data_2XCX
# 
_entry.id   2XCX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XCX         
PDBE  EBI-43742    
WWPDB D_1290043742 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2XCV unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH INOSINE MONOPHOSPHATE AND 2,3- BISPHOSPHOGLYCERATE
;
PDB 2JC9 unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II IN COMPLEX WITH ADENOSINE
;
PDB 2XJE unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH URIDINE 5'-MONOPHOSPHATE AND ADENOSINE TRIPHOSPHATE
;
PDB 2XJD unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH INORGANIC PHOSPHATE AND DEOXYADENOSINE TRIPHOSPHATE
;
PDB 2XJF unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II WITH A COVALENTLY MODIFIED ASN52
;
PDB 2J2C unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II (NT5C2, CN-II)
;
PDB 2XJB unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH DEOXYGUANOSINE MONOPHOSPHATE AND DEOXYADENOSINE TRIPHOSPHATE
;
PDB 2JCM unspecified 
;CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC 5'- NUCLEOTIDASE II IN COMPLEX WITH BERYLLIUM TRIFLUORIDE
;
PDB 2XJC unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH GUANOSINE MONOPHOSPHATE AND DIADENOSINE TETRAPHOSPHATE
;
PDB 2XCW unspecified 
;CRYSTAL STRUCTURE OF THE D52N VARIANT OF CYTOSOLIC 5'-NUCLEOTIDASE II IN COMPLEX WITH INOSINE MONOPHOSPHATE AND ATP
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XCX 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wallden, K.'  1 
'Nordlund, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structural Basis for the Allosteric Regulation and Substrate Recognition of Human Cytosolic 5'-Nucleotidase II
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            408 
_citation.page_first                684 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21396942 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2011.02.059 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wallden, K.'  1 
primary 'Nordlund, P.' 2 
# 
_cell.entry_id           2XCX 
_cell.length_a           92.120 
_cell.length_b           126.510 
_cell.length_c           130.080 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XCX 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE
;
63956.750 1   3.1.3.5 YES 'RESIDUES 1-536' ? 
2 non-polymer syn GLYCEROL                           92.094    4   ?       ?   ?                ? 
3 water       nat water                              18.015    236 ?       ?   ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CYTOSOLIC 5'-NUCLEOTIDASE II
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYKS
PEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFI
QRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENL
EKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVL
RQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVW
TDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYA
ASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFNMDYTLAVYKS
PEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFI
QRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENL
EKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVL
RQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVW
TDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYA
ASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  LEU n 
1 14  VAL n 
1 15  PRO n 
1 16  ARG n 
1 17  GLY n 
1 18  SER n 
1 19  MET n 
1 20  SER n 
1 21  THR n 
1 22  SER n 
1 23  TRP n 
1 24  SER n 
1 25  ASP n 
1 26  ARG n 
1 27  LEU n 
1 28  GLN n 
1 29  ASN n 
1 30  ALA n 
1 31  ALA n 
1 32  ASP n 
1 33  MET n 
1 34  PRO n 
1 35  ALA n 
1 36  ASN n 
1 37  MET n 
1 38  ASP n 
1 39  LYS n 
1 40  HIS n 
1 41  ALA n 
1 42  LEU n 
1 43  LYS n 
1 44  LYS n 
1 45  TYR n 
1 46  ARG n 
1 47  ARG n 
1 48  GLU n 
1 49  ALA n 
1 50  TYR n 
1 51  HIS n 
1 52  ARG n 
1 53  VAL n 
1 54  PHE n 
1 55  VAL n 
1 56  ASN n 
1 57  ARG n 
1 58  SER n 
1 59  LEU n 
1 60  ALA n 
1 61  MET n 
1 62  GLU n 
1 63  LYS n 
1 64  ILE n 
1 65  LYS n 
1 66  CYS n 
1 67  PHE n 
1 68  GLY n 
1 69  PHE n 
1 70  ASN n 
1 71  MET n 
1 72  ASP n 
1 73  TYR n 
1 74  THR n 
1 75  LEU n 
1 76  ALA n 
1 77  VAL n 
1 78  TYR n 
1 79  LYS n 
1 80  SER n 
1 81  PRO n 
1 82  GLU n 
1 83  TYR n 
1 84  GLU n 
1 85  SER n 
1 86  LEU n 
1 87  GLY n 
1 88  PHE n 
1 89  GLU n 
1 90  LEU n 
1 91  THR n 
1 92  VAL n 
1 93  GLU n 
1 94  ARG n 
1 95  LEU n 
1 96  VAL n 
1 97  SER n 
1 98  ILE n 
1 99  GLY n 
1 100 TYR n 
1 101 PRO n 
1 102 GLN n 
1 103 GLU n 
1 104 LEU n 
1 105 LEU n 
1 106 SER n 
1 107 PHE n 
1 108 ALA n 
1 109 TYR n 
1 110 ASP n 
1 111 SER n 
1 112 THR n 
1 113 PHE n 
1 114 PRO n 
1 115 THR n 
1 116 ARG n 
1 117 GLY n 
1 118 LEU n 
1 119 VAL n 
1 120 PHE n 
1 121 ASP n 
1 122 THR n 
1 123 LEU n 
1 124 TYR n 
1 125 GLY n 
1 126 ASN n 
1 127 LEU n 
1 128 LEU n 
1 129 LYS n 
1 130 VAL n 
1 131 ASP n 
1 132 ALA n 
1 133 TYR n 
1 134 GLY n 
1 135 ASN n 
1 136 LEU n 
1 137 LEU n 
1 138 VAL n 
1 139 CYS n 
1 140 ALA n 
1 141 HIS n 
1 142 GLY n 
1 143 PHE n 
1 144 ASN n 
1 145 PHE n 
1 146 ILE n 
1 147 ARG n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 THR n 
1 152 ARG n 
1 153 GLU n 
1 154 GLN n 
1 155 TYR n 
1 156 PRO n 
1 157 ASN n 
1 158 LYS n 
1 159 PHE n 
1 160 ILE n 
1 161 GLN n 
1 162 ARG n 
1 163 ASP n 
1 164 ASP n 
1 165 THR n 
1 166 GLU n 
1 167 ARG n 
1 168 PHE n 
1 169 TYR n 
1 170 ILE n 
1 171 LEU n 
1 172 ASN n 
1 173 THR n 
1 174 LEU n 
1 175 PHE n 
1 176 ASN n 
1 177 LEU n 
1 178 PRO n 
1 179 GLU n 
1 180 THR n 
1 181 TYR n 
1 182 LEU n 
1 183 LEU n 
1 184 ALA n 
1 185 CYS n 
1 186 LEU n 
1 187 VAL n 
1 188 ASP n 
1 189 PHE n 
1 190 PHE n 
1 191 THR n 
1 192 ASN n 
1 193 CYS n 
1 194 PRO n 
1 195 ARG n 
1 196 TYR n 
1 197 THR n 
1 198 SER n 
1 199 CYS n 
1 200 GLU n 
1 201 THR n 
1 202 GLY n 
1 203 PHE n 
1 204 LYS n 
1 205 ASP n 
1 206 GLY n 
1 207 ASP n 
1 208 LEU n 
1 209 PHE n 
1 210 MET n 
1 211 SER n 
1 212 TYR n 
1 213 ARG n 
1 214 SER n 
1 215 MET n 
1 216 PHE n 
1 217 GLN n 
1 218 ASP n 
1 219 VAL n 
1 220 ARG n 
1 221 ASP n 
1 222 ALA n 
1 223 VAL n 
1 224 ASP n 
1 225 TRP n 
1 226 VAL n 
1 227 HIS n 
1 228 TYR n 
1 229 LYS n 
1 230 GLY n 
1 231 SER n 
1 232 LEU n 
1 233 LYS n 
1 234 GLU n 
1 235 LYS n 
1 236 THR n 
1 237 VAL n 
1 238 GLU n 
1 239 ASN n 
1 240 LEU n 
1 241 GLU n 
1 242 LYS n 
1 243 TYR n 
1 244 VAL n 
1 245 VAL n 
1 246 LYS n 
1 247 ASP n 
1 248 GLY n 
1 249 LYS n 
1 250 LEU n 
1 251 PRO n 
1 252 LEU n 
1 253 LEU n 
1 254 LEU n 
1 255 SER n 
1 256 ARG n 
1 257 MET n 
1 258 LYS n 
1 259 GLU n 
1 260 VAL n 
1 261 GLY n 
1 262 LYS n 
1 263 VAL n 
1 264 PHE n 
1 265 LEU n 
1 266 ALA n 
1 267 THR n 
1 268 ASN n 
1 269 SER n 
1 270 ASP n 
1 271 TYR n 
1 272 LYS n 
1 273 TYR n 
1 274 THR n 
1 275 ASP n 
1 276 LYS n 
1 277 ILE n 
1 278 MET n 
1 279 THR n 
1 280 TYR n 
1 281 LEU n 
1 282 PHE n 
1 283 ASP n 
1 284 PHE n 
1 285 PRO n 
1 286 HIS n 
1 287 GLY n 
1 288 PRO n 
1 289 LYS n 
1 290 PRO n 
1 291 GLY n 
1 292 SER n 
1 293 SER n 
1 294 HIS n 
1 295 ARG n 
1 296 PRO n 
1 297 TRP n 
1 298 GLN n 
1 299 SER n 
1 300 TYR n 
1 301 PHE n 
1 302 ASP n 
1 303 LEU n 
1 304 ILE n 
1 305 LEU n 
1 306 VAL n 
1 307 ASP n 
1 308 ALA n 
1 309 ARG n 
1 310 LYS n 
1 311 PRO n 
1 312 LEU n 
1 313 PHE n 
1 314 PHE n 
1 315 GLY n 
1 316 GLU n 
1 317 GLY n 
1 318 THR n 
1 319 VAL n 
1 320 LEU n 
1 321 ARG n 
1 322 GLN n 
1 323 VAL n 
1 324 ASP n 
1 325 THR n 
1 326 LYS n 
1 327 THR n 
1 328 GLY n 
1 329 LYS n 
1 330 LEU n 
1 331 LYS n 
1 332 ILE n 
1 333 GLY n 
1 334 THR n 
1 335 TYR n 
1 336 THR n 
1 337 GLY n 
1 338 PRO n 
1 339 LEU n 
1 340 GLN n 
1 341 HIS n 
1 342 GLY n 
1 343 ILE n 
1 344 VAL n 
1 345 TYR n 
1 346 SER n 
1 347 GLY n 
1 348 GLY n 
1 349 SER n 
1 350 SER n 
1 351 ASP n 
1 352 THR n 
1 353 ILE n 
1 354 CYS n 
1 355 ASP n 
1 356 LEU n 
1 357 LEU n 
1 358 GLY n 
1 359 ALA n 
1 360 LYS n 
1 361 GLY n 
1 362 LYS n 
1 363 ASP n 
1 364 ILE n 
1 365 LEU n 
1 366 TYR n 
1 367 ILE n 
1 368 GLY n 
1 369 ASP n 
1 370 HIS n 
1 371 ILE n 
1 372 PHE n 
1 373 GLY n 
1 374 ASP n 
1 375 ILE n 
1 376 LEU n 
1 377 LYS n 
1 378 SER n 
1 379 LYS n 
1 380 LYS n 
1 381 ARG n 
1 382 GLN n 
1 383 GLY n 
1 384 TRP n 
1 385 ARG n 
1 386 THR n 
1 387 PHE n 
1 388 LEU n 
1 389 VAL n 
1 390 ILE n 
1 391 PRO n 
1 392 GLU n 
1 393 LEU n 
1 394 ALA n 
1 395 GLN n 
1 396 GLU n 
1 397 LEU n 
1 398 HIS n 
1 399 VAL n 
1 400 TRP n 
1 401 THR n 
1 402 ASP n 
1 403 LYS n 
1 404 SER n 
1 405 SER n 
1 406 LEU n 
1 407 PHE n 
1 408 GLU n 
1 409 GLU n 
1 410 LEU n 
1 411 GLN n 
1 412 SER n 
1 413 LEU n 
1 414 ASP n 
1 415 ILE n 
1 416 PHE n 
1 417 LEU n 
1 418 ALA n 
1 419 GLU n 
1 420 LEU n 
1 421 TYR n 
1 422 LYS n 
1 423 HIS n 
1 424 LEU n 
1 425 ASP n 
1 426 SER n 
1 427 SER n 
1 428 SER n 
1 429 ASN n 
1 430 GLU n 
1 431 ARG n 
1 432 PRO n 
1 433 ASP n 
1 434 ILE n 
1 435 SER n 
1 436 SER n 
1 437 ILE n 
1 438 GLN n 
1 439 ARG n 
1 440 ARG n 
1 441 ILE n 
1 442 LYS n 
1 443 LYS n 
1 444 VAL n 
1 445 THR n 
1 446 HIS n 
1 447 ASP n 
1 448 MET n 
1 449 ASP n 
1 450 MET n 
1 451 CYS n 
1 452 TYR n 
1 453 GLY n 
1 454 MET n 
1 455 MET n 
1 456 GLY n 
1 457 SER n 
1 458 LEU n 
1 459 PHE n 
1 460 ARG n 
1 461 SER n 
1 462 GLY n 
1 463 SER n 
1 464 ARG n 
1 465 GLN n 
1 466 THR n 
1 467 LEU n 
1 468 PHE n 
1 469 ALA n 
1 470 SER n 
1 471 GLN n 
1 472 VAL n 
1 473 MET n 
1 474 ARG n 
1 475 TYR n 
1 476 ALA n 
1 477 ASP n 
1 478 LEU n 
1 479 TYR n 
1 480 ALA n 
1 481 ALA n 
1 482 SER n 
1 483 PHE n 
1 484 ILE n 
1 485 ASN n 
1 486 LEU n 
1 487 LEU n 
1 488 TYR n 
1 489 TYR n 
1 490 PRO n 
1 491 PHE n 
1 492 SER n 
1 493 TYR n 
1 494 LEU n 
1 495 PHE n 
1 496 ARG n 
1 497 ALA n 
1 498 ALA n 
1 499 HIS n 
1 500 VAL n 
1 501 LEU n 
1 502 MET n 
1 503 PRO n 
1 504 HIS n 
1 505 GLU n 
1 506 SER n 
1 507 THR n 
1 508 VAL n 
1 509 GLU n 
1 510 HIS n 
1 511 THR n 
1 512 HIS n 
1 513 VAL n 
1 514 ASP n 
1 515 ILE n 
1 516 ASN n 
1 517 GLU n 
1 518 MET n 
1 519 GLU n 
1 520 SER n 
1 521 PRO n 
1 522 LEU n 
1 523 ALA n 
1 524 THR n 
1 525 ARG n 
1 526 ASN n 
1 527 ARG n 
1 528 THR n 
1 529 SER n 
1 530 VAL n 
1 531 ASP n 
1 532 PHE n 
1 533 LYS n 
1 534 ASP n 
1 535 THR n 
1 536 ASP n 
1 537 TYR n 
1 538 LYS n 
1 539 ARG n 
1 540 HIS n 
1 541 GLN n 
1 542 LEU n 
1 543 THR n 
1 544 ARG n 
1 545 SER n 
1 546 ILE n 
1 547 SER n 
1 548 GLU n 
1 549 ILE n 
1 550 LYS n 
1 551 PRO n 
1 552 PRO n 
1 553 ASN n 
1 554 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'R3 PRARE2' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               P28A-LIC 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    5NTC_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P49902 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XCX 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 19 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 554 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P49902 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  536 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       536 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XCX GLY A 1  ? UNP P49902 ?   ?  'expression tag'      -17 1  
1 2XCX SER A 2  ? UNP P49902 ?   ?  'expression tag'      -16 2  
1 2XCX SER A 3  ? UNP P49902 ?   ?  'expression tag'      -15 3  
1 2XCX HIS A 4  ? UNP P49902 ?   ?  'expression tag'      -14 4  
1 2XCX HIS A 5  ? UNP P49902 ?   ?  'expression tag'      -13 5  
1 2XCX HIS A 6  ? UNP P49902 ?   ?  'expression tag'      -12 6  
1 2XCX HIS A 7  ? UNP P49902 ?   ?  'expression tag'      -11 7  
1 2XCX HIS A 8  ? UNP P49902 ?   ?  'expression tag'      -10 8  
1 2XCX HIS A 9  ? UNP P49902 ?   ?  'expression tag'      -9  9  
1 2XCX SER A 10 ? UNP P49902 ?   ?  'expression tag'      -8  10 
1 2XCX SER A 11 ? UNP P49902 ?   ?  'expression tag'      -7  11 
1 2XCX GLY A 12 ? UNP P49902 ?   ?  'expression tag'      -6  12 
1 2XCX LEU A 13 ? UNP P49902 ?   ?  'expression tag'      -5  13 
1 2XCX VAL A 14 ? UNP P49902 ?   ?  'expression tag'      -4  14 
1 2XCX PRO A 15 ? UNP P49902 ?   ?  'expression tag'      -3  15 
1 2XCX ARG A 16 ? UNP P49902 ?   ?  'expression tag'      -2  16 
1 2XCX GLY A 17 ? UNP P49902 ?   ?  'expression tag'      -1  17 
1 2XCX SER A 18 ? UNP P49902 ?   ?  'expression tag'      0   18 
1 2XCX ASN A 70 ? UNP P49902 ASP 52 'engineered mutation' 52  19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2XCX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.density_percent_sol   61 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M BICINE PH9.0, 10% PEG6000' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2008-01-30 
_diffrn_detector.details                'DYNAMICALLY BENDABLE' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0081 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.0081 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XCX 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   34076 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.37 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.40 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.60 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.60 
_reflns_shell.pdbx_redundancy        5.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XCX 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     32347 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.68 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_R_factor_obs                          0.18476 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18234 
_refine.ls_R_factor_R_free                       0.22901 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1727 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               44.200 
_refine.aniso_B[1][1]                            -1.21 
_refine.aniso_B[2][2]                            0.74 
_refine.aniso_B[3][3]                            0.47 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2JCM' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.217 
_refine.pdbx_overall_ESU_R_Free                  0.191 
_refine.overall_SU_ML                            0.147 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.728 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3805 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             236 
_refine_hist.number_atoms_total               4065 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        48.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 3975 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.548  1.961  ? 5370 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.631  5.000  ? 474  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.498 23.105 ? 190  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.109 15.000 ? 679  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.137 15.000 ? 25   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.106  0.200  ? 567  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 3027 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.197  0.200  ? 1702 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.305  0.200  ? 2691 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.149  0.200  ? 230  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.195  0.200  ? 58   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.187  0.200  ? 10   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.796  1.500  ? 2416 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.326  2.000  ? 3792 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.192  3.000  ? 1793 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.183  4.500  ? 1578 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_R_work             2347 
_refine_ls_shell.R_factor_R_work                  0.258 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.339 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             138 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2XCX 
_struct.title                     
;Crystal structure of the apoform of the D52N variant of cytosolic 5'- nucleotidase II
;
_struct.pdbx_descriptor           
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE (E.C.3.1.3.5)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XCX 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;CN-II, GMP-IMP SPECIFIC NUCLEOTIDASE, HIGH KM 5-PRIME NUCLEOTIDASE, HYDROLASE, METAL-BINDING, NT5C2, NUCLEOTIDE METABOLISM, NUCLEOTIDE-BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 22  ? ASP A 32  ? SER A 4   ASP A 14  1 ? 11 
HELX_P HELX_P2  2  ASP A 38  ? ARG A 46  ? ASP A 20  ARG A 28  1 ? 9  
HELX_P HELX_P3  3  ARG A 47  ? ARG A 52  ? ARG A 29  ARG A 34  5 ? 6  
HELX_P HELX_P4  4  GLU A 62  ? ILE A 64  ? GLU A 44  ILE A 46  5 ? 3  
HELX_P HELX_P5  5  PRO A 81  ? ILE A 98  ? PRO A 63  ILE A 80  1 ? 18 
HELX_P HELX_P6  6  PRO A 101 ? PHE A 107 ? PRO A 83  PHE A 89  5 ? 7  
HELX_P HELX_P7  7  ARG A 147 ? ARG A 152 ? ARG A 129 ARG A 134 1 ? 6  
HELX_P HELX_P8  8  THR A 173 ? PHE A 175 ? THR A 155 PHE A 157 5 ? 3  
HELX_P HELX_P9  9  ASN A 176 ? CYS A 193 ? ASN A 158 CYS A 175 1 ? 18 
HELX_P HELX_P10 10 TYR A 212 ? LYS A 229 ? TYR A 194 LYS A 211 1 ? 18 
HELX_P HELX_P11 11 SER A 231 ? GLU A 238 ? SER A 213 GLU A 220 1 ? 8  
HELX_P HELX_P12 12 ASN A 239 ? VAL A 244 ? ASN A 221 VAL A 226 1 ? 6  
HELX_P HELX_P13 13 LYS A 249 ? GLY A 261 ? LYS A 231 GLY A 243 1 ? 13 
HELX_P HELX_P14 14 ASP A 270 ? PHE A 282 ? ASP A 252 PHE A 264 1 ? 13 
HELX_P HELX_P15 15 PRO A 296 ? PHE A 301 ? PRO A 278 PHE A 283 5 ? 6  
HELX_P HELX_P16 16 PRO A 311 ? GLY A 315 ? PRO A 293 GLY A 297 5 ? 5  
HELX_P HELX_P17 17 SER A 349 ? GLY A 358 ? SER A 331 GLY A 340 1 ? 10 
HELX_P HELX_P18 18 LYS A 360 ? LYS A 362 ? LYS A 342 LYS A 344 5 ? 3  
HELX_P HELX_P19 19 GLU A 392 ? LYS A 403 ? GLU A 374 LYS A 385 1 ? 12 
HELX_P HELX_P20 20 LYS A 403 ? LYS A 422 ? LYS A 385 LYS A 404 1 ? 20 
HELX_P HELX_P21 21 SER A 436 ? CYS A 451 ? SER A 418 CYS A 433 1 ? 16 
HELX_P HELX_P22 22 THR A 466 ? ALA A 476 ? THR A 448 ALA A 458 1 ? 11 
HELX_P HELX_P23 23 SER A 482 ? TYR A 489 ? SER A 464 TYR A 471 5 ? 8  
HELX_P HELX_P24 24 MET A 502 ? SER A 506 ? MET A 484 SER A 488 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 80  A . ? SER 62  A PRO 81  A ? PRO 63  A 1 -0.18 
2 LYS 310 A . ? LYS 292 A PRO 311 A ? PRO 293 A 1 7.90  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 9 ? 
AB ? 2 ? 
AC ? 5 ? 
AD ? 3 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AA 7 8 ? parallel      
AA 8 9 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 54  ? VAL A 55  ? PHE A 36  VAL A 37  
AA 2 LEU A 478 ? ALA A 480 ? LEU A 460 ALA A 462 
AA 3 ARG A 385 ? VAL A 389 ? ARG A 367 VAL A 371 
AA 4 ILE A 364 ? GLY A 368 ? ILE A 346 GLY A 350 
AA 5 CYS A 66  ? PHE A 69  ? CYS A 48  PHE A 51  
AA 6 LYS A 262 ? ALA A 266 ? LYS A 244 ALA A 248 
AA 7 LEU A 303 ? VAL A 306 ? LEU A 285 VAL A 288 
AA 8 TYR A 345 ? GLY A 347 ? TYR A 327 GLY A 329 
AA 9 LEU A 320 ? GLN A 322 ? LEU A 302 GLN A 304 
AB 1 LEU A 59  ? ALA A 60  ? LEU A 41  ALA A 42  
AB 2 LEU A 494 ? PHE A 495 ? LEU A 476 PHE A 477 
AC 1 ASN A 144 ? ILE A 146 ? ASN A 126 ILE A 128 
AC 2 LEU A 136 ? HIS A 141 ? LEU A 118 HIS A 123 
AC 3 ASN A 126 ? VAL A 130 ? ASN A 108 VAL A 112 
AC 4 LEU A 118 ? ASP A 121 ? LEU A 100 ASP A 103 
AC 5 PHE A 168 ? LEU A 171 ? PHE A 150 LEU A 153 
AD 1 THR A 197 ? SER A 198 ? THR A 179 SER A 180 
AD 2 GLY A 202 ? ASP A 205 ? GLY A 184 ASP A 187 
AD 3 LEU A 208 ? SER A 211 ? LEU A 190 SER A 193 
AE 1 ARG A 460 ? SER A 461 ? ARG A 442 SER A 443 
AE 2 ARG A 464 ? GLN A 465 ? ARG A 446 GLN A 447 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N PHE A 54  ? N PHE A 36  O TYR A 479 ? O TYR A 461 
AA 2 3 N LEU A 478 ? N LEU A 460 O THR A 386 ? O THR A 368 
AA 3 4 N ARG A 385 ? N ARG A 367 O ILE A 364 ? O ILE A 346 
AA 4 5 N LEU A 365 ? N LEU A 347 O CYS A 66  ? O CYS A 48  
AA 5 6 N PHE A 67  ? N PHE A 49  O LYS A 262 ? O LYS A 244 
AA 6 7 N LEU A 265 ? N LEU A 247 O LEU A 303 ? O LEU A 285 
AA 7 8 N VAL A 306 ? N VAL A 288 O TYR A 345 ? O TYR A 327 
AA 8 9 N SER A 346 ? N SER A 328 O ARG A 321 ? O ARG A 303 
AB 1 2 N LEU A 59  ? N LEU A 41  O PHE A 495 ? O PHE A 477 
AC 1 2 N ILE A 146 ? N ILE A 128 O CYS A 139 ? O CYS A 121 
AC 2 3 N ALA A 140 ? N ALA A 122 O LEU A 127 ? O LEU A 109 
AC 3 4 N LEU A 128 ? N LEU A 110 O VAL A 119 ? O VAL A 101 
AC 4 5 N PHE A 120 ? N PHE A 102 O TYR A 169 ? O TYR A 151 
AD 1 2 N THR A 197 ? N THR A 179 O LYS A 204 ? O LYS A 186 
AD 2 3 N ASP A 205 ? N ASP A 187 O LEU A 208 ? O LEU A 190 
AE 1 2 N SER A 461 ? N SER A 443 O ARG A 464 ? O ARG A 446 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 1489' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 1490' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 1491' 
AC4 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 1492' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 270 ? ASP A 252  . ? 1_555 ? 
2  AC1 6 TYR A 271 ? TYR A 253  . ? 1_555 ? 
3  AC1 6 VAL A 306 ? VAL A 288  . ? 1_555 ? 
4  AC1 6 ASP A 307 ? ASP A 289  . ? 1_555 ? 
5  AC1 6 GLY A 328 ? GLY A 310  . ? 1_555 ? 
6  AC1 6 HOH F .   ? HOH A 2233 . ? 1_555 ? 
7  AC2 6 ASP A 275 ? ASP A 257  . ? 1_555 ? 
8  AC2 6 THR A 279 ? THR A 261  . ? 1_555 ? 
9  AC2 6 PRO A 296 ? PRO A 278  . ? 1_555 ? 
10 AC2 6 GLN A 298 ? GLN A 280  . ? 1_555 ? 
11 AC2 6 HOH F .   ? HOH A 2141 . ? 1_555 ? 
12 AC2 6 HOH F .   ? HOH A 2164 . ? 1_555 ? 
13 AC3 4 ARG A 220 ? ARG A 202  . ? 1_555 ? 
14 AC3 4 ASP A 224 ? ASP A 206  . ? 1_555 ? 
15 AC3 4 TYR A 228 ? TYR A 210  . ? 1_555 ? 
16 AC3 4 HOH F .   ? HOH A 2234 . ? 1_555 ? 
17 AC4 8 THR A 115 ? THR A 97   . ? 1_555 ? 
18 AC4 8 GLU A 392 ? GLU A 374  . ? 1_555 ? 
19 AC4 8 GLU A 396 ? GLU A 378  . ? 1_555 ? 
20 AC4 8 TYR A 452 ? TYR A 434  . ? 1_555 ? 
21 AC4 8 GLY A 456 ? GLY A 438  . ? 1_555 ? 
22 AC4 8 LEU A 458 ? LEU A 440  . ? 1_555 ? 
23 AC4 8 HOH F .   ? HOH A 2235 . ? 1_555 ? 
24 AC4 8 HOH F .   ? HOH A 2236 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XCX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XCX 
_atom_sites.fract_transf_matrix[1][1]   0.010855 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007905 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007688 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 21  ? 7.251   -37.399 -31.262 1.00 90.04  ? 3    THR A N   1 
ATOM   2    C CA  . THR A 1 21  ? 5.811   -37.062 -31.042 1.00 82.47  ? 3    THR A CA  1 
ATOM   3    C C   . THR A 1 21  ? 5.637   -35.938 -30.013 1.00 76.89  ? 3    THR A C   1 
ATOM   4    O O   . THR A 1 21  ? 5.979   -36.084 -28.831 1.00 77.63  ? 3    THR A O   1 
ATOM   5    C CB  . THR A 1 21  ? 4.980   -38.296 -30.599 1.00 83.46  ? 3    THR A CB  1 
ATOM   6    O OG1 . THR A 1 21  ? 5.287   -39.427 -31.432 1.00 90.29  ? 3    THR A OG1 1 
ATOM   7    C CG2 . THR A 1 21  ? 3.480   -37.994 -30.671 1.00 77.01  ? 3    THR A CG2 1 
ATOM   8    N N   . SER A 1 22  ? 5.103   -34.815 -30.484 1.00 71.89  ? 4    SER A N   1 
ATOM   9    C CA  . SER A 1 22  ? 4.768   -33.705 -29.615 1.00 67.21  ? 4    SER A CA  1 
ATOM   10   C C   . SER A 1 22  ? 3.520   -34.049 -28.790 1.00 63.74  ? 4    SER A C   1 
ATOM   11   O O   . SER A 1 22  ? 2.740   -34.956 -29.138 1.00 63.35  ? 4    SER A O   1 
ATOM   12   C CB  . SER A 1 22  ? 4.529   -32.429 -30.439 1.00 64.40  ? 4    SER A CB  1 
ATOM   13   O OG  . SER A 1 22  ? 3.144   -32.135 -30.554 1.00 59.50  ? 4    SER A OG  1 
ATOM   14   N N   . TRP A 1 23  ? 3.327   -33.312 -27.702 1.00 61.39  ? 5    TRP A N   1 
ATOM   15   C CA  . TRP A 1 23  ? 2.097   -33.448 -26.916 1.00 58.59  ? 5    TRP A CA  1 
ATOM   16   C C   . TRP A 1 23  ? 0.839   -33.141 -27.762 1.00 55.21  ? 5    TRP A C   1 
ATOM   17   O O   . TRP A 1 23  ? -0.187  -33.809 -27.601 1.00 54.49  ? 5    TRP A O   1 
ATOM   18   C CB  . TRP A 1 23  ? 2.153   -32.649 -25.582 1.00 57.75  ? 5    TRP A CB  1 
ATOM   19   C CG  . TRP A 1 23  ? 2.565   -31.148 -25.687 1.00 57.18  ? 5    TRP A CG  1 
ATOM   20   C CD1 . TRP A 1 23  ? 3.789   -30.595 -25.350 1.00 59.53  ? 5    TRP A CD1 1 
ATOM   21   C CD2 . TRP A 1 23  ? 1.739   -30.044 -26.122 1.00 53.79  ? 5    TRP A CD2 1 
ATOM   22   N NE1 . TRP A 1 23  ? 3.769   -29.228 -25.560 1.00 57.78  ? 5    TRP A NE1 1 
ATOM   23   C CE2 . TRP A 1 23  ? 2.530   -28.864 -26.031 1.00 54.83  ? 5    TRP A CE2 1 
ATOM   24   C CE3 . TRP A 1 23  ? 0.413   -29.940 -26.596 1.00 52.46  ? 5    TRP A CE3 1 
ATOM   25   C CZ2 . TRP A 1 23  ? 2.034   -27.592 -26.393 1.00 53.51  ? 5    TRP A CZ2 1 
ATOM   26   C CZ3 . TRP A 1 23  ? -0.081  -28.657 -26.977 1.00 51.10  ? 5    TRP A CZ3 1 
ATOM   27   C CH2 . TRP A 1 23  ? 0.732   -27.511 -26.861 1.00 51.10  ? 5    TRP A CH2 1 
ATOM   28   N N   . SER A 1 24  ? 0.934   -32.172 -28.678 1.00 54.16  ? 6    SER A N   1 
ATOM   29   C CA  . SER A 1 24  ? -0.212  -31.805 -29.518 1.00 53.26  ? 6    SER A CA  1 
ATOM   30   C C   . SER A 1 24  ? -0.503  -32.831 -30.647 1.00 57.08  ? 6    SER A C   1 
ATOM   31   O O   . SER A 1 24  ? -1.636  -32.881 -31.168 1.00 57.07  ? 6    SER A O   1 
ATOM   32   C CB  . SER A 1 24  ? -0.054  -30.393 -30.095 1.00 52.23  ? 6    SER A CB  1 
ATOM   33   O OG  . SER A 1 24  ? 0.821   -30.403 -31.202 1.00 51.82  ? 6    SER A OG  1 
ATOM   34   N N   . ASP A 1 25  ? 0.515   -33.620 -31.026 1.00 61.02  ? 7    ASP A N   1 
ATOM   35   C CA  . ASP A 1 25  ? 0.316   -34.802 -31.869 1.00 65.76  ? 7    ASP A CA  1 
ATOM   36   C C   . ASP A 1 25  ? -0.537  -35.852 -31.162 1.00 65.87  ? 7    ASP A C   1 
ATOM   37   O O   . ASP A 1 25  ? -1.406  -36.459 -31.793 1.00 67.31  ? 7    ASP A O   1 
ATOM   38   C CB  . ASP A 1 25  ? 1.647   -35.445 -32.273 1.00 70.77  ? 7    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 25  ? 2.449   -34.595 -33.232 1.00 73.13  ? 7    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 25  ? 1.863   -33.983 -34.152 1.00 73.06  ? 7    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 25  ? 3.685   -34.562 -33.070 1.00 77.06  ? 7    ASP A OD2 1 
ATOM   42   N N   . ARG A 1 26  ? -0.269  -36.065 -29.865 1.00 65.40  ? 8    ARG A N   1 
ATOM   43   C CA  . ARG A 1 26  ? -1.057  -36.976 -28.998 1.00 65.72  ? 8    ARG A CA  1 
ATOM   44   C C   . ARG A 1 26  ? -2.534  -36.541 -28.894 1.00 63.03  ? 8    ARG A C   1 
ATOM   45   O O   . ARG A 1 26  ? -3.456  -37.369 -29.013 1.00 63.72  ? 8    ARG A O   1 
ATOM   46   C CB  . ARG A 1 26  ? -0.441  -37.075 -27.589 1.00 65.60  ? 8    ARG A CB  1 
ATOM   47   C CG  . ARG A 1 26  ? 1.053   -37.391 -27.536 1.00 69.99  ? 8    ARG A CG  1 
ATOM   48   C CD  . ARG A 1 26  ? 1.318   -38.879 -27.589 1.00 76.02  ? 8    ARG A CD  1 
ATOM   49   N NE  . ARG A 1 26  ? 2.747   -39.187 -27.595 1.00 81.95  ? 8    ARG A NE  1 
ATOM   50   C CZ  . ARG A 1 26  ? 3.249   -40.404 -27.800 1.00 89.41  ? 8    ARG A CZ  1 
ATOM   51   N NH1 . ARG A 1 26  ? 2.433   -41.432 -28.012 1.00 90.62  ? 8    ARG A NH1 1 
ATOM   52   N NH2 . ARG A 1 26  ? 4.565   -40.602 -27.791 1.00 95.32  ? 8    ARG A NH2 1 
ATOM   53   N N   . LEU A 1 27  ? -2.738  -35.236 -28.688 1.00 60.44  ? 9    LEU A N   1 
ATOM   54   C CA  . LEU A 1 27  ? -4.072  -34.635 -28.609 1.00 58.86  ? 9    LEU A CA  1 
ATOM   55   C C   . LEU A 1 27  ? -4.808  -34.711 -29.949 1.00 61.12  ? 9    LEU A C   1 
ATOM   56   O O   . LEU A 1 27  ? -6.004  -35.056 -29.993 1.00 61.88  ? 9    LEU A O   1 
ATOM   57   C CB  . LEU A 1 27  ? -3.968  -33.171 -28.147 1.00 57.07  ? 9    LEU A CB  1 
ATOM   58   C CG  . LEU A 1 27  ? -3.261  -32.923 -26.811 1.00 57.01  ? 9    LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 27  ? -2.911  -31.441 -26.692 1.00 57.98  ? 9    LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 27  ? -4.114  -33.425 -25.642 1.00 55.57  ? 9    LEU A CD2 1 
ATOM   61   N N   . GLN A 1 28  ? -4.091  -34.371 -31.027 1.00 62.24  ? 10   GLN A N   1 
ATOM   62   C CA  . GLN A 1 28  ? -4.598  -34.530 -32.390 1.00 65.57  ? 10   GLN A CA  1 
ATOM   63   C C   . GLN A 1 28  ? -4.844  -36.002 -32.824 1.00 69.03  ? 10   GLN A C   1 
ATOM   64   O O   . GLN A 1 28  ? -5.763  -36.249 -33.612 1.00 72.18  ? 10   GLN A O   1 
ATOM   65   C CB  . GLN A 1 28  ? -3.700  -33.807 -33.403 1.00 67.41  ? 10   GLN A CB  1 
ATOM   66   C CG  . GLN A 1 28  ? -4.289  -33.716 -34.807 1.00 72.04  ? 10   GLN A CG  1 
ATOM   67   C CD  . GLN A 1 28  ? -5.610  -32.974 -34.820 1.00 72.20  ? 10   GLN A CD  1 
ATOM   68   O OE1 . GLN A 1 28  ? -5.624  -31.749 -34.780 1.00 72.84  ? 10   GLN A OE1 1 
ATOM   69   N NE2 . GLN A 1 28  ? -6.726  -33.709 -34.868 1.00 72.04  ? 10   GLN A NE2 1 
ATOM   70   N N   . ASN A 1 29  ? -4.040  -36.955 -32.328 1.00 69.14  ? 11   ASN A N   1 
ATOM   71   C CA  . ASN A 1 29  ? -4.282  -38.401 -32.572 1.00 73.20  ? 11   ASN A CA  1 
ATOM   72   C C   . ASN A 1 29  ? -5.600  -38.887 -31.945 1.00 72.02  ? 11   ASN A C   1 
ATOM   73   O O   . ASN A 1 29  ? -6.380  -39.574 -32.604 1.00 75.40  ? 11   ASN A O   1 
ATOM   74   C CB  . ASN A 1 29  ? -3.111  -39.299 -32.100 1.00 75.08  ? 11   ASN A CB  1 
ATOM   75   C CG  . ASN A 1 29  ? -1.846  -39.182 -32.979 1.00 79.18  ? 11   ASN A CG  1 
ATOM   76   O OD1 . ASN A 1 29  ? -1.885  -38.715 -34.125 1.00 80.67  ? 11   ASN A OD1 1 
ATOM   77   N ND2 . ASN A 1 29  ? -0.714  -39.616 -32.424 1.00 80.68  ? 11   ASN A ND2 1 
ATOM   78   N N   . ALA A 1 30  ? -5.827  -38.516 -30.676 1.00 67.95  ? 12   ALA A N   1 
ATOM   79   C CA  . ALA A 1 30  ? -7.072  -38.824 -29.945 1.00 67.20  ? 12   ALA A CA  1 
ATOM   80   C C   . ALA A 1 30  ? -8.269  -38.036 -30.510 1.00 68.07  ? 12   ALA A C   1 
ATOM   81   O O   . ALA A 1 30  ? -9.408  -38.526 -30.484 1.00 69.96  ? 12   ALA A O   1 
ATOM   82   C CB  . ALA A 1 30  ? -6.906  -38.553 -28.456 1.00 62.84  ? 12   ALA A CB  1 
ATOM   83   N N   . ALA A 1 31  ? -7.990  -36.827 -31.019 1.00 67.48  ? 13   ALA A N   1 
ATOM   84   C CA  . ALA A 1 31  ? -8.982  -35.959 -31.681 1.00 70.05  ? 13   ALA A CA  1 
ATOM   85   C C   . ALA A 1 31  ? -9.530  -36.527 -33.000 1.00 76.49  ? 13   ALA A C   1 
ATOM   86   O O   . ALA A 1 31  ? -10.627 -36.163 -33.414 1.00 79.93  ? 13   ALA A O   1 
ATOM   87   C CB  . ALA A 1 31  ? -8.422  -34.522 -31.879 1.00 67.98  ? 13   ALA A CB  1 
ATOM   88   N N   . ASP A 1 32  ? -8.770  -37.416 -33.642 1.00 79.95  ? 14   ASP A N   1 
ATOM   89   C CA  . ASP A 1 32  ? -9.195  -38.085 -34.890 1.00 87.86  ? 14   ASP A CA  1 
ATOM   90   C C   . ASP A 1 32  ? -10.133 -39.280 -34.646 1.00 91.26  ? 14   ASP A C   1 
ATOM   91   O O   . ASP A 1 32  ? -10.781 -39.774 -35.577 1.00 97.94  ? 14   ASP A O   1 
ATOM   92   C CB  . ASP A 1 32  ? -7.983  -38.535 -35.722 1.00 90.82  ? 14   ASP A CB  1 
ATOM   93   C CG  . ASP A 1 32  ? -7.077  -37.382 -36.125 1.00 89.14  ? 14   ASP A CG  1 
ATOM   94   O OD1 . ASP A 1 32  ? -7.575  -36.251 -36.346 1.00 88.64  ? 14   ASP A OD1 1 
ATOM   95   O OD2 . ASP A 1 32  ? -5.852  -37.614 -36.218 1.00 88.52  ? 14   ASP A OD2 1 
ATOM   96   N N   . MET A 1 33  ? -10.180 -39.741 -33.396 1.00 87.62  ? 15   MET A N   1 
ATOM   97   C CA  . MET A 1 33  ? -11.121 -40.765 -32.956 1.00 90.31  ? 15   MET A CA  1 
ATOM   98   C C   . MET A 1 33  ? -12.556 -40.227 -32.965 1.00 92.01  ? 15   MET A C   1 
ATOM   99   O O   . MET A 1 33  ? -12.814 -39.134 -32.436 1.00 88.38  ? 15   MET A O   1 
ATOM   100  C CB  . MET A 1 33  ? -10.758 -41.242 -31.541 1.00 86.00  ? 15   MET A CB  1 
ATOM   101  C CG  . MET A 1 33  ? -10.019 -42.579 -31.457 1.00 90.26  ? 15   MET A CG  1 
ATOM   102  S SD  . MET A 1 33  ? -8.613  -42.787 -32.581 1.00 97.73  ? 15   MET A SD  1 
ATOM   103  C CE  . MET A 1 33  ? -8.430  -44.583 -32.581 1.00 100.88 ? 15   MET A CE  1 
ATOM   104  N N   . PRO A 1 34  ? -13.492 -40.970 -33.598 1.00 98.65  ? 16   PRO A N   1 
ATOM   105  C CA  . PRO A 1 34  ? -14.909 -40.707 -33.323 1.00 100.77 ? 16   PRO A CA  1 
ATOM   106  C C   . PRO A 1 34  ? -15.267 -41.108 -31.877 1.00 96.12  ? 16   PRO A C   1 
ATOM   107  O O   . PRO A 1 34  ? -14.537 -41.890 -31.248 1.00 93.02  ? 16   PRO A O   1 
ATOM   108  C CB  . PRO A 1 34  ? -15.642 -41.589 -34.348 1.00 109.78 ? 16   PRO A CB  1 
ATOM   109  C CG  . PRO A 1 34  ? -14.671 -42.661 -34.708 1.00 111.07 ? 16   PRO A CG  1 
ATOM   110  C CD  . PRO A 1 34  ? -13.309 -42.035 -34.605 1.00 105.46 ? 16   PRO A CD  1 
ATOM   111  N N   . ALA A 1 35  ? -16.363 -40.562 -31.353 1.00 96.30  ? 17   ALA A N   1 
ATOM   112  C CA  . ALA A 1 35  ? -16.813 -40.905 -30.003 1.00 92.97  ? 17   ALA A CA  1 
ATOM   113  C C   . ALA A 1 35  ? -17.714 -42.146 -29.981 1.00 97.73  ? 17   ALA A C   1 
ATOM   114  O O   . ALA A 1 35  ? -18.857 -42.104 -30.464 1.00 103.52 ? 17   ALA A O   1 
ATOM   115  C CB  . ALA A 1 35  ? -17.517 -39.715 -29.361 1.00 91.51  ? 17   ALA A CB  1 
ATOM   116  N N   . ASN A 1 36  ? -17.190 -43.253 -29.447 1.00 96.13  ? 18   ASN A N   1 
ATOM   117  C CA  . ASN A 1 36  ? -18.044 -44.389 -29.084 1.00 99.92  ? 18   ASN A CA  1 
ATOM   118  C C   . ASN A 1 36  ? -18.570 -44.165 -27.662 1.00 96.69  ? 18   ASN A C   1 
ATOM   119  O O   . ASN A 1 36  ? -17.801 -44.212 -26.679 1.00 91.68  ? 18   ASN A O   1 
ATOM   120  C CB  . ASN A 1 36  ? -17.334 -45.744 -29.233 1.00 101.51 ? 18   ASN A CB  1 
ATOM   121  C CG  . ASN A 1 36  ? -18.310 -46.929 -29.154 1.00 106.73 ? 18   ASN A CG  1 
ATOM   122  O OD1 . ASN A 1 36  ? -18.839 -47.243 -28.087 1.00 103.14 ? 18   ASN A OD1 1 
ATOM   123  N ND2 . ASN A 1 36  ? -18.552 -47.581 -30.293 1.00 112.97 ? 18   ASN A ND2 1 
ATOM   124  N N   . MET A 1 37  ? -19.880 -43.901 -27.576 1.00 100.54 ? 19   MET A N   1 
ATOM   125  C CA  . MET A 1 37  ? -20.515 -43.398 -26.346 1.00 98.47  ? 19   MET A CA  1 
ATOM   126  C C   . MET A 1 37  ? -21.267 -44.457 -25.538 1.00 101.12 ? 19   MET A C   1 
ATOM   127  O O   . MET A 1 37  ? -21.921 -44.136 -24.543 1.00 100.45 ? 19   MET A O   1 
ATOM   128  C CB  . MET A 1 37  ? -21.417 -42.180 -26.645 1.00 101.16 ? 19   MET A CB  1 
ATOM   129  C CG  . MET A 1 37  ? -20.651 -40.884 -27.003 1.00 97.13  ? 19   MET A CG  1 
ATOM   130  S SD  . MET A 1 37  ? -19.539 -40.238 -25.707 1.00 87.24  ? 19   MET A SD  1 
ATOM   131  C CE  . MET A 1 37  ? -20.722 -39.398 -24.646 1.00 88.08  ? 19   MET A CE  1 
ATOM   132  N N   . ASP A 1 38  ? -21.155 -45.714 -25.970 1.00 104.84 ? 20   ASP A N   1 
ATOM   133  C CA  . ASP A 1 38  ? -21.668 -46.854 -25.213 1.00 107.74 ? 20   ASP A CA  1 
ATOM   134  C C   . ASP A 1 38  ? -21.088 -46.853 -23.789 1.00 102.96 ? 20   ASP A C   1 
ATOM   135  O O   . ASP A 1 38  ? -19.919 -46.510 -23.582 1.00 98.01  ? 20   ASP A O   1 
ATOM   136  C CB  . ASP A 1 38  ? -21.345 -48.166 -25.943 1.00 111.84 ? 20   ASP A CB  1 
ATOM   137  C CG  . ASP A 1 38  ? -22.103 -49.370 -25.373 1.00 116.22 ? 20   ASP A CG  1 
ATOM   138  O OD1 . ASP A 1 38  ? -23.360 -49.381 -25.378 1.00 119.61 ? 20   ASP A OD1 1 
ATOM   139  O OD2 . ASP A 1 38  ? -21.425 -50.323 -24.940 1.00 115.47 ? 20   ASP A OD2 1 
ATOM   140  N N   . LYS A 1 39  ? -21.928 -47.227 -22.824 1.00 105.56 ? 21   LYS A N   1 
ATOM   141  C CA  . LYS A 1 39  ? -21.602 -47.202 -21.387 1.00 103.16 ? 21   LYS A CA  1 
ATOM   142  C C   . LYS A 1 39  ? -20.176 -47.673 -21.024 1.00 100.64 ? 21   LYS A C   1 
ATOM   143  O O   . LYS A 1 39  ? -19.390 -46.895 -20.463 1.00 96.18  ? 21   LYS A O   1 
ATOM   144  C CB  . LYS A 1 39  ? -22.659 -47.999 -20.598 1.00 107.53 ? 21   LYS A CB  1 
ATOM   145  C CG  . LYS A 1 39  ? -22.732 -47.676 -19.101 1.00 105.97 ? 21   LYS A CG  1 
ATOM   146  C CD  . LYS A 1 39  ? -24.010 -48.218 -18.459 1.00 110.56 ? 21   LYS A CD  1 
ATOM   147  C CE  . LYS A 1 39  ? -23.882 -49.687 -18.068 1.00 113.71 ? 21   LYS A CE  1 
