . ARG E  1 121 ? -1.905  -46.265 1.523   1.00 32.99 ? 1194 ARG E CZ  1 
ATOM   3265  N NH1 . ARG E  1 121 ? -0.800  -46.934 1.217   1.00 29.29 ? 1194 ARG E NH1 1 
ATOM   3266  N NH2 . ARG E  1 121 ? -1.848  -44.953 1.960   1.00 24.00 ? 1194 ARG E NH2 1 
ATOM   3267  N N   . ALA E  1 122 ? -9.393  -44.595 2.191   1.00 17.17 ? 1195 ALA E N   1 
ATOM   3268  C CA  . ALA E  1 122 ? -10.465 -44.134 3.051   1.00 16.93 ? 1195 ALA E CA  1 
ATOM   3269  C C   . ALA E  1 122 ? -11.771 -44.735 2.617   1.00 16.95 ? 1195 ALA E C   1 
ATOM   3270  O O   . ALA E  1 122 ? -12.632 -45.065 3.443   1.00 16.49 ? 1195 ALA E O   1 
ATOM   3271  C CB  . ALA E  1 122 ? -10.536 -42.562 2.976   1.00 14.08 ? 1195 ALA E CB  1 
ATOM   3272  N N   . LEU E  1 123 ? -11.977 -44.840 1.304   1.00 16.15 ? 1196 LEU E N   1 
ATOM   3273  C CA  . LEU E  1 123 ? -13.294 -45.332 0.890   1.00 17.91 ? 1196 LEU E CA  1 
ATOM   3274  C C   . LEU E  1 123 ? -13.397 -46.842 1.128   1.00 19.62 ? 1196 LEU E C   1 
ATOM   3275  O O   . LEU E  1 123 ? -14.488 -47.369 1.405   1.00 20.67 ? 1196 LEU E O   1 
ATOM   3276  C CB  . LEU E  1 123 ? -13.570 -45.001 -0.570  1.00 15.56 ? 1196 LEU E CB  1 
ATOM   3277  C CG  . LEU E  1 123 ? -13.640 -43.505 -0.923  1.00 20.80 ? 1196 LEU E CG  1 
ATOM   3278  C CD1 . LEU E  1 123 ? -14.201 -43.293 -2.324  1.00 22.56 ? 1196 LEU E CD1 1 
ATOM   3279  C CD2 . LEU E  1 123 ? -14.387 -42.755 0.122   1.00 22.74 ? 1196 LEU E CD2 1 
ATOM   3280  N N   . GLN E  1 124 ? -12.275 -47.513 1.067   1.00 16.20 ? 1197 GLN E N   1 
ATOM   3281  C CA  . GLN E  1 124 ? -12.234 -48.954 1.512   1.00 19.04 ? 1197 GLN E CA  1 
ATOM   3282  C C   . GLN E  1 124 ? -12.632 -49.118 2.973   1.00 23.77 ? 1197 GLN E C   1 
ATOM   3283  O O   . GLN E  1 124 ? -13.322 -50.068 3.350   1.00 22.42 ? 1197 GLN E O   1 
ATOM   3284  C CB  . GLN E  1 124 ? -10.878 -49.593 1.228   1.00 18.18 ? 1197 GLN E CB  1 
ATOM   3285  C CG  . GLN E  1 124 ? -10.701 -49.859 -0.295  1.00 19.82 ? 1197 GLN E CG  1 
ATOM   3286  C CD  . GLN E  1 124 ? -9.270  -50.211 -0.613  1.00 22.54 ? 1197 GLN E CD  1 
ATOM   3287  O OE1 . GLN E  1 124 ? -8.503  -49.353 -1.047  1.00 23.25 ? 1197 GLN E OE1 1 
ATOM   3288  N NE2 . GLN E  1 124 ? -8.872  -51.451 -0.306  1.00 19.68 ? 1197 GLN E NE2 1 
ATOM   3289  N N   . HIS E  1 125 ? -12.184 -48.191 3.811   1.00 20.29 ? 1198 HIS E N   1 
ATOM   3290  C CA  . HIS E  1 125 ? -12.539 -48.293 5.212   1.00 20.24 ? 1198 HIS E CA  1 
ATOM   3291  C C   . HIS E  1 125 ? -14.053 -48.100 5.355   1.00 22.70 ? 1198 HIS E C   1 
ATOM   3292  O O   . HIS E  1 125 ? -14.715 -48.815 6.117   1.00 24.78 ? 1198 HIS E O   1 
ATOM   3293  C CB  . HIS E  1 125 ? -11.770 -47.215 5.987   1.00 17.91 ? 1198 HIS E CB  1 
ATOM   3294  C CG  . HIS E  1 125 ? -12.316 -46.933 7.337   1.00 22.04 ? 1198 HIS E CG  1 
ATOM   3295  N ND1 . HIS E  1 125 ? -11.862 -47.584 8.457   1.00 27.31 ? 1198 HIS E ND1 1 
ATOM   3296  C CD2 . HIS E  1 125 ? -13.268 -46.065 7.751   1.00 22.41 ? 1198 HIS E CD2 1 
ATOM   3297  C CE1 . HIS E  1 125 ? -12.535 -47.148 9.510   1.00 21.93 ? 1198 HIS E CE1 1 
ATOM   3298  N NE2 . HIS E  1 125 ? -13.379 -46.216 9.109   1.00 24.69 ? 1198 HIS E NE2 1 
ATOM   3299  N N   . ARG E  1 126 ? -14.602 -47.110 4.668   1.00 18.56 ? 1199 ARG E N   1 
ATOM   3300  C CA  . ARG E  1 126 ? -16.015 -46.851 4.730   1.00 20.51 ? 1199 ARG E CA  1 
ATOM   3301  C C   . ARG E  1 126 ? -16.761 -48.115 4.350   1.00 26.79 ? 1199 ARG E C   1 
ATOM   3302  O O   . ARG E  1 126 ? -17.777 -48.464 4.984   1.00 27.86 ? 1199 ARG E O   1 
ATOM   3303  C CB  . ARG E  1 126 ? -16.401 -45.751 3.768   1.00 19.54 ? 1199 ARG E CB  1 
ATOM   3304  C CG  . ARG E  1 126 ? -17.879 -45.393 3.838   1.00 23.46 ? 1199 ARG E CG  1 
ATOM   3305  C CD  . ARG E  1 126 ? -18.166 -44.056 3.117   1.00 25.23 ? 1199 ARG E CD  1 
ATOM   3306  N NE  . ARG E  1 126 ? -18.082 -44.198 1.679   1.00 27.16 ? 1199 ARG E NE  1 
ATOM   3307  C CZ  . ARG E  1 126 ? -18.331 -43.223 0.820   1.00 26.60 ? 1199 ARG E CZ  1 
ATOM   3308  N NH1 . ARG E  1 126 ? -18.267 -43.460 -0.467  1.00 28.26 ? 1199 ARG E NH1 1 
ATOM   3309  N NH2 . ARG E  1 126 ? -18.671 -42.033 1.270   1.00 27.84 ? 1199 ARG E NH2 1 
ATOM   3310  N N   . SER E  1 127 ? -16.271 -48.766 3.305   1.00 22.53 ? 1200 SER E N   1 
ATOM   3311  C CA  . SER E  1 127 ? -16.988 -49.935 2.750   1.00 26.29 ? 1200 SER E CA  1 
ATOM   3312  C C   . SER E  1 127 ? -17.037 -51.039 3.781   1.00 33.68 ? 1200 SER E C   1 
ATOM   3313  O O   . SER E  1 127 ? -18.080 -51.693 3.949   1.00 34.54 ? 1200 SER E O   1 
ATOM   3314  C CB  . SER E  1 127 ? -16.289 -50.470 1.494   1.00 29.74 ? 1200 SER E CB  1 
ATOM   3315  O OG  . SER E  1 127 ? -16.610 -49.654 0.401   1.00 30.46 ? 1200 SER E OG  1 
ATOM   3316  N N   . LYS E  1 128 ? -15.905 -51.258 4.436   1.00 27.50 ? 1201 LYS E N   1 
ATOM   3317  C CA  . LYS E  1 128 ? -15.823 -52.247 5.507   1.00 30.98 ? 1201 LYS E CA  1 
ATOM   3318  C C   . LYS E  1 128 ? -16.743 -51.899 6.655   1.00 36.22 ? 1201 LYS E C   1 
ATOM   3319  O O   . LYS E  1 128 ? -17.352 -52.809 7.250   1.00 34.68 ? 1201 LYS E O   1 
ATOM   3320  C CB  . LYS E  1 128 ? -14.404 -52.389 6.042   1.00 28.19 ? 1201 LYS E CB  1 
ATOM   3321  C CG  . LYS E  1 128 ? -13.457 -53.111 5.114   1.00 34.07 ? 1201 LYS E CG  1 
ATOM   3322  C CD  . LYS E  1 128 ? -12.048 -53.121 5.711   1.00 32.42 ? 1201 LYS E CD  1 
ATOM   3323  C CE  . LYS E  1 128 ? -11.044 -53.584 4.650   1.00 43.78 ? 1201 LYS E CE  1 
ATOM   3324  N NZ  . LYS E  1 128 ? -9.629  -53.201 4.950   1.00 46.90 ? 1201 LYS E NZ  1 
ATOM   3325  N N   . VAL E  1 129 ? -16.851 -50.609 6.998   1.00 27.85 ? 1202 VAL E N   1 
ATOM   3326  C CA  . VAL E  1 129 ? -17.740 -50.228 8.084   1.00 30.60 ? 1202 VAL E CA  1 
ATOM   3327  C C   . VAL E  1 129 ? -19.200 -50.451 7.711   1.00 36.96 ? 1202 VAL E C   1 
ATOM   3328  O O   . VAL E  1 129 ? -20.010 -50.826 8.557   1.00 36.83 ? 1202 VAL E O   1 
ATOM   3329  C CB  . VAL E  1 129 ? -17.514 -48.773 8.583   1.00 30.96 ? 1202 VAL E CB  1 
ATOM   3330  C CG1 . VAL E  1 129 ? -18.622 -48.356 9.563   1.00 32.43 ? 1202 VAL E CG1 1 
ATOM   3331  C CG2 . VAL E  1 129 ? -16.138 -48.666 9.236   1.00 27.32 ? 1202 VAL E CG2 1 
ATOM   3332  N N   . GLN E  1 130 ? -19.518 -50.262 6.438   1.00 29.75 ? 1203 GLN E N   1 
ATOM   3333  C CA  . GLN E  1 130 ? -20.901 -50.335 5.973   1.00 39.11 ? 1203 GLN E CA  1 
ATOM   3334  C C   . GLN E  1 130 ? -21.224 -51.765 5.582   1.00 44.14 ? 1203 GLN E C   1 
ATOM   3335  O O   . GLN E  1 130 ? -22.291 -52.037 5.018   1.00 48.81 ? 1203 GLN E O   1 
ATOM   3336  C CB  . GLN E  1 130 ? -21.115 -49.422 4.768   1.00 40.44 ? 1203 GLN E CB  1 
ATOM   3337  C CG  . GLN E  1 130 ? -21.245 -47.946 5.121   1.00 33.55 ? 1203 GLN E CG  1 
ATOM   3338  C CD  . GLN E  1 130 ? -21.197 -47.046 3.884   1.00 42.86 ? 1203 GLN E CD  1 
ATOM   3339  O OE1 . GLN E  1 130 ? -21.538 -45.861 3.945   1.00 49.98 ? 1203 GLN E OE1 1 
ATOM   3340  N NE2 . GLN E  1 130 ? -20.752 -47.611 2.750   1.00 44.53 ? 1203 GLN E NE2 1 
ATOM   3341  N N   . GLY E  1 131 ? -20.301 -52.682 5.872   1.00 41.14 ? 1204 GLY E N   1 
ATOM   3342  C CA  . GLY E  1 131 ? -20.522 -54.082 5.557   1.00 48.35 ? 1204 GLY E CA  1 
ATOM   3343  C C   . GLY E  1 131 ? -20.780 -54.200 4.072   1.00 54.10 ? 1204 GLY E C   1 
ATOM   3344  O O   . GLY E  1 131 ? -21.913 -54.417 3.629   1.00 58.64 ? 1204 GLY E O   1 
ATOM   3345  N N   . GLU E  1 132 ? -19.709 -54.040 3.303   1.00 51.95 ? 1205 GLU E N   1 
ATOM   3346  C CA  . GLU E  1 132 ? -19.779 -53.992 1.850   1.00 56.07 ? 1205 GLU E CA  1 
ATOM   3347  C C   . GLU E  1 132 ? -18.376 -54.246 1.291   1.00 60.54 ? 1205 GLU E C   1 
ATOM   3348  O O   . GLU E  1 132 ? -18.199 -54.294 0.061   1.00 65.92 ? 1205 GLU E O   1 
ATOM   3349  C CB  . GLU E  1 132 ? -20.270 -52.617 1.378   1.00 52.26 ? 1205 GLU E CB  1 
ATOM   3350  C CG  . GLU E  1 132 ? -21.789 -52.458 1.264   1.00 55.12 ? 1205 GLU E CG  1 
ATOM   3351  C CD  . GLU E  1 132 ? -22.186 -50.986 1.173   1.00 64.18 ? 1205 GLU E CD  1 
ATOM   3352  O OE1 . GLU E  1 132 ? -23.364 -50.677 0.850   1.00 67.57 ? 1205 GLU E OE1 1 
ATOM   3353  O OE2 . GLU E  1 132 ? -21.300 -50.132 1.425   1.00 60.48 ? 1205 GLU E OE2 1 
ATOM   3354  O OXT . GLU E  1 132 ? -17.398 -54.392 2.059   1.00 54.95 ? 1205 GLU E OXT 1 
ATOM   3355  N N   . ALA F  2 4   ? -9.397  -55.669 21.146  1.00 41.89 ? 25   ALA F N   1 
ATOM   3356  C CA  . ALA F  2 4   ? -9.642  -54.671 20.091  1.00 39.22 ? 25   ALA F CA  1 
ATOM   3357  C C   . ALA F  2 4   ? -8.369  -53.879 19.791  1.00 43.01 ? 25   ALA F C   1 
ATOM   3358  O O   . ALA F  2 4   ? -7.984  -53.680 18.619  1.00 39.31 ? 25   ALA F O   1 
ATOM   3359  C CB  . ALA F  2 4   ? -10.766 -53.728 20.496  1.00 40.00 ? 25   ALA F CB  1 
ATOM   3360  N N   . ARG F  2 5   ? -7.712  -53.432 20.859  1.00 39.90 ? 26   ARG F N   1 
ATOM   3361  C CA  . ARG F  2 5   ? -6.526  -52.603 20.712  1.00 42.81 ? 26   ARG F CA  1 
ATOM   3362  C C   . ARG F  2 5   ? -5.423  -53.266 19.884  1.00 43.01 ? 26   ARG F C   1 
ATOM   3363  O O   . ARG F  2 5   ? -4.862  -52.639 18.990  1.00 41.32 ? 26   ARG F O   1 
ATOM   3364  C CB  . ARG F  2 5   ? -5.980  -52.169 22.074  1.00 36.09 ? 26   ARG F CB  1 
ATOM   3365  C CG  . ARG F  2 5   ? -4.757  -51.308 21.948  1.00 34.28 ? 26   ARG F CG  1 
ATOM   3366  C CD  . ARG F  2 5   ? -4.584  -50.409 23.177  1.00 34.07 ? 26   ARG F CD  1 
ATOM   3367  N NE  . ARG F  2 5   ? -3.332  -49.665 23.117  1.00 37.43 ? 26   ARG F NE  1 
ATOM   3368  C CZ  . ARG F  2 5   ? -2.952  -48.812 24.060  1.00 32.70 ? 26   ARG F CZ  1 
ATOM   3369  N NH1 . ARG F  2 5   ? -1.803  -48.158 23.945  1.00 36.13 ? 26   ARG F NH1 1 
ATOM   3370  N NH2 . ARG F  2 5   ? -3.740  -48.623 25.116  1.00 31.68 ? 26   ARG F NH2 1 
ATOM   3371  N N   . LYS F  2 6   ? -5.107  -54.523 20.172  1.00 38.99 ? 27   LYS F N   1 
ATOM   3372  C CA  . LYS F  2 6   ? -4.034  -55.198 19.438  1.00 40.21 ? 27   LYS F CA  1 
ATOM   3373  C C   . LYS F  2 6   ? -4.410  -55.568 17.975  1.00 37.29 ? 27   LYS F C   1 
ATOM   3374  O O   . LYS F  2 6   ? -3.522  -55.696 17.141  1.00 42.85 ? 27   LYS F O   1 
ATOM   3375  C CB  . LYS F  2 6   ? -3.454  -56.408 20.221  1.00 44.40 ? 27   LYS F CB  1 
ATOM   3376  C CG  . LYS F  2 6   ? -4.343  -57.655 20.229  1.00 47.70 ? 27   LYS F CG  1 
ATOM   3377  C CD  . LYS F  2 6   ? -3.617  -58.919 20.805  1.00 52.25 ? 27   LYS F CD  1 
ATOM   3378  C CE  . LYS F  2 6   ? -4.609  -60.096 20.999  1.00 51.39 ? 27   LYS F CE  1 
ATOM   3379  N NZ  . LYS F  2 6   ? -5.386  -60.378 19.744  1.00 51.87 ? 27   LYS F NZ  1 
ATOM   3380  N N   . SER F  2 7   ? -5.701  -55.710 17.645  1.00 39.74 ? 28   SER F N   1 
ATOM   3381  C CA  . SER F  2 7   ? -6.062  -56.093 16.263  1.00 35.06 ? 28   SER F CA  1 
ATOM   3382  C C   . SER F  2 7   ? -6.112  -54.892 15.304  1.00 35.51 ? 28   SER F C   1 
ATOM   3383  O O   . SER F  2 7   ? -6.195  -55.057 14.085  1.00 35.49 ? 28   SER F O   1 
ATOM   3384  C CB  . SER F  2 7   ? -7.389  -56.856 16.191  1.00 42.13 ? 28   SER F CB  1 
ATOM   3385  O OG  . SER F  2 7   ? -8.473  -56.102 16.711  1.00 43.31 ? 28   SER F OG  1 
ATOM   3386  N N   . ALA F  2 8   ? -6.090  -53.692 15.867  1.00 33.58 ? 29   ALA F N   1 
ATOM   3387  C CA  . ALA F  2 8   ? -6.103  -52.478 15.049  1.00 29.85 ? 29   ALA F CA  1 
ATOM   3388  C C   . ALA F  2 8   ? -4.790  -52.348 14.300  1.00 29.14 ? 29   ALA F C   1 
ATOM   3389  O O   . ALA F  2 8   ? -3.759  -52.731 14.790  1.00 29.15 ? 29   ALA F O   1 
ATOM   3390  C CB  . ALA F  2 8   ? -6.323  -51.247 15.966  1.00 27.61 ? 29   ALA F CB  1 
ATOM   3391  N N   . PRO F  2 9   ? -4.806  -51.718 13.110  1.00 31.60 ? 30   PRO F N   1 
ATOM   3392  C CA  . PRO F  2 9   ? -3.542  -51.450 12.397  1.00 31.52 ? 30   PRO F CA  1 
ATOM   3393  C C   . PRO F  2 9   ? -2.586  -50.608 13.234  1.00 29.32 ? 30   PRO F C   1 
ATOM   3394  O O   . PRO F  2 9   ? -3.017  -49.713 13.974  1.00 32.48 ? 30   PRO F O   1 
ATOM   3395  C CB  . PRO F  2 9   ? -3.986  -50.589 11.215  1.00 31.59 ? 30   PRO F CB  1 
ATOM   3396  C CG  . PRO F  2 9   ? -5.433  -50.867 11.043  1.00 37.55 ? 30   PRO F CG  1 
ATOM   3397  C CD  . PRO F  2 9   ? -5.987  -51.238 12.380  1.00 29.99 ? 30   PRO F CD  1 
ATOM   3398  N N   . ALA F  2 10  ? -1.303  -50.857 13.083  1.00 30.53 ? 31   ALA F N   1 
ATOM   3399  C CA  . ALA F  2 10  ? -0.284  -50.066 13.749  1.00 28.97 ? 31   ALA F CA  1 
ATOM   3400  C C   . ALA F  2 10  ? -0.345  -48.599 13.275  1.00 31.38 ? 31   ALA F C   1 
ATOM   3401  O O   . ALA F  2 10  ? -0.705  -48.317 12.130  1.00 31.62 ? 31   ALA F O   1 
ATOM   3402  C CB  . ALA F  2 10  ? 1.071   -50.634 13.471  1.00 35.42 ? 31   ALA F CB  1 
ATOM   3403  N N   . THR F  2 11  ? 0.049   -47.676 14.136  1.00 28.07 ? 32   THR F N   1 
ATOM   3404  C CA  . THR F  2 11  ? 0.127   -46.281 13.668  1.00 26.45 ? 32   THR F CA  1 
ATOM   3405  C C   . THR F  2 11  ? 1.512   -45.707 13.841  1.00 32.40 ? 32   THR F C   1 
ATOM   3406  O O   . THR F  2 11  ? 2.358   -46.253 14.571  1.00 30.36 ? 32   THR F O   1 
ATOM   3407  C CB  . THR F  2 11  ? -0.911  -45.405 14.370  1.00 28.27 ? 32   THR F CB  1 
ATOM   3408  O OG1 . THR F  2 11  ? -0.656  -45.394 15.780  1.00 28.34 ? 32   THR F OG1 1 
ATOM   3409  C CG2 . THR F  2 11  ? -2.316  -45.918 14.113  1.00 25.59 ? 32   THR F CG2 1 
ATOM   3410  N N   . GLY F  2 12  ? 1.763   -44.621 13.131  1.00 29.47 ? 33   GLY F N   1 
ATOM   3411  C CA  . GLY F  2 12  ? 2.988   -43.886 13.280  1.00 30.51 ? 33   GLY F CA  1 
ATOM   3412  C C   . GLY F  2 12  ? 2.803   -42.997 14.494  1.00 29.69 ? 33   GLY F C   1 
ATOM   3413  O O   . GLY F  2 12  ? 1.942   -43.192 15.373  1.00 41.15 ? 33   GLY F O   1 
ATOM   3414  N N   . GLY F  2 13  ? 3.615   -41.994 14.569  1.00 31.86 ? 34   GLY F N   1 
ATOM   3415  C CA  . GLY F  2 13  ? 3.429   -41.045 15.618  1.00 32.02 ? 34   GLY F CA  1 
ATOM   3416  C C   . GLY F  2 13  ? 2.761   -39.844 14.991  1.00 24.84 ? 34   GLY F C   1 
ATOM   3417  O O   . GLY F  2 13  ? 1.964   -39.961 14.047  1.00 23.44 ? 34   GLY F O   1 
ATOM   3418  N N   . VAL F  2 14  ? 3.133   -38.711 15.522  1.00 23.93 ? 35   VAL F N   1 
ATOM   3419  C CA  . VAL F  2 14  ? 2.625   -37.449 15.082  1.00 21.73 ? 35   VAL F CA  1 
ATOM   3420  C C   . VAL F  2 14  ? 3.251   -37.140 13.746  1.00 25.87 ? 35   VAL F C   1 
ATOM   3421  O O   . VAL F  2 14  ? 4.469   -37.266 13.558  1.00 27.47 ? 35   VAL F O   1 
ATOM   3422  C CB  . VAL F  2 14  ? 3.004   -36.367 16.058  1.00 25.77 ? 35   VAL F CB  1 
ATOM   3423  C CG1 . VAL F  2 14  ? 2.509   -35.006 15.510  1.00 25.34 ? 35   VAL F CG1 1 
ATOM   3424  C CG2 . VAL F  2 14  ? 2.408   -36.710 17.440  1.00 30.45 ? 35   VAL F CG2 1 
HETATM 3425  N N   . M3L F  2 15  ? 2.419   -36.736 12.799  1.00 22.97 ? 36   M3L F N   1 
HETATM 3426  C CA  . M3L F  2 15  ? 2.939   -36.377 11.490  1.00 21.81 ? 36   M3L F CA  1 
HETATM 3427  C CB  . M3L F  2 15  ? 1.765   -36.040 10.560  1.00 21.10 ? 36   M3L F CB  1 
HETATM 3428  C CG  . M3L F  2 15  ? 2.210   -35.913 9.116   1.00 20.56 ? 36   M3L F CG  1 
HETATM 3429  C CD  . M3L F  2 15  ? 1.050   -35.883 8.112   1.00 19.66 ? 36   M3L F CD  1 
HETATM 3430  C CE  . M3L F  2 15  ? 1.466   -35.864 6.641   1.00 21.61 ? 36   M3L F CE  1 
HETATM 3431  N NZ  . M3L F  2 15  ? 0.408   -35.848 5.632   1.00 19.53 ? 36   M3L F NZ  1 
HETATM 3432  C C   . M3L F  2 15  ? 3.930   -35.206 11.583  1.00 28.60 ? 36   M3L F C   1 
HETATM 3433  O O   . M3L F  2 15  ? 3.645   -34.213 12.163  1.00 24.87 ? 36   M3L F O   1 
HETATM 3434  C CM1 . M3L F  2 15  ? -0.392  -34.660 5.721   1.00 18.53 ? 36   M3L F CM1 1 
HETATM 3435  C CM2 . M3L F  2 15  ? -0.359  -37.047 5.715   1.00 18.93 ? 36   M3L F CM2 1 
HETATM 3436  C CM3 . M3L F  2 15  ? 1.099   -35.886 4.342   1.00 21.66 ? 36   M3L F CM3 1 
ATOM   3437  N N   . LYS F  2 16  ? 5.083   -35.374 10.934  1.00 28.76 ? 37   LYS F N   1 
ATOM   3438  C CA  . LYS F  2 16  ? 6.114   -34.369 10.908  1.00 29.63 ? 37   LYS F CA  1 
ATOM   3439  C C   . LYS F  2 16  ? 5.693   -33.183 10.091  1.00 32.37 ? 37   LYS F C   1 
ATOM   3440  O O   . LYS F  2 16  ? 5.063   -33.349 9.046   1.00 29.34 ? 37   LYS F O   1 
ATOM   3441  C CB  . LYS F  2 16  ? 7.393   -34.981 10.298  1.00 31.02 ? 37   LYS F CB  1 
ATOM   3442  C CG  . LYS F  2 16  ? 7.988   -36.090 11.148  1.00 41.41 ? 37   LYS F CG  1 
ATOM   3443  C CD  . LYS F  2 16  ? 9.489   -36.328 10.861  1.00 52.47 ? 37   LYS F CD  1 
ATOM   3444  C CE  . LYS F  2 16  ? 10.108  -37.313 11.878  1.00 53.32 ? 37   LYS F CE  1 
ATOM   3445  N NZ  . LYS F  2 16  ? 11.614  -37.208 11.997  1.00 52.56 ? 37   LYS F NZ  1 
ATOM   3446  N N   . PRO F  2 17  ? 6.074   -31.984 10.539  1.00 29.52 ? 38   PRO F N   1 
ATOM   3447  C CA  . PRO F  2 17  ? 5.897   -30.724 9.811   1.00 29.31 ? 38   PRO F CA  1 
ATOM   3448  C C   . PRO F  2 17  ? 6.521   -30.801 8.406   1.00 31.91 ? 38   PRO F C   1 
ATOM   3449  O O   . PRO F  2 17  ? 7.552   -31.444 8.183   1.00 32.26 ? 38   PRO F O   1 
ATOM   3450  C CB  . PRO F  2 17  ? 6.642   -29.681 10.691  1.00 36.21 ? 38   PRO F CB  1 
ATOM   3451  C CG  . PRO F  2 17  ? 6.675   -30.302 12.069  1.00 37.31 ? 38   PRO F CG  1 
ATOM   3452  C CD  . PRO F  2 17  ? 6.838   -31.796 11.794  1.00 37.13 ? 38   PRO F CD  1 
ATOM   3453  N N   . HIS F  2 18  ? 5.871   -30.146 7.464   1.00 31.07 ? 39   HIS F N   1 
ATOM   3454  C CA  . HIS F  2 18  ? 6.353   -30.118 6.094   1.00 34.23 ? 39   HIS F CA  1 
ATOM   3455  C C   . HIS F  2 18  ? 7.761   -29.494 6.020   1.00 37.82 ? 39   HIS F C   1 
ATOM   3456  O O   . HIS F  2 18  ? 7.944   -28.359 6.476   1.00 39.23 ? 39   HIS F O   1 
ATOM   3457  C CB  . HIS F  2 18  ? 5.389   -29.290 5.258   1.00 35.15 ? 39   HIS F CB  1 
ATOM   3458  C CG  . HIS F  2 18  ? 5.768   -29.211 3.821   1.00 33.78 ? 39   HIS F CG  1 
ATOM   3459  N ND1 . HIS F  2 18  ? 6.137   -28.031 3.216   1.00 37.45 ? 39   HIS F ND1 1 
ATOM   3460  C CD2 . HIS F  2 18  ? 5.861   -30.176 2.873   1.00 33.84 ? 39   HIS F CD2 1 
ATOM   3461  C CE1 . HIS F  2 18  ? 6.423   -28.269 1.947   1.00 36.47 ? 39   HIS F CE1 1 
ATOM   3462  N NE2 . HIS F  2 18  ? 6.276   -29.564 1.719   1.00 35.20 ? 39   HIS F NE2 1 
ATOM   3463  N N   . ASP G  1 7   ? -7.071  -4.130  58.343  1.00 44.14 ? 1080 ASP G N   1 
ATOM   3464  C CA  . ASP G  1 7   ? -6.985  -4.493  59.755  1.00 44.20 ? 1080 ASP G CA  1 
ATOM   3465  C C   . ASP G  1 7   ? -6.057  -3.583  60.575  1.00 41.68 ? 1080 ASP G C   1 
ATOM   3466  O O   . ASP G  1 7   ? -6.063  -3.623  61.801  1.00 47.36 ? 1080 ASP G O   1 
ATOM   3467  C CB  . ASP G  1 7   ? -6.557  -5.960  59.918  1.00 50.01 ? 1080 ASP G CB  1 
ATOM   3468  C CG  . ASP G  1 7   ? -7.006  -6.540  61.242  1.00 56.86 ? 1080 ASP G CG  1 
ATOM   3469  O OD1 . ASP G  1 7   ? -6.762  -7.749  61.507  1.00 62.74 ? 1080 ASP G OD1 1 
ATOM   3470  O OD2 . ASP G  1 7   ? -7.628  -5.766  62.013  1.00 55.47 ? 1080 ASP G OD2 1 
ATOM   3471  N N   . SER G  1 8   ? -5.238  -2.793  59.892  1.00 40.63 ? 1081 SER G N   1 
ATOM   3472  C CA  . SER G  1 8   ? -4.438  -1.757  60.531  1.00 39.02 ? 1081 SER G CA  1 
ATOM   3473  C C   . SER G  1 8   ? -5.337  -0.785  61.291  1.00 38.39 ? 1081 SER G C   1 
ATOM   3474  O O   . SER G  1 8   ? -6.427  -0.474  60.830  1.00 39.93 ? 1081 SER G O   1 
ATOM   3475  C CB  . SER G  1 8   ? -3.748  -0.949  59.449  1.00 41.48 ? 1081 SER G CB  1 
ATOM   3476  O OG  . SER G  1 8   ? -4.723  -0.124  58.798  1.00 44.26 ? 1081 SER G OG  1 
ATOM   3477  N N   . PRO G  1 9   ? -4.850  -0.256  62.419  1.00 31.98 ? 1082 PRO G N   1 
ATOM   3478  C CA  . PRO G  1 9   ? -5.509  0.823   63.160  1.00 34.14 ? 1082 PRO G CA  1 
ATOM   3479  C C   . PRO G  1 9   ? -5.612  2.076   62.282  1.00 38.38 ? 1082 PRO G C   1 
ATOM   3480  O O   . PRO G  1 9   ? -4.710  2.375   61.470  1.00 36.61 ? 1082 PRO G O   1 
ATOM   3481  C CB  . PRO G  1 9   ? -4.551  1.095   64.313  1.00 35.15 ? 1082 PRO G CB  1 
ATOM   3482  C CG  . PRO G  1 9   ? -3.682  -0.107  64.402  1.00 38.22 ? 1082 PRO G CG  1 
ATOM   3483  C CD  . PRO G  1 9   ? -3.548  -0.610  63.001  1.00 39.08 ? 1082 PRO G CD  1 
ATOM   3484  N N   . LEU G  1 10  ? -6.724  2.781   62.447  1.00 31.02 ? 1083 LEU G N   1 
ATOM   3485  C CA  . LEU G  1 10  ? -7.015  4.017   61.728  1.00 31.25 ? 1083 LEU G CA  1 
ATOM   3486  C C   . LEU G  1 10  ? -6.791  5.198   62.660  1.00 27.21 ? 1083 LEU G C   1 
ATOM   3487  O O   . LEU G  1 10  ? -6.883  5.052   63.857  1.00 27.07 ? 1083 LEU G O   1 
ATOM   3488  C CB  . LEU G  1 10  ? -8.492  3.992   61.317  1.00 23.78 ? 1083 LEU G CB  1 
ATOM   3489  C CG  . LEU G  1 10  ? -8.793  2.755   60.494  1.00 27.50 ? 1083 LEU G CG  1 
ATOM   3490  C CD1 . LEU G  1 10  ? -10.210 2.810   60.040  1.00 24.11 ? 1083 LEU G CD1 1 
ATOM   3491  C CD2 . LEU G  1 10  ? -7.855  2.695   59.277  1.00 30.65 ? 1083 LEU G CD2 1 
ATOM   3492  N N   . ASP G  1 11  ? -6.545  6.385   62.114  1.00 25.47 ? 1084 ASP G N   1 
ATOM   3493  C CA  . ASP G  1 11  ? -6.287  7.581   62.928  1.00 23.85 ? 1084 ASP G CA  1 
ATOM   3494  C C   . ASP G  1 11  ? -7.485  8.499   63.049  1.00 22.63 ? 1084 ASP G C   1 
ATOM   3495  O O   . ASP G  1 11  ? -8.336  8.546   62.164  1.00 22.08 ? 1084 ASP G O   1 
ATOM   3496  C CB  . ASP G  1 11  ? -5.178  8.408   62.266  1.00 27.66 ? 1084 ASP G CB  1 
ATOM   3497  C CG  . ASP G  1 11  ? -3.881  7.640   62.160  1.00 37.92 ? 1084 ASP G CG  1 
ATOM   3498  O OD1 . ASP G  1 11  ? -3.149  7.812   61.159  1.00 48.86 ? 1084 ASP G OD1 1 
ATOM   3499  O OD2 . ASP G  1 11  ? -3.588  6.847   63.078  1.00 42.98 ? 1084 ASP G OD2 1 
ATOM   3500  N N   . ALA G  1 12  ? -7.527  9.299   64.116  1.00 19.84 ? 1085 ALA G N   1 
ATOM   3501  C CA  . ALA G  1 12  ? -8.507  10.337  64.211  1.00 20.17 ? 1085 ALA G CA  1 
ATOM   3502  C C   . ALA G  1 12  ? -8.442  11.265  63.019  1.00 24.06 ? 1085 ALA G C   1 
ATOM   3503  O O   . ALA G  1 12  ? -7.335  11.560  62.499  1.00 22.38 ? 1085 ALA G O   1 
ATOM   3504  C CB  . ALA G  1 12  ? -8.308  11.145  65.486  1.00 23.53 ? 1085 ALA G CB  1 
ATOM   3505  N N   . LEU G  1 13  ? -9.646  11.677  62.598  1.00 19.28 ? 1086 LEU G N   1 
ATOM   3506  C CA  . LEU G  1 13  ? -9.875  12.570  61.447  1.00 19.52 ? 1086 LEU G CA  1 
ATOM   3507  C C   . LEU G  1 13  ? -9.708  11.915  60.058  1.00 18.84 ? 1086 LEU G C   1 
ATOM   3508  O O   . LEU G  1 13  ? -9.775  12.599  59.037  1.00 23.28 ? 1086 LEU G O   1 
ATOM   3509  C CB  . LEU G  1 13  ? -9.071  13.864  61.559  1.00 23.64 ? 1086 LEU G CB  1 
ATOM   3510  C CG  . LEU G  1 13  ? -9.227  14.516  62.929  1.00 25.40 ? 1086 LEU G CG  1 
ATOM   3511  C CD1 . LEU G  1 13  ? -8.335  15.762  63.101  1.00 29.52 ? 1086 LEU G CD1 1 
ATOM   3512  C CD2 . LEU G  1 13  ? -10.681 14.861  63.174  1.00 26.82 ? 1086 LEU G CD2 1 
ATOM   3513  N N   . ASP G  1 14  ? -9.527  10.608  60.021  1.00 18.36 ? 1087 ASP G N   1 
ATOM   3514  C CA  . ASP G  1 14  ? -9.548  9.823   58.773  1.00 15.06 ? 1087 ASP G CA  1 
ATOM   3515  C C   . ASP G  1 14  ? -10.993 9.773   58.302  1.00 17.64 ? 1087 ASP G C   1 
ATOM   3516  O O   . ASP G  1 14  ? -11.920 9.662   59.136  1.00 19.35 ? 1087 ASP G O   1 
ATOM   3517  C CB  . ASP G  1 14  ? -9.126  8.359   58.984  1.00 16.44 ? 1087 ASP G CB  1 
ATOM   3518  C CG  . ASP G  1 14  ? -7.611  8.167   59.030  1.00 28.48 ? 1087 ASP G CG  1 
ATOM   3519  O OD1 . ASP G  1 14  ? -6.899  9.150   58.771  1.00 27.93 ? 1087 ASP G OD1 1 
ATOM   3520  O OD2 . ASP G  1 14  ? -7.139  7.031   59.355  1.00 28.94 ? 1087 ASP G OD2 1 
ATOM   3521  N N   . LEU G  1 15  ? -11.191 9.812   56.987  1.00 16.53 ? 1088 LEU G N   1 
ATOM   3522  C CA  . LEU G  1 15  ? -12.537 9.625   56.401  1.00 15.86 ? 1088 LEU G CA  1 
ATOM   3523  C C   . LEU G  1 15  ? -12.741 8.154   56.187  1.00 14.77 ? 1088 LEU G C   1 
ATOM   3524  O O   . LEU G  1 15  ? -11.823 7.470   55.709  1.00 15.80 ? 1088 LEU G O   1 
ATOM   3525  C CB  . LEU G  1 15  ? -12.613 10.271  55.011  1.00 17.29 ? 1088 LEU G CB  1 
ATOM   3526  C CG  . LEU G  1 15  ? -12.512 11.797  55.127  1.00 19.48 ? 1088 LEU G CG  1 
ATOM   3527  C CD1 . LEU G  1 15  ? -12.417 12.315  53.702  1.00 20.16 ? 1088 LEU G CD1 1 
ATOM   3528  C CD2 . LEU G  1 15  ? -13.745 12.342  55.837  1.00 19.92 ? 1088 LEU G CD2 1 
ATOM   3529  N N   . VAL G  1 16  ? -13.918 7.638   56.572  1.00 14.58 ? 1089 VAL G N   1 
ATOM   3530  C CA  . VAL G  1 16  ? -14.156 6.206   56.480  1.00 12.80 ? 1089 VAL G CA  1 
ATOM   3531  C C   . VAL G  1 16  ? -15.568 5.918   55.954  1.00 14.32 ? 1089 VAL G C   1 
ATOM   3532  O O   . VAL G  1 16  ? -16.474 6.777   56.029  1.00 15.37 ? 1089 VAL G O   1 
ATOM   3533  C CB  . VAL G  1 16  ? -14.020 5.517   57.863  1.00 14.77 ? 1089 VAL G CB  1 
ATOM   3534  C CG1 . VAL G  1 16  ? -12.542 5.503   58.292  1.00 17.83 ? 1089 VAL G CG1 1 
ATOM   3535  C CG2 . VAL G  1 16  ? -14.950 6.184   58.906  1.00 14.82 ? 1089 VAL G CG2 1 
ATOM   3536  N N   . TRP G  1 17  ? -15.721 4.718   55.401  1.00 13.26 ? 1090 TRP G N   1 
ATOM   3537  C CA  . TRP G  1 17  ? -17.068 4.167   55.188  1.00 13.31 ? 1090 TRP G CA  1 
ATOM   3538  C C   . TRP G  1 17  ? -17.345 3.410   56.451  1.00 16.29 ? 1090 TRP G C   1 
ATOM   3539  O O   . TRP G  1 17  ? -16.556 2.514   56.820  1.00 17.47 ? 1090 TRP G O   1 
ATOM   3540  C CB  . TRP G  1 17  ? -17.022 3.146   54.023  1.00 12.62 ? 1090 TRP G CB  1 
ATOM   3541  C CG  . TRP G  1 17  ? -16.894 3.783   52.678  1.00 15.57 ? 1090 TRP G CG  1 
ATOM   3542  C CD1 . TRP G  1 17  ? -15.760 3.964   51.940  1.00 15.76 ? 1090 TRP G CD1 1 
ATOM   3543  C CD2 . TRP G  1 17  ? -17.954 4.396   51.945  1.00 15.18 ? 1090 TRP G CD2 1 
ATOM   3544  N NE1 . TRP G  1 17  ? -16.063 4.643   50.775  1.00 16.06 ? 1090 TRP G NE1 1 
ATOM   3545  C CE2 . TRP G  1 17  ? -17.406 4.909   50.762  1.00 14.49 ? 1090 TRP G CE2 1 
ATOM   3546  C CE3 . TRP G  1 17  ? -19.346 4.510   52.163  1.00 16.57 ? 1090 TRP G CE3 1 
ATOM   3547  C CZ2 . TRP G  1 17  ? -18.175 5.572   49.815  1.00 15.24 ? 1090 TRP G CZ2 1 
ATOM   3548  C CZ3 . TRP G  1 17  ? -20.099 5.155   51.226  1.00 17.50 ? 1090 TRP G CZ3 1 
ATOM   3549  C CH2 . TRP G  1 17  ? -19.527 5.646   50.042  1.00 16.38 ? 1090 TRP G CH2 1 
ATOM   3550  N N   . ALA G  1 18  ? -18.473 3.711   57.092  1.00 15.92 ? 1091 ALA G N   1 
ATOM   3551  C CA  . ALA G  1 18  ? -18.760 3.152   58.405  1.00 15.10 ? 1091 ALA G CA  1 
ATOM   3552  C C   . ALA G  1 18  ? -20.068 2.403   58.334  1.00 15.20 ? 1091 ALA G C   1 
ATOM   3553  O O   . ALA G  1 18  ? -21.080 2.923   57.875  1.00 16.38 ? 1091 ALA G O   1 
ATOM   3554  C CB  . ALA G  1 18  ? -18.787 4.269   59.475  1.00 16.32 ? 1091 ALA G CB  1 
ATOM   3555  N N   . LYS G  1 19  ? -20.032 1.141   58.747  1.00 17.29 ? 1092 LYS G N   1 
ATOM   3556  C CA  . LYS G  1 19  ? -21.175 0.247   58.569  1.00 20.16 ? 1092 LYS G CA  1 
ATOM   3557  C C   . LYS G  1 19  ? -21.885 -0.057  59.885  1.00 22.22 ? 1092 LYS G C   1 
ATOM   3558  O O   . LYS G  1 19  ? -21.325 -0.728  60.769  1.00 21.88 ? 1092 LYS G O   1 
ATOM   3559  C CB  . LYS G  1 19  ? -20.713 -1.077  57.945  1.00 21.59 ? 1092 LYS G CB  1 
ATOM   3560  C CG  . LYS G  1 19  ? -21.832 -2.116  57.700  1.00 22.78 ? 1092 LYS G CG  1 
ATOM   3561  C CD  . LYS G  1 19  ? -22.825 -1.660  56.673  1.00 22.10 ? 1092 LYS G CD  1 
ATOM   3562  C CE  . LYS G  1 19  ? -23.803 -2.836  56.381  1.00 28.71 ? 1092 LYS G CE  1 
ATOM   3563  N NZ  . LYS G  1 19  ? -24.776 -2.967  57.523  1.00 29.03 ? 1092 LYS G NZ  1 
ATOM   3564  N N   . CYS G  1 20  ? -23.116 0.432   60.008  1.00 22.07 ? 1093 CYS G N   1 
ATOM   3565  C CA  . CYS G  1 20  ? -23.967 0.094   61.155  1.00 26.99 ? 1093 CYS G CA  1 
ATOM   3566  C C   . CYS G  1 20  ? -24.941 -0.978  60.736  1.00 33.81 ? 1093 CYS G C   1 
ATOM   3567  O O   . CYS G  1 20  ? -25.336 -1.034  59.581  1.00 27.59 ? 1093 CYS G O   1 
ATOM   3568  C CB  . CYS G  1 20  ? -24.816 1.279   61.550  1.00 34.35 ? 1093 CYS G CB  1 
ATOM   3569  S SG  . CYS G  1 20  ? -23.915 2.740   61.976  1.00 42.93 ? 1093 CYS G SG  1 
ATOM   3570  N N   . ARG G  1 21  ? -25.414 -1.789  61.680  1.00 32.23 ? 1094 ARG G N   1 
ATOM   3571  C CA  . ARG G  1 21  ? -26.341 -2.849  61.286  1.00 35.75 ? 1094 ARG G CA  1 
ATOM   3572  C C   . ARG G  1 21  ? -27.618 -2.257  60.696  1.00 29.45 ? 1094 ARG G C   1 
ATOM   3573  O O   . ARG G  1 21  ? -28.159 -1.311  61.235  1.00 34.68 ? 1094 ARG G O   1 
ATOM   3574  C CB  . ARG G  1 21  ? -26.663 -3.753  62.477  1.00 42.57 ? 1094 ARG G CB  1 
ATOM   3575  C CG  . ARG G  1 21  ? -26.637 -3.047  63.805  1.00 48.65 ? 1094 ARG G CG  1 
ATOM   3576  C CD  . ARG G  1 21  ? -26.433 -4.058  64.953  1.00 63.48 ? 1094 ARG G CD  1 
ATOM   3577  N NE  . ARG G  1 21  ? -27.665 -4.758  65.329  1.00 67.76 ? 1094 ARG G NE  1 
ATOM   3578  C CZ  . ARG G  1 21  ? -28.613 -4.229  66.102  1.00 68.17 ? 1094 ARG G CZ  1 
ATOM   3579  N NH1 . ARG G  1 21  ? -29.697 -4.935  66.402  1.00 69.05 ? 1094 ARG G NH1 1 
ATOM   3580  N NH2 . ARG G  1 21  ? -28.480 -2.988  66.568  1.00 63.03 ? 1094 ARG G NH2 1 
ATOM   3581  N N   . GLY G  1 22  ? -28.056 -2.787  59.559  1.00 33.18 ? 1095 GLY G N   1 
ATOM   3582  C CA  . GLY G  1 22  ? -29.315 -2.364  58.973  1.00 36.40 ? 1095 GLY G CA  1 
ATOM   3583  C C   . GLY G  1 22  ? -29.265 -0.995  58.328  1.00 38.65 ? 1095 GLY G C   1 
ATOM   3584  O O   . GLY G  1 22  ? -30.292 -0.324  58.165  1.00 39.25 ? 1095 GLY G O   1 
ATOM   3585  N N   . TYR G  1 23  ? -28.059 -0.549  58.003  1.00 28.11 ? 1096 TYR G N   1 
ATOM   3586  C CA  . TYR G  1 23  ? -27.905 0.602   57.125  1.00 28.91 ? 1096 TYR G CA  1 
ATOM   3587  C C   . TYR G  1 23  ? -26.752 0.251   56.200  1.00 24.61 ? 1096 TYR G C   1 
ATOM   3588  O O   . TYR G  1 23  ? -25.876 -0.521  56.572  1.00 25.66 ? 1096 TYR G O   1 
ATOM   3589  C CB  . TYR G  1 23  ? -27.486 1.827   57.911  1.00 27.47 ? 1096 TYR G CB  1 
ATOM   3590  C CG  . TYR G  1 23  ? -28.521 2.427   58.813  1.00 32.34 ? 1096 TYR G CG  1 
ATOM   3591  C CD1 . TYR G  1 23  ? -29.650 3.049   58.297  1.00 32.23 ? 1096 TYR G CD1 1 
ATOM   3592  C CD2 . TYR G  1 23  ? -28.340 2.412   60.186  1.00 35.32 ? 1096 TYR G CD2 1 
ATOM   3593  C CE1 . TYR G  1 23  ? -30.590 3.646   59.154  1.00 37.23 ? 1096 TYR G CE1 1 
ATOM   3594  C CE2 . TYR G  1 23  ? -29.277 2.993   61.051  1.00 36.84 ? 1096 TYR G CE2 1 
ATOM   3595  C CZ  . TYR G  1 23  ? -30.391 3.612   60.525  1.00 42.07 ? 1096 TYR G CZ  1 
ATOM   3596  O OH  . TYR G  1 23  ? -31.311 4.191   61.388  1.00 48.30 ? 1096 TYR G OH  1 
ATOM   3597  N N   . PRO G  1 24  ? -26.732 0.823   54.998  1.00 22.56 ? 1097 PRO G N   1 
ATOM   3598  C CA  . PRO G  1 24  ? -25.588 0.568   54.122  1.00 23.20 ? 1097 PRO G CA  1 
ATOM   3599  C C   . PRO G  1 24  ? -24.393 1.358   54.660  1.00 21.50 ? 1097 PRO G C   1 
ATOM   3600  O O   . PRO G  1 24  ? -24.543 2.293   55.470  1.00 21.47 ? 1097 PRO G O   1 
ATOM   3601  C CB  . PRO G  1 24  ? -26.006 1.226   52.812  1.00 23.91 ? 1097 PRO G CB  1 
ATOM   3602  C CG  . PRO G  1 24  ? -26.878 2.369   53.275  1.00 29.60 ? 1097 PRO G CG  1 
ATOM   3603  C CD  . PRO G  1 24  ? -27.713 1.723   54.375  1.00 29.41 ? 1097 PRO G CD  1 
ATOM   3604  N N   . SER G  1 25  ? -23.207 1.024   54.158  1.00 20.34 ? 1098 SER G N   1 
ATOM   3605  C CA  . SER G  1 25  ? -22.021 1.742   54.588  1.00 15.41 ? 1098 SER G CA  1 
ATOM   3606  C C   . SER G  1 25  ? -22.232 3.194   54.331  1.00 16.25 ? 1098 SER G C   1 
ATOM   3607  O O   . SER G  1 25  ? -22.742 3.570   53.258  1.00 19.52 ? 1098 SER G O   1 
ATOM   3608  C CB  . SER G  1 25  ? -20.860 1.309   53.702  1.00 20.33 ? 1098 SER G CB  1 
ATOM   3609  O OG  . SER G  1 25  ? -20.708 -0.084  53.770  1.00 23.71 ? 1098 SER G OG  1 
ATOM   3610  N N   . TYR G  1 26  ? -21.758 4.026   55.251  1.00 15.30 ? 1099 TYR G N   1 
ATOM   3611  C CA  . TYR G  1 26  ? -22.038 5.452   55.180  1.00 13.97 ? 1099 TYR G CA  1 
ATOM   3612  C C   . TYR G  1 26  ? -20.802 6.297   55.479  1.00 15.41 ? 1099 TYR G C   1 
ATOM   3613  O O   . TYR G  1 26  ? -20.060 6.021   56.378  1.00 16.54 ? 1099 TYR G O   1 
ATOM   3614  C CB  . TYR G  1 26  ? -23.157 5.778   56.205  1.00 16.65 ? 1099 TYR G CB  1 
ATOM   3615  C CG  . TYR G  1 26  ? -23.999 6.993   55.866  1.00 17.11 ? 1099 TYR G CG  1 
ATOM   3616  C CD1 . TYR G  1 26  ? -23.528 8.255   56.197  1.00 15.13 ? 1099 TYR G CD1 1 
ATOM   3617  C CD2 . TYR G  1 26  ? -25.229 6.868   55.228  1.00 20.00 ? 1099 TYR G CD2 1 
ATOM   3618  C CE1 . TYR G  1 26  ? -24.253 9.405   55.901  1.00 19.43 ? 1099 TYR G CE1 1 
ATOM   3619  C CE2 . TYR G  1 26  ? -25.996 8.006   54.930  1.00 21.03 ? 1099 TYR G CE2 1 
ATOM   3620  C CZ  . TYR G  1 26  ? -25.519 9.255   55.302  1.00 20.89 ? 1099 TYR G CZ  1 
ATOM   3621  O OH  . TYR G  1 26  ? -26.233 10.401  55.021  1.00 23.45 ? 1099 TYR G OH  1 
ATOM   3622  N N   . PRO G  1 27  ? -20.621 7.400   54.737  1.00 14.14 ? 1100 PRO G N   1 
ATOM   3623  C CA  . PRO G  1 27  ? -19.403 8.179   54.991  1.00 13.30 ? 1100 PRO G CA  1 
ATOM   3624  C C   . PRO G  1 27  ? -19.373 8.821   56.352  1.00 13.74 ? 1100 PRO G C   1 
ATOM   3625  O O   . PRO G  1 27  ? -20.370 9.368   56.859  1.00 17.23 ? 1100 PRO G O   1 
ATOM   3626  C CB  . PRO G  1 27  ? -19.440 9.279   53.899  1.00 12.45 ? 1100 PRO G CB  1 
ATOM   3627  C CG  . PRO G  1 27  ? -20.233 8.681   52.803  1.00 15.51 ? 1100 PRO G CG  1 
ATOM   3628  C CD  . PRO G  1 27  ? -21.293 7.773   53.480  1.00 15.74 ? 1100 PRO G CD  1 
ATOM   3629  N N   . ALA G  1 28  ? -18.202 8.811   56.955  1.00 13.74 ? 1101 ALA G N   1 
ATOM   3630  C CA  . ALA G  1 28  ? -18.051 9.345   58.302  1.00 12.40 ? 1101 ALA G CA  1 
ATOM   3631  C C   . ALA G  1 28  ? -16.606 9.779   58.571  1.00 13.68 ? 1101 ALA G C   1 
ATOM   3632  O O   . ALA G  1 28  ? -15.703 9.528   57.753  1.00 14.68 ? 1101 ALA G O   1 
ATOM   3633  C CB  . ALA G  1 28  ? -18.499 8.267   59.330  1.00 18.35 ? 1101 ALA G CB  1 
ATOM   3634  N N   . LEU G  1 29  ? -16.401 10.470  59.699  1.00 14.80 ? 1102 LEU G N   1 
ATOM   3635  C CA  . LEU G  1 29  ? -15.125 11.021  60.078  1.00 14.56 ? 1102 LEU G CA  1 
ATOM   3636  C C   . LEU G  1 29  ? -14.773 10.357  61.420  1.00 17.92 ? 1102 LEU G C   1 
ATOM   3637  O O   . LEU G  1 29  ? -15.623 10.346  62.300  1.00 20.34 ? 1102 LEU G O   1 
ATOM   3638  C CB  . LEU G  1 29  ? -15.284 12.560  60.318  1.00 16.98 ? 1102 LEU G CB  1 
ATOM   3639  C CG  . LEU G  1 29  ? -14.039 13.367  60.630  1.00 18.92 ? 1102 LEU G CG  1 
ATOM   3640  C CD1 . LEU G  1 29  ? -13.087 13.273  59.468  1.00 18.25 ? 1102 LEU G CD1 1 
ATOM   3641  C CD2 . LEU G  1 29  ? -14.479 14.839  60.800  1.00 19.74 ? 1102 LEU G CD2 1 
ATOM   3642  N N   . ILE G  1 30  ? -13.555 9.825   61.571  1.00 17.49 ? 1103 ILE G N   1 
ATOM   3643  C CA  . ILE G  1 30  ? -13.148 9.260   62.870  1.00 15.74 ? 1103 ILE G CA  1 
ATOM   3644  C C   . ILE G  1 30  ? -12.833 10.456  63.772  1.00 19.63 ? 1103 ILE G C   1 
ATOM   3645  O O   . ILE G  1 30  ? -12.125 11.361  63.370  1.00 18.75 ? 1103 ILE G O   1 
ATOM   3646  C CB  . ILE G  1 30  ? -11.961 8.353   62.784  1.00 16.46 ? 1103 ILE G CB  1 
ATOM   3647  C CG1 . ILE G  1 30  ? -12.314 7.169   61.860  1.00 18.15 ? 1103 ILE G CG1 1 
ATOM   3648  C CG2 . ILE G  1 30  ? -11.588 7.799   64.138  1.00 19.12 ? 1103 ILE G CG2 1 
ATOM   3649  C CD1 . ILE G  1 30  ? -11.293 6.158   61.791  1.00 19.87 ? 1103 ILE G CD1 1 
ATOM   3650  N N   . ILE G  1 31  ? -13.407 10.467  64.965  1.00 19.31 ? 1104 ILE G N   1 
ATOM   3651  C CA  . ILE G  1 31  ? -13.158 11.574  65.907  1.00 19.75 ? 1104 ILE G CA  1 
ATOM   3652  C C   . ILE G  1 31  ? -12.408 11.032  67.147  1.00 23.20 ? 1104 ILE G C   1 
ATOM   3653  O O   . ILE G  1 31  ? -12.683 9.941   67.604  1.00 23.42 ? 1104 ILE G O   1 
ATOM   3654  C CB  . ILE G  1 31  ? -14.494 12.135  66.334  1.00 21.01 ? 1104 ILE G CB  1 
ATOM   3655  C CG1 . ILE G  1 31  ? -15.209 12.742  65.117  1.00 22.59 ? 1104 ILE G CG1 1 
ATOM   3656  C CG2 . ILE G  1 31  ? -14.342 13.197  67.484  1.00 20.25 ? 1104 ILE G CG2 1 
ATOM   3657  C CD1 . ILE G  1 31  ? -14.504 13.920  64.519  1.00 23.68 ? 1104 ILE G CD1 1 
ATOM   3658  N N   . ASP G  1 32  ? -11.463 11.794  67.709  1.00 22.71 ? 1105 ASP G N   1 
ATOM   3659  C CA  . ASP G  1 32  ? -10.743 11.358  68.926  1.00 25.18 ? 1105 ASP G CA  1 
ATOM   3660  C C   . ASP G  1 32  ? -11.596 11.647  70.173  1.00 24.00 ? 1105 ASP G C   1 
ATOM   3661  O O   . ASP G  1 32  ? -11.929 12.797  70.428  1.00 25.64 ? 1105 ASP G O   1 
ATOM   3662  C CB  . ASP G  1 32  ? -9.432  12.159  69.005  1.00 30.12 ? 1105 ASP G CB  1 
ATOM   3663  C CG  . ASP G  1 32  ? -8.565  11.810  70.230  1.00 34.54 ? 1105 ASP G CG  1 
ATOM   3664  O OD1 . ASP G  1 32  ? -9.038  11.126  71.162  1.00 29.60 ? 1105 ASP G OD1 1 
ATOM   3665  O OD2 . ASP G  1 32  ? -7.394  12.258  70.270  1.00 36.45 ? 1105 ASP G OD2 1 
ATOM   3666  N N   . PRO G  1 33  ? -11.971 10.617  70.953  1.00 24.21 ? 1106 PRO G N   1 
ATOM   3667  C CA  . PRO G  1 33  ? -12.932 10.878  72.042  1.00 24.46 ? 1106 PRO G CA  1 
ATOM   3668  C C   . PRO G  1 33  ? -12.276 11.770  73.072  1.00 27.07 ? 1106 PRO G C   1 
ATOM   3669  O O   . PRO G  1 33  ? -12.960 12.354  73.905  1.00 27.55 ? 1106 PRO G O   1 
ATOM   3670  C CB  . PRO G  1 33  ? -13.171 9.488   72.675  1.00 23.07 ? 1106 PRO G CB  1 
ATOM   3671  C CG  . PRO G  1 33  ? -12.776 8.516   71.635  1.00 28.11 ? 1106 PRO G CG  1 
ATOM   3672  C CD  . PRO G  1 33  ? -11.753 9.187   70.715  1.00 26.64 ? 1106 PRO G CD  1 
ATOM   3673  N N   . LYS G  1 34  ? -10.956 11.837  73.035  1.00 26.84 ? 1107 LYS G N   1 
ATOM   3674  C CA  . LYS G  1 34  ? -10.237 12.618  74.043  1.00 29.64 ? 1107 LYS G CA  1 
ATOM   3675  C C   . LYS G  1 34  ? -9.855  14.002  73.526  1.00 33.71 ? 1107 LYS G C   1 
ATOM   3676  O O   . LYS G  1 34  ? -9.044  14.684  74.139  1.00 32.83 ? 1107 LYS G O   1 
ATOM   3677  C CB  . LYS G  1 34  ? -8.987  11.866  74.523  1.00 28.70 ? 1107 LYS G CB  1 
ATOM   3678  C CG  . LYS G  1 34  ? -9.213  10.482  75.186  1.00 39.45 ? 1107 LYS G CG  1 
ATOM   3679  C CD  . LYS G  1 34  ? -10.399 10.517  76.180  1.00 40.54 ? 1107 LYS G CD  1 
ATOM   3680  C CE  . LYS G  1 34  ? -10.641 9.160   76.891  1.00 46.94 ? 1107 LYS G CE  1 
ATOM   3681  N NZ  . LYS G  1 34  ? -11.445 8.137   76.108  1.00 39.74 ? 1107 LYS G NZ  1 
ATOM   3682  N N   . MET G  1 35  ? -10.440 14.439  72.408  1.00 29.94 ? 1108 MET G N   1 
ATOM   3683  C CA  . MET G  1 35  ? -10.147 15.782  71.918  1.00 31.24 ? 1108 MET G CA  1 
ATOM   3684  C C   . MET G  1 35  ? -10.527 16.826  72.988  1.00 35.85 ? 1108 MET G C   1 
ATOM   3685  O O   . MET G  1 35  ? -11.347 16.551  73.875  1.00 31.73 ? 1108 MET G O   1 
ATOM   3686  C CB  . MET G  1 35  ? -10.865 16.079  70.605  1.00 30.06 ? 1108 MET G CB  1 
ATOM   3687  C CG  . MET G  1 35  ? -12.371 15.906  70.650  1.00 30.55 ? 1108 MET G CG  1 
ATOM   3688  S SD  . MET G  1 35  ? -13.142 16.429  69.088  1.00 30.40 ? 1108 MET G SD  1 
ATOM   3689  C CE  . MET G  1 35  ? -12.928 18.198  69.093  1.00 33.11 ? 1108 MET G CE  1 
ATOM   3690  N N   . PRO G  1 36  ? -9.940  18.028  72.901  1.00 32.21 ? 1109 PRO G N   1 
ATOM   3691  C CA  . PRO G  1 36  ? -10.298 19.083  73.858  1.00 33.62 ? 1109 PRO G CA  1 
ATOM   3692  C C   . PRO G  1 36  ? -11.791 19.368  73.894  1.00 35.20 ? 1109 PRO G C   1 
ATOM   3693  O O   . PRO G  1 36  ? -12.408 19.500  72.838  1.00 33.13 ? 1109 PRO G O   1 
ATOM   3694  C CB  . PRO G  1 36  ? -9.585  20.305  73.304  1.00 35.12 ? 1109 PRO G CB  1 
ATOM   3695  C CG  . PRO G  1 36  ? -8.388  19.771  72.636  1.00 37.07 ? 1109 PRO G CG  1 
ATOM   3696  C CD  . PRO G  1 36  ? -8.751  18.385  72.112  1.00 39.14 ? 1109 PRO G CD  1 
ATOM   3697  N N   . ARG G  1 37  ? -12.362 19.502  75.092  1.00 30.86 ? 1110 ARG G N   1 
ATOM   3698  C CA  . ARG G  1 37  ? -13.785 19.740  75.207  1.00 33.96 ? 1110 ARG G CA  1 
ATOM   3699  C C   . ARG G  1 37  ? -14.138 21.108  74.660  1.00 34.16 ? 1110 ARG G C   1 
ATOM   3700  O O   . ARG G  1 37  ? -15.272 21.356  74.239  1.00 34.47 ? 1110 ARG G O   1 
ATOM   3701  C CB  . ARG G  1 37  ? -14.227 19.622  76.664  1.00 33.10 ? 1110 ARG G CB  1 
ATOM   3702  C CG  . ARG G  1 37  ? -13.791 18.342  77.294  1.00 34.37 ? 1110 ARG G CG  1 
ATOM   3703  C CD  . ARG G  1 37  ? -14.407 17.186  76.524  1.00 34.00 ? 1110 ARG G CD  1 
ATOM   3704  N NE  . ARG G  1 37  ? -15.860 17.212  76.612  1.00 31.42 ? 1110 ARG G NE  1 
ATOM   3705  C CZ  . ARG G  1 37  ? -16.677 16.584  75.767  1.00 36.20 ? 1110 ARG G CZ  1 
ATOM   3706  N NH1 . ARG G  1 37  ? -17.987 16.680  75.934  1.00 30.56 ? 1110 ARG G NH1 1 
ATOM   3707  N NH2 . ARG G  1 37  ? -16.179 15.863  74.746  1.00 28.17 ? 1110 ARG G NH2 1 
ATOM   3708  N N   . GLU G  1 38  ? -13.165 22.012  74.647  1.00 37.55 ? 1111 GLU G N   1 
ATOM   3709  C CA  . GLU G  1 38  ? -13.468 23.343  74.162  1.00 38.63 ? 1111 GLU G CA  1 
ATOM   3710  C C   . GLU G  1 38  ? -13.385 23.399  72.642  1.00 41.38 ? 1111 GLU G C   1 
ATOM   3711  O O   . GLU G  1 38  ? -13.625 24.436  72.028  1.00 44.32 ? 1111 GLU G O   1 
ATOM   3712  C CB  . GLU G  1 38  ? -12.588 24.390  74.850  1.00 43.91 ? 1111 GLU G CB  1 
ATOM   3713  C CG  . GLU G  1 38  ? -13.106 24.725  76.268  1.00 45.62 ? 1111 GLU G CG  1 
ATOM   3714  C CD  . GLU G  1 38  ? -12.146 25.574  77.100  1.00 55.52 ? 1111 GLU G CD  1 
ATOM   3715  O OE1 . GLU G  1 38  ? -11.047 25.055  77.444  1.00 56.58 ? 1111 GLU G OE1 1 
ATOM   3716  O OE2 . GLU G  1 38  ? -12.500 26.742  77.430  1.00 49.42 ? 1111 GLU G OE2 1 
ATOM   3717  N N   . GLY G  1 39  ? -13.086 22.262  72.035  1.00 34.98 ? 1112 GLY G N   1 
ATOM   3718  C CA  . GLY G  1 39  ? -13.063 22.177  70.580  1.00 39.02 ? 1112 GLY G CA  1 
ATOM   3719  C C   . GLY G  1 39  ? -11.649 22.290  70.047  1.00 37.66 ? 1112 GLY G C   1 
ATOM   3720  O O   . GLY G  1 39  ? -10.682 22.400  70.825  1.00 40.20 ? 1112 GLY G O   1 
ATOM   3721  N N   . MET G  1 40  ? -11.520 22.265  68.721  1.00 38.76 ? 1113 MET G N   1 
ATOM   3722  C CA  . MET G  1 40  ? -10.222 22.414  68.055  1.00 37.21 ? 1113 MET G CA  1 
ATOM   3723  C C   . MET G  1 40  ? -10.419 22.601  66.563  1.00 40.73 ? 1113 MET G C   1 
ATOM   3724  O O   . MET G  1 40  ? -11.507 22.366  66.032  1.00 37.97 ? 1113 MET G O   1 
ATOM   3725  C CB  . MET G  1 40  ? -9.344  21.182  68.251  1.00 41.71 ? 1113 MET G CB  1 
ATOM   3726  C CG  . MET G  1 40  ? -9.890  19.996  67.521  1.00 45.53 ? 1113 MET G CG  1 
ATOM   3727  S SD  . MET G  1 40  ? -8.698  18.689  67.408  1.00 60.39 ? 1113 MET G SD  1 
ATOM   3728  C CE  . MET G  1 40  ? -7.620  19.342  66.136  1.00 47.31 ? 1113 MET G CE  1 
ATOM   3729  N N   . PHE G  1 41  ? -9.342  23.014  65.907  1.00 42.47 ? 1114 PHE G N   1 
ATOM   3730  C CA  . PHE G  1 41  ? -9.307  23.209  64.471  1.00 41.73 ? 1114 PHE G CA  1 
ATOM   3731  C C   . PHE G  1 41  ? -8.274  22.272  63.870  1.00 41.11 ? 1114 PHE G C   1 
ATOM   3732  O O   . PHE G  1 41  ? -7.205  22.032  64.458  1.00 40.35 ? 1114 PHE G O   1 
ATOM   3733  C CB  . PHE G  1 41  ? -8.954  24.669  64.152  1.00 43.07 ? 1114 PHE G CB  1 
ATOM   3734  C CG  . PHE G  1 41  ? -9.969  25.643  64.635  1.00 40.87 ? 1114 PHE G CG  1 
ATOM   3735  C CD1 . PHE G  1 41  ? -9.861  26.203  65.907  1.00 45.49 ? 1114 PHE G CD1 1 
ATOM   3736  C CD2 . PHE G  1 41  ? -11.049 25.983  63.838  1.00 39.64 ? 1114 PHE G CD2 1 
ATOM   3737  C CE1 . PHE G  1 41  ? -10.807 27.078  66.368  1.00 43.28 ? 1114 PHE G CE1 1 
ATOM   3738  C CE2 . PHE G  1 41  ? -12.004 26.880  64.288  1.00 45.67 ? 1114 PHE G CE2 1 
ATOM   3739  C CZ  . PHE G  1 41  ? -11.883 27.431  65.555  1.00 44.75 ? 1114 PHE G CZ  1 
ATOM   3740  N N   . HIS G  1 42  ? -8.584  21.724  62.701  1.00 37.39 ? 1115 HIS G N   1 
ATOM   3741  C CA  . HIS G  1 42  ? -7.644  20.842  62.031  1.00 37.37 ? 1115 HIS G CA  1 
ATOM   3742  C C   . HIS G  1 42  ? -7.358  21.537  60.710  1.00 40.32 ? 1115 HIS G C   1 
ATOM   3743  O O   . HIS G  1 42  ? -8.239  21.660  59.882  1.00 35.82 ? 1115 HIS G O   1 
ATOM   3744  C CB  . HIS G  1 42  ? -8.286  19.452  61.832  1.00 33.77 ? 1115 HIS G CB  1 
ATOM   3745  C CG  . HIS G  1 42  ? -7.420  18.440  61.136  1.00 35.38 ? 1115 HIS G CG  1 
ATOM   3746  N ND1 . HIS G  1 42  ? -6.101  18.203  61.477  1.00 38.98 ? 1115 HIS G ND1 1 
ATOM   3747  C CD2 . HIS G  1 42  ? -7.726  17.526  60.178  1.00 32.42 ? 1115 HIS G CD2 1 
ATOM   3748  C CE1 . HIS G  1 42  ? -5.618  17.230  60.718  1.00 35.87 ? 1115 HIS G CE1 1 
ATOM   3749  N NE2 . HIS G  1 42  ? -6.587  16.799  59.926  1.00 35.70 ? 1115 HIS G NE2 1 
ATOM   3750  N N   . HIS G  1 43  ? -6.124  22.001  60.528  1.00 45.93 ? 1116 HIS G N   1 
ATOM   3751  C CA  . HIS G  1 43  ? -5.806  22.863  59.384  1.00 45.09 ? 1116 HIS G CA  1 
ATOM   3752  C C   . HIS G  1 43  ? -6.921  23.871  59.138  1.00 41.00 ? 1116 HIS G C   1 
ATOM   3753  O O   . HIS G  1 43  ? -7.401  24.049  58.015  1.00 44.28 ? 1116 HIS G O   1 
ATOM   3754  C CB  . HIS G  1 43  ? -5.495  22.024  58.140  1.00 44.76 ? 1116 HIS G CB  1 
ATOM   3755  C CG  . HIS G  1 43  ? -4.393  21.037  58.360  1.00 47.13 ? 1116 HIS G CG  1 
ATOM   3756  N ND1 . HIS G  1 43  ? -3.152  21.406  58.832  1.00 49.96 ? 1116 HIS G ND1 1 
ATOM   3757  C CD2 . HIS G  1 43  ? -4.356  19.693  58.219  1.00 45.01 ? 1116 HIS G CD2 1 
ATOM   3758  C CE1 . HIS G  1 43  ? -2.393  20.332  58.962  1.00 46.52 ? 1116 HIS G CE1 1 
ATOM   3759  N NE2 . HIS G  1 43  ? -3.099  19.280  58.591  1.00 49.42 ? 1116 HIS G NE2 1 
ATOM   3760  N N   . GLY G  1 44  ? -7.337  24.522  60.219  1.00 42.36 ? 1117 GLY G N   1 
ATOM   3761  C CA  . GLY G  1 44  ? -8.355  25.549  60.162  1.00 40.97 ? 1117 GLY G CA  1 
ATOM   3762  C C   . GLY G  1 44  ? -9.807  25.117  60.075  1.00 44.37 ? 1117 GLY G C   1 
ATOM   3763  O O   . GLY G  1 44  ? -10.678 25.990  60.070  1.00 42.35 ? 1117 GLY G O   1 
ATOM   3764  N N   . VAL G  1 45  ? -10.093 23.807  60.014  1.00 39.71 ? 1118 VAL G N   1 
ATOM   3765  C CA  . VAL G  1 45  ? -11.483 23.333  60.024  1.00 32.72 ? 1118 VAL G CA  1 
ATOM   3766  C C   . VAL G  1 45  ? -11.944 23.001  61.448  1.00 32.91 ? 1118 VAL G C   1 
ATOM   3767  O O   . VAL G  1 45  ? -11.309 22.206  62.103  1.00 32.29 ? 1118 VAL G O   1 
ATOM   3768  C CB  . VAL G  1 45  ? -11.648 21.997  59.200  1.00 34.50 ? 1118 VAL G CB  1 
ATOM   3769  C CG1 . VAL G  1 45  ? -13.112 21.600  59.086  1.00 34.44 ? 1118 VAL G CG1 1 
ATOM   3770  C CG2 . VAL G  1 45  ? -11.022 22.133  57.802  1.00 39.26 ? 1118 VAL G CG2 1 
ATOM   3771  N N   . PRO G  1 46  ? -13.081 23.559  61.905  1.00 35.16 ? 1119 PRO G N   1 
ATOM   3772  C CA  . PRO G  1 46  ? -13.515 23.230  63.271  1.00 36.98 ? 1119 PRO G CA  1 
ATOM   3773  C C   . PRO G  1 46  ? -14.093 21.797  63.387  1.00 33.73 ? 1119 PRO G C   1 
ATOM   3774  O O   . PRO G  1 46  ? -15.012 21.460  62.654  1.00 33.61 ? 1119 PRO G O   1 
ATOM   3775  C CB  . PRO G  1 46  ? -14.647 24.232  63.539  1.00 38.48 ? 1119 PRO G CB  1 
ATOM   3776  C CG  . PRO G  1 46  ? -15.052 24.781  62.199  1.00 33.79 ? 1119 PRO G CG  1 
ATOM   3777  C CD  . PRO G  1 46  ? -14.125 24.255  61.141  1.00 36.67 ? 1119 PRO G CD  1 
ATOM   3778  N N   . ILE G  1 47  ? -13.613 21.002  64.342  1.00 32.56 ? 1120 ILE G N   1 
ATOM   3779  C CA  . ILE G  1 47  ? -14.077 19.610  64.483  1.00 26.80 ? 1120 ILE G CA  1 
ATOM   3780  C C   . ILE G  1 47  ? -15.045 19.530  65.640  1.00 24.19 ? 1120 ILE G C   1 
ATOM   3781  O O   . ILE G  1 47  ? -14.729 19.982  66.747  1.00 27.26 ? 1120 ILE G O   1 
ATOM   3782  C CB  . ILE G  1 47  ? -12.908 18.730  64.833  1.00 29.12 ? 1120 ILE G CB  1 
ATOM   3783  C CG1 . ILE G  1 47  ? -11.789 18.888  63.809  1.00 28.75 ? 1120 ILE G CG1 1 
ATOM   3784  C CG2 . ILE G  1 47  ? -13.374 17.296  64.947  1.00 27.68 ? 1120 ILE G CG2 1 
ATOM   3785  C CD1 . ILE G  1 47  ? -12.224 18.638  62.343  1.00 29.18 ? 1120 ILE G CD1 1 
ATOM   3786  N N   . PRO G  1 48  ? -16.227 18.967  65.419  1.00 24.73 ? 1121 PRO G N   1 
ATOM   3787  C CA  . PRO G  1 48  ? -17.228 18.933  66.476  1.00 25.61 ? 1121 PRO G CA  1 
ATOM   3788  C C   . PRO G  1 48  ? -16.811 18.057  67.650  1.00 29.86 ? 1121 PRO G C   1 
ATOM   3789  O O   . PRO G  1 48  ? -16.057 17.107  67.453  1.00 25.41 ? 1121 PRO G O   1 
ATOM   3790  C CB  . PRO G  1 48  ? -18.468 18.355  65.781  1.00 25.71 ? 1121 PRO G CB  1 
ATOM   3791  C CG  . PRO G  1 48  ? -18.205 18.554  64.274  1.00 27.99 ? 1121 PRO G CG  1 
ATOM   3792  C CD  . PRO G  1 48  ? -16.717 18.419  64.143  1.00 28.44 ? 1121 PRO G CD  1 
ATOM   3793  N N   . VAL G  1 49  ? -17.297 18.397  68.848  1.00 27.20 ? 1122 VAL G N   1 
ATOM   3794  C CA  . VAL G  1 49  ? -16.854 17.763  70.073  1.00 22.56 ? 1122 VAL G CA  1 
ATOM   3795  C C   . VAL G  1 49  ? -17.917 16.812  70.462  1.00 22.31 ? 1122 VAL G C   1 
ATOM   3796  O O   . VAL G  1 49  ? -19.088 17.117  70.375  1.00 26.21 ? 1122 VAL G O   1 
ATOM   3797  C CB  . VAL G  1 49  ? -16.706 18.840  71.203  1.00 27.03 ? 1122 VAL G CB  1 
ATOM   3798  C CG1 . VAL G  1 49  ? -16.263 18.169  72.517  1.00 28.42 ? 1122 VAL G CG1 1 
ATOM   3799  C CG2 . VAL G  1 49  ? -15.717 19.903  70.773  1.00 29.31 ? 1122 VAL G CG2 1 
ATOM   3800  N N   . PRO G  1 50  ? -17.523 15.585  70.834  1.00 24.33 ? 1123 PRO G N   1 
ATOM   3801  C CA  . PRO G  1 50  ? -18.603 14.643  71.109  1.00 26.43 ? 1123 PRO G CA  1 
ATOM   3802  C C   . PRO G  1 50  ? -19.247 14.991  72.440  1.00 23.69 ? 1123 PRO G C   1 
ATOM   3803  O O   . PRO G  1 50  ? -18.552 15.301  73.390  1.00 26.59 ? 1123 PRO G O   1 
ATOM   3804  C CB  . PRO G  1 50  ? -17.894 13.290  71.250  1.00 23.76 ? 1123 PRO G CB  1 
ATOM   3805  C CG  . PRO G  1 50  ? -16.419 13.565  71.281  1.00 24.50 ? 1123 PRO G CG  1 
ATOM   3806  C CD  . PRO G  1 50  ? -16.194 14.977  70.746  1.00 23.86 ? 1123 PRO G CD  1 
ATOM   3807  N N   . PRO G  1 51  ? -20.569 14.944  72.484  1.00 24.80 ? 1124 PRO G N   1 
ATOM   3808  C CA  . PRO G  1 51  ? -21.327 15.119  73.715  1.00 33.30 ? 1124 PRO G CA  1 
ATOM   3809  C C   . PRO G  1 51  ? -20.861 14.143  74.803  1.00 28.27 ? 1124 PRO G C   1 
ATOM   3810  O O   . PRO G  1 51  ? -20.512 13.013  74.515  1.00 25.44 ? 1124 PRO G O   1 
ATOM   3811  C CB  . PRO G  1 51  ? -22.739 14.792  73.277  1.00 28.17 ? 1124 PRO G CB  1 
ATOM   3812  C CG  . PRO G  1 51  ? -22.787 15.172  71.845  1.00 32.75 ? 1124 PRO G CG  1 
ATOM   3813  C CD  . PRO G  1 51  ? -21.432 14.832  71.304  1.00 26.73 ? 1124 PRO G CD  1 
ATOM   3814  N N   . LEU G  1 52  ? -20.839 14.590  76.056  1.00 29.36 ? 1125 LEU G N   1 
ATOM   3815  C CA  . LEU G  1 52  ? -20.632 13.654  77.164  1.00 28.36 ? 1125 LEU G CA  1 
ATOM   3816  C C   . LEU G  1 52  ? -21.501 12.410  77.093  1.00 26.85 ? 1125 LEU G C   1 
ATOM   3817  O O   . LEU G  1 52  ? -21.062 11.314  77.446  1.00 26.54 ? 1125 LEU G O   1 
ATOM   3818  C CB  . LEU G  1 52  ? -20.922 14.360  78.497  1.00 35.09 ? 1125 LEU G CB  1 
ATOM   3819  C CG  . LEU G  1 52  ? -20.015 15.511  78.872  1.00 35.99 ? 1125 LEU G CG  1 
ATOM   3820  C CD1 . LEU G  1 52  ? -20.655 16.268  80.053  1.00 39.29 ? 1125 LEU G CD1 1 
ATOM   3821  C CD2 . LEU G  1 52  ? -18.669 14.977  79.255  1.00 38.06 ? 1125 LEU G CD2 1 
ATOM   3822  N N   . GLU G  1 53  ? -22.737 12.537  76.638  1.00 30.01 ? 1126 GLU G N   1 
ATOM   3823  C CA  . GLU G  1 53  ? -23.599 11.370  76.605  1.00 29.75 ? 1126 GLU G CA  1 
ATOM   3824  C C   . GLU G  1 53  ? -22.999 10.341  75.630  1.00 29.71 ? 1126 GLU G C   1 
ATOM   3825  O O   . GLU G  1 53  ? -22.991 9.133   75.871  1.00 28.22 ? 1126 GLU G O   1 
ATOM   3826  C CB  . GLU G  1 53  ? -24.993 11.788  76.145  1.00 38.19 ? 1126 GLU G CB  1 
ATOM   3827  C CG  . GLU G  1 53  ? -26.088 10.789  76.373  1.00 47.26 ? 1126 GLU G CG  1 
ATOM   3828  C CD  . GLU G  1 53  ? -27.456 11.425  76.153  1.00 59.65 ? 1126 GLU G CD  1 
ATOM   3829  O OE1 . GLU G  1 53  ? -28.423 10.708  75.779  1.00 61.56 ? 1126 GLU G OE1 1 
ATOM   3830  O OE2 . GLU G  1 53  ? -27.550 12.662  76.352  1.00 61.88 ? 1126 GLU G OE2 1 
ATOM   3831  N N   . VAL G  1 54  ? -22.497 10.855  74.522  1.00 26.67 ? 1127 VAL G N   1 
ATOM   3832  C CA  . VAL G  1 54  ? -21.858 10.007  73.506  1.00 24.62 ? 1127 VAL G CA  1 
ATOM   3833  C C   . VAL G  1 54  ? -20.630 9.322   74.076  1.00 24.97 ? 1127 VAL G C   1 
ATOM   3834  O O   . VAL G  1 54  ? -20.396 8.131   73.824  1.00 22.88 ? 1127 VAL G O   1 
ATOM   3835  C CB  . VAL G  1 54  ? -21.501 10.845  72.260  1.00 25.04 ? 1127 VAL G CB  1 
ATOM   3836  C CG1 . VAL G  1 54  ? -20.584 10.034  71.308  1.00 26.40 ? 1127 VAL G CG1 1 
ATOM   3837  C CG2 . VAL G  1 54  ? -22.781 11.213  71.561  1.00 24.78 ? 1127 VAL G CG2 1 
ATOM   3838  N N   . LEU G  1 55  ? -19.857 10.054  74.875  1.00 25.26 ? 1128 LEU G N   1 
ATOM   3839  C CA  . LEU G  1 55  ? -18.660 9.482   75.456  1.00 25.25 ? 1128 LEU G CA  1 
ATOM   3840  C C   . LEU G  1 55  ? -19.010 8.359   76.465  1.00 26.69 ? 1128 LEU G C   1 
ATOM   3841  O O   . LEU G  1 55  ? -18.368 7.307   76.469  1.00 24.70 ? 1128 LEU G O   1 
ATOM   3842  C CB  . LEU G  1 55  ? -17.786 10.561  76.105  1.00 27.30 ? 1128 LEU G CB  1 
ATOM   3843  C CG  . LEU G  1 55  ? -17.097 11.554  75.139  1.00 21.67 ? 1128 LEU G CG  1 
ATOM   3844  C CD1 . LEU G  1 55  ? -16.066 12.392  75.878  1.00 30.90 ? 1128 LEU G CD1 1 
ATOM   3845  C CD2 . LEU G  1 55  ? -16.444 10.771  73.974  1.00 23.41 ? 1128 LEU G CD2 1 
ATOM   3846  N N   . LYS G  1 56  ? -20.058 8.575   77.252  1.00 28.64 ? 1129 LYS G N   1 
ATOM   3847  C CA  . LYS G  1 56  ? -20.496 7.546   78.212  1.00 28.37 ? 1129 LYS G CA  1 
ATOM   3848  C C   . LYS G  1 56  ? -20.943 6.276   77.534  1.00 27.65 ? 1129 LYS G C   1 
ATOM   3849  O O   . LYS G  1 56  ? -20.535 5.192   77.933  1.00 28.29 ? 1129 LYS G O   1 
ATOM   3850  C CB  . LYS G  1 56  ? -21.606 8.055   79.111  1.00 33.31 ? 1129 LYS G CB  1 
ATOM   3851  C CG  . LYS G  1 56  ? -22.163 6.966   80.038  1.00 37.00 ? 1129 LYS G CG  1 
ATOM   3852  C CD  . LYS G  1 56  ? -22.779 7.584   81.277  1.00 49.18 ? 1129 LYS G CD  1 
ATOM   3853  C CE  . LYS G  1 56  ? -22.621 6.657   82.487  1.00 57.41 ? 1129 LYS G CE  1 
ATOM   3854  N NZ  . LYS G  1 56  ? -23.079 7.325   83.761  1.00 68.91 ? 1129 LYS G NZ  1 
ATOM   3855  N N   . LEU G  1 57  ? -21.801 6.415   76.531  1.00 27.76 ? 1130 LEU G N   1 
ATOM   3856  C CA  . LEU G  1 57  ? -22.239 5.314   75.694  1.00 26.43 ? 1130 LEU G CA  1 
ATOM   3857  C C   . LEU G  1 57  ? -21.028 4.541   75.117  1.00 23.00 ? 1130 LEU G C   1 
ATOM   3858  O O   . LEU G  1 57  ? -21.005 3.310   75.125  1.00 26.55 ? 1130 LEU G O   1 
ATOM   3859  C CB  . LEU G  1 57  ? -23.131 5.875   74.579  1.00 28.65 ? 1130 LEU G CB  1 
ATOM   3860  C CG  . LEU G  1 57  ? -24.298 5.097   73.954  1.00 39.97 ? 1130 LEU G CG  1 
ATOM   3861  C CD1 . LEU G  1 57  ? -24.304 5.233   72.411  1.00 34.06 ? 1130 LEU G CD1 1 
ATOM   3862  C CD2 . LEU G  1 57  ? -24.340 3.627   74.319  1.00 27.61 ? 1130 LEU G CD2 1 
ATOM   3863  N N   . GLY G  1 58  ? -20.029 5.268   74.609  1.00 21.29 ? 1131 GLY G N   1 
ATOM   3864  C CA  . GLY G  1 58  ? -18.786 4.678   74.162  1.00 23.60 ? 1131 GLY G CA  1 
ATOM   3865  C C   . GLY G  1 58  ? -18.138 3.747   75.201  1.00 24.09 ? 1131 GLY G C   1 
ATOM   3866  O O   . GLY G  1 58  ? -17.771 2.598   74.883  1.00 23.03 ? 1131 GLY G O   1 
ATOM   3867  N N   . GLU G  1 59  ? -17.978 4.224   76.438  1.00 25.79 ? 1132 GLU G N   1 
ATOM   3868  C CA  . GLU G  1 59  ? -17.367 3.362   77.466  1.00 26.61 ? 1132 GLU G CA  1 
ATOM   3869  C C   . GLU G  1 59  ? -18.216 2.129   77.712  1.00 23.56 ? 1132 GLU G C   1 
ATOM   3870  O O   . GLU G  1 59  ? -17.705 1.007   77.798  1.00 23.33 ? 1132 GLU G O   1 
ATOM   3871  C CB  . GLU G  1 59  ? -17.167 4.128   78.775  1.00 31.58 ? 1132 GLU G CB  1 
ATOM   3872  C CG  . GLU G  1 59  ? -16.000 5.040   78.710  1.00 35.66 ? 1132 GLU G CG  1 
ATOM   3873  C CD  . GLU G  1 59  ? -15.953 6.011   79.854  1.00 48.57 ? 1132 GLU G CD  1 
ATOM   3874  O OE1 . GLU G  1 59  ? -14.838 6.510   80.132  1.00 53.74 ? 1132 GLU G OE1 1 
ATOM   3875  O OE2 . GLU G  1 59  ? -17.018 6.279   80.465  1.00 51.82 ? 1132 GLU G OE2 1 
ATOM   3876  N N   . GLN G  1 60  ? -19.511 2.325   77.805  1.00 21.75 ? 1133 GLN G N   1 
ATOM   3877  C CA  . GLN G  1 60  ? -20.388 1.197   78.013  1.00 25.26 ? 1133 GLN G CA  1 
ATOM   3878  C C   . GLN G  1 60  ? -20.285 0.164   76.888  1.00 25.30 ? 1133 GLN G C   1 
ATOM   3879  O O   . GLN G  1 60  ? -20.123 -1.024  77.126  1.00 23.23 ? 1133 GLN G O   1 
ATOM   3880  C CB  . GLN G  1 60  ? -21.833 1.648   78.181  1.00 28.13 ? 1133 GLN G CB  1 
ATOM   3881  C CG  . GLN G  1 60  ? -22.032 2.607   79.360  1.00 27.25 ? 1133 GLN G CG  1 
ATOM   3882  C CD  . GLN G  1 60  ? -23.491 3.015   79.522  1.00 41.03 ? 1133 GLN G CD  1 
ATOM   3883  O OE1 . GLN G  1 60  ? -23.995 3.142   80.648  1.00 46.00 ? 1133 GLN G OE1 1 
ATOM   3884  N NE2 . GLN G  1 60  ? -24.174 3.232   78.397  1.00 35.18 ? 1133 GLN G NE2 1 
ATOM   3885  N N   . MET G  1 61  ? -20.367 0.626   75.652  1.00 21.57 ? 1134 MET G N   1 
ATOM   3886  C CA  . MET G  1 61  ? -20.355 -0.281  74.527  1.00 19.59 ? 1134 MET G CA  1 
ATOM   3887  C C   . MET G  1 61  ? -19.002 -0.954  74.435  1.00 20.05 ? 1134 MET G C   1 
ATOM   3888  O O   . MET G  1 61  ? -18.924 -2.094  73.995  1.00 20.98 ? 1134 MET G O   1 
ATOM   3889  C CB  . MET G  1 61  ? -20.638 0.486   73.205  1.00 19.82 ? 1134 MET G CB  1 
ATOM   3890  C CG  . MET G  1 61  ? -22.004 1.090   73.138  1.00 24.12 ? 1134 MET G CG  1 
ATOM   3891  S SD  . MET G  1 61  ? -22.247 1.971   71.538  1.00 25.43 ? 1134 MET G SD  1 
ATOM   3892  C CE  . MET G  1 61  ? -22.060 0.632   70.365  1.00 25.26 ? 1134 MET G CE  1 
ATOM   3893  N N   . THR G  1 62  ? -17.932 -0.206  74.730  1.00 21.59 ? 1135 THR G N   1 
ATOM   3894  C CA  . THR G  1 62  ? -16.617 -0.794  74.662  1.00 19.83 ? 1135 THR G CA  1 
ATOM   3895  C C   . THR G  1 62  ? -16.441 -1.890  75.694  1.00 22.88 ? 1135 THR G C   1 
ATOM   3896  O O   . THR G  1 62  ? -15.904 -2.969  75.397  1.00 24.09 ? 1135 THR G O   1 
ATOM   3897  C CB  . THR G  1 62  ? -15.522 0.250   74.852  1.00 23.67 ? 1135 THR G CB  1 
ATOM   3898  O OG1 . THR G  1 62  ? -15.673 1.233   73.819  1.00 23.02 ? 1135 THR G OG1 1 
ATOM   3899  C CG2 . THR G  1 62  ? -14.177 -0.353  74.698  1.00 22.99 ? 1135 THR G CG2 1 
ATOM   3900  N N   . GLN G  1 63  ? -16.929 -1.612  76.896  1.00 20.03 ? 1136 GLN G N   1 
ATOM   3901  C CA  . GLN G  1 63  ? -16.808 -2.635  77.964  1.00 21.35 ? 1136 GLN G CA  1 
ATOM   3902  C C   . GLN G  1 63  ? -17.668 -3.844  77.698  1.00 22.06 ? 1136 GLN G C   1 
ATOM   3903  O O   . GLN G  1 63  ? -17.334 -4.959  78.127  1.00 22.91 ? 1136 GLN G O   1 
ATOM   3904  C CB  . GLN G  1 63  ? -17.168 -2.016  79.307  1.00 21.47 ? 1136 GLN G CB  1 
ATOM   3905  C CG  . GLN G  1 63  ? -16.186 -0.944  79.764  1.00 25.99 ? 1136 GLN G CG  1 
ATOM   3906  C CD  . GLN G  1 63  ? -16.742 -0.084  80.859  1.00 28.51 ? 1136 GLN G CD  1 
ATOM   3907  O OE1 . GLN G  1 63  ? -17.691 -0.486  81.566  1.00 34.98 ? 1136 GLN G OE1 1 
ATOM   3908  N NE2 . GLN G  1 63  ? -16.194 1.118   81.004  1.00 30.94 ? 1136 GLN G NE2 1 
ATOM   3909  N N   . GLU G  1 64  ? -18.746 -3.680  76.950  1.00 22.69 ? 1137 GLU G N   1 
ATOM   3910  C CA  . GLU G  1 64  ? -19.583 -4.836  76.614  1.00 24.04 ? 1137 GLU G CA  1 
ATOM   3911  C C   . GLU G  1 64  ? -18.969 -5.684  75.541  1.00 25.90 ? 1137 GLU G C   1 
ATOM   3912  O O   . GLU G  1 64  ? -19.029 -6.902  75.594  1.00 29.84 ? 1137 GLU G O   1 
ATOM   3913  C CB  . GLU G  1 64  ? -20.976 -4.387  76.152  1.00 24.21 ? 1137 GLU G CB  1 
ATOM   3914  C CG  . GLU G  1 64  ? -21.740 -3.711  77.221  1.00 29.79 ? 1137 GLU G CG  1 
ATOM   3915  C CD  . GLU G  1 64  ? -23.022 -3.128  76.677  1.00 36.45 ? 1137 GLU G CD  1 
ATOM   3916  O OE1 . GLU G  1 64  ? -23.440 -2.066  77.209  1.00 35.65 ? 1137 GLU G OE1 1 
ATOM   3917  O OE2 . GLU G  1 64  ? -23.561 -3.739  75.704  1.00 36.79 ? 1137 GLU G OE2 1 
ATOM   3918  N N   . ALA G  1 65  ? -18.332 -5.032  74.574  1.00 24.09 ? 1138 ALA G N   1 
ATOM   3919  C CA  . ALA G  1 65  ? -17.762 -5.710  73.417  1.00 22.94 ? 1138 ALA G CA  1 
ATOM   3920  C C   . ALA G  1 65  ? -16.373 -6.332  73.671  1.00 25.10 ? 1138 ALA G C   1 
ATOM   3921  O O   . ALA G  1 65  ? -15.964 -7.251  72.956  1.00 28.38 ? 1138 ALA G O   1 
ATOM   3922  C CB  . ALA G  1 65  ? -17.649 -4.699  72.247  1.00 28.99 ? 1138 ALA G CB  1 
ATOM   3923  N N   . ARG G  1 66  ? -15.653 -5.800  74.646  1.00 20.90 ? 1139 ARG G N   1 
ATOM   3924  C CA  . ARG G  1 66  ? -14.246 -6.137  74.823  1.00 21.86 ? 1139 ARG G CA  1 
ATOM   3925  C C   . ARG G  1 66  ? -13.607 -6.020  73.452  1.00 27.24 ? 1139 ARG G C   1 
ATOM   3926  O O   . ARG G  1 66  ? -12.946 -6.917  72.971  1.00 24.89 ? 1139 ARG G O   1 
ATOM   3927  C CB  . ARG G  1 66  ? -14.072 -7.593  75.285  1.00 27.27 ? 1139 ARG G CB  1 
ATOM   3928  C CG  . ARG G  1 66  ? -13.944 -7.717  76.766  1.00 33.56 ? 1139 ARG G CG  1 
ATOM   3929  C CD  . ARG G  1 66  ? -15.287 -7.795  77.414  1.00 35.91 ? 1139 ARG G CD  1 
ATOM   3930  N NE  . ARG G  1 66  ? -15.621 -9.189  77.606  1.00 40.09 ? 1139 ARG G NE  1 
ATOM   3931  C CZ  . ARG G  1 66  ? -16.682 -9.616  78.271  1.00 43.62 ? 1139 ARG G CZ  1 
ATOM   3932  N NH1 . ARG G  1 66  ? -16.884 -10.921 78.389  1.00 46.36 ? 1139 ARG G NH1 1 
ATOM   3933  N NH2 . ARG G  1 66  ? -17.533 -8.741  78.817  1.00 45.44 ? 1139 ARG G NH2 1 
ATOM   3934  N N   . GLU G  1 67  ? -13.835 -4.885  72.802  1.00 24.71 ? 1140 GLU G N   1 
ATOM   3935  C CA  . GLU G  1 67  ? -13.219 -4.707  71.482  1.00 23.57 ? 1140 GLU G CA  1 
ATOM   3936  C C   . GLU G  1 67  ? -13.050 -3.205  71.359  1.00 20.81 ? 1140 GLU G C   1 
ATOM   3937  O O   . GLU G  1 67  ? -13.904 -2.453  71.789  1.00 21.95 ? 1140 GLU G O   1 
ATOM   3938  C CB  . GLU G  1 67  ? -14.158 -5.259  70.415  1.00 28.96 ? 1140 GLU G CB  1 
ATOM   3939  C CG  . GLU G  1 67  ? -13.781 -5.030  68.968  1.00 29.33 ? 1140 GLU G CG  1 
ATOM   3940  C CD  . GLU G  1 67  ? -14.726 -5.755  67.995  1.00 38.93 ? 1140 GLU G CD  1 
ATOM   3941  O OE1 . GLU G  1 67  ? -15.964 -5.861  68.263  1.00 42.37 ? 1140 GLU G OE1 1 
ATOM   3942  O OE2 . GLU G  1 67  ? -14.219 -6.202  66.946  1.00 41.51 ? 1140 GLU G OE2 1 
ATOM   3943  N N   . HIS G  1 68  ? -11.948 -2.742  70.780  1.00 19.44 ? 1141 HIS G N   1 
ATOM   3944  C CA  . HIS G  1 68  ? -11.795 -1.294  70.666  1.00 20.39 ? 1141 HIS G CA  1 
ATOM   3945  C C   . HIS G  1 68  ? -12.799 -0.739  69.655  1.00 20.25 ? 1141 HIS G C   1 
ATOM   3946  O O   . HIS G  1 68  ? -12.963 -1.287  68.559  1.00 21.39 ? 1141 HIS G O   1 
ATOM   3947  C CB  . HIS G  1 68  ? -10.364 -0.972  70.190  1.00 19.59 ? 1141 HIS G CB  1 
ATOM   3948  C CG  . HIS G  1 68  ? -10.134 0.485   69.947  1.00 25.14 ? 1141 HIS G CG  1 
ATOM   3949  N ND1 . HIS G  1 68  ? -10.024 1.414   70.962  1.00 26.29 ? 1141 HIS G ND1 1 
ATOM   3950  C CD2 . HIS G  1 68  ? -10.045 1.183   68.788  1.00 25.08 ? 1141 HIS G CD2 1 
ATOM   3951  C CE1 . HIS G  1 68  ? -9.834  2.616   70.438  1.00 28.15 ? 1141 HIS G CE1 1 
ATOM   3952  N NE2 . HIS G  1 68  ? -9.859  2.503   69.123  1.00 24.77 ? 1141 HIS G NE2 1 
ATOM   3953  N N   . LEU G  1 69  ? -13.469 0.339   70.040  1.00 18.20 ? 1142 LEU G N   1 
ATOM   3954  C CA  . LEU G  1 69  ? -14.437 0.962   69.179  1.00 19.31 ? 1142 LEU G CA  1 
ATOM   3955  C C   . LEU G  1 69  ? -13.956 2.373   68.883  1.00 17.64 ? 1142 LEU G C   1 
ATOM   3956  O O   . LEU G  1 69  ? -13.544 3.135   69.784  1.00 18.99 ? 1142 LEU G O   1 
ATOM   3957  C CB  . LEU G  1 69  ? -15.819 1.043   69.842  1.00 21.62 ? 1142 LEU G CB  1 
ATOM   3958  C CG  . LEU G  1 69  ? -16.355 -0.286  70.390  1.00 17.83 ? 1142 LEU G CG  1 
ATOM   3959  C CD1 . LEU G  1 69  ? -17.652 -0.013  71.165  1.00 20.64 ? 1142 LEU G CD1 1 
ATOM   3960  C CD2 . LEU G  1 69  ? -16.552 -1.290  69.269  1.00 17.83 ? 1142 LEU G CD2 1 
ATOM   3961  N N   . TYR G  1 70  ? -14.014 2.690   67.591  1.00 17.16 ? 1143 TYR G N   1 
ATOM   3962  C CA  . TYR G  1 70  ? -13.768 4.034   67.100  1.00 16.84 ? 1143 TYR G CA  1 
ATOM   3963  C C   . TYR G  1 70  ? -15.026 4.837   67.191  1.00 16.23 ? 1143 TYR G C   1 
ATOM   3964  O O   . TYR G  1 70  ? -16.108 4.313   66.949  1.00 18.53 ? 1143 TYR G O   1 
ATOM   3965  C CB  . TYR G  1 70  ? -13.413 3.934   65.608  1.00 14.79 ? 1143 TYR G CB  1 
ATOM   3966  C CG  . TYR G  1 70  ? -12.084 3.303   65.402  1.00 17.62 ? 1143 TYR G CG  1 
ATOM   3967  C CD1 . TYR G  1 70  ? -10.934 4.077   65.332  1.00 19.34 ? 1143 TYR G CD1 1 
ATOM   3968  C CD2 . TYR G  1 70  ? -11.963 1.929   65.301  1.00 20.51 ? 1143 TYR G CD2 1 
ATOM   3969  C CE1 . TYR G  1 70  ? -9.724  3.510   65.147  1.00 18.97 ? 1143 TYR G CE1 1 
ATOM   3970  C CE2 . TYR G  1 70  ? -10.733 1.347   65.094  1.00 20.42 ? 1143 TYR G CE2 1 
ATOM   3971  C CZ  . TYR G  1 70  ? -9.617  2.154   65.014  1.00 22.10 ? 1143 TYR G CZ  1 
ATOM   3972  O OH  . TYR G  1 70  ? -8.389  1.576   64.811  1.00 24.04 ? 1143 TYR G OH  1 
ATOM   3973  N N   . LEU G  1 71  ? -14.884 6.111   67.550  1.00 16.55 ? 1144 LEU G N   1 
ATOM   3974  C CA  . LEU G  1 71  ? -15.973 7.066   67.449  1.00 14.41 ? 1144 LEU G CA  1 
ATOM   3975  C C   . LEU G  1 71  ? -16.052 7.663   66.057  1.00 17.46 ? 1144 LEU G C   1 
ATOM   3976  O O   . LEU G  1 71  ? -15.057 8.124   65.557  1.00 17.41 ? 1144 LEU G O   1 
ATOM   3977  C CB  . LEU G  1 71  ? -15.693 8.201   68.437  1.00 15.37 ? 1144 LEU G CB  1 
ATOM   3978  C CG  . LEU G  1 71  ? -16.704 9.320   68.470  1.00 18.77 ? 1144 LEU G CG  1 
ATOM   3979  C CD1 . LEU G  1 71  ? -18.101 8.752   68.763  1.00 19.34 ? 1144 LEU G CD1 1 
ATOM   3980  C CD2 . LEU G  1 71  ? -16.276 10.384  69.532  1.00 20.73 ? 1144 LEU G CD2 1 
ATOM   3981  N N   . VAL G  1 72  ? -17.188 7.554   65.420  1.00 15.42 ? 1145 VAL G N   1 
ATOM   3982  C CA  . VAL G  1 72  ? -17.327 8.185   64.089  1.00 17.06 ? 1145 VAL G CA  1 
ATOM   3983  C C   . VAL G  1 72  ? -18.433 9.200   64.115  1.00 19.50 ? 1145 VAL G C   1 
ATOM   3984  O O   . VAL G  1 72  ? -19.407 9.052   64.860  1.00 18.90 ? 1145 VAL G O   1 
ATOM   3985  C CB  . VAL G  1 72  ? -17.580 7.143   62.992  1.00 17.81 ? 1145 VAL G CB  1 
ATOM   3986  C CG1 . VAL G  1 72  ? -16.461 6.122   63.062  1.00 17.29 ? 1145 VAL G CG1 1 
ATOM   3987  C CG2 . VAL G  1 72  ? -18.995 6.461   63.142  1.00 17.96 ? 1145 VAL G CG2 1 
ATOM   3988  N N   . LEU G  1 73  ? -18.291 10.247  63.297  1.00 15.53 ? 1146 LEU G N   1 
ATOM   3989  C CA  . LEU G  1 73  ? -19.367 11.225  63.106  1.00 17.08 ? 1146 LEU G CA  1 
ATOM   3990  C C   . LEU G  1 73  ? -19.769 11.147  61.633  1.00 15.95 ? 1146 LEU G C   1 
ATOM   3991  O O   . LEU G  1 73  ? -18.938 11.352  60.742  1.00 14.98 ? 1146 LEU G O   1 
ATOM   3992  C CB  . LEU G  1 73  ? -18.837 12.612  63.416  1.00 20.03 ? 1146 LEU G CB  1 
ATOM   3993  C CG  . LEU G  1 73  ? -19.781 13.775  63.133  1.00 19.30 ? 1146 LEU G CG  1 
ATOM   3994  C CD1 . LEU G  1 73  ? -21.011 13.737  64.053  1.00 21.98 ? 1146 LEU G CD1 1 
ATOM   3995  C CD2 . LEU G  1 73  ? -18.974 15.029  63.381  1.00 24.12 ? 1146 LEU G CD2 1 
ATOM   3996  N N   . PHE G  1 74  ? -21.021 10.823  61.379  1.00 14.19 ? 1147 PHE G N   1 
ATOM   3997  C CA  . PHE G  1 74  ? -21.473 10.617  60.001  1.00 14.86 ? 1147 PHE G CA  1 
ATOM   3998  C C   . PHE G  1 74  ? -21.645 11.949  59.279  1.00 18.42 ? 1147 PHE G C   1 
ATOM   3999  O O   . PHE G  1 74  ? -21.893 12.978  59.910  1.00 18.33 ? 1147 PHE G O   1 
ATOM   4000  C CB  . PHE G  1 74  ? -22.817 9.905   59.987  1.00 15.84 ? 1147 PHE G CB  1 
ATOM   4001  C CG  . PHE G  1 74  ? -22.714 8.481   60.376  1.00 16.13 ? 1147 PHE G CG  1 
ATOM   4002  C CD1 . PHE G  1 74  ? -22.162 7.549   59.500  1.00 18.51 ? 1147 PHE G CD1 1 
ATOM   4003  C CD2 . PHE G  1 74  ? -23.158 8.089   61.624  1.00 17.86 ? 1147 PHE G CD2 1 
ATOM   4004  C CE1 . PHE G  1 74  ? -22.074 6.192   59.872  1.00 19.48 ? 1147 PHE G CE1 1 
ATOM   4005  C CE2 . PHE G  1 74  ? -23.084 6.738   61.991  1.00 21.06 ? 1147 PHE G CE2 1 
ATOM   4006  C CZ  . PHE G  1 74  ? -22.540 5.807   61.111  1.00 20.23 ? 1147 PHE G CZ  1 
ATOM   4007  N N   . PHE G  1 75  ? -21.472 11.923  57.962  1.00 17.30 ? 1148 PHE G N   1 
ATOM   4008  C CA  . PHE G  1 75  ? -21.768 13.109  57.146  1.00 16.93 ? 1148 PHE G CA  1 
ATOM   4009  C C   . PHE G  1 75  ? -23.223 13.164  56.726  1.00 19.00 ? 1148 PHE G C   1 
ATOM   4010  O O   . PHE G  1 75  ? -23.549 13.656  55.646  1.00 20.19 ? 1148 PHE G O   1 
ATOM   4011  C CB  . PHE G  1 75  ? -20.868 13.135  55.884  1.00 16.44 ? 1148 PHE G CB  1 
ATOM   4012  C CG  . PHE G  1 75  ? -19.446 13.520  56.175  1.00 18.53 ? 1148 PHE G CG  1 
ATOM   4013  C CD1 . PHE G  1 75  ? -19.098 14.850  56.319  1.00 19.18 ? 1148 PHE G CD1 1 
ATOM   4014  C CD2 . PHE G  1 75  ? -18.468 12.553  56.381  1.00 15.68 ? 1148 PHE G CD2 1 
ATOM   4015  C CE1 . PHE G  1 75  ? -17.803 15.234  56.595  1.00 20.12 ? 1148 PHE G CE1 1 
ATOM   4016  C CE2 . PHE G  1 75  ? -17.147 12.935  56.647  1.00 16.48 ? 1148 PHE G CE2 1 
ATOM   4017  C CZ  . PHE G  1 75  ? -16.828 14.291  56.809  1.00 16.74 ? 1148 PHE G CZ  1 
ATOM   4018  N N   . ASP G  1 76  ? -24.109 12.659  57.588  1.00 17.26 ? 1149 ASP G N   1 
ATOM   4019  C CA  . ASP G  1 76  ? -25.529 12.784  57.370  1.00 21.62 ? 1149 ASP G CA  1 
ATOM   4020  C C   . ASP G  1 76  ? -26.073 14.190  57.706  1.00 18.98 ? 1149 ASP G C   1 
ATOM   4021  O O   . ASP G  1 76  ? -25.364 15.005  58.270  1.00 21.91 ? 1149 ASP G O   1 
ATOM   4022  C CB  . ASP G  1 76  ? -26.282 11.665  58.083  1.00 22.74 ? 1149 ASP G CB  1 
ATOM   4023  C CG  . ASP G  1 76  ? -26.061 11.621  59.598  1.00 24.29 ? 1149 ASP G CG  1 
ATOM   4024  O OD1 . ASP G  1 76  ? -25.189 12.300  60.160  1.00 22.70 ? 1149 ASP G OD1 1 
ATOM   4025  O OD2 . ASP G  1 76  ? -26.797 10.822  60.258  1.00 28.30 ? 1149 ASP G OD2 1 
ATOM   4026  N N   . ASN G  1 77  ? -27.313 14.439  57.327  1.00 25.59 ? 1150 ASN G N   1 
ATOM   4027  C CA  . ASN G  1 77  ? -27.922 15.752  57.567  1.00 27.16 ? 1150 ASN G CA  1 
ATOM   4028  C C   . ASN G  1 77  ? -27.813 16.165  59.006  1.00 26.64 ? 1150 ASN G C   1 
ATOM   4029  O O   . ASN G  1 77  ? -27.448 17.311  59.331  1.00 32.26 ? 1150 ASN G O   1 
ATOM   4030  C CB  . ASN G  1 77  ? -29.397 15.681  57.228  1.00 30.73 ? 1150 ASN G CB  1 
ATOM   4031  C CG  . ASN G  1 77  ? -29.637 15.739  55.769  1.00 37.69 ? 1150 ASN G CG  1 
ATOM   4032  O OD1 . ASN G  1 77  ? -28.718 16.011  54.998  1.00 38.23 ? 1150 ASN G OD1 1 
ATOM   4033  N ND2 . ASN G  1 77  ? -30.877 15.480  55.357  1.00 42.75 ? 1150 ASN G ND2 1 
ATOM   4034  N N   . LYS G  1 78  ? -28.108 15.217  59.884  1.00 26.12 ? 1151 LYS G N   1 
ATOM   4035  C CA  . LYS G  1 78  ? -28.125 15.514  61.312  1.00 30.19 ? 1151 LYS G CA  1 
ATOM   4036  C C   . LYS G  1 78  ? -26.776 15.405  62.000  1.00 31.99 ? 1151 LYS G C   1 
ATOM   4037  O O   . LYS G  1 78  ? -26.677 15.740  63.165  1.00 29.05 ? 1151 LYS G O   1 
ATOM   4038  C CB  . LYS G  1 78  ? -29.144 14.631  62.021  1.00 29.57 ? 1151 LYS G CB  1 
ATOM   4039  C CG  . LYS G  1 78  ? -30.557 15.125  61.835  1.00 39.68 ? 1151 LYS G CG  1 
ATOM   4040  C CD  . LYS G  1 78  ? -31.552 14.142  62.396  1.00 48.10 ? 1151 LYS G CD  1 
ATOM   4041  C CE  . LYS G  1 78  ? -31.488 12.804  61.672  1.00 47.40 ? 1151 LYS G CE  1 
ATOM   4042  N NZ  . LYS G  1 78  ? -32.765 12.057  61.883  1.00 56.19 ? 1151 LYS G NZ  1 
ATOM   4043  N N   . ARG G  1 79  ? -25.742 14.926  61.290  1.00 26.55 ? 1152 ARG G N   1 
ATOM   4044  C CA  . ARG G  1 79  ? -24.410 14.734  61.881  1.00 20.50 ? 1152 ARG G CA  1 
ATOM   4045  C C   . ARG G  1 79  ? -24.479 13.891  63.172  1.00 20.79 ? 1152 ARG G C   1 
ATOM   4046  O O   . ARG G  1 79  ? -24.269 14.407  64.289  1.00 22.61 ? 1152 ARG G O   1 
ATOM   4047  C CB  . ARG G  1 79  ? -23.725 16.074  62.146  1.00 23.53 ? 1152 ARG G CB  1 
ATOM   4048  C CG  . ARG G  1 79  ? -23.373 16.939  60.888  1.00 30.18 ? 1152 ARG G CG  1 
ATOM   4049  C CD  . ARG G  1 79  ? -22.584 16.174  59.764  1.00 27.70 ? 1152 ARG G CD  1 
ATOM   4050  N NE  . ARG G  1 79  ? -21.131 16.004  59.932  1.00 25.03 ? 1152 ARG G NE  1 
ATOM   4051  C CZ  . ARG G  1 79  ? -20.215 16.964  59.823  1.00 27.10 ? 1152 ARG G CZ  1 
ATOM   4052  N NH1 . ARG G  1 79  ? -20.588 18.228  59.571  1.00 29.47 ? 1152 ARG G NH1 1 
ATOM   4053  N NH2 . ARG G  1 79  ? -18.924 16.689  59.989  1.00 24.69 ? 1152 ARG G NH2 1 
ATOM   4054  N N   . THR G  1 80  ? -24.732 12.602  62.994  1.00 20.08 ? 1153 THR G N   1 
ATOM   4055  C CA  . THR G  1 80  ? -24.996 11.677  64.104  1.00 21.36 ? 1153 THR G CA  1 
ATOM   4056  C C   . THR G  1 80  ? -23.729 10.879  64.414  1.00 21.54 ? 1153 THR G C   1 
ATOM   4057  O O   . THR G  1 80  ? -22.799 10.845  63.582  1.00 21.89 ? 1153 THR G O   1 
ATOM   4058  C CB  . THR G  1 80  ? -26.176 10.709  63.811  1.00 23.55 ? 1153 THR G CB  1 
ATOM   4059  O OG1 . THR G  1 80  ? -25.924 9.951   62.608  1.00 23.31 ? 1153 THR G OG1 1 
ATOM   4060  C CG2 . THR G  1 80  ? -27.519 11.448  63.659  1.00 26.85 ? 1153 THR G CG2 1 
ATOM   4061  N N   . TRP G  1 81  ? -23.672 10.314  65.619  1.00 18.58 ? 1154 TRP G N   1 
ATOM   4062  C CA  . TRP G  1 81  ? -22.471 9.608   66.115  1.00 18.00 ? 1154 TRP G CA  1 
ATOM   4063  C C   . TRP G  1 81  ? -22.686 8.115   66.232  1.00 21.06 ? 1154 TRP G C   1 
ATOM   4064  O O   . TRP G  1 81  ? -23.802 7.651   66.451  1.00 22.68 ? 1154 TRP G O   1 
ATOM   4065  C CB  . TRP G  1 81  ? -22.088 10.110  67.507  1.00 20.96 ? 1154 TRP G CB  1 
ATOM   4066  C CG  . TRP G  1 81  ? -21.850 11.574  67.626  1.00 20.41 ? 1154 TRP G CG  1 
ATOM   4067  C CD1 . TRP G  1 81  ? -22.778 12.534  67.920  1.00 23.45 ? 1154 TRP G CD1 1 
ATOM   4068  C CD2 . TRP G  1 81  ? -20.588 12.240  67.539  1.00 17.61 ? 1154 TRP G CD2 1 
ATOM   4069  N NE1 . TRP G  1 81  ? -22.178 13.779  67.982  1.00 22.10 ? 1154 TRP G NE1 1 
ATOM   4070  C CE2 . TRP G  1 81  ? -20.837 13.640  67.772  1.00 19.35 ? 1154 TRP G CE2 1 
ATOM   4071  C CE3 . TRP G  1 81  ? -19.275 11.815  67.290  1.00 21.59 ? 1154 TRP G CE3 1 
ATOM   4072  C CZ2 . TRP G  1 81  ? -19.827 14.574  67.788  1.00 23.44 ? 1154 TRP G CZ2 1 
ATOM   4073  C CZ3 . TRP G  1 81  ? -18.300 12.712  67.287  1.00 19.52 ? 1154 TRP G CZ3 1 
ATOM   4074  C CH2 . TRP G  1 81  ? -18.565 14.119  67.516  1.00 22.53 ? 1154 TRP G CH2 1 
ATOM   4075  N N   . GLN G  1 82  ? -21.607 7.365   66.126  1.00 16.08 ? 1155 GLN G N   1 
ATOM   4076  C CA  . GLN G  1 82  ? -21.691 5.925   66.476  1.00 19.37 ? 1155 GLN G CA  1 
ATOM   4077  C C   . GLN G  1 82  ? -20.331 5.429   66.916  1.00 21.49 ? 1155 GLN G C   1 
ATOM   4078  O O   . GLN G  1 82  ? -19.325 6.082   66.670  1.00 19.33 ? 1155 GLN G O   1 
ATOM   4079  C CB  . GLN G  1 82  ? -22.183 5.126   65.281  1.00 21.13 ? 1155 GLN G CB  1 
ATOM   4080  C CG  . GLN G  1 82  ? -23.620 4.608   65.415  1.00 33.74 ? 1155 GLN G CG  1 
ATOM   4081  C CD  . GLN G  1 82  ? -23.898 3.815   66.703  1.00 37.04 ? 1155 GLN G CD  1 
ATOM   4082  O OE1 . GLN G  1 82  ? -22.987 3.333   67.373  1.00 33.05 ? 1155 GLN G OE1 1 
ATOM   4083  N NE2 . GLN G  1 82  ? -25.179 3.717   67.068  1.00 37.77 ? 1155 GLN G NE2 1 
ATOM   4084  N N   . TRP G  1 83  ? -20.305 4.281   67.611  1.00 17.94 ? 1156 TRP G N   1 
ATOM   4085  C CA  . TRP G  1 83  ? -19.055 3.684   68.041  1.00 19.22 ? 1156 TRP G CA  1 
ATOM   4086  C C   . TRP G  1 83  ? -18.959 2.353   67.335  1.00 20.36 ? 1156 TRP G C   1 
ATOM   4087  O O   . TRP G  1 83  ? -19.889 1.554   67.374  1.00 19.90 ? 1156 TRP G O   1 
ATOM   4088  C CB  . TRP G  1 83  ? -19.091 3.426   69.551  1.00 17.48 ? 1156 TRP G CB  1 
ATOM   4089  C CG  . TRP G  1 83  ? -19.048 4.651   70.364  1.00 18.42 ? 1156 TRP G CG  1 
ATOM   4090  C CD1 . TRP G  1 83  ? -20.105 5.404   70.803  1.00 18.14 ? 1156 TRP G CD1 1 
ATOM   4091  C CD2 . TRP G  1 83  ? -17.871 5.296   70.850  1.00 19.62 ? 1156 TRP G CD2 1 
ATOM   4092  N NE1 . TRP G  1 83  ? -19.659 6.452   71.553  1.00 17.43 ? 1156 TRP G NE1 1 
ATOM   4093  C CE2 . TRP G  1 83  ? -18.286 6.427   71.576  1.00 16.98 ? 1156 TRP G CE2 1 
ATOM   4094  C CE3 . TRP G  1 83  ? -16.489 5.023   70.728  1.00 18.27 ? 1156 TRP G CE3 1 
ATOM   4095  C CZ2 . TRP G  1 83  ? -17.395 7.255   72.238  1.00 21.16 ? 1156 TRP G CZ2 1 
ATOM   4096  C CZ3 . TRP G  1 83  ? -15.595 5.860   71.384  1.00 22.23 ? 1156 TRP G CZ3 1 
ATOM   4097  C CH2 . TRP G  1 83  ? -16.060 6.987   72.109  1.00 20.04 ? 1156 TRP G CH2 1 
ATOM   4098  N N   . LEU G  1 84  ? -17.872 2.132   66.611  1.00 15.20 ? 1157 LEU G N   1 
ATOM   4099  C CA  . LEU G  1 84  ? -17.780 0.949   65.723  1.00 16.58 ? 1157 LEU G CA  1 
ATOM   4100  C C   . LEU G  1 84  ? -16.422 0.315   65.801  1.00 15.72 ? 1157 LEU G C   1 
ATOM   4101  O O   . LEU G  1 84  ? -15.386 1.001   65.858  1.00 18.02 ? 1157 LEU G O   1 
ATOM   4102  C CB  . LEU G  1 84  ? -18.013 1.374   64.237  1.00 16.32 ? 1157 LEU G CB  1 
ATOM   4103  C CG  . LEU G  1 84  ? -19.443 1.876   63.968  1.00 18.55 ? 1157 LEU G CG  1 
ATOM   4104  C CD1 . LEU G  1 84  ? -19.548 2.341   62.506  1.00 18.16 ? 1157 LEU G CD1 1 
ATOM   4105  C CD2 . LEU G  1 84  ? -20.435 0.819   64.267  1.00 23.04 ? 1157 LEU G CD2 1 
ATOM   4106  N N   . PRO G  1 85  ? -16.371 -1.037  65.701  1.00 18.65 ? 1158 PRO G N   1 
ATOM   4107  C CA  . PRO G  1 85  ? -15.066 -1.681  65.698  1.00 18.95 ? 1158 PRO G CA  1 
ATOM   4108  C C   . PRO G  1 85  ? -14.374 -1.556  64.335  1.00 17.88 ? 1158 PRO G C   1 
ATOM   4109  O O   . PRO G  1 85  ? -15.008 -1.258  63.320  1.00 18.12 ? 1158 PRO G O   1 
ATOM   4110  C CB  . PRO G  1 85  ? -15.403 -3.146  65.910  1.00 21.51 ? 1158 PRO G CB  1 
ATOM   4111  C CG  . PRO G  1 85  ? -16.757 -3.294  65.273  1.00 18.88 ? 1158 PRO G CG  1 
ATOM   4112  C CD  . PRO G  1 85  ? -17.485 -2.000  65.648  1.00 18.83 ? 1158 PRO G CD  1 
ATOM   4113  N N   . ARG G  1 86  ? -13.080 -1.830  64.334  1.00 19.79 ? 1159 ARG G N   1 
ATOM   4114  C CA  . ARG G  1 86  ? -12.274 -1.753  63.105  1.00 23.38 ? 1159 ARG G CA  1 
ATOM   4115  C C   . ARG G  1 86  ? -12.882 -2.505  61.914  1.00 24.05 ? 1159 ARG G C   1 
ATOM   4116  O O   . ARG G  1 86  ? -12.809 -2.035  60.801  1.00 18.78 ? 1159 ARG G O   1 
ATOM   4117  C CB  . ARG G  1 86  ? -10.863 -2.284  63.369  1.00 19.14 ? 1159 ARG G CB  1 
ATOM   4118  C CG  . ARG G  1 86  ? -10.035 -2.362  62.097  1.00 24.78 ? 1159 ARG G CG  1 
ATOM   4119  C CD  . ARG G  1 86  ? -9.634  -0.917  61.723  1.00 25.49 ? 1159 ARG G CD  1 
ATOM   4120  N NE  . ARG G  1 86  ? -8.796  -0.780  60.507  1.00 26.07 ? 1159 ARG G NE  1 
ATOM   4121  C CZ  . ARG G  1 86  ? -9.221  -0.838  59.250  1.00 27.05 ? 1159 ARG G CZ  1 
ATOM   4122  N NH1 . ARG G  1 86  ? -8.359  -0.669  58.252  1.00 27.41 ? 1159 ARG G NH1 1 
ATOM   4123  N NH2 . ARG G  1 86  ? -10.484 -1.083  58.966  1.00 23.49 ? 1159 ARG G NH2 1 
ATOM   4124  N N   . THR G  1 87  ? -13.515 -3.655  62.161  1.00 19.70 ? 1160 THR G N   1 
ATOM   4125  C CA  . THR G  1 87  ? -14.060 -4.502  61.120  1.00 19.85 ? 1160 THR G CA  1 
ATOM   4126  C C   . THR G  1 87  ? -15.270 -3.882  60.422  1.00 20.98 ? 1160 THR G C   1 
ATOM   4127  O O   . THR G  1 87  ? -15.714 -4.399  59.398  1.00 22.83 ? 1160 THR G O   1 
ATOM   4128  C CB  . THR G  1 87  ? -14.564 -5.843  61.722  1.00 23.17 ? 1160 THR G CB  1 
ATOM   4129  O OG1 . THR G  1 87  ? -15.466 -5.547  62.797  1.00 26.61 ? 1160 THR G OG1 1 
ATOM   4130  C CG2 . THR G  1 87  ? -13.416 -6.662  62.249  1.00 31.73 ? 1160 THR G CG2 1 
ATOM   4131  N N   . LYS G  1 88  ? -15.781 -2.768  60.937  1.00 18.76 ? 1161 LYS G N   1 
ATOM   4132  C CA  . LYS G  1 88  ? -16.914 -2.121  60.311  1.00 19.45 ? 1161 LYS G CA  1 
ATOM   4133  C C   . LYS G  1 88  ? -16.513 -0.840  59.646  1.00 17.59 ? 1161 LYS G C   1 
ATOM   4134  O O   . LYS G  1 88  ? -17.374 -0.099  59.215  1.00 17.13 ? 1161 LYS G O   1 
ATOM   4135  C CB  . LYS G  1 88  ? -18.034 -1.795  61.301  1.00 20.80 ? 1161 LYS G CB  1 
ATOM   4136  C CG  . LYS G  1 88  ? -18.516 -3.055  62.019  1.00 23.11 ? 1161 LYS G CG  1 
ATOM   4137  C CD  . LYS G  1 88  ? -19.398 -3.850  61.161  1.00 23.99 ? 1161 LYS G CD  1 
ATOM   4138  C CE  . LYS G  1 88  ? -19.945 -5.042  62.003  1.00 31.70 ? 1161 LYS G CE  1 
ATOM   4139  N NZ  . LYS G  1 88  ? -20.274 -6.180  61.113  1.00 29.86 ? 1161 LYS G NZ  1 
ATOM   4140  N N   . LEU G  1 89  ? -15.204 -0.598  59.522  1.00 16.13 ? 1162 LEU G N   1 
ATOM   4141  C CA  . LEU G  1 89  ? -14.730 0.645   58.880  1.00 15.63 ? 1162 LEU G CA  1 
ATOM   4142  C C   . LEU G  1 89  ? -13.808 0.338   57.710  1.00 20.31 ? 1162 LEU G C   1 
ATOM   4143  O O   . LEU G  1 89  ? -13.003 -0.626  57.757  1.00 21.14 ? 1162 LEU G O   1 
ATOM   4144  C CB  . LEU G  1 89  ? -13.938 1.468   59.908  1.00 16.07 ? 1162 LEU G CB  1 
ATOM   4145  C CG  . LEU G  1 89  ? -14.663 1.789   61.221  1.00 18.98 ? 1162 LEU G CG  1 
ATOM   4146  C CD1 . LEU G  1 89  ? -13.706 2.523   62.139  1.00 20.68 ? 1162 LEU G CD1 1 
ATOM   4147  C CD2 . LEU G  1 89  ? -15.965 2.599   60.917  1.00 15.52 ? 1162 LEU G CD2 1 
ATOM   4148  N N   . VAL G  1 90  ? -13.940 1.119   56.648  1.00 16.17 ? 1163 VAL G N   1 
ATOM   4149  C CA  . VAL G  1 90  ? -12.982 1.024   55.535  1.00 17.35 ? 1163 VAL G CA  1 
ATOM   4150  C C   . VAL G  1 90  ? -12.584 2.430   55.118  1.00 16.46 ? 1163 VAL G C   1 
ATOM   4151  O O   . VAL G  1 90  ? -13.392 3.318   55.046  1.00 16.84 ? 1163 VAL G O   1 
ATOM   4152  C CB  . VAL G  1 90  ? -13.592 0.240   54.292  1.00 20.75 ? 1163 VAL G CB  1 
ATOM   4153  C CG1 . VAL G  1 90  ? -14.928 0.679   53.969  1.00 26.77 ? 1163 VAL G CG1 1 
ATOM   4154  C CG2 . VAL G  1 90  ? -12.690 0.378   53.084  1.00 25.13 ? 1163 VAL G CG2 1 
ATOM   4155  N N   . PRO G  1 91  ? -11.301 2.644   54.817  1.00 17.68 ? 1164 PRO G N   1 
ATOM   4156  C CA  . PRO G  1 91  ? -10.958 4.004   54.421  1.00 17.86 ? 1164 PRO G CA  1 
ATOM   4157  C C   . PRO G  1 91  ? -11.700 4.535   53.186  1.00 15.98 ? 1164 PRO G C   1 
ATOM   4158  O O   . PRO G  1 91  ? -11.838 3.804   52.195  1.00 17.31 ? 1164 PRO G O   1 
ATOM   4159  C CB  . PRO G  1 91  ? -9.432  3.903   54.144  1.00 22.69 ? 1164 PRO G CB  1 
ATOM   4160  C CG  . PRO G  1 91  ? -8.966  2.761   55.082  1.00 22.74 ? 1164 PRO G CG  1 
ATOM   4161  C CD  . PRO G  1 91  ? -10.138 1.759   55.005  1.00 22.20 ? 1164 PRO G CD  1 
ATOM   4162  N N   . LEU G  1 92  ? -12.077 5.824   53.202  1.00 15.51 ? 1165 LEU G N   1 
ATOM   4163  C CA  . LEU G  1 92  ? -12.933 6.419   52.171  1.00 16.55 ? 1165 LEU G CA  1 
ATOM   4164  C C   . LEU G  1 92  ? -12.073 7.437   51.418  1.00 16.63 ? 1165 LEU G C   1 
ATOM   4165  O O   . LEU G  1 92  ? -11.244 8.142   52.037  1.00 17.92 ? 1165 LEU G O   1 
ATOM   4166  C CB  . LEU G  1 92  ? -14.157 7.138   52.794  1.00 15.95 ? 1165 LEU G CB  1 
ATOM   4167  C CG  . LEU G  1 92  ? -15.138 7.901   51.887  1.00 15.42 ? 1165 LEU G CG  1 
ATOM   4168  C CD1 . LEU G  1 92  ? -16.545 7.861   52.583  1.00 14.42 ? 1165 LEU G CD1 1 
ATOM   4169  C CD2 . LEU G  1 92  ? -14.646 9.338   51.648  1.00 16.76 ? 1165 LEU G CD2 1 
ATOM   4170  N N   . GLY G  1 93  ? -12.261 7.488   50.106  1.00 15.91 ? 1166 GLY G N   1 
ATOM   4171  C CA  . GLY G  1 93  ? -11.661 8.511   49.266  1.00 18.29 ? 1166 GLY G CA  1 
ATOM   4172  C C   . GLY G  1 93  ? -10.239 8.150   48.902  1.00 22.26 ? 1166 GLY G C   1 
ATOM   4173  O O   . GLY G  1 93  ? -9.509  9.024   48.443  1.00 25.51 ? 1166 GLY G O   1 
ATOM   4174  N N   . VAL G  1 94  ? -9.859  6.896   49.124  1.00 19.36 ? 1167 VAL G N   1 
ATOM   4175  C CA  . VAL G  1 94  ? -8.513  6.379   48.812  1.00 20.67 ? 1167 VAL G CA  1 
ATOM   4176  C C   . VAL G  1 94  ? -8.510  5.545   47.534  1.00 24.80 ? 1167 VAL G C   1 
ATOM   4177  O O   . VAL G  1 94  ? -7.546  5.562   46.780  1.00 25.98 ? 1167 VAL G O   1 
ATOM   4178  C CB  . VAL G  1 94  ? -7.974  5.503   49.927  1.00 28.18 ? 1167 VAL G CB  1 
ATOM   4179  C CG1 . VAL G  1 94  ? -6.608  4.912   49.522  1.00 38.43 ? 1167 VAL G CG1 1 
ATOM   4180  C CG2 . VAL G  1 94  ? -7.843  6.310   51.180  1.00 30.49 ? 1167 VAL G CG2 1 
ATOM   4181  N N   . ASN G  1 95  ? -9.580  4.785   47.306  1.00 20.33 ? 1168 ASN G N   1 
ATOM   4182  C CA  . ASN G  1 95  ? -9.680  3.911   46.135  1.00 21.74 ? 1168 ASN G CA  1 
ATOM   4183  C C   . ASN G  1 95  ? -11.048 4.167   45.485  1.00 19.74 ? 1168 ASN G C   1 
ATOM   4184  O O   . ASN G  1 95  ? -12.077 3.898   46.106  1.00 21.37 ? 1168 ASN G O   1 
ATOM   4185  C CB  . ASN G  1 95  ? -9.520  2.453   46.550  1.00 23.42 ? 1168 ASN G CB  1 
ATOM   4186  C CG  . ASN G  1 95  ? -9.680  1.483   45.387  1.00 24.81 ? 1168 ASN G CG  1 
ATOM   4187  O OD1 . ASN G  1 95  ? -10.626 1.559   44.606  1.00 22.42 ? 1168 ASN G OD1 1 
ATOM   4188  N ND2 . ASN G  1 95  ? -8.728  0.562   45.268  1.00 36.52 ? 1168 ASN G ND2 1 
ATOM   4189  N N   . GLN G  1 96  ? -11.039 4.711   44.260  1.00 19.13 ? 1169 GLN G N   1 
ATOM   4190  C CA  . GLN G  1 96  ? -12.226 5.193   43.593  1.00 22.18 ? 1169 GLN G CA  1 
ATOM   4191  C C   . GLN G  1 96  ? -13.215 4.084   43.350  1.00 18.35 ? 1169 GLN G C   1 
ATOM   4192  O O   . GLN G  1 96  ? -14.424 4.290   43.406  1.00 19.69 ? 1169 GLN G O   1 
ATOM   4193  C CB  . GLN G  1 96  ? -11.853 5.859   42.266  1.00 26.92 ? 1169 GLN G CB  1 
ATOM   4194  C CG  . GLN G  1 96  ? -11.813 7.347   42.381  1.00 37.34 ? 1169 GLN G CG  1 
ATOM   4195  C CD  . GLN G  1 96  ? -12.682 8.034   41.330  1.00 48.33 ? 1169 GLN G CD  1 
ATOM   4196  O OE1 . GLN G  1 96  ? -13.697 8.671   41.660  1.00 49.80 ? 1169 GLN G OE1 1 
ATOM   4197  N NE2 . GLN G  1 96  ? -12.299 7.889   40.054  1.00 43.91 ? 1169 GLN G NE2 1 
ATOM   4198  N N   . ASP G  1 97  ? -12.705 2.888   43.051  1.00 20.70 ? 1170 ASP G N   1 
ATOM   4199  C CA  . ASP G  1 97  ? -13.580 1.780   42.707  1.00 19.75 ? 1170 ASP G CA  1 
ATOM   4200  C C   . ASP G  1 97  ? -14.252 1.227   43.940  1.00 16.85 ? 1170 ASP G C   1 
ATOM   4201  O O   . ASP G  1 97  ? -15.438 0.922   43.925  1.00 16.82 ? 1170 ASP G O   1 
ATOM   4202  C CB  . ASP G  1 97  ? -12.841 0.710   41.860  1.00 19.89 ? 1170 ASP G CB  1 
ATOM   4203  C CG  . ASP G  1 97  ? -12.535 1.262   40.470  1.00 24.52 ? 1170 ASP G CG  1 
ATOM   4204  O OD1 . ASP G  1 97  ? -11.350 1.461   40.143  1.00 28.10 ? 1170 ASP G OD1 1 
ATOM   4205  O OD2 . ASP G  1 97  ? -13.503 1.605   39.760  1.00 25.91 ? 1170 ASP G OD2 1 
ATOM   4206  N N   . LEU G  1 98  ? -13.502 1.187   45.043  1.00 16.36 ? 1171 LEU G N   1 
ATOM   4207  C CA  . LEU G  1 98  ? -14.131 0.833   46.314  1.00 16.88 ? 1171 LEU G CA  1 
ATOM   4208  C C   . LEU G  1 98  ? -15.220 1.829   46.689  1.00 17.71 ? 1171 LEU G C   1 
ATOM   4209  O O   . LEU G  1 98  ? -16.331 1.422   47.075  1.00 16.19 ? 1171 LEU G O   1 
ATOM   4210  C CB  . LEU G  1 98  ? -13.065 0.759   47.416  1.00 18.65 ? 1171 LEU G CB  1 
ATOM   4211  C CG  . LEU G  1 98  ? -13.622 0.337   48.770  1.00 20.43 ? 1171 LEU G CG  1 
ATOM   4212  C CD1 . LEU G  1 98  ? -12.512 -0.376  49.552  1.00 27.69 ? 1171 LEU G CD1 1 
ATOM   4213  C CD2 . LEU G  1 98  ? -14.109 1.548   49.536  1.00 20.55 ? 1171 LEU G CD2 1 
ATOM   4214  N N   . ASP G  1 99  ? -14.924 3.128   46.591  1.00 15.17 ? 1172 ASP G N   1 
ATOM   4215  C CA  . ASP G  1 99  ? -15.920 4.159   46.900  1.00 18.60 ? 1172 ASP G CA  1 
ATOM   4216  C C   . ASP G  1 99  ? -17.163 3.961   46.013  1.00 17.08 ? 1172 ASP G C   1 
ATOM   4217  O O   . ASP G  1 99  ? -18.306 4.004   46.516  1.00 15.84 ? 1172 ASP G O   1 
ATOM   4218  C CB  . ASP G  1 99  ? -15.374 5.559   46.683  1.00 16.25 ? 1172 ASP G CB  1 
ATOM   4219  C CG  . ASP G  1 99  ? -14.310 5.981   47.739  1.00 16.72 ? 1172 ASP G CG  1 
ATOM   4220  O OD1 . ASP G  1 99  ? -13.644 6.991   47.467  1.00 20.40 ? 1172 ASP G OD1 1 
ATOM   4221  O OD2 . ASP G  1 99  ? -14.169 5.303   48.767  1.00 19.31 ? 1172 ASP G OD2 1 
ATOM   4222  N N   . LYS G  1 100 ? -16.947 3.710   44.699  1.00 14.52 ? 1173 LYS G N   1 
ATOM   4223  C CA  . LYS G  1 100 ? -18.075 3.570   43.761  1.00 16.11 ? 1173 LYS G CA  1 
ATOM   4224  C C   . LYS G  1 100 ? -18.896 2.318   44.129  1.00 19.13 ? 1173 LYS G C   1 
ATOM   4225  O O   . LYS G  1 100 ? -20.143 2.331   44.071  1.00 21.03 ? 1173 LYS G O   1 
ATOM   4226  C CB  . LYS G  1 100 ? -17.588 3.582   42.286  1.00 17.31 ? 1173 LYS G CB  1 
ATOM   4227  C CG  . LYS G  1 100 ? -17.337 5.005   41.795  1.00 22.74 ? 1173 LYS G CG  1 
ATOM   4228  C CD  . LYS G  1 100 ? -16.631 5.095   40.439  1.00 30.20 ? 1173 LYS G CD  1 
ATOM   4229  C CE  . LYS G  1 100 ? -16.419 6.621   40.120  1.00 36.71 ? 1173 LYS G CE  1 
ATOM   4230  N NZ  . LYS G  1 100 ? -15.472 6.995   39.014  1.00 43.39 ? 1173 LYS G NZ  1 
ATOM   4231  N N   . GLU G  1 101 ? -18.226 1.244   44.527  1.00 17.13 ? 1174 GLU G N   1 
ATOM   4232  C CA  . GLU G  1 101 ? -18.953 0.073   44.949  1.00 18.59 ? 1174 GLU G CA  1 