ATOM   148  N NZ  . LYS A 1 39  ? -24.009 -50.603 -19.233 1.00 116.70 ? 21   LYS A NZ  1 
ATOM   149  N N   . HIS A 1 40  ? -19.859 -48.933 -21.350 1.00 104.60 ? 22   HIS A N   1 
ATOM   150  C CA  . HIS A 1 40  ? -18.557 -49.546 -21.016 1.00 104.47 ? 22   HIS A CA  1 
ATOM   151  C C   . HIS A 1 40  ? -17.417 -49.199 -21.982 1.00 102.75 ? 22   HIS A C   1 
ATOM   152  O O   . HIS A 1 40  ? -16.246 -49.466 -21.689 1.00 102.30 ? 22   HIS A O   1 
ATOM   153  C CB  . HIS A 1 40  ? -18.684 -51.063 -20.845 1.00 110.15 ? 22   HIS A CB  1 
ATOM   154  C CG  . HIS A 1 40  ? -19.557 -51.461 -19.697 1.00 112.73 ? 22   HIS A CG  1 
ATOM   155  N ND1 . HIS A 1 40  ? -20.750 -52.130 -19.867 1.00 117.41 ? 22   HIS A ND1 1 
ATOM   156  C CD2 . HIS A 1 40  ? -19.425 -51.256 -18.365 1.00 111.71 ? 22   HIS A CD2 1 
ATOM   157  C CE1 . HIS A 1 40  ? -21.310 -52.332 -18.688 1.00 118.84 ? 22   HIS A CE1 1 
ATOM   158  N NE2 . HIS A 1 40  ? -20.528 -51.809 -17.760 1.00 115.85 ? 22   HIS A NE2 1 
ATOM   159  N N   . ALA A 1 41  ? -17.759 -48.607 -23.125 1.00 102.90 ? 23   ALA A N   1 
ATOM   160  C CA  . ALA A 1 41  ? -16.754 -48.005 -23.990 1.00 100.90 ? 23   ALA A CA  1 
ATOM   161  C C   . ALA A 1 41  ? -16.064 -46.864 -23.240 1.00 95.29  ? 23   ALA A C   1 
ATOM   162  O O   . ALA A 1 41  ? -14.833 -46.849 -23.145 1.00 93.86  ? 23   ALA A O   1 
ATOM   163  C CB  . ALA A 1 41  ? -17.373 -47.503 -25.287 1.00 102.74 ? 23   ALA A CB  1 
ATOM   164  N N   . LEU A 1 42  ? -16.864 -45.939 -22.691 1.00 93.33  ? 24   LEU A N   1 
ATOM   165  C CA  . LEU A 1 42  ? -16.357 -44.761 -21.943 1.00 88.87  ? 24   LEU A CA  1 
ATOM   166  C C   . LEU A 1 42  ? -15.670 -45.156 -20.640 1.00 88.06  ? 24   LEU A C   1 
ATOM   167  O O   . LEU A 1 42  ? -14.715 -44.500 -20.219 1.00 85.27  ? 24   LEU A O   1 
ATOM   168  C CB  . LEU A 1 42  ? -17.475 -43.739 -21.647 1.00 88.43  ? 24   LEU A CB  1 
ATOM   169  C CG  . LEU A 1 42  ? -18.277 -43.107 -22.790 1.00 89.96  ? 24   LEU A CG  1 
ATOM   170  C CD1 . LEU A 1 42  ? -19.387 -42.236 -22.209 1.00 91.09  ? 24   LEU A CD1 1 
ATOM   171  C CD2 . LEU A 1 42  ? -17.387 -42.313 -23.746 1.00 87.14  ? 24   LEU A CD2 1 
ATOM   172  N N   . LYS A 1 43  ? -16.167 -46.233 -20.023 1.00 91.40  ? 25   LYS A N   1 
ATOM   173  C CA  . LYS A 1 43  ? -15.592 -46.805 -18.803 1.00 92.63  ? 25   LYS A CA  1 
ATOM   174  C C   . LYS A 1 43  ? -14.153 -47.318 -19.025 1.00 93.53  ? 25   LYS A C   1 
ATOM   175  O O   . LYS A 1 43  ? -13.235 -46.909 -18.303 1.00 92.65  ? 25   LYS A O   1 
ATOM   176  C CB  . LYS A 1 43  ? -16.513 -47.898 -18.234 1.00 96.84  ? 25   LYS A CB  1 
ATOM   177  C CG  . LYS A 1 43  ? -16.209 -48.302 -16.792 1.00 99.28  ? 25   LYS A CG  1 
ATOM   178  C CD  . LYS A 1 43  ? -17.299 -49.171 -16.169 1.00 103.57 ? 25   LYS A CD  1 
ATOM   179  C CE  . LYS A 1 43  ? -18.464 -48.330 -15.645 1.00 102.47 ? 25   LYS A CE  1 
ATOM   180  N NZ  . LYS A 1 43  ? -19.251 -49.050 -14.601 1.00 105.49 ? 25   LYS A NZ  1 
ATOM   181  N N   . LYS A 1 44  ? -13.952 -48.175 -20.031 1.00 96.10  ? 26   LYS A N   1 
ATOM   182  C CA  . LYS A 1 44  ? -12.623 -48.761 -20.296 1.00 98.51  ? 26   LYS A CA  1 
ATOM   183  C C   . LYS A 1 44  ? -11.609 -47.764 -20.911 1.00 94.96  ? 26   LYS A C   1 
ATOM   184  O O   . LYS A 1 44  ? -10.391 -47.996 -20.863 1.00 96.60  ? 26   LYS A O   1 
ATOM   185  C CB  . LYS A 1 44  ? -12.728 -50.053 -21.133 1.00 103.84 ? 26   LYS A CB  1 
ATOM   186  C CG  . LYS A 1 44  ? -13.663 -51.162 -20.566 1.00 108.61 ? 26   LYS A CG  1 
ATOM   187  C CD  . LYS A 1 44  ? -13.474 -51.452 -19.063 1.00 109.87 ? 26   LYS A CD  1 
ATOM   188  C CE  . LYS A 1 44  ? -12.239 -52.301 -18.782 1.00 115.26 ? 26   LYS A CE  1 
ATOM   189  N NZ  . LYS A 1 44  ? -12.509 -53.762 -18.930 1.00 122.59 ? 26   LYS A NZ  1 
ATOM   190  N N   . TYR A 1 45  ? -12.125 -46.660 -21.464 1.00 90.72  ? 27   TYR A N   1 
ATOM   191  C CA  . TYR A 1 45  ? -11.318 -45.594 -22.095 1.00 87.29  ? 27   TYR A CA  1 
ATOM   192  C C   . TYR A 1 45  ? -10.598 -44.703 -21.074 1.00 84.36  ? 27   TYR A C   1 
ATOM   193  O O   . TYR A 1 45  ? -9.419  -44.373 -21.245 1.00 83.64  ? 27   TYR A O   1 
ATOM   194  C CB  . TYR A 1 45  ? -12.202 -44.737 -23.012 1.00 85.36  ? 27   TYR A CB  1 
ATOM   195  C CG  . TYR A 1 45  ? -11.481 -44.151 -24.203 1.00 84.71  ? 27   TYR A CG  1 
ATOM   196  C CD1 . TYR A 1 45  ? -10.893 -44.979 -25.165 1.00 88.74  ? 27   TYR A CD1 1 
ATOM   197  C CD2 . TYR A 1 45  ? -11.400 -42.772 -24.381 1.00 81.12  ? 27   TYR A CD2 1 
ATOM   198  C CE1 . TYR A 1 45  ? -10.231 -44.445 -26.276 1.00 89.31  ? 27   TYR A CE1 1 
ATOM   199  C CE2 . TYR A 1 45  ? -10.741 -42.220 -25.495 1.00 81.35  ? 27   TYR A CE2 1 
ATOM   200  C CZ  . TYR A 1 45  ? -10.157 -43.061 -26.439 1.00 85.00  ? 27   TYR A CZ  1 
ATOM   201  O OH  . TYR A 1 45  ? -9.503  -42.528 -27.538 1.00 84.84  ? 27   TYR A OH  1 
ATOM   202  N N   . ARG A 1 46  ? -11.325 -44.329 -20.019 1.00 83.36  ? 28   ARG A N   1 
ATOM   203  C CA  . ARG A 1 46  ? -10.786 -43.598 -18.864 1.00 82.41  ? 28   ARG A CA  1 
ATOM   204  C C   . ARG A 1 46  ? -10.063 -44.512 -17.822 1.00 87.91  ? 28   ARG A C   1 
ATOM   205  O O   . ARG A 1 46  ? -10.048 -44.214 -16.609 1.00 89.68  ? 28   ARG A O   1 
ATOM   206  C CB  . ARG A 1 46  ? -11.907 -42.774 -18.208 1.00 80.02  ? 28   ARG A CB  1 
ATOM   207  C CG  . ARG A 1 46  ? -12.979 -43.625 -17.535 1.00 80.77  ? 28   ARG A CG  1 
ATOM   208  C CD  . ARG A 1 46  ? -14.105 -42.810 -16.998 1.00 75.53  ? 28   ARG A CD  1 
ATOM   209  N NE  . ARG A 1 46  ? -14.826 -43.503 -15.939 1.00 78.00  ? 28   ARG A NE  1 
ATOM   210  C CZ  . ARG A 1 46  ? -16.082 -43.939 -16.033 1.00 79.70  ? 28   ARG A CZ  1 
ATOM   211  N NH1 . ARG A 1 46  ? -16.786 -43.764 -17.143 1.00 78.70  ? 28   ARG A NH1 1 
ATOM   212  N NH2 . ARG A 1 46  ? -16.644 -44.559 -15.006 1.00 83.31  ? 28   ARG A NH2 1 
ATOM   213  N N   . ARG A 1 47  ? -9.509  -45.640 -18.287 1.00 91.96  ? 29   ARG A N   1 
ATOM   214  C CA  . ARG A 1 47  ? -8.501  -46.395 -17.529 1.00 97.72  ? 29   ARG A CA  1 
ATOM   215  C C   . ARG A 1 47  ? -7.158  -45.850 -17.989 1.00 97.19  ? 29   ARG A C   1 
ATOM   216  O O   . ARG A 1 47  ? -6.195  -45.762 -17.209 1.00 100.54 ? 29   ARG A O   1 
ATOM   217  C CB  . ARG A 1 47  ? -8.523  -47.901 -17.844 1.00 103.49 ? 29   ARG A CB  1 
ATOM   218  C CG  . ARG A 1 47  ? -9.735  -48.700 -17.396 1.00 106.93 ? 29   ARG A CG  1 
ATOM   219  C CD  . ARG A 1 47  ? -10.004 -48.567 -15.912 1.00 111.52 ? 29   ARG A CD  1 
ATOM   220  N NE  . ARG A 1 47  ? -11.147 -47.690 -15.675 1.00 108.25 ? 29   ARG A NE  1 
ATOM   221  C CZ  . ARG A 1 47  ? -12.394 -48.116 -15.473 1.00 110.02 ? 29   ARG A CZ  1 
ATOM   222  N NH1 . ARG A 1 47  ? -12.675 -49.422 -15.462 1.00 114.90 ? 29   ARG A NH1 1 
ATOM   223  N NH2 . ARG A 1 47  ? -13.366 -47.232 -15.274 1.00 106.90 ? 29   ARG A NH2 1 
ATOM   224  N N   . GLU A 1 48  ? -7.114  -45.512 -19.280 1.00 93.47  ? 30   GLU A N   1 
ATOM   225  C CA  . GLU A 1 48  ? -5.899  -45.077 -19.942 1.00 93.18  ? 30   GLU A CA  1 
ATOM   226  C C   . GLU A 1 48  ? -5.585  -43.666 -19.476 1.00 88.42  ? 30   GLU A C   1 
ATOM   227  O O   . GLU A 1 48  ? -6.438  -42.783 -19.539 1.00 83.44  ? 30   GLU A O   1 
ATOM   228  C CB  . GLU A 1 48  ? -6.077  -45.142 -21.454 1.00 91.91  ? 30   GLU A CB  1 
ATOM   229  C CG  . GLU A 1 48  ? -4.787  -45.333 -22.223 1.00 96.74  ? 30   GLU A CG  1 
ATOM   230  C CD  . GLU A 1 48  ? -5.000  -45.270 -23.723 1.00 97.79  ? 30   GLU A CD  1 
ATOM   231  O OE1 . GLU A 1 48  ? -4.231  -44.554 -24.406 1.00 96.98  ? 30   GLU A OE1 1 
ATOM   232  O OE2 . GLU A 1 48  ? -5.948  -45.929 -24.215 1.00 99.52  ? 30   GLU A OE2 1 
ATOM   233  N N   . ALA A 1 49  ? -4.364  -43.475 -18.983 1.00 90.72  ? 31   ALA A N   1 
ATOM   234  C CA  . ALA A 1 49  ? -3.994  -42.259 -18.269 1.00 88.28  ? 31   ALA A CA  1 
ATOM   235  C C   . ALA A 1 49  ? -4.260  -40.987 -19.072 1.00 81.71  ? 31   ALA A C   1 
ATOM   236  O O   . ALA A 1 49  ? -4.805  -40.032 -18.546 1.00 78.12  ? 31   ALA A O   1 
ATOM   237  C CB  . ALA A 1 49  ? -2.551  -42.332 -17.820 1.00 93.64  ? 31   ALA A CB  1 
ATOM   238  N N   . TYR A 1 50  ? -3.916  -41.018 -20.355 1.00 81.00  ? 32   TYR A N   1 
ATOM   239  C CA  . TYR A 1 50  ? -3.944  -39.859 -21.259 1.00 77.42  ? 32   TYR A CA  1 
ATOM   240  C C   . TYR A 1 50  ? -5.371  -39.312 -21.469 1.00 73.71  ? 32   TYR A C   1 
ATOM   241  O O   . TYR A 1 50  ? -5.560  -38.176 -21.869 1.00 69.77  ? 32   TYR A O   1 
ATOM   242  C CB  . TYR A 1 50  ? -3.242  -40.231 -22.586 1.00 78.99  ? 32   TYR A CB  1 
ATOM   243  C CG  . TYR A 1 50  ? -2.144  -41.292 -22.391 1.00 86.81  ? 32   TYR A CG  1 
ATOM   244  C CD1 . TYR A 1 50  ? -0.831  -40.931 -22.044 1.00 90.15  ? 32   TYR A CD1 1 
ATOM   245  C CD2 . TYR A 1 50  ? -2.432  -42.668 -22.508 1.00 91.06  ? 32   TYR A CD2 1 
ATOM   246  C CE1 . TYR A 1 50  ? 0.163   -41.912 -21.831 1.00 96.96  ? 32   TYR A CE1 1 
ATOM   247  C CE2 . TYR A 1 50  ? -1.444  -43.644 -22.308 1.00 97.86  ? 32   TYR A CE2 1 
ATOM   248  C CZ  . TYR A 1 50  ? -0.153  -43.261 -21.972 1.00 100.84 ? 32   TYR A CZ  1 
ATOM   249  O OH  . TYR A 1 50  ? 0.815   -44.226 -21.776 1.00 108.60 ? 32   TYR A OH  1 
ATOM   250  N N   . HIS A 1 51  ? -6.353  -40.143 -21.125 1.00 36.99  ? 33   HIS A N   1 
ATOM   251  C CA  . HIS A 1 51  ? -7.782  -39.869 -21.241 1.00 38.06  ? 33   HIS A CA  1 
ATOM   252  C C   . HIS A 1 51  ? -8.519  -39.685 -19.898 1.00 38.22  ? 33   HIS A C   1 
ATOM   253  O O   . HIS A 1 51  ? -9.762  -39.626 -19.861 1.00 39.60  ? 33   HIS A O   1 
ATOM   254  C CB  . HIS A 1 51  ? -8.432  -41.038 -21.982 1.00 39.50  ? 33   HIS A CB  1 
ATOM   255  C CG  . HIS A 1 51  ? -7.927  -41.202 -23.381 1.00 42.37  ? 33   HIS A CG  1 
ATOM   256  N ND1 . HIS A 1 51  ? -7.367  -42.379 -23.839 1.00 48.41  ? 33   HIS A ND1 1 
ATOM   257  C CD2 . HIS A 1 51  ? -7.870  -40.328 -24.413 1.00 43.75  ? 33   HIS A CD2 1 
ATOM   258  C CE1 . HIS A 1 51  ? -6.985  -42.221 -25.094 1.00 48.28  ? 33   HIS A CE1 1 
ATOM   259  N NE2 . HIS A 1 51  ? -7.288  -40.988 -25.467 1.00 47.23  ? 33   HIS A NE2 1 
ATOM   260  N N   . ARG A 1 52  ? -7.770  -39.665 -18.801 1.00 36.87  ? 34   ARG A N   1 
ATOM   261  C CA  . ARG A 1 52  ? -8.352  -39.529 -17.487 1.00 37.38  ? 34   ARG A CA  1 
ATOM   262  C C   . ARG A 1 52  ? -8.349  -38.044 -17.128 1.00 34.23  ? 34   ARG A C   1 
ATOM   263  O O   . ARG A 1 52  ? -7.631  -37.222 -17.723 1.00 31.67  ? 34   ARG A O   1 
ATOM   264  C CB  . ARG A 1 52  ? -7.568  -40.332 -16.408 1.00 38.01  ? 34   ARG A CB  1 
ATOM   265  C CG  . ARG A 1 52  ? -7.652  -41.837 -16.526 1.00 41.60  ? 34   ARG A CG  1 
ATOM   266  C CD  . ARG A 1 52  ? -6.956  -42.625 -15.327 1.00 44.56  ? 34   ARG A CD  1 
ATOM   267  N NE  . ARG A 1 52  ? -7.156  -42.011 -13.991 1.00 52.49  ? 34   ARG A NE  1 
ATOM   268  C CZ  . ARG A 1 52  ? -6.397  -42.246 -12.903 1.00 54.72  ? 34   ARG A CZ  1 
ATOM   269  N NH1 . ARG A 1 52  ? -5.359  -43.077 -12.958 1.00 53.31  ? 34   ARG A NH1 1 
ATOM   270  N NH2 . ARG A 1 52  ? -6.663  -41.634 -11.749 1.00 54.23  ? 34   ARG A NH2 1 
ATOM   271  N N   . VAL A 1 53  ? -9.200  -37.747 -16.154 1.00 33.64  ? 35   VAL A N   1 
ATOM   272  C CA  . VAL A 1 53  ? -9.225  -36.493 -15.431 1.00 31.75  ? 35   VAL A CA  1 
ATOM   273  C C   . VAL A 1 53  ? -8.642  -36.846 -14.067 1.00 32.09  ? 35   VAL A C   1 
ATOM   274  O O   . VAL A 1 53  ? -9.097  -37.778 -13.420 1.00 33.58  ? 35   VAL A O   1 
ATOM   275  C CB  . VAL A 1 53  ? -10.691 -35.954 -15.320 1.00 32.10  ? 35   VAL A CB  1 
ATOM   276  C CG1 . VAL A 1 53  ? -10.791 -34.663 -14.415 1.00 30.59  ? 35   VAL A CG1 1 
ATOM   277  C CG2 . VAL A 1 53  ? -11.234 -35.668 -16.699 1.00 27.49  ? 35   VAL A CG2 1 
ATOM   278  N N   . PHE A 1 54  ? -7.622  -36.115 -13.641 1.00 31.28  ? 36   PHE A N   1 
ATOM   279  C CA  . PHE A 1 54  ? -6.992  -36.338 -12.333 1.00 31.29  ? 36   PHE A CA  1 
ATOM   280  C C   . PHE A 1 54  ? -7.546  -35.388 -11.278 1.00 31.17  ? 36   PHE A C   1 
ATOM   281  O O   . PHE A 1 54  ? -7.967  -34.282 -11.576 1.00 30.45  ? 36   PHE A O   1 
ATOM   282  C CB  . PHE A 1 54  ? -5.479  -36.238 -12.493 1.00 30.92  ? 36   PHE A CB  1 
ATOM   283  C CG  . PHE A 1 54  ? -4.942  -37.204 -13.522 1.00 31.04  ? 36   PHE A CG  1 
ATOM   284  C CD1 . PHE A 1 54  ? -4.761  -38.545 -13.199 1.00 30.25  ? 36   PHE A CD1 1 
ATOM   285  C CD2 . PHE A 1 54  ? -4.669  -36.780 -14.824 1.00 32.15  ? 36   PHE A CD2 1 
ATOM   286  C CE1 . PHE A 1 54  ? -4.277  -39.437 -14.133 1.00 31.86  ? 36   PHE A CE1 1 
ATOM   287  C CE2 . PHE A 1 54  ? -4.178  -37.689 -15.794 1.00 31.57  ? 36   PHE A CE2 1 
ATOM   288  C CZ  . PHE A 1 54  ? -3.991  -39.005 -15.451 1.00 29.54  ? 36   PHE A CZ  1 
ATOM   289  N N   . VAL A 1 55  ? -7.579  -35.829 -10.029 1.00 32.97  ? 37   VAL A N   1 
ATOM   290  C CA  . VAL A 1 55  ? -8.360  -35.154 -8.992  1.00 32.70  ? 37   VAL A CA  1 
ATOM   291  C C   . VAL A 1 55  ? -7.459  -34.781 -7.818  1.00 33.23  ? 37   VAL A C   1 
ATOM   292  O O   . VAL A 1 55  ? -6.901  -35.669 -7.159  1.00 33.78  ? 37   VAL A O   1 
ATOM   293  C CB  . VAL A 1 55  ? -9.534  -36.072 -8.513  1.00 33.79  ? 37   VAL A CB  1 
ATOM   294  C CG1 . VAL A 1 55  ? -10.460 -35.343 -7.571  1.00 34.25  ? 37   VAL A CG1 1 
ATOM   295  C CG2 . VAL A 1 55  ? -10.320 -36.621 -9.711  1.00 33.24  ? 37   VAL A CG2 1 
ATOM   296  N N   . ASN A 1 56  ? -7.320  -33.471 -7.566  1.00 32.17  ? 38   ASN A N   1 
ATOM   297  C CA  . ASN A 1 56  ? -6.638  -32.965 -6.373  1.00 32.16  ? 38   ASN A CA  1 
ATOM   298  C C   . ASN A 1 56  ? -7.586  -32.800 -5.197  1.00 33.47  ? 38   ASN A C   1 
ATOM   299  O O   . ASN A 1 56  ? -7.209  -32.973 -4.022  1.00 33.93  ? 38   ASN A O   1 
ATOM   300  C CB  . ASN A 1 56  ? -5.980  -31.605 -6.653  1.00 30.96  ? 38   ASN A CB  1 
ATOM   301  C CG  . ASN A 1 56  ? -4.845  -31.702 -7.620  1.00 31.60  ? 38   ASN A CG  1 
ATOM   302  O OD1 . ASN A 1 56  ? -4.745  -30.909 -8.559  1.00 38.82  ? 38   ASN A OD1 1 
ATOM   303  N ND2 . ASN A 1 56  ? -3.993  -32.672 -7.430  1.00 30.89  ? 38   ASN A ND2 1 
ATOM   304  N N   . ARG A 1 57  ? -8.803  -32.401 -5.527  1.00 33.36  ? 39   ARG A N   1 
ATOM   305  C CA  . ARG A 1 57  ? -9.840  -32.146 -4.564  1.00 34.66  ? 39   ARG A CA  1 
ATOM   306  C C   . ARG A 1 57  ? -11.164 -32.646 -5.113  1.00 34.86  ? 39   ARG A C   1 
ATOM   307  O O   . ARG A 1 57  ? -11.563 -32.289 -6.228  1.00 34.83  ? 39   ARG A O   1 
ATOM   308  C CB  . ARG A 1 57  ? -9.936  -30.651 -4.297  1.00 34.78  ? 39   ARG A CB  1 
ATOM   309  C CG  . ARG A 1 57  ? -9.037  -30.177 -3.166  1.00 36.96  ? 39   ARG A CG  1 
ATOM   310  C CD  . ARG A 1 57  ? -9.193  -28.705 -2.988  1.00 41.41  ? 39   ARG A CD  1 
ATOM   311  N NE  . ARG A 1 57  ? -8.791  -27.969 -4.197  1.00 46.57  ? 39   ARG A NE  1 
ATOM   312  C CZ  . ARG A 1 57  ? -7.540  -27.918 -4.672  1.00 47.53  ? 39   ARG A CZ  1 
ATOM   313  N NH1 . ARG A 1 57  ? -6.551  -28.568 -4.046  1.00 46.46  ? 39   ARG A NH1 1 
ATOM   314  N NH2 . ARG A 1 57  ? -7.276  -27.222 -5.778  1.00 45.25  ? 39   ARG A NH2 1 
ATOM   315  N N   . SER A 1 58  ? -11.877 -33.414 -4.306  1.00 35.39  ? 40   SER A N   1 
ATOM   316  C CA  . SER A 1 58  ? -13.127 -34.029 -4.724  1.00 35.37  ? 40   SER A CA  1 
ATOM   317  C C   . SER A 1 58  ? -14.113 -33.036 -5.312  1.00 35.38  ? 40   SER A C   1 
ATOM   318  O O   . SER A 1 58  ? -14.151 -31.865 -4.912  1.00 36.77  ? 40   SER A O   1 
ATOM   319  C CB  . SER A 1 58  ? -13.742 -34.819 -3.554  1.00 36.86  ? 40   SER A CB  1 
ATOM   320  O OG  . SER A 1 58  ? -12.812 -35.808 -3.138  1.00 34.29  ? 40   SER A OG  1 
ATOM   321  N N   . LEU A 1 59  ? -14.880 -33.479 -6.293  1.00 34.48  ? 41   LEU A N   1 
ATOM   322  C CA  . LEU A 1 59  ? -15.830 -32.582 -6.946  1.00 34.84  ? 41   LEU A CA  1 
ATOM   323  C C   . LEU A 1 59  ? -17.017 -33.396 -7.439  1.00 35.15  ? 41   LEU A C   1 
ATOM   324  O O   . LEU A 1 59  ? -16.860 -34.259 -8.279  1.00 34.69  ? 41   LEU A O   1 
ATOM   325  C CB  . LEU A 1 59  ? -15.148 -31.790 -8.091  1.00 32.33  ? 41   LEU A CB  1 
ATOM   326  C CG  . LEU A 1 59  ? -15.882 -30.755 -8.974  1.00 31.61  ? 41   LEU A CG  1 
ATOM   327  C CD1 . LEU A 1 59  ? -14.912 -29.710 -9.533  1.00 27.68  ? 41   LEU A CD1 1 
ATOM   328  C CD2 . LEU A 1 59  ? -16.663 -31.387 -10.132 1.00 28.25  ? 41   LEU A CD2 1 
ATOM   329  N N   . ALA A 1 60  ? -18.187 -33.130 -6.873  1.00 36.92  ? 42   ALA A N   1 
ATOM   330  C CA  . ALA A 1 60  ? -19.445 -33.715 -7.345  1.00 38.62  ? 42   ALA A CA  1 
ATOM   331  C C   . ALA A 1 60  ? -19.949 -33.007 -8.619  1.00 38.37  ? 42   ALA A C   1 
ATOM   332  O O   . ALA A 1 60  ? -20.507 -31.928 -8.547  1.00 39.24  ? 42   ALA A O   1 
ATOM   333  C CB  . ALA A 1 60  ? -20.498 -33.683 -6.238  1.00 38.82  ? 42   ALA A CB  1 
ATOM   334  N N   . MET A 1 61  ? -19.737 -33.623 -9.784  1.00 39.27  ? 43   MET A N   1 
ATOM   335  C CA  . MET A 1 61  ? -20.225 -33.103 -11.064 1.00 39.69  ? 43   MET A CA  1 
ATOM   336  C C   . MET A 1 61  ? -21.710 -32.833 -11.113 1.00 41.37  ? 43   MET A C   1 
ATOM   337  O O   . MET A 1 61  ? -22.154 -31.943 -11.833 1.00 41.08  ? 43   MET A O   1 
ATOM   338  C CB  . MET A 1 61  ? -19.863 -34.028 -12.208 1.00 38.86  ? 43   MET A CB  1 
ATOM   339  C CG  . MET A 1 61  ? -18.471 -33.801 -12.702 1.00 42.30  ? 43   MET A CG  1 
ATOM   340  S SD  . MET A 1 61  ? -18.223 -32.181 -13.461 1.00 47.20  ? 43   MET A SD  1 
ATOM   341  C CE  . MET A 1 61  ? -18.427 -32.577 -15.176 1.00 43.81  ? 43   MET A CE  1 
ATOM   342  N N   . GLU A 1 62  ? -22.480 -33.603 -10.355 1.00 43.50  ? 44   GLU A N   1 
ATOM   343  C CA  . GLU A 1 62  ? -23.918 -33.437 -10.331 1.00 45.86  ? 44   GLU A CA  1 
ATOM   344  C C   . GLU A 1 62  ? -24.300 -32.107 -9.722  1.00 46.41  ? 44   GLU A C   1 
ATOM   345  O O   . GLU A 1 62  ? -25.388 -31.602 -9.984  1.00 47.63  ? 44   GLU A O   1 
ATOM   346  C CB  . GLU A 1 62  ? -24.594 -34.572 -9.567  1.00 47.99  ? 44   GLU A CB  1 
ATOM   347  C CG  . GLU A 1 62  ? -26.087 -34.683 -9.844  1.00 51.73  ? 44   GLU A CG  1 
ATOM   348  C CD  . GLU A 1 62  ? -26.865 -34.993 -8.581  1.00 59.49  ? 44   GLU A CD  1 
ATOM   349  O OE1 . GLU A 1 62  ? -26.424 -34.563 -7.476  1.00 61.15  ? 44   GLU A OE1 1 
ATOM   350  O OE2 . GLU A 1 62  ? -27.912 -35.675 -8.694  1.00 61.80  ? 44   GLU A OE2 1 
ATOM   351  N N   . LYS A 1 63  ? -23.407 -31.519 -8.932  1.00 46.18  ? 45   LYS A N   1 
ATOM   352  C CA  . LYS A 1 63  ? -23.720 -30.260 -8.276  1.00 46.51  ? 45   LYS A CA  1 
ATOM   353  C C   . LYS A 1 63  ? -23.265 -29.024 -9.085  1.00 44.07  ? 45   LYS A C   1 
ATOM   354  O O   . LYS A 1 63  ? -23.565 -27.901 -8.706  1.00 44.03  ? 45   LYS A O   1 
ATOM   355  C CB  . LYS A 1 63  ? -23.199 -30.260 -6.826  1.00 48.03  ? 45   LYS A CB  1 
ATOM   356  C CG  . LYS A 1 63  ? -23.860 -31.344 -5.933  1.00 50.79  ? 45   LYS A CG  1 
ATOM   357  C CD  . LYS A 1 63  ? -23.287 -31.333 -4.492  1.00 51.45  ? 45   LYS A CD  1 
ATOM   358  C CE  . LYS A 1 63  ? -23.567 -32.662 -3.735  1.00 55.81  ? 45   LYS A CE  1 
ATOM   359  N NZ  . LYS A 1 63  ? -22.748 -32.810 -2.476  1.00 56.09  ? 45   LYS A NZ  1 
ATOM   360  N N   . ILE A 1 64  ? -22.594 -29.239 -10.219 1.00 41.33  ? 46   ILE A N   1 
ATOM   361  C CA  . ILE A 1 64  ? -22.136 -28.139 -11.063 1.00 38.76  ? 46   ILE A CA  1 
ATOM   362  C C   . ILE A 1 64  ? -23.303 -27.572 -11.924 1.00 39.93  ? 46   ILE A C   1 
ATOM   363  O O   . ILE A 1 64  ? -23.891 -28.274 -12.713 1.00 40.99  ? 46   ILE A O   1 
ATOM   364  C CB  . ILE A 1 64  ? -20.871 -28.536 -11.932 1.00 36.22  ? 46   ILE A CB  1 
ATOM   365  C CG1 . ILE A 1 64  ? -19.630 -28.810 -11.073 1.00 33.53  ? 46   ILE A CG1 1 
ATOM   366  C CG2 . ILE A 1 64  ? -20.550 -27.506 -13.009 1.00 34.43  ? 46   ILE A CG2 1 
ATOM   367  C CD1 . ILE A 1 64  ? -19.170 -27.679 -10.092 1.00 27.90  ? 46   ILE A CD1 1 
ATOM   368  N N   . LYS A 1 65  ? -23.625 -26.298 -11.757 1.00 40.83  ? 47   LYS A N   1 
ATOM   369  C CA  . LYS A 1 65  ? -24.663 -25.624 -12.546 1.00 41.85  ? 47   LYS A CA  1 
ATOM   370  C C   . LYS A 1 65  ? -24.167 -24.884 -13.840 1.00 39.98  ? 47   LYS A C   1 
ATOM   371  O O   . LYS A 1 65  ? -24.970 -24.635 -14.726 1.00 40.45  ? 47   LYS A O   1 
ATOM   372  C CB  . LYS A 1 65  ? -25.452 -24.645 -11.645 1.00 43.82  ? 47   LYS A CB  1 
ATOM   373  C CG  . LYS A 1 65  ? -26.246 -25.294 -10.476 1.00 49.35  ? 47   LYS A CG  1 
ATOM   374  C CD  . LYS A 1 65  ? -27.049 -26.527 -10.954 1.00 54.82  ? 47   LYS A CD  1 
ATOM   375  C CE  . LYS A 1 65  ? -27.226 -27.597 -9.830  1.00 59.23  ? 47   LYS A CE  1 
ATOM   376  N NZ  . LYS A 1 65  ? -27.388 -28.976 -10.419 1.00 59.48  ? 47   LYS A NZ  1 
ATOM   377  N N   . CYS A 1 66  ? -22.889 -24.498 -13.908 1.00 37.82  ? 48   CYS A N   1 
ATOM   378  C CA  . CYS A 1 66  ? -22.309 -23.796 -15.054 1.00 36.94  ? 48   CYS A CA  1 
ATOM   379  C C   . CYS A 1 66  ? -20.920 -24.277 -15.349 1.00 34.15  ? 48   CYS A C   1 
ATOM   380  O O   . CYS A 1 66  ? -20.137 -24.537 -14.439 1.00 33.88  ? 48   CYS A O   1 
ATOM   381  C CB  . CYS A 1 66  ? -22.178 -22.275 -14.806 1.00 38.20  ? 48   CYS A CB  1 
ATOM   382  S SG  . CYS A 1 66  ? -23.685 -21.458 -14.190 1.00 46.91  ? 48   CYS A SG  1 
ATOM   383  N N   . PHE A 1 67  ? -20.599 -24.323 -16.631 1.00 32.52  ? 49   PHE A N   1 
ATOM   384  C CA  . PHE A 1 67  ? -19.265 -24.667 -17.107 1.00 31.28  ? 49   PHE A CA  1 
ATOM   385  C C   . PHE A 1 67  ? -18.699 -23.459 -17.837 1.00 29.91  ? 49   PHE A C   1 
ATOM   386  O O   . PHE A 1 67  ? -19.292 -22.989 -18.797 1.00 29.53  ? 49   PHE A O   1 
ATOM   387  C CB  . PHE A 1 67  ? -19.312 -25.884 -18.043 1.00 29.90  ? 49   PHE A CB  1 
ATOM   388  C CG  . PHE A 1 67  ? -19.941 -27.088 -17.431 1.00 31.38  ? 49   PHE A CG  1 
ATOM   389  C CD1 . PHE A 1 67  ? -19.151 -28.053 -16.788 1.00 32.20  ? 49   PHE A CD1 1 
ATOM   390  C CD2 . PHE A 1 67  ? -21.327 -27.290 -17.496 1.00 31.52  ? 49   PHE A CD2 1 
ATOM   391  C CE1 . PHE A 1 67  ? -19.729 -29.181 -16.199 1.00 30.74  ? 49   PHE A CE1 1 
ATOM   392  C CE2 . PHE A 1 67  ? -21.915 -28.443 -16.904 1.00 33.50  ? 49   PHE A CE2 1 
ATOM   393  C CZ  . PHE A 1 67  ? -21.109 -29.381 -16.274 1.00 32.75  ? 49   PHE A CZ  1 
ATOM   394  N N   . GLY A 1 68  ? -17.567 -22.943 -17.370 1.00 29.47  ? 50   GLY A N   1 
ATOM   395  C CA  . GLY A 1 68  ? -16.963 -21.753 -17.996 1.00 28.10  ? 50   GLY A CA  1 
ATOM   396  C C   . GLY A 1 68  ? -15.685 -22.149 -18.682 1.00 28.21  ? 50   GLY A C   1 
ATOM   397  O O   . GLY A 1 68  ? -15.020 -23.089 -18.223 1.00 28.29  ? 50   GLY A O   1 
ATOM   398  N N   . PHE A 1 69  ? -15.337 -21.443 -19.767 1.00 27.72  ? 51   PHE A N   1 
ATOM   399  C CA  . PHE A 1 69  ? -14.181 -21.799 -20.586 1.00 26.79  ? 51   PHE A CA  1 
ATOM   400  C C   . PHE A 1 69  ? -13.380 -20.607 -20.945 1.00 26.81  ? 51   PHE A C   1 
ATOM   401  O O   . PHE A 1 69  ? -13.939 -19.585 -21.341 1.00 27.03  ? 51   PHE A O   1 
ATOM   402  C CB  . PHE A 1 69  ? -14.602 -22.387 -21.933 1.00 27.30  ? 51   PHE A CB  1 
ATOM   403  C CG  . PHE A 1 69  ? -15.168 -23.747 -21.839 1.00 26.29  ? 51   PHE A CG  1 
ATOM   404  C CD1 . PHE A 1 69  ? -14.337 -24.855 -21.937 1.00 25.98  ? 51   PHE A CD1 1 
ATOM   405  C CD2 . PHE A 1 69  ? -16.530 -23.923 -21.693 1.00 25.22  ? 51   PHE A CD2 1 
ATOM   406  C CE1 . PHE A 1 69  ? -14.861 -26.119 -21.864 1.00 25.51  ? 51   PHE A CE1 1 
ATOM   407  C CE2 . PHE A 1 69  ? -17.083 -25.168 -21.638 1.00 24.26  ? 51   PHE A CE2 1 
ATOM   408  C CZ  . PHE A 1 69  ? -16.249 -26.278 -21.700 1.00 28.19  ? 51   PHE A CZ  1 
ATOM   409  N N   . ASN A 1 70  ? -12.065 -20.755 -20.822 1.00 26.10  ? 52   ASN A N   1 
ATOM   410  C CA  . ASN A 1 70  ? -11.127 -19.927 -21.535 1.00 25.91  ? 52   ASN A CA  1 
ATOM   411  C C   . ASN A 1 70  ? -11.028 -20.466 -22.978 1.00 25.99  ? 52   ASN A C   1 
ATOM   412  O O   . ASN A 1 70  ? -11.379 -21.607 -23.210 1.00 23.91  ? 52   ASN A O   1 
ATOM   413  C CB  . ASN A 1 70  ? -9.761  -19.987 -20.858 1.00 25.74  ? 52   ASN A CB  1 
ATOM   414  C CG  . ASN A 1 70  ? -8.829  -18.896 -21.370 1.00 27.09  ? 52   ASN A CG  1 
ATOM   415  O OD1 . ASN A 1 70  ? -9.236  -17.746 -21.476 1.00 28.12  ? 52   ASN A OD1 1 
ATOM   416  N ND2 . ASN A 1 70  ? -7.596  -19.266 -21.729 1.00 25.57  ? 52   ASN A ND2 1 
ATOM   417  N N   . MET A 1 71  ? -10.594 -19.641 -23.942 1.00 25.90  ? 53   MET A N   1 
ATOM   418  C CA  . MET A 1 71  ? -10.409 -20.112 -25.297 1.00 26.88  ? 53   MET A CA  1 
ATOM   419  C C   . MET A 1 71  ? -9.028  -20.720 -25.547 1.00 26.80  ? 53   MET A C   1 
ATOM   420  O O   . MET A 1 71  ? -8.915  -21.906 -25.851 1.00 27.10  ? 53   MET A O   1 
ATOM   421  C CB  . MET A 1 71  ? -10.712 -19.017 -26.320 1.00 26.70  ? 53   MET A CB  1 
ATOM   422  C CG  . MET A 1 71  ? -10.926 -19.573 -27.718 1.00 26.87  ? 53   MET A CG  1 
ATOM   423  S SD  . MET A 1 71  ? -11.171 -18.317 -28.989 1.00 31.59  ? 53   MET A SD  1 
ATOM   424  C CE  . MET A 1 71  ? -9.685  -17.316 -28.840 1.00 26.49  ? 53   MET A CE  1 
ATOM   425  N N   . ASP A 1 72  ? -7.999  -19.892 -25.463 1.00 27.96  ? 54   ASP A N   1 
ATOM   426  C CA  . ASP A 1 72  ? -6.633  -20.260 -25.814 1.00 29.89  ? 54   ASP A CA  1 
ATOM   427  C C   . ASP A 1 72  ? -6.121  -21.413 -24.986 1.00 29.94  ? 54   ASP A C   1 
ATOM   428  O O   . ASP A 1 72  ? -6.257  -21.401 -23.741 1.00 31.36  ? 54   ASP A O   1 
ATOM   429  C CB  . ASP A 1 72  ? -5.682  -19.105 -25.541 1.00 30.94  ? 54   ASP A CB  1 
ATOM   430  C CG  . ASP A 1 72  ? -5.896  -17.930 -26.445 1.00 34.71  ? 54   ASP A CG  1 
ATOM   431  O OD1 . ASP A 1 72  ? -6.319  -18.062 -27.608 1.00 39.17  ? 54   ASP A OD1 1 
ATOM   432  O OD2 . ASP A 1 72  ? -5.595  -16.841 -25.970 1.00 41.84  ? 54   ASP A OD2 1 
ATOM   433  N N   . TYR A 1 73  ? -5.487  -22.368 -25.668 1.00 29.04  ? 55   TYR A N   1 
ATOM   434  C CA  . TYR A 1 73  ? -4.945  -23.581 -25.063 1.00 27.32  ? 55   TYR A CA  1 
ATOM   435  C C   . TYR A 1 73  ? -5.927  -24.399 -24.255 1.00 27.86  ? 55   TYR A C   1 
ATOM   436  O O   . TYR A 1 73  ? -5.535  -25.337 -23.530 1.00 29.14  ? 55   TYR A O   1 
ATOM   437  C CB  . TYR A 1 73  ? -3.686  -23.285 -24.274 1.00 26.31  ? 55   TYR A CB  1 
ATOM   438  C CG  . TYR A 1 73  ? -2.477  -23.082 -25.166 1.00 26.44  ? 55   TYR A CG  1 
ATOM   439  C CD1 . TYR A 1 73  ? -1.925  -24.157 -25.879 1.00 23.61  ? 55   TYR A CD1 1 
ATOM   440  C CD2 . TYR A 1 73  ? -1.870  -21.816 -25.279 1.00 23.93  ? 55   TYR A CD2 1 
ATOM   441  C CE1 . TYR A 1 73  ? -0.796  -24.002 -26.647 1.00 24.13  ? 55   TYR A CE1 1 
ATOM   442  C CE2 . TYR A 1 73  ? -0.736  -21.644 -26.067 1.00 23.73  ? 55   TYR A CE2 1 
ATOM   443  C CZ  . TYR A 1 73  ? -0.213  -22.729 -26.764 1.00 24.23  ? 55   TYR A CZ  1 
ATOM   444  O OH  . TYR A 1 73  ? 0.915   -22.563 -27.577 1.00 24.59  ? 55   TYR A OH  1 
ATOM   445  N N   . THR A 1 74  ? -7.206  -24.101 -24.453 1.00 27.41  ? 56   THR A N   1 
ATOM   446  C CA  . THR A 1 74  ? -8.281  -24.784 -23.765 1.00 27.12  ? 56   THR A CA  1 
ATOM   447  C C   . THR A 1 74  ? -9.223  -25.384 -24.805 1.00 27.70  ? 56   THR A C   1 
ATOM   448  O O   . THR A 1 74  ? -9.244  -26.600 -25.001 1.00 29.15  ? 56   THR A O   1 
ATOM   449  C CB  . THR A 1 74  ? -8.987  -23.798 -22.808 1.00 26.69  ? 56   THR A CB  1 
ATOM   450  O OG1 . THR A 1 74  ? -7.985  -23.153 -22.023 1.00 25.31  ? 56   THR A OG1 1 
ATOM   451  C CG2 . THR A 1 74  ? -9.962  -24.498 -21.881 1.00 25.15  ? 56   THR A CG2 1 
ATOM   452  N N   . LEU A 1 75  ? -9.996  -24.527 -25.459 1.00 27.70  ? 57   LEU A N   1 
ATOM   453  C CA  . LEU A 1 75  ? -10.824 -24.913 -26.619 1.00 27.90  ? 57   LEU A CA  1 
ATOM   454  C C   . LEU A 1 75  ? -9.961  -24.896 -27.863 1.00 27.52  ? 57   LEU A C   1 
ATOM   455  O O   . LEU A 1 75  ? -10.063 -25.799 -28.713 1.00 28.88  ? 57   LEU A O   1 
ATOM   456  C CB  . LEU A 1 75  ? -11.979 -23.918 -26.794 1.00 27.45  ? 57   LEU A CB  1 
ATOM   457  C CG  . LEU A 1 75  ? -13.010 -23.945 -25.657 1.00 28.68  ? 57   LEU A CG  1 
ATOM   458  C CD1 . LEU A 1 75  ? -13.827 -22.714 -25.675 1.00 27.82  ? 57   LEU A CD1 1 
ATOM   459  C CD2 . LEU A 1 75  ? -13.926 -25.210 -25.737 1.00 29.20  ? 57   LEU A CD2 1 
ATOM   460  N N   . ALA A 1 76  ? -9.098  -23.885 -27.940 1.00 26.38  ? 58   ALA A N   1 
ATOM   461  C CA  . ALA A 1 76  ? -8.155  -23.701 -29.035 1.00 27.42  ? 58   ALA A CA  1 
ATOM   462  C C   . ALA A 1 76  ? -6.742  -24.109 -28.617 1.00 27.18  ? 58   ALA A C   1 
ATOM   463  O O   . ALA A 1 76  ? -5.970  -23.292 -28.100 1.00 27.80  ? 58   ALA A O   1 
ATOM   464  C CB  . ALA A 1 76  ? -8.174  -22.213 -29.541 1.00 26.03  ? 58   ALA A CB  1 
ATOM   465  N N   . VAL A 1 77  ? -6.430  -25.377 -28.831 1.00 28.43  ? 59   VAL A N   1 
ATOM   466  C CA  . VAL A 1 77  ? -5.114  -25.950 -28.534 1.00 29.13  ? 59   VAL A CA  1 
ATOM   467  C C   . VAL A 1 77  ? -4.216  -25.724 -29.720 1.00 28.78  ? 59   VAL A C   1 
ATOM   468  O O   . VAL A 1 77  ? -4.408  -26.321 -30.788 1.00 29.55  ? 59   VAL A O   1 
ATOM   469  C CB  . VAL A 1 77  ? -5.205  -27.481 -28.227 1.00 30.19  ? 59   VAL A CB  1 
ATOM   470  C CG1 . VAL A 1 77  ? -3.820  -28.052 -27.892 1.00 31.05  ? 59   VAL A CG1 1 
ATOM   471  C CG2 . VAL A 1 77  ? -6.113  -27.711 -27.025 1.00 31.76  ? 59   VAL A CG2 1 
ATOM   472  N N   . TYR A 1 78  ? -3.262  -24.825 -29.550 1.00 28.50  ? 60   TYR A N   1 
ATOM   473  C CA  . TYR A 1 78  ? -2.323  -24.490 -30.614 1.00 28.81  ? 60   TYR A CA  1 
ATOM   474  C C   . TYR A 1 78  ? -1.334  -25.648 -30.785 1.00 29.51  ? 60   TYR A C   1 
ATOM   475  O O   . TYR A 1 78  ? -0.839  -26.202 -29.794 1.00 28.84  ? 60   TYR A O   1 
ATOM   476  C CB  . TYR A 1 78  ? -1.623  -23.163 -30.296 1.00 28.30  ? 60   TYR A CB  1 
ATOM   477  C CG  . TYR A 1 78  ? -2.600  -22.023 -30.182 1.00 27.58  ? 60   TYR A CG  1 
ATOM   478  C CD1 . TYR A 1 78  ? -3.161  -21.449 -31.321 1.00 26.98  ? 60   TYR A CD1 1 
ATOM   479  C CD2 . TYR A 1 78  ? -2.965  -21.521 -28.936 1.00 27.79  ? 60   TYR A CD2 1 
ATOM   480  C CE1 . TYR A 1 78  ? -4.078  -20.397 -31.238 1.00 30.29  ? 60   TYR A CE1 1 
ATOM   481  C CE2 . TYR A 1 78  ? -3.859  -20.459 -28.819 1.00 29.19  ? 60   TYR A CE2 1 
ATOM   482  C CZ  . TYR A 1 78  ? -4.419  -19.902 -29.972 1.00 31.63  ? 60   TYR A CZ  1 
ATOM   483  O OH  . TYR A 1 78  ? -5.326  -18.885 -29.862 1.00 30.14  ? 60   TYR A OH  1 
ATOM   484  N N   . LYS A 1 79  ? -1.073  -26.027 -32.039 1.00 30.02  ? 61   LYS A N   1 
ATOM   485  C CA  . LYS A 1 79  ? -0.179  -27.149 -32.337 1.00 30.28  ? 61   LYS A CA  1 
ATOM   486  C C   . LYS A 1 79  ? 1.269   -26.849 -32.019 1.00 30.53  ? 61   LYS A C   1 
ATOM   487  O O   . LYS A 1 79  ? 1.764   -25.759 -32.265 1.00 30.74  ? 61   LYS A O   1 
ATOM   488  C CB  . LYS A 1 79  ? -0.301  -27.566 -33.791 1.00 31.40  ? 61   LYS A CB  1 
ATOM   489  C CG  . LYS A 1 79  ? -1.539  -28.384 -34.025 1.00 31.85  ? 61   LYS A CG  1 
ATOM   490  C CD  . LYS A 1 79  ? -1.832  -28.582 -35.462 1.00 33.23  ? 61   LYS A CD  1 
ATOM   491  C CE  . LYS A 1 79  ? -3.219  -29.163 -35.613 1.00 37.37  ? 61   LYS A CE  1 
ATOM   492  N NZ  . LYS A 1 79  ? -3.492  -29.713 -37.001 1.00 39.33  ? 61   LYS A NZ  1 
ATOM   493  N N   . SER A 1 80  ? 1.933   -27.836 -31.465 1.00 30.17  ? 62   SER A N   1 
ATOM   494  C CA  . SER A 1 80  ? 3.300   -27.732 -31.058 1.00 30.64  ? 62   SER A CA  1 
ATOM   495  C C   . SER A 1 80  ? 4.127   -28.703 -31.895 1.00 30.92  ? 62   SER A C   1 
ATOM   496  O O   . SER A 1 80  ? 3.685   -29.803 -32.159 1.00 31.31  ? 62   SER A O   1 
ATOM   497  C CB  . SER A 1 80  ? 3.394   -28.186 -29.625 1.00 29.67  ? 62   SER A CB  1 
ATOM   498  O OG  . SER A 1 80  ? 4.732   -28.115 -29.210 1.00 32.71  ? 62   SER A OG  1 
ATOM   499  N N   . PRO A 1 81  ? 5.359   -28.329 -32.281 1.00 31.48  ? 63   PRO A N   1 
ATOM   500  C CA  . PRO A 1 81  ? 6.075   -27.070 -32.017 1.00 29.75  ? 63   PRO A CA  1 
ATOM   501  C C   . PRO A 1 81  ? 5.766   -25.899 -32.929 1.00 29.69  ? 63   PRO A C   1 
ATOM   502  O O   . PRO A 1 81  ? 6.354   -24.855 -32.739 1.00 30.30  ? 63   PRO A O   1 
ATOM   503  C CB  . PRO A 1 81  ? 7.550   -27.458 -32.205 1.00 30.49  ? 63   PRO A CB  1 
ATOM   504  C CG  . PRO A 1 81  ? 7.521   -28.669 -33.198 1.00 31.44  ? 63   PRO A CG  1 
ATOM   505  C CD  . PRO A 1 81  ? 6.182   -29.335 -33.026 1.00 31.16  ? 63   PRO A CD  1 
ATOM   506  N N   . GLU A 1 82  ? 4.873   -26.047 -33.896 1.00 29.95  ? 64   GLU A N   1 
ATOM   507  C CA  . GLU A 1 82  ? 4.594   -25.006 -34.897 1.00 29.91  ? 64   GLU A CA  1 
ATOM   508  C C   . GLU A 1 82  ? 4.197   -23.628 -34.337 1.00 29.51  ? 64   GLU A C   1 
ATOM   509  O O   . GLU A 1 82  ? 4.676   -22.563 -34.804 1.00 29.17  ? 64   GLU A O   1 
ATOM   510  C CB  . GLU A 1 82  ? 3.499   -25.476 -35.849 1.00 30.46  ? 64   GLU A CB  1 
ATOM   511  C CG  . GLU A 1 82  ? 3.970   -26.486 -36.921 1.00 35.43  ? 64   GLU A CG  1 
ATOM   512  C CD  . GLU A 1 82  ? 4.031   -27.948 -36.431 1.00 39.85  ? 64   GLU A CD  1 
ATOM   513  O OE1 . GLU A 1 82  ? 3.617   -28.244 -35.286 1.00 38.81  ? 64   GLU A OE1 1 
ATOM   514  O OE2 . GLU A 1 82  ? 4.472   -28.822 -37.220 1.00 45.10  ? 64   GLU A OE2 1 
ATOM   515  N N   . TYR A 1 83  ? 3.290   -23.620 -33.375 1.00 27.72  ? 65   TYR A N   1 
ATOM   516  C CA  . TYR A 1 83  ? 2.817   -22.344 -32.896 1.00 27.31  ? 65   TYR A CA  1 
ATOM   517  C C   . TYR A 1 83  ? 3.891   -21.621 -32.075 1.00 26.85  ? 65   TYR A C   1 
ATOM   518  O O   . TYR A 1 83  ? 4.107   -20.441 -32.283 1.00 26.94  ? 65   TYR A O   1 
ATOM   519  C CB  . TYR A 1 83  ? 1.514   -22.502 -32.152 1.00 26.37  ? 65   TYR A CB  1 
ATOM   520  C CG  . TYR A 1 83  ? 0.889   -21.186 -31.742 1.00 25.73  ? 65   TYR A CG  1 
ATOM   521  C CD1 . TYR A 1 83  ? 0.191   -20.402 -32.665 1.00 20.13  ? 65   TYR A CD1 1 
ATOM   522  C CD2 . TYR A 1 83  ? 0.946   -20.762 -30.414 1.00 22.69  ? 65   TYR A CD2 1 
ATOM   523  C CE1 . TYR A 1 83  ? -0.403  -19.261 -32.287 1.00 22.00  ? 65   TYR A CE1 1 
ATOM   524  C CE2 . TYR A 1 83  ? 0.345   -19.592 -30.020 1.00 22.52  ? 65   TYR A CE2 1 
ATOM   525  C CZ  . TYR A 1 83  ? -0.325  -18.853 -30.947 1.00 24.67  ? 65   TYR A CZ  1 
ATOM   526  O OH  . TYR A 1 83  ? -0.900  -17.677 -30.539 1.00 27.54  ? 65   TYR A OH  1 
ATOM   527  N N   . GLU A 1 84  ? 4.604   -22.350 -31.213 1.00 26.47  ? 66   GLU A N   1 
ATOM   528  C CA  . GLU A 1 84  ? 5.745   -21.806 -30.482 1.00 26.26  ? 66   GLU A CA  1 
ATOM   529  C C   . GLU A 1 84  ? 6.784   -21.290 -31.460 1.00 26.46  ? 66   GLU A C   1 
ATOM   530  O O   . GLU A 1 84  ? 7.375   -20.225 -31.261 1.00 25.47  ? 66   GLU A O   1 
ATOM   531  C CB  . GLU A 1 84  ? 6.412   -22.849 -29.578 1.00 25.94  ? 66   GLU A CB  1 
ATOM   532  C CG  . GLU A 1 84  ? 5.535   -23.408 -28.469 1.00 28.25  ? 66   GLU A CG  1 
ATOM   533  C CD  . GLU A 1 84  ? 4.925   -24.758 -28.856 1.00 32.18  ? 66   GLU A CD  1 
ATOM   534  O OE1 . GLU A 1 84  ? 4.104   -24.763 -29.811 1.00 28.78  ? 66   GLU A OE1 1 
ATOM   535  O OE2 . GLU A 1 84  ? 5.287   -25.804 -28.212 1.00 33.21  ? 66   GLU A OE2 1 
ATOM   536  N N   . SER A 1 85  ? 7.015   -22.076 -32.501 1.00 26.69  ? 67   SER A N   1 
ATOM   537  C CA  . SER A 1 85  ? 7.961   -21.707 -33.524 1.00 28.25  ? 67   SER A CA  1 
ATOM   538  C C   . SER A 1 85  ? 7.560   -20.406 -34.257 1.00 28.64  ? 67   SER A C   1 
ATOM   539  O O   . SER A 1 85  ? 8.398   -19.527 -34.498 1.00 29.03  ? 67   SER A O   1 
ATOM   540  C CB  . SER A 1 85  ? 8.183   -22.872 -34.472 1.00 28.54  ? 67   SER A CB  1 
ATOM   541  O OG  . SER A 1 85  ? 9.233   -22.501 -35.332 1.00 32.15  ? 67   SER A OG  1 
ATOM   542  N N   . LEU A 1 86  ? 6.276   -20.255 -34.561 1.00 29.46  ? 68   LEU A N   1 
ATOM   543  C CA  . LEU A 1 86  ? 5.776   -19.000 -35.122 1.00 30.37  ? 68   LEU A CA  1 
ATOM   544  C C   . LEU A 1 86  ? 5.950   -17.802 -34.170 1.00 29.74  ? 68   LEU A C   1 
ATOM   545  O O   . LEU A 1 86  ? 6.357   -16.724 -34.588 1.00 30.34  ? 68   LEU A O   1 
ATOM   546  C CB  . LEU A 1 86  ? 4.311   -19.145 -35.590 1.00 30.88  ? 68   LEU A CB  1 
ATOM   547  C CG  . LEU A 1 86  ? 3.645   -17.857 -36.128 1.00 32.43  ? 68   LEU A CG  1 
ATOM   548  C CD1 . LEU A 1 86  ? 4.322   -17.389 -37.416 1.00 30.82  ? 68   LEU A CD1 1 
ATOM   549  C CD2 . LEU A 1 86  ? 2.160   -18.126 -36.346 1.00 31.62  ? 68   LEU A CD2 1 
ATOM   550  N N   . GLY A 1 87  ? 5.618   -17.990 -32.900 1.00 28.95  ? 69   GLY A N   1 
ATOM   551  C CA  . GLY A 1 87  ? 5.789   -16.959 -31.906 1.00 27.42  ? 69   GLY A CA  1 
ATOM   552  C C   . GLY A 1 87  ? 7.247   -16.553 -31.822 1.00 27.95  ? 69   GLY A C   1 
ATOM   553  O O   . GLY A 1 87  ? 7.561   -15.346 -31.789 1.00 27.93  ? 69   GLY A O   1 
ATOM   554  N N   . PHE A 1 88  ? 8.131   -17.550 -31.755 1.00 27.64  ? 70   PHE A N   1 
ATOM   555  C CA  . PHE A 1 88  ? 9.583   -17.351 -31.649 1.00 27.66  ? 70   PHE A CA  1 
ATOM   556  C C   . PHE A 1 88  ? 10.132  -16.509 -32.800 1.00 29.37  ? 70   PHE A C   1 
ATOM   557  O O   . PHE A 1 88  ? 10.811  -15.503 -32.570 1.00 30.22  ? 70   PHE A O   1 
ATOM   558  C CB  . PHE A 1 88  ? 10.307  -18.719 -31.583 1.00 27.53  ? 70   PHE A CB  1 
ATOM   559  C CG  . PHE A 1 88  ? 11.811  -18.625 -31.538 1.00 25.81  ? 70   PHE A CG  1 
ATOM   560  C CD1 . PHE A 1 88  ? 12.473  -18.431 -30.321 1.00 24.70  ? 70   PHE A CD1 1 
ATOM   561  C CD2 . PHE A 1 88  ? 12.566  -18.747 -32.703 1.00 27.45  ? 70   PHE A CD2 1 
ATOM   562  C CE1 . PHE A 1 88  ? 13.865  -18.363 -30.260 1.00 23.69  ? 70   PHE A CE1 1 
ATOM   563  C CE2 . PHE A 1 88  ? 13.974  -18.660 -32.659 1.00 26.91  ? 70   PHE A CE2 1 
ATOM   564  C CZ  . PHE A 1 88  ? 14.615  -18.467 -31.424 1.00 26.18  ? 70   PHE A CZ  1 
ATOM   565  N N   . GLU A 1 89  ? 9.837   -16.910 -34.034 1.00 30.46  ? 71   GLU A N   1 
ATOM   566  C CA  . GLU A 1 89  ? 10.330  -16.197 -35.200 1.00 33.19  ? 71   GLU A CA  1 
ATOM   567  C C   . GLU A 1 89  ? 9.789   -14.766 -35.356 1.00 30.98  ? 71   GLU A C   1 
ATOM   568  O O   . GLU A 1 89  ? 10.525  -13.890 -35.750 1.00 30.29  ? 71   GLU A O   1 
ATOM   569  C CB  . GLU A 1 89  ? 10.164  -17.010 -36.496 1.00 34.07  ? 71   GLU A CB  1 
ATOM   570  C CG  . GLU A 1 89  ? 8.795   -17.546 -36.791 1.00 39.40  ? 71   GLU A CG  1 
ATOM   571  C CD  . GLU A 1 89  ? 8.752   -18.344 -38.133 1.00 41.95  ? 71   GLU A CD  1 
ATOM   572  O OE1 . GLU A 1 89  ? 8.872   -19.614 -38.109 1.00 45.40  ? 71   GLU A OE1 1 
ATOM   573  O OE2 . GLU A 1 89  ? 8.637   -17.662 -39.207 1.00 51.56  ? 71   GLU A OE2 1 
ATOM   574  N N   . LEU A 1 90  ? 8.532   -14.527 -34.993 1.00 29.70  ? 72   LEU A N   1 
ATOM   575  C CA  . LEU A 1 90  ? 7.970   -13.188 -35.068 1.00 28.68  ? 72   LEU A CA  1 
ATOM   576  C C   . LEU A 1 90  ? 8.572   -12.270 -33.990 1.00 28.75  ? 72   LEU A C   1 
ATOM   577  O O   . LEU A 1 90  ? 8.770   -11.083 -34.224 1.00 27.40  ? 72   LEU A O   1 
ATOM   578  C CB  . LEU A 1 90  ? 6.466   -13.239 -34.931 1.00 27.96  ? 72   LEU A CB  1 
ATOM   579  C CG  . LEU A 1 90  ? 5.668   -13.907 -36.042 1.00 26.99  ? 72   LEU A CG  1 
ATOM   580  C CD1 . LEU A 1 90  ? 4.238   -14.047 -35.557 1.00 23.19  ? 72   LEU A CD1 1 
ATOM   581  C CD2 . LEU A 1 90  ? 5.780   -13.115 -37.353 1.00 25.03  ? 72   LEU A CD2 1 
ATOM   582  N N   . THR A 1 91  ? 8.882   -12.857 -32.836 1.00 28.57  ? 73   THR A N   1 
ATOM   583  C CA  . THR A 1 91  ? 9.554   -12.159 -31.725 1.00 28.70  ? 73   THR A CA  1 
ATOM   584  C C   . THR A 1 91  ? 10.997  -11.860 -32.063 1.00 29.10  ? 73   THR A C   1 
ATOM   585  O O   . THR A 1 91  ? 11.462  -10.776 -31.773 1.00 30.90  ? 73   THR A O   1 
ATOM   586  C CB  . THR A 1 91  ? 9.489   -12.985 -30.422 1.00 28.04  ? 73   THR A CB  1 
ATOM   587  O OG1 . THR A 1 91  ? 8.117   -13.291 -30.138 1.00 27.89  ? 73   THR A OG1 1 
ATOM   588  C CG2 . THR A 1 91  ? 10.091  -12.236 -29.241 1.00 27.62  ? 73   THR A CG2 1 
ATOM   589  N N   . VAL A 1 92  ? 11.694  -12.802 -32.691 1.00 28.42  ? 74   VAL A N   1 
ATOM   590  C CA  . VAL A 1 92  ? 13.061  -12.568 -33.125 1.00 28.35  ? 74   VAL A CA  1 
ATOM   591  C C   . VAL A 1 92  ? 13.105  -11.407 -34.126 1.00 31.04  ? 74   VAL A C   1 
ATOM   592  O O   . VAL A 1 92  ? 13.942  -10.488 -34.042 1.00 31.17  ? 74   VAL A O   1 
ATOM   593  C CB  . VAL A 1 92  ? 13.702  -13.864 -33.751 1.00 28.29  ? 74   VAL A CB  1 
ATOM   594  C CG1 . VAL A 1 92  ? 14.848  -13.501 -34.657 1.00 26.36  ? 74   VAL A CG1 1 
ATOM   595  C CG2 . VAL A 1 92  ? 14.164  -14.810 -32.671 1.00 22.88  ? 74   VAL A CG2 1 
ATOM   596  N N   . GLU A 1 93  ? 12.175  -11.443 -35.069 1.00 32.50  ? 75   GLU A N   1 
ATOM   597  C CA  . GLU A 1 93  ? 12.098  -10.442 -36.114 1.00 35.22  ? 75   GLU A CA  1 
ATOM   598  C C   . GLU A 1 93  ? 11.755  -9.038  -35.549 1.00 33.47  ? 75   GLU A C   1 
ATOM   599  O O   . GLU A 1 93  ? 12.295  -8.016  -36.011 1.00 33.36  ? 75   GLU A O   1 
ATOM   600  C CB  . GLU A 1 93  ? 11.180  -10.992 -37.202 1.00 35.11  ? 75   GLU A CB  1 
ATOM   601  C CG  . GLU A 1 93  ? 10.314  -10.003 -37.960 1.00 41.62  ? 75   GLU A CG  1 
ATOM   602  C CD  . GLU A 1 93  ? 9.142   -10.722 -38.664 1.00 42.69  ? 75   GLU A CD  1 
ATOM   603  O OE1 . GLU A 1 93  ? 9.310   -11.948 -39.015 1.00 50.99  ? 75   GLU A OE1 1 
ATOM   604  O OE2 . GLU A 1 93  ? 8.072   -10.074 -38.840 1.00 47.85  ? 75   GLU A OE2 1 
ATOM   605  N N   . ARG A 1 94  ? 10.934  -8.997  -34.499 1.00 32.27  ? 76   ARG A N   1 
ATOM   606  C CA  . ARG A 1 94  ? 10.641  -7.746  -33.783 1.00 31.78  ? 76   ARG A CA  1 
ATOM   607  C C   . ARG A 1 94  ? 11.924  -7.182  -33.097 1.00 32.32  ? 76   ARG A C   1 
ATOM   608  O O   . ARG A 1 94  ? 12.223  -5.993  -33.211 1.00 32.54  ? 76   ARG A O   1 
ATOM   609  C CB  . ARG A 1 94  ? 9.513   -7.953  -32.755 1.00 30.72  ? 76   ARG A CB  1 
ATOM   610  C CG  . ARG A 1 94  ? 9.249   -6.736  -31.856 1.00 29.18  ? 76   ARG A CG  1 
ATOM   611  C CD  . ARG A 1 94  ? 8.906   -5.496  -32.648 1.00 31.01  ? 76   ARG A CD  1 
ATOM   612  N NE  . ARG A 1 94  ? 8.738   -4.321  -31.787 1.00 31.51  ? 76   ARG A NE  1 
ATOM   613  C CZ  . ARG A 1 94  ? 8.377   -3.108  -32.219 1.00 34.10  ? 76   ARG A CZ  1 
ATOM   614  N NH1 . ARG A 1 94  ? 8.154   -2.869  -33.511 1.00 33.73  ? 76   ARG A NH1 1 
ATOM   615  N NH2 . ARG A 1 94  ? 8.227   -2.130  -31.353 1.00 31.94  ? 76   ARG A NH2 1 
ATOM   616  N N   . LEU A 1 95  ? 12.691  -8.057  -32.429 1.00 31.69  ? 77   LEU A N   1 
ATOM   617  C CA  . LEU A 1 95  ? 13.946  -7.642  -31.816 1.00 31.41  ? 77   LEU A CA  1 
ATOM   618  C C   . LEU A 1 95  ? 14.949  -7.093  -32.836 1.00 32.32  ? 77   LEU A C   1 
ATOM   619  O O   . LEU A 1 95  ? 15.495  -5.997  -32.648 1.00 32.70  ? 77   LEU A O   1 
ATOM   620  C CB  . LEU A 1 95  ? 14.553  -8.757  -30.969 1.00 30.49  ? 77   LEU A CB  1 
ATOM   621  C CG  . LEU A 1 95  ? 13.780  -9.149  -29.702 1.00 29.54  ? 77   LEU A CG  1 
ATOM   622  C CD1 . LEU A 1 95  ? 14.373  -10.412 -29.137 1.00 26.25  ? 77   LEU A CD1 1 
ATOM   623  C CD2 . LEU A 1 95  ? 13.804  -8.015  -28.659 1.00 26.65  ? 77   LEU A CD2 1 
ATOM   624  N N   . VAL A 1 96  ? 15.173  -7.817  -33.924 1.00 32.45  ? 78   VAL A N   1 
ATOM   625  C CA  . VAL A 1 96  ? 16.027  -7.282  -34.990 1.00 33.54  ? 78   VAL A CA  1 
ATOM   626  C C   . VAL A 1 96  ? 15.535  -5.897  -35.504 1.00 34.64  ? 78   VAL A C   1 
ATOM   627  O O   . VAL A 1 96  ? 16.294  -4.927  -35.579 1.00 35.71  ? 78   VAL A O   1 
ATOM   628  C CB  . VAL A 1 96  ? 16.233  -8.320  -36.081 1.00 33.21  ? 78   VAL A CB  1 
ATOM   629  C CG1 . VAL A 1 96  ? 17.084  -7.757  -37.268 1.00 34.50  ? 78   VAL A CG1 1 
ATOM   630  C CG2 . VAL A 1 96  ? 16.876  -9.526  -35.452 1.00 31.95  ? 78   VAL A CG2 1 
ATOM   631  N N   . SER A 1 97  ? 14.241  -5.804  -35.766 1.00 35.48  ? 79   SER A N   1 
ATOM   632  C CA  . SER A 1 97  ? 13.614  -4.589  -36.265 1.00 36.72  ? 79   SER A CA  1 
ATOM   633  C C   . SER A 1 97  ? 13.792  -3.376  -35.319 1.00 37.18  ? 79   SER A C   1 
ATOM   634  O O   . SER A 1 97  ? 13.836  -2.231  -35.794 1.00 37.15  ? 79   SER A O   1 
ATOM   635  C CB  . SER A 1 97  ? 12.152  -4.898  -36.576 1.00 36.49  ? 79   SER A CB  1 
ATOM   636  O OG  . SER A 1 97  ? 11.271  -3.847  -36.295 1.00 40.15  ? 79   SER A OG  1 
ATOM   637  N N   . ILE A 1 98  ? 13.906  -3.627  -34.003 1.00 36.37  ? 80   ILE A N   1 
ATOM   638  C CA  . ILE A 1 98  ? 14.197  -2.553  -33.033 1.00 36.43  ? 80   ILE A CA  1 
ATOM   639  C C   . ILE A 1 98  ? 15.671  -2.373  -32.598 1.00 36.88  ? 80   ILE A C   1 
ATOM   640  O O   . ILE A 1 98  ? 15.975  -1.563  -31.706 1.00 36.86  ? 80   ILE A O   1 
ATOM   641  C CB  . ILE A 1 98  ? 13.229  -2.564  -31.820 1.00 35.98  ? 80   ILE A CB  1 
ATOM   642  C CG1 . ILE A 1 98  ? 13.345  -3.854  -30.999 1.00 33.25  ? 80   ILE A CG1 1 
ATOM   643  C CG2 . ILE A 1 98  ? 11.795  -2.308  -32.306 1.00 36.45  ? 80   ILE A CG2 1 
ATOM   644  C CD1 . ILE A 1 98  ? 14.355  -3.816  -29.876 1.00 31.27  ? 80   ILE A CD1 1 
ATOM   645  N N   . GLY A 1 99  ? 16.586  -3.108  -33.228 1.00 36.16  ? 81   GLY A N   1 
ATOM   646  C CA  . GLY A 1 99  ? 18.002  -2.788  -33.067 1.00 36.95  ? 81   GLY A CA  1 
ATOM   647  C C   . GLY A 1 99  ? 18.932  -3.913  -32.644 1.00 37.18  ? 81   GLY A C   1 
ATOM   648  O O   . GLY A 1 99  ? 20.157  -3.704  -32.572 1.00 37.91  ? 81   GLY A O   1 
ATOM   649  N N   . TYR A 1 100 ? 18.357  -5.081  -32.365 1.00 35.23  ? 82   TYR A N   1 
ATOM   650  C CA  . TYR A 1 100 ? 19.133  -6.273  -32.061 1.00 35.41  ? 82   TYR A CA  1 
ATOM   651  C C   . TYR A 1 100 ? 19.958  -6.709  -33.283 1.00 36.63  ? 82   TYR A C   1 
ATOM   652  O O   . TYR A 1 100 ? 19.567  -6.427  -34.431 1.00 38.36  ? 82   TYR A O   1 
ATOM   653  C CB  . TYR A 1 100 ? 18.242  -7.384  -31.455 1.00 33.30  ? 82   TYR A CB  1 
ATOM   654  C CG  . TYR A 1 100 ? 18.079  -7.175  -29.960 1.00 31.71  ? 82   TYR A CG  1 
ATOM   655  C CD1 . TYR A 1 100 ? 17.214  -6.201  -29.451 1.00 31.50  ? 82   TYR A CD1 1 
ATOM   656  C CD2 . TYR A 1 100 ? 18.813  -7.927  -29.057 1.00 32.70  ? 82   TYR A CD2 1 
ATOM   657  C CE1 . TYR A 1 100 ? 17.094  -5.977  -28.059 1.00 32.36  ? 82   TYR A CE1 1 
ATOM   658  C CE2 . TYR A 1 100 ? 18.692  -7.735  -27.674 1.00 30.82  ? 82   TYR A CE2 1 
ATOM   659  C CZ  . TYR A 1 100 ? 17.857  -6.762  -27.188 1.00 33.62  ? 82   TYR A CZ  1 
ATOM   660  O OH  . TYR A 1 100 ? 17.790  -6.590  -25.833 1.00 33.59  ? 82   TYR A OH  1 
ATOM   661  N N   . PRO A 1 101 ? 21.137  -7.318  -33.045 1.00 36.95  ? 83   PRO A N   1 
ATOM   662  C CA  . PRO A 1 101 ? 22.022  -7.685  -34.154 1.00 38.05  ? 83   PRO A CA  1 
ATOM   663  C C   . PRO A 1 101 ? 21.408  -8.741  -35.065 1.00 38.50  ? 83   PRO A C   1 
ATOM   664  O O   . PRO A 1 101 ? 20.581  -9.544  -34.618 1.00 37.52  ? 83   PRO A O   1 
ATOM   665  C CB  . PRO A 1 101 ? 23.254  -8.264  -33.442 1.00 38.21  ? 83   PRO A CB  1 
ATOM   666  C CG  . PRO A 1 101 ? 22.771  -8.676  -32.108 1.00 37.07  ? 83   PRO A CG  1 
ATOM   667  C CD  . PRO A 1 101 ? 21.709  -7.700  -31.740 1.00 35.93  ? 83   PRO A CD  1 
ATOM   668  N N   . GLN A 1 102 ? 21.848  -8.740  -36.320 1.00 39.84  ? 84   GLN A N   1 
ATOM   669  C CA  . GLN A 1 102 ? 21.382  -9.639  -37.362 1.00 41.19  ? 84   GLN A CA  1 
ATOM   670  C C   . GLN A 1 102 ? 21.502  -11.142 -37.045 1.00 40.15  ? 84   GLN A C   1 
ATOM   671  O O   . GLN A 1 102 ? 20.761  -11.944 -37.599 1.00 39.54  ? 84   GLN A O   1 
ATOM   672  C CB  . GLN A 1 102 ? 22.132  -9.341  -38.673 1.00 43.65  ? 84   GLN A CB  1 
ATOM   673  C CG  . GLN A 1 102 ? 21.792  -7.984  -39.300 1.00 48.24  ? 84   GLN A CG  1 
ATOM   674  C CD  . GLN A 1 102 ? 20.402  -7.953  -39.932 1.00 54.24  ? 84   GLN A CD  1 
ATOM   675  O OE1 . GLN A 1 102 ? 20.055  -8.829  -40.738 1.00 58.22  ? 84   GLN A OE1 1 
ATOM   676  N NE2 . GLN A 1 102 ? 19.606  -6.928  -39.588 1.00 54.74  ? 84   GLN A NE2 1 
ATOM   677  N N   . GLU A 1 103 ? 22.421  -11.513 -36.155 1.00 39.65  ? 85   GLU A N   1 
ATOM   678  C CA  . GLU A 1 103 ? 22.692  -12.931 -35.886 1.00 39.62  ? 85   GLU A CA  1 
ATOM   679  C C   . GLU A 1 103 ? 21.511  -13.619 -35.258 1.00 37.54  ? 85   GLU A C   1 
ATOM   680  O O   . GLU A 1 103 ? 21.406  -14.835 -35.351 1.00 37.89  ? 85   GLU A O   1 
ATOM   681  C CB  . GLU A 1 103 ? 23.946  -13.129 -35.029 1.00 40.05  ? 85   GLU A CB  1 
ATOM   682  C CG  . GLU A 1 103 ? 25.248  -12.728 -35.736 1.00 43.24  ? 85   GLU A CG  1 
ATOM   683  C CD  . GLU A 1 103 ? 25.555  -11.238 -35.590 1.00 48.16  ? 85   GLU A CD  1 
ATOM   684  O OE1 . GLU A 1 103 ? 24.608  -10.416 -35.495 1.00 48.39  ? 85   GLU A OE1 1 
ATOM   685  O OE2 . GLU A 1 103 ? 26.752  -10.878 -35.557 1.00 50.68  ? 85   GLU A OE2 1 
ATOM   686  N N   . LEU A 1 104 ? 20.614  -12.837 -34.660 1.00 35.54  ? 86   LEU A N   1 
ATOM   687  C CA  . LEU A 1 104 ? 19.371  -13.362 -34.112 1.00 34.45  ? 86   LEU A CA  1 
ATOM   688  C C   . LEU A 1 104 ? 18.502  -14.118 -35.138 1.00 35.00  ? 86   LEU A C   1 
ATOM   689  O O   . LEU A 1 104 ? 17.770  -15.041 -34.778 1.00 33.84  ? 86   LEU A O   1 
ATOM   690  C CB  . LEU A 1 104 ? 18.539  -12.249 -33.479 1.00 33.84  ? 86   LEU A CB  1 
ATOM   691  C CG  . LEU A 1 104 ? 18.667  -11.990 -31.980 1.00 32.55  ? 86   LEU A CG  1 
ATOM   692  C CD1 . LEU A 1 104 ? 19.958  -11.254 -31.634 1.00 28.97  ? 86   LEU A CD1 1 
ATOM   693  C CD2 . LEU A 1 104 ? 17.471  -11.189 -31.541 1.00 31.23  ? 86   LEU A CD2 1 
ATOM   694  N N   . LEU A 1 105 ? 18.579  -13.705 -36.401 1.00 35.80  ? 87   LEU A N   1 
ATOM   695  C CA  . LEU A 1 105 ? 17.805  -14.333 -37.471 1.00 36.39  ? 87   LEU A CA  1 
ATOM   696  C C   . LEU A 1 105 ? 18.226  -15.784 -37.756 1.00 37.10  ? 87   LEU A C   1 
ATOM   697  O O   . LEU A 1 105 ? 17.488  -16.535 -38.390 1.00 37.35  ? 87   LEU A O   1 
ATOM   698  C CB  . LEU A 1 105 ? 17.868  -13.485 -38.746 1.00 36.82  ? 87   LEU A CB  1 
ATOM   699  C CG  . LEU A 1 105 ? 17.228  -12.081 -38.652 1.00 36.93  ? 87   LEU A CG  1 
ATOM   700  C CD1 . LEU A 1 105 ? 17.570  -11.273 -39.911 1.00 38.34  ? 87   LEU A CD1 1 
ATOM   701  C CD2 . LEU A 1 105 ? 15.703  -12.111 -38.447 1.00 33.48  ? 87   LEU A CD2 1 
ATOM   702  N N   . SER A 1 106 ? 19.411  -16.176 -37.298 1.00 37.20  ? 88   SER A N   1 
ATOM   703  C CA  . SER A 1 106 ? 19.867  -17.540 -37.508 1.00 37.89  ? 88   SER A CA  1 
ATOM   704  C C   . SER A 1 106 ? 19.498  -18.463 -36.320 1.00 36.12  ? 88   SER A C   1 
ATOM   705  O O   . SER A 1 106 ? 19.876  -19.617 -36.319 1.00 36.24  ? 88   SER A O   1 
ATOM   706  C CB  . SER A 1 106 ? 21.377  -17.543 -37.748 1.00 39.56  ? 88   SER A CB  1 
ATOM   707  O OG  . SER A 1 106 ? 22.058  -17.259 -36.531 1.00 41.68  ? 88   SER A OG  1 
ATOM   708  N N   . PHE A 1 107 ? 18.785  -17.945 -35.308 1.00 34.09  ? 89   PHE A N   1 
ATOM   709  C CA  . PHE A 1 107 ? 18.197  -18.790 -34.262 1.00 32.89  ? 89   PHE A CA  1 
ATOM   710  C C   . PHE A 1 107 ? 17.055  -19.633 -34.864 1.00 33.59  ? 89   PHE A C   1 
ATOM   711  O O   . PHE A 1 107 ? 16.372  -19.192 -35.789 1.00 34.00  ? 89   PHE A O   1 
ATOM   712  C CB  . PHE A 1 107 ? 17.615  -17.976 -33.111 1.00 30.72  ? 89   PHE A CB  1 
ATOM   713  C CG  . PHE A 1 107 ? 18.621  -17.127 -32.349 1.00 30.76  ? 89   PHE A CG  1 
ATOM   714  C CD1 . PHE A 1 107 ? 20.004  -17.286 -32.518 1.00 30.46  ? 89   PHE A CD1 1 
ATOM   715  C CD2 . PHE A 1 107 ? 18.170  -16.206 -31.410 1.00 24.45  ? 89   PHE A CD2 1 
ATOM   716  C CE1 . PHE A 1 107 ? 20.916  -16.505 -31.777 1.00 30.17  ? 89   PHE A CE1 1 
ATOM   717  C CE2 . PHE A 1 107 ? 19.075  -15.428 -30.671 1.00 26.45  ? 89   PHE A CE2 1 
ATOM   718  C CZ  . PHE A 1 107 ? 20.451  -15.576 -30.848 1.00 27.64  ? 89   PHE A CZ  1 
ATOM   719  N N   . ALA A 1 108 ? 16.849  -20.839 -34.354 1.00 33.25  ? 90   ALA A N   1 
ATOM   720  C CA  . ALA A 1 108 ? 15.679  -21.612 -34.752 1.00 34.04  ? 90   ALA A CA  1 
ATOM   721  C C   . ALA A 1 108 ? 15.128  -22.246 -33.489 1.00 33.56  ? 90   ALA A C   1 
ATOM   722  O O   . ALA A 1 108 ? 15.891  -22.598 -32.604 1.00 34.53  ? 90   ALA A O   1 
ATOM   723  C CB  . ALA A 1 108 ? 16.041  -22.675 -35.805 1.00 34.74  ? 90   ALA A CB  1 
ATOM   724  N N   . TYR A 1 109 ? 13.804  -22.339 -33.387 1.00 33.07  ? 91   TYR A N   1 
ATOM   725  C CA  . TYR A 1 109 ? 13.163  -22.768 -32.155 1.00 31.48  ? 91   TYR A CA  1 
ATOM   726  C C   . TYR A 1 109 ? 13.399  -24.292 -31.945 1.00 31.77  ? 91   TYR A C   1 
ATOM   727  O O   . TYR A 1 109 ? 13.297  -25.094 -32.882 1.00 31.46  ? 91   TYR A O   1 
ATOM   728  C CB  . TYR A 1 109 ? 11.675  -22.406 -32.153 1.00 30.14  ? 91   TYR A CB  1 
ATOM   729  C CG  . TYR A 1 109 ? 10.956  -22.855 -30.885 1.00 29.91  ? 91   TYR A CG  1 
ATOM   730  C CD1 . TYR A 1 109 ? 11.004  -22.087 -29.720 1.00 27.77  ? 91   TYR A CD1 1 
ATOM   731  C CD2 . TYR A 1 109 ? 10.268  -24.058 -30.845 1.00 27.09  ? 91   TYR A CD2 1 
ATOM   732  C CE1 . TYR A 1 109 ? 10.393  -22.510 -28.583 1.00 28.21  ? 91   TYR A CE1 1 
ATOM   733  C CE2 . TYR A 1 109 ? 9.643   -24.472 -29.720 1.00 26.40  ? 91   TYR A CE2 1 
ATOM   734  C CZ  . TYR A 1 109 ? 9.699   -23.690 -28.586 1.00 29.17  ? 91   TYR A CZ  1 
ATOM   735  O OH  . TYR A 1 109 ? 9.067   -24.103 -27.429 1.00 29.75  ? 91   TYR A OH  1 
ATOM   736  N N   . ASP A 1 110 ? 13.754  -24.648 -30.715 1.00 31.85  ? 92   ASP A N   1 
ATOM   737  C CA  . ASP A 1 110 ? 14.048  -26.027 -30.344 1.00 34.02  ? 92   ASP A CA  1 
ATOM   738  C C   . ASP A 1 110 ? 13.067  -26.362 -29.231 1.00 33.06  ? 92   ASP A C   1 
ATOM   739  O O   . ASP A 1 110 ? 13.183  -25.845 -28.111 1.00 33.43  ? 92   ASP A O   1 
ATOM   740  C CB  . ASP A 1 110 ? 15.483  -26.153 -29.853 1.00 34.59  ? 92   ASP A CB  1 
ATOM   741  C CG  . ASP A 1 110 ? 15.988  -27.579 -29.854 1.00 40.27  ? 92   ASP A CG  1 
ATOM   742  O OD1 . ASP A 1 110 ? 15.243  -28.539 -29.480 1.00 39.75  ? 92   ASP A OD1 1 
ATOM   743  O OD2 . ASP A 1 110 ? 17.173  -27.726 -30.256 1.00 47.03  ? 92   ASP A OD2 1 
ATOM   744  N N   . SER A 1 111 ? 12.074  -27.180 -29.556 1.00 32.18  ? 93   SER A N   1 
ATOM   745  C CA  . SER A 1 111 ? 11.062  -27.560 -28.600 1.00 32.15  ? 93   SER A CA  1 
ATOM   746  C C   . SER A 1 111 ? 11.620  -28.490 -27.510 1.00 32.35  ? 93   SER A C   1 
ATOM   747  O O   . SER A 1 111 ? 11.012  -28.614 -26.470 1.00 32.09  ? 93   SER A O   1 
ATOM   748  C CB  . SER A 1 111 ? 9.888   -28.235 -29.305 1.00 32.46  ? 93   SER A CB  1 
ATOM   749  O OG  . SER A 1 111 ? 10.323  -29.488 -29.799 1.00 33.07  ? 93   SER A OG  1 
ATOM   750  N N   . THR A 1 112 ? 12.761  -29.137 -27.739 1.00 33.29  ? 94   THR A N   1 
ATOM   751  C CA  . THR A 1 112 ? 13.373  -29.917 -26.654 1.00 34.06  ? 94   THR A CA  1 
ATOM   752  C C   . THR A 1 112 ? 14.060  -29.114 -25.526 1.00 34.42  ? 94   THR A C   1 
ATOM   753  O O   . THR A 1 112 ? 14.428  -29.710 -24.502 1.00 37.31  ? 94   THR A O   1 
ATOM   754  C CB  . THR A 1 112 ? 14.412  -30.907 -27.120 1.00 34.74  ? 94   THR A CB  1 
ATOM   755  O OG1 . THR A 1 112 ? 15.613  -30.207 -27.425 1.00 35.77  ? 94   THR A OG1 1 
ATOM   756  C CG2 . THR A 1 112 ? 13.933  -31.766 -28.337 1.00 34.94  ? 94   THR A CG2 1 
ATOM   757  N N   . PHE A 1 113 ? 14.279  -27.812 -25.686 1.00 31.37  ? 95   PHE A N   1 
ATOM   758  C CA  . PHE A 1 113 ? 14.927  -27.100 -24.597 1.00 29.88  ? 95   PHE A CA  1 
ATOM   759  C C   . PHE A 1 113 ? 13.950  -26.607 -23.510 1.00 29.48  ? 95   PHE A C   1 
ATOM   760  O O   . PHE A 1 113 ? 14.156  -26.932 -22.335 1.00 29.27  ? 95   PHE A O   1 
ATOM   761  C CB  . PHE A 1 113 ? 15.849  -25.975 -25.088 1.00 28.44  ? 95   PHE A CB  1 
ATOM   762  C CG  . PHE A 1 113 ? 16.405  -25.108 -23.975 1.00 27.26  ? 95   PHE A CG  1 
ATOM   763  C CD1 . PHE A 1 113 ? 17.650  -25.381 -23.408 1.00 27.16  ? 95   PHE A CD1 1 
ATOM   764  C CD2 . PHE A 1 113 ? 15.675  -24.009 -23.485 1.00 23.43  ? 95   PHE A CD2 1 
ATOM   765  C CE1 . PHE A 1 113 ? 18.157  -24.554 -22.360 1.00 26.95  ? 95   PHE A CE1 1 
ATOM   766  C CE2 . PHE A 1 113 ? 16.173  -23.203 -22.460 1.00 24.73  ? 95   PHE A CE2 1 
ATOM   767  C CZ  . PHE A 1 113 ? 17.410  -23.470 -21.899 1.00 24.74  ? 95   PHE A CZ  1 
ATOM   768  N N   . PRO A 1 114 ? 12.895  -25.836 -23.879 1.00 28.90  ? 96   PRO A N   1 
ATOM   769  C CA  . PRO A 1 114 ? 12.175  -25.186 -22.767 1.00 29.50  ? 96   PRO A CA  1 
ATOM   770  C C   . PRO A 1 114 ? 11.265  -26.167 -22.012 1.00 30.38  ? 96   PRO A C   1 
ATOM   771  O O   . PRO A 1 114 ? 10.802  -27.196 -22.568 1.00 32.43  ? 96   PRO A O   1 
ATOM   772  C CB  . PRO A 1 114 ? 11.379  -24.076 -23.473 1.00 28.21  ? 96   PRO A CB  1 
ATOM   773  C CG  . PRO A 1 114 ? 11.183  -24.559 -24.841 1.00 25.92  ? 96   PRO A CG  1 
ATOM   774  C CD  . PRO A 1 114 ? 12.288  -25.493 -25.181 1.00 28.66  ? 96   PRO A CD  1 
ATOM   775  N N   . THR A 1 115 ? 11.111  -25.919 -20.725 1.00 29.44  ? 97   THR A N   1 
ATOM   776  C CA  . THR A 1 115 ? 10.142  -26.620 -19.922 1.00 27.81  ? 97   THR A CA  1 
ATOM   777  C C   . THR A 1 115 ? 9.375   -25.428 -19.381 1.00 26.40  ? 97   THR A C   1 
ATOM   778  O O   . THR A 1 115 ? 9.963   -24.364 -19.207 1.00 25.64  ? 97   THR A O   1 
ATOM   779  C CB  . THR A 1 115 ? 10.841  -27.471 -18.860 1.00 28.57  ? 97   THR A CB  1 
ATOM   780  O OG1 . THR A 1 115 ? 11.404  -28.633 -19.511 1.00 32.27  ? 97   THR A OG1 1 
ATOM   781  C CG2 . THR A 1 115 ? 9.868   -27.963 -17.802 1.00 28.37  ? 97   THR A CG2 1 
ATOM   782  N N   . ARG A 1 116 ? 8.065   -25.567 -19.216 1.00 25.71  ? 98   ARG A N   1 
ATOM   783  C CA  . ARG A 1 116 ? 7.240   -24.463 -18.742 1.00 25.70  ? 98   ARG A CA  1 
ATOM   784  C C   . ARG A 1 116 ? 7.504   -24.217 -17.248 1.00 25.56  ? 98   ARG A C   1 
ATOM   785  O O   . ARG A 1 116 ? 7.866   -25.126 -16.526 1.00 25.42  ? 98   ARG A O   1 
ATOM   786  C CB  . ARG A 1 116 ? 5.772   -24.728 -19.061 1.00 24.24  ? 98   ARG A CB  1 
ATOM   787  C CG  . ARG A 1 116 ? 4.842   -23.587 -18.711 1.00 26.50  ? 98   ARG A CG  1 
ATOM   788  C CD  . ARG A 1 116 ? 3.701   -23.561 -19.660 1.00 21.96  ? 98   ARG A CD  1 
ATOM   789  N NE  . ARG A 1 116 ? 2.877   -24.768 -19.600 1.00 24.27  ? 98   ARG A NE  1 
ATOM   790  C CZ  . ARG A 1 116 ? 1.692   -24.820 -19.007 1.00 22.95  ? 98   ARG A CZ  1 
ATOM   791  N NH1 . ARG A 1 116 ? 1.193   -23.732 -18.420 1.00 17.99  ? 98   ARG A NH1 1 
ATOM   792  N NH2 . ARG A 1 116 ? 0.992   -25.938 -19.045 1.00 20.67  ? 98   ARG A NH2 1 
ATOM   793  N N   . GLY A 1 117 ? 7.406   -22.970 -16.799 1.00 26.45  ? 99   GLY A N   1 
ATOM   794  C CA  . GLY A 1 117 ? 7.562   -22.688 -15.369 1.00 25.89  ? 99   GLY A CA  1 
ATOM   795  C C   . GLY A 1 117 ? 8.951   -22.341 -14.894 1.00 26.64  ? 99   GLY A C   1 
ATOM   796  O O   . GLY A 1 117 ? 9.167   -22.194 -13.685 1.00 27.92  ? 99   GLY A O   1 
ATOM   797  N N   . LEU A 1 118 ? 9.903   -22.173 -15.817 1.00 26.52  ? 100  LEU A N   1 
ATOM   798  C CA  . LEU A 1 118 ? 11.257  -21.762 -15.424 1.00 26.36  ? 100  LEU A CA  1 
ATOM   799  C C   . LEU A 1 118 ? 11.252  -20.320 -14.930 1.00 26.63  ? 100  LEU A C   1 
ATOM   800  O O   . LEU A 1 118 ? 10.380  -19.516 -15.299 1.00 25.63  ? 100  LEU A O   1 
ATOM   801  C CB  . LEU A 1 118 ? 12.252  -21.918 -16.573 1.00 25.01  ? 100  LEU A CB  1 
ATOM   802  C CG  . LEU A 1 118 ? 12.364  -23.351 -17.073 1.00 27.76  ? 100  LEU A CG  1 
ATOM   803  C CD1 . LEU A 1 118 ? 13.348  -23.472 -18.250 1.00 23.58  ? 100  LEU A CD1 1 
ATOM   804  C CD2 . LEU A 1 118 ? 12.659  -24.383 -15.930 1.00 22.66  ? 100  LEU A CD2 1 
ATOM   805  N N   . VAL A 1 119 ? 12.249  -19.994 -14.118 1.00 27.32  ? 101  VAL A N   1 
ATOM   806  C CA  . VAL A 1 119 ? 12.389  -18.660 -13.602 1.00 27.06  ? 101  VAL A CA  1 
ATOM   807  C C   . VAL A 1 119 ? 13.545  -18.060 -14.328 1.00 27.58  ? 101  VAL A C   1 
ATOM   808  O O   . VAL A 1 119 ? 14.624  -18.651 -14.377 1.00 28.32  ? 101  VAL A O   1 
ATOM   809  C CB  . VAL A 1 119 ? 12.670  -18.673 -12.078 1.00 28.13  ? 101  VAL A CB  1 
ATOM   810  C CG1 . VAL A 1 119 ? 12.703  -17.263 -11.515 1.00 25.94  ? 101  VAL A CG1 1 
ATOM   811  C CG2 . VAL A 1 119 ? 11.606  -19.558 -11.339 1.00 26.97  ? 101  VAL A CG2 1 
ATOM   812  N N   . PHE A 1 120 ? 13.310  -16.915 -14.947 1.00 26.74  ? 102  PHE A N   1 
ATOM   813  C CA  . PHE A 1 120 ? 14.429  -16.095 -15.387 1.00 27.16  ? 102  PHE A CA  1 
ATOM   814  C C   . PHE A 1 120 ? 14.964  -15.104 -14.315 1.00 28.29  ? 102  PHE A C   1 
ATOM   815  O O   . PHE A 1 120 ? 14.236  -14.227 -13.794 1.00 27.23  ? 102  PHE A O   1 
ATOM   816  C CB  . PHE A 1 120 ? 14.142  -15.379 -16.713 1.00 26.35  ? 102  PHE A CB  1 
ATOM   817  C CG  . PHE A 1 120 ? 15.368  -14.816 -17.347 1.00 24.52  ? 102  PHE A CG  1 
ATOM   818  C CD1 . PHE A 1 120 ? 16.255  -15.649 -18.030 1.00 24.47  ? 102  PHE A CD1 1 
ATOM   819  C CD2 . PHE A 1 120 ? 15.671  -13.456 -17.222 1.00 24.39  ? 102  PHE A CD2 1 
ATOM   820  C CE1 . PHE A 1 120 ? 17.434  -15.130 -18.615 1.00 25.58  ? 102  PHE A CE1 1 
ATOM   821  C CE2 . PHE A 1 120 ? 16.830  -12.932 -17.782 1.00 23.85  ? 102  PHE A CE2 1 
ATOM   822  C CZ  . PHE A 1 120 ? 17.709  -13.778 -18.493 1.00 25.32  ? 102  PHE A CZ  1 
ATOM   823  N N   . ASP A 1 121 ? 16.247  -15.283 -13.986 1.00 29.52  ? 103  ASP A N   1 
ATOM   824  C CA  . ASP A 1 121 ? 16.935  -14.414 -13.067 1.00 30.38  ? 103  ASP A CA  1 
ATOM   825  C C   . ASP A 1 121 ? 17.500  -13.250 -13.894 1.00 31.08  ? 103  ASP A C   1 
ATOM   826  O O   . ASP A 1 121 ? 18.483  -13.421 -14.620 1.00 32.44  ? 103  ASP A O   1 
ATOM   827  C CB  . ASP A 1 121 ? 18.049  -15.192 -12.366 1.00 30.50  ? 103  ASP A CB  1 
ATOM   828  C CG  . ASP A 1 121 ? 18.784  -14.350 -11.309 1.00 32.08  ? 103  ASP A CG  1 
ATOM   829  O OD1 . ASP A 1 121 ? 18.535  -13.131 -11.211 1.00 31.06  ? 103  ASP A OD1 1 
ATOM   830  O OD2 . ASP A 1 121 ? 19.626  -14.900 -10.581 1.00 34.29  ? 103  ASP A OD2 1 
ATOM   831  N N   . THR A 1 122 ? 16.862  -12.089 -13.822 1.00 30.93  ? 104  THR A N   1 
ATOM   832  C CA  . THR A 1 122 ? 17.310  -10.908 -14.590 1.00 30.91  ? 104  THR A CA  1 
ATOM   833  C C   . THR A 1 122 ? 18.625  -10.309 -14.082 1.00 31.82  ? 104  THR A C   1 
ATOM   834  O O   . THR A 1 122 ? 19.268  -9.574  -14.815 1.00 32.82  ? 104  THR A O   1 
ATOM   835  C CB  . THR A 1 122 ? 16.311  -9.744  -14.510 1.00 31.39  ? 104  THR A CB  1 
ATOM   836  O OG1 . THR A 1 122 ? 16.184  -9.352  -13.136 1.00 30.40  ? 104  THR A OG1 1 
ATOM   837  C CG2 . THR A 1 122 ? 14.946  -10.111 -15.108 1.00 28.13  ? 104  THR A CG2 1 
ATOM   838  N N   . LEU A 1 123 ? 19.016  -10.600 -12.841 1.00 32.02  ? 105  LEU A N   1 
ATOM   839  C CA  . LEU A 1 123 ? 20.319  -10.161 -12.348 1.00 32.79  ? 105  LEU A CA  1 
ATOM   840  C C   . LEU A 1 123 ? 21.465  -10.885 -13.078 1.00 32.95  ? 105  LEU A C   1 
ATOM   841  O O   . LEU A 1 123 ? 22.315  -10.234 -13.700 1.00 32.78  ? 105  LEU A O   1 
ATOM   842  C CB  . LEU A 1 123 ? 20.426  -10.323 -10.824 1.00 33.53  ? 105  LEU A CB  1 
ATOM   843  C CG  . LEU A 1 123 ? 21.691  -9.758  -10.171 1.00 35.05  ? 105  LEU A CG  1 
ATOM   844  C CD1 . LEU A 1 123 ? 21.879  -8.294  -10.505 1.00 37.78  ? 105  LEU A CD1 1 
ATOM   845  C CD2 . LEU A 1 123 ? 21.689  -9.936  -8.674  1.00 35.29  ? 105  LEU A CD2 1 
ATOM   846  N N   . TYR A 1 124 ? 21.450  -12.227 -13.047 1.00 32.41  ? 106  TYR A N   1 
ATOM   847  C CA  . TYR A 1 124 ? 22.530  -13.055 -13.614 1.00 31.62  ? 106  TYR A CA  1 
ATOM   848  C C   . TYR A 1 124 ? 22.314  -13.644 -15.006 1.00 30.53  ? 106  TYR A C   1 
ATOM   849  O O   . TYR A 1 124 ? 23.254  -14.232 -15.581 1.00 29.90  ? 106  TYR A O   1 
ATOM   850  C CB  . TYR A 1 124 ? 22.893  -14.183 -12.630 1.00 32.39  ? 106  TYR A CB  1 
ATOM   851  C CG  . TYR A 1 124 ? 23.457  -13.614 -11.347 1.00 34.21  ? 106  TYR A CG  1 
ATOM   852  C CD1 . TYR A 1 124 ? 24.450  -12.641 -11.388 1.00 35.55  ? 106  TYR A CD1 1 
ATOM   853  C CD2 . TYR A 1 124 ? 23.004  -14.049 -10.104 1.00 35.21  ? 106  TYR A CD2 1 
ATOM   854  C CE1 . TYR A 1 124 ? 24.968  -12.089 -10.221 1.00 38.91  ? 106  TYR A CE1 1 
ATOM   855  C CE2 . TYR A 1 124 ? 23.515  -13.522 -8.939  1.00 39.00  ? 106  TYR A CE2 1 
ATOM   856  C CZ  . TYR A 1 124 ? 24.498  -12.541 -9.003  1.00 38.33  ? 106  TYR A CZ  1 
ATOM   857  O OH  . TYR A 1 124 ? 25.007  -12.008 -7.857  1.00 39.28  ? 106  TYR A OH  1 
ATOM   858  N N   . GLY A 1 125 ? 21.104  -13.522 -15.548 1.00 29.01  ? 107  GLY A N   1 
ATOM   859  C CA  . GLY A 1 125 ? 20.842  -14.060 -16.902 1.00 28.10  ? 107  GLY A CA  1 
ATOM   860  C C   . GLY A 1 125 ? 20.704  -15.584 -16.980 1.00 28.82  ? 107  GLY A C   1 
ATOM   861  O O   . GLY A 1 125 ? 20.935  -16.189 -18.052 1.00 28.88  ? 107  GLY A O   1 
ATOM   862  N N   . ASN A 1 126 ? 20.327  -16.206 -15.850 1.00 27.80  ? 108  ASN A N   1 
ATOM   863  C CA  . ASN A 1 126 ? 20.103  -17.634 -15.763 1.00 27.50  ? 108  ASN A CA  1 
ATOM   864  C C   . ASN A 1 126 ? 18.630  -17.989 -15.821 1.00 26.88  ? 108  ASN A C   1 
ATOM   865  O O   . ASN A 1 126 ? 17.825  -17.264 -15.279 1.00 26.80  ? 108  ASN A O   1 
ATOM   866  C CB  . ASN A 1 126 ? 20.661  -18.190 -14.440 1.00 28.16  ? 108  ASN A CB  1 
ATOM   867  C CG  . ASN A 1 126 ? 22.139  -17.877 -14.238 1.00 28.54  ? 108  ASN A CG  1 
ATOM   868  O OD1 . ASN A 1 126 ? 22.927  -17.947 -15.174 1.00 32.19  ? 108  ASN A OD1 1 
ATOM   869  N ND2 . ASN A 1 126 ? 22.520  -17.567 -13.018 1.00 21.94  ? 108  ASN A ND2 1 
ATOM   870  N N   . LEU A 1 127 ? 18.295  -19.118 -16.466 1.00 26.60  ? 109  LEU A N   1 
ATOM   871  C CA  . LEU A 1 127 ? 17.030  -19.837 -16.230 1.00 26.19  ? 109  LEU A CA  1 
ATOM   872  C C   . LEU A 1 127 ? 17.170  -20.882 -15.110 1.00 27.02  ? 109  LEU A C   1 
ATOM   873  O O   . LEU A 1 127 ? 18.106  -21.709 -15.077 1.00 27.25  ? 109  LEU A O   1 
ATOM   874  C CB  . LEU A 1 127 ? 16.463  -20.510 -17.503 1.00 25.91  ? 109  LEU A CB  1 
ATOM   875  C CG  . LEU A 1 127 ? 15.912  -19.641 -18.619 1.00 25.11  ? 109  LEU A CG  1 
ATOM   876  C CD1 . LEU A 1 127 ? 15.905  -20.385 -19.885 1.00 26.05  ? 109  LEU A CD1 1 
ATOM   877  C CD2 . LEU A 1 127 ? 14.502  -19.026 -18.336 1.00 23.12  ? 109  LEU A CD2 1 
ATOM   878  N N   . LEU A 1 128 ? 16.207  -20.829 -14.189 1.00 27.61  ? 110  LEU A N   1 
ATOM   879  C CA  . LEU A 1 128 ? 16.221  -21.642 -12.989 1.00 28.25  ? 110  LEU A CA  1 
ATOM   880  C C   . LEU A 1 128 ? 14.964  -22.464 -12.973 1.00 28.13  ? 110  LEU A C   1 
ATOM   881  O O   . LEU A 1 128 ? 13.902  -21.942 -13.271 1.00 28.15  ? 110  LEU A O   1 
ATOM   882  C CB  . LEU A 1 128 ? 16.227  -20.734 -11.768 1.00 28.33  ? 110  LEU A CB  1 
ATOM   883  C CG  . LEU A 1 128 ? 17.339  -19.665 -11.662 1.00 30.22  ? 110  LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 128 ? 17.131  -18.766 -10.420 1.00 27.25  ? 110  LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 128 ? 18.701  -20.362 -11.624 1.00 28.70  ? 110  LEU A CD2 1 
ATOM   886  N N   . LYS A 1 129 ? 15.085  -23.747 -12.640 1.00 28.53  ? 111  LYS A N   1 
ATOM   887  C CA  . LYS A 1 129 ? 13.956  -24.555 -12.241 1.00 29.01  ? 111  LYS A CA  1 
ATOM   888  C C   . LYS A 1 129 ? 13.996  -24.688 -10.702 1.00 29.63  ? 111  LYS A C   1 
ATOM   889  O O   . LYS A 1 129 ? 15.023  -25.053 -10.129 1.00 30.40  ? 111  LYS A O   1 
ATOM   890  C CB  . LYS A 1 129 ? 14.064  -25.936 -12.890 1.00 29.60  ? 111  LYS A CB  1 
ATOM   891  C CG  . LYS A 1 129 ? 12.783  -26.772 -12.888 1.00 31.19  ? 111  LYS A CG  1 
ATOM   892  C CD  . LYS A 1 129 ? 13.164  -28.273 -13.054 1.00 33.11  ? 111  LYS A CD  1 
ATOM   893  C CE  . LYS A 1 129 ? 12.207  -28.930 -13.990 1.00 31.88  ? 111  LYS A CE  1 
ATOM   894  N NZ  . LYS A 1 129 ? 12.641  -30.299 -14.433 1.00 28.99  ? 111  LYS A NZ  1 
ATOM   895  N N   . VAL A 1 130 ? 12.875  -24.413 -10.042 1.00 29.29  ? 112  VAL A N   1 
ATOM   896  C CA  . VAL A 1 130 ? 12.845  -24.385 -8.575  1.00 30.49  ? 112  VAL A CA  1 
ATOM   897  C C   . VAL A 1 130 ? 11.693  -25.206 -8.001  1.00 31.12  ? 112  VAL A C   1 
ATOM   898  O O   . VAL A 1 130 ? 10.731  -25.498 -8.716  1.00 29.93  ? 112  VAL A O   1 
ATOM   899  C CB  . VAL A 1 130 ? 12.809  -22.931 -8.017  1.00 30.12  ? 112  VAL A CB  1 
ATOM   900  C CG1 . VAL A 1 130 ? 13.959  -22.157 -8.572  1.00 29.11  ? 112  VAL A CG1 1 
ATOM   901  C CG2 . VAL A 1 130 ? 11.488  -22.223 -8.352  1.00 27.68  ? 112  VAL A CG2 1 
ATOM   902  N N   . ASP A 1 131 ? 11.810  -25.583 -6.727  1.00 32.57  ? 113  ASP A N   1 
ATOM   903  C CA  . ASP A 1 131 ? 10.714  -26.210 -6.028  1.00 34.05  ? 113  ASP A CA  1 
ATOM   904  C C   . ASP A 1 131 ? 9.865   -25.118 -5.357  1.00 34.81  ? 113  ASP A C   1 
ATOM   905  O O   . ASP A 1 131 ? 10.175  -23.915 -5.498  1.00 33.93  ? 113  ASP A O   1 
ATOM   906  C CB  . ASP A 1 131 ? 11.219  -27.317 -5.085  1.00 36.09  ? 113  ASP A CB  1 
ATOM   907  C CG  . ASP A 1 131 ? 11.965  -26.790 -3.841  1.00 40.09  ? 113  ASP A CG  1 
ATOM   908  O OD1 . ASP A 1 131 ? 11.965  -25.560 -3.537  1.00 43.24  ? 113  ASP A OD1 1 
ATOM   909  O OD2 . ASP A 1 131 ? 12.543  -27.644 -3.128  1.00 44.01  ? 113  ASP A OD2 1 
ATOM   910  N N   . ALA A 1 132 ? 8.800   -25.516 -4.657  1.00 35.64  ? 114  ALA A N   1 
ATOM   911  C CA  . ALA A 1 132 ? 7.889   -24.546 -3.993  1.00 36.12  ? 114  ALA A CA  1 
ATOM   912  C C   . ALA A 1 132 ? 8.538   -23.744 -2.890  1.00 37.06  ? 114  ALA A C   1 
ATOM   913  O O   . ALA A 1 132 ? 7.994   -22.736 -2.471  1.00 38.27  ? 114  ALA A O   1 
ATOM   914  C CB  . ALA A 1 132 ? 6.645   -25.254 -3.445  1.00 36.36  ? 114  ALA A CB  1 
ATOM   915  N N   . TYR A 1 133 ? 9.695   -24.184 -2.410  1.00 37.75  ? 115  TYR A N   1 
ATOM   916  C CA  . TYR A 1 133 ? 10.361  -23.540 -1.269  1.00 38.94  ? 115  TYR A CA  1 
ATOM   917  C C   . TYR A 1 133 ? 11.553  -22.676 -1.679  1.00 38.34  ? 115  TYR A C   1 
ATOM   918  O O   . TYR A 1 133 ? 12.259  -22.122 -0.826  1.00 39.49  ? 115  TYR A O   1 
ATOM   919  C CB  . TYR A 1 133 ? 10.722  -24.601 -0.206  1.00 40.76  ? 115  TYR A CB  1 
ATOM   920  C CG  . TYR A 1 133 ? 9.449   -25.149 0.390   1.00 42.40  ? 115  TYR A CG  1 
ATOM   921  C CD1 . TYR A 1 133 ? 8.845   -24.491 1.466   1.00 43.54  ? 115  TYR A CD1 1 
ATOM   922  C CD2 . TYR A 1 133 ? 8.785   -26.258 -0.180  1.00 41.14  ? 115  TYR A CD2 1 
ATOM   923  C CE1 . TYR A 1 133 ? 7.645   -24.926 1.997   1.00 45.55  ? 115  TYR A CE1 1 
ATOM   924  C CE2 . TYR A 1 133 ? 7.567   -26.706 0.340   1.00 41.77  ? 115  TYR A CE2 1 
ATOM   925  C CZ  . TYR A 1 133 ? 7.005   -26.025 1.432   1.00 45.50  ? 115  TYR A CZ  1 
ATOM   926  O OH  . TYR A 1 133 ? 5.804   -26.415 2.011   1.00 47.46  ? 115  TYR A OH  1 
ATOM   927  N N   . GLY A 1 134 ? 11.757  -22.542 -2.987  1.00 36.66  ? 116  GLY A N   1 
ATOM   928  C CA  . GLY A 1 134 ? 12.825  -21.700 -3.529  1.00 35.89  ? 116  GLY A CA  1 
ATOM   929  C C   . GLY A 1 134 ? 14.124  -22.439 -3.839  1.00 36.36  ? 116  GLY A C   1 
ATOM   930  O O   . GLY A 1 134 ? 15.083  -21.817 -4.308  1.00 37.02  ? 116  GLY A O   1 
ATOM   931  N N   . ASN A 1 135 ? 14.164  -23.749 -3.582  1.00 36.43  ? 117  ASN A N   1 
ATOM   932  C CA  . ASN A 1 135 ? 15.373  -24.544 -3.780  1.00 37.19  ? 117  ASN A CA  1 
ATOM   933  C C   . ASN A 1 135 ? 15.614  -24.754 -5.252  1.00 35.76  ? 117  ASN A C   1 