ATOM   4233  C C   . GLU G  1 101 ? -19.831 0.386   46.166  1.00 21.50 ? 1174 GLU G C   1 
ATOM   4234  O O   . GLU G  1 101 ? -20.990 -0.026  46.240  1.00 21.66 ? 1174 GLU G O   1 
ATOM   4235  C CB  . GLU G  1 101 ? -18.000 -1.062  45.297  1.00 21.48 ? 1174 GLU G CB  1 
ATOM   4236  C CG  . GLU G  1 101 ? -18.689 -2.343  45.712  1.00 23.41 ? 1174 GLU G CG  1 
ATOM   4237  C CD  . GLU G  1 101 ? -17.766 -3.360  46.346  1.00 31.98 ? 1174 GLU G CD  1 
ATOM   4238  O OE1 . GLU G  1 101 ? -16.518 -3.157  46.340  1.00 27.10 ? 1174 GLU G OE1 1 
ATOM   4239  O OE2 . GLU G  1 101 ? -18.277 -4.415  46.831  1.00 31.19 ? 1174 GLU G OE2 1 
ATOM   4240  N N   . LYS G  1 102 ? -19.241 1.069   47.141  1.00 18.62 ? 1175 LYS G N   1 
ATOM   4241  C CA  . LYS G  1 102 ? -19.977 1.352   48.379  1.00 19.97 ? 1175 LYS G CA  1 
ATOM   4242  C C   . LYS G  1 102 ? -21.167 2.253   48.113  1.00 18.90 ? 1175 LYS G C   1 
ATOM   4243  O O   . LYS G  1 102 ? -22.225 2.107   48.743  1.00 22.06 ? 1175 LYS G O   1 
ATOM   4244  C CB  . LYS G  1 102 ? -19.050 1.989   49.398  1.00 18.08 ? 1175 LYS G CB  1 
ATOM   4245  C CG  . LYS G  1 102 ? -17.905 1.145   49.820  1.00 21.92 ? 1175 LYS G CG  1 
ATOM   4246  C CD  . LYS G  1 102 ? -18.196 0.154   50.899  1.00 26.71 ? 1175 LYS G CD  1 
ATOM   4247  C CE  . LYS G  1 102 ? -17.056 -0.876  51.014  1.00 32.18 ? 1175 LYS G CE  1 
ATOM   4248  N NZ  . LYS G  1 102 ? -17.223 -1.850  52.130  1.00 36.67 ? 1175 LYS G NZ  1 
ATOM   4249  N N   . MET G  1 103 ? -21.017 3.195   47.186  1.00 16.55 ? 1176 MET G N   1 
ATOM   4250  C CA  . MET G  1 103 ? -22.072 4.111   46.920  1.00 24.97 ? 1176 MET G CA  1 
ATOM   4251  C C   . MET G  1 103 ? -23.301 3.395   46.391  1.00 24.25 ? 1176 MET G C   1 
ATOM   4252  O O   . MET G  1 103 ? -24.399 3.927   46.519  1.00 22.91 ? 1176 MET G O   1 
ATOM   4253  C CB  . MET G  1 103 ? -21.625 5.276   46.009  1.00 22.16 ? 1176 MET G CB  1 
ATOM   4254  C CG  . MET G  1 103 ? -21.257 6.540   46.906  1.00 24.58 ? 1176 MET G CG  1 
ATOM   4255  S SD  . MET G  1 103 ? -20.632 7.812   45.900  1.00 41.34 ? 1176 MET G SD  1 
ATOM   4256  C CE  . MET G  1 103 ? -19.032 7.159   45.493  1.00 27.61 ? 1176 MET G CE  1 
ATOM   4257  N N   . LEU G  1 104 ? -23.128 2.207   45.821  1.00 19.77 ? 1177 LEU G N   1 
ATOM   4258  C CA  . LEU G  1 104 ? -24.268 1.442   45.265  1.00 22.96 ? 1177 LEU G CA  1 
ATOM   4259  C C   . LEU G  1 104 ? -24.911 0.449   46.229  1.00 20.78 ? 1177 LEU G C   1 
ATOM   4260  O O   . LEU G  1 104 ? -25.815 -0.314  45.841  1.00 27.19 ? 1177 LEU G O   1 
ATOM   4261  C CB  . LEU G  1 104 ? -23.826 0.693   44.011  1.00 23.31 ? 1177 LEU G CB  1 
ATOM   4262  C CG  . LEU G  1 104 ? -23.402 1.665   42.927  1.00 24.84 ? 1177 LEU G CG  1 
ATOM   4263  C CD1 . LEU G  1 104 ? -22.617 0.990   41.820  1.00 28.87 ? 1177 LEU G CD1 1 
ATOM   4264  C CD2 . LEU G  1 104 ? -24.659 2.320   42.366  1.00 31.27 ? 1177 LEU G CD2 1 
ATOM   4265  N N   . GLU G  1 105 ? -24.465 0.419   47.482  1.00 21.64 ? 1178 GLU G N   1 
ATOM   4266  C CA  . GLU G  1 105 ? -24.885 -0.618  48.389  1.00 23.29 ? 1178 GLU G CA  1 
ATOM   4267  C C   . GLU G  1 105 ? -26.369 -0.452  48.807  1.00 25.82 ? 1178 GLU G C   1 
ATOM   4268  O O   . GLU G  1 105 ? -27.066 -1.451  49.019  1.00 28.29 ? 1178 GLU G O   1 
ATOM   4269  C CB  . GLU G  1 105 ? -23.999 -0.550  49.621  1.00 26.00 ? 1178 GLU G CB  1 
ATOM   4270  C CG  . GLU G  1 105 ? -24.082 -1.670  50.560  1.00 34.59 ? 1178 GLU G CG  1 
ATOM   4271  C CD  . GLU G  1 105 ? -23.131 -1.449  51.715  1.00 31.06 ? 1178 GLU G CD  1 
ATOM   4272  O OE1 . GLU G  1 105 ? -21.968 -1.141  51.450  1.00 29.75 ? 1178 GLU G OE1 1 
ATOM   4273  O OE2 . GLU G  1 105 ? -23.537 -1.611  52.880  1.00 33.75 ? 1178 GLU G OE2 1 
ATOM   4274  N N   . GLY G  1 106 ? -26.827 0.794   48.920  1.00 21.58 ? 1179 GLY G N   1 
ATOM   4275  C CA  . GLY G  1 106 ? -28.164 1.112   49.429  1.00 24.01 ? 1179 GLY G CA  1 
ATOM   4276  C C   . GLY G  1 106 ? -29.195 0.418   48.553  1.00 27.13 ? 1179 GLY G C   1 
ATOM   4277  O O   . GLY G  1 106 ? -29.087 0.407   47.327  1.00 24.54 ? 1179 GLY G O   1 
ATOM   4278  N N   . ARG G  1 107 ? -30.226 -0.146  49.182  1.00 30.11 ? 1180 ARG G N   1 
ATOM   4279  C CA  . ARG G  1 107 ? -31.190 -0.956  48.448  1.00 31.73 ? 1180 ARG G CA  1 
ATOM   4280  C C   . ARG G  1 107 ? -32.305 -0.158  47.807  1.00 33.95 ? 1180 ARG G C   1 
ATOM   4281  O O   . ARG G  1 107 ? -33.066 -0.697  46.984  1.00 36.78 ? 1180 ARG G O   1 
ATOM   4282  C CB  . ARG G  1 107 ? -31.805 -2.021  49.363  1.00 36.90 ? 1180 ARG G CB  1 
ATOM   4283  C CG  . ARG G  1 107 ? -30.820 -3.107  49.762  1.00 42.65 ? 1180 ARG G CG  1 
ATOM   4284  C CD  . ARG G  1 107 ? -31.231 -3.865  51.029  1.00 51.85 ? 1180 ARG G CD  1 
ATOM   4285  N NE  . ARG G  1 107 ? -30.177 -4.805  51.422  1.00 59.12 ? 1180 ARG G NE  1 
ATOM   4286  C CZ  . ARG G  1 107 ? -30.035 -5.318  52.641  1.00 65.73 ? 1180 ARG G CZ  1 
ATOM   4287  N NH1 . ARG G  1 107 ? -29.038 -6.168  52.892  1.00 67.74 ? 1180 ARG G NH1 1 
ATOM   4288  N NH2 . ARG G  1 107 ? -30.886 -4.983  53.612  1.00 70.00 ? 1180 ARG G NH2 1 
ATOM   4289  N N   . LYS G  1 108 ? -32.440 1.101   48.192  1.00 28.92 ? 1181 LYS G N   1 
ATOM   4290  C CA  . LYS G  1 108 ? -33.359 1.975   47.461  1.00 30.45 ? 1181 LYS G CA  1 
ATOM   4291  C C   . LYS G  1 108 ? -32.697 3.254   46.963  1.00 31.30 ? 1181 LYS G C   1 
ATOM   4292  O O   . LYS G  1 108 ? -31.678 3.711   47.492  1.00 27.67 ? 1181 LYS G O   1 
ATOM   4293  C CB  . LYS G  1 108 ? -34.589 2.321   48.323  1.00 31.19 ? 1181 LYS G CB  1 
ATOM   4294  C CG  . LYS G  1 108 ? -35.124 1.118   49.101  1.00 36.13 ? 1181 LYS G CG  1 
ATOM   4295  C CD  . LYS G  1 108 ? -35.881 1.571   50.364  1.00 45.42 ? 1181 LYS G CD  1 
ATOM   4296  C CE  . LYS G  1 108 ? -35.743 0.556   51.558  1.00 52.27 ? 1181 LYS G CE  1 
ATOM   4297  N NZ  . LYS G  1 108 ? -36.057 1.161   52.920  1.00 51.90 ? 1181 LYS G NZ  1 
ATOM   4298  N N   . SER G  1 109 ? -33.331 3.851   45.975  1.00 28.53 ? 1182 SER G N   1 
ATOM   4299  C CA  . SER G  1 109 ? -32.893 5.123   45.409  1.00 32.92 ? 1182 SER G CA  1 
ATOM   4300  C C   . SER G  1 109 ? -32.664 6.257   46.407  1.00 29.96 ? 1182 SER G C   1 
ATOM   4301  O O   . SER G  1 109 ? -31.623 6.921   46.379  1.00 27.37 ? 1182 SER G O   1 
ATOM   4302  C CB  . SER G  1 109 ? -33.923 5.570   44.379  1.00 37.75 ? 1182 SER G CB  1 
ATOM   4303  O OG  . SER G  1 109 ? -33.300 6.400   43.445  1.00 46.97 ? 1182 SER G OG  1 
ATOM   4304  N N   . ASN G  1 110 ? -33.626 6.515   47.282  1.00 32.18 ? 1183 ASN G N   1 
ATOM   4305  C CA  . ASN G  1 110 ? -33.458 7.611   48.238  1.00 29.44 ? 1183 ASN G CA  1 
ATOM   4306  C C   . ASN G  1 110 ? -32.277 7.395   49.215  1.00 26.04 ? 1183 ASN G C   1 
ATOM   4307  O O   . ASN G  1 110 ? -31.567 8.341   49.607  1.00 25.03 ? 1183 ASN G O   1 
ATOM   4308  C CB  . ASN G  1 110 ? -34.764 7.851   49.011  1.00 34.79 ? 1183 ASN G CB  1 
ATOM   4309  C CG  . ASN G  1 110 ? -35.283 6.589   49.683  1.00 36.53 ? 1183 ASN G CG  1 
ATOM   4310  O OD1 . ASN G  1 110 ? -35.461 5.555   49.042  1.00 44.90 ? 1183 ASN G OD1 1 
ATOM   4311  N ND2 . ASN G  1 110 ? -35.523 6.668   50.983  1.00 47.18 ? 1183 ASN G ND2 1 
ATOM   4312  N N   . ILE G  1 111 ? -32.072 6.151   49.602  1.00 24.82 ? 1184 ILE G N   1 
ATOM   4313  C CA  . ILE G  1 111 ? -30.977 5.766   50.482  1.00 21.84 ? 1184 ILE G CA  1 
ATOM   4314  C C   . ILE G  1 111 ? -29.639 6.026   49.751  1.00 22.65 ? 1184 ILE G C   1 
ATOM   4315  O O   . ILE G  1 111 ? -28.689 6.597   50.325  1.00 20.97 ? 1184 ILE G O   1 
ATOM   4316  C CB  . ILE G  1 111 ? -31.096 4.272   50.772  1.00 27.26 ? 1184 ILE G CB  1 
ATOM   4317  C CG1 . ILE G  1 111 ? -32.400 3.975   51.526  1.00 34.69 ? 1184 ILE G CG1 1 
ATOM   4318  C CG2 . ILE G  1 111 ? -29.906 3.766   51.532  1.00 28.46 ? 1184 ILE G CG2 1 
ATOM   4319  C CD1 . ILE G  1 111 ? -32.639 2.488   51.702  1.00 38.11 ? 1184 ILE G CD1 1 
ATOM   4320  N N   . ARG G  1 112 ? -29.568 5.597   48.496  1.00 23.85 ? 1185 ARG G N   1 
ATOM   4321  C CA  . ARG G  1 112 ? -28.344 5.764   47.742  1.00 22.39 ? 1185 ARG G CA  1 
ATOM   4322  C C   . ARG G  1 112 ? -28.077 7.240   47.569  1.00 22.61 ? 1185 ARG G C   1 
ATOM   4323  O O   . ARG G  1 112 ? -26.935 7.669   47.622  1.00 20.54 ? 1185 ARG G O   1 
ATOM   4324  C CB  . ARG G  1 112 ? -28.430 5.041   46.376  1.00 21.37 ? 1185 ARG G CB  1 
ATOM   4325  C CG  . ARG G  1 112 ? -28.517 3.539   46.549  1.00 20.81 ? 1185 ARG G CG  1 
ATOM   4326  C CD  . ARG G  1 112 ? -28.270 2.808   45.199  1.00 23.63 ? 1185 ARG G CD  1 
ATOM   4327  N NE  . ARG G  1 112 ? -29.366 3.067   44.255  1.00 28.00 ? 1185 ARG G NE  1 
ATOM   4328  C CZ  . ARG G  1 112 ? -30.488 2.346   44.202  1.00 28.04 ? 1185 ARG G CZ  1 
ATOM   4329  N NH1 . ARG G  1 112 ? -30.681 1.315   45.022  1.00 23.79 ? 1185 ARG G NH1 1 
ATOM   4330  N NH2 . ARG G  1 112 ? -31.420 2.653   43.322  1.00 30.41 ? 1185 ARG G NH2 1 
ATOM   4331  N N   . LYS G  1 113 ? -29.122 8.036   47.348  1.00 23.20 ? 1186 LYS G N   1 
ATOM   4332  C CA  . LYS G  1 113 ? -28.858 9.447   47.146  1.00 20.12 ? 1186 LYS G CA  1 
ATOM   4333  C C   . LYS G  1 113 ? -28.294 10.087  48.412  1.00 17.76 ? 1186 LYS G C   1 
ATOM   4334  O O   . LYS G  1 113 ? -27.400 10.930  48.335  1.00 21.58 ? 1186 LYS G O   1 
ATOM   4335  C CB  . LYS G  1 113 ? -30.106 10.203  46.628  1.00 25.30 ? 1186 LYS G CB  1 
ATOM   4336  C CG  . LYS G  1 113 ? -29.737 11.601  46.054  1.00 30.72 ? 1186 LYS G CG  1 
ATOM   4337  C CD  . LYS G  1 113 ? -30.932 12.448  45.563  1.00 29.87 ? 1186 LYS G CD  1 
ATOM   4338  C CE  . LYS G  1 113 ? -31.479 13.319  46.682  1.00 34.86 ? 1186 LYS G CE  1 
ATOM   4339  N NZ  . LYS G  1 113 ? -32.547 14.195  46.205  1.00 33.43 ? 1186 LYS G NZ  1 
ATOM   4340  N N   . SER G  1 114 ? -28.836 9.719   49.583  1.00 18.50 ? 1187 SER G N   1 
ATOM   4341  C CA  . SER G  1 114 ? -28.336 10.251  50.836  1.00 21.68 ? 1187 SER G CA  1 
ATOM   4342  C C   . SER G  1 114 ? -26.865 9.873   51.043  1.00 16.60 ? 1187 SER G C   1 
ATOM   4343  O O   . SER G  1 114 ? -26.064 10.670  51.527  1.00 18.55 ? 1187 SER G O   1 
ATOM   4344  C CB  . SER G  1 114 ? -29.144 9.698   52.000  1.00 27.06 ? 1187 SER G CB  1 
ATOM   4345  O OG  . SER G  1 114 ? -28.443 9.952   53.213  1.00 36.39 ? 1187 SER G OG  1 
ATOM   4346  N N   . VAL G  1 115 ? -26.531 8.643   50.661  1.00 18.38 ? 1188 VAL G N   1 
ATOM   4347  C CA  . VAL G  1 115 ? -25.122 8.187   50.757  1.00 16.91 ? 1188 VAL G CA  1 
ATOM   4348  C C   . VAL G  1 115 ? -24.254 8.979   49.799  1.00 17.85 ? 1188 VAL G C   1 
ATOM   4349  O O   . VAL G  1 115 ? -23.151 9.430   50.172  1.00 17.68 ? 1188 VAL G O   1 
ATOM   4350  C CB  . VAL G  1 115 ? -24.995 6.663   50.496  1.00 17.24 ? 1188 VAL G CB  1 
ATOM   4351  C CG1 . VAL G  1 115 ? -23.522 6.235   50.308  1.00 17.58 ? 1188 VAL G CG1 1 
ATOM   4352  C CG2 . VAL G  1 115 ? -25.634 5.874   51.643  1.00 17.86 ? 1188 VAL G CG2 1 
ATOM   4353  N N   . GLN G  1 116 ? -24.736 9.157   48.575  1.00 17.92 ? 1189 GLN G N   1 
ATOM   4354  C CA  . GLN G  1 116 ? -23.950 9.959   47.609  1.00 19.93 ? 1189 GLN G CA  1 
ATOM   4355  C C   . GLN G  1 116 ? -23.720 11.400  48.082  1.00 19.27 ? 1189 GLN G C   1 
ATOM   4356  O O   . GLN G  1 116 ? -22.620 11.960  47.940  1.00 17.47 ? 1189 GLN G O   1 
ATOM   4357  C CB  . GLN G  1 116 ? -24.589 10.004  46.237  1.00 18.63 ? 1189 GLN G CB  1 
ATOM   4358  C CG  . GLN G  1 116 ? -24.696 8.732   45.525  1.00 28.32 ? 1189 GLN G CG  1 
ATOM   4359  C CD  . GLN G  1 116 ? -25.438 8.962   44.186  1.00 30.42 ? 1189 GLN G CD  1 
ATOM   4360  O OE1 . GLN G  1 116 ? -25.247 9.995   43.508  1.00 35.43 ? 1189 GLN G OE1 1 
ATOM   4361  N NE2 . GLN G  1 116 ? -26.281 8.024   43.828  1.00 39.25 ? 1189 GLN G NE2 1 
ATOM   4362  N N   . ILE G  1 117 ? -24.756 12.031  48.603  1.00 15.11 ? 1190 ILE G N   1 
ATOM   4363  C CA  . ILE G  1 117 ? -24.574 13.368  49.190  1.00 17.77 ? 1190 ILE G CA  1 
ATOM   4364  C C   . ILE G  1 117 ? -23.549 13.372  50.323  1.00 18.71 ? 1190 ILE G C   1 
ATOM   4365  O O   . ILE G  1 117 ? -22.641 14.222  50.364  1.00 17.23 ? 1190 ILE G O   1 
ATOM   4366  C CB  . ILE G  1 117 ? -25.951 13.912  49.628  1.00 21.88 ? 1190 ILE G CB  1 
ATOM   4367  C CG1 . ILE G  1 117 ? -26.725 14.301  48.383  1.00 24.76 ? 1190 ILE G CG1 1 
ATOM   4368  C CG2 . ILE G  1 117 ? -25.799 15.153  50.511  1.00 23.52 ? 1190 ILE G CG2 1 
ATOM   4369  C CD1 . ILE G  1 117 ? -28.269 14.485  48.655  1.00 25.80 ? 1190 ILE G CD1 1 
ATOM   4370  N N   . ALA G  1 118 ? -23.653 12.391  51.232  1.00 18.55 ? 1191 ALA G N   1 
ATOM   4371  C CA  . ALA G  1 118 ? -22.697 12.323  52.331  1.00 15.70 ? 1191 ALA G CA  1 
ATOM   4372  C C   . ALA G  1 118 ? -21.260 12.135  51.816  1.00 15.14 ? 1191 ALA G C   1 
ATOM   4373  O O   . ALA G  1 118 ? -20.336 12.699  52.357  1.00 16.11 ? 1191 ALA G O   1 
ATOM   4374  C CB  . ALA G  1 118 ? -23.093 11.198  53.337  1.00 17.89 ? 1191 ALA G CB  1 
ATOM   4375  N N   . TYR G  1 119 ? -21.095 11.335  50.755  1.00 15.59 ? 1192 TYR G N   1 
ATOM   4376  C CA  . TYR G  1 119 ? -19.778 11.142  50.183  1.00 16.56 ? 1192 TYR G CA  1 
ATOM   4377  C C   . TYR G  1 119 ? -19.190 12.438  49.669  1.00 18.99 ? 1192 TYR G C   1 
ATOM   4378  O O   . TYR G  1 119 ? -18.012 12.728  49.880  1.00 15.92 ? 1192 TYR G O   1 
ATOM   4379  C CB  . TYR G  1 119 ? -19.892 10.137  49.016  1.00 15.98 ? 1192 TYR G CB  1 
ATOM   4380  C CG  . TYR G  1 119 ? -18.593 9.877   48.319  1.00 16.64 ? 1192 TYR G CG  1 
ATOM   4381  C CD1 . TYR G  1 119 ? -17.653 9.013   48.883  1.00 16.39 ? 1192 TYR G CD1 1 
ATOM   4382  C CD2 . TYR G  1 119 ? -18.312 10.453  47.084  1.00 19.52 ? 1192 TYR G CD2 1 
ATOM   4383  C CE1 . TYR G  1 119 ? -16.449 8.713   48.235  1.00 21.85 ? 1192 TYR G CE1 1 
ATOM   4384  C CE2 . TYR G  1 119 ? -17.115 10.170  46.411  1.00 22.46 ? 1192 TYR G CE2 1 
ATOM   4385  C CZ  . TYR G  1 119 ? -16.190 9.306   46.999  1.00 21.51 ? 1192 TYR G CZ  1 
ATOM   4386  O OH  . TYR G  1 119 ? -15.007 9.006   46.382  1.00 22.66 ? 1192 TYR G OH  1 
ATOM   4387  N N   . HIS G  1 120 ? -20.007 13.198  48.942  1.00 16.02 ? 1193 HIS G N   1 
ATOM   4388  C CA  . HIS G  1 120 ? -19.540 14.469  48.417  1.00 18.25 ? 1193 HIS G CA  1 
ATOM   4389  C C   . HIS G  1 120 ? -19.253 15.469  49.527  1.00 18.45 ? 1193 HIS G C   1 
ATOM   4390  O O   . HIS G  1 120 ? -18.251 16.175  49.461  1.00 17.91 ? 1193 HIS G O   1 
ATOM   4391  C CB  . HIS G  1 120 ? -20.495 14.992  47.328  1.00 18.00 ? 1193 HIS G CB  1 
ATOM   4392  C CG  . HIS G  1 120 ? -20.476 14.103  46.107  1.00 20.45 ? 1193 HIS G CG  1 
ATOM   4393  N ND1 . HIS G  1 120 ? -19.313 13.850  45.410  1.00 21.73 ? 1193 HIS G ND1 1 
ATOM   4394  C CD2 . HIS G  1 120 ? -21.447 13.389  45.505  1.00 23.44 ? 1193 HIS G CD2 1 
ATOM   4395  C CE1 . HIS G  1 120 ? -19.572 13.002  44.427  1.00 22.60 ? 1193 HIS G CE1 1 
ATOM   4396  N NE2 . HIS G  1 120 ? -20.863 12.721  44.453  1.00 23.23 ? 1193 HIS G NE2 1 
ATOM   4397  N N   . ARG G  1 121 ? -20.025 15.389  50.615  1.00 14.63 ? 1194 ARG G N   1 
ATOM   4398  C CA  . ARG G  1 121 ? -19.684 16.207  51.776  1.00 15.77 ? 1194 ARG G CA  1 
ATOM   4399  C C   . ARG G  1 121 ? -18.353 15.798  52.395  1.00 15.24 ? 1194 ARG G C   1 
ATOM   4400  O O   . ARG G  1 121 ? -17.542 16.663  52.813  1.00 17.65 ? 1194 ARG G O   1 
ATOM   4401  C CB  . ARG G  1 121 ? -20.819 16.118  52.803  1.00 19.30 ? 1194 ARG G CB  1 
ATOM   4402  C CG  . ARG G  1 121 ? -22.096 16.848  52.398  1.00 20.98 ? 1194 ARG G CG  1 
ATOM   4403  C CD  . ARG G  1 121 ? -23.145 16.498  53.436  1.00 27.09 ? 1194 ARG G CD  1 
ATOM   4404  N NE  . ARG G  1 121 ? -24.443 17.103  53.223  1.00 28.68 ? 1194 ARG G NE  1 
ATOM   4405  C CZ  . ARG G  1 121 ? -25.591 16.573  53.661  1.00 31.28 ? 1194 ARG G CZ  1 
ATOM   4406  N NH1 . ARG G  1 121 ? -26.726 17.218  53.428  1.00 27.96 ? 1194 ARG G NH1 1 
ATOM   4407  N NH2 . ARG G  1 121 ? -25.610 15.375  54.281  1.00 30.47 ? 1194 ARG G NH2 1 
ATOM   4408  N N   . ALA G  1 122 ? -18.133 14.482  52.481  1.00 15.77 ? 1195 ALA G N   1 
ATOM   4409  C CA  . ALA G  1 122 ? -16.882 14.023  53.015  1.00 13.94 ? 1195 ALA G CA  1 
ATOM   4410  C C   . ALA G  1 122 ? -15.683 14.511  52.174  1.00 18.41 ? 1195 ALA G C   1 
ATOM   4411  O O   . ALA G  1 122 ? -14.663 14.947  52.726  1.00 19.48 ? 1195 ALA G O   1 
ATOM   4412  C CB  . ALA G  1 122 ? -16.892 12.474  53.103  1.00 16.34 ? 1195 ALA G CB  1 
ATOM   4413  N N   . LEU G  1 123 ? -15.826 14.438  50.848  1.00 18.09 ? 1196 LEU G N   1 
ATOM   4414  C CA  . LEU G  1 123 ? -14.719 14.893  50.016  1.00 15.20 ? 1196 LEU G CA  1 
ATOM   4415  C C   . LEU G  1 123 ? -14.499 16.394  50.095  1.00 22.01 ? 1196 LEU G C   1 
ATOM   4416  O O   . LEU G  1 123 ? -13.358 16.878  49.961  1.00 21.68 ? 1196 LEU G O   1 
ATOM   4417  C CB  . LEU G  1 123 ? -14.919 14.445  48.582  1.00 17.35 ? 1196 LEU G CB  1 
ATOM   4418  C CG  . LEU G  1 123 ? -14.848 12.950  48.342  1.00 22.39 ? 1196 LEU G CG  1 
ATOM   4419  C CD1 . LEU G  1 123 ? -14.742 12.737  46.830  1.00 23.14 ? 1196 LEU G CD1 1 
ATOM   4420  C CD2 . LEU G  1 123 ? -13.704 12.291  49.153  1.00 22.05 ? 1196 LEU G CD2 1 
ATOM   4421  N N   . GLN G  1 124 ? -15.572 17.135  50.343  1.00 20.22 ? 1197 GLN G N   1 
ATOM   4422  C CA  . GLN G  1 124 ? -15.439 18.566  50.577  1.00 20.93 ? 1197 GLN G CA  1 
ATOM   4423  C C   . GLN G  1 124 ? -14.670 18.850  51.863  1.00 24.78 ? 1197 GLN G C   1 
ATOM   4424  O O   . GLN G  1 124 ? -13.940 19.811  51.916  1.00 26.34 ? 1197 GLN G O   1 
ATOM   4425  C CB  . GLN G  1 124 ? -16.782 19.278  50.618  1.00 23.77 ? 1197 GLN G CB  1 
ATOM   4426  C CG  . GLN G  1 124 ? -17.481 19.326  49.283  1.00 24.01 ? 1197 GLN G CG  1 
ATOM   4427  C CD  . GLN G  1 124 ? -18.883 19.879  49.428  1.00 24.97 ? 1197 GLN G CD  1 
ATOM   4428  O OE1 . GLN G  1 124 ? -19.056 21.048  49.757  1.00 24.48 ? 1197 GLN G OE1 1 
ATOM   4429  N NE2 . GLN G  1 124 ? -19.887 19.032  49.239  1.00 19.52 ? 1197 GLN G NE2 1 
ATOM   4430  N N   . HIS G  1 125 ? -14.833 17.998  52.870  1.00 20.83 ? 1198 HIS G N   1 
ATOM   4431  C CA  . HIS G  1 125 ? -14.155 18.176  54.126  1.00 27.12 ? 1198 HIS G CA  1 
ATOM   4432  C C   . HIS G  1 125 ? -12.672 18.003  53.859  1.00 24.45 ? 1198 HIS G C   1 
ATOM   4433  O O   . HIS G  1 125 ? -11.816 18.781  54.326  1.00 26.51 ? 1198 HIS G O   1 
ATOM   4434  C CB  . HIS G  1 125 ? -14.598 17.086  55.134  1.00 22.86 ? 1198 HIS G CB  1 
ATOM   4435  C CG  . HIS G  1 125 ? -13.744 17.045  56.362  1.00 25.69 ? 1198 HIS G CG  1 
ATOM   4436  N ND1 . HIS G  1 125 ? -13.956 17.878  57.439  1.00 28.53 ? 1198 HIS G ND1 1 
ATOM   4437  C CD2 . HIS G  1 125 ? -12.643 16.319  56.651  1.00 24.72 ? 1198 HIS G CD2 1 
ATOM   4438  C CE1 . HIS G  1 125 ? -13.011 17.669  58.337  1.00 23.41 ? 1198 HIS G CE1 1 
ATOM   4439  N NE2 . HIS G  1 125 ? -12.225 16.708  57.896  1.00 23.74 ? 1198 HIS G NE2 1 
ATOM   4440  N N   . ARG G  1 126 ? -12.364 16.968  53.107  1.00 22.64 ? 1199 ARG G N   1 
ATOM   4441  C CA  . ARG G  1 126 ? -11.002 16.644  52.836  1.00 26.02 ? 1199 ARG G CA  1 
ATOM   4442  C C   . ARG G  1 126 ? -10.331 17.808  52.112  1.00 27.12 ? 1199 ARG G C   1 
ATOM   4443  O O   . ARG G  1 126 ? -9.183  18.162  52.409  1.00 27.80 ? 1199 ARG G O   1 
ATOM   4444  C CB  . ARG G  1 126 ? -10.915 15.362  52.018  1.00 26.72 ? 1199 ARG G CB  1 
ATOM   4445  C CG  . ARG G  1 126 ? -9.459  14.936  51.742  1.00 29.77 ? 1199 ARG G CG  1 
ATOM   4446  C CD  . ARG G  1 126 ? -9.386  13.644  50.949  1.00 27.19 ? 1199 ARG G CD  1 
ATOM   4447  N NE  . ARG G  1 126 ? -9.877  13.756  49.587  1.00 31.90 ? 1199 ARG G NE  1 
ATOM   4448  C CZ  . ARG G  1 126 ? -9.925  12.741  48.732  1.00 28.56 ? 1199 ARG G CZ  1 
ATOM   4449  N NH1 . ARG G  1 126 ? -10.396 12.920  47.510  1.00 29.81 ? 1199 ARG G NH1 1 
ATOM   4450  N NH2 . ARG G  1 126 ? -9.537  11.536  49.130  1.00 30.58 ? 1199 ARG G NH2 1 
ATOM   4451  N N   . SER G  1 127 ? -11.043 18.375  51.161  1.00 25.58 ? 1200 SER G N   1 
ATOM   4452  C CA  . SER G  1 127 ? -10.465 19.442  50.331  1.00 24.27 ? 1200 SER G CA  1 
ATOM   4453  C C   . SER G  1 127 ? -10.136 20.643  51.213  1.00 31.46 ? 1200 SER G C   1 
ATOM   4454  O O   . SER G  1 127 ? -9.107  21.300  51.036  1.00 37.91 ? 1200 SER G O   1 
ATOM   4455  C CB  . SER G  1 127 ? -11.416 19.742  49.168  1.00 28.76 ? 1200 SER G CB  1 
ATOM   4456  O OG  . SER G  1 127 ? -11.075 20.929  48.497  1.00 42.99 ? 1200 SER G OG  1 
ATOM   4457  N N   . LYS G  1 128 ? -10.972 20.905  52.206  1.00 25.58 ? 1201 LYS G N   1 
ATOM   4458  C CA  . LYS G  1 128 ? -10.718 22.034  53.119  1.00 30.78 ? 1201 LYS G CA  1 
ATOM   4459  C C   . LYS G  1 128 ? -9.519  21.826  54.028  1.00 35.82 ? 1201 LYS G C   1 
ATOM   4460  O O   . LYS G  1 128 ? -8.790  22.776  54.333  1.00 36.38 ? 1201 LYS G O   1 
ATOM   4461  C CB  . LYS G  1 128 ? -11.924 22.326  53.956  1.00 27.18 ? 1201 LYS G CB  1 
ATOM   4462  C CG  . LYS G  1 128 ? -13.064 22.953  53.205  1.00 32.50 ? 1201 LYS G CG  1 
ATOM   4463  C CD  . LYS G  1 128 ? -14.222 23.092  54.136  1.00 39.77 ? 1201 LYS G CD  1 
ATOM   4464  C CE  . LYS G  1 128 ? -15.484 23.548  53.427  1.00 46.67 ? 1201 LYS G CE  1 
ATOM   4465  N NZ  . LYS G  1 128 ? -16.613 23.617  54.414  1.00 50.13 ? 1201 LYS G NZ  1 
ATOM   4466  N N   . VAL G  1 129 ? -9.332  20.592  54.476  1.00 32.24 ? 1202 VAL G N   1 
ATOM   4467  C CA  . VAL G  1 129 ? -8.205  20.259  55.321  1.00 35.63 ? 1202 VAL G CA  1 
ATOM   4468  C C   . VAL G  1 129 ? -6.919  20.295  54.533  1.00 35.64 ? 1202 VAL G C   1 
ATOM   4469  O O   . VAL G  1 129 ? -5.876  20.691  55.041  1.00 43.22 ? 1202 VAL G O   1 
ATOM   4470  C CB  . VAL G  1 129 ? -8.370  18.872  55.940  1.00 34.09 ? 1202 VAL G CB  1 
ATOM   4471  C CG1 . VAL G  1 129 ? -7.092  18.483  56.636  1.00 38.32 ? 1202 VAL G CG1 1 
ATOM   4472  C CG2 . VAL G  1 129 ? -9.538  18.909  56.885  1.00 28.14 ? 1202 VAL G CG2 1 
ATOM   4473  N N   . GLN G  1 130 ? -6.998  19.867  53.287  1.00 36.73 ? 1203 GLN G N   1 
ATOM   4474  C CA  . GLN G  1 130 ? -5.838  19.877  52.417  1.00 46.67 ? 1203 GLN G CA  1 
ATOM   4475  C C   . GLN G  1 130 ? -5.808  21.164  51.603  1.00 44.15 ? 1203 GLN G C   1 
ATOM   4476  O O   . GLN G  1 130 ? -4.783  21.505  51.013  1.00 54.12 ? 1203 GLN G O   1 
ATOM   4477  C CB  . GLN G  1 130 ? -5.848  18.663  51.498  1.00 43.39 ? 1203 GLN G CB  1 
ATOM   4478  C CG  . GLN G  1 130 ? -5.999  17.351  52.216  1.00 44.94 ? 1203 GLN G CG  1 
ATOM   4479  C CD  . GLN G  1 130 ? -6.074  16.214  51.238  1.00 47.91 ? 1203 GLN G CD  1 
ATOM   4480  O OE1 . GLN G  1 130 ? -5.950  15.041  51.604  1.00 53.73 ? 1203 GLN G OE1 1 
ATOM   4481  N NE2 . GLN G  1 130 ? -6.269  16.554  49.967  1.00 48.33 ? 1203 GLN G NE2 1 
ATOM   4482  N N   . SER H  2 7   ? -17.582 27.772  66.237  1.00 51.06 ? 28   SER H N   1 
ATOM   4483  C CA  . SER H  2 7   ? -17.915 27.647  64.823  1.00 45.02 ? 28   SER H CA  1 
ATOM   4484  C C   . SER H  2 7   ? -18.090 26.204  64.309  1.00 39.61 ? 28   SER H C   1 
ATOM   4485  O O   . SER H  2 7   ? -18.521 26.040  63.188  1.00 37.91 ? 28   SER H O   1 
ATOM   4486  C CB  . SER H  2 7   ? -16.882 28.382  63.956  1.00 47.75 ? 28   SER H CB  1 
ATOM   4487  O OG  . SER H  2 7   ? -15.550 27.958  64.242  1.00 46.21 ? 28   SER H OG  1 
ATOM   4488  N N   . ALA H  2 8   ? -17.764 25.169  65.104  1.00 37.45 ? 29   ALA H N   1 
ATOM   4489  C CA  . ALA H  2 8   ? -17.943 23.797  64.614  1.00 33.09 ? 29   ALA H CA  1 
ATOM   4490  C C   . ALA H  2 8   ? -19.407 23.518  64.389  1.00 28.53 ? 29   ALA H C   1 
ATOM   4491  O O   . ALA H  2 8   ? -20.245 23.944  65.155  1.00 34.67 ? 29   ALA H O   1 
ATOM   4492  C CB  . ALA H  2 8   ? -17.376 22.778  65.608  1.00 36.02 ? 29   ALA H CB  1 
ATOM   4493  N N   . PRO H  2 9   ? -19.721 22.762  63.340  1.00 32.14 ? 30   PRO H N   1 
ATOM   4494  C CA  . PRO H  2 9   ? -21.109 22.385  63.005  1.00 34.31 ? 30   PRO H CA  1 
ATOM   4495  C C   . PRO H  2 9   ? -21.853 21.747  64.189  1.00 34.52 ? 30   PRO H C   1 
ATOM   4496  O O   . PRO H  2 9   ? -21.231 21.018  64.954  1.00 33.77 ? 30   PRO H O   1 
ATOM   4497  C CB  . PRO H  2 9   ? -20.939 21.330  61.899  1.00 34.56 ? 30   PRO H CB  1 
ATOM   4498  C CG  . PRO H  2 9   ? -19.516 21.537  61.370  1.00 38.95 ? 30   PRO H CG  1 
ATOM   4499  C CD  . PRO H  2 9   ? -18.707 22.165  62.461  1.00 35.55 ? 30   PRO H CD  1 
ATOM   4500  N N   . ALA H  2 10  ? -23.152 22.004  64.329  1.00 34.47 ? 31   ALA H N   1 
ATOM   4501  C CA  . ALA H  2 10  ? -23.951 21.283  65.312  1.00 34.03 ? 31   ALA H CA  1 
ATOM   4502  C C   . ALA H  2 10  ? -24.049 19.768  64.979  1.00 32.73 ? 31   ALA H C   1 
ATOM   4503  O O   . ALA H  2 10  ? -24.115 19.367  63.808  1.00 31.14 ? 31   ALA H O   1 
ATOM   4504  C CB  . ALA H  2 10  ? -25.331 21.882  65.410  1.00 37.93 ? 31   ALA H CB  1 
ATOM   4505  N N   . THR H  2 11  ? -24.051 18.931  66.006  1.00 31.23 ? 32   THR H N   1 
ATOM   4506  C CA  . THR H  2 11  ? -24.229 17.501  65.761  1.00 28.33 ? 32   THR H CA  1 
ATOM   4507  C C   . THR H  2 11  ? -25.509 16.966  66.366  1.00 32.38 ? 32   THR H C   1 
ATOM   4508  O O   . THR H  2 11  ? -26.197 17.630  67.159  1.00 34.79 ? 32   THR H O   1 
ATOM   4509  C CB  . THR H  2 11  ? -23.055 16.656  66.277  1.00 26.82 ? 32   THR H CB  1 
ATOM   4510  O OG1 . THR H  2 11  ? -22.923 16.851  67.676  1.00 29.23 ? 32   THR H OG1 1 
ATOM   4511  C CG2 . THR H  2 11  ? -21.758 17.048  65.617  1.00 26.39 ? 32   THR H CG2 1 
ATOM   4512  N N   . GLY H  2 12  ? -25.849 15.767  65.943  1.00 29.84 ? 33   GLY H N   1 
ATOM   4513  C CA  . GLY H  2 12  ? -26.974 15.071  66.491  1.00 27.56 ? 33   GLY H CA  1 
ATOM   4514  C C   . GLY H  2 12  ? -26.416 14.340  67.713  1.00 28.49 ? 33   GLY H C   1 
ATOM   4515  O O   . GLY H  2 12  ? -25.352 14.666  68.268  1.00 35.02 ? 33   GLY H O   1 
ATOM   4516  N N   . GLY H  2 13  ? -27.142 13.337  68.145  1.00 32.57 ? 34   GLY H N   1 
ATOM   4517  C CA  . GLY H  2 13  ? -26.663 12.481  69.188  1.00 30.05 ? 34   GLY H CA  1 
ATOM   4518  C C   . GLY H  2 13  ? -26.355 11.181  68.496  1.00 31.21 ? 34   GLY H C   1 
ATOM   4519  O O   . GLY H  2 13  ? -25.954 11.162  67.317  1.00 26.87 ? 34   GLY H O   1 
ATOM   4520  N N   . VAL H  2 14  ? -26.576 10.090  69.219  1.00 29.08 ? 35   VAL H N   1 
ATOM   4521  C CA  . VAL H  2 14  ? -26.259 8.764   68.724  1.00 30.84 ? 35   VAL H CA  1 
ATOM   4522  C C   . VAL H  2 14  ? -27.212 8.346   67.619  1.00 30.69 ? 35   VAL H C   1 
ATOM   4523  O O   . VAL H  2 14  ? -28.432 8.460   67.734  1.00 34.64 ? 35   VAL H O   1 
ATOM   4524  C CB  . VAL H  2 14  ? -26.281 7.727   69.866  1.00 30.70 ? 35   VAL H CB  1 
ATOM   4525  C CG1 . VAL H  2 14  ? -26.145 6.361   69.319  1.00 33.59 ? 35   VAL H CG1 1 
ATOM   4526  C CG2 . VAL H  2 14  ? -25.152 8.014   70.842  1.00 34.49 ? 35   VAL H CG2 1 
HETATM 4527  N N   . M3L H  2 15  ? -26.659 7.889   66.503  1.00 26.90 ? 36   M3L H N   1 
HETATM 4528  C CA  . M3L H  2 15  ? -27.489 7.403   65.448  1.00 27.38 ? 36   M3L H CA  1 
HETATM 4529  C CB  . M3L H  2 15  ? -26.678 7.005   64.219  1.00 24.50 ? 36   M3L H CB  1 
HETATM 4530  C CG  . M3L H  2 15  ? -27.485 6.725   62.977  1.00 24.62 ? 36   M3L H CG  1 
HETATM 4531  C CD  . M3L H  2 15  ? -26.666 6.694   61.679  1.00 23.85 ? 36   M3L H CD  1 
HETATM 4532  C CE  . M3L H  2 15  ? -27.441 6.481   60.400  1.00 25.81 ? 36   M3L H CE  1 
HETATM 4533  N NZ  . M3L H  2 15  ? -26.667 6.489   59.161  1.00 27.13 ? 36   M3L H NZ  1 
HETATM 4534  C C   . M3L H  2 15  ? -28.354 6.255   65.942  1.00 32.16 ? 36   M3L H C   1 
HETATM 4535  O O   . M3L H  2 15  ? -27.862 5.315   66.520  1.00 32.50 ? 36   M3L H O   1 
HETATM 4536  C CM1 . M3L H  2 15  ? -25.702 5.395   59.230  1.00 26.37 ? 36   M3L H CM1 1 
HETATM 4537  C CM2 . M3L H  2 15  ? -26.041 7.801   59.016  1.00 20.42 ? 36   M3L H CM2 1 
HETATM 4538  C CM3 . M3L H  2 15  ? -27.589 6.294   58.069  1.00 27.68 ? 36   M3L H CM3 1 
ATOM   4539  N N   . LYS H  2 16  ? -29.649 6.372   65.679  1.00 32.32 ? 37   LYS H N   1 
ATOM   4540  C CA  . LYS H  2 16  ? -30.611 5.364   66.127  1.00 41.51 ? 37   LYS H CA  1 
ATOM   4541  C C   . LYS H  2 16  ? -30.535 4.164   65.214  1.00 42.41 ? 37   LYS H C   1 
ATOM   4542  O O   . LYS H  2 16  ? -30.303 4.319   64.017  1.00 41.13 ? 37   LYS H O   1 
ATOM   4543  C CB  . LYS H  2 16  ? -32.041 5.924   66.145  1.00 44.35 ? 37   LYS H CB  1 
ATOM   4544  C CG  . LYS H  2 16  ? -32.672 6.170   64.770  1.00 51.10 ? 37   LYS H CG  1 
ATOM   4545  C CD  . LYS H  2 16  ? -34.204 6.333   64.874  1.00 52.67 ? 37   LYS H CD  1 
ATOM   4546  C CE  . LYS H  2 16  ? -34.859 6.608   63.515  1.00 54.96 ? 37   LYS H CE  1 
ATOM   4547  N NZ  . LYS H  2 16  ? -36.350 6.319   63.533  1.00 57.21 ? 37   LYS H NZ  1 
ATOM   4548  N N   . PRO H  2 17  ? -30.754 2.970   65.781  1.00 47.24 ? 38   PRO H N   1 
ATOM   4549  C CA  . PRO H  2 17  ? -30.587 1.679   65.104  1.00 43.23 ? 38   PRO H CA  1 
ATOM   4550  C C   . PRO H  2 17  ? -31.701 1.416   64.084  1.00 49.49 ? 38   PRO H C   1 
ATOM   4551  O O   . PRO H  2 17  ? -32.701 2.145   64.082  1.00 51.65 ? 38   PRO H O   1 
ATOM   4552  C CB  . PRO H  2 17  ? -30.658 0.659   66.257  1.00 44.68 ? 38   PRO H CB  1 
ATOM   4553  C CG  . PRO H  2 17  ? -30.617 1.462   67.542  1.00 45.60 ? 38   PRO H CG  1 
ATOM   4554  C CD  . PRO H  2 17  ? -31.179 2.808   67.184  1.00 47.94 ? 38   PRO H CD  1 
ATOM   4555  N N   . ASP I  1 7   ? -19.998 35.586  53.421  1.00 53.57 ? 1080 ASP I N   1 
ATOM   4556  C CA  . ASP I  1 7   ? -18.571 35.542  53.097  1.00 54.38 ? 1080 ASP I CA  1 
ATOM   4557  C C   . ASP I  1 7   ? -18.183 36.634  52.108  1.00 48.21 ? 1080 ASP I C   1 
ATOM   4558  O O   . ASP I  1 7   ? -18.781 37.717  52.068  1.00 53.96 ? 1080 ASP I O   1 
ATOM   4559  C CB  . ASP I  1 7   ? -18.140 34.195  52.486  1.00 50.05 ? 1080 ASP I CB  1 
ATOM   4560  C CG  . ASP I  1 7   ? -19.125 33.075  52.741  1.00 54.27 ? 1080 ASP I CG  1 
ATOM   4561  O OD1 . ASP I  1 7   ? -20.344 33.276  52.518  1.00 52.13 ? 1080 ASP I OD1 1 
ATOM   4562  O OD2 . ASP I  1 7   ? -18.662 31.969  53.125  1.00 54.21 ? 1080 ASP I OD2 1 
ATOM   4563  N N   . SER I  1 8   ? -17.173 36.326  51.302  1.00 51.20 ? 1081 SER I N   1 
ATOM   4564  C CA  . SER I  1 8   ? -16.667 37.258  50.307  1.00 53.03 ? 1081 SER I CA  1 
ATOM   4565  C C   . SER I  1 8   ? -17.767 37.806  49.418  1.00 49.83 ? 1081 SER I C   1 
ATOM   4566  O O   . SER I  1 8   ? -18.692 37.081  49.048  1.00 44.74 ? 1081 SER I O   1 
ATOM   4567  C CB  . SER I  1 8   ? -15.620 36.584  49.416  1.00 56.73 ? 1081 SER I CB  1 
ATOM   4568  O OG  . SER I  1 8   ? -15.600 37.157  48.108  1.00 54.53 ? 1081 SER I OG  1 
ATOM   4569  N N   . PRO I  1 9   ? -17.664 39.100  49.074  1.00 54.65 ? 1082 PRO I N   1 
ATOM   4570  C CA  . PRO I  1 9   ? -18.441 39.665  47.968  1.00 45.95 ? 1082 PRO I CA  1 
ATOM   4571  C C   . PRO I  1 9   ? -18.081 38.940  46.652  1.00 45.02 ? 1082 PRO I C   1 
ATOM   4572  O O   . PRO I  1 9   ? -16.915 38.536  46.438  1.00 45.00 ? 1082 PRO I O   1 
ATOM   4573  C CB  . PRO I  1 9   ? -17.992 41.136  47.944  1.00 46.54 ? 1082 PRO I CB  1 
ATOM   4574  C CG  . PRO I  1 9   ? -17.504 41.401  49.323  1.00 51.87 ? 1082 PRO I CG  1 
ATOM   4575  C CD  . PRO I  1 9   ? -16.873 40.125  49.779  1.00 51.56 ? 1082 PRO I CD  1 
ATOM   4576  N N   . LEU I  1 10  ? -19.088 38.754  45.798  1.00 33.95 ? 1083 LEU I N   1 
ATOM   4577  C CA  . LEU I  1 10  ? -18.951 38.033  44.529  1.00 32.42 ? 1083 LEU I CA  1 
ATOM   4578  C C   . LEU I  1 10  ? -18.949 39.065  43.421  1.00 32.82 ? 1083 LEU I C   1 
ATOM   4579  O O   . LEU I  1 10  ? -19.361 40.216  43.645  1.00 33.93 ? 1083 LEU I O   1 
ATOM   4580  C CB  . LEU I  1 10  ? -20.162 37.130  44.336  1.00 31.98 ? 1083 LEU I CB  1 
ATOM   4581  C CG  . LEU I  1 10  ? -20.458 36.146  45.462  1.00 31.38 ? 1083 LEU I CG  1 
ATOM   4582  C CD1 . LEU I  1 10  ? -21.797 35.481  45.217  1.00 30.87 ? 1083 LEU I CD1 1 
ATOM   4583  C CD2 . LEU I  1 10  ? -19.376 35.112  45.493  1.00 35.23 ? 1083 LEU I CD2 1 
ATOM   4584  N N   . ASP I  1 11  ? -18.482 38.686  42.237  1.00 28.95 ? 1084 ASP I N   1 
ATOM   4585  C CA  . ASP I  1 11  ? -18.406 39.648  41.127  1.00 28.82 ? 1084 ASP I CA  1 
ATOM   4586  C C   . ASP I  1 11  ? -19.442 39.383  40.025  1.00 27.01 ? 1084 ASP I C   1 
ATOM   4587  O O   . ASP I  1 11  ? -19.898 38.257  39.824  1.00 22.10 ? 1084 ASP I O   1 
ATOM   4588  C CB  . ASP I  1 11  ? -17.011 39.641  40.460  1.00 27.50 ? 1084 ASP I CB  1 
ATOM   4589  C CG  . ASP I  1 11  ? -15.871 39.943  41.432  1.00 36.46 ? 1084 ASP I CG  1 
ATOM   4590  O OD1 . ASP I  1 11  ? -14.875 39.190  41.402  1.00 44.98 ? 1084 ASP I OD1 1 
ATOM   4591  O OD2 . ASP I  1 11  ? -15.956 40.908  42.212  1.00 35.67 ? 1084 ASP I OD2 1 
ATOM   4592  N N   . ALA I  1 12  ? -19.808 40.446  39.308  1.00 26.60 ? 1085 ALA I N   1 
ATOM   4593  C CA  . ALA I  1 12  ? -20.585 40.304  38.103  1.00 24.92 ? 1085 ALA I CA  1 
ATOM   4594  C C   . ALA I  1 12  ? -19.905 39.312  37.198  1.00 25.43 ? 1085 ALA I C   1 
ATOM   4595  O O   . ALA I  1 12  ? -18.675 39.358  37.016  1.00 25.93 ? 1085 ALA I O   1 
ATOM   4596  C CB  . ALA I  1 12  ? -20.676 41.653  37.376  1.00 25.29 ? 1085 ALA I CB  1 
ATOM   4597  N N   . LEU I  1 13  ? -20.728 38.449  36.603  1.00 20.37 ? 1086 LEU I N   1 
ATOM   4598  C CA  . LEU I  1 13  ? -20.319 37.434  35.623  1.00 22.66 ? 1086 LEU I CA  1 
ATOM   4599  C C   . LEU I  1 13  ? -19.696 36.196  36.254  1.00 22.99 ? 1086 LEU I C   1 
ATOM   4600  O O   . LEU I  1 13  ? -19.257 35.344  35.536  1.00 24.83 ? 1086 LEU I O   1 
ATOM   4601  C CB  . LEU I  1 13  ? -19.361 37.981  34.549  1.00 23.96 ? 1086 LEU I CB  1 
ATOM   4602  C CG  . LEU I  1 13  ? -20.004 39.128  33.778  1.00 23.47 ? 1086 LEU I CG  1 
ATOM   4603  C CD1 . LEU I  1 13  ? -19.181 39.478  32.546  1.00 35.90 ? 1086 LEU I CD1 1 
ATOM   4604  C CD2 . LEU I  1 13  ? -21.424 38.777  33.376  1.00 26.78 ? 1086 LEU I CD2 1 
ATOM   4605  N N   . ASP I  1 14  ? -19.664 36.124  37.584  1.00 21.09 ? 1087 ASP I N   1 
ATOM   4606  C CA  . ASP I  1 14  ? -19.354 34.868  38.278  1.00 21.44 ? 1087 ASP I CA  1 
ATOM   4607  C C   . ASP I  1 14  ? -20.481 33.856  38.086  1.00 21.22 ? 1087 ASP I C   1 
ATOM   4608  O O   . ASP I  1 14  ? -21.659 34.236  38.067  1.00 21.00 ? 1087 ASP I O   1 
ATOM   4609  C CB  . ASP I  1 14  ? -19.254 35.075  39.791  1.00 22.13 ? 1087 ASP I CB  1 
ATOM   4610  C CG  . ASP I  1 14  ? -17.922 35.666  40.223  1.00 31.83 ? 1087 ASP I CG  1 
ATOM   4611  O OD1 . ASP I  1 14  ? -17.011 35.827  39.368  1.00 31.73 ? 1087 ASP I OD1 1 
ATOM   4612  O OD2 . ASP I  1 14  ? -17.802 36.000  41.421  1.00 31.75 ? 1087 ASP I OD2 1 
ATOM   4613  N N   . LEU I  1 15  ? -20.131 32.555  38.010  1.00 19.77 ? 1088 LEU I N   1 
ATOM   4614  C CA  . LEU I  1 15  ? -21.149 31.505  38.001  1.00 19.57 ? 1088 LEU I CA  1 
ATOM   4615  C C   . LEU I  1 15  ? -21.487 31.108  39.435  1.00 18.38 ? 1088 LEU I C   1 
ATOM   4616  O O   . LEU I  1 15  ? -20.623 30.946  40.259  1.00 20.89 ? 1088 LEU I O   1 
ATOM   4617  C CB  . LEU I  1 15  ? -20.731 30.229  37.235  1.00 18.76 ? 1088 LEU I CB  1 
ATOM   4618  C CG  . LEU I  1 15  ? -20.429 30.434  35.746  1.00 18.64 ? 1088 LEU I CG  1 
ATOM   4619  C CD1 . LEU I  1 15  ? -19.796 29.147  35.228  1.00 21.92 ? 1088 LEU I CD1 1 
ATOM   4620  C CD2 . LEU I  1 15  ? -21.712 30.838  34.995  1.00 26.19 ? 1088 LEU I CD2 1 
ATOM   4621  N N   . VAL I  1 16  ? -22.758 30.903  39.715  1.00 16.45 ? 1089 VAL I N   1 
ATOM   4622  C CA  . VAL I  1 16  ? -23.119 30.626  41.102  1.00 18.69 ? 1089 VAL I CA  1 
ATOM   4623  C C   . VAL I  1 16  ? -24.188 29.609  41.151  1.00 19.51 ? 1089 VAL I C   1 
ATOM   4624  O O   . VAL I  1 16  ? -24.943 29.421  40.204  1.00 18.23 ? 1089 VAL I O   1 
ATOM   4625  C CB  . VAL I  1 16  ? -23.621 31.910  41.851  1.00 20.24 ? 1089 VAL I CB  1 
ATOM   4626  C CG1 . VAL I  1 16  ? -22.445 32.891  42.144  1.00 23.28 ? 1089 VAL I CG1 1 
ATOM   4627  C CG2 . VAL I  1 16  ? -24.778 32.586  41.061  1.00 19.98 ? 1089 VAL I CG2 1 
ATOM   4628  N N   . TRP I  1 17  ? -24.245 28.893  42.266  1.00 16.73 ? 1090 TRP I N   1 
ATOM   4629  C CA  . TRP I  1 17  ? -25.497 28.204  42.625  1.00 18.45 ? 1090 TRP I CA  1 
ATOM   4630  C C   . TRP I  1 17  ? -26.377 29.179  43.354  1.00 18.40 ? 1090 TRP I C   1 
ATOM   4631  O O   . TRP I  1 17  ? -25.950 29.752  44.345  1.00 20.96 ? 1090 TRP I O   1 
ATOM   4632  C CB  . TRP I  1 17  ? -25.160 27.097  43.626  1.00 16.30 ? 1090 TRP I CB  1 
ATOM   4633  C CG  . TRP I  1 17  ? -24.394 25.913  42.945  1.00 19.59 ? 1090 TRP I CG  1 
ATOM   4634  C CD1 . TRP I  1 17  ? -23.017 25.633  42.968  1.00 18.02 ? 1090 TRP I CD1 1 
ATOM   4635  C CD2 . TRP I  1 17  ? -24.984 24.900  42.173  1.00 17.87 ? 1090 TRP I CD2 1 
ATOM   4636  N NE1 . TRP I  1 17  ? -22.763 24.502  42.243  1.00 18.51 ? 1090 TRP I NE1 1 
ATOM   4637  C CE2 . TRP I  1 17  ? -23.952 24.025  41.746  1.00 20.01 ? 1090 TRP I CE2 1 
ATOM   4638  C CE3 . TRP I  1 17  ? -26.297 24.618  41.809  1.00 17.74 ? 1090 TRP I CE3 1 
ATOM   4639  C CZ2 . TRP I  1 17  ? -24.202 22.900  40.950  1.00 17.20 ? 1090 TRP I CZ2 1 
ATOM   4640  C CZ3 . TRP I  1 17  ? -26.549 23.475  41.040  1.00 20.06 ? 1090 TRP I CZ3 1 
ATOM   4641  C CH2 . TRP I  1 17  ? -25.501 22.643  40.609  1.00 18.02 ? 1090 TRP I CH2 1 
ATOM   4642  N N   . ALA I  1 18  ? -27.619 29.365  42.881  1.00 19.48 ? 1091 ALA I N   1 
ATOM   4643  C CA  . ALA I  1 18  ? -28.484 30.388  43.457  1.00 18.96 ? 1091 ALA I CA  1 
ATOM   4644  C C   . ALA I  1 18  ? -29.749 29.730  43.959  1.00 18.01 ? 1091 ALA I C   1 
ATOM   4645  O O   . ALA I  1 18  ? -30.456 29.041  43.215  1.00 20.34 ? 1091 ALA I O   1 
ATOM   4646  C CB  . ALA I  1 18  ? -28.837 31.437  42.420  1.00 17.05 ? 1091 ALA I CB  1 
ATOM   4647  N N   . LYS I  1 19  ? -30.045 29.995  45.235  1.00 19.24 ? 1092 LYS I N   1 
ATOM   4648  C CA  . LYS I  1 19  ? -31.150 29.308  45.925  1.00 22.50 ? 1092 LYS I CA  1 
ATOM   4649  C C   . LYS I  1 19  ? -32.381 30.205  46.044  1.00 21.06 ? 1092 LYS I C   1 
ATOM   4650  O O   . LYS I  1 19  ? -32.319 31.247  46.726  1.00 23.25 ? 1092 LYS I O   1 
ATOM   4651  C CB  . LYS I  1 19  ? -30.689 28.932  47.344  1.00 20.99 ? 1092 LYS I CB  1 
ATOM   4652  C CG  . LYS I  1 19  ? -31.774 28.212  48.190  1.00 24.09 ? 1092 LYS I CG  1 
ATOM   4653  C CD  . LYS I  1 19  ? -32.076 26.807  47.641  1.00 27.41 ? 1092 LYS I CD  1 
ATOM   4654  C CE  . LYS I  1 19  ? -33.219 26.117  48.417  1.00 31.35 ? 1092 LYS I CE  1 
ATOM   4655  N NZ  . LYS I  1 19  ? -34.503 26.906  48.397  1.00 28.24 ? 1092 LYS I NZ  1 
ATOM   4656  N N   . CYS I  1 20  ? -33.472 29.817  45.378  1.00 23.06 ? 1093 CYS I N   1 
ATOM   4657  C CA  . CYS I  1 20  ? -34.750 30.522  45.474  1.00 26.22 ? 1093 CYS I CA  1 
ATOM   4658  C C   . CYS I  1 20  ? -35.722 29.772  46.336  1.00 29.84 ? 1093 CYS I C   1 
ATOM   4659  O O   . CYS I  1 20  ? -35.760 28.557  46.311  1.00 28.27 ? 1093 CYS I O   1 
ATOM   4660  C CB  . CYS I  1 20  ? -35.415 30.566  44.120  1.00 31.03 ? 1093 CYS I CB  1 
ATOM   4661  S SG  . CYS I  1 20  ? -34.713 31.788  43.135  1.00 50.22 ? 1093 CYS I SG  1 
ATOM   4662  N N   . ARG I  1 21  ? -36.589 30.494  47.020  1.00 30.32 ? 1094 ARG I N   1 
ATOM   4663  C CA  . ARG I  1 21  ? -37.687 29.819  47.715  1.00 32.47 ? 1094 ARG I CA  1 
ATOM   4664  C C   . ARG I  1 21  ? -38.469 28.830  46.827  1.00 29.56 ? 1094 ARG I C   1 
ATOM   4665  O O   . ARG I  1 21  ? -38.900 29.163  45.723  1.00 34.05 ? 1094 ARG I O   1 
ATOM   4666  C CB  . ARG I  1 21  ? -38.632 30.873  48.317  1.00 40.40 ? 1094 ARG I CB  1 
ATOM   4667  C CG  . ARG I  1 21  ? -39.569 30.305  49.381  1.00 50.18 ? 1094 ARG I CG  1 
ATOM   4668  C CD  . ARG I  1 21  ? -40.014 31.370  50.362  1.00 57.66 ? 1094 ARG I CD  1 
ATOM   4669  N NE  . ARG I  1 21  ? -40.251 30.787  51.680  1.00 68.08 ? 1094 ARG I NE  1 
ATOM   4670  C CZ  . ARG I  1 21  ? -40.542 31.492  52.770  1.00 74.06 ? 1094 ARG I CZ  1 
ATOM   4671  N NH1 . ARG I  1 21  ? -40.744 30.873  53.934  1.00 71.52 ? 1094 ARG I NH1 1 
ATOM   4672  N NH2 . ARG I  1 21  ? -40.631 32.817  52.693  1.00 74.74 ? 1094 ARG I NH2 1 
ATOM   4673  N N   . GLY I  1 22  ? -38.673 27.613  47.318  1.00 34.19 ? 1095 GLY I N   1 
ATOM   4674  C CA  . GLY I  1 22  ? -39.440 26.632  46.573  1.00 33.60 ? 1095 GLY I CA  1 
ATOM   4675  C C   . GLY I  1 22  ? -38.673 25.751  45.592  1.00 32.76 ? 1095 GLY I C   1 
ATOM   4676  O O   . GLY I  1 22  ? -39.213 24.757  45.109  1.00 32.64 ? 1095 GLY I O   1 
ATOM   4677  N N   . TYR I  1 23  ? -37.417 26.114  45.304  1.00 28.45 ? 1096 TYR I N   1 
ATOM   4678  C CA  . TYR I  1 23  ? -36.579 25.371  44.351  1.00 27.43 ? 1096 TYR I CA  1 
ATOM   4679  C C   . TYR I  1 23  ? -35.242 24.978  44.980  1.00 24.69 ? 1096 TYR I C   1 
ATOM   4680  O O   . TYR I  1 23  ? -34.796 25.628  45.895  1.00 25.84 ? 1096 TYR I O   1 
ATOM   4681  C CB  . TYR I  1 23  ? -36.251 26.267  43.172  1.00 29.71 ? 1096 TYR I CB  1 
ATOM   4682  C CG  . TYR I  1 23  ? -37.410 26.432  42.266  1.00 34.70 ? 1096 TYR I CG  1 
ATOM   4683  C CD1 . TYR I  1 23  ? -37.807 25.377  41.446  1.00 36.29 ? 1096 TYR I CD1 1 
ATOM   4684  C CD2 . TYR I  1 23  ? -38.131 27.623  42.232  1.00 35.47 ? 1096 TYR I CD2 1 
ATOM   4685  C CE1 . TYR I  1 23  ? -38.887 25.514  40.615  1.00 41.38 ? 1096 TYR I CE1 1 
ATOM   4686  C CE2 . TYR I  1 23  ? -39.228 27.767  41.382  1.00 35.89 ? 1096 TYR I CE2 1 
ATOM   4687  C CZ  . TYR I  1 23  ? -39.587 26.712  40.592  1.00 35.64 ? 1096 TYR I CZ  1 
ATOM   4688  O OH  . TYR I  1 23  ? -40.659 26.823  39.740  1.00 47.59 ? 1096 TYR I OH  1 
ATOM   4689  N N   . PRO I  1 24  ? -34.603 23.925  44.463  1.00 25.52 ? 1097 PRO I N   1 
ATOM   4690  C CA  . PRO I  1 24  ? -33.267 23.617  44.996  1.00 26.15 ? 1097 PRO I CA  1 
ATOM   4691  C C   . PRO I  1 24  ? -32.287 24.596  44.382  1.00 24.84 ? 1097 PRO I C   1 
ATOM   4692  O O   . PRO I  1 24  ? -32.682 25.318  43.452  1.00 24.84 ? 1097 PRO I O   1 
ATOM   4693  C CB  . PRO I  1 24  ? -32.982 22.201  44.470  1.00 29.30 ? 1097 PRO I CB  1 
ATOM   4694  C CG  . PRO I  1 24  ? -33.874 22.023  43.261  1.00 28.07 ? 1097 PRO I CG  1 
ATOM   4695  C CD  . PRO I  1 24  ? -34.958 23.121  43.287  1.00 27.58 ? 1097 PRO I CD  1 
ATOM   4696  N N   . SER I  1 25  ? -31.062 24.678  44.892  1.00 22.48 ? 1098 SER I N   1 
ATOM   4697  C CA  . SER I  1 25  ? -30.115 25.614  44.288  1.00 21.53 ? 1098 SER I CA  1 
ATOM   4698  C C   . SER I  1 25  ? -29.980 25.340  42.808  1.00 16.15 ? 1098 SER I C   1 
ATOM   4699  O O   . SER I  1 25  ? -29.935 24.185  42.354  1.00 18.59 ? 1098 SER I O   1 
ATOM   4700  C CB  . SER I  1 25  ? -28.707 25.483  44.883  1.00 25.90 ? 1098 SER I CB  1 
ATOM   4701  O OG  . SER I  1 25  ? -28.738 25.432  46.297  1.00 32.24 ? 1098 SER I OG  1 
ATOM   4702  N N   . TYR I  1 26  ? -29.847 26.436  42.042  1.00 15.88 ? 1099 TYR I N   1 
ATOM   4703  C CA  . TYR I  1 26  ? -29.972 26.320  40.605  1.00 17.77 ? 1099 TYR I CA  1 
ATOM   4704  C C   . TYR I  1 26  ? -28.868 27.153  39.962  1.00 17.69 ? 1099 TYR I C   1 
ATOM   4705  O O   . TYR I  1 26  ? -28.589 28.269  40.420  1.00 18.32 ? 1099 TYR I O   1 
ATOM   4706  C CB  . TYR I  1 26  ? -31.330 26.867  40.180  1.00 20.27 ? 1099 TYR I CB  1 
ATOM   4707  C CG  . TYR I  1 26  ? -31.772 26.334  38.840  1.00 20.41 ? 1099 TYR I CG  1 
ATOM   4708  C CD1 . TYR I  1 26  ? -31.267 26.888  37.659  1.00 20.89 ? 1099 TYR I CD1 1 
ATOM   4709  C CD2 . TYR I  1 26  ? -32.698 25.304  38.745  1.00 20.79 ? 1099 TYR I CD2 1 
ATOM   4710  C CE1 . TYR I  1 26  ? -31.672 26.433  36.413  1.00 22.67 ? 1099 TYR I CE1 1 
ATOM   4711  C CE2 . TYR I  1 26  ? -33.114 24.821  37.476  1.00 23.03 ? 1099 TYR I CE2 1 
ATOM   4712  C CZ  . TYR I  1 26  ? -32.591 25.409  36.315  1.00 23.82 ? 1099 TYR I CZ  1 
ATOM   4713  O OH  . TYR I  1 26  ? -32.975 24.948  35.077  1.00 24.46 ? 1099 TYR I OH  1 
ATOM   4714  N N   . PRO I  1 27  ? -28.236 26.630  38.890  1.00 16.87 ? 1100 PRO I N   1 
ATOM   4715  C CA  . PRO I  1 27  ? -27.117 27.379  38.284  1.00 17.04 ? 1100 PRO I CA  1 
ATOM   4716  C C   . PRO I  1 27  ? -27.535 28.714  37.653  1.00 18.21 ? 1100 PRO I C   1 
ATOM   4717  O O   . PRO I  1 27  ? -28.593 28.825  36.993  1.00 16.49 ? 1100 PRO I O   1 
ATOM   4718  C CB  . PRO I  1 27  ? -26.645 26.438  37.168  1.00 16.81 ? 1100 PRO I CB  1 
ATOM   4719  C CG  . PRO I  1 27  ? -26.914 25.056  37.747  1.00 17.73 ? 1100 PRO I CG  1 
ATOM   4720  C CD  . PRO I  1 27  ? -28.355 25.278  38.290  1.00 20.35 ? 1100 PRO I CD  1 
ATOM   4721  N N   . ALA I  1 28  ? -26.695 29.721  37.867  1.00 16.30 ? 1101 ALA I N   1 
ATOM   4722  C CA  . ALA I  1 28  ? -27.017 31.068  37.393  1.00 15.95 ? 1101 ALA I CA  1 
ATOM   4723  C C   . ALA I  1 28  ? -25.772 31.897  37.133  1.00 19.50 ? 1101 ALA I C   1 
ATOM   4724  O O   . ALA I  1 28  ? -24.684 31.477  37.455  1.00 18.98 ? 1101 ALA I O   1 
ATOM   4725  C CB  . ALA I  1 28  ? -27.884 31.755  38.441  1.00 16.63 ? 1101 ALA I CB  1 
ATOM   4726  N N   . LEU I  1 29  ? -25.937 33.104  36.557  1.00 18.05 ? 1102 LEU I N   1 
ATOM   4727  C CA  . LEU I  1 29  ? -24.815 33.991  36.288  1.00 18.52 ? 1102 LEU I CA  1 
ATOM   4728  C C   . LEU I  1 29  ? -25.094 35.297  37.017  1.00 20.18 ? 1102 LEU I C   1 
ATOM   4729  O O   . LEU I  1 29  ? -26.233 35.775  36.944  1.00 20.04 ? 1102 LEU I O   1 
ATOM   4730  C CB  . LEU I  1 29  ? -24.800 34.286  34.760  1.00 20.17 ? 1102 LEU I CB  1 
ATOM   4731  C CG  . LEU I  1 29  ? -23.725 35.192  34.179  1.00 26.24 ? 1102 LEU I CG  1 
ATOM   4732  C CD1 . LEU I  1 29  ? -22.320 34.579  34.461  1.00 22.89 ? 1102 LEU I CD1 1 
ATOM   4733  C CD2 . LEU I  1 29  ? -23.969 35.286  32.660  1.00 21.08 ? 1102 LEU I CD2 1 
ATOM   4734  N N   . ILE I  1 30  ? -24.117 35.864  37.730  1.00 16.28 ? 1103 ILE I N   1 
ATOM   4735  C CA  . ILE I  1 30  ? -24.371 37.166  38.360  1.00 16.85 ? 1103 ILE I CA  1 
ATOM   4736  C C   . ILE I  1 30  ? -24.248 38.229  37.275  1.00 21.18 ? 1103 ILE I C   1 
ATOM   4737  O O   . ILE I  1 30  ? -23.292 38.216  36.494  1.00 22.86 ? 1103 ILE I O   1 
ATOM   4738  C CB  . ILE I  1 30  ? -23.373 37.460  39.438  1.00 19.38 ? 1103 ILE I CB  1 
ATOM   4739  C CG1 . ILE I  1 30  ? -23.440 36.340  40.490  1.00 22.25 ? 1103 ILE I CG1 1 
ATOM   4740  C CG2 . ILE I  1 30  ? -23.634 38.865  40.065  1.00 20.38 ? 1103 ILE I CG2 1 
ATOM   4741  C CD1 . ILE I  1 30  ? -22.714 36.684  41.773  1.00 23.09 ? 1103 ILE I CD1 1 
ATOM   4742  N N   . ILE I  1 31  ? -25.221 39.120  37.245  1.00 19.40 ? 1104 ILE I N   1 
ATOM   4743  C CA  . ILE I  1 31  ? -25.269 40.196  36.245  1.00 20.48 ? 1104 ILE I CA  1 
ATOM   4744  C C   . ILE I  1 31  ? -25.176 41.554  36.941  1.00 23.35 ? 1104 ILE I C   1 
ATOM   4745  O O   . ILE I  1 31  ? -25.787 41.765  37.978  1.00 23.46 ? 1104 ILE I O   1 
ATOM   4746  C CB  . ILE I  1 31  ? -26.604 40.105  35.474  1.00 20.09 ? 1104 ILE I CB  1 
ATOM   4747  C CG1 . ILE I  1 31  ? -26.683 38.762  34.746  1.00 22.08 ? 1104 ILE I CG1 1 
ATOM   4748  C CG2 . ILE I  1 31  ? -26.727 41.277  34.466  1.00 21.08 ? 1104 ILE I CG2 1 
ATOM   4749  C CD1 . ILE I  1 31  ? -25.618 38.561  33.726  1.00 25.91 ? 1104 ILE I CD1 1 
ATOM   4750  N N   . ASP I  1 32  ? -24.388 42.468  36.375  1.00 23.89 ? 1105 ASP I N   1 
ATOM   4751  C CA  . ASP I  1 32  ? -24.259 43.820  36.954  1.00 27.72 ? 1105 ASP I CA  1 
ATOM   4752  C C   . ASP I  1 32  ? -25.498 44.643  36.571  1.00 27.55 ? 1105 ASP I C   1 
ATOM   4753  O O   . ASP I  1 32  ? -25.760 44.876  35.378  1.00 27.15 ? 1105 ASP I O   1 
ATOM   4754  C CB  . ASP I  1 32  ? -22.992 44.476  36.399  1.00 26.73 ? 1105 ASP I CB  1 
ATOM   4755  C CG  . ASP I  1 32  ? -22.881 45.930  36.775  1.00 32.07 ? 1105 ASP I CG  1 
ATOM   4756  O OD1 . ASP I  1 32  ? -23.647 46.382  37.654  1.00 29.83 ? 1105 ASP I OD1 1 
ATOM   4757  O OD2 . ASP I  1 32  ? -22.010 46.609  36.199  1.00 34.11 ? 1105 ASP I OD2 1 
ATOM   4758  N N   . PRO I  1 33  ? -26.285 45.065  37.569  1.00 25.55 ? 1106 PRO I N   1 
ATOM   4759  C CA  . PRO I  1 33  ? -27.554 45.741  37.270  1.00 26.27 ? 1106 PRO I CA  1 
ATOM   4760  C C   . PRO I  1 33  ? -27.271 47.032  36.516  1.00 27.51 ? 1106 PRO I C   1 
ATOM   4761  O O   . PRO I  1 33  ? -28.185 47.558  35.905  1.00 29.19 ? 1106 PRO I O   1 
ATOM   4762  C CB  . PRO I  1 33  ? -28.102 46.089  38.652  1.00 30.10 ? 1106 PRO I CB  1 
ATOM   4763  C CG  . PRO I  1 33  ? -27.376 45.185  39.591  1.00 27.93 ? 1106 PRO I CG  1 
ATOM   4764  C CD  . PRO I  1 33  ? -26.046 44.925  39.014  1.00 29.45 ? 1106 PRO I CD  1 
ATOM   4765  N N   . LYS I  1 34  ? -26.038 47.517  36.591  1.00 29.24 ? 1107 LYS I N   1 
ATOM   4766  C CA  . LYS I  1 34  ? -25.666 48.796  35.963  1.00 32.68 ? 1107 LYS I CA  1 
ATOM   4767  C C   . LYS I  1 34  ? -24.837 48.582  34.709  1.00 35.87 ? 1107 LYS I C   1 
ATOM   4768  O O   . LYS I  1 34  ? -24.133 49.488  34.228  1.00 33.85 ? 1107 LYS I O   1 
ATOM   4769  C CB  . LYS I  1 34  ? -24.909 49.686  36.957  1.00 35.82 ? 1107 LYS I CB  1 
ATOM   4770  C CG  . LYS I  1 34  ? -25.689 50.005  38.242  1.00 40.20 ? 1107 LYS I CG  1 
ATOM   4771  C CD  . LYS I  1 34  ? -26.910 50.921  38.010  1.00 43.30 ? 1107 LYS I CD  1 
ATOM   4772  C CE  . LYS I  1 34  ? -28.237 50.140  37.812  1.00 46.62 ? 1107 LYS I CE  1 
ATOM   4773  N NZ  . LYS I  1 34  ? -29.489 51.002  37.811  1.00 52.87 ? 1107 LYS I NZ  1 
ATOM   4774  N N   . MET I  1 35  ? -24.917 47.388  34.154  1.00 28.50 ? 1108 MET I N   1 
ATOM   4775  C CA  . MET I  1 35  ? -24.316 47.195  32.838  1.00 29.88 ? 1108 MET I CA  1 
ATOM   4776  C C   . MET I  1 35  ? -24.939 48.156  31.807  1.00 34.56 ? 1108 MET I C   1 
ATOM   4777  O O   . MET I  1 35  ? -26.074 48.600  31.956  1.00 31.47 ? 1108 MET I O   1 
ATOM   4778  C CB  . MET I  1 35  ? -24.462 45.753  32.348  1.00 28.40 ? 1108 MET I CB  1 
ATOM   4779  C CG  . MET I  1 35  ? -25.873 45.262  32.218  1.00 29.56 ? 1108 MET I CG  1 
ATOM   4780  S SD  . MET I  1 35  ? -25.840 43.610  31.485  1.00 32.79 ? 1108 MET I SD  1 
ATOM   4781  C CE  . MET I  1 35  ? -25.016 43.985  29.939  1.00 30.73 ? 1108 MET I CE  1 
ATOM   4782  N N   . PRO I  1 36  ? -24.181 48.477  30.754  1.00 34.03 ? 1109 PRO I N   1 
ATOM   4783  C CA  . PRO I  1 36  ? -24.681 49.359  29.686  1.00 33.21 ? 1109 PRO I CA  1 
ATOM   4784  C C   . PRO I  1 36  ? -26.044 48.922  29.164  1.00 35.43 ? 1109 PRO I C   1 
ATOM   4785  O O   . PRO I  1 36  ? -26.250 47.734  28.942  1.00 35.52 ? 1109 PRO I O   1 
ATOM   4786  C CB  . PRO I  1 36  ? -23.639 49.196  28.585  1.00 34.31 ? 1109 PRO I CB  1 
ATOM   4787  C CG  . PRO I  1 36  ? -22.345 48.887  29.331  1.00 38.69 ? 1109 PRO I CG  1 
ATOM   4788  C CD  . PRO I  1 36  ? -22.751 48.139  30.597  1.00 37.61 ? 1109 PRO I CD  1 
ATOM   4789  N N   . ARG I  1 37  ? -26.964 49.868  28.989  1.00 31.54 ? 1110 ARG I N   1 
ATOM   4790  C CA  . ARG I  1 37  ? -28.300 49.549  28.484  1.00 32.30 ? 1110 ARG I CA  1 
ATOM   4791  C C   . ARG I  1 37  ? -28.279 49.161  27.009  1.00 33.19 ? 1110 ARG I C   1 
ATOM   4792  O O   . ARG I  1 37  ? -29.257 48.625  26.489  1.00 37.38 ? 1110 ARG I O   1 
ATOM   4793  C CB  . ARG I  1 37  ? -29.255 50.709  28.696  1.00 30.07 ? 1110 ARG I CB  1 
ATOM   4794  C CG  . ARG I  1 37  ? -29.304 51.154  30.139  1.00 33.62 ? 1110 ARG I CG  1 
ATOM   4795  C CD  . ARG I  1 37  ? -29.757 49.994  31.037  1.00 33.73 ? 1110 ARG I CD  1 
ATOM   4796  N NE  . ARG I  1 37  ? -31.057 49.491  30.630  1.00 31.67 ? 1110 ARG I NE  1 
ATOM   4797  C CZ  . ARG I  1 37  ? -31.597 48.352  31.043  1.00 32.92 ? 1110 ARG I CZ  1 
ATOM   4798  N NH1 . ARG I  1 37  ? -32.806 47.995  30.602  1.00 29.24 ? 1110 ARG I NH1 1 
ATOM   4799  N NH2 . ARG I  1 37  ? -30.914 47.565  31.878  1.00 28.46 ? 1110 ARG I NH2 1 
ATOM   4800  N N   . GLU I  1 38  ? -27.151 49.409  26.353  1.00 36.35 ? 1111 GLU I N   1 
ATOM   4801  C CA  . GLU I  1 38  ? -27.010 49.010  24.968  1.00 38.60 ? 1111 GLU I CA  1 
ATOM   4802  C C   . GLU I  1 38  ? -26.320 47.654  24.865  1.00 40.27 ? 1111 GLU I C   1 
ATOM   4803  O O   . GLU I  1 38  ? -26.084 47.162  23.772  1.00 40.09 ? 1111 GLU I O   1 
ATOM   4804  C CB  . GLU I  1 38  ? -26.269 50.080  24.164  1.00 41.32 ? 1111 GLU I CB  1 
ATOM   4805  C CG  . GLU I  1 38  ? -24.775 50.199  24.462  1.00 45.01 ? 1111 GLU I CG  1 
ATOM   4806  C CD  . GLU I  1 38  ? -24.464 51.157  25.611  1.00 48.79 ? 1111 GLU I CD  1 
ATOM   4807  O OE1 . GLU I  1 38  ? -23.249 51.398  25.849  1.00 52.67 ? 1111 GLU I OE1 1 
ATOM   4808  O OE2 . GLU I  1 38  ? -25.422 51.666  26.269  1.00 46.97 ? 1111 GLU I OE2 1 
ATOM   4809  N N   . GLY I  1 39  ? -26.011 47.042  26.010  1.00 37.02 ? 1112 GLY I N   1 
ATOM   4810  C CA  . GLY I  1 39  ? -25.400 45.718  26.032  1.00 33.53 ? 1112 GLY I CA  1 
ATOM   4811  C C   . GLY I  1 39  ? -23.884 45.684  26.116  1.00 38.49 ? 1112 GLY I C   1 
ATOM   4812  O O   . GLY I  1 39  ? -23.216 46.714  26.067  1.00 38.14 ? 1112 GLY I O   1 
ATOM   4813  N N   . MET I  1 40  ? -23.327 44.487  26.264  1.00 32.49 ? 1113 MET I N   1 
ATOM   4814  C CA  . MET I  1 40  ? -21.878 44.322  26.241  1.00 34.28 ? 1113 MET I CA  1 
ATOM   4815  C C   . MET I  1 40  ? -21.506 42.905  25.837  1.00 40.35 ? 1113 MET I C   1 
ATOM   4816  O O   . MET I  1 40  ? -22.329 41.987  25.902  1.00 34.35 ? 1113 MET I O   1 
ATOM   4817  C CB  . MET I  1 40  ? -21.293 44.612  27.608  1.00 37.27 ? 1113 MET I CB  1 
ATOM   4818  C CG  . MET I  1 40  ? -22.057 43.946  28.708  1.00 42.09 ? 1113 MET I CG  1 
ATOM   4819  S SD  . MET I  1 40  ? -21.084 43.841  30.205  1.00 54.58 ? 1113 MET I SD  1 
ATOM   4820  C CE  . MET I  1 40  ? -19.769 42.785  29.573  1.00 38.52 ? 1113 MET I CE  1 
ATOM   4821  N N   . PHE I  1 41  ? -20.261 42.743  25.418  1.00 39.13 ? 1114 PHE I N   1 
ATOM   4822  C CA  . PHE I  1 41  ? -19.727 41.440  25.095  1.00 40.52 ? 1114 PHE I CA  1 
ATOM   4823  C C   . PHE I  1 41  ? -18.715 41.125  26.170  1.00 40.79 ? 1114 PHE I C   1 
ATOM   4824  O O   . PHE I  1 41  ? -17.925 41.983  26.557  1.00 45.57 ? 1114 PHE I O   1 
ATOM   4825  C CB  . PHE I  1 41  ? -19.060 41.477  23.726  1.00 39.88 ? 1114 PHE I CB  1 
ATOM   4826  C CG  . PHE I  1 41  ? -20.031 41.484  22.605  1.00 36.59 ? 1114 PHE I CG  1 
ATOM   4827  C CD1 . PHE I  1 41  ? -20.464 42.680  22.054  1.00 41.75 ? 1114 PHE I CD1 1 
ATOM   4828  C CD2 . PHE I  1 41  ? -20.527 40.301  22.106  1.00 39.13 ? 1114 PHE I CD2 1 
ATOM   4829  C CE1 . PHE I  1 41  ? -21.380 42.697  21.020  1.00 40.78 ? 1114 PHE I CE1 1 
ATOM   4830  C CE2 . PHE I  1 41  ? -21.452 40.302  21.066  1.00 44.27 ? 1114 PHE I CE2 1 
ATOM   4831  C CZ  . PHE I  1 41  ? -21.879 41.510  20.522  1.00 42.65 ? 1114 PHE I CZ  1 
ATOM   4832  N N   . HIS I  1 42  ? -18.750 39.913  26.694  1.00 39.05 ? 1115 HIS I N   1 
ATOM   4833  C CA  . HIS I  1 42  ? -17.740 39.533  27.659  1.00 41.48 ? 1115 HIS I CA  1 
ATOM   4834  C C   . HIS I  1 42  ? -16.891 38.493  26.954  1.00 40.79 ? 1115 HIS I C   1 
ATOM   4835  O O   . HIS I  1 42  ? -17.363 37.391  26.670  1.00 37.84 ? 1115 HIS I O   1 
ATOM   4836  C CB  . HIS I  1 42  ? -18.401 39.002  28.937  1.00 38.84 ? 1115 HIS I CB  1 
ATOM   4837  C CG  . HIS I  1 42  ? -17.437 38.532  29.976  1.00 40.52 ? 1115 HIS I CG  1 
ATOM   4838  N ND1 . HIS I  1 42  ? -16.496 39.358  30.552  1.00 43.74 ? 1115 HIS I ND1 1 
ATOM   4839  C CD2 . HIS I  1 42  ? -17.302 37.329  30.583  1.00 39.06 ? 1115 HIS I CD2 1 
ATOM   4840  C CE1 . HIS I  1 42  ? -15.795 38.674  31.438  1.00 41.46 ? 1115 HIS I CE1 1 
ATOM   4841  N NE2 . HIS I  1 42  ? -16.265 37.440  31.479  1.00 38.73 ? 1115 HIS I NE2 1 
ATOM   4842  N N   . HIS I  1 43  ? -15.652 38.872  26.627  1.00 42.94 ? 1116 HIS I N   1 
ATOM   4843  C CA  . HIS I  1 43  ? -14.798 38.050  25.777  1.00 40.06 ? 1116 HIS I CA  1 
ATOM   4844  C C   . HIS I  1 43  ? -15.586 37.480  24.610  1.00 40.64 ? 1116 HIS I C   1 
ATOM   4845  O O   . HIS I  1 43  ? -15.516 36.291  24.310  1.00 45.12 ? 1116 HIS I O   1 
ATOM   4846  C CB  . HIS I  1 43  ? -14.180 36.929  26.591  1.00 44.55 ? 1116 HIS I CB  1 
ATOM   4847  C CG  . HIS I  1 43  ? -13.346 37.414  27.731  1.00 49.01 ? 1116 HIS I CG  1 
ATOM   4848  N ND1 . HIS I  1 43  ? -12.185 38.130  27.541  1.00 51.63 ? 1116 HIS I ND1 1 
ATOM   4849  C CD2 . HIS I  1 43  ? -13.502 37.296  29.072  1.00 48.42 ? 1116 HIS I CD2 1 
ATOM   4850  C CE1 . HIS I  1 43  ? -11.657 38.428  28.717  1.00 53.89 ? 1116 HIS I CE1 1 
ATOM   4851  N NE2 . HIS I  1 43  ? -12.438 37.937  29.662  1.00 54.97 ? 1116 HIS I NE2 1 
ATOM   4852  N N   . GLY I  1 44  ? -16.375 38.322  23.966  1.00 42.56 ? 1117 GLY I N   1 
ATOM   4853  C CA  . GLY I  1 44  ? -17.038 37.893  22.761  1.00 41.66 ? 1117 GLY I CA  1 
ATOM   4854  C C   . GLY I  1 44  ? -18.413 37.334  22.980  1.00 40.33 ? 1117 GLY I C   1 
ATOM   4855  O O   . GLY I  1 44  ? -19.134 37.121  22.017  1.00 40.35 ? 1117 GLY I O   1 
ATOM   4856  N N   . VAL I  1 45  ? -18.789 37.116  24.236  1.00 38.38 ? 1118 VAL I N   1 
ATOM   4857  C CA  . VAL I  1 45  ? -20.105 36.575  24.548  1.00 37.97 ? 1118 VAL I CA  1 
ATOM   4858  C C   . VAL I  1 45  ? -21.016 37.713  24.950  1.00 34.77 ? 1118 VAL I C   1 
ATOM   4859  O O   . VAL I  1 45  ? -20.673 38.435  25.876  1.00 34.43 ? 1118 VAL I O   1 
ATOM   4860  C CB  . VAL I  1 45  ? -20.000 35.593  25.737  1.00 38.78 ? 1118 VAL I CB  1 
ATOM   4861  C CG1 . VAL I  1 45  ? -21.373 35.138  26.198  1.00 34.14 ? 1118 VAL I CG1 1 
ATOM   4862  C CG2 . VAL I  1 45  ? -19.095 34.406  25.369  1.00 37.80 ? 1118 VAL I CG2 1 
ATOM   4863  N N   . PRO I  1 46  ? -22.167 37.869  24.264  1.00 34.51 ? 1119 PRO I N   1 
ATOM   4864  C CA  . PRO I  1 46  ? -23.193 38.878  24.571  1.00 37.97 ? 1119 PRO I CA  1 
ATOM   4865  C C   . PRO I  1 46  ? -23.935 38.544  25.869  1.00 34.42 ? 1119 PRO I C   1 
ATOM   4866  O O   . PRO I  1 46  ? -24.466 37.439  26.006  1.00 33.80 ? 1119 PRO I O   1 
ATOM   4867  C CB  . PRO I  1 46  ? -24.174 38.753  23.389  1.00 39.05 ? 1119 PRO I CB  1 
ATOM   4868  C CG  . PRO I  1 46  ? -23.985 37.312  22.929  1.00 37.21 ? 1119 PRO I CG  1 
ATOM   4869  C CD  . PRO I  1 46  ? -22.487 37.161  23.012  1.00 33.83 ? 1119 PRO I CD  1 
ATOM   4870  N N   . ILE I  1 47  ? -23.972 39.508  26.782  1.00 30.77 ? 1120 ILE I N   1 
ATOM   4871  C CA  . ILE I  1 47  ? -24.621 39.341  28.076  1.00 25.63 ? 1120 ILE I CA  1 
ATOM   4872  C C   . ILE I  1 47  ? -26.001 39.984  28.009  1.00 27.16 ? 1120 ILE I C   1 
ATOM   4873  O O   . ILE I  1 47  ? -26.126 41.132  27.596  1.00 27.23 ? 1120 ILE I O   1 
ATOM   4874  C CB  . ILE I  1 47  ? -23.763 39.979  29.184  1.00 31.30 ? 1120 ILE I CB  1 
ATOM   4875  C CG1 . ILE I  1 47  ? -22.315 39.461  29.147  1.00 28.93 ? 1120 ILE I CG1 1 
ATOM   4876  C CG2 . ILE I  1 47  ? -24.410 39.806  30.578  1.00 27.94 ? 1120 ILE I CG2 1 
ATOM   4877  C CD1 . ILE I  1 47  ? -22.146 37.927  29.098  1.00 32.03 ? 1120 ILE I CD1 1 
ATOM   4878  N N   . PRO I  1 48  ? -27.049 39.251  28.383  1.00 24.80 ? 1121 PRO I N   1 
ATOM   4879  C CA  . PRO I  1 48  ? -28.409 39.796  28.339  1.00 27.10 ? 1121 PRO I CA  1 
ATOM   4880  C C   . PRO I  1 48  ? -28.535 41.026  29.218  1.00 27.29 ? 1121 PRO I C   1 
ATOM   4881  O O   . PRO I  1 48  ? -27.975 41.044  30.304  1.00 24.01 ? 1121 PRO I O   1 
ATOM   4882  C CB  . PRO I  1 48  ? -29.250 38.659  28.926  1.00 28.46 ? 1121 PRO I CB  1 
ATOM   4883  C CG  . PRO I  1 48  ? -28.507 37.432  28.570  1.00 28.19 ? 1121 PRO I CG  1 
ATOM   4884  C CD  . PRO I  1 48  ? -27.045 37.822  28.723  1.00 28.34 ? 1121 PRO I CD  1 
ATOM   4885  N N   . VAL I  1 49  ? -29.262 42.034  28.754  1.00 25.99 ? 1122 VAL I N   1 
ATOM   4886  C CA  . VAL I  1 49  ? -29.402 43.248  29.519  1.00 22.35 ? 1122 VAL I CA  1 
ATOM   4887  C C   . VAL I  1 49  ? -30.654 43.106  30.373  1.00 23.29 ? 1122 VAL I C   1 
ATOM   4888  O O   . VAL I  1 49  ? -31.710 42.705  29.898  1.00 27.05 ? 1122 VAL I O   1 
ATOM   4889  C CB  . VAL I  1 49  ? -29.514 44.481  28.568  1.00 24.24 ? 1122 VAL I CB  1 
ATOM   4890  C CG1 . VAL I  1 49  ? -29.861 45.749  29.349  1.00 26.31 ? 1122 VAL I CG1 1 
ATOM   4891  C CG2 . VAL I  1 49  ? -28.211 44.656  27.786  1.00 29.15 ? 1122 VAL I CG2 1 
ATOM   4892  N N   . PRO I  1 50  ? -30.531 43.381  31.674  1.00 25.17 ? 1123 PRO I N   1 
ATOM   4893  C CA  . PRO I  1 50  ? -31.692 43.234  32.563  1.00 25.21 ? 1123 PRO I CA  1 
ATOM   4894  C C   . PRO I  1 50  ? -32.822 44.170  32.145  1.00 30.09 ? 1123 PRO I C   1 
ATOM   4895  O O   . PRO I  1 50  ? -32.559 45.345  31.912  1.00 30.40 ? 1123 PRO I O   1 
ATOM   4896  C CB  . PRO I  1 50  ? -31.180 43.753  33.913  1.00 25.13 ? 1123 PRO I CB  1 
ATOM   4897  C CG  . PRO I  1 50  ? -29.719 43.850  33.801  1.00 27.01 ? 1123 PRO I CG  1 
ATOM   4898  C CD  . PRO I  1 50  ? -29.306 43.808  32.355  1.00 24.12 ? 1123 PRO I CD  1 
ATOM   4899  N N   . PRO I  1 51  ? -34.051 43.677  32.090  1.00 28.48 ? 1124 PRO I N   1 
ATOM   4900  C CA  . PRO I  1 51  ? -35.226 44.499  31.798  1.00 28.96 ? 1124 PRO I CA  1 
ATOM   4901  C C   . PRO I  1 51  ? -35.458 45.592  32.847  1.00 32.94 ? 1124 PRO I C   1 
ATOM   4902  O O   . PRO I  1 51  ? -35.087 45.419  34.001  1.00 29.01 ? 1124 PRO I O   1 
ATOM   4903  C CB  . PRO I  1 51  ? -36.363 43.484  31.879  1.00 31.63 ? 1124 PRO I CB  1 
ATOM   4904  C CG  . PRO I  1 51  ? -35.735 42.206  31.458  1.00 30.83 ? 1124 PRO I CG  1 
ATOM   4905  C CD  . PRO I  1 51  ? -34.370 42.239  32.089  1.00 31.54 ? 1124 PRO I CD  1 
ATOM   4906  N N   . LEU I  1 52  ? -36.122 46.685  32.468  1.00 30.29 ? 1125 LEU I N   1 
ATOM   4907  C CA  . LEU I  1 52  ? -36.358 47.746  33.426  1.00 26.05 ? 1125 LEU I CA  1 
ATOM   4908  C C   . LEU I  1 52  ? -37.203 47.299  34.602  1.00 29.82 ? 1125 LEU I C   1 
ATOM   4909  O O   . LEU I  1 52  ? -36.960 47.725  35.734  1.00 30.46 ? 1125 LEU I O   1 
ATOM   4910  C CB  . LEU I  1 52  ? -37.029 48.976  32.757  1.00 31.49 ? 1125 LEU I CB  1 
ATOM   4911  C CG  . LEU I  1 52  ? -36.187 49.696  31.711  1.00 33.72 ? 1125 LEU I CG  1 
ATOM   4912  C CD1 . LEU I  1 52  ? -37.050 50.820  31.150  1.00 35.03 ? 1125 LEU I CD1 1 
ATOM   4913  C CD2 . LEU I  1 52  ? -34.886 50.252  32.258  1.00 30.95 ? 1125 LEU I CD2 1 
ATOM   4914  N N   . GLU I  1 53  ? -38.194 46.465  34.331  1.00 31.35 ? 1126 GLU I N   1 
ATOM   4915  C CA  . GLU I  1 53  ? -39.072 45.959  35.379  1.00 35.43 ? 1126 GLU I CA  1 
ATOM   4916  C C   . GLU I  1 53  ? -38.287 45.099  36.371  1.00 33.27 ? 1126 GLU I C   1 
ATOM   4917  O O   . GLU I  1 53  ? -38.615 45.049  37.567  1.00 32.27 ? 1126 GLU I O   1 
ATOM   4918  C CB  . GLU I  1 53  ? -40.197 45.133  34.752  1.00 40.92 ? 1126 GLU I CB  1 
ATOM   4919  C CG  . GLU I  1 53  ? -41.183 44.503  35.737  1.00 46.98 ? 1126 GLU I CG  1 
ATOM   4920  C CD  . GLU I  1 53  ? -42.444 43.991  35.033  1.00 59.42 ? 1126 GLU I CD  1 
ATOM   4921  O OE1 . GLU I  1 53  ? -43.471 43.736  35.714  1.00 63.86 ? 1126 GLU I OE1 1 
ATOM   4922  O OE2 . GLU I  1 53  ? -42.404 43.855  33.783  1.00 67.20 ? 1126 GLU I OE2 1 
ATOM   4923  N N   . VAL I  1 54  ? -37.253 44.429  35.869  1.00 29.49 ? 1127 VAL I N   1 
ATOM   4924  C CA  . VAL I  1 54  ? -36.379 43.645  36.764  1.00 26.58 ? 1127 VAL I CA  1 
ATOM   4925  C C   . VAL I  1 54  ? -35.535 44.541  37.681  1.00 27.70 ? 1127 VAL I C   1 
ATOM   4926  O O   . VAL I  1 54  ? -35.368 44.255  38.874  1.00 24.29 ? 1127 VAL I O   1 
ATOM   4927  C CB  . VAL I  1 54  ? -35.520 42.665  35.973  1.00 26.99 ? 1127 VAL I CB  1 
ATOM   4928  C CG1 . VAL I  1 54  ? -34.432 42.067  36.828  1.00 23.10 ? 1127 VAL I CG1 1 
ATOM   4929  C CG2 . VAL I  1 54  ? -36.439 41.563  35.367  1.00 28.70 ? 1127 VAL I CG2 1 
ATOM   4930  N N   . LEU I  1 55  ? -34.981 45.609  37.128  1.00 26.72 ? 1128 LEU I N   1 
ATOM   4931  C CA  . LEU I  1 55  ? -34.251 46.561  37.956  1.00 25.98 ? 1128 LEU I CA  1 
ATOM   4932  C C   . LEU I  1 55  ? -35.125 47.203  39.031  1.00 28.11 ? 1128 LEU I C   1 
ATOM   4933  O O   . LEU I  1 55  ? -34.643 47.481  40.142  1.00 31.24 ? 1128 LEU I O   1 
ATOM   4934  C CB  . LEU I  1 55  ? -33.585 47.639  37.094  1.00 27.92 ? 1128 LEU I CB  1 
ATOM   4935  C CG  . LEU I  1 55  ? -32.511 47.070  36.178  1.00 31.77 ? 1128 LEU I CG  1 
ATOM   4936  C CD1 . LEU I  1 55  ? -31.835 48.193  35.448  1.00 30.33 ? 1128 LEU I CD1 1 
ATOM   4937  C CD2 . LEU I  1 55  ? -31.497 46.265  36.975  1.00 30.09 ? 1128 LEU I CD2 1 
ATOM   4938  N N   . LYS I  1 56  ? -36.406 47.421  38.719  1.00 29.21 ? 1129 LYS I N   1 
ATOM   4939  C CA  . LYS I  1 56  ? -37.281 48.179  39.620  1.00 31.21 ? 1129 LYS I CA  1 
ATOM   4940  C C   . LYS I  1 56  ? -37.607 47.273  40.792  1.00 33.37 ? 1129 LYS I C   1 
ATOM   4941  O O   . LYS I  1 56  ? -37.613 47.696  41.956  1.00 30.46 ? 1129 LYS I O   1 
ATOM   4942  C CB  . LYS I  1 56  ? -38.579 48.595  38.898  1.00 37.15 ? 1129 LYS I CB  1 
ATOM   4943  C CG  . LYS I  1 56  ? -39.666 49.180  39.841  1.00 40.71 ? 1129 LYS I CG  1 
ATOM   4944  C CD  . LYS I  1 56  ? -41.006 49.316  39.122  1.00 44.24 ? 1129 LYS I CD  1 
ATOM   4945  C CE  . LYS I  1 56  ? -42.101 49.835  40.059  1.00 50.88 ? 1129 LYS I CE  1 
ATOM   4946  N NZ  . LYS I  1 56  ? -43.429 49.883  39.362  1.00 54.76 ? 1129 LYS I NZ  1 
ATOM   4947  N N   . LEU I  1 57  ? -37.876 46.017  40.456  1.00 28.99 ? 1130 LEU I N   1 
ATOM   4948  C CA  . LEU I  1 57  ? -38.083 44.948  41.427  1.00 32.61 ? 1130 LEU I CA  1 
ATOM   4949  C C   . LEU I  1 57  ? -36.914 44.906  42.385  1.00 30.91 ? 1130 LEU I C   1 
ATOM   4950  O O   . LEU I  1 57  ? -37.090 44.753  43.604  1.00 31.14 ? 1130 LEU I O   1 
ATOM   4951  C CB  . LEU I  1 57  ? -38.144 43.614  40.689  1.00 30.99 ? 1130 LEU I CB  1 
ATOM   4952  C CG  . LEU I  1 57  ? -39.048 42.546  41.256  1.00 35.99 ? 1130 LEU I CG  1 
ATOM   4953  C CD1 . LEU I  1 57  ? -38.324 41.178  41.088  1.00 36.71 ? 1130 LEU I CD1 1 
ATOM   4954  C CD2 . LEU I  1 57  ? -39.418 42.801  42.700  1.00 31.99 ? 1130 LEU I CD2 1 
ATOM   4955  N N   . GLY I  1 58  ? -35.722 45.028  41.816  1.00 27.66 ? 1131 GLY I N   1 
ATOM   4956  C CA  . GLY I  1 58  ? -34.486 44.956  42.579  1.00 28.39 ? 1131 GLY I CA  1 
ATOM   4957  C C   . GLY I  1 58  ? -34.427 46.025  43.657  1.00 31.80 ? 1131 GLY I C   1 
ATOM   4958  O O   . GLY I  1 58  ? -34.128 45.740  44.833  1.00 31.21 ? 1131 GLY I O   1 
ATOM   4959  N N   . GLU I  1 59  ? -34.716 47.263  43.257  1.00 30.36 ? 1132 GLU I N   1 
ATOM   4960  C CA  . GLU I  1 59  ? -34.760 48.373  44.218  1.00 33.83 ? 1132 GLU I CA  1 
ATOM   4961  C C   . GLU I  1 59  ? -35.782 48.112  45.327  1.00 34.40 ? 1132 GLU I C   1 
ATOM   4962  O O   . GLU I  1 59  ? -35.460 48.215  46.503  1.00 39.56 ? 1132 GLU I O   1 
ATOM   4963  C CB  . GLU I  1 59  ? -35.056 49.677  43.497  1.00 40.70 ? 1132 GLU I CB  1 
ATOM   4964  C CG  . GLU I  1 59  ? -33.850 50.326  42.839  1.00 45.77 ? 1132 GLU I CG  1 
ATOM   4965  C CD  . GLU I  1 59  ? -34.269 51.420  41.868  1.00 55.45 ? 1132 GLU I CD  1 
ATOM   4966  O OE1 . GLU I  1 59  ? -35.030 52.325  42.291  1.00 56.56 ? 1132 GLU I OE1 1 
ATOM   4967  O OE2 . GLU I  1 59  ? -33.856 51.363  40.682  1.00 59.55 ? 1132 GLU I OE2 1 
ATOM   4968  N N   . GLN I  1 60  ? -36.998 47.720  44.967  1.00 30.40 ? 1133 GLN I N   1 
ATOM   4969  C CA  . GLN I  1 60  ? -37.992 47.361  45.969  1.00 34.78 ? 1133 GLN I CA  1 
ATOM   4970  C C   . GLN I  1 60  ? -37.516 46.274  46.922  1.00 36.65 ? 1133 GLN I C   1 
ATOM   4971  O O   . GLN I  1 60  ? -37.666 46.400  48.126  1.00 33.42 ? 1133 GLN I O   1 
ATOM   4972  C CB  . GLN I  1 60  ? -39.281 46.869  45.318  1.00 34.39 ? 1133 GLN I CB  1 
ATOM   4973  C CG  . GLN I  1 60  ? -40.023 47.926  44.533  1.00 40.97 ? 1133 GLN I CG  1 
ATOM   4974  C CD  . GLN I  1 60  ? -41.193 47.365  43.739  1.00 45.93 ? 1133 GLN I CD  1 
ATOM   4975  O OE1 . GLN I  1 60  ? -41.474 46.160  43.770  1.00 46.47 ? 1133 GLN I OE1 1 
ATOM   4976  N NE2 . GLN I  1 60  ? -41.884 48.247  43.019  1.00 51.91 ? 1133 GLN I NE2 1 
ATOM   4977  N N   . MET I  1 61  ? -37.015 45.167  46.375  1.00 29.74 ? 1134 MET I N   1 
ATOM   4978  C CA  . MET I  1 61  ? -36.649 44.031  47.205  1.00 27.42 ? 1134 MET I CA  1 
ATOM   4979  C C   . MET I  1 61  ? -35.509 44.415  48.119  1.00 30.09 ? 1134 MET I C   1 
ATOM   4980  O O   . MET I  1 61  ? -35.402 43.958  49.244  1.00 29.12 ? 1134 MET I O   1 
ATOM   4981  C CB  . MET I  1 61  ? -36.244 42.854  46.320  1.00 27.79 ? 1134 MET I CB  1 
ATOM   4982  C CG  . MET I  1 61  ? -37.457 42.191  45.695  1.00 27.77 ? 1134 MET I CG  1 
ATOM   4983  S SD  . MET I  1 61  ? -37.019 40.841  44.563  1.00 28.27 ? 1134 MET I SD  1 
ATOM   4984  C CE  . MET I  1 61  ? -36.342 39.546  45.602  1.00 27.62 ? 1134 MET I CE  1 
ATOM   4985  N N   . THR I  1 62  ? -34.619 45.225  47.603  1.00 27.68 ? 1135 THR I N   1 
ATOM   4986  C CA  . THR I  1 62  ? -33.443 45.593  48.362  1.00 30.87 ? 1135 THR I CA  1 
ATOM   4987  C C   . THR I  1 62  ? -33.869 46.442  49.555  1.00 32.01 ? 1135 THR I C   1 
ATOM   4988  O O   . THR I  1 62  ? -33.419 46.206  50.670  1.00 33.65 ? 1135 THR I O   1 
ATOM   4989  C CB  . THR I  1 62  ? -32.489 46.406  47.495  1.00 25.57 ? 1135 THR I CB  1 
ATOM   4990  O OG1 . THR I  1 62  ? -31.992 45.554  46.455  1.00 30.31 ? 1135 THR I OG1 1 
ATOM   4991  C CG2 . THR I  1 62  ? -31.327 46.927  48.316  1.00 34.82 ? 1135 THR I CG2 1 
ATOM   4992  N N   . GLN I  1 63  ? -34.757 47.401  49.298  1.00 35.18 ? 1136 GLN I N   1 
ATOM   4993  C CA  . GLN I  1 63  ? -35.197 48.355  50.315  1.00 34.34 ? 1136 GLN I CA  1 
ATOM   4994  C C   . GLN I  1 63  ? -36.094 47.639  51.331  1.00 40.93 ? 1136 GLN I C   1 
ATOM   4995  O O   . GLN I  1 63  ? -36.048 47.946  52.527  1.00 42.45 ? 1136 GLN I O   1 
ATOM   4996  C CB  . GLN I  1 63  ? -35.859 49.584  49.655  1.00 42.33 ? 1136 GLN I CB  1 
ATOM   4997  C CG  . GLN I  1 63  ? -34.838 50.564  48.960  1.00 47.91 ? 1136 GLN I CG  1 
ATOM   4998  C CD  . GLN I  1 63  ? -35.431 51.466  47.825  1.00 53.45 ? 1136 GLN I CD  1 
ATOM   4999  O OE1 . GLN I  1 63  ? -36.659 51.606  47.682  1.00 53.11 ? 1136 GLN I OE1 1 
ATOM   5000  N NE2 . GLN I  1 63  ? -34.535 52.083  47.020  1.00 51.32 ? 1136 GLN I NE2 1 
ATOM   5001  N N   . GLU I  1 64  ? -36.867 46.641  50.909  1.00 37.89 ? 1137 GLU I N   1 
ATOM   5002  C CA  . GLU I  1 64  ? -37.608 45.898  51.919  1.00 39.87 ? 1137 GLU I CA  1 
ATOM   5003  C C   . GLU I  1 64  ? -36.756 44.864  52.676  1.00 39.10 ? 1137 GLU I C   1 
ATOM   5004  O O   . GLU I  1 64  ? -36.999 44.590  53.840  1.00 39.88 ? 1137 GLU I O   1 
ATOM   5005  C CB  . GLU I  1 64  ? -38.945 45.351  51.394  1.00 42.89 ? 1137 GLU I CB  1 
ATOM   5006  C CG  . GLU I  1 64  ? -38.855 44.062  50.648  1.00 42.48 ? 1137 GLU I CG  1 
ATOM   5007  C CD  . GLU I  1 64  ? -40.168 43.693  49.930  1.00 53.90 ? 1137 GLU I CD  1 
ATOM   5008  O OE1 . GLU I  1 64  ? -40.367 42.480  49.653  1.00 57.25 ? 1137 GLU I OE1 1 
ATOM   5009  O OE2 . GLU I  1 64  ? -40.985 44.606  49.634  1.00 53.11 ? 1137 GLU I OE2 1 
ATOM   5010  N N   . ALA I  1 65  ? -35.700 44.345  52.073  1.00 31.38 ? 1138 ALA I N   1 
ATOM   5011  C CA  . ALA I  1 65  ? -34.843 43.435  52.822  1.00 32.56 ? 1138 ALA I CA  1 
ATOM   5012  C C   . ALA I  1 65  ? -33.749 44.152  53.630  1.00 30.86 ? 1138 ALA I C   1 
ATOM   5013  O O   . ALA I  1 65  ? -33.221 43.589  54.595  1.00 35.05 ? 1138 ALA I O   1 
ATOM   5014  C CB  . ALA I  1 65  ? -34.214 42.362  51.899  1.00 35.69 ? 1138 ALA I CB  1 
ATOM   5015  N N   . ARG I  1 66  ? -33.432 45.380  53.235  1.00 31.44 ? 1139 ARG I N   1 
ATOM   5016  C CA  . ARG I  1 66  ? -32.230 46.066  53.723  1.00 33.58 ? 1139 ARG I CA  1 
ATOM   5017  C C   . ARG I  1 66  ? -31.054 45.090  53.772  1.00 32.09 ? 1139 ARG I C   1 
ATOM   5018  O O   . ARG I  1 66  ? -30.336 44.938  54.771  1.00 31.47 ? 1139 ARG I O   1 
ATOM   5019  C CB  . ARG I  1 66  ? -32.483 46.794  55.056  1.00 33.57 ? 1139 ARG I CB  1 
ATOM   5020  C CG  . ARG I  1 66  ? -33.180 48.131  54.844  1.00 36.29 ? 1139 ARG I CG  1 
ATOM   5021  C CD  . ARG I  1 66  ? -34.287 48.384  55.871  1.00 33.36 ? 1139 ARG I CD  1 
ATOM   5022  N NE  . ARG I  1 66  ? -35.357 47.417  55.727  1.00 40.53 ? 1139 ARG I NE  1 
ATOM   5023  C CZ  . ARG I  1 66  ? -36.480 47.456  56.428  1.00 38.41 ? 1139 ARG I CZ  1 
ATOM   5024  N NH1 . ARG I  1 66  ? -37.408 46.525  56.250  1.00 40.83 ? 1139 ARG I NH1 1 
ATOM   5025  N NH2 . ARG I  1 66  ? -36.671 48.429  57.310  1.00 35.06 ? 1139 ARG I NH2 1 
ATOM   5026  N N   . GLU I  1 67  ? -30.874 44.415  52.643  1.00 30.35 ? 1140 GLU I N   1 
ATOM   5027  C CA  . GLU I  1 67  ? -29.751 43.511  52.431  1.00 30.74 ? 1140 GLU I CA  1 
ATOM   5028  C C   . GLU I  1 67  ? -29.298 43.744  51.010  1.00 28.28 ? 1140 GLU I C   1 
ATOM   5029  O O   . GLU I  1 67  ? -30.131 44.019  50.135  1.00 28.16 ? 1140 GLU I O   1 
ATOM   5030  C CB  . GLU I  1 67  ? -30.206 42.066  52.538  1.00 31.69 ? 1140 GLU I CB  1 
ATOM   5031  C CG  . GLU I  1 67  ? -29.745 41.348  53.738  1.00 41.67 ? 1140 GLU I CG  1 
ATOM   5032  C CD  . GLU I  1 67  ? -29.788 39.845  53.531  1.00 39.55 ? 1140 GLU I CD  1 
ATOM   5033  O OE1 . GLU I  1 67  ? -30.911 39.300  53.382  1.00 43.06 ? 1140 GLU I OE1 1 
ATOM   5034  O OE2 . GLU I  1 67  ? -28.697 39.222  53.516  1.00 43.46 ? 1140 GLU I OE2 1 
ATOM   5035  N N   . HIS I  1 68  ? -27.995 43.658  50.757  1.00 24.29 ? 1141 HIS I N   1 
ATOM   5036  C CA  . HIS I  1 68  ? -27.518 43.866  49.396  1.00 25.72 ? 1141 HIS I CA  1 
ATOM   5037  C C   . HIS I  1 68  ? -27.942 42.637  48.576  1.00 22.69 ? 1141 HIS I C   1 
ATOM   5038  O O   . HIS I  1 68  ? -27.691 41.509  48.999  1.00 23.93 ? 1141 HIS I O   1 
ATOM   5039  C CB  . HIS I  1 68  ? -26.001 43.980  49.385  1.00 24.77 ? 1141 HIS I CB  1 
ATOM   5040  C CG  . HIS I  1 68  ? -25.413 44.051  48.018  1.00 29.36 ? 1141 HIS I CG  1 
ATOM   5041  N ND1 . HIS I  1 68  ? -25.386 45.208  47.277  1.00 31.51 ? 1141 HIS I ND1 1 
ATOM   5042  C CD2 . HIS I  1 68  ? -24.817 43.099  47.256  1.00 31.29 ? 1141 HIS I CD2 1 
ATOM   5043  C CE1 . HIS I  1 68  ? -24.820 44.969  46.104  1.00 35.06 ? 1141 HIS I CE1 1 
ATOM   5044  N NE2 . HIS I  1 68  ? -24.462 43.696  46.069  1.00 34.53 ? 1141 HIS I NE2 1 
ATOM   5045  N N   . LEU I  1 69  ? -28.580 42.857  47.434  1.00 22.83 ? 1142 LEU I N   1 
ATOM   5046  C CA  . LEU I  1 69  ? -29.003 41.731  46.598  1.00 23.29 ? 1142 LEU I CA  1 
ATOM   5047  C C   . LEU I  1 69  ? -28.220 41.714  45.293  1.00 21.79 ? 1142 LEU I C   1 
ATOM   5048  O O   . LEU I  1 69  ? -27.965 42.765  44.679  1.00 25.44 ? 1142 LEU I O   1 
ATOM   5049  C CB  . LEU I  1 69  ? -30.512 41.789  46.332  1.00 24.17 ? 1142 LEU I CB  1 
ATOM   5050  C CG  . LEU I  1 69  ? -31.369 41.853  47.597  1.00 24.98 ? 1142 LEU I CG  1 
ATOM   5051  C CD1 . LEU I  1 69  ? -32.874 42.051  47.264  1.00 25.20 ? 1142 LEU I CD1 1 
ATOM   5052  C CD2 . LEU I  1 69  ? -31.144 40.640  48.457  1.00 24.52 ? 1142 LEU I CD2 1 
ATOM   5053  N N   . TYR I  1 70  ? -27.859 40.512  44.861  1.00 21.01 ? 1143 TYR I N   1 
ATOM   5054  C CA  . TYR I  1 70  ? -27.190 40.291  43.600  1.00 19.22 ? 1143 TYR I CA  1 
ATOM   5055  C C   . TYR I  1 70  ? -28.275 39.955  42.605  1.00 20.07 ? 1143 TYR I C   1 
ATOM   5056  O O   . TYR I  1 70  ? -29.223 39.280  42.944  1.00 19.93 ? 1143 TYR I O   1 
ATOM   5057  C CB  . TYR I  1 70  ? -26.269 39.051  43.704  1.00 20.59 ? 1143 TYR I CB  1 
ATOM   5058  C CG  . TYR I  1 70  ? -25.053 39.317  44.562  1.00 19.61 ? 1143 TYR I CG  1 
ATOM   5059  C CD1 . TYR I  1 70  ? -23.890 39.874  44.012  1.00 24.77 ? 1143 TYR I CD1 1 
ATOM   5060  C CD2 . TYR I  1 70  ? -25.099 39.086  45.935  1.00 23.96 ? 1143 TYR I CD2 1 
ATOM   5061  C CE1 . TYR I  1 70  ? -22.773 40.111  44.787  1.00 23.29 ? 1143 TYR I CE1 1 
ATOM   5062  C CE2 . TYR I  1 70  ? -23.988 39.335  46.729  1.00 25.15 ? 1143 TYR I CE2 1 
ATOM   5063  C CZ  . TYR I  1 70  ? -22.828 39.847  46.143  1.00 24.88 ? 1143 TYR I CZ  1 
ATOM   5064  O OH  . TYR I  1 70  ? -21.711 40.099  46.904  1.00 28.14 ? 1143 TYR I OH  1 
ATOM   5065  N N   . LEU I  1 71  ? -28.116 40.445  41.377  1.00 20.43 ? 1144 LEU I N   1 
ATOM   5066  C CA  . LEU I  1 71  ? -28.993 40.070  40.278  1.00 18.30 ? 1144 LEU I CA  1 
ATOM   5067  C C   . LEU I  1 71  ? -28.447 38.820  39.609  1.00 18.39 ? 1144 LEU I C   1 
ATOM   5068  O O   . LEU I  1 71  ? -27.281 38.763  39.218  1.00 19.40 ? 1144 LEU I O   1 
ATOM   5069  C CB  . LEU I  1 71  ? -29.011 41.212  39.261  1.00 18.53 ? 1144 LEU I CB  1 
ATOM   5070  C CG  . LEU I  1 71  ? -29.832 40.954  37.996  1.00 22.54 ? 1144 LEU I CG  1 
ATOM   5071  C CD1 . LEU I  1 71  ? -31.268 40.695  38.348  1.00 18.88 ? 1144 LEU I CD1 1 
ATOM   5072  C CD2 . LEU I  1 71  ? -29.722 42.234  37.117  1.00 21.40 ? 1144 LEU I CD2 1 
ATOM   5073  N N   . VAL I  1 72  ? -29.256 37.796  39.523  1.00 18.30 ? 1145 VAL I N   1 
ATOM   5074  C CA  . VAL I  1 72  ? -28.783 36.611  38.810  1.00 18.06 ? 1145 VAL I CA  1 
ATOM   5075  C C   . VAL I  1 72  ? -29.687 36.270  37.650  1.00 19.48 ? 1145 VAL I C   1 
ATOM   5076  O O   . VAL I  1 72  ? -30.889 36.539  37.689  1.00 19.84 ? 1145 VAL I O   1 
ATOM   5077  C CB  . VAL I  1 72  ? -28.615 35.376  39.763  1.00 19.33 ? 1145 VAL I CB  1 
ATOM   5078  C CG1 . VAL I  1 72  ? -27.706 35.771  40.932  1.00 20.48 ? 1145 VAL I CG1 1 
ATOM   5079  C CG2 . VAL I  1 72  ? -30.033 34.804  40.207  1.00 20.04 ? 1145 VAL I CG2 1 
ATOM   5080  N N   . LEU I  1 73  ? -29.092 35.639  36.647  1.00 18.66 ? 1146 LEU I N   1 
ATOM   5081  C CA  . LEU I  1 73  ? -29.818 35.147  35.466  1.00 18.28 ? 1146 LEU I CA  1 
ATOM   5082  C C   . LEU I  1 73  ? -29.613 33.642  35.462  1.00 17.25 ? 1146 LEU I C   1 
ATOM   5083  O O   . LEU I  1 73  ? -28.506 33.171  35.353  1.00 17.90 ? 1146 LEU I O   1 
ATOM   5084  C CB  . LEU I  1 73  ? -29.194 35.710  34.204  1.00 21.18 ? 1146 LEU I CB  1 
ATOM   5085  C CG  . LEU I  1 73  ? -29.872 35.283  32.892  1.00 22.65 ? 1146 LEU I CG  1 
ATOM   5086  C CD1 . LEU I  1 73  ? -31.324 35.687  32.857  1.00 20.47 ? 1146 LEU I CD1 1 
ATOM   5087  C CD2 . LEU I  1 73  ? -29.112 35.919  31.775  1.00 20.45 ? 1146 LEU I CD2 1 
ATOM   5088  N N   . PHE I  1 74  ? -30.694 32.917  35.600  1.00 15.74 ? 1147 PHE I N   1 
ATOM   5089  C CA  . PHE I  1 74  ? -30.601 31.449  35.704  1.00 17.97 ? 1147 PHE I CA  1 
ATOM   5090  C C   . PHE I  1 74  ? -30.309 30.843  34.333  1.00 20.14 ? 1147 PHE I C   1 
ATOM   5091  O O   . PHE I  1 74  ? -30.658 31.414  33.339  1.00 22.03 ? 1147 PHE I O   1 
ATOM   5092  C CB  . PHE I  1 74  ? -31.926 30.896  36.209  1.00 20.13 ? 1147 PHE I CB  1 
ATOM   5093  C CG  . PHE I  1 74  ? -32.164 31.167  37.661  1.00 17.43 ? 1147 PHE I CG  1 
ATOM   5094  C CD1 . PHE I  1 74  ? -31.477 30.443  38.613  1.00 20.29 ? 1147 PHE I CD1 1 
ATOM   5095  C CD2 . PHE I  1 74  ? -33.085 32.134  38.061  1.00 21.24 ? 1147 PHE I CD2 1 
ATOM   5096  C CE1 . PHE I  1 74  ? -31.720 30.655  39.976  1.00 21.08 ? 1147 PHE I CE1 1 
ATOM   5097  C CE2 . PHE I  1 74  ? -33.330 32.356  39.419  1.00 23.26 ? 1147 PHE I CE2 1 
ATOM   5098  C CZ  . PHE I  1 74  ? -32.620 31.613  40.360  1.00 22.50 ? 1147 PHE I CZ  1 
ATOM   5099  N N   . PHE I  1 75  ? -29.654 29.685  34.310  1.00 17.42 ? 1148 PHE I N   1 
ATOM   5100  C CA  . PHE I  1 75  ? -29.401 28.929  33.077  1.00 17.80 ? 1148 PHE I CA  1 
ATOM   5101  C C   . PHE I  1 75  ? -30.536 27.944  32.765  1.00 22.03 ? 1148 PHE I C   1 
ATOM   5102  O O   . PHE I  1 75  ? -30.333 26.915  32.105  1.00 24.26 ? 1148 PHE I O   1 
ATOM   5103  C CB  . PHE I  1 75  ? -28.076 28.178  33.218  1.00 18.87 ? 1148 PHE I CB  1 
ATOM   5104  C CG  . PHE I  1 75  ? -26.846 29.058  33.039  1.00 21.80 ? 1148 PHE I CG  1 
ATOM   5105  C CD1 . PHE I  1 75  ? -26.416 29.417  31.779  1.00 24.51 ? 1148 PHE I CD1 1 
ATOM   5106  C CD2 . PHE I  1 75  ? -26.127 29.516  34.146  1.00 19.09 ? 1148 PHE I CD2 1 
ATOM   5107  C CE1 . PHE I  1 75  ? -25.312 30.223  31.603  1.00 20.38 ? 1148 PHE I CE1 1 
ATOM   5108  C CE2 . PHE I  1 75  ? -24.961 30.284  33.996  1.00 20.95 ? 1148 PHE I CE2 1 
ATOM   5109  C CZ  . PHE I  1 75  ? -24.566 30.666  32.686  1.00 21.45 ? 1148 PHE I CZ  1 
ATOM   5110  N N   . ASP I  1 76  ? -31.728 28.252  33.254  1.00 18.07 ? 1149 ASP I N   1 
ATOM   5111  C CA  . ASP I  1 76  ? -32.946 27.548  32.856  1.00 24.26 ? 1149 ASP I CA  1 
ATOM   5112  C C   . ASP I  1 76  ? -33.354 27.807  31.402  1.00 26.58 ? 1149 ASP I C   1 
ATOM   5113  O O   . ASP I  1 76  ? -32.780 28.665  30.729  1.00 25.97 ? 1149 ASP I O   1 
ATOM   5114  C CB  . ASP I  1 76  ? -34.096 27.834  33.834  1.00 22.85 ? 1149 ASP I CB  1 
ATOM   5115  C CG  . ASP I  1 76  ? -34.493 29.349  33.909  1.00 26.82 ? 1149 ASP I CG  1 
ATOM   5116  O OD1 . ASP I  1 76  ? -33.717 30.229  33.484  1.00 23.80 ? 1149 ASP I OD1 1 
ATOM   5117  O OD2 . ASP I  1 76  ? -35.598 29.631  34.424  1.00 29.94 ? 1149 ASP I OD2 1 
ATOM   5118  N N   . ASN I  1 77  ? -34.308 27.025  30.899  1.00 28.39 ? 1150 ASN I N   1 
ATOM   5119  C CA  . ASN I  1 77  ? -34.755 27.182  29.510  1.00 29.40 ? 1150 ASN I CA  1 
ATOM   5120  C C   . ASN I  1 77  ? -35.178 28.612  29.182  1.00 29.82 ? 1150 ASN I C   1 
ATOM   5121  O O   . ASN I  1 77  ? -34.782 29.142  28.125  1.00 33.83 ? 1150 ASN I O   1 
ATOM   5122  C CB  . ASN I  1 77  ? -35.919 26.245  29.204  1.00 33.26 ? 1150 ASN I CB  1 
ATOM   5123  C CG  . ASN I  1 77  ? -35.487 24.811  29.080  1.00 41.56 ? 1150 ASN I CG  1 
ATOM   5124  O OD1 . ASN I  1 77  ? -34.314 24.531  28.803  1.00 40.80 ? 1150 ASN I OD1 1 
ATOM   5125  N ND2 . ASN I  1 77  ? -36.430 23.879  29.279  1.00 40.40 ? 1150 ASN I ND2 1 
ATOM   5126  N N   . LYS I  1 78  ? -35.975 29.227  30.063  1.00 26.81 ? 1151 LYS I N   1 
ATOM   5127  C CA  . LYS I  1 78  ? -36.505 30.576  29.812  1.00 30.91 ? 1151 LYS I CA  1 
ATOM   5128  C C   . LYS I  1 78  ? -35.551 31.727  30.150  1.00 30.30 ? 1151 LYS I C   1 
ATOM   5129  O O   . LYS I  1 78  ? -35.859 32.866  29.864  1.00 30.36 ? 1151 LYS I O   1 
ATOM   5130  C CB  . LYS I  1 78  ? -37.834 30.777  30.523  1.00 32.11 ? 1151 LYS I CB  1 
ATOM   5131  C CG  . LYS I  1 78  ? -38.896 29.781  30.069  1.00 37.84 ? 1151 LYS I CG  1 
ATOM   5132  C CD  . LYS I  1 78  ? -40.186 29.914  30.860  1.00 45.20 ? 1151 LYS I CD  1 
ATOM   5133  C CE  . LYS I  1 78  ? -40.063 29.449  32.312  1.00 42.96 ? 1151 LYS I CE  1 
ATOM   5134  N NZ  . LYS I  1 78  ? -41.413 29.267  32.982  1.00 52.26 ? 1151 LYS I NZ  1 
ATOM   5135  N N   . ARG I  1 79  ? -34.408 31.436  30.767  1.00 26.79 ? 1152 ARG I N   1 
ATOM   5136  C CA  . ARG I  1 79  ? -33.477 32.460  31.244  1.00 23.83 ? 1152 ARG I CA  1 
ATOM   5137  C C   . ARG I  1 79  ? -34.156 33.539  32.124  1.00 25.28 ? 1152 ARG I C   1 
ATOM   5138  O O   . ARG I  1 79  ? -34.368 34.681  31.689  1.00 27.81 ? 1152 ARG I O   1 
ATOM   5139  C CB  . ARG I  1 79  ? -32.670 33.095  30.103  1.00 22.67 ? 1152 ARG I CB  1 
ATOM   5140  C CG  . ARG I  1 79  ? -31.964 32.116  29.191  1.00 29.29 ? 1152 ARG I CG  1 
ATOM   5141  C CD  . ARG I  1 79  ? -30.909 31.286  29.938  1.00 24.99 ? 1152 ARG I CD  1 
ATOM   5142  N NE  . ARG I  1 79  ? -29.711 31.974  30.414  1.00 26.18 ? 1152 ARG I NE  1 
ATOM   5143  C CZ  . ARG I  1 79  ? -28.698 32.344  29.631  1.00 32.41 ? 1152 ARG I CZ  1 
ATOM   5144  N NH1 . ARG I  1 79  ? -28.798 32.161  28.308  1.00 31.72 ? 1152 ARG I NH1 1 
ATOM   5145  N NH2 . ARG I  1 79  ? -27.620 32.935  30.149  1.00 31.53 ? 1152 ARG I NH2 1 
ATOM   5146  N N   . THR I  1 80  ? -34.525 33.151  33.348  1.00 24.43 ? 1153 THR I N   1 
ATOM   5147  C CA  . THR I  1 80  ? -35.290 34.010  34.240  1.00 22.21 ? 1153 THR I CA  1 
ATOM   5148  C C   . THR I  1 80  ? -34.355 34.657  35.227  1.00 22.11 ? 1153 THR I C   1 
ATOM   5149  O O   . THR I  1 80  ? -33.213 34.246  35.395  1.00 20.33 ? 1153 THR I O   1 
ATOM   5150  C CB  . THR I  1 80  ? -36.403 33.257  35.004  1.00 26.13 ? 1153 THR I CB  1 
ATOM   5151  O OG1 . THR I  1 80  ? -35.827 32.121  35.675  1.00 24.76 ? 1153 THR I OG1 1 
ATOM   5152  C CG2 . THR I  1 80  ? -37.438 32.736  34.007  1.00 26.99 ? 1153 THR I CG2 1 
ATOM   5153  N N   . TRP I  1 81  ? -34.847 35.722  35.825  1.00 21.81 ? 1154 TRP I N   1 
ATOM   5154  C CA  . TRP I  1 81  ? -34.032 36.546  36.720  1.00 20.34 ? 1154 TRP I CA  1 
ATOM   5155  C C   . TRP I  1 81  ? -34.466 36.411  38.156  1.00 21.56 ? 1154 TRP I C   1 
ATOM   5156  O O   . TRP I  1 81  ? -35.629 36.150  38.421  1.00 21.86 ? 1154 TRP I O   1 
ATOM   5157  C CB  . TRP I  1 81  ? -34.202 38.013  36.319  1.00 20.66 ? 1154 TRP I CB  1 
ATOM   5158  C CG  . TRP I  1 81  ? -33.873 38.359  34.890  1.00 21.91 ? 1154 TRP I CG  1 
ATOM   5159  C CD1 . TRP I  1 81  ? -34.728 38.358  33.799  1.00 21.81 ? 1154 TRP I CD1 1 
ATOM   5160  C CD2 . TRP I  1 81  ? -32.627 38.858  34.419  1.00 19.91 ? 1154 TRP I CD2 1 
ATOM   5161  N NE1 . TRP I  1 81  ? -34.058 38.806  32.673  1.00 23.44 ? 1154 TRP I NE1 1 
ATOM   5162  C CE2 . TRP I  1 81  ? -32.776 39.131  33.032  1.00 22.56 ? 1154 TRP I CE2 1 
ATOM   5163  C CE3 . TRP I  1 81  ? -31.390 39.110  35.031  1.00 18.47 ? 1154 TRP I CE3 1 
ATOM   5164  C CZ2 . TRP I  1 81  ? -31.727 39.606  32.257  1.00 22.29 ? 1154 TRP I CZ2 1 
ATOM   5165  C CZ3 . TRP I  1 81  ? -30.359 39.603  34.267  1.00 20.95 ? 1154 TRP I CZ3 1 
ATOM   5166  C CH2 . TRP I  1 81  ? -30.528 39.846  32.880  1.00 24.10 ? 1154 TRP I CH2 1 
ATOM   5167  N N   . GLN I  1 82  ? -33.540 36.680  39.078  1.00 19.73 ? 1155 GLN I N   1 
ATOM   5168  C CA  . GLN I  1 82  ? -33.888 36.858  40.495  1.00 20.93 ? 1155 GLN I CA  1 
ATOM   5169  C C   . GLN I  1 82  ? -32.883 37.761  41.191  1.00 20.16 ? 1155 GLN I C   1 
ATOM   5170  O O   . GLN I  1 82  ? -31.750 37.995  40.701  1.00 22.24 ? 1155 GLN I O   1 
ATOM   5171  C CB  . GLN I  1 82  ? -33.942 35.504  41.235  1.00 23.13 ? 1155 GLN I CB  1 
ATOM   5172  C CG  . GLN I  1 82  ? -35.318 34.996  41.522  1.00 31.15 ? 1155 GLN I CG  1 
ATOM   5173  C CD  . GLN I  1 82  ? -36.201 35.978  42.268  1.00 36.28 ? 1155 GLN I CD  1 
ATOM   5174  O OE1 . GLN I  1 82  ? -35.734 36.869  42.990  1.00 35.87 ? 1155 GLN I OE1 1 
ATOM   5175  N NE2 . GLN I  1 82  ? -37.504 35.818  42.086  1.00 37.30 ? 1155 GLN I NE2 1 
ATOM   5176  N N   . TRP I  1 83  ? -33.301 38.295  42.342  1.00 19.35 ? 1156 TRP I N   1 
ATOM   5177  C CA  . TRP I  1 83  ? -32.418 39.106  43.204  1.00 19.09 ? 1156 TRP I CA  1 
ATOM   5178  C C   . TRP I  1 83  ? -32.257 38.330  44.506  1.00 19.86 ? 1156 TRP I C   1 
ATOM   5179  O O   . TRP I  1 83  ? -33.233 37.933  45.116  1.00 22.16 ? 1156 TRP I O   1 
ATOM   5180  C CB  . TRP I  1 83  ? -33.069 40.443  43.506  1.00 20.78 ? 1156 TRP I CB  1 
ATOM   5181  C CG  . TRP I  1 83  ? -33.214 41.327  42.331  1.00 21.87 ? 1156 TRP I CG  1 
ATOM   5182  C CD1 . TRP I  1 83  ? -34.295 41.421  41.487  1.00 27.46 ? 1156 TRP I CD1 1 
ATOM   5183  C CD2 . TRP I  1 83  ? -32.277 42.298  41.902  1.00 25.39 ? 1156 TRP I CD2 1 
ATOM   5184  N NE1 . TRP I  1 83  ? -34.056 42.371  40.525  1.00 23.42 ? 1156 TRP I NE1 1 
ATOM   5185  C CE2 . TRP I  1 83  ? -32.824 42.931  40.761  1.00 24.13 ? 1156 TRP I CE2 1 
ATOM   5186  C CE3 . TRP I  1 83  ? -31.007 42.680  42.353  1.00 22.54 ? 1156 TRP I CE3 1 
ATOM   5187  C CZ2 . TRP I  1 83  ? -32.155 43.923  40.074  1.00 24.67 ? 1156 TRP I CZ2 1 
ATOM   5188  C CZ3 . TRP I  1 83  ? -30.336 43.693  41.669  1.00 24.47 ? 1156 TRP I CZ3 1 
ATOM   5189  C CH2 . TRP I  1 83  ? -30.918 44.301  40.538  1.00 28.81 ? 1156 TRP I CH2 1 
ATOM   5190  N N   . LEU I  1 84  ? -31.013 38.073  44.887  1.00 17.89 ? 1157 LEU I N   1 
ATOM   5191  C CA  . LEU I  1 84  ? -30.726 37.186  45.998  1.00 19.21 ? 1157 LEU I CA  1 
ATOM   5192  C C   . LEU I  1 84  ? -29.567 37.723  46.818  1.00 20.79 ? 1157 LEU I C   1 
ATOM   5193  O O   . LEU I  1 84  ? -28.636 38.284  46.264  1.00 20.10 ? 1157 LEU I O   1 
ATOM   5194  C CB  . LEU I  1 84  ? -30.338 35.804  45.460  1.00 19.25 ? 1157 LEU I CB  1 
ATOM   5195  C CG  . LEU I  1 84  ? -31.462 35.017  44.777  1.00 19.30 ? 1157 LEU I CG  1 
ATOM   5196  C CD1 . LEU I  1 84  ? -30.924 33.723  44.221  1.00 18.18 ? 1157 LEU I CD1 1 
ATOM   5197  C CD2 . LEU I  1 84  ? -32.586 34.662  45.766  1.00 22.78 ? 1157 LEU I CD2 1 
ATOM   5198  N N   . PRO I  1 85  ? -29.656 37.594  48.160  1.00 23.64 ? 1158 PRO I N   1 
ATOM   5199  C CA  . PRO I  1 85  ? -28.555 37.941  49.046  1.00 24.13 ? 1158 PRO I CA  1 
ATOM   5200  C C   . PRO I  1 85  ? -27.406 36.927  48.979  1.00 20.36 ? 1158 PRO I C   1 
ATOM   5201  O O   . PRO I  1 85  ? -27.541 35.790  48.501  1.00 21.44 ? 1158 PRO I O   1 
ATOM   5202  C CB  . PRO I  1 85  ? -29.211 37.900  50.432  1.00 26.63 ? 1158 PRO I CB  1 