ATOM   934  O O   . ASN A 1 135 ? 14.698  -25.070 -5.989  1.00 35.12  ? 117  ASN A O   1 
ATOM   935  C CB  . ASN A 1 135 ? 15.269  -25.906 -3.066  1.00 38.06  ? 117  ASN A CB  1 
ATOM   936  C CG  . ASN A 1 135 ? 15.057  -25.771 -1.558  1.00 41.17  ? 117  ASN A CG  1 
ATOM   937  O OD1 . ASN A 1 135 ? 15.859  -25.155 -0.849  1.00 43.81  ? 117  ASN A OD1 1 
ATOM   938  N ND2 . ASN A 1 135 ? 13.982  -26.357 -1.067  1.00 41.75  ? 117  ASN A ND2 1 
ATOM   939  N N   . LEU A 1 136 ? 16.853  -24.564 -5.674  1.00 36.28  ? 118  LEU A N   1 
ATOM   940  C CA  . LEU A 1 136 ? 17.237  -24.643 -7.070  1.00 36.24  ? 118  LEU A CA  1 
ATOM   941  C C   . LEU A 1 136 ? 17.354  -26.080 -7.474  1.00 36.48  ? 118  LEU A C   1 
ATOM   942  O O   . LEU A 1 136 ? 18.070  -26.842 -6.833  1.00 37.68  ? 118  LEU A O   1 
ATOM   943  C CB  . LEU A 1 136 ? 18.605  -24.001 -7.274  1.00 36.17  ? 118  LEU A CB  1 
ATOM   944  C CG  . LEU A 1 136 ? 18.816  -22.628 -7.910  1.00 38.76  ? 118  LEU A CG  1 
ATOM   945  C CD1 . LEU A 1 136 ? 17.844  -21.492 -7.447  1.00 38.42  ? 118  LEU A CD1 1 
ATOM   946  C CD2 . LEU A 1 136 ? 20.276  -22.237 -7.616  1.00 38.22  ? 118  LEU A CD2 1 
ATOM   947  N N   . LEU A 1 137 ? 16.682  -26.452 -8.556  1.00 35.54  ? 119  LEU A N   1 
ATOM   948  C CA  . LEU A 1 137 ? 16.748  -27.827 -9.041  1.00 35.20  ? 119  LEU A CA  1 
ATOM   949  C C   . LEU A 1 137 ? 17.666  -27.890 -10.255 1.00 35.12  ? 119  LEU A C   1 
ATOM   950  O O   . LEU A 1 137 ? 18.391  -28.857 -10.405 1.00 35.54  ? 119  LEU A O   1 
ATOM   951  C CB  . LEU A 1 137 ? 15.346  -28.376 -9.377  1.00 33.99  ? 119  LEU A CB  1 
ATOM   952  C CG  . LEU A 1 137 ? 14.280  -28.365 -8.269  1.00 32.95  ? 119  LEU A CG  1 
ATOM   953  C CD1 . LEU A 1 137 ? 12.921  -28.835 -8.779  1.00 30.22  ? 119  LEU A CD1 1 
ATOM   954  C CD2 . LEU A 1 137 ? 14.741  -29.197 -7.083  1.00 32.62  ? 119  LEU A CD2 1 
ATOM   955  N N   . VAL A 1 138 ? 17.624  -26.849 -11.097 1.00 34.00  ? 120  VAL A N   1 
ATOM   956  C CA  . VAL A 1 138 ? 18.374  -26.759 -12.346 1.00 33.61  ? 120  VAL A CA  1 
ATOM   957  C C   . VAL A 1 138 ? 18.740  -25.281 -12.568 1.00 34.09  ? 120  VAL A C   1 
ATOM   958  O O   . VAL A 1 138 ? 17.931  -24.383 -12.378 1.00 32.79  ? 120  VAL A O   1 
ATOM   959  C CB  . VAL A 1 138 ? 17.537  -27.286 -13.573 1.00 33.32  ? 120  VAL A CB  1 
ATOM   960  C CG1 . VAL A 1 138 ? 18.345  -27.258 -14.849 1.00 34.29  ? 120  VAL A CG1 1 
ATOM   961  C CG2 . VAL A 1 138 ? 17.028  -28.682 -13.348 1.00 30.84  ? 120  VAL A CG2 1 
ATOM   962  N N   . CYS A 1 139 ? 19.983  -25.030 -12.948 1.00 35.74  ? 121  CYS A N   1 
ATOM   963  C CA  . CYS A 1 139 ? 20.432  -23.688 -13.290 1.00 34.43  ? 121  CYS A CA  1 
ATOM   964  C C   . CYS A 1 139 ? 21.166  -23.745 -14.635 1.00 33.40  ? 121  CYS A C   1 
ATOM   965  O O   . CYS A 1 139 ? 22.099  -24.522 -14.804 1.00 32.93  ? 121  CYS A O   1 
ATOM   966  C CB  . CYS A 1 139 ? 21.335  -23.109 -12.181 1.00 35.50  ? 121  CYS A CB  1 
ATOM   967  S SG  . CYS A 1 139 ? 21.957  -21.440 -12.580 1.00 39.31  ? 121  CYS A SG  1 
ATOM   968  N N   . ALA A 1 140 ? 20.720  -22.933 -15.597 1.00 32.33  ? 122  ALA A N   1 
ATOM   969  C CA  . ALA A 1 140 ? 21.384  -22.830 -16.898 1.00 31.45  ? 122  ALA A CA  1 
ATOM   970  C C   . ALA A 1 140 ? 21.602  -21.381 -17.265 1.00 31.07  ? 122  ALA A C   1 
ATOM   971  O O   . ALA A 1 140 ? 20.680  -20.587 -17.197 1.00 30.91  ? 122  ALA A O   1 
ATOM   972  C CB  . ALA A 1 140 ? 20.577  -23.519 -17.985 1.00 29.99  ? 122  ALA A CB  1 
ATOM   973  N N   . HIS A 1 141 ? 22.827  -21.055 -17.645 1.00 31.46  ? 123  HIS A N   1 
ATOM   974  C CA  . HIS A 1 141 ? 23.185  -19.768 -18.219 1.00 31.66  ? 123  HIS A CA  1 
ATOM   975  C C   . HIS A 1 141 ? 23.376  -19.974 -19.730 1.00 31.58  ? 123  HIS A C   1 
ATOM   976  O O   . HIS A 1 141 ? 24.281  -20.685 -20.105 1.00 32.99  ? 123  HIS A O   1 
ATOM   977  C CB  . HIS A 1 141 ? 24.498  -19.325 -17.580 1.00 32.26  ? 123  HIS A CB  1 
ATOM   978  C CG  . HIS A 1 141 ? 24.934  -17.966 -17.996 1.00 34.85  ? 123  HIS A CG  1 
ATOM   979  N ND1 . HIS A 1 141 ? 24.354  -16.815 -17.501 1.00 34.63  ? 123  HIS A ND1 1 
ATOM   980  C CD2 . HIS A 1 141 ? 25.876  -17.566 -18.886 1.00 37.01  ? 123  HIS A CD2 1 
ATOM   981  C CE1 . HIS A 1 141 ? 24.934  -15.766 -18.058 1.00 35.39  ? 123  HIS A CE1 1 
ATOM   982  N NE2 . HIS A 1 141 ? 25.851  -16.194 -18.910 1.00 35.06  ? 123  HIS A NE2 1 
ATOM   983  N N   . GLY A 1 142 ? 22.543  -19.379 -20.592 1.00 31.04  ? 124  GLY A N   1 
ATOM   984  C CA  . GLY A 1 142 ? 22.512  -19.748 -22.011 1.00 29.69  ? 124  GLY A CA  1 
ATOM   985  C C   . GLY A 1 142 ? 22.227  -21.246 -22.105 1.00 31.01  ? 124  GLY A C   1 
ATOM   986  O O   . GLY A 1 142 ? 21.247  -21.759 -21.521 1.00 30.02  ? 124  GLY A O   1 
ATOM   987  N N   . PHE A 1 143 ? 23.089  -21.967 -22.809 1.00 30.70  ? 125  PHE A N   1 
ATOM   988  C CA  . PHE A 1 143 ? 22.944  -23.402 -22.864 1.00 31.71  ? 125  PHE A CA  1 
ATOM   989  C C   . PHE A 1 143 ? 23.917  -24.195 -21.990 1.00 32.85  ? 125  PHE A C   1 
ATOM   990  O O   . PHE A 1 143 ? 24.056  -25.407 -22.176 1.00 34.21  ? 125  PHE A O   1 
ATOM   991  C CB  . PHE A 1 143 ? 22.967  -23.873 -24.319 1.00 31.33  ? 125  PHE A CB  1 
ATOM   992  C CG  . PHE A 1 143 ? 21.930  -23.185 -25.187 1.00 30.56  ? 125  PHE A CG  1 
ATOM   993  C CD1 . PHE A 1 143 ? 20.586  -23.191 -24.837 1.00 29.18  ? 125  PHE A CD1 1 
ATOM   994  C CD2 . PHE A 1 143 ? 22.295  -22.525 -26.345 1.00 30.53  ? 125  PHE A CD2 1 
ATOM   995  C CE1 . PHE A 1 143 ? 19.626  -22.581 -25.649 1.00 27.12  ? 125  PHE A CE1 1 
ATOM   996  C CE2 . PHE A 1 143 ? 21.317  -21.881 -27.147 1.00 30.43  ? 125  PHE A CE2 1 
ATOM   997  C CZ  . PHE A 1 143 ? 19.993  -21.935 -26.788 1.00 27.46  ? 125  PHE A CZ  1 
ATOM   998  N N   A ASN A 1 144 ? 24.593  -23.511 -21.063 0.50 33.11  ? 126  ASN A N   1 
ATOM   999  N N   B ASN A 1 144 ? 24.570  -23.524 -21.046 0.50 32.99  ? 126  ASN A N   1 
ATOM   1000 C CA  A ASN A 1 144 ? 25.521  -24.148 -20.119 0.50 34.23  ? 126  ASN A CA  1 
ATOM   1001 C CA  B ASN A 1 144 ? 25.502  -24.195 -20.146 0.50 34.01  ? 126  ASN A CA  1 
ATOM   1002 C C   A ASN A 1 144 ? 24.810  -24.398 -18.796 0.50 34.19  ? 126  ASN A C   1 
ATOM   1003 C C   B ASN A 1 144 ? 24.867  -24.395 -18.779 0.50 34.11  ? 126  ASN A C   1 
ATOM   1004 O O   A ASN A 1 144 ? 24.252  -23.455 -18.189 0.50 33.10  ? 126  ASN A O   1 
ATOM   1005 O O   B ASN A 1 144 ? 24.408  -23.424 -18.136 0.50 33.10  ? 126  ASN A O   1 
ATOM   1006 C CB  A ASN A 1 144 ? 26.760  -23.267 -19.875 0.50 35.17  ? 126  ASN A CB  1 
ATOM   1007 C CB  B ASN A 1 144 ? 26.807  -23.407 -20.031 0.50 34.91  ? 126  ASN A CB  1 
ATOM   1008 C CG  A ASN A 1 144 ? 27.770  -23.904 -18.903 0.50 37.16  ? 126  ASN A CG  1 
ATOM   1009 C CG  B ASN A 1 144 ? 27.528  -23.289 -21.361 0.50 35.85  ? 126  ASN A CG  1 
ATOM   1010 O OD1 A ASN A 1 144 ? 27.971  -25.119 -18.900 0.50 40.57  ? 126  ASN A OD1 1 
ATOM   1011 O OD1 B ASN A 1 144 ? 27.924  -24.287 -21.956 0.50 35.90  ? 126  ASN A OD1 1 
ATOM   1012 N ND2 A ASN A 1 144 ? 28.405  -23.075 -18.075 0.50 37.77  ? 126  ASN A ND2 1 
ATOM   1013 N ND2 B ASN A 1 144 ? 27.666  -22.067 -21.849 0.50 35.89  ? 126  ASN A ND2 1 
ATOM   1014 N N   . PHE A 1 145 ? 24.832  -25.651 -18.353 1.00 66.01  ? 127  PHE A N   1 
ATOM   1015 C CA  . PHE A 1 145 ? 24.187  -26.023 -17.130 1.00 66.49  ? 127  PHE A CA  1 
ATOM   1016 C C   . PHE A 1 145 ? 25.191  -25.959 -15.993 1.00 68.69  ? 127  PHE A C   1 
ATOM   1017 O O   . PHE A 1 145 ? 26.128  -26.732 -15.927 1.00 75.18  ? 127  PHE A O   1 
ATOM   1018 C CB  . PHE A 1 145 ? 23.456  -27.366 -17.287 1.00 73.01  ? 127  PHE A CB  1 
ATOM   1019 C CG  . PHE A 1 145 ? 22.245  -27.274 -18.190 1.00 72.73  ? 127  PHE A CG  1 
ATOM   1020 C CD1 . PHE A 1 145 ? 22.393  -27.038 -19.577 1.00 72.62  ? 127  PHE A CD1 1 
ATOM   1021 C CD2 . PHE A 1 145 ? 20.966  -27.369 -17.667 1.00 74.50  ? 127  PHE A CD2 1 
ATOM   1022 C CE1 . PHE A 1 145 ? 21.287  -26.927 -20.437 1.00 73.18  ? 127  PHE A CE1 1 
ATOM   1023 C CE2 . PHE A 1 145 ? 19.854  -27.249 -18.506 1.00 78.22  ? 127  PHE A CE2 1 
ATOM   1024 C CZ  . PHE A 1 145 ? 20.021  -27.032 -19.905 1.00 77.99  ? 127  PHE A CZ  1 
ATOM   1025 N N   . ILE A 1 146 ? 24.995  -24.953 -15.145 1.00 65.24  ? 128  ILE A N   1 
ATOM   1026 C CA  . ILE A 1 146 ? 25.751  -24.723 -13.920 1.00 68.25  ? 128  ILE A CA  1 
ATOM   1027 C C   . ILE A 1 146 ? 25.397  -25.812 -12.901 1.00 74.65  ? 128  ILE A C   1 
ATOM   1028 O O   . ILE A 1 146 ? 24.222  -26.168 -12.749 1.00 74.85  ? 128  ILE A O   1 
ATOM   1029 C CB  . ILE A 1 146 ? 25.382  -23.328 -13.317 1.00 62.66  ? 128  ILE A CB  1 
ATOM   1030 C CG1 . ILE A 1 146 ? 25.275  -22.244 -14.414 1.00 58.01  ? 128  ILE A CG1 1 
ATOM   1031 C CG2 . ILE A 1 146 ? 26.344  -22.924 -12.207 1.00 66.31  ? 128  ILE A CG2 1 
ATOM   1032 C CD1 . ILE A 1 146 ? 26.501  -22.093 -15.323 1.00 60.66  ? 128  ILE A CD1 1 
ATOM   1033 N N   . ARG A 1 147 ? 26.398  -26.344 -12.202 1.00 82.59  ? 129  ARG A N   1 
ATOM   1034 C CA  . ARG A 1 147 ? 26.116  -27.288 -11.113 1.00 90.53  ? 129  ARG A CA  1 
ATOM   1035 C C   . ARG A 1 147 ? 26.951  -27.077 -9.851  1.00 96.02  ? 129  ARG A C   1 
ATOM   1036 O O   . ARG A 1 147 ? 27.926  -26.325 -9.865  1.00 96.24  ? 129  ARG A O   1 
ATOM   1037 C CB  . ARG A 1 147 ? 26.190  -28.745 -11.596 1.00 99.10  ? 129  ARG A CB  1 
ATOM   1038 C CG  . ARG A 1 147 ? 27.529  -29.206 -12.147 1.00 106.58 ? 129  ARG A CG  1 
ATOM   1039 C CD  . ARG A 1 147 ? 27.378  -30.592 -12.782 1.00 115.48 ? 129  ARG A CD  1 
ATOM   1040 N NE  . ARG A 1 147 ? 27.009  -30.518 -14.201 1.00 112.50 ? 129  ARG A NE  1 
ATOM   1041 C CZ  . ARG A 1 147 ? 25.775  -30.345 -14.683 1.00 106.55 ? 129  ARG A CZ  1 
ATOM   1042 N NH1 . ARG A 1 147 ? 24.721  -30.218 -13.878 1.00 104.06 ? 129  ARG A NH1 1 
ATOM   1043 N NH2 . ARG A 1 147 ? 25.597  -30.292 -15.997 1.00 104.41 ? 129  ARG A NH2 1 
ATOM   1044 N N   . GLY A 1 148 ? 26.529  -27.727 -8.764  1.00 102.63 ? 130  GLY A N   1 
ATOM   1045 C CA  . GLY A 1 148 ? 27.269  -27.769 -7.502  1.00 111.07 ? 130  GLY A CA  1 
ATOM   1046 C C   . GLY A 1 148 ? 27.933  -26.475 -7.060  1.00 108.04 ? 130  GLY A C   1 
ATOM   1047 O O   . GLY A 1 148 ? 27.254  -25.452 -6.913  1.00 99.70  ? 130  GLY A O   1 
ATOM   1048 N N   . PRO A 1 149 ? 29.268  -26.519 -6.841  1.00 117.20 ? 131  PRO A N   1 
ATOM   1049 C CA  . PRO A 1 149 ? 30.077  -25.401 -6.326  1.00 119.31 ? 131  PRO A CA  1 
ATOM   1050 C C   . PRO A 1 149 ? 29.878  -24.053 -7.041  1.00 108.53 ? 131  PRO A C   1 
ATOM   1051 O O   . PRO A 1 149 ? 29.807  -23.018 -6.374  1.00 107.41 ? 131  PRO A O   1 
ATOM   1052 C CB  . PRO A 1 149 ? 31.519  -25.901 -6.498  1.00 132.93 ? 131  PRO A CB  1 
ATOM   1053 C CG  . PRO A 1 149 ? 31.403  -27.375 -6.415  1.00 140.55 ? 131  PRO A CG  1 
ATOM   1054 C CD  . PRO A 1 149 ? 30.096  -27.721 -7.071  1.00 129.21 ? 131  PRO A CD  1 
ATOM   1055 N N   . GLU A 1 150 ? 29.786  -24.060 -8.367  1.00 102.38 ? 132  GLU A N   1 
ATOM   1056 C CA  . GLU A 1 150 ? 29.684  -22.808 -9.131  1.00 94.69  ? 132  GLU A CA  1 
ATOM   1057 C C   . GLU A 1 150 ? 28.299  -22.129 -9.068  1.00 83.07  ? 132  GLU A C   1 
ATOM   1058 O O   . GLU A 1 150 ? 28.193  -20.907 -9.251  1.00 79.10  ? 132  GLU A O   1 
ATOM   1059 C CB  . GLU A 1 150 ? 30.152  -23.004 -10.579 1.00 95.12  ? 132  GLU A CB  1 
ATOM   1060 C CG  . GLU A 1 150 ? 30.124  -24.451 -11.066 1.00 99.59  ? 132  GLU A CG  1 
ATOM   1061 C CD  . GLU A 1 150 ? 29.856  -24.563 -12.561 1.00 96.33  ? 132  GLU A CD  1 
ATOM   1062 O OE1 . GLU A 1 150 ? 28.799  -25.117 -12.941 1.00 91.13  ? 132  GLU A OE1 1 
ATOM   1063 O OE2 . GLU A 1 150 ? 30.701  -24.093 -13.357 1.00 100.42 ? 132  GLU A OE2 1 
ATOM   1064 N N   . THR A 1 151 ? 27.255  -22.920 -8.805  1.00 79.85  ? 133  THR A N   1 
ATOM   1065 C CA  . THR A 1 151 ? 25.905  -22.401 -8.542  1.00 72.86  ? 133  THR A CA  1 
ATOM   1066 C C   . THR A 1 151 ? 25.876  -21.592 -7.233  1.00 74.71  ? 133  THR A C   1 
ATOM   1067 O O   . THR A 1 151 ? 25.301  -20.502 -7.178  1.00 70.42  ? 133  THR A O   1 
ATOM   1068 C CB  . THR A 1 151 ? 24.856  -23.542 -8.459  1.00 74.47  ? 133  THR A CB  1 
ATOM   1069 O OG1 . THR A 1 151 ? 24.658  -24.123 -9.748  1.00 72.54  ? 133  THR A OG1 1 
ATOM   1070 C CG2 . THR A 1 151 ? 23.531  -23.027 -7.970  1.00 72.16  ? 133  THR A CG2 1 
ATOM   1071 N N   . ARG A 1 152 ? 26.515  -22.135 -6.196  1.00 82.39  ? 134  ARG A N   1 
ATOM   1072 C CA  . ARG A 1 152 ? 26.560  -21.534 -4.855  1.00 86.30  ? 134  ARG A CA  1 
ATOM   1073 C C   . ARG A 1 152 ? 27.292  -20.182 -4.803  1.00 86.26  ? 134  ARG A C   1 
ATOM   1074 O O   . ARG A 1 152 ? 27.146  -19.431 -3.835  1.00 89.18  ? 134  ARG A O   1 
ATOM   1075 C CB  . ARG A 1 152 ? 27.179  -22.512 -3.849  1.00 97.44  ? 134  ARG A CB  1 
ATOM   1076 C CG  . ARG A 1 152 ? 26.405  -23.808 -3.649  1.00 100.57 ? 134  ARG A CG  1 
ATOM   1077 C CD  . ARG A 1 152 ? 27.273  -24.830 -2.932  1.00 113.43 ? 134  ARG A CD  1 
ATOM   1078 N NE  . ARG A 1 152 ? 26.631  -26.138 -2.785  1.00 119.46 ? 134  ARG A NE  1 
ATOM   1079 C CZ  . ARG A 1 152 ? 25.880  -26.504 -1.745  1.00 126.82 ? 134  ARG A CZ  1 
ATOM   1080 N NH1 . ARG A 1 152 ? 25.648  -25.658 -0.745  1.00 127.70 ? 134  ARG A NH1 1 
ATOM   1081 N NH2 . ARG A 1 152 ? 25.354  -27.723 -1.702  1.00 134.23 ? 134  ARG A NH2 1 
ATOM   1082 N N   . GLU A 1 153 ? 28.076  -19.880 -5.836  1.00 84.70  ? 135  GLU A N   1 
ATOM   1083 C CA  . GLU A 1 153 ? 28.698  -18.560 -5.979  1.00 86.33  ? 135  GLU A CA  1 
ATOM   1084 C C   . GLU A 1 153 ? 27.657  -17.444 -6.175  1.00 78.48  ? 135  GLU A C   1 
ATOM   1085 O O   . GLU A 1 153 ? 27.827  -16.350 -5.630  1.00 82.40  ? 135  GLU A O   1 
ATOM   1086 C CB  . GLU A 1 153 ? 29.737  -18.552 -7.114  1.00 89.68  ? 135  GLU A CB  1 
ATOM   1087 C CG  . GLU A 1 153 ? 30.682  -17.334 -7.085  1.00 98.87  ? 135  GLU A CG  1 
ATOM   1088 C CD  . GLU A 1 153 ? 32.115  -17.659 -7.507  1.00 112.04 ? 135  GLU A CD  1 
ATOM   1089 O OE1 . GLU A 1 153 ? 32.307  -18.339 -8.541  1.00 111.24 ? 135  GLU A OE1 1 
ATOM   1090 O OE2 . GLU A 1 153 ? 33.057  -17.221 -6.807  1.00 125.25 ? 135  GLU A OE2 1 
ATOM   1091 N N   . GLN A 1 154 ? 26.589  -17.732 -6.936  1.00 69.21  ? 136  GLN A N   1 
ATOM   1092 C CA  . GLN A 1 154 ? 25.507  -16.773 -7.205  1.00 63.23  ? 136  GLN A CA  1 
ATOM   1093 C C   . GLN A 1 154 ? 24.243  -17.025 -6.380  1.00 63.57  ? 136  GLN A C   1 
ATOM   1094 O O   . GLN A 1 154 ? 23.446  -16.107 -6.160  1.00 63.09  ? 136  GLN A O   1 
ATOM   1095 C CB  . GLN A 1 154 ? 25.136  -16.771 -8.688  1.00 57.08  ? 136  GLN A CB  1 
ATOM   1096 C CG  . GLN A 1 154 ? 26.207  -16.196 -9.639  1.00 58.31  ? 136  GLN A CG  1 
ATOM   1097 C CD  . GLN A 1 154 ? 25.848  -16.416 -11.105 1.00 52.59  ? 136  GLN A CD  1 
ATOM   1098 O OE1 . GLN A 1 154 ? 24.963  -17.197 -11.411 1.00 46.22  ? 136  GLN A OE1 1 
ATOM   1099 N NE2 . GLN A 1 154 ? 26.524  -15.725 -12.004 1.00 51.61  ? 136  GLN A NE2 1 
ATOM   1100 N N   . TYR A 1 155 ? 24.054  -18.272 -5.942  1.00 46.22  ? 137  TYR A N   1 
ATOM   1101 C CA  . TYR A 1 155 ? 22.884  -18.661 -5.134  1.00 47.13  ? 137  TYR A CA  1 
ATOM   1102 C C   . TYR A 1 155 ? 23.366  -19.325 -3.857  1.00 50.83  ? 137  TYR A C   1 
ATOM   1103 O O   . TYR A 1 155 ? 23.439  -20.569 -3.786  1.00 51.55  ? 137  TYR A O   1 
ATOM   1104 C CB  . TYR A 1 155 ? 21.938  -19.571 -5.928  1.00 44.16  ? 137  TYR A CB  1 
ATOM   1105 C CG  . TYR A 1 155 ? 21.564  -18.961 -7.257  1.00 40.47  ? 137  TYR A CG  1 
ATOM   1106 C CD1 . TYR A 1 155 ? 20.602  -17.939 -7.333  1.00 35.30  ? 137  TYR A CD1 1 
ATOM   1107 C CD2 . TYR A 1 155 ? 22.197  -19.376 -8.432  1.00 37.43  ? 137  TYR A CD2 1 
ATOM   1108 C CE1 . TYR A 1 155 ? 20.259  -17.366 -8.543  1.00 35.99  ? 137  TYR A CE1 1 
ATOM   1109 C CE2 . TYR A 1 155 ? 21.865  -18.801 -9.659  1.00 36.63  ? 137  TYR A CE2 1 
ATOM   1110 C CZ  . TYR A 1 155 ? 20.893  -17.795 -9.708  1.00 36.40  ? 137  TYR A CZ  1 
ATOM   1111 O OH  . TYR A 1 155 ? 20.569  -17.228 -10.918 1.00 34.88  ? 137  TYR A OH  1 
ATOM   1112 N N   . PRO A 1 156 ? 23.708  -18.490 -2.846  1.00 53.80  ? 138  PRO A N   1 
ATOM   1113 C CA  . PRO A 1 156 ? 24.459  -18.937 -1.666  1.00 57.21  ? 138  PRO A CA  1 
ATOM   1114 C C   . PRO A 1 156 ? 23.928  -20.221 -1.016  1.00 58.82  ? 138  PRO A C   1 
ATOM   1115 O O   . PRO A 1 156 ? 24.725  -21.134 -0.742  1.00 61.53  ? 138  PRO A O   1 
ATOM   1116 C CB  . PRO A 1 156 ? 24.383  -17.725 -0.715  1.00 58.54  ? 138  PRO A CB  1 
ATOM   1117 C CG  . PRO A 1 156 ? 24.274  -16.576 -1.619  1.00 56.56  ? 138  PRO A CG  1 
ATOM   1118 C CD  . PRO A 1 156 ? 23.403  -17.043 -2.765  1.00 53.39  ? 138  PRO A CD  1 
ATOM   1119 N N   . ASN A 1 157 ? 22.626  -20.326 -0.767  1.00 57.85  ? 139  ASN A N   1 
ATOM   1120 C CA  . ASN A 1 157 ? 22.142  -21.550 -0.129  1.00 58.81  ? 139  ASN A CA  1 
ATOM   1121 C C   . ASN A 1 157 ? 21.458  -22.494 -1.135  1.00 56.11  ? 139  ASN A C   1 
ATOM   1122 O O   . ASN A 1 157 ? 20.691  -23.373 -0.736  1.00 56.48  ? 139  ASN A O   1 
ATOM   1123 C CB  . ASN A 1 157 ? 21.217  -21.221 1.058   1.00 60.59  ? 139  ASN A CB  1 
ATOM   1124 C CG  . ASN A 1 157 ? 21.983  -20.796 2.334   1.00 65.66  ? 139  ASN A CG  1 
ATOM   1125 O OD1 . ASN A 1 157 ? 22.538  -19.692 2.406   1.00 67.13  ? 139  ASN A OD1 1 
ATOM   1126 N ND2 . ASN A 1 157 ? 21.975  -21.662 3.354   1.00 66.75  ? 139  ASN A ND2 1 
ATOM   1127 N N   . LYS A 1 158 ? 21.799  -22.325 -2.415  1.00 53.46  ? 140  LYS A N   1 
ATOM   1128 C CA  . LYS A 1 158 ? 21.031  -22.824 -3.581  1.00 51.14  ? 140  LYS A CA  1 
ATOM   1129 C C   . LYS A 1 158 ? 19.550  -22.433 -3.497  1.00 48.84  ? 140  LYS A C   1 
ATOM   1130 O O   . LYS A 1 158 ? 18.658  -23.267 -3.650  1.00 47.41  ? 140  LYS A O   1 
ATOM   1131 C CB  . LYS A 1 158 ? 21.203  -24.337 -3.800  1.00 51.74  ? 140  LYS A CB  1 
ATOM   1132 C CG  . LYS A 1 158 ? 22.585  -24.773 -4.280  1.00 54.31  ? 140  LYS A CG  1 
ATOM   1133 C CD  . LYS A 1 158 ? 22.593  -26.259 -4.620  1.00 54.62  ? 140  LYS A CD  1 
ATOM   1134 C CE  . LYS A 1 158 ? 24.021  -26.778 -4.859  1.00 60.74  ? 140  LYS A CE  1 
ATOM   1135 N NZ  . LYS A 1 158 ? 24.218  -28.223 -4.441  1.00 62.31  ? 140  LYS A NZ  1 
ATOM   1136 N N   . PHE A 1 159 ? 19.296  -21.151 -3.275  1.00 47.85  ? 141  PHE A N   1 
ATOM   1137 C CA  . PHE A 1 159 ? 17.955  -20.691 -2.937  1.00 46.97  ? 141  PHE A CA  1 
ATOM   1138 C C   . PHE A 1 159 ? 17.635  -19.368 -3.627  1.00 45.56  ? 141  PHE A C   1 
ATOM   1139 O O   . PHE A 1 159 ? 18.483  -18.479 -3.694  1.00 45.18  ? 141  PHE A O   1 
ATOM   1140 C CB  . PHE A 1 159 ? 17.785  -20.583 -1.404  1.00 49.19  ? 141  PHE A CB  1 
ATOM   1141 C CG  . PHE A 1 159 ? 16.611  -19.729 -0.975  1.00 48.28  ? 141  PHE A CG  1 
ATOM   1142 C CD1 . PHE A 1 159 ? 15.366  -20.305 -0.736  1.00 46.84  ? 141  PHE A CD1 1 
ATOM   1143 C CD2 . PHE A 1 159 ? 16.750  -18.341 -0.843  1.00 46.90  ? 141  PHE A CD2 1 
ATOM   1144 C CE1 . PHE A 1 159 ? 14.279  -19.519 -0.361  1.00 47.13  ? 141  PHE A CE1 1 
ATOM   1145 C CE2 . PHE A 1 159 ? 15.664  -17.539 -0.483  1.00 46.46  ? 141  PHE A CE2 1 
ATOM   1146 C CZ  . PHE A 1 159 ? 14.427  -18.133 -0.233  1.00 48.54  ? 141  PHE A CZ  1 
ATOM   1147 N N   . ILE A 1 160 ? 16.415  -19.252 -4.153  1.00 44.74  ? 142  ILE A N   1 
ATOM   1148 C CA  . ILE A 1 160 ? 15.920  -17.957 -4.640  1.00 44.68  ? 142  ILE A CA  1 
ATOM   1149 C C   . ILE A 1 160 ? 14.594  -17.607 -4.001  1.00 45.93  ? 142  ILE A C   1 
ATOM   1150 O O   . ILE A 1 160 ? 13.778  -18.494 -3.727  1.00 46.37  ? 142  ILE A O   1 
ATOM   1151 C CB  . ILE A 1 160 ? 15.758  -17.887 -6.186  1.00 42.34  ? 142  ILE A CB  1 
ATOM   1152 C CG1 . ILE A 1 160 ? 14.670  -18.848 -6.686  1.00 40.50  ? 142  ILE A CG1 1 
ATOM   1153 C CG2 . ILE A 1 160 ? 17.101  -18.096 -6.879  1.00 42.50  ? 142  ILE A CG2 1 
ATOM   1154 C CD1 . ILE A 1 160 ? 14.069  -18.461 -7.977  1.00 36.59  ? 142  ILE A CD1 1 
ATOM   1155 N N   . GLN A 1 161 ? 14.381  -16.315 -3.762  1.00 47.16  ? 143  GLN A N   1 
ATOM   1156 C CA  . GLN A 1 161 ? 13.108  -15.836 -3.254  1.00 48.73  ? 143  GLN A CA  1 
ATOM   1157 C C   . GLN A 1 161 ? 12.233  -15.436 -4.427  1.00 47.69  ? 143  GLN A C   1 
ATOM   1158 O O   . GLN A 1 161 ? 12.437  -14.373 -5.010  1.00 47.80  ? 143  GLN A O   1 
ATOM   1159 C CB  . GLN A 1 161 ? 13.323  -14.678 -2.251  1.00 51.23  ? 143  GLN A CB  1 
ATOM   1160 C CG  . GLN A 1 161 ? 12.034  -14.028 -1.694  1.00 51.56  ? 143  GLN A CG  1 
ATOM   1161 C CD  . GLN A 1 161 ? 10.948  -15.043 -1.351  1.00 51.54  ? 143  GLN A CD  1 
ATOM   1162 O OE1 . GLN A 1 161 ? 10.034  -15.321 -2.165  1.00 48.88  ? 143  GLN A OE1 1 
ATOM   1163 N NE2 . GLN A 1 161 ? 11.058  -15.626 -0.163  1.00 49.49  ? 143  GLN A NE2 1 
ATOM   1164 N N   . ARG A 1 162 ? 11.262  -16.287 -4.776  1.00 48.11  ? 144  ARG A N   1 
ATOM   1165 C CA  . ARG A 1 162 ? 10.438  -16.087 -5.978  1.00 47.96  ? 144  ARG A CA  1 
ATOM   1166 C C   . ARG A 1 162 ? 9.605   -14.774 -5.962  1.00 49.83  ? 144  ARG A C   1 
ATOM   1167 O O   . ARG A 1 162 ? 9.278   -14.229 -7.019  1.00 49.60  ? 144  ARG A O   1 
ATOM   1168 C CB  . ARG A 1 162 ? 9.538   -17.313 -6.264  1.00 47.15  ? 144  ARG A CB  1 
ATOM   1169 C CG  . ARG A 1 162 ? 8.166   -17.263 -5.579  1.00 48.76  ? 144  ARG A CG  1 
ATOM   1170 C CD  . ARG A 1 162 ? 7.207   -18.310 -6.105  1.00 46.94  ? 144  ARG A CD  1 
ATOM   1171 N NE  . ARG A 1 162 ? 7.296   -19.443 -5.214  1.00 51.77  ? 144  ARG A NE  1 
ATOM   1172 C CZ  . ARG A 1 162 ? 6.356   -19.805 -4.355  1.00 52.91  ? 144  ARG A CZ  1 
ATOM   1173 N NH1 . ARG A 1 162 ? 5.192   -19.172 -4.324  1.00 53.95  ? 144  ARG A NH1 1 
ATOM   1174 N NH2 . ARG A 1 162 ? 6.575   -20.830 -3.553  1.00 52.28  ? 144  ARG A NH2 1 
ATOM   1175 N N   . ASP A 1 163 ? 9.274   -14.289 -4.765  1.00 52.76  ? 145  ASP A N   1 
ATOM   1176 C CA  . ASP A 1 163 ? 8.450   -13.092 -4.591  1.00 54.43  ? 145  ASP A CA  1 
ATOM   1177 C C   . ASP A 1 163 ? 9.246   -11.784 -4.653  1.00 54.14  ? 145  ASP A C   1 
ATOM   1178 O O   . ASP A 1 163 ? 8.683   -10.708 -4.421  1.00 55.11  ? 145  ASP A O   1 
ATOM   1179 C CB  . ASP A 1 163 ? 7.643   -13.172 -3.278  1.00 57.42  ? 145  ASP A CB  1 
ATOM   1180 C CG  . ASP A 1 163 ? 6.519   -14.218 -3.342  1.00 60.13  ? 145  ASP A CG  1 
ATOM   1181 O OD1 . ASP A 1 163 ? 6.049   -14.573 -4.472  1.00 62.64  ? 145  ASP A OD1 1 
ATOM   1182 O OD2 . ASP A 1 163 ? 6.113   -14.693 -2.256  1.00 64.16  ? 145  ASP A OD2 1 
ATOM   1183 N N   . ASP A 1 164 ? 10.549  -11.900 -4.939  1.00 52.27  ? 146  ASP A N   1 
ATOM   1184 C CA  . ASP A 1 164 ? 11.360  -10.786 -5.403  1.00 50.27  ? 146  ASP A CA  1 
ATOM   1185 C C   . ASP A 1 164 ? 11.053  -10.678 -6.883  1.00 47.55  ? 146  ASP A C   1 
ATOM   1186 O O   . ASP A 1 164 ? 11.828  -11.109 -7.749  1.00 45.75  ? 146  ASP A O   1 
ATOM   1187 C CB  . ASP A 1 164 ? 12.842  -11.046 -5.124  1.00 50.64  ? 146  ASP A CB  1 
ATOM   1188 C CG  . ASP A 1 164 ? 13.736  -9.856  -5.456  1.00 50.31  ? 146  ASP A CG  1 
ATOM   1189 O OD1 . ASP A 1 164 ? 13.258  -8.797  -5.922  1.00 48.46  ? 146  ASP A OD1 1 
ATOM   1190 O OD2 . ASP A 1 164 ? 14.952  -9.984  -5.243  1.00 52.30  ? 146  ASP A OD2 1 
ATOM   1191 N N   . THR A 1 165 ? 9.875   -10.123 -7.158  1.00 47.31  ? 147  THR A N   1 
ATOM   1192 C CA  . THR A 1 165 ? 9.321   -10.062 -8.509  1.00 45.72  ? 147  THR A CA  1 
ATOM   1193 C C   . THR A 1 165 ? 10.036  -9.072  -9.412  1.00 45.02  ? 147  THR A C   1 
ATOM   1194 O O   . THR A 1 165 ? 9.866   -9.133  -10.635 1.00 44.67  ? 147  THR A O   1 
ATOM   1195 C CB  . THR A 1 165 ? 7.807   -9.757  -8.514  1.00 45.73  ? 147  THR A CB  1 
ATOM   1196 O OG1 . THR A 1 165 ? 7.553   -8.604  -7.708  1.00 49.97  ? 147  THR A OG1 1 
ATOM   1197 C CG2 . THR A 1 165 ? 7.017   -10.949 -7.965  1.00 46.25  ? 147  THR A CG2 1 
ATOM   1198 N N   . GLU A 1 166 ? 10.842  -8.193  -8.828  1.00 45.73  ? 148  GLU A N   1 
ATOM   1199 C CA  . GLU A 1 166 ? 11.661  -7.264  -9.585  1.00 46.59  ? 148  GLU A CA  1 
ATOM   1200 C C   . GLU A 1 166 ? 12.884  -7.956  -10.200 1.00 43.89  ? 148  GLU A C   1 
ATOM   1201 O O   . GLU A 1 166 ? 13.435  -7.506  -11.229 1.00 44.32  ? 148  GLU A O   1 
ATOM   1202 C CB  . GLU A 1 166 ? 12.072  -6.059  -8.712  1.00 48.41  ? 148  GLU A CB  1 
ATOM   1203 C CG  . GLU A 1 166 ? 10.974  -4.973  -8.659  1.00 52.32  ? 148  GLU A CG  1 
ATOM   1204 C CD  . GLU A 1 166 ? 11.264  -3.855  -7.673  1.00 56.81  ? 148  GLU A CD  1 
ATOM   1205 O OE1 . GLU A 1 166 ? 11.901  -4.115  -6.611  1.00 64.95  ? 148  GLU A OE1 1 
ATOM   1206 O OE2 . GLU A 1 166 ? 10.843  -2.693  -7.939  1.00 64.80  ? 148  GLU A OE2 1 
ATOM   1207 N N   . ARG A 1 167 ? 13.309  -9.056  -9.594  1.00 41.54  ? 149  ARG A N   1 
ATOM   1208 C CA  . ARG A 1 167 ? 14.465  -9.777  -10.098 1.00 38.26  ? 149  ARG A CA  1 
ATOM   1209 C C   . ARG A 1 167 ? 14.076  -11.017 -10.926 1.00 35.87  ? 149  ARG A C   1 
ATOM   1210 O O   . ARG A 1 167 ? 14.682  -11.295 -11.966 1.00 34.14  ? 149  ARG A O   1 
ATOM   1211 C CB  . ARG A 1 167 ? 15.378  -10.161 -8.934  1.00 39.33  ? 149  ARG A CB  1 
ATOM   1212 C CG  . ARG A 1 167 ? 16.649  -10.806 -9.358  1.00 38.35  ? 149  ARG A CG  1 
ATOM   1213 C CD  . ARG A 1 167 ? 17.482  -11.156 -8.174  1.00 37.81  ? 149  ARG A CD  1 
ATOM   1214 N NE  . ARG A 1 167 ? 18.432  -12.213 -8.525  1.00 38.74  ? 149  ARG A NE  1 
ATOM   1215 C CZ  . ARG A 1 167 ? 19.326  -12.726 -7.688  1.00 39.97  ? 149  ARG A CZ  1 
ATOM   1216 N NH1 . ARG A 1 167 ? 19.384  -12.273 -6.445  1.00 39.06  ? 149  ARG A NH1 1 
ATOM   1217 N NH2 . ARG A 1 167 ? 20.155  -13.699 -8.090  1.00 40.66  ? 149  ARG A NH2 1 
ATOM   1218 N N   . PHE A 1 168 ? 13.072  -11.749 -10.448 1.00 34.07  ? 150  PHE A N   1 
ATOM   1219 C CA  . PHE A 1 168 ? 12.776  -13.069 -10.944 1.00 31.84  ? 150  PHE A CA  1 
ATOM   1220 C C   . PHE A 1 168 ? 11.457  -13.032 -11.665 1.00 31.01  ? 150  PHE A C   1 
ATOM   1221 O O   . PHE A 1 168 ? 10.487  -12.521 -11.144 1.00 31.37  ? 150  PHE A O   1 
ATOM   1222 C CB  . PHE A 1 168 ? 12.697  -14.104 -9.807  1.00 31.24  ? 150  PHE A CB  1 
ATOM   1223 C CG  . PHE A 1 168 ? 13.982  -14.287 -9.051  1.00 30.85  ? 150  PHE A CG  1 
ATOM   1224 C CD1 . PHE A 1 168 ? 15.080  -14.907 -9.641  1.00 27.85  ? 150  PHE A CD1 1 
ATOM   1225 C CD2 . PHE A 1 168 ? 14.087  -13.863 -7.725  1.00 31.56  ? 150  PHE A CD2 1 
ATOM   1226 C CE1 . PHE A 1 168 ? 16.252  -15.084 -8.927  1.00 26.26  ? 150  PHE A CE1 1 
ATOM   1227 C CE2 . PHE A 1 168 ? 15.265  -14.035 -7.018  1.00 30.94  ? 150  PHE A CE2 1 
ATOM   1228 C CZ  . PHE A 1 168 ? 16.348  -14.645 -7.632  1.00 30.82  ? 150  PHE A CZ  1 
ATOM   1229 N N   . TYR A 1 169 ? 11.446  -13.556 -12.881 1.00 29.62  ? 151  TYR A N   1 
ATOM   1230 C CA  . TYR A 1 169 ? 10.230  -13.633 -13.632 1.00 29.35  ? 151  TYR A CA  1 
ATOM   1231 C C   . TYR A 1 169 ? 9.893   -15.107 -13.939 1.00 28.38  ? 151  TYR A C   1 
ATOM   1232 O O   . TYR A 1 169 ? 10.680  -15.810 -14.567 1.00 26.12  ? 151  TYR A O   1 
ATOM   1233 C CB  . TYR A 1 169 ? 10.389  -12.812 -14.915 1.00 30.47  ? 151  TYR A CB  1 
ATOM   1234 C CG  . TYR A 1 169 ? 9.092   -12.626 -15.656 1.00 30.54  ? 151  TYR A CG  1 
ATOM   1235 C CD1 . TYR A 1 169 ? 8.275   -11.519 -15.395 1.00 32.40  ? 151  TYR A CD1 1 
ATOM   1236 C CD2 . TYR A 1 169 ? 8.682   -13.547 -16.601 1.00 29.06  ? 151  TYR A CD2 1 
ATOM   1237 C CE1 . TYR A 1 169 ? 7.088   -11.341 -16.066 1.00 32.60  ? 151  TYR A CE1 1 
ATOM   1238 C CE2 . TYR A 1 169 ? 7.501   -13.384 -17.269 1.00 31.69  ? 151  TYR A CE2 1 
ATOM   1239 C CZ  . TYR A 1 169 ? 6.706   -12.278 -16.985 1.00 33.43  ? 151  TYR A CZ  1 
ATOM   1240 O OH  . TYR A 1 169 ? 5.524   -12.110 -17.662 1.00 36.74  ? 151  TYR A OH  1 
ATOM   1241 N N   . ILE A 1 170 ? 8.722   -15.557 -13.488 1.00 29.34  ? 152  ILE A N   1 
ATOM   1242 C CA  . ILE A 1 170 ? 8.294   -16.949 -13.652 1.00 29.69  ? 152  ILE A CA  1 
ATOM   1243 C C   . ILE A 1 170 ? 7.586   -17.116 -14.989 1.00 30.27  ? 152  ILE A C   1 
ATOM   1244 O O   . ILE A 1 170 ? 6.627   -16.384 -15.273 1.00 30.78  ? 152  ILE A O   1 
ATOM   1245 C CB  . ILE A 1 170 ? 7.395   -17.409 -12.488 1.00 30.74  ? 152  ILE A CB  1 
ATOM   1246 C CG1 . ILE A 1 170 ? 8.129   -17.155 -11.160 1.00 31.62  ? 152  ILE A CG1 1 
ATOM   1247 C CG2 . ILE A 1 170 ? 7.015   -18.893 -12.660 1.00 28.79  ? 152  ILE A CG2 1 
ATOM   1248 C CD1 . ILE A 1 170 ? 7.286   -17.252 -9.931  1.00 35.23  ? 152  ILE A CD1 1 
ATOM   1249 N N   . LEU A 1 171 ? 8.115   -18.049 -15.812 1.00 29.94  ? 153  LEU A N   1 
ATOM   1250 C CA  . LEU A 1 171 ? 7.760   -18.222 -17.213 1.00 28.77  ? 153  LEU A CA  1 
ATOM   1251 C C   . LEU A 1 171 ? 6.751   -19.331 -17.307 1.00 29.23  ? 153  LEU A C   1 
ATOM   1252 O O   . LEU A 1 171 ? 6.933   -20.359 -17.906 1.00 27.88  ? 153  LEU A O   1 
ATOM   1253 C CB  . LEU A 1 171 ? 8.978   -18.500 -18.082 1.00 28.57  ? 153  LEU A CB  1 
ATOM   1254 C CG  . LEU A 1 171 ? 9.806   -17.249 -18.329 1.00 29.12  ? 153  LEU A CG  1 
ATOM   1255 C CD1 . LEU A 1 171 ? 11.249  -17.611 -18.607 1.00 27.15  ? 153  LEU A CD1 1 
ATOM   1256 C CD2 . LEU A 1 171 ? 9.220   -16.396 -19.461 1.00 28.83  ? 153  LEU A CD2 1 
ATOM   1257 N N   . ASN A 1 172 ? 5.613   -18.967 -16.771 1.00 30.95  ? 154  ASN A N   1 
ATOM   1258 C CA  . ASN A 1 172 ? 4.524   -19.795 -16.346 1.00 31.79  ? 154  ASN A CA  1 
ATOM   1259 C C   . ASN A 1 172 ? 3.567   -20.306 -17.407 1.00 30.33  ? 154  ASN A C   1 
ATOM   1260 O O   . ASN A 1 172 ? 2.910   -21.319 -17.218 1.00 30.16  ? 154  ASN A O   1 
ATOM   1261 C CB  . ASN A 1 172 ? 3.701   -18.858 -15.452 1.00 33.71  ? 154  ASN A CB  1 
ATOM   1262 C CG  . ASN A 1 172 ? 3.487   -19.447 -14.209 1.00 37.60  ? 154  ASN A CG  1 
ATOM   1263 O OD1 . ASN A 1 172 ? 3.122   -18.804 -13.266 1.00 42.21  ? 154  ASN A OD1 1 
ATOM   1264 N ND2 . ASN A 1 172 ? 3.808   -20.735 -14.139 1.00 42.43  ? 154  ASN A ND2 1 
ATOM   1265 N N   . THR A 1 173 ? 3.408   -19.524 -18.467 1.00 29.00  ? 155  THR A N   1 
ATOM   1266 C CA  . THR A 1 173 ? 2.356   -19.784 -19.450 1.00 28.10  ? 155  THR A CA  1 
ATOM   1267 C C   . THR A 1 173 ? 2.925   -20.474 -20.671 1.00 26.59  ? 155  THR A C   1 
ATOM   1268 O O   . THR A 1 173 ? 4.128   -20.465 -20.913 1.00 27.11  ? 155  THR A O   1 
ATOM   1269 C CB  . THR A 1 173 ? 1.647   -18.456 -19.871 1.00 27.97  ? 155  THR A CB  1 
ATOM   1270 O OG1 . THR A 1 173 ? 2.511   -17.715 -20.731 1.00 29.50  ? 155  THR A OG1 1 
ATOM   1271 C CG2 . THR A 1 173 ? 1.287   -17.578 -18.661 1.00 26.55  ? 155  THR A CG2 1 
ATOM   1272 N N   . LEU A 1 174 ? 2.058   -21.084 -21.454 1.00 26.42  ? 156  LEU A N   1 
ATOM   1273 C CA  . LEU A 1 174 ? 2.462   -21.671 -22.730 1.00 25.11  ? 156  LEU A CA  1 
ATOM   1274 C C   . LEU A 1 174 ? 2.893   -20.638 -23.765 1.00 25.28  ? 156  LEU A C   1 
ATOM   1275 O O   . LEU A 1 174 ? 3.730   -20.920 -24.621 1.00 25.14  ? 156  LEU A O   1 
ATOM   1276 C CB  . LEU A 1 174 ? 1.297   -22.509 -23.274 1.00 26.17  ? 156  LEU A CB  1 
ATOM   1277 C CG  . LEU A 1 174 ? 1.033   -23.804 -22.485 1.00 27.25  ? 156  LEU A CG  1 
ATOM   1278 C CD1 . LEU A 1 174 ? -0.461  -24.085 -22.434 1.00 28.37  ? 156  LEU A CD1 1 
ATOM   1279 C CD2 . LEU A 1 174 ? 1.833   -24.967 -23.027 1.00 22.45  ? 156  LEU A CD2 1 
ATOM   1280 N N   . PHE A 1 175 ? 2.350   -19.427 -23.684 1.00 25.52  ? 157  PHE A N   1 
ATOM   1281 C CA  . PHE A 1 175 ? 2.852   -18.328 -24.518 1.00 26.02  ? 157  PHE A CA  1 
ATOM   1282 C C   . PHE A 1 175 ? 4.293   -17.931 -24.171 1.00 26.13  ? 157  PHE A C   1 
ATOM   1283 O O   . PHE A 1 175 ? 4.950   -17.296 -24.977 1.00 26.66  ? 157  PHE A O   1 
ATOM   1284 C CB  . PHE A 1 175 ? 1.914   -17.112 -24.448 1.00 26.29  ? 157  PHE A CB  1 
ATOM   1285 C CG  . PHE A 1 175 ? 0.598   -17.333 -25.125 1.00 26.93  ? 157  PHE A CG  1 
ATOM   1286 C CD1 . PHE A 1 175 ? 0.543   -17.831 -26.424 1.00 26.14  ? 157  PHE A CD1 1 
ATOM   1287 C CD2 . PHE A 1 175 ? -0.581  -17.015 -24.497 1.00 30.27  ? 157  PHE A CD2 1 
ATOM   1288 C CE1 . PHE A 1 175 ? -0.672  -18.007 -27.077 1.00 27.60  ? 157  PHE A CE1 1 
ATOM   1289 C CE2 . PHE A 1 175 ? -1.817  -17.198 -25.171 1.00 34.57  ? 157  PHE A CE2 1 
ATOM   1290 C CZ  . PHE A 1 175 ? -1.843  -17.706 -26.462 1.00 27.96  ? 157  PHE A CZ  1 
ATOM   1291 N N   . ASN A 1 176 ? 4.768   -18.312 -22.976 1.00 26.65  ? 158  ASN A N   1 
ATOM   1292 C CA  . ASN A 1 176 ? 6.150   -18.018 -22.513 1.00 26.40  ? 158  ASN A CA  1 
ATOM   1293 C C   . ASN A 1 176 ? 7.128   -19.062 -23.053 1.00 25.60  ? 158  ASN A C   1 
ATOM   1294 O O   . ASN A 1 176 ? 8.331   -18.956 -22.848 1.00 26.30  ? 158  ASN A O   1 
ATOM   1295 C CB  . ASN A 1 176 ? 6.276   -18.061 -20.971 1.00 26.04  ? 158  ASN A CB  1 
ATOM   1296 C CG  . ASN A 1 176 ? 5.546   -16.932 -20.253 1.00 27.03  ? 158  ASN A CG  1 
ATOM   1297 O OD1 . ASN A 1 176 ? 5.042   -17.150 -19.155 1.00 29.33  ? 158  ASN A OD1 1 
ATOM   1298 N ND2 . ASN A 1 176 ? 5.564   -15.725 -20.803 1.00 23.99  ? 158  ASN A ND2 1 
ATOM   1299 N N   . LEU A 1 177 ? 6.640   -20.088 -23.718 1.00 25.46  ? 159  LEU A N   1 
ATOM   1300 C CA  . LEU A 1 177 ? 7.588   -21.108 -24.236 1.00 26.23  ? 159  LEU A CA  1 
ATOM   1301 C C   . LEU A 1 177 ? 8.661   -20.574 -25.205 1.00 26.54  ? 159  LEU A C   1 
ATOM   1302 O O   . LEU A 1 177 ? 9.861   -20.759 -24.943 1.00 26.34  ? 159  LEU A O   1 
ATOM   1303 C CB  . LEU A 1 177 ? 6.884   -22.364 -24.743 1.00 27.10  ? 159  LEU A CB  1 
ATOM   1304 C CG  . LEU A 1 177 ? 6.323   -23.260 -23.637 1.00 27.85  ? 159  LEU A CG  1 
ATOM   1305 C CD1 . LEU A 1 177 ? 5.435   -24.319 -24.264 1.00 26.62  ? 159  LEU A CD1 1 
ATOM   1306 C CD2 . LEU A 1 177 ? 7.443   -23.914 -22.776 1.00 27.64  ? 159  LEU A CD2 1 
ATOM   1307 N N   . PRO A 1 178 ? 8.254   -19.868 -26.291 1.00 26.76  ? 160  PRO A N   1 
ATOM   1308 C CA  . PRO A 1 178 ? 9.258   -19.332 -27.205 1.00 26.68  ? 160  PRO A CA  1 
ATOM   1309 C C   . PRO A 1 178 ? 10.271  -18.404 -26.512 1.00 26.81  ? 160  PRO A C   1 
ATOM   1310 O O   . PRO A 1 178 ? 11.449  -18.463 -26.824 1.00 26.81  ? 160  PRO A O   1 
ATOM   1311 C CB  . PRO A 1 178 ? 8.433   -18.508 -28.218 1.00 27.34  ? 160  PRO A CB  1 
ATOM   1312 C CG  . PRO A 1 178 ? 7.043   -18.926 -28.054 1.00 27.42  ? 160  PRO A CG  1 
ATOM   1313 C CD  . PRO A 1 178 ? 6.883   -19.481 -26.683 1.00 26.96  ? 160  PRO A CD  1 
ATOM   1314 N N   . GLU A 1 179 ? 9.825   -17.560 -25.583 1.00 27.26  ? 161  GLU A N   1 
ATOM   1315 C CA  . GLU A 1 179 ? 10.731  -16.609 -24.949 1.00 28.50  ? 161  GLU A CA  1 
ATOM   1316 C C   . GLU A 1 179 ? 11.645  -17.264 -23.895 1.00 28.53  ? 161  GLU A C   1 
ATOM   1317 O O   . GLU A 1 179 ? 12.769  -16.830 -23.666 1.00 29.88  ? 161  GLU A O   1 
ATOM   1318 C CB  . GLU A 1 179 ? 9.952   -15.398 -24.436 1.00 29.60  ? 161  GLU A CB  1 
ATOM   1319 C CG  . GLU A 1 179 ? 9.739   -15.292 -22.927 1.00 30.22  ? 161  GLU A CG  1 
ATOM   1320 C CD  . GLU A 1 179 ? 8.677   -14.267 -22.575 1.00 31.98  ? 161  GLU A CD  1 
ATOM   1321 O OE1 . GLU A 1 179 ? 9.043   -13.214 -21.959 1.00 33.34  ? 161  GLU A OE1 1 
ATOM   1322 O OE2 . GLU A 1 179 ? 7.467   -14.511 -22.915 1.00 34.20  ? 161  GLU A OE2 1 
ATOM   1323 N N   . THR A 1 180 ? 11.198  -18.363 -23.308 1.00 27.54  ? 162  THR A N   1 
ATOM   1324 C CA  . THR A 1 180 ? 12.064  -19.186 -22.497 1.00 26.74  ? 162  THR A CA  1 
ATOM   1325 C C   . THR A 1 180 ? 13.309  -19.635 -23.290 1.00 26.31  ? 162  THR A C   1 
ATOM   1326 O O   . THR A 1 180 ? 14.452  -19.459 -22.837 1.00 26.23  ? 162  THR A O   1 
ATOM   1327 C CB  . THR A 1 180 ? 11.281  -20.385 -21.968 1.00 26.77  ? 162  THR A CB  1 
ATOM   1328 O OG1 . THR A 1 180 ? 10.227  -19.904 -21.139 1.00 24.90  ? 162  THR A OG1 1 
ATOM   1329 C CG2 . THR A 1 180 ? 12.173  -21.357 -21.193 1.00 27.16  ? 162  THR A CG2 1 
ATOM   1330 N N   . TYR A 1 181 ? 13.063  -20.224 -24.459 1.00 25.38  ? 163  TYR A N   1 
ATOM   1331 C CA  . TYR A 1 181 ? 14.113  -20.573 -25.401 1.00 24.63  ? 163  TYR A CA  1 
ATOM   1332 C C   . TYR A 1 181 ? 14.897  -19.362 -25.932 1.00 24.72  ? 163  TYR A C   1 
ATOM   1333 O O   . TYR A 1 181 ? 16.114  -19.391 -26.007 1.00 25.61  ? 163  TYR A O   1 
ATOM   1334 C CB  . TYR A 1 181 ? 13.555  -21.414 -26.552 1.00 23.51  ? 163  TYR A CB  1 
ATOM   1335 C CG  . TYR A 1 181 ? 14.645  -21.924 -27.451 1.00 23.27  ? 163  TYR A CG  1 
ATOM   1336 C CD1 . TYR A 1 181 ? 15.616  -22.824 -26.969 1.00 24.96  ? 163  TYR A CD1 1 
ATOM   1337 C CD2 . TYR A 1 181 ? 14.749  -21.483 -28.763 1.00 20.22  ? 163  TYR A CD2 1 
ATOM   1338 C CE1 . TYR A 1 181 ? 16.641  -23.319 -27.810 1.00 24.93  ? 163  TYR A CE1 1 
ATOM   1339 C CE2 . TYR A 1 181 ? 15.763  -21.945 -29.596 1.00 22.29  ? 163  TYR A CE2 1 
ATOM   1340 C CZ  . TYR A 1 181 ? 16.706  -22.851 -29.122 1.00 25.04  ? 163  TYR A CZ  1 
ATOM   1341 O OH  . TYR A 1 181 ? 17.703  -23.277 -29.968 1.00 25.76  ? 163  TYR A OH  1 
ATOM   1342 N N   . LEU A 1 182 ? 14.198  -18.288 -26.282 1.00 25.01  ? 164  LEU A N   1 
ATOM   1343 C CA  . LEU A 1 182 ? 14.835  -17.094 -26.807 1.00 25.04  ? 164  LEU A CA  1 
ATOM   1344 C C   . LEU A 1 182 ? 15.834  -16.445 -25.815 1.00 25.98  ? 164  LEU A C   1 
ATOM   1345 O O   . LEU A 1 182 ? 16.905  -15.957 -26.221 1.00 26.92  ? 164  LEU A O   1 
ATOM   1346 C CB  . LEU A 1 182 ? 13.760  -16.089 -27.233 1.00 25.48  ? 164  LEU A CB  1 
ATOM   1347 C CG  . LEU A 1 182 ? 14.254  -14.798 -27.882 1.00 24.09  ? 164  LEU A CG  1 
ATOM   1348 C CD1 . LEU A 1 182 ? 15.230  -15.123 -29.027 1.00 23.21  ? 164  LEU A CD1 1 
ATOM   1349 C CD2 . LEU A 1 182 ? 13.078  -13.925 -28.291 1.00 24.86  ? 164  LEU A CD2 1 
ATOM   1350 N N   . LEU A 1 183 ? 15.479  -16.439 -24.531 1.00 25.22  ? 165  LEU A N   1 
ATOM   1351 C CA  . LEU A 1 183 ? 16.307  -15.851 -23.512 1.00 25.40  ? 165  LEU A CA  1 
ATOM   1352 C C   . LEU A 1 183 ? 17.615  -16.607 -23.400 1.00 26.60  ? 165  LEU A C   1 
ATOM   1353 O O   . LEU A 1 183 ? 18.672  -15.982 -23.322 1.00 27.92  ? 165  LEU A O   1 
ATOM   1354 C CB  . LEU A 1 183 ? 15.572  -15.826 -22.156 1.00 24.76  ? 165  LEU A CB  1 
ATOM   1355 C CG  . LEU A 1 183 ? 14.448  -14.779 -22.002 1.00 23.51  ? 165  LEU A CG  1 
ATOM   1356 C CD1 . LEU A 1 183 ? 13.538  -15.138 -20.853 1.00 18.66  ? 165  LEU A CD1 1 
ATOM   1357 C CD2 . LEU A 1 183 ? 14.960  -13.358 -21.880 1.00 23.48  ? 165  LEU A CD2 1 
ATOM   1358 N N   . ALA A 1 184 ? 17.531  -17.941 -23.366 1.00 26.42  ? 166  ALA A N   1 
ATOM   1359 C CA  . ALA A 1 184 ? 18.696  -18.846 -23.436 1.00 27.57  ? 166  ALA A CA  1 
ATOM   1360 C C   . ALA A 1 184 ? 19.566  -18.623 -24.689 1.00 28.23  ? 166  ALA A C   1 
ATOM   1361 O O   . ALA A 1 184 ? 20.789  -18.512 -24.570 1.00 28.44  ? 166  ALA A O   1 
ATOM   1362 C CB  . ALA A 1 184 ? 18.246  -20.324 -23.330 1.00 26.66  ? 166  ALA A CB  1 
ATOM   1363 N N   . CYS A 1 185 ? 18.928  -18.555 -25.868 1.00 28.34  ? 167  CYS A N   1 
ATOM   1364 C CA  . CYS A 1 185 ? 19.624  -18.281 -27.144 1.00 30.11  ? 167  CYS A CA  1 
ATOM   1365 C C   . CYS A 1 185 ? 20.401  -16.986 -27.116 1.00 30.38  ? 167  CYS A C   1 
ATOM   1366 O O   . CYS A 1 185 ? 21.523  -16.931 -27.592 1.00 31.76  ? 167  CYS A O   1 
ATOM   1367 C CB  . CYS A 1 185 ? 18.634  -18.107 -28.288 1.00 30.49  ? 167  CYS A CB  1 
ATOM   1368 S SG  . CYS A 1 185 ? 17.823  -19.567 -28.812 1.00 30.84  ? 167  CYS A SG  1 
ATOM   1369 N N   . LEU A 1 186 ? 19.763  -15.935 -26.612 1.00 29.57  ? 168  LEU A N   1 
ATOM   1370 C CA  . LEU A 1 186 ? 20.405  -14.649 -26.448 1.00 30.14  ? 168  LEU A CA  1 
ATOM   1371 C C   . LEU A 1 186 ? 21.568  -14.656 -25.459 1.00 30.83  ? 168  LEU A C   1 
ATOM   1372 O O   . LEU A 1 186 ? 22.652  -14.203 -25.809 1.00 32.39  ? 168  LEU A O   1 
ATOM   1373 C CB  . LEU A 1 186 ? 19.375  -13.559 -26.101 1.00 30.02  ? 168  LEU A CB  1 
ATOM   1374 C CG  . LEU A 1 186 ? 18.300  -13.192 -27.137 1.00 28.17  ? 168  LEU A CG  1 
ATOM   1375 C CD1 . LEU A 1 186 ? 17.280  -12.384 -26.413 1.00 26.18  ? 168  LEU A CD1 1 
ATOM   1376 C CD2 . LEU A 1 186 ? 18.898  -12.400 -28.271 1.00 26.73  ? 168  LEU A CD2 1 
ATOM   1377 N N   . VAL A 1 187 ? 21.385  -15.178 -24.243 1.00 30.33  ? 169  VAL A N   1 
ATOM   1378 C CA  . VAL A 1 187 ? 22.518  -15.244 -23.306 1.00 30.90  ? 169  VAL A CA  1 
ATOM   1379 C C   . VAL A 1 187 ? 23.703  -16.031 -23.922 1.00 31.75  ? 169  VAL A C   1 
ATOM   1380 O O   . VAL A 1 187 ? 24.868  -15.613 -23.866 1.00 33.37  ? 169  VAL A O   1 
ATOM   1381 C CB  . VAL A 1 187 ? 22.120  -15.834 -21.935 1.00 30.55  ? 169  VAL A CB  1 
ATOM   1382 C CG1 . VAL A 1 187 ? 23.346  -16.040 -21.076 1.00 31.33  ? 169  VAL A CG1 1 
ATOM   1383 C CG2 . VAL A 1 187 ? 21.119  -14.935 -21.246 1.00 29.80  ? 169  VAL A CG2 1 
ATOM   1384 N N   . ASP A 1 188 ? 23.389  -17.147 -24.543 1.00 30.70  ? 170  ASP A N   1 
ATOM   1385 C CA  . ASP A 1 188 ? 24.378  -17.947 -25.262 1.00 31.79  ? 170  ASP A CA  1 
ATOM   1386 C C   . ASP A 1 188 ? 25.060  -17.146 -26.397 1.00 32.17  ? 170  ASP A C   1 
ATOM   1387 O O   . ASP A 1 188 ? 26.267  -17.214 -26.568 1.00 32.87  ? 170  ASP A O   1 
ATOM   1388 C CB  . ASP A 1 188 ? 23.705  -19.220 -25.794 1.00 30.82  ? 170  ASP A CB  1 
ATOM   1389 C CG  . ASP A 1 188 ? 24.598  -20.012 -26.719 1.00 34.12  ? 170  ASP A CG  1 
ATOM   1390 O OD1 . ASP A 1 188 ? 25.559  -20.640 -26.211 1.00 35.57  ? 170  ASP A OD1 1 
ATOM   1391 O OD2 . ASP A 1 188 ? 24.329  -20.015 -27.951 1.00 31.78  ? 170  ASP A OD2 1 
ATOM   1392 N N   . PHE A 1 189 ? 24.282  -16.396 -27.172 1.00 31.73  ? 171  PHE A N   1 
ATOM   1393 C CA  . PHE A 1 189 ? 24.844  -15.629 -28.273 1.00 33.10  ? 171  PHE A CA  1 
ATOM   1394 C C   . PHE A 1 189 ? 25.813  -14.520 -27.777 1.00 34.62  ? 171  PHE A C   1 
ATOM   1395 O O   . PHE A 1 189 ? 26.957  -14.456 -28.201 1.00 35.69  ? 171  PHE A O   1 
ATOM   1396 C CB  . PHE A 1 189 ? 23.747  -15.024 -29.156 1.00 31.90  ? 171  PHE A CB  1 
ATOM   1397 C CG  . PHE A 1 189 ? 24.272  -14.013 -30.111 1.00 32.34  ? 171  PHE A CG  1 
ATOM   1398 C CD1 . PHE A 1 189 ? 25.058  -14.413 -31.202 1.00 32.64  ? 171  PHE A CD1 1 
ATOM   1399 C CD2 . PHE A 1 189 ? 24.022  -12.642 -29.909 1.00 33.87  ? 171  PHE A CD2 1 
ATOM   1400 C CE1 . PHE A 1 189 ? 25.597  -13.467 -32.080 1.00 33.99  ? 171  PHE A CE1 1 
ATOM   1401 C CE2 . PHE A 1 189 ? 24.559  -11.659 -30.795 1.00 29.42  ? 171  PHE A CE2 1 
ATOM   1402 C CZ  . PHE A 1 189 ? 25.336  -12.069 -31.858 1.00 33.81  ? 171  PHE A CZ  1 
ATOM   1403 N N   . PHE A 1 190 ? 25.343  -13.672 -26.866 1.00 34.13  ? 172  PHE A N   1 
ATOM   1404 C CA  . PHE A 1 190 ? 26.172  -12.623 -26.290 1.00 35.77  ? 172  PHE A CA  1 
ATOM   1405 C C   . PHE A 1 190 ? 27.391  -13.115 -25.496 1.00 37.60  ? 172  PHE A C   1 
ATOM   1406 O O   . PHE A 1 190 ? 28.415  -12.446 -25.463 1.00 39.38  ? 172  PHE A O   1 
ATOM   1407 C CB  . PHE A 1 190 ? 25.295  -11.697 -25.458 1.00 34.14  ? 172  PHE A CB  1 
ATOM   1408 C CG  . PHE A 1 190 ? 24.349  -10.864 -26.285 1.00 34.26  ? 172  PHE A CG  1 
ATOM   1409 C CD1 . PHE A 1 190 ? 24.842  -9.920  -27.185 1.00 32.13  ? 172  PHE A CD1 1 
ATOM   1410 C CD2 . PHE A 1 190 ? 22.962  -11.008 -26.154 1.00 32.32  ? 172  PHE A CD2 1 
ATOM   1411 C CE1 . PHE A 1 190 ? 23.972  -9.125  -27.953 1.00 32.80  ? 172  PHE A CE1 1 
ATOM   1412 C CE2 . PHE A 1 190 ? 22.087  -10.234 -26.923 1.00 30.76  ? 172  PHE A CE2 1 
ATOM   1413 C CZ  . PHE A 1 190 ? 22.593  -9.281  -27.821 1.00 32.62  ? 172  PHE A CZ  1 
ATOM   1414 N N   . THR A 1 191 ? 27.273  -14.291 -24.882 1.00 38.82  ? 173  THR A N   1 
ATOM   1415 C CA  . THR A 1 191 ? 28.332  -14.944 -24.087 1.00 41.04  ? 173  THR A CA  1 
ATOM   1416 C C   . THR A 1 191 ? 29.432  -15.547 -24.965 1.00 42.41  ? 173  THR A C   1 
ATOM   1417 O O   . THR A 1 191 ? 30.583  -15.624 -24.551 1.00 43.36  ? 173  THR A O   1 
ATOM   1418 C CB  . THR A 1 191 ? 27.720  -16.074 -23.162 1.00 40.51  ? 173  THR A CB  1 
ATOM   1419 O OG1 . THR A 1 191 ? 27.070  -15.471 -22.035 1.00 44.06  ? 173  THR A OG1 1 
ATOM   1420 C CG2 . THR A 1 191 ? 28.767  -17.014 -22.634 1.00 43.54  ? 173  THR A CG2 1 
ATOM   1421 N N   . ASN A 1 192 ? 29.073  -16.005 -26.161 1.00 42.85  ? 174  ASN A N   1 
ATOM   1422 C CA  . ASN A 1 192 ? 30.043  -16.690 -27.034 1.00 45.24  ? 174  ASN A CA  1 
ATOM   1423 C C   . ASN A 1 192 ? 30.526  -15.869 -28.225 1.00 45.99  ? 174  ASN A C   1 
ATOM   1424 O O   . ASN A 1 192 ? 31.552  -16.201 -28.836 1.00 48.09  ? 174  ASN A O   1 
ATOM   1425 C CB  . ASN A 1 192 ? 29.530  -18.072 -27.467 1.00 44.65  ? 174  ASN A CB  1 
ATOM   1426 C CG  . ASN A 1 192 ? 29.433  -19.040 -26.287 1.00 46.50  ? 174  ASN A CG  1 
ATOM   1427 O OD1 . ASN A 1 192 ? 28.336  -19.335 -25.771 1.00 44.09  ? 174  ASN A OD1 1 
ATOM   1428 N ND2 . ASN A 1 192 ? 30.587  -19.499 -25.823 1.00 49.42  ? 174  ASN A ND2 1 
ATOM   1429 N N   . CYS A 1 193 ? 29.795  -14.805 -28.551 1.00 44.87  ? 175  CYS A N   1 
ATOM   1430 C CA  . CYS A 1 193 ? 30.209  -13.903 -29.617 1.00 45.79  ? 175  CYS A CA  1 
ATOM   1431 C C   . CYS A 1 193 ? 31.323  -12.961 -29.116 1.00 46.82  ? 175  CYS A C   1 
ATOM   1432 O O   . CYS A 1 193 ? 31.159  -12.336 -28.090 1.00 46.22  ? 175  CYS A O   1 
ATOM   1433 C CB  . CYS A 1 193 ? 29.026  -13.097 -30.144 1.00 44.08  ? 175  CYS A CB  1 
ATOM   1434 S SG  . CYS A 1 193 ? 29.525  -11.949 -31.454 1.00 46.65  ? 175  CYS A SG  1 
ATOM   1435 N N   . PRO A 1 194 ? 32.468  -12.897 -29.833 1.00 48.74  ? 176  PRO A N   1 
ATOM   1436 C CA  . PRO A 1 194 ? 33.650  -12.057 -29.530 1.00 49.98  ? 176  PRO A CA  1 
ATOM   1437 C C   . PRO A 1 194 ? 33.551  -10.521 -29.717 1.00 49.98  ? 176  PRO A C   1 
ATOM   1438 O O   . PRO A 1 194 ? 34.486  -9.823  -29.336 1.00 50.85  ? 176  PRO A O   1 
ATOM   1439 C CB  . PRO A 1 194 ? 34.737  -12.630 -30.448 1.00 51.85  ? 176  PRO A CB  1 
ATOM   1440 C CG  . PRO A 1 194 ? 34.200  -13.940 -30.937 1.00 52.31  ? 176  PRO A CG  1 
ATOM   1441 C CD  . PRO A 1 194 ? 32.718  -13.756 -31.000 1.00 49.87  ? 176  PRO A CD  1 
ATOM   1442 N N   . ARG A 1 195 ? 32.469  -10.002 -30.304 1.00 48.67  ? 177  ARG A N   1 
ATOM   1443 C CA  . ARG A 1 195 ? 32.164  -8.563  -30.199 1.00 48.99  ? 177  ARG A CA  1 
ATOM   1444 C C   . ARG A 1 195 ? 31.936  -8.127  -28.745 1.00 47.88  ? 177  ARG A C   1 
ATOM   1445 O O   . ARG A 1 195 ? 32.117  -6.952  -28.396 1.00 48.49  ? 177  ARG A O   1 
ATOM   1446 C CB  . ARG A 1 195 ? 30.911  -8.181  -31.004 1.00 47.83  ? 177  ARG A CB  1 
ATOM   1447 C CG  . ARG A 1 195 ? 31.133  -7.977  -32.499 1.00 51.41  ? 177  ARG A CG  1 
ATOM   1448 C CD  . ARG A 1 195 ? 30.073  -7.082  -33.176 1.00 49.92  ? 177  ARG A CD  1 
ATOM   1449 N NE  . ARG A 1 195 ? 28.684  -7.514  -32.979 1.00 50.27  ? 177  ARG A NE  1 
ATOM   1450 C CZ  . ARG A 1 195 ? 28.059  -8.486  -33.660 1.00 49.86  ? 177  ARG A CZ  1 
ATOM   1451 N NH1 . ARG A 1 195 ? 28.686  -9.169  -34.614 1.00 50.59  ? 177  ARG A NH1 1 
ATOM   1452 N NH2 . ARG A 1 195 ? 26.793  -8.778  -33.376 1.00 44.61  ? 177  ARG A NH2 1 
ATOM   1453 N N   . TYR A 1 196 ? 31.523  -9.079  -27.914 1.00 46.77  ? 178  TYR A N   1 
ATOM   1454 C CA  . TYR A 1 196 ? 30.981  -8.803  -26.596 1.00 45.73  ? 178  TYR A CA  1 
ATOM   1455 C C   . TYR A 1 196 ? 31.903  -9.333  -25.521 1.00 46.70  ? 178  TYR A C   1 
ATOM   1456 O O   . TYR A 1 196 ? 32.643  -10.281 -25.753 1.00 47.44  ? 178  TYR A O   1 
ATOM   1457 C CB  . TYR A 1 196 ? 29.567  -9.400  -26.480 1.00 43.48  ? 178  TYR A CB  1 
ATOM   1458 C CG  . TYR A 1 196 ? 28.669  -8.926  -27.612 1.00 42.71  ? 178  TYR A CG  1 
ATOM   1459 C CD1 . TYR A 1 196 ? 28.051  -7.677  -27.570 1.00 41.27  ? 178  TYR A CD1 1 
ATOM   1460 C CD2 . TYR A 1 196 ? 28.475  -9.714  -28.745 1.00 40.84  ? 178  TYR A CD2 1 
ATOM   1461 C CE1 . TYR A 1 196 ? 27.237  -7.234  -28.635 1.00 42.33  ? 178  TYR A CE1 1 
ATOM   1462 C CE2 . TYR A 1 196 ? 27.685  -9.295  -29.798 1.00 39.62  ? 178  TYR A CE2 1 
ATOM   1463 C CZ  . TYR A 1 196 ? 27.067  -8.061  -29.746 1.00 43.23  ? 178  TYR A CZ  1 
ATOM   1464 O OH  . TYR A 1 196 ? 26.288  -7.666  -30.813 1.00 44.35  ? 178  TYR A OH  1 
ATOM   1465 N N   . THR A 1 197 ? 31.866  -8.703  -24.356 1.00 46.80  ? 179  THR A N   1 
ATOM   1466 C CA  . THR A 1 197 ? 32.607  -9.179  -23.201 1.00 47.96  ? 179  THR A CA  1 
ATOM   1467 C C   . THR A 1 197 ? 31.585  -9.561  -22.138 1.00 46.47  ? 179  THR A C   1 
ATOM   1468 O O   . THR A 1 197 ? 30.639  -8.843  -21.931 1.00 45.43  ? 179  THR A O   1 
ATOM   1469 C CB  . THR A 1 197 ? 33.573  -8.092  -22.698 1.00 49.65  ? 179  THR A CB  1 
ATOM   1470 O OG1 . THR A 1 197 ? 34.463  -7.739  -23.761 1.00 51.45  ? 179  THR A OG1 1 
ATOM   1471 C CG2 . THR A 1 197 ? 34.409  -8.585  -21.503 1.00 51.75  ? 179  THR A CG2 1 
ATOM   1472 N N   . SER A 1 198 ? 31.747  -10.715 -21.505 1.00 46.78  ? 180  SER A N   1 
ATOM   1473 C CA  . SER A 1 198 ? 30.806  -11.158 -20.488 1.00 46.39  ? 180  SER A CA  1 
ATOM   1474 C C   . SER A 1 198 ? 31.079  -10.460 -19.163 1.00 47.06  ? 180  SER A C   1 
ATOM   1475 O O   . SER A 1 198 ? 32.231  -10.219 -18.813 1.00 48.71  ? 180  SER A O   1 
ATOM   1476 C CB  . SER A 1 198 ? 30.899  -12.664 -20.291 1.00 46.51  ? 180  SER A CB  1 
ATOM   1477 O OG  . SER A 1 198 ? 30.492  -13.356 -21.460 1.00 48.27  ? 180  SER A OG  1 
ATOM   1478 N N   . CYS A 1 199 ? 30.004  -10.125 -18.450 1.00 46.13  ? 181  CYS A N   1 
ATOM   1479 C CA  . CYS A 1 199 ? 30.061  -9.606  -17.078 1.00 47.44  ? 181  CYS A CA  1 
ATOM   1480 C C   . CYS A 1 199 ? 29.121  -10.477 -16.231 1.00 45.91  ? 181  CYS A C   1 
ATOM   1481 O O   . CYS A 1 199 ? 28.387  -11.301 -16.767 1.00 44.13  ? 181  CYS A O   1 
ATOM   1482 C CB  . CYS A 1 199 ? 29.612  -8.138  -17.034 1.00 47.88  ? 181  CYS A CB  1 
ATOM   1483 S SG  . CYS A 1 199 ? 30.617  -6.954  -18.002 1.00 53.60  ? 181  CYS A SG  1 
ATOM   1484 N N   . GLU A 1 200 ? 29.136  -10.291 -14.915 1.00 46.36  ? 182  GLU A N   1 
ATOM   1485 C CA  . GLU A 1 200 ? 28.229  -11.022 -14.028 1.00 45.25  ? 182  GLU A CA  1 
ATOM   1486 C C   . GLU A 1 200 ? 26.745  -10.748 -14.305 1.00 42.20  ? 182  GLU A C   1 
ATOM   1487 O O   . GLU A 1 200 ? 25.922  -11.673 -14.242 1.00 41.34  ? 182  GLU A O   1 
ATOM   1488 C CB  . GLU A 1 200 ? 28.530  -10.702 -12.560 1.00 47.46  ? 182  GLU A CB  1 
ATOM   1489 C CG  . GLU A 1 200 ? 29.439  -11.718 -11.912 1.00 54.11  ? 182  GLU A CG  1 
ATOM   1490 C CD  . GLU A 1 200 ? 28.894  -12.242 -10.590 1.00 59.72  ? 182  GLU A CD  1 
ATOM   1491 O OE1 . GLU A 1 200 ? 28.815  -11.451 -9.616  1.00 62.74  ? 182  GLU A OE1 1 
ATOM   1492 O OE2 . GLU A 1 200 ? 28.556  -13.452 -10.531 1.00 59.78  ? 182  GLU A OE2 1 
ATOM   1493 N N   . THR A 1 201 ? 26.415  -9.496  -14.629 1.00 39.85  ? 183  THR A N   1 
ATOM   1494 C CA  . THR A 1 201 ? 25.016  -9.028  -14.682 1.00 37.14  ? 183  THR A CA  1 
ATOM   1495 C C   . THR A 1 201 ? 24.552  -8.579  -16.086 1.00 36.04  ? 183  THR A C   1 
ATOM   1496 O O   . THR A 1 201 ? 23.460  -7.979  -16.239 1.00 35.16  ? 183  THR A O   1 
ATOM   1497 C CB  . THR A 1 201 ? 24.776  -7.868  -13.671 1.00 37.57  ? 183  THR A CB  1 
ATOM   1498 O OG1 . THR A 1 201 ? 25.743  -6.854  -13.909 1.00 37.02  ? 183  THR A OG1 1 
ATOM   1499 C CG2 . THR A 1 201 ? 24.950  -8.339  -12.227 1.00 36.83  ? 183  THR A CG2 1 
ATOM   1500 N N   . GLY A 1 202 ? 25.372  -8.888  -17.094 1.00 34.98  ? 184  GLY A N   1 
ATOM   1501 C CA  . GLY A 1 202 ? 25.119  -8.502  -18.474 1.00 33.77  ? 184  GLY A CA  1 
ATOM   1502 C C   . GLY A 1 202 ? 26.402  -8.637  -19.271 1.00 34.70  ? 184  GLY A C   1 
ATOM   1503 O O   . GLY A 1 202 ? 27.190  -9.514  -19.009 1.00 34.66  ? 184  GLY A O   1 
ATOM   1504 N N   . PHE A 1 203 ? 26.639  -7.743  -20.227 1.00 36.14  ? 185  PHE A N   1 
ATOM   1505 C CA  . PHE A 1 203 ? 27.776  -7.903  -21.176 1.00 37.68  ? 185  PHE A CA  1 
ATOM   1506 C C   . PHE A 1 203 ? 28.071  -6.570  -21.832 1.00 39.30  ? 185  PHE A C   1 
ATOM   1507 O O   . PHE A 1 203 ? 27.190  -5.690  -21.890 1.00 39.62  ? 185  PHE A O   1 
ATOM   1508 C CB  . PHE A 1 203 ? 27.476  -8.970  -22.263 1.00 36.27  ? 185  PHE A CB  1 
ATOM   1509 C CG  . PHE A 1 203 ? 26.229  -8.662  -23.076 1.00 34.75  ? 185  PHE A CG  1 
ATOM   1510 C CD1 . PHE A 1 203 ? 24.975  -9.106  -22.639 1.00 29.93  ? 185  PHE A CD1 1 
ATOM   1511 C CD2 . PHE A 1 203 ? 26.308  -7.853  -24.238 1.00 33.97  ? 185  PHE A CD2 1 
ATOM   1512 C CE1 . PHE A 1 203 ? 23.805  -8.788  -23.371 1.00 29.86  ? 185  PHE A CE1 1 
ATOM   1513 C CE2 . PHE A 1 203 ? 25.160  -7.513  -24.966 1.00 29.92  ? 185  PHE A CE2 1 
ATOM   1514 C CZ  . PHE A 1 203 ? 23.900  -7.996  -24.534 1.00 30.15  ? 185  PHE A CZ  1 
ATOM   1515 N N   . LYS A 1 204 ? 29.304  -6.406  -22.318 1.00 40.79  ? 186  LYS A N   1 
ATOM   1516 C CA  . LYS A 1 204 ? 29.724  -5.145  -22.907 1.00 42.62  ? 186  LYS A CA  1 
ATOM   1517 C C   . LYS A 1 204 ? 29.956  -5.310  -24.393 1.00 43.12  ? 186  LYS A C   1 
ATOM   1518 O O   . LYS A 1 204 ? 30.349  -6.379  -24.838 1.00 43.45  ? 186  LYS A O   1 
ATOM   1519 C CB  . LYS A 1 204 ? 30.981  -4.603  -22.220 1.00 43.72  ? 186  LYS A CB  1 
ATOM   1520 C CG  . LYS A 1 204 ? 30.849  -4.525  -20.696 1.00 45.55  ? 186  LYS A CG  1 
ATOM   1521 C CD  . LYS A 1 204 ? 32.040  -3.906  -20.000 1.00 47.72  ? 186  LYS A CD  1 
ATOM   1522 C CE  . LYS A 1 204 ? 31.927  -2.392  -20.012 1.00 54.23  ? 186  LYS A CE  1 
ATOM   1523 N NZ  . LYS A 1 204 ? 32.917  -1.756  -19.079 1.00 57.99  ? 186  LYS A NZ  1 
ATOM   1524 N N   . ASP A 1 205 ? 29.657  -4.262  -25.157 1.00 44.08  ? 187  ASP A N   1 
ATOM   1525 C CA  . ASP A 1 205 ? 30.104  -4.131  -26.530 1.00 45.70  ? 187  ASP A CA  1 
ATOM   1526 C C   . ASP A 1 205 ? 31.024  -2.910  -26.575 1.00 47.82  ? 187  ASP A C   1 
ATOM   1527 O O   . ASP A 1 205 ? 30.575  -1.774  -26.740 1.00 49.13  ? 187  ASP A O   1 
ATOM   1528 C CB  . ASP A 1 205 ? 28.905  -3.968  -27.462 1.00 45.15  ? 187  ASP A CB  1 
ATOM   1529 C CG  . ASP A 1 205 ? 29.296  -3.571  -28.879 1.00 46.59  ? 187  ASP A CG  1 
ATOM   1530 O OD1 . ASP A 1 205 ? 30.474  -3.630  -29.272 1.00 48.80  ? 187  ASP A OD1 1 
ATOM   1531 O OD2 . ASP A 1 205 ? 28.392  -3.188  -29.623 1.00 49.73  ? 187  ASP A OD2 1 
ATOM   1532 N N   . GLY A 1 206 ? 32.316  -3.144  -26.396 1.00 48.95  ? 188  GLY A N   1 
ATOM   1533 C CA  . GLY A 1 206 ? 33.255  -2.048  -26.216 1.00 50.89  ? 188  GLY A CA  1 
ATOM   1534 C C   . GLY A 1 206 ? 33.008  -1.458  -24.844 1.00 50.54  ? 188  GLY A C   1 
ATOM   1535 O O   . GLY A 1 206 ? 33.083  -2.166  -23.839 1.00 50.50  ? 188  GLY A O   1 
ATOM   1536 N N   A ASP A 1 207 ? 32.707  -0.168  -24.767 0.50 51.08  ? 189  ASP A N   1 
ATOM   1537 N N   B ASP A 1 207 ? 32.694  -0.162  -24.850 0.50 51.17  ? 189  ASP A N   1 
ATOM   1538 C CA  A ASP A 1 207 ? 32.425  0.442   -23.463 0.50 50.63  ? 189  ASP A CA  1 
ATOM   1539 C CA  B ASP A 1 207 ? 32.400  0.625   -23.654 0.50 50.95  ? 189  ASP A CA  1 
ATOM   1540 C C   A ASP A 1 207 ? 30.918  0.429   -23.133 0.50 48.36  ? 189  ASP A C   1 
ATOM   1541 C C   B ASP A 1 207 ? 30.886  0.791   -23.441 0.50 48.79  ? 189  ASP A C   1 
ATOM   1542 O O   A ASP A 1 207 ? 30.498  0.870   -22.064 0.50 48.73  ? 189  ASP A O   1 
ATOM   1543 O O   B ASP A 1 207 ? 30.434  1.714   -22.759 0.50 49.48  ? 189  ASP A O   1 
ATOM   1544 C CB  A ASP A 1 207 ? 33.031  1.857   -23.372 0.50 52.50  ? 189  ASP A CB  1 
ATOM   1545 C CB  B ASP A 1 207 ? 33.118  1.990   -23.714 0.50 52.92  ? 189  ASP A CB  1 
ATOM   1546 C CG  A ASP A 1 207 ? 34.522  1.853   -22.973 0.50 54.51  ? 189  ASP A CG  1 
ATOM   1547 C CG  B ASP A 1 207 ? 32.882  2.746   -25.031 0.50 54.40  ? 189  ASP A CG  1 
ATOM   1548 O OD1 A ASP A 1 207 ? 35.019  2.908   -22.519 0.50 57.03  ? 189  ASP A OD1 1 
ATOM   1549 O OD1 B ASP A 1 207 ? 31.752  2.714   -25.565 0.50 53.23  ? 189  ASP A OD1 1 
ATOM   1550 O OD2 A ASP A 1 207 ? 35.203  0.811   -23.103 0.50 54.89  ? 189  ASP A OD2 1 
ATOM   1551 O OD2 B ASP A 1 207 ? 33.831  3.413   -25.517 0.50 56.10  ? 189  ASP A OD2 1 
ATOM   1552 N N   . LEU A 1 208 ? 30.117  -0.105  -24.046 1.00 46.44  ? 190  LEU A N   1 
ATOM   1553 C CA  . LEU A 1 208 ? 28.662  -0.139  -23.879 1.00 43.76  ? 190  LEU A CA  1 
ATOM   1554 C C   . LEU A 1 208 ? 28.291  -1.315  -22.991 1.00 41.80  ? 190  LEU A C   1 
ATOM   1555 O O   . LEU A 1 208 ? 28.541  -2.418  -23.375 1.00 41.54  ? 190  LEU A O   1 
ATOM   1556 C CB  . LEU A 1 208 ? 27.998  -0.278  -25.254 1.00 42.04  ? 190  LEU A CB  1 
ATOM   1557 C CG  . LEU A 1 208 ? 27.685  0.969   -26.121 1.00 42.89  ? 190  LEU A CG  1 
ATOM   1558 C CD1 . LEU A 1 208 ? 28.502  2.197   -25.812 1.00 44.70  ? 190  LEU A CD1 1 
ATOM   1559 C CD2 . LEU A 1 208 ? 27.798  0.609   -27.596 1.00 37.91  ? 190  LEU A CD2 1 
ATOM   1560 N N   . PHE A 1 209 ? 27.734  -1.073  -21.800 1.00 41.24  ? 191  PHE A N   1 
ATOM   1561 C CA  . PHE A 1 209 ? 27.181  -2.130  -20.952 1.00 39.40  ? 191  PHE A CA  1 
ATOM   1562 C C   . PHE A 1 209 ? 25.658  -2.344  -21.127 1.00 38.45  ? 191  PHE A C   1 
ATOM   1563 O O   . PHE A 1 209 ? 24.859  -1.414  -20.996 1.00 38.62  ? 191  PHE A O   1 
ATOM   1564 C CB  . PHE A 1 209 ? 27.511  -1.914  -19.462 1.00 40.10  ? 191  PHE A CB  1 
ATOM   1565 C CG  . PHE A 1 209 ? 26.826  -2.915  -18.533 1.00 39.38  ? 191  PHE A CG  1 
ATOM   1566 C CD1 . PHE A 1 209 ? 27.316  -4.226  -18.400 1.00 39.47  ? 191  PHE A CD1 1 
ATOM   1567 C CD2 . PHE A 1 209 ? 25.688  -2.550  -17.809 1.00 38.07  ? 191  PHE A CD2 1 
ATOM   1568 C CE1 . PHE A 1 209 ? 26.688  -5.158  -17.569 1.00 38.17  ? 191  PHE A CE1 1 
ATOM   1569 C CE2 . PHE A 1 209 ? 25.061  -3.464  -16.972 1.00 37.30  ? 191  PHE A CE2 1 
ATOM   1570 C CZ  . PHE A 1 209 ? 25.558  -4.781  -16.855 1.00 37.86  ? 191  PHE A CZ  1 
ATOM   1571 N N   . MET A 1 210 ? 25.278  -3.591  -21.414 1.00 37.00  ? 192  MET A N   1 
ATOM   1572 C CA  . MET A 1 210 ? 23.892  -3.997  -21.527 1.00 35.54  ? 192  MET A CA  1 
ATOM   1573 C C   . MET A 1 210 ? 23.624  -5.014  -20.408 1.00 35.15  ? 192  MET A C   1 
ATOM   1574 O O   . MET A 1 210 ? 24.300  -6.052  -20.325 1.00 34.50  ? 192  MET A O   1 
ATOM   1575 C CB  . MET A 1 210 ? 23.651  -4.639  -22.899 1.00 35.00  ? 192  MET A CB  1 
ATOM   1576 C CG  . MET A 1 210 ? 22.223  -5.160  -23.125 1.00 33.59  ? 192  MET A CG  1 
ATOM   1577 S SD  . MET A 1 210 ? 21.080  -3.765  -23.394 1.00 35.60  ? 192  MET A SD  1 
ATOM   1578 C CE  . MET A 1 210 ? 19.589  -4.612  -23.956 1.00 32.86  ? 192  MET A CE  1 
ATOM   1579 N N   . SER A 1 211 ? 22.671  -4.716  -19.527 1.00 34.65  ? 193  SER A N   1 
ATOM   1580 C CA  . SER A 1 211 ? 22.302  -5.684  -18.491 1.00 34.36  ? 193  SER A CA  1 
ATOM   1581 C C   . SER A 1 211 ? 21.365  -6.744  -19.072 1.00 33.67  ? 193  SER A C   1 
ATOM   1582 O O   . SER A 1 211 ? 20.647  -6.500  -20.068 1.00 33.44  ? 193  SER A O   1 
ATOM   1583 C CB  . SER A 1 211 ? 21.674  -4.999  -17.259 1.00 35.12  ? 193  SER A CB  1 
ATOM   1584 O OG  . SER A 1 211 ? 20.413  -4.404  -17.574 1.00 33.90  ? 193  SER A OG  1 
ATOM   1585 N N   . TYR A 1 212 ? 21.382  -7.914  -18.453 1.00 33.70  ? 194  TYR A N   1 
ATOM   1586 C CA  . TYR A 1 212 ? 20.400  -8.978  -18.725 1.00 33.14  ? 194  TYR A CA  1 
ATOM   1587 C C   . TYR A 1 212 ? 18.943  -8.573  -18.430 1.00 32.65  ? 194  TYR A C   1 
ATOM   1588 O O   . TYR A 1 212 ? 18.004  -9.105  -19.047 1.00 32.46  ? 194  TYR A O   1 
ATOM   1589 C CB  . TYR A 1 212 ? 20.727  -10.222 -17.915 1.00 31.90  ? 194  TYR A CB  1 
ATOM   1590 C CG  . TYR A 1 212 ? 21.973  -10.885 -18.361 1.00 33.80  ? 194  TYR A CG  1 
ATOM   1591 C CD1 . TYR A 1 212 ? 22.174  -11.198 -19.718 1.00 32.29  ? 194  TYR A CD1 1 
ATOM   1592 C CD2 . TYR A 1 212 ? 22.965  -11.233 -17.438 1.00 34.30  ? 194  TYR A CD2 1 
ATOM   1593 C CE1 . TYR A 1 212 ? 23.333  -11.810 -20.143 1.00 32.27  ? 194  TYR A CE1 1 
ATOM   1594 C CE2 . TYR A 1 212 ? 24.136  -11.871 -17.854 1.00 34.05  ? 194  TYR A CE2 1 
ATOM   1595 C CZ  . TYR A 1 212 ? 24.305  -12.153 -19.212 1.00 34.64  ? 194  TYR A CZ  1 
ATOM   1596 O OH  . TYR A 1 212 ? 25.465  -12.764 -19.646 1.00 37.37  ? 194  TYR A OH  1 
ATOM   1597 N N   . ARG A 1 213 ? 18.768  -7.684  -17.461 1.00 33.29  ? 195  ARG A N   1 
ATOM   1598 C CA  . ARG A 1 213 ? 17.462  -7.120  -17.134 1.00 33.09  ? 195  ARG A CA  1 
ATOM   1599 C C   . ARG A 1 213 ? 16.910  -6.276  -18.268 1.00 31.98  ? 195  ARG A C   1 
ATOM   1600 O O   . ARG A 1 213 ? 15.762  -6.472  -18.647 1.00 30.49  ? 195  ARG A O   1 
ATOM   1601 C CB  . ARG A 1 213 ? 17.525  -6.291  -15.857 1.00 35.00  ? 195  ARG A CB  1 
ATOM   1602 C CG  . ARG A 1 213 ? 16.154  -5.930  -15.352 1.00 38.51  ? 195  ARG A CG  1 
ATOM   1603 C CD  . ARG A 1 213 ? 16.267  -5.261  -14.033 1.00 48.68  ? 195  ARG A CD  1 
ATOM   1604 N NE  . ARG A 1 213 ? 15.044  -5.416  -13.250 1.00 55.61  ? 195  ARG A NE  1 
ATOM   1605 C CZ  . ARG A 1 213 ? 14.268  -4.408  -12.838 1.00 58.30  ? 195  ARG A CZ  1 
ATOM   1606 N NH1 . ARG A 1 213 ? 14.571  -3.132  -13.134 1.00 58.59  ? 195  ARG A NH1 1 
ATOM   1607 N NH2 . ARG A 1 213 ? 13.178  -4.686  -12.121 1.00 58.70  ? 195  ARG A NH2 1 
ATOM   1608 N N   . SER A 1 214 ? 17.703  -5.330  -18.801 1.00 32.54  ? 196  SER A N   1 
ATOM   1609 C CA  . SER A 1 214 ? 17.300  -4.612  -20.020 1.00 32.33  ? 196  SER A CA  1 
ATOM   1610 C C   . SER A 1 214 ? 16.986  -5.586  -21.161 1.00 31.02  ? 196  SER A C   1 
ATOM   1611 O O   . SER A 1 214 ? 16.000  -5.427  -21.880 1.00 31.71  ? 196  SER A O   1 
ATOM   1612 C CB  . SER A 1 214 ? 18.351  -3.618  -20.495 1.00 32.36  ? 196  SER A CB  1 
ATOM   1613 O OG  . SER A 1 214 ? 18.500  -2.569  -19.569 1.00 36.52  ? 196  SER A OG  1 
ATOM   1614 N N   . MET A 1 215 ? 17.827  -6.574  -21.334 1.00 30.38  ? 197  MET A N   1 
ATOM   1615 C CA  . MET A 1 215 ? 17.644  -7.530  -22.405 1.00 31.88  ? 197  MET A CA  1 
ATOM   1616 C C   . MET A 1 215 ? 16.336  -8.350  -22.205 1.00 30.63  ? 197  MET A C   1 
ATOM   1617 O O   . MET A 1 215 ? 15.565  -8.532  -23.152 1.00 30.26  ? 197  MET A O   1 
ATOM   1618 C CB  . MET A 1 215 ? 18.887  -8.437  -22.511 1.00 30.92  ? 197  MET A CB  1 
ATOM   1619 C CG  . MET A 1 215 ? 18.896  -9.392  -23.695 1.00 31.68  ? 197  MET A CG  1 
ATOM   1620 S SD  . MET A 1 215 ? 20.060  -10.756 -23.456 1.00 35.63  ? 197  MET A SD  1 
ATOM   1621 C CE  . MET A 1 215 ? 19.083  -11.783 -22.351 1.00 29.90  ? 197  MET A CE  1 
ATOM   1622 N N   . PHE A 1 216 ? 16.117  -8.855  -20.988 1.00 30.51  ? 198  PHE A N   1 
ATOM   1623 C CA  . PHE A 1 216 ? 14.860  -9.514  -20.628 1.00 30.40  ? 198  PHE A CA  1 
ATOM   1624 C C   . PHE A 1 216 ? 13.636  -8.606  -20.909 1.00 30.82  ? 198  PHE A C   1 
ATOM   1625 O O   . PHE A 1 216 ? 12.646  -9.059  -21.446 1.00 30.30  ? 198  PHE A O   1 
ATOM   1626 C CB  . PHE A 1 216 ? 14.864  -9.945  -19.161 1.00 30.24  ? 198  PHE A CB  1 
ATOM   1627 C CG  . PHE A 1 216 ? 13.496  -10.314 -18.649 1.00 31.35  ? 198  PHE A CG  1 
ATOM   1628 C CD1 . PHE A 1 216 ? 12.951  -11.566 -18.924 1.00 31.64  ? 198  PHE A CD1 1 
ATOM   1629 C CD2 . PHE A 1 216 ? 12.738  -9.386  -17.910 1.00 33.13  ? 198  PHE A CD2 1 
ATOM   1630 C CE1 . PHE A 1 216 ? 11.667  -11.900 -18.475 1.00 30.56  ? 198  PHE A CE1 1 
ATOM   1631 C CE2 . PHE A 1 216 ? 11.474  -9.710  -17.460 1.00 32.01  ? 198  PHE A CE2 1 
ATOM   1632 C CZ  . PHE A 1 216 ? 10.937  -10.959 -17.759 1.00 30.05  ? 198  PHE A CZ  1 
ATOM   1633 N N   . GLN A 1 217 ? 13.715  -7.337  -20.544 1.00 31.46  ? 199  GLN A N   1 
ATOM   1634 C CA  . GLN A 1 217 ? 12.618  -6.388  -20.805 1.00 32.18  ? 199  GLN A CA  1 
ATOM   1635 C C   . GLN A 1 217 ? 12.323  -6.161  -22.287 1.00 31.46  ? 199  GLN A C   1 
ATOM   1636 O O   . GLN A 1 217 ? 11.165  -6.134  -22.688 1.00 30.85  ? 199  GLN A O   1 
ATOM   1637 C CB  . GLN A 1 217 ? 12.824  -5.062  -20.059 1.00 32.46  ? 199  GLN A CB  1 
ATOM   1638 C CG  . GLN A 1 217 ? 11.533  -4.150  -19.986 1.00 35.82  ? 199  GLN A CG  1 
ATOM   1639 C CD  . GLN A 1 217 ? 10.355  -4.853  -19.249 1.00 41.57  ? 199  GLN A CD  1 
ATOM   1640 O OE1 . GLN A 1 217 ? 10.477  -5.244  -18.073 1.00 42.49  ? 199  GLN A OE1 1 
ATOM   1641 N NE2 . GLN A 1 217 ? 9.230   -5.036  -19.956 1.00 39.68  ? 199  GLN A NE2 1 
ATOM   1642 N N   . ASP A 1 218 ? 13.361  -6.011  -23.093 1.00 32.55  ? 200  ASP A N   1 
ATOM   1643 C CA  . ASP A 1 218 ? 13.182  -5.981  -24.554 1.00 34.07  ? 200  ASP A CA  1 
ATOM   1644 C C   . ASP A 1 218 ? 12.466  -7.230  -25.101 1.00 33.05  ? 200  ASP A C   1 
ATOM   1645 O O   . ASP A 1 218 ? 11.604  -7.098  -25.982 1.00 34.08  ? 200  ASP A O   1 
ATOM   1646 C CB  . ASP A 1 218 ? 14.515  -5.769  -25.290 1.00 34.44  ? 200  ASP A CB  1 
ATOM   1647 C CG  . ASP A 1 218 ? 15.189  -4.432  -24.934 1.00 38.97  ? 200  ASP A CG  1 
ATOM   1648 O OD1 . ASP A 1 218 ? 14.510  -3.524  -24.379 1.00 42.66  ? 200  ASP A OD1 1 
ATOM   1649 O OD2 . ASP A 1 218 ? 16.420  -4.302  -25.189 1.00 41.66  ? 200  ASP A OD2 1 
ATOM   1650 N N   . VAL A 1 219 ? 12.821  -8.420  -24.613 1.00 31.66  ? 201  VAL A N   1 
ATOM   1651 C CA  . VAL A 1 219 ? 12.184  -9.670  -25.073 1.00 31.14  ? 201  VAL A CA  1 
ATOM   1652 C C   . VAL A 1 219 ? 10.683  -9.696  -24.714 1.00 31.33  ? 201  VAL A C   1 
ATOM   1653 O O   . VAL A 1 219 ? 9.838   -10.016 -25.526 1.00 31.86  ? 201  VAL A O   1 
ATOM   1654 C CB  . VAL A 1 219 ? 12.919  -10.942 -24.520 1.00 30.38  ? 201  VAL A CB  1 
ATOM   1655 C CG1 . VAL A 1 219 ? 12.146  -12.254 -24.817 1.00 29.29  ? 201  VAL A CG1 1 
ATOM   1656 C CG2 . VAL A 1 219 ? 14.325  -11.047 -25.099 1.00 30.14  ? 201  VAL A CG2 1 
ATOM   1657 N N   . ARG A 1 220 ? 10.397  -9.351  -23.477 1.00 31.73  ? 202  ARG A N   1 
ATOM   1658 C CA  . ARG A 1 220 ? 9.090   -9.310  -22.878 1.00 32.11  ? 202  ARG A CA  1 
ATOM   1659 C C   . ARG A 1 220 ? 8.211   -8.319  -23.629 1.00 32.44  ? 202  ARG A C   1 
ATOM   1660 O O   . ARG A 1 220 ? 7.094   -8.672  -24.041 1.00 31.97  ? 202  ARG A O   1 
ATOM   1661 C CB  . ARG A 1 220 ? 9.329   -8.894  -21.424 1.00 33.58  ? 202  ARG A CB  1 
ATOM   1662 C CG  . ARG A 1 220 ? 8.229   -9.099  -20.421 1.00 35.56  ? 202  ARG A CG  1 
ATOM   1663 C CD  . ARG A 1 220 ? 8.125   -10.493 -19.928 1.00 30.55  ? 202  ARG A CD  1 
ATOM   1664 N NE  . ARG A 1 220 ? 7.570   -11.436 -20.908 1.00 33.74  ? 202  ARG A NE  1 
ATOM   1665 C CZ  . ARG A 1 220 ? 6.378   -11.342 -21.503 1.00 33.76  ? 202  ARG A CZ  1 
ATOM   1666 N NH1 . ARG A 1 220 ? 5.578   -10.310 -21.256 1.00 31.56  ? 202  ARG A NH1 1 
ATOM   1667 N NH2 . ARG A 1 220 ? 5.990   -12.291 -22.371 1.00 32.73  ? 202  ARG A NH2 1 
ATOM   1668 N N   . ASP A 1 221 ? 8.752   -7.105  -23.859 1.00 32.94  ? 203  ASP A N   1 
ATOM   1669 C CA  . ASP A 1 221 ? 8.163   -6.081  -24.733 1.00 33.12  ? 203  ASP A CA  1 
ATOM   1670 C C   . ASP A 1 221 ? 7.900   -6.564  -26.163 1.00 33.00  ? 203  ASP A C   1 
ATOM   1671 O O   . ASP A 1 221 ? 6.869   -6.224  -26.762 1.00 33.35  ? 203  ASP A O   1 
ATOM   1672 C CB  . ASP A 1 221 ? 9.106   -4.895  -24.870 1.00 35.08  ? 203  ASP A CB  1 
ATOM   1673 C CG  . ASP A 1 221 ? 9.160   -4.012  -23.632 1.00 37.62  ? 203  ASP A CG  1 
ATOM   1674 O OD1 . ASP A 1 221 ? 8.373   -4.240  -22.667 1.00 35.78  ? 203  ASP A OD1 1 
ATOM   1675 O OD2 . ASP A 1 221 ? 10.017  -3.075  -23.653 1.00 40.13  ? 203  ASP A OD2 1 
ATOM   1676 N N   . ALA A 1 222 ? 8.860   -7.300  -26.731 1.00 31.76  ? 204  ALA A N   1 
ATOM   1677 C CA  . ALA A 1 222 ? 8.740   -7.816  -28.099 1.00 30.92  ? 204  ALA A CA  1 
ATOM   1678 C C   . ALA A 1 222 ? 7.690   -8.926  -28.197 1.00 29.98  ? 204  ALA A C   1 
ATOM   1679 O O   . ALA A 1 222 ? 6.942   -8.967  -29.163 1.00 30.01  ? 204  ALA A O   1 
ATOM   1680 C CB  . ALA A 1 222 ? 10.088  -8.302  -28.608 1.00 30.28  ? 204  ALA A CB  1 
ATOM   1681 N N   . VAL A 1 223 ? 7.649   -9.829  -27.216 1.00 29.30  ? 205  VAL A N   1 
ATOM   1682 C CA  . VAL A 1 223 ? 6.560   -10.835 -27.115 1.00 29.21  ? 205  VAL A CA  1 
ATOM   1683 C C   . VAL A 1 223 ? 5.179   -10.166 -27.010 1.00 30.81  ? 205  VAL A C   1 
ATOM   1684 O O   . VAL A 1 223 ? 4.259   -10.552 -27.741 1.00 31.62  ? 205  VAL A O   1 
ATOM   1685 C CB  . VAL A 1 223 ? 6.753   -11.907 -25.964 1.00 28.53  ? 205  VAL A CB  1 
ATOM   1686 C CG1 . VAL A 1 223 ? 5.586   -12.908 -25.951 1.00 26.20  ? 205  VAL A CG1 1 
ATOM   1687 C CG2 . VAL A 1 223 ? 8.078   -12.645 -26.116 1.00 24.91  ? 205  VAL A CG2 1 
ATOM   1688 N N   . ASP A 1 224 ? 5.050   -9.161  -26.138 1.00 31.86  ? 206  ASP A N   1 
ATOM   1689 C CA  . ASP A 1 224 ? 3.805   -8.399  -25.997 1.00 32.79  ? 206  ASP A CA  1 
ATOM   1690 C C   . ASP A 1 224 ? 3.404   -7.774  -27.308 1.00 32.75  ? 206  ASP A C   1 
ATOM   1691 O O   . ASP A 1 224 ? 2.227   -7.769  -27.641 1.00 33.51  ? 206  ASP A O   1 
ATOM   1692 C CB  . ASP A 1 224 ? 3.922   -7.263  -24.964 1.00 34.30  ? 206  ASP A CB  1 
ATOM   1693 C CG  . ASP A 1 224 ? 3.920   -7.748  -23.525 1.00 37.11  ? 206  ASP A CG  1 
ATOM   1694 O OD1 . ASP A 1 224 ? 3.800   -8.970  -23.277 1.00 40.45  ? 206  ASP A OD1 1 
ATOM   1695 O OD2 . ASP A 1 224 ? 4.061   -6.896  -22.613 1.00 40.43  ? 206  ASP A OD2 1 
ATOM   1696 N N   . TRP A 1 225 ? 4.371   -7.205  -28.027 1.00 32.30  ? 207  TRP A N   1 
ATOM   1697 C CA  . TRP A 1 225 ? 4.088   -6.512  -29.288 1.00 32.54  ? 207  TRP A CA  1 
ATOM   1698 C C   . TRP A 1 225 ? 3.591   -7.487  -30.362 1.00 32.48  ? 207  TRP A C   1 
ATOM   1699 O O   . TRP A 1 225 ? 2.591   -7.237  -31.005 1.00 33.24  ? 207  TRP A O   1 
ATOM   1700 C CB  . TRP A 1 225 ? 5.312   -5.696  -29.750 1.00 33.01  ? 207  TRP A CB  1 
ATOM   1701 C CG  . TRP A 1 225 ? 5.100   -4.944  -31.051 1.00 34.75  ? 207  TRP A CG  1 
ATOM   1702 C CD1 . TRP A 1 225 ? 4.707   -3.651  -31.185 1.00 35.97  ? 207  TRP A CD1 1 
ATOM   1703 C CD2 . TRP A 1 225 ? 5.287   -5.455  -32.394 1.00 34.02  ? 207  TRP A CD2 1 
ATOM   1704 N NE1 . TRP A 1 225 ? 4.634   -3.321  -32.523 1.00 38.73  ? 207  TRP A NE1 1 
ATOM   1705 C CE2 . TRP A 1 225 ? 4.983   -4.413  -33.279 1.00 37.06  ? 207  TRP A CE2 1 
ATOM   1706 C CE3 . TRP A 1 225 ? 5.699   -6.695  -32.920 1.00 34.51  ? 207  TRP A CE3 1 
ATOM   1707 C CZ2 . TRP A 1 225 ? 5.059   -4.562  -34.668 1.00 38.04  ? 207  TRP A CZ2 1 
ATOM   1708 C CZ3 . TRP A 1 225 ? 5.769   -6.850  -34.291 1.00 34.59  ? 207  TRP A CZ3 1 
ATOM   1709 C CH2 . TRP A 1 225 ? 5.443   -5.786  -35.154 1.00 37.32  ? 207  TRP A CH2 1 
ATOM   1710 N N   . VAL A 1 226 ? 4.277   -8.619  -30.518 1.00 31.79  ? 208  VAL A N   1 
ATOM   1711 C CA  . VAL A 1 226 ? 3.888   -9.689  -31.444 1.00 31.65  ? 208  VAL A CA  1 
ATOM   1712 C C   . VAL A 1 226 ? 2.420   -10.103 -31.230 1.00 32.47  ? 208  VAL A C   1 
ATOM   1713 O O   . VAL A 1 226 ? 1.682   -10.252 -32.197 1.00 32.59  ? 208  VAL A O   1 
ATOM   1714 C CB  . VAL A 1 226 ? 4.868   -10.898 -31.313 1.00 30.94  ? 208  VAL A CB  1 
ATOM   1715 C CG1 . VAL A 1 226 ? 4.218   -12.203 -31.751 1.00 31.18  ? 208  VAL A CG1 1 
ATOM   1716 C CG2 . VAL A 1 226 ? 6.193   -10.624 -32.062 1.00 28.76  ? 208  VAL A CG2 1 
ATOM   1717 N N   . HIS A 1 227 ? 2.010   -10.249 -29.965 1.00 32.97  ? 209  HIS A N   1 
ATOM   1718 C CA  . HIS A 1 227 ? 0.647   -10.598 -29.590 1.00 35.49  ? 209  HIS A CA  1 
ATOM   1719 C C   . HIS A 1 227 ? -0.397  -9.488  -29.808 1.00 38.74  ? 209  HIS A C   1 
ATOM   1720 O O   . HIS A 1 227 ? -1.455  -9.761  -30.397 1.00 39.62  ? 209  HIS A O   1 