ATOM   5203  C CG  . PRO I  1 85  ? -30.224 36.822  50.299  1.00 26.83 ? 1158 PRO I CG  1 
ATOM   5204  C CD  . PRO I  1 85  ? -30.835 37.139  48.917  1.00 22.12 ? 1158 PRO I CD  1 
ATOM   5205  N N   . ARG I  1 86  ? -26.248 37.386  49.445  1.00 26.07 ? 1159 ARG I N   1 
ATOM   5206  C CA  . ARG I  1 86  ? -25.039 36.604  49.460  1.00 28.82 ? 1159 ARG I CA  1 
ATOM   5207  C C   . ARG I  1 86  ? -25.290 35.239  50.087  1.00 26.58 ? 1159 ARG I C   1 
ATOM   5208  O O   . ARG I  1 86  ? -24.758 34.255  49.634  1.00 23.35 ? 1159 ARG I O   1 
ATOM   5209  C CB  . ARG I  1 86  ? -23.941 37.328  50.255  1.00 28.99 ? 1159 ARG I CB  1 
ATOM   5210  C CG  . ARG I  1 86  ? -22.658 36.536  50.334  1.00 28.89 ? 1159 ARG I CG  1 
ATOM   5211  C CD  . ARG I  1 86  ? -21.996 36.428  48.942  1.00 29.43 ? 1159 ARG I CD  1 
ATOM   5212  N NE  . ARG I  1 86  ? -20.739 35.678  48.944  1.00 34.89 ? 1159 ARG I NE  1 
ATOM   5213  C CZ  . ARG I  1 86  ? -20.619 34.350  48.955  1.00 35.29 ? 1159 ARG I CZ  1 
ATOM   5214  N NH1 . ARG I  1 86  ? -19.406 33.813  48.954  1.00 37.93 ? 1159 ARG I NH1 1 
ATOM   5215  N NH2 . ARG I  1 86  ? -21.690 33.549  48.978  1.00 29.86 ? 1159 ARG I NH2 1 
ATOM   5216  N N   . THR I  1 87  ? -26.128 35.178  51.117  1.00 25.36 ? 1160 THR I N   1 
ATOM   5217  C CA  . THR I  1 87  ? -26.315 33.905  51.807  1.00 28.05 ? 1160 THR I CA  1 
ATOM   5218  C C   . THR I  1 87  ? -27.014 32.826  50.991  1.00 27.27 ? 1160 THR I C   1 
ATOM   5219  O O   . THR I  1 87  ? -27.108 31.662  51.434  1.00 30.71 ? 1160 THR I O   1 
ATOM   5220  C CB  . THR I  1 87  ? -27.167 34.114  53.057  1.00 29.02 ? 1160 THR I CB  1 
ATOM   5221  O OG1 . THR I  1 87  ? -28.386 34.749  52.641  1.00 31.54 ? 1160 THR I OG1 1 
ATOM   5222  C CG2 . THR I  1 87  ? -26.425 34.993  54.054  1.00 35.18 ? 1160 THR I CG2 1 
ATOM   5223  N N   . LYS I  1 88  ? -27.539 33.191  49.825  1.00 24.88 ? 1161 LYS I N   1 
ATOM   5224  C CA  . LYS I  1 88  ? -28.249 32.235  48.987  1.00 21.29 ? 1161 LYS I CA  1 
ATOM   5225  C C   . LYS I  1 88  ? -27.445 31.942  47.743  1.00 19.88 ? 1161 LYS I C   1 
ATOM   5226  O O   . LYS I  1 88  ? -27.957 31.310  46.807  1.00 21.77 ? 1161 LYS I O   1 
ATOM   5227  C CB  . LYS I  1 88  ? -29.620 32.780  48.574  1.00 27.57 ? 1161 LYS I CB  1 
ATOM   5228  C CG  . LYS I  1 88  ? -30.523 33.124  49.751  1.00 26.84 ? 1161 LYS I CG  1 
ATOM   5229  C CD  . LYS I  1 88  ? -31.248 31.880  50.238  1.00 29.00 ? 1161 LYS I CD  1 
ATOM   5230  C CE  . LYS I  1 88  ? -31.916 32.069  51.614  1.00 37.74 ? 1161 LYS I CE  1 
ATOM   5231  N NZ  . LYS I  1 88  ? -32.539 30.707  51.933  1.00 38.76 ? 1161 LYS I NZ  1 
ATOM   5232  N N   . LEU I  1 89  ? -26.186 32.376  47.716  1.00 21.13 ? 1162 LEU I N   1 
ATOM   5233  C CA  . LEU I  1 89  ? -25.325 32.101  46.569  1.00 20.81 ? 1162 LEU I CA  1 
ATOM   5234  C C   . LEU I  1 89  ? -24.071 31.345  46.976  1.00 23.01 ? 1162 LEU I C   1 
ATOM   5235  O O   . LEU I  1 89  ? -23.510 31.599  48.043  1.00 25.60 ? 1162 LEU I O   1 
ATOM   5236  C CB  . LEU I  1 89  ? -24.917 33.426  45.913  1.00 19.78 ? 1162 LEU I CB  1 
ATOM   5237  C CG  . LEU I  1 89  ? -26.128 34.295  45.548  1.00 22.74 ? 1162 LEU I CG  1 
ATOM   5238  C CD1 . LEU I  1 89  ? -25.610 35.600  45.053  1.00 22.07 ? 1162 LEU I CD1 1 
ATOM   5239  C CD2 . LEU I  1 89  ? -26.979 33.632  44.453  1.00 23.45 ? 1162 LEU I CD2 1 
ATOM   5240  N N   . VAL I  1 90  ? -23.649 30.409  46.147  1.00 23.03 ? 1163 VAL I N   1 
ATOM   5241  C CA  . VAL I  1 90  ? -22.369 29.715  46.348  1.00 20.81 ? 1163 VAL I CA  1 
ATOM   5242  C C   . VAL I  1 90  ? -21.661 29.666  44.998  1.00 20.52 ? 1163 VAL I C   1 
ATOM   5243  O O   . VAL I  1 90  ? -22.270 29.323  44.023  1.00 20.89 ? 1163 VAL I O   1 
ATOM   5244  C CB  . VAL I  1 90  ? -22.654 28.269  46.845  1.00 27.79 ? 1163 VAL I CB  1 
ATOM   5245  C CG1 . VAL I  1 90  ? -21.365 27.519  46.983  1.00 27.60 ? 1163 VAL I CG1 1 
ATOM   5246  C CG2 . VAL I  1 90  ? -23.446 28.290  48.186  1.00 29.49 ? 1163 VAL I CG2 1 
ATOM   5247  N N   . PRO I  1 91  ? -20.350 29.951  44.938  1.00 20.53 ? 1164 PRO I N   1 
ATOM   5248  C CA  . PRO I  1 91  ? -19.727 29.825  43.607  1.00 21.89 ? 1164 PRO I CA  1 
ATOM   5249  C C   . PRO I  1 91  ? -19.854 28.460  43.008  1.00 22.08 ? 1164 PRO I C   1 
ATOM   5250  O O   . PRO I  1 91  ? -19.716 27.409  43.698  1.00 21.63 ? 1164 PRO I O   1 
ATOM   5251  C CB  . PRO I  1 91  ? -18.238 30.125  43.892  1.00 23.13 ? 1164 PRO I CB  1 
ATOM   5252  C CG  . PRO I  1 91  ? -18.311 31.086  45.056  1.00 26.99 ? 1164 PRO I CG  1 
ATOM   5253  C CD  . PRO I  1 91  ? -19.399 30.476  45.931  1.00 27.28 ? 1164 PRO I CD  1 
ATOM   5254  N N   . LEU I  1 92  ? -20.064 28.446  41.698  1.00 19.99 ? 1165 LEU I N   1 
ATOM   5255  C CA  . LEU I  1 92  ? -20.265 27.237  40.915  1.00 19.43 ? 1165 LEU I CA  1 
ATOM   5256  C C   . LEU I  1 92  ? -19.061 26.927  40.004  1.00 24.26 ? 1165 LEU I C   1 
ATOM   5257  O O   . LEU I  1 92  ? -18.444 27.819  39.446  1.00 23.85 ? 1165 LEU I O   1 
ATOM   5258  C CB  . LEU I  1 92  ? -21.557 27.348  40.099  1.00 19.53 ? 1165 LEU I CB  1 
ATOM   5259  C CG  . LEU I  1 92  ? -21.960 26.252  39.094  1.00 15.07 ? 1165 LEU I CG  1 
ATOM   5260  C CD1 . LEU I  1 92  ? -23.534 26.243  38.908  1.00 16.92 ? 1165 LEU I CD1 1 
ATOM   5261  C CD2 . LEU I  1 92  ? -21.233 26.285  37.719  1.00 21.34 ? 1165 LEU I CD2 1 
ATOM   5262  N N   . GLY I  1 93  ? -18.723 25.642  39.893  1.00 21.44 ? 1166 GLY I N   1 
ATOM   5263  C CA  . GLY I  1 93  ? -17.727 25.179  38.952  1.00 23.99 ? 1166 GLY I CA  1 
ATOM   5264  C C   . GLY I  1 93  ? -16.332 25.293  39.499  1.00 27.02 ? 1166 GLY I C   1 
ATOM   5265  O O   . GLY I  1 93  ? -15.374 25.164  38.711  1.00 30.28 ? 1166 GLY I O   1 
ATOM   5266  N N   . VAL I  1 94  ? -16.216 25.476  40.820  1.00 24.12 ? 1167 VAL I N   1 
ATOM   5267  C CA  . VAL I  1 94  ? -14.919 25.682  41.467  1.00 24.38 ? 1167 VAL I CA  1 
ATOM   5268  C C   . VAL I  1 94  ? -14.513 24.512  42.363  1.00 26.98 ? 1167 VAL I C   1 
ATOM   5269  O O   . VAL I  1 94  ? -13.332 24.256  42.542  1.00 28.47 ? 1167 VAL I O   1 
ATOM   5270  C CB  . VAL I  1 94  ? -14.820 27.010  42.260  1.00 28.11 ? 1167 VAL I CB  1 
ATOM   5271  C CG1 . VAL I  1 94  ? -15.119 28.200  41.346  1.00 33.04 ? 1167 VAL I CG1 1 
ATOM   5272  C CG2 . VAL I  1 94  ? -15.750 27.019  43.422  1.00 29.61 ? 1167 VAL I CG2 1 
ATOM   5273  N N   . ASN I  1 95  ? -15.498 23.783  42.878  1.00 22.79 ? 1168 ASN I N   1 
ATOM   5274  C CA  . ASN I  1 95  ? -15.244 22.614  43.741  1.00 24.80 ? 1168 ASN I CA  1 
ATOM   5275  C C   . ASN I  1 95  ? -16.184 21.539  43.226  1.00 22.04 ? 1168 ASN I C   1 
ATOM   5276  O O   . ASN I  1 95  ? -17.425 21.724  43.295  1.00 21.37 ? 1168 ASN I O   1 
ATOM   5277  C CB  . ASN I  1 95  ? -15.611 23.015  45.164  1.00 23.57 ? 1168 ASN I CB  1 
ATOM   5278  C CG  . ASN I  1 95  ? -15.493 21.894  46.173  1.00 28.98 ? 1168 ASN I CG  1 
ATOM   5279  O OD1 . ASN I  1 95  ? -15.636 20.703  45.863  1.00 27.87 ? 1168 ASN I OD1 1 
ATOM   5280  N ND2 . ASN I  1 95  ? -15.286 22.295  47.453  1.00 35.93 ? 1168 ASN I ND2 1 
ATOM   5281  N N   . GLN I  1 96  ? -15.630 20.468  42.641  1.00 21.85 ? 1169 GLN I N   1 
ATOM   5282  C CA  . GLN I  1 96  ? -16.418 19.449  41.962  1.00 23.40 ? 1169 GLN I CA  1 
ATOM   5283  C C   . GLN I  1 96  ? -17.366 18.749  42.929  1.00 20.74 ? 1169 GLN I C   1 
ATOM   5284  O O   . GLN I  1 96  ? -18.490 18.384  42.562  1.00 21.86 ? 1169 GLN I O   1 
ATOM   5285  C CB  . GLN I  1 96  ? -15.534 18.369  41.358  1.00 30.18 ? 1169 GLN I CB  1 
ATOM   5286  C CG  . GLN I  1 96  ? -15.054 18.694  39.982  1.00 41.76 ? 1169 GLN I CG  1 
ATOM   5287  C CD  . GLN I  1 96  ? -15.032 17.475  39.076  1.00 47.86 ? 1169 GLN I CD  1 
ATOM   5288  O OE1 . GLN I  1 96  ? -14.279 16.525  39.307  1.00 54.20 ? 1169 GLN I OE1 1 
ATOM   5289  N NE2 . GLN I  1 96  ? -15.858 17.499  38.032  1.00 53.98 ? 1169 GLN I NE2 1 
ATOM   5290  N N   . ASP I  1 97  ? -16.887 18.532  44.137  1.00 24.66 ? 1170 ASP I N   1 
ATOM   5291  C CA  . ASP I  1 97  ? -17.739 17.792  45.094  1.00 20.35 ? 1170 ASP I CA  1 
ATOM   5292  C C   . ASP I  1 97  ? -18.869 18.646  45.628  1.00 20.69 ? 1170 ASP I C   1 
ATOM   5293  O O   . ASP I  1 97  ? -19.945 18.145  45.890  1.00 21.70 ? 1170 ASP I O   1 
ATOM   5294  C CB  . ASP I  1 97  ? -16.882 17.181  46.208  1.00 23.85 ? 1170 ASP I CB  1 
ATOM   5295  C CG  . ASP I  1 97  ? -15.930 16.129  45.655  1.00 27.36 ? 1170 ASP I CG  1 
ATOM   5296  O OD1 . ASP I  1 97  ? -14.703 16.387  45.730  1.00 29.27 ? 1170 ASP I OD1 1 
ATOM   5297  O OD2 . ASP I  1 97  ? -16.412 15.089  45.138  1.00 26.94 ? 1170 ASP I OD2 1 
ATOM   5298  N N   . LEU I  1 98  ? -18.647 19.948  45.756  1.00 18.94 ? 1171 LEU I N   1 
ATOM   5299  C CA  . LEU I  1 98  ? -19.729 20.820  46.139  1.00 22.19 ? 1171 LEU I CA  1 
ATOM   5300  C C   . LEU I  1 98  ? -20.742 20.807  45.017  1.00 21.12 ? 1171 LEU I C   1 
ATOM   5301  O O   . LEU I  1 98  ? -21.945 20.742  45.259  1.00 18.90 ? 1171 LEU I O   1 
ATOM   5302  C CB  . LEU I  1 98  ? -19.199 22.224  46.363  1.00 21.38 ? 1171 LEU I CB  1 
ATOM   5303  C CG  . LEU I  1 98  ? -20.218 23.267  46.777  1.00 23.17 ? 1171 LEU I CG  1 
ATOM   5304  C CD1 . LEU I  1 98  ? -19.438 24.271  47.638  1.00 27.93 ? 1171 LEU I CD1 1 
ATOM   5305  C CD2 . LEU I  1 98  ? -20.785 23.928  45.500  1.00 20.09 ? 1171 LEU I CD2 1 
ATOM   5306  N N   . ASP I  1 99  ? -20.257 20.910  43.782  1.00 17.48 ? 1172 ASP I N   1 
ATOM   5307  C CA  . ASP I  1 99  ? -21.143 20.929  42.635  1.00 21.96 ? 1172 ASP I CA  1 
ATOM   5308  C C   . ASP I  1 99  ? -21.966 19.640  42.548  1.00 21.72 ? 1172 ASP I C   1 
ATOM   5309  O O   . ASP I  1 99  ? -23.179 19.654  42.286  1.00 20.68 ? 1172 ASP I O   1 
ATOM   5310  C CB  . ASP I  1 99  ? -20.358 21.058  41.332  1.00 18.51 ? 1172 ASP I CB  1 
ATOM   5311  C CG  . ASP I  1 99  ? -19.837 22.482  41.057  1.00 24.16 ? 1172 ASP I CG  1 
ATOM   5312  O OD1 . ASP I  1 99  ? -19.009 22.619  40.114  1.00 25.11 ? 1172 ASP I OD1 1 
ATOM   5313  O OD2 . ASP I  1 99  ? -20.170 23.402  41.796  1.00 21.43 ? 1172 ASP I OD2 1 
ATOM   5314  N N   . LYS I  1 100 ? -21.306 18.486  42.771  1.00 19.31 ? 1173 LYS I N   1 
ATOM   5315  C CA  . LYS I  1 100 ? -22.046 17.248  42.748  1.00 21.25 ? 1173 LYS I CA  1 
ATOM   5316  C C   . LYS I  1 100 ? -23.062 17.128  43.894  1.00 20.26 ? 1173 LYS I C   1 
ATOM   5317  O O   . LYS I  1 100 ? -24.121 16.575  43.680  1.00 24.17 ? 1173 LYS I O   1 
ATOM   5318  C CB  . LYS I  1 100 ? -21.075 16.075  42.765  1.00 21.34 ? 1173 LYS I CB  1 
ATOM   5319  C CG  . LYS I  1 100 ? -20.362 15.914  41.406  1.00 21.78 ? 1173 LYS I CG  1 
ATOM   5320  C CD  . LYS I  1 100 ? -19.229 14.896  41.437  1.00 30.20 ? 1173 LYS I CD  1 
ATOM   5321  C CE  . LYS I  1 100 ? -18.691 14.672  40.027  1.00 38.55 ? 1173 LYS I CE  1 
ATOM   5322  N NZ  . LYS I  1 100 ? -17.782 13.464  39.939  1.00 42.29 ? 1173 LYS I NZ  1 
ATOM   5323  N N   . GLU I  1 101 ? -22.736 17.640  45.081  1.00 20.34 ? 1174 GLU I N   1 
ATOM   5324  C CA  . GLU I  1 101 ? -23.699 17.655  46.188  1.00 21.53 ? 1174 GLU I CA  1 
ATOM   5325  C C   . GLU I  1 101 ? -24.901 18.489  45.771  1.00 25.86 ? 1174 GLU I C   1 
ATOM   5326  O O   . GLU I  1 101 ? -26.052 18.083  45.935  1.00 22.48 ? 1174 GLU I O   1 
ATOM   5327  C CB  . GLU I  1 101 ? -23.075 18.221  47.447  1.00 20.63 ? 1174 GLU I CB  1 
ATOM   5328  C CG  . GLU I  1 101 ? -24.056 18.271  48.635  1.00 26.65 ? 1174 GLU I CG  1 
ATOM   5329  C CD  . GLU I  1 101 ? -23.514 19.053  49.820  1.00 30.68 ? 1174 GLU I CD  1 
ATOM   5330  O OE1 . GLU I  1 101 ? -22.359 19.549  49.758  1.00 30.72 ? 1174 GLU I OE1 1 
ATOM   5331  O OE2 . GLU I  1 101 ? -24.237 19.156  50.836  1.00 31.60 ? 1174 GLU I OE2 1 
ATOM   5332  N N   . LYS I  1 102 ? -24.631 19.652  45.172  1.00 19.92 ? 1175 LYS I N   1 
ATOM   5333  C CA  . LYS I  1 102 ? -25.738 20.521  44.794  1.00 22.70 ? 1175 LYS I CA  1 
ATOM   5334  C C   . LYS I  1 102 ? -26.639 19.923  43.757  1.00 22.56 ? 1175 LYS I C   1 
ATOM   5335  O O   . LYS I  1 102 ? -27.854 20.099  43.846  1.00 24.21 ? 1175 LYS I O   1 
ATOM   5336  C CB  . LYS I  1 102 ? -25.249 21.885  44.287  1.00 20.48 ? 1175 LYS I CB  1 
ATOM   5337  C CG  . LYS I  1 102 ? -24.633 22.760  45.381  1.00 22.89 ? 1175 LYS I CG  1 
ATOM   5338  C CD  . LYS I  1 102 ? -25.673 23.443  46.218  1.00 29.15 ? 1175 LYS I CD  1 
ATOM   5339  C CE  . LYS I  1 102 ? -25.048 24.544  47.077  1.00 31.81 ? 1175 LYS I CE  1 
ATOM   5340  N NZ  . LYS I  1 102 ? -24.987 24.188  48.540  1.00 35.44 ? 1175 LYS I NZ  1 
ATOM   5341  N N   . MET I  1 103 ? -26.065 19.251  42.760  1.00 21.35 ? 1176 MET I N   1 
ATOM   5342  C CA  . MET I  1 103 ? -26.863 18.610  41.713  1.00 22.85 ? 1176 MET I CA  1 
ATOM   5343  C C   . MET I  1 103 ? -27.834 17.585  42.269  1.00 25.06 ? 1176 MET I C   1 
ATOM   5344  O O   . MET I  1 103 ? -28.860 17.322  41.653  1.00 24.47 ? 1176 MET I O   1 
ATOM   5345  C CB  . MET I  1 103 ? -25.981 18.019  40.636  1.00 27.64 ? 1176 MET I CB  1 
ATOM   5346  C CG  . MET I  1 103 ? -25.623 19.143  39.623  1.00 31.36 ? 1176 MET I CG  1 
ATOM   5347  S SD  . MET I  1 103 ? -24.617 18.542  38.332  1.00 42.78 ? 1176 MET I SD  1 
ATOM   5348  C CE  . MET I  1 103 ? -23.037 18.363  39.125  1.00 28.53 ? 1176 MET I CE  1 
ATOM   5349  N N   . LEU I  1 104 ? -27.526 17.034  43.441  1.00 23.24 ? 1177 LEU I N   1 
ATOM   5350  C CA  . LEU I  1 104 ? -28.423 16.027  44.037  1.00 24.87 ? 1177 LEU I CA  1 
ATOM   5351  C C   . LEU I  1 104 ? -29.491 16.563  44.971  1.00 28.76 ? 1177 LEU I C   1 
ATOM   5352  O O   . LEU I  1 104 ? -30.263 15.792  45.521  1.00 27.37 ? 1177 LEU I O   1 
ATOM   5353  C CB  . LEU I  1 104 ? -27.603 14.953  44.779  1.00 23.06 ? 1177 LEU I CB  1 
ATOM   5354  C CG  . LEU I  1 104 ? -26.567 14.257  43.918  1.00 29.63 ? 1177 LEU I CG  1 
ATOM   5355  C CD1 . LEU I  1 104 ? -25.580 13.437  44.806  1.00 27.41 ? 1177 LEU I CD1 1 
ATOM   5356  C CD2 . LEU I  1 104 ? -27.215 13.386  42.833  1.00 32.26 ? 1177 LEU I CD2 1 
ATOM   5357  N N   . GLU I  1 105 ? -29.546 17.876  45.147  1.00 24.92 ? 1178 GLU I N   1 
ATOM   5358  C CA  . GLU I  1 105 ? -30.381 18.498  46.127  1.00 29.42 ? 1178 GLU I CA  1 
ATOM   5359  C C   . GLU I  1 105 ? -31.841 18.241  45.875  1.00 29.58 ? 1178 GLU I C   1 
ATOM   5360  O O   . GLU I  1 105 ? -32.598 18.015  46.827  1.00 32.06 ? 1178 GLU I O   1 
ATOM   5361  C CB  . GLU I  1 105 ? -30.151 19.997  46.103  1.00 29.08 ? 1178 GLU I CB  1 
ATOM   5362  C CG  . GLU I  1 105 ? -30.576 20.735  47.326  1.00 33.15 ? 1178 GLU I CG  1 
ATOM   5363  C CD  . GLU I  1 105 ? -30.118 22.205  47.263  1.00 34.31 ? 1178 GLU I CD  1 
ATOM   5364  O OE1 . GLU I  1 105 ? -28.890 22.415  47.098  1.00 33.22 ? 1178 GLU I OE1 1 
ATOM   5365  O OE2 . GLU I  1 105 ? -30.959 23.124  47.429  1.00 34.51 ? 1178 GLU I OE2 1 
ATOM   5366  N N   . GLY I  1 106 ? -32.239 18.283  44.607  1.00 26.39 ? 1179 GLY I N   1 
ATOM   5367  C CA  . GLY I  1 106 ? -33.663 18.296  44.288  1.00 31.58 ? 1179 GLY I CA  1 
ATOM   5368  C C   . GLY I  1 106 ? -34.380 17.045  44.765  1.00 30.29 ? 1179 GLY I C   1 
ATOM   5369  O O   . GLY I  1 106 ? -33.886 15.936  44.587  1.00 29.56 ? 1179 GLY I O   1 
ATOM   5370  N N   . ARG I  1 107 ? -35.566 17.220  45.336  1.00 36.56 ? 1180 ARG I N   1 
ATOM   5371  C CA  . ARG I  1 107 ? -36.358 16.070  45.776  1.00 37.12 ? 1180 ARG I CA  1 
ATOM   5372  C C   . ARG I  1 107 ? -36.716 15.108  44.637  1.00 34.77 ? 1180 ARG I C   1 
ATOM   5373  O O   . ARG I  1 107 ? -36.562 13.893  44.764  1.00 34.81 ? 1180 ARG I O   1 
ATOM   5374  C CB  . ARG I  1 107 ? -37.636 16.547  46.457  1.00 35.47 ? 1180 ARG I CB  1 
ATOM   5375  C CG  . ARG I  1 107 ? -38.188 15.573  47.466  1.00 46.01 ? 1180 ARG I CG  1 
ATOM   5376  C CD  . ARG I  1 107 ? -38.608 16.291  48.753  1.00 52.30 ? 1180 ARG I CD  1 
ATOM   5377  N NE  . ARG I  1 107 ? -38.359 15.472  49.952  1.00 55.55 ? 1180 ARG I NE  1 
ATOM   5378  C CZ  . ARG I  1 107 ? -38.152 15.972  51.172  1.00 54.03 ? 1180 ARG I CZ  1 
ATOM   5379  N NH1 . ARG I  1 107 ? -37.936 15.164  52.206  1.00 62.56 ? 1180 ARG I NH1 1 
ATOM   5380  N NH2 . ARG I  1 107 ? -38.161 17.284  51.367  1.00 55.79 ? 1180 ARG I NH2 1 
ATOM   5381  N N   . LYS I  1 108 ? -37.211 15.632  43.526  1.00 34.83 ? 1181 LYS I N   1 
ATOM   5382  C CA  . LYS I  1 108 ? -37.700 14.767  42.471  1.00 35.95 ? 1181 LYS I CA  1 
ATOM   5383  C C   . LYS I  1 108 ? -36.749 14.719  41.300  1.00 33.10 ? 1181 LYS I C   1 
ATOM   5384  O O   . LYS I  1 108 ? -36.009 15.654  41.062  1.00 30.94 ? 1181 LYS I O   1 
ATOM   5385  C CB  . LYS I  1 108 ? -39.087 15.205  42.006  1.00 38.79 ? 1181 LYS I CB  1 
ATOM   5386  C CG  . LYS I  1 108 ? -40.174 14.953  43.057  1.00 38.66 ? 1181 LYS I CG  1 
ATOM   5387  C CD  . LYS I  1 108 ? -41.193 16.078  43.066  1.00 49.55 ? 1181 LYS I CD  1 
ATOM   5388  C CE  . LYS I  1 108 ? -40.966 17.000  44.280  1.00 51.01 ? 1181 LYS I CE  1 
ATOM   5389  N NZ  . LYS I  1 108 ? -41.440 18.400  44.094  1.00 52.00 ? 1181 LYS I NZ  1 
ATOM   5390  N N   . SER I  1 109 ? -36.810 13.621  40.567  1.00 33.32 ? 1182 SER I N   1 
ATOM   5391  C CA  . SER I  1 109 ? -35.938 13.391  39.432  1.00 34.37 ? 1182 SER I CA  1 
ATOM   5392  C C   . SER I  1 109 ? -36.031 14.498  38.347  1.00 36.63 ? 1182 SER I C   1 
ATOM   5393  O O   . SER I  1 109 ? -35.019 14.919  37.786  1.00 31.97 ? 1182 SER I O   1 
ATOM   5394  C CB  . SER I  1 109 ? -36.243 12.022  38.845  1.00 41.21 ? 1182 SER I CB  1 
ATOM   5395  O OG  . SER I  1 109 ? -35.169 11.583  38.040  1.00 48.67 ? 1182 SER I OG  1 
ATOM   5396  N N   . ASN I  1 110 ? -37.234 14.980  38.066  1.00 37.34 ? 1183 ASN I N   1 
ATOM   5397  C CA  . ASN I  1 110 ? -37.397 16.001  37.021  1.00 35.35 ? 1183 ASN I CA  1 
ATOM   5398  C C   . ASN I  1 110 ? -36.663 17.315  37.307  1.00 30.68 ? 1183 ASN I C   1 
ATOM   5399  O O   . ASN I  1 110 ? -35.997 17.878  36.412  1.00 28.17 ? 1183 ASN I O   1 
ATOM   5400  C CB  . ASN I  1 110 ? -38.887 16.247  36.666  1.00 37.14 ? 1183 ASN I CB  1 
ATOM   5401  C CG  . ASN I  1 110 ? -39.688 16.866  37.816  1.00 41.13 ? 1183 ASN I CG  1 
ATOM   5402  O OD1 . ASN I  1 110 ? -39.256 16.851  38.968  1.00 44.41 ? 1183 ASN I OD1 1 
ATOM   5403  N ND2 . ASN I  1 110 ? -40.862 17.435  37.495  1.00 48.87 ? 1183 ASN I ND2 1 
ATOM   5404  N N   . ILE I  1 111 ? -36.770 17.805  38.541  1.00 29.68 ? 1184 ILE I N   1 
ATOM   5405  C CA  . ILE I  1 111 ? -36.048 19.001  38.922  1.00 31.60 ? 1184 ILE I CA  1 
ATOM   5406  C C   . ILE I  1 111 ? -34.519 18.772  38.938  1.00 25.74 ? 1184 ILE I C   1 
ATOM   5407  O O   . ILE I  1 111 ? -33.773 19.650  38.544  1.00 24.33 ? 1184 ILE I O   1 
ATOM   5408  C CB  . ILE I  1 111 ? -36.585 19.625  40.250  1.00 33.35 ? 1184 ILE I CB  1 
ATOM   5409  C CG1 . ILE I  1 111 ? -35.912 20.967  40.515  1.00 37.20 ? 1184 ILE I CG1 1 
ATOM   5410  C CG2 . ILE I  1 111 ? -36.422 18.672  41.404  1.00 35.47 ? 1184 ILE I CG2 1 
ATOM   5411  C CD1 . ILE I  1 111 ? -36.071 21.988  39.363  1.00 34.88 ? 1184 ILE I CD1 1 
ATOM   5412  N N   . ARG I  1 112 ? -34.070 17.593  39.372  1.00 28.12 ? 1185 ARG I N   1 
ATOM   5413  C CA  . ARG I  1 112 ? -32.637 17.264  39.346  1.00 25.60 ? 1185 ARG I CA  1 
ATOM   5414  C C   . ARG I  1 112 ? -32.151 17.300  37.904  1.00 25.97 ? 1185 ARG I C   1 
ATOM   5415  O O   . ARG I  1 112 ? -31.065 17.796  37.642  1.00 25.46 ? 1185 ARG I O   1 
ATOM   5416  C CB  . ARG I  1 112 ? -32.338 15.887  40.012  1.00 27.84 ? 1185 ARG I CB  1 
ATOM   5417  C CG  . ARG I  1 112 ? -32.436 15.935  41.559  1.00 26.80 ? 1185 ARG I CG  1 
ATOM   5418  C CD  . ARG I  1 112 ? -31.822 14.695  42.265  1.00 24.09 ? 1185 ARG I CD  1 
ATOM   5419  N NE  . ARG I  1 112 ? -32.271 13.437  41.696  1.00 32.32 ? 1185 ARG I NE  1 
ATOM   5420  C CZ  . ARG I  1 112 ? -33.351 12.788  42.139  1.00 36.44 ? 1185 ARG I CZ  1 
ATOM   5421  N NH1 . ARG I  1 112 ? -34.080 13.298  43.144  1.00 27.75 ? 1185 ARG I NH1 1 
ATOM   5422  N NH2 . ARG I  1 112 ? -33.697 11.641  41.582  1.00 34.83 ? 1185 ARG I NH2 1 
ATOM   5423  N N   . LYS I  1 113 ? -32.943 16.777  36.969  1.00 25.81 ? 1186 LYS I N   1 
ATOM   5424  C CA  . LYS I  1 113 ? -32.494 16.726  35.590  1.00 28.11 ? 1186 LYS I CA  1 
ATOM   5425  C C   . LYS I  1 113 ? -32.414 18.157  35.032  1.00 25.79 ? 1186 LYS I C   1 
ATOM   5426  O O   . LYS I  1 113 ? -31.480 18.499  34.309  1.00 26.35 ? 1186 LYS I O   1 
ATOM   5427  C CB  . LYS I  1 113 ? -33.378 15.813  34.722  1.00 26.69 ? 1186 LYS I CB  1 
ATOM   5428  C CG  . LYS I  1 113 ? -32.655 15.361  33.431  1.00 33.96 ? 1186 LYS I CG  1 
ATOM   5429  C CD  . LYS I  1 113 ? -33.549 14.667  32.362  1.00 36.15 ? 1186 LYS I CD  1 
ATOM   5430  C CE  . LYS I  1 113 ? -34.631 15.566  31.832  1.00 34.93 ? 1186 LYS I CE  1 
ATOM   5431  N NZ  . LYS I  1 113 ? -34.902 15.276  30.414  1.00 36.47 ? 1186 LYS I NZ  1 
ATOM   5432  N N   . SER I  1 114 ? -33.394 18.989  35.378  1.00 26.28 ? 1187 SER I N   1 
ATOM   5433  C CA  . SER I  1 114 ? -33.377 20.409  34.984  1.00 23.91 ? 1187 SER I CA  1 
ATOM   5434  C C   . SER I  1 114 ? -32.093 21.094  35.513  1.00 23.47 ? 1187 SER I C   1 
ATOM   5435  O O   . SER I  1 114 ? -31.406 21.826  34.794  1.00 23.93 ? 1187 SER I O   1 
ATOM   5436  C CB  . SER I  1 114 ? -34.616 21.132  35.544  1.00 27.92 ? 1187 SER I CB  1 
ATOM   5437  O OG  . SER I  1 114 ? -34.488 22.546  35.327  1.00 34.05 ? 1187 SER I OG  1 
ATOM   5438  N N   . VAL I  1 115 ? -31.798 20.864  36.792  1.00 23.41 ? 1188 VAL I N   1 
ATOM   5439  C CA  . VAL I  1 115 ? -30.603 21.418  37.436  1.00 22.74 ? 1188 VAL I CA  1 
ATOM   5440  C C   . VAL I  1 115 ? -29.317 20.941  36.732  1.00 23.96 ? 1188 VAL I C   1 
ATOM   5441  O O   . VAL I  1 115 ? -28.400 21.741  36.480  1.00 21.89 ? 1188 VAL I O   1 
ATOM   5442  C CB  . VAL I  1 115 ? -30.547 21.073  38.972  1.00 24.72 ? 1188 VAL I CB  1 
ATOM   5443  C CG1 . VAL I  1 115 ? -29.128 21.383  39.546  1.00 19.39 ? 1188 VAL I CG1 1 
ATOM   5444  C CG2 . VAL I  1 115 ? -31.611 21.873  39.750  1.00 22.53 ? 1188 VAL I CG2 1 
ATOM   5445  N N   . GLN I  1 116 ? -29.223 19.633  36.451  1.00 22.62 ? 1189 GLN I N   1 
ATOM   5446  C CA  . GLN I  1 116 ? -28.048 19.094  35.782  1.00 23.87 ? 1189 GLN I CA  1 
ATOM   5447  C C   . GLN I  1 116 ? -27.873 19.722  34.395  1.00 21.86 ? 1189 GLN I C   1 
ATOM   5448  O O   . GLN I  1 116 ? -26.773 20.097  33.994  1.00 22.79 ? 1189 GLN I O   1 
ATOM   5449  C CB  . GLN I  1 116 ? -28.197 17.583  35.614  1.00 26.20 ? 1189 GLN I CB  1 
ATOM   5450  C CG  . GLN I  1 116 ? -28.093 16.811  36.875  1.00 33.74 ? 1189 GLN I CG  1 
ATOM   5451  C CD  . GLN I  1 116 ? -28.314 15.352  36.571  1.00 32.33 ? 1189 GLN I CD  1 
ATOM   5452  O OE1 . GLN I  1 116 ? -27.617 14.774  35.719  1.00 38.22 ? 1189 GLN I OE1 1 
ATOM   5453  N NE2 . GLN I  1 116 ? -29.333 14.769  37.187  1.00 38.94 ? 1189 GLN I NE2 1 
ATOM   5454  N N   . ILE I  1 117 ? -28.950 19.784  33.633  1.00 21.75 ? 1190 ILE I N   1 
ATOM   5455  C CA  . ILE I  1 117 ? -28.886 20.498  32.346  1.00 19.20 ? 1190 ILE I CA  1 
ATOM   5456  C C   . ILE I  1 117 ? -28.355 21.922  32.501  1.00 21.80 ? 1190 ILE I C   1 
ATOM   5457  O O   . ILE I  1 117 ? -27.417 22.349  31.783  1.00 23.03 ? 1190 ILE I O   1 
ATOM   5458  C CB  . ILE I  1 117 ? -30.225 20.456  31.604  1.00 24.04 ? 1190 ILE I CB  1 
ATOM   5459  C CG1 . ILE I  1 117 ? -30.404 19.053  31.006  1.00 27.93 ? 1190 ILE I CG1 1 
ATOM   5460  C CG2 . ILE I  1 117 ? -30.270 21.500  30.428  1.00 27.82 ? 1190 ILE I CG2 1 
ATOM   5461  C CD1 . ILE I  1 117 ? -31.887 18.673  30.705  1.00 28.41 ? 1190 ILE I CD1 1 
ATOM   5462  N N   . ALA I  1 118 ? -28.932 22.653  33.440  1.00 20.53 ? 1191 ALA I N   1 
ATOM   5463  C CA  . ALA I  1 118 ? -28.488 24.031  33.660  1.00 20.95 ? 1191 ALA I CA  1 
ATOM   5464  C C   . ALA I  1 118 ? -27.009 24.086  34.031  1.00 21.19 ? 1191 ALA I C   1 
ATOM   5465  O O   . ALA I  1 118 ? -26.283 25.002  33.645  1.00 19.23 ? 1191 ALA I O   1 
ATOM   5466  C CB  . ALA I  1 118 ? -29.338 24.681  34.770  1.00 20.52 ? 1191 ALA I CB  1 
ATOM   5467  N N   . TYR I  1 119 ? -26.558 23.103  34.821  1.00 19.82 ? 1192 TYR I N   1 
ATOM   5468  C CA  . TYR I  1 119 ? -25.164 23.103  35.216  1.00 20.92 ? 1192 TYR I CA  1 
ATOM   5469  C C   . TYR I  1 119 ? -24.259 22.976  34.011  1.00 19.58 ? 1192 TYR I C   1 
ATOM   5470  O O   . TYR I  1 119 ? -23.222 23.670  33.904  1.00 23.22 ? 1192 TYR I O   1 
ATOM   5471  C CB  . TYR I  1 119 ? -24.917 21.926  36.168  1.00 21.70 ? 1192 TYR I CB  1 
ATOM   5472  C CG  . TYR I  1 119 ? -23.497 21.752  36.608  1.00 24.03 ? 1192 TYR I CG  1 
ATOM   5473  C CD1 . TYR I  1 119 ? -22.963 22.552  37.575  1.00 21.02 ? 1192 TYR I CD1 1 
ATOM   5474  C CD2 . TYR I  1 119 ? -22.700 20.730  36.082  1.00 26.95 ? 1192 TYR I CD2 1 
ATOM   5475  C CE1 . TYR I  1 119 ? -21.662 22.408  37.970  1.00 24.06 ? 1192 TYR I CE1 1 
ATOM   5476  C CE2 . TYR I  1 119 ? -21.411 20.551  36.505  1.00 26.07 ? 1192 TYR I CE2 1 
ATOM   5477  C CZ  . TYR I  1 119 ? -20.895 21.396  37.434  1.00 24.10 ? 1192 TYR I CZ  1 
ATOM   5478  O OH  . TYR I  1 119 ? -19.617 21.221  37.890  1.00 26.84 ? 1192 TYR I OH  1 
ATOM   5479  N N   . HIS I  1 120 ? -24.564 22.003  33.148  1.00 18.71 ? 1193 HIS I N   1 
ATOM   5480  C CA  . HIS I  1 120 ? -23.725 21.859  31.965  1.00 21.93 ? 1193 HIS I CA  1 
ATOM   5481  C C   . HIS I  1 120 ? -23.826 23.048  31.038  1.00 23.28 ? 1193 HIS I C   1 
ATOM   5482  O O   . HIS I  1 120 ? -22.834 23.400  30.397  1.00 22.72 ? 1193 HIS I O   1 
ATOM   5483  C CB  . HIS I  1 120 ? -24.028 20.558  31.236  1.00 23.42 ? 1193 HIS I CB  1 
ATOM   5484  C CG  . HIS I  1 120 ? -23.643 19.383  32.062  1.00 24.52 ? 1193 HIS I CG  1 
ATOM   5485  N ND1 . HIS I  1 120 ? -22.332 19.158  32.430  1.00 26.95 ? 1193 HIS I ND1 1 
ATOM   5486  C CD2 . HIS I  1 120 ? -24.392 18.457  32.701  1.00 29.33 ? 1193 HIS I CD2 1 
ATOM   5487  C CE1 . HIS I  1 120 ? -22.291 18.095  33.216  1.00 33.16 ? 1193 HIS I CE1 1 
ATOM   5488  N NE2 . HIS I  1 120 ? -23.525 17.655  33.391  1.00 29.35 ? 1193 HIS I NE2 1 
ATOM   5489  N N   . ARG I  1 121 ? -24.990 23.669  30.983  1.00 20.64 ? 1194 ARG I N   1 
ATOM   5490  C CA  . ARG I  1 121 ? -25.108 24.925  30.225  1.00 21.09 ? 1194 ARG I CA  1 
ATOM   5491  C C   . ARG I  1 121 ? -24.210 26.024  30.800  1.00 20.76 ? 1194 ARG I C   1 
ATOM   5492  O O   . ARG I  1 121 ? -23.522 26.764  30.061  1.00 22.84 ? 1194 ARG I O   1 
ATOM   5493  C CB  . ARG I  1 121 ? -26.542 25.380  30.252  1.00 22.93 ? 1194 ARG I CB  1 
ATOM   5494  C CG  . ARG I  1 121 ? -27.408 24.692  29.242  1.00 24.50 ? 1194 ARG I CG  1 
ATOM   5495  C CD  . ARG I  1 121 ? -28.785 25.031  29.667  1.00 31.39 ? 1194 ARG I CD  1 
ATOM   5496  N NE  . ARG I  1 121 ? -29.801 24.541  28.769  1.00 30.00 ? 1194 ARG I NE  1 
ATOM   5497  C CZ  . ARG I  1 121 ? -31.100 24.600  29.054  1.00 36.35 ? 1194 ARG I CZ  1 
ATOM   5498  N NH1 . ARG I  1 121 ? -31.986 24.128  28.178  1.00 35.50 ? 1194 ARG I NH1 1 
ATOM   5499  N NH2 . ARG I  1 121 ? -31.504 25.082  30.238  1.00 32.21 ? 1194 ARG I NH2 1 
ATOM   5500  N N   . ALA I  1 122 ? -24.189 26.105  32.122  1.00 21.66 ? 1195 ALA I N   1 
ATOM   5501  C CA  . ALA I  1 122 ? -23.320 27.027  32.808  1.00 20.79 ? 1195 ALA I CA  1 
ATOM   5502  C C   . ALA I  1 122 ? -21.863 26.775  32.447  1.00 24.13 ? 1195 ALA I C   1 
ATOM   5503  O O   . ALA I  1 122 ? -21.099 27.726  32.236  1.00 21.63 ? 1195 ALA I O   1 
ATOM   5504  C CB  . ALA I  1 122 ? -23.542 26.956  34.379  1.00 22.66 ? 1195 ALA I CB  1 
ATOM   5505  N N   . LEU I  1 123 ? -21.449 25.499  32.412  1.00 21.08 ? 1196 LEU I N   1 
ATOM   5506  C CA  . LEU I  1 123 ? -20.043 25.241  32.123  1.00 22.03 ? 1196 LEU I CA  1 
ATOM   5507  C C   . LEU I  1 123 ? -19.726 25.504  30.663  1.00 22.63 ? 1196 LEU I C   1 
ATOM   5508  O O   . LEU I  1 123 ? -18.602 25.885  30.334  1.00 28.52 ? 1196 LEU I O   1 
ATOM   5509  C CB  . LEU I  1 123 ? -19.618 23.836  32.554  1.00 24.72 ? 1196 LEU I CB  1 
ATOM   5510  C CG  . LEU I  1 123 ? -19.657 23.611  34.071  1.00 28.45 ? 1196 LEU I CG  1 
ATOM   5511  C CD1 . LEU I  1 123 ? -18.977 22.301  34.437  1.00 28.93 ? 1196 LEU I CD1 1 
ATOM   5512  C CD2 . LEU I  1 123 ? -19.046 24.757  34.872  1.00 28.63 ? 1196 LEU I CD2 1 
ATOM   5513  N N   . GLN I  1 124 ? -20.687 25.297  29.779  1.00 22.07 ? 1197 GLN I N   1 
ATOM   5514  C CA  . GLN I  1 124 ? -20.448 25.709  28.393  1.00 26.75 ? 1197 GLN I CA  1 
ATOM   5515  C C   . GLN I  1 124 ? -20.245 27.213  28.262  1.00 29.41 ? 1197 GLN I C   1 
ATOM   5516  O O   . GLN I  1 124 ? -19.370 27.687  27.517  1.00 29.67 ? 1197 GLN I O   1 
ATOM   5517  C CB  . GLN I  1 124 ? -21.601 25.290  27.523  1.00 24.10 ? 1197 GLN I CB  1 
ATOM   5518  C CG  . GLN I  1 124 ? -21.516 23.828  27.245  1.00 28.44 ? 1197 GLN I CG  1 
ATOM   5519  C CD  . GLN I  1 124 ? -22.761 23.374  26.623  1.00 28.93 ? 1197 GLN I CD  1 
ATOM   5520  O OE1 . GLN I  1 124 ? -22.958 23.558  25.410  1.00 34.49 ? 1197 GLN I OE1 1 
ATOM   5521  N NE2 . GLN I  1 124 ? -23.657 22.781  27.438  1.00 26.64 ? 1197 GLN I NE2 1 
ATOM   5522  N N   . HIS I  1 125 ? -21.050 27.965  28.999  1.00 25.09 ? 1198 HIS I N   1 
ATOM   5523  C CA  . HIS I  1 125 ? -20.867 29.423  29.006  1.00 27.94 ? 1198 HIS I CA  1 
ATOM   5524  C C   . HIS I  1 125 ? -19.452 29.754  29.456  1.00 27.60 ? 1198 HIS I C   1 
ATOM   5525  O O   . HIS I  1 125 ? -18.744 30.519  28.815  1.00 30.20 ? 1198 HIS I O   1 
ATOM   5526  C CB  . HIS I  1 125 ? -21.873 30.100  29.921  1.00 27.20 ? 1198 HIS I CB  1 
ATOM   5527  C CG  . HIS I  1 125 ? -21.543 31.529  30.222  1.00 26.75 ? 1198 HIS I CG  1 
ATOM   5528  N ND1 . HIS I  1 125 ? -22.130 32.572  29.537  1.00 30.72 ? 1198 HIS I ND1 1 
ATOM   5529  C CD2 . HIS I  1 125 ? -20.695 32.092  31.117  1.00 24.70 ? 1198 HIS I CD2 1 
ATOM   5530  C CE1 . HIS I  1 125 ? -21.654 33.716  29.998  1.00 30.38 ? 1198 HIS I CE1 1 
ATOM   5531  N NE2 . HIS I  1 125 ? -20.767 33.455  30.934  1.00 28.67 ? 1198 HIS I NE2 1 
ATOM   5532  N N   . ARG I  1 126 ? -19.000 29.143  30.539  1.00 25.81 ? 1199 ARG I N   1 
ATOM   5533  C CA  . ARG I  1 126 ? -17.639 29.388  30.975  1.00 28.09 ? 1199 ARG I CA  1 
ATOM   5534  C C   . ARG I  1 126 ? -16.609 29.067  29.884  1.00 32.45 ? 1199 ARG I C   1 
ATOM   5535  O O   . ARG I  1 126 ? -15.663 29.814  29.679  1.00 33.01 ? 1199 ARG I O   1 
ATOM   5536  C CB  . ARG I  1 126 ? -17.303 28.546  32.184  1.00 23.82 ? 1199 ARG I CB  1 
ATOM   5537  C CG  . ARG I  1 126 ? -15.913 28.848  32.765  1.00 29.04 ? 1199 ARG I CG  1 
ATOM   5538  C CD  . ARG I  1 126 ? -15.678 28.103  34.108  1.00 32.57 ? 1199 ARG I CD  1 
ATOM   5539  N NE  . ARG I  1 126 ? -15.596 26.664  33.903  1.00 35.48 ? 1199 ARG I NE  1 
ATOM   5540  C CZ  . ARG I  1 126 ? -15.474 25.754  34.874  1.00 34.49 ? 1199 ARG I CZ  1 
ATOM   5541  N NH1 . ARG I  1 126 ? -15.404 24.466  34.556  1.00 39.24 ? 1199 ARG I NH1 1 
ATOM   5542  N NH2 . ARG I  1 126 ? -15.422 26.118  36.152  1.00 36.87 ? 1199 ARG I NH2 1 
ATOM   5543  N N   . SER I  1 127 ? -16.797 27.940  29.212  1.00 28.39 ? 1200 SER I N   1 
ATOM   5544  C CA  . SER I  1 127 ? -15.925 27.559  28.100  1.00 34.28 ? 1200 SER I CA  1 
ATOM   5545  C C   . SER I  1 127 ? -15.844 28.603  26.996  1.00 33.35 ? 1200 SER I C   1 
ATOM   5546  O O   . SER I  1 127 ? -14.762 28.868  26.471  1.00 35.90 ? 1200 SER I O   1 
ATOM   5547  C CB  . SER I  1 127 ? -16.405 26.241  27.500  1.00 30.52 ? 1200 SER I CB  1 
ATOM   5548  O OG  . SER I  1 127 ? -16.024 25.202  28.363  1.00 38.16 ? 1200 SER I OG  1 
ATOM   5549  N N   . LYS I  1 128 ? -16.993 29.158  26.621  1.00 29.61 ? 1201 LYS I N   1 
ATOM   5550  C CA  . LYS I  1 128 ? -17.052 30.193  25.582  1.00 30.26 ? 1201 LYS I CA  1 
ATOM   5551  C C   . LYS I  1 128 ? -16.285 31.446  26.001  1.00 37.87 ? 1201 LYS I C   1 
ATOM   5552  O O   . LYS I  1 128 ? -15.476 32.003  25.222  1.00 37.88 ? 1201 LYS I O   1 
ATOM   5553  C CB  . LYS I  1 128 ? -18.503 30.539  25.234  1.00 34.66 ? 1201 LYS I CB  1 
ATOM   5554  C CG  . LYS I  1 128 ? -19.168 29.554  24.290  1.00 38.58 ? 1201 LYS I CG  1 
ATOM   5555  C CD  . LYS I  1 128 ? -20.631 29.899  24.031  1.00 37.32 ? 1201 LYS I CD  1 
ATOM   5556  C CE  . LYS I  1 128 ? -21.328 28.730  23.339  1.00 50.89 ? 1201 LYS I CE  1 
ATOM   5557  N NZ  . LYS I  1 128 ? -22.819 28.714  23.484  1.00 51.65 ? 1201 LYS I NZ  1 
ATOM   5558  N N   . VAL I  1 129 ? -16.514 31.887  27.234  1.00 32.99 ? 1202 VAL I N   1 
ATOM   5559  C CA  . VAL I  1 129 ? -15.809 33.035  27.770  1.00 34.35 ? 1202 VAL I CA  1 
ATOM   5560  C C   . VAL I  1 129 ? -14.288 32.841  27.797  1.00 42.37 ? 1202 VAL I C   1 
ATOM   5561  O O   . VAL I  1 129 ? -13.532 33.787  27.584  1.00 45.48 ? 1202 VAL I O   1 
ATOM   5562  C CB  . VAL I  1 129 ? -16.269 33.357  29.193  1.00 35.58 ? 1202 VAL I CB  1 
ATOM   5563  C CG1 . VAL I  1 129 ? -15.412 34.466  29.762  1.00 38.92 ? 1202 VAL I CG1 1 
ATOM   5564  C CG2 . VAL I  1 129 ? -17.727 33.717  29.201  1.00 33.61 ? 1202 VAL I CG2 1 
ATOM   5565  N N   . GLN I  1 130 ? -13.828 31.624  28.057  1.00 40.73 ? 1203 GLN I N   1 
ATOM   5566  C CA  . GLN I  1 130 ? -12.392 31.420  28.179  1.00 45.32 ? 1203 GLN I CA  1 
ATOM   5567  C C   . GLN I  1 130 ? -11.747 30.862  26.919  1.00 46.86 ? 1203 GLN I C   1 
ATOM   5568  O O   . GLN I  1 130 ? -10.527 30.781  26.842  1.00 51.58 ? 1203 GLN I O   1 
ATOM   5569  C CB  . GLN I  1 130 ? -12.090 30.503  29.350  1.00 47.39 ? 1203 GLN I CB  1 
ATOM   5570  C CG  . GLN I  1 130 ? -12.505 31.095  30.665  1.00 48.43 ? 1203 GLN I CG  1 
ATOM   5571  C CD  . GLN I  1 130 ? -12.226 30.172  31.817  1.00 55.44 ? 1203 GLN I CD  1 
ATOM   5572  O OE1 . GLN I  1 130 ? -12.242 30.590  32.975  1.00 62.78 ? 1203 GLN I OE1 1 
ATOM   5573  N NE2 . GLN I  1 130 ? -11.955 28.901  31.511  1.00 50.55 ? 1203 GLN I NE2 1 
ATOM   5574  N N   . GLY I  1 131 ? -12.562 30.467  25.943  1.00 46.49 ? 1204 GLY I N   1 
ATOM   5575  C CA  . GLY I  1 131 ? -12.049 29.813  24.749  1.00 49.31 ? 1204 GLY I CA  1 
ATOM   5576  C C   . GLY I  1 131 ? -12.460 28.354  24.672  1.00 53.25 ? 1204 GLY I C   1 
ATOM   5577  O O   . GLY I  1 131 ? -11.939 27.495  25.401  1.00 62.24 ? 1204 GLY I O   1 
ATOM   5578  N N   . SER J  2 7   ? -29.008 40.577  20.185  1.00 37.16 ? 28   SER J N   1 
ATOM   5579  C CA  . SER J  2 7   ? -27.826 39.727  20.002  1.00 40.32 ? 28   SER J CA  1 
ATOM   5580  C C   . SER J  2 7   ? -27.700 38.690  21.118  1.00 41.59 ? 28   SER J C   1 
ATOM   5581  O O   . SER J  2 7   ? -27.547 37.486  20.878  1.00 40.93 ? 28   SER J O   1 
ATOM   5582  C CB  . SER J  2 7   ? -26.577 40.588  19.996  1.00 44.12 ? 28   SER J CB  1 
ATOM   5583  O OG  . SER J  2 7   ? -25.414 39.786  19.905  1.00 50.30 ? 28   SER J OG  1 
ATOM   5584  N N   . ALA J  2 8   ? -27.722 39.197  22.346  1.00 36.66 ? 29   ALA J N   1 
ATOM   5585  C CA  . ALA J  2 8   ? -27.776 38.359  23.533  1.00 31.87 ? 29   ALA J CA  1 
ATOM   5586  C C   . ALA J  2 8   ? -29.033 37.505  23.505  1.00 34.67 ? 29   ALA J C   1 
ATOM   5587  O O   . ALA J  2 8   ? -30.057 37.906  22.933  1.00 33.60 ? 29   ALA J O   1 
ATOM   5588  C CB  . ALA J  2 8   ? -27.772 39.268  24.807  1.00 34.34 ? 29   ALA J CB  1 
ATOM   5589  N N   . PRO J  2 9   ? -28.978 36.320  24.145  1.00 32.04 ? 30   PRO J N   1 
ATOM   5590  C CA  . PRO J  2 9   ? -30.149 35.458  24.290  1.00 35.58 ? 30   PRO J CA  1 
ATOM   5591  C C   . PRO J  2 9   ? -31.342 36.190  24.877  1.00 28.37 ? 30   PRO J C   1 
ATOM   5592  O O   . PRO J  2 9   ? -31.177 37.002  25.806  1.00 31.42 ? 30   PRO J O   1 
ATOM   5593  C CB  . PRO J  2 9   ? -29.693 34.414  25.318  1.00 31.28 ? 30   PRO J CB  1 
ATOM   5594  C CG  . PRO J  2 9   ? -28.247 34.417  25.267  1.00 36.64 ? 30   PRO J CG  1 
ATOM   5595  C CD  . PRO J  2 9   ? -27.769 35.734  24.733  1.00 32.78 ? 30   PRO J CD  1 
ATOM   5596  N N   . ALA J  2 10  ? -32.536 35.863  24.404  1.00 29.50 ? 31   ALA J N   1 
ATOM   5597  C CA  . ALA J  2 10  ? -33.732 36.362  25.042  1.00 33.00 ? 31   ALA J CA  1 
ATOM   5598  C C   . ALA J  2 10  ? -33.739 35.930  26.498  1.00 31.27 ? 31   ALA J C   1 
ATOM   5599  O O   . ALA J  2 10  ? -33.153 34.886  26.829  1.00 31.34 ? 31   ALA J O   1 
ATOM   5600  C CB  . ALA J  2 10  ? -34.999 35.861  24.313  1.00 41.92 ? 31   ALA J CB  1 
ATOM   5601  N N   . THR J  2 11  ? -34.363 36.746  27.361  1.00 30.65 ? 32   THR J N   1 
ATOM   5602  C CA  . THR J  2 11  ? -34.593 36.363  28.748  1.00 28.69 ? 32   THR J CA  1 
ATOM   5603  C C   . THR J  2 11  ? -36.078 36.441  29.100  1.00 31.91 ? 32   THR J C   1 
ATOM   5604  O O   . THR J  2 11  ? -36.845 37.133  28.440  1.00 34.76 ? 32   THR J O   1 
ATOM   5605  C CB  . THR J  2 11  ? -33.776 37.202  29.732  1.00 26.54 ? 32   THR J CB  1 
ATOM   5606  O OG1 . THR J  2 11  ? -34.175 38.583  29.645  1.00 29.54 ? 32   THR J OG1 1 
ATOM   5607  C CG2 . THR J  2 11  ? -32.273 37.069  29.437  1.00 26.03 ? 32   THR J CG2 1 
ATOM   5608  N N   . GLY J  2 12  ? -36.469 35.781  30.174  1.00 27.96 ? 33   GLY J N   1 
ATOM   5609  C CA  . GLY J  2 12  ? -37.878 35.503  30.409  1.00 33.72 ? 33   GLY J CA  1 
ATOM   5610  C C   . GLY J  2 12  ? -38.502 36.069  31.666  1.00 38.45 ? 33   GLY J C   1 
ATOM   5611  O O   . GLY J  2 12  ? -39.440 35.464  32.248  1.00 37.68 ? 33   GLY J O   1 
ATOM   5612  N N   . GLY J  2 13  ? -37.984 37.210  32.115  1.00 31.71 ? 34   GLY J N   1 
ATOM   5613  C CA  . GLY J  2 13  ? -38.606 37.886  33.246  1.00 33.63 ? 34   GLY J CA  1 
ATOM   5614  C C   . GLY J  2 13  ? -38.231 37.369  34.624  1.00 32.65 ? 34   GLY J C   1 
ATOM   5615  O O   . GLY J  2 13  ? -37.468 36.427  34.761  1.00 27.65 ? 34   GLY J O   1 
ATOM   5616  N N   . VAL J  2 14  ? -38.791 37.972  35.654  1.00 31.77 ? 35   VAL J N   1 
ATOM   5617  C CA  . VAL J  2 14  ? -38.495 37.537  37.029  1.00 31.09 ? 35   VAL J CA  1 
ATOM   5618  C C   . VAL J  2 14  ? -39.022 36.135  37.321  1.00 31.59 ? 35   VAL J C   1 
ATOM   5619  O O   . VAL J  2 14  ? -40.179 35.826  37.037  1.00 34.22 ? 35   VAL J O   1 
ATOM   5620  C CB  . VAL J  2 14  ? -39.061 38.494  38.078  1.00 37.11 ? 35   VAL J CB  1 
ATOM   5621  C CG1 . VAL J  2 14  ? -38.886 37.897  39.455  1.00 33.79 ? 35   VAL J CG1 1 
ATOM   5622  C CG2 . VAL J  2 14  ? -38.373 39.881  37.993  1.00 33.54 ? 35   VAL J CG2 1 
HETATM 5623  N N   . M3L J  2 15  ? -38.170 35.271  37.881  1.00 25.80 ? 36   M3L J N   1 
HETATM 5624  C CA  . M3L J  2 15  ? -38.578 33.907  38.137  1.00 27.97 ? 36   M3L J CA  1 
HETATM 5625  C CB  . M3L J  2 15  ? -37.413 32.965  38.447  1.00 25.41 ? 36   M3L J CB  1 
HETATM 5626  C CG  . M3L J  2 15  ? -37.726 31.483  38.473  1.00 31.04 ? 36   M3L J CG  1 
HETATM 5627  C CD  . M3L J  2 15  ? -36.511 30.593  38.803  1.00 24.31 ? 36   M3L J CD  1 
HETATM 5628  C CE  . M3L J  2 15  ? -36.796 29.101  38.919  1.00 24.89 ? 36   M3L J CE  1 
HETATM 5629  N NZ  . M3L J  2 15  ? -35.664 28.178  38.976  1.00 25.07 ? 36   M3L J NZ  1 
HETATM 5630  C C   . M3L J  2 15  ? -39.712 33.848  39.161  1.00 32.53 ? 36   M3L J C   1 
HETATM 5631  O O   . M3L J  2 15  ? -39.644 34.413  40.215  1.00 32.01 ? 36   M3L J O   1 
HETATM 5632  C CM1 . M3L J  2 15  ? -34.930 28.409  40.211  1.00 26.98 ? 36   M3L J CM1 1 
HETATM 5633  C CM2 . M3L J  2 15  ? -34.819 28.423  37.807  1.00 24.61 ? 36   M3L J CM2 1 
HETATM 5634  C CM3 . M3L J  2 15  ? -36.128 26.812  38.911  1.00 29.61 ? 36   M3L J CM3 1 
ATOM   5635  N N   . LYS J  2 16  ? -40.780 33.156  38.788  1.00 36.84 ? 37   LYS J N   1 
ATOM   5636  C CA  . LYS J  2 16  ? -41.940 33.066  39.649  1.00 41.39 ? 37   LYS J CA  1 
ATOM   5637  C C   . LYS J  2 16  ? -41.920 31.803  40.485  1.00 45.01 ? 37   LYS J C   1 
ATOM   5638  O O   . LYS J  2 16  ? -41.214 30.833  40.160  1.00 41.05 ? 37   LYS J O   1 
ATOM   5639  C CB  . LYS J  2 16  ? -43.218 33.129  38.805  1.00 49.76 ? 37   LYS J CB  1 
ATOM   5640  C CG  . LYS J  2 16  ? -43.089 32.506  37.426  1.00 51.86 ? 37   LYS J CG  1 
ATOM   5641  C CD  . LYS J  2 16  ? -44.350 32.802  36.597  1.00 58.57 ? 37   LYS J CD  1 
ATOM   5642  C CE  . LYS J  2 16  ? -44.211 32.387  35.131  1.00 56.68 ? 37   LYS J CE  1 
ATOM   5643  N NZ  . LYS J  2 16  ? -45.320 32.964  34.287  1.00 63.11 ? 37   LYS J NZ  1 
ATOM   5644  N N   . PRO J  2 17  ? -42.726 31.800  41.554  1.00 45.44 ? 38   PRO J N   1 
ATOM   5645  C CA  . PRO J  2 17  ? -42.750 30.746  42.575  1.00 50.52 ? 38   PRO J CA  1 
ATOM   5646  C C   . PRO J  2 17  ? -43.135 29.385  42.004  1.00 46.49 ? 38   PRO J C   1 
ATOM   5647  O O   . PRO J  2 17  ? -43.885 29.305  41.022  1.00 48.20 ? 38   PRO J O   1 
ATOM   5648  C CB  . PRO J  2 17  ? -43.814 31.241  43.558  1.00 53.22 ? 38   PRO J CB  1 
ATOM   5649  C CG  . PRO J  2 17  ? -43.898 32.746  43.317  1.00 48.55 ? 38   PRO J CG  1 
ATOM   5650  C CD  . PRO J  2 17  ? -43.693 32.875  41.845  1.00 51.29 ? 38   PRO J CD  1 
ATOM   5651  N N   . HIS J  2 18  ? -42.618 28.323  42.619  1.00 52.47 ? 39   HIS J N   1 
ATOM   5652  C CA  . HIS J  2 18  ? -42.854 26.965  42.133  1.00 52.30 ? 39   HIS J CA  1 
ATOM   5653  C C   . HIS J  2 18  ? -44.350 26.598  42.051  1.00 56.45 ? 39   HIS J C   1 
ATOM   5654  O O   . HIS J  2 18  ? -45.115 26.797  43.006  1.00 57.30 ? 39   HIS J O   1 
ATOM   5655  C CB  . HIS J  2 18  ? -42.088 25.930  42.977  1.00 49.08 ? 39   HIS J CB  1 
ATOM   5656  C CG  . HIS J  2 18  ? -42.370 24.515  42.576  1.00 53.56 ? 39   HIS J CG  1 
ATOM   5657  N ND1 . HIS J  2 18  ? -43.268 23.714  43.254  1.00 59.53 ? 39   HIS J ND1 1 
ATOM   5658  C CD2 . HIS J  2 18  ? -41.917 23.774  41.536  1.00 53.58 ? 39   HIS J CD2 1 
ATOM   5659  C CE1 . HIS J  2 18  ? -43.332 22.532  42.665  1.00 61.96 ? 39   HIS J CE1 1 
ATOM   5660  N NE2 . HIS J  2 18  ? -42.521 22.541  41.621  1.00 61.29 ? 39   HIS J NE2 1 
ATOM   5661  N N   . ASP K  1 7   ? -14.575 -60.454 -36.551 1.00 45.11 ? 1080 ASP K N   1 
ATOM   5662  C CA  . ASP K  1 7   ? -14.529 -60.760 -37.983 1.00 49.16 ? 1080 ASP K CA  1 
ATOM   5663  C C   . ASP K  1 7   ? -15.771 -60.271 -38.739 1.00 46.98 ? 1080 ASP K C   1 
ATOM   5664  O O   . ASP K  1 7   ? -15.784 -60.223 -39.968 1.00 48.25 ? 1080 ASP K O   1 
ATOM   5665  C CB  . ASP K  1 7   ? -14.372 -62.269 -38.195 1.00 58.75 ? 1080 ASP K CB  1 
ATOM   5666  C CG  . ASP K  1 7   ? -15.317 -63.095 -37.308 1.00 65.20 ? 1080 ASP K CG  1 
ATOM   5667  O OD1 . ASP K  1 7   ? -15.264 -64.347 -37.399 1.00 72.92 ? 1080 ASP K OD1 1 
ATOM   5668  O OD2 . ASP K  1 7   ? -16.104 -62.502 -36.521 1.00 61.82 ? 1080 ASP K OD2 1 
ATOM   5669  N N   . SER K  1 8   ? -16.818 -59.925 -38.002 1.00 44.73 ? 1081 SER K N   1 
ATOM   5670  C CA  . SER K  1 8   ? -18.062 -59.487 -38.614 1.00 46.66 ? 1081 SER K CA  1 
ATOM   5671  C C   . SER K  1 8   ? -17.870 -58.217 -39.468 1.00 41.39 ? 1081 SER K C   1 
ATOM   5672  O O   . SER K  1 8   ? -17.037 -57.368 -39.151 1.00 37.49 ? 1081 SER K O   1 
ATOM   5673  C CB  . SER K  1 8   ? -19.097 -59.214 -37.530 1.00 44.06 ? 1081 SER K CB  1 
ATOM   5674  O OG  . SER K  1 8   ? -18.621 -58.198 -36.656 1.00 47.94 ? 1081 SER K OG  1 
ATOM   5675  N N   . PRO K  1 9   ? -18.654 -58.094 -40.549 1.00 41.86 ? 1082 PRO K N   1 
ATOM   5676  C CA  . PRO K  1 9   ? -18.721 -56.886 -41.380 1.00 37.25 ? 1082 PRO K CA  1 
ATOM   5677  C C   . PRO K  1 9   ? -19.234 -55.708 -40.557 1.00 36.36 ? 1082 PRO K C   1 
ATOM   5678  O O   . PRO K  1 9   ? -20.097 -55.875 -39.689 1.00 34.01 ? 1082 PRO K O   1 
ATOM   5679  C CB  . PRO K  1 9   ? -19.757 -57.266 -42.457 1.00 41.67 ? 1082 PRO K CB  1 
ATOM   5680  C CG  . PRO K  1 9   ? -19.716 -58.742 -42.525 1.00 44.85 ? 1082 PRO K CG  1 
ATOM   5681  C CD  . PRO K  1 9   ? -19.485 -59.183 -41.102 1.00 43.30 ? 1082 PRO K CD  1 
ATOM   5682  N N   . LEU K  1 10  ? -18.721 -54.521 -40.865 1.00 30.23 ? 1083 LEU K N   1 
ATOM   5683  C CA  . LEU K  1 10  ? -19.047 -53.302 -40.129 1.00 25.92 ? 1083 LEU K CA  1 
ATOM   5684  C C   . LEU K  1 10  ? -19.835 -52.437 -41.083 1.00 25.95 ? 1083 LEU K C   1 
ATOM   5685  O O   . LEU K  1 10  ? -19.697 -52.601 -42.294 1.00 28.17 ? 1083 LEU K O   1 
ATOM   5686  C CB  . LEU K  1 10  ? -17.761 -52.573 -39.743 1.00 25.43 ? 1083 LEU K CB  1 
ATOM   5687  C CG  . LEU K  1 10  ? -16.858 -53.378 -38.820 1.00 27.90 ? 1083 LEU K CG  1 
ATOM   5688  C CD1 . LEU K  1 10  ? -15.571 -52.643 -38.446 1.00 29.80 ? 1083 LEU K CD1 1 
ATOM   5689  C CD2 . LEU K  1 10  ? -17.638 -53.667 -37.574 1.00 30.80 ? 1083 LEU K CD2 1 
ATOM   5690  N N   . ASP K  1 11  ? -20.608 -51.488 -40.559 1.00 24.44 ? 1084 ASP K N   1 
ATOM   5691  C CA  . ASP K  1 11  ? -21.481 -50.670 -41.395 1.00 23.37 ? 1084 ASP K CA  1 
ATOM   5692  C C   . ASP K  1 11  ? -20.948 -49.245 -41.538 1.00 23.84 ? 1084 ASP K C   1 
ATOM   5693  O O   . ASP K  1 11  ? -20.280 -48.738 -40.643 1.00 19.63 ? 1084 ASP K O   1 
ATOM   5694  C CB  . ASP K  1 11  ? -22.892 -50.579 -40.797 1.00 25.88 ? 1084 ASP K CB  1 
ATOM   5695  C CG  . ASP K  1 11  ? -23.607 -51.906 -40.785 1.00 33.14 ? 1084 ASP K CG  1 
ATOM   5696  O OD1 . ASP K  1 11  ? -24.544 -52.074 -39.975 1.00 42.48 ? 1084 ASP K OD1 1 
ATOM   5697  O OD2 . ASP K  1 11  ? -23.273 -52.781 -41.602 1.00 33.10 ? 1084 ASP K OD2 1 
ATOM   5698  N N   . ALA K  1 12  ? -21.281 -48.607 -42.656 1.00 23.87 ? 1085 ALA K N   1 
ATOM   5699  C CA  . ALA K  1 12  ? -21.027 -47.202 -42.830 1.00 22.70 ? 1085 ALA K CA  1 
ATOM   5700  C C   . ALA K  1 12  ? -21.630 -46.474 -41.640 1.00 24.81 ? 1085 ALA K C   1 
ATOM   5701  O O   . ALA K  1 12  ? -22.759 -46.805 -41.171 1.00 21.89 ? 1085 ALA K O   1 
ATOM   5702  C CB  . ALA K  1 12  ? -21.657 -46.672 -44.116 1.00 23.35 ? 1085 ALA K CB  1 
ATOM   5703  N N   . LEU K  1 13  ? -20.848 -45.512 -41.170 1.00 19.91 ? 1086 LEU K N   1 
ATOM   5704  C CA  . LEU K  1 13  ? -21.173 -44.602 -40.063 1.00 20.41 ? 1086 LEU K CA  1 
ATOM   5705  C C   . LEU K  1 13  ? -21.038 -45.257 -38.677 1.00 22.38 ? 1086 LEU K C   1 
ATOM   5706  O O   . LEU K  1 13  ? -21.480 -44.687 -37.666 1.00 20.27 ? 1086 LEU K O   1 
ATOM   5707  C CB  . LEU K  1 13  ? -22.582 -44.000 -40.239 1.00 21.36 ? 1086 LEU K CB  1 
ATOM   5708  C CG  . LEU K  1 13  ? -22.698 -43.228 -41.559 1.00 22.96 ? 1086 LEU K CG  1 
ATOM   5709  C CD1 . LEU K  1 13  ? -24.077 -42.535 -41.637 1.00 27.82 ? 1086 LEU K CD1 1 
ATOM   5710  C CD2 . LEU K  1 13  ? -21.577 -42.215 -41.707 1.00 25.18 ? 1086 LEU K CD2 1 
ATOM   5711  N N   . ASP K  1 14  ? -20.444 -46.449 -38.633 1.00 21.10 ? 1087 ASP K N   1 
ATOM   5712  C CA  . ASP K  1 14  ? -20.112 -47.058 -37.344 1.00 19.45 ? 1087 ASP K CA  1 
ATOM   5713  C C   . ASP K  1 14  ? -18.935 -46.285 -36.784 1.00 18.66 ? 1087 ASP K C   1 
ATOM   5714  O O   . ASP K  1 14  ? -18.096 -45.802 -37.568 1.00 17.83 ? 1087 ASP K O   1 
ATOM   5715  C CB  . ASP K  1 14  ? -19.696 -48.514 -37.491 1.00 16.15 ? 1087 ASP K CB  1 
ATOM   5716  C CG  . ASP K  1 14  ? -20.886 -49.486 -37.607 1.00 24.89 ? 1087 ASP K CG  1 
ATOM   5717  O OD1 . ASP K  1 14  ? -22.042 -49.058 -37.414 1.00 25.12 ? 1087 ASP K OD1 1 
ATOM   5718  O OD2 . ASP K  1 14  ? -20.631 -50.706 -37.874 1.00 27.48 ? 1087 ASP K OD2 1 
ATOM   5719  N N   . LEU K  1 15  ? -18.851 -46.137 -35.442 1.00 16.57 ? 1088 LEU K N   1 
ATOM   5720  C CA  . LEU K  1 15  ? -17.614 -45.631 -34.821 1.00 19.32 ? 1088 LEU K CA  1 
ATOM   5721  C C   . LEU K  1 15  ? -16.601 -46.740 -34.554 1.00 16.18 ? 1088 LEU K C   1 
ATOM   5722  O O   . LEU K  1 15  ? -16.962 -47.782 -33.983 1.00 16.60 ? 1088 LEU K O   1 
ATOM   5723  C CB  . LEU K  1 15  ? -17.954 -44.978 -33.482 1.00 15.68 ? 1088 LEU K CB  1 
ATOM   5724  C CG  . LEU K  1 15  ? -18.835 -43.736 -33.507 1.00 24.28 ? 1088 LEU K CG  1 
ATOM   5725  C CD1 . LEU K  1 15  ? -19.134 -43.313 -32.099 1.00 21.79 ? 1088 LEU K CD1 1 
ATOM   5726  C CD2 . LEU K  1 15  ? -18.206 -42.625 -34.294 1.00 20.75 ? 1088 LEU K CD2 1 
ATOM   5727  N N   . VAL K  1 16  ? -15.315 -46.515 -34.896 1.00 13.92 ? 1089 VAL K N   1 
ATOM   5728  C CA  . VAL K  1 16  ? -14.345 -47.552 -34.721 1.00 14.34 ? 1089 VAL K CA  1 
ATOM   5729  C C   . VAL K  1 16  ? -13.033 -46.941 -34.215 1.00 13.72 ? 1089 VAL K C   1 
ATOM   5730  O O   . VAL K  1 16  ? -12.819 -45.732 -34.290 1.00 15.18 ? 1089 VAL K O   1 
ATOM   5731  C CB  . VAL K  1 16  ? -14.052 -48.263 -36.055 1.00 14.66 ? 1089 VAL K CB  1 
ATOM   5732  C CG1 . VAL K  1 16  ? -15.337 -48.963 -36.576 1.00 15.81 ? 1089 VAL K CG1 1 
ATOM   5733  C CG2 . VAL K  1 16  ? -13.539 -47.190 -37.076 1.00 17.78 ? 1089 VAL K CG2 1 
ATOM   5734  N N   . TRP K  1 17  ? -12.264 -47.789 -33.543 1.00 12.46 ? 1090 TRP K N   1 
ATOM   5735  C CA  . TRP K  1 17  ? -10.830 -47.548 -33.345 1.00 14.69 ? 1090 TRP K CA  1 
ATOM   5736  C C   . TRP K  1 17  ? -10.179 -48.019 -34.628 1.00 16.07 ? 1090 TRP K C   1 
ATOM   5737  O O   . TRP K  1 17  ? -10.330 -49.195 -35.005 1.00 17.52 ? 1090 TRP K O   1 
ATOM   5738  C CB  . TRP K  1 17  ? -10.354 -48.443 -32.156 1.00 13.95 ? 1090 TRP K CB  1 
ATOM   5739  C CG  . TRP K  1 17  ? -10.836 -47.925 -30.826 1.00 14.60 ? 1090 TRP K CG  1 
ATOM   5740  C CD1 . TRP K  1 17  ? -11.873 -48.432 -30.065 1.00 14.62 ? 1090 TRP K CD1 1 
ATOM   5741  C CD2 . TRP K  1 17  ? -10.311 -46.820 -30.105 1.00 15.48 ? 1090 TRP K CD2 1 
ATOM   5742  N NE1 . TRP K  1 17  ? -12.021 -47.677 -28.921 1.00 17.44 ? 1090 TRP K NE1 1 
ATOM   5743  C CE2 . TRP K  1 17  ? -11.067 -46.691 -28.916 1.00 16.97 ? 1090 TRP K CE2 1 
ATOM   5744  C CE3 . TRP K  1 17  ? -9.256  -45.926 -30.333 1.00 12.76 ? 1090 TRP K CE3 1 
ATOM   5745  C CZ2 . TRP K  1 17  ? -10.803 -45.705 -27.962 1.00 17.22 ? 1090 TRP K CZ2 1 
ATOM   5746  C CZ3 . TRP K  1 17  ? -8.984  -44.943 -29.358 1.00 16.21 ? 1090 TRP K CZ3 1 
ATOM   5747  C CH2 . TRP K  1 17  ? -9.753  -44.855 -28.193 1.00 19.55 ? 1090 TRP K CH2 1 
ATOM   5748  N N   . ALA K  1 18  ? -9.394  -47.169 -35.262 1.00 15.01 ? 1091 ALA K N   1 
ATOM   5749  C CA  . ALA K  1 18  ? -8.834  -47.554 -36.542 1.00 15.56 ? 1091 ALA K CA  1 
ATOM   5750  C C   . ALA K  1 18  ? -7.314  -47.415 -36.400 1.00 16.53 ? 1091 ALA K C   1 
ATOM   5751  O O   . ALA K  1 18  ? -6.797  -46.376 -35.967 1.00 18.25 ? 1091 ALA K O   1 
ATOM   5752  C CB  . ALA K  1 18  ? -9.371  -46.645 -37.611 1.00 15.25 ? 1091 ALA K CB  1 
ATOM   5753  N N   . LYS K  1 19  ? -6.597  -48.500 -36.752 1.00 16.25 ? 1092 LYS K N   1 
ATOM   5754  C CA  . LYS K  1 19  ? -5.140  -48.517 -36.549 1.00 19.91 ? 1092 LYS K CA  1 
ATOM   5755  C C   . LYS K  1 19  ? -4.462  -48.421 -37.881 1.00 21.24 ? 1092 LYS K C   1 
ATOM   5756  O O   . LYS K  1 19  ? -4.581  -49.329 -38.729 1.00 23.42 ? 1092 LYS K O   1 
ATOM   5757  C CB  . LYS K  1 19  ? -4.707  -49.847 -35.941 1.00 23.65 ? 1092 LYS K CB  1 
ATOM   5758  C CG  . LYS K  1 19  ? -3.161  -49.953 -35.771 1.00 23.44 ? 1092 LYS K CG  1 
ATOM   5759  C CD  . LYS K  1 19  ? -2.653  -49.110 -34.618 1.00 21.91 ? 1092 LYS K CD  1 
ATOM   5760  C CE  . LYS K  1 19  ? -1.101  -49.268 -34.499 1.00 25.40 ? 1092 LYS K CE  1 
ATOM   5761  N NZ  . LYS K  1 19  ? -0.402  -48.840 -35.784 1.00 24.27 ? 1092 LYS K NZ  1 
ATOM   5762  N N   . CYS K  1 20  ? -3.719  -47.357 -38.076 1.00 23.84 ? 1093 CYS K N   1 
ATOM   5763  C CA  . CYS K  1 20  ? -2.940  -47.272 -39.285 1.00 27.29 ? 1093 CYS K CA  1 
ATOM   5764  C C   . CYS K  1 20  ? -1.450  -47.146 -38.967 1.00 28.55 ? 1093 CYS K C   1 
ATOM   5765  O O   . CYS K  1 20  ? -1.043  -46.837 -37.831 1.00 28.42 ? 1093 CYS K O   1 
ATOM   5766  C CB  . CYS K  1 20  ? -3.449  -46.171 -40.215 1.00 28.58 ? 1093 CYS K CB  1 
ATOM   5767  S SG  . CYS K  1 20  ? -3.388  -44.505 -39.614 1.00 33.87 ? 1093 CYS K SG  1 
ATOM   5768  N N   . ARG K  1 21  ? -0.642  -47.460 -39.972 1.00 27.86 ? 1094 ARG K N   1 
ATOM   5769  C CA  . ARG K  1 21  ? 0.808   -47.506 -39.808 1.00 31.74 ? 1094 ARG K CA  1 
ATOM   5770  C C   . ARG K  1 21  ? 1.373   -46.217 -39.270 1.00 32.41 ? 1094 ARG K C   1 
ATOM   5771  O O   . ARG K  1 21  ? 1.109   -45.127 -39.796 1.00 34.43 ? 1094 ARG K O   1 
ATOM   5772  C CB  . ARG K  1 21  ? 1.458   -47.854 -41.160 1.00 35.89 ? 1094 ARG K CB  1 
ATOM   5773  C CG  . ARG K  1 21  ? 2.988   -47.699 -41.205 1.00 48.12 ? 1094 ARG K CG  1 
ATOM   5774  C CD  . ARG K  1 21  ? 3.514   -48.480 -42.421 1.00 52.16 ? 1094 ARG K CD  1 
ATOM   5775  N NE  . ARG K  1 21  ? 4.869   -48.144 -42.870 1.00 58.70 ? 1094 ARG K NE  1 
ATOM   5776  C CZ  . ARG K  1 21  ? 5.254   -46.958 -43.351 1.00 55.63 ? 1094 ARG K CZ  1 
ATOM   5777  N NH1 . ARG K  1 21  ? 6.507   -46.798 -43.760 1.00 53.09 ? 1094 ARG K NH1 1 
ATOM   5778  N NH2 . ARG K  1 21  ? 4.404   -45.931 -43.413 1.00 50.74 ? 1094 ARG K NH2 1 
ATOM   5779  N N   . GLY K  1 22  ? 2.158   -46.338 -38.206 1.00 30.96 ? 1095 GLY K N   1 
ATOM   5780  C CA  . GLY K  1 22  ? 2.872   -45.190 -37.665 1.00 34.22 ? 1095 GLY K CA  1 
ATOM   5781  C C   . GLY K  1 22  ? 2.169   -44.414 -36.573 1.00 33.65 ? 1095 GLY K C   1 
ATOM   5782  O O   . GLY K  1 22  ? 2.720   -43.439 -36.051 1.00 30.37 ? 1095 GLY K O   1 
ATOM   5783  N N   . TYR K  1 23  ? 0.951   -44.840 -36.220 1.00 29.24 ? 1096 TYR K N   1 
ATOM   5784  C CA  . TYR K  1 23  ? 0.113   -44.107 -35.272 1.00 25.10 ? 1096 TYR K CA  1 
ATOM   5785  C C   . TYR K  1 23  ? -0.574  -45.113 -34.375 1.00 20.74 ? 1096 TYR K C   1 
ATOM   5786  O O   . TYR K  1 23  ? -0.795  -46.219 -34.768 1.00 24.14 ? 1096 TYR K O   1 
ATOM   5787  C CB  . TYR K  1 23  ? -0.988  -43.396 -36.026 1.00 24.83 ? 1096 TYR K CB  1 
ATOM   5788  C CG  . TYR K  1 23  ? -0.523  -42.316 -36.972 1.00 25.65 ? 1096 TYR K CG  1 
ATOM   5789  C CD1 . TYR K  1 23  ? -0.121  -41.074 -36.490 1.00 26.84 ? 1096 TYR K CD1 1 
ATOM   5790  C CD2 . TYR K  1 23  ? -0.476  -42.551 -38.343 1.00 30.07 ? 1096 TYR K CD2 1 
ATOM   5791  C CE1 . TYR K  1 23  ? 0.287   -40.067 -37.366 1.00 33.14 ? 1096 TYR K CE1 1 
ATOM   5792  C CE2 . TYR K  1 23  ? -0.085  -41.562 -39.220 1.00 31.07 ? 1096 TYR K CE2 1 
ATOM   5793  C CZ  . TYR K  1 23  ? 0.298   -40.326 -38.730 1.00 33.00 ? 1096 TYR K CZ  1 
ATOM   5794  O OH  . TYR K  1 23  ? 0.681   -39.343 -39.624 1.00 38.26 ? 1096 TYR K OH  1 
ATOM   5795  N N   . PRO K  1 24  ? -0.961  -44.695 -33.169 1.00 23.21 ? 1097 PRO K N   1 
ATOM   5796  C CA  . PRO K  1 24  ? -1.709  -45.603 -32.313 1.00 20.09 ? 1097 PRO K CA  1 
ATOM   5797  C C   . PRO K  1 24  ? -3.142  -45.609 -32.802 1.00 20.44 ? 1097 PRO K C   1 
ATOM   5798  O O   . PRO K  1 24  ? -3.531  -44.720 -33.584 1.00 19.35 ? 1097 PRO K O   1 
ATOM   5799  C CB  . PRO K  1 24  ? -1.647  -44.927 -30.930 1.00 23.78 ? 1097 PRO K CB  1 
ATOM   5800  C CG  . PRO K  1 24  ? -1.570  -43.518 -31.247 1.00 25.57 ? 1097 PRO K CG  1 
ATOM   5801  C CD  . PRO K  1 24  ? -0.675  -43.419 -32.502 1.00 27.18 ? 1097 PRO K CD  1 
ATOM   5802  N N   . SER K  1 25  ? -3.898  -46.564 -32.285 1.00 18.96 ? 1098 SER K N   1 
ATOM   5803  C CA  . SER K  1 25  ? -5.302  -46.721 -32.662 1.00 18.33 ? 1098 SER K CA  1 
ATOM   5804  C C   . SER K  1 25  ? -5.982  -45.388 -32.435 1.00 18.59 ? 1098 SER K C   1 
ATOM   5805  O O   . SER K  1 25  ? -5.717  -44.732 -31.411 1.00 17.88 ? 1098 SER K O   1 
ATOM   5806  C CB  . SER K  1 25  ? -5.973  -47.724 -31.718 1.00 17.47 ? 1098 SER K CB  1 
ATOM   5807  O OG  . SER K  1 25  ? -5.507  -49.031 -31.965 1.00 24.13 ? 1098 SER K OG  1 
ATOM   5808  N N   . TYR K  1 26  ? -6.942  -45.041 -33.302 1.00 17.08 ? 1099 TYR K N   1 
ATOM   5809  C CA  . TYR K  1 26  ? -7.474  -43.672 -33.268 1.00 16.11 ? 1099 TYR K CA  1 
ATOM   5810  C C   . TYR K  1 26  ? -8.946  -43.678 -33.638 1.00 17.43 ? 1099 TYR K C   1 
ATOM   5811  O O   . TYR K  1 26  ? -9.365  -44.395 -34.542 1.00 16.00 ? 1099 TYR K O   1 
ATOM   5812  C CB  . TYR K  1 26  ? -6.631  -42.779 -34.194 1.00 16.20 ? 1099 TYR K CB  1 
ATOM   5813  C CG  . TYR K  1 26  ? -6.684  -41.285 -33.884 1.00 18.48 ? 1099 TYR K CG  1 
ATOM   5814  C CD1 . TYR K  1 26  ? -7.734  -40.541 -34.314 1.00 15.33 ? 1099 TYR K CD1 1 
ATOM   5815  C CD2 . TYR K  1 26  ? -5.660  -40.652 -33.178 1.00 19.87 ? 1099 TYR K CD2 1 
ATOM   5816  C CE1 . TYR K  1 26  ? -7.804  -39.166 -34.050 1.00 15.37 ? 1099 TYR K CE1 1 
ATOM   5817  C CE2 . TYR K  1 26  ? -5.704  -39.310 -32.905 1.00 19.76 ? 1099 TYR K CE2 1 
ATOM   5818  C CZ  . TYR K  1 26  ? -6.776  -38.570 -33.350 1.00 19.79 ? 1099 TYR K CZ  1 
ATOM   5819  O OH  . TYR K  1 26  ? -6.812  -37.215 -33.074 1.00 21.67 ? 1099 TYR K OH  1 
ATOM   5820  N N   . PRO K  1 27  ? -9.760  -42.907 -32.905 1.00 13.50 ? 1100 PRO K N   1 
ATOM   5821  C CA  . PRO K  1 27  ? -11.206 -42.909 -33.187 1.00 12.73 ? 1100 PRO K CA  1 
ATOM   5822  C C   . PRO K  1 27  ? -11.535 -42.371 -34.564 1.00 15.59 ? 1100 PRO K C   1 
ATOM   5823  O O   . PRO K  1 27  ? -10.990 -41.360 -35.020 1.00 15.96 ? 1100 PRO K O   1 
ATOM   5824  C CB  . PRO K  1 27  ? -11.762 -41.919 -32.126 1.00 15.14 ? 1100 PRO K CB  1 
ATOM   5825  C CG  . PRO K  1 27  ? -10.782 -42.081 -30.957 1.00 15.78 ? 1100 PRO K CG  1 
ATOM   5826  C CD  . PRO K  1 27  ? -9.452  -42.107 -31.704 1.00 13.38 ? 1100 PRO K CD  1 
ATOM   5827  N N   . ALA K  1 28  ? -12.432 -43.086 -35.235 1.00 14.54 ? 1101 ALA K N   1 
ATOM   5828  C CA  . ALA K  1 28  ? -12.805 -42.734 -36.612 1.00 14.18 ? 1101 ALA K CA  1 
ATOM   5829  C C   . ALA K  1 28  ? -14.276 -43.136 -36.877 1.00 16.20 ? 1101 ALA K C   1 
ATOM   5830  O O   . ALA K  1 28  ? -14.894 -43.898 -36.120 1.00 15.22 ? 1101 ALA K O   1 
ATOM   5831  C CB  . ALA K  1 28  ? -11.855 -43.505 -37.595 1.00 14.82 ? 1101 ALA K CB  1 
ATOM   5832  N N   . LEU K  1 29  ? -14.786 -42.706 -38.042 1.00 17.28 ? 1102 LEU K N   1 
ATOM   5833  C CA  . LEU K  1 29  ? -16.118 -43.034 -38.481 1.00 13.87 ? 1102 LEU K CA  1 
ATOM   5834  C C   . LEU K  1 29  ? -15.959 -43.789 -39.810 1.00 16.49 ? 1102 LEU K C   1 
ATOM   5835  O O   . LEU K  1 29  ? -15.194 -43.335 -40.645 1.00 18.44 ? 1102 LEU K O   1 
ATOM   5836  C CB  . LEU K  1 29  ? -16.813 -41.689 -38.727 1.00 17.91 ? 1102 LEU K CB  1 
ATOM   5837  C CG  . LEU K  1 29  ? -18.296 -41.701 -39.089 1.00 18.52 ? 1102 LEU K CG  1 
ATOM   5838  C CD1 . LEU K  1 29  ? -19.161 -42.260 -37.984 1.00 20.63 ? 1102 LEU K CD1 1 
ATOM   5839  C CD2 . LEU K  1 29  ? -18.654 -40.233 -39.415 1.00 20.39 ? 1102 LEU K CD2 1 
ATOM   5840  N N   . ILE K  1 30  ? -16.672 -44.898 -39.988 1.00 17.20 ? 1103 ILE K N   1 
ATOM   5841  C CA  . ILE K  1 30  ? -16.620 -45.592 -41.293 1.00 18.09 ? 1103 ILE K CA  1 
ATOM   5842  C C   . ILE K  1 30  ? -17.506 -44.780 -42.227 1.00 18.99 ? 1103 ILE K C   1 
ATOM   5843  O O   . ILE K  1 30  ? -18.621 -44.404 -41.853 1.00 19.66 ? 1103 ILE K O   1 
ATOM   5844  C CB  . ILE K  1 30  ? -17.148 -46.978 -41.178 1.00 19.03 ? 1103 ILE K CB  1 
ATOM   5845  C CG1 . ILE K  1 30  ? -16.195 -47.746 -40.276 1.00 17.17 ? 1103 ILE K CG1 1 
ATOM   5846  C CG2 . ILE K  1 30  ? -17.196 -47.690 -42.561 1.00 17.51 ? 1103 ILE K CG2 1 
ATOM   5847  C CD1 . ILE K  1 30  ? -16.570 -49.171 -40.090 1.00 20.44 ? 1103 ILE K CD1 1 
ATOM   5848  N N   . ILE K  1 31  ? -17.008 -44.500 -43.432 1.00 17.30 ? 1104 ILE K N   1 
ATOM   5849  C CA  . ILE K  1 31  ? -17.718 -43.692 -44.403 1.00 20.00 ? 1104 ILE K CA  1 
ATOM   5850  C C   . ILE K  1 31  ? -17.973 -44.542 -45.679 1.00 21.82 ? 1104 ILE K C   1 
ATOM   5851  O O   . ILE K  1 31  ? -17.130 -45.304 -46.096 1.00 23.51 ? 1104 ILE K O   1 
ATOM   5852  C CB  . ILE K  1 31  ? -16.871 -42.485 -44.763 1.00 19.85 ? 1104 ILE K CB  1 
ATOM   5853  C CG1 . ILE K  1 31  ? -16.685 -41.609 -43.504 1.00 23.19 ? 1104 ILE K CG1 1 
ATOM   5854  C CG2 . ILE K  1 31  ? -17.517 -41.664 -45.916 1.00 20.46 ? 1104 ILE K CG2 1 
ATOM   5855  C CD1 . ILE K  1 31  ? -17.965 -40.936 -43.119 1.00 24.37 ? 1104 ILE K CD1 1 
ATOM   5856  N N   . ASP K  1 32  ? -19.162 -44.418 -46.255 1.00 21.16 ? 1105 ASP K N   1 
ATOM   5857  C CA  . ASP K  1 32  ? -19.458 -45.118 -47.536 1.00 21.22 ? 1105 ASP K CA  1 
ATOM   5858  C C   . ASP K  1 32  ? -18.780 -44.400 -48.690 1.00 20.66 ? 1105 ASP K C   1 
ATOM   5859  O O   . ASP K  1 32  ? -19.092 -43.238 -48.942 1.00 25.34 ? 1105 ASP K O   1 
ATOM   5860  C CB  . ASP K  1 32  ? -20.967 -45.116 -47.731 1.00 23.90 ? 1105 ASP K CB  1 
ATOM   5861  C CG  . ASP K  1 32  ? -21.403 -45.850 -48.988 1.00 30.49 ? 1105 ASP K CG  1 
ATOM   5862  O OD1 . ASP K  1 32  ? -20.543 -46.176 -49.813 1.00 32.26 ? 1105 ASP K OD1 1 
ATOM   5863  O OD2 . ASP K  1 32  ? -22.615 -46.087 -49.122 1.00 36.99 ? 1105 ASP K OD2 1 
ATOM   5864  N N   . PRO K  1 33  ? -17.882 -45.076 -49.418 1.00 24.80 ? 1106 PRO K N   1 
ATOM   5865  C CA  . PRO K  1 33  ? -17.212 -44.434 -50.568 1.00 27.43 ? 1106 PRO K CA  1 
ATOM   5866  C C   . PRO K  1 33  ? -18.183 -44.026 -51.682 1.00 27.26 ? 1106 PRO K C   1 
ATOM   5867  O O   . PRO K  1 33  ? -17.839 -43.136 -52.478 1.00 30.88 ? 1106 PRO K O   1 
ATOM   5868  C CB  . PRO K  1 33  ? -16.265 -45.524 -51.097 1.00 30.21 ? 1106 PRO K CB  1 
ATOM   5869  C CG  . PRO K  1 33  ? -16.138 -46.498 -50.019 1.00 26.80 ? 1106 PRO K CG  1 
ATOM   5870  C CD  . PRO K  1 33  ? -17.390 -46.440 -49.185 1.00 23.01 ? 1106 PRO K CD  1 
ATOM   5871  N N   . LYS K  1 34  ? -19.366 -44.641 -51.718 1.00 32.11 ? 1107 LYS K N   1 
ATOM   5872  C CA  . LYS K  1 34  ? -20.363 -44.361 -52.756 1.00 32.10 ? 1107 LYS K CA  1 
ATOM   5873  C C   . LYS K  1 34  ? -21.392 -43.389 -52.261 1.00 35.38 ? 1107 LYS K C   1 
ATOM   5874  O O   . LYS K  1 34  ? -22.501 -43.312 -52.829 1.00 32.13 ? 1107 LYS K O   1 
ATOM   5875  C CB  . LYS K  1 34  ? -21.141 -45.629 -53.169 1.00 36.61 ? 1107 LYS K CB  1 
ATOM   5876  C CG  . LYS K  1 34  ? -20.316 -46.811 -53.645 1.00 39.59 ? 1107 LYS K CG  1 
ATOM   5877  C CD  . LYS K  1 34  ? -19.033 -46.384 -54.330 1.00 42.96 ? 1107 LYS K CD  1 
ATOM   5878  C CE  . LYS K  1 34  ? -18.039 -47.577 -54.438 1.00 50.03 ? 1107 LYS K CE  1 
ATOM   5879  N NZ  . LYS K  1 34  ? -16.675 -47.192 -54.957 1.00 52.11 ? 1107 LYS K NZ  1 
ATOM   5880  N N   . MET K  1 35  ? -21.093 -42.672 -51.177 1.00 29.46 ? 1108 MET K N   1 
ATOM   5881  C CA  . MET K  1 35  ? -22.105 -41.761 -50.680 1.00 28.45 ? 1108 MET K CA  1 
ATOM   5882  C C   . MET K  1 35  ? -22.276 -40.626 -51.671 1.00 34.83 ? 1108 MET K C   1 
ATOM   5883  O O   . MET K  1 35  ? -21.342 -40.291 -52.412 1.00 34.21 ? 1108 MET K O   1 
ATOM   5884  C CB  . MET K  1 35  ? -21.766 -41.234 -49.285 1.00 33.96 ? 1108 MET K CB  1 
ATOM   5885  C CG  . MET K  1 35  ? -20.489 -40.444 -49.196 1.00 29.04 ? 1108 MET K CG  1 
ATOM   5886  S SD  . MET K  1 35  ? -20.237 -39.611 -47.569 1.00 35.65 ? 1108 MET K SD  1 
ATOM   5887  C CE  . MET K  1 35  ? -21.025 -38.072 -47.872 1.00 25.74 ? 1108 MET K CE  1 
ATOM   5888  N N   . PRO K  1 36  ? -23.473 -40.031 -51.693 1.00 32.42 ? 1109 PRO K N   1 
ATOM   5889  C CA  . PRO K  1 36  ? -23.776 -38.919 -52.617 1.00 37.38 ? 1109 PRO K CA  1 
ATOM   5890  C C   . PRO K  1 36  ? -22.700 -37.833 -52.662 1.00 34.88 ? 1109 PRO K C   1 
ATOM   5891  O O   . PRO K  1 36  ? -22.398 -37.247 -51.627 1.00 33.15 ? 1109 PRO K O   1 
ATOM   5892  C CB  . PRO K  1 36  ? -25.033 -38.308 -52.006 1.00 36.65 ? 1109 PRO K CB  1 
ATOM   5893  C CG  . PRO K  1 36  ? -25.690 -39.414 -51.290 1.00 40.36 ? 1109 PRO K CG  1 
ATOM   5894  C CD  . PRO K  1 36  ? -24.578 -40.297 -50.760 1.00 33.97 ? 1109 PRO K CD  1 
ATOM   5895  N N   . ARG K  1 37  ? -22.182 -37.508 -53.840 1.00 34.16 ? 1110 ARG K N   1 
ATOM   5896  C CA  . ARG K  1 37  ? -21.176 -36.455 -53.938 1.00 36.68 ? 1110 ARG K CA  1 
ATOM   5897  C C   . ARG K  1 37  ? -21.727 -35.086 -53.519 1.00 32.22 ? 1110 ARG K C   1 
ATOM   5898  O O   . ARG K  1 37  ? -20.973 -34.195 -53.097 1.00 32.93 ? 1110 ARG K O   1 
ATOM   5899  C CB  . ARG K  1 37  ? -20.618 -36.391 -55.359 1.00 37.53 ? 1110 ARG K CB  1 
ATOM   5900  C CG  . ARG K  1 37  ? -20.206 -37.737 -55.918 1.00 36.03 ? 1110 ARG K CG  1 
ATOM   5901  C CD  . ARG K  1 37  ? -19.011 -38.273 -55.148 1.00 31.74 ? 1110 ARG K CD  1 
ATOM   5902  N NE  . ARG K  1 37  ? -17.866 -37.357 -55.111 1.00 33.39 ? 1110 ARG K NE  1 
ATOM   5903  C CZ  . ARG K  1 37  ? -16.813 -37.534 -54.308 1.00 33.47 ? 1110 ARG K CZ  1 
ATOM   5904  N NH1 . ARG K  1 37  ? -15.780 -36.707 -54.318 1.00 35.47 ? 1110 ARG K NH1 1 
ATOM   5905  N NH2 . ARG K  1 37  ? -16.810 -38.555 -53.465 1.00 33.32 ? 1110 ARG K NH2 1 
ATOM   5906  N N   . GLU K  1 38  ? -23.051 -34.922 -53.600 1.00 33.08 ? 1111 GLU K N   1 
ATOM   5907  C CA  . GLU K  1 38  ? -23.681 -33.666 -53.203 1.00 37.76 ? 1111 GLU K CA  1 
ATOM   5908  C C   . GLU K  1 38  ? -23.576 -33.530 -51.694 1.00 38.06 ? 1111 GLU K C   1 
ATOM   5909  O O   . GLU K  1 38  ? -23.770 -32.444 -51.125 1.00 40.22 ? 1111 GLU K O   1 
ATOM   5910  C CB  . GLU K  1 38  ? -25.150 -33.595 -53.670 1.00 40.79 ? 1111 GLU K CB  1 
ATOM   5911  C CG  . GLU K  1 38  ? -25.857 -34.944 -53.765 1.00 43.99 ? 1111 GLU K CG  1 
ATOM   5912  C CD  . GLU K  1 38  ? -25.341 -35.798 -54.920 1.00 45.08 ? 1111 GLU K CD  1 
ATOM   5913  O OE1 . GLU K  1 38  ? -24.932 -36.946 -54.651 1.00 50.14 ? 1111 GLU K OE1 1 
ATOM   5914  O OE2 . GLU K  1 38  ? -25.316 -35.330 -56.094 1.00 50.74 ? 1111 GLU K OE2 1 
ATOM   5915  N N   . GLY K  1 39  ? -23.240 -34.648 -51.049 1.00 36.58 ? 1112 GLY K N   1 
ATOM   5916  C CA  . GLY K  1 39  ? -23.051 -34.689 -49.618 1.00 34.41 ? 1112 GLY K CA  1 
ATOM   5917  C C   . GLY K  1 39  ? -24.287 -35.212 -48.934 1.00 36.43 ? 1112 GLY K C   1 
ATOM   5918  O O   . GLY K  1 39  ? -25.285 -35.515 -49.597 1.00 38.90 ? 1112 GLY K O   1 
ATOM   5919  N N   . MET K  1 40  ? -24.231 -35.323 -47.609 1.00 32.88 ? 1113 MET K N   1 
ATOM   5920  C CA  . MET K  1 40  ? -25.307 -35.981 -46.874 1.00 34.71 ? 1113 MET K CA  1 
ATOM   5921  C C   . MET K  1 40  ? -25.296 -35.592 -45.397 1.00 34.14 ? 1113 MET K C   1 
ATOM   5922  O O   . MET K  1 40  ? -24.277 -35.145 -44.864 1.00 30.21 ? 1113 MET K O   1 
ATOM   5923  C CB  . MET K  1 40  ? -25.275 -37.514 -47.046 1.00 36.28 ? 1113 MET K CB  1 
ATOM   5924  C CG  . MET K  1 40  ? -24.351 -38.294 -46.133 1.00 41.48 ? 1113 MET K CG  1 
ATOM   5925  S SD  . MET K  1 40  ? -24.837 -40.072 -46.065 1.00 53.67 ? 1113 MET K SD  1 
ATOM   5926  C CE  . MET K  1 40  ? -25.743 -40.180 -44.527 1.00 41.88 ? 1113 MET K CE  1 
ATOM   5927  N N   . PHE K  1 41  ? -26.469 -35.705 -44.784 1.00 31.60 ? 1114 PHE K N   1 
ATOM   5928  C CA  . PHE K  1 41  ? -26.694 -35.385 -43.381 1.00 34.73 ? 1114 PHE K CA  1 
ATOM   5929  C C   . PHE K  1 41  ? -27.243 -36.622 -42.735 1.00 32.87 ? 1114 PHE K C   1 
ATOM   5930  O O   . PHE K  1 41  ? -28.173 -37.240 -43.274 1.00 33.83 ? 1114 PHE K O   1 
ATOM   5931  C CB  . PHE K  1 41  ? -27.757 -34.311 -43.241 1.00 34.57 ? 1114 PHE K CB  1 
ATOM   5932  C CG  . PHE K  1 41  ? -27.345 -33.002 -43.795 1.00 38.87 ? 1114 PHE K CG  1 
ATOM   5933  C CD1 . PHE K  1 41  ? -27.639 -32.679 -45.110 1.00 40.66 ? 1114 PHE K CD1 1 
ATOM   5934  C CD2 . PHE K  1 41  ? -26.651 -32.095 -43.004 1.00 39.14 ? 1114 PHE K CD2 1 
ATOM   5935  C CE1 . PHE K  1 41  ? -27.256 -31.455 -45.623 1.00 45.56 ? 1114 PHE K CE1 1 
ATOM   5936  C CE2 . PHE K  1 41  ? -26.261 -30.872 -43.512 1.00 40.91 ? 1114 PHE K CE2 1 
ATOM   5937  C CZ  . PHE K  1 41  ? -26.564 -30.553 -44.822 1.00 44.22 ? 1114 PHE K CZ  1 
ATOM   5938  N N   . HIS K  1 42  ? -26.687 -36.971 -41.577 1.00 25.97 ? 1115 HIS K N   1 
ATOM   5939  C CA  . HIS K  1 42  ? -27.168 -38.114 -40.836 1.00 27.70 ? 1115 HIS K CA  1 
ATOM   5940  C C   . HIS K  1 42  ? -27.865 -37.551 -39.608 1.00 30.84 ? 1115 HIS K C   1 
ATOM   5941  O O   . HIS K  1 42  ? -27.210 -36.974 -38.768 1.00 29.09 ? 1115 HIS K O   1 
ATOM   5942  C CB  . HIS K  1 42  ? -25.981 -38.996 -40.423 1.00 27.98 ? 1115 HIS K CB  1 
ATOM   5943  C CG  . HIS K  1 42  ? -26.378 -40.268 -39.742 1.00 27.08 ? 1115 HIS K CG  1 
ATOM   5944  N ND1 . HIS K  1 42  ? -25.552 -40.925 -38.862 1.00 23.73 ? 1115 HIS K ND1 1 
ATOM   5945  C CD2 . HIS K  1 42  ? -27.516 -40.999 -39.815 1.00 31.21 ? 1115 HIS K CD2 1 
ATOM   5946  C CE1 . HIS K  1 42  ? -26.157 -42.017 -38.426 1.00 28.92 ? 1115 HIS K CE1 1 
ATOM   5947  N NE2 . HIS K  1 42  ? -27.353 -42.084 -38.991 1.00 30.70 ? 1115 HIS K NE2 1 
ATOM   5948  N N   . HIS K  1 43  ? -29.191 -37.694 -39.517 1.00 28.15 ? 1116 HIS K N   1 
ATOM   5949  C CA  . HIS K  1 43  ? -29.949 -36.962 -38.476 1.00 30.38 ? 1116 HIS K CA  1 
ATOM   5950  C C   . HIS K  1 43  ? -29.504 -35.505 -38.363 1.00 31.92 ? 1116 HIS K C   1 
ATOM   5951  O O   . HIS K  1 43  ? -29.282 -34.974 -37.276 1.00 33.71 ? 1116 HIS K O   1 
ATOM   5952  C CB  . HIS K  1 43  ? -29.868 -37.667 -37.132 1.00 28.92 ? 1116 HIS K CB  1 
ATOM   5953  C CG  . HIS K  1 43  ? -30.349 -39.087 -37.157 1.00 34.57 ? 1116 HIS K CG  1 
ATOM   5954  N ND1 . HIS K  1 43  ? -31.692 -39.417 -37.183 1.00 33.97 ? 1116 HIS K ND1 1 
ATOM   5955  C CD2 . HIS K  1 43  ? -29.675 -40.265 -37.194 1.00 35.56 ? 1116 HIS K CD2 1 
ATOM   5956  C CE1 . HIS K  1 43  ? -31.818 -40.731 -37.182 1.00 32.84 ? 1116 HIS K CE1 1 
ATOM   5957  N NE2 . HIS K  1 43  ? -30.612 -41.272 -37.208 1.00 39.01 ? 1116 HIS K NE2 1 
ATOM   5958  N N   . GLY K  1 44  ? -29.335 -34.870 -39.507 1.00 33.89 ? 1117 GLY K N   1 
ATOM   5959  C CA  . GLY K  1 44  ? -28.953 -33.482 -39.563 1.00 34.81 ? 1117 GLY K CA  1 
ATOM   5960  C C   . GLY K  1 44  ? -27.489 -33.143 -39.362 1.00 36.31 ? 1117 GLY K C   1 
ATOM   5961  O O   . GLY K  1 44  ? -27.126 -31.963 -39.405 1.00 37.25 ? 1117 GLY K O   1 
ATOM   5962  N N   . VAL K  1 45  ? -26.653 -34.141 -39.113 1.00 32.17 ? 1118 VAL K N   1 
ATOM   5963  C CA  . VAL K  1 45  ? -25.211 -33.881 -38.987 1.00 33.14 ? 1118 VAL K CA  1 
ATOM   5964  C C   . VAL K  1 45  ? -24.550 -34.112 -40.344 1.00 31.43 ? 1118 VAL K C   1 
ATOM   5965  O O   . VAL K  1 45  ? -24.675 -35.177 -40.939 1.00 29.77 ? 1118 VAL K O   1 
ATOM   5966  C CB  . VAL K  1 45  ? -24.556 -34.736 -37.868 0.93 33.14 ? 1118 VAL K CB  1 
ATOM   5967  C CG1 . VAL K  1 45  ? -24.957 -36.145 -38.028 0.93 31.52 ? 1118 VAL K CG1 1 
ATOM   5968  C CG2 . VAL K  1 45  ? -23.032 -34.639 -37.915 0.93 31.03 ? 1118 VAL K CG2 1 
ATOM   5969  N N   . PRO K  1 46  ? -23.867 -33.087 -40.854 1.00 32.98 ? 1119 PRO K N   1 
ATOM   5970  C CA  . PRO K  1 46  ? -23.138 -33.143 -42.124 1.00 34.30 ? 1119 PRO K CA  1 
ATOM   5971  C C   . PRO K  1 46  ? -22.033 -34.209 -42.069 1.00 29.72 ? 1119 PRO K C   1 
ATOM   5972  O O   . PRO K  1 46  ? -21.206 -34.179 -41.163 1.00 29.76 ? 1119 PRO K O   1 
ATOM   5973  C CB  . PRO K  1 46  ? -22.494 -31.745 -42.221 1.00 34.08 ? 1119 PRO K CB  1 
ATOM   5974  C CG  . PRO K  1 46  ? -23.204 -30.912 -41.245 1.00 35.87 ? 1119 PRO K CG  1 
ATOM   5975  C CD  . PRO K  1 46  ? -23.627 -31.824 -40.139 1.00 36.56 ? 1119 PRO K CD  1 
ATOM   5976  N N   . ILE K  1 47  ? -22.041 -35.151 -43.011 1.00 28.94 ? 1120 ILE K N   1 
ATOM   5977  C CA  . ILE K  1 47  ? -20.936 -36.133 -43.152 1.00 23.58 ? 1120 ILE K CA  1 
ATOM   5978  C C   . ILE K  1 47  ? -20.065 -35.738 -44.332 1.00 22.50 ? 1120 ILE K C   1 
ATOM   5979  O O   . ILE K  1 47  ? -20.535 -35.584 -45.448 1.00 24.55 ? 1120 ILE K O   1 
ATOM   5980  C CB  . ILE K  1 47  ? -21.481 -37.486 -43.444 1.00 27.27 ? 1120 ILE K CB  1 
ATOM   5981  C CG1 . ILE K  1 47  ? -22.597 -37.833 -42.463 1.00 26.40 ? 1120 ILE K CG1 1 
ATOM   5982  C CG2 . ILE K  1 47  ? -20.369 -38.528 -43.394 1.00 23.74 ? 1120 ILE K CG2 1 
ATOM   5983  C CD1 . ILE K  1 47  ? -22.119 -37.962 -41.052 1.00 29.80 ? 1120 ILE K CD1 1 
ATOM   5984  N N   . PRO K  1 48  ? -18.788 -35.503 -44.079 1.00 24.08 ? 1121 PRO K N   1 
ATOM   5985  C CA  . PRO K  1 48  ? -17.901 -35.091 -45.162 1.00 22.54 ? 1121 PRO K CA  1 
ATOM   5986  C C   . PRO K  1 48  ? -17.845 -36.101 -46.296 1.00 26.31 ? 1121 PRO K C   1 
ATOM   5987  O O   . PRO K  1 48  ? -17.883 -37.311 -46.109 1.00 23.64 ? 1121 PRO K O   1 
ATOM   5988  C CB  . PRO K  1 48  ? -16.517 -35.026 -44.474 1.00 21.41 ? 1121 PRO K CB  1 
ATOM   5989  C CG  . PRO K  1 48  ? -16.797 -34.753 -43.053 1.00 26.35 ? 1121 PRO K CG  1 
ATOM   5990  C CD  . PRO K  1 48  ? -18.125 -35.478 -42.764 1.00 23.61 ? 1121 PRO K CD  1 
ATOM   5991  N N   . VAL K  1 49  ? -17.687 -35.574 -47.498 1.00 24.12 ? 1122 VAL K N   1 
ATOM   5992  C CA  . VAL K  1 49  ? -17.680 -36.405 -48.687 1.00 24.02 ? 1122 VAL K CA  1 
ATOM   5993  C C   . VAL K  1 49  ? -16.219 -36.709 -49.023 1.00 25.88 ? 1122 VAL K C   1 
ATOM   5994  O O   . VAL K  1 49  ? -15.395 -35.807 -48.995 1.00 26.71 ? 1122 VAL K O   1 
ATOM   5995  C CB  . VAL K  1 49  ? -18.315 -35.609 -49.844 1.00 27.22 ? 1122 VAL K CB  1 
ATOM   5996  C CG1 . VAL K  1 49  ? -18.037 -36.285 -51.181 1.00 27.27 ? 1122 VAL K CG1 1 
ATOM   5997  C CG2 . VAL K  1 49  ? -19.817 -35.488 -49.617 1.00 30.17 ? 1122 VAL K CG2 1 
ATOM   5998  N N   . PRO K  1 50  ? -15.901 -37.977 -49.304 1.00 24.65 ? 1123 PRO K N   1 
ATOM   5999  C CA  . PRO K  1 50  ? -14.543 -38.417 -49.630 1.00 23.99 ? 1123 PRO K CA  1 
ATOM   6000  C C   . PRO K  1 50  ? -14.070 -37.674 -50.882 1.00 30.81 ? 1123 PRO K C   1 
ATOM   6001  O O   . PRO K  1 50  ? -14.748 -37.736 -51.893 1.00 29.84 ? 1123 PRO K O   1 
ATOM   6002  C CB  . PRO K  1 50  ? -14.726 -39.895 -50.018 1.00 25.01 ? 1123 PRO K CB  1 
ATOM   6003  C CG  . PRO K  1 50  ? -16.095 -40.314 -49.436 1.00 27.63 ? 1123 PRO K CG  1 
ATOM   6004  C CD  . PRO K  1 50  ? -16.896 -39.057 -49.330 1.00 29.51 ? 1123 PRO K CD  1 
ATOM   6005  N N   . PRO K  1 51  ? -12.905 -37.035 -50.832 1.00 29.24 ? 1124 PRO K N   1 
ATOM   6006  C CA  . PRO K  1 51  ? -12.364 -36.434 -52.056 1.00 31.51 ? 1124 PRO K CA  1 
ATOM   6007  C C   . PRO K  1 51  ? -12.066 -37.476 -53.139 1.00 34.84 ? 1124 PRO K C   1 
ATOM   6008  O O   . PRO K  1 51  ? -11.770 -38.648 -52.860 1.00 31.69 ? 1124 PRO K O   1 
ATOM   6009  C CB  . PRO K  1 51  ? -11.060 -35.795 -51.572 1.00 35.43 ? 1124 PRO K CB  1 
ATOM   6010  C CG  . PRO K  1 51  ? -11.235 -35.636 -50.100 1.00 37.29 ? 1124 PRO K CG  1 
ATOM   6011  C CD  . PRO K  1 51  ? -12.060 -36.776 -49.658 1.00 28.54 ? 1124 PRO K CD  1 
ATOM   6012  N N   . LEU K  1 52  ? -12.125 -37.056 -54.395 1.00 36.92 ? 1125 LEU K N   1 
ATOM   6013  C CA  . LEU K  1 52  ? -11.864 -37.996 -55.476 1.00 33.78 ? 1125 LEU K CA  1 
ATOM   6014  C C   . LEU K  1 52  ? -10.475 -38.633 -55.389 1.00 28.60 ? 1125 LEU K C   1 
ATOM   6015  O O   . LEU K  1 52  ? -10.318 -39.793 -55.761 1.00 34.89 ? 1125 LEU K O   1 
ATOM   6016  C CB  . LEU K  1 52  ? -12.054 -37.318 -56.845 1.00 36.86 ? 1125 LEU K CB  1 
ATOM   6017  C CG  . LEU K  1 52  ? -13.441 -36.711 -57.092 1.00 41.99 ? 1125 LEU K CG  1 
ATOM   6018  C CD1 . LEU K  1 52  ? -13.360 -35.642 -58.178 1.00 52.94 ? 1125 LEU K CD1 1 
ATOM   6019  C CD2 . LEU K  1 52  ? -14.490 -37.755 -57.451 1.00 37.49 ? 1125 LEU K CD2 1 
ATOM   6020  N N   . GLU K  1 53  ? -9.490  -37.883 -54.899 1.00 33.12 ? 1126 GLU K N   1 
ATOM   6021  C CA  . GLU K  1 53  ? -8.125  -38.386 -54.748 1.00 35.31 ? 1126 GLU K CA  1 
ATOM   6022  C C   . GLU K  1 53  ? -8.075  -39.505 -53.735 1.00 36.35 ? 1126 GLU K C   1 
ATOM   6023  O O   . GLU K  1 53  ? -7.326  -40.478 -53.883 1.00 32.59 ? 1126 GLU K O   1 
ATOM   6024  C CB  . GLU K  1 53  ? -7.189  -37.292 -54.229 1.00 37.18 ? 1126 GLU K CB  1 
ATOM   6025  C CG  . GLU K  1 53  ? -5.740  -37.727 -54.330 1.00 47.34 ? 1126 GLU K CG  1 
ATOM   6026  C CD  . GLU K  1 53  ? -4.936  -37.415 -53.078 1.00 59.19 ? 1126 GLU K CD  1 
ATOM   6027  O OE1 . GLU K  1 53  ? -5.147  -38.110 -52.046 1.00 60.23 ? 1126 GLU K OE1 1 
ATOM   6028  O OE2 . GLU K  1 53  ? -4.092  -36.484 -53.137 1.00 60.84 ? 1126 GLU K OE2 1 
ATOM   6029  N N   . VAL K  1 54  ? -8.859  -39.331 -52.674 1.00 35.21 ? 1127 VAL K N   1 
ATOM   6030  C CA  . VAL K  1 54  ? -9.000  -40.378 -51.670 1.00 30.44 ? 1127 VAL K CA  1 
ATOM   6031  C C   . VAL K  1 54  ? -9.626  -41.640 -52.260 1.00 29.20 ? 1127 VAL K C   1 
ATOM   6032  O O   . VAL K  1 54  ? -9.152  -42.753 -52.003 1.00 31.06 ? 1127 VAL K O   1 
ATOM   6033  C CB  . VAL K  1 54  ? -9.799  -39.878 -50.434 1.00 29.11 ? 1127 VAL K CB  1 
ATOM   6034  C CG1 . VAL K  1 54  ? -10.069 -41.039 -49.449 1.00 30.43 ? 1127 VAL K CG1 1 
ATOM   6035  C CG2 . VAL K  1 54  ? -9.031  -38.764 -49.724 1.00 30.80 ? 1127 VAL K CG2 1 
ATOM   6036  N N   . LEU K  1 55  ? -10.695 -41.494 -53.026 1.00 30.60 ? 1128 LEU K N   1 
ATOM   6037  C CA  . LEU K  1 55  ? -11.314 -42.670 -53.644 1.00 32.32 ? 1128 LEU K CA  1 
ATOM   6038  C C   . LEU K  1 55  ? -10.332 -43.413 -54.560 1.00 28.54 ? 1128 LEU K C   1 
ATOM   6039  O O   . LEU K  1 55  ? -10.281 -44.634 -54.582 1.00 29.92 ? 1128 LEU K O   1 
ATOM   6040  C CB  . LEU K  1 55  ? -12.564 -42.274 -54.433 1.00 32.55 ? 1128 LEU K CB  1 
ATOM   6041  C CG  . LEU K  1 55  ? -13.688 -41.692 -53.579 1.00 32.70 ? 1128 LEU K CG  1 
ATOM   6042  C CD1 . LEU K  1 55  ? -14.939 -41.509 -54.429 1.00 34.57 ? 1128 LEU K CD1 1 
ATOM   6043  C CD2 . LEU K  1 55  ? -13.971 -42.593 -52.350 1.00 25.83 ? 1128 LEU K CD2 1 
ATOM   6044  N N   . LYS K  1 56  ? -9.552  -42.648 -55.305 1.00 32.52 ? 1129 LYS K N   1 
ATOM   6045  C CA  . LYS K  1 56  ? -8.651  -43.262 -56.268 1.00 36.79 ? 1129 LYS K CA  1 
ATOM   6046  C C   . LYS K  1 56  ? -7.614  -44.081 -55.503 1.00 33.48 ? 1129 LYS K C   1 
ATOM   6047  O O   . LYS K  1 56  ? -7.299  -45.204 -55.874 1.00 31.80 ? 1129 LYS K O   1 
ATOM   6048  C CB  . LYS K  1 56  ? -8.006  -42.181 -57.151 1.00 34.61 ? 1129 LYS K CB  1 
ATOM   6049  C CG  . LYS K  1 56  ? -7.011  -42.719 -58.182 1.00 47.03 ? 1129 LYS K CG  1 
ATOM   6050  C CD  . LYS K  1 56  ? -5.771  -41.813 -58.297 1.00 53.68 ? 1129 LYS K CD  1 
ATOM   6051  C CE  . LYS K  1 56  ? -4.833  -42.290 -59.433 1.00 62.65 ? 1129 LYS K CE  1 
ATOM   6052  N NZ  . LYS K  1 56  ? -3.391  -41.923 -59.253 1.00 55.13 ? 1129 LYS K NZ  1 
ATOM   6053  N N   . LEU K  1 57  ? -7.115  -43.538 -54.402 1.00 31.26 ? 1130 LEU K N   1 
ATOM   6054  C CA  . LEU K  1 57  ? -6.151  -44.263 -53.579 1.00 33.03 ? 1130 LEU K CA  1 
ATOM   6055  C C   . LEU K  1 57  ? -6.750  -45.584 -53.111 1.00 33.69 ? 1130 LEU K C   1 
ATOM   6056  O O   . LEU K  1 57  ? -6.090  -46.628 -53.113 1.00 30.70 ? 1130 LEU K O   1 
ATOM   6057  C CB  . LEU K  1 57  ? -5.790  -43.415 -52.359 1.00 36.36 ? 1130 LEU K CB  1 
ATOM   6058  C CG  . LEU K  1 57  ? -4.348  -43.400 -51.846 1.00 44.39 ? 1130 LEU K CG  1 
ATOM   6059  C CD1 . LEU K  1 57  ? -4.339  -43.263 -50.327 1.00 45.30 ? 1130 LEU K CD1 1 
ATOM   6060  C CD2 . LEU K  1 57  ? -3.548  -44.629 -52.273 1.00 39.07 ? 1130 LEU K CD2 1 
ATOM   6061  N N   . GLY K  1 58  ? -8.008  -45.522 -52.676 1.00 29.59 ? 1131 GLY K N   1 
ATOM   6062  C CA  . GLY K  1 58  ? -8.699  -46.687 -52.162 1.00 26.45 ? 1131 GLY K CA  1 
ATOM   6063  C C   . GLY K  1 58  ? -8.770  -47.836 -53.159 1.00 31.25 ? 1131 GLY K C   1 
ATOM   6064  O O   . GLY K  1 58  ? -8.596  -48.996 -52.793 1.00 28.98 ? 1131 GLY K O   1 
ATOM   6065  N N   . GLU K  1 59  ? -9.057  -47.505 -54.409 1.00 33.22 ? 1132 GLU K N   1 
ATOM   6066  C CA  . GLU K  1 59  ? -9.039  -48.499 -55.488 1.00 38.45 ? 1132 GLU K CA  1 
ATOM   6067  C C   . GLU K  1 59  ? -7.652  -49.135 -55.631 1.00 29.49 ? 1132 GLU K C   1 
ATOM   6068  O O   . GLU K  1 59  ? -7.542  -50.336 -55.625 1.00 32.17 ? 1132 GLU K O   1 
ATOM   6069  C CB  . GLU K  1 59  ? -9.492  -47.866 -56.814 1.00 41.70 ? 1132 GLU K CB  1 
ATOM   6070  C CG  . GLU K  1 59  ? -10.270 -48.799 -57.756 1.00 47.68 ? 1132 GLU K CG  1 
ATOM   6071  C CD  . GLU K  1 59  ? -11.019 -48.024 -58.844 1.00 57.72 ? 1132 GLU K CD  1 
ATOM   6072  O OE1 . GLU K  1 59  ? -11.191 -48.567 -59.964 1.00 59.78 ? 1132 GLU K OE1 1 
ATOM   6073  O OE2 . GLU K  1 59  ? -11.429 -46.860 -58.582 1.00 59.67 ? 1132 GLU K OE2 1 
ATOM   6074  N N   . GLN K  1 60  ? -6.594  -48.345 -55.733 1.00 34.72 ? 1133 GLN K N   1 
ATOM   6075  C CA  . GLN K  1 60  ? -5.250  -48.936 -55.821 1.00 36.02 ? 1133 GLN K CA  1 
ATOM   6076  C C   . GLN K  1 60  ? -4.924  -49.823 -54.608 1.00 34.43 ? 1133 GLN K C   1 
ATOM   6077  O O   . GLN K  1 60  ? -4.507  -50.964 -54.758 1.00 32.21 ? 1133 GLN K O   1 
ATOM   6078  C CB  . GLN K  1 60  ? -4.187  -47.845 -55.936 1.00 34.70 ? 1133 GLN K CB  1 
ATOM   6079  C CG  . GLN K  1 60  ? -4.391  -46.879 -57.078 1.00 38.60 ? 1133 GLN K CG  1 
ATOM   6080  C CD  . GLN K  1 60  ? -3.585  -45.608 -56.876 1.00 49.64 ? 1133 GLN K CD  1 
ATOM   6081  O OE1 . GLN K  1 60  ? -3.961  -44.526 -57.352 1.00 53.37 ? 1133 GLN K OE1 1 
ATOM   6082  N NE2 . GLN K  1 60  ? -2.466  -45.729 -56.155 1.00 51.37 ? 1133 GLN K NE2 1 
ATOM   6083  N N   . MET K  1 61  ? -5.134  -49.297 -53.394 1.00 31.82 ? 1134 MET K N   1 
ATOM   6084  C CA  . MET K  1 61  ? -4.840  -50.073 -52.207 1.00 30.67 ? 1134 MET K CA  1 
ATOM   6085  C C   . MET K  1 61  ? -5.636  -51.351 -52.167 1.00 30.87 ? 1134 MET K C   1 
ATOM   6086  O O   . MET K  1 61  ? -5.148  -52.376 -51.675 1.00 30.15 ? 1134 MET K O   1 
ATOM   6087  C CB  . MET K  1 61  ? -5.083  -49.249 -50.914 1.00 27.09 ? 1134 MET K CB  1 
ATOM   6088  C CG  . MET K  1 61  ? -4.202  -48.052 -50.831 1.00 30.89 ? 1134 MET K CG  1 
ATOM   6089  S SD  . MET K  1 61  ? -4.567  -46.940 -49.457 1.00 30.63 ? 1134 MET K SD  1 
ATOM   6090  C CE  . MET K  1 61  ? -4.236  -48.052 -48.090 1.00 26.99 ? 1134 MET K CE  1 
ATOM   6091  N N   . THR K  1 62  ? -6.877  -51.287 -52.647 1.00 29.59 ? 1135 THR K N   1 
ATOM   6092  C CA  . THR K  1 62  ? -7.739  -52.439 -52.538 1.00 28.12 ? 1135 THR K CA  1 
ATOM   6093  C C   . THR K  1 62  ? -7.217  -53.510 -53.478 1.00 30.66 ? 1135 THR K C   1 
ATOM   6094  O O   . THR K  1 62  ? -7.052  -54.657 -53.084 1.00 31.49 ? 1135 THR K O   1 
ATOM   6095  C CB  . THR K  1 62  ? -9.199  -52.117 -52.876 1.00 30.16 ? 1135 THR K CB  1 
ATOM   6096  O OG1 . THR K  1 62  ? -9.736  -51.302 -51.821 1.00 28.19 ? 1135 THR K OG1 1 
ATOM   6097  C CG2 . THR K  1 62  ? -10.005 -53.399 -52.929 1.00 33.71 ? 1135 THR K CG2 1 
ATOM   6098  N N   . GLN K  1 63  ? -6.939  -53.108 -54.713 1.00 34.82 ? 1136 GLN K N   1 
ATOM   6099  C CA  . GLN K  1 63  ? -6.447  -54.087 -55.681 1.00 36.01 ? 1136 GLN K CA  1 
ATOM   6100  C C   . GLN K  1 63  ? -5.034  -54.570 -55.330 1.00 34.63 ? 1136 GLN K C   1 
ATOM   6101  O O   . GLN K  1 63  ? -4.719  -55.708 -55.588 1.00 40.90 ? 1136 GLN K O   1 
ATOM   6102  C CB  . GLN K  1 63  ? -6.602  -53.611 -57.124 1.00 41.02 ? 1136 GLN K CB  1 
ATOM   6103  C CG  . GLN K  1 63  ? -6.001  -52.254 -57.415 1.00 42.00 ? 1136 GLN K CG  1 
ATOM   6104  C CD  . GLN K  1 63  ? -6.492  -51.633 -58.734 1.00 54.73 ? 1136 GLN K CD  1 
ATOM   6105  O OE1 . GLN K  1 63  ? -5.725  -50.951 -59.434 1.00 56.24 ? 1136 GLN K OE1 1 
ATOM   6106  N NE2 . GLN K  1 63  ? -7.774  -51.851 -59.065 1.00 53.01 ? 1136 GLN K NE2 1 
ATOM   6107  N N   . GLU K  1 64  ? -4.209  -53.753 -54.685 1.00 37.17 ? 1137 GLU K N   1 
ATOM   6108  C CA  . GLU K  1 64  ? -2.886  -54.252 -54.301 1.00 37.48 ? 1137 GLU K CA  1 
ATOM   6109  C C   . GLU K  1 64  ? -2.917  -55.182 -53.092 1.00 38.96 ? 1137 GLU K C   1 
ATOM   6110  O O   . GLU K  1 64  ? -2.133  -56.106 -53.012 1.00 42.04 ? 1137 GLU K O   1 
ATOM   6111  C CB  . GLU K  1 64  ? -1.843  -53.143 -54.144 1.00 38.65 ? 1137 GLU K CB  1 
ATOM   6112  C CG  . GLU K  1 64  ? -1.743  -52.468 -52.765 1.00 45.38 ? 1137 GLU K CG  1 
ATOM   6113  C CD  . GLU K  1 64  ? -0.752  -51.285 -52.760 1.00 48.71 ? 1137 GLU K CD  1 
ATOM   6114  O OE1 . GLU K  1 64  ? -0.866  -50.379 -51.886 1.00 50.97 ? 1137 GLU K OE1 1 
ATOM   6115  O OE2 . GLU K  1 64  ? 0.136   -51.258 -53.642 1.00 53.46 ? 1137 GLU K OE2 1 
ATOM   6116  N N   . ALA K  1 65  ? -3.841  -54.957 -52.173 1.00 34.24 ? 1138 ALA K N   1 
ATOM   6117  C CA  . ALA K  1 65  ? -4.004  -55.829 -51.018 1.00 33.72 ? 1138 ALA K CA  1 
ATOM   6118  C C   . ALA K  1 65  ? -4.869  -57.074 -51.255 1.00 31.20 ? 1138 ALA K C   1 
ATOM   6119  O O   . ALA K  1 65  ? -4.800  -58.008 -50.485 1.00 30.42 ? 1138 ALA K O   1 
ATOM   6120  C CB  . ALA K  1 65  ? -4.567  -55.042 -49.833 1.00 32.97 ? 1138 ALA K CB  1 
ATOM   6121  N N   . ARG K  1 66  ? -5.728  -57.058 -52.269 1.00 31.52 ? 1139 ARG K N   1 
ATOM   6122  C CA  . ARG K  1 66  ? -6.620  -58.178 -52.472 1.00 32.76 ? 1139 ARG K CA  1 
ATOM   6123  C C   . ARG K  1 66  ? -7.451  -58.381 -51.211 1.00 30.69 ? 1139 ARG K C   1 
ATOM   6124  O O   . ARG K  1 66  ? -7.731  -59.494 -50.799 1.00 26.93 ? 1139 ARG K O   1 
ATOM   6125  C CB  . ARG K  1 66  ? -5.802  -59.436 -52.801 1.00 37.60 ? 1139 ARG K CB  1 
ATOM   6126  C CG  . ARG K  1 66  ? -5.896  -59.931 -54.260 1.00 43.62 ? 1139 ARG K CG  1 
ATOM   6127  C CD  . ARG K  1 66  ? -5.307  -58.976 -55.272 1.00 41.55 ? 1139 ARG K CD  1 
ATOM   6128  N NE  . ARG K  1 66  ? -3.933  -58.640 -54.933 1.00 49.59 ? 1139 ARG K NE  1 
ATOM   6129  C CZ  . ARG K  1 66  ? -2.869  -59.083 -55.591 1.00 44.51 ? 1139 ARG K CZ  1 
ATOM   6130  N NH1 . ARG K  1 66  ? -1.656  -58.715 -55.197 1.00 52.01 ? 1139 ARG K NH1 1 
ATOM   6131  N NH2 . ARG K  1 66  ? -3.016  -59.896 -56.629 1.00 41.99 ? 1139 ARG K NH2 1 
ATOM   6132  N N   . GLU K  1 67  ? -7.803  -57.287 -50.544 1.00 28.25 ? 1140 GLU K N   1 
ATOM   6133  C CA  . GLU K  1 67  ? -8.681  -57.409 -49.378 1.00 30.34 ? 1140 GLU K CA  1 
ATOM   6134  C C   . GLU K  1 67  ? -9.617  -56.211 -49.291 1.00 24.35 ? 1140 GLU K C   1 
ATOM   6135  O O   . GLU K  1 67  ? -9.303  -55.162 -49.816 1.00 24.84 ? 1140 GLU K O   1 
ATOM   6136  C CB  . GLU K  1 67  ? -7.918  -57.737 -48.064 1.00 36.25 ? 1140 GLU K CB  1 
ATOM   6137  C CG  . GLU K  1 67  ? -7.325  -56.610 -47.284 1.00 37.80 ? 1140 GLU K CG  1 
ATOM   6138  C CD  . GLU K  1 67  ? -6.560  -57.082 -46.010 1.00 37.12 ? 1140 GLU K CD  1 
ATOM   6139  O OE1 . GLU K  1 67  ? -5.450  -56.570 -45.786 1.00 42.98 ? 1140 GLU K OE1 1 
ATOM   6140  O OE2 . GLU K  1 67  ? -7.049  -57.951 -45.241 1.00 36.83 ? 1140 GLU K OE2 1 
ATOM   6141  N N   . HIS K  1 68  ? -10.805 -56.431 -48.731 1.00 22.78 ? 1141 HIS K N   1 
ATOM   6142  C CA  . HIS K  1 68  ? -11.779 -55.361 -48.600 1.00 25.99 ? 1141 HIS K CA  1 
ATOM   6143  C C   . HIS K  1 68  ? -11.247 -54.288 -47.638 1.00 24.41 ? 1141 HIS K C   1 
ATOM   6144  O O   . HIS K  1 68  ? -10.801 -54.597 -46.545 1.00 25.07 ? 1141 HIS K O   1 
ATOM   6145  C CB  . HIS K  1 68  ? -13.089 -55.927 -48.068 1.00 31.29 ? 1141 HIS K CB  1 
ATOM   6146  C CG  . HIS K  1 68  ? -14.179 -54.913 -48.004 1.00 29.27 ? 1141 HIS K CG  1 
ATOM   6147  N ND1 . HIS K  1 68  ? -14.755 -54.378 -49.133 1.00 31.18 ? 1141 HIS K ND1 1 
ATOM   6148  C CD2 . HIS K  1 68  ? -14.751 -54.281 -46.947 1.00 27.40 ? 1141 HIS K CD2 1 
ATOM   6149  C CE1 . HIS K  1 68  ? -15.650 -53.473 -48.776 1.00 36.54 ? 1141 HIS K CE1 1 
ATOM   6150  N NE2 . HIS K  1 68  ? -15.678 -53.408 -47.454 1.00 33.09 ? 1141 HIS K NE2 1 
ATOM   6151  N N   . LEU K  1 69  ? -11.253 -53.042 -48.072 1.00 21.17 ? 1142 LEU K N   1 
ATOM   6152  C CA  . LEU K  1 69  ? -10.793 -51.974 -47.217 1.00 22.08 ? 1142 LEU K CA  1 
ATOM   6153  C C   . LEU K  1 69  ? -11.938 -51.037 -46.938 1.00 21.75 ? 1142 LEU K C   1 
ATOM   6154  O O   . LEU K  1 69  ? -12.695 -50.642 -47.839 1.00 22.74 ? 1142 LEU K O   1 
ATOM   6155  C CB  . LEU K  1 69  ? -9.666  -51.191 -47.870 1.00 22.51 ? 1142 LEU K CB  1 
ATOM   6156  C CG  . LEU K  1 69  ? -8.439  -51.987 -48.320 1.00 25.00 ? 1142 LEU K CG  1 
ATOM   6157  C CD1 . LEU K  1 69  ? -7.416  -51.047 -49.010 1.00 25.68 ? 1142 LEU K CD1 1 
ATOM   6158  C CD2 . LEU K  1 69  ? -7.819  -52.753 -47.116 1.00 24.81 ? 1142 LEU K CD2 1 
ATOM   6159  N N   . TYR K  1 70  ? -12.049 -50.644 -45.674 1.00 21.07 ? 1143 TYR K N   1 
ATOM   6160  C CA  . TYR K  1 70  ? -13.086 -49.705 -45.282 1.00 22.07 ? 1143 TYR K CA  1 
ATOM   6161  C C   . TYR K  1 70  ? -12.475 -48.334 -45.304 1.00 17.18 ? 1143 TYR K C   1 
ATOM   6162  O O   . TYR K  1 70  ? -11.309 -48.158 -44.958 1.00 19.93 ? 1143 TYR K O   1 
ATOM   6163  C CB  . TYR K  1 70  ? -13.497 -49.996 -43.832 1.00 18.63 ? 1143 TYR K CB  1 
ATOM   6164  C CG  . TYR K  1 70  ? -14.269 -51.286 -43.603 1.00 18.68 ? 1143 TYR K CG  1 
ATOM   6165  C CD1 . TYR K  1 70  ? -15.661 -51.290 -43.647 1.00 19.95 ? 1143 TYR K CD1 1 
ATOM   6166  C CD2 . TYR K  1 70  ? -13.610 -52.481 -43.338 1.00 20.86 ? 1143 TYR K CD2 1 
ATOM   6167  C CE1 . TYR K  1 70  ? -16.367 -52.435 -43.426 1.00 22.41 ? 1143 TYR K CE1 1 
ATOM   6168  C CE2 . TYR K  1 70  ? -14.310 -53.622 -43.104 1.00 23.75 ? 1143 TYR K CE2 1 
ATOM   6169  C CZ  . TYR K  1 70  ? -15.692 -53.594 -43.150 1.00 23.24 ? 1143 TYR K CZ  1 
ATOM   6170  O OH  . TYR K  1 70  ? -16.387 -54.739 -42.910 1.00 24.85 ? 1143 TYR K OH  1 
ATOM   6171  N N   . LEU K  1 71  ? -13.268 -47.362 -45.721 1.00 18.89 ? 1144 LEU K N   1 