ATOM   1721 C CB  . HIS A 1 227 ? 0.578   -11.118 -28.137 1.00 35.14  ? 209  HIS A CB  1 
ATOM   1722 C CG  . HIS A 1 227 ? 1.047   -12.530 -27.992 1.00 32.89  ? 209  HIS A CG  1 
ATOM   1723 N ND1 . HIS A 1 227 ? 0.181   -13.594 -27.939 1.00 34.88  ? 209  HIS A ND1 1 
ATOM   1724 C CD2 . HIS A 1 227 ? 2.295   -13.058 -27.930 1.00 33.74  ? 209  HIS A CD2 1 
ATOM   1725 C CE1 . HIS A 1 227 ? 0.869   -14.722 -27.844 1.00 33.16  ? 209  HIS A CE1 1 
ATOM   1726 N NE2 . HIS A 1 227 ? 2.156   -14.424 -27.831 1.00 32.52  ? 209  HIS A NE2 1 
ATOM   1727 N N   . TYR A 1 228 ? -0.097  -8.274  -29.350 1.00 40.50  ? 210  TYR A N   1 
ATOM   1728 C CA  . TYR A 1 228 ? -1.049  -7.176  -29.362 1.00 44.31  ? 210  TYR A CA  1 
ATOM   1729 C C   . TYR A 1 228 ? -1.001  -6.315  -30.619 1.00 45.04  ? 210  TYR A C   1 
ATOM   1730 O O   . TYR A 1 228 ? -2.018  -5.757  -30.987 1.00 46.62  ? 210  TYR A O   1 
ATOM   1731 C CB  . TYR A 1 228 ? -0.797  -6.182  -28.220 1.00 47.81  ? 210  TYR A CB  1 
ATOM   1732 C CG  . TYR A 1 228 ? -0.774  -6.621  -26.758 1.00 51.92  ? 210  TYR A CG  1 
ATOM   1733 C CD1 . TYR A 1 228 ? -0.562  -7.952  -26.378 1.00 51.28  ? 210  TYR A CD1 1 
ATOM   1734 C CD2 . TYR A 1 228 ? -0.907  -5.634  -25.726 1.00 58.09  ? 210  TYR A CD2 1 
ATOM   1735 C CE1 . TYR A 1 228 ? -0.521  -8.317  -25.031 1.00 53.51  ? 210  TYR A CE1 1 
ATOM   1736 C CE2 . TYR A 1 228 ? -0.862  -5.989  -24.352 1.00 58.79  ? 210  TYR A CE2 1 
ATOM   1737 C CZ  . TYR A 1 228 ? -0.668  -7.341  -24.018 1.00 55.76  ? 210  TYR A CZ  1 
ATOM   1738 O OH  . TYR A 1 228 ? -0.627  -7.725  -22.674 1.00 56.58  ? 210  TYR A OH  1 
ATOM   1739 N N   A LYS A 1 229 ? 0.186   -6.172  -31.226 0.50 44.53  ? 211  LYS A N   1 
ATOM   1740 N N   B LYS A 1 229 ? 0.162   -6.188  -31.251 0.50 44.64  ? 211  LYS A N   1 
ATOM   1741 C CA  A LYS A 1 229 ? 0.441   -5.216  -32.326 0.50 45.60  ? 211  LYS A CA  1 
ATOM   1742 C CA  B LYS A 1 229 ? 0.309   -5.292  -32.395 0.50 45.78  ? 211  LYS A CA  1 
ATOM   1743 C C   A LYS A 1 229 ? 1.123   -5.804  -33.578 0.50 45.58  ? 211  LYS A C   1 
ATOM   1744 C C   B LYS A 1 229 ? 0.801   -5.993  -33.664 0.50 45.72  ? 211  LYS A C   1 
ATOM   1745 O O   A LYS A 1 229 ? 1.239   -5.116  -34.598 0.50 46.97  ? 211  LYS A O   1 
ATOM   1746 O O   B LYS A 1 229 ? 0.455   -5.582  -34.777 0.50 47.23  ? 211  LYS A O   1 
ATOM   1747 C CB  A LYS A 1 229 ? 1.286   -4.024  -31.830 0.50 46.11  ? 211  LYS A CB  1 
ATOM   1748 C CB  B LYS A 1 229 ? 1.230   -4.110  -32.045 0.50 46.49  ? 211  LYS A CB  1 
ATOM   1749 C CG  A LYS A 1 229 ? 0.500   -2.873  -31.181 0.50 47.45  ? 211  LYS A CG  1 
ATOM   1750 C CG  B LYS A 1 229 ? 0.568   -2.993  -31.205 0.50 47.73  ? 211  LYS A CG  1 
ATOM   1751 C CD  A LYS A 1 229 ? 1.396   -1.689  -30.773 0.50 48.11  ? 211  LYS A CD  1 
ATOM   1752 C CD  B LYS A 1 229 ? 0.660   -3.254  -29.692 0.50 47.63  ? 211  LYS A CD  1 
ATOM   1753 C CE  A LYS A 1 229 ? 1.408   -0.576  -31.839 0.50 51.53  ? 211  LYS A CE  1 
ATOM   1754 C CE  B LYS A 1 229 ? -0.203  -2.284  -28.865 0.50 49.20  ? 211  LYS A CE  1 
ATOM   1755 N NZ  A LYS A 1 229 ? 2.116   0.677   -31.395 0.50 51.33  ? 211  LYS A NZ  1 
ATOM   1756 N NZ  B LYS A 1 229 ? -1.569  -2.812  -28.546 0.50 48.31  ? 211  LYS A NZ  1 
ATOM   1757 N N   . GLY A 1 230 ? 1.598   -7.048  -33.497 1.00 43.96  ? 212  GLY A N   1 
ATOM   1758 C CA  . GLY A 1 230 ? 2.242   -7.708  -34.632 1.00 43.38  ? 212  GLY A CA  1 
ATOM   1759 C C   . GLY A 1 230 ? 1.401   -8.750  -35.361 1.00 43.36  ? 212  GLY A C   1 
ATOM   1760 O O   . GLY A 1 230 ? 0.151   -8.813  -35.212 1.00 43.77  ? 212  GLY A O   1 
ATOM   1761 N N   . SER A 1 231 ? 2.067   -9.604  -36.126 1.00 41.72  ? 213  SER A N   1 
ATOM   1762 C CA  . SER A 1 231 ? 1.300   -10.438 -37.046 1.00 42.39  ? 213  SER A CA  1 
ATOM   1763 C C   . SER A 1 231 ? 0.942   -11.865 -36.570 1.00 39.76  ? 213  SER A C   1 
ATOM   1764 O O   . SER A 1 231 ? 0.534   -12.693 -37.386 1.00 40.02  ? 213  SER A O   1 
ATOM   1765 C CB  . SER A 1 231 ? 1.935   -10.421 -38.460 1.00 43.95  ? 213  SER A CB  1 
ATOM   1766 O OG  . SER A 1 231 ? 3.202   -11.064 -38.462 1.00 45.66  ? 213  SER A OG  1 
ATOM   1767 N N   . LEU A 1 232 ? 1.059   -12.130 -35.267 1.00 36.86  ? 214  LEU A N   1 
ATOM   1768 C CA  . LEU A 1 232 ? 0.834   -13.482 -34.741 1.00 35.59  ? 214  LEU A CA  1 
ATOM   1769 C C   . LEU A 1 232 ? -0.588  -14.009 -35.039 1.00 35.77  ? 214  LEU A C   1 
ATOM   1770 O O   . LEU A 1 232 ? -0.739  -15.099 -35.569 1.00 35.12  ? 214  LEU A O   1 
ATOM   1771 C CB  . LEU A 1 232 ? 1.162   -13.604 -33.231 1.00 33.60  ? 214  LEU A CB  1 
ATOM   1772 C CG  . LEU A 1 232 ? 0.981   -15.000 -32.547 1.00 33.53  ? 214  LEU A CG  1 
ATOM   1773 C CD1 . LEU A 1 232 ? 1.858   -16.136 -33.115 1.00 28.07  ? 214  LEU A CD1 1 
ATOM   1774 C CD2 . LEU A 1 232 ? 1.139   -14.969 -31.011 1.00 32.19  ? 214  LEU A CD2 1 
ATOM   1775 N N   . LYS A 1 233 ? -1.599  -13.232 -34.655 1.00 35.82  ? 215  LYS A N   1 
ATOM   1776 C CA  . LYS A 1 233 ? -2.989  -13.546 -34.884 1.00 36.84  ? 215  LYS A CA  1 
ATOM   1777 C C   . LYS A 1 233 ? -3.277  -13.709 -36.371 1.00 38.29  ? 215  LYS A C   1 
ATOM   1778 O O   . LYS A 1 233 ? -3.959  -14.646 -36.782 1.00 38.53  ? 215  LYS A O   1 
ATOM   1779 C CB  . LYS A 1 233 ? -3.858  -12.433 -34.321 1.00 37.47  ? 215  LYS A CB  1 
ATOM   1780 C CG  . LYS A 1 233 ? -4.034  -12.531 -32.811 1.00 37.77  ? 215  LYS A CG  1 
ATOM   1781 C CD  . LYS A 1 233 ? -4.928  -11.417 -32.310 1.00 43.15  ? 215  LYS A CD  1 
ATOM   1782 C CE  . LYS A 1 233 ? -5.239  -11.624 -30.833 1.00 48.91  ? 215  LYS A CE  1 
ATOM   1783 N NZ  . LYS A 1 233 ? -4.014  -12.001 -30.023 1.00 49.82  ? 215  LYS A NZ  1 
ATOM   1784 N N   . GLU A 1 234 ? -2.722  -12.804 -37.166 1.00 38.91  ? 216  GLU A N   1 
ATOM   1785 C CA  . GLU A 1 234 ? -2.932  -12.771 -38.597 1.00 41.27  ? 216  GLU A CA  1 
ATOM   1786 C C   . GLU A 1 234 ? -2.398  -14.030 -39.222 1.00 39.00  ? 216  GLU A C   1 
ATOM   1787 O O   . GLU A 1 234 ? -3.090  -14.677 -39.985 1.00 40.42  ? 216  GLU A O   1 
ATOM   1788 C CB  . GLU A 1 234 ? -2.246  -11.539 -39.192 1.00 41.94  ? 216  GLU A CB  1 
ATOM   1789 C CG  . GLU A 1 234 ? -2.201  -11.529 -40.694 1.00 46.94  ? 216  GLU A CG  1 
ATOM   1790 C CD  . GLU A 1 234 ? -1.665  -10.210 -41.275 1.00 49.66  ? 216  GLU A CD  1 
ATOM   1791 O OE1 . GLU A 1 234 ? -0.858  -9.480  -40.615 1.00 54.11  ? 216  GLU A OE1 1 
ATOM   1792 O OE2 . GLU A 1 234 ? -2.074  -9.907  -42.418 1.00 56.28  ? 216  GLU A OE2 1 
ATOM   1793 N N   . LYS A 1 235 ? -1.170  -14.381 -38.876 1.00 36.90  ? 217  LYS A N   1 
ATOM   1794 C CA  . LYS A 1 235 ? -0.537  -15.599 -39.387 1.00 36.32  ? 217  LYS A CA  1 
ATOM   1795 C C   . LYS A 1 235 ? -1.168  -16.914 -38.890 1.00 34.42  ? 217  LYS A C   1 
ATOM   1796 O O   . LYS A 1 235 ? -1.165  -17.913 -39.597 1.00 34.29  ? 217  LYS A O   1 
ATOM   1797 C CB  . LYS A 1 235 ? 0.959   -15.533 -39.127 1.00 36.02  ? 217  LYS A CB  1 
ATOM   1798 C CG  . LYS A 1 235 ? 1.625   -14.455 -39.979 1.00 39.72  ? 217  LYS A CG  1 
ATOM   1799 C CD  . LYS A 1 235 ? 3.125   -14.516 -39.863 1.00 44.38  ? 217  LYS A CD  1 
ATOM   1800 C CE  . LYS A 1 235 ? 3.780   -13.303 -40.569 1.00 47.79  ? 217  LYS A CE  1 
ATOM   1801 N NZ  . LYS A 1 235 ? 3.256   -13.072 -41.930 1.00 48.77  ? 217  LYS A NZ  1 
ATOM   1802 N N   . THR A 1 236 ? -1.730  -16.893 -37.687 1.00 32.45  ? 218  THR A N   1 
ATOM   1803 C CA  . THR A 1 236 ? -2.488  -18.032 -37.149 1.00 32.47  ? 218  THR A CA  1 
ATOM   1804 C C   . THR A 1 236 ? -3.743  -18.338 -37.986 1.00 34.12  ? 218  THR A C   1 
ATOM   1805 O O   . THR A 1 236 ? -3.984  -19.456 -38.420 1.00 34.60  ? 218  THR A O   1 
ATOM   1806 C CB  . THR A 1 236 ? -2.884  -17.761 -35.684 1.00 30.34  ? 218  THR A CB  1 
ATOM   1807 O OG1 . THR A 1 236 ? -1.694  -17.481 -34.935 1.00 30.54  ? 218  THR A OG1 1 
ATOM   1808 C CG2 . THR A 1 236 ? -3.589  -18.953 -35.064 1.00 28.25  ? 218  THR A CG2 1 
ATOM   1809 N N   . VAL A 1 237 ? -4.521  -17.292 -38.173 1.00 35.25  ? 219  VAL A N   1 
ATOM   1810 C CA  . VAL A 1 237 ? -5.831  -17.288 -38.749 1.00 37.16  ? 219  VAL A CA  1 
ATOM   1811 C C   . VAL A 1 237 ? -5.785  -17.547 -40.270 1.00 40.14  ? 219  VAL A C   1 
ATOM   1812 O O   . VAL A 1 237 ? -6.768  -18.011 -40.849 1.00 41.75  ? 219  VAL A O   1 
ATOM   1813 C CB  . VAL A 1 237 ? -6.466  -15.919 -38.323 1.00 38.31  ? 219  VAL A CB  1 
ATOM   1814 C CG1 . VAL A 1 237 ? -7.036  -15.118 -39.460 1.00 38.11  ? 219  VAL A CG1 1 
ATOM   1815 C CG2 . VAL A 1 237 ? -7.398  -16.074 -37.068 1.00 36.40  ? 219  VAL A CG2 1 
ATOM   1816 N N   . GLU A 1 238 ? -4.647  -17.286 -40.918 1.00 40.78  ? 220  GLU A N   1 
ATOM   1817 C CA  . GLU A 1 238 ? -4.510  -17.652 -42.327 1.00 44.01  ? 220  GLU A CA  1 
ATOM   1818 C C   . GLU A 1 238 ? -4.139  -19.124 -42.542 1.00 42.83  ? 220  GLU A C   1 
ATOM   1819 O O   . GLU A 1 238 ? -4.195  -19.609 -43.659 1.00 44.74  ? 220  GLU A O   1 
ATOM   1820 C CB  . GLU A 1 238 ? -3.554  -16.722 -43.076 1.00 44.78  ? 220  GLU A CB  1 
ATOM   1821 C CG  . GLU A 1 238 ? -2.071  -16.886 -42.723 1.00 46.74  ? 220  GLU A CG  1 
ATOM   1822 C CD  . GLU A 1 238 ? -1.141  -15.918 -43.517 1.00 48.52  ? 220  GLU A CD  1 
ATOM   1823 O OE1 . GLU A 1 238 ? -1.647  -14.860 -43.989 1.00 53.57  ? 220  GLU A OE1 1 
ATOM   1824 O OE2 . GLU A 1 238 ? 0.093   -16.217 -43.651 1.00 50.68  ? 220  GLU A OE2 1 
ATOM   1825 N N   . ASN A 1 239 ? -3.777  -19.830 -41.475 1.00 40.36  ? 221  ASN A N   1 
ATOM   1826 C CA  . ASN A 1 239 ? -3.454  -21.231 -41.578 1.00 39.32  ? 221  ASN A CA  1 
ATOM   1827 C C   . ASN A 1 239 ? -3.835  -21.982 -40.337 1.00 37.36  ? 221  ASN A C   1 
ATOM   1828 O O   . ASN A 1 239 ? -2.969  -22.475 -39.617 1.00 35.59  ? 221  ASN A O   1 
ATOM   1829 C CB  . ASN A 1 239 ? -1.979  -21.428 -41.882 1.00 39.32  ? 221  ASN A CB  1 
ATOM   1830 C CG  . ASN A 1 239 ? -1.706  -22.716 -42.674 1.00 42.14  ? 221  ASN A CG  1 
ATOM   1831 O OD1 . ASN A 1 239 ? -2.462  -23.720 -42.606 1.00 42.71  ? 221  ASN A OD1 1 
ATOM   1832 N ND2 . ASN A 1 239 ? -0.615  -22.692 -43.429 1.00 42.71  ? 221  ASN A ND2 1 
ATOM   1833 N N   . LEU A 1 240 ? -5.147  -22.092 -40.110 1.00 37.63  ? 222  LEU A N   1 
ATOM   1834 C CA  . LEU A 1 240 ? -5.688  -22.681 -38.880 1.00 36.21  ? 222  LEU A CA  1 
ATOM   1835 C C   . LEU A 1 240 ? -5.432  -24.189 -38.764 1.00 37.20  ? 222  LEU A C   1 
ATOM   1836 O O   . LEU A 1 240 ? -5.231  -24.747 -37.654 1.00 35.76  ? 222  LEU A O   1 
ATOM   1837 C CB  . LEU A 1 240 ? -7.166  -22.333 -38.765 1.00 36.16  ? 222  LEU A CB  1 
ATOM   1838 C CG  . LEU A 1 240 ? -7.435  -20.843 -38.452 1.00 35.43  ? 222  LEU A CG  1 
ATOM   1839 C CD1 . LEU A 1 240 ? -8.844  -20.406 -38.801 1.00 37.57  ? 222  LEU A CD1 1 
ATOM   1840 C CD2 . LEU A 1 240 ? -7.134  -20.466 -37.013 1.00 29.88  ? 222  LEU A CD2 1 
ATOM   1841 N N   . GLU A 1 241 ? -5.416  -24.847 -39.920 1.00 39.03  ? 223  GLU A N   1 
ATOM   1842 C CA  . GLU A 1 241 ? -5.115  -26.267 -39.992 1.00 40.69  ? 223  GLU A CA  1 
ATOM   1843 C C   . GLU A 1 241 ? -3.706  -26.581 -39.493 1.00 38.48  ? 223  GLU A C   1 
ATOM   1844 O O   . GLU A 1 241 ? -3.500  -27.581 -38.813 1.00 38.80  ? 223  GLU A O   1 
ATOM   1845 C CB  . GLU A 1 241 ? -5.380  -26.825 -41.400 1.00 43.32  ? 223  GLU A CB  1 
ATOM   1846 C CG  . GLU A 1 241 ? -6.865  -26.747 -41.817 1.00 49.70  ? 223  GLU A CG  1 
ATOM   1847 C CD  . GLU A 1 241 ? -7.333  -25.349 -42.388 1.00 59.82  ? 223  GLU A CD  1 
ATOM   1848 O OE1 . GLU A 1 241 ? -6.517  -24.350 -42.470 1.00 58.04  ? 223  GLU A OE1 1 
ATOM   1849 O OE2 . GLU A 1 241 ? -8.555  -25.276 -42.767 1.00 63.28  ? 223  GLU A OE2 1 
ATOM   1850 N N   . LYS A 1 242 ? -2.758  -25.704 -39.779 1.00 37.40  ? 224  LYS A N   1 
ATOM   1851 C CA  . LYS A 1 242 ? -1.397  -25.866 -39.310 1.00 36.19  ? 224  LYS A CA  1 
ATOM   1852 C C   . LYS A 1 242 ? -1.186  -25.536 -37.808 1.00 34.19  ? 224  LYS A C   1 
ATOM   1853 O O   . LYS A 1 242 ? -0.294  -26.095 -37.158 1.00 33.80  ? 224  LYS A O   1 
ATOM   1854 C CB  . LYS A 1 242 ? -0.486  -24.989 -40.170 1.00 37.21  ? 224  LYS A CB  1 
ATOM   1855 C CG  . LYS A 1 242 ? 0.938   -24.944 -39.691 1.00 37.10  ? 224  LYS A CG  1 
ATOM   1856 C CD  . LYS A 1 242 ? 1.853   -24.258 -40.685 1.00 41.15  ? 224  LYS A CD  1 
ATOM   1857 C CE  . LYS A 1 242 ? 3.229   -24.143 -40.063 1.00 41.35  ? 224  LYS A CE  1 
ATOM   1858 N NZ  . LYS A 1 242 ? 4.222   -23.598 -40.968 1.00 44.64  ? 224  LYS A NZ  1 
ATOM   1859 N N   . TYR A 1 243 ? -1.999  -24.630 -37.257 1.00 32.87  ? 225  TYR A N   1 
ATOM   1860 C CA  . TYR A 1 243 ? -1.712  -24.031 -35.957 1.00 30.26  ? 225  TYR A CA  1 
ATOM   1861 C C   . TYR A 1 243 ? -2.648  -24.401 -34.815 1.00 29.23  ? 225  TYR A C   1 
ATOM   1862 O O   . TYR A 1 243 ? -2.309  -24.198 -33.651 1.00 28.64  ? 225  TYR A O   1 
ATOM   1863 C CB  . TYR A 1 243 ? -1.656  -22.510 -36.097 1.00 29.83  ? 225  TYR A CB  1 
ATOM   1864 C CG  . TYR A 1 243 ? -0.446  -22.027 -36.867 1.00 30.08  ? 225  TYR A CG  1 
ATOM   1865 C CD1 . TYR A 1 243 ? 0.849   -22.332 -36.429 1.00 28.77  ? 225  TYR A CD1 1 
ATOM   1866 C CD2 . TYR A 1 243 ? -0.590  -21.284 -38.035 1.00 28.67  ? 225  TYR A CD2 1 
ATOM   1867 C CE1 . TYR A 1 243 ? 1.983   -21.914 -37.153 1.00 27.87  ? 225  TYR A CE1 1 
ATOM   1868 C CE2 . TYR A 1 243 ? 0.535   -20.850 -38.754 1.00 31.92  ? 225  TYR A CE2 1 
ATOM   1869 C CZ  . TYR A 1 243 ? 1.816   -21.177 -38.302 1.00 30.23  ? 225  TYR A CZ  1 
ATOM   1870 O OH  . TYR A 1 243 ? 2.924   -20.759 -39.005 1.00 32.44  ? 225  TYR A OH  1 
ATOM   1871 N N   . VAL A 1 244 ? -3.815  -24.943 -35.142 1.00 29.61  ? 226  VAL A N   1 
ATOM   1872 C CA  . VAL A 1 244 ? -4.862  -25.208 -34.158 1.00 28.90  ? 226  VAL A CA  1 
ATOM   1873 C C   . VAL A 1 244 ? -5.443  -26.627 -34.313 1.00 30.32  ? 226  VAL A C   1 
ATOM   1874 O O   . VAL A 1 244 ? -5.836  -27.049 -35.404 1.00 32.23  ? 226  VAL A O   1 
ATOM   1875 C CB  . VAL A 1 244 ? -5.993  -24.103 -34.267 1.00 28.77  ? 226  VAL A CB  1 
ATOM   1876 C CG1 . VAL A 1 244 ? -7.034  -24.256 -33.212 1.00 27.13  ? 226  VAL A CG1 1 
ATOM   1877 C CG2 . VAL A 1 244 ? -5.392  -22.698 -34.190 1.00 29.12  ? 226  VAL A CG2 1 
ATOM   1878 N N   . VAL A 1 245 ? -5.481  -27.367 -33.216 1.00 30.81  ? 227  VAL A N   1 
ATOM   1879 C CA  . VAL A 1 245 ? -6.133  -28.661 -33.153 1.00 31.48  ? 227  VAL A CA  1 
ATOM   1880 C C   . VAL A 1 245 ? -7.646  -28.481 -33.368 1.00 33.07  ? 227  VAL A C   1 
ATOM   1881 O O   . VAL A 1 245 ? -8.256  -27.587 -32.774 1.00 32.40  ? 227  VAL A O   1 
ATOM   1882 C CB  . VAL A 1 245 ? -5.896  -29.311 -31.751 1.00 31.29  ? 227  VAL A CB  1 
ATOM   1883 C CG1 . VAL A 1 245 ? -6.650  -30.682 -31.589 1.00 32.50  ? 227  VAL A CG1 1 
ATOM   1884 C CG2 . VAL A 1 245 ? -4.398  -29.444 -31.448 1.00 30.65  ? 227  VAL A CG2 1 
ATOM   1885 N N   . LYS A 1 246 ? -8.226  -29.322 -34.232 1.00 34.61  ? 228  LYS A N   1 
ATOM   1886 C CA  . LYS A 1 246 ? -9.663  -29.394 -34.488 1.00 35.62  ? 228  LYS A CA  1 
ATOM   1887 C C   . LYS A 1 246 ? -10.122 -30.786 -34.080 1.00 35.86  ? 228  LYS A C   1 
ATOM   1888 O O   . LYS A 1 246 ? -9.515  -31.765 -34.464 1.00 36.51  ? 228  LYS A O   1 
ATOM   1889 C CB  . LYS A 1 246 ? -9.942  -29.212 -35.981 1.00 37.04  ? 228  LYS A CB  1 
ATOM   1890 C CG  . LYS A 1 246 ? -11.256 -28.550 -36.279 1.00 37.37  ? 228  LYS A CG  1 
ATOM   1891 C CD  . LYS A 1 246 ? -11.633 -28.756 -37.711 1.00 38.98  ? 228  LYS A CD  1 
ATOM   1892 C CE  . LYS A 1 246 ? -12.514 -27.676 -38.181 1.00 38.64  ? 228  LYS A CE  1 
ATOM   1893 N NZ  . LYS A 1 246 ? -12.521 -27.632 -39.659 1.00 43.19  ? 228  LYS A NZ  1 
ATOM   1894 N N   . ASP A 1 247 ? -11.181 -30.866 -33.287 1.00 36.31  ? 229  ASP A N   1 
ATOM   1895 C CA  . ASP A 1 247 ? -11.662 -32.131 -32.746 1.00 37.16  ? 229  ASP A CA  1 
ATOM   1896 C C   . ASP A 1 247 ? -13.155 -32.148 -32.835 1.00 37.28  ? 229  ASP A C   1 
ATOM   1897 O O   . ASP A 1 247 ? -13.808 -31.320 -32.192 1.00 37.86  ? 229  ASP A O   1 
ATOM   1898 C CB  . ASP A 1 247 ? -11.245 -32.286 -31.261 1.00 36.81  ? 229  ASP A CB  1 
ATOM   1899 C CG  . ASP A 1 247 ? -11.636 -33.685 -30.642 1.00 40.32  ? 229  ASP A CG  1 
ATOM   1900 O OD1 . ASP A 1 247 ? -12.399 -34.495 -31.241 1.00 40.65  ? 229  ASP A OD1 1 
ATOM   1901 O OD2 . ASP A 1 247 ? -11.192 -33.959 -29.503 1.00 43.48  ? 229  ASP A OD2 1 
ATOM   1902 N N   . GLY A 1 248 ? -13.691 -33.116 -33.567 1.00 37.08  ? 230  GLY A N   1 
ATOM   1903 C CA  . GLY A 1 248 ? -15.113 -33.239 -33.772 1.00 38.19  ? 230  GLY A CA  1 
ATOM   1904 C C   . GLY A 1 248 ? -15.929 -33.562 -32.551 1.00 38.65  ? 230  GLY A C   1 
ATOM   1905 O O   . GLY A 1 248 ? -17.152 -33.441 -32.562 1.00 39.09  ? 230  GLY A O   1 
ATOM   1906 N N   . LYS A 1 249 ? -15.248 -33.987 -31.498 1.00 38.83  ? 231  LYS A N   1 
ATOM   1907 C CA  . LYS A 1 249 ? -15.875 -34.304 -30.204 1.00 39.90  ? 231  LYS A CA  1 
ATOM   1908 C C   . LYS A 1 249 ? -16.178 -33.057 -29.357 1.00 40.29  ? 231  LYS A C   1 
ATOM   1909 O O   . LYS A 1 249 ? -16.906 -33.141 -28.373 1.00 41.09  ? 231  LYS A O   1 
ATOM   1910 C CB  . LYS A 1 249 ? -14.983 -35.281 -29.424 1.00 39.20  ? 231  LYS A CB  1 
ATOM   1911 C CG  . LYS A 1 249 ? -14.995 -36.711 -30.035 1.00 40.89  ? 231  LYS A CG  1 
ATOM   1912 C CD  . LYS A 1 249 ? -14.256 -37.744 -29.180 1.00 40.76  ? 231  LYS A CD  1 
ATOM   1913 C CE  . LYS A 1 249 ? -12.829 -37.353 -28.886 1.00 40.64  ? 231  LYS A CE  1 
ATOM   1914 N NZ  . LYS A 1 249 ? -12.064 -36.979 -30.117 1.00 44.30  ? 231  LYS A NZ  1 
ATOM   1915 N N   . LEU A 1 250 ? -15.657 -31.898 -29.759 1.00 29.95  ? 232  LEU A N   1 
ATOM   1916 C CA  . LEU A 1 250 ? -15.913 -30.656 -29.018 1.00 30.39  ? 232  LEU A CA  1 
ATOM   1917 C C   . LEU A 1 250 ? -17.396 -30.246 -28.958 1.00 30.24  ? 232  LEU A C   1 
ATOM   1918 O O   . LEU A 1 250 ? -17.902 -29.979 -27.887 1.00 31.60  ? 232  LEU A O   1 
ATOM   1919 C CB  . LEU A 1 250 ? -15.010 -29.504 -29.507 1.00 29.66  ? 232  LEU A CB  1 
ATOM   1920 C CG  . LEU A 1 250 ? -15.421 -28.056 -29.137 1.00 30.77  ? 232  LEU A CG  1 
ATOM   1921 C CD1 . LEU A 1 250 ? -15.156 -27.838 -27.671 1.00 31.80  ? 232  LEU A CD1 1 
ATOM   1922 C CD2 . LEU A 1 250 ? -14.671 -27.015 -29.946 1.00 29.97  ? 232  LEU A CD2 1 
ATOM   1923 N N   . PRO A 1 251 ? -18.094 -30.168 -30.098 1.00 30.48  ? 233  PRO A N   1 
ATOM   1924 C CA  . PRO A 1 251 ? -19.506 -29.826 -30.044 1.00 29.80  ? 233  PRO A CA  1 
ATOM   1925 C C   . PRO A 1 251 ? -20.342 -30.825 -29.286 1.00 30.95  ? 233  PRO A C   1 
ATOM   1926 O O   . PRO A 1 251 ? -21.373 -30.440 -28.711 1.00 31.81  ? 233  PRO A O   1 
ATOM   1927 C CB  . PRO A 1 251 ? -19.906 -29.870 -31.517 1.00 30.82  ? 233  PRO A CB  1 
ATOM   1928 C CG  . PRO A 1 251 ? -18.602 -29.523 -32.244 1.00 31.38  ? 233  PRO A CG  1 
ATOM   1929 C CD  . PRO A 1 251 ? -17.631 -30.329 -31.491 1.00 30.71  ? 233  PRO A CD  1 
ATOM   1930 N N   . LEU A 1 252 ? -19.939 -32.105 -29.330 1.00 30.56  ? 234  LEU A N   1 
ATOM   1931 C CA  . LEU A 1 252 ? -20.607 -33.149 -28.579 1.00 30.68  ? 234  LEU A CA  1 
ATOM   1932 C C   . LEU A 1 252 ? -20.509 -32.977 -27.051 1.00 30.55  ? 234  LEU A C   1 
ATOM   1933 O O   . LEU A 1 252 ? -21.516 -32.976 -26.368 1.00 30.11  ? 234  LEU A O   1 
ATOM   1934 C CB  . LEU A 1 252 ? -20.123 -34.540 -29.043 1.00 31.96  ? 234  LEU A CB  1 
ATOM   1935 C CG  . LEU A 1 252 ? -20.736 -35.717 -28.293 1.00 31.17  ? 234  LEU A CG  1 
ATOM   1936 C CD1 . LEU A 1 252 ? -22.261 -35.795 -28.487 1.00 30.82  ? 234  LEU A CD1 1 
ATOM   1937 C CD2 . LEU A 1 252 ? -20.008 -37.019 -28.657 1.00 32.42  ? 234  LEU A CD2 1 
ATOM   1938 N N   . LEU A 1 253 ? -19.306 -32.788 -26.526 1.00 31.05  ? 235  LEU A N   1 
ATOM   1939 C CA  . LEU A 1 253 ? -19.146 -32.494 -25.091 1.00 31.66  ? 235  LEU A CA  1 
ATOM   1940 C C   . LEU A 1 253 ? -19.923 -31.240 -24.671 1.00 31.60  ? 235  LEU A C   1 
ATOM   1941 O O   . LEU A 1 253 ? -20.632 -31.252 -23.656 1.00 32.65  ? 235  LEU A O   1 
ATOM   1942 C CB  . LEU A 1 253 ? -17.673 -32.339 -24.710 1.00 30.89  ? 235  LEU A CB  1 
ATOM   1943 C CG  . LEU A 1 253 ? -17.368 -32.156 -23.221 1.00 32.08  ? 235  LEU A CG  1 
ATOM   1944 C CD1 . LEU A 1 253 ? -18.143 -33.178 -22.349 1.00 31.24  ? 235  LEU A CD1 1 
ATOM   1945 C CD2 . LEU A 1 253 ? -15.890 -32.329 -22.992 1.00 32.18  ? 235  LEU A CD2 1 
ATOM   1946 N N   . LEU A 1 254 ? -19.801 -30.166 -25.451 1.00 30.79  ? 236  LEU A N   1 
ATOM   1947 C CA  . LEU A 1 254 ? -20.446 -28.922 -25.079 1.00 30.61  ? 236  LEU A CA  1 
ATOM   1948 C C   . LEU A 1 254 ? -21.957 -29.011 -25.070 1.00 31.14  ? 236  LEU A C   1 
ATOM   1949 O O   . LEU A 1 254 ? -22.575 -28.425 -24.198 1.00 32.35  ? 236  LEU A O   1 
ATOM   1950 C CB  . LEU A 1 254 ? -19.997 -27.745 -25.931 1.00 29.33  ? 236  LEU A CB  1 
ATOM   1951 C CG  . LEU A 1 254 ? -18.531 -27.312 -25.874 1.00 31.35  ? 236  LEU A CG  1 
ATOM   1952 C CD1 . LEU A 1 254 ? -18.360 -25.889 -26.401 1.00 30.95  ? 236  LEU A CD1 1 
ATOM   1953 C CD2 . LEU A 1 254 ? -17.883 -27.431 -24.533 1.00 33.24  ? 236  LEU A CD2 1 
ATOM   1954 N N   . SER A 1 255 ? -22.542 -29.710 -26.038 1.00 31.14  ? 237  SER A N   1 
ATOM   1955 C CA  . SER A 1 255 ? -23.977 -29.911 -26.085 1.00 32.95  ? 237  SER A CA  1 
ATOM   1956 C C   . SER A 1 255 ? -24.418 -30.791 -24.933 1.00 34.44  ? 237  SER A C   1 
ATOM   1957 O O   . SER A 1 255 ? -25.471 -30.541 -24.363 1.00 36.03  ? 237  SER A O   1 
ATOM   1958 C CB  . SER A 1 255 ? -24.408 -30.523 -27.429 1.00 34.45  ? 237  SER A CB  1 
ATOM   1959 O OG  . SER A 1 255 ? -23.676 -31.710 -27.706 1.00 36.21  ? 237  SER A OG  1 
ATOM   1960 N N   . ARG A 1 256 ? -23.610 -31.792 -24.558 1.00 34.43  ? 238  ARG A N   1 
ATOM   1961 C CA  . ARG A 1 256 ? -23.883 -32.597 -23.350 1.00 36.70  ? 238  ARG A CA  1 
ATOM   1962 C C   . ARG A 1 256 ? -23.869 -31.753 -22.054 1.00 36.96  ? 238  ARG A C   1 
ATOM   1963 O O   . ARG A 1 256 ? -24.724 -31.936 -21.188 1.00 37.56  ? 238  ARG A O   1 
ATOM   1964 C CB  . ARG A 1 256 ? -22.923 -33.778 -23.233 1.00 35.59  ? 238  ARG A CB  1 
ATOM   1965 C CG  . ARG A 1 256 ? -23.143 -34.850 -24.272 1.00 37.50  ? 238  ARG A CG  1 
ATOM   1966 C CD  . ARG A 1 256 ? -22.435 -36.179 -23.890 1.00 41.63  ? 238  ARG A CD  1 
ATOM   1967 N NE  . ARG A 1 256 ? -22.347 -36.446 -22.427 1.00 49.17  ? 238  ARG A NE  1 
ATOM   1968 C CZ  . ARG A 1 256 ? -22.927 -37.481 -21.797 1.00 52.09  ? 238  ARG A CZ  1 
ATOM   1969 N NH1 . ARG A 1 256 ? -23.639 -38.366 -22.484 1.00 51.93  ? 238  ARG A NH1 1 
ATOM   1970 N NH2 . ARG A 1 256 ? -22.790 -37.643 -20.480 1.00 51.45  ? 238  ARG A NH2 1 
ATOM   1971 N N   . MET A 1 257 ? -22.908 -30.834 -21.932 1.00 35.82  ? 239  MET A N   1 
ATOM   1972 C CA  . MET A 1 257 ? -22.848 -29.916 -20.782 1.00 37.60  ? 239  MET A CA  1 
ATOM   1973 C C   . MET A 1 257 ? -24.051 -28.980 -20.688 1.00 38.58  ? 239  MET A C   1 
ATOM   1974 O O   . MET A 1 257 ? -24.575 -28.735 -19.594 1.00 39.80  ? 239  MET A O   1 
ATOM   1975 C CB  . MET A 1 257 ? -21.586 -29.044 -20.853 1.00 35.99  ? 239  MET A CB  1 
ATOM   1976 C CG  . MET A 1 257 ? -20.334 -29.783 -20.490 1.00 36.69  ? 239  MET A CG  1 
ATOM   1977 S SD  . MET A 1 257 ? -18.961 -28.760 -20.964 1.00 36.89  ? 239  MET A SD  1 
ATOM   1978 C CE  . MET A 1 257 ? -17.635 -29.722 -20.212 1.00 34.72  ? 239  MET A CE  1 
ATOM   1979 N N   . LYS A 1 258 ? -24.458 -28.449 -21.837 1.00 38.58  ? 240  LYS A N   1 
ATOM   1980 C CA  . LYS A 1 258 ? -25.622 -27.581 -21.944 1.00 41.14  ? 240  LYS A CA  1 
ATOM   1981 C C   . LYS A 1 258 ? -26.947 -28.298 -21.614 1.00 42.87  ? 240  LYS A C   1 
ATOM   1982 O O   . LYS A 1 258 ? -27.922 -27.645 -21.279 1.00 44.52  ? 240  LYS A O   1 
ATOM   1983 C CB  . LYS A 1 258 ? -25.658 -26.907 -23.332 1.00 40.08  ? 240  LYS A CB  1 
ATOM   1984 C CG  . LYS A 1 258 ? -26.528 -25.647 -23.400 1.00 43.07  ? 240  LYS A CG  1 
ATOM   1985 C CD  . LYS A 1 258 ? -25.813 -24.501 -24.111 1.00 42.80  ? 240  LYS A CD  1 
ATOM   1986 C CE  . LYS A 1 258 ? -26.721 -23.848 -25.145 1.00 45.25  ? 240  LYS A CE  1 
ATOM   1987 N NZ  . LYS A 1 258 ? -27.644 -22.839 -24.566 1.00 47.07  ? 240  LYS A NZ  1 
ATOM   1988 N N   . GLU A 1 259 ? -26.976 -29.627 -21.679 1.00 44.00  ? 241  GLU A N   1 
ATOM   1989 C CA  . GLU A 1 259 ? -28.113 -30.411 -21.177 1.00 46.50  ? 241  GLU A CA  1 
ATOM   1990 C C   . GLU A 1 259 ? -28.265 -30.338 -19.658 1.00 47.08  ? 241  GLU A C   1 
ATOM   1991 O O   . GLU A 1 259 ? -29.384 -30.367 -19.136 1.00 48.15  ? 241  GLU A O   1 
ATOM   1992 C CB  . GLU A 1 259 ? -27.967 -31.874 -21.576 1.00 46.95  ? 241  GLU A CB  1 
ATOM   1993 C CG  . GLU A 1 259 ? -28.443 -32.198 -22.983 1.00 49.33  ? 241  GLU A CG  1 
ATOM   1994 C CD  . GLU A 1 259 ? -27.868 -33.515 -23.532 1.00 50.39  ? 241  GLU A CD  1 
ATOM   1995 O OE1 . GLU A 1 259 ? -27.673 -34.477 -22.726 1.00 55.04  ? 241  GLU A OE1 1 
ATOM   1996 O OE2 . GLU A 1 259 ? -27.620 -33.575 -24.777 1.00 52.73  ? 241  GLU A OE2 1 
ATOM   1997 N N   . VAL A 1 260 ? -27.140 -30.256 -18.946 1.00 46.08  ? 242  VAL A N   1 
ATOM   1998 C CA  . VAL A 1 260 ? -27.149 -30.369 -17.489 1.00 45.95  ? 242  VAL A CA  1 
ATOM   1999 C C   . VAL A 1 260 ? -26.891 -29.070 -16.751 1.00 45.51  ? 242  VAL A C   1 
ATOM   2000 O O   . VAL A 1 260 ? -27.095 -29.002 -15.542 1.00 46.58  ? 242  VAL A O   1 
ATOM   2001 C CB  . VAL A 1 260 ? -26.190 -31.498 -16.959 1.00 46.54  ? 242  VAL A CB  1 
ATOM   2002 C CG1 . VAL A 1 260 ? -26.632 -32.862 -17.470 1.00 48.22  ? 242  VAL A CG1 1 
ATOM   2003 C CG2 . VAL A 1 260 ? -24.728 -31.251 -17.309 1.00 42.62  ? 242  VAL A CG2 1 
ATOM   2004 N N   . GLY A 1 261 ? -26.464 -28.035 -17.473 1.00 43.08  ? 243  GLY A N   1 
ATOM   2005 C CA  . GLY A 1 261 ? -26.207 -26.734 -16.864 1.00 42.04  ? 243  GLY A CA  1 
ATOM   2006 C C   . GLY A 1 261 ? -25.972 -25.653 -17.905 1.00 40.54  ? 243  GLY A C   1 
ATOM   2007 O O   . GLY A 1 261 ? -26.156 -25.900 -19.090 1.00 40.51  ? 243  GLY A O   1 
ATOM   2008 N N   . LYS A 1 262 ? -25.568 -24.458 -17.482 1.00 39.03  ? 244  LYS A N   1 
ATOM   2009 C CA  . LYS A 1 262 ? -25.195 -23.416 -18.444 1.00 37.66  ? 244  LYS A CA  1 
ATOM   2010 C C   . LYS A 1 262 ? -23.727 -23.501 -18.851 1.00 35.16  ? 244  LYS A C   1 
ATOM   2011 O O   . LYS A 1 262 ? -22.893 -23.939 -18.060 1.00 35.00  ? 244  LYS A O   1 
ATOM   2012 C CB  . LYS A 1 262 ? -25.500 -21.998 -17.916 1.00 38.63  ? 244  LYS A CB  1 
ATOM   2013 C CG  . LYS A 1 262 ? -26.768 -21.912 -17.115 1.00 42.76  ? 244  LYS A CG  1 
ATOM   2014 C CD  . LYS A 1 262 ? -27.609 -20.781 -17.569 1.00 49.27  ? 244  LYS A CD  1 
ATOM   2015 C CE  . LYS A 1 262 ? -28.857 -20.710 -16.716 1.00 53.96  ? 244  LYS A CE  1 
ATOM   2016 N NZ  . LYS A 1 262 ? -29.724 -19.629 -17.229 1.00 57.74  ? 244  LYS A NZ  1 
ATOM   2017 N N   . VAL A 1 263 ? -23.438 -23.056 -20.079 1.00 32.57  ? 245  VAL A N   1 
ATOM   2018 C CA  . VAL A 1 263 ? -22.090 -22.989 -20.625 1.00 29.79  ? 245  VAL A CA  1 
ATOM   2019 C C   . VAL A 1 263 ? -21.754 -21.540 -20.978 1.00 29.00  ? 245  VAL A C   1 
ATOM   2020 O O   . VAL A 1 263 ? -22.580 -20.814 -21.561 1.00 29.33  ? 245  VAL A O   1 
ATOM   2021 C CB  . VAL A 1 263 ? -21.920 -23.931 -21.863 1.00 29.55  ? 245  VAL A CB  1 
ATOM   2022 C CG1 . VAL A 1 263 ? -20.478 -23.928 -22.379 1.00 26.07  ? 245  VAL A CG1 1 
ATOM   2023 C CG2 . VAL A 1 263 ? -22.349 -25.375 -21.493 1.00 29.70  ? 245  VAL A CG2 1 
ATOM   2024 N N   . PHE A 1 264 ? -20.552 -21.118 -20.606 1.00 27.24  ? 246  PHE A N   1 
ATOM   2025 C CA  . PHE A 1 264 ? -20.078 -19.801 -20.946 1.00 25.78  ? 246  PHE A CA  1 
ATOM   2026 C C   . PHE A 1 264 ? -18.609 -19.782 -21.435 1.00 25.07  ? 246  PHE A C   1 
ATOM   2027 O O   . PHE A 1 264 ? -17.805 -20.686 -21.144 1.00 23.79  ? 246  PHE A O   1 
ATOM   2028 C CB  . PHE A 1 264 ? -20.365 -18.785 -19.802 1.00 26.76  ? 246  PHE A CB  1 
ATOM   2029 C CG  . PHE A 1 264 ? -19.445 -18.888 -18.594 1.00 26.25  ? 246  PHE A CG  1 
ATOM   2030 C CD1 . PHE A 1 264 ? -18.284 -18.125 -18.514 1.00 26.61  ? 246  PHE A CD1 1 
ATOM   2031 C CD2 . PHE A 1 264 ? -19.768 -19.703 -17.520 1.00 27.69  ? 246  PHE A CD2 1 
ATOM   2032 C CE1 . PHE A 1 264 ? -17.435 -18.187 -17.394 1.00 25.43  ? 246  PHE A CE1 1 
ATOM   2033 C CE2 . PHE A 1 264 ? -18.941 -19.775 -16.397 1.00 28.78  ? 246  PHE A CE2 1 
ATOM   2034 C CZ  . PHE A 1 264 ? -17.781 -19.000 -16.329 1.00 28.25  ? 246  PHE A CZ  1 
ATOM   2035 N N   . LEU A 1 265 ? -18.307 -18.765 -22.230 1.00 25.05  ? 247  LEU A N   1 
ATOM   2036 C CA  . LEU A 1 265 ? -16.975 -18.479 -22.718 1.00 24.93  ? 247  LEU A CA  1 
ATOM   2037 C C   . LEU A 1 265 ? -16.528 -17.133 -22.109 1.00 25.36  ? 247  LEU A C   1 
ATOM   2038 O O   . LEU A 1 265 ? -17.235 -16.138 -22.208 1.00 24.79  ? 247  LEU A O   1 
ATOM   2039 C CB  . LEU A 1 265 ? -16.985 -18.398 -24.256 1.00 24.36  ? 247  LEU A CB  1 
ATOM   2040 C CG  . LEU A 1 265 ? -15.584 -18.231 -24.880 1.00 26.50  ? 247  LEU A CG  1 
ATOM   2041 C CD1 . LEU A 1 265 ? -14.810 -19.582 -24.827 1.00 25.85  ? 247  LEU A CD1 1 
ATOM   2042 C CD2 . LEU A 1 265 ? -15.656 -17.729 -26.282 1.00 24.54  ? 247  LEU A CD2 1 
ATOM   2043 N N   . ALA A 1 266 ? -15.373 -17.101 -21.451 1.00 26.57  ? 248  ALA A N   1 
ATOM   2044 C CA  . ALA A 1 266 ? -14.771 -15.801 -21.082 1.00 27.72  ? 248  ALA A CA  1 
ATOM   2045 C C   . ALA A 1 266 ? -13.364 -15.800 -21.597 1.00 28.00  ? 248  ALA A C   1 
ATOM   2046 O O   . ALA A 1 266 ? -12.542 -16.605 -21.183 1.00 29.21  ? 248  ALA A O   1 
ATOM   2047 C CB  . ALA A 1 266 ? -14.838 -15.551 -19.546 1.00 27.97  ? 248  ALA A CB  1 
ATOM   2048 N N   . THR A 1 267 ? -13.083 -14.930 -22.555 1.00 28.61  ? 249  THR A N   1 
ATOM   2049 C CA  . THR A 1 267 ? -11.752 -14.905 -23.154 1.00 28.73  ? 249  THR A CA  1 
ATOM   2050 C C   . THR A 1 267 ? -11.130 -13.488 -23.150 1.00 28.93  ? 249  THR A C   1 
ATOM   2051 O O   . THR A 1 267 ? -11.851 -12.489 -23.169 1.00 28.89  ? 249  THR A O   1 
ATOM   2052 C CB  . THR A 1 267 ? -11.749 -15.588 -24.569 1.00 28.07  ? 249  THR A CB  1 
ATOM   2053 O OG1 . THR A 1 267 ? -10.472 -15.431 -25.196 1.00 29.31  ? 249  THR A OG1 1 
ATOM   2054 C CG2 . THR A 1 267 ? -12.787 -14.990 -25.502 1.00 28.26  ? 249  THR A CG2 1 
ATOM   2055 N N   . ASN A 1 268 ? -9.797  -13.410 -23.114 1.00 29.04  ? 250  ASN A N   1 
ATOM   2056 C CA  . ASN A 1 268 ? -9.095  -12.132 -23.269 1.00 29.32  ? 250  ASN A CA  1 
ATOM   2057 C C   . ASN A 1 268 ? -9.042  -11.613 -24.701 1.00 29.44  ? 250  ASN A C   1 
ATOM   2058 O O   . ASN A 1 268 ? -8.812  -10.423 -24.929 1.00 29.75  ? 250  ASN A O   1 
ATOM   2059 C CB  . ASN A 1 268 ? -7.684  -12.230 -22.726 1.00 29.69  ? 250  ASN A CB  1 
ATOM   2060 C CG  . ASN A 1 268 ? -7.630  -12.011 -21.237 1.00 31.73  ? 250  ASN A CG  1 
ATOM   2061 O OD1 . ASN A 1 268 ? -8.639  -12.128 -20.551 1.00 33.55  ? 250  ASN A OD1 1 
ATOM   2062 N ND2 . ASN A 1 268 ? -6.454  -11.660 -20.725 1.00 32.28  ? 250  ASN A ND2 1 
ATOM   2063 N N   . SER A 1 269 ? -9.229  -12.510 -25.666 1.00 29.39  ? 251  SER A N   1 
ATOM   2064 C CA  . SER A 1 269 ? -9.221  -12.140 -27.093 1.00 30.68  ? 251  SER A CA  1 
ATOM   2065 C C   . SER A 1 269 ? -10.379 -11.215 -27.446 1.00 29.39  ? 251  SER A C   1 
ATOM   2066 O O   . SER A 1 269 ? -11.429 -11.253 -26.819 1.00 29.31  ? 251  SER A O   1 
ATOM   2067 C CB  . SER A 1 269 ? -9.340  -13.406 -27.974 1.00 30.00  ? 251  SER A CB  1 
ATOM   2068 O OG  . SER A 1 269 ? -8.355  -14.328 -27.597 1.00 36.41  ? 251  SER A OG  1 
ATOM   2069 N N   . ASP A 1 270 ? -10.205 -10.441 -28.501 1.00 30.07  ? 252  ASP A N   1 
ATOM   2070 C CA  . ASP A 1 270 ? -11.274 -9.605  -28.996 1.00 31.03  ? 252  ASP A CA  1 
ATOM   2071 C C   . ASP A 1 270 ? -12.273 -10.474 -29.763 1.00 30.08  ? 252  ASP A C   1 
ATOM   2072 O O   . ASP A 1 270 ? -12.030 -11.656 -29.960 1.00 30.15  ? 252  ASP A O   1 
ATOM   2073 C CB  . ASP A 1 270 ? -10.713 -8.490  -29.886 1.00 32.81  ? 252  ASP A CB  1 
ATOM   2074 C CG  . ASP A 1 270 ? -10.046 -9.018  -31.163 1.00 35.84  ? 252  ASP A CG  1 
ATOM   2075 O OD1 . ASP A 1 270 ? -10.497 -9.989  -31.786 1.00 38.99  ? 252  ASP A OD1 1 
ATOM   2076 O OD2 . ASP A 1 270 ? -9.048  -8.422  -31.574 1.00 44.82  ? 252  ASP A OD2 1 
ATOM   2077 N N   . TYR A 1 271 ? -13.364 -9.876  -30.212 1.00 29.59  ? 253  TYR A N   1 
ATOM   2078 C CA  . TYR A 1 271 ? -14.411 -10.605 -30.864 1.00 29.89  ? 253  TYR A CA  1 
ATOM   2079 C C   . TYR A 1 271 ? -14.068 -11.200 -32.217 1.00 29.92  ? 253  TYR A C   1 
ATOM   2080 O O   . TYR A 1 271 ? -14.468 -12.340 -32.497 1.00 31.01  ? 253  TYR A O   1 
ATOM   2081 C CB  . TYR A 1 271 ? -15.708 -9.805  -30.973 1.00 30.75  ? 253  TYR A CB  1 
ATOM   2082 C CG  . TYR A 1 271 ? -16.817 -10.687 -31.539 1.00 30.66  ? 253  TYR A CG  1 
ATOM   2083 C CD1 . TYR A 1 271 ? -17.339 -11.741 -30.787 1.00 29.40  ? 253  TYR A CD1 1 
ATOM   2084 C CD2 . TYR A 1 271 ? -17.312 -10.487 -32.843 1.00 30.95  ? 253  TYR A CD2 1 
ATOM   2085 C CE1 . TYR A 1 271 ? -18.352 -12.584 -31.316 1.00 31.00  ? 253  TYR A CE1 1 
ATOM   2086 C CE2 . TYR A 1 271 ? -18.311 -11.299 -33.363 1.00 30.10  ? 253  TYR A CE2 1 
ATOM   2087 C CZ  . TYR A 1 271 ? -18.831 -12.333 -32.600 1.00 30.21  ? 253  TYR A CZ  1 
ATOM   2088 O OH  . TYR A 1 271 ? -19.805 -13.139 -33.130 1.00 31.72  ? 253  TYR A OH  1 
ATOM   2089 N N   . LYS A 1 272 ? -13.339 -10.465 -33.044 1.00 29.74  ? 254  LYS A N   1 
ATOM   2090 C CA  . LYS A 1 272 ? -13.005 -10.944 -34.362 1.00 31.02  ? 254  LYS A CA  1 
ATOM   2091 C C   . LYS A 1 272 ? -12.087 -12.163 -34.337 1.00 30.41  ? 254  LYS A C   1 
ATOM   2092 O O   . LYS A 1 272 ? -12.261 -13.073 -35.126 1.00 30.60  ? 254  LYS A O   1 
ATOM   2093 C CB  . LYS A 1 272 ? -12.368 -9.851  -35.198 1.00 32.71  ? 254  LYS A CB  1 
ATOM   2094 C CG  . LYS A 1 272 ? -13.385 -8.882  -35.800 1.00 38.30  ? 254  LYS A CG  1 
ATOM   2095 C CD  . LYS A 1 272 ? -12.679 -7.667  -36.407 1.00 44.38  ? 254  LYS A CD  1 
ATOM   2096 C CE  . LYS A 1 272 ? -13.622 -6.818  -37.245 1.00 49.31  ? 254  LYS A CE  1 
ATOM   2097 N NZ  . LYS A 1 272 ? -14.247 -7.613  -38.341 1.00 52.08  ? 254  LYS A NZ  1 
ATOM   2098 N N   . TYR A 1 273 ? -11.074 -12.144 -33.473 1.00 29.75  ? 255  TYR A N   1 
ATOM   2099 C CA  . TYR A 1 273 ? -10.195 -13.273 -33.348 1.00 29.24  ? 255  TYR A CA  1 
ATOM   2100 C C   . TYR A 1 273 ? -10.975 -14.512 -32.824 1.00 28.02  ? 255  TYR A C   1 
ATOM   2101 O O   . TYR A 1 273 ? -10.821 -15.609 -33.346 1.00 27.87  ? 255  TYR A O   1 
ATOM   2102 C CB  . TYR A 1 273 ? -8.980  -12.924 -32.472 1.00 28.48  ? 255  TYR A CB  1 
ATOM   2103 C CG  . TYR A 1 273 ? -7.973  -14.052 -32.392 1.00 29.41  ? 255  TYR A CG  1 
ATOM   2104 C CD1 . TYR A 1 273 ? -7.198  -14.402 -33.503 1.00 29.38  ? 255  TYR A CD1 1 
ATOM   2105 C CD2 . TYR A 1 273 ? -7.820  -14.804 -31.210 1.00 28.42  ? 255  TYR A CD2 1 
ATOM   2106 C CE1 . TYR A 1 273 ? -6.276  -15.430 -33.425 1.00 29.72  ? 255  TYR A CE1 1 
ATOM   2107 C CE2 . TYR A 1 273 ? -6.905  -15.829 -31.121 1.00 26.80  ? 255  TYR A CE2 1 
ATOM   2108 C CZ  . TYR A 1 273 ? -6.133  -16.141 -32.232 1.00 30.40  ? 255  TYR A CZ  1 
ATOM   2109 O OH  . TYR A 1 273 ? -5.202  -17.170 -32.156 1.00 30.84  ? 255  TYR A OH  1 
ATOM   2110 N N   . THR A 1 274 ? -11.809 -14.309 -31.808 1.00 27.41  ? 256  THR A N   1 
ATOM   2111 C CA  . THR A 1 274 ? -12.571 -15.373 -31.159 1.00 26.24  ? 256  THR A CA  1 
ATOM   2112 C C   . THR A 1 274 ? -13.490 -16.025 -32.156 1.00 26.04  ? 256  THR A C   1 
ATOM   2113 O O   . THR A 1 274 ? -13.573 -17.243 -32.229 1.00 25.46  ? 256  THR A O   1 
ATOM   2114 C CB  . THR A 1 274 ? -13.425 -14.776 -30.022 1.00 26.52  ? 256  THR A CB  1 
ATOM   2115 O OG1 . THR A 1 274 ? -12.555 -14.117 -29.097 1.00 25.78  ? 256  THR A OG1 1 
ATOM   2116 C CG2 . THR A 1 274 ? -14.270 -15.845 -29.302 1.00 23.77  ? 256  THR A CG2 1 
ATOM   2117 N N   . ASP A 1 275 ? -14.178 -15.192 -32.938 1.00 27.32  ? 257  ASP A N   1 
ATOM   2118 C CA  . ASP A 1 275 ? -15.091 -15.668 -33.972 1.00 27.07  ? 257  ASP A CA  1 
ATOM   2119 C C   . ASP A 1 275 ? -14.374 -16.501 -35.064 1.00 28.13  ? 257  ASP A C   1 
ATOM   2120 O O   . ASP A 1 275 ? -14.833 -17.610 -35.448 1.00 26.06  ? 257  ASP A O   1 
ATOM   2121 C CB  . ASP A 1 275 ? -15.836 -14.478 -34.559 1.00 27.69  ? 257  ASP A CB  1 
ATOM   2122 C CG  . ASP A 1 275 ? -16.988 -14.888 -35.430 1.00 28.90  ? 257  ASP A CG  1 
ATOM   2123 O OD1 . ASP A 1 275 ? -17.537 -15.991 -35.269 1.00 26.91  ? 257  ASP A OD1 1 
ATOM   2124 O OD2 . ASP A 1 275 ? -17.353 -14.099 -36.306 1.00 34.76  ? 257  ASP A OD2 1 
ATOM   2125 N N   . LYS A 1 276 ? -13.245 -15.978 -35.560 1.00 28.74  ? 258  LYS A N   1 
ATOM   2126 C CA  . LYS A 1 276 ? -12.468 -16.744 -36.522 1.00 30.51  ? 258  LYS A CA  1 
ATOM   2127 C C   . LYS A 1 276 ? -12.050 -18.105 -35.968 1.00 29.61  ? 258  LYS A C   1 
ATOM   2128 O O   . LYS A 1 276 ? -12.235 -19.130 -36.621 1.00 30.98  ? 258  LYS A O   1 
ATOM   2129 C CB  . LYS A 1 276 ? -11.254 -15.953 -37.005 1.00 31.72  ? 258  LYS A CB  1 
ATOM   2130 C CG  . LYS A 1 276 ? -11.587 -15.012 -38.137 1.00 36.53  ? 258  LYS A CG  1 
ATOM   2131 C CD  . LYS A 1 276 ? -10.351 -14.218 -38.499 1.00 45.80  ? 258  LYS A CD  1 
ATOM   2132 C CE  . LYS A 1 276 ? -10.680 -12.782 -38.939 1.00 52.21  ? 258  LYS A CE  1 
ATOM   2133 N NZ  . LYS A 1 276 ? -11.052 -12.788 -40.386 1.00 57.58  ? 258  LYS A NZ  1 
ATOM   2134 N N   . ILE A 1 277 ? -11.484 -18.120 -34.768 1.00 28.51  ? 259  ILE A N   1 
ATOM   2135 C CA  . ILE A 1 277 ? -11.048 -19.369 -34.125 1.00 27.96  ? 259  ILE A CA  1 
ATOM   2136 C C   . ILE A 1 277 ? -12.213 -20.310 -33.806 1.00 26.88  ? 259  ILE A C   1 
ATOM   2137 O O   . ILE A 1 277 ? -12.205 -21.478 -34.156 1.00 26.12  ? 259  ILE A O   1 
ATOM   2138 C CB  . ILE A 1 277 ? -10.257 -19.063 -32.827 1.00 28.22  ? 259  ILE A CB  1 
ATOM   2139 C CG1 . ILE A 1 277 ? -8.987  -18.273 -33.178 1.00 27.70  ? 259  ILE A CG1 1 
ATOM   2140 C CG2 . ILE A 1 277 ? -9.988  -20.388 -32.004 1.00 27.20  ? 259  ILE A CG2 1 
ATOM   2141 C CD1 . ILE A 1 277 ? -7.917  -19.071 -33.870 1.00 25.03  ? 259  ILE A CD1 1 
ATOM   2142 N N   . MET A 1 278 ? -13.231 -19.775 -33.153 1.00 26.64  ? 260  MET A N   1 
ATOM   2143 C CA  . MET A 1 278 ? -14.352 -20.601 -32.769 1.00 26.63  ? 260  MET A CA  1 
ATOM   2144 C C   . MET A 1 278 ? -15.116 -21.143 -33.971 1.00 26.58  ? 260  MET A C   1 
ATOM   2145 O O   . MET A 1 278 ? -15.619 -22.248 -33.887 1.00 26.43  ? 260  MET A O   1 
ATOM   2146 C CB  . MET A 1 278 ? -15.287 -19.835 -31.845 1.00 26.09  ? 260  MET A CB  1 
ATOM   2147 C CG  . MET A 1 278 ? -14.677 -19.470 -30.492 1.00 26.35  ? 260  MET A CG  1 
ATOM   2148 S SD  . MET A 1 278 ? -14.241 -20.838 -29.415 1.00 30.36  ? 260  MET A SD  1 
ATOM   2149 C CE  . MET A 1 278 ? -15.852 -21.496 -28.975 1.00 29.35  ? 260  MET A CE  1 
ATOM   2150 N N   . THR A 1 279 ? -15.246 -20.360 -35.054 1.00 26.59  ? 261  THR A N   1 
ATOM   2151 C CA  . THR A 1 279 ? -15.878 -20.865 -36.272 1.00 27.00  ? 261  THR A CA  1 
ATOM   2152 C C   . THR A 1 279 ? -15.100 -22.061 -36.807 1.00 27.34  ? 261  THR A C   1 
ATOM   2153 O O   . THR A 1 279 ? -15.687 -23.055 -37.202 1.00 28.20  ? 261  THR A O   1 
ATOM   2154 C CB  . THR A 1 279 ? -15.993 -19.797 -37.368 1.00 27.37  ? 261  THR A CB  1 
ATOM   2155 O OG1 . THR A 1 279 ? -16.816 -18.733 -36.892 1.00 30.11  ? 261  THR A OG1 1 
ATOM   2156 C CG2 . THR A 1 279 ? -16.585 -20.366 -38.687 1.00 26.78  ? 261  THR A CG2 1 
ATOM   2157 N N   . TYR A 1 280 ? -13.774 -21.945 -36.856 1.00 27.48  ? 262  TYR A N   1 
ATOM   2158 C CA  . TYR A 1 280 ? -12.934 -23.067 -37.296 1.00 27.57  ? 262  TYR A CA  1 
ATOM   2159 C C   . TYR A 1 280 ? -13.113 -24.336 -36.413 1.00 26.36  ? 262  TYR A C   1 
ATOM   2160 O O   . TYR A 1 280 ? -13.162 -25.420 -36.902 1.00 26.22  ? 262  TYR A O   1 
ATOM   2161 C CB  . TYR A 1 280 ? -11.472 -22.623 -37.365 1.00 27.48  ? 262  TYR A CB  1 
ATOM   2162 C CG  . TYR A 1 280 ? -10.464 -23.765 -37.439 1.00 28.02  ? 262  TYR A CG  1 
ATOM   2163 C CD1 . TYR A 1 280 ? -10.118 -24.356 -38.670 1.00 26.47  ? 262  TYR A CD1 1 
ATOM   2164 C CD2 . TYR A 1 280 ? -9.829  -24.227 -36.285 1.00 25.39  ? 262  TYR A CD2 1 
ATOM   2165 C CE1 . TYR A 1 280 ? -9.182  -25.395 -38.732 1.00 26.81  ? 262  TYR A CE1 1 
ATOM   2166 C CE2 . TYR A 1 280 ? -8.902  -25.229 -36.351 1.00 27.11  ? 262  TYR A CE2 1 
ATOM   2167 C CZ  . TYR A 1 280 ? -8.580  -25.804 -37.580 1.00 28.33  ? 262  TYR A CZ  1 
ATOM   2168 O OH  . TYR A 1 280 ? -7.655  -26.811 -37.613 1.00 30.91  ? 262  TYR A OH  1 
ATOM   2169 N N   . LEU A 1 281 ? -13.232 -24.162 -35.106 1.00 25.82  ? 263  LEU A N   1 
ATOM   2170 C CA  . LEU A 1 281 ? -13.334 -25.270 -34.192 1.00 24.79  ? 263  LEU A CA  1 
ATOM   2171 C C   . LEU A 1 281 ? -14.666 -26.022 -34.323 1.00 25.94  ? 263  LEU A C   1 
ATOM   2172 O O   . LEU A 1 281 ? -14.723 -27.206 -33.992 1.00 26.96  ? 263  LEU A O   1 
ATOM   2173 C CB  . LEU A 1 281 ? -13.129 -24.793 -32.742 1.00 24.41  ? 263  LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 281 ? -11.775 -24.253 -32.227 1.00 22.15  ? 263  LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 281 ? -11.939 -23.880 -30.746 1.00 21.83  ? 263  LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 281 ? -10.665 -25.251 -32.391 1.00 23.04  ? 263  LEU A CD2 1 
ATOM   2177 N N   . PHE A 1 282 ? -15.709 -25.339 -34.810 1.00 25.58  ? 264  PHE A N   1 
ATOM   2178 C CA  . PHE A 1 282 ? -17.023 -25.928 -35.045 1.00 26.19  ? 264  PHE A CA  1 
ATOM   2179 C C   . PHE A 1 282 ? -17.255 -26.263 -36.504 1.00 27.33  ? 264  PHE A C   1 
ATOM   2180 O O   . PHE A 1 282 ? -18.308 -26.784 -36.864 1.00 27.35  ? 264  PHE A O   1 
ATOM   2181 C CB  . PHE A 1 282 ? -18.138 -25.051 -34.461 1.00 25.35  ? 264  PHE A CB  1 
ATOM   2182 C CG  . PHE A 1 282 ? -18.172 -25.090 -32.967 1.00 27.47  ? 264  PHE A CG  1 
ATOM   2183 C CD1 . PHE A 1 282 ? -19.092 -25.891 -32.303 1.00 28.26  ? 264  PHE A CD1 1 
ATOM   2184 C CD2 . PHE A 1 282 ? -17.224 -24.375 -32.209 1.00 28.60  ? 264  PHE A CD2 1 
ATOM   2185 C CE1 . PHE A 1 282 ? -19.112 -25.955 -30.904 1.00 29.30  ? 264  PHE A CE1 1 
ATOM   2186 C CE2 . PHE A 1 282 ? -17.246 -24.423 -30.835 1.00 29.28  ? 264  PHE A CE2 1 
ATOM   2187 C CZ  . PHE A 1 282 ? -18.190 -25.218 -30.173 1.00 27.86  ? 264  PHE A CZ  1 
ATOM   2188 N N   . ASP A 1 283 ? -16.237 -26.026 -37.328 1.00 28.33  ? 265  ASP A N   1 
ATOM   2189 C CA  . ASP A 1 283 ? -16.367 -26.260 -38.755 1.00 30.29  ? 265  ASP A CA  1 
ATOM   2190 C C   . ASP A 1 283 ? -16.286 -27.739 -39.156 1.00 30.51  ? 265  ASP A C   1 
ATOM   2191 O O   . ASP A 1 283 ? -15.236 -28.257 -39.561 1.00 30.69  ? 265  ASP A O   1 
ATOM   2192 C CB  . ASP A 1 283 ? -15.396 -25.385 -39.557 1.00 31.21  ? 265  ASP A CB  1 
ATOM   2193 C CG  . ASP A 1 283 ? -15.528 -25.605 -41.076 1.00 35.92  ? 265  ASP A CG  1 
ATOM   2194 O OD1 . ASP A 1 283 ? -16.656 -25.883 -41.584 1.00 35.44  ? 265  ASP A OD1 1 
ATOM   2195 O OD2 . ASP A 1 283 ? -14.485 -25.491 -41.756 1.00 41.40  ? 265  ASP A OD2 1 
ATOM   2196 N N   . PHE A 1 284 ? -17.436 -28.395 -39.053 1.00 30.89  ? 266  PHE A N   1 
ATOM   2197 C CA  . PHE A 1 284 ? -17.612 -29.784 -39.430 1.00 30.96  ? 266  PHE A CA  1 
ATOM   2198 C C   . PHE A 1 284 ? -18.873 -29.807 -40.248 1.00 32.21  ? 266  PHE A C   1 
ATOM   2199 O O   . PHE A 1 284 ? -19.666 -28.873 -40.169 1.00 32.52  ? 266  PHE A O   1 
ATOM   2200 C CB  . PHE A 1 284 ? -17.747 -30.697 -38.196 1.00 31.03  ? 266  PHE A CB  1 
ATOM   2201 C CG  . PHE A 1 284 ? -16.505 -30.753 -37.356 1.00 30.08  ? 266  PHE A CG  1 
ATOM   2202 C CD1 . PHE A 1 284 ? -15.459 -31.620 -37.692 1.00 31.69  ? 266  PHE A CD1 1 
ATOM   2203 C CD2 . PHE A 1 284 ? -16.373 -29.921 -36.257 1.00 27.16  ? 266  PHE A CD2 1 
ATOM   2204 C CE1 . PHE A 1 284 ? -14.292 -31.649 -36.919 1.00 32.33  ? 266  PHE A CE1 1 
ATOM   2205 C CE2 . PHE A 1 284 ? -15.230 -29.936 -35.477 1.00 28.10  ? 266  PHE A CE2 1 
ATOM   2206 C CZ  . PHE A 1 284 ? -14.184 -30.788 -35.804 1.00 28.32  ? 266  PHE A CZ  1 
ATOM   2207 N N   . PRO A 1 285 ? -19.054 -30.835 -41.083 1.00 33.34  ? 267  PRO A N   1 
ATOM   2208 C CA  . PRO A 1 285 ? -20.317 -30.864 -41.790 1.00 35.08  ? 267  PRO A CA  1 
ATOM   2209 C C   . PRO A 1 285 ? -21.423 -31.436 -40.886 1.00 35.51  ? 267  PRO A C   1 
ATOM   2210 O O   . PRO A 1 285 ? -22.199 -32.266 -41.318 1.00 37.46  ? 267  PRO A O   1 
ATOM   2211 C CB  . PRO A 1 285 ? -20.021 -31.789 -42.990 1.00 36.04  ? 267  PRO A CB  1 
ATOM   2212 C CG  . PRO A 1 285 ? -19.003 -32.730 -42.487 1.00 35.73  ? 267  PRO A CG  1 
ATOM   2213 C CD  . PRO A 1 285 ? -18.169 -31.949 -41.468 1.00 34.08  ? 267  PRO A CD  1 
ATOM   2214 N N   . HIS A 1 286 ? -21.496 -30.985 -39.638 1.00 34.20  ? 268  HIS A N   1 
ATOM   2215 C CA  . HIS A 1 286 ? -22.428 -31.572 -38.682 1.00 33.18  ? 268  HIS A CA  1 
ATOM   2216 C C   . HIS A 1 286 ? -22.332 -30.802 -37.390 1.00 31.52  ? 268  HIS A C   1 
ATOM   2217 O O   . HIS A 1 286 ? -21.418 -29.998 -37.208 1.00 30.62  ? 268  HIS A O   1 
ATOM   2218 C CB  . HIS A 1 286 ? -22.177 -33.085 -38.471 1.00 33.28  ? 268  HIS A CB  1 
ATOM   2219 C CG  . HIS A 1 286 ? -20.842 -33.414 -37.862 1.00 32.89  ? 268  HIS A CG  1 
ATOM   2220 N ND1 . HIS A 1 286 ? -20.459 -32.973 -36.607 1.00 33.08  ? 268  HIS A ND1 1 
ATOM   2221 C CD2 . HIS A 1 286 ? -19.806 -34.148 -38.335 1.00 30.60  ? 268  HIS A CD2 1 
ATOM   2222 C CE1 . HIS A 1 286 ? -19.242 -33.417 -36.336 1.00 32.64  ? 268  HIS A CE1 1 
ATOM   2223 N NE2 . HIS A 1 286 ? -18.825 -34.132 -37.371 1.00 35.58  ? 268  HIS A NE2 1 
ATOM   2224 N N   . GLY A 1 287 ? -23.318 -31.020 -36.531 1.00 31.38  ? 269  GLY A N   1 
ATOM   2225 C CA  . GLY A 1 287 ? -23.426 -30.352 -35.247 1.00 30.64  ? 269  GLY A CA  1 
ATOM   2226 C C   . GLY A 1 287 ? -22.850 -31.249 -34.176 1.00 31.19  ? 269  GLY A C   1 
ATOM   2227 O O   . GLY A 1 287 ? -21.812 -31.878 -34.388 1.00 30.29  ? 269  GLY A O   1 
ATOM   2228 N N   . PRO A 1 288 ? -23.536 -31.349 -33.020 1.00 32.31  ? 270  PRO A N   1 
ATOM   2229 C CA  . PRO A 1 288 ? -22.953 -32.190 -31.942 1.00 32.43  ? 270  PRO A CA  1 
ATOM   2230 C C   . PRO A 1 288 ? -22.443 -33.553 -32.432 1.00 33.57  ? 270  PRO A C   1 
ATOM   2231 O O   . PRO A 1 288 ? -21.254 -33.890 -32.197 1.00 34.37  ? 270  PRO A O   1 
ATOM   2232 C CB  . PRO A 1 288 ? -24.092 -32.309 -30.918 1.00 32.27  ? 270  PRO A CB  1 
ATOM   2233 C CG  . PRO A 1 288 ? -24.946 -31.132 -31.144 1.00 31.81  ? 270  PRO A CG  1 
ATOM   2234 C CD  . PRO A 1 288 ? -24.806 -30.719 -32.611 1.00 31.85  ? 270  PRO A CD  1 
ATOM   2235 N N   . LYS A 1 289 ? -23.311 -34.337 -33.089 1.00 34.52  ? 271  LYS A N   1 
ATOM   2236 C CA  . LYS A 1 289 ? -22.959 -35.696 -33.568 1.00 34.63  ? 271  LYS A CA  1 
ATOM   2237 C C   . LYS A 1 289 ? -22.908 -35.683 -35.091 1.00 33.99  ? 271  LYS A C   1 
ATOM   2238 O O   . LYS A 1 289 ? -23.609 -34.889 -35.717 1.00 33.45  ? 271  LYS A O   1 
ATOM   2239 C CB  . LYS A 1 289 ? -23.990 -36.792 -33.116 1.00 36.01  ? 271  LYS A CB  1 
ATOM   2240 C CG  . LYS A 1 289 ? -24.605 -36.638 -31.666 1.00 37.52  ? 271  LYS A CG  1 
ATOM   2241 C CD  . LYS A 1 289 ? -25.420 -37.882 -31.065 1.00 39.29  ? 271  LYS A CD  1 
ATOM   2242 C CE  . LYS A 1 289 ? -26.407 -38.718 -32.043 1.00 44.02  ? 271  LYS A CE  1 
ATOM   2243 N NZ  . LYS A 1 289 ? -27.961 -38.754 -31.832 1.00 39.69  ? 271  LYS A NZ  1 
ATOM   2244 N N   . PRO A 1 290 ? -22.110 -36.589 -35.709 1.00 34.24  ? 272  PRO A N   1 
ATOM   2245 C CA  . PRO A 1 290 ? -22.330 -36.743 -37.163 1.00 33.77  ? 272  PRO A CA  1 
ATOM   2246 C C   . PRO A 1 290 ? -23.776 -37.106 -37.507 1.00 34.01  ? 272  PRO A C   1 
ATOM   2247 O O   . PRO A 1 290 ? -24.453 -37.883 -36.779 1.00 34.15  ? 272  PRO A O   1 
ATOM   2248 C CB  . PRO A 1 290 ? -21.353 -37.874 -37.571 1.00 34.56  ? 272  PRO A CB  1 
ATOM   2249 C CG  . PRO A 1 290 ? -20.263 -37.835 -36.479 1.00 34.61  ? 272  PRO A CG  1 
ATOM   2250 C CD  . PRO A 1 290 ? -21.033 -37.482 -35.205 1.00 33.72  ? 272  PRO A CD  1 
ATOM   2251 N N   . GLY A 1 291 ? -24.239 -36.547 -38.628 1.00 34.01  ? 273  GLY A N   1 
ATOM   2252 C CA  . GLY A 1 291 ? -25.587 -36.772 -39.116 1.00 33.79  ? 273  GLY A CA  1 
ATOM   2253 C C   . GLY A 1 291 ? -26.527 -35.659 -38.709 1.00 33.62  ? 273  GLY A C   1 
ATOM   2254 O O   . GLY A 1 291 ? -27.576 -35.491 -39.336 1.00 35.17  ? 273  GLY A O   1 
ATOM   2255 N N   . SER A 1 292 ? -26.155 -34.891 -37.670 1.00 31.51  ? 274  SER A N   1 
ATOM   2256 C CA  . SER A 1 292 ? -26.931 -33.726 -37.223 1.00 30.57  ? 274  SER A CA  1 
ATOM   2257 C C   . SER A 1 292 ? -26.585 -32.418 -37.955 1.00 30.69  ? 274  SER A C   1 
ATOM   2258 O O   . SER A 1 292 ? -25.468 -32.244 -38.455 1.00 29.32  ? 274  SER A O   1 
ATOM   2259 C CB  . SER A 1 292 ? -26.733 -33.530 -35.709 1.00 29.61  ? 274  SER A CB  1 
ATOM   2260 O OG  . SER A 1 292 ? -25.471 -32.968 -35.443 1.00 26.17  ? 274  SER A OG  1 
ATOM   2261 N N   . SER A 1 293 ? -27.537 -31.479 -38.003 1.00 31.42  ? 275  SER A N   1 
ATOM   2262 C CA  . SER A 1 293 ? -27.292 -30.211 -38.693 1.00 31.50  ? 275  SER A CA  1 
ATOM   2263 C C   . SER A 1 293 ? -26.225 -29.413 -37.944 1.00 30.33  ? 275  SER A C   1 
ATOM   2264 O O   . SER A 1 293 ? -26.229 -29.381 -36.687 1.00 30.26  ? 275  SER A O   1 
ATOM   2265 C CB  . SER A 1 293 ? -28.575 -29.360 -38.824 1.00 32.11  ? 275  SER A CB  1 
ATOM   2266 O OG  . SER A 1 293 ? -29.545 -30.011 -39.636 1.00 34.64  ? 275  SER A OG  1 
ATOM   2267 N N   . HIS A 1 294 ? -25.333 -28.770 -38.709 1.00 29.15  ? 276  HIS A N   1 
ATOM   2268 C CA  . HIS A 1 294 ? -24.331 -27.889 -38.150 1.00 28.80  ? 276  HIS A CA  1 
ATOM   2269 C C   . HIS A 1 294 ? -25.027 -26.699 -37.481 1.00 29.50  ? 276  HIS A C   1 
ATOM   2270 O O   . HIS A 1 294 ? -26.046 -26.213 -37.989 1.00 29.64  ? 276  HIS A O   1 
ATOM   2271 C CB  . HIS A 1 294 ? -23.425 -27.367 -39.255 1.00 28.86  ? 276  HIS A CB  1 
ATOM   2272 C CG  . HIS A 1 294 ? -22.388 -26.384 -38.783 1.00 27.24  ? 276  HIS A CG  1 
ATOM   2273 N ND1 . HIS A 1 294 ? -22.525 -25.017 -38.926 1.00 28.18  ? 276  HIS A ND1 1 
ATOM   2274 C CD2 . HIS A 1 294 ? -21.171 -26.585 -38.227 1.00 25.77  ? 276  HIS A CD2 1 
ATOM   2275 C CE1 . HIS A 1 294 ? -21.447 -24.421 -38.448 1.00 30.09  ? 276  HIS A CE1 1 
ATOM   2276 N NE2 . HIS A 1 294 ? -20.609 -25.353 -38.023 1.00 29.42  ? 276  HIS A NE2 1 
ATOM   2277 N N   . ARG A 1 295 ? -24.529 -26.271 -36.320 1.00 29.69  ? 277  ARG A N   1 
ATOM   2278 C CA  . ARG A 1 295 ? -24.982 -24.984 -35.787 1.00 31.44  ? 277  ARG A CA  1 
ATOM   2279 C C   . ARG A 1 295 ? -23.841 -24.048 -35.467 1.00 30.34  ? 277  ARG A C   1 
ATOM   2280 O O   . ARG A 1 295 ? -22.722 -24.504 -35.271 1.00 30.09  ? 277  ARG A O   1 
ATOM   2281 C CB  . ARG A 1 295 ? -25.950 -25.116 -34.611 1.00 32.05  ? 277  ARG A CB  1 
ATOM   2282 C CG  . ARG A 1 295 ? -25.844 -26.347 -33.804 1.00 34.94  ? 277  ARG A CG  1 
ATOM   2283 C CD  . ARG A 1 295 ? -27.080 -26.461 -32.958 1.00 39.41  ? 277  ARG A CD  1 
ATOM   2284 N NE  . ARG A 1 295 ? -26.884 -27.403 -31.865 1.00 42.81  ? 277  ARG A NE  1 
ATOM   2285 C CZ  . ARG A 1 295 ? -26.409 -27.117 -30.641 1.00 42.63  ? 277  ARG A CZ  1 
ATOM   2286 N NH1 . ARG A 1 295 ? -26.022 -25.878 -30.285 1.00 38.27  ? 277  ARG A NH1 1 
ATOM   2287 N NH2 . ARG A 1 295 ? -26.303 -28.119 -29.765 1.00 40.49  ? 277  ARG A NH2 1 
ATOM   2288 N N   . PRO A 1 296 ? -24.125 -22.731 -35.435 1.00 30.58  ? 278  PRO A N   1 
ATOM   2289 C CA  . PRO A 1 296 ? -23.107 -21.728 -35.169 1.00 29.09  ? 278  PRO A CA  1 
ATOM   2290 C C   . PRO A 1 296 ? -22.464 -21.989 -33.813 1.00 27.99  ? 278  PRO A C   1 
ATOM   2291 O O   . PRO A 1 296 ? -23.129 -22.485 -32.908 1.00 27.78  ? 278  PRO A O   1 
ATOM   2292 C CB  . PRO A 1 296 ? -23.915 -20.428 -35.118 1.00 30.06  ? 278  PRO A CB  1 
ATOM   2293 C CG  . PRO A 1 296 ? -25.152 -20.694 -35.885 1.00 31.34  ? 278  PRO A CG  1 
ATOM   2294 C CD  . PRO A 1 296 ? -25.463 -22.126 -35.636 1.00 31.40  ? 278  PRO A CD  1 
ATOM   2295 N N   . TRP A 1 297 ? -21.185 -21.665 -33.673 1.00 26.03  ? 279  TRP A N   1 
ATOM   2296 C CA  . TRP A 1 297 ? -20.517 -21.865 -32.409 1.00 24.97  ? 279  TRP A CA  1 
ATOM   2297 C C   . TRP A 1 297 ? -21.212 -21.126 -31.251 1.00 25.09  ? 279  TRP A C   1 
ATOM   2298 O O   . TRP A 1 297 ? -21.209 -21.609 -30.106 1.00 24.52  ? 279  TRP A O   1 
ATOM   2299 C CB  . TRP A 1 297 ? -19.024 -21.504 -32.496 1.00 24.09  ? 279  TRP A CB  1 
ATOM   2300 C CG  . TRP A 1 297 ? -18.715 -20.043 -32.691 1.00 23.24  ? 279  TRP A CG  1 
ATOM   2301 C CD1 . TRP A 1 297 ? -18.531 -19.407 -33.866 1.00 23.44  ? 279  TRP A CD1 1 
ATOM   2302 C CD2 . TRP A 1 297 ? -18.543 -19.051 -31.664 1.00 23.77  ? 279  TRP A CD2 1 
ATOM   2303 N NE1 . TRP A 1 297 ? -18.272 -18.085 -33.659 1.00 23.83  ? 279  TRP A NE1 1 
ATOM   2304 C CE2 . TRP A 1 297 ? -18.250 -17.836 -32.312 1.00 25.21  ? 279  TRP A CE2 1 
ATOM   2305 C CE3 . TRP A 1 297 ? -18.594 -19.078 -30.260 1.00 21.57  ? 279  TRP A CE3 1 
ATOM   2306 C CZ2 . TRP A 1 297 ? -18.013 -16.627 -31.598 1.00 24.84  ? 279  TRP A CZ2 1 
ATOM   2307 C CZ3 . TRP A 1 297 ? -18.365 -17.905 -29.553 1.00 23.44  ? 279  TRP A CZ3 1 
ATOM   2308 C CH2 . TRP A 1 297 ? -18.099 -16.682 -30.228 1.00 24.26  ? 279  TRP A CH2 1 
ATOM   2309 N N   . GLN A 1 298 ? -21.822 -19.978 -31.560 1.00 25.38  ? 280  GLN A N   1 
ATOM   2310 C CA  . GLN A 1 298 ? -22.470 -19.151 -30.533 1.00 25.71  ? 280  GLN A CA  1 
ATOM   2311 C C   . GLN A 1 298 ? -23.620 -19.879 -29.845 1.00 26.41  ? 280  GLN A C   1 
ATOM   2312 O O   . GLN A 1 298 ? -23.869 -19.615 -28.665 1.00 27.26  ? 280  GLN A O   1 
ATOM   2313 C CB  . GLN A 1 298 ? -22.934 -17.777 -31.072 1.00 26.08  ? 280  GLN A CB  1 
ATOM   2314 C CG  . GLN A 1 298 ? -21.802 -16.822 -31.508 1.00 25.01  ? 280  GLN A CG  1 
ATOM   2315 C CD  . GLN A 1 298 ? -21.492 -16.978 -33.002 1.00 27.62  ? 280  GLN A CD  1 
ATOM   2316 O OE1 . GLN A 1 298 ? -21.727 -18.053 -33.588 1.00 28.01  ? 280  GLN A OE1 1 
ATOM   2317 N NE2 . GLN A 1 298 ? -20.967 -15.915 -33.622 1.00 26.35  ? 280  GLN A NE2 1 
ATOM   2318 N N   . SER A 1 299 ? -24.316 -20.768 -30.575 1.00 26.64  ? 281  SER A N   1 
ATOM   2319 C CA  . SER A 1 299 ? -25.443 -21.561 -30.034 1.00 27.54  ? 281  SER A CA  1 
ATOM   2320 C C   . SER A 1 299 ? -25.066 -22.513 -28.880 1.00 27.18  ? 281  SER A C   1 
ATOM   2321 O O   . SER A 1 299 ? -25.951 -22.999 -28.165 1.00 29.38  ? 281  SER A O   1 
ATOM   2322 C CB  . SER A 1 299 ? -26.167 -22.352 -31.141 1.00 28.15  ? 281  SER A CB  1 
ATOM   2323 O OG  . SER A 1 299 ? -25.400 -23.468 -31.585 1.00 27.33  ? 281  SER A OG  1 
ATOM   2324 N N   . TYR A 1 300 ? -23.779 -22.771 -28.684 1.00 25.93  ? 282  TYR A N   1 
ATOM   2325 C CA  . TYR A 1 300 ? -23.322 -23.698 -27.650 1.00 26.06  ? 282  TYR A CA  1 
ATOM   2326 C C   . TYR A 1 300 ? -23.094 -23.037 -26.276 1.00 26.64  ? 282  TYR A C   1 
ATOM   2327 O O   . TYR A 1 300 ? -22.821 -23.724 -25.302 1.00 26.17  ? 282  TYR A O   1 
ATOM   2328 C CB  . TYR A 1 300 ? -22.042 -24.425 -28.109 1.00 25.76  ? 282  TYR A CB  1 
ATOM   2329 C CG  . TYR A 1 300 ? -22.251 -25.426 -29.245 1.00 26.05  ? 282  TYR A CG  1 
ATOM   2330 C CD1 . TYR A 1 300 ? -22.389 -26.810 -28.998 1.00 25.69  ? 282  TYR A CD1 1 
ATOM   2331 C CD2 . TYR A 1 300 ? -22.362 -24.971 -30.562 1.00 24.47  ? 282  TYR A CD2 1 
ATOM   2332 C CE1 . TYR A 1 300 ? -22.602 -27.727 -30.102 1.00 27.68  ? 282  TYR A CE1 1 
ATOM   2333 C CE2 . TYR A 1 300 ? -22.576 -25.813 -31.613 1.00 23.36  ? 282  TYR A CE2 1 
ATOM   2334 C CZ  . TYR A 1 300 ? -22.688 -27.185 -31.404 1.00 28.44  ? 282  TYR A CZ  1 
ATOM   2335 O OH  . TYR A 1 300 ? -22.883 -27.943 -32.541 1.00 28.90  ? 282  TYR A OH  1 
ATOM   2336 N N   . PHE A 1 301 ? -23.240 -21.710 -26.202 1.00 27.45  ? 283  PHE A N   1 
ATOM   2337 C CA  . PHE A 1 301 ? -22.896 -20.946 -24.990 1.00 28.38  ? 283  PHE A CA  1 
ATOM   2338 C C   . PHE A 1 301 ? -24.093 -20.165 -24.553 1.00 29.61  ? 283  PHE A C   1 
ATOM   2339 O O   . PHE A 1 301 ? -24.757 -19.565 -25.389 1.00 30.65  ? 283  PHE A O   1 
ATOM   2340 C CB  . PHE A 1 301 ? -21.707 -20.008 -25.254 1.00 27.22  ? 283  PHE A CB  1 
ATOM   2341 C CG  . PHE A 1 301 ? -20.464 -20.751 -25.657 1.00 27.08  ? 283  PHE A CG  1 
ATOM   2342 C CD1 . PHE A 1 301 ? -19.595 -21.231 -24.700 1.00 27.81  ? 283  PHE A CD1 1 
ATOM   2343 C CD2 . PHE A 1 301 ? -20.211 -21.037 -26.997 1.00 25.68  ? 283  PHE A CD2 1 
ATOM   2344 C CE1 . PHE A 1 301 ? -18.463 -21.946 -25.065 1.00 28.27  ? 283  PHE A CE1 1 
ATOM   2345 C CE2 . PHE A 1 301 ? -19.101 -21.775 -27.359 1.00 24.13  ? 283  PHE A CE2 1 
ATOM   2346 C CZ  . PHE A 1 301 ? -18.231 -22.217 -26.396 1.00 26.57  ? 283  PHE A CZ  1 
ATOM   2347 N N   . ASP A 1 302 ? -24.413 -20.216 -23.260 1.00 30.07  ? 284  ASP A N   1 
ATOM   2348 C CA  . ASP A 1 302 ? -25.437 -19.324 -22.717 1.00 31.13  ? 284  ASP A CA  1 
ATOM   2349 C C   . ASP A 1 302 ? -24.917 -17.871 -22.568 1.00 30.72  ? 284  ASP A C   1 
ATOM   2350 O O   . ASP A 1 302 ? -25.683 -16.934 -22.492 1.00 31.12  ? 284  ASP A O   1 
ATOM   2351 C CB  . ASP A 1 302 ? -25.946 -19.869 -21.386 1.00 32.47  ? 284  ASP A CB  1 
ATOM   2352 C CG  . ASP A 1 302 ? -26.631 -21.230 -21.540 1.00 33.35  ? 284  ASP A CG  1 
ATOM   2353 O OD1 . ASP A 1 302 ? -27.782 -21.273 -21.996 1.00 36.93  ? 284  ASP A OD1 1 
ATOM   2354 O OD2 . ASP A 1 302 ? -26.037 -22.269 -21.203 1.00 34.29  ? 284  ASP A OD2 1 
ATOM   2355 N N   . LEU A 1 303 ? -23.605 -17.696 -22.505 1.00 29.70  ? 285  LEU A N   1 
ATOM   2356 C CA  . LEU A 1 303 ? -23.019 -16.371 -22.244 1.00 29.72  ? 285  LEU A CA  1 
ATOM   2357 C C   . LEU A 1 303 ? -21.653 -16.426 -22.903 1.00 28.58  ? 285  LEU A C   1 
ATOM   2358 O O   . LEU A 1 303 ? -20.942 -17.442 -22.775 1.00 28.33  ? 285  LEU A O   1 
ATOM   2359 C CB  . LEU A 1 303 ? -22.892 -16.081 -20.730 1.00 29.37  ? 285  LEU A CB  1 
ATOM   2360 C CG  . LEU A 1 303 ? -22.347 -14.704 -20.306 1.00 30.63  ? 285  LEU A CG  1 
ATOM   2361 C CD1 . LEU A 1 303 ? -22.912 -14.308 -18.980 1.00 31.34  ? 285  LEU A CD1 1 
ATOM   2362 C CD2 . LEU A 1 303 ? -20.808 -14.646 -20.280 1.00 29.56  ? 285  LEU A CD2 1 
ATOM   2363 N N   . ILE A 1 304 ? -21.342 -15.373 -23.654 1.00 28.12  ? 286  ILE A N   1 
ATOM   2364 C CA  . ILE A 1 304 ? -20.083 -15.208 -24.349 1.00 27.21  ? 286  ILE A CA  1 
ATOM   2365 C C   . ILE A 1 304 ? -19.544 -13.844 -23.955 1.00 28.08  ? 286  ILE A C   1 
ATOM   2366 O O   . ILE A 1 304 ? -20.220 -12.823 -24.103 1.00 29.19  ? 286  ILE A O   1 
ATOM   2367 C CB  . ILE A 1 304 ? -20.245 -15.258 -25.892 1.00 27.12  ? 286  ILE A CB  1 
ATOM   2368 C CG1 . ILE A 1 304 ? -20.865 -16.599 -26.313 1.00 27.86  ? 286  ILE A CG1 1 
ATOM   2369 C CG2 . ILE A 1 304 ? -18.884 -15.027 -26.573 1.00 24.52  ? 286  ILE A CG2 1 
ATOM   2370 C CD1 . ILE A 1 304 ? -21.521 -16.630 -27.701 1.00 26.90  ? 286  ILE A CD1 1 
ATOM   2371 N N   . LEU A 1 305 ? -18.325 -13.843 -23.431 1.00 28.03  ? 287  LEU A N   1 
ATOM   2372 C CA  . LEU A 1 305 ? -17.660 -12.647 -22.978 1.00 28.14  ? 287  LEU A CA  1 
ATOM   2373 C C   . LEU A 1 305 ? -16.237 -12.609 -23.574 1.00 27.39  ? 287  LEU A C   1 
ATOM   2374 O O   . LEU A 1 305 ? -15.459 -13.568 -23.455 1.00 26.66  ? 287  LEU A O   1 
ATOM   2375 C CB  . LEU A 1 305 ? -17.663 -12.591 -21.450 1.00 28.80  ? 287  LEU A CB  1 
ATOM   2376 C CG  . LEU A 1 305 ? -17.097 -11.308 -20.834 1.00 33.15  ? 287  LEU A CG  1 
ATOM   2377 C CD1 . LEU A 1 305 ? -17.897 -10.830 -19.647 1.00 35.01  ? 287  LEU A CD1 1 
ATOM   2378 C CD2 . LEU A 1 305 ? -15.624 -11.510 -20.488 1.00 31.91  ? 287  LEU A CD2 1 
ATOM   2379 N N   . VAL A 1 306 ? -15.929 -11.511 -24.254 1.00 26.83  ? 288  VAL A N   1 
ATOM   2380 C CA  . VAL A 1 306 ? -14.618 -11.315 -24.844 1.00 27.17  ? 288  VAL A CA  1 
ATOM   2381 C C   . VAL A 1 306 ? -13.922 -10.110 -24.159 1.00 28.25  ? 288  VAL A C   1 
ATOM   2382 O O   . VAL A 1 306 ? -14.560 -9.432  -23.348 1.00 27.83  ? 288  VAL A O   1 
ATOM   2383 C CB  . VAL A 1 306 ? -14.726 -11.193 -26.407 1.00 27.55  ? 288  VAL A CB  1 
ATOM   2384 C CG1 . VAL A 1 306 ? -15.366 -12.458 -26.981 1.00 24.13  ? 288  VAL A CG1 1 
ATOM   2385 C CG2 . VAL A 1 306 ? -15.513 -9.899  -26.876 1.00 27.57  ? 288  VAL A CG2 1 
ATOM   2386 N N   . ASP A 1 307 ? -12.633 -9.864  -24.457 1.00 28.73  ? 289  ASP A N   1 
ATOM   2387 C CA  . ASP A 1 307 ? -11.858 -8.722  -23.877 1.00 29.90  ? 289  ASP A CA  1 
ATOM   2388 C C   . ASP A 1 307 ? -11.972 -8.715  -22.367 1.00 30.39  ? 289  ASP A C   1 
ATOM   2389 O O   . ASP A 1 307 ? -12.180 -7.657  -21.751 1.00 31.02  ? 289  ASP A O   1 
ATOM   2390 C CB  . ASP A 1 307 ? -12.350 -7.352  -24.385 1.00 29.91  ? 289  ASP A CB  1 
ATOM   2391 C CG  . ASP A 1 307 ? -12.568 -7.329  -25.870 1.00 32.97  ? 289  ASP A CG  1 
ATOM   2392 O OD1 . ASP A 1 307 ? -11.565 -7.461  -26.602 1.00 37.40  ? 289  ASP A OD1 1 
ATOM   2393 O OD2 . ASP A 1 307 ? -13.729 -7.183  -26.314 1.00 33.95  ? 289  ASP A OD2 1 
ATOM   2394 N N   . ALA A 1 308 ? -11.842 -9.900  -21.797 1.00 30.19  ? 290  ALA A N   1 
ATOM   2395 C CA  . ALA A 1 308 ? -12.098 -10.160 -20.409 1.00 31.99  ? 290  ALA A CA  1 
ATOM   2396 C C   . ALA A 1 308 ? -11.090 -9.481  -19.489 1.00 34.24  ? 290  ALA A C   1 
ATOM   2397 O O   . ALA A 1 308 ? -11.453 -9.093  -18.380 1.00 36.68  ? 290  ALA A O   1 
ATOM   2398 C CB  . ALA A 1 308 ? -12.135 -11.699 -20.152 1.00 30.96  ? 290  ALA A CB  1 
ATOM   2399 N N   . ARG A 1 309 ? -9.845  -9.299  -19.944 1.00 35.38  ? 291  ARG A N   1 
ATOM   2400 C CA  . ARG A 1 309 ? -8.765  -8.655  -19.136 1.00 37.47  ? 291  ARG A CA  1 
ATOM   2401 C C   . ARG A 1 309 ? -8.444  -9.451  -17.869 1.00 37.29  ? 291  ARG A C   1 
ATOM   2402 O O   . ARG A 1 309 ? -8.310  -8.890  -16.798 1.00 38.30  ? 291  ARG A O   1 
ATOM   2403 C CB  . ARG A 1 309 ? -9.059  -7.177  -18.785 1.00 38.32  ? 291  ARG A CB  1 
ATOM   2404 C CG  . ARG A 1 309 ? -9.567  -6.313  -19.938 1.00 42.21  ? 291  ARG A CG  1 
ATOM   2405 C CD  . ARG A 1 309 ? -8.632  -5.196  -20.382 1.00 48.07  ? 291  ARG A CD  1 
ATOM   2406 N NE  . ARG A 1 309 ? -7.818  -4.636  -19.290 1.00 55.68  ? 291  ARG A NE  1 
ATOM   2407 C CZ  . ARG A 1 309 ? -7.913  -3.402  -18.780 1.00 57.19  ? 291  ARG A CZ  1 
ATOM   2408 N NH1 . ARG A 1 309 ? -8.801  -2.520  -19.240 1.00 59.70  ? 291  ARG A NH1 1 
ATOM   2409 N NH2 . ARG A 1 309 ? -7.107  -3.042  -17.789 1.00 58.02  ? 291  ARG A NH2 1 
ATOM   2410 N N   . LYS A 1 310 ? -8.356  -10.769 -18.010 1.00 36.21  ? 292  LYS A N   1 
ATOM   2411 C CA  . LYS A 1 310 ? -7.859  -11.613 -16.939 1.00 36.76  ? 292  LYS A CA  1 
ATOM   2412 C C   . LYS A 1 310 ? -6.362  -11.318 -16.756 1.00 37.41  ? 292  LYS A C   1 
ATOM   2413 O O   . LYS A 1 310 ? -5.635  -11.171 -17.750 1.00 37.88  ? 292  LYS A O   1 
ATOM   2414 C CB  . LYS A 1 310 ? -8.134  -13.107 -17.239 1.00 35.01  ? 292  LYS A CB  1 
ATOM   2415 C CG  . LYS A 1 310 ? -9.551  -13.315 -17.751 1.00 35.37  ? 292  LYS A CG  1 
ATOM   2416 C CD  . LYS A 1 310 ? -10.056 -14.727 -17.745 1.00 36.12  ? 292  LYS A CD  1 
ATOM   2417 C CE  . LYS A 1 310 ? -9.726  -15.461 -18.954 1.00 37.65  ? 292  LYS A CE  1 
ATOM   2418 N NZ  . LYS A 1 310 ? -10.623 -16.669 -19.064 1.00 36.27  ? 292  LYS A NZ  1 
ATOM   2419 N N   . PRO A 1 311 ? -5.880  -11.280 -15.499 1.00 37.89  ? 293  PRO A N   1 
ATOM   2420 C CA  . PRO A 1 311 ? -6.587  -11.646 -14.268 1.00 37.75  ? 293  PRO A CA  1 
ATOM   2421 C C   . PRO A 1 311 ? -7.429  -10.544 -13.572 1.00 38.57  ? 293  PRO A C   1 
ATOM   2422 O O   . PRO A 1 311 ? -8.131  -10.856 -12.607 1.00 39.34  ? 293  PRO A O   1 
ATOM   2423 C CB  . PRO A 1 311 ? -5.443  -12.086 -13.357 1.00 39.27  ? 293  PRO A CB  1 
ATOM   2424 C CG  . PRO A 1 311 ? -4.266  -11.141 -13.765 1.00 39.20  ? 293  PRO A CG  1 
ATOM   2425 C CD  . PRO A 1 311 ? -4.481  -10.853 -15.241 1.00 38.67  ? 293  PRO A CD  1 
ATOM   2426 N N   . LEU A 1 312 ? -7.345  -9.285  -14.015 1.00 38.20  ? 294  LEU A N   1 
ATOM   2427 C CA  . LEU A 1 312 ? -8.168  -8.205  -13.454 1.00 39.02  ? 294  LEU A CA  1 
ATOM   2428 C C   . LEU A 1 312 ? -9.668  -8.536  -13.446 1.00 37.83  ? 294  LEU A C   1 
ATOM   2429 O O   . LEU A 1 312 ? -10.403 -8.090  -12.555 1.00 38.59  ? 294  LEU A O   1 
ATOM   2430 C CB  . LEU A 1 312 ? -7.908  -6.853  -14.173 1.00 39.67  ? 294  LEU A CB  1 
ATOM   2431 C CG  . LEU A 1 312 ? -8.661  -5.576  -13.772 1.00 40.21  ? 294  LEU A CG  1 
ATOM   2432 C CD1 . LEU A 1 312 ? -8.283  -5.088  -12.391 1.00 43.00  ? 294  LEU A CD1 1 
ATOM   2433 C CD2 . LEU A 1 312 ? -8.494  -4.423  -14.807 1.00 40.17  ? 294  LEU A CD2 1 
ATOM   2434 N N   . PHE A 1 313 ? -10.092 -9.299  -14.452 1.00 36.00  ? 295  PHE A N   1 
ATOM   2435 C CA  . PHE A 1 313 ? -11.432 -9.844  -14.579 1.00 34.53  ? 295  PHE A CA  1 
ATOM   2436 C C   . PHE A 1 313 ? -11.962 -10.522 -13.330 1.00 35.20  ? 295  PHE A C   1 
ATOM   2437 O O   . PHE A 1 313 ? -13.157 -10.423 -13.032 1.00 35.60  ? 295  PHE A O   1 
ATOM   2438 C CB  . PHE A 1 313 ? -11.417 -10.857 -15.679 1.00 32.75  ? 295  PHE A CB  1 
ATOM   2439 C CG  . PHE A 1 313 ? -12.772 -11.437 -16.006 1.00 32.78  ? 295  PHE A CG  1 
ATOM   2440 C CD1 . PHE A 1 313 ? -13.733 -10.675 -16.668 1.00 32.11  ? 295  PHE A CD1 1 
ATOM   2441 C CD2 . PHE A 1 313 ? -13.065 -12.767 -15.704 1.00 31.85  ? 295  PHE A CD2 1 
ATOM   2442 C CE1 . PHE A 1 313 ? -14.972 -11.226 -17.015 1.00 31.71  ? 295  PHE A CE1 1 
ATOM   2443 C CE2 . PHE A 1 313 ? -14.306 -13.329 -16.031 1.00 31.61  ? 295  PHE A CE2 1 
ATOM   2444 C CZ  . PHE A 1 313 ? -15.274 -12.543 -16.685 1.00 31.18  ? 295  PHE A CZ  1 
ATOM   2445 N N   . PHE A 1 314 ? -11.072 -11.214 -12.619 1.00 35.79  ? 296  PHE A N   1 
ATOM   2446 C CA  . PHE A 1 314 ? -11.399 -11.959 -11.410 1.00 36.46  ? 296  PHE A CA  1 
ATOM   2447 C C   . PHE A 1 314 ? -11.467 -11.109 -10.148 1.00 38.81  ? 296  PHE A C   1 
ATOM   2448 O O   . PHE A 1 314 ? -11.977 -11.564 -9.126  1.00 39.85  ? 296  PHE A O   1 
ATOM   2449 C CB  . PHE A 1 314 ? -10.419 -13.116 -11.252 1.00 37.25  ? 296  PHE A CB  1 
ATOM   2450 C CG  . PHE A 1 314 ? -10.589 -14.189 -12.308 1.00 34.88  ? 296  PHE A CG  1 
ATOM   2451 C CD1 . PHE A 1 314 ? -11.788 -14.904 -12.397 1.00 34.72  ? 296  PHE A CD1 1 
ATOM   2452 C CD2 . PHE A 1 314 ? -9.571  -14.457 -13.215 1.00 34.78  ? 296  PHE A CD2 1 
ATOM   2453 C CE1 . PHE A 1 314 ? -11.983 -15.896 -13.401 1.00 35.59  ? 296  PHE A CE1 1 
ATOM   2454 C CE2 . PHE A 1 314 ? -9.734  -15.450 -14.216 1.00 35.03  ? 296  PHE A CE2 1 
ATOM   2455 C CZ  . PHE A 1 314 ? -10.944 -16.171 -14.305 1.00 34.99  ? 296  PHE A CZ  1 
ATOM   2456 N N   . GLY A 1 315 ? -10.984 -9.864  -10.244 1.00 38.94  ? 297  GLY A N   1 
ATOM   2457 C CA  . GLY A 1 315 ? -11.074 -8.889  -9.179  1.00 41.38  ? 297  GLY A CA  1 
ATOM   2458 C C   . GLY A 1 315 ? -12.131 -7.845  -9.485  1.00 42.04  ? 297  GLY A C   1 
ATOM   2459 O O   . GLY A 1 315 ? -13.311 -8.169  -9.623  1.00 41.94  ? 297  GLY A O   1 
ATOM   2460 N N   A GLU A 1 316 ? -11.692 -6.598  -9.603  0.50 42.75  ? 298  GLU A N   1 
ATOM   2461 N N   B GLU A 1 316 ? -11.730 -6.581  -9.596  0.50 42.73  ? 298  GLU A N   1 
ATOM   2462 C CA  A GLU A 1 316 ? -12.602 -5.485  -9.851  0.50 43.46  ? 298  GLU A CA  1 
ATOM   2463 C CA  B GLU A 1 316 ? -12.708 -5.517  -9.871  0.50 43.30  ? 298  GLU A CA  1 
ATOM   2464 C C   A GLU A 1 316 ? -13.137 -5.449  -11.296 0.50 41.62  ? 298  GLU A C   1 
ATOM   2465 C C   B GLU A 1 316 ? -13.245 -5.583  -11.299 0.50 41.51  ? 298  GLU A C   1 
ATOM   2466 O O   A GLU A 1 316 ? -14.172 -4.835  -11.569 0.50 41.88  ? 298  GLU A O   1 
ATOM   2467 O O   B GLU A 1 316 ? -14.366 -5.144  -11.573 0.50 41.73  ? 298  GLU A O   1 
ATOM   2468 C CB  A GLU A 1 316 ? -11.976 -4.141  -9.398  0.50 45.03  ? 298  GLU A CB  1 
ATOM   2469 C CB  B GLU A 1 316 ? -12.147 -4.109  -9.579  0.50 44.74  ? 298  GLU A CB  1 
ATOM   2470 C CG  A GLU A 1 316 ? -10.606 -3.779  -10.026 0.50 46.03  ? 298  GLU A CG  1 
ATOM   2471 C CG  B GLU A 1 316 ? -11.446 -3.927  -8.240  0.50 47.24  ? 298  GLU A CG  1 
ATOM   2472 C CD  A GLU A 1 316 ? -9.370  -4.288  -9.242  0.50 48.02  ? 298  GLU A CD  1 
ATOM   2473 C CD  B GLU A 1 316 ? -12.390 -3.881  -7.061  0.50 50.35  ? 298  GLU A CD  1 
ATOM   2474 O OE1 A GLU A 1 316 ? -8.468  -3.448  -9.004  0.50 47.14  ? 298  GLU A OE1 1 
ATOM   2475 O OE1 B GLU A 1 316 ? -12.980 -4.922  -6.716  0.50 50.40  ? 298  GLU A OE1 1 
ATOM   2476 O OE2 A GLU A 1 316 ? -9.282  -5.505  -8.900  0.50 45.86  ? 298  GLU A OE2 1 
ATOM   2477 O OE2 B GLU A 1 316 ? -12.517 -2.801  -6.449  0.50 54.03  ? 298  GLU A OE2 1 
ATOM   2478 N N   . GLY A 1 317 ? -12.444 -6.131  -12.207 1.00 40.16  ? 299  GLY A N   1 
ATOM   2479 C CA  . GLY A 1 317 ? -12.824 -6.178  -13.616 1.00 38.78  ? 299  GLY A CA  1 
ATOM   2480 C C   . GLY A 1 317 ? -12.796 -4.778  -14.201 1.00 39.61  ? 299  GLY A C   1 
ATOM   2481 O O   . GLY A 1 317 ? -12.217 -3.858  -13.607 1.00 41.54  ? 299  GLY A O   1 
ATOM   2482 N N   . THR A 1 318 ? -13.433 -4.607  -15.354 1.00 38.03  ? 300  THR A N   1 
ATOM   2483 C CA  . THR A 1 318 ? -13.565 -3.301  -16.011 1.00 37.46  ? 300  THR A CA  1 
ATOM   2484 C C   . THR A 1 318 ? -15.067 -3.149  -16.234 1.00 36.67  ? 300  THR A C   1 
ATOM   2485 O O   . THR A 1 318 ? -15.789 -4.091  -16.004 1.00 35.69  ? 300  THR A O   1 
ATOM   2486 C CB  . THR A 1 318 ? -12.829 -3.266  -17.395 1.00 36.64  ? 300  THR A CB  1 
ATOM   2487 O OG1 . THR A 1 318 ? -13.410 -4.232  -18.261 1.00 35.08  ? 300  THR A OG1 1 
ATOM   2488 C CG2 . THR A 1 318 ? -11.350 -3.562  -17.263 1.00 35.74  ? 300  THR A CG2 1 
ATOM   2489 N N   . VAL A 1 319 ? -15.549 -1.986  -16.674 1.00 36.57  ? 301  VAL A N   1 
ATOM   2490 C CA  . VAL A 1 319 ? -16.985 -1.854  -16.987 1.00 36.08  ? 301  VAL A CA  1 
ATOM   2491 C C   . VAL A 1 319 ? -17.491 -2.905  -18.015 1.00 34.07  ? 301  VAL A C   1 
ATOM   2492 O O   . VAL A 1 319 ? -16.777 -3.296  -18.963 1.00 33.29  ? 301  VAL A O   1 
ATOM   2493 C CB  . VAL A 1 319 ? -17.339 -0.430  -17.418 1.00 36.60  ? 301  VAL A CB  1 
ATOM   2494 C CG1 . VAL A 1 319 ? -18.826 -0.289  -17.699 1.00 36.65  ? 301  VAL A CG1 1 
ATOM   2495 C CG2 . VAL A 1 319 ? -16.979 0.535   -16.299 1.00 41.28  ? 301  VAL A CG2 1 
ATOM   2496 N N   . LEU A 1 320 ? -18.720 -3.367  -17.812 1.00 33.19  ? 302  LEU A N   1 
ATOM   2497 C CA  . LEU A 1 320 ? -19.331 -4.301  -18.739 1.00 30.97  ? 302  LEU A CA  1 
ATOM   2498 C C   . LEU A 1 320 ? -19.783 -3.587  -20.012 1.00 30.66  ? 302  LEU A C   1 
ATOM   2499 O O   . LEU A 1 320 ? -20.579 -2.640  -19.976 1.00 31.25  ? 302  LEU A O   1 
ATOM   2500 C CB  . LEU A 1 320 ? -20.508 -5.051  -18.098 1.00 30.60  ? 302  LEU A CB  1 
ATOM   2501 C CG  . LEU A 1 320 ? -21.106 -6.151  -19.007 1.00 28.90  ? 302  LEU A CG  1 
ATOM   2502 C CD1 . LEU A 1 320 ? -20.227 -7.386  -19.140 1.00 27.30  ? 302  LEU A CD1 1 
ATOM   2503 C CD2 . LEU A 1 320 ? -22.457 -6.567  -18.468 1.00 31.21  ? 302  LEU A CD2 1 
ATOM   2504 N N   . ARG A 1 321 ? -19.272 -4.065  -21.132 1.00 29.45  ? 303  ARG A N   1 
ATOM   2505 C CA  . ARG A 1 321 ? -19.657 -3.569  -22.436 1.00 30.59  ? 303  ARG A CA  1 
ATOM   2506 C C   . ARG A 1 321 ? -20.295 -4.671  -23.291 1.00 30.56  ? 303  ARG A C   1 
ATOM   2507 O O   . ARG A 1 321 ? -20.445 -5.827  -22.871 1.00 30.80  ? 303  ARG A O   1 