ATOM   6172  C CA  . LEU K  1 71  ? -12.853 -45.963 -45.705 1.00 17.29 ? 1144 LEU K CA  1 
ATOM   6173  C C   . LEU K  1 71  ? -13.209 -45.409 -44.333 1.00 18.04 ? 1144 LEU K C   1 
ATOM   6174  O O   . LEU K  1 71  ? -14.359 -45.498 -43.894 1.00 18.48 ? 1144 LEU K O   1 
ATOM   6175  C CB  . LEU K  1 71  ? -13.597 -45.207 -46.786 1.00 17.68 ? 1144 LEU K CB  1 
ATOM   6176  C CG  . LEU K  1 71  ? -13.362 -43.717 -46.861 1.00 21.04 ? 1144 LEU K CG  1 
ATOM   6177  C CD1 . LEU K  1 71  ? -11.885 -43.417 -47.203 1.00 22.14 ? 1144 LEU K CD1 1 
ATOM   6178  C CD2 . LEU K  1 71  ? -14.286 -43.124 -47.901 1.00 24.15 ? 1144 LEU K CD2 1 
ATOM   6179  N N   . VAL K  1 72  ? -12.202 -44.868 -43.673 1.00 16.47 ? 1145 VAL K N   1 
ATOM   6180  C CA  . VAL K  1 72  ? -12.466 -44.204 -42.369 1.00 16.92 ? 1145 VAL K CA  1 
ATOM   6181  C C   . VAL K  1 72  ? -12.086 -42.747 -42.390 1.00 17.62 ? 1145 VAL K C   1 
ATOM   6182  O O   . VAL K  1 72  ? -11.132 -42.335 -43.084 1.00 17.67 ? 1145 VAL K O   1 
ATOM   6183  C CB  . VAL K  1 72  ? -11.830 -44.907 -41.189 1.00 18.54 ? 1145 VAL K CB  1 
ATOM   6184  C CG1 . VAL K  1 72  ? -12.181 -46.428 -41.195 1.00 19.75 ? 1145 VAL K CG1 1 
ATOM   6185  C CG2 . VAL K  1 72  ? -10.274 -44.661 -41.179 1.00 16.80 ? 1145 VAL K CG2 1 
ATOM   6186  N N   . LEU K  1 73  ? -12.803 -41.969 -41.565 1.00 17.15 ? 1146 LEU K N   1 
ATOM   6187  C CA  . LEU K  1 73  ? -12.538 -40.551 -41.409 1.00 17.24 ? 1146 LEU K CA  1 
ATOM   6188  C C   . LEU K  1 73  ? -12.188 -40.356 -39.928 1.00 16.96 ? 1146 LEU K C   1 
ATOM   6189  O O   . LEU K  1 73  ? -13.023 -40.599 -39.078 1.00 16.68 ? 1146 LEU K O   1 
ATOM   6190  C CB  . LEU K  1 73  ? -13.803 -39.764 -41.763 1.00 18.02 ? 1146 LEU K CB  1 
ATOM   6191  C CG  . LEU K  1 73  ? -13.704 -38.244 -41.557 1.00 17.93 ? 1146 LEU K CG  1 
ATOM   6192  C CD1 . LEU K  1 73  ? -12.653 -37.638 -42.464 1.00 23.26 ? 1146 LEU K CD1 1 
ATOM   6193  C CD2 . LEU K  1 73  ? -15.095 -37.647 -41.808 1.00 22.32 ? 1146 LEU K CD2 1 
ATOM   6194  N N   . PHE K  1 74  ? -10.945 -40.000 -39.623 1.00 14.67 ? 1147 PHE K N   1 
ATOM   6195  C CA  . PHE K  1 74  ? -10.552 -39.798 -38.225 1.00 15.16 ? 1147 PHE K CA  1 
ATOM   6196  C C   . PHE K  1 74  ? -11.203 -38.576 -37.562 1.00 17.28 ? 1147 PHE K C   1 
ATOM   6197  O O   . PHE K  1 74  ? -11.515 -37.615 -38.217 1.00 18.35 ? 1147 PHE K O   1 
ATOM   6198  C CB  . PHE K  1 74  ? -9.025  -39.647 -38.206 1.00 16.65 ? 1147 PHE K CB  1 
ATOM   6199  C CG  . PHE K  1 74  ? -8.307  -40.945 -38.534 1.00 15.47 ? 1147 PHE K CG  1 
ATOM   6200  C CD1 . PHE K  1 74  ? -8.361  -42.022 -37.641 1.00 17.35 ? 1147 PHE K CD1 1 
ATOM   6201  C CD2 . PHE K  1 74  ? -7.621  -41.106 -39.727 1.00 19.15 ? 1147 PHE K CD2 1 
ATOM   6202  C CE1 . PHE K  1 74  ? -7.745  -43.228 -37.924 1.00 19.78 ? 1147 PHE K CE1 1 
ATOM   6203  C CE2 . PHE K  1 74  ? -7.025  -42.363 -40.029 1.00 19.83 ? 1147 PHE K CE2 1 
ATOM   6204  C CZ  . PHE K  1 74  ? -7.058  -43.390 -39.106 1.00 22.16 ? 1147 PHE K CZ  1 
ATOM   6205  N N   . PHE K  1 75  ? -11.396 -38.617 -36.251 1.00 16.74 ? 1148 PHE K N   1 
ATOM   6206  C CA  . PHE K  1 75  ? -11.849 -37.444 -35.493 1.00 15.56 ? 1148 PHE K CA  1 
ATOM   6207  C C   . PHE K  1 75  ? -10.649 -36.601 -35.035 1.00 18.55 ? 1148 PHE K C   1 
ATOM   6208  O O   . PHE K  1 75  ? -10.658 -36.052 -33.942 1.00 20.74 ? 1148 PHE K O   1 
ATOM   6209  C CB  . PHE K  1 75  ? -12.647 -37.945 -34.278 1.00 15.31 ? 1148 PHE K CB  1 
ATOM   6210  C CG  . PHE K  1 75  ? -14.043 -38.406 -34.617 1.00 14.71 ? 1148 PHE K CG  1 
ATOM   6211  C CD1 . PHE K  1 75  ? -15.039 -37.495 -34.769 1.00 18.32 ? 1148 PHE K CD1 1 
ATOM   6212  C CD2 . PHE K  1 75  ? -14.318 -39.752 -34.801 1.00 13.69 ? 1148 PHE K CD2 1 
ATOM   6213  C CE1 . PHE K  1 75  ? -16.347 -37.931 -35.096 1.00 16.04 ? 1148 PHE K CE1 1 
ATOM   6214  C CE2 . PHE K  1 75  ? -15.600 -40.205 -35.148 1.00 17.03 ? 1148 PHE K CE2 1 
ATOM   6215  C CZ  . PHE K  1 75  ? -16.613 -39.315 -35.312 1.00 17.49 ? 1148 PHE K CZ  1 
ATOM   6216  N N   . ASP K  1 76  ? -9.648  -36.447 -35.883 1.00 17.16 ? 1149 ASP K N   1 
ATOM   6217  C CA  . ASP K  1 76  ? -8.516  -35.594 -35.568 1.00 19.64 ? 1149 ASP K CA  1 
ATOM   6218  C C   . ASP K  1 76  ? -8.838  -34.184 -36.014 1.00 22.02 ? 1149 ASP K C   1 
ATOM   6219  O O   . ASP K  1 76  ? -9.845  -33.957 -36.676 1.00 20.98 ? 1149 ASP K O   1 
ATOM   6220  C CB  . ASP K  1 76  ? -7.214  -36.148 -36.193 1.00 21.35 ? 1149 ASP K CB  1 
ATOM   6221  C CG  . ASP K  1 76  ? -7.316  -36.400 -37.702 1.00 24.61 ? 1149 ASP K CG  1 
ATOM   6222  O OD1 . ASP K  1 76  ? -8.420  -36.459 -38.257 1.00 22.09 ? 1149 ASP K OD1 1 
ATOM   6223  O OD2 . ASP K  1 76  ? -6.252  -36.555 -38.369 1.00 24.96 ? 1149 ASP K OD2 1 
ATOM   6224  N N   . ASN K  1 77  ? -7.995  -33.239 -35.625 1.00 23.95 ? 1150 ASN K N   1 
ATOM   6225  C CA  . ASN K  1 77  ? -8.268  -31.863 -35.977 1.00 24.50 ? 1150 ASN K CA  1 
ATOM   6226  C C   . ASN K  1 77  ? -8.405  -31.671 -37.466 1.00 27.47 ? 1150 ASN K C   1 
ATOM   6227  O O   . ASN K  1 77  ? -9.325  -30.968 -37.930 1.00 30.19 ? 1150 ASN K O   1 
ATOM   6228  C CB  . ASN K  1 77  ? -7.144  -30.964 -35.476 1.00 30.32 ? 1150 ASN K CB  1 
ATOM   6229  C CG  . ASN K  1 77  ? -7.135  -30.823 -33.961 1.00 35.06 ? 1150 ASN K CG  1 
ATOM   6230  O OD1 . ASN K  1 77  ? -8.119  -31.152 -33.270 1.00 34.40 ? 1150 ASN K OD1 1 
ATOM   6231  N ND2 . ASN K  1 77  ? -6.012  -30.348 -33.429 1.00 33.12 ? 1150 ASN K ND2 1 
ATOM   6232  N N   . LYS K  1 78  ? -7.510  -32.300 -38.231 1.00 26.82 ? 1151 LYS K N   1 
ATOM   6233  C CA  . LYS K  1 78  ? -7.524  -32.149 -39.692 1.00 30.84 ? 1151 LYS K CA  1 
ATOM   6234  C C   . LYS K  1 78  ? -8.580  -32.984 -40.433 1.00 32.83 ? 1151 LYS K C   1 
ATOM   6235  O O   . LYS K  1 78  ? -8.874  -32.732 -41.594 1.00 32.38 ? 1151 LYS K O   1 
ATOM   6236  C CB  . LYS K  1 78  ? -6.138  -32.451 -40.248 1.00 36.21 ? 1151 LYS K CB  1 
ATOM   6237  C CG  . LYS K  1 78  ? -5.137  -31.349 -39.965 1.00 44.22 ? 1151 LYS K CG  1 
ATOM   6238  C CD  . LYS K  1 78  ? -3.803  -31.936 -39.536 1.00 47.12 ? 1151 LYS K CD  1 
ATOM   6239  C CE  . LYS K  1 78  ? -2.818  -32.039 -40.687 1.00 54.75 ? 1151 LYS K CE  1 
ATOM   6240  N NZ  . LYS K  1 78  ? -1.494  -32.611 -40.240 1.00 55.85 ? 1151 LYS K NZ  1 
ATOM   6241  N N   . ARG K  1 79  ? -9.165  -33.956 -39.746 1.00 26.20 ? 1152 ARG K N   1 
ATOM   6242  C CA  . ARG K  1 79  ? -10.181 -34.819 -40.312 1.00 22.27 ? 1152 ARG K CA  1 
ATOM   6243  C C   . ARG K  1 79  ? -9.567  -35.555 -41.519 1.00 25.42 ? 1152 ARG K C   1 
ATOM   6244  O O   . ARG K  1 79  ? -9.967  -35.356 -42.652 1.00 26.44 ? 1152 ARG K O   1 
ATOM   6245  C CB  . ARG K  1 79  ? -11.467 -34.045 -40.671 1.00 26.25 ? 1152 ARG K CB  1 
ATOM   6246  C CG  . ARG K  1 79  ? -12.311 -33.518 -39.456 1.00 30.73 ? 1152 ARG K CG  1 
ATOM   6247  C CD  . ARG K  1 79  ? -12.598 -34.583 -38.302 1.00 27.48 ? 1152 ARG K CD  1 
ATOM   6248  N NE  . ARG K  1 79  ? -13.736 -35.501 -38.515 1.00 26.95 ? 1152 ARG K NE  1 
ATOM   6249  C CZ  . ARG K  1 79  ? -15.027 -35.148 -38.517 1.00 31.57 ? 1152 ARG K CZ  1 
ATOM   6250  N NH1 . ARG K  1 79  ? -15.354 -33.865 -38.430 1.00 35.23 ? 1152 ARG K NH1 1 
ATOM   6251  N NH2 . ARG K  1 79  ? -15.987 -36.065 -38.655 1.00 27.95 ? 1152 ARG K NH2 1 
ATOM   6252  N N   . THR K  1 80  ? -8.577  -36.404 -41.245 1.00 22.02 ? 1153 THR K N   1 
ATOM   6253  C CA  . THR K  1 80  ? -7.935  -37.156 -42.311 1.00 20.65 ? 1153 THR K CA  1 
ATOM   6254  C C   . THR K  1 80  ? -8.574  -38.530 -42.603 1.00 23.73 ? 1153 THR K C   1 
ATOM   6255  O O   . THR K  1 80  ? -9.369  -39.048 -41.817 1.00 18.87 ? 1153 THR K O   1 
ATOM   6256  C CB  . THR K  1 80  ? -6.457  -37.361 -41.985 1.00 23.81 ? 1153 THR K CB  1 
ATOM   6257  O OG1 . THR K  1 80  ? -6.366  -38.006 -40.713 1.00 23.08 ? 1153 THR K OG1 1 
ATOM   6258  C CG2 . THR K  1 80  ? -5.762  -35.999 -41.944 1.00 27.90 ? 1153 THR K CG2 1 
ATOM   6259  N N   . TRP K  1 81  ? -8.206  -39.130 -43.739 1.00 19.85 ? 1154 TRP K N   1 
ATOM   6260  C CA  . TRP K  1 81  ? -8.864  -40.363 -44.173 1.00 22.78 ? 1154 TRP K CA  1 
ATOM   6261  C C   . TRP K  1 81  ? -7.893  -41.514 -44.185 1.00 26.08 ? 1154 TRP K C   1 
ATOM   6262  O O   . TRP K  1 81  ? -6.666  -41.326 -44.270 1.00 23.83 ? 1154 TRP K O   1 
ATOM   6263  C CB  . TRP K  1 81  ? -9.386  -40.237 -45.603 1.00 26.62 ? 1154 TRP K CB  1 
ATOM   6264  C CG  . TRP K  1 81  ? -10.313 -39.103 -45.839 1.00 22.51 ? 1154 TRP K CG  1 
ATOM   6265  C CD1 . TRP K  1 81  ? -9.975  -37.801 -46.140 1.00 25.05 ? 1154 TRP K CD1 1 
ATOM   6266  C CD2 . TRP K  1 81  ? -11.757 -39.144 -45.799 1.00 18.61 ? 1154 TRP K CD2 1 
ATOM   6267  N NE1 . TRP K  1 81  ? -11.112 -37.052 -46.306 1.00 26.44 ? 1154 TRP K NE1 1 
ATOM   6268  C CE2 . TRP K  1 81  ? -12.214 -37.851 -46.141 1.00 19.89 ? 1154 TRP K CE2 1 
ATOM   6269  C CE3 . TRP K  1 81  ? -12.689 -40.166 -45.583 1.00 20.43 ? 1154 TRP K CE3 1 
ATOM   6270  C CZ2 . TRP K  1 81  ? -13.578 -37.520 -46.200 1.00 22.25 ? 1154 TRP K CZ2 1 
ATOM   6271  C CZ3 . TRP K  1 81  ? -14.028 -39.867 -45.674 1.00 17.98 ? 1154 TRP K CZ3 1 
ATOM   6272  C CH2 . TRP K  1 81  ? -14.469 -38.530 -45.939 1.00 21.83 ? 1154 TRP K CH2 1 
ATOM   6273  N N   . GLN K  1 82  ? -8.456  -42.713 -44.141 1.00 19.74 ? 1155 GLN K N   1 
ATOM   6274  C CA  . GLN K  1 82  ? -7.647  -43.909 -44.400 1.00 21.20 ? 1155 GLN K CA  1 
ATOM   6275  C C   . GLN K  1 82  ? -8.521  -45.019 -44.925 1.00 20.32 ? 1155 GLN K C   1 
ATOM   6276  O O   . GLN K  1 82  ? -9.758  -44.953 -44.844 1.00 21.24 ? 1155 GLN K O   1 
ATOM   6277  C CB  . GLN K  1 82  ? -6.915  -44.343 -43.133 1.00 28.04 ? 1155 GLN K CB  1 
ATOM   6278  C CG  . GLN K  1 82  ? -5.462  -43.931 -43.132 1.00 25.59 ? 1155 GLN K CG  1 
ATOM   6279  C CD  . GLN K  1 82  ? -4.620  -44.775 -44.075 1.00 30.94 ? 1155 GLN K CD  1 
ATOM   6280  O OE1 . GLN K  1 82  ? -5.093  -45.774 -44.660 1.00 28.54 ? 1155 GLN K OE1 1 
ATOM   6281  N NE2 . GLN K  1 82  ? -3.345  -44.403 -44.202 1.00 27.85 ? 1155 GLN K NE2 1 
ATOM   6282  N N   . TRP K  1 83  ? -7.858  -45.993 -45.552 1.00 23.09 ? 1156 TRP K N   1 
ATOM   6283  C CA  . TRP K  1 83  ? -8.454  -47.206 -46.062 1.00 19.77 ? 1156 TRP K CA  1 
ATOM   6284  C C   . TRP K  1 83  ? -7.831  -48.394 -45.297 1.00 21.95 ? 1156 TRP K C   1 
ATOM   6285  O O   . TRP K  1 83  ? -6.607  -48.561 -45.315 1.00 23.77 ? 1156 TRP K O   1 
ATOM   6286  C CB  . TRP K  1 83  ? -8.113  -47.338 -47.565 1.00 22.42 ? 1156 TRP K CB  1 
ATOM   6287  C CG  . TRP K  1 83  ? -8.807  -46.367 -48.464 1.00 23.04 ? 1156 TRP K CG  1 
ATOM   6288  C CD1 . TRP K  1 83  ? -8.326  -45.173 -48.945 1.00 23.78 ? 1156 TRP K CD1 1 
ATOM   6289  C CD2 . TRP K  1 83  ? -10.135 -46.485 -48.965 1.00 18.79 ? 1156 TRP K CD2 1 
ATOM   6290  N NE1 . TRP K  1 83  ? -9.265  -44.566 -49.741 1.00 24.23 ? 1156 TRP K NE1 1 
ATOM   6291  C CE2 . TRP K  1 83  ? -10.387 -45.344 -49.769 1.00 24.94 ? 1156 TRP K CE2 1 
ATOM   6292  C CE3 . TRP K  1 83  ? -11.134 -47.473 -48.841 1.00 25.21 ? 1156 TRP K CE3 1 
ATOM   6293  C CZ2 . TRP K  1 83  ? -11.614 -45.153 -50.453 1.00 24.63 ? 1156 TRP K CZ2 1 
ATOM   6294  C CZ3 . TRP K  1 83  ? -12.339 -47.293 -49.516 1.00 24.07 ? 1156 TRP K CZ3 1 
ATOM   6295  C CH2 . TRP K  1 83  ? -12.573 -46.136 -50.314 1.00 26.86 ? 1156 TRP K CH2 1 
ATOM   6296  N N   . LEU K  1 84  ? -8.647  -49.180 -44.590 1.00 18.12 ? 1157 LEU K N   1 
ATOM   6297  C CA  . LEU K  1 84  ? -8.148  -50.210 -43.696 1.00 19.04 ? 1157 LEU K CA  1 
ATOM   6298  C C   . LEU K  1 84  ? -8.991  -51.451 -43.721 1.00 20.95 ? 1157 LEU K C   1 
ATOM   6299  O O   . LEU K  1 84  ? -10.224 -51.387 -43.847 1.00 21.77 ? 1157 LEU K O   1 
ATOM   6300  C CB  . LEU K  1 84  ? -8.140  -49.669 -42.226 1.00 18.74 ? 1157 LEU K CB  1 
ATOM   6301  C CG  . LEU K  1 84  ? -7.325  -48.426 -41.905 1.00 19.03 ? 1157 LEU K CG  1 
ATOM   6302  C CD1 . LEU K  1 84  ? -7.538  -47.961 -40.449 1.00 18.89 ? 1157 LEU K CD1 1 
ATOM   6303  C CD2 . LEU K  1 84  ? -5.833  -48.606 -42.134 1.00 23.99 ? 1157 LEU K CD2 1 
ATOM   6304  N N   . PRO K  1 85  ? -8.344  -52.626 -43.566 1.00 20.66 ? 1158 PRO K N   1 
ATOM   6305  C CA  . PRO K  1 85  ? -9.090  -53.884 -43.560 1.00 25.16 ? 1158 PRO K CA  1 
ATOM   6306  C C   . PRO K  1 85  ? -9.724  -54.103 -42.195 1.00 22.04 ? 1158 PRO K C   1 
ATOM   6307  O O   . PRO K  1 85  ? -9.357  -53.450 -41.192 1.00 22.27 ? 1158 PRO K O   1 
ATOM   6308  C CB  . PRO K  1 85  ? -8.008  -54.943 -43.802 1.00 28.22 ? 1158 PRO K CB  1 
ATOM   6309  C CG  . PRO K  1 85  ? -6.723  -54.302 -43.343 1.00 26.57 ? 1158 PRO K CG  1 
ATOM   6310  C CD  . PRO K  1 85  ? -6.891  -52.792 -43.414 1.00 21.38 ? 1158 PRO K CD  1 
ATOM   6311  N N   . ARG K  1 86  ? -10.680 -55.012 -42.160 1.00 23.69 ? 1159 ARG K N   1 
ATOM   6312  C CA  . ARG K  1 86  ? -11.398 -55.363 -40.970 1.00 26.04 ? 1159 ARG K CA  1 
ATOM   6313  C C   . ARG K  1 86  ? -10.479 -55.618 -39.811 1.00 24.79 ? 1159 ARG K C   1 
ATOM   6314  O O   . ARG K  1 86  ? -10.805 -55.291 -38.688 1.00 23.95 ? 1159 ARG K O   1 
ATOM   6315  C CB  . ARG K  1 86  ? -12.239 -56.616 -41.226 1.00 24.79 ? 1159 ARG K CB  1 
ATOM   6316  C CG  . ARG K  1 86  ? -13.055 -57.042 -40.011 1.00 26.51 ? 1159 ARG K CG  1 
ATOM   6317  C CD  . ARG K  1 86  ? -14.131 -56.038 -39.726 1.00 29.06 ? 1159 ARG K CD  1 
ATOM   6318  N NE  . ARG K  1 86  ? -14.908 -56.351 -38.535 1.00 28.09 ? 1159 ARG K NE  1 
ATOM   6319  C CZ  . ARG K  1 86  ? -14.503 -56.149 -37.290 1.00 29.26 ? 1159 ARG K CZ  1 
ATOM   6320  N NH1 . ARG K  1 86  ? -15.308 -56.467 -36.266 1.00 30.89 ? 1159 ARG K NH1 1 
ATOM   6321  N NH2 . ARG K  1 86  ? -13.281 -55.648 -37.068 1.00 25.26 ? 1159 ARG K NH2 1 
ATOM   6322  N N   . THR K  1 87  ? -9.311  -56.193 -40.070 1.00 24.15 ? 1160 THR K N   1 
ATOM   6323  C CA  . THR K  1 87  ? -8.427  -56.559 -38.978 1.00 25.81 ? 1160 THR K CA  1 
ATOM   6324  C C   . THR K  1 87  ? -7.806  -55.346 -38.235 1.00 25.94 ? 1160 THR K C   1 
ATOM   6325  O O   . THR K  1 87  ? -7.232  -55.513 -37.141 1.00 26.77 ? 1160 THR K O   1 
ATOM   6326  C CB  . THR K  1 87  ? -7.296  -57.431 -39.506 1.00 27.38 ? 1160 THR K CB  1 
ATOM   6327  O OG1 . THR K  1 87  ? -6.752  -56.805 -40.670 1.00 29.32 ? 1160 THR K OG1 1 
ATOM   6328  C CG2 . THR K  1 87  ? -7.854  -58.826 -39.895 1.00 32.48 ? 1160 THR K CG2 1 
ATOM   6329  N N   . LYS K  1 88  ? -7.941  -54.153 -38.818 1.00 21.00 ? 1161 LYS K N   1 
ATOM   6330  C CA  . LYS K  1 88  ? -7.331  -52.962 -38.253 1.00 21.74 ? 1161 LYS K CA  1 
ATOM   6331  C C   . LYS K  1 88  ? -8.391  -52.078 -37.605 1.00 21.02 ? 1161 LYS K C   1 
ATOM   6332  O O   . LYS K  1 88  ? -8.102  -50.975 -37.205 1.00 19.53 ? 1161 LYS K O   1 
ATOM   6333  C CB  . LYS K  1 88  ? -6.549  -52.207 -39.321 1.00 24.44 ? 1161 LYS K CB  1 
ATOM   6334  C CG  . LYS K  1 88  ? -5.295  -53.006 -39.821 1.00 25.57 ? 1161 LYS K CG  1 
ATOM   6335  C CD  . LYS K  1 88  ? -4.197  -53.013 -38.787 1.00 26.34 ? 1161 LYS K CD  1 
ATOM   6336  C CE  . LYS K  1 88  ? -3.005  -53.859 -39.293 1.00 34.53 ? 1161 LYS K CE  1 
ATOM   6337  N NZ  . LYS K  1 88  ? -2.220  -54.348 -38.143 1.00 43.82 ? 1161 LYS K NZ  1 
ATOM   6338  N N   . LEU K  1 89  ? -9.606  -52.601 -37.457 1.00 20.50 ? 1162 LEU K N   1 
ATOM   6339  C CA  . LEU K  1 89  ? -10.690 -51.809 -36.894 1.00 18.66 ? 1162 LEU K CA  1 
ATOM   6340  C C   . LEU K  1 89  ? -11.325 -52.574 -35.780 1.00 20.93 ? 1162 LEU K C   1 
ATOM   6341  O O   . LEU K  1 89  ? -11.455 -53.800 -35.861 1.00 21.28 ? 1162 LEU K O   1 
ATOM   6342  C CB  . LEU K  1 89  ? -11.764 -51.558 -37.968 1.00 15.91 ? 1162 LEU K CB  1 
ATOM   6343  C CG  . LEU K  1 89  ? -11.249 -50.987 -39.285 1.00 20.58 ? 1162 LEU K CG  1 
ATOM   6344  C CD1 . LEU K  1 89  ? -12.436 -51.003 -40.297 1.00 25.44 ? 1162 LEU K CD1 1 
ATOM   6345  C CD2 . LEU K  1 89  ? -10.682 -49.585 -39.136 1.00 18.89 ? 1162 LEU K CD2 1 
ATOM   6346  N N   . VAL K  1 90  ? -11.728 -51.862 -34.729 1.00 17.11 ? 1163 VAL K N   1 
ATOM   6347  C CA  . VAL K  1 90  ? -12.468 -52.466 -33.616 1.00 20.92 ? 1163 VAL K CA  1 
ATOM   6348  C C   . VAL K  1 90  ? -13.599 -51.485 -33.279 1.00 20.51 ? 1163 VAL K C   1 
ATOM   6349  O O   . VAL K  1 90  ? -13.369 -50.277 -33.193 1.00 18.09 ? 1163 VAL K O   1 
ATOM   6350  C CB  . VAL K  1 90  ? -11.570 -52.628 -32.373 1.00 25.46 ? 1163 VAL K CB  1 
ATOM   6351  C CG1 . VAL K  1 90  ? -12.329 -53.322 -31.269 1.00 26.16 ? 1163 VAL K CG1 1 
ATOM   6352  C CG2 . VAL K  1 90  ? -10.295 -53.405 -32.721 1.00 29.20 ? 1163 VAL K CG2 1 
ATOM   6353  N N   . PRO K  1 91  ? -14.815 -51.989 -33.062 1.00 19.55 ? 1164 PRO K N   1 
ATOM   6354  C CA  . PRO K  1 91  ? -15.873 -51.057 -32.671 1.00 15.79 ? 1164 PRO K CA  1 
ATOM   6355  C C   . PRO K  1 91  ? -15.555 -50.235 -31.436 1.00 17.72 ? 1164 PRO K C   1 
ATOM   6356  O O   . PRO K  1 91  ? -15.036 -50.737 -30.456 1.00 21.98 ? 1164 PRO K O   1 
ATOM   6357  C CB  . PRO K  1 91  ? -17.086 -51.981 -32.405 1.00 23.51 ? 1164 PRO K CB  1 
ATOM   6358  C CG  . PRO K  1 91  ? -16.836 -53.132 -33.435 1.00 23.97 ? 1164 PRO K CG  1 
ATOM   6359  C CD  . PRO K  1 91  ? -15.327 -53.333 -33.374 1.00 25.83 ? 1164 PRO K CD  1 
ATOM   6360  N N   . LEU K  1 92  ? -15.940 -48.975 -31.494 1.00 15.67 ? 1165 LEU K N   1 
ATOM   6361  C CA  . LEU K  1 92  ? -15.652 -47.989 -30.467 1.00 15.46 ? 1165 LEU K CA  1 
ATOM   6362  C C   . LEU K  1 92  ? -16.924 -47.639 -29.694 1.00 18.33 ? 1165 LEU K C   1 
ATOM   6363  O O   . LEU K  1 92  ? -18.040 -47.574 -30.281 1.00 20.41 ? 1165 LEU K O   1 
ATOM   6364  C CB  . LEU K  1 92  ? -15.046 -46.719 -31.122 1.00 13.50 ? 1165 LEU K CB  1 
ATOM   6365  C CG  . LEU K  1 92  ? -14.696 -45.527 -30.206 1.00 14.66 ? 1165 LEU K CG  1 
ATOM   6366  C CD1 . LEU K  1 92  ? -13.508 -44.749 -30.835 1.00 14.51 ? 1165 LEU K CD1 1 
ATOM   6367  C CD2 . LEU K  1 92  ? -15.838 -44.568 -30.032 1.00 15.94 ? 1165 LEU K CD2 1 
ATOM   6368  N N   . GLY K  1 93  ? -16.773 -47.444 -28.382 1.00 17.43 ? 1166 GLY K N   1 
ATOM   6369  C CA  . GLY K  1 93  ? -17.866 -47.007 -27.554 1.00 21.50 ? 1166 GLY K CA  1 
ATOM   6370  C C   . GLY K  1 93  ? -18.791 -48.134 -27.162 1.00 21.13 ? 1166 GLY K C   1 
ATOM   6371  O O   . GLY K  1 93  ? -19.902 -47.848 -26.704 1.00 27.36 ? 1166 GLY K O   1 
ATOM   6372  N N   . VAL K  1 94  ? -18.337 -49.374 -27.318 1.00 20.80 ? 1167 VAL K N   1 
ATOM   6373  C CA  . VAL K  1 94  ? -19.169 -50.549 -27.043 1.00 23.55 ? 1167 VAL K CA  1 
ATOM   6374  C C   . VAL K  1 94  ? -18.696 -51.297 -25.820 1.00 27.72 ? 1167 VAL K C   1 
ATOM   6375  O O   . VAL K  1 94  ? -19.479 -51.908 -25.134 1.00 29.31 ? 1167 VAL K O   1 
ATOM   6376  C CB  . VAL K  1 94  ? -19.173 -51.547 -28.238 1.00 25.58 ? 1167 VAL K CB  1 
ATOM   6377  C CG1 . VAL K  1 94  ? -19.883 -52.805 -27.890 1.00 36.60 ? 1167 VAL K CG1 1 
ATOM   6378  C CG2 . VAL K  1 94  ? -19.845 -50.916 -29.445 1.00 29.89 ? 1167 VAL K CG2 1 
ATOM   6379  N N   . ASN K  1 95  ? -17.400 -51.249 -25.547 1.00 24.27 ? 1168 ASN K N   1 
ATOM   6380  C CA  . ASN K  1 95  ? -16.824 -52.032 -24.464 1.00 24.38 ? 1168 ASN K CA  1 
ATOM   6381  C C   . ASN K  1 95  ? -15.918 -51.047 -23.724 1.00 23.56 ? 1168 ASN K C   1 
ATOM   6382  O O   . ASN K  1 95  ? -14.931 -50.601 -24.321 1.00 21.26 ? 1168 ASN K O   1 
ATOM   6383  C CB  . ASN K  1 95  ? -16.011 -53.161 -25.076 1.00 25.39 ? 1168 ASN K CB  1 
ATOM   6384  C CG  . ASN K  1 95  ? -15.317 -54.036 -24.051 1.00 26.62 ? 1168 ASN K CG  1 
ATOM   6385  O OD1 . ASN K  1 95  ? -14.843 -53.576 -23.013 1.00 24.11 ? 1168 ASN K OD1 1 
ATOM   6386  N ND2 . ASN K  1 95  ? -15.198 -55.314 -24.378 1.00 36.05 ? 1168 ASN K ND2 1 
ATOM   6387  N N   . GLN K  1 96  ? -16.260 -50.692 -22.490 1.00 21.53 ? 1169 GLN K N   1 
ATOM   6388  C CA  . GLN K  1 96  ? -15.572 -49.572 -21.802 1.00 21.17 ? 1169 GLN K CA  1 
ATOM   6389  C C   . GLN K  1 96  ? -14.106 -49.944 -21.525 1.00 20.17 ? 1169 GLN K C   1 
ATOM   6390  O O   . GLN K  1 96  ? -13.243 -49.081 -21.614 1.00 21.93 ? 1169 GLN K O   1 
ATOM   6391  C CB  A GLN K  1 96  ? -16.278 -49.143 -20.499 0.62 27.02 ? 1169 GLN K CB  1 
ATOM   6392  C CB  B GLN K  1 96  ? -16.305 -49.125 -20.536 0.38 27.05 ? 1169 GLN K CB  1 
ATOM   6393  C CG  A GLN K  1 96  ? -16.034 -50.105 -19.297 0.62 31.26 ? 1169 GLN K CG  1 
ATOM   6394  C CG  B GLN K  1 96  ? -17.741 -48.674 -20.785 0.38 30.07 ? 1169 GLN K CG  1 
ATOM   6395  C CD  A GLN K  1 96  ? -16.770 -49.736 -17.988 0.62 37.03 ? 1169 GLN K CD  1 
ATOM   6396  C CD  B GLN K  1 96  ? -18.617 -48.729 -19.536 0.38 34.31 ? 1169 GLN K CD  1 
ATOM   6397  O OE1 A GLN K  1 96  ? -16.146 -49.344 -16.994 0.62 39.08 ? 1169 GLN K OE1 1 
ATOM   6398  O OE1 B GLN K  1 96  ? -19.851 -48.802 -19.627 0.38 34.07 ? 1169 GLN K OE1 1 
ATOM   6399  N NE2 A GLN K  1 96  ? -18.089 -49.907 -17.979 0.62 38.87 ? 1169 GLN K NE2 1 
ATOM   6400  N NE2 B GLN K  1 96  ? -17.986 -48.696 -18.365 0.38 38.71 ? 1169 GLN K NE2 1 
ATOM   6401  N N   . ASP K  1 97  ? -13.835 -51.221 -21.210 1.00 18.79 ? 1170 ASP K N   1 
ATOM   6402  C CA  . ASP K  1 97  ? -12.444 -51.594 -20.937 1.00 21.52 ? 1170 ASP K CA  1 
ATOM   6403  C C   . ASP K  1 97  ? -11.611 -51.618 -22.182 1.00 19.06 ? 1170 ASP K C   1 
ATOM   6404  O O   . ASP K  1 97  ? -10.433 -51.268 -22.131 1.00 19.39 ? 1170 ASP K O   1 
ATOM   6405  C CB  . ASP K  1 97  ? -12.384 -52.927 -20.174 1.00 19.44 ? 1170 ASP K CB  1 
ATOM   6406  C CG  . ASP K  1 97  ? -13.031 -52.771 -18.811 1.00 26.22 ? 1170 ASP K CG  1 
ATOM   6407  O OD1 . ASP K  1 97  ? -14.073 -53.410 -18.590 1.00 33.75 ? 1170 ASP K OD1 1 
ATOM   6408  O OD2 . ASP K  1 97  ? -12.565 -51.882 -18.042 1.00 27.22 ? 1170 ASP K OD2 1 
ATOM   6409  N N   . LEU K  1 98  ? -12.205 -52.021 -23.305 1.00 18.38 ? 1171 LEU K N   1 
ATOM   6410  C CA  . LEU K  1 98  ? -11.498 -51.905 -24.562 1.00 20.22 ? 1171 LEU K CA  1 
ATOM   6411  C C   . LEU K  1 98  ? -11.169 -50.451 -24.871 1.00 18.78 ? 1171 LEU K C   1 
ATOM   6412  O O   . LEU K  1 98  ? -10.032 -50.119 -25.261 1.00 18.08 ? 1171 LEU K O   1 
ATOM   6413  C CB  . LEU K  1 98  ? -12.320 -52.537 -25.686 1.00 19.39 ? 1171 LEU K CB  1 
ATOM   6414  C CG  . LEU K  1 98  ? -11.588 -52.630 -27.033 1.00 19.41 ? 1171 LEU K CG  1 
ATOM   6415  C CD1 . LEU K  1 98  ? -12.041 -53.864 -27.753 1.00 29.07 ? 1171 LEU K CD1 1 
ATOM   6416  C CD2 . LEU K  1 98  ? -11.820 -51.327 -27.891 1.00 17.45 ? 1171 LEU K CD2 1 
ATOM   6417  N N   . ASP K  1 99  ? -12.165 -49.593 -24.781 1.00 17.39 ? 1172 ASP K N   1 
ATOM   6418  C CA  . ASP K  1 99  ? -11.961 -48.175 -25.053 1.00 15.10 ? 1172 ASP K CA  1 
ATOM   6419  C C   . ASP K  1 99  ? -10.824 -47.589 -24.183 1.00 20.19 ? 1172 ASP K C   1 
ATOM   6420  O O   . ASP K  1 99  ? -9.963  -46.849 -24.671 1.00 20.38 ? 1172 ASP K O   1 
ATOM   6421  C CB  . ASP K  1 99  ? -13.214 -47.325 -24.856 1.00 15.96 ? 1172 ASP K CB  1 
ATOM   6422  C CG  . ASP K  1 99  ? -14.269 -47.592 -25.887 1.00 16.57 ? 1172 ASP K CG  1 
ATOM   6423  O OD1 . ASP K  1 99  ? -15.403 -47.164 -25.622 1.00 22.39 ? 1172 ASP K OD1 1 
ATOM   6424  O OD2 . ASP K  1 99  ? -14.009 -48.289 -26.895 1.00 20.42 ? 1172 ASP K OD2 1 
ATOM   6425  N N   . LYS K  1 100 ? -10.812 -47.951 -22.907 1.00 18.00 ? 1173 LYS K N   1 
ATOM   6426  C CA  . LYS K  1 100 ? -9.821  -47.409 -21.996 1.00 20.52 ? 1173 LYS K CA  1 
ATOM   6427  C C   . LYS K  1 100 ? -8.451  -47.998 -22.291 1.00 20.00 ? 1173 LYS K C   1 
ATOM   6428  O O   . LYS K  1 100 ? -7.445  -47.322 -22.109 1.00 22.33 ? 1173 LYS K O   1 
ATOM   6429  C CB  . LYS K  1 100 ? -10.245 -47.711 -20.558 1.00 20.79 ? 1173 LYS K CB  1 
ATOM   6430  C CG  . LYS K  1 100 ? -11.392 -46.790 -20.116 1.00 22.95 ? 1173 LYS K CG  1 
ATOM   6431  C CD  . LYS K  1 100 ? -11.984 -47.243 -18.786 1.00 25.15 ? 1173 LYS K CD  1 
ATOM   6432  C CE  . LYS K  1 100 ? -12.998 -46.198 -18.266 1.00 38.66 ? 1173 LYS K CE  1 
ATOM   6433  N NZ  . LYS K  1 100 ? -13.812 -46.708 -17.135 1.00 40.34 ? 1173 LYS K NZ  1 
ATOM   6434  N N   . GLU K  1 101 ? -8.385  -49.255 -22.710 1.00 19.07 ? 1174 GLU K N   1 
ATOM   6435  C CA  . GLU K  1 101 ? -7.110  -49.811 -23.090 1.00 18.85 ? 1174 GLU K CA  1 
ATOM   6436  C C   . GLU K  1 101 ? -6.587  -49.066 -24.290 1.00 24.74 ? 1174 GLU K C   1 
ATOM   6437  O O   . GLU K  1 101 ? -5.413  -48.687 -24.338 1.00 22.41 ? 1174 GLU K O   1 
ATOM   6438  C CB  . GLU K  1 101 ? -7.240  -51.302 -23.429 1.00 23.42 ? 1174 GLU K CB  1 
ATOM   6439  C CG  . GLU K  1 101 ? -5.913  -51.916 -23.876 1.00 24.38 ? 1174 GLU K CG  1 
ATOM   6440  C CD  . GLU K  1 101 ? -6.040  -53.276 -24.544 1.00 32.29 ? 1174 GLU K CD  1 
ATOM   6441  O OE1 . GLU K  1 101 ? -7.163  -53.863 -24.568 1.00 28.78 ? 1174 GLU K OE1 1 
ATOM   6442  O OE2 . GLU K  1 101 ? -4.972  -53.755 -25.019 1.00 35.63 ? 1174 GLU K OE2 1 
ATOM   6443  N N   . LYS K  1 102 ? -7.451  -48.870 -25.283 1.00 19.78 ? 1175 LYS K N   1 
ATOM   6444  C CA  . LYS K  1 102 ? -7.021  -48.149 -26.474 1.00 23.18 ? 1175 LYS K CA  1 
ATOM   6445  C C   . LYS K  1 102 ? -6.579  -46.731 -26.188 1.00 20.30 ? 1175 LYS K C   1 
ATOM   6446  O O   . LYS K  1 102 ? -5.665  -46.208 -26.838 1.00 23.38 ? 1175 LYS K O   1 
ATOM   6447  C CB  . LYS K  1 102 ? -8.161  -48.137 -27.534 1.00 19.26 ? 1175 LYS K CB  1 
ATOM   6448  C CG  . LYS K  1 102 ? -8.439  -49.517 -28.142 1.00 23.90 ? 1175 LYS K CG  1 
ATOM   6449  C CD  . LYS K  1 102 ? -7.302  -49.874 -29.069 1.00 26.90 ? 1175 LYS K CD  1 
ATOM   6450  C CE  . LYS K  1 102 ? -7.665  -51.003 -30.014 1.00 35.87 ? 1175 LYS K CE  1 
ATOM   6451  N NZ  . LYS K  1 102 ? -8.132  -52.228 -29.313 1.00 36.93 ? 1175 LYS K NZ  1 
ATOM   6452  N N   . MET K  1 103 ? -7.187  -46.086 -25.205 1.00 20.08 ? 1176 MET K N   1 
ATOM   6453  C CA  . MET K  1 103 ? -6.880  -44.696 -24.981 1.00 23.99 ? 1176 MET K CA  1 
ATOM   6454  C C   . MET K  1 103 ? -5.460  -44.575 -24.410 1.00 21.27 ? 1176 MET K C   1 
ATOM   6455  O O   . MET K  1 103 ? -4.877  -43.542 -24.543 1.00 20.57 ? 1176 MET K O   1 
ATOM   6456  C CB  . MET K  1 103 ? -7.944  -43.979 -24.142 1.00 24.72 ? 1176 MET K CB  1 
ATOM   6457  C CG  . MET K  1 103 ? -8.919  -43.177 -25.082 1.00 27.14 ? 1176 MET K CG  1 
ATOM   6458  S SD  . MET K  1 103 ? -10.146 -42.371 -24.235 1.00 42.73 ? 1176 MET K SD  1 
ATOM   6459  C CE  . MET K  1 103 ? -10.914 -43.699 -23.325 1.00 25.89 ? 1176 MET K CE  1 
ATOM   6460  N N   . LEU K  1 104 ? -4.921  -45.659 -23.876 1.00 22.62 ? 1177 LEU K N   1 
ATOM   6461  C CA  . LEU K  1 104 ? -3.577  -45.622 -23.252 1.00 21.48 ? 1177 LEU K CA  1 
ATOM   6462  C C   . LEU K  1 104 ? -2.454  -46.102 -24.167 1.00 25.47 ? 1177 LEU K C   1 
ATOM   6463  O O   . LEU K  1 104 ? -1.271  -46.133 -23.762 1.00 25.38 ? 1177 LEU K O   1 
ATOM   6464  C CB  . LEU K  1 104 ? -3.571  -46.498 -21.991 1.00 23.26 ? 1177 LEU K CB  1 
ATOM   6465  C CG  . LEU K  1 104 ? -4.455  -46.059 -20.845 1.00 25.18 ? 1177 LEU K CG  1 
ATOM   6466  C CD1 . LEU K  1 104 ? -4.582  -47.190 -19.793 1.00 26.77 ? 1177 LEU K CD1 1 
ATOM   6467  C CD2 . LEU K  1 104 ? -3.939  -44.748 -20.230 1.00 31.55 ? 1177 LEU K CD2 1 
ATOM   6468  N N   A GLU K  1 105 ? -2.812  -46.486 -25.385 0.65 22.30 ? 1178 GLU K N   1 
ATOM   6469  N N   B GLU K  1 105 ? -2.778  -46.488 -25.399 0.35 22.36 ? 1178 GLU K N   1 
ATOM   6470  C CA  A GLU K  1 105 ? -1.840  -47.019 -26.329 0.65 23.34 ? 1178 GLU K CA  1 
ATOM   6471  C CA  B GLU K  1 105 ? -1.748  -47.043 -26.287 0.35 23.36 ? 1178 GLU K CA  1 
ATOM   6472  C C   A GLU K  1 105 ? -0.688  -46.063 -26.629 0.65 24.59 ? 1178 GLU K C   1 
ATOM   6473  C C   B GLU K  1 105 ? -0.649  -46.050 -26.649 0.35 24.59 ? 1178 GLU K C   1 
ATOM   6474  O O   A GLU K  1 105 ? 0.467   -46.509 -26.786 0.65 25.59 ? 1178 GLU K O   1 
ATOM   6475  O O   B GLU K  1 105 ? 0.505   -46.450 -26.865 0.35 25.60 ? 1178 GLU K O   1 
ATOM   6476  C CB  A GLU K  1 105 ? -2.560  -47.408 -27.631 0.65 23.05 ? 1178 GLU K CB  1 
ATOM   6477  C CB  B GLU K  1 105 ? -2.358  -47.648 -27.567 0.35 23.11 ? 1178 GLU K CB  1 
ATOM   6478  C CG  A GLU K  1 105 ? -1.759  -48.181 -28.615 0.65 24.70 ? 1178 GLU K CG  1 
ATOM   6479  C CG  B GLU K  1 105 ? -3.561  -48.519 -27.280 0.35 24.93 ? 1178 GLU K CG  1 
ATOM   6480  C CD  A GLU K  1 105 ? -2.587  -48.612 -29.823 0.65 22.97 ? 1178 GLU K CD  1 
ATOM   6481  C CD  B GLU K  1 105 ? -3.864  -49.539 -28.355 0.35 25.05 ? 1178 GLU K CD  1 
ATOM   6482  O OE1 A GLU K  1 105 ? -2.077  -48.583 -30.960 0.65 25.89 ? 1178 GLU K OE1 1 
ATOM   6483  O OE1 B GLU K  1 105 ? -4.219  -50.669 -27.967 0.35 23.07 ? 1178 GLU K OE1 1 
ATOM   6484  O OE2 A GLU K  1 105 ? -3.753  -48.992 -29.635 0.65 24.90 ? 1178 GLU K OE2 1 
ATOM   6485  O OE2 B GLU K  1 105 ? -3.755  -49.221 -29.565 0.35 24.81 ? 1178 GLU K OE2 1 
ATOM   6486  N N   . GLY K  1 106 ? -0.995  -44.769 -26.729 1.00 21.63 ? 1179 GLY K N   1 
ATOM   6487  C CA  . GLY K  1 106 ? -0.039  -43.768 -27.179 1.00 25.75 ? 1179 GLY K CA  1 
ATOM   6488  C C   . GLY K  1 106 ? 1.217   -43.713 -26.302 1.00 24.52 ? 1179 GLY K C   1 
ATOM   6489  O O   . GLY K  1 106 ? 1.129   -43.742 -25.066 1.00 23.09 ? 1179 GLY K O   1 
ATOM   6490  N N   . ARG K  1 107 ? 2.369   -43.562 -26.942 1.00 24.62 ? 1180 ARG K N   1 
ATOM   6491  C CA  . ARG K  1 107 ? 3.643   -43.569 -26.203 1.00 29.40 ? 1180 ARG K CA  1 
ATOM   6492  C C   . ARG K  1 107 ? 3.965   -42.258 -25.477 1.00 35.16 ? 1180 ARG K C   1 
ATOM   6493  O O   . ARG K  1 107 ? 4.722   -42.253 -24.500 1.00 35.99 ? 1180 ARG K O   1 
ATOM   6494  C CB  . ARG K  1 107 ? 4.800   -43.946 -27.147 1.00 32.00 ? 1180 ARG K CB  1 
ATOM   6495  C CG  . ARG K  1 107 ? 4.865   -45.427 -27.494 1.00 44.00 ? 1180 ARG K CG  1 
ATOM   6496  C CD  . ARG K  1 107 ? 5.850   -46.142 -26.555 1.00 55.75 ? 1180 ARG K CD  1 
ATOM   6497  N NE  . ARG K  1 107 ? 6.333   -47.417 -27.097 1.00 70.13 ? 1180 ARG K NE  1 
ATOM   6498  C CZ  . ARG K  1 107 ? 7.404   -48.068 -26.641 1.00 66.25 ? 1180 ARG K CZ  1 
ATOM   6499  N NH1 . ARG K  1 107 ? 7.779   -49.222 -27.193 1.00 66.35 ? 1180 ARG K NH1 1 
ATOM   6500  N NH2 . ARG K  1 107 ? 8.108   -47.559 -25.633 1.00 67.50 ? 1180 ARG K NH2 1 
ATOM   6501  N N   . LYS K  1 108 ? 3.411   -41.151 -25.961 1.00 25.32 ? 1181 LYS K N   1 
ATOM   6502  C CA  . LYS K  1 108 ? 3.684   -39.850 -25.380 1.00 27.60 ? 1181 LYS K CA  1 
ATOM   6503  C C   . LYS K  1 108 ? 2.416   -39.236 -24.836 1.00 29.65 ? 1181 LYS K C   1 
ATOM   6504  O O   . LYS K  1 108 ? 1.329   -39.447 -25.374 1.00 25.61 ? 1181 LYS K O   1 
ATOM   6505  C CB  . LYS K  1 108 ? 4.333   -38.914 -26.408 1.00 32.31 ? 1181 LYS K CB  1 
ATOM   6506  C CG  . LYS K  1 108 ? 5.699   -39.414 -26.871 1.00 33.76 ? 1181 LYS K CG  1 
ATOM   6507  C CD  . LYS K  1 108 ? 6.627   -39.610 -25.679 1.00 41.93 ? 1181 LYS K CD  1 
ATOM   6508  C CE  . LYS K  1 108 ? 8.079   -39.841 -26.139 1.00 43.53 ? 1181 LYS K CE  1 
ATOM   6509  N NZ  . LYS K  1 108 ? 9.065   -39.352 -25.124 1.00 42.55 ? 1181 LYS K NZ  1 
ATOM   6510  N N   . SER K  1 109 ? 2.547   -38.476 -23.762 1.00 24.84 ? 1182 SER K N   1 
ATOM   6511  C CA  . SER K  1 109 ? 1.380   -37.774 -23.231 1.00 29.68 ? 1182 SER K CA  1 
ATOM   6512  C C   . SER K  1 109 ? 0.595   -36.965 -24.276 1.00 27.92 ? 1182 SER K C   1 
ATOM   6513  O O   . SER K  1 109 ? -0.644  -36.947 -24.261 1.00 27.34 ? 1182 SER K O   1 
ATOM   6514  C CB  . SER K  1 109 ? 1.794   -36.886 -22.040 1.00 34.40 ? 1182 SER K CB  1 
ATOM   6515  O OG  . SER K  1 109 ? 0.985   -35.729 -21.937 1.00 45.88 ? 1182 SER K OG  1 
ATOM   6516  N N   . ASN K  1 110 ? 1.263   -36.273 -25.186 1.00 24.79 ? 1183 ASN K N   1 
ATOM   6517  C CA  . ASN K  1 110 ? 0.463   -35.418 -26.063 1.00 25.19 ? 1183 ASN K CA  1 
ATOM   6518  C C   . ASN K  1 110 ? -0.264  -36.205 -27.163 1.00 25.29 ? 1183 ASN K C   1 
ATOM   6519  O O   . ASN K  1 110 ? -1.335  -35.789 -27.613 1.00 24.21 ? 1183 ASN K O   1 
ATOM   6520  C CB  . ASN K  1 110 ? 1.181   -34.184 -26.582 1.00 35.18 ? 1183 ASN K CB  1 
ATOM   6521  C CG  . ASN K  1 110 ? 2.185   -34.507 -27.594 1.00 40.01 ? 1183 ASN K CG  1 
ATOM   6522  O OD1 . ASN K  1 110 ? 3.264   -34.995 -27.265 1.00 47.54 ? 1183 ASN K OD1 1 
ATOM   6523  N ND2 . ASN K  1 110 ? 1.874   -34.224 -28.853 1.00 47.06 ? 1183 ASN K ND2 1 
ATOM   6524  N N   . ILE K  1 111 ? 0.267   -37.373 -27.527 1.00 23.67 ? 1184 ILE K N   1 
ATOM   6525  C CA  . ILE K  1 111 ? -0.442  -38.235 -28.476 1.00 22.80 ? 1184 ILE K CA  1 
ATOM   6526  C C   . ILE K  1 111 ? -1.672  -38.830 -27.773 1.00 19.94 ? 1184 ILE K C   1 
ATOM   6527  O O   . ILE K  1 111 ? -2.756  -38.889 -28.359 1.00 19.16 ? 1184 ILE K O   1 
ATOM   6528  C CB  . ILE K  1 111 ? 0.433   -39.369 -28.982 1.00 29.52 ? 1184 ILE K CB  1 
ATOM   6529  C CG1 . ILE K  1 111 ? 1.580   -38.793 -29.810 1.00 30.23 ? 1184 ILE K CG1 1 
ATOM   6530  C CG2 . ILE K  1 111 ? -0.420  -40.328 -29.838 1.00 27.09 ? 1184 ILE K CG2 1 
ATOM   6531  C CD1 . ILE K  1 111 ? 1.167   -38.315 -31.190 1.00 40.31 ? 1184 ILE K CD1 1 
ATOM   6532  N N   . ARG K  1 112 ? -1.499  -39.259 -26.532 1.00 20.96 ? 1185 ARG K N   1 
ATOM   6533  C CA  . ARG K  1 112 ? -2.646  -39.804 -25.799 1.00 21.45 ? 1185 ARG K CA  1 
ATOM   6534  C C   . ARG K  1 112 ? -3.703  -38.700 -25.586 1.00 19.59 ? 1185 ARG K C   1 
ATOM   6535  O O   . ARG K  1 112 ? -4.916  -39.002 -25.619 1.00 19.96 ? 1185 ARG K O   1 
ATOM   6536  C CB  . ARG K  1 112 ? -2.243  -40.409 -24.448 1.00 22.34 ? 1185 ARG K CB  1 
ATOM   6537  C CG  . ARG K  1 112 ? -1.332  -41.609 -24.540 1.00 19.04 ? 1185 ARG K CG  1 
ATOM   6538  C CD  . ARG K  1 112 ? -1.206  -42.294 -23.212 1.00 24.31 ? 1185 ARG K CD  1 
ATOM   6539  N NE  . ARG K  1 112 ? -0.552  -41.455 -22.214 1.00 28.41 ? 1185 ARG K NE  1 
ATOM   6540  C CZ  . ARG K  1 112 ? 0.769   -41.345 -22.028 1.00 30.60 ? 1185 ARG K CZ  1 
ATOM   6541  N NH1 . ARG K  1 112 ? 1.628   -42.009 -22.779 1.00 25.41 ? 1185 ARG K NH1 1 
ATOM   6542  N NH2 . ARG K  1 112 ? 1.221   -40.563 -21.056 1.00 33.26 ? 1185 ARG K NH2 1 
ATOM   6543  N N   . LYS K  1 113 ? -3.267  -37.458 -25.347 1.00 18.87 ? 1186 LYS K N   1 
ATOM   6544  C CA  . LYS K  1 113 ? -4.267  -36.395 -25.185 1.00 19.70 ? 1186 LYS K CA  1 
ATOM   6545  C C   . LYS K  1 113 ? -5.105  -36.234 -26.468 1.00 19.67 ? 1186 LYS K C   1 
ATOM   6546  O O   . LYS K  1 113 ? -6.355  -36.084 -26.452 1.00 18.83 ? 1186 LYS K O   1 
ATOM   6547  C CB  . LYS K  1 113 ? -3.609  -35.060 -24.828 1.00 21.45 ? 1186 LYS K CB  1 
ATOM   6548  C CG  . LYS K  1 113 ? -4.697  -34.079 -24.436 1.00 21.90 ? 1186 LYS K CG  1 
ATOM   6549  C CD  . LYS K  1 113 ? -4.207  -32.808 -23.735 1.00 25.69 ? 1186 LYS K CD  1 
ATOM   6550  C CE  . LYS K  1 113 ? -3.470  -31.852 -24.673 1.00 32.22 ? 1186 LYS K CE  1 
ATOM   6551  N NZ  . LYS K  1 113 ? -4.327  -30.729 -25.169 1.00 29.36 ? 1186 LYS K NZ  1 
ATOM   6552  N N   . SER K  1 114 ? -4.426  -36.222 -27.596 1.00 18.08 ? 1187 SER K N   1 
ATOM   6553  C CA  . SER K  1 114 ? -5.106  -36.110 -28.863 1.00 17.74 ? 1187 SER K CA  1 
ATOM   6554  C C   . SER K  1 114 ? -6.086  -37.284 -29.108 1.00 17.06 ? 1187 SER K C   1 
ATOM   6555  O O   . SER K  1 114 ? -7.203  -37.079 -29.646 1.00 18.06 ? 1187 SER K O   1 
ATOM   6556  C CB  . SER K  1 114 ? -4.055  -36.045 -29.973 1.00 24.78 ? 1187 SER K CB  1 
ATOM   6557  O OG  . SER K  1 114 ? -4.670  -36.075 -31.233 1.00 30.85 ? 1187 SER K OG  1 
ATOM   6558  N N   . VAL K  1 115 ? -5.688  -38.492 -28.717 1.00 17.61 ? 1188 VAL K N   1 
ATOM   6559  C CA  . VAL K  1 115 ? -6.569  -39.674 -28.846 1.00 16.31 ? 1188 VAL K CA  1 
ATOM   6560  C C   . VAL K  1 115 ? -7.769  -39.495 -27.898 1.00 16.70 ? 1188 VAL K C   1 
ATOM   6561  O O   . VAL K  1 115 ? -8.899  -39.745 -28.311 1.00 15.63 ? 1188 VAL K O   1 
ATOM   6562  C CB  . VAL K  1 115 ? -5.841  -40.988 -28.471 1.00 16.84 ? 1188 VAL K CB  1 
ATOM   6563  C CG1 . VAL K  1 115 ? -6.823  -42.146 -28.336 1.00 18.52 ? 1188 VAL K CG1 1 
ATOM   6564  C CG2 . VAL K  1 115 ? -4.834  -41.377 -29.564 1.00 16.57 ? 1188 VAL K CG2 1 
ATOM   6565  N N   . GLN K  1 116 ? -7.545  -39.023 -26.676 1.00 14.97 ? 1189 GLN K N   1 
ATOM   6566  C CA  . GLN K  1 116 ? -8.692  -38.800 -25.776 1.00 18.07 ? 1189 GLN K CA  1 
ATOM   6567  C C   . GLN K  1 116 ? -9.655  -37.751 -26.312 1.00 17.65 ? 1189 GLN K C   1 
ATOM   6568  O O   . GLN K  1 116 ? -10.899 -37.920 -26.226 1.00 17.24 ? 1189 GLN K O   1 
ATOM   6569  C CB  . GLN K  1 116 ? -8.274  -38.374 -24.360 1.00 19.93 ? 1189 GLN K CB  1 
ATOM   6570  C CG  . GLN K  1 116 ? -7.384  -39.319 -23.684 1.00 24.21 ? 1189 GLN K CG  1 
ATOM   6571  C CD  . GLN K  1 116 ? -6.893  -38.747 -22.349 1.00 28.21 ? 1189 GLN K CD  1 
ATOM   6572  O OE1 . GLN K  1 116 ? -7.629  -38.023 -21.653 1.00 34.74 ? 1189 GLN K OE1 1 
ATOM   6573  N NE2 . GLN K  1 116 ? -5.668  -39.058 -21.997 1.00 32.44 ? 1189 GLN K NE2 1 
ATOM   6574  N N   . ILE K  1 117 ? -9.113  -36.660 -26.859 1.00 13.19 ? 1190 ILE K N   1 
ATOM   6575  C CA  . ILE K  1 117 ? -10.000 -35.606 -27.414 1.00 16.66 ? 1190 ILE K CA  1 
ATOM   6576  C C   . ILE K  1 117 ? -10.839 -36.198 -28.582 1.00 17.35 ? 1190 ILE K C   1 
ATOM   6577  O O   . ILE K  1 117 ? -12.053 -36.035 -28.646 1.00 15.87 ? 1190 ILE K O   1 
ATOM   6578  C CB  . ILE K  1 117 ? -9.165  -34.437 -27.914 1.00 16.28 ? 1190 ILE K CB  1 
ATOM   6579  C CG1 . ILE K  1 117 ? -8.653  -33.608 -26.726 1.00 18.23 ? 1190 ILE K CG1 1 
ATOM   6580  C CG2 . ILE K  1 117 ? -9.960  -33.507 -28.859 1.00 18.67 ? 1190 ILE K CG2 1 
ATOM   6581  C CD1 . ILE K  1 117 ? -7.551  -32.573 -27.184 1.00 22.12 ? 1190 ILE K CD1 1 
ATOM   6582  N N   . ALA K  1 118 ? -10.185 -36.960 -29.464 1.00 15.02 ? 1191 ALA K N   1 
ATOM   6583  C CA  . ALA K  1 118 ? -10.884 -37.603 -30.585 1.00 16.14 ? 1191 ALA K CA  1 
ATOM   6584  C C   . ALA K  1 118 ? -11.963 -38.575 -30.092 1.00 15.22 ? 1191 ALA K C   1 
ATOM   6585  O O   . ALA K  1 118 ? -13.030 -38.689 -30.704 1.00 14.56 ? 1191 ALA K O   1 
ATOM   6586  C CB  . ALA K  1 118 ? -9.865  -38.346 -31.524 1.00 16.31 ? 1191 ALA K CB  1 
ATOM   6587  N N   . TYR K  1 119 ? -11.685 -39.274 -28.983 1.00 13.01 ? 1192 TYR K N   1 
ATOM   6588  C CA  . TYR K  1 119 ? -12.660 -40.225 -28.435 1.00 15.03 ? 1192 TYR K CA  1 
ATOM   6589  C C   . TYR K  1 119 ? -13.891 -39.481 -27.962 1.00 16.01 ? 1192 TYR K C   1 
ATOM   6590  O O   . TYR K  1 119 ? -15.033 -39.873 -28.260 1.00 15.37 ? 1192 TYR K O   1 
ATOM   6591  C CB  . TYR K  1 119 ? -12.064 -41.005 -27.300 1.00 14.62 ? 1192 TYR K CB  1 
ATOM   6592  C CG  . TYR K  1 119 ? -13.020 -41.970 -26.633 1.00 14.98 ? 1192 TYR K CG  1 
ATOM   6593  C CD1 . TYR K  1 119 ? -13.215 -43.258 -27.139 1.00 17.80 ? 1192 TYR K CD1 1 
ATOM   6594  C CD2 . TYR K  1 119 ? -13.636 -41.625 -25.442 1.00 19.00 ? 1192 TYR K CD2 1 
ATOM   6595  C CE1 . TYR K  1 119 ? -14.067 -44.189 -26.475 1.00 16.68 ? 1192 TYR K CE1 1 
ATOM   6596  C CE2 . TYR K  1 119 ? -14.463 -42.513 -24.799 1.00 18.85 ? 1192 TYR K CE2 1 
ATOM   6597  C CZ  . TYR K  1 119 ? -14.685 -43.764 -25.321 1.00 18.48 ? 1192 TYR K CZ  1 
ATOM   6598  O OH  . TYR K  1 119 ? -15.489 -44.649 -24.653 1.00 21.00 ? 1192 TYR K OH  1 
ATOM   6599  N N   . HIS K  1 120 ? -13.690 -38.392 -27.216 1.00 14.06 ? 1193 HIS K N   1 
ATOM   6600  C CA  . HIS K  1 120 ? -14.842 -37.614 -26.771 1.00 15.93 ? 1193 HIS K CA  1 
ATOM   6601  C C   . HIS K  1 120 ? -15.526 -36.938 -27.957 1.00 17.15 ? 1193 HIS K C   1 
ATOM   6602  O O   . HIS K  1 120 ? -16.755 -36.801 -27.950 1.00 18.32 ? 1193 HIS K O   1 
ATOM   6603  C CB  . HIS K  1 120 ? -14.404 -36.591 -25.696 1.00 15.04 ? 1193 HIS K CB  1 
ATOM   6604  C CG  . HIS K  1 120 ? -13.866 -37.278 -24.491 1.00 18.85 ? 1193 HIS K CG  1 
ATOM   6605  N ND1 . HIS K  1 120 ? -14.630 -38.171 -23.772 1.00 21.94 ? 1193 HIS K ND1 1 
ATOM   6606  C CD2 . HIS K  1 120 ? -12.647 -37.263 -23.907 1.00 21.72 ? 1193 HIS K CD2 1 
ATOM   6607  C CE1 . HIS K  1 120 ? -13.909 -38.673 -22.787 1.00 24.38 ? 1193 HIS K CE1 1 
ATOM   6608  N NE2 . HIS K  1 120 ? -12.706 -38.132 -22.852 1.00 20.96 ? 1193 HIS K NE2 1 
ATOM   6609  N N   . ARG K  1 121 ? -14.780 -36.550 -28.999 1.00 12.86 ? 1194 ARG K N   1 
ATOM   6610  C CA  . ARG K  1 121 ? -15.480 -36.054 -30.203 1.00 17.57 ? 1194 ARG K CA  1 
ATOM   6611  C C   . ARG K  1 121 ? -16.343 -37.160 -30.865 1.00 16.08 ? 1194 ARG K C   1 
ATOM   6612  O O   . ARG K  1 121 ? -17.492 -36.914 -31.298 1.00 16.89 ? 1194 ARG K O   1 
ATOM   6613  C CB  . ARG K  1 121 ? -14.465 -35.516 -31.217 1.00 16.20 ? 1194 ARG K CB  1 
ATOM   6614  C CG  . ARG K  1 121 ? -13.813 -34.223 -30.800 1.00 21.02 ? 1194 ARG K CG  1 
ATOM   6615  C CD  . ARG K  1 121 ? -12.698 -33.927 -31.858 1.00 26.16 ? 1194 ARG K CD  1 
ATOM   6616  N NE  . ARG K  1 121 ? -11.997 -32.707 -31.538 1.00 23.94 ? 1194 ARG K NE  1 
ATOM   6617  C CZ  . ARG K  1 121 ? -10.785 -32.390 -32.015 1.00 31.78 ? 1194 ARG K CZ  1 
ATOM   6618  N NH1 . ARG K  1 121 ? -10.215 -31.244 -31.667 1.00 25.70 ? 1194 ARG K NH1 1 
ATOM   6619  N NH2 . ARG K  1 121 ? -10.127 -33.248 -32.803 1.00 27.71 ? 1194 ARG K NH2 1 
ATOM   6620  N N   . ALA K  1 122 ? -15.816 -38.396 -30.913 1.00 14.69 ? 1195 ALA K N   1 
ATOM   6621  C CA  . ALA K  1 122 ? -16.594 -39.490 -31.490 1.00 14.96 ? 1195 ALA K CA  1 
ATOM   6622  C C   . ALA K  1 122 ? -17.861 -39.706 -30.649 1.00 16.30 ? 1195 ALA K C   1 
ATOM   6623  O O   . ALA K  1 122 ? -18.951 -39.930 -31.214 1.00 15.22 ? 1195 ALA K O   1 
ATOM   6624  C CB  . ALA K  1 122 ? -15.760 -40.771 -31.506 1.00 15.59 ? 1195 ALA K CB  1 
ATOM   6625  N N   . LEU K  1 123 ? -17.744 -39.704 -29.321 1.00 15.45 ? 1196 LEU K N   1 
ATOM   6626  C CA  . LEU K  1 123 ? -18.982 -39.945 -28.525 1.00 15.45 ? 1196 LEU K CA  1 
ATOM   6627  C C   . LEU K  1 123 ? -19.972 -38.781 -28.613 1.00 19.64 ? 1196 LEU K C   1 
ATOM   6628  O O   . LEU K  1 123 ? -21.202 -39.005 -28.472 1.00 19.91 ? 1196 LEU K O   1 
ATOM   6629  C CB  . LEU K  1 123 ? -18.706 -40.282 -27.078 1.00 15.58 ? 1196 LEU K CB  1 
ATOM   6630  C CG  . LEU K  1 123 ? -17.891 -41.545 -26.775 1.00 20.79 ? 1196 LEU K CG  1 
ATOM   6631  C CD1 . LEU K  1 123 ? -17.923 -41.940 -25.304 1.00 21.12 ? 1196 LEU K CD1 1 
ATOM   6632  C CD2 . LEU K  1 123 ? -18.304 -42.753 -27.655 1.00 21.54 ? 1196 LEU K CD2 1 
ATOM   6633  N N   . GLN K  1 124 ? -19.474 -37.556 -28.779 1.00 17.17 ? 1197 GLN K N   1 
ATOM   6634  C CA  . GLN K  1 124 ? -20.379 -36.438 -29.086 1.00 16.22 ? 1197 GLN K CA  1 
ATOM   6635  C C   . GLN K  1 124 ? -21.119 -36.638 -30.401 1.00 20.50 ? 1197 GLN K C   1 
ATOM   6636  O O   . GLN K  1 124 ? -22.287 -36.317 -30.500 1.00 21.12 ? 1197 GLN K O   1 
ATOM   6637  C CB  . GLN K  1 124 ? -19.660 -35.106 -29.098 1.00 16.99 ? 1197 GLN K CB  1 
ATOM   6638  C CG  . GLN K  1 124 ? -19.267 -34.644 -27.698 1.00 16.62 ? 1197 GLN K CG  1 
ATOM   6639  C CD  . GLN K  1 124 ? -18.419 -33.463 -27.755 1.00 19.84 ? 1197 GLN K CD  1 
ATOM   6640  O OE1 . GLN K  1 124 ? -18.912 -32.364 -28.016 1.00 21.57 ? 1197 GLN K OE1 1 
ATOM   6641  N NE2 . GLN K  1 124 ? -17.109 -33.644 -27.570 1.00 17.37 ? 1197 GLN K NE2 1 
ATOM   6642  N N   . HIS K  1 125 ? -20.394 -37.056 -31.439 1.00 20.12 ? 1198 HIS K N   1 
ATOM   6643  C CA  . HIS K  1 125 ? -21.039 -37.392 -32.699 1.00 22.20 ? 1198 HIS K CA  1 
ATOM   6644  C C   . HIS K  1 125 ? -22.117 -38.432 -32.476 1.00 19.42 ? 1198 HIS K C   1 
ATOM   6645  O O   . HIS K  1 125 ? -23.270 -38.260 -32.932 1.00 23.63 ? 1198 HIS K O   1 
ATOM   6646  C CB  . HIS K  1 125 ? -19.986 -37.877 -33.689 1.00 17.39 ? 1198 HIS K CB  1 
ATOM   6647  C CG  . HIS K  1 125 ? -20.548 -38.342 -35.007 1.00 20.18 ? 1198 HIS K CG  1 
ATOM   6648  N ND1 . HIS K  1 125 ? -20.647 -37.509 -36.095 1.00 26.37 ? 1198 HIS K ND1 1 
ATOM   6649  C CD2 . HIS K  1 125 ? -21.092 -39.526 -35.374 1.00 24.63 ? 1198 HIS K CD2 1 
ATOM   6650  C CE1 . HIS K  1 125 ? -21.188 -38.179 -37.104 1.00 20.43 ? 1198 HIS K CE1 1 
ATOM   6651  N NE2 . HIS K  1 125 ? -21.482 -39.393 -36.685 1.00 23.96 ? 1198 HIS K NE2 1 
ATOM   6652  N N   . ARG K  1 126 ? -21.795 -39.512 -31.765 1.00 15.52 ? 1199 ARG K N   1 
ATOM   6653  C CA  . ARG K  1 126 ? -22.785 -40.526 -31.481 1.00 19.67 ? 1199 ARG K CA  1 
ATOM   6654  C C   . ARG K  1 126 ? -24.044 -39.952 -30.863 1.00 26.21 ? 1199 ARG K C   1 
ATOM   6655  O O   . ARG K  1 126 ? -25.164 -40.289 -31.293 1.00 25.26 ? 1199 ARG K O   1 
ATOM   6656  C CB  . ARG K  1 126 ? -22.240 -41.644 -30.570 1.00 21.56 ? 1199 ARG K CB  1 
ATOM   6657  C CG  . ARG K  1 126 ? -23.228 -42.769 -30.324 1.00 21.21 ? 1199 ARG K CG  1 
ATOM   6658  C CD  . ARG K  1 126 ? -22.544 -43.924 -29.592 1.00 23.31 ? 1199 ARG K CD  1 
ATOM   6659  N NE  . ARG K  1 126 ? -22.246 -43.552 -28.208 1.00 27.81 ? 1199 ARG K NE  1 
ATOM   6660  C CZ  . ARG K  1 126 ? -21.648 -44.365 -27.358 1.00 30.57 ? 1199 ARG K CZ  1 
ATOM   6661  N NH1 . ARG K  1 126 ? -21.425 -43.978 -26.115 1.00 33.76 ? 1199 ARG K NH1 1 
ATOM   6662  N NH2 . ARG K  1 126 ? -21.283 -45.568 -27.780 1.00 29.35 ? 1199 ARG K NH2 1 
ATOM   6663  N N   . SER K  1 127 ? -23.869 -39.130 -29.830 1.00 21.71 ? 1200 SER K N   1 
ATOM   6664  C CA  . SER K  1 127 ? -25.048 -38.514 -29.173 1.00 23.21 ? 1200 SER K CA  1 
ATOM   6665  C C   . SER K  1 127 ? -25.873 -37.682 -30.143 1.00 25.49 ? 1200 SER K C   1 
ATOM   6666  O O   . SER K  1 127 ? -27.101 -37.752 -30.110 1.00 32.00 ? 1200 SER K O   1 
ATOM   6667  C CB  . SER K  1 127 ? -24.633 -37.615 -27.997 1.00 24.99 ? 1200 SER K CB  1 
ATOM   6668  O OG  . SER K  1 127 ? -24.134 -38.443 -26.990 1.00 33.04 ? 1200 SER K OG  1 
ATOM   6669  N N   . LYS K  1 128 ? -25.216 -36.878 -30.969 1.00 25.31 ? 1201 LYS K N   1 
ATOM   6670  C CA  . LYS K  1 128 ? -25.915 -36.012 -31.936 1.00 27.02 ? 1201 LYS K CA  1 
ATOM   6671  C C   . LYS K  1 128 ? -26.736 -36.857 -32.909 1.00 32.54 ? 1201 LYS K C   1 
ATOM   6672  O O   . LYS K  1 128 ? -27.865 -36.498 -33.270 1.00 37.58 ? 1201 LYS K O   1 
ATOM   6673  C CB  . LYS K  1 128 ? -24.944 -35.101 -32.690 1.00 26.94 ? 1201 LYS K CB  1 
ATOM   6674  C CG  . LYS K  1 128 ? -24.310 -34.043 -31.820 1.00 30.33 ? 1201 LYS K CG  1 
ATOM   6675  C CD  . LYS K  1 128 ? -23.619 -32.934 -32.587 1.00 38.63 ? 1201 LYS K CD  1 
ATOM   6676  C CE  . LYS K  1 128 ? -23.363 -31.739 -31.644 1.00 43.59 ? 1201 LYS K CE  1 
ATOM   6677  N NZ  . LYS K  1 128 ? -22.443 -30.714 -32.225 1.00 59.24 ? 1201 LYS K NZ  1 
ATOM   6678  N N   . VAL K  1 129 ? -26.228 -38.018 -33.289 1.00 27.73 ? 1202 VAL K N   1 
ATOM   6679  C CA  . VAL K  1 129 ? -27.008 -38.839 -34.220 1.00 32.94 ? 1202 VAL K CA  1 
ATOM   6680  C C   . VAL K  1 129 ? -28.015 -39.728 -33.494 1.00 35.04 ? 1202 VAL K C   1 
ATOM   6681  O O   . VAL K  1 129 ? -28.941 -40.234 -34.120 1.00 45.56 ? 1202 VAL K O   1 
ATOM   6682  C CB  A VAL K  1 129 ? -26.085 -39.747 -35.052 0.24 28.84 ? 1202 VAL K CB  1 
ATOM   6683  C CB  B VAL K  1 129 ? -26.134 -39.611 -35.258 0.76 28.38 ? 1202 VAL K CB  1 
ATOM   6684  C CG1 A VAL K  1 129 ? -26.856 -40.931 -35.606 0.24 32.65 ? 1202 VAL K CG1 1 
ATOM   6685  C CG1 B VAL K  1 129 ? -25.366 -38.642 -36.103 0.76 29.28 ? 1202 VAL K CG1 1 
ATOM   6686  C CG2 A VAL K  1 129 ? -25.429 -38.959 -36.156 0.24 29.31 ? 1202 VAL K CG2 1 
ATOM   6687  C CG2 B VAL K  1 129 ? -25.189 -40.577 -34.582 0.76 29.85 ? 1202 VAL K CG2 1 
ATOM   6688  N N   . GLN K  1 130 ? -27.851 -39.921 -32.186 1.00 34.10 ? 1203 GLN K N   1 
ATOM   6689  C CA  . GLN K  1 130 ? -28.842 -40.658 -31.397 1.00 35.98 ? 1203 GLN K CA  1 
ATOM   6690  C C   . GLN K  1 130 ? -30.012 -39.764 -30.941 1.00 41.52 ? 1203 GLN K C   1 
ATOM   6691  O O   . GLN K  1 130 ? -30.933 -40.245 -30.306 1.00 44.68 ? 1203 GLN K O   1 
ATOM   6692  C CB  . GLN K  1 130 ? -28.204 -41.304 -30.165 1.00 33.31 ? 1203 GLN K CB  1 
ATOM   6693  C CG  . GLN K  1 130 ? -27.653 -42.690 -30.391 1.00 37.58 ? 1203 GLN K CG  1 
ATOM   6694  C CD  . GLN K  1 130 ? -26.969 -43.262 -29.160 1.00 35.91 ? 1203 GLN K CD  1 
ATOM   6695  O OE1 . GLN K  1 130 ? -26.683 -44.459 -29.092 1.00 49.93 ? 1203 GLN K OE1 1 
ATOM   6696  N NE2 . GLN K  1 130 ? -26.680 -42.406 -28.193 1.00 39.47 ? 1203 GLN K NE2 1 
ATOM   6697  N N   . GLY K  1 131 ? -29.958 -38.466 -31.231 1.00 42.59 ? 1204 GLY K N   1 
ATOM   6698  C CA  . GLY K  1 131 ? -31.063 -37.574 -30.911 1.00 43.24 ? 1204 GLY K CA  1 
ATOM   6699  C C   . GLY K  1 131 ? -30.747 -36.638 -29.754 1.00 49.50 ? 1204 GLY K C   1 
ATOM   6700  O O   . GLY K  1 131 ? -31.624 -36.284 -28.954 1.00 46.12 ? 1204 GLY K O   1 
ATOM   6701  N N   . GLU K  1 132 ? -29.466 -36.281 -29.672 1.00 48.11 ? 1205 GLU K N   1 
ATOM   6702  C CA  . GLU K  1 132 ? -28.933 -35.205 -28.827 1.00 49.16 ? 1205 GLU K CA  1 
ATOM   6703  C C   . GLU K  1 132 ? -28.325 -35.698 -27.529 1.00 45.08 ? 1205 GLU K C   1 
ATOM   6704  O O   . GLU K  1 132 ? -28.001 -34.899 -26.639 1.00 51.46 ? 1205 GLU K O   1 
ATOM   6705  C CB  . GLU K  1 132 ? -29.968 -34.128 -28.574 1.00 48.04 ? 1205 GLU K CB  1 
ATOM   6706  C CG  . GLU K  1 132 ? -30.427 -33.477 -29.843 1.00 54.80 ? 1205 GLU K CG  1 
ATOM   6707  C CD  . GLU K  1 132 ? -31.334 -32.307 -29.570 1.00 60.72 ? 1205 GLU K CD  1 
ATOM   6708  O OE1 . GLU K  1 132 ? -30.876 -31.391 -28.854 1.00 58.00 ? 1205 GLU K OE1 1 
ATOM   6709  O OE2 . GLU K  1 132 ? -32.495 -32.311 -30.064 1.00 64.47 ? 1205 GLU K OE2 1 
ATOM   6710  O OXT . GLU K  1 132 ? -28.138 -36.906 -27.368 1.00 44.52 ? 1205 GLU K OXT 1 
ATOM   6711  N N   . ALA L  2 8   ? -20.823 -28.812 -43.625 1.00 43.42 ? 29   ALA L N   1 
ATOM   6712  C CA  . ALA L  2 8   ? -19.981 -30.027 -43.710 1.00 45.41 ? 29   ALA L CA  1 
ATOM   6713  C C   . ALA L  2 8   ? -18.476 -29.741 -43.567 1.00 45.50 ? 29   ALA L C   1 
ATOM   6714  O O   . ALA L  2 8   ? -17.875 -29.085 -44.430 1.00 45.68 ? 29   ALA L O   1 
ATOM   6715  C CB  . ALA L  2 8   ? -20.255 -30.784 -45.003 1.00 45.86 ? 29   ALA L CB  1 
ATOM   6716  N N   . PRO L  2 9   ? -17.863 -30.254 -42.485 1.00 40.90 ? 30   PRO L N   1 
ATOM   6717  C CA  . PRO L  2 9   ? -16.458 -30.016 -42.116 1.00 40.94 ? 30   PRO L CA  1 
ATOM   6718  C C   . PRO L  2 9   ? -15.488 -30.252 -43.273 1.00 42.41 ? 30   PRO L C   1 
ATOM   6719  O O   . PRO L  2 9   ? -15.601 -31.279 -43.967 1.00 40.02 ? 30   PRO L O   1 
ATOM   6720  C CB  . PRO L  2 9   ? -16.204 -31.063 -41.013 1.00 45.28 ? 30   PRO L CB  1 
ATOM   6721  C CG  . PRO L  2 9   ? -17.575 -31.365 -40.437 1.00 40.97 ? 30   PRO L CG  1 
ATOM   6722  C CD  . PRO L  2 9   ? -18.545 -31.188 -41.561 1.00 41.30 ? 30   PRO L CD  1 
ATOM   6723  N N   . ALA L  2 10  ? -14.534 -29.344 -43.480 1.00 40.08 ? 31   ALA L N   1 
ATOM   6724  C CA  . ALA L  2 10  ? -13.469 -29.634 -44.446 1.00 40.65 ? 31   ALA L CA  1 
ATOM   6725  C C   . ALA L  2 10  ? -12.666 -30.833 -43.938 1.00 35.69 ? 31   ALA L C   1 
ATOM   6726  O O   . ALA L  2 10  ? -12.642 -31.107 -42.726 1.00 36.92 ? 31   ALA L O   1 
ATOM   6727  C CB  . ALA L  2 10  ? -12.552 -28.431 -44.663 1.00 41.77 ? 31   ALA L CB  1 
ATOM   6728  N N   . THR L  2 11  ? -12.035 -31.560 -44.861 1.00 32.80 ? 32   THR L N   1 
ATOM   6729  C CA  . THR L  2 11  ? -11.229 -32.701 -44.459 1.00 30.79 ? 32   THR L CA  1 
ATOM   6730  C C   . THR L  2 11  ? -9.836  -32.614 -45.065 1.00 35.05 ? 32   THR L C   1 
ATOM   6731  O O   . THR L  2 11  ? -9.593  -31.828 -45.993 1.00 41.49 ? 32   THR L O   1 
ATOM   6732  C CB  . THR L  2 11  ? -11.866 -34.057 -44.865 1.00 30.15 ? 32   THR L CB  1 
ATOM   6733  O OG1 . THR L  2 11  ? -11.960 -34.141 -46.296 1.00 32.56 ? 32   THR L OG1 1 
ATOM   6734  C CG2 . THR L  2 11  ? -13.249 -34.230 -44.239 1.00 26.67 ? 32   THR L CG2 1 
ATOM   6735  N N   . GLY L  2 12  ? -8.931  -33.430 -44.543 1.00 27.93 ? 33   GLY L N   1 
ATOM   6736  C CA  . GLY L  2 12  ? -7.571  -33.494 -45.047 1.00 36.50 ? 33   GLY L CA  1 
ATOM   6737  C C   . GLY L  2 12  ? -7.422  -34.572 -46.103 1.00 37.10 ? 33   GLY L C   1 
ATOM   6738  O O   . GLY L  2 12  ? -8.373  -34.933 -46.813 1.00 38.25 ? 33   GLY L O   1 
ATOM   6739  N N   . GLY L  2 13  ? -6.210  -35.088 -46.224 1.00 37.19 ? 34   GLY L N   1 
ATOM   6740  C CA  . GLY L  2 13  ? -5.937  -36.137 -47.174 1.00 39.66 ? 34   GLY L CA  1 
ATOM   6741  C C   . GLY L  2 13  ? -5.865  -37.455 -46.445 1.00 34.97 ? 34   GLY L C   1 
ATOM   6742  O O   . GLY L  2 13  ? -6.362  -37.587 -45.313 1.00 32.51 ? 34   GLY L O   1 
ATOM   6743  N N   . VAL L  2 14  ? -5.276  -38.440 -47.106 1.00 33.46 ? 35   VAL L N   1 
ATOM   6744  C CA  . VAL L  2 14  ? -4.989  -39.720 -46.494 1.00 33.22 ? 35   VAL L CA  1 
ATOM   6745  C C   . VAL L  2 14  ? -3.894  -39.536 -45.448 1.00 37.93 ? 35   VAL L C   1 
ATOM   6746  O O   . VAL L  2 14  ? -2.864  -38.915 -45.704 1.00 39.81 ? 35   VAL L O   1 
ATOM   6747  C CB  . VAL L  2 14  ? -4.575  -40.744 -47.556 1.00 36.40 ? 35   VAL L CB  1 
ATOM   6748  C CG1 . VAL L  2 14  ? -4.265  -42.086 -46.918 1.00 32.74 ? 35   VAL L CG1 1 
ATOM   6749  C CG2 . VAL L  2 14  ? -5.718  -40.879 -48.567 1.00 41.47 ? 35   VAL L CG2 1 
HETATM 6750  N N   . M3L L  2 15  ? -4.141  -40.051 -44.256 1.00 30.81 ? 36   M3L L N   1 
HETATM 6751  C CA  . M3L L  2 15  ? -3.206  -39.919 -43.151 1.00 31.83 ? 36   M3L L CA  1 
HETATM 6752  C CB  . M3L L  2 15  ? -3.934  -40.359 -41.888 1.00 25.71 ? 36   M3L L CB  1 
HETATM 6753  C CG  . M3L L  2 15  ? -3.189  -39.960 -40.629 1.00 27.62 ? 36   M3L L CG  1 
HETATM 6754  C CD  . M3L L  2 15  ? -3.827  -40.456 -39.336 1.00 25.96 ? 36   M3L L CD  1 
HETATM 6755  C CE  . M3L L  2 15  ? -3.387  -39.741 -38.086 1.00 25.81 ? 36   M3L L CE  1 
HETATM 6756  N NZ  . M3L L  2 15  ? -4.080  -40.126 -36.886 1.00 25.49 ? 36   M3L L NZ  1 
HETATM 6757  C C   . M3L L  2 15  ? -1.962  -40.795 -43.287 1.00 33.21 ? 36   M3L L C   1 
HETATM 6758  O O   . M3L L  2 15  ? -2.085  -41.993 -43.230 1.00 34.30 ? 36   M3L L O   1 
HETATM 6759  C CM1 . M3L L  2 15  ? -4.266  -41.579 -36.889 1.00 26.46 ? 36   M3L L CM1 1 
HETATM 6760  C CM2 . M3L L  2 15  ? -5.383  -39.481 -36.924 1.00 21.96 ? 36   M3L L CM2 1 
HETATM 6761  C CM3 . M3L L  2 15  ? -3.351  -39.616 -35.756 1.00 27.66 ? 36   M3L L CM3 1 
ATOM   6762  N N   . LYS L  2 16  ? -0.794  -40.161 -43.448 1.00 32.56 ? 37   LYS L N   1 
ATOM   6763  C CA  . LYS L  2 16  ? 0.477   -40.885 -43.638 1.00 32.29 ? 37   LYS L CA  1 
ATOM   6764  C C   . LYS L  2 16  ? 1.555   -40.288 -42.727 1.00 28.39 ? 37   LYS L C   1 
ATOM   6765  O O   . LYS L  2 16  ? 1.570   -39.101 -42.527 1.00 30.23 ? 37   LYS L O   1 
ATOM   6766  C CB  . LYS L  2 16  ? 0.939   -40.779 -45.096 1.00 37.66 ? 37   LYS L CB  1 
ATOM   6767  C CG  . LYS L  2 16  ? -0.045  -41.350 -46.137 1.00 42.73 ? 37   LYS L CG  1 
ATOM   6768  C CD  . LYS L  2 16  ? 0.002   -40.556 -47.446 1.00 48.14 ? 37   LYS L CD  1 
ATOM   6769  C CE  . LYS L  2 16  ? -0.969  -41.120 -48.497 1.00 52.50 ? 37   LYS L CE  1 
ATOM   6770  N NZ  . LYS L  2 16  ? -1.240  -40.161 -49.636 1.00 56.65 ? 37   LYS L NZ  1 
ATOM   6771  N N   . PRO L  2 17  ? 2.441   -41.130 -42.181 1.00 32.99 ? 38   PRO L N   1 
ATOM   6772  C CA  . PRO L  2 17  ? 3.515   -40.691 -41.283 1.00 33.23 ? 38   PRO L CA  1 
ATOM   6773  C C   . PRO L  2 17  ? 4.650   -40.037 -42.065 1.00 34.74 ? 38   PRO L C   1 
ATOM   6774  O O   . PRO L  2 17  ? 5.416   -39.260 -41.485 1.00 33.32 ? 38   PRO L O   1 
ATOM   6775  C CB  . PRO L  2 17  ? 4.012   -42.004 -40.630 1.00 30.55 ? 38   PRO L CB  1 
ATOM   6776  C CG  . PRO L  2 17  ? 3.336   -43.126 -41.327 1.00 37.08 ? 38   PRO L CG  1 
ATOM   6777  C CD  . PRO L  2 17  ? 2.475   -42.573 -42.442 1.00 33.20 ? 38   PRO L CD  1 
ATOM   6778  N N   . HIS L  2 18  ? 4.713   -40.335 -43.363 1.00 34.20 ? 39   HIS L N   1 
ATOM   6779  C CA  . HIS L  2 18  ? 5.705   -39.760 -44.283 1.00 36.59 ? 39   HIS L CA  1 
ATOM   6780  C C   . HIS L  2 18  ? 5.046   -38.900 -45.354 1.00 39.02 ? 39   HIS L C   1 
ATOM   6781  O O   . HIS L  2 18  ? 5.473   -37.765 -45.575 1.00 42.27 ? 39   HIS L O   1 
ATOM   6782  C CB  . HIS L  2 18  ? 6.532   -40.874 -44.958 1.00 38.44 ? 39   HIS L CB  1 
ATOM   6783  C CG  . HIS L  2 18  ? 6.980   -41.953 -44.015 1.00 39.91 ? 39   HIS L CG  1 
ATOM   6784  N ND1 . HIS L  2 18  ? 7.856   -41.719 -42.976 1.00 38.44 ? 39   HIS L ND1 1 
ATOM   6785  C CD2 . HIS L  2 18  ? 6.651   -43.266 -43.942 1.00 42.45 ? 39   HIS L CD2 1 
ATOM   6786  C CE1 . HIS L  2 18  ? 8.058   -42.846 -42.310 1.00 36.54 ? 39   HIS L CE1 1 
ATOM   6787  N NE2 . HIS L  2 18  ? 7.341   -43.800 -42.876 1.00 44.16 ? 39   HIS L NE2 1 
ATOM   6788  N N   . ASP M  1 7   ? -4.868  -65.386 3.692   1.00 54.94 ? 1080 ASP M N   1 
ATOM   6789  C CA  . ASP M  1 7   ? -6.312  -65.467 3.922   1.00 50.84 ? 1080 ASP M CA  1 
ATOM   6790  C C   . ASP M  1 7   ? -6.912  -66.707 3.244   1.00 49.35 ? 1080 ASP M C   1 
ATOM   6791  O O   . ASP M  1 7   ? -6.368  -67.815 3.340   1.00 52.99 ? 1080 ASP M O   1 
ATOM   6792  C CB  . ASP M  1 7   ? -7.038  -64.204 3.435   1.00 46.07 ? 1080 ASP M CB  1 
ATOM   6793  C CG  . ASP M  1 7   ? -6.117  -63.001 3.275   1.00 48.09 ? 1080 ASP M CG  1 
ATOM   6794  O OD1 . ASP M  1 7   ? -6.505  -61.888 3.724   1.00 56.37 ? 1080 ASP M OD1 1 
ATOM   6795  O OD2 . ASP M  1 7   ? -5.024  -63.147 2.686   1.00 46.94 ? 1080 ASP M OD2 1 
ATOM   6796  N N   . SER M  1 8   ? -8.026  -66.516 2.549   1.00 44.73 ? 1081 SER M N   1 
ATOM   6797  C CA  . SER M  1 8   ? -8.749  -67.633 1.953   1.00 46.47 ? 1081 SER M CA  1 
ATOM   6798  C C   . SER M  1 8   ? -8.065  -68.086 0.685   1.00 42.82 ? 1081 SER M C   1 
ATOM   6799  O O   . SER M  1 8   ? -7.477  -67.283 -0.015  1.00 38.28 ? 1081 SER M O   1 
ATOM   6800  C CB  . SER M  1 8   ? -10.176 -67.212 1.608   1.00 48.92 ? 1081 SER M CB  1 
ATOM   6801  O OG  . SER M  1 8   ? -10.144 -66.179 0.642   1.00 50.76 ? 1081 SER M OG  1 
ATOM   6802  N N   . PRO M  1 9   ? -8.134  -69.388 0.387   1.00 45.16 ? 1082 PRO M N   1 
ATOM   6803  C CA  . PRO M  1 9   ? -7.603  -69.883 -0.890  1.00 39.75 ? 1082 PRO M CA  1 
ATOM   6804  C C   . PRO M  1 9   ? -8.300  -69.238 -2.092  1.00 33.89 ? 1082 PRO M C   1 
ATOM   6805  O O   . PRO M  1 9   ? -9.488  -68.889 -2.054  1.00 40.39 ? 1082 PRO M O   1 
ATOM   6806  C CB  . PRO M  1 9   ? -7.930  -71.384 -0.853  1.00 43.84 ? 1082 PRO M CB  1 
ATOM   6807  C CG  . PRO M  1 9   ? -8.073  -71.714 0.602   1.00 44.40 ? 1082 PRO M CG  1 
ATOM   6808  C CD  . PRO M  1 9   ? -8.622  -70.472 1.259   1.00 44.51 ? 1082 PRO M CD  1 
ATOM   6809  N N   . LEU M  1 10  ? -7.545  -69.089 -3.165  1.00 34.43 ? 1083 LEU M N   1 
ATOM   6810  C CA  . LEU M  1 10  ? -8.073  -68.568 -4.416  1.00 29.92 ? 1083 LEU M CA  1 
ATOM   6811  C C   . LEU M  1 10  ? -8.209  -69.701 -5.419  1.00 31.36 ? 1083 LEU M C   1 
ATOM   6812  O O   . LEU M  1 10  ? -7.565  -70.757 -5.262  1.00 30.90 ? 1083 LEU M O   1 
ATOM   6813  C CB  . LEU M  1 10  ? -7.098  -67.553 -4.956  1.00 24.85 ? 1083 LEU M CB  1 
ATOM   6814  C CG  . LEU M  1 10  ? -6.803  -66.454 -3.921  1.00 25.06 ? 1083 LEU M CG  1 
ATOM   6815  C CD1 . LEU M  1 10  ? -5.739  -65.514 -4.434  1.00 32.45 ? 1083 LEU M CD1 1 
ATOM   6816  C CD2 . LEU M  1 10  ? -8.087  -65.694 -3.583  1.00 29.12 ? 1083 LEU M CD2 1 
ATOM   6817  N N   . ASP M  1 11  ? -9.028  -69.488 -6.446  1.00 27.71 ? 1084 ASP M N   1 
ATOM   6818  C CA  . ASP M  1 11  ? -9.303  -70.555 -7.417  1.00 26.90 ? 1084 ASP M CA  1 
ATOM   6819  C C   . ASP M  1 11  ? -8.621  -70.321 -8.754  1.00 26.48 ? 1084 ASP M C   1 
ATOM   6820  O O   . ASP M  1 11  ? -8.388  -69.192 -9.164  1.00 22.88 ? 1084 ASP M O   1 
ATOM   6821  C CB  . ASP M  1 11  ? -10.798 -70.692 -7.680  1.00 27.81 ? 1084 ASP M CB  1 
ATOM   6822  C CG  . ASP M  1 11  ? -11.597 -71.101 -6.441  1.00 38.46 ? 1084 ASP M CG  1 
ATOM   6823  O OD1 . ASP M  1 11  ? -12.816 -70.843 -6.444  1.00 44.59 ? 1084 ASP M OD1 1 
ATOM   6824  O OD2 . ASP M  1 11  ? -11.029 -71.649 -5.471  1.00 40.49 ? 1084 ASP M OD2 1 
ATOM   6825  N N   . ALA M  1 12  ? -8.357  -71.395 -9.479  1.00 25.04 ? 1085 ALA M N   1 
ATOM   6826  C CA  . ALA M  1 12  ? -7.842  -71.260 -10.832 1.00 24.30 ? 1085 ALA M CA  1 
ATOM   6827  C C   . ALA M  1 12  ? -8.787  -70.393 -11.684 1.00 24.07 ? 1085 ALA M C   1 
ATOM   6828  O O   . ALA M  1 12  ? -10.024 -70.492 -11.563 1.00 26.03 ? 1085 ALA M O   1 
ATOM   6829  C CB  . ALA M  1 12  ? -7.656  -72.639 -11.478 1.00 27.44 ? 1085 ALA M CB  1 
ATOM   6830  N N   . LEU M  1 13  ? -8.183  -69.561 -12.523 1.00 20.50 ? 1086 LEU M N   1 
ATOM   6831  C CA  . LEU M  1 13  ? -8.910  -68.652 -13.398 1.00 22.28 ? 1086 LEU M CA  1 
ATOM   6832  C C   . LEU M  1 13  ? -9.508  -67.405 -12.674 1.00 22.12 ? 1086 LEU M C   1 
ATOM   6833  O O   . LEU M  1 13  ? -10.186 -66.588 -13.301 1.00 21.97 ? 1086 LEU M O   1 
ATOM   6834  C CB  . LEU M  1 13  ? -9.962  -69.392 -14.239 1.00 22.87 ? 1086 LEU M CB  1 
ATOM   6835  C CG  . LEU M  1 13  ? -9.412  -70.658 -14.915 1.00 28.60 ? 1086 LEU M CG  1 
ATOM   6836  C CD1 . LEU M  1 13  ? -10.512 -71.307 -15.766 1.00 36.01 ? 1086 LEU M CD1 1 
ATOM   6837  C CD2 . LEU M  1 13  ? -8.113  -70.381 -15.736 1.00 27.39 ? 1086 LEU M CD2 1 
ATOM   6838  N N   . ASP M  1 14  ? -9.227  -67.259 -11.378 1.00 20.54 ? 1087 ASP M N   1 
ATOM   6839  C CA  . ASP M  1 14  ? -9.424  -65.971 -10.673 1.00 22.03 ? 1087 ASP M CA  1 
ATOM   6840  C C   . ASP M  1 14  ? -8.531  -64.874 -11.261 1.00 20.49 ? 1087 ASP M C   1 
ATOM   6841  O O   . ASP M  1 14  ? -7.345  -65.151 -11.622 1.00 19.28 ? 1087 ASP M O   1 
ATOM   6842  C CB  . ASP M  1 14  ? -9.087  -66.097 -9.152  1.00 23.74 ? 1087 ASP M CB  1 
ATOM   6843  C CG  . ASP M  1 14  ? -10.185 -66.781 -8.331  1.00 27.17 ? 1087 ASP M CG  1 
ATOM   6844  O OD1 . ASP M  1 14  ? -11.253 -67.104 -8.893  1.00 31.97 ? 1087 ASP M OD1 1 
ATOM   6845  O OD2 . ASP M  1 14  ? -9.999  -66.983 -7.105  1.00 26.44 ? 1087 ASP M OD2 1 
ATOM   6846  N N   . LEU M  1 15  ? -9.054  -63.634 -11.353 1.00 17.08 ? 1088 LEU M N   1 
ATOM   6847  C CA  . LEU M  1 15  ? -8.181  -62.481 -11.638 1.00 17.35 ? 1088 LEU M CA  1 
ATOM   6848  C C   . LEU M  1 15  ? -7.660  -61.973 -10.315 1.00 16.06 ? 1088 LEU M C   1 
ATOM   6849  O O   . LEU M  1 15  ? -8.411  -61.856 -9.345  1.00 17.72 ? 1088 LEU M O   1 
ATOM   6850  C CB  . LEU M  1 15  ? -8.926  -61.329 -12.311 1.00 15.98 ? 1088 LEU M CB  1 
ATOM   6851  C CG  . LEU M  1 15  ? -9.608  -61.694 -13.619 1.00 21.62 ? 1088 LEU M CG  1 
ATOM   6852  C CD1 . LEU M  1 15  ? -10.541 -60.506 -13.998 1.00 25.57 ? 1088 LEU M CD1 1 
ATOM   6853  C CD2 . LEU M  1 15  ? -8.549  -61.887 -14.646 1.00 22.24 ? 1088 LEU M CD2 1 
ATOM   6854  N N   . VAL M  1 16  ? -6.374  -61.656 -10.311 1.00 16.54 ? 1089 VAL M N   1 
ATOM   6855  C CA  . VAL M  1 16  ? -5.719  -61.163 -9.136  1.00 15.94 ? 1089 VAL M CA  1 
ATOM   6856  C C   . VAL M  1 16  ? -4.723  -60.067 -9.447  1.00 17.88 ? 1089 VAL M C   1 
ATOM   6857  O O   . VAL M  1 16  ? -4.231  -59.883 -10.586 1.00 18.45 ? 1089 VAL M O   1 
ATOM   6858  C CB  . VAL M  1 16  ? -4.965  -62.323 -8.415  1.00 18.21 ? 1089 VAL M CB  1 
ATOM   6859  C CG1 . VAL M  1 16  ? -5.967  -63.374 -7.914  1.00 20.60 ? 1089 VAL M CG1 1 
ATOM   6860  C CG2 . VAL M  1 16  ? -3.925  -62.946 -9.346  1.00 19.88 ? 1089 VAL M CG2 1 
ATOM   6861  N N   . TRP M  1 17  ? -4.455  -59.268 -8.405  1.00 13.44 ? 1090 TRP M N   1 
ATOM   6862  C CA  . TRP M  1 17  ? -3.290  -58.427 -8.451  1.00 15.52 ? 1090 TRP M CA  1 
ATOM   6863  C C   . TRP M  1 17  ? -2.199  -59.288 -7.891  1.00 17.08 ? 1090 TRP M C   1 
ATOM   6864  O O   . TRP M  1 17  ? -2.374  -59.832 -6.796  1.00 19.42 ? 1090 TRP M O   1 
ATOM   6865  C CB  . TRP M  1 17  ? -3.515  -57.250 -7.475  1.00 18.63 ? 1090 TRP M CB  1 
ATOM   6866  C CG  . TRP M  1 17  ? -4.508  -56.271 -7.977  1.00 18.92 ? 1090 TRP M CG  1 
ATOM   6867  C CD1 . TRP M  1 17  ? -5.828  -56.163 -7.605  1.00 15.88 ? 1090 TRP M CD1 1 
ATOM   6868  C CD2 . TRP M  1 17  ? -4.274  -55.237 -8.941  1.00 15.75 ? 1090 TRP M CD2 1 
ATOM   6869  N NE1 . TRP M  1 17  ? -6.422  -55.130 -8.287  1.00 15.79 ? 1090 TRP M NE1 1 
ATOM   6870  C CE2 . TRP M  1 17  ? -5.495  -54.558 -9.125  1.00 17.37 ? 1090 TRP M CE2 1 
ATOM   6871  C CE3 . TRP M  1 17  ? -3.145  -54.824 -9.673  1.00 16.12 ? 1090 TRP M CE3 1 
ATOM   6872  C CZ2 . TRP M  1 17  ? -5.619  -53.455 -9.975  1.00 15.95 ? 1090 TRP M CZ2 1 
ATOM   6873  C CZ3 . TRP M  1 17  ? -3.271  -53.695 -10.511 1.00 17.24 ? 1090 TRP M CZ3 1 
ATOM   6874  C CH2 . TRP M  1 17  ? -4.500  -53.055 -10.671 1.00 21.31 ? 1090 TRP M CH2 1 
ATOM   6875  N N   . ALA M  1 18  ? -1.055  -59.329 -8.576  1.00 17.08 ? 1091 ALA M N   1 
ATOM   6876  C CA  . ALA M  1 18  ? 0.063   -60.229 -8.207  1.00 16.01 ? 1091 ALA M CA  1 
ATOM   6877  C C   . ALA M  1 18  ? 1.332   -59.420 -8.048  1.00 19.78 ? 1091 ALA M C   1 
ATOM   6878  O O   . ALA M  1 18  ? 1.735   -58.710 -8.974  1.00 18.97 ? 1091 ALA M O   1 
ATOM   6879  C CB  . ALA M  1 18  ? 0.273   -61.320 -9.326  1.00 18.67 ? 1091 ALA M CB  1 
ATOM   6880  N N   . LYS M  1 19  ? 1.938   -59.514 -6.858  1.00 21.07 ? 1092 LYS M N   1 
ATOM   6881  C CA  . LYS M  1 19  ? 3.078   -58.688 -6.507  1.00 23.41 ? 1092 LYS M CA  1 
ATOM   6882  C C   . LYS M  1 19  ? 4.386   -59.468 -6.645  1.00 27.20 ? 1092 LYS M C   1 
ATOM   6883  O O   . LYS M  1 19  ? 4.571   -60.485 -5.996  1.00 30.39 ? 1092 LYS M O   1 
ATOM   6884  C CB  . LYS M  1 19  ? 2.905   -58.190 -5.072  1.00 25.84 ? 1092 LYS M CB  1 
ATOM   6885  C CG  . LYS M  1 19  ? 4.063   -57.288 -4.639  1.00 31.53 ? 1092 LYS M CG  1 
ATOM   6886  C CD  . LYS M  1 19  ? 4.046   -55.961 -5.369  1.00 24.37 ? 1092 LYS M CD  1 
ATOM   6887  C CE  . LYS M  1 19  ? 5.072   -54.950 -4.740  1.00 29.10 ? 1092 LYS M CE  1 
ATOM   6888  N NZ  . LYS M  1 19  ? 6.472   -55.504 -4.820  1.00 32.36 ? 1092 LYS M NZ  1 
ATOM   6889  N N   . CYS M  1 20  ? 5.268   -58.987 -7.505  1.00 28.26 ? 1093 CYS M N   1 
ATOM   6890  C CA  . CYS M  1 20  ? 6.610   -59.535 -7.675  1.00 31.41 ? 1093 CYS M CA  1 
ATOM   6891  C C   . CYS M  1 20  ? 7.619   -58.564 -7.066  1.00 35.96 ? 1093 CYS M C   1 
ATOM   6892  O O   . CYS M  1 20  ? 7.450   -57.353 -7.177  1.00 31.24 ? 1093 CYS M O   1 
ATOM   6893  C CB  . CYS M  1 20  ? 6.922   -59.621 -9.160  1.00 31.77 ? 1093 CYS M CB  1 
ATOM   6894  S SG  . CYS M  1 20  ? 6.152   -61.003 -9.932  1.00 40.04 ? 1093 CYS M SG  1 
ATOM   6895  N N   . ARG M  1 21  ? 8.700   -59.083 -6.474  1.00 39.45 ? 1094 ARG M N   1 
ATOM   6896  C CA  . ARG M  1 21  ? 9.724   -58.204 -5.901  1.00 42.11 ? 1094 ARG M CA  1 
ATOM   6897  C C   . ARG M  1 21  ? 10.111  -57.061 -6.840  1.00 37.78 ? 1094 ARG M C   1 
ATOM   6898  O O   . ARG M  1 21  ? 10.467  -57.296 -7.996  1.00 38.33 ? 1094 ARG M O   1 
ATOM   6899  C CB  . ARG M  1 21  ? 10.980  -59.006 -5.488  1.00 50.97 ? 1094 ARG M CB  1 
ATOM   6900  C CG  . ARG M  1 21  ? 11.678  -59.729 -6.643  1.00 53.70 ? 1094 ARG M CG  1 
ATOM   6901  C CD  . ARG M  1 21  ? 12.912  -60.560 -6.212  1.00 57.86 ? 1094 ARG M CD  1 
ATOM   6902  N NE  . ARG M  1 21  ? 14.003  -59.753 -5.646  1.00 60.42 ? 1094 ARG M NE  1 
ATOM   6903  C CZ  . ARG M  1 21  ? 14.831  -58.978 -6.353  1.00 61.36 ? 1094 ARG M CZ  1 
ATOM   6904  N NH1 . ARG M  1 21  ? 15.797  -58.294 -5.740  1.00 58.75 ? 1094 ARG M NH1 1 
ATOM   6905  N NH2 . ARG M  1 21  ? 14.690  -58.869 -7.671  1.00 59.30 ? 1094 ARG M NH2 1 
ATOM   6906  N N   . GLY M  1 22  ? 10.009  -55.827 -6.338  1.00 40.29 ? 1095 GLY M N   1 
ATOM   6907  C CA  . GLY M  1 22  ? 10.471  -54.647 -7.060  1.00 38.15 ? 1095 GLY M CA  1 
ATOM   6908  C C   . GLY M  1 22  ? 9.624   -54.170 -8.231  1.00 38.84 ? 1095 GLY M C   1 
ATOM   6909  O O   . GLY M  1 22  ? 9.971   -53.202 -8.903  1.00 38.35 ? 1095 GLY M O   1 
ATOM   6910  N N   . TYR M  1 23  ? 8.524   -54.865 -8.500  1.00 34.23 ? 1096 TYR M N   1 
ATOM   6911  C CA  . TYR M  1 23  ? 7.536   -54.385 -9.471  1.00 31.88 ? 1096 TYR M CA  1 
ATOM   6912  C C   . TYR M  1 23  ? 6.294   -54.010 -8.696  1.00 25.95 ? 1096 TYR M C   1 
ATOM   6913  O O   . TYR M  1 23  ? 6.035   -54.596 -7.655  1.00 27.96 ? 1096 TYR M O   1 
ATOM   6914  C CB  . TYR M  1 23  ? 7.114   -55.514 -10.402 1.00 29.60 ? 1096 TYR M CB  1 
ATOM   6915  C CG  . TYR M  1 23  ? 8.131   -55.961 -11.433 1.00 29.29 ? 1096 TYR M CG  1 
ATOM   6916  C CD1 . TYR M  1 23  ? 8.553   -55.108 -12.441 1.00 34.49 ? 1096 TYR M CD1 1 
ATOM   6917  C CD2 . TYR M  1 23  ? 8.631   -57.253 -11.407 1.00 32.90 ? 1096 TYR M CD2 1 
ATOM   6918  C CE1 . TYR M  1 23  ? 9.478   -55.542 -13.398 1.00 36.47 ? 1096 TYR M CE1 1 
ATOM   6919  C CE2 . TYR M  1 23  ? 9.552   -57.696 -12.357 1.00 33.44 ? 1096 TYR M CE2 1 
ATOM   6920  C CZ  . TYR M  1 23  ? 9.979   -56.838 -13.338 1.00 38.66 ? 1096 TYR M CZ  1 
ATOM   6921  O OH  . TYR M  1 23  ? 10.900  -57.306 -14.273 1.00 39.42 ? 1096 TYR M OH  1 
ATOM   6922  N N   . PRO M  1 24  ? 5.469   -53.092 -9.235  1.00 24.80 ? 1097 PRO M N   1 
ATOM   6923  C CA  . PRO M  1 24  ? 4.211   -52.888 -8.508  1.00 26.34 ? 1097 PRO M CA  1 
ATOM   6924  C C   . PRO M  1 24  ? 3.245   -54.061 -8.725  1.00 26.75 ? 1097 PRO M C   1 
ATOM   6925  O O   . PRO M  1 24  ? 3.483   -54.834 -9.638  1.00 25.79 ? 1097 PRO M O   1 
ATOM   6926  C CB  . PRO M  1 24  ? 3.637   -51.623 -9.149  1.00 26.90 ? 1097 PRO M CB  1 
ATOM   6927  C CG  . PRO M  1 24  ? 4.136   -51.646 -10.511 1.00 28.80 ? 1097 PRO M CG  1 
ATOM   6928  C CD  . PRO M  1 24  ? 5.491   -52.378 -10.520 1.00 29.50 ? 1097 PRO M CD  1 
ATOM   6929  N N   . SER M  1 25  ? 2.170   -54.155 -7.940  1.00 24.81 ? 1098 SER M N   1 
ATOM   6930  C CA  . SER M  1 25  ? 1.177   -55.215 -8.114  1.00 22.14 ? 1098 SER M CA  1 
ATOM   6931  C C   . SER M  1 25  ? 0.676   -55.164 -9.545  1.00 19.66 ? 1098 SER M C   1 
ATOM   6932  O O   . SER M  1 25  ? 0.473   -54.086 -10.093 1.00 21.25 ? 1098 SER M O   1 
ATOM   6933  C CB  . SER M  1 25  ? -0.015  -55.002 -7.195  1.00 26.69 ? 1098 SER M CB  1 
ATOM   6934  O OG  . SER M  1 25  ? 0.384   -54.955 -5.826  1.00 33.06 ? 1098 SER M OG  1 
ATOM   6935  N N   . TYR M  1 26  ? 0.446   -56.320 -10.149 1.00 18.12 ? 1099 TYR M N   1 
ATOM   6936  C CA  . TYR M  1 26  ? 0.201   -56.326 -11.594 1.00 17.94 ? 1099 TYR M CA  1 
ATOM   6937  C C   . TYR M  1 26  ? -0.908  -57.328 -11.907 1.00 16.50 ? 1099 TYR M C   1 
ATOM   6938  O O   . TYR M  1 26  ? -0.944  -58.440 -11.345 1.00 17.86 ? 1099 TYR M O   1 
ATOM   6939  C CB  . TYR M  1 26  ? 1.513   -56.692 -12.333 1.00 18.74 ? 1099 TYR M CB  1 
ATOM   6940  C CG  . TYR M  1 26  ? 1.572   -56.269 -13.782 1.00 20.04 ? 1099 TYR M CG  1 
ATOM   6941  C CD1 . TYR M  1 26  ? 0.911   -57.010 -14.771 1.00 18.47 ? 1099 TYR M CD1 1 
ATOM   6942  C CD2 . TYR M  1 26  ? 2.319   -55.163 -14.183 1.00 23.00 ? 1099 TYR M CD2 1 
ATOM   6943  C CE1 . TYR M  1 26  ? 0.974   -56.654 -16.079 1.00 20.34 ? 1099 TYR M CE1 1 
ATOM   6944  C CE2 . TYR M  1 26  ? 2.361   -54.766 -15.538 1.00 23.66 ? 1099 TYR M CE2 1 
ATOM   6945  C CZ  . TYR M  1 26  ? 1.698   -55.554 -16.470 1.00 24.28 ? 1099 TYR M CZ  1 
ATOM   6946  O OH  . TYR M  1 26  ? 1.713   -55.211 -17.803 1.00 27.70 ? 1099 TYR M OH  1 
ATOM   6947  N N   . PRO M  1 27  ? -1.830  -56.963 -12.789 1.00 15.06 ? 1100 PRO M N   1 
ATOM   6948  C CA  . PRO M  1 27  ? -2.952  -57.874 -13.042 1.00 14.56 ? 1100 PRO M CA  1 
ATOM   6949  C C   . PRO M  1 27  ? -2.526  -59.162 -13.686 1.00 17.04 ? 1100 PRO M C   1 
ATOM   6950  O O   . PRO M  1 27  ? -1.659  -59.182 -14.581 1.00 18.22 ? 1100 PRO M O   1 
ATOM   6951  C CB  . PRO M  1 27  ? -3.771  -57.105 -14.099 1.00 15.53 ? 1100 PRO M CB  1 
ATOM   6952  C CG  . PRO M  1 27  ? -3.562  -55.664 -13.695 1.00 16.13 ? 1100 PRO M CG  1 
ATOM   6953  C CD  . PRO M  1 27  ? -2.075  -55.616 -13.347 1.00 14.58 ? 1100 PRO M CD  1 
ATOM   6954  N N   . ALA M  1 28  ? -3.164  -60.225 -13.243 1.00 15.48 ? 1101 ALA M N   1 
ATOM   6955  C CA  . ALA M  1 28  ? -2.845  -61.605 -13.660 1.00 15.38 ? 1101 ALA M CA  1 
ATOM   6956  C C   . ALA M  1 28  ? -4.004  -62.526 -13.516 1.00 17.76 ? 1101 ALA M C   1 
ATOM   6957  O O   . ALA M  1 28  ? -4.994  -62.222 -12.868 1.00 17.69 ? 1101 ALA M O   1 
ATOM   6958  C CB  . ALA M  1 28  ? -1.647  -62.161 -12.824 1.00 18.21 ? 1101 ALA M CB  1 
ATOM   6959  N N   . LEU M  1 29  ? -3.836  -63.736 -14.089 1.00 18.77 ? 1102 LEU M N   1 
ATOM   6960  C CA  . LEU M  1 29  ? -4.840  -64.772 -14.033 1.00 18.62 ? 1102 LEU M CA  1 
ATOM   6961  C C   . LEU M  1 29  ? -4.222  -65.970 -13.330 1.00 20.65 ? 1102 LEU M C   1 
ATOM   6962  O O   . LEU M  1 29  ? -3.098  -66.363 -13.677 1.00 20.51 ? 1102 LEU M O   1 
ATOM   6963  C CB  . LEU M  1 29  ? -5.155  -65.193 -15.485 1.00 20.35 ? 1102 LEU M CB  1 
ATOM   6964  C CG  . LEU M  1 29  ? -6.265  -66.217 -15.642 1.00 22.10 ? 1102 LEU M CG  1 
ATOM   6965  C CD1 . LEU M  1 29  ? -7.595  -65.679 -15.211 1.00 21.40 ? 1102 LEU M CD1 1 
ATOM   6966  C CD2 . LEU M  1 29  ? -6.286  -66.594 -17.140 1.00 25.89 ? 1102 LEU M CD2 1 
ATOM   6967  N N   . ILE M  1 30  ? -4.925  -66.545 -12.360 1.00 19.73 ? 1103 ILE M N   1 
ATOM   6968  C CA  . ILE M  1 30  ? -4.423  -67.752 -11.726 1.00 19.67 ? 1103 ILE M CA  1 
ATOM   6969  C C   . ILE M  1 30  ? -4.660  -68.936 -12.682 1.00 23.10 ? 1103 ILE M C   1 
ATOM   6970  O O   . ILE M  1 30  ? -5.754  -69.093 -13.240 1.00 21.60 ? 1103 ILE M O   1 
ATOM   6971  C CB  . ILE M  1 30  ? -5.153  -68.028 -10.438 1.00 20.36 ? 1103 ILE M CB  1 
ATOM   6972  C CG1 . ILE M  1 30  ? -4.909  -66.893 -9.453  1.00 21.16 ? 1103 ILE M CG1 1 
ATOM   6973  C CG2 . ILE M  1 30  ? -4.619  -69.325 -9.768  1.00 22.03 ? 1103 ILE M CG2 1 
ATOM   6974  C CD1 . ILE M  1 30  ? -5.490  -67.202 -8.068  1.00 24.74 ? 1103 ILE M CD1 1 
ATOM   6975  N N   . ILE M  1 31  ? -3.645  -69.781 -12.831 1.00 19.26 ? 1104 ILE M N   1 
ATOM   6976  C CA  . ILE M  1 31  ? -3.724  -70.883 -13.791 1.00 19.24 ? 1104 ILE M CA  1 
ATOM   6977  C C   . ILE M  1 31  ? -3.531  -72.185 -13.028 1.00 27.39 ? 1104 ILE M C   1 
ATOM   6978  O O   . ILE M  1 31  ? -2.677  -72.271 -12.135 1.00 28.44 ? 1104 ILE M O   1 
ATOM   6979  C CB  . ILE M  1 31  ? -2.655  -70.712 -14.930 1.00 19.86 ? 1104 ILE M CB  1 
ATOM   6980  C CG1 . ILE M  1 31  ? -2.831  -69.399 -15.711 1.00 24.34 ? 1104 ILE M CG1 1 
ATOM   6981  C CG2 . ILE M  1 31  ? -2.643  -71.947 -15.871 1.00 23.50 ? 1104 ILE M CG2 1 
ATOM   6982  C CD1 . ILE M  1 31  ? -4.009  -69.363 -16.708 1.00 25.05 ? 1104 ILE M CD1 1 
ATOM   6983  N N   . ASP M  1 32  ? -4.333  -73.201 -13.368 1.00 24.16 ? 1105 ASP M N   1 
ATOM   6984  C CA  . ASP M  1 32  ? -4.190  -74.505 -12.726 1.00 25.82 ? 1105 ASP M CA  1 
ATOM   6985  C C   . ASP M  1 32  ? -3.010  -75.257 -13.345 1.00 30.49 ? 1105 ASP M C   1 
ATOM   6986  O O   . ASP M  1 32  ? -3.028  -75.543 -14.543 1.00 30.54 ? 1105 ASP M O   1 
ATOM   6987  C CB  . ASP M  1 32  ? -5.508  -75.298 -12.918 1.00 30.68 ? 1105 ASP M CB  1 
ATOM   6988  C CG  . ASP M  1 32  ? -5.398  -76.748 -12.472 1.00 33.91 ? 1105 ASP M CG  1 
ATOM   6989  O OD1 . ASP M  1 32  ? -4.338  -77.128 -11.979 1.00 33.58 ? 1105 ASP M OD1 1 
ATOM   6990  O OD2 . ASP M  1 32  ? -6.382  -77.499 -12.608 1.00 40.44 ? 1105 ASP M OD2 1 
ATOM   6991  N N   . PRO M  1 33  ? -1.968  -75.558 -12.551 1.00 28.25 ? 1106 PRO M N   1 
ATOM   6992  C CA  . PRO M  1 33  ? -0.781  -76.230 -13.115 1.00 32.99 ? 1106 PRO M CA  1 
ATOM   6993  C C   . PRO M  1 33  ? -1.108  -77.604 -13.709 1.00 29.48 ? 1106 PRO M C   1 
ATOM   6994  O O   . PRO M  1 33  ? -0.369  -78.112 -14.533 1.00 30.99 ? 1106 PRO M O   1 
ATOM   6995  C CB  . PRO M  1 33  ? 0.112   -76.468 -11.899 1.00 31.13 ? 1106 PRO M CB  1 
ATOM   6996  C CG  . PRO M  1 33  ? -0.332  -75.528 -10.881 1.00 30.88 ? 1106 PRO M CG  1 
ATOM   6997  C CD  . PRO M  1 33  ? -1.766  -75.172 -11.147 1.00 30.19 ? 1106 PRO M CD  1 
ATOM   6998  N N   . LYS M  1 34  ? -2.213  -78.180 -13.281 1.00 32.95 ? 1107 LYS M N   1 
ATOM   6999  C CA  . LYS M  1 34  ? -2.579  -79.500 -13.767 1.00 32.39 ? 1107 LYS M CA  1 
ATOM   7000  C C   . LYS M  1 34  ? -3.584  -79.449 -14.918 1.00 36.45 ? 1107 LYS M C   1 
ATOM   7001  O O   . LYS M  1 34  ? -4.121  -80.482 -15.329 1.00 31.84 ? 1107 LYS M O   1 
ATOM   7002  C CB  . LYS M  1 34  ? -3.119  -80.331 -12.612 1.00 39.10 ? 1107 LYS M CB  1 
ATOM   7003  C CG  . LYS M  1 34  ? -2.045  -80.841 -11.652 1.00 45.93 ? 1107 LYS M CG  1 
ATOM   7004  C CD  . LYS M  1 34  ? -2.689  -81.670 -10.549 1.00 53.03 ? 1107 LYS M CD  1 
ATOM   7005  C CE  . LYS M  1 34  ? -1.663  -82.240 -9.576  1.00 60.20 ? 1107 LYS M CE  1 
ATOM   7006  N NZ  . LYS M  1 34  ? -2.248  -82.359 -8.193  1.00 58.59 ? 1107 LYS M NZ  1 
ATOM   7007  N N   . MET M  1 35  ? -3.856  -78.261 -15.452 1.00 31.54 ? 1108 MET M N   1 
ATOM   7008  C CA  . MET M  1 35  ? -4.803  -78.178 -16.566 1.00 35.17 ? 1108 MET M CA  1 
ATOM   7009  C C   . MET M  1 35  ? -4.328  -79.037 -17.737 1.00 36.33 ? 1108 MET M C   1 
ATOM   7010  O O   . MET M  1 35  ? -3.123  -79.210 -17.921 1.00 36.38 ? 1108 MET M O   1 
ATOM   7011  C CB  . MET M  1 35  ? -4.960  -76.729 -17.035 1.00 32.65 ? 1108 MET M CB  1 
ATOM   7012  C CG  . MET M  1 35  ? -3.734  -76.237 -17.768 1.00 33.01 ? 1108 MET M CG  1 
ATOM   7013  S SD  . MET M  1 35  ? -3.813  -74.512 -18.337 1.00 34.54 ? 1108 MET M SD  1 
ATOM   7014  C CE  . MET M  1 35  ? -5.290  -74.543 -19.330 1.00 36.07 ? 1108 MET M CE  1 
ATOM   7015  N N   . PRO M  1 36  ? -5.268  -79.545 -18.563 1.00 35.19 ? 1109 PRO M N   1 
ATOM   7016  C CA  . PRO M  1 36  ? -4.876  -80.442 -19.659 1.00 40.51 ? 1109 PRO M CA  1 
ATOM   7017  C C   . PRO M  1 36  ? -3.741  -79.882 -20.499 1.00 39.18 ? 1109 PRO M C   1 
ATOM   7018  O O   . PRO M  1 36  ? -3.798  -78.731 -20.927 1.00 39.85 ? 1109 PRO M O   1 
ATOM   7019  C CB  . PRO M  1 36  ? -6.142  -80.535 -20.511 1.00 38.52 ? 1109 PRO M CB  1 
ATOM   7020  C CG  . PRO M  1 36  ? -7.255  -80.345 -19.540 1.00 41.22 ? 1109 PRO M CG  1 
ATOM   7021  C CD  . PRO M  1 36  ? -6.726  -79.362 -18.488 1.00 40.29 ? 1109 PRO M CD  1 
ATOM   7022  N N   . ARG M  1 37  ? -2.731  -80.699 -20.758 1.00 36.40 ? 1110 ARG M N   1 
ATOM   7023  C CA  . ARG M  1 37  ? -1.641  -80.292 -21.634 1.00 39.72 ? 1110 ARG M CA  1 
ATOM   7024  C C   . ARG M  1 37  ? -2.094  -79.890 -23.028 1.00 39.87 ? 1110 ARG M C   1 
ATOM   7025  O O   . ARG M  1 37  ? -1.419  -79.134 -23.717 1.00 37.51 ? 1110 ARG M O   1 
ATOM   7026  C CB  . ARG M  1 37  ? -0.626  -81.416 -21.748 1.00 37.86 ? 1110 ARG M CB  1 
ATOM   7027  C CG  . ARG M  1 37  ? -0.017  -81.770 -20.410 1.00 41.43 ? 1110 ARG M CG  1 
ATOM   7028  C CD  . ARG M  1 37  ? 0.485   -80.522 -19.692 1.00 41.02 ? 1110 ARG M CD  1 
ATOM   7029  N NE  . ARG M  1 37  ? 1.674   -79.948 -20.314 1.00 40.07 ? 1110 ARG M NE  1 
ATOM   7030  C CZ  . ARG M  1 37  ? 2.076   -78.702 -20.097 1.00 39.90 ? 1110 ARG M CZ  1 
ATOM   7031  N NH1 . ARG M  1 37  ? 3.166   -78.223 -20.670 1.00 40.56 ? 1110 ARG M NH1 1 
ATOM   7032  N NH2 . ARG M  1 37  ? 1.345   -77.927 -19.313 1.00 34.14 ? 1110 ARG M NH2 1 
ATOM   7033  N N   . GLU M  1 38  ? -3.245  -80.406 -23.440 1.00 43.33 ? 1111 GLU M N   1 
ATOM   7034  C CA  . GLU M  1 38  ? -3.783  -80.130 -24.763 1.00 43.07 ? 1111 GLU M CA  1 
ATOM   7035  C C   . GLU M  1 38  ? -4.546  -78.804 -24.773 1.00 43.09 ? 1111 GLU M C   1 
ATOM   7036  O O   . GLU M  1 38  ? -5.009  -78.349 -25.823 1.00 49.09 ? 1111 GLU M O   1 
ATOM   7037  C CB  . GLU M  1 38  ? -4.711  -81.279 -25.175 1.00 42.95 ? 1111 GLU M CB  1 
ATOM   7038  C CG  . GLU M  1 38  ? -5.592  -81.743 -24.022 1.00 43.46 ? 1111 GLU M CG  1 
ATOM   7039  C CD  . GLU M  1 38  ? -4.973  -82.869 -23.170 1.00 46.70 ? 1111 GLU M CD  1 
ATOM   7040  O OE1 . GLU M  1 38  ? -5.695  -83.416 -22.305 1.00 51.59 ? 1111 GLU M OE1 1 
ATOM   7041  O OE2 . GLU M  1 38  ? -3.787  -83.233 -23.365 1.00 49.40 ? 1111 GLU M OE2 1 
ATOM   7042  N N   . GLY M  1 39  ? -4.678  -78.188 -23.602 1.00 39.13 ? 1112 GLY M N   1 
ATOM   7043  C CA  . GLY M  1 39  ? -5.373  -76.921 -23.494 1.00 39.79 ? 1112 GLY M CA  1 
ATOM   7044  C C   . GLY M  1 39  ? -6.817  -77.070 -23.056 1.00 40.81 ? 1112 GLY M C   1 
ATOM   7045  O O   . GLY M  1 39  ? -7.337  -78.183 -22.903 1.00 39.10 ? 1112 GLY M O   1 
ATOM   7046  N N   . MET M  1 40  ? -7.484  -75.943 -22.846 1.00 38.22 ? 1113 MET M N   1 
ATOM   7047  C CA  . MET M  1 40  ? -8.830  -76.003 -22.309 1.00 38.30 ? 1113 MET M CA  1 
ATOM   7048  C C   . MET M  1 40  ? -9.543  -74.726 -22.641 1.00 35.37 ? 1113 MET M C   1 
ATOM   7049  O O   . MET M  1 40  ? -8.922  -73.731 -23.008 1.00 35.16 ? 1113 MET M O   1 
ATOM   7050  C CB  . MET M  1 40  ? -8.799  -76.201 -20.798 1.00 40.44 ? 1113 MET M CB  1 
ATOM   7051  C CG  . MET M  1 40  ? -8.317  -74.958 -20.100 1.00 42.58 ? 1113 MET M CG  1 
ATOM   7052  S SD  . MET M  1 40  ? -8.604  -75.017 -18.348 1.00 56.75 ? 1113 MET M SD  1 
ATOM   7053  C CE  . MET M  1 40  ? -10.298 -74.403 -18.280 1.00 39.40 ? 1113 MET M CE  1 
ATOM   7054  N N   . PHE M  1 41  ? -10.858 -74.790 -22.534 1.00 40.23 ? 1114 PHE M N   1 
ATOM   7055  C CA  . PHE M  1 41  ? -11.722 -73.669 -22.806 1.00 40.19 ? 1114 PHE M CA  1 
ATOM   7056  C C   . PHE M  1 41  ? -12.503 -73.358 -21.562 1.00 41.28 ? 1114 PHE M C   1 
ATOM   7057  O O   . PHE M  1 41  ? -13.073 -74.258 -20.952 1.00 44.97 ? 1114 PHE M O   1 
ATOM   7058  C CB  . PHE M  1 41  ? -12.670 -74.016 -23.954 1.00 41.29 ? 1114 PHE M CB  1 
ATOM   7059  C CG  . PHE M  1 41  ? -12.001 -73.982 -25.269 1.00 41.73 ? 1114 PHE M CG  1 
ATOM   7060  C CD1 . PHE M  1 41  ? -11.585 -75.157 -25.887 1.00 43.74 ? 1114 PHE M CD1 1 
ATOM   7061  C CD2 . PHE M  1 41  ? -11.713 -72.769 -25.868 1.00 41.11 ? 1114 PHE M CD2 1 
ATOM   7062  C CE1 . PHE M  1 41  ? -10.919 -75.118 -27.109 1.00 46.91 ? 1114 PHE M CE1 1 
ATOM   7063  C CE2 . PHE M  1 41  ? -11.053 -72.722 -27.093 1.00 42.96 ? 1114 PHE M CE2 1 
ATOM   7064  C CZ  . PHE M  1 41  ? -10.659 -73.896 -27.711 1.00 42.41 ? 1114 PHE M CZ  1 
ATOM   7065  N N   . HIS M  1 42  ? -12.518 -72.084 -21.181 1.00 40.81 ? 1115 HIS M N   1 
ATOM   7066  C CA  . HIS M  1 42  ? -13.297 -71.634 -20.039 1.00 37.93 ? 1115 HIS M CA  1 
ATOM   7067  C C   . HIS M  1 42  ? -14.450 -70.813 -20.604 1.00 38.42 ? 1115 HIS M C   1 
ATOM   7068  O O   . HIS M  1 42  ? -14.255 -69.720 -21.156 1.00 38.97 ? 1115 HIS M O   1 
ATOM   7069  C CB  . HIS M  1 42  ? -12.410 -70.821 -19.079 1.00 38.78 ? 1115 HIS M CB  1 
ATOM   7070  C CG  . HIS M  1 42  ? -13.094 -70.388 -17.819 1.00 34.62 ? 1115 HIS M CG  1 
ATOM   7071  N ND1 . HIS M  1 42  ? -13.843 -71.248 -17.041 1.00 40.72 ? 1115 HIS M ND1 1 
ATOM   7072  C CD2 . HIS M  1 42  ? -13.097 -69.197 -17.174 1.00 35.10 ? 1115 HIS M CD2 1 
ATOM   7073  C CE1 . HIS M  1 42  ? -14.307 -70.594 -15.991 1.00 44.66 ? 1115 HIS M CE1 1 
ATOM   7074  N NE2 . HIS M  1 42  ? -13.869 -69.347 -16.046 1.00 41.47 ? 1115 HIS M NE2 1 
ATOM   7075  N N   . HIS M  1 43  ? -15.652 -71.373 -20.498 1.00 43.59 ? 1116 HIS M N   1 
ATOM   7076  C CA  . HIS M  1 43  ? -16.823 -70.805 -21.159 1.00 40.39 ? 1116 HIS M CA  1 
ATOM   7077  C C   . HIS M  1 43  ? -16.431 -70.254 -22.511 1.00 41.22 ? 1116 HIS M C   1 
ATOM   7078  O O   . HIS M  1 43  ? -16.648 -69.082 -22.794 1.00 40.77 ? 1116 HIS M O   1 
ATOM   7079  C CB  . HIS M  1 43  ? -17.444 -69.723 -20.299 1.00 41.98 ? 1116 HIS M CB  1 
ATOM   7080  C CG  . HIS M  1 43  ? -17.640 -70.149 -18.882 1.00 43.36 ? 1116 HIS M CG  1 
ATOM   7081  N ND1 . HIS M  1 43  ? -18.885 -70.381 -18.341 1.00 44.88 ? 1116 HIS M ND1 1 
ATOM   7082  C CD2 . HIS M  1 43  ? -16.744 -70.436 -17.909 1.00 42.51 ? 1116 HIS M CD2 1 
ATOM   7083  C CE1 . HIS M  1 43  ? -18.748 -70.761 -17.082 1.00 51.94 ? 1116 HIS M CE1 1 
ATOM   7084  N NE2 . HIS M  1 43  ? -17.458 -70.797 -16.793 1.00 48.39 ? 1116 HIS M NE2 1 
ATOM   7085  N N   . GLY M  1 44  ? -15.812 -71.098 -23.328 1.00 41.58 ? 1117 GLY M N   1 
ATOM   7086  C CA  . GLY M  1 44  ? -15.481 -70.711 -24.681 1.00 41.26 ? 1117 GLY M CA  1 
ATOM   7087  C C   . GLY M  1 44  ? -14.144 -70.028 -24.856 1.00 40.69 ? 1117 GLY M C   1 
ATOM   7088  O O   . GLY M  1 44  ? -13.666 -69.903 -25.984 1.00 41.32 ? 1117 GLY M O   1 
ATOM   7089  N N   . VAL M  1 45  ? -13.524 -69.596 -23.760 1.00 33.56 ? 1118 VAL M N   1 
ATOM   7090  C CA  . VAL M  1 45  ? -12.304 -68.797 -23.877 1.00 38.23 ? 1118 VAL M CA  1 
ATOM   7091  C C   . VAL M  1 45  ? -11.083 -69.683 -23.712 1.00 34.75 ? 1118 VAL M C   1 
ATOM   7092  O O   . VAL M  1 45  ? -10.941 -70.362 -22.720 1.00 33.22 ? 1118 VAL M O   1 
ATOM   7093  C CB  . VAL M  1 45  ? -12.238 -67.634 -22.837 1.00 35.05 ? 1118 VAL M CB  1 
ATOM   7094  C CG1 . VAL M  1 45  ? -10.833 -66.994 -22.817 1.00 28.97 ? 1118 VAL M CG1 1 
ATOM   7095  C CG2 . VAL M  1 45  ? -13.269 -66.568 -23.126 1.00 35.33 ? 1118 VAL M CG2 1 
ATOM   7096  N N   . PRO M  1 46  ? -10.176 -69.656 -24.683 1.00 36.57 ? 1119 PRO M N   1 
ATOM   7097  C CA  . PRO M  1 46  ? -9.046  -70.597 -24.623 1.00 37.10 ? 1119 PRO M CA  1 
ATOM   7098  C C   . PRO M  1 46  ? -7.998  -70.185 -23.583 1.00 34.04 ? 1119 PRO M C   1 
ATOM   7099  O O   . PRO M  1 46  ? -7.425  -69.121 -23.745 1.00 39.88 ? 1119 PRO M O   1 
ATOM   7100  C CB  . PRO M  1 46  ? -8.439  -70.495 -26.029 1.00 36.35 ? 1119 PRO M CB  1 
ATOM   7101  C CG  . PRO M  1 46  ? -8.736  -69.073 -26.429 1.00 39.14 ? 1119 PRO M CG  1 
ATOM   7102  C CD  . PRO M  1 46  ? -10.178 -68.870 -25.923 1.00 38.53 ? 1119 PRO M CD  1 
ATOM   7103  N N   . ILE M  1 47  ? -7.751  -71.011 -22.563 1.00 35.73 ? 1120 ILE M N   1 
ATOM   7104  C CA  . ILE M  1 47  ? -6.732  -70.709 -21.529 1.00 34.29 ? 1120 ILE M CA  1 
ATOM   7105  C C   . ILE M  1 47  ? -5.306  -71.213 -21.869 1.00 32.35 ? 1120 ILE M C   1 
ATOM   7106  O O   . ILE M  1 47  ? -5.130  -72.398 -22.194 1.00 33.67 ? 1120 ILE M O   1 
ATOM   7107  C CB  . ILE M  1 47  ? -7.144  -71.326 -20.208 1.00 31.42 ? 1120 ILE M CB  1 
ATOM   7108  C CG1 . ILE M  1 47  ? -8.590  -70.955 -19.861 1.00 30.59 ? 1120 ILE M CG1 1 
ATOM   7109  C CG2 . ILE M  1 47  ? -6.135  -70.992 -19.101 1.00 26.46 ? 1120 ILE M CG2 1 
ATOM   7110  C CD1 . ILE M  1 47  ? -8.887  -69.438 -19.771 1.00 32.00 ? 1120 ILE M CD1 1 
ATOM   7111  N N   . PRO M  1 48  ? -4.289  -70.331 -21.798 1.00 30.06 ? 1121 PRO M N   1 
ATOM   7112  C CA  . PRO M  1 48  ? -2.930  -70.768 -22.170 1.00 31.11 ? 1121 PRO M CA  1 
ATOM   7113  C C   . PRO M  1 48  ? -2.377  -71.883 -21.268 1.00 33.86 ? 1121 PRO M C   1 
ATOM   7114  O O   . PRO M  1 48  ? -2.635  -71.865 -20.084 1.00 29.02 ? 1121 PRO M O   1 
ATOM   7115  C CB  . PRO M  1 48  ? -2.087  -69.481 -22.017 1.00 31.65 ? 1121 PRO M CB  1 
ATOM   7116  C CG  . PRO M  1 48  ? -3.063  -68.353 -22.172 1.00 34.56 ? 1121 PRO M CG  1 
ATOM   7117  C CD  . PRO M  1 48  ? -4.370  -68.867 -21.596 1.00 30.36 ? 1121 PRO M CD  1 
ATOM   7118  N N   . VAL M  1 49  ? -1.627  -72.836 -21.842 1.00 28.36 ? 1122 VAL M N   1 
ATOM   7119  C CA  . VAL M  1 49  ? -1.061  -73.943 -21.107 1.00 27.82 ? 1122 VAL M CA  1 
ATOM   7120  C C   . VAL M  1 49  ? 0.368   -73.593 -20.660 1.00 28.45 ? 1122 VAL M C   1 
ATOM   7121  O O   . VAL M  1 49  ? 1.171   -73.105 -21.448 1.00 30.10 ? 1122 VAL M O   1 
ATOM   7122  C CB  . VAL M  1 49  ? -1.022  -75.200 -22.020 1.00 32.75 ? 1122 VAL M CB  1 
ATOM   7123  C CG1 . VAL M  1 49  ? -0.276  -76.309 -21.347 1.00 34.80 ? 1122 VAL M CG1 1 
ATOM   7124  C CG2 . VAL M  1 49  ? -2.456  -75.626 -22.386 1.00 33.09 ? 1122 VAL M CG2 1 
ATOM   7125  N N   . PRO M  1 50  ? 0.680   -73.806 -19.387 1.00 27.87 ? 1123 PRO M N   1 
ATOM   7126  C CA  . PRO M  1 50  ? 2.043   -73.451 -18.955 1.00 30.55 ? 1123 PRO M CA  1 
ATOM   7127  C C   . PRO M  1 50  ? 3.063   -74.405 -19.548 1.00 33.00 ? 1123 PRO M C   1 
ATOM   7128  O O   . PRO M  1 50  ? 2.851   -75.616 -19.467 1.00 36.38 ? 1123 PRO M O   1 
ATOM   7129  C CB  . PRO M  1 50  ? 2.022   -73.669 -17.440 1.00 29.90 ? 1123 PRO M CB  1 
ATOM   7130  C CG  . PRO M  1 50  ? 0.621   -74.148 -17.097 1.00 33.09 ? 1123 PRO M CG  1 
ATOM   7131  C CD  . PRO M  1 50  ? -0.143  -74.405 -18.336 1.00 30.39 ? 1123 PRO M CD  1 
ATOM   7132  N N   . PRO M  1 51  ? 4.149   -73.879 -20.105 1.00 32.55 ? 1124 PRO M N   1 
ATOM   7133  C CA  . PRO M  1 51  ? 5.270   -74.730 -20.526 1.00 38.25 ? 1124 PRO M CA  1 
ATOM   7134  C C   . PRO M  1 51  ? 5.705   -75.714 -19.450 1.00 39.52 ? 1124 PRO M C   1 
ATOM   7135  O O   . PRO M  1 51  ? 5.577   -75.439 -18.249 1.00 38.09 ? 1124 PRO M O   1 
ATOM   7136  C CB  . PRO M  1 51  ? 6.395   -73.730 -20.750 1.00 37.38 ? 1124 PRO M CB  1 
ATOM   7137  C CG  . PRO M  1 51  ? 5.718   -72.459 -21.105 1.00 38.29 ? 1124 PRO M CG  1 
ATOM   7138  C CD  . PRO M  1 51  ? 4.449   -72.453 -20.278 1.00 36.04 ? 1124 PRO M CD  1 
ATOM   7139  N N   . LEU M  1 52  ? 6.247   -76.863 -19.861 1.00 38.54 ? 1125 LEU M N   1 
ATOM   7140  C CA  . LEU M  1 52  ? 6.715   -77.850 -18.895 1.00 41.27 ? 1125 LEU M CA  1 
ATOM   7141  C C   . LEU M  1 52  ? 7.768   -77.240 -17.981 1.00 36.58 ? 1125 LEU M C   1 
ATOM   7142  O O   . LEU M  1 52  ? 7.856   -77.560 -16.786 1.00 39.61 ? 1125 LEU M O   1 
ATOM   7143  C CB  . LEU M  1 52  ? 7.333   -79.051 -19.631 1.00 41.23 ? 1125 LEU M CB  1 
ATOM   7144  C CG  . LEU M  1 52  ? 6.327   -79.767 -20.520 1.00 43.40 ? 1125 LEU M CG  1 
ATOM   7145  C CD1 . LEU M  1 52  ? 7.082   -80.636 -21.526 1.00 51.20 ? 1125 LEU M CD1 1 
ATOM   7146  C CD2 . LEU M  1 52  ? 5.380   -80.600 -19.644 1.00 44.54 ? 1125 LEU M CD2 1 
ATOM   7147  N N   . GLU M  1 53  ? 8.575   -76.369 -18.556 1.00 38.90 ? 1126 GLU M N   1 
ATOM   7148  C CA  . GLU M  1 53  ? 9.671   -75.742 -17.829 1.00 40.60 ? 1126 GLU M CA  1 
ATOM   7149  C C   . GLU M  1 53  ? 9.112   -74.868 -16.697 1.00 43.63 ? 1126 GLU M C   1 
ATOM   7150  O O   . GLU M  1 53  ? 9.705   -74.761 -15.628 1.00 37.25 ? 1126 GLU M O   1 
ATOM   7151  C CB  . GLU M  1 53  ? 10.462  -74.903 -18.816 1.00 46.38 ? 1126 GLU M CB  1 
ATOM   7152  C CG  . GLU M  1 53  ? 11.509  -74.004 -18.228 1.00 53.91 ? 1126 GLU M CG  1 
ATOM   7153  C CD  . GLU M  1 53  ? 11.897  -72.911 -19.207 1.00 60.27 ? 1126 GLU M CD  1 
ATOM   7154  O OE1 . GLU M  1 53  ? 13.107  -72.600 -19.298 1.00 64.84 ? 1126 GLU M OE1 1 
ATOM   7155  O OE2 . GLU M  1 53  ? 10.989  -72.374 -19.897 1.00 61.05 ? 1126 GLU M OE2 1 
ATOM   7156  N N   . VAL M  1 54  ? 7.951   -74.264 -16.930 1.00 40.74 ? 1127 VAL M N   1 
ATOM   7157  C CA  . VAL M  1 54  ? 7.375   -73.383 -15.920 1.00 36.77 ? 1127 VAL M CA  1 
ATOM   7158  C C   . VAL M  1 54  ? 6.923   -74.251 -14.766 1.00 35.82 ? 1127 VAL M C   1 
ATOM   7159  O O   . VAL M  1 54  ? 7.064   -73.888 -13.615 1.00 33.69 ? 1127 VAL M O   1 
ATOM   7160  C CB  . VAL M  1 54  ? 6.206   -72.499 -16.493 1.00 35.67 ? 1127 VAL M CB  1 
ATOM   7161  C CG1 . VAL M  1 54  ? 5.372   -71.890 -15.336 1.00 29.91 ? 1127 VAL M CG1 1 
ATOM   7162  C CG2 . VAL M  1 54  ? 6.764   -71.409 -17.384 1.00 32.98 ? 1127 VAL M CG2 1 
ATOM   7163  N N   . LEU M  1 55  ? 6.386   -75.423 -15.086 1.00 34.81 ? 1128 LEU M N   1 
ATOM   7164  C CA  . LEU M  1 55  ? 5.948   -76.378 -14.078 1.00 37.09 ? 1128 LEU M CA  1 
ATOM   7165  C C   . LEU M  1 55  ? 7.101   -76.918 -13.229 1.00 39.84 ? 1128 LEU M C   1 
ATOM   7166  O O   . LEU M  1 55  ? 6.970   -77.073 -12.017 1.00 39.17 ? 1128 LEU M O   1 
ATOM   7167  C CB  . LEU M  1 55  ? 5.219   -77.546 -14.759 1.00 36.42 ? 1128 LEU M CB  1 
ATOM   7168  C CG  . LEU M  1 55  ? 3.892   -77.105 -15.380 1.00 33.09 ? 1128 LEU M CG  1 
ATOM   7169  C CD1 . LEU M  1 55  ? 3.106   -78.320 -15.897 1.00 40.02 ? 1128 LEU M CD1 1 
ATOM   7170  C CD2 . LEU M  1 55  ? 3.096   -76.358 -14.350 1.00 31.77 ? 1128 LEU M CD2 1 
ATOM   7171  N N   . LYS M  1 56  ? 8.217   -77.224 -13.884 1.00 40.89 ? 1129 LYS M N   1 
ATOM   7172  C CA  . LYS M  1 56  ? 9.423   -77.654 -13.192 1.00 40.49 ? 1129 LYS M CA  1 
ATOM   7173  C C   . LYS M  1 56  ? 9.837   -76.543 -12.233 1.00 42.74 ? 1129 LYS M C   1 
ATOM   7174  O O   . LYS M  1 56  ? 10.150  -76.787 -11.062 1.00 42.14 ? 1129 LYS M O   1 
ATOM   7175  C CB  . LYS M  1 56  ? 10.528  -77.907 -14.225 1.00 42.88 ? 1129 LYS M CB  1 
ATOM   7176  C CG  . LYS M  1 56  ? 11.865  -78.410 -13.677 1.00 52.44 ? 1129 LYS M CG  1 
ATOM   7177  C CD  . LYS M  1 56  ? 12.929  -78.419 -14.797 1.00 58.97 ? 1129 LYS M CD  1 
ATOM   7178  C CE  . LYS M  1 56  ? 14.249  -79.056 -14.354 1.00 62.92 ? 1129 LYS M CE  1 
ATOM   7179  N NZ  . LYS M  1 56  ? 14.214  -80.551 -14.424 1.00 61.91 ? 1129 LYS M NZ  1 
ATOM   7180  N N   . LEU M  1 57  ? 9.828   -75.310 -12.735 1.00 42.15 ? 1130 LEU M N   1 
ATOM   7181  C CA  . LEU M  1 57  ? 10.335  -74.196 -11.957 1.00 40.24 ? 1130 LEU M CA  1 
ATOM   7182  C C   . LEU M  1 57  ? 9.480   -74.100 -10.705 1.00 35.81 ? 1130 LEU M C   1 
ATOM   7183  O O   . LEU M  1 57  ? 9.981   -73.874 -9.612  1.00 39.05 ? 1130 LEU M O   1 
ATOM   7184  C CB  . LEU M  1 57  ? 10.331  -72.913 -12.799 1.00 37.21 ? 1130 LEU M CB  1 
ATOM   7185  C CG  . LEU M  1 57  ? 10.911  -71.609 -12.243 1.00 42.90 ? 1130 LEU M CG  1 
ATOM   7186  C CD1 . LEU M  1 57  ? 9.891   -70.461 -12.138 1.00 41.25 ? 1130 LEU M CD1 1 
ATOM   7187  C CD2 . LEU M  1 57  ? 11.609  -71.841 -10.931 1.00 44.58 ? 1130 LEU M CD2 1 
ATOM   7188  N N   . GLY M  1 58  ? 8.178   -74.312 -10.867 1.00 34.72 ? 1131 GLY M N   1 
ATOM   7189  C CA  . GLY M  1 58  ? 7.251   -74.277 -9.752  1.00 31.93 ? 1131 GLY M CA  1 
ATOM   7190  C C   . GLY M  1 58  ? 7.533   -75.313 -8.696  1.00 35.85 ? 1131 GLY M C   1 
ATOM   7191  O O   . GLY M  1 58  ? 7.388   -75.068 -7.488  1.00 36.41 ? 1131 GLY M O   1 
ATOM   7192  N N   . GLU M  1 59  ? 7.921   -76.497 -9.152  1.00 37.61 ? 1132 GLU M N   1 
ATOM   7193  C CA  . GLU M  1 59  ? 8.223   -77.583 -8.243  1.00 39.98 ? 1132 GLU M CA  1 
ATOM   7194  C C   . GLU M  1 59  ? 9.415   -77.158 -7.397  1.00 36.82 ? 1132 GLU M C   1 
ATOM   7195  O O   . GLU M  1 59  ? 9.426   -77.347 -6.184  1.00 40.58 ? 1132 GLU M O   1 
ATOM   7196  C CB  . GLU M  1 59  ? 8.588   -78.830 -9.052  1.00 43.63 ? 1132 GLU M CB  1 
ATOM   7197  C CG  . GLU M  1 59  ? 8.126   -80.157 -8.465  1.00 56.80 ? 1132 GLU M CG  1 
ATOM   7198  C CD  . GLU M  1 59  ? 8.383   -81.335 -9.424  1.00 65.66 ? 1132 GLU M CD  1 
ATOM   7199  O OE1 . GLU M  1 59  ? 7.565   -82.291 -9.443  1.00 68.96 ? 1132 GLU M OE1 1 
ATOM   7200  O OE2 . GLU M  1 59  ? 9.397   -81.293 -10.167 1.00 65.20 ? 1132 GLU M OE2 1 
ATOM   7201  N N   . GLN M  1 60  ? 10.414  -76.590 -8.055  1.00 37.65 ? 1133 GLN M N   1 
ATOM   7202  C CA  . GLN M  1 60  ? 11.646  -76.187 -7.367  1.00 41.14 ? 1133 GLN M CA  1 
ATOM   7203  C C   . GLN M  1 60  ? 11.345  -75.105 -6.347  1.00 40.44 ? 1133 GLN M C   1 
ATOM   7204  O O   . GLN M  1 60  ? 11.823  -75.159 -5.214  1.00 40.62 ? 1133 GLN M O   1 
ATOM   7205  C CB  . GLN M  1 60  ? 12.692  -75.653 -8.348  1.00 38.48 ? 1133 GLN M CB  1 
ATOM   7206  C CG  . GLN M  1 60  ? 13.362  -76.672 -9.269  1.00 48.73 ? 1133 GLN M CG  1 
ATOM   7207  C CD  . GLN M  1 60  ? 14.308  -75.992 -10.264 1.00 54.81 ? 1133 GLN M CD  1 
ATOM   7208  O OE1 . GLN M  1 60  ? 14.810  -76.620 -11.205 1.00 60.39 ? 1133 GLN M OE1 1 
ATOM   7209  N NE2 . GLN M  1 60  ? 14.559  -74.697 -10.048 1.00 53.91 ? 1133 GLN M NE2 1 
ATOM   7210  N N   . MET M  1 61  ? 10.559  -74.105 -6.748  1.00 39.91 ? 1134 MET M N   1 
ATOM   7211  C CA  . MET M  1 61  ? 10.294  -72.964 -5.870  1.00 35.66 ? 1134 MET M CA  1 
ATOM   7212  C C   . MET M  1 61  ? 9.446   -73.303 -4.653  1.00 38.63 ? 1134 MET M C   1 
ATOM   7213  O O   . MET M  1 61  ? 9.664   -72.762 -3.559  1.00 36.54 ? 1134 MET M O   1 
ATOM   7214  C CB  . MET M  1 61  ? 9.659   -71.793 -6.646  1.00 34.80 ? 1134 MET M CB  1 
ATOM   7215  C CG  . MET M  1 61  ? 10.514  -71.199 -7.755  1.00 35.25 ? 1134 MET M CG  1 
ATOM   7216  S SD  . MET M  1 61  ? 9.614   -69.952 -8.744  1.00 33.52 ? 1134 MET M SD  1 
ATOM   7217  C CE  . MET M  1 61  ? 9.250   -68.770 -7.483  1.00 30.54 ? 1134 MET M CE  1 
ATOM   7218  N N   . THR M  1 62  ? 8.450   -74.159 -4.846  1.00 38.44 ? 1135 THR M N   1 
ATOM   7219  C CA  . THR M  1 62  ? 7.590   -74.560 -3.752  1.00 38.09 ? 1135 THR M CA  1 
ATOM   7220  C C   . THR M  1 62  ? 8.479   -75.259 -2.728  1.00 43.44 ? 1135 THR M C   1 
ATOM   7221  O O   . THR M  1 62  ? 8.427   -74.977 -1.527  1.00 42.42 ? 1135 THR M O   1 
ATOM   7222  C CB  . THR M  1 62  ? 6.533   -75.511 -4.281  1.00 37.99 ? 1135 THR M CB  1 
ATOM   7223  O OG1 . THR M  1 62  ? 5.707   -74.801 -5.211  1.00 38.98 ? 1135 THR M OG1 1 
ATOM   7224  C CG2 . THR M  1 62  ? 5.654   -76.069 -3.176  1.00 38.93 ? 1135 THR M CG2 1 
ATOM   7225  N N   . GLN M  1 63  ? 9.304   -76.154 -3.265  1.00 45.15 ? 1136 GLN M N   1 
ATOM   7226  C CA  . GLN M  1 63  ? 10.307  -76.934 -2.544  1.00 49.22 ? 1136 GLN M CA  1 
ATOM   7227  C C   . GLN M  1 63  ? 11.188  -76.029 -1.682  1.00 49.81 ? 1136 GLN M C   1 
ATOM   7228  O O   . GLN M  1 63  ? 11.405  -76.306 -0.509  1.00 54.56 ? 1136 GLN M O   1 
ATOM   7229  C CB  . GLN M  1 63  ? 11.166  -77.682 -3.580  1.00 53.85 ? 1136 GLN M CB  1 
ATOM   7230  C CG  . GLN M  1 63  ? 11.795  -79.013 -3.137  1.00 58.85 ? 1136 GLN M CG  1 
ATOM   7231  C CD  . GLN M  1 63  ? 12.321  -79.859 -4.322  1.00 65.00 ? 1136 GLN M CD  1 
ATOM   7232  O OE1 . GLN M  1 63  ? 13.535  -80.035 -4.487  1.00 66.28 ? 1136 GLN M OE1 1 
ATOM   7233  N NE2 . GLN M  1 63  ? 11.400  -80.381 -5.144  1.00 60.65 ? 1136 GLN M NE2 1 
ATOM   7234  N N   . GLU M  1 64  ? 11.677  -74.936 -2.262  1.00 49.23 ? 1137 GLU M N   1 
ATOM   7235  C CA  . GLU M  1 64  ? 12.606  -74.038 -1.574  1.00 49.48 ? 1137 GLU M CA  1 
ATOM   7236  C C   . GLU M  1 64  ? 11.950  -73.110 -0.557  1.00 51.27 ? 1137 GLU M C   1 
ATOM   7237  O O   . GLU M  1 64  ? 12.502  -72.858 0.518   1.00 51.89 ? 1137 GLU M O   1 
ATOM   7238  C CB  . GLU M  1 64  ? 13.400  -73.210 -2.597  1.00 51.77 ? 1137 GLU M CB  1 
ATOM   7239  C CG  . GLU M  1 64  ? 13.564  -71.731 -2.245  1.00 54.08 ? 1137 GLU M CG  1 
ATOM   7240  C CD  . GLU M  1 64  ? 14.819  -71.132 -2.854  1.00 65.08 ? 1137 GLU M CD  1 
ATOM   7241  O OE1 . GLU M  1 64  ? 14.866  -69.895 -3.074  1.00 68.42 ? 1137 GLU M OE1 1 
ATOM   7242  O OE2 . GLU M  1 64  ? 15.768  -71.910 -3.108  1.00 70.79 ? 1137 GLU M OE2 1 
ATOM   7243  N N   . ALA M  1 65  ? 10.777  -72.593 -0.897  1.00 46.65 ? 1138 ALA M N   1 
ATOM   7244  C CA  . ALA M  1 65  ? 10.104  -71.631 -0.044  1.00 45.71 ? 1138 ALA M CA  1 
ATOM   7245  C C   . ALA M  1 65  ? 9.366   -72.365 1.052   1.00 44.75 ? 1138 ALA M C   1 
ATOM   7246  O O   . ALA M  1 65  ? 9.108   -71.813 2.112   1.00 48.68 ? 1138 ALA M O   1 
ATOM   7247  C CB  . ALA M  1 65  ? 9.140   -70.785 -0.855  1.00 43.64 ? 1138 ALA M CB  1 
ATOM   7248  N N   . ARG M  1 66  ? 9.018   -73.618 0.789   1.00 43.75 ? 1139 ARG M N   1 
ATOM   7249  C CA  . ARG M  1 66  ? 8.246   -74.372 1.749   1.00 43.57 ? 1139 ARG M CA  1 
ATOM   7250  C C   . ARG M  1 66  ? 6.850   -73.748 1.896   1.00 42.38 ? 1139 ARG M C   1 
ATOM   7251  O O   . ARG M  1 66  ? 6.288   -73.663 2.986   1.00 37.73 ? 1139 ARG M O   1 
ATOM   7252  C CB  . ARG M  1 66  ? 8.979   -74.364 3.099   1.00 46.87 ? 1139 ARG M CB  1 
ATOM   7253  C CG  . ARG M  1 66  ? 9.207   -75.731 3.706   1.00 49.77 ? 1139 ARG M CG  1 
ATOM   7254  C CD  . ARG M  1 66  ? 10.091  -76.590 2.818   1.00 50.50 ? 1139 ARG M CD  1 
ATOM   7255  N NE  . ARG M  1 66  ? 11.355  -75.931 2.514   1.00 52.79 ? 1139 ARG M NE  1 
ATOM   7256  C CZ  . ARG M  1 66  ? 12.494  -76.168 3.156   1.00 55.90 ? 1139 ARG M CZ  1 
ATOM   7257  N NH1 . ARG M  1 66  ? 13.595  -75.511 2.803   1.00 59.65 ? 1139 ARG M NH1 1 
ATOM   7258  N NH2 . ARG M  1 66  ? 12.540  -77.054 4.149   1.00 52.60 ? 1139 ARG M NH2 1 
ATOM   7259  N N   . GLU M  1 67  ? 6.287   -73.282 0.799   1.00 39.51 ? 1140 GLU M N   1 
ATOM   7260  C CA  . GLU M  1 67  ? 4.956   -72.695 0.895   1.00 37.74 ? 1140 GLU M CA  1 
ATOM   7261  C C   . GLU M  1 67  ? 4.190   -72.953 -0.384  1.00 26.83 ? 1140 GLU M C   1 
ATOM   7262  O O   . GLU M  1 67  ? 4.782   -73.161 -1.449  1.00 35.15 ? 1140 GLU M O   1 
ATOM   7263  C CB  . GLU M  1 67  ? 5.003   -71.194 1.227   1.00 40.44 ? 1140 GLU M CB  1 
ATOM   7264  C CG  . GLU M  1 67  ? 5.760   -70.355 0.215   1.00 45.34 ? 1140 GLU M CG  1 
ATOM   7265  C CD  . GLU M  1 67  ? 5.809   -68.840 0.561   1.00 46.43 ? 1140 GLU M CD  1 
ATOM   7266  O OE1 . GLU M  1 67  ? 6.563   -68.117 -0.150  1.00 49.67 ? 1140 GLU M OE1 1 
ATOM   7267  O OE2 . GLU M  1 67  ? 5.100   -68.375 1.508   1.00 44.74 ? 1140 GLU M OE2 1 
ATOM   7268  N N   . HIS M  1 68  ? 2.872   -73.002 -0.267  1.00 29.68 ? 1141 HIS M N   1 
ATOM   7269  C CA  . HIS M  1 68  ? 2.062   -73.253 -1.444  1.00 30.14 ? 1141 HIS M CA  1 
ATOM   7270  C C   . HIS M  1 68  ? 2.259   -72.106 -2.464  1.00 28.53 ? 1141 HIS M C   1 
ATOM   7271  O O   . HIS M  1 68  ? 2.192   -70.934 -2.100  1.00 29.55 ? 1141 HIS M O   1 
ATOM   7272  C CB  . HIS M  1 68  ? 0.584   -73.389 -1.053  1.00 32.29 ? 1141 HIS M CB  1 
ATOM   7273  C CG  . HIS M  1 68  ? -0.306  -73.627 -2.226  1.00 34.26 ? 1141 HIS M CG  1 
ATOM   7274  N ND1 . HIS M  1 68  ? -0.460  -74.866 -2.797  1.00 35.61 ? 1141 HIS M ND1 1 
ATOM   7275  C CD2 . HIS M  1 68  ? -1.018  -72.763 -2.992  1.00 33.34 ? 1141 HIS M CD2 1 
ATOM   7276  C CE1 . HIS M  1 68  ? -1.262  -74.766 -3.846  1.00 41.57 ? 1141 HIS M CE1 1 
ATOM   7277  N NE2 . HIS M  1 68  ? -1.616  -73.499 -3.982  1.00 35.38 ? 1141 HIS M NE2 1 
ATOM   7278  N N   . LEU M  1 69  ? 2.494   -72.422 -3.728  1.00 27.10 ? 1142 LEU M N   1 
ATOM   7279  C CA  . LEU M  1 69  ? 2.582   -71.324 -4.700  1.00 28.96 ? 1142 LEU M CA  1 
ATOM   7280  C C   . LEU M  1 69  ? 1.522   -71.412 -5.784  1.00 25.68 ? 1142 LEU M C   1 
ATOM   7281  O O   . LEU M  1 69  ? 1.375   -72.442 -6.419  1.00 27.20 ? 1142 LEU M O   1 
ATOM   7282  C CB  . LEU M  1 69  ? 3.967   -71.224 -5.335  1.00 27.30 ? 1142 LEU M CB  1 
ATOM   7283  C CG  . LEU M  1 69  ? 5.200   -71.181 -4.420  1.00 31.10 ? 1142 LEU M CG  1 
ATOM   7284  C CD1 . LEU M  1 69  ? 6.467   -71.185 -5.268  1.00 31.27 ? 1142 LEU M CD1 1 
ATOM   7285  C CD2 . LEU M  1 69  ? 5.125   -69.977 -3.530  1.00 28.84 ? 1142 LEU M CD2 1 
ATOM   7286  N N   . TYR M  1 70  ? 0.845   -70.295 -6.058  1.00 27.42 ? 1143 TYR M N   1 
ATOM   7287  C CA  . TYR M  1 70  ? -0.070  -70.253 -7.196  1.00 23.56 ? 1143 TYR M CA  1 
ATOM   7288  C C   . TYR M  1 70  ? 0.712   -69.916 -8.434  1.00 26.35 ? 1143 TYR M C   1 
ATOM   7289  O O   . TYR M  1 70  ? 1.681   -69.148 -8.380  1.00 24.56 ? 1143 TYR M O   1 
ATOM   7290  C CB  . TYR M  1 70  ? -1.086  -69.142 -6.970  1.00 20.75 ? 1143 TYR M CB  1 
ATOM   7291  C CG  . TYR M  1 70  ? -2.002  -69.404 -5.861  1.00 24.43 ? 1143 TYR M CG  1 
ATOM   7292  C CD1 . TYR M  1 70  ? -3.246  -69.999 -6.093  1.00 20.78 ? 1143 TYR M CD1 1 
ATOM   7293  C CD2 . TYR M  1 70  ? -1.653  -69.073 -4.550  1.00 25.10 ? 1143 TYR M CD2 1 
ATOM   7294  C CE1 . TYR M  1 70  ? -4.117  -70.209 -5.079  1.00 23.82 ? 1143 TYR M CE1 1 
ATOM   7295  C CE2 . TYR M  1 70  ? -2.520  -69.301 -3.523  1.00 24.92 ? 1143 TYR M CE2 1 
ATOM   7296  C CZ  . TYR M  1 70  ? -3.751  -69.857 -3.788  1.00 26.16 ? 1143 TYR M CZ  1 
ATOM   7297  O OH  . TYR M  1 70  ? -4.620  -70.060 -2.756  1.00 31.15 ? 1143 TYR M OH  1 
ATOM   7298  N N   . LEU M  1 71  ? 0.284   -70.490 -9.569  1.00 23.19 ? 1144 LEU M N   1 
ATOM   7299  C CA  . LEU M  1 71  ? 0.820   -70.129 -10.828 1.00 23.56 ? 1144 LEU M CA  1 
ATOM   7300  C C   . LEU M  1 71  ? 0.001   -68.977 -11.389 1.00 21.73 ? 1144 LEU M C   1 
ATOM   7301  O O   . LEU M  1 71  ? -1.253  -69.059 -11.469 1.00 24.23 ? 1144 LEU M O   1 
ATOM   7302  C CB  . LEU M  1 71  ? 0.696   -71.325 -11.769 1.00 22.33 ? 1144 LEU M CB  1 
ATOM   7303  C CG  . LEU M  1 71  ? 1.154   -71.088 -13.193 1.00 25.95 ? 1144 LEU M CG  1 
ATOM   7304  C CD1 . LEU M  1 71  ? 2.617   -70.632 -13.275 1.00 24.68 ? 1144 LEU M CD1 1 
ATOM   7305  C CD2 . LEU M  1 71  ? 0.965   -72.379 -13.922 1.00 25.83 ? 1144 LEU M CD2 1 
ATOM   7306  N N   . VAL M  1 72  ? 0.693   -67.914 -11.750 1.00 21.35 ? 1145 VAL M N   1 
ATOM   7307  C CA  . VAL M  1 72  ? -0.019  -66.789 -12.395 1.00 21.60 ? 1145 VAL M CA  1 
ATOM   7308  C C   . VAL M  1 72  ? 0.485   -66.467 -13.788 1.00 22.85 ? 1145 VAL M C   1 
ATOM   7309  O O   . VAL M  1 72  ? 1.673   -66.580 -14.102 1.00 25.05 ? 1145 VAL M O   1 
ATOM   7310  C CB  . VAL M  1 72  ? -0.046  -65.498 -11.515 1.00 22.67 ? 1145 VAL M CB  1 
ATOM   7311  C CG1 . VAL M  1 72  ? -0.561  -65.831 -10.173 1.00 23.16 ? 1145 VAL M CG1 1 
ATOM   7312  C CG2 . VAL M  1 72  ? 1.360   -64.864 -11.441 1.00 20.76 ? 1145 VAL M CG2 1 
ATOM   7313  N N   . LEU M  1 73  ? -0.445  -66.001 -14.623 1.00 19.69 ? 1146 LEU M N   1 
ATOM   7314  C CA  . LEU M  1 73  ? -0.105  -65.532 -15.939 1.00 20.24 ? 1146 LEU M CA  1 
ATOM   7315  C C   . LEU M  1 73  ? -0.495  -64.047 -16.010 1.00 19.10 ? 1146 LEU M C   1 
ATOM   7316  O O   . LEU M  1 73  ? -1.675  -63.699 -15.891 1.00 19.56 ? 1146 LEU M O   1 
ATOM   7317  C CB  . LEU M  1 73  ? -0.884  -66.355 -16.977 1.00 22.51 ? 1146 LEU M CB  1 
ATOM   7318  C CG  . LEU M  1 73  ? -0.652  -65.934 -18.419 1.00 22.32 ? 1146 LEU M CG  1 
ATOM   7319  C CD1 . LEU M  1 73  ? 0.824   -66.144 -18.977 1.00 23.14 ? 1146 LEU M CD1 1 
ATOM   7320  C CD2 . LEU M  1 73  ? -1.690  -66.643 -19.300 1.00 25.22 ? 1146 LEU M CD2 1 
ATOM   7321  N N   . PHE M  1 74  ? 0.498   -63.190 -16.153 1.00 18.36 ? 1147 PHE M N   1 
ATOM   7322  C CA  . PHE M  1 74  ? 0.268   -61.740 -16.179 1.00 17.75 ? 1147 PHE M CA  1 
ATOM   7323  C C   . PHE M  1 74  ? -0.432  -61.273 -17.445 1.00 20.68 ? 1147 PHE M C   1 
ATOM   7324  O O   . PHE M  1 74  ? -0.298  -61.869 -18.526 1.00 21.30 ? 1147 PHE M O   1 
ATOM   7325  C CB  . PHE M  1 74  ? 1.584   -61.002 -16.047 1.00 20.60 ? 1147 PHE M CB  1 
ATOM   7326  C CG  . PHE M  1 74  ? 2.215   -61.157 -14.702 1.00 25.54 ? 1147 PHE M CG  1 
ATOM   7327  C CD1 . PHE M  1 74  ? 1.685   -60.475 -13.594 1.00 23.32 ? 1147 PHE M CD1 1 
ATOM   7328  C CD2 . PHE M  1 74  ? 3.346   -61.953 -14.528 1.00 24.14 ? 1147 PHE M CD2 1 
ATOM   7329  C CE1 . PHE M  1 74  ? 2.268   -60.583 -12.354 1.00 20.77 ? 1147 PHE M CE1 1 
ATOM   7330  C CE2 . PHE M  1 74  ? 3.936   -62.071 -13.268 1.00 26.05 ? 1147 PHE M CE2 1 
ATOM   7331  C CZ  . PHE M  1 74  ? 3.391   -61.383 -12.176 1.00 23.44 ? 1147 PHE M CZ  1 
ATOM   7332  N N   . PHE M  1 75  ? -1.177  -60.190 -17.328 1.00 19.84 ? 1148 PHE M N   1 
ATOM   7333  C CA  . PHE M  1 75  ? -1.809  -59.605 -18.515 1.00 17.21 ? 1148 PHE M CA  1 
ATOM   7334  C C   . PHE M  1 75  ? -0.860  -58.608 -19.154 1.00 20.60 ? 1148 PHE M C   1 
ATOM   7335  O O   . PHE M  1 75  ? -1.285  -57.634 -19.762 1.00 23.05 ? 1148 PHE M O   1 
ATOM   7336  C CB  . PHE M  1 75  ? -3.128  -58.937 -18.190 1.00 19.65 ? 1148 PHE M CB  1 
ATOM   7337  C CG  . PHE M  1 75  ? -4.249  -59.920 -17.941 1.00 19.47 ? 1148 PHE M CG  1 
ATOM   7338  C CD1 . PHE M  1 75  ? -4.942  -60.498 -19.022 1.00 22.39 ? 1148 PHE M CD1 1 
ATOM   7339  C CD2 . PHE M  1 75  ? -4.598  -60.308 -16.657 1.00 17.11 ? 1148 PHE M CD2 1 
ATOM   7340  C CE1 . PHE M  1 75  ? -5.974  -61.411 -18.806 1.00 21.78 ? 1148 PHE M CE1 1 
ATOM   7341  C CE2 . PHE M  1 75  ? -5.619  -61.202 -16.434 1.00 19.23 ? 1148 PHE M CE2 1 
ATOM   7342  C CZ  . PHE M  1 75  ? -6.313  -61.771 -17.526 1.00 22.85 ? 1148 PHE M CZ  1 
ATOM   7343  N N   . ASP M  1 76  ? 0.437   -58.837 -18.992 1.00 21.12 ? 1149 ASP M N   1 
ATOM   7344  C CA  . ASP M  1 76  ? 1.382   -57.962 -19.642 1.00 21.91 ? 1149 ASP M CA  1 
ATOM   7345  C C   . ASP M  1 76  ? 1.501   -58.270 -21.126 1.00 24.64 ? 1149 ASP M C   1 
ATOM   7346  O O   . ASP M  1 76  ? 0.914   -59.216 -21.615 1.00 28.92 ? 1149 ASP M O   1 
ATOM   7347  C CB  . ASP M  1 76  ? 2.743   -58.037 -18.935 1.00 25.07 ? 1149 ASP M CB  1 
ATOM   7348  C CG  . ASP M  1 76  ? 3.326   -59.432 -18.886 1.00 27.96 ? 1149 ASP M CG  1 
ATOM   7349  O OD1 . ASP M  1 76  ? 2.613   -60.434 -19.081 1.00 26.76 ? 1149 ASP M OD1 1 
ATOM   7350  O OD2 . ASP M  1 76  ? 4.550   -59.517 -18.624 1.00 30.59 ? 1149 ASP M OD2 1 
ATOM   7351  N N   . ASN M  1 77  ? 2.260   -57.467 -21.845 1.00 27.87 ? 1150 ASN M N   1 
ATOM   7352  C CA  . ASN M  1 77  ? 2.331   -57.658 -23.300 1.00 31.55 ? 1150 ASN M CA  1 
ATOM   7353  C C   . ASN M  1 77  ? 2.723   -59.059 -23.683 1.00 31.81 ? 1150 ASN M C   1 
ATOM   7354  O O   . ASN M  1 77  ? 2.054   -59.713 -24.495 1.00 34.88 ? 1150 ASN M O   1 
ATOM   7355  C CB  . ASN M  1 77  ? 3.303   -56.656 -23.914 1.00 33.15 ? 1150 ASN M CB  1 
ATOM   7356  C CG  . ASN M  1 77  ? 2.658   -55.350 -24.168 1.00 39.43 ? 1150 ASN M CG  1 
ATOM   7357  O OD1 . ASN M  1 77  ? 1.422   -55.268 -24.206 1.00 37.24 ? 1150 ASN M OD1 1 
ATOM   7358  N ND2 . ASN M  1 77  ? 3.465   -54.298 -24.321 1.00 46.42 ? 1150 ASN M ND2 1 
ATOM   7359  N N   . LYS M  1 78  ? 3.818   -59.534 -23.110 1.00 29.98 ? 1151 LYS M N   1 
ATOM   7360  C CA  . LYS M  1 78  ? 4.342   -60.853 -23.480 1.00 35.92 ? 1151 LYS M CA  1 
ATOM   7361  C C   . LYS M  1 78  ? 3.588   -62.007 -22.838 1.00 33.82 ? 1151 LYS M C   1 
ATOM   7362  O O   . LYS M  1 78  ? 3.880   -63.165 -23.128 1.00 33.72 ? 1151 LYS M O   1 
ATOM   7363  C CB  . LYS M  1 78  ? 5.803   -60.966 -23.070 1.00 37.00 ? 1151 LYS M CB  1 
ATOM   7364  C CG  . LYS M  1 78  ? 6.722   -59.962 -23.770 1.00 45.64 ? 1151 LYS M CG  1 
ATOM   7365  C CD  . LYS M  1 78  ? 8.061   -59.816 -23.047 1.00 48.58 ? 1151 LYS M CD  1 
ATOM   7366  C CE  . LYS M  1 78  ? 7.979   -58.737 -21.966 1.00 55.15 ? 1151 LYS M CE  1 
ATOM   7367  N NZ  . LYS M  1 78  ? 9.322   -58.265 -21.485 1.00 62.98 ? 1151 LYS M NZ  1 
ATOM   7368  N N   . ARG M  1 79  ? 2.652   -61.721 -21.936 1.00 31.14 ? 1152 ARG M N   1 
ATOM   7369  C CA  . ARG M  1 79  ? 2.016   -62.791 -21.157 1.00 24.09 ? 1152 ARG M CA  1 
ATOM   7370  C C   . ARG M  1 79  ? 3.018   -63.722 -20.435 1.00 27.51 ? 1152 ARG M C   1 
ATOM   7371  O O   . ARG M  1 79  ? 3.173   -64.887 -20.783 1.00 28.11 ? 1152 ARG M O   1 
ATOM   7372  C CB  . ARG M  1 79  ? 1.043   -63.628 -22.020 1.00 30.19 ? 1152 ARG M CB  1 
ATOM   7373  C CG  . ARG M  1 79  ? -0.087  -62.825 -22.685 1.00 31.59 ? 1152 ARG M CG  1 
ATOM   7374  C CD  . ARG M  1 79  ? -0.979  -62.016 -21.695 1.00 25.74 ? 1152 ARG M CD  1 
ATOM   7375  N NE  . ARG M  1 79  ? -1.924  -62.819 -20.910 1.00 23.60 ? 1152 ARG M NE  1 
ATOM   7376  C CZ  . ARG M  1 79  ? -3.051  -63.352 -21.397 1.00 30.34 ? 1152 ARG M CZ  1 
ATOM   7377  N NH1 . ARG M  1 79  ? -3.349  -63.196 -22.684 1.00 34.66 ? 1152 ARG M NH1 1 
ATOM   7378  N NH2 . ARG M  1 79  ? -3.889  -64.053 -20.610 1.00 29.23 ? 1152 ARG M NH2 1 
ATOM   7379  N N   . THR M  1 80  ? 3.705   -63.201 -19.424 1.00 25.85 ? 1153 THR M N   1 
ATOM   7380  C CA  . THR M  1 80  ? 4.710   -63.971 -18.709 1.00 25.85 ? 1153 THR M CA  1 
ATOM   7381  C C   . THR M  1 80  ? 4.126   -64.653 -17.464 1.00 25.81 ? 1153 THR M C   1 
ATOM   7382  O O   . THR M  1 80  ? 3.065   -64.272 -16.955 1.00 21.95 ? 1153 THR M O   1 
ATOM   7383  C CB  . THR M  1 80  ? 5.836   -63.058 -18.241 1.00 27.43 ? 1153 THR M CB  1 
ATOM   7384  O OG1 . THR M  1 80  ? 5.256   -62.005 -17.458 1.00 26.95 ? 1153 THR M OG1 1 
ATOM   7385  C CG2 . THR M  1 80  ? 6.524   -62.412 -19.441 1.00 29.27 ? 1153 THR M CG2 1 
ATOM   7386  N N   . TRP M  1 81  ? 4.879   -65.621 -16.947 1.00 22.95 ? 1154 TRP M N   1 
ATOM   7387  C CA  . TRP M  1 81  ? 4.436   -66.508 -15.877 1.00 24.98 ? 1154 TRP M CA  1 
ATOM   7388  C C   . TRP M  1 81  ? 5.226   -66.234 -14.605 1.00 25.00 ? 1154 TRP M C   1 
ATOM   7389  O O   . TRP M  1 81  ? 6.375   -65.789 -14.670 1.00 27.24 ? 1154 TRP M O   1 
ATOM   7390  C CB  . TRP M  1 81  ? 4.678   -67.991 -16.250 1.00 26.31 ? 1154 TRP M CB  1 
ATOM   7391  C CG  . TRP M  1 81  ? 3.936   -68.473 -17.454 1.00 24.20 ? 1154 TRP M CG  1 
ATOM   7392  C CD1 . TRP M  1 81  ? 4.375   -68.454 -18.741 1.00 29.05 ? 1154 TRP M CD1 1 
ATOM   7393  C CD2 . TRP M  1 81  ? 2.628   -69.076 -17.479 1.00 21.96 ? 1154 TRP M CD2 1 
ATOM   7394  N NE1 . TRP M  1 81  ? 3.419   -69.005 -19.581 1.00 28.13 ? 1154 TRP M NE1 1 
ATOM   7395  C CE2 . TRP M  1 81  ? 2.348   -69.409 -18.828 1.00 26.81 ? 1154 TRP M CE2 1 
ATOM   7396  C CE3 . TRP M  1 81  ? 1.697   -69.398 -16.499 1.00 23.26 ? 1154 TRP M CE3 1 
ATOM   7397  C CZ2 . TRP M  1 81  ? 1.136   -69.992 -19.222 1.00 24.89 ? 1154 TRP M CZ2 1 
ATOM   7398  C CZ3 . TRP M  1 81  ? 0.498   -69.980 -16.867 1.00 21.92 ? 1154 TRP M CZ3 1 
ATOM   7399  C CH2 . TRP M  1 81  ? 0.231   -70.300 -18.237 1.00 24.59 ? 1154 TRP M CH2 1 
ATOM   7400  N N   . GLN M  1 82  ? 4.601   -66.485 -13.460 1.00 24.44 ? 1155 GLN M N   1 
ATOM   7401  C CA  . GLN M  1 82  ? 5.339   -66.480 -12.188 1.00 26.54 ? 1155 GLN M CA  1 
ATOM   7402  C C   . GLN M  1 82  ? 4.618   -67.334 -11.164 1.00 24.71 ? 1155 GLN M C   1 
ATOM   7403  O O   . GLN M  1 82  ? 3.441   -67.631 -11.327 1.00 25.64 ? 1155 GLN M O   1 
ATOM   7404  C CB  . GLN M  1 82  ? 5.460   -65.028 -11.691 1.00 26.67 ? 1155 GLN M CB  1 
ATOM   7405  C CG  . GLN M  1 82  ? 6.418   -64.820 -10.573 1.00 32.89 ? 1155 GLN M CG  1 
ATOM   7406  C CD  . GLN M  1 82  ? 7.715   -65.548 -10.797 1.00 35.55 ? 1155 GLN M CD  1 
ATOM   7407  O OE1 . GLN M  1 82  ? 7.900   -66.654 -10.319 1.00 35.52 ? 1155 GLN M OE1 1 
ATOM   7408  N NE2 . GLN M  1 82  ? 8.614   -64.937 -11.546 1.00 38.25 ? 1155 GLN M NE2 1 
ATOM   7409  N N   . TRP M  1 83  ? 5.330   -67.747 -10.100 1.00 23.09 ? 1156 TRP M N   1 
ATOM   7410  C CA  . TRP M  1 83  ? 4.771   -68.532 -9.015  1.00 21.65 ? 1156 TRP M CA  1 
ATOM   7411  C C   . TRP M  1 83  ? 4.800   -67.674 -7.745  1.00 25.83 ? 1156 TRP M C   1 
ATOM   7412  O O   . TRP M  1 83  ? 5.856   -67.168 -7.378  1.00 25.93 ? 1156 TRP M O   1 
ATOM   7413  C CB  . TRP M  1 83  ? 5.646   -69.779 -8.758  1.00 23.16 ? 1156 TRP M CB  1 
ATOM   7414  C CG  . TRP M  1 83  ? 5.579   -70.809 -9.871  1.00 27.24 ? 1156 TRP M CG  1 
ATOM   7415  C CD1 . TRP M  1 83  ? 6.369   -70.885 -10.975 1.00 27.88 ? 1156 TRP M CD1 1 
ATOM   7416  C CD2 . TRP M  1 83  ? 4.638   -71.868 -9.976  1.00 26.88 ? 1156 TRP M CD2 1 
ATOM   7417  N NE1 . TRP M  1 83  ? 5.988   -71.941 -11.771 1.00 31.53 ? 1156 TRP M NE1 1 
ATOM   7418  C CE2 . TRP M  1 83  ? 4.927   -72.567 -11.173 1.00 26.89 ? 1156 TRP M CE2 1 
ATOM   7419  C CE3 . TRP M  1 83  ? 3.594   -72.317 -9.155  1.00 23.52 ? 1156 TRP M CE3 1 
ATOM   7420  C CZ2 . TRP M  1 83  ? 4.198   -73.678 -11.579 1.00 27.29 ? 1156 TRP M CZ2 1 
ATOM   7421  C CZ3 . TRP M  1 83  ? 2.871   -73.421 -9.554  1.00 30.59 ? 1156 TRP M CZ3 1 
ATOM   7422  C CH2 . TRP M  1 83  ? 3.188   -74.097 -10.764 1.00 25.78 ? 1156 TRP M CH2 1 
ATOM   7423  N N   . LEU M  1 84  ? 3.668   -67.527 -7.069  1.00 23.51 ? 1157 LEU M N   1 
ATOM   7424  C CA  . LEU M  1 84  ? 3.619   -66.644 -5.928  1.00 22.56 ? 1157 LEU M CA  1 
ATOM   7425  C C   . LEU M  1 84  ? 2.779   -67.224 -4.855  1.00 22.13 ? 1157 LEU M C   1 
ATOM   7426  O O   . LEU M  1 84  ? 1.784   -67.859 -5.122  1.00 24.24 ? 1157 LEU M O   1 
ATOM   7427  C CB  . LEU M  1 84  ? 2.996   -65.272 -6.331  1.00 20.22 ? 1157 LEU M CB  1 
ATOM   7428  C CG  . LEU M  1 84  ? 3.775   -64.496 -7.386  1.00 21.59 ? 1157 LEU M CG  1 
ATOM   7429  C CD1 . LEU M  1 84  ? 2.895   -63.340 -7.983  1.00 22.93 ? 1157 LEU M CD1 1 
ATOM   7430  C CD2 . LEU M  1 84  ? 5.007   -63.892 -6.767  1.00 27.25 ? 1157 LEU M CD2 1 
ATOM   7431  N N   . PRO M  1 85  ? 3.139   -66.939 -3.594  1.00 25.56 ? 1158 PRO M N   1 
ATOM   7432  C CA  . PRO M  1 85  ? 2.304   -67.336 -2.455  1.00 26.98 ? 1158 PRO M CA  1 
ATOM   7433  C C   . PRO M  1 85  ? 1.066   -66.433 -2.305  1.00 27.67 ? 1158 PRO M C   1 
ATOM   7434  O O   . PRO M  1 85  ? 0.962   -65.348 -2.905  1.00 24.93 ? 1158 PRO M O   1 
ATOM   7435  C CB  . PRO M  1 85  ? 3.200   -67.092 -1.245  1.00 29.06 ? 1158 PRO M CB  1 
ATOM   7436  C CG  . PRO M  1 85  ? 4.233   -66.058 -1.727  1.00 28.59 ? 1158 PRO M CG  1 
ATOM   7437  C CD  . PRO M  1 85  ? 4.299   -66.112 -3.231  1.00 28.78 ? 1158 PRO M CD  1 
ATOM   7438  N N   . ARG M  1 86  ? 0.145   -66.894 -1.471  1.00 25.32 ? 1159 ARG M N   1 
ATOM   7439  C CA  . ARG M  1 86  ? -1.142  -66.278 -1.247  1.00 27.64 ? 1159 ARG M CA  1 
ATOM   7440  C C   . ARG M  1 86  ? -0.956  -64.863 -0.743  1.00 28.74 ? 1159 ARG M C   1 
ATOM   7441  O O   . ARG M  1 86  ? -1.783  -64.015 -1.002  1.00 26.89 ? 1159 ARG M O   1 
ATOM   7442  C CB  . ARG M  1 86  ? -1.934  -67.084 -0.212  1.00 29.14 ? 1159 ARG M CB  1 
ATOM   7443  C CG  . ARG M  1 86  ? -3.228  -66.452 0.195   1.00 31.74 ? 1159 ARG M CG  1 
ATOM   7444  C CD  . ARG M  1 86  ? -4.175  -66.505 -0.978  1.00 27.80 ? 1159 ARG M CD  1 
ATOM   7445  N NE  . ARG M  1 86  ? -5.441  -65.828 -0.709  1.00 32.90 ? 1159 ARG M NE  1 
ATOM   7446  C CZ  . ARG M  1 86  ? -5.654  -64.512 -0.752  1.00 30.08 ? 1159 ARG M CZ  1 
ATOM   7447  N NH1 . ARG M  1 86  ? -6.870  -64.053 -0.521  1.00 33.04 ? 1159 ARG M NH1 1 
ATOM   7448  N NH2 . ARG M  1 86  ? -4.669  -63.652 -1.042  1.00 31.26 ? 1159 ARG M NH2 1 
ATOM   7449  N N   . THR M  1 87  ? 0.148   -64.603 -0.036  1.00 30.48 ? 1160 THR M N   1 
ATOM   7450  C CA  . THR M  1 87  ? 0.400   -63.288 0.523   1.00 25.36 ? 1160 THR M CA  1 
ATOM   7451  C C   . THR M  1 87  ? 0.749   -62.210 -0.504  1.00 27.15 ? 1160 THR M C   1 
ATOM   7452  O O   . THR M  1 87  ? 0.731   -61.019 -0.161  1.00 27.43 ? 1160 THR M O   1 
ATOM   7453  C CB  . THR M  1 87  ? 1.590   -63.307 1.544   1.00 32.14 ? 1160 THR M CB  1 
ATOM   7454  O OG1 . THR M  1 87  ? 2.782   -63.772 0.894   1.00 36.65 ? 1160 THR M OG1 1 
ATOM   7455  C CG2 . THR M  1 87  ? 1.268   -64.206 2.710   1.00 31.74 ? 1160 THR M CG2 1 
ATOM   7456  N N   . LYS M  1 88  ? 1.079   -62.622 -1.729  1.00 25.89 ? 1161 LYS M N   1 
ATOM   7457  C CA  . LYS M  1 88  ? 1.426   -61.695 -2.809  1.00 25.68 ? 1161 LYS M CA  1 
ATOM   7458  C C   . LYS M  1 88  ? 0.250   -61.492 -3.792  1.00 24.27 ? 1161 LYS M C   1 
ATOM   7459  O O   . LYS M  1 88  ? 0.418   -60.829 -4.829  1.00 23.53 ? 1161 LYS M O   1 
ATOM   7460  C CB  . LYS M  1 88  ? 2.648   -62.190 -3.596  1.00 24.70 ? 1161 LYS M CB  1 
ATOM   7461  C CG  . LYS M  1 88  ? 3.918   -62.347 -2.748  1.00 31.18 ? 1161 LYS M CG  1 
ATOM   7462  C CD  . LYS M  1 88  ? 4.277   -61.064 -2.035  1.00 32.01 ? 1161 LYS M CD  1 
ATOM   7463  C CE  . LYS M  1 88  ? 5.525   -61.291 -1.147  1.00 39.42 ? 1161 LYS M CE  1 
ATOM   7464  N NZ  . LYS M  1 88  ? 5.699   -60.159 -0.203  1.00 50.54 ? 1161 LYS M NZ  1 
ATOM   7465  N N   . LEU M  1 89  ? -0.919  -62.023 -3.440  1.00 23.27 ? 1162 LEU M N   1 
ATOM   7466  C CA  . LEU M  1 89  ? -2.099  -61.928 -4.299  1.00 25.92 ? 1162 LEU M CA  1 
ATOM   7467  C C   . LEU M  1 89  ? -3.282  -61.279 -3.638  1.00 26.02 ? 1162 LEU M C   1 
ATOM   7468  O O   . LEU M  1 89  ? -3.569  -61.500 -2.430  1.00 25.12 ? 1162 LEU M O   1 
ATOM   7469  C CB  . LEU M  1 89  ? -2.538  -63.326 -4.773  1.00 22.00 ? 1162 LEU M CB  1 
ATOM   7470  C CG  . LEU M  1 89  ? -1.454  -64.193 -5.414  1.00 25.03 ? 1162 LEU M CG  1 
ATOM   7471  C CD1 . LEU M  1 89  ? -2.138  -65.503 -5.724  1.00 25.91 ? 1162 LEU M CD1 1 
ATOM   7472  C CD2 . LEU M  1 89  ? -0.810  -63.602 -6.728  1.00 22.26 ? 1162 LEU M CD2 1 
ATOM   7473  N N   . VAL M  1 90  ? -3.983  -60.453 -4.419  1.00 19.55 ? 1163 VAL M N   1 
ATOM   7474  C CA  . VAL M  1 90  ? -5.231  -59.892 -3.977  1.00 23.88 ? 1163 VAL M CA  1 
ATOM   7475  C C   . VAL M  1 90  ? -6.262  -60.038 -5.100  1.00 21.21 ? 1163 VAL M C   1 
ATOM   7476  O O   . VAL M  1 90  ? -5.957  -59.696 -6.241  1.00 20.86 ? 1163 VAL M O   1 
ATOM   7477  C CB  . VAL M  1 90  ? -5.034  -58.375 -3.705  1.00 22.58 ? 1163 VAL M CB  1 
ATOM   7478  C CG1 . VAL M  1 90  ? -6.342  -57.736 -3.337  1.00 26.96 ? 1163 VAL M CG1 1 
ATOM   7479  C CG2 . VAL M  1 90  ? -3.981  -58.169 -2.606  1.00 23.85 ? 1163 VAL M CG2 1 
ATOM   7480  N N   . PRO M  1 91  ? -7.494  -60.474 -4.788  1.00 19.30 ? 1164 PRO M N   1 
ATOM   7481  C CA  . PRO M  1 91  ? -8.457  -60.519 -5.881  1.00 18.03 ? 1164 PRO M CA  1 
ATOM   7482  C C   . PRO M  1 91  ? -8.631  -59.178 -6.577  1.00 18.25 ? 1164 PRO M C   1 
ATOM   7483  O O   . PRO M  1 91  ? -8.641  -58.130 -5.950  1.00 19.92 ? 1164 PRO M O   1 
ATOM   7484  C CB  . PRO M  1 91  ? -9.776  -60.897 -5.189  1.00 20.56 ? 1164 PRO M CB  1 
ATOM   7485  C CG  . PRO M  1 91  ? -9.304  -61.791 -4.059  1.00 23.24 ? 1164 PRO M CG  1 
ATOM   7486  C CD  . PRO M  1 91  ? -8.018  -61.134 -3.565  1.00 21.95 ? 1164 PRO M CD  1 
ATOM   7487  N N   . LEU M  1 92  ? -8.776  -59.256 -7.896  1.00 16.73 ? 1165 LEU M N   1 
ATOM   7488  C CA  . LEU M  1 92  ? -8.851  -58.074 -8.749  1.00 16.58 ? 1165 LEU M CA  1 
ATOM   7489  C C   . LEU M  1 92  ? -10.283 -58.034 -9.317  1.00 19.54 ? 1165 LEU M C   1 
ATOM   7490  O O   . LEU M  1 92  ? -10.868 -59.073 -9.625  1.00 18.93 ? 1165 LEU M O   1 
ATOM   7491  C CB  . LEU M  1 92  ? -7.829  -58.220 -9.900  1.00 16.95 ? 1165 LEU M CB  1 
ATOM   7492  C CG  . LEU M  1 92  ? -7.814  -57.111 -10.952 1.00 18.00 ? 1165 LEU M CG  1 
ATOM   7493  C CD1 . LEU M  1 92  ? -6.388  -57.039 -11.530 1.00 16.21 ? 1165 LEU M CD1 1 
ATOM   7494  C CD2 . LEU M  1 92  ? -8.838  -57.359 -12.057 1.00 15.73 ? 1165 LEU M CD2 1 
ATOM   7495  N N   . GLY M  1 93  ? -10.828 -56.819 -9.438  1.00 16.80 ? 1166 GLY M N   1 
ATOM   7496  C CA  . GLY M  1 93  ? -12.104 -56.522 -10.089 1.00 18.09 ? 1166 GLY M CA  1 
ATOM   7497  C C   . GLY M  1 93  ? -13.265 -56.818 -9.182  1.00 19.79 ? 1166 GLY M C   1 
ATOM   7498  O O   . GLY M  1 93  ? -14.401 -57.022 -9.619  1.00 25.13 ? 1166 GLY M O   1 
ATOM   7499  N N   . VAL M  1 94  ? -12.976 -56.846 -7.896  1.00 19.39 ? 1167 VAL M N   1 
ATOM   7500  C CA  . VAL M  1 94  ? -13.983 -57.163 -6.870  1.00 21.34 ? 1167 VAL M CA  1 
ATOM   7501  C C   . VAL M  1 94  ? -14.333 -55.886 -6.064  1.00 24.44 ? 1167 VAL M C   1 
ATOM   7502  O O   . VAL M  1 94  ? -15.452 -55.698 -5.618  1.00 26.40 ? 1167 VAL M O   1 
ATOM   7503  C CB  . VAL M  1 94  ? -13.446 -58.255 -5.875  1.00 24.64 ? 1167 VAL M CB  1 
ATOM   7504  C CG1 . VAL M  1 94  ? -14.390 -58.415 -4.714  1.00 31.54 ? 1167 VAL M CG1 1 
ATOM   7505  C CG2 . VAL M  1 94  ? -13.242 -59.570 -6.540  1.00 28.54 ? 1167 VAL M CG2 1 
ATOM   7506  N N   . ASN M  1 95  ? -13.374 -54.990 -5.887  1.00 20.57 ? 1168 ASN M N   1 
ATOM   7507  C CA  . ASN M  1 95  ? -13.627 -53.769 -5.088  1.00 18.85 ? 1168 ASN M CA  1 
ATOM   7508  C C   . ASN M  1 95  ? -13.000 -52.642 -5.847  1.00 18.53 ? 1168 ASN M C   1 
ATOM   7509  O O   . ASN M  1 95  ? -11.775 -52.687 -6.032  1.00 19.25 ? 1168 ASN M O   1 
ATOM   7510  C CB  . ASN M  1 95  ? -12.931 -53.941 -3.736  1.00 23.56 ? 1168 ASN M CB  1 
ATOM   7511  C CG  . ASN M  1 95  ? -13.060 -52.706 -2.794  1.00 23.70 ? 1168 ASN M CG  1 
ATOM   7512  O OD1 . ASN M  1 95  ? -13.406 -52.869 -1.616  1.00 39.57 ? 1168 ASN M OD1 1 
ATOM   7513  N ND2 . ASN M  1 95  ? -12.794 -51.537 -3.283  1.00 21.19 ? 1168 ASN M ND2 1 
ATOM   7514  N N   . GLN M  1 96  ? -13.805 -51.674 -6.305  1.00 17.46 ? 1169 GLN M N   1 
ATOM   7515  C CA  . GLN M  1 96  ? -13.319 -50.638 -7.217  1.00 22.46 ? 1169 GLN M CA  1 
ATOM   7516  C C   . GLN M  1 96  ? -12.263 -49.770 -6.553  1.00 19.03 ? 1169 GLN M C   1 
ATOM   7517  O O   . GLN M  1 96  ? -11.244 -49.438 -7.165  1.00 20.42 ? 1169 GLN M O   1 
ATOM   7518  C CB  . GLN M  1 96  ? -14.462 -49.750 -7.735  1.00 28.48 ? 1169 GLN M CB  1 
ATOM   7519  C CG  . GLN M  1 96  ? -14.005 -48.718 -8.776  1.00 34.87 ? 1169 GLN M CG  1 
ATOM   7520  C CD  . GLN M  1 96  ? -15.168 -48.049 -9.507  1.00 40.18 ? 1169 GLN M CD  1 
ATOM   7521  O OE1 . GLN M  1 96  ? -16.165 -47.672 -8.891  1.00 44.78 ? 1169 GLN M OE1 1 
ATOM   7522  N NE2 . GLN M  1 96  ? -15.044 -47.914 -10.818 1.00 43.67 ? 1169 GLN M NE2 1 
ATOM   7523  N N   . ASP M  1 97  ? -12.479 -49.426 -5.283  1.00 18.76 ? 1170 ASP M N   1 
ATOM   7524  C CA  . ASP M  1 97  ? -11.473 -48.620 -4.595  1.00 19.07 ? 1170 ASP M CA  1 
ATOM   7525  C C   . ASP M  1 97  ? -10.165 -49.335 -4.355  1.00 18.62 ? 1170 ASP M C   1 
ATOM   7526  O O   . ASP M  1 97  ? -9.056  -48.745 -4.474  1.00 18.97 ? 1170 ASP M O   1 
ATOM   7527  C CB  . ASP M  1 97  ? -12.027 -47.990 -3.304  1.00 19.17 ? 1170 ASP M CB  1 
ATOM   7528  C CG  . ASP M  1 97  ? -13.137 -47.042 -3.595  1.00 23.97 ? 1170 ASP M CG  1 
ATOM   7529  O OD1 . ASP M  1 97  ? -14.265 -47.326 -3.126  1.00 24.45 ? 1170 ASP M OD1 1 
ATOM   7530  O OD2 . ASP M  1 97  ? -12.899 -46.053 -4.367  1.00 25.81 ? 1170 ASP M OD2 1 
ATOM   7531  N N   . LEU M  1 98  ? -10.222 -50.635 -4.048  1.00 17.51 ? 1171 LEU M N   1 
ATOM   7532  C CA  . LEU M  1 98  ? -8.983  -51.374 -3.998  1.00 18.22 ? 1171 LEU M CA  1 
ATOM   7533  C C   . LEU M  1 98  ? -8.269  -51.359 -5.363  1.00 17.60 ? 1171 LEU M C   1 
ATOM   7534  O O   . LEU M  1 98  ? -7.044  -51.137 -5.449  1.00 18.75 ? 1171 LEU M O   1 
ATOM   7535  C CB  . LEU M  1 98  ? -9.264  -52.823 -3.563  1.00 18.65 ? 1171 LEU M CB  1 
ATOM   7536  C CG  . LEU M  1 98  ? -8.092  -53.784 -3.394  1.00 21.85 ? 1171 LEU M CG  1 
ATOM   7537  C CD1 . LEU M  1 98  ? -8.595  -54.866 -2.432  1.00 34.01 ? 1171 LEU M CD1 1 
ATOM   7538  C CD2 . LEU M  1 98  ? -7.612  -54.467 -4.710  1.00 24.04 ? 1171 LEU M CD2 1 
ATOM   7539  N N   . ASP M  1 99  ? -9.016  -51.635 -6.425  1.00 15.72 ? 1172 ASP M N   1 
ATOM   7540  C CA  . ASP M  1 99  ? -8.410  -51.666 -7.747  1.00 17.52 ? 1172 ASP M CA  1 
ATOM   7541  C C   . ASP M  1 99  ? -7.779  -50.319 -8.075  1.00 19.03 ? 1172 ASP M C   1 
ATOM   7542  O O   . ASP M  1 99  ? -6.695  -50.286 -8.645  1.00 20.30 ? 1172 ASP M O   1 
ATOM   7543  C CB  . ASP M  1 99  ? -9.438  -52.003 -8.832  1.00 16.68 ? 1172 ASP M CB  1 
ATOM   7544  C CG  . ASP M  1 99  ? -9.846  -53.497 -8.828  1.00 19.84 ? 1172 ASP M CG  1 
ATOM   7545  O OD1 . ASP M  1 99  ? -10.830 -53.853 -9.505  1.00 21.32 ? 1172 ASP M OD1 1 
ATOM   7546  O OD2 . ASP M  1 99  ? -9.223  -54.308 -8.127  1.00 18.46 ? 1172 ASP M OD2 1 
ATOM   7547  N N   . LYS M  1 100 ? -8.472  -49.229 -7.770  1.00 18.55 ? 1173 LYS M N   1 
ATOM   7548  C CA  . LYS M  1 100 ? -7.908  -47.917 -8.078  1.00 20.46 ? 1173 LYS M CA  1 
ATOM   7549  C C   . LYS M  1 100 ? -6.656  -47.664 -7.246  1.00 21.06 ? 1173 LYS M C   1 
ATOM   7550  O O   . LYS M  1 100 ? -5.665  -47.096 -7.758  1.00 22.84 ? 1173 LYS M O   1 
ATOM   7551  C CB  . LYS M  1 100 ? -8.949  -46.811 -7.916  1.00 20.67 ? 1173 LYS M CB  1 
ATOM   7552  C CG  . LYS M  1 100 ? -10.066 -46.952 -8.955  1.00 23.22 ? 1173 LYS M CG  1 
ATOM   7553  C CD  . LYS M  1 100 ? -11.104 -45.840 -8.804  1.00 28.76 ? 1173 LYS M CD  1 
ATOM   7554  C CE  . LYS M  1 100 ? -12.151 -45.918 -9.897  1.00 34.44 ? 1173 LYS M CE  1 
ATOM   7555  N NZ  . LYS M  1 100 ? -13.254 -44.982 -9.572  1.00 39.81 ? 1173 LYS M NZ  1 
ATOM   7556  N N   . GLU M  1 101 ? -6.678  -48.076 -5.986  1.00 18.67 ? 1174 GLU M N   1 
ATOM   7557  C CA  . GLU M  1 101 ? -5.440  -48.001 -5.170  1.00 19.98 ? 1174 GLU M CA  1 
ATOM   7558  C C   . GLU M  1 101 ? -4.257  -48.722 -5.793  1.00 25.37 ? 1174 GLU M C   1 
ATOM   7559  O O   . GLU M  1 101 ? -3.146  -48.203 -5.876  1.00 21.22 ? 1174 GLU M O   1 
ATOM   7560  C CB  . GLU M  1 101 ? -5.679  -48.557 -3.768  1.00 22.97 ? 1174 GLU M CB  1 
ATOM   7561  C CG  . GLU M  1 101 ? -4.463  -48.486 -2.866  1.00 29.05 ? 1174 GLU M CG  1 
ATOM   7562  C CD  . GLU M  1 101 ? -4.637  -49.248 -1.546  1.00 27.64 ? 1174 GLU M CD  1 
ATOM   7563  O OE1 . GLU M  1 101 ? -5.722  -49.786 -1.265  1.00 27.73 ? 1174 GLU M OE1 1 
ATOM   7564  O OE2 . GLU M  1 101 ? -3.664  -49.308 -0.801  1.00 35.26 ? 1174 GLU M OE2 1 
ATOM   7565  N N   . LYS M  1 102 ? -4.503  -49.956 -6.222  1.00 17.79 ? 1175 LYS M N   1 
ATOM   7566  C CA  . LYS M  1 102 ? -3.450  -50.743 -6.831  1.00 20.95 ? 1175 LYS M CA  1 
ATOM   7567  C C   . LYS M  1 102 ? -2.947  -50.131 -8.112  1.00 19.63 ? 1175 LYS M C   1 
ATOM   7568  O O   . LYS M  1 102 ? -1.770  -50.185 -8.368  1.00 23.31 ? 1175 LYS M O   1 
ATOM   7569  C CB  . LYS M  1 102 ? -3.913  -52.174 -7.151  1.00 18.79 ? 1175 LYS M CB  1 
ATOM   7570  C CG  . LYS M  1 102 ? -4.353  -52.999 -5.947  1.00 20.97 ? 1175 LYS M CG  1 
ATOM   7571  C CD  . LYS M  1 102 ? -3.185  -53.453 -5.157  1.00 28.53 ? 1175 LYS M CD  1 
ATOM   7572  C CE  . LYS M  1 102 ? -3.548  -54.679 -4.359  1.00 31.59 ? 1175 LYS M CE  1 
ATOM   7573  N NZ  . LYS M  1 102 ? -2.993  -54.593 -2.981  1.00 39.37 ? 1175 LYS M NZ  1 
ATOM   7574  N N   . MET M  1 103 ? -3.833  -49.565 -8.910  1.00 18.62 ? 1176 MET M N   1 
ATOM   7575  C CA  . MET M  1 103 ? -3.443  -49.001 -10.189 1.00 23.14 ? 1176 MET M CA  1 
ATOM   7576  C C   . MET M  1 103 ? -2.490  -47.856 -10.011 1.00 24.91 ? 1176 MET M C   1 
ATOM   7577  O O   . MET M  1 103 ? -1.775  -47.505 -10.961 1.00 24.56 ? 1176 MET M O   1 
ATOM   7578  C CB  . MET M  1 103 ? -4.679  -48.549 -10.998 1.00 22.11 ? 1176 MET M CB  1 
ATOM   7579  C CG  . MET M  1 103 ? -5.102  -49.672 -12.002 1.00 26.99 ? 1176 MET M CG  1 
ATOM   7580  S SD  . MET M  1 103 ? -6.490  -49.198 -12.989 1.00 45.15 ? 1176 MET M SD  1 
ATOM   7581  C CE  . MET M  1 103 ? -7.745  -49.224 -11.720 1.00 29.08 ? 1176 MET M CE  1 
ATOM   7582  N N   . LEU M  1 104 ? -2.489  -47.249 -8.829  1.00 21.34 ? 1177 LEU M N   1 
ATOM   7583  C CA  . LEU M  1 104 ? -1.603  -46.098 -8.605  1.00 27.79 ? 1177 LEU M CA  1 
ATOM   7584  C C   . LEU M  1 104 ? -0.282  -46.429 -7.955  1.00 24.48 ? 1177 LEU M C   1 
ATOM   7585  O O   . LEU M  1 104 ? 0.513   -45.535 -7.641  1.00 27.70 ? 1177 LEU M O   1 
ATOM   7586  C CB  . LEU M  1 104 ? -2.301  -45.047 -7.745  1.00 23.09 ? 1177 LEU M CB  1 
ATOM   7587  C CG  . LEU M  1 104 ? -3.526  -44.457 -8.383  1.00 26.81 ? 1177 LEU M CG  1 
ATOM   7588  C CD1 . LEU M  1 104 ? -4.292  -43.624 -7.346  1.00 25.31 ? 1177 LEU M CD1 1 
ATOM   7589  C CD2 . LEU M  1 104 ? -3.086  -43.586 -9.574  1.00 30.64 ? 1177 LEU M CD2 1 
ATOM   7590  N N   . GLU M  1 105 ? -0.042  -47.694 -7.710  1.00 25.67 ? 1178 GLU M N   1 
ATOM   7591  C CA  . GLU M  1 105 ? 1.125   -48.113 -6.951  1.00 24.34 ? 1178 GLU M CA  1 
ATOM   7592  C C   . GLU M  1 105 ? 2.472   -47.780 -7.646  1.00 25.86 ? 1178 GLU M C   1 
ATOM   7593  O O   . GLU M  1 105 ? 3.435   -47.385 -6.983  1.00 30.07 ? 1178 GLU M O   1 
ATOM   7594  C CB  . GLU M  1 105 ? 1.026   -49.615 -6.724  1.00 28.68 ? 1178 GLU M CB  1 
ATOM   7595  C CG  . GLU M  1 105 ? 1.967   -50.194 -5.735  1.00 31.71 ? 1178 GLU M CG  1 
ATOM   7596  C CD  . GLU M  1 105 ? 1.805   -51.714 -5.627  1.00 35.38 ? 1178 GLU M CD  1 
ATOM   7597  O OE1 . GLU M  1 105 ? 0.698   -52.194 -5.299  1.00 33.12 ? 1178 GLU M OE1 1 
ATOM   7598  O OE2 . GLU M  1 105 ? 2.799   -52.408 -5.845  1.00 32.71 ? 1178 GLU M OE2 1 
ATOM   7599  N N   . GLY M  1 106 ? 2.547   -47.927 -8.961  1.00 25.90 ? 1179 GLY M N   1 
ATOM   7600  C CA  . GLY M  1 106 ? 3.821   -47.815 -9.655  1.00 26.77 ? 1179 GLY M CA  1 
ATOM   7601  C C   . GLY M  1 106 ? 4.473   -46.449 -9.462  1.00 28.85 ? 1179 GLY M C   1 
ATOM   7602  O O   . GLY M  1 106 ? 3.793   -45.459 -9.355  1.00 25.29 ? 1179 GLY M O   1 
ATOM   7603  N N   . ARG M  1 107 ? 5.809   -46.404 -9.450  1.00 31.41 ? 1180 ARG M N   1 
ATOM   7604  C CA  . ARG M  1 107 ? 6.505   -45.167 -9.084  1.00 34.05 ? 1180 ARG M CA  1 
ATOM   7605  C C   . ARG M  1 107 ? 6.626   -44.206 -10.239 1.00 31.53 ? 1180 ARG M C   1 
ATOM   7606  O O   . ARG M  1 107 ? 6.562   -43.005 -10.057 1.00 32.83 ? 1180 ARG M O   1 
ATOM   7607  C CB  . ARG M  1 107 ? 7.892   -45.474 -8.508  1.00 37.44 ? 1180 ARG M CB  1 
ATOM   7608  C CG  . ARG M  1 107 ? 8.760   -46.368 -9.355  1.00 46.91 ? 1180 ARG M CG  1 
ATOM   7609  C CD  . ARG M  1 107 ? 10.096  -46.641 -8.609  1.00 53.94 ? 1180 ARG M CD  1 
ATOM   7610  N NE  . ARG M  1 107 ? 11.090  -47.383 -9.393  1.00 55.40 ? 1180 ARG M NE  1 
ATOM   7611  C CZ  . ARG M  1 107 ? 11.046  -48.695 -9.621  1.00 55.10 ? 1180 ARG M CZ  1 
ATOM   7612  N NH1 . ARG M  1 107 ? 12.004  -49.272 -10.339 1.00 53.11 ? 1180 ARG M NH1 1 
ATOM   7613  N NH2 . ARG M  1 107 ? 10.036  -49.430 -9.153  1.00 54.62 ? 1180 ARG M NH2 1 
ATOM   7614  N N   . LYS M  1 108 ? 6.813   -44.720 -11.447 1.00 30.25 ? 1181 LYS M N   1 
ATOM   7615  C CA  . LYS M  1 108 ? 6.840   -43.811 -12.595 1.00 33.15 ? 1181 LYS M CA  1 
ATOM   7616  C C   . LYS M  1 108 ? 5.605   -43.954 -13.480 1.00 34.54 ? 1181 LYS M C   1 
ATOM   7617  O O   . LYS M  1 108 ? 4.962   -45.004 -13.513 1.00 29.24 ? 1181 LYS M O   1 
ATOM   7618  C CB  . LYS M  1 108 ? 8.080   -44.061 -13.449 1.00 37.91 ? 1181 LYS M CB  1 
ATOM   7619  C CG  . LYS M  1 108 ? 9.399   -43.988 -12.682 1.00 39.39 ? 1181 LYS M CG  1 
ATOM   7620  C CD  . LYS M  1 108 ? 10.381  -45.018 -13.246 1.00 51.23 ? 1181 LYS M CD  1 
ATOM   7621  C CE  . LYS M  1 108 ? 11.832  -44.727 -12.847 1.00 60.18 ? 1181 LYS M CE  1 
ATOM   7622  N NZ  . LYS M  1 108 ? 12.480  -43.666 -13.687 1.00 61.63 ? 1181 LYS M NZ  1 
ATOM   7623  N N   . SER M  1 109 ? 5.326   -42.899 -14.232 1.00 33.27 ? 1182 SER M N   1 
ATOM   7624  C CA  . SER M  1 109 ? 4.203   -42.870 -15.145 1.00 34.06 ? 1182 SER M CA  1 
ATOM   7625  C C   . SER M  1 109 ? 4.126   -44.087 -16.083 1.00 34.37 ? 1182 SER M C   1 
ATOM   7626  O O   . SER M  1 109 ? 3.045   -44.640 -16.301 1.00 31.52 ? 1182 SER M O   1 
ATOM   7627  C CB  . SER M  1 109 ? 4.234   -41.561 -15.943 1.00 44.24 ? 1182 SER M CB  1 
ATOM   7628  O OG  . SER M  1 109 ? 2.931   -41.014 -16.069 1.00 49.34 ? 1182 SER M OG  1 
ATOM   7629  N N   . ASN M  1 110 ? 5.251   -44.518 -16.649 1.00 36.78 ? 1183 ASN M N   1 
ATOM   7630  C CA  . ASN M  1 110 ? 5.221   -45.600 -17.654 1.00 36.01 ? 1183 ASN M CA  1 
ATOM   7631  C C   . ASN M  1 110 ? 4.902   -46.972 -17.066 1.00 31.89 ? 1183 ASN M C   1 
ATOM   7632  O O   . ASN M  1 110 ? 4.230   -47.805 -17.682 1.00 27.51 ? 1183 ASN M O   1 
ATOM   7633  C CB  . ASN M  1 110 ? 6.517   -45.643 -18.497 1.00 34.91 ? 1183 ASN M CB  1 
ATOM   7634  C CG  . ASN M  1 110 ? 7.731   -46.062 -17.685 1.00 42.18 ? 1183 ASN M CG  1 
ATOM   7635  O OD1 . ASN M  1 110 ? 8.108   -45.383 -16.721 1.00 46.16 ? 1183 ASN M OD1 1 
ATOM   7636  N ND2 . ASN M  1 110 ? 8.349   -47.195 -18.059 1.00 45.19 ? 1183 ASN M ND2 1 
ATOM   7637  N N   . ILE M  1 111 ? 5.383   -47.196 -15.857 1.00 31.68 ? 1184 ILE M N   1 
ATOM   7638  C CA  . ILE M  1 111 ? 5.043   -48.379 -15.102 1.00 30.79 ? 1184 ILE M CA  1 
ATOM   7639  C C   . ILE M  1 111 ? 3.526   -48.392 -14.816 1.00 28.79 ? 1184 ILE M C   1 
ATOM   7640  O O   . ILE M  1 111 ? 2.849   -49.423 -15.022 1.00 25.57 ? 1184 ILE M O   1 
ATOM   7641  C CB  . ILE M  1 111 ? 5.832   -48.348 -13.776 1.00 33.44 ? 1184 ILE M CB  1 
ATOM   7642  C CG1 . ILE M  1 111 ? 7.331   -48.445 -14.097 1.00 37.46 ? 1184 ILE M CG1 1 
ATOM   7643  C CG2 . ILE M  1 111 ? 5.408   -49.439 -12.882 1.00 32.47 ? 1184 ILE M CG2 1 
ATOM   7644  C CD1 . ILE M  1 111 ? 8.248   -48.420 -12.879 1.00 43.14 ? 1184 ILE M CD1 1 
ATOM   7645  N N   . ARG M  1 112 ? 3.011   -47.268 -14.328 1.00 27.92 ? 1185 ARG M N   1 
ATOM   7646  C CA  . ARG M  1 112 ? 1.574   -47.200 -14.006 1.00 24.31 ? 1185 ARG M CA  1 
ATOM   7647  C C   . ARG M  1 112 ? 0.748   -47.448 -15.269 1.00 25.48 ? 1185 ARG M C   1 
ATOM   7648  O O   . ARG M  1 112 ? -0.325  -48.038 -15.209 1.00 22.22 ? 1185 ARG M O   1 
ATOM   7649  C CB  . ARG M  1 112 ? 1.172   -45.860 -13.380 1.00 29.17 ? 1185 ARG M CB  1 
ATOM   7650  C CG  . ARG M  1 112 ? 1.705   -45.696 -11.991 1.00 26.96 ? 1185 ARG M CG  1 
ATOM   7651  C CD  . ARG M  1 112 ? 1.141   -44.513 -11.267 1.00 27.86 ? 1185 ARG M CD  1 
ATOM   7652  N NE  . ARG M  1 112 ? 1.443   -43.223 -11.901 1.00 32.93 ? 1185 ARG M NE  1 
ATOM   7653  C CZ  . ARG M  1 112 ? 2.561   -42.519 -11.716 1.00 36.04 ? 1185 ARG M CZ  1 
ATOM   7654  N NH1 . ARG M  1 112 ? 3.537   -42.968 -10.925 1.00 30.02 ? 1185 ARG M NH1 1 
ATOM   7655  N NH2 . ARG M  1 112 ? 2.706   -41.343 -12.331 1.00 38.79 ? 1185 ARG M NH2 1 
ATOM   7656  N N   . LYS M  1 113 ? 1.224   -46.953 -16.408 1.00 25.40 ? 1186 LYS M N   1 
ATOM   7657  C CA  . LYS M  1 113 ? 0.445   -47.067 -17.642 1.00 24.38 ? 1186 LYS M CA  1 
ATOM   7658  C C   . LYS M  1 113 ? 0.340   -48.524 -18.084 1.00 22.71 ? 1186 LYS M C   1 
ATOM   7659  O O   . LYS M  1 113 ? -0.738  -48.968 -18.507 1.00 23.48 ? 1186 LYS M O   1 
ATOM   7660  C CB  . LYS M  1 113 ? 1.003   -46.178 -18.787 1.00 23.48 ? 1186 LYS M CB  1 
ATOM   7661  C CG  . LYS M  1 113 ? 0.092   -46.254 -20.033 1.00 28.50 ? 1186 LYS M CG  1 
ATOM   7662  C CD  . LYS M  1 113 ? 0.426   -45.255 -21.158 1.00 30.52 ? 1186 LYS M CD  1 
ATOM   7663  C CE  . LYS M  1 113 ? 1.684   -45.651 -21.920 1.00 27.85 ? 1186 LYS M CE  1 
ATOM   7664  N NZ  . LYS M  1 113 ? 1.449   -46.607 -23.041 1.00 31.13 ? 1186 LYS M NZ  1 
ATOM   7665  N N   . SER M  1 114 ? 1.436   -49.273 -17.958 1.00 22.96 ? 1187 SER M N   1 
ATOM   7666  C CA  . SER M  1 114 ? 1.454   -50.673 -18.290 1.00 21.97 ? 1187 SER M CA  1 
ATOM   7667  C C   . SER M  1 114 ? 0.493   -51.441 -17.371 1.00 19.77 ? 1187 SER M C   1 
ATOM   7668  O O   . SER M  1 114 ? -0.171  -52.386 -17.796 1.00 22.26 ? 1187 SER M O   1 
ATOM   7669  C CB  . SER M  1 114 ? 2.874   -51.237 -18.115 1.00 24.73 ? 1187 SER M CB  1 
ATOM   7670  O OG  . SER M  1 114 ? 2.908   -52.630 -18.351 1.00 29.27 ? 1187 SER M OG  1 
ATOM   7671  N N   . VAL M  1 115 ? 0.448   -51.036 -16.109 1.00 21.25 ? 1188 VAL M N   1 
ATOM   7672  C CA  . VAL M  1 115 ? -0.415  -51.710 -15.155 1.00 18.03 ? 1188 VAL M CA  1 
ATOM   7673  C C   . VAL M  1 115 ? -1.870  -51.437 -15.530 1.00 17.79 ? 1188 VAL M C   1 
ATOM   7674  O O   . VAL M  1 115 ? -2.700  -52.333 -15.443 1.00 18.83 ? 1188 VAL M O   1 
ATOM   7675  C CB  . VAL M  1 115 ? -0.172  -51.165 -13.734 1.00 19.65 ? 1188 VAL M CB  1 
ATOM   7676  C CG1 . VAL M  1 115 ? -1.299  -51.581 -12.790 1.00 16.39 ? 1188 VAL M CG1 1 
ATOM   7677  C CG2 . VAL M  1 115 ? 1.173   -51.727 -13.195 1.00 21.47 ? 1188 VAL M CG2 1 
ATOM   7678  N N   . GLN M  1 116 ? -2.172  -50.195 -15.910 1.00 17.73 ? 1189 GLN M N   1 
ATOM   7679  C CA  . GLN M  1 116 ? -3.568  -49.807 -16.233 1.00 19.17 ? 1189 GLN M CA  1 
ATOM   7680  C C   . GLN M  1 116 ? -4.018  -50.528 -17.474 1.00 20.82 ? 1189 GLN M C   1 
ATOM   7681  O O   . GLN M  1 116 ? -5.134  -50.980 -17.562 1.00 19.34 ? 1189 GLN M O   1 
ATOM   7682  C CB  . GLN M  1 116 ? -3.711  -48.302 -16.462 1.00 23.11 ? 1189 GLN M CB  1 
ATOM   7683  C CG  . GLN M  1 116 ? -3.459  -47.425 -15.243 1.00 24.85 ? 1189 GLN M CG  1 
ATOM   7684  C CD  . GLN M  1 116 ? -3.433  -45.937 -15.667 1.00 27.57 ? 1189 GLN M CD  1 
ATOM   7685  O OE1 . GLN M  1 116 ? -4.346  -45.465 -16.335 1.00 35.70 ? 1189 GLN M OE1 1 
ATOM   7686  N NE2 . GLN M  1 116 ? -2.386  -45.234 -15.306 1.00 35.86 ? 1189 GLN M NE2 1 
ATOM   7687  N N   . ILE M  1 117 ? -3.157  -50.587 -18.477 1.00 16.21 ? 1190 ILE M N   1 
ATOM   7688  C CA  . ILE M  1 117 ? -3.509  -51.367 -19.669 1.00 16.12 ? 1190 ILE M CA  1 
ATOM   7689  C C   . ILE M  1 117 ? -3.821  -52.810 -19.328 1.00 20.66 ? 1190 ILE M C   1 
ATOM   7690  O O   . ILE M  1 117 ? -4.825  -53.395 -19.798 1.00 19.14 ? 1190 ILE M O   1 
ATOM   7691  C CB  . ILE M  1 117 ? -2.380  -51.260 -20.735 1.00 21.36 ? 1190 ILE M CB  1 
ATOM   7692  C CG1 . ILE M  1 117 ? -2.406  -49.855 -21.321 1.00 24.13 ? 1190 ILE M CG1 1 
ATOM   7693  C CG2 . ILE M  1 117 ? -2.504  -52.362 -21.807 1.00 23.00 ? 1190 ILE M CG2 1 
ATOM   7694  C CD1 . ILE M  1 117 ? -1.180  -49.603 -22.274 1.00 24.29 ? 1190 ILE M CD1 1 
ATOM   7695  N N   . ALA M  1 118 ? -2.966  -53.390 -18.483 1.00 18.66 ? 1191 ALA M N   1 
ATOM   7696  C CA  . ALA M  1 118 ? -3.100  -54.774 -18.124 1.00 17.73 ? 1191 ALA M CA  1 
ATOM   7697  C C   . ALA M  1 118 ? -4.426  -54.964 -17.355 1.00 15.47 ? 1191 ALA M C   1 
ATOM   7698  O O   . ALA M  1 118 ? -5.050  -55.998 -17.445 1.00 17.20 ? 1191 ALA M O   1 
ATOM   7699  C CB  . ALA M  1 118 ? -1.953  -55.167 -17.253 1.00 18.30 ? 1191 ALA M CB  1 
ATOM   7700  N N   . TYR M  1 119 ? -4.791  -53.963 -16.585 1.00 16.02 ? 1192 TYR M N   1 
ATOM   7701  C CA  . TYR M  1 119 ? -6.021  -54.063 -15.806 1.00 14.92 ? 1192 TYR M CA  1 
ATOM   7702  C C   . TYR M  1 119 ? -7.221  -54.102 -16.719 1.00 16.72 ? 1192 TYR M C   1 
ATOM   7703  O O   . TYR M  1 119 ? -8.147  -54.908 -16.505 1.00 17.31 ? 1192 TYR M O   1 
ATOM   7704  C CB  . TYR M  1 119 ? -6.151  -52.849 -14.865 1.00 17.45 ? 1192 TYR M CB  1 
ATOM   7705  C CG  . TYR M  1 119 ? -7.455  -52.778 -14.135 1.00 17.07 ? 1192 TYR M CG  1 
ATOM   7706  C CD1 . TYR M  1 119 ? -7.657  -53.494 -12.964 1.00 16.88 ? 1192 TYR M CD1 1 
ATOM   7707  C CD2 . TYR M  1 119 ? -8.461  -51.955 -14.573 1.00 20.50 ? 1192 TYR M CD2 1 
ATOM   7708  C CE1 . TYR M  1 119 ? -8.858  -53.427 -12.270 1.00 24.15 ? 1192 TYR M CE1 1 
ATOM   7709  C CE2 . TYR M  1 119 ? -9.673  -51.860 -13.866 1.00 23.96 ? 1192 TYR M CE2 1 
ATOM   7710  C CZ  . TYR M  1 119 ? -9.859  -52.604 -12.729 1.00 21.35 ? 1192 TYR M CZ  1 
ATOM   7711  O OH  . TYR M  1 119 ? -11.064 -52.532 -12.014 1.00 27.03 ? 1192 TYR M OH  1 
ATOM   7712  N N   . HIS M  1 120 ? -7.234  -53.208 -17.705 1.00 16.66 ? 1193 HIS M N   1 
ATOM   7713  C CA  . HIS M  1 120 ? -8.347  -53.242 -18.675 1.00 17.22 ? 1193 HIS M CA  1 
ATOM   7714  C C   . HIS M  1 120 ? -8.340  -54.491 -19.523 1.00 18.21 ? 1193 HIS M C   1 
ATOM   7715  O O   . HIS M  1 120 ? -9.402  -54.997 -19.890 1.00 19.84 ? 1193 HIS M O   1 
ATOM   7716  C CB  . HIS M  1 120 ? -8.391  -51.951 -19.496 1.00 17.49 ? 1193 HIS M CB  1 
ATOM   7717  C CG  . HIS M  1 120 ? -8.691  -50.750 -18.649 1.00 18.42 ? 1193 HIS M CG  1 
ATOM   7718  N ND1 . HIS M  1 120 ? -9.904  -50.579 -18.004 1.00 19.15 ? 1193 HIS M ND1 1 
ATOM   7719  C CD2 . HIS M  1 120 ? -7.904  -49.730 -18.244 1.00 23.40 ? 1193 HIS M CD2 1 
ATOM   7720  C CE1 . HIS M  1 120 ? -9.859  -49.462 -17.292 1.00 23.60 ? 1193 HIS M CE1 1 
ATOM   7721  N NE2 . HIS M  1 120 ? -8.659  -48.926 -17.432 1.00 23.94 ? 1193 HIS M NE2 1 
ATOM   7722  N N   . ARG M  1 121 ? -7.158  -55.038 -19.793 1.00 16.08 ? 1194 ARG M N   1 
ATOM   7723  C CA  . ARG M  1 121 ? -7.131  -56.329 -20.501 1.00 15.53 ? 1194 ARG M CA  1 
ATOM   7724  C C   . ARG M  1 121 ? -7.709  -57.448 -19.644 1.00 19.57 ? 1194 ARG M C   1 
ATOM   7725  O O   . ARG M  1 121 ? -8.426  -58.311 -20.129 1.00 21.54 ? 1194 ARG M O   1 
ATOM   7726  C CB  . ARG M  1 121 ? -5.725  -56.717 -20.901 1.00 20.25 ? 1194 ARG M CB  1 
ATOM   7727  C CG  . ARG M  1 121 ? -5.154  -55.806 -21.933 1.00 22.37 ? 1194 ARG M CG  1 
ATOM   7728  C CD  . ARG M  1 121 ? -3.675  -55.995 -21.829 1.00 31.24 ? 1194 ARG M CD  1 
ATOM   7729  N NE  . ARG M  1 121 ? -2.969  -55.503 -22.985 1.00 34.61 ? 1194 ARG M NE  1 
ATOM   7730  C CZ  . ARG M  1 121 ? -1.638  -55.399 -23.023 1.00 36.51 ? 1194 ARG M CZ  1 
ATOM   7731  N NH1 . ARG M  1 121 ? -1.065  -54.925 -24.113 1.00 30.79 ? 1194 ARG M NH1 1 
ATOM   7732  N NH2 . ARG M  1 121 ? -0.907  -55.730 -21.936 1.00 30.90 ? 1194 ARG M NH2 1 
ATOM   7733  N N   . ALA M  1 122 ? -7.414  -57.410 -18.351 1.00 17.24 ? 1195 ALA M N   1 
ATOM   7734  C CA  . ALA M  1 122 ? -7.921  -58.421 -17.423 1.00 16.59 ? 1195 ALA M CA  1 
ATOM   7735  C C   . ALA M  1 122 ? -9.479  -58.332 -17.380 1.00 17.88 ? 1195 ALA M C   1 
ATOM   7736  O O   . ALA M  1 122 ? -10.146 -59.363 -17.385 1.00 19.94 ? 1195 ALA M O   1 
ATOM   7737  C CB  . ALA M  1 122 ? -7.339  -58.177 -16.003 1.00 15.51 ? 1195 ALA M CB  1 
ATOM   7738  N N   . LEU M  1 123 ? -10.035 -57.125 -17.341 1.00 18.64 ? 1196 LEU M N   1 
ATOM   7739  C CA  . LEU M  1 123 ? -11.512 -57.002 -17.290 1.00 21.47 ? 1196 LEU M CA  1 
ATOM   7740  C C   . LEU M  1 123 ? -12.166 -57.382 -18.623 1.00 22.93 ? 1196 LEU M C   1 
ATOM   7741  O O   . LEU M  1 123 ? -13.319 -57.831 -18.655 1.00 22.87 ? 1196 LEU M O   1 
ATOM   7742  C CB  . LEU M  1 123 ? -11.922 -55.578 -16.922 1.00 17.78 ? 1196 LEU M CB  1 
ATOM   7743  C CG  . LEU M  1 123 ? -11.510 -55.162 -15.489 1.00 20.76 ? 1196 LEU M CG  1 
ATOM   7744  C CD1 . LEU M  1 123 ? -12.292 -53.981 -15.037 1.00 24.20 ? 1196 LEU M CD1 1 
ATOM   7745  C CD2 . LEU M  1 123 ? -11.772 -56.313 -14.533 1.00 24.65 ? 1196 LEU M CD2 1 
ATOM   7746  N N   . GLN M  1 124 ? -11.453 -57.173 -19.720 1.00 19.85 ? 1197 GLN M N   1 
ATOM   7747  C CA  . GLN M  1 124 ? -11.966 -57.671 -21.031 1.00 21.27 ? 1197 GLN M CA  1 
ATOM   7748  C C   . GLN M  1 124 ? -12.007 -59.193 -21.112 1.00 24.90 ? 1197 GLN M C   1 
ATOM   7749  O O   . GLN M  1 124 ? -12.958 -59.788 -21.677 1.00 24.61 ? 1197 GLN M O   1 
ATOM   7750  C CB  . GLN M  1 124 ? -11.101 -57.132 -22.160 1.00 20.44 ? 1197 GLN M CB  1 
ATOM   7751  C CG  . GLN M  1 124 ? -11.294 -55.622 -22.405 1.00 21.09 ? 1197 GLN M CG  1 
ATOM   7752  C CD  . GLN M  1 124 ? -10.374 -55.153 -23.470 1.00 24.01 ? 1197 GLN M CD  1 
ATOM   7753  O OE1 . GLN M  1 124 ? -10.594 -55.448 -24.641 1.00 25.26 ? 1197 GLN M OE1 1 
ATOM   7754  N NE2 . GLN M  1 124 ? -9.319  -54.443 -23.087 1.00 21.76 ? 1197 GLN M NE2 1 
ATOM   7755  N N   . HIS M  1 125 ? -10.953 -59.825 -20.619 1.00 23.03 ? 1198 HIS M N   1 
ATOM   7756  C CA  . HIS M  1 125 ? -10.957 -61.283 -20.401 1.00 21.98 ? 1198 HIS M CA  1 
ATOM   7757  C C   . HIS M  1 125 ? -12.179 -61.710 -19.614 1.00 21.75 ? 1198 HIS M C   1 
ATOM   7758  O O   . HIS M  1 125 ? -12.902 -62.639 -20.007 1.00 26.20 ? 1198 HIS M O   1 
ATOM   7759  C CB  . HIS M  1 125 ? -9.697  -61.757 -19.665 1.00 20.97 ? 1198 HIS M CB  1 
ATOM   7760  C CG  . HIS M  1 125 ? -9.767  -63.188 -19.195 1.00 21.77 ? 1198 HIS M CG  1 
ATOM   7761  N ND1 . HIS M  1 125 ? -9.317  -64.251 -19.953 1.00 25.34 ? 1198 HIS M ND1 1 
ATOM   7762  C CD2 . HIS M  1 125 ? -10.259 -63.718 -18.056 1.00 20.34 ? 1198 HIS M CD2 1 
ATOM   7763  C CE1 . HIS M  1 125 ? -9.506  -65.372 -19.280 1.00 22.53 ? 1198 HIS M CE1 1 
ATOM   7764  N NE2 . HIS M  1 125 ? -10.100 -65.080 -18.140 1.00 23.11 ? 1198 HIS M NE2 1 
ATOM   7765  N N   . ARG M  1 126 ? -12.432 -61.038 -18.502 1.00 18.01 ? 1199 ARG M N   1 
ATOM   7766  C CA  . ARG M  1 126 ? -13.574 -61.418 -17.699 1.00 23.90 ? 1199 ARG M CA  1 
ATOM   7767  C C   . ARG M  1 126 ? -14.849 -61.301 -18.495 1.00 26.47 ? 1199 ARG M C   1 
ATOM   7768  O O   . ARG M  1 126 ? -15.772 -62.108 -18.369 1.00 26.31 ? 1199 ARG M O   1 
ATOM   7769  C CB  . ARG M  1 126 ? -13.692 -60.526 -16.463 1.00 23.98 ? 1199 ARG M CB  1 
ATOM   7770  C CG  . ARG M  1 126 ? -14.742 -61.043 -15.452 1.00 29.30 ? 1199 ARG M CG  1 
ATOM   7771  C CD  . ARG M  1 126 ? -14.718 -60.168 -14.157 1.00 26.33 ? 1199 ARG M CD  1 
ATOM   7772  N NE  . ARG M  1 126 ? -15.072 -58.799 -14.476 1.00 25.52 ? 1199 ARG M NE  1 
ATOM   7773  C CZ  . ARG M  1 126 ? -15.073 -57.822 -13.575 1.00 27.83 ? 1199 ARG M CZ  1 
ATOM   7774  N NH1 . ARG M  1 126 ? -15.441 -56.591 -13.913 1.00 27.75 ? 1199 ARG M NH1 1 
ATOM   7775  N NH2 . ARG M  1 126 ? -14.706 -58.098 -12.333 1.00 26.61 ? 1199 ARG M NH2 1 
ATOM   7776  N N   . SER M  1 127 ? -14.938 -60.231 -19.258 1.00 25.39 ? 1200 SER M N   1 
ATOM   7777  C CA  . SER M  1 127 ? -16.152 -59.987 -20.019 1.00 28.42 ? 1200 SER M CA  1 
ATOM   7778  C C   . SER M  1 127 ? -16.370 -61.105 -21.059 1.00 33.37 ? 1200 SER M C   1 
ATOM   7779  O O   . SER M  1 127 ? -17.501 -61.550 -21.291 1.00 29.64 ? 1200 SER M O   1 
ATOM   7780  C CB  . SER M  1 127 ? -16.090 -58.576 -20.641 1.00 29.52 ? 1200 SER M CB  1 
ATOM   7781  O OG  . SER M  1 127 ? -17.014 -58.430 -21.689 1.00 44.39 ? 1200 SER M OG  1 
ATOM   7782  N N   . LYS M  1 128 ? -15.295 -61.593 -21.646 1.00 26.54 ? 1201 LYS M N   1 
ATOM   7783  C CA  . LYS M  1 128 ? -15.435 -62.696 -22.614 1.00 31.56 ? 1201 LYS M CA  1 
ATOM   7784  C C   . LYS M  1 128 ? -15.879 -63.993 -21.935 1.00 33.53 ? 1201 LYS M C   1 
ATOM   7785  O O   . LYS M  1 128 ? -16.758 -64.713 -22.417 1.00 33.76 ? 1201 LYS M O   1 
ATOM   7786  C CB  . LYS M  1 128 ? -14.135 -62.905 -23.393 1.00 32.26 ? 1201 LYS M CB  1 
ATOM   7787  C CG  . LYS M  1 128 ? -13.808 -61.785 -24.354 1.00 39.39 ? 1201 LYS M CG  1 
ATOM   7788  C CD  . LYS M  1 128 ? -12.364 -61.936 -24.864 1.00 46.25 ? 1201 LYS M CD  1 
ATOM   7789  C CE  . LYS M  1 128 ? -11.954 -60.805 -25.827 1.00 47.53 ? 1201 LYS M CE  1 
ATOM   7790  N NZ  . LYS M  1 128 ? -10.494 -60.855 -26.188 1.00 44.75 ? 1201 LYS M NZ  1 
ATOM   7791  N N   . VAL M  1 129 ? -15.287 -64.310 -20.802 1.00 27.11 ? 1202 VAL M N   1 
ATOM   7792  C CA  . VAL M  1 129 ? -15.711 -65.477 -20.037 1.00 26.82 ? 1202 VAL M CA  1 
ATOM   7793  C C   . VAL M  1 129 ? -17.194 -65.366 -19.601 1.00 33.40 ? 1202 VAL M C   1 
ATOM   7794  O O   . VAL M  1 129 ? -17.921 -66.358 -19.584 1.00 33.05 ? 1202 VAL M O   1 
ATOM   7795  C CB  . VAL M  1 129 ? -14.789 -65.674 -18.794 1.00 32.29 ? 1202 VAL M CB  1 
ATOM   7796  C CG1 . VAL M  1 129 ? -15.246 -66.857 -17.942 1.00 35.43 ? 1202 VAL M CG1 1 
ATOM   7797  C CG2 . VAL M  1 129 ? -13.362 -65.884 -19.239 1.00 26.96 ? 1202 VAL M CG2 1 
ATOM   7798  N N   . GLN M  1 130 ? -17.655 -64.159 -19.289 1.00 29.61 ? 1203 GLN M N   1 
ATOM   7799  C CA  . GLN M  1 130 ? -19.045 -63.980 -18.843 1.00 36.24 ? 1203 GLN M CA  1 
ATOM   7800  C C   . GLN M  1 130 ? -20.098 -63.943 -19.943 1.00 39.90 ? 1203 GLN M C   1 
ATOM   7801  O O   . GLN M  1 130 ? -21.288 -63.767 -19.658 1.00 44.05 ? 1203 GLN M O   1 
ATOM   7802  C CB  . GLN M  1 130 ? -19.184 -62.703 -18.028 1.00 39.51 ? 1203 GLN M CB  1 
ATOM   7803  C CG  . GLN M  1 130 ? -18.603 -62.813 -16.656 1.00 37.69 ? 1203 GLN M CG  1 
ATOM   7804  C CD  . GLN M  1 130 ? -18.483 -61.465 -15.962 1.00 37.99 ? 1203 GLN M CD  1 
ATOM   7805  O OE1 . GLN M  1 130 ? -18.237 -61.407 -14.764 1.00 42.70 ? 1203 GLN M OE1 1 
ATOM   7806  N NE2 . GLN M  1 130 ? -18.659 -60.380 -16.721 1.00 39.86 ? 1203 GLN M NE2 1 
ATOM   7807  N N   . GLY M  1 131 ? -19.677 -64.074 -21.193 1.00 43.03 ? 1204 GLY M N   1 
ATOM   7808  C CA  . GLY M  1 131 ? -20.627 -64.074 -22.297 1.00 47.30 ? 1204 GLY M CA  1 
ATOM   7809  C C   . GLY M  1 131 ? -20.523 -62.830 -23.156 1.00 50.09 ? 1204 GLY M C   1 
ATOM   7810  O O   . GLY M  1 131 ? -21.218 -62.697 -24.170 1.00 54.23 ? 1204 GLY M O   1 
ATOM   7811  N N   . GLU M  1 132 ? -19.642 -61.929 -22.719 1.00 49.31 ? 1205 GLU M N   1 
ATOM   7812  C CA  . GLU M  1 132 ? -19.285 -60.670 -23.385 1.00 49.76 ? 1205 GLU M CA  1 
ATOM   7813  C C   . GLU M  1 132 ? -20.432 -59.659 -23.434 1.00 61.57 ? 1205 GLU M C   1 
ATOM   7814  O O   . GLU M  1 132 ? -21.117 -59.460 -22.414 1.00 63.43 ? 1205 GLU M O   1 
ATOM   7815  C CB  . GLU M  1 132 ? -18.614 -60.879 -24.762 1.00 51.23 ? 1205 GLU M CB  1 
ATOM   7816  C CG  . GLU M  1 132 ? -17.997 -59.578 -25.299 1.00 57.40 ? 1205 GLU M CG  1 
ATOM   7817  C CD  . GLU M  1 132 ? -16.793 -59.755 -26.247 1.00 66.02 ? 1205 GLU M CD  1 
ATOM   7818  O OE1 . GLU M  1 132 ? -16.498 -58.789 -27.003 1.00 64.35 ? 1205 GLU M OE1 1 
ATOM   7819  O OE2 . GLU M  1 132 ? -16.136 -60.827 -26.235 1.00 64.54 ? 1205 GLU M OE2 1 
ATOM   7820  O OXT . GLU M  1 132 ? -20.687 -59.029 -24.472 1.00 65.49 ? 1205 GLU M OXT 1 
ATOM   7821  N N   . SER N  2 7   ? -6.118  -72.103 -29.937 1.00 47.75 ? 28   SER N N   1 
ATOM   7822  C CA  . SER N  2 7   ? -6.295  -70.702 -30.292 1.00 43.16 ? 28   SER N CA  1 
ATOM   7823  C C   . SER N  2 7   ? -5.885  -69.812 -29.119 1.00 40.70 ? 28   SER N C   1 
ATOM   7824  O O   . SER N  2 7   ? -6.096  -68.600 -29.141 1.00 39.13 ? 28   SER N O   1 
ATOM   7825  C CB  . SER N  2 7   ? -7.758  -70.432 -30.674 1.00 40.65 ? 28   SER N CB  1 
ATOM   7826  O OG  . SER N  2 7   ? -8.643  -71.136 -29.815 1.00 42.28 ? 28   SER N OG  1 
ATOM   7827  N N   . ALA N  2 8   ? -5.314  -70.427 -28.094 1.00 40.61 ? 29   ALA N N   1 
ATOM   7828  C CA  . ALA N  2 8   ? -4.919  -69.685 -26.900 1.00 39.26 ? 29   ALA N CA  1 
ATOM   7829  C C   . ALA N  2 8   ? -3.768  -68.783 -27.256 1.00 44.68 ? 29   ALA N C   1 
ATOM   7830  O O   . ALA N  2 8   ? -2.927  -69.138 -28.076 1.00 42.85 ? 29   ALA N O   1 
ATOM   7831  C CB  . ALA N  2 8   ? -4.525  -70.625 -25.796 1.00 38.28 ? 29   ALA N CB  1 
ATOM   7832  N N   . PRO N  2 9   ? -3.714  -67.599 -26.637 1.00 38.70 ? 30   PRO N N   1 
ATOM   7833  C CA  . PRO N  2 9   ? -2.639  -66.678 -26.986 1.00 37.50 ? 30   PRO N CA  1 
ATOM   7834  C C   . PRO N  2 9   ? -1.285  -67.262 -26.643 1.00 35.98 ? 30   PRO N C   1 
ATOM   7835  O O   . PRO N  2 9   ? -1.196  -68.114 -25.752 1.00 39.14 ? 30   PRO N O   1 
ATOM   7836  C CB  . PRO N  2 9   ? -2.927  -65.462 -26.097 1.00 40.06 ? 30   PRO N CB  1 
ATOM   7837  C CG  . PRO N  2 9   ? -3.815  -66.005 -24.998 1.00 44.57 ? 30   PRO N CG  1 
ATOM   7838  C CD  . PRO N  2 9   ? -4.688  -66.980 -25.735 1.00 43.67 ? 30   PRO N CD  1 
ATOM   7839  N N   . ALA N  2 10  ? -0.253  -66.796 -27.332 1.00 37.81 ? 31   ALA N N   1 
ATOM   7840  C CA  . ALA N  2 10  ? 1.123   -67.129 -26.965 1.00 40.10 ? 31   ALA N CA  1 
ATOM   7841  C C   . ALA N  2 10  ? 1.508   -66.539 -25.601 1.00 41.07 ? 31   ALA N C   1 
ATOM   7842  O O   . ALA N  2 10  ? 1.031   -65.470 -25.220 1.00 36.06 ? 31   ALA N O   1 
ATOM   7843  C CB  . ALA N  2 10  ? 2.092   -66.645 -28.028 1.00 39.99 ? 31   ALA N CB  1 
ATOM   7844  N N   . THR N  2 11  ? 2.373   -67.248 -24.886 1.00 38.45 ? 32   THR N N   1 
ATOM   7845  C CA  . THR N  2 11  ? 2.902   -66.763 -23.608 1.00 33.09 ? 32   THR N CA  1 
ATOM   7846  C C   . THR N  2 11  ? 4.417   -66.659 -23.671 1.00 40.08 ? 32   THR N C   1 
ATOM   7847  O O   . THR N  2 11  ? 5.048   -67.218 -24.588 1.00 38.82 ? 32   THR N O   1 
ATOM   7848  C CB  . THR N  2 11  ? 2.434   -67.647 -22.429 1.00 27.45 ? 32   THR N CB  1 
ATOM   7849  O OG1 . THR N  2 11  ? 3.031   -68.954 -22.475 1.00 32.35 ? 32   THR N OG1 1 
ATOM   7850  C CG2 . THR N  2 11  ? 0.909   -67.736 -22.418 1.00 33.77 ? 32   THR N CG2 1 
ATOM   7851  N N   . GLY N  2 12  ? 5.000   -65.936 -22.717 1.00 33.99 ? 33   GLY N N   1 
ATOM   7852  C CA  . GLY N  2 12  ? 6.358   -65.440 -22.874 1.00 31.57 ? 33   GLY N CA  1 
ATOM   7853  C C   . GLY N  2 12  ? 7.369   -65.901 -21.844 1.00 38.85 ? 33   GLY N C   1 
ATOM   7854  O O   . GLY N  2 12  ? 8.340   -65.185 -21.543 1.00 35.67 ? 33   GLY N O   1 
ATOM   7855  N N   . GLY N  2 13  ? 7.162   -67.092 -21.300 1.00 30.07 ? 34   GLY N N   1 
ATOM   7856  C CA  . GLY N  2 13  ? 8.130   -67.635 -20.363 1.00 35.20 ? 34   GLY N CA  1 
ATOM   7857  C C   . GLY N  2 13  ? 8.029   -67.003 -18.976 1.00 36.64 ? 34   GLY N C   1 
ATOM   7858  O O   . GLY N  2 13  ? 7.101   -66.236 -18.691 1.00 31.41 ? 34   GLY N O   1 
ATOM   7859  N N   . VAL N  2 14  ? 8.973   -67.349 -18.112 1.00 34.63 ? 35   VAL N N   1 
ATOM   7860  C CA  . VAL N  2 14  ? 8.981   -66.861 -16.731 1.00 31.98 ? 35   VAL N CA  1 
ATOM   7861  C C   . VAL N  2 14  ? 9.324   -65.377 -16.735 1.00 34.08 ? 35   VAL N C   1 
ATOM   7862  O O   . VAL N  2 14  ? 10.232  -64.951 -17.453 1.00 32.64 ? 35   VAL N O   1 
ATOM   7863  C CB  . VAL N  2 14  ? 9.990   -67.690 -15.881 1.00 35.32 ? 35   VAL N CB  1 
ATOM   7864  C CG1 . VAL N  2 14  ? 10.199  -67.089 -14.516 1.00 34.44 ? 35   VAL N CG1 1 
ATOM   7865  C CG2 . VAL N  2 14  ? 9.511   -69.126 -15.740 1.00 33.82 ? 35   VAL N CG2 1 
HETATM 7866  N N   . M3L N  2 15  ? 8.564   -64.561 -15.992 1.00 28.36 ? 36   M3L N N   1 
HETATM 7867  C CA  . M3L N  2 15  ? 8.853   -63.136 -15.952 1.00 30.45 ? 36   M3L N CA  1 
HETATM 7868  C CB  . M3L N  2 15  ? 7.792   -62.407 -15.136 1.00 28.98 ? 36   M3L N CB  1 
HETATM 7869  C CG  . M3L N  2 15  ? 7.866   -60.892 -15.080 1.00 30.99 ? 36   M3L N CG  1 
HETATM 7870  C CD  . M3L N  2 15  ? 6.636   -60.139 -14.573 1.00 26.02 ? 36   M3L N CD  1 
HETATM 7871  C CE  . M3L N  2 15  ? 6.733   -58.651 -14.832 1.00 29.05 ? 36   M3L N CE  1 
HETATM 7872  N NZ  . M3L N  2 15  ? 5.612   -57.835 -14.427 1.00 28.87 ? 36   M3L N NZ  1 
HETATM 7873  C C   . M3L N  2 15  ? 10.242  -62.790 -15.377 1.00 32.13 ? 36   M3L N C   1 
HETATM 7874  O O   . M3L N  2 15  ? 10.551  -63.264 -14.341 1.00 33.44 ? 36   M3L N O   1 
HETATM 7875  C CM1 . M3L N  2 15  ? 5.329   -58.096 -13.013 1.00 29.27 ? 36   M3L N CM1 1 
HETATM 7876  C CM2 . M3L N  2 15  ? 4.445   -58.202 -15.203 1.00 28.09 ? 36   M3L N CM2 1 
HETATM 7877  C CM3 . M3L N  2 15  ? 5.928   -56.450 -14.679 1.00 28.28 ? 36   M3L N CM3 1 
ATOM   7878  N N   . LYS N  2 16  ? 11.010  -61.944 -16.047 1.00 35.22 ? 37   LYS N N   1 
ATOM   7879  C CA  . LYS N  2 16  ? 12.358  -61.641 -15.547 1.00 41.60 ? 37   LYS N CA  1 
ATOM   7880  C C   . LYS N  2 16  ? 12.236  -60.869 -14.252 1.00 38.99 ? 37   LYS N C   1 
ATOM   7881  O O   . LYS N  2 16  ? 11.273  -60.123 -14.061 1.00 37.04 ? 37   LYS N O   1 
ATOM   7882  C CB  . LYS N  2 16  ? 13.176  -60.846 -16.571 1.00 41.07 ? 37   LYS N CB  1 
ATOM   7883  C CG  . LYS N  2 16  ? 12.637  -59.474 -16.890 1.00 46.81 ? 37   LYS N CG  1 
ATOM   7884  C CD  . LYS N  2 16  ? 13.511  -58.711 -17.894 1.00 47.18 ? 37   LYS N CD  1 
ATOM   7885  C CE  . LYS N  2 16  ? 12.990  -57.280 -18.108 1.00 53.85 ? 37   LYS N CE  1 
ATOM   7886  N NZ  . LYS N  2 16  ? 14.069  -56.322 -18.533 1.00 48.84 ? 37   LYS N NZ  1 
ATOM   7887  N N   . PRO N  2 17  ? 13.196  -61.056 -13.350 1.00 36.62 ? 38   PRO N N   1 
ATOM   7888  C CA  . PRO N  2 17  ? 13.240  -60.256 -12.130 1.00 40.63 ? 38   PRO N CA  1 
ATOM   7889  C C   . PRO N  2 17  ? 13.460  -58.791 -12.466 1.00 36.95 ? 38   PRO N C   1 
ATOM   7890  O O   . PRO N  2 17  ? 13.881  -58.451 -13.566 1.00 39.49 ? 38   PRO N O   1 
ATOM   7891  C CB  . PRO N  2 17  ? 14.471  -60.793 -11.396 1.00 40.08 ? 38   PRO N CB  1 
ATOM   7892  C CG  . PRO N  2 17  ? 14.771  -62.094 -12.023 1.00 42.97 ? 38   PRO N CG  1 
ATOM   7893  C CD  . PRO N  2 17  ? 14.339  -61.975 -13.452 1.00 39.54 ? 38   PRO N CD  1 
ATOM   7894  N N   . HIS N  2 18  ? 13.157  -57.928 -11.510 1.00 38.85 ? 39   HIS N N   1 
ATOM   7895  C CA  . HIS N  2 18  ? 13.358  -56.496 -11.663 1.00 40.20 ? 39   HIS N CA  1 
ATOM   7896  C C   . HIS N  2 18  ? 14.858  -56.209 -11.708 1.00 42.94 ? 39   HIS N C   1 
ATOM   7897  O O   . HIS N  2 18  ? 15.659  -57.062 -11.325 1.00 45.55 ? 39   HIS N O   1 
ATOM   7898  C CB  . HIS N  2 18  ? 12.691  -55.762 -10.500 1.00 43.26 ? 39   HIS N CB  1 
ATOM   7899  C CG  . HIS N  2 18  ? 12.669  -54.270 -10.642 1.00 45.03 ? 39   HIS N CG  1 
ATOM   7900  N ND1 . HIS N  2 18  ? 13.389  -53.433 -9.813  1.00 50.51 ? 39   HIS N ND1 1 
ATOM   7901  C CD2 . HIS N  2 18  ? 11.997  -53.465 -11.499 1.00 46.41 ? 39   HIS N CD2 1 
ATOM   7902  C CE1 . HIS N  2 18  ? 13.166  -52.178 -10.158 1.00 50.09 ? 39   HIS N CE1 1 
ATOM   7903  N NE2 . HIS N  2 18  ? 12.332  -52.169 -11.185 1.00 52.48 ? 39   HIS N NE2 1 
ATOM   7904  N N   . ARG N  2 19  ? 15.226  -55.016 -12.178 1.00 45.39 ? 40   ARG N N   1 
ATOM   7905  C CA  . ARG N  2 19  ? 16.623  -54.684 -12.454 1.00 42.21 ? 40   ARG N CA  1 
ATOM   7906  C C   . ARG N  2 19  ? 17.564  -55.010 -11.291 1.00 45.29 ? 40   ARG N C   1 
ATOM   7907  O O   . ARG N  2 19  ? 18.667  -55.542 -11.513 1.00 40.79 ? 40   ARG N O   1 
ATOM   7908  C CB  . ARG N  2 19  ? 16.745  -53.204 -12.836 1.00 47.84 ? 40   ARG N CB  1 
ATOM   7909  C CG  . ARG N  2 19  ? 18.111  -52.804 -13.385 1.00 48.55 ? 40   ARG N CG  1 
ATOM   7910  C CD  . ARG N  2 19  ? 18.270  -51.292 -13.402 1.00 53.93 ? 40   ARG N CD  1 
ATOM   7911  N NE  . ARG N  2 19  ? 17.268  -50.627 -14.239 1.00 58.18 ? 40   ARG N NE  1 
ATOM   7912  C CZ  . ARG N  2 19  ? 17.102  -49.302 -14.319 1.00 65.55 ? 40   ARG N CZ  1 
ATOM   7913  N NH1 . ARG N  2 19  ? 16.156  -48.803 -15.119 1.00 59.30 ? 40   ARG N NH1 1 
ATOM   7914  N NH2 . ARG N  2 19  ? 17.876  -48.471 -13.603 1.00 64.04 ? 40   ARG N NH2 1 
ATOM   7915  N N   . TYR N  2 20  ? 17.137  -54.703 -10.060 1.00 43.32 ? 41   TYR N N   1 
ATOM   7916  C CA  . TYR N  2 20  ? 17.976  -54.933 -8.864  1.00 42.51 ? 41   TYR N CA  1 
ATOM   7917  C C   . TYR N  2 20  ? 17.346  -55.810 -7.761  1.00 49.16 ? 41   TYR N C   1 
ATOM   7918  O O   . TYR N  2 20  ? 17.989  -56.749 -7.242  1.00 44.29 ? 41   TYR N O   1 
ATOM   7919  C CB  . TYR N  2 20  ? 18.462  -53.602 -8.272  1.00 38.83 ? 41   TYR N CB  1 
ATOM   7920  C CG  . TYR N  2 20  ? 19.459  -52.886 -9.167  1.00 36.57 ? 41   TYR N CG  1 
ATOM   7921  C CD1 . TYR N  2 20  ? 20.800  -53.300 -9.231  1.00 34.46 ? 41   TYR N CD1 1 
ATOM   7922  C CD2 . TYR N  2 20  ? 19.066  -51.795 -9.944  1.00 40.08 ? 41   TYR N CD2 1 
ATOM   7923  C CE1 . TYR N  2 20  ? 21.722  -52.652 -10.059 1.00 31.76 ? 41   TYR N CE1 1 
ATOM   7924  C CE2 . TYR N  2 20  ? 19.981  -51.137 -10.764 1.00 41.30 ? 41   TYR N CE2 1 
ATOM   7925  C CZ  . TYR N  2 20  ? 21.299  -51.569 -10.815 1.00 40.12 ? 41   TYR N CZ  1 
ATOM   7926  O OH  . TYR N  2 20  ? 22.197  -50.905 -11.635 1.00 54.81 ? 41   TYR N OH  1 
ATOM   7927  N N   . ASP O  1 7   ? -24.386 26.688  11.623  1.00 59.99 ? 1080 ASP O N   1 
ATOM   7928  C CA  . ASP O  1 7   ? -23.111 27.384  11.788  1.00 61.80 ? 1080 ASP O CA  1 
ATOM   7929  C C   . ASP O  1 7   ? -22.119 26.935  10.718  1.00 61.16 ? 1080 ASP O C   1 
ATOM   7930  O O   . ASP O  1 7   ? -22.455 26.848  9.530   1.00 63.69 ? 1080 ASP O O   1 
ATOM   7931  C CB  . ASP O  1 7   ? -22.502 27.092  13.161  1.00 62.95 ? 1080 ASP O CB  1 
ATOM   7932  C CG  . ASP O  1 7   ? -23.547 26.888  14.246  1.00 64.90 ? 1080 ASP O CG  1 
ATOM   7933  O OD1 . ASP O  1 7   ? -23.195 27.130  15.425  1.00 65.77 ? 1080 ASP O OD1 1 
ATOM   7934  O OD2 . ASP O  1 7   ? -24.698 26.483  13.930  1.00 60.08 ? 1080 ASP O OD2 1 
ATOM   7935  N N   . SER O  1 8   ? -20.902 26.632  11.161  1.00 58.89 ? 1081 SER O N   1 
ATOM   7936  C CA  . SER O  1 8   ? -19.833 26.123  10.292  1.00 62.80 ? 1081 SER O CA  1 
ATOM   7937  C C   . SER O  1 8   ? -20.213 24.945  9.368   1.00 63.86 ? 1081 SER O C   1 
ATOM   7938  O O   . SER O  1 8   ? -21.258 24.305  9.530   1.00 56.63 ? 1081 SER O O   1 
ATOM   7939  C CB  . SER O  1 8   ? -18.633 25.695  11.146  1.00 62.58 ? 1081 SER O CB  1 
ATOM   7940  O OG  . SER O  1 8   ? -18.756 24.339  11.540  1.00 61.28 ? 1081 SER O OG  1 
ATOM   7941  N N   . PRO O  1 9   ? -19.349 24.669  8.376   1.00 65.80 ? 1082 PRO O N   1 
ATOM   7942  C CA  . PRO O  1 9   ? -19.468 23.487  7.510   1.00 61.52 ? 1082 PRO O CA  1 
ATOM   7943  C C   . PRO O  1 9   ? -18.896 22.213  8.148   1.00 59.73 ? 1082 PRO O C   1 
ATOM   7944  O O   . PRO O  1 9   ? -17.758 22.231  8.653   1.00 59.78 ? 1082 PRO O O   1 
ATOM   7945  C CB  . PRO O  1 9   ? -18.656 23.886  6.269   1.00 63.29 ? 1082 PRO O CB  1 
ATOM   7946  C CG  . PRO O  1 9   ? -18.563 25.408  6.328   1.00 63.19 ? 1082 PRO O CG  1 
ATOM   7947  C CD  . PRO O  1 9   ? -18.452 25.683  7.795   1.00 64.71 ? 1082 PRO O CD  1 
ATOM   7948  N N   . LEU O  1 10  ? -19.682 21.130  8.114   1.00 51.68 ? 1083 LEU O N   1 
ATOM   7949  C CA  . LEU O  1 10  ? -19.323 19.842  8.728   1.00 46.03 ? 1083 LEU O CA  1 
ATOM   7950  C C   . LEU O  1 10  ? -18.809 18.871  7.672   1.00 43.56 ? 1083 LEU O C   1 
ATOM   7951  O O   . LEU O  1 10  ? -19.167 18.993  6.498   1.00 45.76 ? 1083 LEU O O   1 
ATOM   7952  C CB  . LEU O  1 10  ? -20.540 19.235  9.435   1.00 42.31 ? 1083 LEU O CB  1 
ATOM   7953  C CG  . LEU O  1 10  ? -21.188 20.044  10.558  1.00 43.84 ? 1083 LEU O CG  1 
ATOM   7954  C CD1 . LEU O  1 10  ? -22.582 19.558  10.841  1.00 40.26 ? 1083 LEU O CD1 1 
ATOM   7955  C CD2 . LEU O  1 10  ? -20.344 19.950  11.812  1.00 44.80 ? 1083 LEU O CD2 1 
ATOM   7956  N N   . ASP O  1 11  ? -17.965 17.919  8.076   1.00 43.76 ? 1084 ASP O N   1 
ATOM   7957  C CA  . ASP O  1 11  ? -17.293 17.038  7.111   1.00 37.68 ? 1084 ASP O CA  1 
ATOM   7958  C C   . ASP O  1 11  ? -17.749 15.588  7.206   1.00 37.16 ? 1084 ASP O C   1 
ATOM   7959  O O   . ASP O  1 11  ? -18.241 15.153  8.241   1.00 32.23 ? 1084 ASP O O   1 
ATOM   7960  C CB  . ASP O  1 11  ? -15.777 17.073  7.297   1.00 40.34 ? 1084 ASP O CB  1 
ATOM   7961  C CG  . ASP O  1 11  ? -15.171 18.379  6.827   1.00 52.34 ? 1084 ASP O CG  1 
ATOM   7962  O OD1 . ASP O  1 11  ? -14.042 18.692  7.260   1.00 57.71 ? 1084 ASP O OD1 1 
ATOM   7963  O OD2 . ASP O  1 11  ? -15.825 19.093  6.034   1.00 50.47 ? 1084 ASP O OD2 1 
ATOM   7964  N N   . ALA O  1 12  ? -17.561 14.853  6.109   1.00 35.36 ? 1085 ALA O N   1 
ATOM   7965  C CA  . ALA O  1 12  ? -17.868 13.446  6.076   1.00 37.14 ? 1085 ALA O CA  1 
ATOM   7966  C C   . ALA O  1 12  ? -17.036 12.756  7.151   1.00 34.12 ? 1085 ALA O C   1 
ATOM   7967  O O   . ALA O  1 12  ? -15.850 13.057  7.328   1.00 33.53 ? 1085 ALA O O   1 
ATOM   7968  C CB  . ALA O  1 12  ? -17.568 12.872  4.672   1.00 34.72 ? 1085 ALA O CB  1 
ATOM   7969  N N   . LEU O  1 13  ? -17.708 11.888  7.899   1.00 29.87 ? 1086 LEU O N   1 
ATOM   7970  C CA  . LEU O  1 13  ? -17.127 11.035  8.944   1.00 26.12 ? 1086 LEU O CA  1 
ATOM   7971  C C   . LEU O  1 13  ? -16.906 11.771  10.282  1.00 29.27 ? 1086 LEU O C   1 
ATOM   7972  O O   . LEU O  1 13  ? -16.270 11.223  11.190  1.00 29.90 ? 1086 LEU O O   1 
ATOM   7973  C CB  . LEU O  1 13  ? -15.862 10.308  8.508   1.00 30.62 ? 1086 LEU O CB  1 
ATOM   7974  C CG  . LEU O  1 13  ? -15.989 9.482   7.222   1.00 30.25 ? 1086 LEU O CG  1 
ATOM   7975  C CD1 . LEU O  1 13  ? -14.678 8.770   6.948   1.00 39.60 ? 1086 LEU O CD1 1 
ATOM   7976  C CD2 . LEU O  1 13  ? -17.150 8.508   7.329   1.00 33.65 ? 1086 LEU O CD2 1 
ATOM   7977  N N   . ASP O  1 14  ? -17.473 12.970  10.404  1.00 28.13 ? 1087 ASP O N   1 
ATOM   7978  C CA  . ASP O  1 14  ? -17.538 13.642  11.704  1.00 28.88 ? 1087 ASP O CA  1 
ATOM   7979  C C   . ASP O  1 14  ? -18.567 12.970  12.588  1.00 32.51 ? 1087 ASP O C   1 
ATOM   7980  O O   . ASP O  1 14  ? -19.618 12.505  12.083  1.00 29.13 ? 1087 ASP O O   1 
ATOM   7981  C CB  . ASP O  1 14  ? -17.961 15.104  11.535  1.00 28.94 ? 1087 ASP O CB  1 
ATOM   7982  C CG  . ASP O  1 14  ? -16.825 16.001  11.120  1.00 38.92 ? 1087 ASP O CG  1 
ATOM   7983  O OD1 . ASP O  1 14  ? -15.671 15.518  11.063  1.00 38.31 ? 1087 ASP O OD1 1 
ATOM   7984  O OD2 . ASP O  1 14  ? -17.082 17.200  10.888  1.00 36.73 ? 1087 ASP O OD2 1 
ATOM   7985  N N   . LEU O  1 15  ? -18.325 12.967  13.906  1.00 25.52 ? 1088 LEU O N   1 
ATOM   7986  C CA  . LEU O  1 15  ? -19.338 12.510  14.819  1.00 24.89 ? 1088 LEU O CA  1 
ATOM   7987  C C   . LEU O  1 15  ? -20.214 13.714  15.124  1.00 29.00 ? 1088 LEU O C   1 
ATOM   7988  O O   . LEU O  1 15  ? -19.688 14.819  15.352  1.00 25.05 ? 1088 LEU O O   1 
ATOM   7989  C CB  . LEU O  1 15  ? -18.712 11.977  16.106  1.00 24.17 ? 1088 LEU O CB  1 
ATOM   7990  C CG  . LEU O  1 15  ? -17.874 10.697  15.984  1.00 29.90 ? 1088 LEU O CG  1 
ATOM   7991  C CD1 . LEU O  1 15  ? -17.175 10.337  17.312  1.00 26.69 ? 1088 LEU O CD1 1 
ATOM   7992  C CD2 . LEU O  1 15  ? -18.791 9.567   15.542  1.00 28.78 ? 1088 LEU O CD2 1 
ATOM   7993  N N   . VAL O  1 16  ? -21.528 13.495  15.188  1.00 23.76 ? 1089 VAL O N   1 
ATOM   7994  C CA  . VAL O  1 16  ? -22.473 14.585  15.454  1.00 23.65 ? 1089 VAL O CA  1 
ATOM   7995  C C   . VAL O  1 16  ? -23.634 14.115  16.308  1.00 27.46 ? 1089 VAL O C   1 
ATOM   7996  O O   . VAL O  1 16  ? -23.965 12.915  16.357  1.00 25.74 ? 1089 VAL O O   1 
ATOM   7997  C CB  . VAL O  1 16  ? -23.075 15.174  14.157  1.00 26.33 ? 1089 VAL O CB  1 
ATOM   7998  C CG1 . VAL O  1 16  ? -22.024 15.880  13.326  1.00 28.09 ? 1089 VAL O CG1 1 
ATOM   7999  C CG2 . VAL O  1 16  ? -23.758 14.049  13.341  1.00 25.79 ? 1089 VAL O CG2 1 
ATOM   8000  N N   . TRP O  1 17  ? -24.219 15.063  17.038  1.00 25.40 ? 1090 TRP O N   1 
ATOM   8001  C CA  . TRP O  1 17  ? -25.544 14.888  17.616  1.00 25.03 ? 1090 TRP O CA  1 
ATOM   8002  C C   . TRP O  1 17  ? -26.460 15.244  16.461  1.00 34.31 ? 1090 TRP O C   1 
ATOM   8003  O O   . TRP O  1 17  ? -26.287 16.328  15.867  1.00 29.92 ? 1090 TRP O O   1 
ATOM   8004  C CB  . TRP O  1 17  ? -25.744 15.891  18.775  1.00 29.60 ? 1090 TRP O CB  1 
ATOM   8005  C CG  . TRP O  1 17  ? -24.928 15.543  19.956  1.00 27.35 ? 1090 TRP O CG  1 
ATOM   8006  C CD1 . TRP O  1 17  ? -23.714 16.060  20.311  1.00 29.03 ? 1090 TRP O CD1 1 
ATOM   8007  C CD2 . TRP O  1 17  ? -25.230 14.532  20.911  1.00 23.97 ? 1090 TRP O CD2 1 
ATOM   8008  N NE1 . TRP O  1 17  ? -23.259 15.456  21.451  1.00 25.57 ? 1090 TRP O NE1 1 
ATOM   8009  C CE2 . TRP O  1 17  ? -24.160 14.492  21.830  1.00 26.03 ? 1090 TRP O CE2 1 
ATOM   8010  C CE3 . TRP O  1 17  ? -26.309 13.636  21.071  1.00 25.24 ? 1090 TRP O CE3 1 
ATOM   8011  C CZ2 . TRP O  1 17  ? -24.135 13.604  22.917  1.00 26.24 ? 1090 TRP O CZ2 1 
ATOM   8012  C CZ3 . TRP O  1 17  ? -26.291 12.771  22.160  1.00 25.61 ? 1090 TRP O CZ3 1 
ATOM   8013  C CH2 . TRP O  1 17  ? -25.212 12.761  23.066  1.00 27.05 ? 1090 TRP O CH2 1 
ATOM   8014  N N   . ALA O  1 18  ? -27.395 14.341  16.132  1.00 29.96 ? 1091 ALA O N   1 
ATOM   8015  C CA  . ALA O  1 18  ? -28.310 14.514  14.999  1.00 29.63 ? 1091 ALA O CA  1 
ATOM   8016  C C   . ALA O  1 18  ? -29.735 14.538  15.553  1.00 33.42 ? 1091 ALA O C   1 
ATOM   8017  O O   . ALA O  1 18  ? -30.134 13.668  16.348  1.00 29.29 ? 1091 ALA O O   1 
ATOM   8018  C CB  . ALA O  1 18  ? -28.133 13.410  13.982  1.00 28.84 ? 1091 ALA O CB  1 
ATOM   8019  N N   . LYS O  1 19  ? -30.483 15.588  15.187  1.00 37.61 ? 1092 LYS O N   1 
ATOM   8020  C CA  . LYS O  1 19  ? -31.791 15.833  15.779  1.00 38.76 ? 1092 LYS O CA  1 
ATOM   8021  C C   . LYS O  1 19  ? -32.899 15.504  14.790  1.00 46.52 ? 1092 LYS O C   1 
ATOM   8022  O O   . LYS O  1 19  ? -32.887 15.959  13.635  1.00 42.66 ? 1092 LYS O O   1 
ATOM   8023  C CB  . LYS O  1 19  ? -31.916 17.294  16.225  1.00 43.08 ? 1092 LYS O CB  1 
ATOM   8024  C CG  . LYS O  1 19  ? -33.275 17.658  16.841  1.00 46.22 ? 1092 LYS O CG  1 
ATOM   8025  C CD  . LYS O  1 19  ? -33.482 17.021  18.215  1.00 45.65 ? 1092 LYS O CD  1 
ATOM   8026  C CE  . LYS O  1 19  ? -34.958 17.075  18.640  1.00 51.24 ? 1092 LYS O CE  1 
ATOM   8027  N NZ  . LYS O  1 19  ? -35.859 16.639  17.522  1.00 50.27 ? 1092 LYS O NZ  1 
ATOM   8028  N N   . CYS O  1 20  ? -33.856 14.718  15.255  1.00 49.62 ? 1093 CYS O N   1 
ATOM   8029  C CA  . CYS O  1 20  ? -34.954 14.287  14.412  1.00 51.77 ? 1093 CYS O CA  1 
ATOM   8030  C C   . CYS O  1 20  ? -36.280 14.547  15.063  1.00 57.02 ? 1093 CYS O C   1 
ATOM   8031  O O   . CYS O  1 20  ? -36.374 14.654  16.279  1.00 56.64 ? 1093 CYS O O   1 
ATOM   8032  C CB  . CYS O  1 20  ? -34.842 12.806  14.133  1.00 53.66 ? 1093 CYS O CB  1 
ATOM   8033  S SG  . CYS O  1 20  ? -34.039 12.476  12.603  1.00 56.98 ? 1093 CYS O SG  1 
ATOM   8034  N N   . ARG O  1 21  ? -37.303 14.643  14.224  1.00 63.17 ? 1094 ARG O N   1 
ATOM   8035  C CA  . ARG O  1 21  ? -38.694 14.712  14.645  1.00 60.48 ? 1094 ARG O CA  1 
ATOM   8036  C C   . ARG O  1 21  ? -39.014 13.845  15.862  1.00 54.01 ? 1094 ARG O C   1 
ATOM   8037  O O   . ARG O  1 21  ? -39.006 12.623  15.774  1.00 62.41 ? 1094 ARG O O   1 
ATOM   8038  C CB  . ARG O  1 21  ? -39.558 14.262  13.472  1.00 66.34 ? 1094 ARG O CB  1 
ATOM   8039  C CG  . ARG O  1 21  ? -38.882 13.160  12.649  1.00 62.81 ? 1094 ARG O CG  1 
ATOM   8040  C CD  . ARG O  1 21  ? -39.846 12.453  11.692  1.00 67.99 ? 1094 ARG O CD  1 
ATOM   8041  N NE  . ARG O  1 21  ? -39.226 11.268  11.105  1.00 62.60 ? 1094 ARG O NE  1 
ATOM   8042  C CZ  . ARG O  1 21  ? -39.904 10.248  10.593  1.00 69.16 ? 1094 ARG O CZ  1 
ATOM   8043  N NH1 . ARG O  1 21  ? -39.255 9.200   10.090  1.00 65.95 ? 1094 ARG O NH1 1 
ATOM   8044  N NH2 . ARG O  1 21  ? -41.234 10.271  10.590  1.00 66.38 ? 1094 ARG O NH2 1 
ATOM   8045  N N   . GLY O  1 22  ? -39.295 14.484  16.995  1.00 57.37 ? 1095 GLY O N   1 
ATOM   8046  C CA  . GLY O  1 22  ? -39.776 13.786  18.174  1.00 60.42 ? 1095 GLY O CA  1 
ATOM   8047  C C   . GLY O  1 22  ? -38.816 12.721  18.671  1.00 61.35 ? 1095 GLY O C   1 
ATOM   8048  O O   . GLY O  1 22  ? -39.159 11.535  18.772  1.00 61.88 ? 1095 GLY O O   1 
ATOM   8049  N N   . TYR O  1 23  ? -37.597 13.165  18.963  1.00 54.91 ? 1096 TYR O N   1 
ATOM   8050  C CA  . TYR O  1 23  ? -36.557 12.322  19.511  1.00 52.18 ? 1096 TYR O CA  1 
ATOM   8051  C C   . TYR O  1 23  ? -35.655 13.240  20.280  1.00 49.34 ? 1096 TYR O C   1 
ATOM   8052  O O   . TYR O  1 23  ? -35.639 14.445  20.045  1.00 50.97 ? 1096 TYR O O   1 
ATOM   8053  C CB  . TYR O  1 23  ? -35.712 11.704  18.408  1.00 55.28 ? 1096 TYR O CB  1 
ATOM   8054  C CG  . TYR O  1 23  ? -36.385 10.666  17.543  1.00 56.02 ? 1096 TYR O CG  1 
ATOM   8055  C CD1 . TYR O  1 23  ? -36.838 9.458   18.075  1.00 56.74 ? 1096 TYR O CD1 1 
ATOM   8056  C CD2 . TYR O  1 23  ? -36.520 10.875  16.175  1.00 57.19 ? 1096 TYR O CD2 1 
ATOM   8057  C CE1 . TYR O  1 23  ? -37.439 8.497   17.258  1.00 55.89 ? 1096 TYR O CE1 1 
ATOM   8058  C CE2 . TYR O  1 23  ? -37.110 9.929   15.353  1.00 58.97 ? 1096 TYR O CE2 1 
ATOM   8059  C CZ  . TYR O  1 23  ? -37.564 8.743   15.896  1.00 57.99 ? 1096 TYR O CZ  1 
ATOM   8060  O OH  . TYR O  1 23  ? -38.145 7.816   15.055  1.00 60.96 ? 1096 TYR O OH  1 
ATOM   8061  N N   . PRO O  1 24  ? -34.886 12.694  21.213  1.00 43.30 ? 1097 PRO O N   1 
ATOM   8062  C CA  . PRO O  1 24  ? -33.827 13.600  21.640  1.00 40.40 ? 1097 PRO O CA  1 
ATOM   8063  C C   . PRO O  1 24  ? -32.739 13.553  20.555  1.00 36.28 ? 1097 PRO O C   1 
ATOM   8064  O O   . PRO O  1 24  ? -32.784 12.668  19.701  1.00 38.97 ? 1097 PRO O O   1 
ATOM   8065  C CB  . PRO O  1 24  ? -33.341 12.984  22.961  1.00 39.00 ? 1097 PRO O CB  1 
ATOM   8066  C CG  . PRO O  1 24  ? -34.192 11.784  23.205  1.00 40.49 ? 1097 PRO O CG  1 
ATOM   8067  C CD  . PRO O  1 24  ? -34.843 11.410  21.915  1.00 43.00 ? 1097 PRO O CD  1 
ATOM   8068  N N   . SER O  1 25  ? -31.810 14.504  20.566  1.00 31.01 ? 1098 SER O N   1 
ATOM   8069  C CA  . SER O  1 25  ? -30.624 14.425  19.718  1.00 29.83 ? 1098 SER O CA  1 
ATOM   8070  C C   . SER O  1 25  ? -29.978 13.057  19.927  1.00 24.30 ? 1098 SER O C   1 
ATOM   8071  O O   . SER O  1 25  ? -29.959 12.550  21.059  1.00 30.12 ? 1098 SER O O   1 
ATOM   8072  C CB  . SER O  1 25  ? -29.618 15.472  20.164  1.00 32.08 ? 1098 SER O CB  1 
ATOM   8073  O OG  . SER O  1 25  ? -30.221 16.739  20.298  1.00 34.99 ? 1098 SER O OG  1 
ATOM   8074  N N   . TYR O  1 26  ? -29.488 12.478  18.843  1.00 27.64 ? 1099 TYR O N   1 
ATOM   8075  C CA  . TYR O  1 26  ? -28.970 11.116  18.877  1.00 25.60 ? 1099 TYR O CA  1 
ATOM   8076  C C   . TYR O  1 26  ? -27.593 11.027  18.199  1.00 27.29 ? 1099 TYR O C   1 
ATOM   8077  O O   . TYR O  1 26  ? -27.374 11.618  17.160  1.00 24.32 ? 1099 TYR O O   1 
ATOM   8078  C CB  . TYR O  1 26  ? -29.953 10.227  18.130  1.00 29.38 ? 1099 TYR O CB  1 
ATOM   8079  C CG  . TYR O  1 26  ? -29.850 8.787   18.556  1.00 29.16 ? 1099 TYR O CG  1 
ATOM   8080  C CD1 . TYR O  1 26  ? -28.963 7.944   17.934  1.00 31.25 ? 1099 TYR O CD1 1 
ATOM   8081  C CD2 . TYR O  1 26  ? -30.627 8.305   19.588  1.00 30.48 ? 1099 TYR O CD2 1 
ATOM   8082  C CE1 . TYR O  1 26  ? -28.854 6.613   18.319  1.00 30.36 ? 1099 TYR O CE1 1 
ATOM   8083  C CE2 . TYR O  1 26  ? -30.531 6.978   19.987  1.00 31.79 ? 1099 TYR O CE2 1 
ATOM   8084  C CZ  . TYR O  1 26  ? -29.637 6.149   19.348  1.00 30.48 ? 1099 TYR O CZ  1 
ATOM   8085  O OH  . TYR O  1 26  ? -29.523 4.823   19.733  1.00 34.03 ? 1099 TYR O OH  1 
ATOM   8086  N N   . PRO O  1 27  ? -26.653 10.234  18.777  1.00 22.85 ? 1100 PRO O N   1 
ATOM   8087  C CA  . PRO O  1 27  ? -25.322 10.254  18.164  1.00 20.10 ? 1100 PRO O CA  1 
ATOM   8088  C C   . PRO O  1 27  ? -25.329 9.631   16.764  1.00 25.51 ? 1100 PRO O C   1 
ATOM   8089  O O   . PRO O  1 27  ? -26.016 8.634   16.549  1.00 26.00 ? 1100 PRO O O   1 
ATOM   8090  C CB  . PRO O  1 27  ? -24.497 9.355   19.116  1.00 21.05 ? 1100 PRO O CB  1 
ATOM   8091  C CG  . PRO O  1 27  ? -25.153 9.527   20.440  1.00 23.58 ? 1100 PRO O CG  1 
ATOM   8092  C CD  . PRO O  1 27  ? -26.646 9.726   20.151  1.00 24.89 ? 1100 PRO O CD  1 
ATOM   8093  N N   . ALA O  1 28  ? -24.522 10.167  15.861  1.00 20.94 ? 1101 ALA O N   1 
ATOM   8094  C CA  . ALA O  1 28  ? -24.463 9.734   14.473  1.00 22.66 ? 1101 ALA O CA  1 
ATOM   8095  C C   . ALA O  1 28  ? -23.128 10.069  13.830  1.00 24.74 ? 1101 ALA O C   1 
ATOM   8096  O O   . ALA O  1 28  ? -22.278 10.793  14.416  1.00 24.43 ? 1101 ALA O O   1 
ATOM   8097  C CB  . ALA O  1 28  ? -25.619 10.339  13.650  1.00 24.25 ? 1101 ALA O CB  1 
ATOM   8098  N N   . LEU O  1 29  ? -22.929 9.514   12.630  1.00 20.28 ? 1102 LEU O N   1 
ATOM   8099  C CA  . LEU O  1 29  ? -21.767 9.713   11.825  1.00 22.16 ? 1102 LEU O CA  1 
ATOM   8100  C C   . LEU O  1 29  ? -22.283 10.295  10.522  1.00 28.32 ? 1102 LEU O C   1 
ATOM   8101  O O   . LEU O  1 29  ? -23.259 9.778   9.941   1.00 29.29 ? 1102 LEU O O   1 
ATOM   8102  C CB  . LEU O  1 29  ? -21.113 8.328   11.505  1.00 25.51 ? 1102 LEU O CB  1 
ATOM   8103  C CG  . LEU O  1 29  ? -19.790 8.320   10.733  1.00 26.26 ? 1102 LEU O CG  1 
ATOM   8104  C CD1 . LEU O  1 29  ? -18.665 8.854   11.610  1.00 27.00 ? 1102 LEU O CD1 1 
ATOM   8105  C CD2 . LEU O  1 29  ? -19.400 6.889   10.324  1.00 29.99 ? 1102 LEU O CD2 1 
ATOM   8106  N N   . ILE O  1 30  ? -21.657 11.366  10.077  1.00 27.53 ? 1103 ILE O N   1 
ATOM   8107  C CA  . ILE O  1 30  ? -21.937 11.964  8.781   1.00 28.97 ? 1103 ILE O CA  1 
ATOM   8108  C C   . ILE O  1 30  ? -21.271 11.102  7.715   1.00 27.98 ? 1103 ILE O C   1 
ATOM   8109  O O   . ILE O  1 30  ? -20.060 10.791  7.788   1.00 26.94 ? 1103 ILE O O   1 
ATOM   8110  C CB  . ILE O  1 30  ? -21.345 13.358  8.698   1.00 27.34 ? 1103 ILE O CB  1 
ATOM   8111  C CG1 . ILE O  1 30  ? -21.922 14.207  9.819   1.00 27.59 ? 1103 ILE O CG1 1 
ATOM   8112  C CG2 . ILE O  1 30  ? -21.626 13.983  7.346   1.00 28.98 ? 1103 ILE O CG2 1 
ATOM   8113  C CD1 . ILE O  1 30  ? -21.644 15.705  9.636   1.00 32.72 ? 1103 ILE O CD1 1 
ATOM   8114  N N   . ILE O  1 31  ? -22.060 10.693  6.725   1.00 26.24 ? 1104 ILE O N   1 
ATOM   8115  C CA  . ILE O  1 31  ? -21.516 9.904   5.638   1.00 29.13 ? 1104 ILE O CA  1 
ATOM   8116  C C   . ILE O  1 31  ? -21.665 10.658  4.320   1.00 31.13 ? 1104 ILE O C   1 
ATOM   8117  O O   . ILE O  1 31  ? -22.710 11.270  4.051   1.00 31.46 ? 1104 ILE O O   1 
ATOM   8118  C CB  . ILE O  1 31  ? -22.264 8.574   5.511   1.00 31.77 ? 1104 ILE O CB  1 
ATOM   8119  C CG1 . ILE O  1 31  ? -22.180 7.757   6.815   1.00 32.14 ? 1104 ILE O CG1 1 
ATOM   8120  C CG2 . ILE O  1 31  ? -21.781 7.804   4.261   1.00 28.08 ? 1104 ILE O CG2 1 
ATOM   8121  C CD1 . ILE O  1 31  ? -20.845 7.178   7.120   1.00 31.17 ? 1104 ILE O CD1 1 
ATOM   8122  N N   . ASP O  1 32  ? -20.614 10.610  3.515   1.00 29.00 ? 1105 ASP O N   1 
ATOM   8123  C CA  . ASP O  1 32  ? -20.614 11.170  2.174   1.00 35.52 ? 1105 ASP O CA  1 
ATOM   8124  C C   . ASP O  1 32  ? -21.489 10.314  1.261   1.00 35.96 ? 1105 ASP O C   1 
ATOM   8125  O O   . ASP O  1 32  ? -21.138 9.173   0.966   1.00 33.65 ? 1105 ASP O O   1 
ATOM   8126  C CB  . ASP O  1 32  ? -19.193 11.130  1.630   1.00 31.95 ? 1105 ASP O CB  1 
ATOM   8127  C CG  . ASP O  1 32  ? -19.054 11.852  0.311   1.00 40.77 ? 1105 ASP O CG  1 
ATOM   8128  O OD1 . ASP O  1 32  ? -20.095 12.242  -0.262  1.00 37.68 ? 1105 ASP O OD1 1 
ATOM   8129  O OD2 . ASP O  1 32  ? -17.899 12.030  -0.155  1.00 43.17 ? 1105 ASP O OD2 1 
ATOM   8130  N N   . PRO O  1 33  ? -22.607 10.865  0.798   1.00 35.99 ? 1106 PRO O N   1 
ATOM   8131  C CA  . PRO O  1 33  ? -23.486 10.141  -0.128  1.00 35.34 ? 1106 PRO O CA  1 
ATOM   8132  C C   . PRO O  1 33  ? -22.737 9.725   -1.374  1.00 39.00 ? 1106 PRO O C   1 
ATOM   8133  O O   . PRO O  1 33  ? -23.168 8.815   -2.105  1.00 38.05 ? 1106 PRO O O   1 
ATOM   8134  C CB  . PRO O  1 33  ? -24.542 11.193  -0.487  1.00 35.93 ? 1106 PRO O CB  1 
ATOM   8135  C CG  . PRO O  1 33  ? -24.548 12.107  0.650   1.00 39.57 ? 1106 PRO O CG  1 
ATOM   8136  C CD  . PRO O  1 33  ? -23.100 12.230  1.049   1.00 35.25 ? 1106 PRO O CD  1 
ATOM   8137  N N   . LYS O  1 34  ? -21.620 10.381  -1.634  1.00 32.03 ? 1107 LYS O N   1 
ATOM   8138  C CA  . LYS O  1 34  ? -20.849 10.067  -2.819  1.00 38.09 ? 1107 LYS O CA  1 
ATOM   8139  C C   . LYS O  1 34  ? -19.574 9.272   -2.519  1.00 39.70 ? 1107 LYS O C   1 
ATOM   8140  O O   . LYS O  1 34  ? -18.626 9.278   -3.313  1.00 41.70 ? 1107 LYS O O   1 
ATOM   8141  C CB  . LYS O  1 34  ? -20.561 11.347  -3.610  1.00 43.16 ? 1107 LYS O CB  1 
ATOM   8142  C CG  . LYS O  1 34  ? -21.846 11.997  -4.186  1.00 44.63 ? 1107 LYS O CG  1 
ATOM   8143  C CD  . LYS O  1 34  ? -22.762 10.911  -4.793  1.00 48.07 ? 1107 LYS O CD  1 
ATOM   8144  C CE  . LYS O  1 34  ? -24.218 11.365  -5.062  1.00 52.11 ? 1107 LYS O CE  1 
ATOM   8145  N NZ  . LYS O  1 34  ? -25.100 10.203  -5.467  1.00 42.83 ? 1107 LYS O NZ  1 
ATOM   8146  N N   . MET O  1 35  ? -19.548 8.575   -1.384  1.00 37.36 ? 1108 MET O N   1 
ATOM   8147  C CA  . MET O  1 35  ? -18.437 7.663   -1.121  1.00 37.21 ? 1108 MET O CA  1 
ATOM   8148  C C   . MET O  1 35  ? -18.446 6.556   -2.191  1.00 39.93 ? 1108 MET O C   1 
ATOM   8149  O O   . MET O  1 35  ? -19.484 6.309   -2.804  1.00 38.71 ? 1108 MET O O   1 
ATOM   8150  C CB  . MET O  1 35  ? -18.511 7.081   0.286   1.00 38.76 ? 1108 MET O CB  1 
ATOM   8151  C CG  . MET O  1 35  ? -19.834 6.388   0.636   1.00 37.31 ? 1108 MET O CG  1 
ATOM   8152  S SD  . MET O  1 35  ? -19.817 5.510   2.224   1.00 37.01 ? 1108 MET O SD  1 
ATOM   8153  C CE  . MET O  1 35  ? -18.487 4.316   1.949   1.00 37.77 ? 1108 MET O CE  1 
ATOM   8154  N N   . PRO O  1 36  ? -17.287 5.936   -2.447  1.00 39.56 ? 1109 PRO O N   1 
ATOM   8155  C CA  . PRO O  1 36  ? -17.175 4.848   -3.441  1.00 41.95 ? 1109 PRO O CA  1 
ATOM   8156  C C   . PRO O  1 36  ? -18.226 3.761   -3.225  1.00 41.91 ? 1109 PRO O C   1 
ATOM   8157  O O   . PRO O  1 36  ? -18.413 3.278   -2.103  1.00 39.08 ? 1109 PRO O O   1 
ATOM   8158  C CB  . PRO O  1 36  ? -15.793 4.267   -3.172  1.00 40.57 ? 1109 PRO O CB  1 
ATOM   8159  C CG  . PRO O  1 36  ? -15.015 5.423   -2.582  1.00 44.82 ? 1109 PRO O CG  1 
ATOM   8160  C CD  . PRO O  1 36  ? -16.007 6.200   -1.771  1.00 42.65 ? 1109 PRO O CD  1 
ATOM   8161  N N   . ARG O  1 37  ? -18.909 3.368   -4.299  1.00 39.07 ? 1110 ARG O N   1 
ATOM   8162  C CA  . ARG O  1 37  ? -20.000 2.405   -4.167  1.00 39.69 ? 1110 ARG O CA  1 
ATOM   8163  C C   . ARG O  1 37  ? -19.462 1.017   -3.751  1.00 38.95 ? 1110 ARG O C   1 
ATOM   8164  O O   . ARG O  1 37  ? -20.214 0.159   -3.252  1.00 35.48 ? 1110 ARG O O   1 
ATOM   8165  C CB  . ARG O  1 37  ? -20.783 2.326   -5.478  1.00 37.64 ? 1110 ARG O CB  1 
ATOM   8166  C CG  . ARG O  1 37  ? -21.470 3.623   -5.842  1.00 34.24 ? 1110 ARG O CG  1 
ATOM   8167  C CD  . ARG O  1 37  ? -22.333 4.090   -4.712  1.00 32.98 ? 1110 ARG O CD  1 
ATOM   8168  N NE  . ARG O  1 37  ? -23.392 3.140   -4.433  1.00 28.55 ? 1110 ARG O NE  1 
ATOM   8169  C CZ  . ARG O  1 37  ? -24.201 3.204   -3.389  1.00 31.37 ? 1110 ARG O CZ  1 
ATOM   8170  N NH1 . ARG O  1 37  ? -25.135 2.292   -3.230  1.00 33.10 ? 1110 ARG O NH1 1 
ATOM   8171  N NH2 . ARG O  1 37  ? -24.085 4.197   -2.478  1.00 31.02 ? 1110 ARG O NH2 1 
ATOM   8172  N N   . GLU O  1 38  ? -18.161 0.828   -3.941  1.00 37.58 ? 1111 GLU O N   1 
ATOM   8173  C CA  . GLU O  1 38  ? -17.504 -0.416  -3.555  1.00 45.50 ? 1111 GLU O CA  1 
ATOM   8174  C C   . GLU O  1 38  ? -16.973 -0.335  -2.121  1.00 48.50 ? 1111 GLU O C   1 
ATOM   8175  O O   . GLU O  1 38  ? -16.187 -1.192  -1.682  1.00 46.04 ? 1111 GLU O O   1 
ATOM   8176  C CB  . GLU O  1 38  ? -16.351 -0.742  -4.503  1.00 49.08 ? 1111 GLU O CB  1 
ATOM   8177  C CG  . GLU O  1 38  ? -15.122 0.149   -4.327  1.00 52.65 ? 1111 GLU O CG  1 
ATOM   8178  C CD  . GLU O  1 38  ? -15.112 1.350   -5.277  1.00 55.34 ? 1111 GLU O CD  1 
ATOM   8179  O OE1 . GLU O  1 38  ? -14.010 1.915   -5.483  1.00 58.80 ? 1111 GLU O OE1 1 
ATOM   8180  O OE2 . GLU O  1 38  ? -16.189 1.716   -5.827  1.00 51.68 ? 1111 GLU O OE2 1 
ATOM   8181  N N   . GLY O  1 39  ? -17.391 0.696   -1.395  1.00 43.80 ? 1112 GLY O N   1 
ATOM   8182  C CA  . GLY O  1 39  ? -17.016 0.826   0.006   1.00 42.81 ? 1112 GLY O CA  1 
ATOM   8183  C C   . GLY O  1 39  ? -15.661 1.475   0.231   1.00 47.99 ? 1112 GLY O C   1 
ATOM   8184  O O   . GLY O  1 39  ? -14.932 1.782   -0.719  1.00 47.68 ? 1112 GLY O O   1 
ATOM   8185  N N   . MET O  1 40  ? -15.329 1.683   1.504   1.00 46.97 ? 1113 MET O N   1 
ATOM   8186  C CA  . MET O  1 40  ? -14.057 2.295   1.872   1.00 50.12 ? 1113 MET O CA  1 
ATOM   8187  C C   . MET O  1 40  ? -13.694 1.978   3.314   1.00 45.76 ? 1113 MET O C   1 
ATOM   8188  O O   . MET O  1 40  ? -14.559 1.754   4.162   1.00 44.84 ? 1113 MET O O   1 
ATOM   8189  C CB  . MET O  1 40  ? -14.115 3.813   1.711   1.00 51.47 ? 1113 MET O CB  1 
ATOM   8190  C CG  . MET O  1 40  ? -14.993 4.474   2.762   1.00 53.34 ? 1113 MET O CG  1 
ATOM   8191  S SD  . MET O  1 40  ? -14.845 6.266   2.825   1.00 64.88 ? 1113 MET O SD  1 
ATOM   8192  C CE  . MET O  1 40  ? -13.195 6.430   3.504   1.00 54.18 ? 1113 MET O CE  1 
ATOM   8193  N N   . PHE O  1 41  ? -12.396 1.966   3.574   1.00 50.87 ? 1114 PHE O N   1 
ATOM   8194  C CA  . PHE O  1 41  ? -11.860 1.844   4.917   1.00 50.70 ? 1114 PHE O CA  1 
ATOM   8195  C C   . PHE O  1 41  ? -11.384 3.212   5.372   1.00 51.98 ? 1114 PHE O C   1 
ATOM   8196  O O   . PHE O  1 41  ? -10.655 3.894   4.646   1.00 53.18 ? 1114 PHE O O   1 
ATOM   8197  C CB  . PHE O  1 41  ? -10.696 0.859   4.930   1.00 50.31 ? 1114 PHE O CB  1 
ATOM   8198  C CG  . PHE O  1 41  ? -11.126 -0.550  4.787   1.00 49.83 ? 1114 PHE O CG  1 
ATOM   8199  C CD1 . PHE O  1 41  ? -10.959 -1.222  3.583   1.00 51.73 ? 1114 PHE O CD1 1 
ATOM   8200  C CD2 . PHE O  1 41  ? -11.736 -1.200  5.848   1.00 49.55 ? 1114 PHE O CD2 1 
ATOM   8201  C CE1 . PHE O  1 41  ? -11.372 -2.533  3.443   1.00 52.81 ? 1114 PHE O CE1 1 
ATOM   8202  C CE2 . PHE O  1 41  ? -12.158 -2.513  5.723   1.00 52.55 ? 1114 PHE O CE2 1 
ATOM   8203  C CZ  . PHE O  1 41  ? -11.975 -3.186  4.516   1.00 49.66 ? 1114 PHE O CZ  1 
ATOM   8204  N N   . HIS O  1 42  ? -11.848 3.625   6.548   1.00 53.28 ? 1115 HIS O N   1 
ATOM   8205  C CA  . HIS O  1 42  ? -11.365 4.834   7.196   1.00 48.94 ? 1115 HIS O CA  1 
ATOM   8206  C C   . HIS O  1 42  ? -10.487 4.362   8.357   1.00 49.42 ? 1115 HIS O C   1 
ATOM   8207  O O   . HIS O  1 42  ? -10.968 4.037   9.448   1.00 48.26 ? 1115 HIS O O   1 
ATOM   8208  C CB  . HIS O  1 42  ? -12.539 5.702   7.668   1.00 46.53 ? 1115 HIS O CB  1 
ATOM   8209  C CG  . HIS O  1 42  ? -12.131 7.002   8.302   1.00 48.45 ? 1115 HIS O CG  1 
ATOM   8210  N ND1 . HIS O  1 42  ? -11.161 7.826   7.767   1.00 53.30 ? 1115 HIS O ND1 1 
ATOM   8211  C CD2 . HIS O  1 42  ? -12.582 7.629   9.416   1.00 49.16 ? 1115 HIS O CD2 1 
ATOM   8212  C CE1 . HIS O  1 42  ? -11.023 8.895   8.533   1.00 50.64 ? 1115 HIS O CE1 1 
ATOM   8213  N NE2 . HIS O  1 42  ? -11.882 8.804   9.534   1.00 43.75 ? 1115 HIS O NE2 1 
ATOM   8214  N N   . HIS O  1 43  ? -9.192  4.279   8.077   1.00 54.43 ? 1116 HIS O N   1 
ATOM   8215  C CA  . HIS O  1 43  ? -8.213  3.778   9.029   1.00 53.37 ? 1116 HIS O CA  1 
ATOM   8216  C C   . HIS O  1 43  ? -8.611  2.394   9.531   1.00 57.05 ? 1116 HIS O C   1 
ATOM   8217  O O   . HIS O  1 43  ? -8.743  2.171   10.741  1.00 56.19 ? 1116 HIS O O   1 
ATOM   8218  C CB  . HIS O  1 43  ? -8.032  4.780   10.166  1.00 54.75 ? 1116 HIS O CB  1 
ATOM   8219  C CG  . HIS O  1 43  ? -7.650  6.150   9.690   1.00 56.11 ? 1116 HIS O CG  1 
ATOM   8220  N ND1 . HIS O  1 43  ? -6.547  6.379   8.892   1.00 62.48 ? 1116 HIS O ND1 1 
ATOM   8221  C CD2 . HIS O  1 43  ? -8.224  7.360   9.890   1.00 56.85 ? 1116 HIS O CD2 1 
ATOM   8222  C CE1 . HIS O  1 43  ? -6.456  7.670   8.628   1.00 61.48 ? 1116 HIS O CE1 1 
ATOM   8223  N NE2 . HIS O  1 43  ? -7.464  8.288   9.218   1.00 56.44 ? 1116 HIS O NE2 1 
ATOM   8224  N N   . GLY O  1 44  ? -8.820  1.474   8.584   1.00 54.11 ? 1117 GLY O N   1 
ATOM   8225  C CA  . GLY O  1 44  ? -9.194  0.109   8.905   1.00 50.65 ? 1117 GLY O CA  1 
ATOM   8226  C C   . GLY O  1 44  ? -10.596 -0.066  9.460   1.00 52.31 ? 1117 GLY O C   1 
ATOM   8227  O O   . GLY O  1 44  ? -10.926 -1.133  9.986   1.00 58.23 ? 1117 GLY O O   1 
ATOM   8228  N N   . VAL O  1 45  ? -11.434 0.960   9.365   1.00 46.54 ? 1118 VAL O N   1 
ATOM   8229  C CA  . VAL O  1 45  ? -12.810 0.812   9.831   1.00 46.70 ? 1118 VAL O CA  1 
ATOM   8230  C C   . VAL O  1 45  ? -13.739 0.843   8.619   1.00 43.91 ? 1118 VAL O C   1 
ATOM   8231  O O   . VAL O  1 45  ? -13.746 1.809   7.875   1.00 40.37 ? 1118 VAL O O   1 
ATOM   8232  C CB  . VAL O  1 45  ? -13.185 1.898   10.866  1.00 47.06 ? 1118 VAL O CB  1 
ATOM   8233  C CG1 . VAL O  1 45  ? -14.648 1.873   11.175  1.00 43.40 ? 1118 VAL O CG1 1 
ATOM   8234  C CG2 . VAL O  1 45  ? -12.388 1.694   12.163  1.00 47.68 ? 1118 VAL O CG2 1 
ATOM   8235  N N   . PRO O  1 46  ? -14.491 -0.240  8.382   1.00 44.64 ? 1119 PRO O N   1 
ATOM   8236  C CA  . PRO O  1 46  ? -15.271 -0.219  7.141   1.00 38.80 ? 1119 PRO O CA  1 
ATOM   8237  C C   . PRO O  1 46  ? -16.487 0.677   7.308   1.00 37.72 ? 1119 PRO O C   1 
ATOM   8238  O O   . PRO O  1 46  ? -17.228 0.504   8.269   1.00 36.34 ? 1119 PRO O O   1 
ATOM   8239  C CB  . PRO O  1 46  ? -15.704 -1.680  6.957   1.00 42.20 ? 1119 PRO O CB  1 
ATOM   8240  C CG  . PRO O  1 46  ? -14.976 -2.457  8.016   1.00 44.37 ? 1119 PRO O CG  1 
ATOM   8241  C CD  . PRO O  1 46  ? -14.619 -1.514  9.104   1.00 44.43 ? 1119 PRO O CD  1 
ATOM   8242  N N   . ILE O  1 47  ? -16.675 1.630   6.397   1.00 38.78 ? 1120 ILE O N   1 
ATOM   8243  C CA  . ILE O  1 47  ? -17.801 2.569   6.487   1.00 35.42 ? 1120 ILE O CA  1 
ATOM   8244  C C   . ILE O  1 47  ? -18.965 2.058   5.634   1.00 36.58 ? 1120 ILE O C   1 
ATOM   8245  O O   . ILE O  1 47  ? -18.773 1.779   4.443   1.00 35.49 ? 1120 ILE O O   1 
ATOM   8246  C CB  . ILE O  1 47  ? -17.394 3.946   5.979   1.00 37.78 ? 1120 ILE O CB  1 
ATOM   8247  C CG1 . ILE O  1 47  ? -16.154 4.434   6.724   1.00 36.62 ? 1120 ILE O CG1 1 
ATOM   8248  C CG2 . ILE O  1 47  ? -18.556 4.919   6.135   1.00 33.97 ? 1120 ILE O CG2 1 
ATOM   8249  C CD1 . ILE O  1 47  ? -16.337 4.457   8.225   1.00 37.34 ? 1120 ILE O CD1 1 
ATOM   8250  N N   . PRO O  1 48  ? -20.159 1.902   6.240   1.00 31.26 ? 1121 PRO O N   1 
ATOM   8251  C CA  . PRO O  1 48  ? -21.284 1.361   5.468   1.00 33.80 ? 1121 PRO O CA  1 
ATOM   8252  C C   . PRO O  1 48  ? -21.604 2.231   4.258   1.00 36.89 ? 1121 PRO O C   1 
ATOM   8253  O O   . PRO O  1 48  ? -21.547 3.458   4.367   1.00 29.26 ? 1121 PRO O O   1 
ATOM   8254  C CB  . PRO O  1 48  ? -22.434 1.386   6.460   1.00 30.06 ? 1121 PRO O CB  1 
ATOM   8255  C CG  . PRO O  1 48  ? -21.770 1.314   7.794   1.00 30.72 ? 1121 PRO O CG  1 
ATOM   8256  C CD  . PRO O  1 48  ? -20.508 2.096   7.653   1.00 30.72 ? 1121 PRO O CD  1 
ATOM   8257  N N   . VAL O  1 49  ? -21.945 1.594   3.130   1.00 30.84 ? 1122 VAL O N   1 
ATOM   8258  C CA  . VAL O  1 49  ? -22.255 2.308   1.908   1.00 29.36 ? 1122 VAL O CA  1 
ATOM   8259  C C   . VAL O  1 49  ? -23.753 2.603   1.909   1.00 32.44 ? 1122 VAL O C   1 
ATOM   8260  O O   . VAL O  1 49  ? -24.577 1.715   2.128   1.00 32.09 ? 1122 VAL O O   1 
ATOM   8261  C CB  . VAL O  1 49  ? -21.842 1.496   0.658   1.00 34.09 ? 1122 VAL O CB  1 
ATOM   8262  C CG1 . VAL O  1 49  ? -22.291 2.195   -0.600  1.00 36.07 ? 1122 VAL O CG1 1 
ATOM   8263  C CG2 . VAL O  1 49  ? -20.361 1.319   0.612   1.00 36.51 ? 1122 VAL O CG2 1 
ATOM   8264  N N   . PRO O  1 50  ? -24.125 3.866   1.690   1.00 29.25 ? 1123 PRO O N   1 
ATOM   8265  C CA  . PRO O  1 50  ? -25.560 4.130   1.696   1.00 29.16 ? 1123 PRO O CA  1 
ATOM   8266  C C   . PRO O  1 50  ? -26.274 3.332   0.601   1.00 28.92 ? 1123 PRO O C   1 
ATOM   8267  O O   . PRO O  1 50  ? -25.797 3.292   -0.526  1.00 28.72 ? 1123 PRO O O   1 
ATOM   8268  C CB  . PRO O  1 50  ? -25.652 5.626   1.344   1.00 26.12 ? 1123 PRO O CB  1 
ATOM   8269  C CG  . PRO O  1 50  ? -24.237 6.165   1.471   1.00 34.61 ? 1123 PRO O CG  1 
ATOM   8270  C CD  . PRO O  1 50  ? -23.314 5.010   1.246   1.00 33.45 ? 1123 PRO O CD  1 
ATOM   8271  N N   . PRO O  1 51  ? -27.409 2.742   0.933   1.00 32.01 ? 1124 PRO O N   1 
ATOM   8272  C CA  . PRO O  1 51  ? -28.285 2.038   -0.021  1.00 34.49 ? 1124 PRO O CA  1 
ATOM   8273  C C   . PRO O  1 51  ? -28.787 2.989   -1.128  1.00 37.88 ? 1124 PRO O C   1 
ATOM   8274  O O   . PRO O  1 51  ? -28.977 4.194   -0.876  1.00 35.02 ? 1124 PRO O O   1 
ATOM   8275  C CB  . PRO O  1 51  ? -29.445 1.577   0.855   1.00 34.70 ? 1124 PRO O CB  1 
ATOM   8276  C CG  . PRO O  1 51  ? -28.804 1.425   2.210   1.00 36.13 ? 1124 PRO O CG  1 
ATOM   8277  C CD  . PRO O  1 51  ? -27.830 2.545   2.327   1.00 33.16 ? 1124 PRO O CD  1 
ATOM   8278  N N   . LEU O  1 52  ? -28.963 2.466   -2.351  1.00 34.09 ? 1125 LEU O N   1 
ATOM   8279  C CA  . LEU O  1 52  ? -29.420 3.310   -3.454  1.00 29.85 ? 1125 LEU O CA  1 
ATOM   8280  C C   . LEU O  1 52  ? -30.697 3.993   -3.030  1.00 34.96 ? 1125 LEU O C   1 
ATOM   8281  O O   . LEU O  1 52  ? -30.888 5.168   -3.319  1.00 39.11 ? 1125 LEU O O   1 
ATOM   8282  C CB  . LEU O  1 52  ? -29.610 2.505   -4.747  1.00 31.99 ? 1125 LEU O CB  1 
ATOM   8283  C CG  . LEU O  1 52  ? -28.278 2.136   -5.404  1.00 36.13 ? 1125 LEU O CG  1 
ATOM   8284  C CD1 . LEU O  1 52  ? -28.469 1.150   -6.554  1.00 34.87 ? 1125 LEU O CD1 1 
ATOM   8285  C CD2 . LEU O  1 52  ? -27.554 3.356   -5.890  1.00 32.69 ? 1125 LEU O CD2 1 
ATOM   8286  N N   . GLU O  1 53  ? -31.543 3.276   -2.300  1.00 36.08 ? 1126 GLU O N   1 
ATOM   8287  C CA  . GLU O  1 53  ? -32.860 3.782   -1.923  1.00 37.05 ? 1126 GLU O CA  1 
ATOM   8288  C C   . GLU O  1 53  ? -32.831 4.940   -0.895  1.00 39.95 ? 1126 GLU O C   1 
ATOM   8289  O O   . GLU O  1 53  ? -33.757 5.773   -0.815  1.00 41.31 ? 1126 GLU O O   1 
ATOM   8290  C CB  . GLU O  1 53  ? -33.711 2.636   -1.401  1.00 42.77 ? 1126 GLU O CB  1 
ATOM   8291  C CG  . GLU O  1 53  ? -35.031 3.079   -0.848  1.00 50.46 ? 1126 GLU O CG  1 
ATOM   8292  C CD  . GLU O  1 53  ? -35.895 1.912   -0.432  1.00 61.71 ? 1126 GLU O CD  1 
ATOM   8293  O OE1 . GLU O  1 53  ? -37.133 2.093   -0.353  1.00 69.53 ? 1126 GLU O OE1 1 
ATOM   8294  O OE2 . GLU O  1 53  ? -35.330 0.817   -0.187  1.00 63.81 ? 1126 GLU O OE2 1 
ATOM   8295  N N   . VAL O  1 54  ? -31.770 4.981   -0.100  1.00 37.47 ? 1127 VAL O N   1 
ATOM   8296  C CA  . VAL O  1 54  ? -31.601 6.056   0.864   1.00 32.89 ? 1127 VAL O CA  1 
ATOM   8297  C C   . VAL O  1 54  ? -31.133 7.299   0.094   1.00 33.60 ? 1127 VAL O C   1 
ATOM   8298  O O   . VAL O  1 54  ? -31.590 8.412   0.363   1.00 36.90 ? 1127 VAL O O   1 
ATOM   8299  C CB  . VAL O  1 54  ? -30.598 5.638   1.973   1.00 36.29 ? 1127 VAL O CB  1 
ATOM   8300  C CG1 . VAL O  1 54  ? -30.208 6.822   2.875   1.00 32.39 ? 1127 VAL O CG1 1 
ATOM   8301  C CG2 . VAL O  1 54  ? -31.153 4.448   2.819   1.00 34.90 ? 1127 VAL O CG2 1 
ATOM   8302  N N   . LEU O  1 55  ? -30.224 7.119   -0.854  1.00 33.38 ? 1128 LEU O N   1 
ATOM   8303  C CA  . LEU O  1 55  ? -29.774 8.237   -1.693  1.00 36.88 ? 1128 LEU O CA  1 
ATOM   8304  C C   . LEU O  1 55  ? -30.951 8.839   -2.473  1.00 42.35 ? 1128 LEU O C   1 
ATOM   8305  O O   . LEU O  1 55  ? -31.113 10.060  -2.544  1.00 36.81 ? 1128 LEU O O   1 
ATOM   8306  C CB  . LEU O  1 55  ? -28.694 7.799   -2.679  1.00 32.23 ? 1128 LEU O CB  1 
ATOM   8307  C CG  . LEU O  1 55  ? -27.377 7.265   -2.119  1.00 32.04 ? 1128 LEU O CG  1 
ATOM   8308  C CD1 . LEU O  1 55  ? -26.363 7.102   -3.227  1.00 32.44 ? 1128 LEU O CD1 1 
ATOM   8309  C CD2 . LEU O  1 55  ? -26.829 8.240   -1.056  1.00 34.87 ? 1128 LEU O CD2 1 
ATOM   8310  N N   . LYS O  1 56  ? -31.763 7.974   -3.074  1.00 40.53 ? 1129 LYS O N   1 
ATOM   8311  C CA  . LYS O  1 56  ? -32.960 8.439   -3.766  1.00 42.62 ? 1129 LYS O CA  1 
ATOM   8312  C C   . LYS O  1 56  ? -33.826 9.295   -2.845  1.00 40.44 ? 1129 LYS O C   1 
ATOM   8313  O O   . LYS O  1 56  ? -34.360 10.345  -3.240  1.00 39.95 ? 1129 LYS O O   1 
ATOM   8314  C CB  . LYS O  1 56  ? -33.771 7.254   -4.300  1.00 42.49 ? 1129 LYS O CB  1 
ATOM   8315  C CG  . LYS O  1 56  ? -35.187 7.643   -4.785  1.00 47.11 ? 1129 LYS O CG  1 
ATOM   8316  C CD  . LYS O  1 56  ? -36.051 6.384   -4.963  1.00 55.27 ? 1129 LYS O CD  1 
ATOM   8317  C CE  . LYS O  1 56  ? -37.383 6.705   -5.617  1.00 60.93 ? 1129 LYS O CE  1 
ATOM   8318  N NZ  . LYS O  1 56  ? -37.159 7.330   -6.944  1.00 63.08 ? 1129 LYS O NZ  1 
ATOM   8319  N N   . LEU O  1 57  ? -33.966 8.858   -1.605  1.00 38.34 ? 1130 LEU O N   1 
ATOM   8320  C CA  . LEU O  1 57  ? -34.766 9.577   -0.650  1.00 34.86 ? 1130 LEU O CA  1 
ATOM   8321  C C   . LEU O  1 57  ? -34.130 10.945  -0.396  1.00 43.26 ? 1130 LEU O C   1 
ATOM   8322  O O   . LEU O  1 57  ? -34.827 11.976  -0.257  1.00 37.05 ? 1130 LEU O O   1 
ATOM   8323  C CB  . LEU O  1 57  ? -34.833 8.792   0.648   1.00 40.32 ? 1130 LEU O CB  1 
ATOM   8324  C CG  . LEU O  1 57  ? -36.106 8.918   1.463   1.00 44.35 ? 1130 LEU O CG  1 
ATOM   8325  C CD1 . LEU O  1 57  ? -35.800 8.755   2.958   1.00 44.14 ? 1130 LEU O CD1 1 
ATOM   8326  C CD2 . LEU O  1 57  ? -36.721 10.256  1.180   1.00 48.89 ? 1130 LEU O CD2 1 
ATOM   8327  N N   . GLY O  1 58  ? -32.799 10.961  -0.357  1.00 38.54 ? 1131 GLY O N   1 
ATOM   8328  C CA  . GLY O  1 58  ? -32.097 12.202  -0.079  1.00 38.12 ? 1131 GLY O CA  1 
ATOM   8329  C C   . GLY O  1 58  ? -32.351 13.217  -1.185  1.00 39.88 ? 1131 GLY O C   1 
ATOM   8330  O O   . GLY O  1 58  ? -32.598 14.389  -0.893  1.00 36.46 ? 1131 GLY O O   1 
ATOM   8331  N N   . GLU O  1 59  ? -32.265 12.757  -2.441  1.00 42.39 ? 1132 GLU O N   1 
ATOM   8332  C CA  . GLU O  1 59  ? -32.622 13.559  -3.619  1.00 40.77 ? 1132 GLU O CA  1 
ATOM   8333  C C   . GLU O  1 59  ? -33.998 14.155  -3.414  1.00 43.05 ? 1132 GLU O C   1 
ATOM   8334  O O   . GLU O  1 59  ? -34.163 15.383  -3.404  1.00 45.36 ? 1132 GLU O O   1 
ATOM   8335  C CB  . GLU O  1 59  ? -32.652 12.684  -4.883  1.00 46.32 ? 1132 GLU O CB  1 
ATOM   8336  C CG  . GLU O  1 59  ? -32.974 13.445  -6.188  1.00 52.20 ? 1132 GLU O CG  1 
ATOM   8337  C CD  . GLU O  1 59  ? -33.852 12.654  -7.182  1.00 61.55 ? 1132 GLU O CD  1 
ATOM   8338  O OE1 . GLU O  1 59  ? -34.748 13.281  -7.809  1.00 62.73 ? 1132 GLU O OE1 1 
ATOM   8339  O OE2 . GLU O  1 59  ? -33.653 11.417  -7.337  1.00 59.49 ? 1132 GLU O OE2 1 
ATOM   8340  N N   . GLN O  1 60  ? -34.991 13.282  -3.278  1.00 34.62 ? 1133 GLN O N   1 
ATOM   8341  C CA  . GLN O  1 60  ? -36.361 13.720  -3.018  1.00 46.67 ? 1133 GLN O CA  1 
ATOM   8342  C C   . GLN O  1 60  ? -36.461 14.810  -1.940  1.00 46.36 ? 1133 GLN O C   1 
ATOM   8343  O O   . GLN O  1 60  ? -37.108 15.851  -2.142  1.00 43.43 ? 1133 GLN O O   1 
ATOM   8344  C CB  . GLN O  1 60  ? -37.253 12.533  -2.636  1.00 43.73 ? 1133 GLN O CB  1 
ATOM   8345  C CG  . GLN O  1 60  ? -37.386 11.463  -3.712  1.00 51.20 ? 1133 GLN O CG  1 
ATOM   8346  C CD  . GLN O  1 60  ? -38.530 10.494  -3.438  1.00 57.59 ? 1133 GLN O CD  1 
ATOM   8347  O OE1 . GLN O  1 60  ? -38.920 9.712   -4.314  1.00 57.00 ? 1133 GLN O OE1 1 
ATOM   8348  N NE2 . GLN O  1 60  ? -39.086 10.553  -2.220  1.00 57.55 ? 1133 GLN O NE2 1 
ATOM   8349  N N   . MET O  1 61  ? -35.820 14.564  -0.797  1.00 40.70 ? 1134 MET O N   1 
ATOM   8350  C CA  . MET O  1 61  ? -35.944 15.430  0.377   1.00 36.90 ? 1134 MET O CA  1 
ATOM   8351  C C   . MET O  1 61  ? -35.209 16.759  0.212   1.00 40.96 ? 1134 MET O C   1 
ATOM   8352  O O   . MET O  1 61  ? -35.619 17.767  0.776   1.00 43.70 ? 1134 MET O O   1 
ATOM   8353  C CB  . MET O  1 61  ? -35.395 14.741  1.616   1.00 40.77 ? 1134 MET O CB  1 
ATOM   8354  C CG  . MET O  1 61  ? -36.294 13.663  2.209   1.00 42.15 ? 1134 MET O CG  1 
ATOM   8355  S SD  . MET O  1 61  ? -35.353 12.625  3.352   1.00 38.90 ? 1134 MET O SD  1 
ATOM   8356  C CE  . MET O  1 61  ? -35.634 13.466  4.871   1.00 34.64 ? 1134 MET O CE  1 
ATOM   8357  N N   . THR O  1 62  ? -34.104 16.747  -0.516  1.00 40.06 ? 1135 THR O N   1 
ATOM   8358  C CA  . THR O  1 62  ? -33.315 17.953  -0.684  1.00 41.58 ? 1135 THR O CA  1 
ATOM   8359  C C   . THR O  1 62  ? -34.056 18.896  -1.637  1.00 45.91 ? 1135 THR O C   1 
ATOM   8360  O O   . THR O  1 62  ? -34.151 20.101  -1.381  1.00 45.07 ? 1135 THR O O   1 
ATOM   8361  C CB  . THR O  1 62  ? -31.932 17.634  -1.257  1.00 41.70 ? 1135 THR O CB  1 
ATOM   8362  O OG1 . THR O  1 62  ? -31.200 16.848  -0.308  1.00 41.65 ? 1135 THR O OG1 1 
ATOM   8363  C CG2 . THR O  1 62  ? -31.161 18.904  -1.517  1.00 41.82 ? 1135 THR O CG2 1 
ATOM   8364  N N   . GLN O  1 63  ? -34.564 18.331  -2.736  1.00 44.80 ? 1136 GLN O N   1 
ATOM   8365  C CA  . GLN O  1 63  ? -35.348 19.084  -3.708  1.00 49.38 ? 1136 GLN O CA  1 
ATOM   8366  C C   . GLN O  1 63  ? -36.624 19.646  -3.093  1.00 49.50 ? 1136 GLN O C   1 
ATOM   8367  O O   . GLN O  1 63  ? -37.048 20.765  -3.428  1.00 51.33 ? 1136 GLN O O   1 
ATOM   8368  C CB  . GLN O  1 63  ? -35.680 18.224  -4.928  1.00 54.23 ? 1136 GLN O CB  1 
ATOM   8369  C CG  . GLN O  1 63  ? -36.261 19.029  -6.099  1.00 60.89 ? 1136 GLN O CG  1 
ATOM   8370  C CD  . GLN O  1 63  ? -36.301 18.243  -7.411  1.00 68.57 ? 1136 GLN O CD  1 
ATOM   8371  O OE1 . GLN O  1 63  ? -36.625 18.795  -8.477  1.00 63.98 ? 1136 GLN O OE1 1 
ATOM   8372  N NE2 . GLN O  1 63  ? -35.971 16.947  -7.338  1.00 65.06 ? 1136 GLN O NE2 1 
ATOM   8373  N N   . GLU O  1 64  ? -37.221 18.880  -2.182  1.00 45.90 ? 1137 GLU O N   1 
ATOM   8374  C CA  . GLU O  1 64  ? -38.438 19.288  -1.491  1.00 47.49 ? 1137 GLU O CA  1 
ATOM   8375  C C   . GLU O  1 64  ? -38.238 20.389  -0.458  1.00 49.12 ? 1137 GLU O C   1 
ATOM   8376  O O   . GLU O  1 64  ? -39.027 21.338  -0.399  1.00 43.40 ? 1137 GLU O O   1 
ATOM   8377  C CB  . GLU O  1 64  ? -39.110 18.086  -0.831  1.00 48.81 ? 1137 GLU O CB  1 
ATOM   8378  C CG  . GLU O  1 64  ? -40.336 18.421  0.002   1.00 50.16 ? 1137 GLU O CG  1 
ATOM   8379  C CD  . GLU O  1 64  ? -41.276 17.224  0.118   1.00 62.33 ? 1137 GLU O CD  1 
ATOM   8380  O OE1 . GLU O  1 64  ? -42.249 17.294  0.907   1.00 64.66 ? 1137 GLU O OE1 1 
ATOM   8381  O OE2 . GLU O  1 64  ? -41.032 16.206  -0.586  1.00 58.97 ? 1137 GLU O OE2 1 
ATOM   8382  N N   . ALA O  1 65  ? -37.195 20.258  0.360   1.00 47.59 ? 1138 ALA O N   1 
ATOM   8383  C CA  . ALA O  1 65  ? -36.906 21.250  1.403   1.00 42.43 ? 1138 ALA O CA  1 
ATOM   8384  C C   . ALA O  1 65  ? -36.125 22.439  0.857   1.00 43.59 ? 1138 ALA O C   1 
ATOM   8385  O O   . ALA O  1 65  ? -36.085 23.503  1.481   1.00 45.73 ? 1138 ALA O O   1 
ATOM   8386  C CB  . ALA O  1 65  ? -36.128 20.622  2.531   1.00 45.23 ? 1138 ALA O CB  1 
ATOM   8387  N N   . ARG O  1 66  ? -35.491 22.247  -0.294  1.00 40.10 ? 1139 ARG O N   1 
ATOM   8388  C CA  . ARG O  1 66  ? -34.578 23.251  -0.812  1.00 40.44 ? 1139 ARG O CA  1 
ATOM   8389  C C   . ARG O  1 66  ? -33.643 23.733  0.313   1.00 42.71 ? 1139 ARG O C   1 
ATOM   8390  O O   . ARG O  1 66  ? -33.386 24.923  0.482   1.00 39.00 ? 1139 ARG O O   1 
ATOM   8391  C CB  . ARG O  1 66  ? -35.360 24.398  -1.488  1.00 39.63 ? 1139 ARG O CB  1 
ATOM   8392  C CG  . ARG O  1 66  ? -35.620 24.126  -2.992  1.00 38.30 ? 1139 ARG O CG  1 
ATOM   8393  C CD  . ARG O  1 66  ? -37.018 24.548  -3.452  1.00 39.67 ? 1139 ARG O CD  1 
ATOM   8394  N NE  . ARG O  1 66  ? -38.043 23.725  -2.825  1.00 43.70 ? 1139 ARG O NE  1 
ATOM   8395  C CZ  . ARG O  1 66  ? -39.348 23.843  -3.024  1.00 43.31 ? 1139 ARG O CZ  1 
ATOM   8396  N NH1 . ARG O  1 66  ? -40.162 23.022  -2.390  1.00 42.64 ? 1139 ARG O NH1 1 
ATOM   8397  N NH2 . ARG O  1 66  ? -39.846 24.767  -3.839  1.00 32.68 ? 1139 ARG O NH2 1 
ATOM   8398  N N   . GLU O  1 67  ? -33.135 22.790  1.107   1.00 38.76 ? 1140 GLU O N   1 
ATOM   8399  C CA  . GLU O  1 67  ? -31.926 23.072  1.861   1.00 37.73 ? 1140 GLU O CA  1 
ATOM   8400  C C   . GLU O  1 67  ? -30.950 21.900  1.762   1.00 37.62 ? 1140 GLU O C   1 
ATOM   8401  O O   . GLU O  1 67  ? -31.339 20.798  1.404   1.00 32.17 ? 1140 GLU O O   1 
ATOM   8402  C CB  . GLU O  1 67  ? -32.218 23.511  3.302   1.00 45.59 ? 1140 GLU O CB  1 
ATOM   8403  C CG  . GLU O  1 67  ? -33.089 22.612  4.138   1.00 48.35 ? 1140 GLU O CG  1 
ATOM   8404  C CD  . GLU O  1 67  ? -33.229 23.130  5.580   1.00 53.92 ? 1140 GLU O CD  1 
ATOM   8405  O OE1 . GLU O  1 67  ? -34.331 22.992  6.156   1.00 53.30 ? 1140 GLU O OE1 1 
ATOM   8406  O OE2 . GLU O  1 67  ? -32.243 23.685  6.142   1.00 51.35 ? 1140 GLU O OE2 1 
ATOM   8407  N N   . HIS O  1 68  ? -29.679 22.177  2.011   1.00 33.85 ? 1141 HIS O N   1 
ATOM   8408  C CA  . HIS O  1 68  ? -28.614 21.209  1.911   1.00 33.82 ? 1141 HIS O CA  1 
ATOM   8409  C C   . HIS O  1 68  ? -28.763 20.244  3.078   1.00 35.65 ? 1141 HIS O C   1 
ATOM   8410  O O   . HIS O  1 68  ? -28.821 20.654  4.240   1.00 32.10 ? 1141 HIS O O   1 
ATOM   8411  C CB  . HIS O  1 68  ? -27.273 21.940  1.970   1.00 36.25 ? 1141 HIS O CB  1 
ATOM   8412  C CG  . HIS O  1 68  ? -26.082 21.045  1.916   1.00 37.53 ? 1141 HIS O CG  1 
ATOM   8413  N ND1 . HIS O  1 68  ? -25.571 20.559  0.733   1.00 41.56 ? 1141 HIS O ND1 1 
ATOM   8414  C CD2 . HIS O  1 68  ? -25.271 20.579  2.895   1.00 38.65 ? 1141 HIS O CD2 1 
ATOM   8415  C CE1 . HIS O  1 68  ? -24.511 19.812  0.986   1.00 43.66 ? 1141 HIS O CE1 1 
ATOM   8416  N NE2 . HIS O  1 68  ? -24.303 19.812  2.288   1.00 39.39 ? 1141 HIS O NE2 1 
ATOM   8417  N N   . LEU O  1 69  ? -28.861 18.960  2.755   1.00 36.05 ? 1142 LEU O N   1 
ATOM   8418  C CA  . LEU O  1 69  ? -28.936 17.931  3.781   1.00 34.04 ? 1142 LEU O CA  1 
ATOM   8419  C C   . LEU O  1 69  ? -27.642 17.151  3.879   1.00 27.77 ? 1142 LEU O C   1 
ATOM   8420  O O   . LEU O  1 69  ? -26.963 16.885  2.896   1.00 34.12 ? 1142 LEU O O   1 
ATOM   8421  C CB  . LEU O  1 69  ? -30.124 16.983  3.549   1.00 32.68 ? 1142 LEU O CB  1 
ATOM   8422  C CG  . LEU O  1 69  ? -31.402 17.800  3.308   1.00 34.11 ? 1142 LEU O CG  1 
ATOM   8423  C CD1 . LEU O  1 69  ? -32.637 16.950  3.092   1.00 37.33 ? 1142 LEU O CD1 1 
ATOM   8424  C CD2 . LEU O  1 69  ? -31.603 18.721  4.478   1.00 32.46 ? 1142 LEU O CD2 1 
ATOM   8425  N N   . TYR O  1 70  ? -27.311 16.825  5.113   1.00 27.39 ? 1143 TYR O N   1 
ATOM   8426  C CA  . TYR O  1 70  ? -26.246 15.879  5.381   1.00 29.11 ? 1143 TYR O CA  1 
ATOM   8427  C C   . TYR O  1 70  ? -26.862 14.514  5.578   1.00 22.85 ? 1143 TYR O C   1 
ATOM   8428  O O   . TYR O  1 70  ? -27.939 14.380  6.165   1.00 27.38 ? 1143 TYR O O   1 
ATOM   8429  C CB  . TYR O  1 70  ? -25.521 16.297  6.658   1.00 25.68 ? 1143 TYR O CB  1 
ATOM   8430  C CG  . TYR O  1 70  ? -24.810 17.614  6.533   1.00 28.20 ? 1143 TYR O CG  1 
ATOM   8431  C CD1 . TYR O  1 70  ? -23.470 17.661  6.210   1.00 30.06 ? 1143 TYR O CD1 1 
ATOM   8432  C CD2 . TYR O  1 70  ? -25.488 18.817  6.740   1.00 32.96 ? 1143 TYR O CD2 1 
ATOM   8433  C CE1 . TYR O  1 70  ? -22.798 18.868  6.104   1.00 36.26 ? 1143 TYR O CE1 1 
ATOM   8434  C CE2 . TYR O  1 70  ? -24.814 20.041  6.626   1.00 33.50 ? 1143 TYR O CE2 1 
ATOM   8435  C CZ  . TYR O  1 70  ? -23.476 20.051  6.304   1.00 33.98 ? 1143 TYR O CZ  1 
ATOM   8436  O OH  . TYR O  1 70  ? -22.802 21.239  6.206   1.00 37.57 ? 1143 TYR O OH  1 
ATOM   8437  N N   . LEU O  1 71  ? -26.155 13.497  5.106   1.00 29.05 ? 1144 LEU O N   1 
ATOM   8438  C CA  . LEU O  1 71  ? -26.568 12.117  5.350   1.00 31.30 ? 1144 LEU O CA  1 
ATOM   8439  C C   . LEU O  1 71  ? -25.848 11.598  6.588   1.00 25.48 ? 1144 LEU O C   1 
ATOM   8440  O O   . LEU O  1 71  ? -24.625 11.692  6.680   1.00 29.34 ? 1144 LEU O O   1 
ATOM   8441  C CB  . LEU O  1 71  ? -26.271 11.232  4.141   1.00 33.52 ? 1144 LEU O CB  1 
ATOM   8442  C CG  . LEU O  1 71  ? -26.534 9.730   4.356   1.00 27.40 ? 1144 LEU O CG  1 
ATOM   8443  C CD1 . LEU O  1 71  ? -27.994 9.456   4.683   1.00 28.57 ? 1144 LEU O CD1 1 
ATOM   8444  C CD2 . LEU O  1 71  ? -26.091 9.014   3.094   1.00 32.04 ? 1144 LEU O CD2 1 
ATOM   8445  N N   . VAL O  1 72  ? -26.632 11.131  7.542   1.00 25.40 ? 1145 VAL O N   1 
ATOM   8446  C CA  . VAL O  1 72  ? -26.087 10.650  8.805   1.00 27.66 ? 1145 VAL O CA  1 
ATOM   8447  C C   . VAL O  1 72  ? -26.528 9.205   9.075   1.00 29.44 ? 1145 VAL O C   1 
ATOM   8448  O O   . VAL O  1 72  ? -27.599 8.755   8.662   1.00 29.53 ? 1145 VAL O O   1 
ATOM   8449  C CB  . VAL O  1 72  ? -26.492 11.525  9.990   1.00 29.38 ? 1145 VAL O CB  1 
ATOM   8450  C CG1 . VAL O  1 72  ? -26.158 13.014  9.687   1.00 24.90 ? 1145 VAL O CG1 1 
ATOM   8451  C CG2 . VAL O  1 72  ? -28.003 11.358  10.334  1.00 29.49 ? 1145 VAL O CG2 1 
ATOM   8452  N N   . LEU O  1 73  ? -25.683 8.494   9.798   1.00 24.77 ? 1146 LEU O N   1 
ATOM   8453  C CA  . LEU O  1 73  ? -25.909 7.087   10.102  1.00 25.39 ? 1146 LEU O CA  1 
ATOM   8454  C C   . LEU O  1 73  ? -25.823 7.052   11.598  1.00 26.21 ? 1146 LEU O C   1 
ATOM   8455  O O   . LEU O  1 73  ? -24.768 7.402   12.174  1.00 25.84 ? 1146 LEU O O   1 
ATOM   8456  C CB  . LEU O  1 73  ? -24.803 6.245   9.498   1.00 26.52 ? 1146 LEU O CB  1 
ATOM   8457  C CG  . LEU O  1 73  ? -24.911 4.739   9.846   1.00 28.13 ? 1146 LEU O CG  1 
ATOM   8458  C CD1 . LEU O  1 73  ? -26.163 4.101   9.227   1.00 30.68 ? 1146 LEU O CD1 1 
ATOM   8459  C CD2 . LEU O  1 73  ? -23.648 4.002   9.343   1.00 28.42 ? 1146 LEU O CD2 1 
ATOM   8460  N N   . PHE O  1 74  ? -26.940 6.702   12.224  1.00 24.06 ? 1147 PHE O N   1 
ATOM   8461  C CA  . PHE O  1 74  ? -27.068 6.728   13.650  1.00 23.81 ? 1147 PHE O CA  1 
ATOM   8462  C C   . PHE O  1 74  ? -26.299 5.563   14.283  1.00 25.33 ? 1147 PHE O C   1 
ATOM   8463  O O   . PHE O  1 74  ? -26.174 4.500   13.673  1.00 26.28 ? 1147 PHE O O   1 
ATOM   8464  C CB  . PHE O  1 74  ? -28.526 6.620   14.059  1.00 25.03 ? 1147 PHE O CB  1 
ATOM   8465  C CG  . PHE O  1 74  ? -29.305 7.890   13.831  1.00 29.34 ? 1147 PHE O CG  1 
ATOM   8466  C CD1 . PHE O  1 74  ? -29.099 9.001   14.658  1.00 29.30 ? 1147 PHE O CD1 1 
ATOM   8467  C CD2 . PHE O  1 74  ? -30.241 7.971   12.809  1.00 32.25 ? 1147 PHE O CD2 1 
ATOM   8468  C CE1 . PHE O  1 74  ? -29.808 10.187  14.450  1.00 34.77 ? 1147 PHE O CE1 1 
ATOM   8469  C CE2 . PHE O  1 74  ? -30.956 9.168   12.599  1.00 33.33 ? 1147 PHE O CE2 1 
ATOM   8470  C CZ  . PHE O  1 74  ? -30.736 10.256  13.414  1.00 39.52 ? 1147 PHE O CZ  1 
ATOM   8471  N N   . PHE O  1 75  ? -25.790 5.777   15.491  1.00 23.78 ? 1148 PHE O N   1 
ATOM   8472  C CA  . PHE O  1 75  ? -25.183 4.676   16.252  1.00 27.60 ? 1148 PHE O CA  1 
ATOM   8473  C C   . PHE O  1 75  ? -26.267 3.916   16.991  1.00 27.66 ? 1148 PHE O C   1 
ATOM   8474  O O   . PHE O  1 75  ? -26.057 3.433   18.116  1.00 29.95 ? 1148 PHE O O   1 
ATOM   8475  C CB  . PHE O  1 75  ? -24.093 5.191   17.216  1.00 22.79 ? 1148 PHE O CB  1 
ATOM   8476  C CG  . PHE O  1 75  ? -22.841 5.613   16.508  1.00 25.73 ? 1148 PHE O CG  1 
ATOM   8477  C CD1 . PHE O  1 75  ? -21.872 4.687   16.154  1.00 26.03 ? 1148 PHE O CD1 1 
ATOM   8478  C CD2 . PHE O  1 75  ? -22.648 6.925   16.139  1.00 22.76 ? 1148 PHE O CD2 1 
ATOM   8479  C CE1 . PHE O  1 75  ? -20.709 5.093   15.481  1.00 25.38 ? 1148 PHE O CE1 1 
ATOM   8480  C CE2 . PHE O  1 75  ? -21.501 7.325   15.477  1.00 26.15 ? 1148 PHE O CE2 1 
ATOM   8481  C CZ  . PHE O  1 75  ? -20.541 6.414   15.120  1.00 26.11 ? 1148 PHE O CZ  1 
ATOM   8482  N N   . ASP O  1 76  ? -27.444 3.760   16.381  1.00 27.97 ? 1149 ASP O N   1 
ATOM   8483  C CA  . ASP O  1 76  ? -28.477 3.005   17.077  1.00 28.28 ? 1149 ASP O CA  1 
ATOM   8484  C C   . ASP O  1 76  ? -28.254 1.529   16.771  1.00 28.67 ? 1149 ASP O C   1 
ATOM   8485  O O   . ASP O  1 76  ? -27.404 1.182   15.945  1.00 31.14 ? 1149 ASP O O   1 
ATOM   8486  C CB  . ASP O  1 76  ? -29.911 3.465   16.702  1.00 31.46 ? 1149 ASP O CB  1 
ATOM   8487  C CG  . ASP O  1 76  ? -30.162 3.487   15.199  1.00 30.65 ? 1149 ASP O CG  1 
ATOM   8488  O OD1 . ASP O  1 76  ? -29.225 3.475   14.386  1.00 30.91 ? 1149 ASP O OD1 1 
ATOM   8489  O OD2 . ASP O  1 76  ? -31.353 3.517   14.808  1.00 35.82 ? 1149 ASP O OD2 1 
ATOM   8490  N N   . ASN O  1 77  ? -29.001 0.664   17.447  1.00 38.21 ? 1150 ASN O N   1 
ATOM   8491  C CA  . ASN O  1 77  ? -28.872 -0.785  17.232  1.00 35.34 ? 1150 ASN O CA  1 
ATOM   8492  C C   . ASN O  1 77  ? -28.915 -1.139  15.757  1.00 36.13 ? 1150 ASN O C   1 
ATOM   8493  O O   . ASN O  1 77  ? -28.077 -1.889  15.261  1.00 41.44 ? 1150 ASN O O   1 
ATOM   8494  C CB  . ASN O  1 77  ? -30.000 -1.542  17.957  1.00 46.53 ? 1150 ASN O CB  1 
ATOM   8495  C CG  . ASN O  1 77  ? -29.854 -1.502  19.464  1.00 45.03 ? 1150 ASN O CG  1 
ATOM   8496  O OD1 . ASN O  1 77  ? -28.769 -1.240  19.976  1.00 45.87 ? 1150 ASN O OD1 1 
ATOM   8497  N ND2 . ASN O  1 77  ? -30.953 -1.755  20.187  1.00 44.99 ? 1150 ASN O ND2 1 
ATOM   8498  N N   . LYS O  1 78  ? -29.886 -0.571  15.047  1.00 36.92 ? 1151 LYS O N   1 
ATOM   8499  C CA  . LYS O  1 78  ? -30.150 -0.989  13.681  1.00 37.81 ? 1151 LYS O CA  1 
ATOM   8500  C C   . LYS O  1 78  ? -29.354 -0.243  12.627  1.00 35.51 ? 1151 LYS O C   1 
ATOM   8501  O O   . LYS O  1 78  ? -29.472 -0.542  11.442  1.00 38.46 ? 1151 LYS O O   1 
ATOM   8502  C CB  . LYS O  1 78  ? -31.639 -0.894  13.382  1.00 40.67 ? 1151 LYS O CB  1 
ATOM   8503  C CG  . LYS O  1 78  ? -32.481 -1.841  14.204  1.00 47.93 ? 1151 LYS O CG  1 
ATOM   8504  C CD  . LYS O  1 78  ? -33.936 -1.380  14.237  1.00 58.50 ? 1151 LYS O CD  1 
ATOM   8505  C CE  . LYS O  1 78  ? -34.773 -2.215  15.213  1.00 63.99 ? 1151 LYS O CE  1 
ATOM   8506  N NZ  . LYS O  1 78  ? -36.179 -1.704  15.334  1.00 70.15 ? 1151 LYS O NZ  1 
ATOM   8507  N N   . ARG O  1 79  ? -28.520 0.704   13.061  1.00 35.39 ? 1152 ARG O N   1 
ATOM   8508  C CA  . ARG O  1 79  ? -27.754 1.527   12.145  1.00 31.32 ? 1152 ARG O CA  1 
ATOM   8509  C C   . ARG O  1 79  ? -28.662 2.115   11.033  1.00 28.85 ? 1152 ARG O C   1 
ATOM   8510  O O   . ARG O  1 79  ? -28.587 1.723   9.860   1.00 30.43 ? 1152 ARG O O   1 
ATOM   8511  C CB  . ARG O  1 79  ? -26.566 0.754   11.561  1.00 35.92 ? 1152 ARG O CB  1 
ATOM   8512  C CG  . ARG O  1 79  ? -25.556 0.203   12.609  1.00 36.19 ? 1152 ARG O CG  1 
ATOM   8513  C CD  . ARG O  1 79  ? -25.122 1.246   13.667  1.00 35.83 ? 1152 ARG O CD  1 
ATOM   8514  N NE  . ARG O  1 79  ? -24.135 2.228   13.198  1.00 32.34 ? 1152 ARG O NE  1 
ATOM   8515  C CZ  . ARG O  1 79  ? -22.876 1.942   12.852  1.00 38.83 ? 1152 ARG O CZ  1 
ATOM   8516  N NH1 . ARG O  1 79  ? -22.419 0.682   12.879  1.00 36.44 ? 1152 ARG O NH1 1 
ATOM   8517  N NH2 . ARG O  1 79  ? -22.062 2.910   12.476  1.00 31.11 ? 1152 ARG O NH2 1 
ATOM   8518  N N   . THR O  1 80  ? -29.513 3.057   11.424  1.00 34.13 ? 1153 THR O N   1 
ATOM   8519  C CA  . THR O  1 80  ? -30.435 3.704   10.482  1.00 37.11 ? 1153 THR O CA  1 
ATOM   8520  C C   . THR O  1 80  ? -29.921 5.037   9.956   1.00 34.89 ? 1153 THR O C   1 
ATOM   8521  O O   . THR O  1 80  ? -29.031 5.673   10.559  1.00 31.83 ? 1153 THR O O   1 
ATOM   8522  C CB  . THR O  1 80  ? -31.851 3.886   11.087  1.00 33.55 ? 1153 THR O CB  1 
ATOM   8523  O OG1 . THR O  1 80  ? -31.819 4.850   12.135  1.00 36.44 ? 1153 THR O OG1 1 
ATOM   8524  C CG2 . THR O  1 80  ? -32.382 2.564   11.690  1.00 38.34 ? 1153 THR O CG2 1 
ATOM   8525  N N   . TRP O  1 81  ? -30.502 5.449   8.832   1.00 30.77 ? 1154 TRP O N   1 
ATOM   8526  C CA  . TRP O  1 81  ? -30.008 6.554   8.012   1.00 30.13 ? 1154 TRP O CA  1 
ATOM   8527  C C   . TRP O  1 81  ? -31.009 7.716   8.066   1.00 35.12 ? 1154 TRP O C   1 
ATOM   8528  O O   . TRP O  1 81  ? -32.223 7.498   8.218   1.00 34.04 ? 1154 TRP O O   1 
ATOM   8529  C CB  . TRP O  1 81  ? -29.923 6.105   6.561   1.00 35.62 ? 1154 TRP O CB  1 
ATOM   8530  C CG  . TRP O  1 81  ? -28.969 5.029   6.234   1.00 32.59 ? 1154 TRP O CG  1 
ATOM   8531  C CD1 . TRP O  1 81  ? -29.244 3.685   6.137   1.00 34.05 ? 1154 TRP O CD1 1 
ATOM   8532  C CD2 . TRP O  1 81  ? -27.597 5.194   5.890   1.00 30.48 ? 1154 TRP O CD2 1 
ATOM   8533  N NE1 . TRP O  1 81  ? -28.108 3.001   5.771   1.00 31.60 ? 1154 TRP O NE1 1 
ATOM   8534  C CE2 . TRP O  1 81  ? -27.078 3.901   5.619   1.00 33.57 ? 1154 TRP O CE2 1 
ATOM   8535  C CE3 . TRP O  1 81  ? -26.735 6.308   5.818   1.00 30.70 ? 1154 TRP O CE3 1 
ATOM   8536  C CZ2 . TRP O  1 81  ? -25.750 3.694   5.255   1.00 29.65 ? 1154 TRP O CZ2 1 
ATOM   8537  C CZ3 . TRP O  1 81  ? -25.427 6.117   5.448   1.00 24.96 ? 1154 TRP O CZ3 1 
ATOM   8538  C CH2 . TRP O  1 81  ? -24.931 4.793   5.170   1.00 32.93 ? 1154 TRP O CH2 1 
ATOM   8539  N N   . GLN O  1 82  ? -30.502 8.940   7.986   1.00 34.89 ? 1155 GLN O N   1 
ATOM   8540  C CA  . GLN O  1 82  ? -31.381 10.135  7.837   1.00 33.57 ? 1155 GLN O CA  1 
ATOM   8541  C C   . GLN O  1 82  ? -30.687 11.205  7.033   1.00 36.02 ? 1155 GLN O C   1 
ATOM   8542  O O   . GLN O  1 82  ? -29.473 11.142  6.812   1.00 33.25 ? 1155 GLN O O   1 
ATOM   8543  C CB  . GLN O  1 82  ? -31.847 10.692  9.175   1.00 35.50 ? 1155 GLN O CB  1 
ATOM   8544  C CG  . GLN O  1 82  ? -33.305 10.465  9.499   1.00 44.49 ? 1155 GLN O CG  1 
ATOM   8545  C CD  . GLN O  1 82  ? -34.263 10.828  8.339   1.00 48.65 ? 1155 GLN O CD  1 
ATOM   8546  O OE1 . GLN O  1 82  ? -33.880 11.499  7.384   1.00 42.65 ? 1155 GLN O OE1 1 
ATOM   8547  N NE2 . GLN O  1 82  ? -35.510 10.363  8.431   1.00 47.17 ? 1155 GLN O NE2 1 
ATOM   8548  N N   . TRP O  1 83  ? -31.467 12.169  6.534   1.00 36.15 ? 1156 TRP O N   1 
ATOM   8549  C CA  . TRP O  1 83  ? -30.907 13.317  5.856   1.00 37.18 ? 1156 TRP O CA  1 
ATOM   8550  C C   . TRP O  1 83  ? -31.332 14.547  6.662   1.00 36.67 ? 1156 TRP O C   1 
ATOM   8551  O O   . TRP O  1 83  ? -32.524 14.692  7.012   1.00 37.96 ? 1156 TRP O O   1 
ATOM   8552  C CB  . TRP O  1 83  ? -31.437 13.430  4.437   1.00 37.20 ? 1156 TRP O CB  1 
ATOM   8553  C CG  . TRP O  1 83  ? -31.013 12.330  3.489   1.00 36.16 ? 1156 TRP O CG  1 
ATOM   8554  C CD1 . TRP O  1 83  ? -31.658 11.143  3.272   1.00 31.82 ? 1156 TRP O CD1 1 
ATOM   8555  C CD2 . TRP O  1 83  ? -29.897 12.348  2.607   1.00 32.59 ? 1156 TRP O CD2 1 
ATOM   8556  N NE1 . TRP O  1 83  ? -30.993 10.416  2.329   1.00 35.07 ? 1156 TRP O NE1 1 
ATOM   8557  C CE2 . TRP O  1 83  ? -29.908 11.130  1.899   1.00 34.64 ? 1156 TRP O CE2 1 
ATOM   8558  C CE3 . TRP O  1 83  ? -28.871 13.267  2.355   1.00 33.20 ? 1156 TRP O CE3 1 
ATOM   8559  C CZ2 . TRP O  1 83  ? -28.948 10.815  0.958   1.00 34.75 ? 1156 TRP O CZ2 1 
ATOM   8560  C CZ3 . TRP O  1 83  ? -27.918 12.951  1.412   1.00 33.39 ? 1156 TRP O CZ3 1 
ATOM   8561  C CH2 . TRP O  1 83  ? -27.963 11.730  0.724   1.00 34.79 ? 1156 TRP O CH2 1 
ATOM   8562  N N   . LEU O  1 84  ? -30.360 15.405  6.979   1.00 31.80 ? 1157 LEU O N   1 
ATOM   8563  C CA  . LEU O  1 84  ? -30.597 16.518  7.909   1.00 30.69 ? 1157 LEU O CA  1 
ATOM   8564  C C   . LEU O  1 84  ? -29.797 17.751  7.572   1.00 31.53 ? 1157 LEU O C   1 
ATOM   8565  O O   . LEU O  1 84  ? -28.614 17.665  7.184   1.00 26.21 ? 1157 LEU O O   1 
ATOM   8566  C CB  . LEU O  1 84  ? -30.295 16.093  9.361   1.00 31.98 ? 1157 LEU O CB  1 
ATOM   8567  C CG  . LEU O  1 84  ? -31.182 15.048  10.047  1.00 35.98 ? 1157 LEU O CG  1 
ATOM   8568  C CD1 . LEU O  1 84  ? -30.575 14.627  11.390  1.00 32.96 ? 1157 LEU O CD1 1 
ATOM   8569  C CD2 . LEU O  1 84  ? -32.558 15.612  10.277  1.00 38.88 ? 1157 LEU O CD2 1 
ATOM   8570  N N   . PRO O  1 85  ? -30.429 18.933  7.762   1.00 31.89 ? 1158 PRO O N   1 
ATOM   8571  C CA  . PRO O  1 85  ? -29.781 20.229  7.551   1.00 34.74 ? 1158 PRO O CA  1 
ATOM   8572  C C   . PRO O  1 85  ? -28.835 20.620  8.700   1.00 32.10 ? 1158 PRO O C   1 
ATOM   8573  O O   . PRO O  1 85  ? -28.962 20.085  9.821   1.00 32.68 ? 1158 PRO O O   1 
ATOM   8574  C CB  . PRO O  1 85  ? -30.976 21.184  7.493   1.00 35.28 ? 1158 PRO O CB  1 
ATOM   8575  C CG  . PRO O  1 85  ? -31.995 20.584  8.419   1.00 36.49 ? 1158 PRO O CG  1 
ATOM   8576  C CD  . PRO O  1 85  ? -31.745 19.071  8.425   1.00 33.49 ? 1158 PRO O CD  1 
ATOM   8577  N N   . ARG O  1 86  ? -27.894 21.524  8.410   1.00 35.77 ? 1159 ARG O N   1 
ATOM   8578  C CA  . ARG O  1 86  ? -26.843 21.924  9.356   1.00 37.26 ? 1159 ARG O CA  1 
ATOM   8579  C C   . ARG O  1 86  ? -27.396 22.337  10.706  1.00 36.60 ? 1159 ARG O C   1 
ATOM   8580  O O   . ARG O  1 86  ? -26.758 22.151  11.744  1.00 35.31 ? 1159 ARG O O   1 
ATOM   8581  C CB  . ARG O  1 86  ? -26.024 23.076  8.788   1.00 39.69 ? 1159 ARG O CB  1 
ATOM   8582  C CG  . ARG O  1 86  ? -25.001 23.613  9.763   1.00 42.91 ? 1159 ARG O CG  1 
ATOM   8583  C CD  . ARG O  1 86  ? -23.869 22.628  9.866   1.00 44.86 ? 1159 ARG O CD  1 
ATOM   8584  N NE  . ARG O  1 86  ? -22.834 22.966  10.841  1.00 45.97 ? 1159 ARG O NE  1 
ATOM   8585  C CZ  . ARG O  1 86  ? -22.994 22.850  12.152  1.00 44.00 ? 1159 ARG O CZ  1 
ATOM   8586  N NH1 . ARG O  1 86  ? -21.995 23.156  12.980  1.00 48.59 ? 1159 ARG O NH1 1 
ATOM   8587  N NH2 . ARG O  1 86  ? -24.166 22.451  12.632  1.00 41.53 ? 1159 ARG O NH2 1 
ATOM   8588  N N   . THR O  1 87  ? -28.604 22.889  10.699  1.00 36.42 ? 1160 THR O N   1 
ATOM   8589  C CA  . THR O  1 87  ? -29.168 23.408  11.930  1.00 36.38 ? 1160 THR O CA  1 
ATOM   8590  C C   . THR O  1 87  ? -29.584 22.313  12.908  1.00 35.05 ? 1160 THR O C   1 
ATOM   8591  O O   . THR O  1 87  ? -29.916 22.610  14.051  1.00 33.14 ? 1160 THR O O   1 
ATOM   8592  C CB  . THR O  1 87  ? -30.362 24.341  11.657  1.00 42.95 ? 1160 THR O CB  1 
ATOM   8593  O OG1 . THR O  1 87  ? -31.383 23.625  10.943  1.00 44.51 ? 1160 THR O OG1 1 
ATOM   8594  C CG2 . THR O  1 87  ? -29.894 25.566  10.844  1.00 45.47 ? 1160 THR O CG2 1 
ATOM   8595  N N   . LYS O  1 88  ? -29.575 21.050  12.466  1.00 35.65 ? 1161 LYS O N   1 
ATOM   8596  C CA  . LYS O  1 88  ? -29.997 19.938  13.347  1.00 32.02 ? 1161 LYS O CA  1 
ATOM   8597  C C   . LYS O  1 88  ? -28.821 19.067  13.768  1.00 32.35 ? 1161 LYS O C   1 
ATOM   8598  O O   . LYS O  1 88  ? -29.008 18.037  14.412  1.00 33.65 ? 1161 LYS O O   1 
ATOM   8599  C CB  . LYS O  1 88  ? -31.056 19.043  12.688  1.00 39.89 ? 1161 LYS O CB  1 
ATOM   8600  C CG  . LYS O  1 88  ? -32.364 19.752  12.291  1.00 38.81 ? 1161 LYS O CG  1 
ATOM   8601  C CD  . LYS O  1 88  ? -32.974 20.449  13.461  1.00 39.12 ? 1161 LYS O CD  1 
ATOM   8602  C CE  . LYS O  1 88  ? -34.392 20.931  13.131  1.00 49.86 ? 1161 LYS O CE  1 
ATOM   8603  N NZ  . LYS O  1 88  ? -35.061 21.453  14.359  1.00 55.36 ? 1161 LYS O NZ  1 
ATOM   8604  N N   . LEU O  1 89  ? -27.624 19.490  13.394  1.00 30.70 ? 1162 LEU O N   1 
ATOM   8605  C CA  . LEU O  1 89  ? -26.407 18.789  13.759  1.00 29.97 ? 1162 LEU O CA  1 
ATOM   8606  C C   . LEU O  1 89  ? -25.552 19.646  14.696  1.00 34.17 ? 1162 LEU O C   1 
ATOM   8607  O O   . LEU O  1 89  ? -25.460 20.870  14.534  1.00 33.60 ? 1162 LEU O O   1 
ATOM   8608  C CB  . LEU O  1 89  ? -25.618 18.484  12.513  1.00 31.92 ? 1162 LEU O CB  1 
ATOM   8609  C CG  . LEU O  1 89  ? -26.445 17.725  11.466  1.00 31.74 ? 1162 LEU O CG  1 
ATOM   8610  C CD1 . LEU O  1 89  ? -25.591 17.512  10.274  1.00 27.26 ? 1162 LEU O CD1 1 
ATOM   8611  C CD2 . LEU O  1 89  ? -26.973 16.403  12.046  1.00 30.80 ? 1162 LEU O CD2 1 
ATOM   8612  N N   . VAL O  1 90  ? -24.935 18.992  15.670  1.00 30.38 ? 1163 VAL O N   1 
ATOM   8613  C CA  . VAL O  1 90  ? -23.895 19.606  16.472  1.00 30.48 ? 1163 VAL O CA  1 
ATOM   8614  C C   . VAL O  1 90  ? -22.738 18.625  16.665  1.00 28.53 ? 1163 VAL O C   1 
ATOM   8615  O O   . VAL O  1 90  ? -22.937 17.476  17.030  1.00 27.87 ? 1163 VAL O O   1 
ATOM   8616  C CB  . VAL O  1 90  ? -24.501 20.118  17.819  1.00 34.93 ? 1163 VAL O CB  1 
ATOM   8617  C CG1 . VAL O  1 90  ? -25.448 19.100  18.375  1.00 39.53 ? 1163 VAL O CG1 1 
ATOM   8618  C CG2 . VAL O  1 90  ? -23.456 20.456  18.814  1.00 30.66 ? 1163 VAL O CG2 1 
ATOM   8619  N N   . PRO O  1 91  ? -21.508 19.092  16.457  1.00 28.20 ? 1164 PRO O N   1 
ATOM   8620  C CA  . PRO O  1 91  ? -20.359 18.226  16.731  1.00 26.84 ? 1164 PRO O CA  1 
ATOM   8621  C C   . PRO O  1 91  ? -20.418 17.479  18.071  1.00 29.13 ? 1164 PRO O C   1 
ATOM   8622  O O   . PRO O  1 91  ? -20.738 18.094  19.104  1.00 28.70 ? 1164 PRO O O   1 
ATOM   8623  C CB  . PRO O  1 91  ? -19.177 19.192  16.667  1.00 28.98 ? 1164 PRO O CB  1 
ATOM   8624  C CG  . PRO O  1 91  ? -19.656 20.285  15.713  1.00 33.57 ? 1164 PRO O CG  1 
ATOM   8625  C CD  . PRO O  1 91  ? -21.113 20.444  16.013  1.00 32.09 ? 1164 PRO O CD  1 
ATOM   8626  N N   . LEU O  1 92  ? -20.084 16.174  18.044  1.00 22.70 ? 1165 LEU O N   1 
ATOM   8627  C CA  . LEU O  1 92  ? -20.107 15.280  19.196  1.00 23.54 ? 1165 LEU O CA  1 
ATOM   8628  C C   . LEU O  1 92  ? -18.710 14.918  19.670  1.00 26.34 ? 1165 LEU O C   1 
ATOM   8629  O O   . LEU O  1 92  ? -17.834 14.635  18.855  1.00 25.16 ? 1165 LEU O O   1 
ATOM   8630  C CB  . LEU O  1 92  ? -20.817 13.972  18.826  1.00 22.36 ? 1165 LEU O CB  1 
ATOM   8631  C CG  . LEU O  1 92  ? -21.053 12.903  19.881  1.00 26.86 ? 1165 LEU O CG  1 
ATOM   8632  C CD1 . LEU O  1 92  ? -22.380 12.169  19.624  1.00 25.18 ? 1165 LEU O CD1 1 
ATOM   8633  C CD2 . LEU O  1 92  ? -19.871 11.874  19.962  1.00 20.55 ? 1165 LEU O CD2 1 
ATOM   8634  N N   . GLY O  1 93  ? -18.501 14.926  20.983  1.00 24.11 ? 1166 GLY O N   1 
ATOM   8635  C CA  . GLY O  1 93  ? -17.245 14.470  21.564  1.00 28.89 ? 1166 GLY O CA  1 
ATOM   8636  C C   . GLY O  1 93  ? -16.151 15.526  21.547  1.00 29.97 ? 1166 GLY O C   1 
ATOM   8637  O O   . GLY O  1 93  ? -14.972 15.203  21.692  1.00 38.11 ? 1166 GLY O O   1 
ATOM   8638  N N   . VAL O  1 94  ? -16.547 16.773  21.393  1.00 32.92 ? 1167 VAL O N   1 
ATOM   8639  C CA  . VAL O  1 94  ? -15.632 17.912  21.270  1.00 30.34 ? 1167 VAL O CA  1 
ATOM   8640  C C   . VAL O  1 94  ? -15.678 18.740  22.582  1.00 36.36 ? 1167 VAL O C   1 
ATOM   8641  O O   . VAL O  1 94  ? -14.669 19.287  23.046  1.00 33.34 ? 1167 VAL O O   1 
ATOM   8642  C CB  . VAL O  1 94  ? -16.066 18.789  20.095  1.00 34.31 ? 1167 VAL O CB  1 
ATOM   8643  C CG1 . VAL O  1 94  ? -15.245 20.078  20.041  1.00 41.76 ? 1167 VAL O CG1 1 
ATOM   8644  C CG2 . VAL O  1 94  ? -15.947 18.008  18.799  1.00 38.32 ? 1167 VAL O CG2 1 
ATOM   8645  N N   . ASN O  1 95  ? -16.859 18.773  23.183  1.00 32.22 ? 1168 ASN O N   1 
ATOM   8646  C CA  . ASN O  1 95  ? -17.167 19.642  24.322  1.00 32.83 ? 1168 ASN O CA  1 
ATOM   8647  C C   . ASN O  1 95  ? -17.947 18.745  25.291  1.00 30.11 ? 1168 ASN O C   1 
ATOM   8648  O O   . ASN O  1 95  ? -19.113 18.405  25.051  1.00 31.38 ? 1168 ASN O O   1 
ATOM   8649  C CB  . ASN O  1 95  ? -17.981 20.844  23.785  1.00 33.32 ? 1168 ASN O CB  1 
ATOM   8650  C CG  . ASN O  1 95  ? -18.506 21.807  24.868  1.00 37.42 ? 1168 ASN O CG  1 
ATOM   8651  O OD1 . ASN O  1 95  ? -18.845 22.965  24.554  1.00 42.70 ? 1168 ASN O OD1 1 
ATOM   8652  N ND2 . ASN O  1 95  ? -18.601 21.353  26.104  1.00 28.63 ? 1168 ASN O ND2 1 
ATOM   8653  N N   . GLN O  1 96  ? -17.291 18.312  26.357  1.00 28.58 ? 1169 GLN O N   1 
ATOM   8654  C CA  . GLN O  1 96  ? -17.891 17.331  27.261  1.00 32.29 ? 1169 GLN O CA  1 
ATOM   8655  C C   . GLN O  1 96  ? -19.197 17.818  27.889  1.00 28.78 ? 1169 GLN O C   1 
ATOM   8656  O O   . GLN O  1 96  ? -20.120 17.043  28.093  1.00 29.52 ? 1169 GLN O O   1 
ATOM   8657  C CB  . GLN O  1 96  ? -16.920 16.948  28.371  1.00 36.76 ? 1169 GLN O CB  1 
ATOM   8658  C CG  . GLN O  1 96  ? -15.643 16.325  27.861  1.00 50.08 ? 1169 GLN O CG  1 
ATOM   8659  C CD  . GLN O  1 96  ? -14.514 16.372  28.879  1.00 59.37 ? 1169 GLN O CD  1 
ATOM   8660  O OE1 . GLN O  1 96  ? -13.484 15.705  28.713  1.00 64.79 ? 1169 GLN O OE1 1 
ATOM   8661  N NE2 . GLN O  1 96  ? -14.697 17.170  29.932  1.00 52.22 ? 1169 GLN O NE2 1 
ATOM   8662  N N   . ASP O  1 97  ? -19.247 19.102  28.229  1.00 29.53 ? 1170 ASP O N   1 
ATOM   8663  C CA  . ASP O  1 97  ? -20.431 19.630  28.866  1.00 24.72 ? 1170 ASP O CA  1 
ATOM   8664  C C   . ASP O  1 97  ? -21.591 19.659  27.890  1.00 25.42 ? 1170 ASP O C   1 
ATOM   8665  O O   . ASP O  1 97  ? -22.764 19.430  28.242  1.00 25.85 ? 1170 ASP O O   1 
ATOM   8666  C CB  . ASP O  1 97  ? -20.102 20.995  29.469  1.00 28.21 ? 1170 ASP O CB  1 
ATOM   8667  C CG  . ASP O  1 97  ? -19.329 20.841  30.749  1.00 31.27 ? 1170 ASP O CG  1 
ATOM   8668  O OD1 . ASP O  1 97  ? -18.153 21.230  30.807  1.00 32.34 ? 1170 ASP O OD1 1 
ATOM   8669  O OD2 . ASP O  1 97  ? -19.894 20.235  31.686  1.00 33.22 ? 1170 ASP O OD2 1 
ATOM   8670  N N   . LEU O  1 98  ? -21.268 19.946  26.640  1.00 27.11 ? 1171 LEU O N   1 
ATOM   8671  C CA  . LEU O  1 98  ? -22.279 19.946  25.643  1.00 24.48 ? 1171 LEU O CA  1 
ATOM   8672  C C   . LEU O  1 98  ? -22.806 18.525  25.469  1.00 29.43 ? 1171 LEU O C   1 
ATOM   8673  O O   . LEU O  1 98  ? -24.029 18.321  25.390  1.00 25.86 ? 1171 LEU O O   1 
ATOM   8674  C CB  . LEU O  1 98  ? -21.741 20.504  24.331  1.00 29.02 ? 1171 LEU O CB  1 
ATOM   8675  C CG  . LEU O  1 98  ? -22.766 20.464  23.193  1.00 33.45 ? 1171 LEU O CG  1 
ATOM   8676  C CD1 . LEU O  1 98  ? -22.627 21.698  22.303  1.00 35.88 ? 1171 LEU O CD1 1 
ATOM   8677  C CD2 . LEU O  1 98  ? -22.644 19.170  22.363  1.00 31.90 ? 1171 LEU O CD2 1 
ATOM   8678  N N   . ASP O  1 99  ? -21.886 17.544  25.395  1.00 27.80 ? 1172 ASP O N   1 
ATOM   8679  C CA  . ASP O  1 99  ? -22.291 16.137  25.242  1.00 27.99 ? 1172 ASP O CA  1 
ATOM   8680  C C   . ASP O  1 99  ? -23.215 15.706  26.405  1.00 27.16 ? 1172 ASP O C   1 
ATOM   8681  O O   . ASP O  1 99  ? -24.277 15.118  26.188  1.00 28.43 ? 1172 ASP O O   1 
ATOM   8682  C CB  . ASP O  1 99  ? -21.070 15.206  25.191  1.00 25.45 ? 1172 ASP O CB  1 
ATOM   8683  C CG  . ASP O  1 99  ? -20.236 15.329  23.880  1.00 25.49 ? 1172 ASP O CG  1 
ATOM   8684  O OD1 . ASP O  1 99  ? -19.069 14.892  23.896  1.00 31.50 ? 1172 ASP O OD1 1 
ATOM   8685  O OD2 . ASP O  1 99  ? -20.718 15.852  22.863  1.00 25.62 ? 1172 ASP O OD2 1 
ATOM   8686  N N   . LYS O  1 100 ? -22.831 16.050  27.634  1.00 25.49 ? 1173 LYS O N   1 
ATOM   8687  C CA  . LYS O  1 100 ? -23.633 15.728  28.819  1.00 25.51 ? 1173 LYS O CA  1 
ATOM   8688  C C   . LYS O  1 100 ? -25.020 16.364  28.831  1.00 31.84 ? 1173 LYS O C   1 
ATOM   8689  O O   . LYS O  1 100 ? -26.005 15.716  29.202  1.00 31.87 ? 1173 LYS O O   1 
ATOM   8690  C CB  . LYS O  1 100 ? -22.859 16.070  30.084  1.00 25.09 ? 1173 LYS O CB  1 
ATOM   8691  C CG  . LYS O  1 100 ? -21.673 15.126  30.297  1.00 30.78 ? 1173 LYS O CG  1 
ATOM   8692  C CD  . LYS O  1 100 ? -20.838 15.521  31.488  1.00 37.96 ? 1173 LYS O CD  1 
ATOM   8693  C CE  . LYS O  1 100 ? -19.619 14.627  31.656  1.00 46.67 ? 1173 LYS O CE  1 
ATOM   8694  N NZ  . LYS O  1 100 ? -18.754 15.139  32.756  1.00 50.58 ? 1173 LYS O NZ  1 
ATOM   8695  N N   . GLU O  1 101 ? -25.106 17.627  28.410  1.00 28.06 ? 1174 GLU O N   1 
ATOM   8696  C CA  . GLU O  1 101 ? -26.420 18.243  28.190  1.00 29.64 ? 1174 GLU O CA  1 
ATOM   8697  C C   . GLU O  1 101 ? -27.255 17.449  27.194  1.00 31.87 ? 1174 GLU O C   1 
ATOM   8698  O O   . GLU O  1 101 ? -28.448 17.169  27.417  1.00 30.68 ? 1174 GLU O O   1 
ATOM   8699  C CB  . GLU O  1 101 ? -26.269 19.693  27.697  1.00 26.46 ? 1174 GLU O CB  1 
ATOM   8700  C CG  . GLU O  1 101 ? -27.613 20.322  27.243  1.00 30.51 ? 1174 GLU O CG  1 
ATOM   8701  C CD  . GLU O  1 101 ? -27.503 21.799  26.823  1.00 32.87 ? 1174 GLU O CD  1 
ATOM   8702  O OE1 . GLU O  1 101 ? -26.388 22.254  26.468  1.00 31.90 ? 1174 GLU O OE1 1 
ATOM   8703  O OE2 . GLU O  1 101 ? -28.546 22.501  26.859  1.00 34.48 ? 1174 GLU O OE2 1 
ATOM   8704  N N   . LYS O  1 102 ? -26.644 17.121  26.064  1.00 27.98 ? 1175 LYS O N   1 
ATOM   8705  C CA  . LYS O  1 102 ? -27.352 16.423  25.012  1.00 30.85 ? 1175 LYS O CA  1 
ATOM   8706  C C   . LYS O  1 102 ? -27.819 15.086  25.551  1.00 32.23 ? 1175 LYS O C   1 
ATOM   8707  O O   . LYS O  1 102 ? -28.914 14.650  25.245  1.00 31.24 ? 1175 LYS O O   1 
ATOM   8708  C CB  . LYS O  1 102 ? -26.479 16.204  23.784  1.00 29.57 ? 1175 LYS O CB  1 
ATOM   8709  C CG  . LYS O  1 102 ? -26.213 17.465  22.941  1.00 31.04 ? 1175 LYS O CG  1 
ATOM   8710  C CD  . LYS O  1 102 ? -27.416 17.824  22.081  1.00 33.52 ? 1175 LYS O CD  1 
ATOM   8711  C CE  . LYS O  1 102 ? -27.189 19.141  21.335  1.00 38.11 ? 1175 LYS O CE  1 
ATOM   8712  N NZ  . LYS O  1 102 ? -26.731 20.230  22.225  1.00 37.74 ? 1175 LYS O NZ  1 
ATOM   8713  N N   . MET O  1 103 ? -27.006 14.446  26.382  1.00 32.58 ? 1176 MET O N   1 
ATOM   8714  C CA  . MET O  1 103 ? -27.419 13.128  26.857  1.00 35.65 ? 1176 MET O CA  1 
ATOM   8715  C C   . MET O  1 103 ? -28.633 13.178  27.778  1.00 36.45 ? 1176 MET O C   1 
ATOM   8716  O O   . MET O  1 103 ? -29.300 12.172  27.976  1.00 36.96 ? 1176 MET O O   1 
ATOM   8717  C CB  . MET O  1 103 ? -26.260 12.373  27.486  1.00 35.18 ? 1176 MET O CB  1 
ATOM   8718  C CG  . MET O  1 103 ? -25.589 11.478  26.458  1.00 34.51 ? 1176 MET O CG  1 
ATOM   8719  S SD  . MET O  1 103 ? -24.198 10.671  27.188  1.00 44.70 ? 1176 MET O SD  1 
ATOM   8720  C CE  . MET O  1 103 ? -23.174 12.119  27.492  1.00 32.48 ? 1176 MET O CE  1 
ATOM   8721  N N   . LEU O  1 104 ? -28.934 14.355  28.315  1.00 34.60 ? 1177 LEU O N   1 
ATOM   8722  C CA  . LEU O  1 104 ? -30.002 14.456  29.303  1.00 37.33 ? 1177 LEU O CA  1 
ATOM   8723  C C   . LEU O  1 104 ? -31.309 14.851  28.656  1.00 37.04 ? 1177 LEU O C   1 
ATOM   8724  O O   . LEU O  1 104 ? -32.311 15.021  29.338  1.00 40.59 ? 1177 LEU O O   1 
ATOM   8725  C CB  . LEU O  1 104 ? -29.639 15.445  30.410  1.00 32.45 ? 1177 LEU O CB  1 
ATOM   8726  C CG  . LEU O  1 104 ? -28.520 14.997  31.343  1.00 34.29 ? 1177 LEU O CG  1 
ATOM   8727  C CD1 . LEU O  1 104 ? -28.016 16.136  32.221  1.00 32.53 ? 1177 LEU O CD1 1 
ATOM   8728  C CD2 . LEU O  1 104 ? -29.051 13.855  32.187  1.00 42.01 ? 1177 LEU O CD2 1 
ATOM   8729  N N   . GLU O  1 105 ? -31.291 14.980  27.338  1.00 37.01 ? 1178 GLU O N   1 
ATOM   8730  C CA  . GLU O  1 105 ? -32.427 15.502  26.576  1.00 38.28 ? 1178 GLU O CA  1 
ATOM   8731  C C   . GLU O  1 105 ? -33.677 14.594  26.627  1.00 42.19 ? 1178 GLU O C   1 
ATOM   8732  O O   . GLU O  1 105 ? -34.776 15.069  26.886  1.00 41.27 ? 1178 GLU O O   1 
ATOM   8733  C CB  . GLU O  1 105 ? -31.977 15.769  25.142  1.00 39.12 ? 1178 GLU O CB  1 
ATOM   8734  C CG  . GLU O  1 105 ? -32.923 16.543  24.254  1.00 43.00 ? 1178 GLU O CG  1 
ATOM   8735  C CD  . GLU O  1 105 ? -32.331 16.771  22.863  1.00 42.79 ? 1178 GLU O CD  1 
ATOM   8736  O OE1 . GLU O  1 105 ? -31.150 17.191  22.770  1.00 43.37 ? 1178 GLU O OE1 1 
ATOM   8737  O OE2 . GLU O  1 105 ? -33.040 16.540  21.857  1.00 42.62 ? 1178 GLU O OE2 1 
ATOM   8738  N N   . GLY O  1 106 ? -33.509 13.292  26.398  1.00 43.16 ? 1179 GLY O N   1 
ATOM   8739  C CA  . GLY O  1 106 ? -34.637 12.364  26.445  1.00 39.38 ? 1179 GLY O CA  1 
ATOM   8740  C C   . GLY O  1 106 ? -35.513 12.510  27.674  1.00 37.05 ? 1179 GLY O C   1 
ATOM   8741  O O   . GLY O  1 106 ? -35.018 12.647  28.790  1.00 37.22 ? 1179 GLY O O   1 
ATOM   8742  N N   . ARG O  1 107 ? -36.830 12.434  27.465  1.00 45.35 ? 1180 ARG O N   1 
ATOM   8743  C CA  . ARG O  1 107 ? -37.808 12.635  28.541  1.00 43.02 ? 1180 ARG O CA  1 
ATOM   8744  C C   . ARG O  1 107 ? -37.900 11.447  29.486  1.00 46.87 ? 1180 ARG O C   1 
ATOM   8745  O O   . ARG O  1 107 ? -38.124 11.618  30.693  1.00 47.70 ? 1180 ARG O O   1 
ATOM   8746  C CB  . ARG O  1 107 ? -39.199 12.930  27.972  1.00 47.56 ? 1180 ARG O CB  1 
ATOM   8747  C CG  . ARG O  1 107 ? -39.601 11.991  26.857  1.00 55.78 ? 1180 ARG O CG  1 
ATOM   8748  C CD  . ARG O  1 107 ? -41.062 11.558  26.977  1.00 60.69 ? 1180 ARG O CD  1 
ATOM   8749  N NE  . ARG O  1 107 ? -41.324 10.383  26.144  1.00 64.86 ? 1180 ARG O NE  1 
ATOM   8750  C CZ  . ARG O  1 107 ? -41.604 10.435  24.845  1.00 59.28 ? 1180 ARG O CZ  1 
ATOM   8751  N NH1 . ARG O  1 107 ? -41.820 9.314   24.166  1.00 59.99 ? 1180 ARG O NH1 1 
ATOM   8752  N NH2 . ARG O  1 107 ? -41.672 11.609  24.229  1.00 58.91 ? 1180 ARG O NH2 1 
ATOM   8753  N N   . LYS O  1 108 ? -37.728 10.249  28.930  1.00 47.98 ? 1181 LYS O N   1 
ATOM   8754  C CA  . LYS O  1 108 ? -37.794 9.018   29.716  1.00 47.34 ? 1181 LYS O CA  1 
ATOM   8755  C C   . LYS O  1 108 ? -36.427 8.323   29.864  1.00 44.16 ? 1181 LYS O C   1 
ATOM   8756  O O   . LYS O  1 108 ? -35.561 8.429   28.995  1.00 41.57 ? 1181 LYS O O   1 
ATOM   8757  C CB  . LYS O  1 108 ? -38.856 8.067   29.151  1.00 48.49 ? 1181 LYS O CB  1 
ATOM   8758  C CG  . LYS O  1 108 ? -40.227 8.753   28.966  1.00 54.00 ? 1181 LYS O CG  1 
ATOM   8759  C CD  . LYS O  1 108 ? -41.411 7.796   29.099  1.00 60.90 ? 1181 LYS O CD  1 
ATOM   8760  C CE  . LYS O  1 108 ? -42.733 8.569   29.331  1.00 67.23 ? 1181 LYS O CE  1 
ATOM   8761  N NZ  . LYS O  1 108 ? -43.940 7.702   29.580  1.00 65.73 ? 1181 LYS O NZ  1 
ATOM   8762  N N   . SER O  1 109 ? -36.252 7.663   31.004  1.00 41.44 ? 1182 SER O N   1 
ATOM   8763  C CA  . SER O  1 109 ? -35.074 6.859   31.296  1.00 46.72 ? 1182 SER O CA  1 
ATOM   8764  C C   . SER O  1 109 ? -34.653 5.950   30.141  1.00 46.77 ? 1182 SER O C   1 
ATOM   8765  O O   . SER O  1 109 ? -33.485 5.969   29.745  1.00 45.32 ? 1182 SER O O   1 
ATOM   8766  C CB  . SER O  1 109 ? -35.322 6.029   32.555  1.00 51.74 ? 1182 SER O CB  1 
ATOM   8767  O OG  . SER O  1 109 ? -34.317 5.048   32.723  1.00 58.73 ? 1182 SER O OG  1 
ATOM   8768  N N   . ASN O  1 110 ? -35.579 5.161   29.594  1.00 41.12 ? 1183 ASN O N   1 
ATOM   8769  C CA  . ASN O  1 110 ? -35.216 4.230   28.544  1.00 40.79 ? 1183 ASN O CA  1 
ATOM   8770  C C   . ASN O  1 110 ? -34.669 4.929   27.322  1.00 40.70 ? 1183 ASN O C   1 
ATOM   8771  O O   . ASN O  1 110 ? -33.768 4.425   26.657  1.00 33.05 ? 1183 ASN O O   1 
ATOM   8772  C CB  . ASN O  1 110 ? -36.412 3.374   28.137  1.00 49.27 ? 1183 ASN O CB  1 
ATOM   8773  C CG  . ASN O  1 110 ? -37.662 4.200   27.927  1.00 49.66 ? 1183 ASN O CG  1 
ATOM   8774  O OD1 . ASN O  1 110 ? -38.149 4.864   28.854  1.00 51.19 ? 1183 ASN O OD1 1 
ATOM   8775  N ND2 . ASN O  1 110 ? -38.193 4.166   26.707  1.00 53.18 ? 1183 ASN O ND2 1 
ATOM   8776  N N   . ILE O  1 111 ? -35.229 6.094   27.009  1.00 39.89 ? 1184 ILE O N   1 
ATOM   8777  C CA  . ILE O  1 111 ? -34.773 6.834   25.850  1.00 35.81 ? 1184 ILE O CA  1 
ATOM   8778  C C   . ILE O  1 111 ? -33.360 7.347   26.082  1.00 30.94 ? 1184 ILE O C   1 
ATOM   8779  O O   . ILE O  1 111 ? -32.541 7.361   25.171  1.00 32.52 ? 1184 ILE O O   1 
ATOM   8780  C CB  . ILE O  1 111 ? -35.659 8.047   25.586  1.00 39.47 ? 1184 ILE O CB  1 
ATOM   8781  C CG1 . ILE O  1 111 ? -37.126 7.618   25.441  1.00 48.96 ? 1184 ILE O CG1 1 
ATOM   8782  C CG2 . ILE O  1 111 ? -35.164 8.780   24.357  1.00 34.91 ? 1184 ILE O CG2 1 
ATOM   8783  C CD1 . ILE O  1 111 ? -38.044 8.744   24.945  1.00 50.24 ? 1184 ILE O CD1 1 
ATOM   8784  N N   . ARG O  1 112 ? -33.109 7.786   27.301  1.00 33.65 ? 1185 ARG O N   1 
ATOM   8785  C CA  . ARG O  1 112 ? -31.836 8.393   27.673  1.00 34.19 ? 1185 ARG O CA  1 
ATOM   8786  C C   . ARG O  1 112 ? -30.762 7.323   27.658  1.00 34.90 ? 1185 ARG O C   1 
ATOM   8787  O O   . ARG O  1 112 ? -29.627 7.567   27.215  1.00 29.39 ? 1185 ARG O O   1 
ATOM   8788  C CB  . ARG O  1 112 ? -31.946 9.053   29.042  1.00 33.46 ? 1185 ARG O CB  1 
ATOM   8789  C CG  . ARG O  1 112 ? -32.745 10.375  28.982  1.00 37.93 ? 1185 ARG O CG  1 
ATOM   8790  C CD  . ARG O  1 112 ? -32.498 11.232  30.184  1.00 37.00 ? 1185 ARG O CD  1 
ATOM   8791  N NE  . ARG O  1 112 ? -32.781 10.541  31.438  1.00 42.34 ? 1185 ARG O NE  1 
ATOM   8792  C CZ  . ARG O  1 112 ? -33.967 10.505  32.057  1.00 45.40 ? 1185 ARG O CZ  1 
ATOM   8793  N NH1 . ARG O  1 112 ? -35.030 11.135  31.545  1.00 37.60 ? 1185 ARG O NH1 1 
ATOM   8794  N NH2 . ARG O  1 112 ? -34.080 9.836   33.208  1.00 47.82 ? 1185 ARG O NH2 1 
ATOM   8795  N N   . LYS O  1 113 ? -31.136 6.125   28.103  1.00 37.06 ? 1186 LYS O N   1 
ATOM   8796  C CA  . LYS O  1 113 ? -30.175 5.012   28.123  1.00 33.83 ? 1186 LYS O CA  1 
ATOM   8797  C C   . LYS O  1 113 ? -29.753 4.664   26.721  1.00 28.97 ? 1186 LYS O C   1 
ATOM   8798  O O   . LYS O  1 113 ? -28.565 4.434   26.458  1.00 34.33 ? 1186 LYS O O   1 
ATOM   8799  C CB  . LYS O  1 113 ? -30.719 3.768   28.841  1.00 35.82 ? 1186 LYS O CB  1 
ATOM   8800  C CG  . LYS O  1 113 ? -29.607 2.827   29.287  1.00 35.08 ? 1186 LYS O CG  1 
ATOM   8801  C CD  . LYS O  1 113 ? -30.094 1.497   29.838  1.00 32.54 ? 1186 LYS O CD  1 
ATOM   8802  C CE  . LYS O  1 113 ? -30.674 0.654   28.719  1.00 35.96 ? 1186 LYS O CE  1 
ATOM   8803  N NZ  . LYS O  1 113 ? -30.699 -0.786  29.051  1.00 38.29 ? 1186 LYS O NZ  1 
ATOM   8804  N N   . SER O  1 114 ? -30.710 4.609   25.802  1.00 29.57 ? 1187 SER O N   1 
ATOM   8805  C CA  . SER O  1 114 ? -30.397 4.270   24.436  1.00 34.25 ? 1187 SER O CA  1 
ATOM   8806  C C   . SER O  1 114 ? -29.456 5.321   23.851  1.00 30.71 ? 1187 SER O C   1 
ATOM   8807  O O   . SER O  1 114 ? -28.550 5.005   23.057  1.00 27.66 ? 1187 SER O O   1 
ATOM   8808  C CB  . SER O  1 114 ? -31.659 4.141   23.599  1.00 34.72 ? 1187 SER O CB  1 
ATOM   8809  O OG  . SER O  1 114 ? -31.324 4.115   22.217  1.00 36.35 ? 1187 SER O OG  1 
ATOM   8810  N N   . VAL O  1 115 ? -29.698 6.578   24.228  1.00 29.28 ? 1188 VAL O N   1 
ATOM   8811  C CA  . VAL O  1 115 ? -28.863 7.656   23.729  1.00 28.01 ? 1188 VAL O CA  1 
ATOM   8812  C C   . VAL O  1 115 ? -27.442 7.538   24.253  1.00 26.28 ? 1188 VAL O C   1 
ATOM   8813  O O   . VAL O  1 115 ? -26.482 7.744   23.489  1.00 25.53 ? 1188 VAL O O   1 
ATOM   8814  C CB  . VAL O  1 115 ? -29.448 9.049   24.061  1.00 27.43 ? 1188 VAL O CB  1 
ATOM   8815  C CG1 . VAL O  1 115 ? -28.345 10.140  24.056  1.00 28.78 ? 1188 VAL O CG1 1 
ATOM   8816  C CG2 . VAL O  1 115 ? -30.545 9.395   23.015  1.00 26.37 ? 1188 VAL O CG2 1 
ATOM   8817  N N   . GLN O  1 116 ? -27.330 7.203   25.525  1.00 25.53 ? 1189 GLN O N   1 
ATOM   8818  C CA  . GLN O  1 116 ? -26.025 7.057   26.179  1.00 29.46 ? 1189 GLN O CA  1 
ATOM   8819  C C   . GLN O  1 116 ? -25.275 5.892   25.561  1.00 25.57 ? 1189 GLN O C   1 
ATOM   8820  O O   . GLN O  1 116 ? -24.059 5.955   25.390  1.00 26.08 ? 1189 GLN O O   1 
ATOM   8821  C CB  . GLN O  1 116 ? -26.167 6.780   27.670  1.00 30.19 ? 1189 GLN O CB  1 
ATOM   8822  C CG  . GLN O  1 116 ? -26.658 7.928   28.498  1.00 40.73 ? 1189 GLN O CG  1 
ATOM   8823  C CD  . GLN O  1 116 ? -26.865 7.490   29.929  1.00 43.29 ? 1189 GLN O CD  1 
ATOM   8824  O OE1 . GLN O  1 116 ? -25.937 7.005   30.585  1.00 49.04 ? 1189 GLN O OE1 1 
ATOM   8825  N NE2 . GLN O  1 116 ? -28.089 7.636   30.417  1.00 48.98 ? 1189 GLN O NE2 1 
ATOM   8826  N N   . ILE O  1 117 ? -25.986 4.827   25.244  1.00 25.04 ? 1190 ILE O N   1 
ATOM   8827  C CA  . ILE O  1 117 ? -25.317 3.661   24.657  1.00 25.42 ? 1190 ILE O CA  1 
ATOM   8828  C C   . ILE O  1 117 ? -24.752 4.090   23.316  1.00 24.45 ? 1190 ILE O C   1 
ATOM   8829  O O   . ILE O  1 117 ? -23.585 3.815   23.002  1.00 25.96 ? 1190 ILE O O   1 
ATOM   8830  C CB  . ILE O  1 117 ? -26.266 2.441   24.545  1.00 26.09 ? 1190 ILE O CB  1 
ATOM   8831  C CG1 . ILE O  1 117 ? -26.429 1.780   25.905  1.00 28.91 ? 1190 ILE O CG1 1 
ATOM   8832  C CG2 . ILE O  1 117 ? -25.774 1.431   23.500  1.00 24.42 ? 1190 ILE O CG2 1 
ATOM   8833  C CD1 . ILE O  1 117 ? -27.590 0.755   25.921  1.00 29.35 ? 1190 ILE O CD1 1 
ATOM   8834  N N   . ALA O  1 118 ? -25.551 4.846   22.539  1.00 21.83 ? 1191 ALA O N   1 
ATOM   8835  C CA  . ALA O  1 118 ? -25.130 5.255   21.217  1.00 23.38 ? 1191 ALA O CA  1 
ATOM   8836  C C   . ALA O  1 118 ? -23.924 6.154   21.322  1.00 20.64 ? 1191 ALA O C   1 
ATOM   8837  O O   . ALA O  1 118 ? -23.059 6.123   20.448  1.00 22.28 ? 1191 ALA O O   1 
ATOM   8838  C CB  . ALA O  1 118 ? -26.276 5.998   20.473  1.00 25.56 ? 1191 ALA O CB  1 
ATOM   8839  N N   . TYR O  1 119 ? -23.886 6.942   22.406  1.00 24.62 ? 1192 TYR O N   1 
ATOM   8840  C CA  . TYR O  1 119 ? -22.825 7.920   22.623  1.00 22.33 ? 1192 TYR O CA  1 
ATOM   8841  C C   . TYR O  1 119 ? -21.527 7.172   22.841  1.00 21.68 ? 1192 TYR O C   1 
ATOM   8842  O O   . TYR O  1 119 ? -20.495 7.486   22.237  1.00 21.29 ? 1192 TYR O O   1 
ATOM   8843  C CB  . TYR O  1 119 ? -23.128 8.788   23.842  1.00 23.81 ? 1192 TYR O CB  1 
ATOM   8844  C CG  . TYR O  1 119 ? -22.011 9.758   24.181  1.00 22.19 ? 1192 TYR O CG  1 
ATOM   8845  C CD1 . TYR O  1 119 ? -21.835 10.950  23.464  1.00 25.43 ? 1192 TYR O CD1 1 
ATOM   8846  C CD2 . TYR O  1 119 ? -21.173 9.511   25.255  1.00 26.74 ? 1192 TYR O CD2 1 
ATOM   8847  C CE1 . TYR O  1 119 ? -20.788 11.836  23.774  1.00 25.52 ? 1192 TYR O CE1 1 
ATOM   8848  C CE2 . TYR O  1 119 ? -20.151 10.406  25.590  1.00 28.48 ? 1192 TYR O CE2 1 
ATOM   8849  C CZ  . TYR O  1 119 ? -19.969 11.548  24.853  1.00 26.83 ? 1192 TYR O CZ  1 
ATOM   8850  O OH  . TYR O  1 119 ? -18.957 12.427  25.201  1.00 28.98 ? 1192 TYR O OH  1 
ATOM   8851  N N   . HIS O  1 120 ? -21.568 6.191   23.715  1.00 25.47 ? 1193 HIS O N   1 
ATOM   8852  C CA  . HIS O  1 120 ? -20.356 5.397   23.907  1.00 24.59 ? 1193 HIS O CA  1 
ATOM   8853  C C   . HIS O  1 120 ? -19.924 4.598   22.692  1.00 26.66 ? 1193 HIS O C   1 
ATOM   8854  O O   . HIS O  1 120 ? -18.719 4.419   22.477  1.00 27.17 ? 1193 HIS O O   1 
ATOM   8855  C CB  . HIS O  1 120 ? -20.503 4.547   25.157  1.00 23.59 ? 1193 HIS O CB  1 
ATOM   8856  C CG  . HIS O  1 120 ? -20.559 5.388   26.398  1.00 27.08 ? 1193 HIS O CG  1 
ATOM   8857  N ND1 . HIS O  1 120 ? -21.642 5.424   27.243  1.00 29.95 ? 1193 HIS O ND1 1 
ATOM   8858  C CD2 . HIS O  1 120 ? -19.662 6.256   26.899  1.00 24.13 ? 1193 HIS O CD2 1 
ATOM   8859  C CE1 . HIS O  1 120 ? -21.388 6.243   28.246  1.00 27.24 ? 1193 HIS O CE1 1 
ATOM   8860  N NE2 . HIS O  1 120 ? -20.199 6.780   28.051  1.00 29.96 ? 1193 HIS O NE2 1 
ATOM   8861  N N   . ARG O  1 121 ? -20.885 4.102   21.919  1.00 22.51 ? 1194 ARG O N   1 
ATOM   8862  C CA  . ARG O  1 121 ? -20.582 3.506   20.614  1.00 23.72 ? 1194 ARG O CA  1 
ATOM   8863  C C   . ARG O  1 121 ? -19.902 4.481   19.663  1.00 25.56 ? 1194 ARG O C   1 
ATOM   8864  O O   . ARG O  1 121 ? -18.978 4.084   18.959  1.00 26.42 ? 1194 ARG O O   1 
ATOM   8865  C CB  . ARG O  1 121 ? -21.839 2.956   19.973  1.00 26.65 ? 1194 ARG O CB  1 
ATOM   8866  C CG  . ARG O  1 121 ? -22.439 1.760   20.697  1.00 22.79 ? 1194 ARG O CG  1 
ATOM   8867  C CD  . ARG O  1 121 ? -23.765 1.501   20.042  1.00 31.50 ? 1194 ARG O CD  1 
ATOM   8868  N NE  . ARG O  1 121 ? -24.473 0.329   20.536  1.00 36.43 ? 1194 ARG O NE  1 
ATOM   8869  C CZ  . ARG O  1 121 ? -25.777 0.121   20.326  1.00 38.68 ? 1194 ARG O CZ  1 
ATOM   8870  N NH1 . ARG O  1 121 ? -26.363 -0.970  20.818  1.00 38.53 ? 1194 ARG O NH1 1 
ATOM   8871  N NH2 . ARG O  1 121 ? -26.508 1.038   19.669  1.00 34.26 ? 1194 ARG O NH2 1 
ATOM   8872  N N   . ALA O  1 122 ? -20.353 5.754   19.636  1.00 22.22 ? 1195 ALA O N   1 
ATOM   8873  C CA  . ALA O  1 122 ? -19.703 6.753   18.824  1.00 22.36 ? 1195 ALA O CA  1 
ATOM   8874  C C   . ALA O  1 122 ? -18.266 6.944   19.287  1.00 23.93 ? 1195 ALA O C   1 
ATOM   8875  O O   . ALA O  1 122 ? -17.335 7.081   18.485  1.00 27.90 ? 1195 ALA O O   1 
ATOM   8876  C CB  . ALA O  1 122 ? -20.487 8.073   18.908  1.00 23.43 ? 1195 ALA O CB  1 
ATOM   8877  N N   . LEU O  1 123 ? -18.059 6.941   20.588  1.00 26.57 ? 1196 LEU O N   1 
ATOM   8878  C CA  . LEU O  1 123 ? -16.692 7.177   21.040  1.00 29.86 ? 1196 LEU O CA  1 
ATOM   8879  C C   . LEU O  1 123 ? -15.809 5.940   20.823  1.00 32.51 ? 1196 LEU O C   1 
ATOM   8880  O O   . LEU O  1 123 ? -14.595 6.068   20.671  1.00 33.88 ? 1196 LEU O O   1 
ATOM   8881  C CB  . LEU O  1 123 ? -16.666 7.645   22.490  1.00 27.19 ? 1196 LEU O CB  1 
ATOM   8882  C CG  . LEU O  1 123 ? -17.318 8.998   22.787  1.00 27.17 ? 1196 LEU O CG  1 
ATOM   8883  C CD1 . LEU O  1 123 ? -16.727 9.542   24.079  1.00 33.14 ? 1196 LEU O CD1 1 
ATOM   8884  C CD2 . LEU O  1 123 ? -17.159 10.004  21.642  1.00 31.73 ? 1196 LEU O CD2 1 
ATOM   8885  N N   . GLN O  1 124 ? -16.410 4.749   20.797  1.00 30.54 ? 1197 GLN O N   1 
ATOM   8886  C CA  . GLN O  1 124 ? -15.642 3.549   20.404  1.00 27.58 ? 1197 GLN O CA  1 
ATOM   8887  C C   . GLN O  1 124 ? -15.264 3.601   18.936  1.00 34.29 ? 1197 GLN O C   1 
ATOM   8888  O O   . GLN O  1 124 ? -14.181 3.180   18.561  1.00 33.44 ? 1197 GLN O O   1 
ATOM   8889  C CB  . GLN O  1 124 ? -16.381 2.261   20.700  1.00 28.24 ? 1197 GLN O CB  1 
ATOM   8890  C CG  . GLN O  1 124 ? -16.548 2.002   22.166  1.00 27.30 ? 1197 GLN O CG  1 
ATOM   8891  C CD  . GLN O  1 124 ? -17.519 0.905   22.398  1.00 30.72 ? 1197 GLN O CD  1 
ATOM   8892  O OE1 . GLN O  1 124 ? -18.668 1.139   22.791  1.00 30.52 ? 1197 GLN O OE1 1 
ATOM   8893  N NE2 . GLN O  1 124 ? -17.086 -0.325  22.138  1.00 26.19 ? 1197 GLN O NE2 1 
ATOM   8894  N N   . HIS O  1 125 ? -16.136 4.156   18.104  1.00 32.01 ? 1198 HIS O N   1 
ATOM   8895  C CA  . HIS O  1 125 ? -15.801 4.297   16.683  1.00 31.59 ? 1198 HIS O CA  1 
ATOM   8896  C C   . HIS O  1 125 ? -14.616 5.234   16.548  1.00 36.59 ? 1198 HIS O C   1 
ATOM   8897  O O   . HIS O  1 125 ? -13.747 5.023   15.702  1.00 40.15 ? 1198 HIS O O   1 
ATOM   8898  C CB  . HIS O  1 125 ? -16.956 4.886   15.881  1.00 28.42 ? 1198 HIS O CB  1 
ATOM   8899  C CG  . HIS O  1 125 ? -16.582 5.291   14.478  1.00 32.84 ? 1198 HIS O CG  1 
ATOM   8900  N ND1 . HIS O  1 125 ? -16.645 4.420   13.413  1.00 36.89 ? 1198 HIS O ND1 1 
ATOM   8901  C CD2 . HIS O  1 125 ? -16.151 6.474   13.974  1.00 32.71 ? 1198 HIS O CD2 1 
ATOM   8902  C CE1 . HIS O  1 125 ? -16.265 5.047   12.312  1.00 38.04 ? 1198 HIS O CE1 1 
ATOM   8903  N NE2 . HIS O  1 125 ? -15.959 6.292   12.627  1.00 34.65 ? 1198 HIS O NE2 1 
ATOM   8904  N N   . ARG O  1 126 ? -14.595 6.276   17.369  1.00 37.99 ? 1199 ARG O N   1 
ATOM   8905  C CA  . ARG O  1 126 ? -13.502 7.245   17.342  1.00 40.98 ? 1199 ARG O CA  1 
ATOM   8906  C C   . ARG O  1 126 ? -12.176 6.605   17.777  1.00 44.06 ? 1199 ARG O C   1 
ATOM   8907  O O   . ARG O  1 126 ? -11.157 6.674   17.074  1.00 41.58 ? 1199 ARG O O   1 
ATOM   8908  C CB  . ARG O  1 126 ? -13.820 8.404   18.266  1.00 43.09 ? 1199 ARG O CB  1 
ATOM   8909  C CG  . ARG O  1 126 ? -12.865 9.553   18.143  1.00 43.92 ? 1199 ARG O CG  1 
ATOM   8910  C CD  . ARG O  1 126 ? -13.422 10.751  18.873  1.00 38.58 ? 1199 ARG O CD  1 
ATOM   8911  N NE  . ARG O  1 126 ? -13.358 10.543  20.308  1.00 38.26 ? 1199 ARG O NE  1 
ATOM   8912  C CZ  . ARG O  1 126 ? -13.588 11.485  21.211  1.00 40.97 ? 1199 ARG O CZ  1 
ATOM   8913  N NH1 . ARG O  1 126 ? -13.487 11.188  22.499  1.00 39.03 ? 1199 ARG O NH1 1 
ATOM   8914  N NH2 . ARG O  1 126 ? -13.915 12.718  20.823  1.00 37.44 ? 1199 ARG O NH2 1 
ATOM   8915  N N   . SER O  1 127 ? -12.198 5.982   18.946  1.00 39.76 ? 1200 SER O N   1 
ATOM   8916  C CA  . SER O  1 127 ? -10.990 5.356   19.451  1.00 44.70 ? 1200 SER O CA  1 
ATOM   8917  C C   . SER O  1 127 ? -10.503 4.229   18.514  1.00 42.78 ? 1200 SER O C   1 
ATOM   8918  O O   . SER O  1 127 ? -9.293  3.986   18.415  1.00 46.68 ? 1200 SER O O   1 
ATOM   8919  C CB  . SER O  1 127 ? -11.199 4.869   20.881  1.00 40.31 ? 1200 SER O CB  1 
ATOM   8920  O OG  . SER O  1 127 ? -11.674 3.532   20.876  1.00 48.08 ? 1200 SER O OG  1 
ATOM   8921  N N   . LYS O  1 128 ? -11.423 3.552   17.822  1.00 39.60 ? 1201 LYS O N   1 
ATOM   8922  C CA  . LYS O  1 128 ? -11.028 2.569   16.815  1.00 43.50 ? 1201 LYS O CA  1 
ATOM   8923  C C   . LYS O  1 128 ? -10.381 3.284   15.644  1.00 49.32 ? 1201 LYS O C   1 
ATOM   8924  O O   . LYS O  1 128 ? -9.745  2.656   14.800  1.00 54.96 ? 1201 LYS O O   1 
ATOM   8925  C CB  . LYS O  1 128 ? -12.215 1.752   16.290  1.00 41.03 ? 1201 LYS O CB  1 
ATOM   8926  C CG  . LYS O  1 128 ? -12.789 0.729   17.264  1.00 43.74 ? 1201 LYS O CG  1 
ATOM   8927  C CD  . LYS O  1 128 ? -13.507 -0.402  16.531  1.00 48.62 ? 1201 LYS O CD  1 
ATOM   8928  C CE  . LYS O  1 128 ? -13.458 -1.692  17.365  1.00 57.54 ? 1201 LYS O CE  1 
ATOM   8929  N NZ  . LYS O  1 128 ? -13.982 -2.896  16.648  1.00 66.49 ? 1201 LYS O NZ  1 
ATOM   8930  N N   . VAL O  1 129 ? -10.554 4.600   15.595  1.00 43.52 ? 1202 VAL O N   1 
ATOM   8931  C CA  . VAL O  1 129 ? -10.016 5.416   14.512  1.00 48.44 ? 1202 VAL O CA  1 
ATOM   8932  C C   . VAL O  1 129 ? -8.686  6.048   14.907  1.00 50.38 ? 1202 VAL O C   1 
ATOM   8933  O O   . VAL O  1 129 ? -7.907  5.463   15.658  1.00 52.96 ? 1202 VAL O O   1 
ATOM   8934  C CB  . VAL O  1 129 ? -11.016 6.532   14.097  1.00 46.91 ? 1202 VAL O CB  1 
ATOM   8935  C CG1 . VAL O  1 129 ? -10.289 7.678   13.404  1.00 48.41 ? 1202 VAL O CG1 1 
ATOM   8936  C CG2 . VAL O  1 129 ? -12.105 5.968   13.212  1.00 42.37 ? 1202 VAL O CG2 1 
ATOM   8937  N N   . ALA P  2 4   ? -14.166 -4.546  1.789   1.00 52.03 ? 25   ALA P N   1 
ATOM   8938  C CA  . ALA P  2 4   ? -14.416 -3.105  1.695   1.00 49.54 ? 25   ALA P CA  1 
ATOM   8939  C C   . ALA P  2 4   ? -15.894 -2.809  1.954   1.00 47.75 ? 25   ALA P C   1 
ATOM   8940  O O   . ALA P  2 4   ? -16.303 -2.552  3.088   1.00 44.05 ? 25   ALA P O   1 
ATOM   8941  C CB  . ALA P  2 4   ? -14.001 -2.584  0.325   1.00 53.45 ? 25   ALA P CB  1 
ATOM   8942  N N   . ARG P  2 5   ? -16.707 -2.860  0.904   1.00 43.32 ? 26   ARG P N   1 
ATOM   8943  C CA  . ARG P  2 5   ? -18.146 -2.708  1.100   1.00 46.52 ? 26   ARG P CA  1 
ATOM   8944  C C   . ARG P  2 5   ? -18.728 -3.883  1.898   1.00 46.64 ? 26   ARG P C   1 
ATOM   8945  O O   . ARG P  2 5   ? -19.538 -3.712  2.814   1.00 44.36 ? 26   ARG P O   1 
ATOM   8946  C CB  . ARG P  2 5   ? -18.872 -2.563  -0.244  1.00 44.92 ? 26   ARG P CB  1 
ATOM   8947  C CG  . ARG P  2 5   ? -20.390 -2.559  -0.107  1.00 42.16 ? 26   ARG P CG  1 
ATOM   8948  C CD  . ARG P  2 5   ? -21.064 -2.068  -1.383  1.00 39.67 ? 26   ARG P CD  1 
ATOM   8949  N NE  . ARG P  2 5   ? -22.518 -2.070  -1.246  1.00 39.04 ? 26   ARG P NE  1 
ATOM   8950  C CZ  . ARG P  2 5   ? -23.340 -1.440  -2.077  1.00 38.80 ? 26   ARG P CZ  1 
ATOM   8951  N NH1 . ARG P  2 5   ? -24.660 -1.495  -1.888  1.00 39.38 ? 26   ARG P NH1 1 
ATOM   8952  N NH2 . ARG P  2 5   ? -22.836 -0.760  -3.099  1.00 33.87 ? 26   ARG P NH2 1 
ATOM   8953  N N   . LYS P  2 6   ? -18.317 -5.089  1.531   1.00 48.28 ? 27   LYS P N   1 
ATOM   8954  C CA  . LYS P  2 6   ? -18.783 -6.279  2.225   1.00 45.38 ? 27   LYS P CA  1 
ATOM   8955  C C   . LYS P  2 6   ? -18.418 -6.275  3.727   1.00 44.23 ? 27   LYS P C   1 
ATOM   8956  O O   . LYS P  2 6   ? -19.198 -6.722  4.553   1.00 43.15 ? 27   LYS P O   1 
ATOM   8957  C CB  . LYS P  2 6   ? -18.273 -7.550  1.510   1.00 47.16 ? 27   LYS P CB  1 
ATOM   8958  C CG  . LYS P  2 6   ? -18.823 -8.867  2.071   1.00 48.30 ? 27   LYS P CG  1 
ATOM   8959  C CD  . LYS P  2 6   ? -17.975 -9.370  3.253   1.00 52.60 ? 27   LYS P CD  1 
ATOM   8960  C CE  . LYS P  2 6   ? -18.495 -10.697 3.833   1.00 57.38 ? 27   LYS P CE  1 
ATOM   8961  N NZ  . LYS P  2 6   ? -18.533 -11.848 2.850   1.00 57.66 ? 27   LYS P NZ  1 
ATOM   8962  N N   . SER P  2 7   ? -17.246 -5.758  4.076   1.00 43.18 ? 28   SER P N   1 
ATOM   8963  C CA  . SER P  2 7   ? -16.773 -5.836  5.458   1.00 43.29 ? 28   SER P CA  1 
ATOM   8964  C C   . SER P  2 7   ? -17.563 -4.947  6.421   1.00 44.39 ? 28   SER P C   1 
ATOM   8965  O O   . SER P  2 7   ? -17.644 -5.226  7.613   1.00 40.08 ? 28   SER P O   1 
ATOM   8966  C CB  . SER P  2 7   ? -15.285 -5.490  5.533   1.00 46.38 ? 28   SER P CB  1 
ATOM   8967  O OG  . SER P  2 7   ? -14.872 -5.277  6.876   1.00 50.11 ? 28   SER P OG  1 
ATOM   8968  N N   . ALA P  2 8   ? -18.140 -3.879  5.882   1.00 39.87 ? 29   ALA P N   1 
ATOM   8969  C CA  . ALA P  2 8   ? -18.890 -2.912  6.657   1.00 40.15 ? 29   ALA P CA  1 
ATOM   8970  C C   . ALA P  2 8   ? -20.110 -3.538  7.311   1.00 41.02 ? 29   ALA P C   1 
ATOM   8971  O O   . ALA P  2 8   ? -20.753 -4.399  6.722   1.00 41.74 ? 29   ALA P O   1 
ATOM   8972  C CB  . ALA P  2 8   ? -19.307 -1.752  5.743   1.00 36.06 ? 29   ALA P CB  1 
ATOM   8973  N N   . PRO P  2 9   ? -20.435 -3.090  8.535   1.00 37.46 ? 30   PRO P N   1 
ATOM   8974  C CA  . PRO P  2 9   ? -21.622 -3.518  9.277   1.00 39.66 ? 30   PRO P CA  1 
ATOM   8975  C C   . PRO P  2 9   ? -22.880 -3.250  8.472   1.00 40.30 ? 30   PRO P C   1 
ATOM   8976  O O   . PRO P  2 9   ? -22.973 -2.190  7.847   1.00 39.41 ? 30   PRO P O   1 
ATOM   8977  C CB  . PRO P  2 9   ? -21.617 -2.604  10.502  1.00 41.20 ? 30   PRO P CB  1 
ATOM   8978  C CG  . PRO P  2 9   ? -20.259 -2.044  10.576  1.00 41.16 ? 30   PRO P CG  1 
ATOM   8979  C CD  . PRO P  2 9   ? -19.718 -1.996  9.214   1.00 40.90 ? 30   PRO P CD  1 
ATOM   8980  N N   . ALA P  2 10  ? -23.816 -4.192  8.484   1.00 39.64 ? 31   ALA P N   1 
ATOM   8981  C CA  . ALA P  2 10  ? -25.111 -4.007  7.839   1.00 41.90 ? 31   ALA P CA  1 
ATOM   8982  C C   . ALA P  2 10  ? -25.817 -2.779  8.426   1.00 43.15 ? 31   ALA P C   1 
ATOM   8983  O O   . ALA P  2 10  ? -25.635 -2.434  9.616   1.00 44.72 ? 31   ALA P O   1 
ATOM   8984  C CB  . ALA P  2 10  ? -25.989 -5.249  8.026   1.00 48.66 ? 31   ALA P CB  1 
ATOM   8985  N N   . THR P  2 11  ? -26.623 -2.118  7.603   1.00 37.11 ? 32   THR P N   1 
ATOM   8986  C CA  . THR P  2 11  ? -27.377 -0.974  8.089   1.00 39.96 ? 32   THR P CA  1 
ATOM   8987  C C   . THR P  2 11  ? -28.863 -1.179  7.867   1.00 41.80 ? 32   THR P C   1 
ATOM   8988  O O   . THR P  2 11  ? -29.284 -2.050  7.086   1.00 40.01 ? 32   THR P O   1 
ATOM   8989  C CB  . THR P  2 11  ? -26.927 0.342   7.431   1.00 38.10 ? 32   THR P CB  1 
ATOM   8990  O OG1 . THR P  2 11  ? -27.109 0.259   6.010   1.00 38.93 ? 32   THR P OG1 1 
ATOM   8991  C CG2 . THR P  2 11  ? -25.444 0.620   7.735   1.00 34.77 ? 32   THR P CG2 1 
ATOM   8992  N N   . GLY P  2 12  ? -29.647 -0.384  8.579   1.00 39.12 ? 33   GLY P N   1 
ATOM   8993  C CA  . GLY P  2 12  ? -31.080 -0.533  8.599   1.00 43.09 ? 33   GLY P CA  1 
ATOM   8994  C C   . GLY P  2 12  ? -31.659 0.352   7.521   1.00 42.12 ? 33   GLY P C   1 
ATOM   8995  O O   . GLY P  2 12  ? -31.024 0.676   6.497   1.00 33.54 ? 33   GLY P O   1 
ATOM   8996  N N   . GLY P  2 13  ? -32.888 0.762   7.751   1.00 42.38 ? 34   GLY P N   1 
ATOM   8997  C CA  . GLY P  2 13  ? -33.533 1.576   6.754   1.00 46.06 ? 34   GLY P CA  1 
ATOM   8998  C C   . GLY P  2 13  ? -33.199 3.027   6.976   1.00 43.68 ? 34   GLY P C   1 
ATOM   8999  O O   . GLY P  2 13  ? -32.227 3.377   7.654   1.00 40.16 ? 34   GLY P O   1 
ATOM   9000  N N   . VAL P  2 14  ? -34.009 3.881   6.378   1.00 45.45 ? 35   VAL P N   1 
ATOM   9001  C CA  . VAL P  2 14  ? -34.033 5.270   6.764   1.00 43.02 ? 35   VAL P CA  1 
ATOM   9002  C C   . VAL P  2 14  ? -34.829 5.266   8.052   1.00 45.22 ? 35   VAL P C   1 
ATOM   9003  O O   . VAL P  2 14  ? -35.752 4.472   8.181   1.00 51.41 ? 35   VAL P O   1 
ATOM   9004  C CB  . VAL P  2 14  ? -34.771 6.078   5.710   1.00 43.57 ? 35   VAL P CB  1 
ATOM   9005  C CG1 . VAL P  2 14  ? -34.613 7.559   5.977   1.00 46.41 ? 35   VAL P CG1 1 
ATOM   9006  C CG2 . VAL P  2 14  ? -34.254 5.698   4.322   1.00 45.19 ? 35   VAL P CG2 1 
HETATM 9007  N N   . M3L P  2 15  ? -34.480 6.126   9.009   1.00 41.39 ? 36   M3L P N   1 
HETATM 9008  C CA  . M3L P  2 15  ? -35.143 6.151   10.310  1.00 40.99 ? 36   M3L P CA  1 
HETATM 9009  C CB  . M3L P  2 15  ? -34.405 6.956   11.390  1.00 40.56 ? 36   M3L P CB  1 
HETATM 9010  C CG  . M3L P  2 15  ? -34.864 6.900   12.847  1.00 44.34 ? 36   M3L P CG  1 
HETATM 9011  C CD  . M3L P  2 15  ? -33.822 7.203   13.930  1.00 37.79 ? 36   M3L P CD  1 
HETATM 9012  C CE  . M3L P  2 15  ? -34.252 7.162   15.390  1.00 43.88 ? 36   M3L P CE  1 
HETATM 9013  N NZ  . M3L P  2 15  ? -33.268 7.544   16.391  1.00 45.83 ? 36   M3L P NZ  1 
HETATM 9014  C C   . M3L P  2 15  ? -36.636 6.479   10.226  1.00 53.09 ? 36   M3L P C   1 
HETATM 9015  O O   . M3L P  2 15  ? -37.010 7.295   9.453   1.00 52.22 ? 36   M3L P O   1 
HETATM 9016  C CM1 . M3L P  2 15  ? -33.123 8.996   16.389  1.00 38.55 ? 36   M3L P CM1 1 
HETATM 9017  C CM2 . M3L P  2 15  ? -31.975 6.929   16.096  1.00 37.40 ? 36   M3L P CM2 1 
HETATM 9018  C CM3 . M3L P  2 15  ? -33.706 7.063   17.687  1.00 44.18 ? 36   M3L P CM3 1 
ATOM   9019  N N   . LYS P  2 16  ? -37.454 5.822   11.048  1.00 54.51 ? 37   LYS P N   1 
ATOM   9020  C CA  . LYS P  2 16  ? -38.907 5.945   10.922  1.00 61.25 ? 37   LYS P CA  1 
ATOM   9021  C C   . LYS P  2 16  ? -39.610 6.091   12.265  1.00 59.24 ? 37   LYS P C   1 
ATOM   9022  O O   . LYS P  2 16  ? -39.427 7.099   12.952  1.00 61.72 ? 37   LYS P O   1 
ATOM   9023  C CB  . LYS P  2 16  ? -39.478 4.762   10.125  1.00 61.97 ? 37   LYS P CB  1 
ATOM   9024  C CG  . LYS P  2 16  ? -39.191 4.844   8.616   1.00 58.78 ? 37   LYS P CG  1 
ATOM   9025  C CD  . LYS P  2 16  ? -39.307 3.488   7.941   1.00 62.46 ? 37   LYS P CD  1 
ATOM   9026  C CE  . LYS P  2 16  ? -40.760 3.054   7.768   1.00 64.74 ? 37   LYS P CE  1 
ATOM   9027  N NZ  . LYS P  2 16  ? -40.862 1.658   7.211   1.00 58.47 ? 37   LYS P NZ  1 
HETATM 9028  S S   . SO4 Q  3 .   ? -24.429 0.144   -6.456  1.00 34.07 ? 2206 SO4 A S   1 
HETATM 9029  O O1  . SO4 Q  3 .   ? -23.862 1.439   -6.781  1.00 36.90 ? 2206 SO4 A O1  1 
HETATM 9030  O O2  . SO4 Q  3 .   ? -23.340 -0.859  -6.592  1.00 35.28 ? 2206 SO4 A O2  1 
HETATM 9031  O O3  . SO4 Q  3 .   ? -25.078 0.169   -5.165  1.00 29.98 ? 2206 SO4 A O3  1 
HETATM 9032  O O4  . SO4 Q  3 .   ? -25.518 -0.136  -7.391  1.00 37.71 ? 2206 SO4 A O4  1 
HETATM 9033  S S   . SO4 R  3 .   ? -6.975  -20.108 -11.504 0.51 31.95 ? 2207 SO4 A S   1 
HETATM 9034  O O1  . SO4 R  3 .   ? -8.132  -20.364 -10.657 0.81 28.80 ? 2207 SO4 A O1  1 
HETATM 9035  O O2  . SO4 R  3 .   ? -5.969  -21.097 -11.118 0.79 31.70 ? 2207 SO4 A O2  1 
HETATM 9036  O O3  . SO4 R  3 .   ? -7.292  -20.276 -12.923 0.68 29.28 ? 2207 SO4 A O3  1 
HETATM 9037  O O4  . SO4 R  3 .   ? -6.580  -18.725 -11.313 0.49 31.90 ? 2207 SO4 A O4  1 
HETATM 9038  S S   . SO4 S  3 .   ? -11.054 -16.079 -28.652 0.68 33.53 ? 2208 SO4 A S   1 
HETATM 9039  O O1  . SO4 S  3 .   ? -12.026 -15.038 -28.934 0.43 32.42 ? 2208 SO4 A O1  1 
HETATM 9040  O O2  . SO4 S  3 .   ? -11.340 -17.343 -29.299 0.68 33.25 ? 2208 SO4 A O2  1 
HETATM 9041  O O3  . SO4 S  3 .   ? -9.739  -15.621 -29.167 0.66 35.80 ? 2208 SO4 A O3  1 
HETATM 9042  O O4  . SO4 S  3 .   ? -11.012 -16.305 -27.222 0.44 29.06 ? 2208 SO4 A O4  1 
HETATM 9043  S S   . SO4 T  3 .   ? -25.477 -10.299 42.302  0.53 33.75 ? 2205 SO4 C S   1 
HETATM 9044  O O1  . SO4 T  3 .   ? -25.729 -10.425 40.861  0.67 35.47 ? 2205 SO4 C O1  1 
HETATM 9045  O O2  . SO4 T  3 .   ? -24.062 -10.037 42.550  0.79 30.45 ? 2205 SO4 C O2  1 
HETATM 9046  O O3  . SO4 T  3 .   ? -26.257 -9.198  42.866  0.61 36.10 ? 2205 SO4 C O3  1 
HETATM 9047  O O4  . SO4 T  3 .   ? -25.840 -11.551 42.949  0.71 38.42 ? 2205 SO4 C O4  1 
HETATM 9048  S S   . SO4 U  3 .   ? -34.830 -10.508 34.946  0.82 47.97 ? 1041 SO4 D S   1 
HETATM 9049  O O1  . SO4 U  3 .   ? -34.424 -11.707 35.667  0.78 46.50 ? 1041 SO4 D O1  1 
HETATM 9050  O O2  . SO4 U  3 .   ? -35.929 -9.829  35.630  0.78 44.94 ? 1041 SO4 D O2  1 
HETATM 9051  O O3  . SO4 U  3 .   ? -33.734 -9.572  34.843  0.71 51.86 ? 1041 SO4 D O3  1 
HETATM 9052  O O4  . SO4 U  3 .   ? -35.203 -10.872 33.584  0.53 48.34 ? 1041 SO4 D O4  1 
HETATM 9053  S S   . SO4 V  3 .   ? -2.577  -46.820 28.277  1.00 30.37 ? 2206 SO4 E S   1 
HETATM 9054  O O1  . SO4 V  3 .   ? -2.108  -46.621 26.907  0.82 36.93 ? 2206 SO4 E O1  1 
HETATM 9055  O O2  . SO4 V  3 .   ? -1.495  -46.388 29.157  0.73 37.10 ? 2206 SO4 E O2  1 
HETATM 9056  O O3  . SO4 V  3 .   ? -3.825  -46.148 28.598  0.83 34.55 ? 2206 SO4 E O3  1 
HETATM 9057  O O4  . SO4 V  3 .   ? -2.824  -48.255 28.509  0.85 31.44 ? 2206 SO4 E O4  1 
HETATM 9058  S S   . SO4 W  3 .   ? -29.592 11.556  55.792  0.57 36.12 ? 2204 SO4 G S   1 
HETATM 9059  O O1  . SO4 W  3 .   ? -30.638 11.709  54.781  0.79 38.01 ? 2204 SO4 G O1  1 
HETATM 9060  O O2  . SO4 W  3 .   ? -29.036 10.199  55.717  0.79 33.12 ? 2204 SO4 G O2  1 
HETATM 9061  O O3  . SO4 W  3 .   ? -28.547 12.527  55.552  0.96 28.69 ? 2204 SO4 G O3  1 
HETATM 9062  O O4  . SO4 W  3 .   ? -30.187 11.828  57.081  0.70 34.56 ? 2204 SO4 G O4  1 
HETATM 9063  O O   . HOH X  4 .   ? -7.248  -35.837 -17.478 1.00 43.79 ? 2001 HOH A O   1 
HETATM 9064  O O   . HOH X  4 .   ? -32.197 -33.280 0.208   1.00 32.21 ? 2002 HOH A O   1 
HETATM 9065  O O   . HOH X  4 .   ? -23.135 -19.648 -31.242 1.00 43.16 ? 2003 HOH A O   1 
HETATM 9066  O O   . HOH X  4 .   ? -32.946 -20.819 -16.492 1.00 36.52 ? 2004 HOH A O   1 
HETATM 9067  O O   . HOH X  4 .   ? -32.246 -17.316 -14.446 1.00 33.12 ? 2005 HOH A O   1 
HETATM 9068  O O   . HOH X  4 .   ? -32.088 -15.235 -17.992 1.00 32.09 ? 2006 HOH A O   1 
HETATM 9069  O O   . HOH X  4 .   ? -26.754 -21.678 -11.112 1.00 28.32 ? 2007 HOH A O   1 
HETATM 9070  O O   . HOH X  4 .   ? -31.196 -22.651 -18.207 1.00 39.62 ? 2008 HOH A O   1 
HETATM 9071  O O   . HOH X  4 .   ? -28.480 -24.911 -17.248 1.00 45.63 ? 2009 HOH A O   1 
HETATM 9072  O O   . HOH X  4 .   ? -27.172 -23.101 -21.024 1.00 29.21 ? 2010 HOH A O   1 
HETATM 9073  O O   . HOH X  4 .   ? -30.521 -20.706 -15.595 1.00 26.76 ? 2011 HOH A O   1 
HETATM 9074  O O   . HOH X  4 .   ? -26.549 -24.773 -16.025 1.00 21.44 ? 2012 HOH A O   1 
HETATM 9075  O O   . HOH X  4 .   ? -25.839 -24.391 -18.950 1.00 22.87 ? 2013 HOH A O   1 
HETATM 9076  O O   . HOH X  4 .   ? -29.514 -34.058 -0.100  1.00 44.40 ? 2014 HOH A O   1 
HETATM 9077  O O   . HOH X  4 .   ? -16.603 -22.073 -24.946 1.00 25.48 ? 2015 HOH A O   1 
HETATM 9078  O O   . HOH X  4 .   ? -6.820  -18.098 -28.296 1.00 40.46 ? 2016 HOH A O   1 
HETATM 9079  O O   . HOH X  4 .   ? -5.086  -13.758 -22.953 1.00 35.65 ? 2017 HOH A O   1 
HETATM 9080  O O   . HOH X  4 .   ? -5.748  -5.597  -28.167 1.00 45.61 ? 2018 HOH A O   1 
HETATM 9081  O O   . HOH X  4 .   ? -3.831  -7.525  -28.025 1.00 36.78 ? 2019 HOH A O   1 
HETATM 9082  O O   . HOH X  4 .   ? -12.000 -12.401 -25.378 1.00 27.81 ? 2020 HOH A O   1 
HETATM 9083  O O   . HOH X  4 .   ? -11.350 -10.908 -27.570 1.00 33.10 ? 2021 HOH A O   1 
HETATM 9084  O O   . HOH X  4 .   ? -5.878  -20.518 -25.341 1.00 40.35 ? 2022 HOH A O   1 
HETATM 9085  O O   . HOH X  4 .   ? -11.488 -18.563 -21.331 1.00 19.38 ? 2023 HOH A O   1 
HETATM 9086  O O   . HOH X  4 .   ? -10.164 -25.739 -21.275 1.00 16.07 ? 2024 HOH A O   1 
HETATM 9087  O O   . HOH X  4 .   ? -31.711 -11.057 -12.146 1.00 39.11 ? 2025 HOH A O   1 
HETATM 9088  O O   . HOH X  4 .   ? -27.723 -12.968 -11.909 1.00 22.28 ? 2026 HOH A O   1 
HETATM 9089  O O   . HOH X  4 .   ? -33.406 -9.058  -16.026 1.00 27.04 ? 2027 HOH A O   1 
HETATM 9090  O O   . HOH X  4 .   ? -26.989 -5.413  -11.383 1.00 29.20 ? 2028 HOH A O   1 
HETATM 9091  O O   . HOH X  4 .   ? -34.132 -7.604  -11.937 1.00 48.40 ? 2029 HOH A O   1 
HETATM 9092  O O   . HOH X  4 .   ? -30.196 -3.722  -11.150 1.00 36.08 ? 2030 HOH A O   1 
HETATM 9093  O O   . HOH X  4 .   ? -31.741 -3.039  -7.993  1.00 35.88 ? 2031 HOH A O   1 
HETATM 9094  O O   . HOH X  4 .   ? -28.078 -6.263  0.658   1.00 46.07 ? 2032 HOH A O   1 
HETATM 9095  O O   . HOH X  4 .   ? -30.987 -1.348  -4.206  1.00 40.11 ? 2033 HOH A O   1 
HETATM 9096  O O   . HOH X  4 .   ? -33.352 -9.483  -4.459  1.00 40.71 ? 2034 HOH A O   1 
HETATM 9097  O O   . HOH X  4 .   ? -32.929 -13.156 -3.023  1.00 37.09 ? 2035 HOH A O   1 
HETATM 9098  O O   . HOH X  4 .   ? -34.645 -18.773 -5.620  1.00 35.14 ? 2036 HOH A O   1 
HETATM 9099  O O   . HOH X  4 .   ? -35.948 -22.608 -2.828  1.00 37.32 ? 2037 HOH A O   1 
HETATM 9100  O O   . HOH X  4 .   ? -34.295 -22.666 -11.394 1.00 38.76 ? 2038 HOH A O   1 
HETATM 9101  O O   . HOH X  4 .   ? -33.731 -18.195 -2.474  1.00 27.92 ? 2039 HOH A O   1 
HETATM 9102  O O   . HOH X  4 .   ? -22.406 -18.077 -4.543  1.00 29.18 ? 2040 HOH A O   1 
HETATM 9103  O O   . HOH X  4 .   ? -26.259 -11.387 -3.837  1.00 23.39 ? 2041 HOH A O   1 
HETATM 9104  O O   . HOH X  4 .   ? -20.432 -5.668  -6.470  1.00 33.85 ? 2042 HOH A O   1 
HETATM 9105  O O   . HOH X  4 .   ? -17.244 -0.672  -9.772  1.00 36.02 ? 2043 HOH A O   1 
HETATM 9106  O O   . HOH X  4 .   ? -23.888 -3.564  -18.873 1.00 32.80 ? 2044 HOH A O   1 
HETATM 9107  O O   . HOH X  4 .   ? -24.507 -0.720  -25.097 1.00 37.05 ? 2045 HOH A O   1 
HETATM 9108  O O   . HOH X  4 .   ? -17.454 1.523   -27.059 1.00 43.93 ? 2046 HOH A O   1 
HETATM 9109  O O   . HOH X  4 .   ? -16.408 -5.573  -27.561 1.00 28.53 ? 2047 HOH A O   1 
HETATM 9110  O O   . HOH X  4 .   ? -24.816 -6.683  -24.573 1.00 23.04 ? 2048 HOH A O   1 
HETATM 9111  O O   . HOH X  4 .   ? -23.619 2.270   -24.810 1.00 44.32 ? 2049 HOH A O   1 
HETATM 9112  O O   . HOH X  4 .   ? -15.678 1.352   -24.952 1.00 48.97 ? 2050 HOH A O   1 
HETATM 9113  O O   . HOH X  4 .   ? -25.319 -8.403  -33.772 1.00 26.06 ? 2051 HOH A O   1 
HETATM 9114  O O   . HOH X  4 .   ? -18.109 -1.374  -34.772 1.00 46.76 ? 2052 HOH A O   1 
HETATM 9115  O O   . HOH X  4 .   ? -17.569 -9.541  -29.730 1.00 37.54 ? 2053 HOH A O   1 
HETATM 9116  O O   . HOH X  4 .   ? -28.458 -7.762  -22.162 1.00 29.26 ? 2054 HOH A O   1 
HETATM 9117  O O   . HOH X  4 .   ? -24.254 -12.846 -28.780 1.00 23.81 ? 2055 HOH A O   1 
HETATM 9118  O O   . HOH X  4 .   ? -25.791 -7.595  -21.970 1.00 28.61 ? 2056 HOH A O   1 
HETATM 9119  O O   . HOH X  4 .   ? -27.658 -14.247 -27.461 1.00 33.33 ? 2057 HOH A O   1 
HETATM 9120  O O   . HOH X  4 .   ? -18.610 -18.398 -11.109 1.00 17.22 ? 2058 HOH A O   1 
HETATM 9121  O O   . HOH X  4 .   ? -14.286 -20.764 -7.579  1.00 29.84 ? 2059 HOH A O   1 
HETATM 9122  O O   . HOH X  4 .   ? -13.079 -19.322 -6.014  1.00 30.24 ? 2060 HOH A O   1 
HETATM 9123  O O   . HOH X  4 .   ? -8.020  -15.833 -13.455 1.00 33.20 ? 2061 HOH A O   1 
HETATM 9124  O O   . HOH X  4 .   ? -6.605  -23.815 -6.756  1.00 30.58 ? 2062 HOH A O   1 
HETATM 9125  O O   . HOH X  4 .   ? -4.859  -17.566 -8.311  1.00 46.27 ? 2063 HOH A O   1 
HETATM 9126  O O   . HOH X  4 .   ? -11.727 -15.089 -4.232  1.00 40.12 ? 2064 HOH A O   1 
HETATM 9127  O O   . HOH X  4 .   ? -11.276 -12.063 -5.714  1.00 32.06 ? 2065 HOH A O   1 
HETATM 9128  O O   . HOH X  4 .   ? -15.104 -17.934 -4.577  1.00 26.92 ? 2066 HOH A O   1 
HETATM 9129  O O   . HOH X  4 .   ? -20.826 -19.132 -6.460  1.00 30.30 ? 2067 HOH A O   1 
HETATM 9130  O O   . HOH X  4 .   ? -16.720 -21.377 -6.223  1.00 30.75 ? 2068 HOH A O   1 
HETATM 9131  O O   . HOH X  4 .   ? -26.232 -0.428  -11.908 1.00 34.74 ? 2069 HOH A O   1 
HETATM 9132  O O   . HOH X  4 .   ? -13.583 -10.355 -24.118 1.00 34.07 ? 2070 HOH A O   1 
HETATM 9133  O O   . HOH X  4 .   ? -15.938 -10.165 -25.732 1.00 24.15 ? 2071 HOH A O   1 
HETATM 9134  O O   . HOH X  4 .   ? -23.697 -23.871 -27.392 1.00 28.58 ? 2072 HOH A O   1 
HETATM 9135  O O   . HOH X  4 .   ? -22.707 -14.169 -30.779 1.00 37.84 ? 2073 HOH A O   1 
HETATM 9136  O O   . HOH X  4 .   ? -19.524 -13.612 -32.265 1.00 39.50 ? 2074 HOH A O   1 
HETATM 9137  O O   . HOH X  4 .   ? -16.929 -21.321 -27.840 1.00 36.63 ? 2075 HOH A O   1 
HETATM 9138  O O   . HOH X  4 .   ? -21.037 -21.585 -28.705 1.00 31.18 ? 2076 HOH A O   1 
HETATM 9139  O O   . HOH X  4 .   ? -23.324 -28.199 -24.214 1.00 31.92 ? 2077 HOH A O   1 
HETATM 9140  O O   . HOH X  4 .   ? -27.592 -33.506 -18.873 1.00 39.85 ? 2078 HOH A O   1 
HETATM 9141  O O   . HOH X  4 .   ? -23.904 -34.610 -18.216 1.00 32.58 ? 2079 HOH A O   1 
HETATM 9142  O O   . HOH X  4 .   ? -17.220 -34.919 -16.558 1.00 39.15 ? 2080 HOH A O   1 
HETATM 9143  O O   . HOH X  4 .   ? -19.242 -39.681 -19.889 1.00 46.64 ? 2081 HOH A O   1 
HETATM 9144  O O   . HOH X  4 .   ? -23.607 -36.603 -20.963 1.00 33.71 ? 2082 HOH A O   1 
HETATM 9145  O O   . HOH X  4 .   ? -17.705 -40.692 -21.925 1.00 38.70 ? 2083 HOH A O   1 
HETATM 9146  O O   . HOH X  4 .   ? -21.865 -29.771 -21.161 1.00 16.32 ? 2084 HOH A O   1 
HETATM 9147  O O   . HOH X  4 .   ? -21.714 -33.333 -17.673 1.00 26.69 ? 2085 HOH A O   1 
HETATM 9148  O O   . HOH X  4 .   ? -11.270 -34.975 -19.959 1.00 24.97 ? 2086 HOH A O   1 
HETATM 9149  O O   . HOH X  4 .   ? -32.315 -15.104 -12.677 1.00 34.05 ? 2087 HOH A O   1 
HETATM 9150  O O   . HOH X  4 .   ? -14.557 -30.477 -31.735 1.00 38.99 ? 2088 HOH A O   1 
HETATM 9151  O O   . HOH X  4 .   ? -10.076 -29.770 -26.604 1.00 30.18 ? 2089 HOH A O   1 
HETATM 9152  O O   . HOH X  4 .   ? -16.787 -32.022 -30.989 1.00 36.78 ? 2090 HOH A O   1 
HETATM 9153  O O   . HOH X  4 .   ? -11.096 -29.917 -29.134 1.00 27.55 ? 2091 HOH A O   1 
HETATM 9154  O O   . HOH X  4 .   ? -26.867 -24.314 -11.335 1.00 31.09 ? 2092 HOH A O   1 
HETATM 9155  O O   . HOH X  4 .   ? -18.450 -26.834 -28.211 1.00 36.17 ? 2093 HOH A O   1 
HETATM 9156  O O   . HOH X  4 .   ? -15.785 -23.899 -25.847 1.00 36.36 ? 2094 HOH A O   1 
HETATM 9157  O O   . HOH X  4 .   ? -7.670  -31.818 -17.957 1.00 30.42 ? 2095 HOH A O   1 
HETATM 9158  O O   . HOH X  4 .   ? -12.037 -27.886 -26.677 1.00 32.36 ? 2096 HOH A O   1 
HETATM 9159  O O   . HOH X  4 .   ? -7.759  -22.989 -26.474 1.00 33.52 ? 2097 HOH A O   1 
HETATM 9160  O O   . HOH X  4 .   ? -5.627  -23.937 -25.617 1.00 41.79 ? 2098 HOH A O   1 
HETATM 9161  O O   . HOH X  4 .   ? -11.839 -23.089 -28.151 1.00 42.53 ? 2099 HOH A O   1 
HETATM 9162  O O   . HOH X  4 .   ? -8.072  -27.223 -20.365 1.00 16.27 ? 2100 HOH A O   1 
HETATM 9163  O O   . HOH X  4 .   ? 2.098   -18.590 -22.811 1.00 46.76 ? 2101 HOH A O   1 
HETATM 9164  O O   . HOH X  4 .   ? -4.186  -23.088 -23.266 1.00 31.28 ? 2102 HOH A O   1 
HETATM 9165  O O   . HOH X  4 .   ? -30.345 -13.496 -12.007 1.00 29.90 ? 2103 HOH A O   1 
HETATM 9166  O O   . HOH X  4 .   ? -28.911 -1.692  -12.395 1.00 42.76 ? 2104 HOH A O   1 
HETATM 9167  O O   . HOH X  4 .   ? -3.509  -31.482 -15.857 1.00 36.95 ? 2105 HOH A O   1 
HETATM 9168  O O   . HOH X  4 .   ? 2.658   -29.259 -19.773 1.00 39.98 ? 2106 HOH A O   1 
HETATM 9169  O O   . HOH X  4 .   ? -1.893  -33.233 -17.694 1.00 43.87 ? 2107 HOH A O   1 
HETATM 9170  O O   . HOH X  4 .   ? 2.398   -26.636 -16.357 1.00 42.00 ? 2108 HOH A O   1 
HETATM 9171  O O   . HOH X  4 .   ? -2.658  -25.369 -11.916 1.00 28.48 ? 2109 HOH A O   1 
HETATM 9172  O O   . HOH X  4 .   ? -32.379 -10.532 -0.904  1.00 44.98 ? 2110 HOH A O   1 
HETATM 9173  O O   . HOH X  4 .   ? -6.047  -22.435 -16.832 1.00 38.75 ? 2111 HOH A O   1 
HETATM 9174  O O   . HOH X  4 .   ? -5.070  -32.959 -18.154 1.00 31.56 ? 2112 HOH A O   1 
HETATM 9175  O O   . HOH X  4 .   ? 0.684   -30.573 -22.227 1.00 39.76 ? 2113 HOH A O   1 
HETATM 9176  O O   . HOH X  4 .   ? 1.849   -32.387 -20.499 1.00 47.96 ? 2114 HOH A O   1 
HETATM 9177  O O   . HOH X  4 .   ? -0.082  -28.444 -10.537 1.00 28.51 ? 2115 HOH A O   1 
HETATM 9178  O O   . HOH X  4 .   ? -1.961  -25.589 -7.846  1.00 40.72 ? 2116 HOH A O   1 
HETATM 9179  O O   . HOH X  4 .   ? -9.121  -23.154 -10.822 1.00 22.94 ? 2117 HOH A O   1 
HETATM 9180  O O   . HOH X  4 .   ? -24.964 -4.899  -21.076 1.00 38.11 ? 2118 HOH A O   1 
HETATM 9181  O O   . HOH X  4 .   ? -14.970 -5.850  -30.184 1.00 44.40 ? 2119 HOH A O   1 
HETATM 9182  O O   . HOH X  4 .   ? -16.498 -8.500  -27.680 1.00 34.72 ? 2120 HOH A O   1 
HETATM 9183  O O   . HOH X  4 .   ? -26.888 -5.971  -25.924 1.00 30.25 ? 2121 HOH A O   1 
HETATM 9184  O O   . HOH X  4 .   ? -10.832 -34.542 -11.919 1.00 32.91 ? 2122 HOH A O   1 
HETATM 9185  O O   . HOH X  4 .   ? -11.081 -20.444 -4.493  1.00 37.48 ? 2123 HOH A O   1 
HETATM 9186  O O   . HOH X  4 .   ? -18.186 -23.774 -5.890  1.00 23.06 ? 2124 HOH A O   1 
HETATM 9187  O O   . HOH X  4 .   ? -5.676  -26.267 -5.798  1.00 25.59 ? 2125 HOH A O   1 
HETATM 9188  O O   . HOH X  4 .   ? -16.032 -18.964 -2.304  1.00 41.15 ? 2126 HOH A O   1 
HETATM 9189  O O   . HOH X  4 .   ? -25.127 0.833   -13.977 1.00 41.00 ? 2127 HOH A O   1 
HETATM 9190  O O   . HOH X  4 .   ? -11.837 -8.081  -23.713 1.00 42.70 ? 2128 HOH A O   1 
HETATM 9191  O O   . HOH X  4 .   ? -15.328 -12.310 -27.476 1.00 29.05 ? 2129 HOH A O   1 
HETATM 9192  O O   . HOH X  4 .   ? -21.797 -28.602 -3.335  1.00 29.39 ? 2130 HOH A O   1 
HETATM 9193  O O   . HOH X  4 .   ? -18.920 -28.096 -2.058  1.00 36.76 ? 2131 HOH A O   1 
HETATM 9194  O O   . HOH X  4 .   ? -14.299 -21.294 -28.757 1.00 46.98 ? 2132 HOH A O   1 
HETATM 9195  O O   . HOH X  4 .   ? -21.607 -21.417 -4.823  1.00 37.14 ? 2133 HOH A O   1 
HETATM 9196  O O   . HOH X  4 .   ? -26.191 -28.116 -24.743 1.00 39.91 ? 2134 HOH A O   1 
HETATM 9197  O O   . HOH X  4 .   ? -22.702 -33.330 -15.067 1.00 32.88 ? 2135 HOH A O   1 
HETATM 9198  O O   . HOH X  4 .   ? -23.778 -30.803 -9.709  1.00 22.27 ? 2136 HOH A O   1 
HETATM 9199  O O   . HOH X  4 .   ? -23.828 -29.835 -2.462  1.00 32.96 ? 2137 HOH A O   1 
HETATM 9200  O O   . HOH X  4 .   ? -20.259 -23.835 -4.386  1.00 28.04 ? 2138 HOH A O   1 
HETATM 9201  O O   . HOH X  4 .   ? -30.195 -24.910 -2.202  1.00 24.76 ? 2139 HOH A O   1 
HETATM 9202  O O   . HOH X  4 .   ? -9.252  -34.410 -18.001 1.00 32.51 ? 2140 HOH A O   1 
HETATM 9203  O O   . HOH X  4 .   ? -7.855  -29.070 -27.986 1.00 33.75 ? 2141 HOH A O   1 
HETATM 9204  O O   . HOH X  4 .   ? -21.063 -27.165 -28.817 1.00 42.13 ? 2142 HOH A O   1 
HETATM 9205  O O   . HOH X  4 .   ? -33.796 -29.915 -4.019  1.00 24.49 ? 2143 HOH A O   1 
HETATM 9206  O O   . HOH X  4 .   ? -25.975 -31.345 -8.826  1.00 33.57 ? 2144 HOH A O   1 
HETATM 9207  O O   . HOH X  4 .   ? -32.447 -30.339 -0.153  1.00 28.37 ? 2145 HOH A O   1 
HETATM 9208  O O   . HOH X  4 .   ? -27.730 -27.064 -0.623  1.00 35.51 ? 2146 HOH A O   1 
HETATM 9209  O O   . HOH X  4 .   ? -3.287  -21.971 -14.524 1.00 41.06 ? 2147 HOH A O   1 
HETATM 9210  O O   . HOH X  4 .   ? -26.957 0.963   -9.581  1.00 34.31 ? 2148 HOH A O   1 
HETATM 9211  O O   . HOH X  4 .   ? -24.259 3.889   -7.897  1.00 34.43 ? 2149 HOH A O   1 
HETATM 9212  O O   . HOH X  4 .   ? -20.739 -1.144  -7.358  1.00 34.96 ? 2150 HOH A O   1 
HETATM 9213  O O   . HOH X  4 .   ? -6.921  -23.468 -9.306  1.00 30.13 ? 2151 HOH A O   1 
HETATM 9214  O O   . HOH X  4 .   ? -7.925  -16.569 -10.381 1.00 28.07 ? 2152 HOH A O   1 
HETATM 9215  O O   . HOH X  4 .   ? -10.999 -12.636 -29.768 1.00 45.25 ? 2153 HOH A O   1 
HETATM 9216  O O   . HOH X  4 .   ? -13.478 -14.454 -26.679 1.00 24.41 ? 2154 HOH A O   1 
HETATM 9217  O O   . HOH Y  4 .   ? -20.058 -9.565  -1.148  1.00 38.90 ? 2001 HOH B O   1 
HETATM 9218  O O   . HOH Y  4 .   ? -22.022 -9.349  -4.108  1.00 25.69 ? 2002 HOH B O   1 
HETATM 9219  O O   . HOH Y  4 .   ? -21.095 -6.806  -3.787  1.00 34.66 ? 2003 HOH B O   1 
HETATM 9220  O O   . HOH Y  4 .   ? -26.002 -6.992  1.527   1.00 44.55 ? 2004 HOH B O   1 
HETATM 9221  O O   . HOH Y  4 .   ? -25.021 -17.444 2.748   1.00 38.38 ? 2005 HOH B O   1 
HETATM 9222  O O   . HOH Y  4 .   ? -19.412 -10.229 -4.086  1.00 29.18 ? 2006 HOH B O   1 
HETATM 9223  O O   . HOH Y  4 .   ? -15.035 -15.214 -1.258  1.00 35.02 ? 2007 HOH B O   1 
HETATM 9224  O O   . HOH Y  4 .   ? -14.399 -15.315 -3.853  1.00 30.19 ? 2008 HOH B O   1 
HETATM 9225  O O   . HOH Y  4 .   ? -19.109 -9.048  -6.654  1.00 25.09 ? 2009 HOH B O   1 
HETATM 9226  O O   . HOH Y  4 .   ? -15.926 -8.215  -4.278  1.00 33.37 ? 2010 HOH B O   1 
HETATM 9227  O O   . HOH Y  4 .   ? -13.731 -5.406  -8.771  1.00 42.35 ? 2011 HOH B O   1 
HETATM 9228  O O   . HOH Y  4 .   ? -9.383  -8.564  -11.808 1.00 41.01 ? 2012 HOH B O   1 
HETATM 9229  O O   . HOH Y  4 .   ? -9.145  -5.616  -15.922 1.00 38.45 ? 2013 HOH B O   1 
HETATM 9230  O O   . HOH Y  4 .   ? -9.700  -7.466  -20.257 1.00 37.97 ? 2014 HOH B O   1 
HETATM 9231  O O   . HOH Y  4 .   ? -10.152 -12.871 -20.241 1.00 34.01 ? 2015 HOH B O   1 
HETATM 9232  O O   . HOH Y  4 .   ? -2.560  -10.085 -17.105 1.00 39.26 ? 2016 HOH B O   1 
HETATM 9233  O O   . HOH Y  4 .   ? 3.396   -12.683 -16.773 1.00 32.79 ? 2017 HOH B O   1 
HETATM 9234  O O   . HOH Y  4 .   ? -1.640  -6.920  -16.958 1.00 45.34 ? 2018 HOH B O   1 
HETATM 9235  O O   . HOH Y  4 .   ? -4.938  -2.698  -17.267 1.00 47.53 ? 2019 HOH B O   1 
HETATM 9236  O O   . HOH Y  4 .   ? 6.847   -6.108  -19.540 1.00 29.20 ? 2020 HOH B O   1 
HETATM 9237  O O   . HOH Y  4 .   ? -19.707 -6.568  -1.997  1.00 45.21 ? 2021 HOH B O   1 
HETATM 9238  O O   . HOH Y  4 .   ? -24.562 -4.658  0.604   1.00 46.45 ? 2022 HOH B O   1 
HETATM 9239  O O   . HOH Y  4 .   ? -9.198  -11.896 -22.010 1.00 36.27 ? 2023 HOH B O   1 
HETATM 9240  O O   . HOH Y  4 .   ? -22.243 -5.576  0.253   1.00 45.54 ? 2024 HOH B O   1 
HETATM 9241  O O   . HOH Z  4 .   ? -10.625 -6.995  45.339  1.00 42.73 ? 2001 HOH C O   1 
HETATM 9242  O O   . HOH Z  4 .   ? -5.841  -7.933  36.365  1.00 34.43 ? 2002 HOH C O   1 
HETATM 9243  O O   . HOH Z  4 .   ? -14.966 -13.716 19.302  1.00 41.19 ? 2003 HOH C O   1 
HETATM 9244  O O   . HOH Z  4 .   ? -9.854  -17.460 19.532  1.00 34.15 ? 2004 HOH C O   1 
HETATM 9245  O O   . HOH Z  4 .   ? -8.482  -11.012 21.468  1.00 46.70 ? 2005 HOH C O   1 
HETATM 9246  O O   . HOH Z  4 .   ? -6.600  -18.889 28.473  1.00 29.97 ? 2006 HOH C O   1 
HETATM 9247  O O   . HOH Z  4 .   ? -3.115  -18.045 29.513  1.00 35.09 ? 2007 HOH C O   1 
HETATM 9248  O O   . HOH Z  4 .   ? -8.116  -9.951  27.631  1.00 30.52 ? 2008 HOH C O   1 
HETATM 9249  O O   . HOH Z  4 .   ? -4.921  -11.546 26.992  1.00 38.80 ? 2009 HOH C O   1 
HETATM 9250  O O   . HOH Z  4 .   ? -8.607  -8.379  29.712  1.00 25.87 ? 2010 HOH C O   1 
HETATM 9251  O O   . HOH Z  4 .   ? -7.295  -7.927  32.517  1.00 23.88 ? 2011 HOH C O   1 
HETATM 9252  O O   . HOH Z  4 .   ? -19.402 -10.177 26.540  1.00 29.08 ? 2012 HOH C O   1 
HETATM 9253  O O   . HOH Z  4 .   ? -23.644 -12.890 31.501  1.00 25.16 ? 2013 HOH C O   1 
HETATM 9254  O O   . HOH Z  4 .   ? -23.400 -17.607 26.482  1.00 30.26 ? 2014 HOH C O   1 
HETATM 9255  O O   . HOH Z  4 .   ? -26.330 -14.611 24.808  1.00 43.21 ? 2015 HOH C O   1 
HETATM 9256  O O   . HOH Z  4 .   ? -31.455 -9.507  32.316  1.00 46.76 ? 2016 HOH C O   1 
HETATM 9257  O O   . HOH Z  4 .   ? -29.552 -13.923 25.317  1.00 45.93 ? 2017 HOH C O   1 
HETATM 9258  O O   . HOH Z  4 .   ? -24.318 -5.604  31.443  1.00 25.02 ? 2018 HOH C O   1 
HETATM 9259  O O   . HOH Z  4 .   ? -5.796  -21.569 30.895  1.00 35.61 ? 2019 HOH C O   1 
HETATM 9260  O O   . HOH Z  4 .   ? -2.181  -21.892 36.665  1.00 39.58 ? 2020 HOH C O   1 
HETATM 9261  O O   . HOH Z  4 .   ? -6.035  -19.411 37.179  1.00 26.11 ? 2021 HOH C O   1 
HETATM 9262  O O   . HOH Z  4 .   ? -5.061  -24.747 30.816  1.00 40.89 ? 2022 HOH C O   1 
HETATM 9263  O O   . HOH Z  4 .   ? -1.215  -25.841 36.598  1.00 45.74 ? 2023 HOH C O   1 
HETATM 9264  O O   . HOH Z  4 .   ? -7.146  -24.810 47.154  1.00 40.02 ? 2024 HOH C O   1 
HETATM 9265  O O   . HOH Z  4 .   ? -7.642  -26.809 38.891  1.00 37.84 ? 2025 HOH C O   1 
HETATM 9266  O O   . HOH Z  4 .   ? -2.082  -29.659 41.879  1.00 44.74 ? 2026 HOH C O   1 
HETATM 9267  O O   . HOH Z  4 .   ? -3.926  -19.096 46.920  1.00 40.57 ? 2027 HOH C O   1 
HETATM 9268  O O   . HOH Z  4 .   ? -0.216  -7.265  44.581  1.00 42.48 ? 2028 HOH C O   1 
HETATM 9269  O O   . HOH Z  4 .   ? 2.197   -14.016 44.015  1.00 43.45 ? 2029 HOH C O   1 
HETATM 9270  O O   . HOH Z  4 .   ? -9.028  -13.056 45.331  1.00 38.67 ? 2030 HOH C O   1 
HETATM 9271  O O   . HOH Z  4 .   ? -5.702  -20.115 45.692  1.00 33.33 ? 2031 HOH C O   1 
HETATM 9272  O O   . HOH Z  4 .   ? -9.722  -21.879 46.396  1.00 30.95 ? 2032 HOH C O   1 
HETATM 9273  O O   . HOH Z  4 .   ? -12.239 -25.698 44.733  1.00 37.07 ? 2033 HOH C O   1 
HETATM 9274  O O   . HOH Z  4 .   ? -14.629 -29.686 44.259  1.00 47.24 ? 2034 HOH C O   1 
HETATM 9275  O O   . HOH Z  4 .   ? -17.616 -34.556 32.195  1.00 46.51 ? 2035 HOH C O   1 
HETATM 9276  O O   . HOH Z  4 .   ? -13.947 -32.333 26.570  1.00 44.03 ? 2036 HOH C O   1 
HETATM 9277  O O   . HOH Z  4 .   ? -20.440 -34.203 26.424  1.00 45.62 ? 2037 HOH C O   1 
HETATM 9278  O O   . HOH Z  4 .   ? -21.633 -26.596 25.399  1.00 35.97 ? 2038 HOH C O   1 
HETATM 9279  O O   . HOH Z  4 .   ? -12.604 -26.199 26.781  1.00 30.34 ? 2039 HOH C O   1 
HETATM 9280  O O   . HOH Z  4 .   ? -16.110 -34.132 21.460  1.00 45.89 ? 2040 HOH C O   1 
HETATM 9281  O O   . HOH Z  4 .   ? -22.127 -31.209 28.910  1.00 46.77 ? 2041 HOH C O   1 
HETATM 9282  O O   . HOH Z  4 .   ? -15.753 -27.670 16.030  1.00 30.62 ? 2042 HOH C O   1 
HETATM 9283  O O   . HOH Z  4 .   ? -21.167 -22.733 22.829  1.00 40.80 ? 2043 HOH C O   1 
HETATM 9284  O O   . HOH Z  4 .   ? -15.777 -19.391 19.954  1.00 36.15 ? 2044 HOH C O   1 
HETATM 9285  O O   . HOH Z  4 .   ? -13.875 -20.450 21.964  1.00 26.95 ? 2045 HOH C O   1 
HETATM 9286  O O   . HOH Z  4 .   ? -10.806 -26.973 24.909  1.00 32.14 ? 2046 HOH C O   1 
HETATM 9287  O O   . HOH Z  4 .   ? -12.928 -23.644 19.427  1.00 23.98 ? 2047 HOH C O   1 
HETATM 9288  O O   . HOH Z  4 .   ? -8.197  -21.259 27.949  1.00 42.37 ? 2048 HOH C O   1 
HETATM 9289  O O   . HOH Z  4 .   ? -10.293 -23.039 29.421  1.00 30.45 ? 2049 HOH C O   1 
HETATM 9290  O O   . HOH Z  4 .   ? -10.084 -18.706 21.966  1.00 28.30 ? 2050 HOH C O   1 
HETATM 9291  O O   . HOH Z  4 .   ? -10.133 -20.873 30.976  1.00 21.31 ? 2051 HOH C O   1 
HETATM 9292  O O   . HOH Z  4 .   ? -18.264 -10.968 45.738  1.00 35.57 ? 2052 HOH C O   1 
HETATM 9293  O O   . HOH Z  4 .   ? -20.310 -18.229 47.559  1.00 36.14 ? 2053 HOH C O   1 
HETATM 9294  O O   . HOH Z  4 .   ? -15.862 -12.756 46.848  1.00 29.24 ? 2054 HOH C O   1 
HETATM 9295  O O   . HOH Z  4 .   ? -14.381 -9.521  44.464  1.00 33.09 ? 2055 HOH C O   1 
HETATM 9296  O O   . HOH Z  4 .   ? -14.061 -13.033 39.699  1.00 19.59 ? 2056 HOH C O   1 
HETATM 9297  O O   . HOH Z  4 .   ? -25.176 -18.932 33.185  1.00 45.62 ? 2057 HOH C O   1 
HETATM 9298  O O   . HOH Z  4 .   ? -21.270 -22.026 27.244  1.00 29.51 ? 2058 HOH C O   1 
HETATM 9299  O O   . HOH Z  4 .   ? -13.056 -9.549  22.161  1.00 30.58 ? 2059 HOH C O   1 
HETATM 9300  O O   . HOH Z  4 .   ? -19.911 -11.215 23.871  1.00 35.89 ? 2060 HOH C O   1 
HETATM 9301  O O   . HOH Z  4 .   ? -25.582 -16.757 24.740  1.00 43.55 ? 2061 HOH C O   1 
HETATM 9302  O O   . HOH Z  4 .   ? -16.228 -11.340 21.423  1.00 37.96 ? 2062 HOH C O   1 
HETATM 9303  O O   . HOH Z  4 .   ? -12.438 -5.006  24.994  1.00 33.66 ? 2063 HOH C O   1 
HETATM 9304  O O   . HOH Z  4 .   ? -8.305  -4.999  32.677  1.00 29.63 ? 2064 HOH C O   1 
HETATM 9305  O O   . HOH Z  4 .   ? -9.660  2.062   30.411  1.00 36.49 ? 2065 HOH C O   1 
HETATM 9306  O O   . HOH Z  4 .   ? -5.935  0.196   27.556  1.00 44.47 ? 2066 HOH C O   1 
HETATM 9307  O O   . HOH Z  4 .   ? -13.363 0.907   20.477  1.00 38.18 ? 2067 HOH C O   1 
HETATM 9308  O O   . HOH Z  4 .   ? -10.124 3.590   27.683  1.00 38.66 ? 2068 HOH C O   1 
HETATM 9309  O O   . HOH Z  4 .   ? -12.686 -2.868  28.090  1.00 22.93 ? 2069 HOH C O   1 
HETATM 9310  O O   . HOH Z  4 .   ? -11.827 1.074   31.202  1.00 33.52 ? 2070 HOH C O   1 
HETATM 9311  O O   . HOH Z  4 .   ? -11.995 -18.901 18.452  1.00 37.71 ? 2071 HOH C O   1 
HETATM 9312  O O   . HOH Z  4 .   ? -22.218 3.460   31.784  1.00 33.62 ? 2072 HOH C O   1 
HETATM 9313  O O   . HOH Z  4 .   ? -7.535  -19.897 30.367  1.00 35.98 ? 2073 HOH C O   1 
HETATM 9314  O O   . HOH Z  4 .   ? -3.195  -20.800 31.142  1.00 36.82 ? 2074 HOH C O   1 
HETATM 9315  O O   . HOH Z  4 .   ? -25.271 -2.110  25.952  1.00 33.11 ? 2075 HOH C O   1 
HETATM 9316  O O   . HOH Z  4 .   ? -25.077 -2.318  23.253  1.00 41.77 ? 2076 HOH C O   1 
HETATM 9317  O O   . HOH Z  4 .   ? -21.995 -4.947  23.341  1.00 47.38 ? 2077 HOH C O   1 
HETATM 9318  O O   . HOH Z  4 .   ? -22.109 -19.934 25.388  1.00 33.65 ? 2078 HOH C O   1 
HETATM 9319  O O   . HOH Z  4 .   ? -23.731 -4.312  25.661  1.00 42.21 ? 2079 HOH C O   1 
HETATM 9320  O O   . HOH Z  4 .   ? -25.955 -3.788  32.760  1.00 25.29 ? 2080 HOH C O   1 
HETATM 9321  O O   . HOH Z  4 .   ? -30.806 -7.273  30.643  1.00 43.26 ? 2081 HOH C O   1 
HETATM 9322  O O   . HOH Z  4 .   ? -6.825  -26.392 30.269  1.00 42.40 ? 2082 HOH C O   1 
HETATM 9323  O O   . HOH Z  4 .   ? -7.274  -21.798 47.077  1.00 38.63 ? 2083 HOH C O   1 
HETATM 9324  O O   . HOH Z  4 .   ? -9.972  -24.684 47.008  1.00 36.72 ? 2084 HOH C O   1 
HETATM 9325  O O   . HOH Z  4 .   ? -28.892 1.189   38.001  1.00 39.58 ? 2085 HOH C O   1 
HETATM 9326  O O   . HOH Z  4 .   ? -36.089 -1.103  35.995  1.00 45.00 ? 2086 HOH C O   1 
HETATM 9327  O O   . HOH Z  4 .   ? 3.311   -15.163 46.506  1.00 45.77 ? 2087 HOH C O   1 
HETATM 9328  O O   . HOH Z  4 .   ? -8.466  -11.072 47.099  1.00 43.78 ? 2088 HOH C O   1 
HETATM 9329  O O   . HOH Z  4 .   ? -27.612 2.349   34.929  1.00 39.04 ? 2089 HOH C O   1 
HETATM 9330  O O   . HOH Z  4 .   ? -25.155 0.842   34.785  1.00 39.12 ? 2090 HOH C O   1 
HETATM 9331  O O   . HOH Z  4 .   ? -21.265 -23.959 24.965  1.00 39.11 ? 2091 HOH C O   1 
HETATM 9332  O O   . HOH Z  4 .   ? -23.819 -25.119 22.294  1.00 43.99 ? 2092 HOH C O   1 
HETATM 9333  O O   . HOH Z  4 .   ? -22.418 -20.614 22.977  1.00 39.94 ? 2093 HOH C O   1 
HETATM 9334  O O   . HOH Z  4 .   ? -20.835 3.419   39.521  1.00 34.62 ? 2094 HOH C O   1 
HETATM 9335  O O   . HOH Z  4 .   ? -12.746 -7.279  44.138  1.00 30.65 ? 2095 HOH C O   1 
HETATM 9336  O O   . HOH Z  4 .   ? -10.373 -2.800  47.207  1.00 39.21 ? 2096 HOH C O   1 
HETATM 9337  O O   . HOH Z  4 .   ? -8.270  -2.498  45.125  1.00 31.03 ? 2097 HOH C O   1 
HETATM 9338  O O   . HOH Z  4 .   ? -10.641 -11.863 43.598  1.00 41.55 ? 2098 HOH C O   1 
HETATM 9339  O O   . HOH Z  4 .   ? -5.956  -10.985 37.616  1.00 29.69 ? 2099 HOH C O   1 
HETATM 9340  O O   . HOH Z  4 .   ? -13.367 -5.593  22.047  1.00 42.88 ? 2100 HOH C O   1 
HETATM 9341  O O   . HOH Z  4 .   ? -6.002  -3.873  32.273  1.00 43.32 ? 2101 HOH C O   1 
HETATM 9342  O O   . HOH Z  4 .   ? -10.115 1.260   33.453  1.00 40.21 ? 2102 HOH C O   1 
HETATM 9343  O O   . HOH Z  4 .   ? -7.934  -0.872  38.625  1.00 30.49 ? 2103 HOH C O   1 
HETATM 9344  O O   . HOH Z  4 .   ? -9.301  0.089   42.114  1.00 31.56 ? 2104 HOH C O   1 
HETATM 9345  O O   . HOH Z  4 .   ? -23.773 2.933   34.109  1.00 41.32 ? 2105 HOH C O   1 
HETATM 9346  O O   . HOH Z  4 .   ? -25.689 -5.584  23.364  1.00 47.02 ? 2106 HOH C O   1 
HETATM 9347  O O   . HOH Z  4 .   ? 0.627   -2.829  38.877  1.00 41.94 ? 2107 HOH C O   1 
HETATM 9348  O O   . HOH Z  4 .   ? -11.810 -10.979 47.715  1.00 37.24 ? 2108 HOH C O   1 
HETATM 9349  O O   . HOH Z  4 .   ? -25.541 -13.041 39.889  1.00 38.57 ? 2109 HOH C O   1 
HETATM 9350  O O   . HOH Z  4 .   ? -26.939 -12.443 45.227  1.00 47.93 ? 2110 HOH C O   1 
HETATM 9351  O O   . HOH Z  4 .   ? -24.593 -13.616 43.246  1.00 34.28 ? 2111 HOH C O   1 
HETATM 9352  O O   . HOH Z  4 .   ? -24.549 -6.595  44.077  1.00 36.05 ? 2112 HOH C O   1 
HETATM 9353  O O   . HOH Z  4 .   ? -22.872 -7.576  42.073  1.00 24.22 ? 2113 HOH C O   1 
HETATM 9354  O O   . HOH AA 4 .   ? -4.378  -19.108 49.817  1.00 48.53 ? 2001 HOH D O   1 
HETATM 9355  O O   . HOH AA 4 .   ? -7.564  -20.411 49.646  1.00 46.65 ? 2002 HOH D O   1 
HETATM 9356  O O   . HOH AA 4 .   ? -12.411 -20.870 46.830  1.00 36.74 ? 2003 HOH D O   1 
HETATM 9357  O O   . HOH AA 4 .   ? -16.840 -15.147 48.230  1.00 37.91 ? 2004 HOH D O   1 
HETATM 9358  O O   . HOH AA 4 .   ? -13.555 -22.041 44.879  1.00 31.25 ? 2005 HOH D O   1 
HETATM 9359  O O   . HOH AA 4 .   ? -15.588 -22.184 47.934  1.00 42.42 ? 2006 HOH D O   1 
HETATM 9360  O O   . HOH AA 4 .   ? -16.370 -23.834 45.910  1.00 45.54 ? 2007 HOH D O   1 
HETATM 9361  O O   . HOH AA 4 .   ? -24.689 -21.697 41.710  1.00 42.08 ? 2008 HOH D O   1 
HETATM 9362  O O   . HOH AA 4 .   ? -27.562 -22.145 43.008  1.00 47.17 ? 2009 HOH D O   1 
HETATM 9363  O O   . HOH AA 4 .   ? -26.350 -19.100 40.312  1.00 41.67 ? 2010 HOH D O   1 
HETATM 9364  O O   . HOH AA 4 .   ? -39.259 -19.005 36.382  1.00 38.54 ? 2011 HOH D O   1 
HETATM 9365  O O   . HOH AA 4 .   ? -34.378 -20.446 37.066  1.00 47.22 ? 2012 HOH D O   1 
HETATM 9366  O O   . HOH AA 4 .   ? -32.099 -13.780 37.293  1.00 47.60 ? 2013 HOH D O   1 
HETATM 9367  O O   . HOH AA 4 .   ? -26.853 -16.397 40.273  1.00 41.49 ? 2014 HOH D O   1 
HETATM 9368  O O   . HOH BA 4 .   ? -16.878 -44.519 7.266   1.00 31.92 ? 2001 HOH E O   1 
HETATM 9369  O O   . HOH BA 4 .   ? -20.820 -55.913 10.437  1.00 49.29 ? 2002 HOH E O   1 
HETATM 9370  O O   . HOH BA 4 .   ? 3.652   -36.449 2.252   1.00 42.05 ? 2003 HOH E O   1 
HETATM 9371  O O   . HOH BA 4 .   ? -16.115 -35.062 17.389  1.00 34.05 ? 2004 HOH E O   1 
HETATM 9372  O O   . HOH BA 4 .   ? -18.938 -41.559 16.392  1.00 35.40 ? 2005 HOH E O   1 
HETATM 9373  O O   . HOH BA 4 .   ? -14.180 -36.692 17.866  1.00 34.97 ? 2006 HOH E O   1 
HETATM 9374  O O   . HOH BA 4 .   ? -19.017 -40.959 12.636  1.00 29.66 ? 2007 HOH E O   1 
HETATM 9375  O O   . HOH BA 4 .   ? -17.848 -37.679 18.422  1.00 38.71 ? 2008 HOH E O   1 
HETATM 9376  O O   . HOH BA 4 .   ? -18.197 -35.258 8.662   1.00 29.08 ? 2009 HOH E O   1 
HETATM 9377  O O   . HOH BA 4 .   ? -17.825 -40.015 6.948   1.00 24.40 ? 2010 HOH E O   1 
HETATM 9378  O O   . HOH BA 4 .   ? -17.511 -37.024 7.120   1.00 25.00 ? 2011 HOH E O   1 
HETATM 9379  O O   . HOH BA 4 .   ? -9.523  -29.672 4.464   1.00 25.59 ? 2012 HOH E O   1 
HETATM 9380  O O   . HOH BA 4 .   ? -3.280  -26.933 9.512   1.00 26.96 ? 2013 HOH E O   1 
HETATM 9381  O O   . HOH BA 4 .   ? -1.064  -25.485 1.096   1.00 40.23 ? 2014 HOH E O   1 
HETATM 9382  O O   . HOH BA 4 .   ? -2.693  -24.945 5.545   1.00 30.55 ? 2015 HOH E O   1 
HETATM 9383  O O   . HOH BA 4 .   ? -2.649  -32.160 5.065   1.00 17.88 ? 2016 HOH E O   1 
HETATM 9384  O O   . HOH BA 4 .   ? 3.294   -28.982 8.350   1.00 34.01 ? 2017 HOH E O   1 
HETATM 9385  O O   . HOH BA 4 .   ? -0.668  -27.791 10.408  1.00 33.27 ? 2018 HOH E O   1 
HETATM 9386  O O   . HOH BA 4 .   ? -2.543  -24.677 7.830   1.00 35.79 ? 2019 HOH E O   1 
HETATM 9387  O O   . HOH BA 4 .   ? 0.439   -24.420 2.482   1.00 38.62 ? 2020 HOH E O   1 
HETATM 9388  O O   . HOH BA 4 .   ? 1.410   -29.323 -1.373  1.00 29.36 ? 2021 HOH E O   1 
HETATM 9389  O O   . HOH BA 4 .   ? -11.336 -35.881 17.735  1.00 19.87 ? 2022 HOH E O   1 
HETATM 9390  O O   . HOH BA 4 .   ? -14.715 -37.441 20.307  1.00 37.33 ? 2023 HOH E O   1 
HETATM 9391  O O   . HOH BA 4 .   ? -14.343 -37.158 23.187  1.00 42.63 ? 2024 HOH E O   1 
HETATM 9392  O O   . HOH BA 4 .   ? -12.479 -43.174 17.944  1.00 26.93 ? 2025 HOH E O   1 
HETATM 9393  O O   . HOH BA 4 .   ? -15.111 -43.611 21.709  1.00 38.52 ? 2026 HOH E O   1 
HETATM 9394  O O   . HOH BA 4 .   ? -7.661  -40.952 26.913  1.00 35.88 ? 2027 HOH E O   1 
HETATM 9395  O O   . HOH BA 4 .   ? -10.099 -43.408 27.418  1.00 39.54 ? 2028 HOH E O   1 
HETATM 9396  O O   . HOH BA 4 .   ? -8.239  -43.026 24.336  1.00 30.37 ? 2029 HOH E O   1 
HETATM 9397  O O   . HOH BA 4 .   ? -10.418 -46.732 28.772  1.00 40.22 ? 2030 HOH E O   1 
HETATM 9398  O O   . HOH BA 4 .   ? -6.536  -51.297 29.707  1.00 41.61 ? 2031 HOH E O   1 
HETATM 9399  O O   . HOH BA 4 .   ? -19.155 -48.680 17.172  1.00 47.23 ? 2032 HOH E O   1 
HETATM 9400  O O   . HOH BA 4 .   ? -18.326 -54.174 16.359  1.00 38.15 ? 2033 HOH E O   1 
HETATM 9401  O O   . HOH BA 4 .   ? -8.782  -50.368 11.170  1.00 34.16 ? 2034 HOH E O   1 
HETATM 9402  O O   . HOH BA 4 .   ? -9.006  -50.928 18.889  1.00 35.48 ? 2035 HOH E O   1 
HETATM 9403  O O   . HOH BA 4 .   ? -1.467  -46.940 21.186  1.00 39.39 ? 2036 HOH E O   1 
HETATM 9404  O O   . HOH BA 4 .   ? -1.430  -38.695 27.806  1.00 35.20 ? 2037 HOH E O   1 
HETATM 9405  O O   . HOH BA 4 .   ? 0.920   -45.060 24.413  1.00 36.04 ? 2038 HOH E O   1 
HETATM 9406  O O   . HOH BA 4 .   ? 2.957   -39.195 27.390  1.00 44.14 ? 2039 HOH E O   1 
HETATM 9407  O O   . HOH BA 4 .   ? 3.763   -35.543 23.472  1.00 39.43 ? 2040 HOH E O   1 
HETATM 9408  O O   . HOH BA 4 .   ? 2.879   -42.550 23.873  1.00 33.09 ? 2041 HOH E O   1 
HETATM 9409  O O   . HOH BA 4 .   ? 4.883   -38.529 25.787  1.00 46.70 ? 2042 HOH E O   1 
HETATM 9410  O O   . HOH BA 4 .   ? -5.716  -34.792 24.445  1.00 34.53 ? 2043 HOH E O   1 
HETATM 9411  O O   . HOH BA 4 .   ? 0.196   -32.071 27.547  1.00 44.65 ? 2044 HOH E O   1 
HETATM 9412  O O   . HOH BA 4 .   ? -6.742  -32.559 23.492  1.00 38.46 ? 2045 HOH E O   1 
HETATM 9413  O O   . HOH BA 4 .   ? -1.860  -25.415 18.848  1.00 30.41 ? 2046 HOH E O   1 
HETATM 9414  O O   . HOH BA 4 .   ? -9.185  -29.774 21.698  1.00 27.17 ? 2047 HOH E O   1 
HETATM 9415  O O   . HOH BA 4 .   ? -4.935  -21.786 27.292  1.00 41.33 ? 2048 HOH E O   1 
HETATM 9416  O O   . HOH BA 4 .   ? 0.005   -20.059 22.806  1.00 46.37 ? 2049 HOH E O   1 
HETATM 9417  O O   . HOH BA 4 .   ? -1.548  -22.319 18.273  1.00 43.21 ? 2050 HOH E O   1 
HETATM 9418  O O   . HOH BA 4 .   ? -7.968  -18.718 18.229  1.00 46.78 ? 2051 HOH E O   1 
HETATM 9419  O O   . HOH BA 4 .   ? -5.515  -19.934 18.073  1.00 41.18 ? 2052 HOH E O   1 
HETATM 9420  O O   . HOH BA 4 .   ? -11.916 -21.025 20.205  1.00 25.46 ? 2053 HOH E O   1 
HETATM 9421  O O   . HOH BA 4 .   ? -8.898  -21.968 12.921  1.00 35.51 ? 2054 HOH E O   1 
HETATM 9422  O O   . HOH BA 4 .   ? -5.249  -23.766 15.536  1.00 36.76 ? 2055 HOH E O   1 
HETATM 9423  O O   . HOH BA 4 .   ? -11.938 -23.894 14.615  1.00 35.75 ? 2056 HOH E O   1 
HETATM 9424  O O   . HOH BA 4 .   ? -14.476 -33.573 19.265  1.00 32.74 ? 2057 HOH E O   1 
HETATM 9425  O O   . HOH BA 4 .   ? -12.275 -26.216 16.064  1.00 22.89 ? 2058 HOH E O   1 
HETATM 9426  O O   . HOH BA 4 .   ? -11.021 -29.287 23.443  1.00 32.24 ? 2059 HOH E O   1 
HETATM 9427  O O   . HOH BA 4 .   ? -10.870 -33.796 20.039  1.00 25.77 ? 2060 HOH E O   1 
HETATM 9428  O O   . HOH BA 4 .   ? -7.097  -43.271 9.039   1.00 17.08 ? 2061 HOH E O   1 
HETATM 9429  O O   . HOH BA 4 .   ? -3.809  -46.433 4.918   1.00 32.68 ? 2062 HOH E O   1 
HETATM 9430  O O   . HOH BA 4 .   ? 2.667   -38.995 5.487   1.00 35.48 ? 2063 HOH E O   1 
HETATM 9431  O O   . HOH BA 4 .   ? 1.187   -43.976 -1.130  1.00 31.93 ? 2064 HOH E O   1 
HETATM 9432  O O   . HOH BA 4 .   ? 1.684   -49.077 8.570   1.00 45.08 ? 2065 HOH E O   1 
HETATM 9433  O O   . HOH BA 4 .   ? 1.644   -42.164 2.154   1.00 28.06 ? 2066 HOH E O   1 
HETATM 9434  O O   . HOH BA 4 .   ? -1.652  -47.584 5.601   1.00 34.38 ? 2067 HOH E O   1 
HETATM 9435  O O   . HOH BA 4 .   ? 2.022   -48.192 3.438   1.00 42.24 ? 2068 HOH E O   1 
HETATM 9436  O O   . HOH BA 4 .   ? 3.251   -46.887 11.067  1.00 37.09 ? 2069 HOH E O   1 
HETATM 9437  O O   . HOH BA 4 .   ? 3.198   -42.318 5.582   1.00 35.30 ? 2070 HOH E O   1 
HETATM 9438  O O   . HOH BA 4 .   ? -6.137  -47.938 5.599   1.00 36.34 ? 2071 HOH E O   1 
HETATM 9439  O O   . HOH BA 4 .   ? -2.674  -49.113 7.924   1.00 26.83 ? 2072 HOH E O   1 
HETATM 9440  O O   . HOH BA 4 .   ? -3.195  -43.098 31.888  1.00 36.25 ? 2073 HOH E O   1 
HETATM 9441  O O   . HOH BA 4 .   ? 1.008   -43.562 31.706  1.00 40.14 ? 2074 HOH E O   1 
HETATM 9442  O O   . HOH BA 4 .   ? -7.300  -43.778 30.770  1.00 41.62 ? 2075 HOH E O   1 
HETATM 9443  O O   . HOH BA 4 .   ? 1.897   -31.290 15.691  1.00 38.10 ? 2076 HOH E O   1 
HETATM 9444  O O   . HOH BA 4 .   ? -1.028  -29.360 12.933  1.00 40.51 ? 2077 HOH E O   1 
HETATM 9445  O O   . HOH BA 4 .   ? 1.478   -32.241 9.953   1.00 36.55 ? 2078 HOH E O   1 
HETATM 9446  O O   . HOH BA 4 .   ? 2.259   -30.549 11.070  1.00 45.60 ? 2079 HOH E O   1 
HETATM 9447  O O   . HOH BA 4 .   ? -3.327  -27.738 14.481  1.00 24.35 ? 2080 HOH E O   1 
HETATM 9448  O O   . HOH BA 4 .   ? -16.825 -28.319 6.017   1.00 33.15 ? 2081 HOH E O   1 
HETATM 9449  O O   . HOH BA 4 .   ? -9.508  -26.979 5.157   1.00 34.88 ? 2082 HOH E O   1 
HETATM 9450  O O   . HOH BA 4 .   ? -13.411 -26.308 6.870   1.00 29.96 ? 2083 HOH E O   1 
HETATM 9451  O O   . HOH BA 4 .   ? -17.888 -40.579 3.787   1.00 28.84 ? 2084 HOH E O   1 
HETATM 9452  O O   . HOH BA 4 .   ? -20.239 -38.727 -2.839  1.00 33.23 ? 2085 HOH E O   1 
HETATM 9453  O O   . HOH BA 4 .   ? -22.668 -32.167 -0.963  1.00 41.42 ? 2086 HOH E O   1 
HETATM 9454  O O   . HOH BA 4 .   ? -20.302 -37.236 -9.092  1.00 43.73 ? 2087 HOH E O   1 
HETATM 9455  O O   . HOH BA 4 .   ? -21.478 -36.609 -5.150  1.00 34.40 ? 2088 HOH E O   1 
HETATM 9456  O O   . HOH BA 4 .   ? -14.463 -39.035 -6.564  1.00 35.10 ? 2089 HOH E O   1 
HETATM 9457  O O   . HOH BA 4 .   ? -18.265 -34.972 -11.343 1.00 37.69 ? 2090 HOH E O   1 
HETATM 9458  O O   . HOH BA 4 .   ? -21.276 -31.853 -7.011  1.00 28.67 ? 2091 HOH E O   1 
HETATM 9459  O O   . HOH BA 4 .   ? -17.742 -38.598 -2.923  1.00 28.10 ? 2092 HOH E O   1 
HETATM 9460  O O   . HOH BA 4 .   ? -16.894 -34.987 0.244   1.00 17.90 ? 2093 HOH E O   1 
HETATM 9461  O O   . HOH BA 4 .   ? -9.852  -35.296 -9.291  1.00 25.20 ? 2094 HOH E O   1 
HETATM 9462  O O   . HOH BA 4 .   ? -17.519 -43.209 18.458  1.00 44.90 ? 2095 HOH E O   1 
HETATM 9463  O O   . HOH BA 4 .   ? -13.246 -23.787 -4.062  1.00 32.91 ? 2096 HOH E O   1 
HETATM 9464  O O   . HOH BA 4 .   ? -9.443  -25.278 -5.037  1.00 26.80 ? 2097 HOH E O   1 
HETATM 9465  O O   . HOH BA 4 .   ? -7.891  -27.829 -5.339  1.00 19.27 ? 2098 HOH E O   1 
HETATM 9466  O O   . HOH BA 4 .   ? -20.447 -34.317 7.525   1.00 43.67 ? 2099 HOH E O   1 
HETATM 9467  O O   . HOH BA 4 .   ? -4.920  -32.937 -1.947  1.00 14.28 ? 2100 HOH E O   1 
HETATM 9468  O O   . HOH BA 4 .   ? -13.357 -26.898 0.999   1.00 40.38 ? 2101 HOH E O   1 
HETATM 9469  O O   . HOH BA 4 .   ? -10.900 -26.785 -1.659  1.00 38.86 ? 2102 HOH E O   1 
HETATM 9470  O O   . HOH BA 4 .   ? -9.457  -29.075 2.148   1.00 32.58 ? 2103 HOH E O   1 
HETATM 9471  O O   . HOH BA 4 .   ? -4.099  -26.182 12.161  1.00 26.99 ? 2104 HOH E O   1 
HETATM 9472  O O   . HOH BA 4 .   ? -1.815  -26.422 -5.180  1.00 24.01 ? 2105 HOH E O   1 
HETATM 9473  O O   . HOH BA 4 .   ? -2.888  -27.123 -1.332  1.00 29.69 ? 2106 HOH E O   1 
HETATM 9474  O O   . HOH BA 4 .   ? -8.527  -27.830 -2.693  1.00 29.41 ? 2107 HOH E O   1 
HETATM 9475  O O   . HOH BA 4 .   ? -3.579  -33.674 -4.277  1.00 15.20 ? 2108 HOH E O   1 
HETATM 9476  O O   . HOH BA 4 .   ? -0.234  -27.292 -0.985  1.00 40.41 ? 2109 HOH E O   1 
HETATM 9477  O O   . HOH BA 4 .   ? 2.716   -26.354 -0.272  1.00 37.13 ? 2110 HOH E O   1 
HETATM 9478  O O   . HOH BA 4 .   ? -14.989 -43.936 18.981  1.00 39.50 ? 2111 HOH E O   1 
HETATM 9479  O O   . HOH BA 4 .   ? -5.381  -41.778 28.296  1.00 29.82 ? 2112 HOH E O   1 
HETATM 9480  O O   . HOH BA 4 .   ? 4.287   -33.933 -11.945 1.00 37.13 ? 2113 HOH E O   1 
HETATM 9481  O O   . HOH BA 4 .   ? 3.741   -40.865 -4.118  1.00 32.52 ? 2114 HOH E O   1 
HETATM 9482  O O   . HOH BA 4 .   ? 4.332   -40.081 -9.356  1.00 38.07 ? 2115 HOH E O   1 
HETATM 9483  O O   . HOH BA 4 .   ? 5.867   -36.702 -9.544  1.00 33.55 ? 2116 HOH E O   1 
HETATM 9484  O O   . HOH BA 4 .   ? -17.565 -56.252 17.659  1.00 44.82 ? 2117 HOH E O   1 
HETATM 9485  O O   . HOH BA 4 .   ? 1.056   -36.333 -0.749  1.00 29.75 ? 2118 HOH E O   1 
HETATM 9486  O O   . HOH BA 4 .   ? -8.274  -52.670 9.811   1.00 39.12 ? 2119 HOH E O   1 
HETATM 9487  O O   . HOH BA 4 .   ? -0.788  -36.418 -13.212 1.00 47.58 ? 2120 HOH E O   1 
HETATM 9488  O O   . HOH BA 4 .   ? 2.061   -31.634 -11.767 1.00 37.76 ? 2121 HOH E O   1 
HETATM 9489  O O   . HOH BA 4 .   ? 5.460   -44.530 -5.296  1.00 38.71 ? 2122 HOH E O   1 
HETATM 9490  O O   . HOH BA 4 .   ? 2.132   -42.891 -3.824  1.00 30.41 ? 2123 HOH E O   1 
HETATM 9491  O O   . HOH BA 4 .   ? -3.765  -39.447 28.738  1.00 36.75 ? 2124 HOH E O   1 
HETATM 9492  O O   . HOH BA 4 .   ? -0.835  -42.676 0.159   1.00 24.47 ? 2125 HOH E O   1 
HETATM 9493  O O   . HOH BA 4 .   ? 3.057   -41.229 1.076   1.00 42.61 ? 2126 HOH E O   1 
HETATM 9494  O O   . HOH BA 4 .   ? 1.843   -39.674 2.309   1.00 38.11 ? 2127 HOH E O   1 
HETATM 9495  O O   . HOH BA 4 .   ? -0.956  -29.102 28.651  1.00 45.67 ? 2128 HOH E O   1 
HETATM 9496  O O   . HOH BA 4 .   ? -9.512  -32.900 22.519  1.00 40.83 ? 2129 HOH E O   1 
HETATM 9497  O O   . HOH BA 4 .   ? -5.059  -36.391 -8.423  1.00 34.54 ? 2130 HOH E O   1 
HETATM 9498  O O   . HOH BA 4 .   ? -1.826  -40.322 -10.793 1.00 47.34 ? 2131 HOH E O   1 
HETATM 9499  O O   . HOH BA 4 .   ? -3.374  -25.770 16.291  1.00 31.19 ? 2132 HOH E O   1 
HETATM 9500  O O   . HOH BA 4 .   ? -4.441  -23.635 12.752  1.00 34.44 ? 2133 HOH E O   1 
HETATM 9501  O O   . HOH BA 4 .   ? -14.303 -22.840 13.460  1.00 38.72 ? 2134 HOH E O   1 
HETATM 9502  O O   . HOH BA 4 .   ? -11.939 -33.683 22.411  1.00 41.64 ? 2135 HOH E O   1 
HETATM 9503  O O   . HOH BA 4 .   ? -8.145  -41.829 -8.375  1.00 35.86 ? 2136 HOH E O   1 
HETATM 9504  O O   . HOH BA 4 .   ? -8.412  -48.934 4.121   1.00 26.87 ? 2137 HOH E O   1 
HETATM 9505  O O   . HOH BA 4 .   ? 5.300   -37.863 6.754   1.00 47.79 ? 2138 HOH E O   1 
HETATM 9506  O O   . HOH BA 4 .   ? 5.654   -43.198 3.835   1.00 46.47 ? 2139 HOH E O   1 
HETATM 9507  O O   . HOH BA 4 .   ? -4.405  -49.977 3.744   1.00 36.54 ? 2140 HOH E O   1 
HETATM 9508  O O   . HOH BA 4 .   ? -3.754  -51.606 7.376   1.00 35.82 ? 2141 HOH E O   1 
HETATM 9509  O O   . HOH BA 4 .   ? 0.227   -40.751 31.341  1.00 43.08 ? 2142 HOH E O   1 
HETATM 9510  O O   . HOH BA 4 .   ? -16.950 -46.743 0.377   1.00 32.14 ? 2143 HOH E O   1 
HETATM 9511  O O   . HOH BA 4 .   ? -12.929 -52.438 1.564   1.00 30.09 ? 2144 HOH E O   1 
HETATM 9512  O O   . HOH BA 4 .   ? -10.858 -53.368 0.614   1.00 33.65 ? 2145 HOH E O   1 
HETATM 9513  O O   . HOH BA 4 .   ? -8.096  -25.043 4.768   1.00 43.50 ? 2146 HOH E O   1 
HETATM 9514  O O   . HOH BA 4 .   ? -10.096 -49.791 8.062   1.00 37.24 ? 2147 HOH E O   1 
HETATM 9515  O O   . HOH BA 4 .   ? -9.139  -48.034 9.326   1.00 40.27 ? 2148 HOH E O   1 
HETATM 9516  O O   . HOH BA 4 .   ? -15.665 -44.840 9.925   1.00 25.30 ? 2149 HOH E O   1 
HETATM 9517  O O   . HOH BA 4 .   ? -20.051 -46.186 -1.722  1.00 46.21 ? 2150 HOH E O   1 
HETATM 9518  O O   . HOH BA 4 .   ? -18.041 -41.483 -2.364  1.00 31.39 ? 2151 HOH E O   1 
HETATM 9519  O O   . HOH BA 4 .   ? -12.603 -40.454 -7.696  1.00 41.33 ? 2152 HOH E O   1 
HETATM 9520  O O   . HOH BA 4 .   ? -14.738 -49.547 -1.365  1.00 30.51 ? 2153 HOH E O   1 
HETATM 9521  O O   . HOH BA 4 .   ? -17.358 -55.342 6.752   1.00 42.46 ? 2154 HOH E O   1 
HETATM 9522  O O   . HOH BA 4 .   ? -7.728  -36.695 -9.449  1.00 37.15 ? 2155 HOH E O   1 
HETATM 9523  O O   . HOH BA 4 .   ? -16.118 -27.293 1.766   1.00 39.97 ? 2156 HOH E O   1 
HETATM 9524  O O   . HOH BA 4 .   ? -20.625 -53.910 9.045   1.00 43.97 ? 2157 HOH E O   1 
HETATM 9525  O O   . HOH BA 4 .   ? -3.906  -25.536 -3.768  1.00 41.18 ? 2158 HOH E O   1 
HETATM 9526  O O   . HOH BA 4 .   ? -14.868 -54.398 1.836   1.00 41.84 ? 2159 HOH E O   1 
HETATM 9527  O O   . HOH BA 4 .   ? 1.846   -34.982 1.099   1.00 30.88 ? 2160 HOH E O   1 
HETATM 9528  O O   . HOH BA 4 .   ? -6.266  -51.798 7.515   1.00 39.78 ? 2161 HOH E O   1 
HETATM 9529  O O   . HOH BA 4 .   ? -2.478  -40.207 31.544  1.00 42.53 ? 2162 HOH E O   1 
HETATM 9530  O O   . HOH BA 4 .   ? -4.761  -43.919 29.886  1.00 30.60 ? 2163 HOH E O   1 
HETATM 9531  O O   . HOH BA 4 .   ? -1.106  -49.945 26.872  1.00 36.19 ? 2164 HOH E O   1 
HETATM 9532  O O   . HOH BA 4 .   ? -4.424  -49.736 28.749  1.00 41.17 ? 2165 HOH E O   1 
HETATM 9533  O O   . HOH BA 4 .   ? -1.333  -44.898 31.424  1.00 30.90 ? 2166 HOH E O   1 
HETATM 9534  O O   . HOH CA 4 .   ? -7.744  -56.780 19.940  1.00 41.25 ? 2001 HOH F O   1 
HETATM 9535  O O   . HOH CA 4 .   ? -4.498  -49.828 18.676  1.00 30.65 ? 2002 HOH F O   1 
HETATM 9536  O O   . HOH CA 4 .   ? -1.683  -49.581 20.389  1.00 39.45 ? 2003 HOH F O   1 
HETATM 9537  O O   . HOH CA 4 .   ? -4.521  -59.586 17.273  1.00 46.69 ? 2004 HOH F O   1 
HETATM 9538  O O   . HOH CA 4 .   ? -5.835  -55.576 23.006  1.00 40.96 ? 2005 HOH F O   1 
HETATM 9539  O O   . HOH CA 4 .   ? -9.706  -57.409 13.851  1.00 48.46 ? 2006 HOH F O   1 
HETATM 9540  O O   . HOH CA 4 .   ? -2.041  -52.538 17.389  1.00 43.80 ? 2007 HOH F O   1 
HETATM 9541  O O   . HOH CA 4 .   ? -2.493  -49.507 16.582  1.00 35.41 ? 2008 HOH F O   1 
HETATM 9542  O O   . HOH CA 4 .   ? -0.850  -52.180 10.287  1.00 39.79 ? 2009 HOH F O   1 
HETATM 9543  O O   . HOH CA 4 .   ? -0.653  -49.600 9.739   1.00 29.75 ? 2010 HOH F O   1 
HETATM 9544  O O   . HOH CA 4 .   ? -1.976  -46.912 17.653  1.00 31.82 ? 2011 HOH F O   1 
HETATM 9545  O O   . HOH CA 4 .   ? 0.459   -48.674 16.867  1.00 39.80 ? 2012 HOH F O   1 
HETATM 9546  O O   . HOH CA 4 .   ? 4.634   -41.904 12.884  1.00 32.29 ? 2013 HOH F O   1 
HETATM 9547  O O   . HOH CA 4 .   ? 6.286   -35.655 14.384  1.00 40.26 ? 2014 HOH F O   1 
HETATM 9548  O O   . HOH CA 4 .   ? 5.758   -39.574 12.770  1.00 40.11 ? 2015 HOH F O   1 
HETATM 9549  O O   . HOH CA 4 .   ? 5.149   -38.890 17.552  1.00 36.07 ? 2016 HOH F O   1 
HETATM 9550  O O   . HOH CA 4 .   ? 5.546   -37.993 9.574   1.00 34.66 ? 2017 HOH F O   1 
HETATM 9551  O O   . HOH CA 4 .   ? -3.068  -55.014 24.232  1.00 48.07 ? 2018 HOH F O   1 
HETATM 9552  O O   . HOH CA 4 .   ? 6.940   -41.168 16.542  1.00 45.23 ? 2019 HOH F O   1 
HETATM 9553  O O   . HOH DA 4 .   ? -6.841  -2.948  64.194  1.00 34.99 ? 2001 HOH G O   1 
HETATM 9554  O O   . HOH DA 4 .   ? -10.048 -5.960  64.018  1.00 38.42 ? 2002 HOH G O   1 
HETATM 9555  O O   . HOH DA 4 .   ? -7.745  6.159   66.009  1.00 33.66 ? 2003 HOH G O   1 
HETATM 9556  O O   . HOH DA 4 .   ? -6.273  11.536  60.065  1.00 30.90 ? 2004 HOH G O   1 
HETATM 9557  O O   . HOH DA 4 .   ? -5.175  12.914  63.511  1.00 37.30 ? 2005 HOH G O   1 
HETATM 9558  O O   . HOH DA 4 .   ? -9.711  15.113  58.095  1.00 29.97 ? 2006 HOH G O   1 
HETATM 9559  O O   . HOH DA 4 .   ? -6.367  10.436  55.615  1.00 47.33 ? 2007 HOH G O   1 
HETATM 9560  O O   . HOH DA 4 .   ? -7.809  5.495   57.024  1.00 32.55 ? 2008 HOH G O   1 
HETATM 9561  O O   . HOH DA 4 .   ? -4.591  6.181   58.947  1.00 40.65 ? 2009 HOH G O   1 
HETATM 9562  O O   . HOH DA 4 .   ? -9.086  7.427   55.390  1.00 28.05 ? 2010 HOH G O   1 
HETATM 9563  O O   . HOH DA 4 .   ? -9.039  10.447  55.170  1.00 25.67 ? 2011 HOH G O   1 
HETATM 9564  O O   . HOH DA 4 .   ? -17.478 -0.146  55.938  1.00 28.54 ? 2012 HOH G O   1 
HETATM 9565  O O   . HOH DA 4 .   ? -23.860 2.542   58.254  1.00 20.87 ? 2013 HOH G O   1 
HETATM 9566  O O   . HOH DA 4 .   ? -23.593 -4.615  59.835  1.00 38.55 ? 2014 HOH G O   1 
HETATM 9567  O O   . HOH DA 4 .   ? -22.063 -2.317  62.917  1.00 30.21 ? 2015 HOH G O   1 
HETATM 9568  O O   . HOH DA 4 .   ? -26.805 -4.296  55.851  1.00 47.72 ? 2016 HOH G O   1 
HETATM 9569  O O   . HOH DA 4 .   ? -24.087 -1.399  64.569  1.00 41.00 ? 2017 HOH G O   1 
HETATM 9570  O O   . HOH DA 4 .   ? -27.103 -5.257  58.022  1.00 45.36 ? 2018 HOH G O   1 
HETATM 9571  O O   . HOH DA 4 .   ? -31.197 0.815   55.430  1.00 45.27 ? 2019 HOH G O   1 
HETATM 9572  O O   . HOH DA 4 .   ? -32.608 0.080   59.447  1.00 44.50 ? 2020 HOH G O   1 
HETATM 9573  O O   . HOH DA 4 .   ? -28.195 -1.533  52.819  1.00 44.01 ? 2021 HOH G O   1 
HETATM 9574  O O   . HOH DA 4 .   ? -23.737 2.707   50.960  1.00 17.93 ? 2022 HOH G O   1 
HETATM 9575  O O   . HOH DA 4 .   ? -12.097 7.137   67.709  1.00 22.10 ? 2023 HOH G O   1 
HETATM 9576  O O   . HOH DA 4 .   ? -11.124 14.440  66.834  1.00 27.69 ? 2024 HOH G O   1 
HETATM 9577  O O   . HOH DA 4 .   ? -7.603  15.445  69.762  1.00 38.55 ? 2025 HOH G O   1 
HETATM 9578  O O   . HOH DA 4 .   ? -13.545 14.924  74.051  1.00 33.17 ? 2026 HOH G O   1 
HETATM 9579  O O   . HOH DA 4 .   ? -13.087 10.687  77.580  1.00 45.69 ? 2027 HOH G O   1 
HETATM 9580  O O   . HOH DA 4 .   ? -6.273  15.140  73.995  1.00 45.18 ? 2028 HOH G O   1 
HETATM 9581  O O   . HOH DA 4 .   ? -8.644  25.598  78.291  1.00 45.07 ? 2029 HOH G O   1 
HETATM 9582  O O   . HOH DA 4 .   ? -14.651 27.585  75.843  1.00 37.23 ? 2030 HOH G O   1 
HETATM 9583  O O   . HOH DA 4 .   ? -10.843 22.420  76.331  1.00 42.15 ? 2031 HOH G O   1 
HETATM 9584  O O   . HOH DA 4 .   ? -13.515 24.649  67.008  1.00 40.67 ? 2032 HOH G O   1 
HETATM 9585  O O   . HOH DA 4 .   ? -6.998  23.698  67.488  1.00 47.68 ? 2033 HOH G O   1 
HETATM 9586  O O   . HOH DA 4 .   ? -3.506  21.655  62.247  1.00 44.88 ? 2034 HOH G O   1 
HETATM 9587  O O   . HOH DA 4 .   ? -16.378 21.068  60.303  1.00 38.44 ? 2035 HOH G O   1 
HETATM 9588  O O   . HOH DA 4 .   ? -14.206 22.459  67.538  1.00 36.92 ? 2036 HOH G O   1 
HETATM 9589  O O   . HOH DA 4 .   ? -18.487 21.085  69.027  1.00 33.12 ? 2037 HOH G O   1 
HETATM 9590  O O   . HOH DA 4 .   ? -20.102 18.622  72.428  1.00 37.11 ? 2038 HOH G O   1 
HETATM 9591  O O   . HOH DA 4 .   ? -19.159 11.000  79.549  1.00 37.63 ? 2039 HOH G O   1 
HETATM 9592  O O   . HOH DA 4 .   ? -22.320 17.153  76.287  1.00 35.02 ? 2040 HOH G O   1 
HETATM 9593  O O   . HOH DA 4 .   ? -24.272 15.150  76.621  1.00 40.14 ? 2041 HOH G O   1 
HETATM 9594  O O   . HOH DA 4 .   ? -25.106 8.180   77.483  1.00 42.99 ? 2042 HOH G O   1 
HETATM 9595  O O   . HOH DA 4 .   ? -15.698 7.285   75.714  1.00 31.00 ? 2043 HOH G O   1 
HETATM 9596  O O   . HOH DA 4 .   ? -14.703 8.513   78.154  1.00 47.10 ? 2044 HOH G O   1 
HETATM 9597  O O   . HOH DA 4 .   ? -26.073 5.582   77.625  1.00 44.01 ? 2045 HOH G O   1 
HETATM 9598  O O   . HOH DA 4 .   ? -20.995 -3.040  72.335  1.00 23.87 ? 2046 HOH G O   1 
HETATM 9599  O O   . HOH DA 4 .   ? -14.702 4.596   74.672  1.00 34.71 ? 2047 HOH G O   1 
HETATM 9600  O O   . HOH DA 4 .   ? -13.439 2.018   72.570  1.00 24.96 ? 2048 HOH G O   1 
HETATM 9601  O O   . HOH DA 4 .   ? -19.678 1.436   81.614  1.00 40.18 ? 2049 HOH G O   1 
HETATM 9602  O O   . HOH DA 4 .   ? -14.130 1.804   78.707  1.00 41.21 ? 2050 HOH G O   1 
HETATM 9603  O O   . HOH DA 4 .   ? -18.465 -9.413  74.667  1.00 42.42 ? 2051 HOH G O   1 
HETATM 9604  O O   . HOH DA 4 .   ? -23.505 -5.817  75.097  1.00 41.76 ? 2052 HOH G O   1 
HETATM 9605  O O   . HOH DA 4 .   ? -17.191 -8.787  71.226  1.00 40.50 ? 2053 HOH G O   1 
HETATM 9606  O O   . HOH DA 4 .   ? -15.389 -6.858  65.206  1.00 39.29 ? 2054 HOH G O   1 
HETATM 9607  O O   . HOH DA 4 .   ? -12.366 -5.090  65.333  1.00 26.87 ? 2055 HOH G O   1 
HETATM 9608  O O   . HOH DA 4 .   ? -18.651 -5.000  68.674  1.00 38.58 ? 2056 HOH G O   1 
HETATM 9609  O O   . HOH DA 4 .   ? -9.983  -4.709  69.777  1.00 26.38 ? 2057 HOH G O   1 
HETATM 9610  O O   . HOH DA 4 .   ? -11.172 1.016   73.590  1.00 28.91 ? 2058 HOH G O   1 
HETATM 9611  O O   . HOH DA 4 .   ? -9.606  5.351   68.153  1.00 34.49 ? 2059 HOH G O   1 
HETATM 9612  O O   . HOH DA 4 .   ? -11.775 -2.690  66.627  1.00 22.14 ? 2060 HOH G O   1 
HETATM 9613  O O   . HOH DA 4 .   ? -12.093 5.476   70.234  1.00 27.84 ? 2061 HOH G O   1 
HETATM 9614  O O   . HOH DA 4 .   ? -8.094  -0.975  65.399  1.00 29.77 ? 2062 HOH G O   1 
HETATM 9615  O O   . HOH DA 4 .   ? -18.593 13.867  59.751  1.00 22.65 ? 2063 HOH G O   1 
HETATM 9616  O O   . HOH DA 4 .   ? -29.099 9.745   59.622  1.00 33.05 ? 2064 HOH G O   1 
HETATM 9617  O O   . HOH DA 4 .   ? -24.491 18.190  57.520  1.00 37.65 ? 2065 HOH G O   1 
HETATM 9618  O O   . HOH DA 4 .   ? -29.221 14.087  52.344  1.00 34.40 ? 2066 HOH G O   1 
HETATM 9619  O O   . HOH DA 4 .   ? -27.710 18.028  64.083  1.00 40.30 ? 2067 HOH G O   1 
HETATM 9620  O O   . HOH DA 4 .   ? -20.342 18.412  55.949  1.00 34.68 ? 2068 HOH G O   1 
HETATM 9621  O O   . HOH DA 4 .   ? -22.529 16.845  56.888  1.00 37.77 ? 2069 HOH G O   1 
HETATM 9622  O O   . HOH DA 4 .   ? -23.045 19.626  59.169  1.00 30.15 ? 2070 HOH G O   1 
HETATM 9623  O O   . HOH DA 4 .   ? -26.271 3.262   63.461  1.00 41.26 ? 2071 HOH G O   1 
HETATM 9624  O O   . HOH DA 4 .   ? -20.647 -1.091  67.541  1.00 25.92 ? 2072 HOH G O   1 
HETATM 9625  O O   . HOH DA 4 .   ? -10.098 -1.459  55.817  1.00 29.84 ? 2073 HOH G O   1 
HETATM 9626  O O   . HOH DA 4 .   ? -17.333 -6.870  58.771  1.00 45.07 ? 2074 HOH G O   1 
HETATM 9627  O O   . HOH DA 4 .   ? -17.365 -2.630  56.832  1.00 32.79 ? 2075 HOH G O   1 
HETATM 9628  O O   . HOH DA 4 .   ? -13.279 -3.374  57.626  1.00 31.50 ? 2076 HOH G O   1 
HETATM 9629  O O   . HOH DA 4 .   ? -10.103 1.547   51.441  1.00 31.71 ? 2077 HOH G O   1 
HETATM 9630  O O   . HOH DA 4 .   ? -9.597  10.373  52.137  1.00 30.03 ? 2078 HOH G O   1 
HETATM 9631  O O   . HOH DA 4 .   ? -8.965  8.122   45.215  1.00 36.02 ? 2079 HOH G O   1 
HETATM 9632  O O   . HOH DA 4 .   ? -8.523  5.142   42.929  1.00 34.76 ? 2080 HOH G O   1 
HETATM 9633  O O   . HOH DA 4 .   ? -11.546 7.790   45.889  1.00 30.62 ? 2081 HOH G O   1 
HETATM 9634  O O   . HOH DA 4 .   ? -11.550 4.447   49.440  1.00 18.03 ? 2082 HOH G O   1 
HETATM 9635  O O   . HOH DA 4 .   ? -8.089  -5.016  65.697  1.00 37.20 ? 2083 HOH G O   1 
HETATM 9636  O O   . HOH DA 4 .   ? -21.130 4.265   42.315  1.00 25.69 ? 2084 HOH G O   1 
HETATM 9637  O O   . HOH DA 4 .   ? -9.486  7.855   67.131  1.00 40.83 ? 2085 HOH G O   1 
HETATM 9638  O O   . HOH DA 4 .   ? -3.288  11.458  60.339  1.00 46.84 ? 2086 HOH G O   1 
HETATM 9639  O O   . HOH DA 4 .   ? -20.590 -5.027  47.459  1.00 33.42 ? 2087 HOH G O   1 
HETATM 9640  O O   . HOH DA 4 .   ? -22.129 -2.569  47.219  1.00 29.45 ? 2088 HOH G O   1 
HETATM 9641  O O   . HOH DA 4 .   ? -16.884 -6.722  47.402  1.00 37.11 ? 2089 HOH G O   1 
HETATM 9642  O O   . HOH DA 4 .   ? -9.349  14.271  55.216  1.00 34.83 ? 2090 HOH G O   1 
HETATM 9643  O O   . HOH DA 4 .   ? -5.871  4.052   55.833  1.00 38.26 ? 2091 HOH G O   1 
HETATM 9644  O O   . HOH DA 4 .   ? -14.480 -2.952  51.397  1.00 35.96 ? 2092 HOH G O   1 
HETATM 9645  O O   . HOH DA 4 .   ? -18.070 -3.744  50.099  1.00 41.94 ? 2093 HOH G O   1 
HETATM 9646  O O   . HOH DA 4 .   ? -20.602 -2.940  65.278  1.00 30.94 ? 2094 HOH G O   1 
HETATM 9647  O O   . HOH DA 4 .   ? -31.286 3.309   54.941  1.00 41.89 ? 2095 HOH G O   1 
HETATM 9648  O O   . HOH DA 4 .   ? -25.934 -3.121  53.098  1.00 38.62 ? 2096 HOH G O   1 
HETATM 9649  O O   . HOH DA 4 .   ? -20.619 -2.329  49.487  1.00 31.67 ? 2097 HOH G O   1 
HETATM 9650  O O   . HOH DA 4 .   ? -21.727 -4.120  53.196  1.00 43.59 ? 2098 HOH G O   1 
HETATM 9651  O O   . HOH DA 4 .   ? -25.725 3.369   48.962  1.00 19.79 ? 2099 HOH G O   1 
HETATM 9652  O O   . HOH DA 4 .   ? -29.908 -0.083  52.159  1.00 34.01 ? 2100 HOH G O   1 
HETATM 9653  O O   . HOH DA 4 .   ? -8.016  14.995  66.851  1.00 40.59 ? 2101 HOH G O   1 
HETATM 9654  O O   . HOH DA 4 .   ? -34.286 9.455   44.886  1.00 45.52 ? 2102 HOH G O   1 
HETATM 9655  O O   . HOH DA 4 .   ? -29.985 7.487   43.879  1.00 32.29 ? 2103 HOH G O   1 
HETATM 9656  O O   . HOH DA 4 .   ? -36.257 5.501   46.893  1.00 37.88 ? 2104 HOH G O   1 
HETATM 9657  O O   . HOH DA 4 .   ? -32.451 10.859  49.799  1.00 30.12 ? 2105 HOH G O   1 
HETATM 9658  O O   . HOH DA 4 .   ? -29.090 6.497   53.381  1.00 36.18 ? 2106 HOH G O   1 
HETATM 9659  O O   . HOH DA 4 .   ? -27.312 5.030   42.702  1.00 33.81 ? 2107 HOH G O   1 
HETATM 9660  O O   . HOH DA 4 .   ? -33.506 0.742   43.911  1.00 42.85 ? 2108 HOH G O   1 
HETATM 9661  O O   . HOH DA 4 .   ? -30.480 5.173   41.416  1.00 46.11 ? 2109 HOH G O   1 
HETATM 9662  O O   . HOH DA 4 .   ? -16.721 23.167  69.353  1.00 33.81 ? 2110 HOH G O   1 
HETATM 9663  O O   . HOH DA 4 .   ? -19.151 21.313  71.965  1.00 35.77 ? 2111 HOH G O   1 
HETATM 9664  O O   . HOH DA 4 .   ? -32.133 15.325  49.074  1.00 42.59 ? 2112 HOH G O   1 
HETATM 9665  O O   . HOH DA 4 .   ? -21.317 12.055  81.871  1.00 42.53 ? 2113 HOH G O   1 
HETATM 9666  O O   . HOH DA 4 .   ? -26.871 12.766  53.172  1.00 27.89 ? 2114 HOH G O   1 
HETATM 9667  O O   . HOH DA 4 .   ? -25.282 5.622   44.359  1.00 32.37 ? 2115 HOH G O   1 
HETATM 9668  O O   . HOH DA 4 .   ? -21.158 -6.077  72.264  1.00 36.58 ? 2116 HOH G O   1 
HETATM 9669  O O   . HOH DA 4 .   ? -20.308 -2.833  69.579  1.00 33.02 ? 2117 HOH G O   1 
HETATM 9670  O O   . HOH DA 4 .   ? -13.435 3.236   76.545  1.00 38.27 ? 2118 HOH G O   1 
HETATM 9671  O O   . HOH DA 4 .   ? -12.279 -0.646  77.746  1.00 36.82 ? 2119 HOH G O   1 
HETATM 9672  O O   . HOH DA 4 .   ? -19.955 -5.300  66.217  1.00 40.34 ? 2120 HOH G O   1 
HETATM 9673  O O   . HOH DA 4 .   ? -11.328 -7.148  69.273  1.00 41.44 ? 2121 HOH G O   1 
HETATM 9674  O O   . HOH DA 4 .   ? -23.104 12.120  42.370  1.00 40.62 ? 2122 HOH G O   1 
HETATM 9675  O O   . HOH DA 4 .   ? -18.348 18.840  54.387  1.00 28.70 ? 2123 HOH G O   1 
HETATM 9676  O O   . HOH DA 4 .   ? -30.863 12.921  50.058  1.00 37.96 ? 2124 HOH G O   1 
HETATM 9677  O O   . HOH DA 4 .   ? -11.152 16.168  48.279  1.00 31.74 ? 2125 HOH G O   1 
HETATM 9678  O O   . HOH DA 4 .   ? -17.031 23.028  50.672  1.00 36.59 ? 2126 HOH G O   1 
HETATM 9679  O O   . HOH DA 4 .   ? -14.461 21.864  50.186  1.00 30.56 ? 2127 HOH G O   1 
HETATM 9680  O O   . HOH DA 4 .   ? -19.084 -4.757  57.576  1.00 40.56 ? 2128 HOH G O   1 
HETATM 9681  O O   . HOH DA 4 .   ? -16.412 18.501  58.680  1.00 40.27 ? 2129 HOH G O   1 
HETATM 9682  O O   . HOH DA 4 .   ? -10.935 -4.792  59.254  1.00 35.00 ? 2130 HOH G O   1 
HETATM 9683  O O   . HOH DA 4 .   ? -7.008  2.010   52.386  1.00 38.30 ? 2131 HOH G O   1 
HETATM 9684  O O   . HOH DA 4 .   ? -11.056 10.753  45.932  1.00 37.14 ? 2132 HOH G O   1 
HETATM 9685  O O   . HOH DA 4 .   ? -11.961 23.400  49.568  1.00 38.29 ? 2133 HOH G O   1 
HETATM 9686  O O   . HOH DA 4 .   ? -16.636 20.893  54.368  1.00 43.25 ? 2134 HOH G O   1 
HETATM 9687  O O   . HOH DA 4 .   ? -23.314 5.877   42.350  1.00 35.38 ? 2135 HOH G O   1 
HETATM 9688  O O   . HOH DA 4 .   ? -24.014 -4.359  47.514  1.00 38.55 ? 2136 HOH G O   1 
HETATM 9689  O O   . HOH DA 4 .   ? -11.730 -3.193  52.280  1.00 45.03 ? 2137 HOH G O   1 
HETATM 9690  O O   . HOH DA 4 .   ? -5.882  4.412   53.502  1.00 41.68 ? 2138 HOH G O   1 
HETATM 9691  O O   . HOH DA 4 .   ? -29.590 17.623  49.945  1.00 39.68 ? 2139 HOH G O   1 
HETATM 9692  O O   . HOH DA 4 .   ? -29.580 12.846  59.359  1.00 37.36 ? 2140 HOH G O   1 
HETATM 9693  O O   . HOH EA 4 .   ? -17.351 25.628  67.834  1.00 37.71 ? 2001 HOH H O   1 
HETATM 9694  O O   . HOH EA 4 .   ? -20.777 20.876  67.693  1.00 33.50 ? 2002 HOH H O   1 
HETATM 9695  O O   . HOH EA 4 .   ? -24.718 20.351  61.483  1.00 32.84 ? 2003 HOH H O   1 
HETATM 9696  O O   . HOH EA 4 .   ? -24.450 19.945  68.881  1.00 37.39 ? 2004 HOH H O   1 
HETATM 9697  O O   . HOH EA 4 .   ? -20.972 18.343  68.684  1.00 31.25 ? 2005 HOH H O   1 
HETATM 9698  O O   . HOH EA 4 .   ? -28.686 13.331  66.747  1.00 33.39 ? 2006 HOH H O   1 
HETATM 9699  O O   . HOH EA 4 .   ? -28.355 10.538  71.650  1.00 42.93 ? 2007 HOH H O   1 
HETATM 9700  O O   . HOH EA 4 .   ? -27.857 3.292   68.474  1.00 45.89 ? 2008 HOH H O   1 
HETATM 9701  O O   . HOH EA 4 .   ? -30.546 8.974   64.231  1.00 41.72 ? 2009 HOH H O   1 
HETATM 9702  O O   . HOH FA 4 .   ? -29.664 32.356  22.152  1.00 40.45 ? 2001 HOH I O   1 
HETATM 9703  O O   . HOH FA 4 .   ? -16.537 26.282  23.912  1.00 43.64 ? 2002 HOH I O   1 
HETATM 9704  O O   . HOH FA 4 .   ? -21.284 39.495  52.050  1.00 43.88 ? 2003 HOH I O   1 
HETATM 9705  O O   . HOH FA 4 .   ? -20.821 42.099  42.290  1.00 36.08 ? 2004 HOH I O   1 
HETATM 9706  O O   . HOH FA 4 .   ? -17.103 41.333  36.067  1.00 39.83 ? 2005 HOH I O   1 
HETATM 9707  O O   . HOH FA 4 .   ? -18.738 34.577  32.867  1.00 32.66 ? 2006 HOH I O   1 
HETATM 9708  O O   . HOH FA 4 .   ? -16.434 37.553  37.304  1.00 33.25 ? 2007 HOH I O   1 
HETATM 9709  O O   . HOH FA 4 .   ? -17.869 33.621  42.687  1.00 35.55 ? 2008 HOH I O   1 
HETATM 9710  O O   . HOH FA 4 .   ? -17.378 31.795  37.824  1.00 31.30 ? 2009 HOH I O   1 
HETATM 9711  O O   . HOH FA 4 .   ? -17.924 31.605  40.652  1.00 30.77 ? 2010 HOH I O   1 
HETATM 9712  O O   . HOH FA 4 .   ? -26.994 28.122  46.811  1.00 29.72 ? 2011 HOH I O   1 
HETATM 9713  O O   . HOH FA 4 .   ? -33.951 32.512  48.484  1.00 29.01 ? 2012 HOH I O   1 
HETATM 9714  O O   . HOH FA 4 .   ? -36.413 33.437  47.003  1.00 36.01 ? 2013 HOH I O   1 
HETATM 9715  O O   . HOH FA 4 .   ? -38.599 22.323  43.390  1.00 43.34 ? 2014 HOH I O   1 
HETATM 9716  O O   . HOH FA 4 .   ? -37.451 25.156  49.279  1.00 49.05 ? 2015 HOH I O   1 
HETATM 9717  O O   . HOH FA 4 .   ? -33.182 28.075  43.139  1.00 22.74 ? 2016 HOH I O   1 
HETATM 9718  O O   . HOH FA 4 .   ? -25.632 41.739  40.735  1.00 23.04 ? 2017 HOH I O   1 
HETATM 9719  O O   . HOH FA 4 .   ? -23.235 42.088  33.678  1.00 32.47 ? 2018 HOH I O   1 
HETATM 9720  O O   . HOH FA 4 .   ? -21.214 46.137  33.165  1.00 45.93 ? 2019 HOH I O   1 
HETATM 9721  O O   . HOH FA 4 .   ? -28.850 50.583  34.739  1.00 43.09 ? 2020 HOH I O   1 
HETATM 9722  O O   . HOH FA 4 .   ? -26.424 51.384  32.669  1.00 37.44 ? 2021 HOH I O   1 
HETATM 9723  O O   . HOH FA 4 .   ? -28.441 47.621  33.114  1.00 32.08 ? 2022 HOH I O   1 
HETATM 9724  O O   . HOH FA 4 .   ? -26.029 52.412  29.794  1.00 34.11 ? 2023 HOH I O   1 
HETATM 9725  O O   . HOH FA 4 .   ? -31.403 46.148  25.417  1.00 40.18 ? 2024 HOH I O   1 
HETATM 9726  O O   . HOH FA 4 .   ? -20.737 47.702  26.013  1.00 45.31 ? 2025 HOH I O   1 
HETATM 9727  O O   . HOH FA 4 .   ? -14.118 41.494  27.653  1.00 48.24 ? 2026 HOH I O   1 
HETATM 9728  O O   . HOH FA 4 .   ? -16.024 41.100  23.960  1.00 45.19 ? 2027 HOH I O   1 
HETATM 9729  O O   . HOH FA 4 .   ? -24.614 34.890  26.216  1.00 40.45 ? 2028 HOH I O   1 
HETATM 9730  O O   . HOH FA 4 .   ? -25.829 42.593  25.628  1.00 33.53 ? 2029 HOH I O   1 
HETATM 9731  O O   . HOH FA 4 .   ? -30.134 41.861  25.967  1.00 29.71 ? 2030 HOH I O   1 
HETATM 9732  O O   . HOH FA 4 .   ? -33.818 43.716  28.073  1.00 40.55 ? 2031 HOH I O   1 
HETATM 9733  O O   . HOH FA 4 .   ? -35.975 50.313  36.141  1.00 35.55 ? 2032 HOH I O   1 
HETATM 9734  O O   . HOH FA 4 .   ? -39.150 45.849  31.863  1.00 40.33 ? 2033 HOH I O   1 
HETATM 9735  O O   . HOH FA 4 .   ? -41.203 45.913  38.603  1.00 44.57 ? 2034 HOH I O   1 
HETATM 9736  O O   . HOH FA 4 .   ? -32.090 47.799  40.809  1.00 34.84 ? 2035 HOH I O   1 
HETATM 9737  O O   . HOH FA 4 .   ? -38.567 50.100  42.627  1.00 42.57 ? 2036 HOH I O   1 
HETATM 9738  O O   . HOH FA 4 .   ? -40.061 48.160  49.125  1.00 48.90 ? 2037 HOH I O   1 
HETATM 9739  O O   . HOH FA 4 .   ? -36.716 41.385  49.631  1.00 30.94 ? 2038 HOH I O   1 
HETATM 9740  O O   . HOH FA 4 .   ? -29.213 45.304  46.192  1.00 31.95 ? 2039 HOH I O   1 
HETATM 9741  O O   . HOH FA 4 .   ? -32.894 50.079  46.964  1.00 44.13 ? 2040 HOH I O   1 
HETATM 9742  O O   . HOH FA 4 .   ? -35.252 50.267  52.604  1.00 46.15 ? 2041 HOH I O   1 
HETATM 9743  O O   . HOH FA 4 .   ? -33.435 53.728  49.146  1.00 42.43 ? 2042 HOH I O   1 
HETATM 9744  O O   . HOH FA 4 .   ? -40.696 43.410  46.379  1.00 45.86 ? 2043 HOH I O   1 
HETATM 9745  O O   . HOH FA 4 .   ? -33.707 41.209  55.947  1.00 45.60 ? 2044 HOH I O   1 
HETATM 9746  O O   . HOH FA 4 .   ? -29.692 45.671  57.449  1.00 34.27 ? 2045 HOH I O   1 
HETATM 9747  O O   . HOH FA 4 .   ? -33.324 38.887  51.488  1.00 39.88 ? 2046 HOH I O   1 
HETATM 9748  O O   . HOH FA 4 .   ? -26.492 37.811  52.943  1.00 40.92 ? 2047 HOH I O   1 
HETATM 9749  O O   . HOH FA 4 .   ? -22.789 43.575  43.537  1.00 35.02 ? 2048 HOH I O   1 
HETATM 9750  O O   . HOH FA 4 .   ? -27.623 47.239  47.468  1.00 33.18 ? 2049 HOH I O   1 
HETATM 9751  O O   . HOH FA 4 .   ? -26.083 40.052  50.557  1.00 25.99 ? 2050 HOH I O   1 
HETATM 9752  O O   . HOH FA 4 .   ? -26.795 43.881  42.679  1.00 35.01 ? 2051 HOH I O   1 
HETATM 9753  O O   . HOH FA 4 .   ? -27.458 32.545  32.989  1.00 23.89 ? 2052 HOH I O   1 
HETATM 9754  O O   . HOH FA 4 .   ? -31.765 28.553  27.915  1.00 39.01 ? 2053 HOH I O   1 
HETATM 9755  O O   . HOH FA 4 .   ? -37.438 28.137  35.339  1.00 38.23 ? 2054 HOH I O   1 
HETATM 9756  O O   . HOH FA 4 .   ? -35.012 31.084  26.052  1.00 41.42 ? 2055 HOH I O   1 
HETATM 9757  O O   . HOH FA 4 .   ? -35.121 24.714  32.614  1.00 37.23 ? 2056 HOH I O   1 
HETATM 9758  O O   . HOH FA 4 .   ? -34.266 21.687  31.029  1.00 40.27 ? 2057 HOH I O   1 
HETATM 9759  O O   . HOH FA 4 .   ? -39.997 29.197  35.674  1.00 43.75 ? 2058 HOH I O   1 
HETATM 9760  O O   . HOH FA 4 .   ? -37.215 27.952  32.170  1.00 38.28 ? 2059 HOH I O   1 
HETATM 9761  O O   . HOH FA 4 .   ? -25.264 32.839  28.296  1.00 44.18 ? 2060 HOH I O   1 
HETATM 9762  O O   . HOH FA 4 .   ? -26.954 29.045  28.035  1.00 40.07 ? 2061 HOH I O   1 
HETATM 9763  O O   . HOH FA 4 .   ? -30.573 30.909  26.444  1.00 31.09 ? 2062 HOH I O   1 
HETATM 9764  O O   . HOH FA 4 .   ? -36.218 35.743  45.644  1.00 37.92 ? 2063 HOH I O   1 
HETATM 9765  O O   . HOH FA 4 .   ? -37.684 31.871  42.452  1.00 44.70 ? 2064 HOH I O   1 
HETATM 9766  O O   . HOH FA 4 .   ? -34.353 37.547  47.611  1.00 28.41 ? 2065 HOH I O   1 
HETATM 9767  O O   . HOH FA 4 .   ? -20.267 30.764  49.440  1.00 32.76 ? 2066 HOH I O   1 
HETATM 9768  O O   . HOH FA 4 .   ? -26.900 28.989  49.755  1.00 40.52 ? 2067 HOH I O   1 
HETATM 9769  O O   . HOH FA 4 .   ? -34.779 29.745  50.319  1.00 42.07 ? 2068 HOH I O   1 
HETATM 9770  O O   . HOH FA 4 .   ? -24.080 30.931  50.782  1.00 37.34 ? 2069 HOH I O   1 
HETATM 9771  O O   . HOH FA 4 .   ? -16.578 28.606  37.518  1.00 35.36 ? 2070 HOH I O   1 
HETATM 9772  O O   . HOH FA 4 .   ? -18.117 25.026  42.848  1.00 23.60 ? 2071 HOH I O   1 
HETATM 9773  O O   . HOH FA 4 .   ? -13.854 18.867  47.176  1.00 31.98 ? 2072 HOH I O   1 
HETATM 9774  O O   . HOH FA 4 .   ? -19.065 17.951  38.477  1.00 43.31 ? 2073 HOH I O   1 
HETATM 9775  O O   . HOH FA 4 .   ? -12.521 20.035  42.845  1.00 40.90 ? 2074 HOH I O   1 
HETATM 9776  O O   . HOH FA 4 .   ? -12.479 15.343  45.162  1.00 37.45 ? 2075 HOH I O   1 
HETATM 9777  O O   . HOH FA 4 .   ? -16.315 21.786  39.227  1.00 35.59 ? 2076 HOH I O   1 
HETATM 9778  O O   . HOH FA 4 .   ? -24.029 14.594  41.528  1.00 33.50 ? 2077 HOH I O   1 
HETATM 9779  O O   . HOH FA 4 .   ? -20.828 11.630  40.441  1.00 46.46 ? 2078 HOH I O   1 
HETATM 9780  O O   . HOH FA 4 .   ? -22.746 42.198  40.711  1.00 39.56 ? 2079 HOH I O   1 
HETATM 9781  O O   . HOH FA 4 .   ? -27.790 18.170  48.417  1.00 34.64 ? 2080 HOH I O   1 
HETATM 9782  O O   . HOH FA 4 .   ? -17.181 32.127  33.162  1.00 36.70 ? 2081 HOH I O   1 
HETATM 9783  O O   . HOH FA 4 .   ? -16.000 31.445  39.527  1.00 47.55 ? 2082 HOH I O   1 
HETATM 9784  O O   . HOH FA 4 .   ? -30.064 21.487  42.988  1.00 23.34 ? 2083 HOH I O   1 
HETATM 9785  O O   . HOH FA 4 .   ? -22.975 25.397  50.151  1.00 39.86 ? 2084 HOH I O   1 
HETATM 9786  O O   . HOH FA 4 .   ? -33.628 35.173  49.314  1.00 30.36 ? 2085 HOH I O   1 
HETATM 9787  O O   . HOH FA 4 .   ? -30.989 19.031  42.164  1.00 24.48 ? 2086 HOH I O   1 
HETATM 9788  O O   . HOH FA 4 .   ? -27.345 21.243  48.528  1.00 38.77 ? 2087 HOH I O   1 
HETATM 9789  O O   . HOH FA 4 .   ? -33.346 22.222  48.272  1.00 39.66 ? 2088 HOH I O   1 
HETATM 9790  O O   . HOH FA 4 .   ? -36.907 20.084  45.459  1.00 38.35 ? 2089 HOH I O   1 
HETATM 9791  O O   . HOH FA 4 .   ? -20.476 43.334  33.751  1.00 39.19 ? 2090 HOH I O   1 
HETATM 9792  O O   . HOH FA 4 .   ? -31.834 51.549  33.666  1.00 34.61 ? 2091 HOH I O   1 
HETATM 9793  O O   . HOH FA 4 .   ? -38.526 18.189  43.582  1.00 40.86 ? 2092 HOH I O   1 
HETATM 9794  O O   . HOH FA 4 .   ? -29.277 45.099  23.876  1.00 48.04 ? 2093 HOH I O   1 
HETATM 9795  O O   . HOH FA 4 .   ? -39.345 11.110  41.326  1.00 42.19 ? 2094 HOH I O   1 
HETATM 9796  O O   . HOH FA 4 .   ? -40.056 18.901  41.154  1.00 44.01 ? 2095 HOH I O   1 
HETATM 9797  O O   . HOH FA 4 .   ? -39.726 13.541  38.681  1.00 41.34 ? 2096 HOH I O   1 
HETATM 9798  O O   . HOH FA 4 .   ? -30.097 12.751  39.823  1.00 36.02 ? 2097 HOH I O   1 
HETATM 9799  O O   . HOH FA 4 .   ? -35.926 10.896  43.396  1.00 44.61 ? 2098 HOH I O   1 
HETATM 9800  O O   . HOH FA 4 .   ? -34.014 51.657  35.536  1.00 40.77 ? 2099 HOH I O   1 
HETATM 9801  O O   . HOH FA 4 .   ? -32.507 23.262  32.430  1.00 30.35 ? 2100 HOH I O   1 
HETATM 9802  O O   . HOH FA 4 .   ? -36.087 24.617  34.768  1.00 39.53 ? 2101 HOH I O   1 
HETATM 9803  O O   . HOH FA 4 .   ? -31.019 47.279  43.056  1.00 41.88 ? 2102 HOH I O   1 
HETATM 9804  O O   . HOH FA 4 .   ? -28.564 15.333  39.414  1.00 37.99 ? 2103 HOH I O   1 
HETATM 9805  O O   . HOH FA 4 .   ? -37.338 40.943  52.426  1.00 39.60 ? 2104 HOH I O   1 
HETATM 9806  O O   . HOH FA 4 .   ? -31.131 48.968  45.059  1.00 40.97 ? 2105 HOH I O   1 
HETATM 9807  O O   . HOH FA 4 .   ? -33.261 35.852  51.968  1.00 35.52 ? 2106 HOH I O   1 
HETATM 9808  O O   . HOH FA 4 .   ? -24.772 27.813  27.730  1.00 30.68 ? 2107 HOH I O   1 
HETATM 9809  O O   . HOH FA 4 .   ? -34.738 18.765  31.961  1.00 37.32 ? 2108 HOH I O   1 
HETATM 9810  O O   . HOH FA 4 .   ? -29.237 30.585  24.059  1.00 43.17 ? 2109 HOH I O   1 
HETATM 9811  O O   . HOH FA 4 .   ? -21.179 25.009  23.899  1.00 40.24 ? 2110 HOH I O   1 
HETATM 9812  O O   . HOH FA 4 .   ? -18.928 25.875  25.236  1.00 36.24 ? 2111 HOH I O   1 
HETATM 9813  O O   . HOH FA 4 .   ? -23.082 31.702  27.085  1.00 42.45 ? 2112 HOH I O   1 
HETATM 9814  O O   . HOH FA 4 .   ? -15.239 22.612  36.785  1.00 41.26 ? 2113 HOH I O   1 
HETATM 9815  O O   . HOH FA 4 .   ? -15.982 25.294  31.486  1.00 36.25 ? 2114 HOH I O   1 
HETATM 9816  O O   . HOH FA 4 .   ? -11.391 21.821  44.529  1.00 42.48 ? 2115 HOH I O   1 
HETATM 9817  O O   . HOH FA 4 .   ? -17.515 23.080  28.643  1.00 42.01 ? 2116 HOH I O   1 
HETATM 9818  O O   . HOH FA 4 .   ? -22.852 28.978  26.353  1.00 38.22 ? 2117 HOH I O   1 
HETATM 9819  O O   . HOH FA 4 .   ? -25.981 13.990  39.644  1.00 37.26 ? 2118 HOH I O   1 
HETATM 9820  O O   . HOH FA 4 .   ? -35.123 54.014  34.339  1.00 46.45 ? 2119 HOH I O   1 
HETATM 9821  O O   . HOH GA 4 .   ? -29.496 41.965  22.783  1.00 43.13 ? 2001 HOH J O   1 
HETATM 9822  O O   . HOH GA 4 .   ? -26.137 42.338  22.788  1.00 37.31 ? 2002 HOH J O   1 
HETATM 9823  O O   . HOH GA 4 .   ? -32.151 40.093  23.005  1.00 41.67 ? 2003 HOH J O   1 
HETATM 9824  O O   . HOH GA 4 .   ? -31.602 39.548  25.798  1.00 35.90 ? 2004 HOH J O   1 
HETATM 9825  O O   . HOH GA 4 .   ? -32.687 32.554  25.614  1.00 33.45 ? 2005 HOH J O   1 
HETATM 9826  O O   . HOH GA 4 .   ? -36.353 38.952  30.970  1.00 36.94 ? 2006 HOH J O   1 
HETATM 9827  O O   . HOH GA 4 .   ? -35.389 39.238  25.873  1.00 37.55 ? 2007 HOH J O   1 
HETATM 9828  O O   . HOH GA 4 .   ? -32.517 40.460  28.420  1.00 29.60 ? 2008 HOH J O   1 
HETATM 9829  O O   . HOH GA 4 .   ? -41.084 34.901  34.347  1.00 44.86 ? 2009 HOH J O   1 
HETATM 9830  O O   . HOH GA 4 .   ? -40.589 31.904  35.953  1.00 48.20 ? 2010 HOH J O   1 
HETATM 9831  O O   . HOH GA 4 .   ? -39.871 21.861  40.937  1.00 45.65 ? 2011 HOH J O   1 
HETATM 9832  O O   . HOH GA 4 .   ? -24.018 43.578  22.415  1.00 43.63 ? 2012 HOH J O   1 
HETATM 9833  O O   . HOH HA 4 .   ? -15.517 -59.327 -42.324 1.00 40.30 ? 2001 HOH K O   1 
HETATM 9834  O O   . HOH HA 4 .   ? -12.821 -59.020 -36.432 1.00 42.60 ? 2002 HOH K O   1 
HETATM 9835  O O   . HOH HA 4 .   ? -19.428 -51.077 -44.672 1.00 32.43 ? 2003 HOH K O   1 
HETATM 9836  O O   . HOH HA 4 .   ? -25.218 -46.660 -42.401 1.00 35.52 ? 2004 HOH K O   1 
HETATM 9837  O O   . HOH HA 4 .   ? -22.938 -49.934 -44.727 1.00 37.51 ? 2005 HOH K O   1 
HETATM 9838  O O   . HOH HA 4 .   ? -23.806 -47.503 -38.825 1.00 26.13 ? 2006 HOH K O   1 
HETATM 9839  O O   . HOH HA 4 .   ? -22.797 -42.693 -36.612 1.00 31.02 ? 2007 HOH K O   1 
HETATM 9840  O O   . HOH HA 4 .   ? -19.272 -51.467 -35.522 1.00 31.50 ? 2008 HOH K O   1 
HETATM 9841  O O   . HOH HA 4 .   ? -20.891 -47.018 -33.905 1.00 27.77 ? 2009 HOH K O   1 
HETATM 9842  O O   . HOH HA 4 .   ? -19.072 -49.458 -33.886 1.00 28.92 ? 2010 HOH K O   1 
HETATM 9843  O O   . HOH HA 4 .   ? -8.029  -50.704 -33.944 1.00 28.22 ? 2011 HOH K O   1 
HETATM 9844  O O   . HOH HA 4 .   ? -2.944  -50.394 -40.657 1.00 28.77 ? 2012 HOH K O   1 
HETATM 9845  O O   . HOH HA 4 .   ? -0.482  -51.086 -38.183 1.00 34.59 ? 2013 HOH K O   1 
HETATM 9846  O O   . HOH HA 4 .   ? 2.882   -48.704 -35.925 1.00 43.27 ? 2014 HOH K O   1 
HETATM 9847  O O   . HOH HA 4 .   ? -0.487  -44.525 -42.158 1.00 34.61 ? 2015 HOH K O   1 
HETATM 9848  O O   . HOH HA 4 .   ? -1.715  -48.466 -42.352 1.00 36.03 ? 2016 HOH K O   1 
HETATM 9849  O O   . HOH HA 4 .   ? 3.914   -43.254 -44.908 1.00 40.95 ? 2017 HOH K O   1 
HETATM 9850  O O   . HOH HA 4 .   ? 2.381   -42.337 -32.641 1.00 43.65 ? 2018 HOH K O   1 
HETATM 9851  O O   . HOH HA 4 .   ? 2.177   -37.339 -38.230 1.00 43.13 ? 2019 HOH K O   1 
HETATM 9852  O O   . HOH HA 4 .   ? 2.366   -45.485 -33.143 1.00 40.75 ? 2020 HOH K O   1 
HETATM 9853  O O   . HOH HA 4 .   ? -4.267  -45.087 -36.313 1.00 22.01 ? 2021 HOH K O   1 
HETATM 9854  O O   . HOH HA 4 .   ? -16.207 -48.024 -46.119 1.00 23.84 ? 2022 HOH K O   1 
HETATM 9855  O O   . HOH HA 4 .   ? -21.134 -42.437 -45.467 1.00 24.24 ? 2023 HOH K O   1 
HETATM 9856  O O   . HOH HA 4 .   ? -24.101 -43.374 -48.732 1.00 39.80 ? 2024 HOH K O   1 
HETATM 9857  O O   . HOH HA 4 .   ? -20.249 -48.705 -47.256 1.00 37.11 ? 2025 HOH K O   1 
HETATM 9858  O O   . HOH HA 4 .   ? -21.013 -48.599 -50.628 1.00 44.59 ? 2026 HOH K O   1 
HETATM 9859  O O   . HOH HA 4 .   ? -18.540 -40.601 -52.658 1.00 38.29 ? 2027 HOH K O   1 
HETATM 9860  O O   . HOH HA 4 .   ? -27.864 -33.703 -49.445 1.00 44.71 ? 2028 HOH K O   1 
HETATM 9861  O O   . HOH HA 4 .   ? -24.353 -32.348 -45.608 1.00 43.68 ? 2029 HOH K O   1 
HETATM 9862  O O   . HOH HA 4 .   ? -29.450 -43.732 -38.047 1.00 40.32 ? 2030 HOH K O   1 
HETATM 9863  O O   . HOH HA 4 .   ? -30.671 -35.901 -42.010 1.00 33.22 ? 2031 HOH K O   1 
HETATM 9864  O O   . HOH HA 4 .   ? -21.920 -33.558 -46.550 1.00 34.08 ? 2032 HOH K O   1 
HETATM 9865  O O   . HOH HA 4 .   ? -14.356 -33.839 -47.538 1.00 32.14 ? 2033 HOH K O   1 
HETATM 9866  O O   . HOH HA 4 .   ? -17.962 -32.513 -47.920 1.00 33.32 ? 2034 HOH K O   1 
HETATM 9867  O O   . HOH HA 4 .   ? -14.684 -34.133 -51.149 1.00 36.78 ? 2035 HOH K O   1 
HETATM 9868  O O   . HOH HA 4 .   ? -12.291 -34.192 -54.955 1.00 43.59 ? 2036 HOH K O   1 
HETATM 9869  O O   . HOH HA 4 .   ? -9.371  -35.123 -55.071 1.00 43.97 ? 2037 HOH K O   1 
HETATM 9870  O O   . HOH HA 4 .   ? -12.781 -46.377 -53.948 1.00 35.15 ? 2038 HOH K O   1 
HETATM 9871  O O   . HOH HA 4 .   ? -3.037  -51.950 -49.928 1.00 37.24 ? 2039 HOH K O   1 
HETATM 9872  O O   . HOH HA 4 .   ? -12.076 -51.873 -50.619 1.00 27.74 ? 2040 HOH K O   1 
HETATM 9873  O O   . HOH HA 4 .   ? -6.481  -56.740 -57.833 1.00 45.73 ? 2041 HOH K O   1 
HETATM 9874  O O   . HOH HA 4 .   ? -10.462 -51.732 -59.077 1.00 49.00 ? 2042 HOH K O   1 
HETATM 9875  O O   . HOH HA 4 .   ? -7.780  -62.131 -51.479 1.00 35.38 ? 2043 HOH K O   1 
HETATM 9876  O O   . HOH HA 4 .   ? -9.464  -61.047 -49.067 1.00 36.62 ? 2044 HOH K O   1 
HETATM 9877  O O   . HOH HA 4 .   ? -3.815  -54.782 -46.096 1.00 40.61 ? 2045 HOH K O   1 
HETATM 9878  O O   . HOH HA 4 .   ? -17.572 -51.498 -46.795 1.00 40.76 ? 2046 HOH K O   1 
HETATM 9879  O O   . HOH HA 4 .   ? -13.598 -53.887 -51.741 1.00 34.78 ? 2047 HOH K O   1 
HETATM 9880  O O   . HOH HA 4 .   ? -11.369 -59.137 -47.997 1.00 27.76 ? 2048 HOH K O   1 
HETATM 9881  O O   . HOH HA 4 .   ? -11.350 -56.454 -44.508 1.00 26.59 ? 2049 HOH K O   1 
HETATM 9882  O O   . HOH HA 4 .   ? -15.091 -49.499 -48.420 1.00 31.33 ? 2050 HOH K O   1 
HETATM 9883  O O   . HOH HA 4 .   ? -14.751 -38.588 -38.178 1.00 19.12 ? 2051 HOH K O   1 
HETATM 9884  O O   . HOH HA 4 .   ? -12.541 -33.686 -34.941 1.00 36.96 ? 2052 HOH K O   1 
HETATM 9885  O O   . HOH HA 4 .   ? -3.892  -35.902 -37.620 1.00 41.71 ? 2053 HOH K O   1 
HETATM 9886  O O   . HOH HA 4 .   ? -12.272 -31.780 -36.089 1.00 41.03 ? 2054 HOH K O   1 
HETATM 9887  O O   . HOH HA 4 .   ? -5.977  -34.014 -33.587 1.00 30.05 ? 2055 HOH K O   1 
HETATM 9888  O O   . HOH HA 4 .   ? -3.321  -30.986 -35.673 1.00 44.88 ? 2056 HOH K O   1 
HETATM 9889  O O   . HOH HA 4 .   ? -5.112  -33.438 -37.204 1.00 33.82 ? 2057 HOH K O   1 
HETATM 9890  O O   . HOH HA 4 .   ? -14.240 -31.454 -37.736 1.00 38.54 ? 2058 HOH K O   1 
HETATM 9891  O O   . HOH HA 4 .   ? -17.256 -34.523 -35.457 1.00 36.38 ? 2059 HOH K O   1 
HETATM 9892  O O   . HOH HA 4 .   ? -3.198  -47.836 -44.819 1.00 32.77 ? 2060 HOH K O   1 
HETATM 9893  O O   . HOH HA 4 .   ? -4.447  -50.348 -45.380 1.00 27.99 ? 2061 HOH K O   1 
HETATM 9894  O O   . HOH HA 4 .   ? -13.465 -56.249 -33.636 1.00 31.63 ? 2062 HOH K O   1 
HETATM 9895  O O   . HOH HA 4 .   ? -5.691  -57.939 -42.864 1.00 39.48 ? 2063 HOH K O   1 
HETATM 9896  O O   . HOH HA 4 .   ? -6.850  -53.121 -34.734 1.00 38.54 ? 2064 HOH K O   1 
HETATM 9897  O O   . HOH HA 4 .   ? 0.190   -55.305 -40.070 1.00 44.53 ? 2065 HOH K O   1 
HETATM 9898  O O   . HOH HA 4 .   ? -4.122  -53.562 -35.292 1.00 45.64 ? 2066 HOH K O   1 
HETATM 9899  O O   . HOH HA 4 .   ? -9.949  -56.155 -35.472 1.00 31.55 ? 2067 HOH K O   1 
HETATM 9900  O O   . HOH HA 4 .   ? -20.561 -46.662 -30.291 1.00 30.81 ? 2068 HOH K O   1 
HETATM 9901  O O   . HOH HA 4 .   ? -19.678 -49.002 -23.491 1.00 35.53 ? 2069 HOH K O   1 
HETATM 9902  O O   . HOH HA 4 .   ? -19.582 -55.137 -25.443 1.00 47.18 ? 2070 HOH K O   1 
HETATM 9903  O O   . HOH HA 4 .   ? -18.799 -51.757 -21.358 1.00 32.90 ? 2071 HOH K O   1 
HETATM 9904  O O   . HOH HA 4 .   ? -15.732 -52.605 -16.529 1.00 38.77 ? 2072 HOH K O   1 
HETATM 9905  O O   . HOH HA 4 .   ? -16.060 -53.283 -20.254 1.00 37.03 ? 2073 HOH K O   1 
HETATM 9906  O O   . HOH HA 4 .   ? -14.856 -55.510 -20.494 1.00 31.22 ? 2074 HOH K O   1 
HETATM 9907  O O   . HOH HA 4 .   ? -15.687 -50.400 -27.715 1.00 20.66 ? 2075 HOH K O   1 
HETATM 9908  O O   . HOH HA 4 .   ? -17.576 -47.668 -24.117 1.00 28.17 ? 2076 HOH K O   1 
HETATM 9909  O O   . HOH HA 4 .   ? -7.886  -45.109 -20.323 1.00 26.82 ? 2077 HOH K O   1 
HETATM 9910  O O   . HOH HA 4 .   ? -3.059  -50.192 -25.182 1.00 32.77 ? 2078 HOH K O   1 
HETATM 9911  O O   . HOH HA 4 .   ? -2.670  -53.004 -25.495 1.00 36.08 ? 2079 HOH K O   1 
HETATM 9912  O O   . HOH HA 4 .   ? -23.069 -43.368 -33.969 1.00 34.33 ? 2080 HOH K O   1 
HETATM 9913  O O   . HOH HA 4 .   ? -20.142 -53.720 -34.553 1.00 42.34 ? 2081 HOH K O   1 
HETATM 9914  O O   . HOH HA 4 .   ? -22.097 -45.679 -32.297 1.00 38.29 ? 2082 HOH K O   1 
HETATM 9915  O O   . HOH HA 4 .   ? -4.463  -44.933 -28.957 1.00 20.07 ? 2083 HOH K O   1 
HETATM 9916  O O   . HOH HA 4 .   ? -8.868  -55.028 -29.777 1.00 38.03 ? 2084 HOH K O   1 
HETATM 9917  O O   . HOH HA 4 .   ? -3.599  -51.721 -43.065 1.00 37.76 ? 2085 HOH K O   1 
HETATM 9918  O O   . HOH HA 4 .   ? 1.518   -46.584 -29.308 1.00 38.21 ? 2086 HOH K O   1 
HETATM 9919  O O   . HOH HA 4 .   ? 0.492   -48.257 -31.215 1.00 36.57 ? 2087 HOH K O   1 
HETATM 9920  O O   . HOH HA 4 .   ? -3.364  -43.327 -26.955 1.00 21.81 ? 2088 HOH K O   1 
HETATM 9921  O O   . HOH HA 4 .   ? 2.332   -44.038 -29.819 1.00 41.25 ? 2089 HOH K O   1 
HETATM 9922  O O   . HOH HA 4 .   ? -23.545 -43.523 -45.764 1.00 39.63 ? 2090 HOH K O   1 
HETATM 9923  O O   . HOH HA 4 .   ? -2.355  -37.176 -21.870 1.00 41.26 ? 2091 HOH K O   1 
HETATM 9924  O O   . HOH HA 4 .   ? 0.377   -32.881 -23.772 1.00 44.75 ? 2092 HOH K O   1 
HETATM 9925  O O   . HOH HA 4 .   ? 5.149   -38.402 -22.464 1.00 37.56 ? 2093 HOH K O   1 
HETATM 9926  O O   . HOH HA 4 .   ? 4.095   -35.396 -24.891 1.00 33.84 ? 2094 HOH K O   1 
HETATM 9927  O O   . HOH HA 4 .   ? -2.190  -33.164 -27.778 1.00 32.75 ? 2095 HOH K O   1 
HETATM 9928  O O   . HOH HA 4 .   ? -29.609 -45.795 -39.918 1.00 43.67 ? 2096 HOH K O   1 
HETATM 9929  O O   . HOH HA 4 .   ? -3.234  -40.805 -20.665 1.00 37.36 ? 2097 HOH K O   1 
HETATM 9930  O O   . HOH HA 4 .   ? -1.562  -38.625 -20.086 1.00 47.13 ? 2098 HOH K O   1 
HETATM 9931  O O   . HOH HA 4 .   ? -17.321 -32.182 -50.704 1.00 40.87 ? 2099 HOH K O   1 
HETATM 9932  O O   . HOH HA 4 .   ? -7.681  -34.832 -31.381 1.00 27.77 ? 2100 HOH K O   1 
HETATM 9933  O O   . HOH HA 4 .   ? -5.008  -41.722 -22.299 1.00 31.48 ? 2101 HOH K O   1 
HETATM 9934  O O   . HOH HA 4 .   ? -4.899  -36.341 -21.598 1.00 37.37 ? 2102 HOH K O   1 
HETATM 9935  O O   . HOH HA 4 .   ? -1.159  -54.159 -49.812 1.00 43.51 ? 2103 HOH K O   1 
HETATM 9936  O O   . HOH HA 4 .   ? -3.773  -52.176 -47.082 1.00 39.56 ? 2104 HOH K O   1 
HETATM 9937  O O   . HOH HA 4 .   ? -2.715  -54.209 -43.566 1.00 39.95 ? 2105 HOH K O   1 
HETATM 9938  O O   . HOH HA 4 .   ? -16.933 -50.296 -50.065 1.00 42.06 ? 2106 HOH K O   1 
HETATM 9939  O O   . HOH HA 4 .   ? -10.571 -37.525 -20.901 1.00 29.44 ? 2107 HOH K O   1 
HETATM 9940  O O   . HOH HA 4 .   ? -17.935 -34.554 -32.779 1.00 27.55 ? 2108 HOH K O   1 
HETATM 9941  O O   . HOH HA 4 .   ? -7.765  -30.116 -30.202 1.00 37.87 ? 2109 HOH K O   1 
HETATM 9942  O O   . HOH HA 4 .   ? -6.146  -32.592 -30.381 1.00 34.13 ? 2110 HOH K O   1 
HETATM 9943  O O   . HOH HA 4 .   ? -22.615 -40.875 -27.032 1.00 31.82 ? 2111 HOH K O   1 
HETATM 9944  O O   . HOH HA 4 .   ? -21.404 -31.899 -28.854 1.00 33.43 ? 2112 HOH K O   1 
HETATM 9945  O O   . HOH HA 4 .   ? -23.056 -34.324 -28.725 1.00 23.58 ? 2113 HOH K O   1 
HETATM 9946  O O   . HOH HA 4 .   ? -17.515 -30.006 -28.510 1.00 39.31 ? 2114 HOH K O   1 
HETATM 9947  O O   . HOH HA 4 .   ? -15.958 -56.759 -31.814 1.00 47.00 ? 2115 HOH K O   1 
HETATM 9948  O O   . HOH HA 4 .   ? -22.830 -40.910 -38.240 1.00 30.71 ? 2116 HOH K O   1 
HETATM 9949  O O   . HOH HA 4 .   ? -19.990 -45.437 -24.389 1.00 34.91 ? 2117 HOH K O   1 
HETATM 9950  O O   . HOH HA 4 .   ? -22.757 -48.286 -29.008 1.00 38.44 ? 2118 HOH K O   1 
HETATM 9951  O O   . HOH HA 4 .   ? -21.933 -37.161 -25.776 1.00 28.91 ? 2119 HOH K O   1 
HETATM 9952  O O   . HOH HA 4 .   ? -6.853  -42.580 -20.469 1.00 32.73 ? 2120 HOH K O   1 
HETATM 9953  O O   . HOH HA 4 .   ? -0.335  -50.665 -25.456 1.00 36.27 ? 2121 HOH K O   1 
HETATM 9954  O O   . HOH HA 4 .   ? -24.959 -41.307 -26.796 1.00 40.59 ? 2122 HOH K O   1 
HETATM 9955  O O   . HOH HA 4 .   ? -25.588 -34.134 -27.961 1.00 39.26 ? 2123 HOH K O   1 
HETATM 9956  O O   . HOH IA 4 .   ? -15.862 -31.566 -46.650 1.00 38.10 ? 2001 HOH L O   1 
HETATM 9957  O O   . HOH IA 4 .   ? -12.061 -29.701 -40.332 1.00 38.77 ? 2002 HOH L O   1 
HETATM 9958  O O   . HOH IA 4 .   ? -4.543  -34.047 -44.967 1.00 43.08 ? 2003 HOH L O   1 
HETATM 9959  O O   . HOH IA 4 .   ? 2.877   -37.011 -41.332 1.00 38.02 ? 2004 HOH L O   1 
HETATM 9960  O O   . HOH IA 4 .   ? 7.135   -35.915 -46.767 1.00 40.83 ? 2005 HOH L O   1 
HETATM 9961  O O   . HOH IA 4 .   ? 5.043   -35.418 -45.631 1.00 44.42 ? 2006 HOH L O   1 
HETATM 9962  O O   . HOH JA 4 .   ? -12.758 -62.216 -3.818  1.00 39.97 ? 2001 HOH M O   1 
HETATM 9963  O O   . HOH JA 4 .   ? -2.636  -62.569 2.256   1.00 43.13 ? 2002 HOH M O   1 
HETATM 9964  O O   . HOH JA 4 .   ? -1.872  -65.226 3.015   1.00 50.08 ? 2003 HOH M O   1 
HETATM 9965  O O   . HOH JA 4 .   ? -11.104 -64.880 -1.739  1.00 47.87 ? 2004 HOH M O   1 
HETATM 9966  O O   . HOH JA 4 .   ? -5.980  -72.656 -6.776  1.00 36.70 ? 2005 HOH M O   1 
HETATM 9967  O O   . HOH JA 4 .   ? -10.931 -74.376 -6.812  1.00 46.95 ? 2006 HOH M O   1 
HETATM 9968  O O   . HOH JA 4 .   ? -11.436 -72.779 -11.774 1.00 36.07 ? 2007 HOH M O   1 
HETATM 9969  O O   . HOH JA 4 .   ? -8.944  -74.074 -8.278  1.00 37.16 ? 2008 HOH M O   1 
HETATM 9970  O O   . HOH JA 4 .   ? -11.218 -66.477 -15.862 1.00 26.48 ? 2009 HOH M O   1 
HETATM 9971  O O   . HOH JA 4 .   ? -12.176 -68.829 -10.862 1.00 32.69 ? 2010 HOH M O   1 
HETATM 9972  O O   . HOH JA 4 .   ? -11.639 -67.600 -5.602  1.00 37.69 ? 2011 HOH M O   1 
HETATM 9973  O O   . HOH JA 4 .   ? -10.210 -64.564 -6.064  1.00 33.84 ? 2012 HOH M O   1 
HETATM 9974  O O   . HOH JA 4 .   ? -10.661 -62.774 -8.171  1.00 24.86 ? 2013 HOH M O   1 
HETATM 9975  O O   . HOH JA 4 .   ? -11.812 -63.212 -10.844 1.00 26.13 ? 2014 HOH M O   1 
HETATM 9976  O O   . HOH JA 4 .   ? 6.746   -61.514 -4.399  1.00 33.09 ? 2015 HOH M O   1 
HETATM 9977  O O   . HOH JA 4 .   ? 7.566   -57.947 -2.922  1.00 47.45 ? 2016 HOH M O   1 
HETATM 9978  O O   . HOH JA 4 .   ? 11.635  -59.020 -9.274  1.00 45.58 ? 2017 HOH M O   1 
HETATM 9979  O O   . HOH JA 4 .   ? 9.290   -55.344 -3.786  1.00 45.37 ? 2018 HOH M O   1 
HETATM 9980  O O   . HOH JA 4 .   ? 8.815   -51.781 -12.559 1.00 42.28 ? 2019 HOH M O   1 
HETATM 9981  O O   . HOH JA 4 .   ? 9.786   -56.408 -16.687 1.00 46.58 ? 2020 HOH M O   1 
HETATM 9982  O O   . HOH JA 4 .   ? 4.221   -57.528 -9.813  1.00 23.06 ? 2021 HOH M O   1 
HETATM 9983  O O   . HOH JA 4 .   ? 0.327   -51.468 -9.545  1.00 23.97 ? 2022 HOH M O   1 
HETATM 9984  O O   . HOH JA 4 .   ? -2.179  -72.040 -9.422  1.00 25.34 ? 2023 HOH M O   1 
HETATM 9985  O O   . HOH JA 4 .   ? -6.020  -73.261 -15.668 1.00 28.81 ? 2024 HOH M O   1 
HETATM 9986  O O   . HOH JA 4 .   ? -7.614  -77.298 -15.626 1.00 40.78 ? 2025 HOH M O   1 
HETATM 9987  O O   . HOH JA 4 .   ? -8.830  -76.242 -11.700 1.00 42.91 ? 2026 HOH M O   1 
HETATM 9988  O O   . HOH JA 4 .   ? -0.733  -78.489 -17.288 1.00 40.54 ? 2027 HOH M O   1 
HETATM 9989  O O   . HOH JA 4 .   ? -1.373  -77.216 -25.450 1.00 43.99 ? 2028 HOH M O   1 
HETATM 9990  O O   . HOH JA 4 .   ? 2.096   -80.601 -22.968 1.00 49.67 ? 2029 HOH M O   1 
HETATM 9991  O O   . HOH JA 4 .   ? -8.153  -74.008 -25.894 1.00 40.51 ? 2030 HOH M O   1 
HETATM 9992  O O   . HOH JA 4 .   ? -16.139 -74.016 -19.473 1.00 45.60 ? 2031 HOH M O   1 
HETATM 9993  O O   . HOH JA 4 .   ? -16.104 -73.885 -22.732 1.00 44.38 ? 2032 HOH M O   1 
HETATM 9994  O O   . HOH JA 4 .   ? -7.475  -66.365 -23.768 1.00 40.51 ? 2033 HOH M O   1 
HETATM 9995  O O   . HOH JA 4 .   ? -5.777  -73.834 -24.298 1.00 34.30 ? 2034 HOH M O   1 
HETATM 9996  O O   . HOH JA 4 .   ? -1.335  -72.956 -24.822 1.00 31.61 ? 2035 HOH M O   1 
HETATM 9997  O O   . HOH JA 4 .   ? 7.524   -80.148 -15.774 1.00 47.56 ? 2036 HOH M O   1 
HETATM 9998  O O   . HOH JA 4 .   ? 9.301   -75.929 -21.775 1.00 48.61 ? 2037 HOH M O   1 
HETATM 9999  O O   . HOH JA 4 .   ? 10.814  -70.162 -3.783  1.00 39.94 ? 2038 HOH M O   1 
HETATM 10000 O O   . HOH JA 4 .   ? 3.124   -75.019 -4.805  1.00 38.01 ? 2039 HOH M O   1 
HETATM 10001 O O   . HOH JA 4 .   ? 4.148   -76.818 -7.827  1.00 43.38 ? 2040 HOH M O   1 
HETATM 10002 O O   . HOH JA 4 .   ? 1.515   -67.721 1.827   1.00 40.96 ? 2041 HOH M O   1 
HETATM 10003 O O   . HOH JA 4 .   ? 1.728   -72.723 2.411   1.00 33.51 ? 2042 HOH M O   1 
HETATM 10004 O O   . HOH JA 4 .   ? 1.973   -76.547 -3.014  1.00 39.48 ? 2043 HOH M O   1 
HETATM 10005 O O   . HOH JA 4 .   ? -3.669  -73.769 -6.004  1.00 42.46 ? 2044 HOH M O   1 
HETATM 10006 O O   . HOH JA 4 .   ? -0.358  -73.791 -7.979  1.00 37.37 ? 2045 HOH M O   1 
HETATM 10007 O O   . HOH JA 4 .   ? -3.275  -63.396 -17.997 1.00 23.34 ? 2046 HOH M O   1 
HETATM 10008 O O   . HOH JA 4 .   ? -2.928  -59.387 -21.935 1.00 34.33 ? 2047 HOH M O   1 
HETATM 10009 O O   . HOH JA 4 .   ? -0.922  -59.278 -23.790 1.00 39.07 ? 2048 HOH M O   1 
HETATM 10010 O O   . HOH JA 4 .   ? 6.308   -57.160 -18.307 1.00 45.02 ? 2049 HOH M O   1 
HETATM 10011 O O   . HOH JA 4 .   ? 3.064   -54.913 -20.911 1.00 33.44 ? 2050 HOH M O   1 
HETATM 10012 O O   . HOH JA 4 .   ? 1.745   -61.814 -26.571 1.00 43.37 ? 2051 HOH M O   1 
HETATM 10013 O O   . HOH JA 4 .   ? 5.396   -57.822 -21.536 1.00 37.58 ? 2052 HOH M O   1 
HETATM 10014 O O   . HOH JA 4 .   ? 4.677   -63.772 -25.747 1.00 39.09 ? 2053 HOH M O   1 
HETATM 10015 O O   . HOH JA 4 .   ? 9.172   -58.728 -18.451 1.00 43.46 ? 2054 HOH M O   1 
HETATM 10016 O O   . HOH JA 4 .   ? -5.404  -60.359 -22.768 1.00 33.41 ? 2055 HOH M O   1 
HETATM 10017 O O   . HOH JA 4 .   ? -2.083  -61.917 -24.963 1.00 33.30 ? 2056 HOH M O   1 
HETATM 10018 O O   . HOH JA 4 .   ? -6.557  -64.959 -21.419 1.00 40.38 ? 2057 HOH M O   1 
HETATM 10019 O O   . HOH JA 4 .   ? 9.077   -61.505 -11.358 1.00 39.35 ? 2058 HOH M O   1 
HETATM 10020 O O   . HOH JA 4 .   ? 7.590   -66.253 -5.595  1.00 31.40 ? 2059 HOH M O   1 
HETATM 10021 O O   . HOH JA 4 .   ? -6.479  -61.120 -0.439  1.00 33.25 ? 2060 HOH M O   1 
HETATM 10022 O O   . HOH JA 4 .   ? 0.456   -69.455 -0.361  1.00 30.12 ? 2061 HOH M O   1 
HETATM 10023 O O   . HOH JA 4 .   ? 0.221   -58.394 -2.226  1.00 39.43 ? 2062 HOH M O   1 
HETATM 10024 O O   . HOH JA 4 .   ? -0.837  -57.980 -4.798  1.00 27.35 ? 2063 HOH M O   1 
HETATM 10025 O O   . HOH JA 4 .   ? -2.660  -60.790 0.079   1.00 36.16 ? 2064 HOH M O   1 
HETATM 10026 O O   . HOH JA 4 .   ? -9.741  -58.022 -3.308  1.00 33.12 ? 2065 HOH M O   1 
HETATM 10027 O O   . HOH JA 4 .   ? -13.008 -60.269 -11.120 1.00 27.07 ? 2066 HOH M O   1 
HETATM 10028 O O   . HOH JA 4 .   ? -16.518 -51.601 -5.562  1.00 32.93 ? 2067 HOH M O   1 
HETATM 10029 O O   . HOH JA 4 .   ? -14.633 -45.283 -6.002  1.00 41.80 ? 2068 HOH M O   1 
HETATM 10030 O O   . HOH JA 4 .   ? -10.675 -55.921 -6.341  1.00 21.62 ? 2069 HOH M O   1 
HETATM 10031 O O   . HOH JA 4 .   ? -6.607  -45.278 -9.942  1.00 30.07 ? 2070 HOH M O   1 
HETATM 10032 O O   . HOH JA 4 .   ? -10.283 -74.484 -13.926 1.00 43.58 ? 2071 HOH M O   1 
HETATM 10033 O O   . HOH JA 4 .   ? -0.947  -48.316 -3.919  1.00 30.96 ? 2072 HOH M O   1 
HETATM 10034 O O   . HOH JA 4 .   ? -1.300  -48.762 -0.708  1.00 37.13 ? 2073 HOH M O   1 
HETATM 10035 O O   . HOH JA 4 .   ? -13.041 -64.063 -15.170 1.00 34.69 ? 2074 HOH M O   1 
HETATM 10036 O O   . HOH JA 4 .   ? -13.152 -63.690 -9.171  1.00 41.27 ? 2075 HOH M O   1 
HETATM 10037 O O   . HOH JA 4 .   ? -1.309  -55.971 -3.913  1.00 40.26 ? 2076 HOH M O   1 
HETATM 10038 O O   . HOH JA 4 .   ? 6.979   -64.380 -3.468  1.00 36.55 ? 2077 HOH M O   1 
HETATM 10039 O O   . HOH JA 4 .   ? 3.245   -46.832 -3.907  1.00 35.11 ? 2078 HOH M O   1 
HETATM 10040 O O   . HOH JA 4 .   ? -1.007  -50.856 -3.753  1.00 39.02 ? 2079 HOH M O   1 
HETATM 10041 O O   . HOH JA 4 .   ? 5.772   -51.216 -5.654  1.00 43.39 ? 2080 HOH M O   1 
HETATM 10042 O O   . HOH JA 4 .   ? 0.787   -48.969 -10.844 1.00 20.81 ? 2081 HOH M O   1 
HETATM 10043 O O   . HOH JA 4 .   ? 7.026   -49.106 -9.177  1.00 38.15 ? 2082 HOH M O   1 
HETATM 10044 O O   . HOH JA 4 .   ? -8.284  -74.752 -15.293 1.00 39.87 ? 2083 HOH M O   1 
HETATM 10045 O O   . HOH JA 4 .   ? 0.704   -43.400 -16.333 1.00 38.72 ? 2084 HOH M O   1 
HETATM 10046 O O   . HOH JA 4 .   ? 0.128   -40.828 -14.534 1.00 48.12 ? 2085 HOH M O   1 
HETATM 10047 O O   . HOH JA 4 .   ? 4.335   -48.163 -20.473 1.00 35.85 ? 2086 HOH M O   1 
HETATM 10048 O O   . HOH JA 4 .   ? 7.460   -42.553 -16.784 1.00 38.25 ? 2087 HOH M O   1 
HETATM 10049 O O   . HOH JA 4 .   ? -0.986  -43.145 -13.356 1.00 41.18 ? 2088 HOH M O   1 
HETATM 10050 O O   . HOH JA 4 .   ? 5.226   -39.740 -12.074 1.00 47.15 ? 2089 HOH M O   1 
HETATM 10051 O O   . HOH JA 4 .   ? 2.301   -49.477 -21.643 1.00 36.90 ? 2090 HOH M O   1 
HETATM 10052 O O   . HOH JA 4 .   ? 0.520   -53.607 -20.146 1.00 25.84 ? 2091 HOH M O   1 
HETATM 10053 O O   . HOH JA 4 .   ? 4.674   -54.571 -18.951 1.00 45.08 ? 2092 HOH M O   1 
HETATM 10054 O O   . HOH JA 4 .   ? -2.491  -45.712 -12.969 1.00 37.22 ? 2093 HOH M O   1 
HETATM 10055 O O   . HOH JA 4 .   ? -1.397  -44.053 -17.773 1.00 43.91 ? 2094 HOH M O   1 
HETATM 10056 O O   . HOH JA 4 .   ? 8.755   -68.130 -3.768  1.00 40.12 ? 2095 HOH M O   1 
HETATM 10057 O O   . HOH JA 4 .   ? -7.629  -46.263 -17.280 1.00 33.75 ? 2096 HOH M O   1 
HETATM 10058 O O   . HOH JA 4 .   ? -7.847  -59.434 -22.581 1.00 29.71 ? 2097 HOH M O   1 
HETATM 10059 O O   . HOH JA 4 .   ? 1.708   -51.852 -21.943 1.00 32.55 ? 2098 HOH M O   1 
HETATM 10060 O O   . HOH JA 4 .   ? -3.937  -61.807 -27.088 1.00 45.38 ? 2099 HOH M O   1 
HETATM 10061 O O   . HOH JA 4 .   ? -15.630 -57.374 -17.064 1.00 30.83 ? 2100 HOH M O   1 
HETATM 10062 O O   . HOH JA 4 .   ? -14.194 -58.274 -23.661 1.00 33.78 ? 2101 HOH M O   1 
HETATM 10063 O O   . HOH JA 4 .   ? -12.275 -57.122 -25.707 1.00 39.09 ? 2102 HOH M O   1 
HETATM 10064 O O   . HOH JA 4 .   ? -11.470 -59.605 -2.274  1.00 38.40 ? 2103 HOH M O   1 
HETATM 10065 O O   . HOH JA 4 .   ? -8.930  -58.071 -0.594  1.00 40.10 ? 2104 HOH M O   1 
HETATM 10066 O O   . HOH JA 4 .   ? -5.065  -44.852 -12.036 1.00 35.85 ? 2105 HOH M O   1 
HETATM 10067 O O   . HOH JA 4 .   ? 1.293   -47.327 -2.688  1.00 36.07 ? 2106 HOH M O   1 
HETATM 10068 O O   . HOH JA 4 .   ? -17.406 -60.271 -11.868 1.00 41.38 ? 2107 HOH M O   1 
HETATM 10069 O O   . HOH JA 4 .   ? 2.788   -49.898 -2.226  1.00 43.80 ? 2108 HOH M O   1 
HETATM 10070 O O   . HOH KA 4 .   ? -0.247  -70.704 -25.479 1.00 36.66 ? 2001 HOH N O   1 
HETATM 10071 O O   . HOH KA 4 .   ? 0.062   -63.626 -26.071 1.00 39.24 ? 2002 HOH N O   1 
HETATM 10072 O O   . HOH KA 4 .   ? 1.242   -70.902 -23.292 1.00 35.70 ? 2003 HOH N O   1 
HETATM 10073 O O   . HOH KA 4 .   ? 3.779   -70.067 -25.907 1.00 43.67 ? 2004 HOH N O   1 
HETATM 10074 O O   . HOH KA 4 .   ? 5.583   -69.003 -21.664 1.00 40.86 ? 2005 HOH N O   1 
HETATM 10075 O O   . HOH KA 4 .   ? 16.778  -58.532 -13.861 1.00 42.36 ? 2006 HOH N O   1 
HETATM 10076 O O   . HOH LA 4 .   ? -20.157 17.404  4.132   1.00 44.16 ? 2001 HOH O O   1 
HETATM 10077 O O   . HOH LA 4 .   ? -16.949 16.336  3.665   1.00 48.63 ? 2002 HOH O O   1 
HETATM 10078 O O   . HOH LA 4 .   ? -14.181 13.756  9.524   1.00 40.18 ? 2003 HOH O O   1 
HETATM 10079 O O   . HOH LA 4 .   ? -17.776 18.544  13.484  1.00 39.24 ? 2004 HOH O O   1 
HETATM 10080 O O   . HOH LA 4 .   ? -15.797 13.995  14.829  1.00 33.34 ? 2005 HOH O O   1 
HETATM 10081 O O   . HOH LA 4 .   ? -17.419 16.318  14.920  1.00 34.74 ? 2006 HOH O O   1 
HETATM 10082 O O   . HOH LA 4 .   ? -32.660 12.601  17.057  1.00 45.40 ? 2007 HOH O O   1 
HETATM 10083 O O   . HOH LA 4 .   ? -30.542 13.088  23.558  1.00 33.34 ? 2008 HOH O O   1 
HETATM 10084 O O   . HOH LA 4 .   ? -18.611 8.574   4.099   1.00 34.74 ? 2009 HOH O O   1 
HETATM 10085 O O   . HOH LA 4 .   ? -22.226 6.229   -1.976  1.00 37.66 ? 2010 HOH O O   1 
HETATM 10086 O O   . HOH LA 4 .   ? -23.507 7.694   -5.236  1.00 40.57 ? 2011 HOH O O   1 
HETATM 10087 O O   . HOH LA 4 .   ? -20.270 7.236   -5.635  1.00 41.10 ? 2012 HOH O O   1 
HETATM 10088 O O   . HOH LA 4 .   ? -17.430 0.109   3.044   1.00 42.05 ? 2013 HOH O O   1 
HETATM 10089 O O   . HOH LA 4 .   ? -21.652 -1.391  2.912   1.00 32.78 ? 2014 HOH O O   1 
HETATM 10090 O O   . HOH LA 4 .   ? -30.563 6.156   -5.728  1.00 37.22 ? 2015 HOH O O   1 
HETATM 10091 O O   . HOH LA 4 .   ? -28.537 -0.293  -2.454  1.00 41.77 ? 2016 HOH O O   1 
HETATM 10092 O O   . HOH LA 4 .   ? -31.374 0.490   -2.207  1.00 37.54 ? 2017 HOH O O   1 
HETATM 10093 O O   . HOH LA 4 .   ? -28.978 11.675  -2.900  1.00 40.17 ? 2018 HOH O O   1 
HETATM 10094 O O   . HOH LA 4 .   ? -31.962 17.186  -5.157  1.00 46.32 ? 2019 HOH O O   1 
HETATM 10095 O O   . HOH LA 4 .   ? -37.403 17.065  3.495   1.00 46.65 ? 2020 HOH O O   1 
HETATM 10096 O O   . HOH LA 4 .   ? -28.628 17.817  0.087   1.00 33.27 ? 2021 HOH O O   1 
HETATM 10097 O O   . HOH LA 4 .   ? -34.203 27.402  -0.264  1.00 35.04 ? 2022 HOH O O   1 
HETATM 10098 O O   . HOH LA 4 .   ? -31.257 26.581  1.310   1.00 39.54 ? 2023 HOH O O   1 
HETATM 10099 O O   . HOH LA 4 .   ? -29.300 24.759  7.187   1.00 42.04 ? 2024 HOH O O   1 
HETATM 10100 O O   . HOH LA 4 .   ? -27.291 22.532  5.674   1.00 38.71 ? 2025 HOH O O   1 
HETATM 10101 O O   . HOH LA 4 .   ? -27.457 19.644  -1.562  1.00 39.11 ? 2026 HOH O O   1 
HETATM 10102 O O   . HOH LA 4 .   ? -22.442 17.919  2.996   1.00 42.05 ? 2027 HOH O O   1 
HETATM 10103 O O   . HOH LA 4 .   ? -24.411 23.393  5.691   1.00 38.29 ? 2028 HOH O O   1 
HETATM 10104 O O   . HOH LA 4 .   ? -23.627 13.948  4.343   1.00 32.35 ? 2029 HOH O O   1 
HETATM 10105 O O   . HOH LA 4 .   ? -22.997 5.456   12.834  1.00 27.10 ? 2030 HOH O O   1 
HETATM 10106 O O   . HOH LA 4 .   ? -25.126 -0.313  16.514  1.00 46.28 ? 2031 HOH O O   1 
HETATM 10107 O O   . HOH LA 4 .   ? -29.432 0.353   22.739  1.00 33.46 ? 2032 HOH O O   1 
HETATM 10108 O O   . HOH LA 4 .   ? -31.176 1.663   19.566  1.00 38.22 ? 2033 HOH O O   1 
HETATM 10109 O O   . HOH LA 4 .   ? -30.092 -3.057  11.369  1.00 41.69 ? 2034 HOH O O   1 
HETATM 10110 O O   . HOH LA 4 .   ? -32.113 0.584   16.704  1.00 41.13 ? 2035 HOH O O   1 
HETATM 10111 O O   . HOH LA 4 .   ? -23.305 -1.809  13.653  1.00 35.18 ? 2036 HOH O O   1 
HETATM 10112 O O   . HOH LA 4 .   ? -34.416 16.659  7.121   1.00 39.18 ? 2037 HOH O O   1 
HETATM 10113 O O   . HOH LA 4 .   ? -22.875 23.465  15.448  1.00 40.85 ? 2038 HOH O O   1 
HETATM 10114 O O   . HOH LA 4 .   ? -28.390 18.369  17.378  1.00 37.39 ? 2039 HOH O O   1 
HETATM 10115 O O   . HOH LA 4 .   ? -15.289 13.604  18.239  1.00 40.57 ? 2040 HOH O O   1 
HETATM 10116 O O   . HOH LA 4 .   ? -17.741 23.770  21.896  1.00 48.20 ? 2041 HOH O O   1 
HETATM 10117 O O   . HOH LA 4 .   ? -14.982 19.200  26.674  1.00 44.73 ? 2042 HOH O O   1 
HETATM 10118 O O   . HOH LA 4 .   ? -16.027 21.330  32.289  1.00 42.14 ? 2043 HOH O O   1 
HETATM 10119 O O   . HOH LA 4 .   ? -19.176 17.887  21.628  1.00 27.40 ? 2044 HOH O O   1 
HETATM 10120 O O   . HOH LA 4 .   ? -16.619 15.259  25.043  1.00 34.29 ? 2045 HOH O O   1 
HETATM 10121 O O   . HOH LA 4 .   ? -25.304 13.644  30.802  1.00 33.29 ? 2046 HOH O O   1 
HETATM 10122 O O   . HOH LA 4 .   ? -20.854 14.894  3.963   1.00 43.57 ? 2047 HOH O O   1 
HETATM 10123 O O   . HOH LA 4 .   ? -30.950 18.758  26.963  1.00 34.57 ? 2048 HOH O O   1 
HETATM 10124 O O   . HOH LA 4 .   ? -31.165 11.702  25.826  1.00 33.05 ? 2049 HOH O O   1 
HETATM 10125 O O   . HOH LA 4 .   ? -30.182 19.071  24.273  1.00 42.40 ? 2050 HOH O O   1 
HETATM 10126 O O   . HOH LA 4 .   ? -16.160 9.200   3.225   1.00 47.10 ? 2051 HOH O O   1 
HETATM 10127 O O   . HOH LA 4 .   ? -24.888 5.944   -6.521  1.00 35.83 ? 2052 HOH O O   1 
HETATM 10128 O O   . HOH LA 4 .   ? -27.763 6.679   -6.581  1.00 39.49 ? 2053 HOH O O   1 
HETATM 10129 O O   . HOH LA 4 .   ? -28.734 2.721   21.658  1.00 37.25 ? 2054 HOH O O   1 
HETATM 10130 O O   . HOH LA 4 .   ? -28.877 9.979   29.849  1.00 42.96 ? 2055 HOH O O   1 
HETATM 10131 O O   . HOH LA 4 .   ? -35.662 18.127  5.430   1.00 38.44 ? 2056 HOH O O   1 
HETATM 10132 O O   . HOH LA 4 .   ? -18.829 1.699   17.298  1.00 32.10 ? 2057 HOH O O   1 
HETATM 10133 O O   . HOH LA 4 .   ? -12.642 7.791   21.154  1.00 41.86 ? 2058 HOH O O   1 
HETATM 10134 O O   . HOH LA 4 .   ? -14.864 -1.066  20.683  1.00 44.75 ? 2059 HOH O O   1 
HETATM 10135 O O   . HOH LA 4 .   ? -12.869 3.996   23.267  1.00 38.64 ? 2060 HOH O O   1 
HETATM 10136 O O   . HOH LA 4 .   ? -10.182 0.888   20.312  1.00 45.34 ? 2061 HOH O O   1 
HETATM 10137 O O   . HOH LA 4 .   ? -33.456 19.113  26.987  1.00 44.13 ? 2062 HOH O O   1 
HETATM 10138 O O   . HOH MA 4 .   ? -26.741 -3.772  -0.846  1.00 40.72 ? 2001 HOH P O   1 
HETATM 10139 O O   . HOH MA 4 .   ? -24.819 -3.275  11.878  1.00 39.28 ? 2002 HOH P O   1 
HETATM 10140 O O   . HOH MA 4 .   ? -24.989 0.137   4.369   1.00 39.46 ? 2003 HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1074 ?    ?   ?   A . n 
A 1 2   GLY 2   1075 ?    ?   ?   A . n 
A 1 3   SER 3   1076 ?    ?   ?   A . n 
A 1 4   GLU 4   1077 ?    ?   ?   A . n 
A 1 5   ASP 5   1078 ?    ?   ?   A . n 
A 1 6   GLU 6   1079 1079 GLU GLU A . n 
A 1 7   ASP 7   1080 1080 ASP ASP A . n 
A 1 8   SER 8   1081 1081 SER SER A . n 
A 1 9   PRO 9   1082 1082 PRO PRO A . n 
A 1 10  LEU 10  1083 1083 LEU LEU A . n 
A 1 11  ASP 11  1084 1084 ASP ASP A . n 
A 1 12  ALA 12  1085 1085 ALA ALA A . n 
A 1 13  LEU 13  1086 1086 LEU LEU A . n 
A 1 14  ASP 14  1087 1087 ASP ASP A . n 
A 1 15  LEU 15  1088 1088 LEU LEU A . n 
A 1 16  VAL 16  1089 1089 VAL VAL A . n 
A 1 17  TRP 17  1090 1090 TRP TRP A . n 
A 1 18  ALA 18  1091 1091 ALA ALA A . n 
A 1 19  LYS 19  1092 1092 LYS LYS A . n 
A 1 20  CYS 20  1093 1093 CYS CYS A . n 
A 1 21  ARG 21  1094 1094 ARG ARG A . n 
A 1 22  GLY 22  1095 1095 GLY GLY A . n 
A 1 23  TYR 23  1096 1096 TYR TYR A . n 
A 1 24  PRO 24  1097 1097 PRO PRO A . n 
A 1 25  SER 25  1098 1098 SER SER A . n 
A 1 26  TYR 26  1099 1099 TYR TYR A . n 
A 1 27  PRO 27  1100 1100 PRO PRO A . n 
A 1 28  ALA 28  1101 1101 ALA ALA A . n 
A 1 29  LEU 29  1102 1102 LEU LEU A . n 
A 1 30  ILE 30  1103 1103 ILE ILE A . n 
A 1 31  ILE 31  1104 1104 ILE ILE A . n 
A 1 32  ASP 32  1105 1105 ASP ASP A . n 
A 1 33  PRO 33  1106 1106 PRO PRO A . n 
A 1 34  LYS 34  1107 1107 LYS LYS A . n 
A 1 35  MET 35  1108 1108 MET MET A . n 
A 1 36  PRO 36  1109 1109 PRO PRO A . n 
A 1 37  ARG 37  1110 1110 ARG ARG A . n 
A 1 38  GLU 38  1111 1111 GLU GLU A . n 
A 1 39  GLY 39  1112 1112 GLY GLY A . n 
A 1 40  MET 40  1113 1113 MET MET A . n 
A 1 41  PHE 41  1114 1114 PHE PHE A . n 
A 1 42  HIS 42  1115 1115 HIS HIS A . n 
A 1 43  HIS 43  1116 1116 HIS HIS A . n 
A 1 44  GLY 44  1117 1117 GLY GLY A . n 
A 1 45  VAL 45  1118 1118 VAL VAL A . n 
A 1 46  PRO 46  1119 1119 PRO PRO A . n 
A 1 47  ILE 47  1120 1120 ILE ILE A . n 
A 1 48  PRO 48  1121 1121 PRO PRO A . n 
A 1 49  VAL 49  1122 1122 VAL VAL A . n 
A 1 50  PRO 50  1123 1123 PRO PRO A . n 
A 1 51  PRO 51  1124 1124 PRO PRO A . n 
A 1 52  LEU 52  1125 1125 LEU LEU A . n 
A 1 53  GLU 53  1126 1126 GLU GLU A . n 
A 1 54  VAL 54  1127 1127 VAL VAL A . n 
A 1 55  LEU 55  1128 1128 LEU LEU A . n 
A 1 56  LYS 56  1129 1129 LYS LYS A . n 
A 1 57  LEU 57  1130 1130 LEU LEU A . n 
A 1 58  GLY 58  1131 1131 GLY GLY A . n 
A 1 59  GLU 59  1132 1132 GLU GLU A . n 
A 1 60  GLN 60  1133 1133 GLN GLN A . n 
A 1 61  MET 61  1134 1134 MET MET A . n 
A 1 62  THR 62  1135 1135 THR THR A . n 
A 1 63  GLN 63  1136 1136 GLN GLN A . n 
A 1 64  GLU 64  1137 1137 GLU GLU A . n 
A 1 65  ALA 65  1138 1138 ALA ALA A . n 
A 1 66  ARG 66  1139 1139 ARG ARG A . n 
A 1 67  GLU 67  1140 1140 GLU GLU A . n 
A 1 68  HIS 68  1141 1141 HIS HIS A . n 
A 1 69  LEU 69  1142 1142 LEU LEU A . n 
A 1 70  TYR 70  1143 1143 TYR TYR A . n 
A 1 71  LEU 71  1144 1144 LEU LEU A . n 
A 1 72  VAL 72  1145 1145 VAL VAL A . n 
A 1 73  LEU 73  1146 1146 LEU LEU A . n 
A 1 74  PHE 74  1147 1147 PHE PHE A . n 
A 1 75  PHE 75  1148 1148 PHE PHE A . n 
A 1 76  ASP 76  1149 1149 ASP ASP A . n 
A 1 77  ASN 77  1150 1150 ASN ASN A . n 
A 1 78  LYS 78  1151 1151 LYS LYS A . n 
A 1 79  ARG 79  1152 1152 ARG ARG A . n 
A 1 80  THR 80  1153 1153 THR THR A . n 
A 1 81  TRP 81  1154 1154 TRP TRP A . n 
A 1 82  GLN 82  1155 1155 GLN GLN A . n 
A 1 83  TRP 83  1156 1156 TRP TRP A . n 
A 1 84  LEU 84  1157 1157 LEU LEU A . n 
A 1 85  PRO 85  1158 1158 PRO PRO A . n 
A 1 86  ARG 86  1159 1159 ARG ARG A . n 
A 1 87  THR 87  1160 1160 THR THR A . n 
A 1 88  LYS 88  1161 1161 LYS LYS A . n 
A 1 89  LEU 89  1162 1162 LEU LEU A . n 
A 1 90  VAL 90  1163 1163 VAL VAL A . n 
A 1 91  PRO 91  1164 1164 PRO PRO A . n 
A 1 92  LEU 92  1165 1165 LEU LEU A . n 
A 1 93  GLY 93  1166 1166 GLY GLY A . n 
A 1 94  VAL 94  1167 1167 VAL VAL A . n 
A 1 95  ASN 95  1168 1168 ASN ASN A . n 
A 1 96  GLN 96  1169 1169 GLN GLN A . n 
A 1 97  ASP 97  1170 1170 ASP ASP A . n 
A 1 98  LEU 98  1171 1171 LEU LEU A . n 
A 1 99  ASP 99  1172 1172 ASP ASP A . n 
A 1 100 LYS 100 1173 1173 LYS LYS A . n 
A 1 101 GLU 101 1174 1174 GLU GLU A . n 
A 1 102 LYS 102 1175 1175 LYS LYS A . n 
A 1 103 MET 103 1176 1176 MET MET A . n 
A 1 104 LEU 104 1177 1177 LEU LEU A . n 
A 1 105 GLU 105 1178 1178 GLU GLU A . n 
A 1 106 GLY 106 1179 1179 GLY GLY A . n 
A 1 107 ARG 107 1180 1180 ARG ARG A . n 
A 1 108 LYS 108 1181 1181 LYS LYS A . n 
A 1 109 SER 109 1182 1182 SER SER A . n 
A 1 110 ASN 110 1183 1183 ASN ASN A . n 
A 1 111 ILE 111 1184 1184 ILE ILE A . n 
A 1 112 ARG 112 1185 1185 ARG ARG A . n 
A 1 113 LYS 113 1186 1186 LYS LYS A . n 
A 1 114 SER 114 1187 1187 SER SER A . n 
A 1 115 VAL 115 1188 1188 VAL VAL A . n 
A 1 116 GLN 116 1189 1189 GLN GLN A . n 
A 1 117 ILE 117 1190 1190 ILE ILE A . n 
A 1 118 ALA 118 1191 1191 ALA ALA A . n 
A 1 119 TYR 119 1192 1192 TYR TYR A . n 
A 1 120 HIS 120 1193 1193 HIS HIS A . n 
A 1 121 ARG 121 1194 1194 ARG ARG A . n 
A 1 122 ALA 122 1195 1195 ALA ALA A . n 
A 1 123 LEU 123 1196 1196 LEU LEU A . n 
A 1 124 GLN 124 1197 1197 GLN GLN A . n 
A 1 125 HIS 125 1198 1198 HIS HIS A . n 
A 1 126 ARG 126 1199 1199 ARG ARG A . n 
A 1 127 SER 127 1200 1200 SER SER A . n 
A 1 128 LYS 128 1201 1201 LYS LYS A . n 
A 1 129 VAL 129 1202 1202 VAL VAL A . n 
A 1 130 GLN 130 1203 1203 GLN GLN A . n 
A 1 131 GLY 131 1204 1204 GLY GLY A . n 
A 1 132 GLU 132 1205 1205 GLU GLU A . n 
B 2 1   THR 1   22   ?    ?   ?   B . n 
B 2 2   LYS 2   23   ?    ?   ?   B . n 
B 2 3   ALA 3   24   24   ALA ALA B . n 
B 2 4   ALA 4   25   25   ALA ALA B . n 
B 2 5   ARG 5   26   26   ARG ARG B . n 
B 2 6   LYS 6   27   27   LYS LYS B . n 
B 2 7   SER 7   28   28   SER SER B . n 
B 2 8   ALA 8   29   29   ALA ALA B . n 
B 2 9   PRO 9   30   30   PRO PRO B . n 
B 2 10  ALA 10  31   31   ALA ALA B . n 
B 2 11  THR 11  32   32   THR THR B . n 
B 2 12  GLY 12  33   33   GLY GLY B . n 
B 2 13  GLY 13  34   34   GLY GLY B . n 
B 2 14  VAL 14  35   35   VAL VAL B . n 
B 2 15  M3L 15  36   36   M3L M3L B . n 
B 2 16  LYS 16  37   37   LYS LYS B . n 
B 2 17  PRO 17  38   38   PRO PRO B . n 
B 2 18  HIS 18  39   39   HIS HIS B . n 
B 2 19  ARG 19  40   40   ARG ARG B . n 
B 2 20  TYR 20  41   41   TYR TYR B . n 
B 2 21  ARG 21  42   ?    ?   ?   B . n 
C 1 1   GLY 1   1074 ?    ?   ?   C . n 
C 1 2   GLY 2   1075 ?    ?   ?   C . n 
C 1 3   SER 3   1076 ?    ?   ?   C . n 
C 1 4   GLU 4   1077 ?    ?   ?   C . n 
C 1 5   ASP 5   1078 ?    ?   ?   C . n 
C 1 6   GLU 6   1079 ?    ?   ?   C . n 
C 1 7   ASP 7   1080 1080 ASP ASP C . n 
C 1 8   SER 8   1081 1081 SER SER C . n 
C 1 9   PRO 9   1082 1082 PRO PRO C . n 
C 1 10  LEU 10  1083 1083 LEU LEU C . n 
C 1 11  ASP 11  1084 1084 ASP ASP C . n 
C 1 12  ALA 12  1085 1085 ALA ALA C . n 
C 1 13  LEU 13  1086 1086 LEU LEU C . n 
C 1 14  ASP 14  1087 1087 ASP ASP C . n 
C 1 15  LEU 15  1088 1088 LEU LEU C . n 
C 1 16  VAL 16  1089 1089 VAL VAL C . n 
C 1 17  TRP 17  1090 1090 TRP TRP C . n 
C 1 18  ALA 18  1091 1091 ALA ALA C . n 
C 1 19  LYS 19  1092 1092 LYS LYS C . n 
C 1 20  CYS 20  1093 1093 CYS CYS C . n 
C 1 21  ARG 21  1094 1094 ARG ARG C . n 
C 1 22  GLY 22  1095 1095 GLY GLY C . n 
C 1 23  TYR 23  1096 1096 TYR TYR C . n 
C 1 24  PRO 24  1097 1097 PRO PRO C . n 
C 1 25  SER 25  1098 1098 SER SER C . n 
C 1 26  TYR 26  1099 1099 TYR TYR C . n 
C 1 27  PRO 27  1100 1100 PRO PRO C . n 
C 1 28  ALA 28  1101 1101 ALA ALA C . n 
C 1 29  LEU 29  1102 1102 LEU LEU C . n 
C 1 30  ILE 30  1103 1103 ILE ILE C . n 
C 1 31  ILE 31  1104 1104 ILE ILE C . n 
C 1 32  ASP 32  1105 1105 ASP ASP C . n 
C 1 33  PRO 33  1106 1106 PRO PRO C . n 
C 1 34  LYS 34  1107 1107 LYS LYS C . n 
C 1 35  MET 35  1108 1108 MET MET C . n 
C 1 36  PRO 36  1109 1109 PRO PRO C . n 
C 1 37  ARG 37  1110 1110 ARG ARG C . n 
C 1 38  GLU 38  1111 1111 GLU GLU C . n 
C 1 39  GLY 39  1112 1112 GLY GLY C . n 
C 1 40  MET 40  1113 1113 MET MET C . n 
C 1 41  PHE 41  1114 1114 PHE PHE C . n 
C 1 42  HIS 42  1115 1115 HIS HIS C . n 
C 1 43  HIS 43  1116 1116 HIS HIS C . n 
C 1 44  GLY 44  1117 1117 GLY GLY C . n 
C 1 45  VAL 45  1118 1118 VAL VAL C . n 
C 1 46  PRO 46  1119 1119 PRO PRO C . n 
C 1 47  ILE 47  1120 1120 ILE ILE C . n 
C 1 48  PRO 48  1121 1121 PRO PRO C . n 
C 1 49  VAL 49  1122 1122 VAL VAL C . n 
C 1 50  PRO 50  1123 1123 PRO PRO C . n 
C 1 51  PRO 51  1124 1124 PRO PRO C . n 
C 1 52  LEU 52  1125 1125 LEU LEU C . n 
C 1 53  GLU 53  1126 1126 GLU GLU C . n 
C 1 54  VAL 54  1127 1127 VAL VAL C . n 
C 1 55  LEU 55  1128 1128 LEU LEU C . n 
C 1 56  LYS 56  1129 1129 LYS LYS C . n 
C 1 57  LEU 57  1130 1130 LEU LEU C . n 
C 1 58  GLY 58  1131 1131 GLY GLY C . n 
C 1 59  GLU 59  1132 1132 GLU GLU C . n 
C 1 60  GLN 60  1133 1133 GLN GLN C . n 
C 1 61  MET 61  1134 1134 MET MET C . n 
C 1 62  THR 62  1135 1135 THR THR C . n 
C 1 63  GLN 63  1136 1136 GLN GLN C . n 
C 1 64  GLU 64  1137 1137 GLU GLU C . n 
C 1 65  ALA 65  1138 1138 ALA ALA C . n 
C 1 66  ARG 66  1139 1139 ARG ARG C . n 
C 1 67  GLU 67  1140 1140 GLU GLU C . n 
C 1 68  HIS 68  1141 1141 HIS HIS C . n 
C 1 69  LEU 69  1142 1142 LEU LEU C . n 
C 1 70  TYR 70  1143 1143 TYR TYR C . n 
C 1 71  LEU 71  1144 1144 LEU LEU C . n 
C 1 72  VAL 72  1145 1145 VAL VAL C . n 
C 1 73  LEU 73  1146 1146 LEU LEU C . n 
C 1 74  PHE 74  1147 1147 PHE PHE C . n 
C 1 75  PHE 75  1148 1148 PHE PHE C . n 
C 1 76  ASP 76  1149 1149 ASP ASP C . n 
C 1 77  ASN 77  1150 1150 ASN ASN C . n 
C 1 78  LYS 78  1151 1151 LYS LYS C . n 
C 1 79  ARG 79  1152 1152 ARG ARG C . n 
C 1 80  THR 80  1153 1153 THR THR C . n 
C 1 81  TRP 81  1154 1154 TRP TRP C . n 
C 1 82  GLN 82  1155 1155 GLN GLN C . n 
C 1 83  TRP 83  1156 1156 TRP TRP C . n 
C 1 84  LEU 84  1157 1157 LEU LEU C . n 
C 1 85  PRO 85  1158 1158 PRO PRO C . n 
C 1 86  ARG 86  1159 1159 ARG ARG C . n 
C 1 87  THR 87  1160 1160 THR THR C . n 
C 1 88  LYS 88  1161 1161 LYS LYS C . n 
C 1 89  LEU 89  1162 1162 LEU LEU C . n 
C 1 90  VAL 90  1163 1163 VAL VAL C . n 
C 1 91  PRO 91  1164 1164 PRO PRO C . n 
C 1 92  LEU 92  1165 1165 LEU LEU C . n 
C 1 93  GLY 93  1166 1166 GLY GLY C . n 
C 1 94  VAL 94  1167 1167 VAL VAL C . n 
C 1 95  ASN 95  1168 1168 ASN ASN C . n 
C 1 96  GLN 96  1169 1169 GLN GLN C . n 
C 1 97  ASP 97  1170 1170 ASP ASP C . n 
C 1 98  LEU 98  1171 1171 LEU LEU C . n 
C 1 99  ASP 99  1172 1172 ASP ASP C . n 
C 1 100 LYS 100 1173 1173 LYS LYS C . n 
C 1 101 GLU 101 1174 1174 GLU GLU C . n 
C 1 102 LYS 102 1175 1175 LYS LYS C . n 
C 1 103 MET 103 1176 1176 MET MET C . n 
C 1 104 LEU 104 1177 1177 LEU LEU C . n 
C 1 105 GLU 105 1178 1178 GLU GLU C . n 
C 1 106 GLY 106 1179 1179 GLY GLY C . n 
C 1 107 ARG 107 1180 1180 ARG ARG C . n 
C 1 108 LYS 108 1181 1181 LYS LYS C . n 
C 1 109 SER 109 1182 1182 SER SER C . n 
C 1 110 ASN 110 1183 1183 ASN ASN C . n 
C 1 111 ILE 111 1184 1184 ILE ILE C . n 
C 1 112 ARG 112 1185 1185 ARG ARG C . n 
C 1 113 LYS 113 1186 1186 LYS LYS C . n 
C 1 114 SER 114 1187 1187 SER SER C . n 
C 1 115 VAL 115 1188 1188 VAL VAL C . n 
C 1 116 GLN 116 1189 1189 GLN GLN C . n 
C 1 117 ILE 117 1190 1190 ILE ILE C . n 
C 1 118 ALA 118 1191 1191 ALA ALA C . n 
C 1 119 TYR 119 1192 1192 TYR TYR C . n 
C 1 120 HIS 120 1193 1193 HIS HIS C . n 
C 1 121 ARG 121 1194 1194 ARG ARG C . n 
C 1 122 ALA 122 1195 1195 ALA ALA C . n 
C 1 123 LEU 123 1196 1196 LEU LEU C . n 
C 1 124 GLN 124 1197 1197 GLN GLN C . n 
C 1 125 HIS 125 1198 1198 HIS HIS C . n 
C 1 126 ARG 126 1199 1199 ARG ARG C . n 
C 1 127 SER 127 1200 1200 SER SER C . n 
C 1 128 LYS 128 1201 1201 LYS LYS C . n 
C 1 129 VAL 129 1202 1202 VAL VAL C . n 
C 1 130 GLN 130 1203 1203 GLN GLN C . n 
C 1 131 GLY 131 1204 1204 GLY GLY C . n 
C 1 132 GLU 132 1205 ?    ?   ?   C . n 
D 2 1   THR 1   22   ?    ?   ?   D . n 
D 2 2   LYS 2   23   ?    ?   ?   D . n 
D 2 3   ALA 3   24   ?    ?   ?   D . n 
D 2 4   ALA 4   25   ?    ?   ?   D . n 
D 2 5   ARG 5   26   ?    ?   ?   D . n 
D 2 6   LYS 6   27   27   LYS LYS D . n 
D 2 7   SER 7   28   28   SER SER D . n 
D 2 8   ALA 8   29   29   ALA ALA D . n 
D 2 9   PRO 9   30   30   PRO PRO D . n 
D 2 10  ALA 10  31   31   ALA ALA D . n 
D 2 11  THR 11  32   32   THR THR D . n 
D 2 12  GLY 12  33   33   GLY GLY D . n 
D 2 13  GLY 13  34   34   GLY GLY D . n 
D 2 14  VAL 14  35   35   VAL VAL D . n 
D 2 15  M3L 15  36   36   M3L M3L D . n 
D 2 16  LYS 16  37   37   LYS LYS D . n 
D 2 17  PRO 17  38   38   PRO PRO D . n 
D 2 18  HIS 18  39   39   HIS HIS D . n 
D 2 19  ARG 19  40   40   ARG ARG D . n 
D 2 20  TYR 20  41   ?    ?   ?   D . n 
D 2 21  ARG 21  42   ?    ?   ?   D . n 
E 1 1   GLY 1   1074 ?    ?   ?   E . n 
E 1 2   GLY 2   1075 ?    ?   ?   E . n 
E 1 3   SER 3   1076 ?    ?   ?   E . n 
E 1 4   GLU 4   1077 ?    ?   ?   E . n 
E 1 5   ASP 5   1078 ?    ?   ?   E . n 
E 1 6   GLU 6   1079 ?    ?   ?   E . n 
E 1 7   ASP 7   1080 1080 ASP ASP E . n 
E 1 8   SER 8   1081 1081 SER SER E . n 
E 1 9   PRO 9   1082 1082 PRO PRO E . n 
E 1 10  LEU 10  1083 1083 LEU LEU E . n 
E 1 11  ASP 11  1084 1084 ASP ASP E . n 
E 1 12  ALA 12  1085 1085 ALA ALA E . n 
E 1 13  LEU 13  1086 1086 LEU LEU E . n 
E 1 14  ASP 14  1087 1087 ASP ASP E . n 
E 1 15  LEU 15  1088 1088 LEU LEU E . n 
E 1 16  VAL 16  1089 1089 VAL VAL E . n 
E 1 17  TRP 17  1090 1090 TRP TRP E . n 
E 1 18  ALA 18  1091 1091 ALA ALA E . n 
E 1 19  LYS 19  1092 1092 LYS LYS E . n 
E 1 20  CYS 20  1093 1093 CYS CYS E . n 
E 1 21  ARG 21  1094 1094 ARG ARG E . n 
E 1 22  GLY 22  1095 1095 GLY GLY E . n 
E 1 23  TYR 23  1096 1096 TYR TYR E . n 
E 1 24  PRO 24  1097 1097 PRO PRO E . n 
E 1 25  SER 25  1098 1098 SER SER E . n 
E 1 26  TYR 26  1099 1099 TYR TYR E . n 
E 1 27  PRO 27  1100 1100 PRO PRO E . n 
E 1 28  ALA 28  1101 1101 ALA ALA E . n 
E 1 29  LEU 29  1102 1102 LEU LEU E . n 
E 1 30  ILE 30  1103 1103 ILE ILE E . n 
E 1 31  ILE 31  1104 1104 ILE ILE E . n 
E 1 32  ASP 32  1105 1105 ASP ASP E . n 
E 1 33  PRO 33  1106 1106 PRO PRO E . n 
E 1 34  LYS 34  1107 1107 LYS LYS E . n 
E 1 35  MET 35  1108 1108 MET MET E . n 
E 1 36  PRO 36  1109 1109 PRO PRO E . n 
E 1 37  ARG 37  1110 1110 ARG ARG E . n 
E 1 38  GLU 38  1111 1111 GLU GLU E . n 
E 1 39  GLY 39  1112 1112 GLY GLY E . n 
E 1 40  MET 40  1113 1113 MET MET E . n 
E 1 41  PHE 41  1114 1114 PHE PHE E . n 
E 1 42  HIS 42  1115 1115 HIS HIS E . n 
E 1 43  HIS 43  1116 1116 HIS HIS E . n 
E 1 44  GLY 44  1117 1117 GLY GLY E . n 
E 1 45  VAL 45  1118 1118 VAL VAL E . n 
E 1 46  PRO 46  1119 1119 PRO PRO E . n 
E 1 47  ILE 47  1120 1120 ILE ILE E . n 
E 1 48  PRO 48  1121 1121 PRO PRO E . n 
E 1 49  VAL 49  1122 1122 VAL VAL E . n 
E 1 50  PRO 50  1123 1123 PRO PRO E . n 
E 1 51  PRO 51  1124 1124 PRO PRO E . n 
E 1 52  LEU 52  1125 1125 LEU LEU E . n 
E 1 53  GLU 53  1126 1126 GLU GLU E . n 
E 1 54  VAL 54  1127 1127 VAL VAL E . n 
E 1 55  LEU 55  1128 1128 LEU LEU E . n 
E 1 56  LYS 56  1129 1129 LYS LYS E . n 
E 1 57  LEU 57  1130 1130 LEU LEU E . n 
E 1 58  GLY 58  1131 1131 GLY GLY E . n 
E 1 59  GLU 59  1132 1132 GLU GLU E . n 
E 1 60  GLN 60  1133 1133 GLN GLN E . n 
E 1 61  MET 61  1134 1134 MET MET E . n 
E 1 62  THR 62  1135 1135 THR THR E . n 
E 1 63  GLN 63  1136 1136 GLN GLN E . n 
E 1 64  GLU 64  1137 1137 GLU GLU E . n 
E 1 65  ALA 65  1138 1138 ALA ALA E . n 
E 1 66  ARG 66  1139 1139 ARG ARG E . n 
E 1 67  GLU 67  1140 1140 GLU GLU E . n 
E 1 68  HIS 68  1141 1141 HIS HIS E . n 
E 1 69  LEU 69  1142 1142 LEU LEU E . n 
E 1 70  TYR 70  1143 1143 TYR TYR E . n 
E 1 71  LEU 71  1144 1144 LEU LEU E . n 
E 1 72  VAL 72  1145 1145 VAL VAL E . n 
E 1 73  LEU 73  1146 1146 LEU LEU E . n 
E 1 74  PHE 74  1147 1147 PHE PHE E . n 
E 1 75  PHE 75  1148 1148 PHE PHE E . n 
E 1 76  ASP 76  1149 1149 ASP ASP E . n 
E 1 77  ASN 77  1150 1150 ASN ASN E . n 
E 1 78  LYS 78  1151 1151 LYS LYS E . n 
E 1 79  ARG 79  1152 1152 ARG ARG E . n 
E 1 80  THR 80  1153 1153 THR THR E . n 
E 1 81  TRP 81  1154 1154 TRP TRP E . n 
E 1 82  GLN 82  1155 1155 GLN GLN E . n 
E 1 83  TRP 83  1156 1156 TRP TRP E . n 
E 1 84  LEU 84  1157 1157 LEU LEU E . n 
E 1 85  PRO 85  1158 1158 PRO PRO E . n 
E 1 86  ARG 86  1159 1159 ARG ARG E . n 
E 1 87  THR 87  1160 1160 THR THR E . n 
E 1 88  LYS 88  1161 1161 LYS LYS E . n 
E 1 89  LEU 89  1162 1162 LEU LEU E . n 
E 1 90  VAL 90  1163 1163 VAL VAL E . n 
E 1 91  PRO 91  1164 1164 PRO PRO E . n 
E 1 92  LEU 92  1165 1165 LEU LEU E . n 
E 1 93  GLY 93  1166 1166 GLY GLY E . n 
E 1 94  VAL 94  1167 1167 VAL VAL E . n 
E 1 95  ASN 95  1168 1168 ASN ASN E . n 
E 1 96  GLN 96  1169 1169 GLN GLN E . n 
E 1 97  ASP 97  1170 1170 ASP ASP E . n 
E 1 98  LEU 98  1171 1171 LEU LEU E . n 
E 1 99  ASP 99  1172 1172 ASP ASP E . n 
E 1 100 LYS 100 1173 1173 LYS LYS E . n 
E 1 101 GLU 101 1174 1174 GLU GLU E . n 
E 1 102 LYS 102 1175 1175 LYS LYS E . n 
E 1 103 MET 103 1176 1176 MET MET E . n 
E 1 104 LEU 104 1177 1177 LEU LEU E . n 
E 1 105 GLU 105 1178 1178 GLU GLU E . n 
E 1 106 GLY 106 1179 1179 GLY GLY E . n 
E 1 107 ARG 107 1180 1180 ARG ARG E . n 
E 1 108 LYS 108 1181 1181 LYS LYS E . n 
E 1 109 SER 109 1182 1182 SER SER E . n 
E 1 110 ASN 110 1183 1183 ASN ASN E . n 
E 1 111 ILE 111 1184 1184 ILE ILE E . n 
E 1 112 ARG 112 1185 1185 ARG ARG E . n 
E 1 113 LYS 113 1186 1186 LYS LYS E . n 
E 1 114 SER 114 1187 1187 SER SER E . n 
E 1 115 VAL 115 1188 1188 VAL VAL E . n 
E 1 116 GLN 116 1189 1189 GLN GLN E . n 
E 1 117 ILE 117 1190 1190 ILE ILE E . n 
E 1 118 ALA 118 1191 1191 ALA ALA E . n 
E 1 119 TYR 119 1192 1192 TYR TYR E . n 
E 1 120 HIS 120 1193 1193 HIS HIS E . n 
E 1 121 ARG 121 1194 1194 ARG ARG E . n 
E 1 122 ALA 122 1195 1195 ALA ALA E . n 
E 1 123 LEU 123 1196 1196 LEU LEU E . n 
E 1 124 GLN 124 1197 1197 GLN GLN E . n 
E 1 125 HIS 125 1198 1198 HIS HIS E . n 
E 1 126 ARG 126 1199 1199 ARG ARG E . n 
E 1 127 SER 127 1200 1200 SER SER E . n 
E 1 128 LYS 128 1201 1201 LYS LYS E . n 
E 1 129 VAL 129 1202 1202 VAL VAL E . n 
E 1 130 GLN 130 1203 1203 GLN GLN E . n 
E 1 131 GLY 131 1204 1204 GLY GLY E . n 
E 1 132 GLU 132 1205 1205 GLU GLU E . n 
F 2 1   THR 1   22   ?    ?   ?   F . n 
F 2 2   LYS 2   23   ?    ?   ?   F . n 
F 2 3   ALA 3   24   ?    ?   ?   F . n 
F 2 4   ALA 4   25   25   ALA ALA F . n 
F 2 5   ARG 5   26   26   ARG ARG F . n 
F 2 6   LYS 6   27   27   LYS LYS F . n 
F 2 7   SER 7   28   28   SER SER F . n 
F 2 8   ALA 8   29   29   ALA ALA F . n 
F 2 9   PRO 9   30   30   PRO PRO F . n 
F 2 10  ALA 10  31   31   ALA ALA F . n 
F 2 11  THR 11  32   32   THR THR F . n 
F 2 12  GLY 12  33   33   GLY GLY F . n 
F 2 13  GLY 13  34   34   GLY GLY F . n 
F 2 14  VAL 14  35   35   VAL VAL F . n 
F 2 15  M3L 15  36   36   M3L M3L F . n 
F 2 16  LYS 16  37   37   LYS LYS F . n 
F 2 17  PRO 17  38   38   PRO PRO F . n 
F 2 18  HIS 18  39   39   HIS HIS F . n 
F 2 19  ARG 19  40   ?    ?   ?   F . n 
F 2 20  TYR 20  41   ?    ?   ?   F . n 
F 2 21  ARG 21  42   ?    ?   ?   F . n 
G 1 1   GLY 1   1074 ?    ?   ?   G . n 
G 1 2   GLY 2   1075 ?    ?   ?   G . n 
G 1 3   SER 3   1076 ?    ?   ?   G . n 
G 1 4   GLU 4   1077 ?    ?   ?   G . n 
G 1 5   ASP 5   1078 ?    ?   ?   G . n 
G 1 6   GLU 6   1079 ?    ?   ?   G . n 
G 1 7   ASP 7   1080 1080 ASP ASP G . n 
G 1 8   SER 8   1081 1081 SER SER G . n 
G 1 9   PRO 9   1082 1082 PRO PRO G . n 
G 1 10  LEU 10  1083 1083 LEU LEU G . n 
G 1 11  ASP 11  1084 1084 ASP ASP G . n 
G 1 12  ALA 12  1085 1085 ALA ALA G . n 
G 1 13  LEU 13  1086 1086 LEU LEU G . n 
G 1 14  ASP 14  1087 1087 ASP ASP G . n 
G 1 15  LEU 15  1088 1088 LEU LEU G . n 
G 1 16  VAL 16  1089 1089 VAL VAL G . n 
G 1 17  TRP 17  1090 1090 TRP TRP G . n 
G 1 18  ALA 18  1091 1091 ALA ALA G . n 
G 1 19  LYS 19  1092 1092 LYS LYS G . n 
G 1 20  CYS 20  1093 1093 CYS CYS G . n 
G 1 21  ARG 21  1094 1094 ARG ARG G . n 
G 1 22  GLY 22  1095 1095 GLY GLY G . n 
G 1 23  TYR 23  1096 1096 TYR TYR G . n 
G 1 24  PRO 24  1097 1097 PRO PRO G . n 
G 1 25  SER 25  1098 1098 SER SER G . n 
G 1 26  TYR 26  1099 1099 TYR TYR G . n 
G 1 27  PRO 27  1100 1100 PRO PRO G . n 
G 1 28  ALA 28  1101 1101 ALA ALA G . n 
G 1 29  LEU 29  1102 1102 LEU LEU G . n 
G 1 30  ILE 30  1103 1103 ILE ILE G . n 
G 1 31  ILE 31  1104 1104 ILE ILE G . n 
G 1 32  ASP 32  1105 1105 ASP ASP G . n 
G 1 33  PRO 33  1106 1106 PRO PRO G . n 
G 1 34  LYS 34  1107 1107 LYS LYS G . n 
G 1 35  MET 35  1108 1108 MET MET G . n 
G 1 36  PRO 36  1109 1109 PRO PRO G . n 
G 1 37  ARG 37  1110 1110 ARG ARG G . n 
G 1 38  GLU 38  1111 1111 GLU GLU G . n 
G 1 39  GLY 39  1112 1112 GLY GLY G . n 
G 1 40  MET 40  1113 1113 MET MET G . n 
G 1 41  PHE 41  1114 1114 PHE PHE G . n 
G 1 42  HIS 42  1115 1115 HIS HIS G . n 
G 1 43  HIS 43  1116 1116 HIS HIS G . n 
G 1 44  GLY 44  1117 1117 GLY GLY G . n 
G 1 45  VAL 45  1118 1118 VAL VAL G . n 
G 1 46  PRO 46  1119 1119 PRO PRO G . n 
G 1 47  ILE 47  1120 1120 ILE ILE G . n 
G 1 48  PRO 48  1121 1121 PRO PRO G . n 
G 1 49  VAL 49  1122 1122 VAL VAL G . n 
G 1 50  PRO 50  1123 1123 PRO PRO G . n 
G 1 51  PRO 51  1124 1124 PRO PRO G . n 
G 1 52  LEU 52  1125 1125 LEU LEU G . n 
G 1 53  GLU 53  1126 1126 GLU GLU G . n 
G 1 54  VAL 54  1127 1127 VAL VAL G . n 
G 1 55  LEU 55  1128 1128 LEU LEU G . n 
G 1 56  LYS 56  1129 1129 LYS LYS G . n 
G 1 57  LEU 57  1130 1130 LEU LEU G . n 
G 1 58  GLY 58  1131 1131 GLY GLY G . n 
G 1 59  GLU 59  1132 1132 GLU GLU G . n 
G 1 60  GLN 60  1133 1133 GLN GLN G . n 
G 1 61  MET 61  1134 1134 MET MET G . n 
G 1 62  THR 62  1135 1135 THR THR G . n 
G 1 63  GLN 63  1136 1136 GLN GLN G . n 
G 1 64  GLU 64  1137 1137 GLU GLU G . n 
G 1 65  ALA 65  1138 1138 ALA ALA G . n 
G 1 66  ARG 66  1139 1139 ARG ARG G . n 
G 1 67  GLU 67  1140 1140 GLU GLU G . n 
G 1 68  HIS 68  1141 1141 HIS HIS G . n 
G 1 69  LEU 69  1142 1142 LEU LEU G . n 
G 1 70  TYR 70  1143 1143 TYR TYR G . n 
G 1 71  LEU 71  1144 1144 LEU LEU G . n 
G 1 72  VAL 72  1145 1145 VAL VAL G . n 
G 1 73  LEU 73  1146 1146 LEU LEU G . n 
G 1 74  PHE 74  1147 1147 PHE PHE G . n 
G 1 75  PHE 75  1148 1148 PHE PHE G . n 
G 1 76  ASP 76  1149 1149 ASP ASP G . n 
G 1 77  ASN 77  1150 1150 ASN ASN G . n 
G 1 78  LYS 78  1151 1151 LYS LYS G . n 
G 1 79  ARG 79  1152 1152 ARG ARG G . n 
G 1 80  THR 80  1153 1153 THR THR G . n 
G 1 81  TRP 81  1154 1154 TRP TRP G . n 
G 1 82  GLN 82  1155 1155 GLN GLN G . n 
G 1 83  TRP 83  1156 1156 TRP TRP G . n 
G 1 84  LEU 84  1157 1157 LEU LEU G . n 
G 1 85  PRO 85  1158 1158 PRO PRO G . n 
G 1 86  ARG 86  1159 1159 ARG ARG G . n 
G 1 87  THR 87  1160 1160 THR THR G . n 
G 1 88  LYS 88  1161 1161 LYS LYS G . n 
G 1 89  LEU 89  1162 1162 LEU LEU G . n 
G 1 90  VAL 90  1163 1163 VAL VAL G . n 
G 1 91  PRO 91  1164 1164 PRO PRO G . n 
G 1 92  LEU 92  1165 1165 LEU LEU G . n 
G 1 93  GLY 93  1166 1166 GLY GLY G . n 
G 1 94  VAL 94  1167 1167 VAL VAL G . n 
G 1 95  ASN 95  1168 1168 ASN ASN G . n 
G 1 96  GLN 96  1169 1169 GLN GLN G . n 
G 1 97  ASP 97  1170 1170 ASP ASP G . n 
G 1 98  LEU 98  1171 1171 LEU LEU G . n 
G 1 99  ASP 99  1172 1172 ASP ASP G . n 
G 1 100 LYS 100 1173 1173 LYS LYS G . n 
G 1 101 GLU 101 1174 1174 GLU GLU G . n 
G 1 102 LYS 102 1175 1175 LYS LYS G . n 
G 1 103 MET 103 1176 1176 MET MET G . n 
G 1 104 LEU 104 1177 1177 LEU LEU G . n 
G 1 105 GLU 105 1178 1178 GLU GLU G . n 
G 1 106 GLY 106 1179 1179 GLY GLY G . n 
G 1 107 ARG 107 1180 1180 ARG ARG G . n 
G 1 108 LYS 108 1181 1181 LYS LYS G . n 
G 1 109 SER 109 1182 1182 SER SER G . n 
G 1 110 ASN 110 1183 1183 ASN ASN G . n 
G 1 111 ILE 111 1184 1184 ILE ILE G . n 
G 1 112 ARG 112 1185 1185 ARG ARG G . n 
G 1 113 LYS 113 1186 1186 LYS LYS G . n 
G 1 114 SER 114 1187 1187 SER SER G . n 
G 1 115 VAL 115 1188 1188 VAL VAL G . n 
G 1 116 GLN 116 1189 1189 GLN GLN G . n 
G 1 117 ILE 117 1190 1190 ILE ILE G . n 
G 1 118 ALA 118 1191 1191 ALA ALA G . n 
G 1 119 TYR 119 1192 1192 TYR TYR G . n 
G 1 120 HIS 120 1193 1193 HIS HIS G . n 
G 1 121 ARG 121 1194 1194 ARG ARG G . n 
G 1 122 ALA 122 1195 1195 ALA ALA G . n 
G 1 123 LEU 123 1196 1196 LEU LEU G . n 
G 1 124 GLN 124 1197 1197 GLN GLN G . n 
G 1 125 HIS 125 1198 1198 HIS HIS G . n 
G 1 126 ARG 126 1199 1199 ARG ARG G . n 
G 1 127 SER 127 1200 1200 SER SER G . n 
G 1 128 LYS 128 1201 1201 LYS LYS G . n 
G 1 129 VAL 129 1202 1202 VAL VAL G . n 
G 1 130 GLN 130 1203 1203 GLN GLN G . n 
G 1 131 GLY 131 1204 ?    ?   ?   G . n 
G 1 132 GLU 132 1205 ?    ?   ?   G . n 
H 2 1   THR 1   22   ?    ?   ?   H . n 
H 2 2   LYS 2   23   ?    ?   ?   H . n 
H 2 3   ALA 3   24   ?    ?   ?   H . n 
H 2 4   ALA 4   25   ?    ?   ?   H . n 
H 2 5   ARG 5   26   ?    ?   ?   H . n 
H 2 6   LYS 6   27   ?    ?   ?   H . n 
H 2 7   SER 7   28   28   SER SER H . n 
H 2 8   ALA 8   29   29   ALA ALA H . n 
H 2 9   PRO 9   30   30   PRO PRO H . n 
H 2 10  ALA 10  31   31   ALA ALA H . n 
H 2 11  THR 11  32   32   THR THR H . n 
H 2 12  GLY 12  33   33   GLY GLY H . n 
H 2 13  GLY 13  34   34   GLY GLY H . n 
H 2 14  VAL 14  35   35   VAL VAL H . n 
H 2 15  M3L 15  36   36   M3L M3L H . n 
H 2 16  LYS 16  37   37   LYS LYS H . n 
H 2 17  PRO 17  38   38   PRO PRO H . n 
H 2 18  HIS 18  39   ?    ?   ?   H . n 
H 2 19  ARG 19  40   ?    ?   ?   H . n 
H 2 20  TYR 20  41   ?    ?   ?   H . n 
H 2 21  ARG 21  42   ?    ?   ?   H . n 
I 1 1   GLY 1   1074 ?    ?   ?   I . n 
I 1 2   GLY 2   1075 ?    ?   ?   I . n 
I 1 3   SER 3   1076 ?    ?   ?   I . n 
I 1 4   GLU 4   1077 ?    ?   ?   I . n 
I 1 5   ASP 5   1078 ?    ?   ?   I . n 
I 1 6   GLU 6   1079 ?    ?   ?   I . n 
I 1 7   ASP 7   1080 1080 ASP ASP I . n 
I 1 8   SER 8   1081 1081 SER SER I . n 
I 1 9   PRO 9   1082 1082 PRO PRO I . n 
I 1 10  LEU 10  1083 1083 LEU LEU I . n 
I 1 11  ASP 11  1084 1084 ASP ASP I . n 
I 1 12  ALA 12  1085 1085 ALA ALA I . n 
I 1 13  LEU 13  1086 1086 LEU LEU I . n 
I 1 14  ASP 14  1087 1087 ASP ASP I . n 
I 1 15  LEU 15  1088 1088 LEU LEU I . n 
I 1 16  VAL 16  1089 1089 VAL VAL I . n 
I 1 17  TRP 17  1090 1090 TRP TRP I . n 
I 1 18  ALA 18  1091 1091 ALA ALA I . n 
I 1 19  LYS 19  1092 1092 LYS LYS I . n 
I 1 20  CYS 20  1093 1093 CYS CYS I . n 
I 1 21  ARG 21  1094 1094 ARG ARG I . n 
I 1 22  GLY 22  1095 1095 GLY GLY I . n 
I 1 23  TYR 23  1096 1096 TYR TYR I . n 
I 1 24  PRO 24  1097 1097 PRO PRO I . n 
I 1 25  SER 25  1098 1098 SER SER I . n 
I 1 26  TYR 26  1099 1099 TYR TYR I . n 
I 1 27  PRO 27  1100 1100 PRO PRO I . n 
I 1 28  ALA 28  1101 1101 ALA ALA I . n 
I 1 29  LEU 29  1102 1102 LEU LEU I . n 
I 1 30  ILE 30  1103 1103 ILE ILE I . n 
I 1 31  ILE 31  1104 1104 ILE ILE I . n 
I 1 32  ASP 32  1105 1105 ASP ASP I . n 
I 1 33  PRO 33  1106 1106 PRO PRO I . n 
I 1 34  LYS 34  1107 1107 LYS LYS I . n 
I 1 35  MET 35  1108 1108 MET MET I . n 
I 1 36  PRO 36  1109 1109 PRO PRO I . n 
I 1 37  ARG 37  1110 1110 ARG ARG I . n 
I 1 38  GLU 38  1111 1111 GLU GLU I . n 
I 1 39  GLY 39  1112 1112 GLY GLY I . n 
I 1 40  MET 40  1113 1113 MET MET I . n 
I 1 41  PHE 41  1114 1114 PHE PHE I . n 
I 1 42  HIS 42  1115 1115 HIS HIS I . n 
I 1 43  HIS 43  1116 1116 HIS HIS I . n 
I 1 44  GLY 44  1117 1117 GLY GLY I . n 
I 1 45  VAL 45  1118 1118 VAL VAL I . n 
I 1 46  PRO 46  1119 1119 PRO PRO I . n 
I 1 47  ILE 47  1120 1120 ILE ILE I . n 
I 1 48  PRO 48  1121 1121 PRO PRO I . n 
I 1 49  VAL 49  1122 1122 VAL VAL I . n 
I 1 50  PRO 50  1123 1123 PRO PRO I . n 
I 1 51  PRO 51  1124 1124 PRO PRO I . n 
I 1 52  LEU 52  1125 1125 LEU LEU I . n 
I 1 53  GLU 53  1126 1126 GLU GLU I . n 
I 1 54  VAL 54  1127 1127 VAL VAL I . n 
I 1 55  LEU 55  1128 1128 LEU LEU I . n 
I 1 56  LYS 56  1129 1129 LYS LYS I . n 
I 1 57  LEU 57  1130 1130 LEU LEU I . n 
I 1 58  GLY 58  1131 1131 GLY GLY I . n 
I 1 59  GLU 59  1132 1132 GLU GLU I . n 
I 1 60  GLN 60  1133 1133 GLN GLN I . n 
I 1 61  MET 61  1134 1134 MET MET I . n 
I 1 62  THR 62  1135 1135 THR THR I . n 
I 1 63  GLN 63  1136 1136 GLN GLN I . n 
I 1 64  GLU 64  1137 1137 GLU GLU I . n 
I 1 65  ALA 65  1138 1138 ALA ALA I . n 
I 1 66  ARG 66  1139 1139 ARG ARG I . n 
I 1 67  GLU 67  1140 1140 GLU GLU I . n 
I 1 68  HIS 68  1141 1141 HIS HIS I . n 
I 1 69  LEU 69  1142 1142 LEU LEU I . n 
I 1 70  TYR 70  1143 1143 TYR TYR I . n 
I 1 71  LEU 71  1144 1144 LEU LEU I . n 
I 1 72  VAL 72  1145 1145 VAL VAL I . n 
I 1 73  LEU 73  1146 1146 LEU LEU I . n 
I 1 74  PHE 74  1147 1147 PHE PHE I . n 
I 1 75  PHE 75  1148 1148 PHE PHE I . n 
I 1 76  ASP 76  1149 1149 ASP ASP I . n 
I 1 77  ASN 77  1150 1150 ASN ASN I . n 
I 1 78  LYS 78  1151 1151 LYS LYS I . n 
I 1 79  ARG 79  1152 1152 ARG ARG I . n 
I 1 80  THR 80  1153 1153 THR THR I . n 
I 1 81  TRP 81  1154 1154 TRP TRP I . n 
I 1 82  GLN 82  1155 1155 GLN GLN I . n 
I 1 83  TRP 83  1156 1156 TRP TRP I . n 
I 1 84  LEU 84  1157 1157 LEU LEU I . n 
I 1 85  PRO 85  1158 1158 PRO PRO I . n 
I 1 86  ARG 86  1159 1159 ARG ARG I . n 
I 1 87  THR 87  1160 1160 THR THR I . n 
I 1 88  LYS 88  1161 1161 LYS LYS I . n 
I 1 89  LEU 89  1162 1162 LEU LEU I . n 
I 1 90  VAL 90  1163 1163 VAL VAL I . n 
I 1 91  PRO 91  1164 1164 PRO PRO I . n 
I 1 92  LEU 92  1165 1165 LEU LEU I . n 
I 1 93  GLY 93  1166 1166 GLY GLY I . n 
I 1 94  VAL 94  1167 1167 VAL VAL I . n 
I 1 95  ASN 95  1168 1168 ASN ASN I . n 
I 1 96  GLN 96  1169 1169 GLN GLN I . n 
I 1 97  ASP 97  1170 1170 ASP ASP I . n 
I 1 98  LEU 98  1171 1171 LEU LEU I . n 
I 1 99  ASP 99  1172 1172 ASP ASP I . n 
I 1 100 LYS 100 1173 1173 LYS LYS I . n 
I 1 101 GLU 101 1174 1174 GLU GLU I . n 
I 1 102 LYS 102 1175 1175 LYS LYS I . n 
I 1 103 MET 103 1176 1176 MET MET I . n 
I 1 104 LEU 104 1177 1177 LEU LEU I . n 
I 1 105 GLU 105 1178 1178 GLU GLU I . n 
I 1 106 GLY 106 1179 1179 GLY GLY I . n 
I 1 107 ARG 107 1180 1180 ARG ARG I . n 
I 1 108 LYS 108 1181 1181 LYS LYS I . n 
I 1 109 SER 109 1182 1182 SER SER I . n 
I 1 110 ASN 110 1183 1183 ASN ASN I . n 
I 1 111 ILE 111 1184 1184 ILE ILE I . n 
I 1 112 ARG 112 1185 1185 ARG ARG I . n 
I 1 113 LYS 113 1186 1186 LYS LYS I . n 
I 1 114 SER 114 1187 1187 SER SER I . n 
I 1 115 VAL 115 1188 1188 VAL VAL I . n 
I 1 116 GLN 116 1189 1189 GLN GLN I . n 
I 1 117 ILE 117 1190 1190 ILE ILE I . n 
I 1 118 ALA 118 1191 1191 ALA ALA I . n 
I 1 119 TYR 119 1192 1192 TYR TYR I . n 
I 1 120 HIS 120 1193 1193 HIS HIS I . n 
I 1 121 ARG 121 1194 1194 ARG ARG I . n 
I 1 122 ALA 122 1195 1195 ALA ALA I . n 
I 1 123 LEU 123 1196 1196 LEU LEU I . n 
I 1 124 GLN 124 1197 1197 GLN GLN I . n 
I 1 125 HIS 125 1198 1198 HIS HIS I . n 
I 1 126 ARG 126 1199 1199 ARG ARG I . n 
I 1 127 SER 127 1200 1200 SER SER I . n 
I 1 128 LYS 128 1201 1201 LYS LYS I . n 
I 1 129 VAL 129 1202 1202 VAL VAL I . n 
I 1 130 GLN 130 1203 1203 GLN GLN I . n 
I 1 131 GLY 131 1204 1204 GLY GLY I . n 
I 1 132 GLU 132 1205 ?    ?   ?   I . n 
J 2 1   THR 1   22   ?    ?   ?   J . n 
J 2 2   LYS 2   23   ?    ?   ?   J . n 
J 2 3   ALA 3   24   ?    ?   ?   J . n 
J 2 4   ALA 4   25   ?    ?   ?   J . n 
J 2 5   ARG 5   26   ?    ?   ?   J . n 
J 2 6   LYS 6   27   ?    ?   ?   J . n 
J 2 7   SER 7   28   28   SER SER J . n 
J 2 8   ALA 8   29   29   ALA ALA J . n 
J 2 9   PRO 9   30   30   PRO PRO J . n 
J 2 10  ALA 10  31   31   ALA ALA J . n 
J 2 11  THR 11  32   32   THR THR J . n 
J 2 12  GLY 12  33   33   GLY GLY J . n 
J 2 13  GLY 13  34   34   GLY GLY J . n 
J 2 14  VAL 14  35   35   VAL VAL J . n 
J 2 15  M3L 15  36   36   M3L M3L J . n 
J 2 16  LYS 16  37   37   LYS LYS J . n 
J 2 17  PRO 17  38   38   PRO PRO J . n 
J 2 18  HIS 18  39   39   HIS HIS J . n 
J 2 19  ARG 19  40   ?    ?   ?   J . n 
J 2 20  TYR 20  41   ?    ?   ?   J . n 
J 2 21  ARG 21  42   ?    ?   ?   J . n 
K 1 1   GLY 1   1074 ?    ?   ?   K . n 
K 1 2   GLY 2   1075 ?    ?   ?   K . n 
K 1 3   SER 3   1076 ?    ?   ?   K . n 
K 1 4   GLU 4   1077 ?    ?   ?   K . n 
K 1 5   ASP 5   1078 ?    ?   ?   K . n 
K 1 6   GLU 6   1079 ?    ?   ?   K . n 
K 1 7   ASP 7   1080 1080 ASP ASP K . n 
K 1 8   SER 8   1081 1081 SER SER K . n 
K 1 9   PRO 9   1082 1082 PRO PRO K . n 
K 1 10  LEU 10  1083 1083 LEU LEU K . n 
K 1 11  ASP 11  1084 1084 ASP ASP K . n 
K 1 12  ALA 12  1085 1085 ALA ALA K . n 
K 1 13  LEU 13  1086 1086 LEU LEU K . n 
K 1 14  ASP 14  1087 1087 ASP ASP K . n 
K 1 15  LEU 15  1088 1088 LEU LEU K . n 
K 1 16  VAL 16  1089 1089 VAL VAL K . n 
K 1 17  TRP 17  1090 1090 TRP TRP K . n 
K 1 18  ALA 18  1091 1091 ALA ALA K . n 
K 1 19  LYS 19  1092 1092 LYS LYS K . n 
K 1 20  CYS 20  1093 1093 CYS CYS K . n 
K 1 21  ARG 21  1094 1094 ARG ARG K . n 
K 1 22  GLY 22  1095 1095 GLY GLY K . n 
K 1 23  TYR 23  1096 1096 TYR TYR K . n 
K 1 24  PRO 24  1097 1097 PRO PRO K . n 
K 1 25  SER 25  1098 1098 SER SER K . n 
K 1 26  TYR 26  1099 1099 TYR TYR K . n 
K 1 27  PRO 27  1100 1100 PRO PRO K . n 
K 1 28  ALA 28  1101 1101 ALA ALA K . n 
K 1 29  LEU 29  1102 1102 LEU LEU K . n 
K 1 30  ILE 30  1103 1103 ILE ILE K . n 
K 1 31  ILE 31  1104 1104 ILE ILE K . n 
K 1 32  ASP 32  1105 1105 ASP ASP K . n 
K 1 33  PRO 33  1106 1106 PRO PRO K . n 
K 1 34  LYS 34  1107 1107 LYS LYS K . n 
K 1 35  MET 35  1108 1108 MET MET K . n 
K 1 36  PRO 36  1109 1109 PRO PRO K . n 
K 1 37  ARG 37  1110 1110 ARG ARG K . n 
K 1 38  GLU 38  1111 1111 GLU GLU K . n 
K 1 39  GLY 39  1112 1112 GLY GLY K . n 
K 1 40  MET 40  1113 1113 MET MET K . n 
K 1 41  PHE 41  1114 1114 PHE PHE K . n 
K 1 42  HIS 42  1115 1115 HIS HIS K . n 
K 1 43  HIS 43  1116 1116 HIS HIS K . n 
K 1 44  GLY 44  1117 1117 GLY GLY K . n 
K 1 45  VAL 45  1118 1118 VAL VAL K . n 
K 1 46  PRO 46  1119 1119 PRO PRO K . n 
K 1 47  ILE 47  1120 1120 ILE ILE K . n 
K 1 48  PRO 48  1121 1121 PRO PRO K . n 
K 1 49  VAL 49  1122 1122 VAL VAL K . n 
K 1 50  PRO 50  1123 1123 PRO PRO K . n 
K 1 51  PRO 51  1124 1124 PRO PRO K . n 
K 1 52  LEU 52  1125 1125 LEU LEU K . n 
K 1 53  GLU 53  1126 1126 GLU GLU K . n 
K 1 54  VAL 54  1127 1127 VAL VAL K . n 
K 1 55  LEU 55  1128 1128 LEU LEU K . n 
K 1 56  LYS 56  1129 1129 LYS LYS K . n 
K 1 57  LEU 57  1130 1130 LEU LEU K . n 
K 1 58  GLY 58  1131 1131 GLY GLY K . n 
K 1 59  GLU 59  1132 1132 GLU GLU K . n 
K 1 60  GLN 60  1133 1133 GLN GLN K . n 
K 1 61  MET 61  1134 1134 MET MET K . n 
K 1 62  THR 62  1135 1135 THR THR K . n 
K 1 63  GLN 63  1136 1136 GLN GLN K . n 
K 1 64  GLU 64  1137 1137 GLU GLU K . n 
K 1 65  ALA 65  1138 1138 ALA ALA K . n 
K 1 66  ARG 66  1139 1139 ARG ARG K . n 
K 1 67  GLU 67  1140 1140 GLU GLU K . n 
K 1 68  HIS 68  1141 1141 HIS HIS K . n 
K 1 69  LEU 69  1142 1142 LEU LEU K . n 
K 1 70  TYR 70  1143 1143 TYR TYR K . n 
K 1 71  LEU 71  1144 1144 LEU LEU K . n 
K 1 72  VAL 72  1145 1145 VAL VAL K . n 
K 1 73  LEU 73  1146 1146 LEU LEU K . n 
K 1 74  PHE 74  1147 1147 PHE PHE K . n 
K 1 75  PHE 75  1148 1148 PHE PHE K . n 
K 1 76  ASP 76  1149 1149 ASP ASP K . n 
K 1 77  ASN 77  1150 1150 ASN ASN K . n 
K 1 78  LYS 78  1151 1151 LYS LYS K . n 
K 1 79  ARG 79  1152 1152 ARG ARG K . n 
K 1 80  THR 80  1153 1153 THR THR K . n 
K 1 81  TRP 81  1154 1154 TRP TRP K . n 
K 1 82  GLN 82  1155 1155 GLN GLN K . n 
K 1 83  TRP 83  1156 1156 TRP TRP K . n 
K 1 84  LEU 84  1157 1157 LEU LEU K . n 
K 1 85  PRO 85  1158 1158 PRO PRO K . n 
K 1 86  ARG 86  1159 1159 ARG ARG K . n 
K 1 87  THR 87  1160 1160 THR THR K . n 
K 1 88  LYS 88  1161 1161 LYS LYS K . n 
K 1 89  LEU 89  1162 1162 LEU LEU K . n 
K 1 90  VAL 90  1163 1163 VAL VAL K . n 
K 1 91  PRO 91  1164 1164 PRO PRO K . n 
K 1 92  LEU 92  1165 1165 LEU LEU K . n 
K 1 93  GLY 93  1166 1166 GLY GLY K . n 
K 1 94  VAL 94  1167 1167 VAL VAL K . n 
K 1 95  ASN 95  1168 1168 ASN ASN K . n 
K 1 96  GLN 96  1169 1169 GLN GLN K . n 
K 1 97  ASP 97  1170 1170 ASP ASP K . n 
K 1 98  LEU 98  1171 1171 LEU LEU K . n 
K 1 99  ASP 99  1172 1172 ASP ASP K . n 
K 1 100 LYS 100 1173 1173 LYS LYS K . n 
K 1 101 GLU 101 1174 1174 GLU GLU K . n 
K 1 102 LYS 102 1175 1175 LYS LYS K . n 
K 1 103 MET 103 1176 1176 MET MET K . n 
K 1 104 LEU 104 1177 1177 LEU LEU K . n 
K 1 105 GLU 105 1178 1178 GLU GLU K . n 
K 1 106 GLY 106 1179 1179 GLY GLY K . n 
K 1 107 ARG 107 1180 1180 ARG ARG K . n 
K 1 108 LYS 108 1181 1181 LYS LYS K . n 
K 1 109 SER 109 1182 1182 SER SER K . n 
K 1 110 ASN 110 1183 1183 ASN ASN K . n 
K 1 111 ILE 111 1184 1184 ILE ILE K . n 
K 1 112 ARG 112 1185 1185 ARG ARG K . n 
K 1 113 LYS 113 1186 1186 LYS LYS K . n 
K 1 114 SER 114 1187 1187 SER SER K . n 
K 1 115 VAL 115 1188 1188 VAL VAL K . n 
K 1 116 GLN 116 1189 1189 GLN GLN K . n 
K 1 117 ILE 117 1190 1190 ILE ILE K . n 
K 1 118 ALA 118 1191 1191 ALA ALA K . n 
K 1 119 TYR 119 1192 1192 TYR TYR K . n 
K 1 120 HIS 120 1193 1193 HIS HIS K . n 
K 1 121 ARG 121 1194 1194 ARG ARG K . n 
K 1 122 ALA 122 1195 1195 ALA ALA K . n 
K 1 123 LEU 123 1196 1196 LEU LEU K . n 
K 1 124 GLN 124 1197 1197 GLN GLN K . n 
K 1 125 HIS 125 1198 1198 HIS HIS K . n 
K 1 126 ARG 126 1199 1199 ARG ARG K . n 
K 1 127 SER 127 1200 1200 SER SER K . n 
K 1 128 LYS 128 1201 1201 LYS LYS K . n 
K 1 129 VAL 129 1202 1202 VAL VAL K . n 
K 1 130 GLN 130 1203 1203 GLN GLN K . n 
K 1 131 GLY 131 1204 1204 GLY GLY K . n 
K 1 132 GLU 132 1205 1205 GLU GLU K . n 
L 2 1   THR 1   22   ?    ?   ?   L . n 
L 2 2   LYS 2   23   ?    ?   ?   L . n 
L 2 3   ALA 3   24   ?    ?   ?   L . n 
L 2 4   ALA 4   25   ?    ?   ?   L . n 
L 2 5   ARG 5   26   ?    ?   ?   L . n 
L 2 6   LYS 6   27   ?    ?   ?   L . n 
L 2 7   SER 7   28   ?    ?   ?   L . n 
L 2 8   ALA 8   29   29   ALA ALA L . n 
L 2 9   PRO 9   30   30   PRO PRO L . n 
L 2 10  ALA 10  31   31   ALA ALA L . n 
L 2 11  THR 11  32   32   THR THR L . n 
L 2 12  GLY 12  33   33   GLY GLY L . n 
L 2 13  GLY 13  34   34   GLY GLY L . n 
L 2 14  VAL 14  35   35   VAL VAL L . n 
L 2 15  M3L 15  36   36   M3L M3L L . n 
L 2 16  LYS 16  37   37   LYS LYS L . n 
L 2 17  PRO 17  38   38   PRO PRO L . n 
L 2 18  HIS 18  39   39   HIS HIS L . n 
L 2 19  ARG 19  40   ?    ?   ?   L . n 
L 2 20  TYR 20  41   ?    ?   ?   L . n 
L 2 21  ARG 21  42   ?    ?   ?   L . n 
M 1 1   GLY 1   1074 ?    ?   ?   M . n 
M 1 2   GLY 2   1075 ?    ?   ?   M . n 
M 1 3   SER 3   1076 ?    ?   ?   M . n 
M 1 4   GLU 4   1077 ?    ?   ?   M . n 
M 1 5   ASP 5   1078 ?    ?   ?   M . n 
M 1 6   GLU 6   1079 ?    ?   ?   M . n 
M 1 7   ASP 7   1080 1080 ASP ASP M . n 
M 1 8   SER 8   1081 1081 SER SER M . n 
M 1 9   PRO 9   1082 1082 PRO PRO M . n 
M 1 10  LEU 10  1083 1083 LEU LEU M . n 
M 1 11  ASP 11  1084 1084 ASP ASP M . n 
M 1 12  ALA 12  1085 1085 ALA ALA M . n 
M 1 13  LEU 13  1086 1086 LEU LEU M . n 
M 1 14  ASP 14  1087 1087 ASP ASP M . n 
M 1 15  LEU 15  1088 1088 LEU LEU M . n 
M 1 16  VAL 16  1089 1089 VAL VAL M . n 
M 1 17  TRP 17  1090 1090 TRP TRP M . n 
M 1 18  ALA 18  1091 1091 ALA ALA M . n 
M 1 19  LYS 19  1092 1092 LYS LYS M . n 
M 1 20  CYS 20  1093 1093 CYS CYS M . n 
M 1 21  ARG 21  1094 1094 ARG ARG M . n 
M 1 22  GLY 22  1095 1095 GLY GLY M . n 
M 1 23  TYR 23  1096 1096 TYR TYR M . n 
M 1 24  PRO 24  1097 1097 PRO PRO M . n 
M 1 25  SER 25  1098 1098 SER SER M . n 
M 1 26  TYR 26  1099 1099 TYR TYR M . n 
M 1 27  PRO 27  1100 1100 PRO PRO M . n 
M 1 28  ALA 28  1101 1101 ALA ALA M . n 
M 1 29  LEU 29  1102 1102 LEU LEU M . n 
M 1 30  ILE 30  1103 1103 ILE ILE M . n 
M 1 31  ILE 31  1104 1104 ILE ILE M . n 
M 1 32  ASP 32  1105 1105 ASP ASP M . n 
M 1 33  PRO 33  1106 1106 PRO PRO M . n 
M 1 34  LYS 34  1107 1107 LYS LYS M . n 
M 1 35  MET 35  1108 1108 MET MET M . n 
M 1 36  PRO 36  1109 1109 PRO PRO M . n 
M 1 37  ARG 37  1110 1110 ARG ARG M . n 
M 1 38  GLU 38  1111 1111 GLU GLU M . n 
M 1 39  GLY 39  1112 1112 GLY GLY M . n 
M 1 40  MET 40  1113 1113 MET MET M . n 
M 1 41  PHE 41  1114 1114 PHE PHE M . n 
M 1 42  HIS 42  1115 1115 HIS HIS M . n 
M 1 43  HIS 43  1116 1116 HIS HIS M . n 
M 1 44  GLY 44  1117 1117 GLY GLY M . n 
M 1 45  VAL 45  1118 1118 VAL VAL M . n 
M 1 46  PRO 46  1119 1119 PRO PRO M . n 
M 1 47  ILE 47  1120 1120 ILE ILE M . n 
M 1 48  PRO 48  1121 1121 PRO PRO M . n 
M 1 49  VAL 49  1122 1122 VAL VAL M . n 
M 1 50  PRO 50  1123 1123 PRO PRO M . n 
M 1 51  PRO 51  1124 1124 PRO PRO M . n 
M 1 52  LEU 52  1125 1125 LEU LEU M . n 
M 1 53  GLU 53  1126 1126 GLU GLU M . n 
M 1 54  VAL 54  1127 1127 VAL VAL M . n 
M 1 55  LEU 55  1128 1128 LEU LEU M . n 
M 1 56  LYS 56  1129 1129 LYS LYS M . n 
M 1 57  LEU 57  1130 1130 LEU LEU M . n 
M 1 58  GLY 58  1131 1131 GLY GLY M . n 
M 1 59  GLU 59  1132 1132 GLU GLU M . n 
M 1 60  GLN 60  1133 1133 GLN GLN M . n 
M 1 61  MET 61  1134 1134 MET MET M . n 
M 1 62  THR 62  1135 1135 THR THR M . n 
M 1 63  GLN 63  1136 1136 GLN GLN M . n 
M 1 64  GLU 64  1137 1137 GLU GLU M . n 
M 1 65  ALA 65  1138 1138 ALA ALA M . n 
M 1 66  ARG 66  1139 1139 ARG ARG M . n 
M 1 67  GLU 67  1140 1140 GLU GLU M . n 
M 1 68  HIS 68  1141 1141 HIS HIS M . n 
M 1 69  LEU 69  1142 1142 LEU LEU M . n 
M 1 70  TYR 70  1143 1143 TYR TYR M . n 
M 1 71  LEU 71  1144 1144 LEU LEU M . n 
M 1 72  VAL 72  1145 1145 VAL VAL M . n 
M 1 73  LEU 73  1146 1146 LEU LEU M . n 
M 1 74  PHE 74  1147 1147 PHE PHE M . n 
M 1 75  PHE 75  1148 1148 PHE PHE M . n 
M 1 76  ASP 76  1149 1149 ASP ASP M . n 
M 1 77  ASN 77  1150 1150 ASN ASN M . n 
M 1 78  LYS 78  1151 1151 LYS LYS M . n 
M 1 79  ARG 79  1152 1152 ARG ARG M . n 
M 1 80  THR 80  1153 1153 THR THR M . n 
M 1 81  TRP 81  1154 1154 TRP TRP M . n 
M 1 82  GLN 82  1155 1155 GLN GLN M . n 
M 1 83  TRP 83  1156 1156 TRP TRP M . n 
M 1 84  LEU 84  1157 1157 LEU LEU M . n 
M 1 85  PRO 85  1158 1158 PRO PRO M . n 
M 1 86  ARG 86  1159 1159 ARG ARG M . n 
M 1 87  THR 87  1160 1160 THR THR M . n 
M 1 88  LYS 88  1161 1161 LYS LYS M . n 
M 1 89  LEU 89  1162 1162 LEU LEU M . n 
M 1 90  VAL 90  1163 1163 VAL VAL M . n 
M 1 91  PRO 91  1164 1164 PRO PRO M . n 
M 1 92  LEU 92  1165 1165 LEU LEU M . n 
M 1 93  GLY 93  1166 1166 GLY GLY M . n 
M 1 94  VAL 94  1167 1167 VAL VAL M . n 
M 1 95  ASN 95  1168 1168 ASN ASN M . n 
M 1 96  GLN 96  1169 1169 GLN GLN M . n 
M 1 97  ASP 97  1170 1170 ASP ASP M . n 
M 1 98  LEU 98  1171 1171 LEU LEU M . n 
M 1 99  ASP 99  1172 1172 ASP ASP M . n 
M 1 100 LYS 100 1173 1173 LYS LYS M . n 
M 1 101 GLU 101 1174 1174 GLU GLU M . n 
M 1 102 LYS 102 1175 1175 LYS LYS M . n 
M 1 103 MET 103 1176 1176 MET MET M . n 
M 1 104 LEU 104 1177 1177 LEU LEU M . n 
M 1 105 GLU 105 1178 1178 GLU GLU M . n 
M 1 106 GLY 106 1179 1179 GLY GLY M . n 
M 1 107 ARG 107 1180 1180 ARG ARG M . n 
M 1 108 LYS 108 1181 1181 LYS LYS M . n 
M 1 109 SER 109 1182 1182 SER SER M . n 
M 1 110 ASN 110 1183 1183 ASN ASN M . n 
M 1 111 ILE 111 1184 1184 ILE ILE M . n 
M 1 112 ARG 112 1185 1185 ARG ARG M . n 
M 1 113 LYS 113 1186 1186 LYS LYS M . n 
M 1 114 SER 114 1187 1187 SER SER M . n 
M 1 115 VAL 115 1188 1188 VAL VAL M . n 
M 1 116 GLN 116 1189 1189 GLN GLN M . n 
M 1 117 ILE 117 1190 1190 ILE ILE M . n 
M 1 118 ALA 118 1191 1191 ALA ALA M . n 
M 1 119 TYR 119 1192 1192 TYR TYR M . n 
M 1 120 HIS 120 1193 1193 HIS HIS M . n 
M 1 121 ARG 121 1194 1194 ARG ARG M . n 
M 1 122 ALA 122 1195 1195 ALA ALA M . n 
M 1 123 LEU 123 1196 1196 LEU LEU M . n 
M 1 124 GLN 124 1197 1197 GLN GLN M . n 
M 1 125 HIS 125 1198 1198 HIS HIS M . n 
M 1 126 ARG 126 1199 1199 ARG ARG M . n 
M 1 127 SER 127 1200 1200 SER SER M . n 
M 1 128 LYS 128 1201 1201 LYS LYS M . n 
M 1 129 VAL 129 1202 1202 VAL VAL M . n 
M 1 130 GLN 130 1203 1203 GLN GLN M . n 
M 1 131 GLY 131 1204 1204 GLY GLY M . n 
M 1 132 GLU 132 1205 1205 GLU GLU M . n 
N 2 1   THR 1   22   ?    ?   ?   N . n 
N 2 2   LYS 2   23   ?    ?   ?   N . n 
N 2 3   ALA 3   24   ?    ?   ?   N . n 
N 2 4   ALA 4   25   ?    ?   ?   N . n 
N 2 5   ARG 5   26   ?    ?   ?   N . n 
N 2 6   LYS 6   27   ?    ?   ?   N . n 
N 2 7   SER 7   28   28   SER SER N . n 
N 2 8   ALA 8   29   29   ALA ALA N . n 
N 2 9   PRO 9   30   30   PRO PRO N . n 
N 2 10  ALA 10  31   31   ALA ALA N . n 
N 2 11  THR 11  32   32   THR THR N . n 
N 2 12  GLY 12  33   33   GLY GLY N . n 
N 2 13  GLY 13  34   34   GLY GLY N . n 
N 2 14  VAL 14  35   35   VAL VAL N . n 
N 2 15  M3L 15  36   36   M3L M3L N . n 
N 2 16  LYS 16  37   37   LYS LYS N . n 
N 2 17  PRO 17  38   38   PRO PRO N . n 
N 2 18  HIS 18  39   39   HIS HIS N . n 
N 2 19  ARG 19  40   40   ARG ARG N . n 
N 2 20  TYR 20  41   41   TYR TYR N . n 
N 2 21  ARG 21  42   ?    ?   ?   N . n 
O 1 1   GLY 1   1074 ?    ?   ?   O . n 
O 1 2   GLY 2   1075 ?    ?   ?   O . n 
O 1 3   SER 3   1076 ?    ?   ?   O . n 
O 1 4   GLU 4   1077 ?    ?   ?   O . n 
O 1 5   ASP 5   1078 ?    ?   ?   O . n 
O 1 6   GLU 6   1079 ?    ?   ?   O . n 
O 1 7   ASP 7   1080 1080 ASP ASP O . n 
O 1 8   SER 8   1081 1081 SER SER O . n 
O 1 9   PRO 9   1082 1082 PRO PRO O . n 
O 1 10  LEU 10  1083 1083 LEU LEU O . n 
O 1 11  ASP 11  1084 1084 ASP ASP O . n 
O 1 12  ALA 12  1085 1085 ALA ALA O . n 
O 1 13  LEU 13  1086 1086 LEU LEU O . n 
O 1 14  ASP 14  1087 1087 ASP ASP O . n 
O 1 15  LEU 15  1088 1088 LEU LEU O . n 
O 1 16  VAL 16  1089 1089 VAL VAL O . n 
O 1 17  TRP 17  1090 1090 TRP TRP O . n 
O 1 18  ALA 18  1091 1091 ALA ALA O . n 
O 1 19  LYS 19  1092 1092 LYS LYS O . n 
O 1 20  CYS 20  1093 1093 CYS CYS O . n 
O 1 21  ARG 21  1094 1094 ARG ARG O . n 
O 1 22  GLY 22  1095 1095 GLY GLY O . n 
O 1 23  TYR 23  1096 1096 TYR TYR O . n 
O 1 24  PRO 24  1097 1097 PRO PRO O . n 
O 1 25  SER 25  1098 1098 SER SER O . n 
O 1 26  TYR 26  1099 1099 TYR TYR O . n 
O 1 27  PRO 27  1100 1100 PRO PRO O . n 
O 1 28  ALA 28  1101 1101 ALA ALA O . n 
O 1 29  LEU 29  1102 1102 LEU LEU O . n 
O 1 30  ILE 30  1103 1103 ILE ILE O . n 
O 1 31  ILE 31  1104 1104 ILE ILE O . n 
O 1 32  ASP 32  1105 1105 ASP ASP O . n 
O 1 33  PRO 33  1106 1106 PRO PRO O . n 
O 1 34  LYS 34  1107 1107 LYS LYS O . n 
O 1 35  MET 35  1108 1108 MET MET O . n 
O 1 36  PRO 36  1109 1109 PRO PRO O . n 
O 1 37  ARG 37  1110 1110 ARG ARG O . n 
O 1 38  GLU 38  1111 1111 GLU GLU O . n 
O 1 39  GLY 39  1112 1112 GLY GLY O . n 
O 1 40  MET 40  1113 1113 MET MET O . n 
O 1 41  PHE 41  1114 1114 PHE PHE O . n 
O 1 42  HIS 42  1115 1115 HIS HIS O . n 
O 1 43  HIS 43  1116 1116 HIS HIS O . n 
O 1 44  GLY 44  1117 1117 GLY GLY O . n 
O 1 45  VAL 45  1118 1118 VAL VAL O . n 
O 1 46  PRO 46  1119 1119 PRO PRO O . n 
O 1 47  ILE 47  1120 1120 ILE ILE O . n 
O 1 48  PRO 48  1121 1121 PRO PRO O . n 
O 1 49  VAL 49  1122 1122 VAL VAL O . n 
O 1 50  PRO 50  1123 1123 PRO PRO O . n 
O 1 51  PRO 51  1124 1124 PRO PRO O . n 
O 1 52  LEU 52  1125 1125 LEU LEU O . n 
O 1 53  GLU 53  1126 1126 GLU GLU O . n 
O 1 54  VAL 54  1127 1127 VAL VAL O . n 
O 1 55  LEU 55  1128 1128 LEU LEU O . n 
O 1 56  LYS 56  1129 1129 LYS LYS O . n 
O 1 57  LEU 57  1130 1130 LEU LEU O . n 
O 1 58  GLY 58  1131 1131 GLY GLY O . n 
O 1 59  GLU 59  1132 1132 GLU GLU O . n 
O 1 60  GLN 60  1133 1133 GLN GLN O . n 
O 1 61  MET 61  1134 1134 MET MET O . n 
O 1 62  THR 62  1135 1135 THR THR O . n 
O 1 63  GLN 63  1136 1136 GLN GLN O . n 
O 1 64  GLU 64  1137 1137 GLU GLU O . n 
O 1 65  ALA 65  1138 1138 ALA ALA O . n 
O 1 66  ARG 66  1139 1139 ARG ARG O . n 
O 1 67  GLU 67  1140 1140 GLU GLU O . n 
O 1 68  HIS 68  1141 1141 HIS HIS O . n 
O 1 69  LEU 69  1142 1142 LEU LEU O . n 
O 1 70  TYR 70  1143 1143 TYR TYR O . n 
O 1 71  LEU 71  1144 1144 LEU LEU O . n 
O 1 72  VAL 72  1145 1145 VAL VAL O . n 
O 1 73  LEU 73  1146 1146 LEU LEU O . n 
O 1 74  PHE 74  1147 1147 PHE PHE O . n 
O 1 75  PHE 75  1148 1148 PHE PHE O . n 
O 1 76  ASP 76  1149 1149 ASP ASP O . n 
O 1 77  ASN 77  1150 1150 ASN ASN O . n 
O 1 78  LYS 78  1151 1151 LYS LYS O . n 
O 1 79  ARG 79  1152 1152 ARG ARG O . n 
O 1 80  THR 80  1153 1153 THR THR O . n 
O 1 81  TRP 81  1154 1154 TRP TRP O . n 
O 1 82  GLN 82  1155 1155 GLN GLN O . n 
O 1 83  TRP 83  1156 1156 TRP TRP O . n 
O 1 84  LEU 84  1157 1157 LEU LEU O . n 
O 1 85  PRO 85  1158 1158 PRO PRO O . n 
O 1 86  ARG 86  1159 1159 ARG ARG O . n 
O 1 87  THR 87  1160 1160 THR THR O . n 
O 1 88  LYS 88  1161 1161 LYS LYS O . n 
O 1 89  LEU 89  1162 1162 LEU LEU O . n 
O 1 90  VAL 90  1163 1163 VAL VAL O . n 
O 1 91  PRO 91  1164 1164 PRO PRO O . n 
O 1 92  LEU 92  1165 1165 LEU LEU O . n 
O 1 93  GLY 93  1166 1166 GLY GLY O . n 
O 1 94  VAL 94  1167 1167 VAL VAL O . n 
O 1 95  ASN 95  1168 1168 ASN ASN O . n 
O 1 96  GLN 96  1169 1169 GLN GLN O . n 
O 1 97  ASP 97  1170 1170 ASP ASP O . n 
O 1 98  LEU 98  1171 1171 LEU LEU O . n 
O 1 99  ASP 99  1172 1172 ASP ASP O . n 
O 1 100 LYS 100 1173 1173 LYS LYS O . n 
O 1 101 GLU 101 1174 1174 GLU GLU O . n 
O 1 102 LYS 102 1175 1175 LYS LYS O . n 
O 1 103 MET 103 1176 1176 MET MET O . n 
O 1 104 LEU 104 1177 1177 LEU LEU O . n 
O 1 105 GLU 105 1178 1178 GLU GLU O . n 
O 1 106 GLY 106 1179 1179 GLY GLY O . n 
O 1 107 ARG 107 1180 1180 ARG ARG O . n 
O 1 108 LYS 108 1181 1181 LYS LYS O . n 
O 1 109 SER 109 1182 1182 SER SER O . n 
O 1 110 ASN 110 1183 1183 ASN ASN O . n 
O 1 111 ILE 111 1184 1184 ILE ILE O . n 
O 1 112 ARG 112 1185 1185 ARG ARG O . n 
O 1 113 LYS 113 1186 1186 LYS LYS O . n 
O 1 114 SER 114 1187 1187 SER SER O . n 
O 1 115 VAL 115 1188 1188 VAL VAL O . n 
O 1 116 GLN 116 1189 1189 GLN GLN O . n 
O 1 117 ILE 117 1190 1190 ILE ILE O . n 
O 1 118 ALA 118 1191 1191 ALA ALA O . n 
O 1 119 TYR 119 1192 1192 TYR TYR O . n 
O 1 120 HIS 120 1193 1193 HIS HIS O . n 
O 1 121 ARG 121 1194 1194 ARG ARG O . n 
O 1 122 ALA 122 1195 1195 ALA ALA O . n 
O 1 123 LEU 123 1196 1196 LEU LEU O . n 
O 1 124 GLN 124 1197 1197 GLN GLN O . n 
O 1 125 HIS 125 1198 1198 HIS HIS O . n 
O 1 126 ARG 126 1199 1199 ARG ARG O . n 
O 1 127 SER 127 1200 1200 SER SER O . n 
O 1 128 LYS 128 1201 1201 LYS LYS O . n 
O 1 129 VAL 129 1202 1202 VAL VAL O . n 
O 1 130 GLN 130 1203 ?    ?   ?   O . n 
O 1 131 GLY 131 1204 ?    ?   ?   O . n 
O 1 132 GLU 132 1205 ?    ?   ?   O . n 
P 2 1   THR 1   22   ?    ?   ?   P . n 
P 2 2   LYS 2   23   ?    ?   ?   P . n 
P 2 3   ALA 3   24   ?    ?   ?   P . n 
P 2 4   ALA 4   25   25   ALA ALA P . n 
P 2 5   ARG 5   26   26   ARG ARG P . n 
P 2 6   LYS 6   27   27   LYS LYS P . n 
P 2 7   SER 7   28   28   SER SER P . n 
P 2 8   ALA 8   29   29   ALA ALA P . n 
P 2 9   PRO 9   30   30   PRO PRO P . n 
P 2 10  ALA 10  31   31   ALA ALA P . n 
P 2 11  THR 11  32   32   THR THR P . n 
P 2 12  GLY 12  33   33   GLY GLY P . n 
P 2 13  GLY 13  34   34   GLY GLY P . n 
P 2 14  VAL 14  35   35   VAL VAL P . n 
P 2 15  M3L 15  36   36   M3L M3L P . n 
P 2 16  LYS 16  37   37   LYS LYS P . n 
P 2 17  PRO 17  38   ?    ?   ?   P . n 
P 2 18  HIS 18  39   ?    ?   ?   P . n 
P 2 19  ARG 19  40   ?    ?   ?   P . n 
P 2 20  TYR 20  41   ?    ?   ?   P . n 
P 2 21  ARG 21  42   ?    ?   ?   P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
Q  3 SO4 1   2206 2206 SO4 SO4 A . 
R  3 SO4 1   2207 2207 SO4 SO4 A . 
S  3 SO4 1   2208 2208 SO4 SO4 A . 
T  3 SO4 1   2205 2205 SO4 SO4 C . 
U  3 SO4 1   1041 1041 SO4 SO4 D . 
V  3 SO4 1   2206 2206 SO4 SO4 E . 
W  3 SO4 1   2204 2204 SO4 SO4 G . 
X  4 HOH 1   2001 2001 HOH HOH A . 
X  4 HOH 2   2002 2002 HOH HOH A . 
X  4 HOH 3   2003 2003 HOH HOH A . 
X  4 HOH 4   2004 2004 HOH HOH A . 
X  4 HOH 5   2005 2005 HOH HOH A . 
X  4 HOH 6   2006 2006 HOH HOH A . 
X  4 HOH 7   2007 2007 HOH HOH A . 
X  4 HOH 8   2008 2008 HOH HOH A . 
X  4 HOH 9   2009 2009 HOH HOH A . 
X  4 HOH 10  2010 2010 HOH HOH A . 
X  4 HOH 11  2011 2011 HOH HOH A . 
X  4 HOH 12  2012 2012 HOH HOH A . 
X  4 HOH 13  2013 2013 HOH HOH A . 
X  4 HOH 14  2014 2014 HOH HOH A . 
X  4 HOH 15  2015 2015 HOH HOH A . 
X  4 HOH 16  2016 2016 HOH HOH A . 
X  4 HOH 17  2017 2017 HOH HOH A . 
X  4 HOH 18  2018 2018 HOH HOH A . 
X  4 HOH 19  2019 2019 HOH HOH A . 
X  4 HOH 20  2020 2020 HOH HOH A . 
X  4 HOH 21  2021 2021 HOH HOH A . 
X  4 HOH 22  2022 2022 HOH HOH A . 
X  4 HOH 23  2023 2023 HOH HOH A . 
X  4 HOH 24  2024 2024 HOH HOH A . 
X  4 HOH 25  2025 2025 HOH HOH A . 
X  4 HOH 26  2026 2026 HOH HOH A . 
X  4 HOH 27  2027 2027 HOH HOH A . 
X  4 HOH 28  2028 2028 HOH HOH A . 
X  4 HOH 29  2029 2029 HOH HOH A . 
X  4 HOH 30  2030 2030 HOH HOH A . 
X  4 HOH 31  2031 2031 HOH HOH A . 
X  4 HOH 32  2032 2032 HOH HOH A . 
X  4 HOH 33  2033 2033 HOH HOH A . 
X  4 HOH 34  2034 2034 HOH HOH A . 
X  4 HOH 35  2035 2035 HOH HOH A . 
X  4 HOH 36  2036 2036 HOH HOH A . 
X  4 HOH 37  2037 2037 HOH HOH A . 
X  4 HOH 38  2038 2038 HOH HOH A . 
X  4 HOH 39  2039 2039 HOH HOH A . 
X  4 HOH 40  2040 2040 HOH HOH A . 
X  4 HOH 41  2041 2041 HOH HOH A . 
X  4 HOH 42  2042 2042 HOH HOH A . 
X  4 HOH 43  2043 2043 HOH HOH A . 
X  4 HOH 44  2044 2044 HOH HOH A . 
X  4 HOH 45  2045 2045 HOH HOH A . 
X  4 HOH 46  2046 2046 HOH HOH A . 
X  4 HOH 47  2047 2047 HOH HOH A . 
X  4 HOH 48  2048 2048 HOH HOH A . 
X  4 HOH 49  2049 2049 HOH HOH A . 
X  4 HOH 50  2050 2050 HOH HOH A . 
X  4 HOH 51  2051 2051 HOH HOH A . 
X  4 HOH 52  2052 2052 HOH HOH A . 
X  4 HOH 53  2053 2053 HOH HOH A . 
X  4 HOH 54  2054 2054 HOH HOH A . 
X  4 HOH 55  2055 2055 HOH HOH A . 
X  4 HOH 56  2056 2056 HOH HOH A . 
X  4 HOH 57  2057 2057 HOH HOH A . 
X  4 HOH 58  2058 2058 HOH HOH A . 
X  4 HOH 59  2059 2059 HOH HOH A . 
X  4 HOH 60  2060 2060 HOH HOH A . 
X  4 HOH 61  2061 2061 HOH HOH A . 
X  4 HOH 62  2062 2062 HOH HOH A . 
X  4 HOH 63  2063 2063 HOH HOH A . 
X  4 HOH 64  2064 2064 HOH HOH A . 
X  4 HOH 65  2065 2065 HOH HOH A . 
X  4 HOH 66  2066 2066 HOH HOH A . 
X  4 HOH 67  2067 2067 HOH HOH A . 
X  4 HOH 68  2068 2068 HOH HOH A . 
X  4 HOH 69  2069 2069 HOH HOH A . 
X  4 HOH 70  2070 2070 HOH HOH A . 
X  4 HOH 71  2071 2071 HOH HOH A . 
X  4 HOH 72  2072 2072 HOH HOH A . 
X  4 HOH 73  2073 2073 HOH HOH A . 
X  4 HOH 74  2074 2074 HOH HOH A . 
X  4 HOH 75  2075 2075 HOH HOH A . 
X  4 HOH 76  2076 2076 HOH HOH A . 
X  4 HOH 77  2077 2077 HOH HOH A . 
X  4 HOH 78  2078 2078 HOH HOH A . 
X  4 HOH 79  2079 2079 HOH HOH A . 
X  4 HOH 80  2080 2080 HOH HOH A . 
X  4 HOH 81  2081 2081 HOH HOH A . 
X  4 HOH 82  2082 2082 HOH HOH A . 
X  4 HOH 83  2083 2083 HOH HOH A . 
X  4 HOH 84  2084 2084 HOH HOH A . 
X  4 HOH 85  2085 2085 HOH HOH A . 
X  4 HOH 86  2086 2086 HOH HOH A . 
X  4 HOH 87  2087 2087 HOH HOH A . 
X  4 HOH 88  2088 2088 HOH HOH A . 
X  4 HOH 89  2089 2089 HOH HOH A . 
X  4 HOH 90  2090 2090 HOH HOH A . 
X  4 HOH 91  2091 2091 HOH HOH A . 
X  4 HOH 92  2092 2092 HOH HOH A . 
X  4 HOH 93  2093 2093 HOH HOH A . 
X  4 HOH 94  2094 2094 HOH HOH A . 
X  4 HOH 95  2095 2095 HOH HOH A . 
X  4 HOH 96  2096 2096 HOH HOH A . 
X  4 HOH 97  2097 2097 HOH HOH A . 
X  4 HOH 98  2098 2098 HOH HOH A . 
X  4 HOH 99  2099 2099 HOH HOH A . 
X  4 HOH 100 2100 2100 HOH HOH A . 
X  4 HOH 101 2101 2101 HOH HOH A . 
X  4 HOH 102 2102 2102 HOH HOH A . 
X  4 HOH 103 2103 2103 HOH HOH A . 
X  4 HOH 104 2104 2104 HOH HOH A . 
X  4 HOH 105 2105 2105 HOH HOH A . 
X  4 HOH 106 2106 2106 HOH HOH A . 
X  4 HOH 107 2107 2107 HOH HOH A . 
X  4 HOH 108 2108 2108 HOH HOH A . 
X  4 HOH 109 2109 2109 HOH HOH A . 
X  4 HOH 110 2110 2110 HOH HOH A . 
X  4 HOH 111 2111 2111 HOH HOH A . 
X  4 HOH 112 2112 2112 HOH HOH A . 
X  4 HOH 113 2113 2113 HOH HOH A . 
X  4 HOH 114 2114 2114 HOH HOH A . 
X  4 HOH 115 2115 2115 HOH HOH A . 
X  4 HOH 116 2116 2116 HOH HOH A . 
X  4 HOH 117 2117 2117 HOH HOH A . 
X  4 HOH 118 2118 2118 HOH HOH A . 
X  4 HOH 119 2119 2119 HOH HOH A . 
X  4 HOH 120 2120 2120 HOH HOH A . 
X  4 HOH 121 2121 2121 HOH HOH A . 
X  4 HOH 122 2122 2122 HOH HOH A . 
X  4 HOH 123 2123 2123 HOH HOH A . 
X  4 HOH 124 2124 2124 HOH HOH A . 
X  4 HOH 125 2125 2125 HOH HOH A . 
X  4 HOH 126 2126 2126 HOH HOH A . 
X  4 HOH 127 2127 2127 HOH HOH A . 
X  4 HOH 128 2128 2128 HOH HOH A . 
X  4 HOH 129 2129 2129 HOH HOH A . 
X  4 HOH 130 2130 2130 HOH HOH A . 
X  4 HOH 131 2131 2131 HOH HOH A . 
X  4 HOH 132 2132 2132 HOH HOH A . 
X  4 HOH 133 2133 2133 HOH HOH A . 
X  4 HOH 134 2134 2134 HOH HOH A . 
X  4 HOH 135 2135 2135 HOH HOH A . 
X  4 HOH 136 2136 2136 HOH HOH A . 
X  4 HOH 137 2137 2137 HOH HOH A . 
X  4 HOH 138 2138 2138 HOH HOH A . 
X  4 HOH 139 2139 2139 HOH HOH A . 
X  4 HOH 140 2140 2140 HOH HOH A . 
X  4 HOH 141 2141 2141 HOH HOH A . 
X  4 HOH 142 2142 2142 HOH HOH A . 
X  4 HOH 143 2143 2143 HOH HOH A . 
X  4 HOH 144 2144 2144 HOH HOH A . 
X  4 HOH 145 2145 2145 HOH HOH A . 
X  4 HOH 146 2146 2146 HOH HOH A . 
X  4 HOH 147 2147 2147 HOH HOH A . 
X  4 HOH 148 2148 2148 HOH HOH A . 
X  4 HOH 149 2149 2149 HOH HOH A . 
X  4 HOH 150 2150 2150 HOH HOH A . 
X  4 HOH 151 2151 2151 HOH HOH A . 
X  4 HOH 152 2152 2152 HOH HOH A . 
X  4 HOH 153 2153 2153 HOH HOH A . 
X  4 HOH 154 2154 2154 HOH HOH A . 
Y  4 HOH 1   2001 2001 HOH HOH B . 
Y  4 HOH 2   2002 2002 HOH HOH B . 
Y  4 HOH 3   2003 2003 HOH HOH B . 
Y  4 HOH 4   2004 2004 HOH HOH B . 
Y  4 HOH 5   2005 2005 HOH HOH B . 
Y  4 HOH 6   2006 2006 HOH HOH B . 
Y  4 HOH 7   2007 2007 HOH HOH B . 
Y  4 HOH 8   2008 2008 HOH HOH B . 
Y  4 HOH 9   2009 2009 HOH HOH B . 
Y  4 HOH 10  2010 2010 HOH HOH B . 
Y  4 HOH 11  2011 2011 HOH HOH B . 
Y  4 HOH 12  2012 2012 HOH HOH B . 
Y  4 HOH 13  2013 2013 HOH HOH B . 
Y  4 HOH 14  2014 2014 HOH HOH B . 
Y  4 HOH 15  2015 2015 HOH HOH B . 
Y  4 HOH 16  2016 2016 HOH HOH B . 
Y  4 HOH 17  2017 2017 HOH HOH B . 
Y  4 HOH 18  2018 2018 HOH HOH B . 
Y  4 HOH 19  2019 2019 HOH HOH B . 
Y  4 HOH 20  2020 2020 HOH HOH B . 
Y  4 HOH 21  2021 2021 HOH HOH B . 
Y  4 HOH 22  2022 2022 HOH HOH B . 
Y  4 HOH 23  2023 2023 HOH HOH B . 
Y  4 HOH 24  2024 2024 HOH HOH B . 
Z  4 HOH 1   2001 2001 HOH HOH C . 
Z  4 HOH 2   2002 2002 HOH HOH C . 
Z  4 HOH 3   2003 2003 HOH HOH C . 
Z  4 HOH 4   2004 2004 HOH HOH C . 
Z  4 HOH 5   2005 2005 HOH HOH C . 
Z  4 HOH 6   2006 2006 HOH HOH C . 
Z  4 HOH 7   2007 2007 HOH HOH C . 
Z  4 HOH 8   2008 2008 HOH HOH C . 
Z  4 HOH 9   2009 2009 HOH HOH C . 
Z  4 HOH 10  2010 2010 HOH HOH C . 
Z  4 HOH 11  2011 2011 HOH HOH C . 
Z  4 HOH 12  2012 2012 HOH HOH C . 
Z  4 HOH 13  2013 2013 HOH HOH C . 
Z  4 HOH 14  2014 2014 HOH HOH C . 
Z  4 HOH 15  2015 2015 HOH HOH C . 
Z  4 HOH 16  2016 2016 HOH HOH C . 
Z  4 HOH 17  2017 2017 HOH HOH C . 
Z  4 HOH 18  2018 2018 HOH HOH C . 
Z  4 HOH 19  2019 2019 HOH HOH C . 
Z  4 HOH 20  2020 2020 HOH HOH C . 
Z  4 HOH 21  2021 2021 HOH HOH C . 
Z  4 HOH 22  2022 2022 HOH HOH C . 
Z  4 HOH 23  2023 2023 HOH HOH C . 
Z  4 HOH 24  2024 2024 HOH HOH C . 
Z  4 HOH 25  2025 2025 HOH HOH C . 
Z  4 HOH 26  2026 2026 HOH HOH C . 
Z  4 HOH 27  2027 2027 HOH HOH C . 
Z  4 HOH 28  2028 2028 HOH HOH C . 
Z  4 HOH 29  2029 2029 HOH HOH C . 
Z  4 HOH 30  2030 2030 HOH HOH C . 
Z  4 HOH 31  2031 2031 HOH HOH C . 
Z  4 HOH 32  2032 2032 HOH HOH C . 
Z  4 HOH 33  2033 2033 HOH HOH C . 
Z  4 HOH 34  2034 2034 HOH HOH C . 
Z  4 HOH 35  2035 2035 HOH HOH C . 
Z  4 HOH 36  2036 2036 HOH HOH C . 
Z  4 HOH 37  2037 2037 HOH HOH C . 
Z  4 HOH 38  2038 2038 HOH HOH C . 
Z  4 HOH 39  2039 2039 HOH HOH C . 
Z  4 HOH 40  2040 2040 HOH HOH C . 
Z  4 HOH 41  2041 2041 HOH HOH C . 
Z  4 HOH 42  2042 2042 HOH HOH C . 
Z  4 HOH 43  2043 2043 HOH HOH C . 
Z  4 HOH 44  2044 2044 HOH HOH C . 
Z  4 HOH 45  2045 2045 HOH HOH C . 
Z  4 HOH 46  2046 2046 HOH HOH C . 
Z  4 HOH 47  2047 2047 HOH HOH C . 
Z  4 HOH 48  2048 2048 HOH HOH C . 
Z  4 HOH 49  2049 2049 HOH HOH C . 
Z  4 HOH 50  2050 2050 HOH HOH C . 
Z  4 HOH 51  2051 2051 HOH HOH C . 
Z  4 HOH 52  2052 2052 HOH HOH C . 
Z  4 HOH 53  2053 2053 HOH HOH C . 
Z  4 HOH 54  2054 2054 HOH HOH C . 
Z  4 HOH 55  2055 2055 HOH HOH C . 
Z  4 HOH 56  2056 2056 HOH HOH C . 
Z  4 HOH 57  2057 2057 HOH HOH C . 
Z  4 HOH 58  2058 2058 HOH HOH C . 
Z  4 HOH 59  2059 2059 HOH HOH C . 
Z  4 HOH 60  2060 2060 HOH HOH C . 
Z  4 HOH 61  2061 2061 HOH HOH C . 
Z  4 HOH 62  2062 2062 HOH HOH C . 
Z  4 HOH 63  2063 2063 HOH HOH C . 
Z  4 HOH 64  2064 2064 HOH HOH C . 
Z  4 HOH 65  2065 2065 HOH HOH C . 
Z  4 HOH 66  2066 2066 HOH HOH C . 
Z  4 HOH 67  2067 2067 HOH HOH C . 
Z  4 HOH 68  2068 2068 HOH HOH C . 
Z  4 HOH 69  2069 2069 HOH HOH C . 
Z  4 HOH 70  2070 2070 HOH HOH C . 
Z  4 HOH 71  2071 2071 HOH HOH C . 
Z  4 HOH 72  2072 2072 HOH HOH C . 
Z  4 HOH 73  2073 2073 HOH HOH C . 
Z  4 HOH 74  2074 2074 HOH HOH C . 
Z  4 HOH 75  2075 2075 HOH HOH C . 
Z  4 HOH 76  2076 2076 HOH HOH C . 
Z  4 HOH 77  2077 2077 HOH HOH C . 
Z  4 HOH 78  2078 2078 HOH HOH C . 
Z  4 HOH 79  2079 2079 HOH HOH C . 
Z  4 HOH 80  2080 2080 HOH HOH C . 
Z  4 HOH 81  2081 2081 HOH HOH C . 
Z  4 HOH 82  2082 2082 HOH HOH C . 
Z  4 HOH 83  2083 2083 HOH HOH C . 
Z  4 HOH 84  2084 2084 HOH HOH C . 
Z  4 HOH 85  2085 2085 HOH HOH C . 
Z  4 HOH 86  2086 2086 HOH HOH C . 
Z  4 HOH 87  2087 2087 HOH HOH C . 
Z  4 HOH 88  2088 2088 HOH HOH C . 
Z  4 HOH 89  2089 2089 HOH HOH C . 
Z  4 HOH 90  2090 2090 HOH HOH C . 
Z  4 HOH 91  2091 2091 HOH HOH C . 
Z  4 HOH 92  2092 2092 HOH HOH C . 
Z  4 HOH 93  2093 2093 HOH HOH C . 
Z  4 HOH 94  2094 2094 HOH HOH C . 
Z  4 HOH 95  2095 2095 HOH HOH C . 
Z  4 HOH 96  2096 2096 HOH HOH C . 
Z  4 HOH 97  2097 2097 HOH HOH C . 
Z  4 HOH 98  2098 2098 HOH HOH C . 
Z  4 HOH 99  2099 2099 HOH HOH C . 
Z  4 HOH 100 2100 2100 HOH HOH C . 
Z  4 HOH 101 2101 2101 HOH HOH C . 
Z  4 HOH 102 2102 2102 HOH HOH C . 
Z  4 HOH 103 2103 2103 HOH HOH C . 
Z  4 HOH 104 2104 2104 HOH HOH C . 
Z  4 HOH 105 2105 2105 HOH HOH C . 
Z  4 HOH 106 2106 2106 HOH HOH C . 
Z  4 HOH 107 2107 2107 HOH HOH C . 
Z  4 HOH 108 2108 2108 HOH HOH C . 
Z  4 HOH 109 2109 2109 HOH HOH C . 
Z  4 HOH 110 2110 2110 HOH HOH C . 
Z  4 HOH 111 2111 2111 HOH HOH C . 
Z  4 HOH 112 2112 2112 HOH HOH C . 
Z  4 HOH 113 2113 2113 HOH HOH C . 
AA 4 HOH 1   2001 2001 HOH HOH D . 
AA 4 HOH 2   2002 2002 HOH HOH D . 
AA 4 HOH 3   2003 2003 HOH HOH D . 
AA 4 HOH 4   2004 2004 HOH HOH D . 
AA 4 HOH 5   2005 2005 HOH HOH D . 
AA 4 HOH 6   2006 2006 HOH HOH D . 
AA 4 HOH 7   2007 2007 HOH HOH D . 
AA 4 HOH 8   2008 2008 HOH HOH D . 
AA 4 HOH 9   2009 2009 HOH HOH D . 
AA 4 HOH 10  2010 2010 HOH HOH D . 
AA 4 HOH 11  2011 2011 HOH HOH D . 
AA 4 HOH 12  2012 2012 HOH HOH D . 
AA 4 HOH 13  2013 2013 HOH HOH D . 
AA 4 HOH 14  2014 2014 HOH HOH D . 
BA 4 HOH 1   2001 2001 HOH HOH E . 
BA 4 HOH 2   2002 2002 HOH HOH E . 
BA 4 HOH 3   2003 2003 HOH HOH E . 
BA 4 HOH 4   2004 2004 HOH HOH E . 
BA 4 HOH 5   2005 2005 HOH HOH E . 
BA 4 HOH 6   2006 2006 HOH HOH E . 
BA 4 HOH 7   2007 2007 HOH HOH E . 
BA 4 HOH 8   2008 2008 HOH HOH E . 
BA 4 HOH 9   2009 2009 HOH HOH E . 
BA 4 HOH 10  2010 2010 HOH HOH E . 
BA 4 HOH 11  2011 2011 HOH HOH E . 
BA 4 HOH 12  2012 2012 HOH HOH E . 
BA 4 HOH 13  2013 2013 HOH HOH E . 
BA 4 HOH 14  2014 2014 HOH HOH E . 
BA 4 HOH 15  2015 2015 HOH HOH E . 
BA 4 HOH 16  2016 2016 HOH HOH E . 
BA 4 HOH 17  2017 2017 HOH HOH E . 
BA 4 HOH 18  2018 2018 HOH HOH E . 
BA 4 HOH 19  2019 2019 HOH HOH E . 
BA 4 HOH 20  2020 2020 HOH HOH E . 
BA 4 HOH 21  2021 2021 HOH HOH E . 
BA 4 HOH 22  2022 2022 HOH HOH E . 
BA 4 HOH 23  2023 2023 HOH HOH E . 
BA 4 HOH 24  2024 2024 HOH HOH E . 
BA 4 HOH 25  2025 2025 HOH HOH E . 
BA 4 HOH 26  2026 2026 HOH HOH E . 
BA 4 HOH 27  2027 2027 HOH HOH E . 
BA 4 HOH 28  2028 2028 HOH HOH E . 
BA 4 HOH 29  2029 2029 HOH HOH E . 
BA 4 HOH 30  2030 2030 HOH HOH E . 
BA 4 HOH 31  2031 2031 HOH HOH E . 
BA 4 HOH 32  2032 2032 HOH HOH E . 
BA 4 HOH 33  2033 2033 HOH HOH E . 
BA 4 HOH 34  2034 2034 HOH HOH E . 
BA 4 HOH 35  2035 2035 HOH HOH E . 
BA 4 HOH 36  2036 2036 HOH HOH E . 
BA 4 HOH 37  2037 2037 HOH HOH E . 
BA 4 HOH 38  2038 2038 HOH HOH E . 
BA 4 HOH 39  2039 2039 HOH HOH E . 
BA 4 HOH 40  2040 2040 HOH HOH E . 
BA 4 HOH 41  2041 2041 HOH HOH E . 
BA 4 HOH 42  2042 2042 HOH HOH E . 
BA 4 HOH 43  2043 2043 HOH HOH E . 
BA 4 HOH 44  2044 2044 HOH HOH E . 
BA 4 HOH 45  2045 2045 HOH HOH E . 
BA 4 HOH 46  2046 2046 HOH HOH E . 
BA 4 HOH 47  2047 2047 HOH HOH E . 
BA 4 HOH 48  2048 2048 HOH HOH E . 
BA 4 HOH 49  2049 2049 HOH HOH E . 
BA 4 HOH 50  2050 2050 HOH HOH E . 
BA 4 HOH 51  2051 2051 HOH HOH E . 
BA 4 HOH 52  2052 2052 HOH HOH E . 
BA 4 HOH 53  2053 2053 HOH HOH E . 
BA 4 HOH 54  2054 2054 HOH HOH E . 
BA 4 HOH 55  2055 2055 HOH HOH E . 
BA 4 HOH 56  2056 2056 HOH HOH E . 
BA 4 HOH 57  2057 2057 HOH HOH E . 
BA 4 HOH 58  2058 2058 HOH HOH E . 
BA 4 HOH 59  2059 2059 HOH HOH E . 
BA 4 HOH 60  2060 2060 HOH HOH E . 
BA 4 HOH 61  2061 2061 HOH HOH E . 
BA 4 HOH 62  2062 2062 HOH HOH E . 
BA 4 HOH 63  2063 2063 HOH HOH E . 
BA 4 HOH 64  2064 2064 HOH HOH E . 
BA 4 HOH 65  2065 2065 HOH HOH E . 
BA 4 HOH 66  2066 2066 HOH HOH E . 
BA 4 HOH 67  2067 2067 HOH HOH E . 
BA 4 HOH 68  2068 2068 HOH HOH E . 
BA 4 HOH 69  2069 2069 HOH HOH E . 
BA 4 HOH 70  2070 2070 HOH HOH E . 
BA 4 HOH 71  2071 2071 HOH HOH E . 
BA 4 HOH 72  2072 2072 HOH HOH E . 
BA 4 HOH 73  2073 2073 HOH HOH E . 
BA 4 HOH 74  2074 2074 HOH HOH E . 
BA 4 HOH 75  2075 2075 HOH HOH E . 
BA 4 HOH 76  2076 2076 HOH HOH E . 
BA 4 HOH 77  2077 2077 HOH HOH E . 
BA 4 HOH 78  2078 2078 HOH HOH E . 
BA 4 HOH 79  2079 2079 HOH HOH E . 
BA 4 HOH 80  2080 2080 HOH HOH E . 
BA 4 HOH 81  2081 2081 HOH HOH E . 
BA 4 HOH 82  2082 2082 HOH HOH E . 
BA 4 HOH 83  2083 2083 HOH HOH E . 
BA 4 HOH 84  2084 2084 HOH HOH E . 
BA 4 HOH 85  2085 2085 HOH HOH E . 
BA 4 HOH 86  2086 2086 HOH HOH E . 
BA 4 HOH 87  2087 2087 HOH HOH E . 
BA 4 HOH 88  2088 2088 HOH HOH E . 
BA 4 HOH 89  2089 2089 HOH HOH E . 
BA 4 HOH 90  2090 2090 HOH HOH E . 
BA 4 HOH 91  2091 2091 HOH HOH E . 
BA 4 HOH 92  2092 2092 HOH HOH E . 
BA 4 HOH 93  2093 2093 HOH HOH E . 
BA 4 HOH 94  2094 2094 HOH HOH E . 
BA 4 HOH 95  2095 2095 HOH HOH E . 
BA 4 HOH 96  2096 2096 HOH HOH E . 
BA 4 HOH 97  2097 2097 HOH HOH E . 
BA 4 HOH 98  2098 2098 HOH HOH E . 
BA 4 HOH 99  2099 2099 HOH HOH E . 
BA 4 HOH 100 2100 2100 HOH HOH E . 
BA 4 HOH 101 2101 2101 HOH HOH E . 
BA 4 HOH 102 2102 2102 HOH HOH E . 
BA 4 HOH 103 2103 2103 HOH HOH E . 
BA 4 HOH 104 2104 2104 HOH HOH E . 
BA 4 HOH 105 2105 2105 HOH HOH E . 
BA 4 HOH 106 2106 2106 HOH HOH E . 
BA 4 HOH 107 2107 2107 HOH HOH E . 
BA 4 HOH 108 2108 2108 HOH HOH E . 
BA 4 HOH 109 2109 2109 HOH HOH E . 
BA 4 HOH 110 2110 2110 HOH HOH E . 
BA 4 HOH 111 2111 2111 HOH HOH E . 
BA 4 HOH 112 2112 2112 HOH HOH E . 
BA 4 HOH 113 2113 2113 HOH HOH E . 
BA 4 HOH 114 2114 2114 HOH HOH E . 
BA 4 HOH 115 2115 2115 HOH HOH E . 
BA 4 HOH 116 2116 2116 HOH HOH E . 
BA 4 HOH 117 2117 2117 HOH HOH E . 
BA 4 HOH 118 2118 2118 HOH HOH E . 
BA 4 HOH 119 2119 2119 HOH HOH E . 
BA 4 HOH 120 2120 2120 HOH HOH E . 
BA 4 HOH 121 2121 2121 HOH HOH E . 
BA 4 HOH 122 2122 2122 HOH HOH E . 
BA 4 HOH 123 2123 2123 HOH HOH E . 
BA 4 HOH 124 2124 2124 HOH HOH E . 
BA 4 HOH 125 2125 2125 HOH HOH E . 
BA 4 HOH 126 2126 2126 HOH HOH E . 
BA 4 HOH 127 2127 2127 HOH HOH E . 
BA 4 HOH 128 2128 2128 HOH HOH E . 
BA 4 HOH 129 2129 2129 HOH HOH E . 
BA 4 HOH 130 2130 2130 HOH HOH E . 
BA 4 HOH 131 2131 2131 HOH HOH E . 
BA 4 HOH 132 2132 2132 HOH HOH E . 
BA 4 HOH 133 2133 2133 HOH HOH E . 
BA 4 HOH 134 2134 2134 HOH HOH E . 
BA 4 HOH 135 2135 2135 HOH HOH E . 
BA 4 HOH 136 2136 2136 HOH HOH E . 
BA 4 HOH 137 2137 2137 HOH HOH E . 
BA 4 HOH 138 2138 2138 HOH HOH E . 
BA 4 HOH 139 2139 2139 HOH HOH E . 
BA 4 HOH 140 2140 2140 HOH HOH E . 
BA 4 HOH 141 2141 2141 HOH HOH E . 
BA 4 HOH 142 2142 2142 HOH HOH E . 
BA 4 HOH 143 2143 2143 HOH HOH E . 
BA 4 HOH 144 2144 2144 HOH HOH E . 
BA 4 HOH 145 2145 2145 HOH HOH E . 
BA 4 HOH 146 2146 2146 HOH HOH E . 
BA 4 HOH 147 2147 2147 HOH HOH E . 
BA 4 HOH 148 2148 2148 HOH HOH E . 
BA 4 HOH 149 2149 2149 HOH HOH E . 
BA 4 HOH 150 2150 2150 HOH HOH E . 
BA 4 HOH 151 2151 2151 HOH HOH E . 
BA 4 HOH 152 2152 2152 HOH HOH E . 
BA 4 HOH 153 2153 2153 HOH HOH E . 
BA 4 HOH 154 2154 2154 HOH HOH E . 
BA 4 HOH 155 2155 2155 HOH HOH E . 
BA 4 HOH 156 2156 2156 HOH HOH E . 
BA 4 HOH 157 2157 2157 HOH HOH E . 
BA 4 HOH 158 2158 2158 HOH HOH E . 
BA 4 HOH 159 2159 2159 HOH HOH E . 
BA 4 HOH 160 2160 2160 HOH HOH E . 
BA 4 HOH 161 2161 2161 HOH HOH E . 
BA 4 HOH 162 2162 2162 HOH HOH E . 
BA 4 HOH 163 2163 2163 HOH HOH E . 
BA 4 HOH 164 2164 2164 HOH HOH E . 
BA 4 HOH 165 2165 2165 HOH HOH E . 
BA 4 HOH 166 2166 2166 HOH HOH E . 
CA 4 HOH 1   2001 2001 HOH HOH F . 
CA 4 HOH 2   2002 2002 HOH HOH F . 
CA 4 HOH 3   2003 2003 HOH HOH F . 
CA 4 HOH 4   2004 2004 HOH HOH F . 
CA 4 HOH 5   2005 2005 HOH HOH F . 
CA 4 HOH 6   2006 2006 HOH HOH F . 
CA 4 HOH 7   2007 2007 HOH HOH F . 
CA 4 HOH 8   2008 2008 HOH HOH F . 
CA 4 HOH 9   2009 2009 HOH HOH F . 
CA 4 HOH 10  2010 2010 HOH HOH F . 
CA 4 HOH 11  2011 2011 HOH HOH F . 
CA 4 HOH 12  2012 2012 HOH HOH F . 
CA 4 HOH 13  2013 2013 HOH HOH F . 
CA 4 HOH 14  2014 2014 HOH HOH F . 
CA 4 HOH 15  2015 2015 HOH HOH F . 
CA 4 HOH 16  2016 2016 HOH HOH F . 
CA 4 HOH 17  2017 2017 HOH HOH F . 
CA 4 HOH 18  2018 2018 HOH HOH F . 
CA 4 HOH 19  2019 2019 HOH HOH F . 
DA 4 HOH 1   2001 2001 HOH HOH G . 
DA 4 HOH 2   2002 2002 HOH HOH G . 
DA 4 HOH 3   2003 2003 HOH HOH G . 
DA 4 HOH 4   2004 2004 HOH HOH G . 
DA 4 HOH 5   2005 2005 HOH HOH G . 
DA 4 HOH 6   2006 2006 HOH HOH G . 
DA 4 HOH 7   2007 2007 HOH HOH G . 
DA 4 HOH 8   2008 2008 HOH HOH G . 
DA 4 HOH 9   2009 2009 HOH HOH G . 
DA 4 HOH 10  2010 2010 HOH HOH G . 
DA 4 HOH 11  2011 2011 HOH HOH G . 
DA 4 HOH 12  2012 2012 HOH HOH G . 
DA 4 HOH 13  2013 2013 HOH HOH G . 
DA 4 HOH 14  2014 2014 HOH HOH G . 
DA 4 HOH 15  2015 2015 HOH HOH G . 
DA 4 HOH 16  2016 2016 HOH HOH G . 
DA 4 HOH 17  2017 2017 HOH HOH G . 
DA 4 HOH 18  2018 2018 HOH HOH G . 
DA 4 HOH 19  2019 2019 HOH HOH G . 
DA 4 HOH 20  2020 2020 HOH HOH G . 
DA 4 HOH 21  2021 2021 HOH HOH G . 
DA 4 HOH 22  2022 2022 HOH HOH G . 
DA 4 HOH 23  2023 2023 HOH HOH G . 
DA 4 HOH 24  2024 2024 HOH HOH G . 
DA 4 HOH 25  2025 2025 HOH HOH G . 
DA 4 HOH 26  2026 2026 HOH HOH G . 
DA 4 HOH 27  2027 2027 HOH HOH G . 
DA 4 HOH 28  2028 2028 HOH HOH G . 
DA 4 HOH 29  2029 2029 HOH HOH G . 
DA 4 HOH 30  2030 2030 HOH HOH G . 
DA 4 HOH 31  2031 2031 HOH HOH G . 
DA 4 HOH 32  2032 2032 HOH HOH G . 
DA 4 HOH 33  2033 2033 HOH HOH G . 
DA 4 HOH 34  2034 2034 HOH HOH G . 
DA 4 HOH 35  2035 2035 HOH HOH G . 
DA 4 HOH 36  2036 2036 HOH HOH G . 
DA 4 HOH 37  2037 2037 HOH HOH G . 
DA 4 HOH 38  2038 2038 HOH HOH G . 
DA 4 HOH 39  2039 2039 HOH HOH G . 
DA 4 HOH 40  2040 2040 HOH HOH G . 
DA 4 HOH 41  2041 2041 HOH HOH G . 
DA 4 HOH 42  2042 2042 HOH HOH G . 
DA 4 HOH 43  2043 2043 HOH HOH G . 
DA 4 HOH 44  2044 2044 HOH HOH G . 
DA 4 HOH 45  2045 2045 HOH HOH G . 
DA 4 HOH 46  2046 2046 HOH HOH G . 
DA 4 HOH 47  2047 2047 HOH HOH G . 
DA 4 HOH 48  2048 2048 HOH HOH G . 
DA 4 HOH 49  2049 2049 HOH HOH G . 
DA 4 HOH 50  2050 2050 HOH HOH G . 
DA 4 HOH 51  2051 2051 HOH HOH G . 
DA 4 HOH 52  2052 2052 HOH HOH G . 
DA 4 HOH 53  2053 2053 HOH HOH G . 
DA 4 HOH 54  2054 2054 HOH HOH G . 
DA 4 HOH 55  2055 2055 HOH HOH G . 
DA 4 HOH 56  2056 2056 HOH HOH G . 
DA 4 HOH 57  2057 2057 HOH HOH G . 
DA 4 HOH 58  2058 2058 HOH HOH G . 
DA 4 HOH 59  2059 2059 HOH HOH G . 
DA 4 HOH 60  2060 2060 HOH HOH G . 
DA 4 HOH 61  2061 2061 HOH HOH G . 
DA 4 HOH 62  2062 2062 HOH HOH G . 
DA 4 HOH 63  2063 2063 HOH HOH G . 
DA 4 HOH 64  2064 2064 HOH HOH G . 
DA 4 HOH 65  2065 2065 HOH HOH G . 
DA 4 HOH 66  2066 2066 HOH HOH G . 
DA 4 HOH 67  2067 2067 HOH HOH G . 
DA 4 HOH 68  2068 2068 HOH HOH G . 
DA 4 HOH 69  2069 2069 HOH HOH G . 
DA 4 HOH 70  2070 2070 HOH HOH G . 
DA 4 HOH 71  2071 2071 HOH HOH G . 
DA 4 HOH 72  2072 2072 HOH HOH G . 
DA 4 HOH 73  2073 2073 HOH HOH G . 
DA 4 HOH 74  2074 2074 HOH HOH G . 
DA 4 HOH 75  2075 2075 HOH HOH G . 
DA 4 HOH 76  2076 2076 HOH HOH G . 
DA 4 HOH 77  2077 2077 HOH HOH G . 
DA 4 HOH 78  2078 2078 HOH HOH G . 
DA 4 HOH 79  2079 2079 HOH HOH G . 
DA 4 HOH 80  2080 2080 HOH HOH G . 
DA 4 HOH 81  2081 2081 HOH HOH G . 
DA 4 HOH 82  2082 2082 HOH HOH G . 
DA 4 HOH 83  2083 2083 HOH HOH G . 
DA 4 HOH 84  2084 2084 HOH HOH G . 
DA 4 HOH 85  2085 2085 HOH HOH G . 
DA 4 HOH 86  2086 2086 HOH HOH G . 
DA 4 HOH 87  2087 2087 HOH HOH G . 
DA 4 HOH 88  2088 2088 HOH HOH G . 
DA 4 HOH 89  2089 2089 HOH HOH G . 
DA 4 HOH 90  2090 2090 HOH HOH G . 
DA 4 HOH 91  2091 2091 HOH HOH G . 
DA 4 HOH 92  2092 2092 HOH HOH G . 
DA 4 HOH 93  2093 2093 HOH HOH G . 
DA 4 HOH 94  2094 2094 HOH HOH G . 
DA 4 HOH 95  2095 2095 HOH HOH G . 
DA 4 HOH 96  2096 2096 HOH HOH G . 
DA 4 HOH 97  2097 2097 HOH HOH G . 
DA 4 HOH 98  2098 2098 HOH HOH G . 
DA 4 HOH 99  2099 2099 HOH HOH G . 
DA 4 HOH 100 2100 2100 HOH HOH G . 
DA 4 HOH 101 2101 2101 HOH HOH G . 
DA 4 HOH 102 2102 2102 HOH HOH G . 
DA 4 HOH 103 2103 2103 HOH HOH G . 
DA 4 HOH 104 2104 2104 HOH HOH G . 
DA 4 HOH 105 2105 2105 HOH HOH G . 
DA 4 HOH 106 2106 2106 HOH HOH G . 
DA 4 HOH 107 2107 2107 HOH HOH G . 
DA 4 HOH 108 2108 2108 HOH HOH G . 
DA 4 HOH 109 2109 2109 HOH HOH G . 
DA 4 HOH 110 2110 2110 HOH HOH G . 
DA 4 HOH 111 2111 2111 HOH HOH G . 
DA 4 HOH 112 2112 2112 HOH HOH G . 
DA 4 HOH 113 2113 2113 HOH HOH G . 
DA 4 HOH 114 2114 2114 HOH HOH G . 
DA 4 HOH 115 2115 2115 HOH HOH G . 
DA 4 HOH 116 2116 2116 HOH HOH G . 
DA 4 HOH 117 2117 2117 HOH HOH G . 
DA 4 HOH 118 2118 2118 HOH HOH G . 
DA 4 HOH 119 2119 2119 HOH HOH G . 
DA 4 HOH 120 2120 2120 HOH HOH G . 
DA 4 HOH 121 2121 2121 HOH HOH G . 
DA 4 HOH 122 2122 2122 HOH HOH G . 
DA 4 HOH 123 2123 2123 HOH HOH G . 
DA 4 HOH 124 2124 2124 HOH HOH G . 
DA 4 HOH 125 2125 2125 HOH HOH G . 
DA 4 HOH 126 2126 2126 HOH HOH G . 
DA 4 HOH 127 2127 2127 HOH HOH G . 
DA 4 HOH 128 2128 2128 HOH HOH G . 
DA 4 HOH 129 2129 2129 HOH HOH G . 
DA 4 HOH 130 2130 2130 HOH HOH G . 
DA 4 HOH 131 2131 2131 HOH HOH G . 
DA 4 HOH 132 2132 2132 HOH HOH G . 
DA 4 HOH 133 2133 2133 HOH HOH G . 
DA 4 HOH 134 2134 2134 HOH HOH G . 
DA 4 HOH 135 2135 2135 HOH HOH G . 
DA 4 HOH 136 2136 2136 HOH HOH G . 
DA 4 HOH 137 2137 2137 HOH HOH G . 
DA 4 HOH 138 2138 2138 HOH HOH G . 
DA 4 HOH 139 2139 2139 HOH HOH G . 
DA 4 HOH 140 2140 2140 HOH HOH G . 
EA 4 HOH 1   2001 2001 HOH HOH H . 
EA 4 HOH 2   2002 2002 HOH HOH H . 
EA 4 HOH 3   2003 2003 HOH HOH H . 
EA 4 HOH 4   2004 2004 HOH HOH H . 
EA 4 HOH 5   2005 2005 HOH HOH H . 
EA 4 HOH 6   2006 2006 HOH HOH H . 
EA 4 HOH 7   2007 2007 HOH HOH H . 
EA 4 HOH 8   2008 2008 HOH HOH H . 
EA 4 HOH 9   2009 2009 HOH HOH H . 
FA 4 HOH 1   2001 2001 HOH HOH I . 
FA 4 HOH 2   2002 2002 HOH HOH I . 
FA 4 HOH 3   2003 2003 HOH HOH I . 
FA 4 HOH 4   2004 2004 HOH HOH I . 
FA 4 HOH 5   2005 2005 HOH HOH I . 
FA 4 HOH 6   2006 2006 HOH HOH I . 
FA 4 HOH 7   2007 2007 HOH HOH I . 
FA 4 HOH 8   2008 2008 HOH HOH I . 
FA 4 HOH 9   2009 2009 HOH HOH I . 
FA 4 HOH 10  2010 2010 HOH HOH I . 
FA 4 HOH 11  2011 2011 HOH HOH I . 
FA 4 HOH 12  2012 2012 HOH HOH I . 
FA 4 HOH 13  2013 2013 HOH HOH I . 
FA 4 HOH 14  2014 2014 HOH HOH I . 
FA 4 HOH 15  2015 2015 HOH HOH I . 
FA 4 HOH 16  2016 2016 HOH HOH I . 
FA 4 HOH 17  2017 2017 HOH HOH I . 
FA 4 HOH 18  2018 2018 HOH HOH I . 
FA 4 HOH 19  2019 2019 HOH HOH I . 
FA 4 HOH 20  2020 2020 HOH HOH I . 
FA 4 HOH 21  2021 2021 HOH HOH I . 
FA 4 HOH 22  2022 2022 HOH HOH I . 
FA 4 HOH 23  2023 2023 HOH HOH I . 
FA 4 HOH 24  2024 2024 HOH HOH I . 
FA 4 HOH 25  2025 2025 HOH HOH I . 
FA 4 HOH 26  2026 2026 HOH HOH I . 
FA 4 HOH 27  2027 2027 HOH HOH I . 
FA 4 HOH 28  2028 2028 HOH HOH I . 
FA 4 HOH 29  2029 2029 HOH HOH I . 
FA 4 HOH 30  2030 2030 HOH HOH I . 
FA 4 HOH 31  2031 2031 HOH HOH I . 
FA 4 HOH 32  2032 2032 HOH HOH I . 
FA 4 HOH 33  2033 2033 HOH HOH I . 
FA 4 HOH 34  2034 2034 HOH HOH I . 
FA 4 HOH 35  2035 2035 HOH HOH I . 
FA 4 HOH 36  2036 2036 HOH HOH I . 
FA 4 HOH 37  2037 2037 HOH HOH I . 
FA 4 HOH 38  2038 2038 HOH HOH I . 
FA 4 HOH 39  2039 2039 HOH HOH I . 
FA 4 HOH 40  2040 2040 HOH HOH I . 
FA 4 HOH 41  2041 2041 HOH HOH I . 
FA 4 HOH 42  2042 2042 HOH HOH I . 
FA 4 HOH 43  2043 2043 HOH HOH I . 
FA 4 HOH 44  2044 2044 HOH HOH I . 
FA 4 HOH 45  2045 2045 HOH HOH I . 
FA 4 HOH 46  2046 2046 HOH HOH I . 
FA 4 HOH 47  2047 2047 HOH HOH I . 
FA 4 HOH 48  2048 2048 HOH HOH I . 
FA 4 HOH 49  2049 2049 HOH HOH I . 
FA 4 HOH 50  2050 2050 HOH HOH I . 
FA 4 HOH 51  2051 2051 HOH HOH I . 
FA 4 HOH 52  2052 2052 HOH HOH I . 
FA 4 HOH 53  2053 2053 HOH HOH I . 
FA 4 HOH 54  2054 2054 HOH HOH I . 
FA 4 HOH 55  2055 2055 HOH HOH I . 
FA 4 HOH 56  2056 2056 HOH HOH I . 
FA 4 HOH 57  2057 2057 HOH HOH I . 
FA 4 HOH 58  2058 2058 HOH HOH I . 
FA 4 HOH 59  2059 2059 HOH HOH I . 
FA 4 HOH 60  2060 2060 HOH HOH I . 
FA 4 HOH 61  2061 2061 HOH HOH I . 
FA 4 HOH 62  2062 2062 HOH HOH I . 
FA 4 HOH 63  2063 2063 HOH HOH I . 
FA 4 HOH 64  2064 2064 HOH HOH I . 
FA 4 HOH 65  2065 2065 HOH HOH I . 
FA 4 HOH 66  2066 2066 HOH HOH I . 
FA 4 HOH 67  2067 2067 HOH HOH I . 
FA 4 HOH 68  2068 2068 HOH HOH I . 
FA 4 HOH 69  2069 2069 HOH HOH I . 
FA 4 HOH 70  2070 2070 HOH HOH I . 
FA 4 HOH 71  2071 2071 HOH HOH I . 
FA 4 HOH 72  2072 2072 HOH HOH I . 
FA 4 HOH 73  2073 2073 HOH HOH I . 
FA 4 HOH 74  2074 2074 HOH HOH I . 
FA 4 HOH 75  2075 2075 HOH HOH I . 
FA 4 HOH 76  2076 2076 HOH HOH I . 
FA 4 HOH 77  2077 2077 HOH HOH I . 
FA 4 HOH 78  2078 2078 HOH HOH I . 
FA 4 HOH 79  2079 2079 HOH HOH I . 
FA 4 HOH 80  2080 2080 HOH HOH I . 
FA 4 HOH 81  2081 2081 HOH HOH I . 
FA 4 HOH 82  2082 2082 HOH HOH I . 
FA 4 HOH 83  2083 2083 HOH HOH I . 
FA 4 HOH 84  2084 2084 HOH HOH I . 
FA 4 HOH 85  2085 2085 HOH HOH I . 
FA 4 HOH 86  2086 2086 HOH HOH I . 
FA 4 HOH 87  2087 2087 HOH HOH I . 
FA 4 HOH 88  2088 2088 HOH HOH I . 
FA 4 HOH 89  2089 2089 HOH HOH I . 
FA 4 HOH 90  2090 2090 HOH HOH I . 
FA 4 HOH 91  2091 2091 HOH HOH I . 
FA 4 HOH 92  2092 2092 HOH HOH I . 
FA 4 HOH 93  2093 2093 HOH HOH I . 
FA 4 HOH 94  2094 2094 HOH HOH I . 
FA 4 HOH 95  2095 2095 HOH HOH I . 
FA 4 HOH 96  2096 2096 HOH HOH I . 
FA 4 HOH 97  2097 2097 HOH HOH I . 
FA 4 HOH 98  2098 2098 HOH HOH I . 
FA 4 HOH 99  2099 2099 HOH HOH I . 
FA 4 HOH 100 2100 2100 HOH HOH I . 
FA 4 HOH 101 2101 2101 HOH HOH I . 
FA 4 HOH 102 2102 2102 HOH HOH I . 
FA 4 HOH 103 2103 2103 HOH HOH I . 
FA 4 HOH 104 2104 2104 HOH HOH I . 
FA 4 HOH 105 2105 2105 HOH HOH I . 
FA 4 HOH 106 2106 2106 HOH HOH I . 
FA 4 HOH 107 2107 2107 HOH HOH I . 
FA 4 HOH 108 2108 2108 HOH HOH I . 
FA 4 HOH 109 2109 2109 HOH HOH I . 
FA 4 HOH 110 2110 2110 HOH HOH I . 
FA 4 HOH 111 2111 2111 HOH HOH I . 
FA 4 HOH 112 2112 2112 HOH HOH I . 
FA 4 HOH 113 2113 2113 HOH HOH I . 
FA 4 HOH 114 2114 2114 HOH HOH I . 
FA 4 HOH 115 2115 2115 HOH HOH I . 
FA 4 HOH 116 2116 2116 HOH HOH I . 
FA 4 HOH 117 2117 2117 HOH HOH I . 
FA 4 HOH 118 2118 2118 HOH HOH I . 
FA 4 HOH 119 2119 2119 HOH HOH I . 
GA 4 HOH 1   2001 2001 HOH HOH J . 
GA 4 HOH 2   2002 2002 HOH HOH J . 
GA 4 HOH 3   2003 2003 HOH HOH J . 
GA 4 HOH 4   2004 2004 HOH HOH J . 
GA 4 HOH 5   2005 2005 HOH HOH J . 
GA 4 HOH 6   2006 2006 HOH HOH J . 
GA 4 HOH 7   2007 2007 HOH HOH J . 
GA 4 HOH 8   2008 2008 HOH HOH J . 
GA 4 HOH 9   2009 2009 HOH HOH J . 
GA 4 HOH 10  2010 2010 HOH HOH J . 
GA 4 HOH 11  2011 2011 HOH HOH J . 
GA 4 HOH 12  2012 2012 HOH HOH J . 
HA 4 HOH 1   2001 2001 HOH HOH K . 
HA 4 HOH 2   2002 2002 HOH HOH K . 
HA 4 HOH 3   2003 2003 HOH HOH K . 
HA 4 HOH 4   2004 2004 HOH HOH K . 
HA 4 HOH 5   2005 2005 HOH HOH K . 
HA 4 HOH 6   2006 2006 HOH HOH K . 
HA 4 HOH 7   2007 2007 HOH HOH K . 
HA 4 HOH 8   2008 2008 HOH HOH K . 
HA 4 HOH 9   2009 2009 HOH HOH K . 
HA 4 HOH 10  2010 2010 HOH HOH K . 
HA 4 HOH 11  2011 2011 HOH HOH K . 
HA 4 HOH 12  2012 2012 HOH HOH K . 
HA 4 HOH 13  2013 2013 HOH HOH K . 
HA 4 HOH 14  2014 2014 HOH HOH K . 
HA 4 HOH 15  2015 2015 HOH HOH K . 
HA 4 HOH 16  2016 2016 HOH HOH K . 
HA 4 HOH 17  2017 2017 HOH HOH K . 
HA 4 HOH 18  2018 2018 HOH HOH K . 
HA 4 HOH 19  2019 2019 HOH HOH K . 
HA 4 HOH 20  2020 2020 HOH HOH K . 
HA 4 HOH 21  2021 2021 HOH HOH K . 
HA 4 HOH 22  2022 2022 HOH HOH K . 
HA 4 HOH 23  2023 2023 HOH HOH K . 
HA 4 HOH 24  2024 2024 HOH HOH K . 
HA 4 HOH 25  2025 2025 HOH HOH K . 
HA 4 HOH 26  2026 2026 HOH HOH K . 
HA 4 HOH 27  2027 2027 HOH HOH K . 
HA 4 HOH 28  2028 2028 HOH HOH K . 
HA 4 HOH 29  2029 2029 HOH HOH K . 
HA 4 HOH 30  2030 2030 HOH HOH K . 
HA 4 HOH 31  2031 2031 HOH HOH K . 
HA 4 HOH 32  2032 2032 HOH HOH K . 
HA 4 HOH 33  2033 2033 HOH HOH K . 
HA 4 HOH 34  2034 2034 HOH HOH K . 
HA 4 HOH 35  2035 2035 HOH HOH K . 
HA 4 HOH 36  2036 2036 HOH HOH K . 
HA 4 HOH 37  2037 2037 HOH HOH K . 
HA 4 HOH 38  2038 2038 HOH HOH K . 
HA 4 HOH 39  2039 2039 HOH HOH K . 
HA 4 HOH 40  2040 2040 HOH HOH K . 
HA 4 HOH 41  2041 2041 HOH HOH K . 
HA 4 HOH 42  2042 2042 HOH HOH K . 
HA 4 HOH 43  2043 2043 HOH HOH K . 
HA 4 HOH 44  2044 2044 HOH HOH K . 
HA 4 HOH 45  2045 2045 HOH HOH K . 
HA 4