ATOM   2508 C CB  . ARG A 1 321 ? -18.449 -2.928  -23.147 1.00 30.40  ? 303  ARG A CB  1 
ATOM   2509 C CG  . ARG A 1 321 ? -17.747 -1.834  -22.338 1.00 30.05  ? 303  ARG A CG  1 
ATOM   2510 C CD  . ARG A 1 321 ? -18.611 -0.556  -22.254 1.00 34.29  ? 303  ARG A CD  1 
ATOM   2511 N NE  . ARG A 1 321 ? -18.999 -0.017  -23.566 1.00 36.60  ? 303  ARG A NE  1 
ATOM   2512 C CZ  . ARG A 1 321 ? -18.301 0.914   -24.232 1.00 38.66  ? 303  ARG A CZ  1 
ATOM   2513 N NH1 . ARG A 1 321 ? -17.170 1.375   -23.718 1.00 34.14  ? 303  ARG A NH1 1 
ATOM   2514 N NH2 . ARG A 1 321 ? -18.717 1.375   -25.426 1.00 38.89  ? 303  ARG A NH2 1 
ATOM   2515 N N   . GLN A 1 322 ? -20.636 -4.320  -24.517 1.00 31.71  ? 304  GLN A N   1 
ATOM   2516 C CA  . GLN A 1 322 ? -21.371 -5.202  -25.394 1.00 31.69  ? 304  GLN A CA  1 
ATOM   2517 C C   . GLN A 1 322 ? -20.838 -5.016  -26.816 1.00 31.30  ? 304  GLN A C   1 
ATOM   2518 O O   . GLN A 1 322 ? -20.595 -3.880  -27.246 1.00 31.71  ? 304  GLN A O   1 
ATOM   2519 C CB  . GLN A 1 322 ? -22.840 -4.808  -25.316 1.00 33.37  ? 304  GLN A CB  1 
ATOM   2520 C CG  . GLN A 1 322 ? -23.735 -5.731  -26.042 1.00 35.73  ? 304  GLN A CG  1 
ATOM   2521 C CD  . GLN A 1 322 ? -25.178 -5.371  -25.838 1.00 38.55  ? 304  GLN A CD  1 
ATOM   2522 O OE1 . GLN A 1 322 ? -25.537 -4.724  -24.853 1.00 39.46  ? 304  GLN A OE1 1 
ATOM   2523 N NE2 . GLN A 1 322 ? -26.021 -5.802  -26.764 1.00 39.28  ? 304  GLN A NE2 1 
ATOM   2524 N N   . VAL A 1 323 ? -20.660 -6.119  -27.543 1.00 29.71  ? 305  VAL A N   1 
ATOM   2525 C CA  . VAL A 1 323 ? -20.095 -6.073  -28.893 1.00 29.47  ? 305  VAL A CA  1 
ATOM   2526 C C   . VAL A 1 323 ? -21.220 -5.997  -29.924 1.00 31.43  ? 305  VAL A C   1 
ATOM   2527 O O   . VAL A 1 323 ? -22.245 -6.700  -29.800 1.00 32.86  ? 305  VAL A O   1 
ATOM   2528 C CB  . VAL A 1 323 ? -19.248 -7.336  -29.167 1.00 28.90  ? 305  VAL A CB  1 
ATOM   2529 C CG1 . VAL A 1 323 ? -18.634 -7.346  -30.613 1.00 28.50  ? 305  VAL A CG1 1 
ATOM   2530 C CG2 . VAL A 1 323 ? -18.185 -7.509  -28.089 1.00 25.63  ? 305  VAL A CG2 1 
ATOM   2531 N N   . ASP A 1 324 ? -21.043 -5.137  -30.922 1.00 34.71  ? 306  ASP A N   1 
ATOM   2532 C CA  . ASP A 1 324 ? -21.855 -5.162  -32.120 1.00 37.92  ? 306  ASP A CA  1 
ATOM   2533 C C   . ASP A 1 324 ? -21.266 -6.266  -32.990 1.00 39.39  ? 306  ASP A C   1 
ATOM   2534 O O   . ASP A 1 324 ? -20.180 -6.110  -33.574 1.00 40.11  ? 306  ASP A O   1 
ATOM   2535 C CB  . ASP A 1 324 ? -21.762 -3.824  -32.862 1.00 38.53  ? 306  ASP A CB  1 
ATOM   2536 C CG  . ASP A 1 324 ? -22.616 -3.782  -34.104 1.00 41.92  ? 306  ASP A CG  1 
ATOM   2537 O OD1 . ASP A 1 324 ? -23.237 -4.792  -34.478 1.00 48.76  ? 306  ASP A OD1 1 
ATOM   2538 O OD2 . ASP A 1 324 ? -22.691 -2.712  -34.735 1.00 47.23  ? 306  ASP A OD2 1 
ATOM   2539 N N   . THR A 1 325 ? -21.963 -7.380  -33.086 1.00 40.17  ? 307  THR A N   1 
ATOM   2540 C CA  . THR A 1 325 ? -21.356 -8.531  -33.738 1.00 41.52  ? 307  THR A CA  1 
ATOM   2541 C C   . THR A 1 325 ? -21.281 -8.446  -35.261 1.00 45.22  ? 307  THR A C   1 
ATOM   2542 O O   . THR A 1 325 ? -20.602 -9.284  -35.877 1.00 47.07  ? 307  THR A O   1 
ATOM   2543 C CB  . THR A 1 325 ? -21.996 -9.868  -33.296 1.00 41.98  ? 307  THR A CB  1 
ATOM   2544 O OG1 . THR A 1 325 ? -23.370 -9.884  -33.683 1.00 44.13  ? 307  THR A OG1 1 
ATOM   2545 C CG2 . THR A 1 325 ? -21.867 -10.064 -31.795 1.00 36.29  ? 307  THR A CG2 1 
ATOM   2546 N N   . LYS A 1 326 ? -21.950 -7.468  -35.879 1.00 46.72  ? 308  LYS A N   1 
ATOM   2547 C CA  . LYS A 1 326 ? -21.725 -7.270  -37.325 1.00 50.64  ? 308  LYS A CA  1 
ATOM   2548 C C   . LYS A 1 326 ? -20.486 -6.457  -37.662 1.00 49.04  ? 308  LYS A C   1 
ATOM   2549 O O   . LYS A 1 326 ? -19.924 -6.607  -38.728 1.00 51.41  ? 308  LYS A O   1 
ATOM   2550 C CB  . LYS A 1 326 ? -22.970 -6.862  -38.174 1.00 54.28  ? 308  LYS A CB  1 
ATOM   2551 C CG  . LYS A 1 326 ? -24.026 -5.928  -37.571 1.00 56.90  ? 308  LYS A CG  1 
ATOM   2552 C CD  . LYS A 1 326 ? -25.419 -6.361  -38.090 1.00 64.87  ? 308  LYS A CD  1 
ATOM   2553 C CE  . LYS A 1 326 ? -26.061 -7.377  -37.103 1.00 67.40  ? 308  LYS A CE  1 
ATOM   2554 N NZ  . LYS A 1 326 ? -26.554 -8.667  -37.700 1.00 71.22  ? 308  LYS A NZ  1 
ATOM   2555 N N   . THR A 1 327 ? -20.037 -5.624  -36.734 1.00 46.15  ? 309  THR A N   1 
ATOM   2556 C CA  . THR A 1 327 ? -18.861 -4.801  -36.986 1.00 44.52  ? 309  THR A CA  1 
ATOM   2557 C C   . THR A 1 327 ? -17.645 -5.273  -36.196 1.00 42.65  ? 309  THR A C   1 
ATOM   2558 O O   . THR A 1 327 ? -16.518 -4.956  -36.562 1.00 44.36  ? 309  THR A O   1 
ATOM   2559 C CB  . THR A 1 327 ? -19.126 -3.284  -36.717 1.00 43.25  ? 309  THR A CB  1 
ATOM   2560 O OG1 . THR A 1 327 ? -19.532 -3.088  -35.357 1.00 40.13  ? 309  THR A OG1 1 
ATOM   2561 C CG2 . THR A 1 327 ? -20.201 -2.742  -37.651 1.00 43.57  ? 309  THR A CG2 1 
ATOM   2562 N N   . GLY A 1 328 ? -17.867 -6.019  -35.119 1.00 40.33  ? 310  GLY A N   1 
ATOM   2563 C CA  . GLY A 1 328 ? -16.796 -6.401  -34.201 1.00 37.80  ? 310  GLY A CA  1 
ATOM   2564 C C   . GLY A 1 328 ? -16.374 -5.297  -33.228 1.00 36.32  ? 310  GLY A C   1 
ATOM   2565 O O   . GLY A 1 328 ? -15.422 -5.487  -32.464 1.00 36.76  ? 310  GLY A O   1 
ATOM   2566 N N   . LYS A 1 329 ? -17.080 -4.160  -33.233 1.00 34.74  ? 311  LYS A N   1 
ATOM   2567 C CA  . LYS A 1 329 ? -16.770 -3.010  -32.391 1.00 32.99  ? 311  LYS A CA  1 
ATOM   2568 C C   . LYS A 1 329 ? -17.702 -2.949  -31.177 1.00 32.05  ? 311  LYS A C   1 
ATOM   2569 O O   . LYS A 1 329 ? -18.772 -3.544  -31.210 1.00 32.89  ? 311  LYS A O   1 
ATOM   2570 C CB  . LYS A 1 329 ? -16.939 -1.720  -33.217 1.00 33.63  ? 311  LYS A CB  1 
ATOM   2571 C CG  . LYS A 1 329 ? -16.022 -1.606  -34.421 1.00 32.92  ? 311  LYS A CG  1 
ATOM   2572 C CD  . LYS A 1 329 ? -16.531 -0.516  -35.369 1.00 36.52  ? 311  LYS A CD  1 
ATOM   2573 C CE  . LYS A 1 329 ? -15.656 -0.412  -36.621 1.00 38.27  ? 311  LYS A CE  1 
ATOM   2574 N NZ  . LYS A 1 329 ? -15.918 0.890   -37.278 1.00 44.49  ? 311  LYS A NZ  1 
ATOM   2575 N N   . LEU A 1 330 ? -17.340 -2.209  -30.125 1.00 30.86  ? 312  LEU A N   1 
ATOM   2576 C CA  . LEU A 1 330 ? -18.252 -2.056  -28.979 1.00 30.68  ? 312  LEU A CA  1 
ATOM   2577 C C   . LEU A 1 330 ? -19.477 -1.230  -29.341 1.00 31.68  ? 312  LEU A C   1 
ATOM   2578 O O   . LEU A 1 330 ? -19.388 -0.259  -30.075 1.00 32.42  ? 312  LEU A O   1 
ATOM   2579 C CB  . LEU A 1 330 ? -17.564 -1.432  -27.745 1.00 29.89  ? 312  LEU A CB  1 
ATOM   2580 C CG  . LEU A 1 330 ? -16.351 -2.172  -27.136 1.00 30.94  ? 312  LEU A CG  1 
ATOM   2581 C CD1 . LEU A 1 330 ? -15.866 -1.522  -25.878 1.00 27.39  ? 312  LEU A CD1 1 
ATOM   2582 C CD2 . LEU A 1 330 ? -16.634 -3.676  -26.902 1.00 28.59  ? 312  LEU A CD2 1 
ATOM   2583 N N   . LYS A 1 331 ? -20.629 -1.631  -28.823 1.00 32.79  ? 313  LYS A N   1 
ATOM   2584 C CA  . LYS A 1 331 ? -21.827 -0.809  -28.896 1.00 34.01  ? 313  LYS A CA  1 
ATOM   2585 C C   . LYS A 1 331 ? -21.667 0.376   -27.978 1.00 34.10  ? 313  LYS A C   1 
ATOM   2586 O O   . LYS A 1 331 ? -20.938 0.319   -26.991 1.00 33.47  ? 313  LYS A O   1 
ATOM   2587 C CB  . LYS A 1 331 ? -23.065 -1.621  -28.487 1.00 34.35  ? 313  LYS A CB  1 
ATOM   2588 C CG  . LYS A 1 331 ? -23.724 -2.359  -29.634 1.00 37.34  ? 313  LYS A CG  1 
ATOM   2589 C CD  . LYS A 1 331 ? -24.685 -3.401  -29.058 1.00 41.02  ? 313  LYS A CD  1 
ATOM   2590 C CE  . LYS A 1 331 ? -25.095 -4.479  -30.043 1.00 43.76  ? 313  LYS A CE  1 
ATOM   2591 N NZ  . LYS A 1 331 ? -26.296 -4.082  -30.823 1.00 46.88  ? 313  LYS A NZ  1 
ATOM   2592 N N   . ILE A 1 332 ? -22.357 1.466   -28.293 1.00 35.73  ? 314  ILE A N   1 
ATOM   2593 C CA  . ILE A 1 332 ? -22.466 2.552   -27.326 1.00 36.67  ? 314  ILE A CA  1 
ATOM   2594 C C   . ILE A 1 332 ? -23.639 2.242   -26.401 1.00 38.26  ? 314  ILE A C   1 
ATOM   2595 O O   . ILE A 1 332 ? -24.792 2.420   -26.760 1.00 40.21  ? 314  ILE A O   1 
ATOM   2596 C CB  . ILE A 1 332 ? -22.605 3.965   -27.992 1.00 37.63  ? 314  ILE A CB  1 
ATOM   2597 C CG1 . ILE A 1 332 ? -21.463 4.224   -28.996 1.00 35.25  ? 314  ILE A CG1 1 
ATOM   2598 C CG2 . ILE A 1 332 ? -22.690 5.065   -26.923 1.00 38.37  ? 314  ILE A CG2 1 
ATOM   2599 C CD1 . ILE A 1 332 ? -20.105 4.173   -28.419 1.00 29.96  ? 314  ILE A CD1 1 
ATOM   2600 N N   . GLY A 1 333 ? -23.323 1.769   -25.202 1.00 38.87  ? 315  GLY A N   1 
ATOM   2601 C CA  . GLY A 1 333 ? -24.342 1.267   -24.286 1.00 41.43  ? 315  GLY A CA  1 
ATOM   2602 C C   . GLY A 1 333 ? -24.274 -0.247  -24.155 1.00 41.40  ? 315  GLY A C   1 
ATOM   2603 O O   . GLY A 1 333 ? -23.750 -0.952  -25.035 1.00 39.21  ? 315  GLY A O   1 
ATOM   2604 N N   . THR A 1 334 ? -24.786 -0.732  -23.029 1.00 43.57  ? 316  THR A N   1 
ATOM   2605 C CA  . THR A 1 334 ? -24.830 -2.153  -22.724 1.00 43.73  ? 316  THR A CA  1 
ATOM   2606 C C   . THR A 1 334 ? -26.241 -2.510  -22.302 1.00 47.39  ? 316  THR A C   1 
ATOM   2607 O O   . THR A 1 334 ? -26.883 -1.759  -21.545 1.00 49.05  ? 316  THR A O   1 
ATOM   2608 C CB  . THR A 1 334 ? -23.865 -2.524  -21.607 1.00 42.57  ? 316  THR A CB  1 
ATOM   2609 O OG1 . THR A 1 334 ? -22.573 -2.047  -21.957 1.00 40.55  ? 316  THR A OG1 1 
ATOM   2610 C CG2 . THR A 1 334 ? -23.798 -4.081  -21.399 1.00 42.49  ? 316  THR A CG2 1 
ATOM   2611 N N   . TYR A 1 335 ? -26.719 -3.636  -22.829 1.00 48.96  ? 317  TYR A N   1 
ATOM   2612 C CA  . TYR A 1 335 ? -28.013 -4.168  -22.449 1.00 54.56  ? 317  TYR A CA  1 
ATOM   2613 C C   . TYR A 1 335 ? -28.030 -4.465  -20.952 1.00 56.71  ? 317  TYR A C   1 
ATOM   2614 O O   . TYR A 1 335 ? -27.250 -5.266  -20.441 1.00 54.20  ? 317  TYR A O   1 
ATOM   2615 C CB  . TYR A 1 335 ? -28.388 -5.411  -23.268 1.00 54.93  ? 317  TYR A CB  1 
ATOM   2616 C CG  . TYR A 1 335 ? -29.703 -6.005  -22.813 1.00 59.29  ? 317  TYR A CG  1 
ATOM   2617 C CD1 . TYR A 1 335 ? -30.880 -5.269  -22.902 1.00 63.34  ? 317  TYR A CD1 1 
ATOM   2618 C CD2 . TYR A 1 335 ? -29.764 -7.283  -22.270 1.00 59.74  ? 317  TYR A CD2 1 
ATOM   2619 C CE1 . TYR A 1 335 ? -32.077 -5.786  -22.487 1.00 67.54  ? 317  TYR A CE1 1 
ATOM   2620 C CE2 . TYR A 1 335 ? -30.965 -7.812  -21.840 1.00 63.30  ? 317  TYR A CE2 1 
ATOM   2621 C CZ  . TYR A 1 335 ? -32.117 -7.059  -21.955 1.00 67.37  ? 317  TYR A CZ  1 
ATOM   2622 O OH  . TYR A 1 335 ? -33.327 -7.574  -21.542 1.00 72.49  ? 317  TYR A OH  1 
ATOM   2623 N N   . THR A 1 336 ? -28.920 -3.766  -20.262 1.00 62.93  ? 318  THR A N   1 
ATOM   2624 C CA  . THR A 1 336 ? -28.962 -3.775  -18.801 1.00 67.39  ? 318  THR A CA  1 
ATOM   2625 C C   . THR A 1 336 ? -29.493 -5.111  -18.267 1.00 69.62  ? 318  THR A C   1 
ATOM   2626 O O   . THR A 1 336 ? -28.881 -5.728  -17.375 1.00 69.10  ? 318  THR A O   1 
ATOM   2627 C CB  . THR A 1 336 ? -29.791 -2.562  -18.246 1.00 72.06  ? 318  THR A CB  1 
ATOM   2628 O OG1 . THR A 1 336 ? -30.901 -2.273  -19.113 1.00 74.96  ? 318  THR A OG1 1 
ATOM   2629 C CG2 . THR A 1 336 ? -28.910 -1.295  -18.145 1.00 72.21  ? 318  THR A CG2 1 
ATOM   2630 N N   . GLY A 1 337 ? -30.589 -5.572  -18.884 1.00 72.39  ? 319  GLY A N   1 
ATOM   2631 C CA  . GLY A 1 337 ? -31.465 -6.605  -18.344 1.00 75.13  ? 319  GLY A CA  1 
ATOM   2632 C C   . GLY A 1 337 ? -30.907 -7.997  -18.207 1.00 73.22  ? 319  GLY A C   1 
ATOM   2633 O O   . GLY A 1 337 ? -29.690 -8.180  -18.264 1.00 69.51  ? 319  GLY A O   1 
ATOM   2634 N N   . PRO A 1 338 ? -31.806 -8.994  -17.998 1.00 76.14  ? 320  PRO A N   1 
ATOM   2635 C CA  . PRO A 1 338 ? -31.404 -10.393 -17.794 1.00 74.50  ? 320  PRO A CA  1 
ATOM   2636 C C   . PRO A 1 338 ? -30.782 -11.026 -19.031 1.00 71.46  ? 320  PRO A C   1 
ATOM   2637 O O   . PRO A 1 338 ? -30.969 -10.534 -20.145 1.00 71.56  ? 320  PRO A O   1 
ATOM   2638 C CB  . PRO A 1 338 ? -32.730 -11.100 -17.445 1.00 79.03  ? 320  PRO A CB  1 
ATOM   2639 C CG  . PRO A 1 338 ? -33.675 -10.006 -17.067 1.00 83.03  ? 320  PRO A CG  1 
ATOM   2640 C CD  . PRO A 1 338 ? -33.273 -8.840  -17.904 1.00 81.01  ? 320  PRO A CD  1 
ATOM   2641 N N   . LEU A 1 339 ? -30.049 -12.114 -18.810 1.00 69.32  ? 321  LEU A N   1 
ATOM   2642 C CA  . LEU A 1 339 ? -29.460 -12.930 -19.871 1.00 67.03  ? 321  LEU A CA  1 
ATOM   2643 C C   . LEU A 1 339 ? -30.446 -13.383 -20.959 1.00 69.73  ? 321  LEU A C   1 
ATOM   2644 O O   . LEU A 1 339 ? -31.401 -14.135 -20.682 1.00 73.28  ? 321  LEU A O   1 
ATOM   2645 C CB  . LEU A 1 339 ? -28.789 -14.166 -19.254 1.00 65.46  ? 321  LEU A CB  1 
ATOM   2646 C CG  . LEU A 1 339 ? -27.702 -14.857 -20.061 1.00 61.51  ? 321  LEU A CG  1 
ATOM   2647 C CD1 . LEU A 1 339 ? -26.504 -13.939 -20.162 1.00 57.40  ? 321  LEU A CD1 1 
ATOM   2648 C CD2 . LEU A 1 339 ? -27.339 -16.160 -19.402 1.00 61.06  ? 321  LEU A CD2 1 
ATOM   2649 N N   . GLN A 1 340 ? -30.178 -12.933 -22.187 1.00 68.70  ? 322  GLN A N   1 
ATOM   2650 C CA  . GLN A 1 340 ? -30.894 -13.350 -23.402 1.00 71.20  ? 322  GLN A CA  1 
ATOM   2651 C C   . GLN A 1 340 ? -29.885 -13.659 -24.506 1.00 68.34  ? 322  GLN A C   1 
ATOM   2652 O O   . GLN A 1 340 ? -28.783 -13.122 -24.509 1.00 65.54  ? 322  GLN A O   1 
ATOM   2653 C CB  . GLN A 1 340 ? -31.845 -12.252 -23.874 1.00 74.45  ? 322  GLN A CB  1 
ATOM   2654 C CG  . GLN A 1 340 ? -31.156 -10.916 -24.129 1.00 72.66  ? 322  GLN A CG  1 
ATOM   2655 C CD  . GLN A 1 340 ? -32.067 -9.896  -24.774 1.00 78.28  ? 322  GLN A CD  1 
ATOM   2656 O OE1 . GLN A 1 340 ? -31.655 -9.170  -25.690 1.00 78.01  ? 322  GLN A OE1 1 
ATOM   2657 N NE2 . GLN A 1 340 ? -33.319 -9.833  -24.308 1.00 83.35  ? 322  GLN A NE2 1 
ATOM   2658 N N   . HIS A 1 341 ? -30.262 -14.516 -25.449 1.00 69.81  ? 323  HIS A N   1 
ATOM   2659 C CA  . HIS A 1 341 ? -29.303 -15.004 -26.436 1.00 67.29  ? 323  HIS A CA  1 
ATOM   2660 C C   . HIS A 1 341 ? -29.082 -13.952 -27.515 1.00 64.94  ? 323  HIS A C   1 
ATOM   2661 O O   . HIS A 1 341 ? -29.895 -13.051 -27.684 1.00 66.61  ? 323  HIS A O   1 
ATOM   2662 C CB  . HIS A 1 341 ? -29.753 -16.368 -27.026 1.00 71.43  ? 323  HIS A CB  1 
ATOM   2663 C CG  . HIS A 1 341 ? -30.578 -16.257 -28.275 1.00 77.56  ? 323  HIS A CG  1 
ATOM   2664 N ND1 . HIS A 1 341 ? -30.061 -15.811 -29.476 1.00 78.54  ? 323  HIS A ND1 1 
ATOM   2665 C CD2 . HIS A 1 341 ? -31.880 -16.553 -28.512 1.00 85.23  ? 323  HIS A CD2 1 
ATOM   2666 C CE1 . HIS A 1 341 ? -31.013 -15.813 -30.391 1.00 85.13  ? 323  HIS A CE1 1 
ATOM   2667 N NE2 . HIS A 1 341 ? -32.125 -16.267 -29.836 1.00 89.28  ? 323  HIS A NE2 1 
ATOM   2668 N N   . GLY A 1 342 ? -27.979 -14.069 -28.243 1.00 61.03  ? 324  GLY A N   1 
ATOM   2669 C CA  . GLY A 1 342 ? -27.669 -13.112 -29.298 1.00 57.98  ? 324  GLY A CA  1 
ATOM   2670 C C   . GLY A 1 342 ? -26.622 -12.113 -28.856 1.00 52.34  ? 324  GLY A C   1 
ATOM   2671 O O   . GLY A 1 342 ? -25.868 -11.608 -29.672 1.00 51.47  ? 324  GLY A O   1 
ATOM   2672 N N   . ILE A 1 343 ? -26.578 -11.846 -27.556 1.00 49.03  ? 325  ILE A N   1 
ATOM   2673 C CA  . ILE A 1 343 ? -25.697 -10.838 -26.972 1.00 44.65  ? 325  ILE A CA  1 
ATOM   2674 C C   . ILE A 1 343 ? -24.298 -11.374 -26.711 1.00 41.11  ? 325  ILE A C   1 
ATOM   2675 O O   . ILE A 1 343 ? -24.127 -12.513 -26.282 1.00 41.14  ? 325  ILE A O   1 
ATOM   2676 C CB  . ILE A 1 343 ? -26.291 -10.262 -25.668 1.00 45.07  ? 325  ILE A CB  1 
ATOM   2677 C CG1 . ILE A 1 343 ? -27.490 -9.371  -26.008 1.00 48.75  ? 325  ILE A CG1 1 
ATOM   2678 C CG2 . ILE A 1 343 ? -25.272 -9.393  -24.930 1.00 42.04  ? 325  ILE A CG2 1 
ATOM   2679 C CD1 . ILE A 1 343 ? -28.406 -9.076  -24.834 1.00 51.82  ? 325  ILE A CD1 1 
ATOM   2680 N N   . VAL A 1 344 ? -23.303 -10.540 -26.977 1.00 37.92  ? 326  VAL A N   1 
ATOM   2681 C CA  . VAL A 1 344 ? -21.921 -10.846 -26.724 1.00 34.75  ? 326  VAL A CA  1 
ATOM   2682 C C   . VAL A 1 344 ? -21.395 -9.690  -25.867 1.00 33.20  ? 326  VAL A C   1 
ATOM   2683 O O   . VAL A 1 344 ? -21.485 -8.524  -26.247 1.00 33.25  ? 326  VAL A O   1 
ATOM   2684 C CB  . VAL A 1 344 ? -21.157 -10.977 -28.056 1.00 35.17  ? 326  VAL A CB  1 
ATOM   2685 C CG1 . VAL A 1 344 ? -19.660 -11.135 -27.837 1.00 34.81  ? 326  VAL A CG1 1 
ATOM   2686 C CG2 . VAL A 1 344 ? -21.710 -12.127 -28.877 1.00 36.97  ? 326  VAL A CG2 1 
ATOM   2687 N N   . TYR A 1 345 ? -20.885 -10.017 -24.686 1.00 31.88  ? 327  TYR A N   1 
ATOM   2688 C CA  . TYR A 1 345 ? -20.300 -9.024  -23.758 1.00 30.50  ? 327  TYR A CA  1 
ATOM   2689 C C   . TYR A 1 345 ? -18.808 -8.869  -23.924 1.00 28.60  ? 327  TYR A C   1 
ATOM   2690 O O   . TYR A 1 345 ? -18.138 -9.689  -24.567 1.00 29.01  ? 327  TYR A O   1 
ATOM   2691 C CB  . TYR A 1 345 ? -20.547 -9.450  -22.314 1.00 30.86  ? 327  TYR A CB  1 
ATOM   2692 C CG  . TYR A 1 345 ? -22.001 -9.474  -21.948 1.00 33.31  ? 327  TYR A CG  1 
ATOM   2693 C CD1 . TYR A 1 345 ? -22.718 -8.270  -21.741 1.00 34.27  ? 327  TYR A CD1 1 
ATOM   2694 C CD2 . TYR A 1 345 ? -22.672 -10.674 -21.814 1.00 33.10  ? 327  TYR A CD2 1 
ATOM   2695 C CE1 . TYR A 1 345 ? -24.067 -8.293  -21.407 1.00 35.46  ? 327  TYR A CE1 1 
ATOM   2696 C CE2 . TYR A 1 345 ? -24.029 -10.710 -21.468 1.00 36.60  ? 327  TYR A CE2 1 
ATOM   2697 C CZ  . TYR A 1 345 ? -24.711 -9.515  -21.262 1.00 37.17  ? 327  TYR A CZ  1 
ATOM   2698 O OH  . TYR A 1 345 ? -26.037 -9.558  -20.926 1.00 39.41  ? 327  TYR A OH  1 
ATOM   2699 N N   . SER A 1 346 ? -18.297 -7.846  -23.271 1.00 27.81  ? 328  SER A N   1 
ATOM   2700 C CA  . SER A 1 346 ? -16.911 -7.434  -23.375 1.00 27.60  ? 328  SER A CA  1 
ATOM   2701 C C   . SER A 1 346 ? -16.527 -6.839  -22.020 1.00 28.69  ? 328  SER A C   1 
ATOM   2702 O O   . SER A 1 346 ? -17.287 -6.045  -21.463 1.00 29.78  ? 328  SER A O   1 
ATOM   2703 C CB  . SER A 1 346 ? -16.776 -6.408  -24.506 1.00 26.64  ? 328  SER A CB  1 
ATOM   2704 O OG  . SER A 1 346 ? -15.475 -5.866  -24.585 1.00 28.97  ? 328  SER A OG  1 
ATOM   2705 N N   . GLY A 1 347 ? -15.374 -7.228  -21.484 1.00 29.16  ? 329  GLY A N   1 
ATOM   2706 C CA  . GLY A 1 347 ? -14.893 -6.677  -20.222 1.00 31.32  ? 329  GLY A CA  1 
ATOM   2707 C C   . GLY A 1 347 ? -15.653 -7.240  -19.056 1.00 31.83  ? 329  GLY A C   1 
ATOM   2708 O O   . GLY A 1 347 ? -15.773 -8.462  -18.939 1.00 32.35  ? 329  GLY A O   1 
ATOM   2709 N N   . GLY A 1 348 ? -16.154 -6.362  -18.182 1.00 32.95  ? 330  GLY A N   1 
ATOM   2710 C CA  . GLY A 1 348 ? -16.920 -6.794  -17.026 1.00 33.17  ? 330  GLY A CA  1 
ATOM   2711 C C   . GLY A 1 348 ? -16.042 -7.502  -16.014 1.00 34.99  ? 330  GLY A C   1 
ATOM   2712 O O   . GLY A 1 348 ? -14.814 -7.237  -15.929 1.00 35.68  ? 330  GLY A O   1 
ATOM   2713 N N   . SER A 1 349 ? -16.651 -8.417  -15.256 1.00 34.90  ? 331  SER A N   1 
ATOM   2714 C CA  . SER A 1 349 ? -15.932 -9.144  -14.194 1.00 35.47  ? 331  SER A CA  1 
ATOM   2715 C C   . SER A 1 349 ? -16.510 -10.549 -13.978 1.00 34.77  ? 331  SER A C   1 
ATOM   2716 O O   . SER A 1 349 ? -17.600 -10.869 -14.468 1.00 32.82  ? 331  SER A O   1 
ATOM   2717 C CB  . SER A 1 349 ? -15.989 -8.357  -12.888 1.00 38.21  ? 331  SER A CB  1 
ATOM   2718 O OG  . SER A 1 349 ? -17.257 -8.523  -12.302 1.00 36.78  ? 331  SER A OG  1 
ATOM   2719 N N   . SER A 1 350 ? -15.807 -11.394 -13.236 1.00 35.62  ? 332  SER A N   1 
ATOM   2720 C CA  . SER A 1 350 ? -16.356 -12.730 -12.999 1.00 36.32  ? 332  SER A CA  1 
ATOM   2721 C C   . SER A 1 350 ? -17.618 -12.679 -12.126 1.00 38.53  ? 332  SER A C   1 
ATOM   2722 O O   . SER A 1 350 ? -18.476 -13.553 -12.217 1.00 38.11  ? 332  SER A O   1 
ATOM   2723 C CB  . SER A 1 350 ? -15.302 -13.685 -12.438 1.00 36.39  ? 332  SER A CB  1 
ATOM   2724 O OG  . SER A 1 350 ? -14.840 -13.212 -11.210 1.00 39.26  ? 332  SER A OG  1 
ATOM   2725 N N   . ASP A 1 351 ? -17.725 -11.650 -11.293 1.00 42.28  ? 333  ASP A N   1 
ATOM   2726 C CA  . ASP A 1 351 ? -18.901 -11.425 -10.476 1.00 46.27  ? 333  ASP A CA  1 
ATOM   2727 C C   . ASP A 1 351 ? -20.083 -11.058 -11.353 1.00 46.43  ? 333  ASP A C   1 
ATOM   2728 O O   . ASP A 1 351 ? -21.216 -11.398 -11.034 1.00 48.30  ? 333  ASP A O   1 
ATOM   2729 C CB  . ASP A 1 351 ? -18.675 -10.311 -9.435  1.00 49.29  ? 333  ASP A CB  1 
ATOM   2730 C CG  . ASP A 1 351 ? -17.813 -10.760 -8.236  1.00 52.45  ? 333  ASP A CG  1 
ATOM   2731 O OD1 . ASP A 1 351 ? -17.706 -11.986 -7.941  1.00 51.36  ? 333  ASP A OD1 1 
ATOM   2732 O OD2 . ASP A 1 351 ? -17.236 -9.863  -7.578  1.00 52.36  ? 333  ASP A OD2 1 
ATOM   2733 N N   . THR A 1 352 ? -19.830 -10.352 -12.447 1.00 46.16  ? 334  THR A N   1 
ATOM   2734 C CA  . THR A 1 352 ? -20.914 -9.980  -13.354 1.00 47.33  ? 334  THR A CA  1 
ATOM   2735 C C   . THR A 1 352 ? -21.456 -11.225 -14.089 1.00 45.63  ? 334  THR A C   1 
ATOM   2736 O O   . THR A 1 352 ? -22.677 -11.394 -14.263 1.00 46.91  ? 334  THR A O   1 
ATOM   2737 C CB  . THR A 1 352 ? -20.518 -8.802  -14.285 1.00 46.41  ? 334  THR A CB  1 
ATOM   2738 O OG1 . THR A 1 352 ? -20.720 -7.571  -13.574 1.00 50.83  ? 334  THR A OG1 1 
ATOM   2739 C CG2 . THR A 1 352 ? -21.386 -8.752  -15.513 1.00 47.33  ? 334  THR A CG2 1 
ATOM   2740 N N   . ILE A 1 353 ? -20.552 -12.115 -14.473 1.00 43.83  ? 335  ILE A N   1 
ATOM   2741 C CA  . ILE A 1 353 ? -20.951 -13.383 -15.040 1.00 42.52  ? 335  ILE A CA  1 
ATOM   2742 C C   . ILE A 1 353 ? -21.865 -14.200 -14.106 1.00 44.25  ? 335  ILE A C   1 
ATOM   2743 O O   . ILE A 1 353 ? -22.904 -14.700 -14.533 1.00 44.67  ? 335  ILE A O   1 
ATOM   2744 C CB  . ILE A 1 353 ? -19.700 -14.180 -15.449 1.00 41.93  ? 335  ILE A CB  1 
ATOM   2745 C CG1 . ILE A 1 353 ? -19.091 -13.579 -16.710 1.00 40.19  ? 335  ILE A CG1 1 
ATOM   2746 C CG2 . ILE A 1 353 ? -20.019 -15.631 -15.651 1.00 40.80  ? 335  ILE A CG2 1 
ATOM   2747 C CD1 . ILE A 1 353 ? -18.406 -14.612 -17.545 1.00 37.38  ? 335  ILE A CD1 1 
ATOM   2748 N N   . CYS A 1 354 ? -21.483 -14.330 -12.838 1.00 45.73  ? 336  CYS A N   1 
ATOM   2749 C CA  . CYS A 1 354 ? -22.327 -14.987 -11.842 1.00 48.87  ? 336  CYS A CA  1 
ATOM   2750 C C   . CYS A 1 354 ? -23.719 -14.403 -11.763 1.00 50.32  ? 336  CYS A C   1 
ATOM   2751 O O   . CYS A 1 354 ? -24.704 -15.133 -11.698 1.00 51.58  ? 336  CYS A O   1 
ATOM   2752 C CB  . CYS A 1 354 ? -21.704 -14.866 -10.455 1.00 51.00  ? 336  CYS A CB  1 
ATOM   2753 S SG  . CYS A 1 354 ? -20.258 -15.862 -10.291 1.00 55.61  ? 336  CYS A SG  1 
ATOM   2754 N N   . ASP A 1 355 ? -23.790 -13.077 -11.721 1.00 50.79  ? 337  ASP A N   1 
ATOM   2755 C CA  . ASP A 1 355 ? -25.068 -12.392 -11.657 1.00 53.23  ? 337  ASP A CA  1 
ATOM   2756 C C   . ASP A 1 355 ? -25.945 -12.714 -12.864 1.00 51.93  ? 337  ASP A C   1 
ATOM   2757 O O   . ASP A 1 355 ? -27.092 -13.132 -12.699 1.00 54.29  ? 337  ASP A O   1 
ATOM   2758 C CB  . ASP A 1 355 ? -24.869 -10.886 -11.463 1.00 54.44  ? 337  ASP A CB  1 
ATOM   2759 C CG  . ASP A 1 355 ? -24.212 -10.554 -10.118 1.00 57.77  ? 337  ASP A CG  1 
ATOM   2760 O OD1 . ASP A 1 355 ? -24.358 -11.346 -9.151  1.00 60.17  ? 337  ASP A OD1 1 
ATOM   2761 O OD2 . ASP A 1 355 ? -23.545 -9.497  -10.029 1.00 59.24  ? 337  ASP A OD2 1 
ATOM   2762 N N   . LEU A 1 356 ? -25.384 -12.546 -14.058 1.00 48.58  ? 338  LEU A N   1 
ATOM   2763 C CA  . LEU A 1 356 ? -26.044 -12.928 -15.304 1.00 47.96  ? 338  LEU A CA  1 
ATOM   2764 C C   . LEU A 1 356 ? -26.471 -14.393 -15.391 1.00 48.01  ? 338  LEU A C   1 
ATOM   2765 O O   . LEU A 1 356 ? -27.592 -14.678 -15.824 1.00 49.75  ? 338  LEU A O   1 
ATOM   2766 C CB  . LEU A 1 356 ? -25.177 -12.558 -16.504 1.00 45.02  ? 338  LEU A CB  1 
ATOM   2767 C CG  . LEU A 1 356 ? -25.019 -11.065 -16.728 1.00 44.63  ? 338  LEU A CG  1 
ATOM   2768 C CD1 . LEU A 1 356 ? -24.036 -10.827 -17.831 1.00 43.19  ? 338  LEU A CD1 1 
ATOM   2769 C CD2 . LEU A 1 356 ? -26.373 -10.448 -17.054 1.00 47.92  ? 338  LEU A CD2 1 
ATOM   2770 N N   . LEU A 1 357 ? -25.606 -15.314 -14.973 1.00 46.69  ? 339  LEU A N   1 
ATOM   2771 C CA  . LEU A 1 357 ? -25.953 -16.741 -15.036 1.00 47.82  ? 339  LEU A CA  1 
ATOM   2772 C C   . LEU A 1 357 ? -26.810 -17.223 -13.869 1.00 51.21  ? 339  LEU A C   1 
ATOM   2773 O O   . LEU A 1 357 ? -27.364 -18.316 -13.921 1.00 52.47  ? 339  LEU A O   1 
ATOM   2774 C CB  . LEU A 1 357 ? -24.710 -17.626 -15.184 1.00 45.10  ? 339  LEU A CB  1 
ATOM   2775 C CG  . LEU A 1 357 ? -23.812 -17.309 -16.391 1.00 44.25  ? 339  LEU A CG  1 
ATOM   2776 C CD1 . LEU A 1 357 ? -22.457 -17.983 -16.232 1.00 43.54  ? 339  LEU A CD1 1 
ATOM   2777 C CD2 . LEU A 1 357 ? -24.455 -17.681 -17.719 1.00 44.30  ? 339  LEU A CD2 1 
ATOM   2778 N N   . GLY A 1 358 ? -26.914 -16.417 -12.816 1.00 53.52  ? 340  GLY A N   1 
ATOM   2779 C CA  . GLY A 1 358 ? -27.691 -16.789 -11.648 1.00 57.60  ? 340  GLY A CA  1 
ATOM   2780 C C   . GLY A 1 358 ? -27.084 -17.936 -10.862 1.00 57.95  ? 340  GLY A C   1 
ATOM   2781 O O   . GLY A 1 358 ? -27.794 -18.682 -10.202 1.00 60.82  ? 340  GLY A O   1 
ATOM   2782 N N   . ALA A 1 359 ? -25.765 -18.078 -10.909 1.00 55.99  ? 341  ALA A N   1 
ATOM   2783 C CA  . ALA A 1 359 ? -25.101 -19.126 -10.132 1.00 56.62  ? 341  ALA A CA  1 
ATOM   2784 C C   . ALA A 1 359 ? -23.779 -18.631 -9.577  1.00 55.63  ? 341  ALA A C   1 
ATOM   2785 O O   . ALA A 1 359 ? -22.998 -18.038 -10.325 1.00 53.81  ? 341  ALA A O   1 
ATOM   2786 C CB  . ALA A 1 359 ? -24.871 -20.356 -11.004 1.00 54.99  ? 341  ALA A CB  1 
ATOM   2787 N N   . LYS A 1 360 ? -23.514 -18.904 -8.297  1.00 57.39  ? 342  LYS A N   1 
ATOM   2788 C CA  . LYS A 1 360 ? -22.260 -18.473 -7.634  1.00 57.49  ? 342  LYS A CA  1 
ATOM   2789 C C   . LYS A 1 360 ? -21.204 -19.574 -7.353  1.00 55.96  ? 342  LYS A C   1 
ATOM   2790 O O   . LYS A 1 360 ? -21.533 -20.768 -7.238  1.00 56.25  ? 342  LYS A O   1 
ATOM   2791 C CB  . LYS A 1 360 ? -22.579 -17.716 -6.331  1.00 62.03  ? 342  LYS A CB  1 
ATOM   2792 C CG  . LYS A 1 360 ? -23.024 -16.270 -6.544  1.00 64.44  ? 342  LYS A CG  1 
ATOM   2793 C CD  . LYS A 1 360 ? -23.882 -15.778 -5.380  1.00 71.79  ? 342  LYS A CD  1 
ATOM   2794 C CE  . LYS A 1 360 ? -24.707 -14.541 -5.784  1.00 74.19  ? 342  LYS A CE  1 
ATOM   2795 N NZ  . LYS A 1 360 ? -25.636 -14.088 -4.700  1.00 79.11  ? 342  LYS A NZ  1 
ATOM   2796 N N   . GLY A 1 361 ? -19.939 -19.151 -7.283  1.00 54.15  ? 343  GLY A N   1 
ATOM   2797 C CA  . GLY A 1 361 ? -18.835 -19.935 -6.710  1.00 53.46  ? 343  GLY A CA  1 
ATOM   2798 C C   . GLY A 1 361 ? -18.737 -21.405 -7.057  1.00 51.39  ? 343  GLY A C   1 
ATOM   2799 O O   . GLY A 1 361 ? -18.440 -21.762 -8.203  1.00 48.65  ? 343  GLY A O   1 
ATOM   2800 N N   . LYS A 1 362 ? -19.001 -22.248 -6.063  1.00 53.20  ? 344  LYS A N   1 
ATOM   2801 C CA  . LYS A 1 362 ? -18.819 -23.707 -6.157  1.00 52.77  ? 344  LYS A CA  1 
ATOM   2802 C C   . LYS A 1 362 ? -19.814 -24.391 -7.107  1.00 50.55  ? 344  LYS A C   1 
ATOM   2803 O O   . LYS A 1 362 ? -19.697 -25.577 -7.392  1.00 50.35  ? 344  LYS A O   1 
ATOM   2804 C CB  . LYS A 1 362 ? -18.887 -24.333 -4.750  1.00 56.46  ? 344  LYS A CB  1 
ATOM   2805 C CG  . LYS A 1 362 ? -17.597 -24.170 -3.928  1.00 60.01  ? 344  LYS A CG  1 
ATOM   2806 C CD  . LYS A 1 362 ? -17.833 -23.602 -2.489  1.00 65.60  ? 344  LYS A CD  1 
ATOM   2807 C CE  . LYS A 1 362 ? -18.081 -22.064 -2.477  1.00 63.31  ? 344  LYS A CE  1 
ATOM   2808 N NZ  . LYS A 1 362 ? -16.850 -21.238 -2.501  1.00 62.58  ? 344  LYS A NZ  1 
ATOM   2809 N N   . ASP A 1 363 ? -20.806 -23.636 -7.568  1.00 49.96  ? 345  ASP A N   1 
ATOM   2810 C CA  . ASP A 1 363 ? -21.755 -24.083 -8.586  1.00 48.53  ? 345  ASP A CA  1 
ATOM   2811 C C   . ASP A 1 363 ? -21.101 -24.019 -9.949  1.00 44.10  ? 345  ASP A C   1 
ATOM   2812 O O   . ASP A 1 363 ? -21.620 -24.576 -10.909 1.00 42.36  ? 345  ASP A O   1 
ATOM   2813 C CB  . ASP A 1 363 ? -22.984 -23.160 -8.620  1.00 51.14  ? 345  ASP A CB  1 
ATOM   2814 C CG  . ASP A 1 363 ? -23.787 -23.183 -7.318  1.00 57.54  ? 345  ASP A CG  1 
ATOM   2815 O OD1 . ASP A 1 363 ? -23.801 -24.234 -6.625  1.00 61.04  ? 345  ASP A OD1 1 
ATOM   2816 O OD2 . ASP A 1 363 ? -24.409 -22.136 -6.998  1.00 64.25  ? 345  ASP A OD2 1 
ATOM   2817 N N   . ILE A 1 364 ? -19.959 -23.333 -10.024 1.00 36.59  ? 346  ILE A N   1 
ATOM   2818 C CA  . ILE A 1 364 ? -19.257 -23.104 -11.300 1.00 32.99  ? 346  ILE A CA  1 
ATOM   2819 C C   . ILE A 1 364 ? -17.940 -23.870 -11.436 1.00 30.73  ? 346  ILE A C   1 
ATOM   2820 O O   . ILE A 1 364 ? -17.089 -23.780 -10.577 1.00 29.90  ? 346  ILE A O   1 
ATOM   2821 C CB  . ILE A 1 364 ? -19.057 -21.619 -11.570 1.00 32.68  ? 346  ILE A CB  1 
ATOM   2822 C CG1 . ILE A 1 364 ? -20.424 -20.937 -11.660 1.00 34.39  ? 346  ILE A CG1 1 
ATOM   2823 C CG2 . ILE A 1 364 ? -18.229 -21.403 -12.856 1.00 30.41  ? 346  ILE A CG2 1 
ATOM   2824 C CD1 . ILE A 1 364 ? -20.355 -19.499 -12.063 1.00 36.21  ? 346  ILE A CD1 1 
ATOM   2825 N N   . LEU A 1 365 ? -17.818 -24.650 -12.516 1.00 30.15  ? 347  LEU A N   1 
ATOM   2826 C CA  . LEU A 1 365 ? -16.537 -25.180 -12.974 1.00 28.65  ? 347  LEU A CA  1 
ATOM   2827 C C   . LEU A 1 365 ? -15.986 -24.331 -14.118 1.00 28.07  ? 347  LEU A C   1 
ATOM   2828 O O   . LEU A 1 365 ? -16.552 -24.253 -15.223 1.00 28.65  ? 347  LEU A O   1 
ATOM   2829 C CB  . LEU A 1 365 ? -16.659 -26.628 -13.432 1.00 29.08  ? 347  LEU A CB  1 
ATOM   2830 C CG  . LEU A 1 365 ? -15.370 -27.365 -13.848 1.00 28.29  ? 347  LEU A CG  1 
ATOM   2831 C CD1 . LEU A 1 365 ? -14.347 -27.428 -12.713 1.00 24.99  ? 347  LEU A CD1 1 
ATOM   2832 C CD2 . LEU A 1 365 ? -15.714 -28.792 -14.373 1.00 27.26  ? 347  LEU A CD2 1 
ATOM   2833 N N   . TYR A 1 366 ? -14.849 -23.715 -13.843 1.00 27.75  ? 348  TYR A N   1 
ATOM   2834 C CA  . TYR A 1 366 ? -14.078 -22.960 -14.836 1.00 27.16  ? 348  TYR A CA  1 
ATOM   2835 C C   . TYR A 1 366 ? -12.929 -23.817 -15.386 1.00 24.64  ? 348  TYR A C   1 
ATOM   2836 O O   . TYR A 1 366 ? -12.139 -24.364 -14.638 1.00 23.61  ? 348  TYR A O   1 
ATOM   2837 C CB  . TYR A 1 366 ? -13.551 -21.699 -14.175 1.00 27.91  ? 348  TYR A CB  1 
ATOM   2838 C CG  . TYR A 1 366 ? -12.677 -20.864 -15.062 1.00 31.46  ? 348  TYR A CG  1 
ATOM   2839 C CD1 . TYR A 1 366 ? -13.196 -20.192 -16.173 1.00 33.75  ? 348  TYR A CD1 1 
ATOM   2840 C CD2 . TYR A 1 366 ? -11.328 -20.743 -14.792 1.00 33.48  ? 348  TYR A CD2 1 
ATOM   2841 C CE1 . TYR A 1 366 ? -12.373 -19.425 -16.978 1.00 34.79  ? 348  TYR A CE1 1 
ATOM   2842 C CE2 . TYR A 1 366 ? -10.510 -20.006 -15.583 1.00 33.77  ? 348  TYR A CE2 1 
ATOM   2843 C CZ  . TYR A 1 366 ? -11.030 -19.344 -16.670 1.00 33.22  ? 348  TYR A CZ  1 
ATOM   2844 O OH  . TYR A 1 366 ? -10.176 -18.587 -17.427 1.00 33.88  ? 348  TYR A OH  1 
ATOM   2845 N N   . ILE A 1 367 ? -12.880 -23.938 -16.694 1.00 23.99  ? 349  ILE A N   1 
ATOM   2846 C CA  . ILE A 1 367 ? -11.925 -24.762 -17.424 1.00 23.79  ? 349  ILE A CA  1 
ATOM   2847 C C   . ILE A 1 367 ? -10.972 -23.839 -18.212 1.00 24.78  ? 349  ILE A C   1 
ATOM   2848 O O   . ILE A 1 367 ? -11.380 -23.091 -19.112 1.00 25.81  ? 349  ILE A O   1 
ATOM   2849 C CB  . ILE A 1 367 ? -12.731 -25.722 -18.373 1.00 25.38  ? 349  ILE A CB  1 
ATOM   2850 C CG1 . ILE A 1 367 ? -13.692 -26.592 -17.544 1.00 25.26  ? 349  ILE A CG1 1 
ATOM   2851 C CG2 . ILE A 1 367 ? -11.821 -26.617 -19.257 1.00 24.34  ? 349  ILE A CG2 1 
ATOM   2852 C CD1 . ILE A 1 367 ? -14.848 -27.193 -18.344 1.00 25.50  ? 349  ILE A CD1 1 
ATOM   2853 N N   . GLY A 1 368 ? -9.697  -23.865 -17.864 1.00 25.29  ? 350  GLY A N   1 
ATOM   2854 C CA  . GLY A 1 368 ? -8.711  -23.013 -18.503 1.00 26.20  ? 350  GLY A CA  1 
ATOM   2855 C C   . GLY A 1 368 ? -7.321  -23.625 -18.481 1.00 28.09  ? 350  GLY A C   1 
ATOM   2856 O O   . GLY A 1 368 ? -7.083  -24.694 -17.892 1.00 27.23  ? 350  GLY A O   1 
ATOM   2857 N N   . ASP A 1 369 ? -6.386  -22.928 -19.102 1.00 30.12  ? 351  ASP A N   1 
ATOM   2858 C CA  . ASP A 1 369 ? -5.001  -23.383 -19.141 1.00 33.12  ? 351  ASP A CA  1 
ATOM   2859 C C   . ASP A 1 369 ? -4.086  -22.679 -18.130 1.00 34.97  ? 351  ASP A C   1 
ATOM   2860 O O   . ASP A 1 369 ? -2.889  -22.974 -18.062 1.00 35.83  ? 351  ASP A O   1 
ATOM   2861 C CB  . ASP A 1 369 ? -4.434  -23.175 -20.535 1.00 34.01  ? 351  ASP A CB  1 
ATOM   2862 C CG  . ASP A 1 369 ? -4.289  -21.716 -20.881 1.00 34.63  ? 351  ASP A CG  1 
ATOM   2863 O OD1 . ASP A 1 369 ? -5.296  -20.984 -20.719 1.00 37.02  ? 351  ASP A OD1 1 
ATOM   2864 O OD2 . ASP A 1 369 ? -3.173  -21.308 -21.299 1.00 35.18  ? 351  ASP A OD2 1 
ATOM   2865 N N   . HIS A 1 370 ? -4.635  -21.738 -17.369 1.00 37.02  ? 352  HIS A N   1 
ATOM   2866 C CA  . HIS A 1 370 ? -3.815  -20.986 -16.481 1.00 39.73  ? 352  HIS A CA  1 
ATOM   2867 C C   . HIS A 1 370 ? -4.299  -20.928 -15.064 1.00 41.41  ? 352  HIS A C   1 
ATOM   2868 O O   . HIS A 1 370 ? -5.471  -20.679 -14.805 1.00 41.96  ? 352  HIS A O   1 
ATOM   2869 C CB  . HIS A 1 370 ? -3.579  -19.575 -16.987 1.00 41.47  ? 352  HIS A CB  1 
ATOM   2870 C CG  . HIS A 1 370 ? -2.614  -18.807 -16.138 1.00 45.13  ? 352  HIS A CG  1 
ATOM   2871 N ND1 . HIS A 1 370 ? -1.331  -19.258 -15.879 1.00 47.12  ? 352  HIS A ND1 1 
ATOM   2872 C CD2 . HIS A 1 370 ? -2.751  -17.643 -15.458 1.00 46.16  ? 352  HIS A CD2 1 
ATOM   2873 C CE1 . HIS A 1 370 ? -0.717  -18.391 -15.091 1.00 49.01  ? 352  HIS A CE1 1 
ATOM   2874 N NE2 . HIS A 1 370 ? -1.556  -17.403 -14.823 1.00 48.35  ? 352  HIS A NE2 1 
ATOM   2875 N N   . ILE A 1 371 ? -3.318  -21.121 -14.178 1.00 43.72  ? 353  ILE A N   1 
ATOM   2876 C CA  . ILE A 1 371 ? -3.390  -21.038 -12.709 1.00 45.63  ? 353  ILE A CA  1 
ATOM   2877 C C   . ILE A 1 371 ? -3.415  -19.598 -12.181 1.00 47.11  ? 353  ILE A C   1 
ATOM   2878 O O   . ILE A 1 371 ? -2.372  -18.930 -12.171 1.00 48.99  ? 353  ILE A O   1 
ATOM   2879 C CB  . ILE A 1 371 ? -2.107  -21.748 -12.077 1.00 46.36  ? 353  ILE A CB  1 
ATOM   2880 C CG1 . ILE A 1 371 ? -1.914  -23.152 -12.655 1.00 43.84  ? 353  ILE A CG1 1 
ATOM   2881 C CG2 . ILE A 1 371 ? -2.118  -21.708 -10.514 1.00 47.00  ? 353  ILE A CG2 1 
ATOM   2882 C CD1 . ILE A 1 371 ? -0.988  -24.033 -11.847 1.00 45.57  ? 353  ILE A CD1 1 
ATOM   2883 N N   . PHE A 1 372 ? -4.568  -19.123 -11.724 1.00 47.94  ? 354  PHE A N   1 
ATOM   2884 C CA  . PHE A 1 372 ? -4.622  -17.741 -11.208 1.00 51.33  ? 354  PHE A CA  1 
ATOM   2885 C C   . PHE A 1 372 ? -4.329  -17.522 -9.696  1.00 53.38  ? 354  PHE A C   1 
ATOM   2886 O O   . PHE A 1 372 ? -4.126  -18.474 -8.921  1.00 53.16  ? 354  PHE A O   1 
ATOM   2887 C CB  . PHE A 1 372 ? -5.937  -17.071 -11.607 1.00 52.07  ? 354  PHE A CB  1 
ATOM   2888 C CG  . PHE A 1 372 ? -6.060  -16.812 -13.082 1.00 51.75  ? 354  PHE A CG  1 
ATOM   2889 C CD1 . PHE A 1 372 ? -5.380  -15.741 -13.669 1.00 51.05  ? 354  PHE A CD1 1 
ATOM   2890 C CD2 . PHE A 1 372 ? -6.848  -17.662 -13.888 1.00 51.87  ? 354  PHE A CD2 1 
ATOM   2891 C CE1 . PHE A 1 372 ? -5.478  -15.488 -15.030 1.00 50.90  ? 354  PHE A CE1 1 
ATOM   2892 C CE2 . PHE A 1 372 ? -6.956  -17.433 -15.268 1.00 50.71  ? 354  PHE A CE2 1 
ATOM   2893 C CZ  . PHE A 1 372 ? -6.267  -16.321 -15.836 1.00 51.40  ? 354  PHE A CZ  1 
ATOM   2894 N N   . GLN A 1 382 ? -16.969 -16.003 -2.407  1.00 64.29  ? 364  GLN A N   1 
ATOM   2895 C CA  . GLN A 1 382 ? -16.112 -16.197 -3.573  1.00 60.41  ? 364  GLN A CA  1 
ATOM   2896 C C   . GLN A 1 382 ? -15.943 -17.696 -3.872  1.00 57.44  ? 364  GLN A C   1 
ATOM   2897 O O   . GLN A 1 382 ? -16.375 -18.532 -3.039  1.00 59.15  ? 364  GLN A O   1 
ATOM   2898 C CB  . GLN A 1 382 ? -14.727 -15.513 -3.340  1.00 61.32  ? 364  GLN A CB  1 
ATOM   2899 N N   . GLY A 1 383 ? -15.415 -17.992 -5.081  1.00 52.39  ? 365  GLY A N   1 
ATOM   2900 C CA  . GLY A 1 383 ? -14.569 -19.161 -5.374  1.00 49.09  ? 365  GLY A CA  1 
ATOM   2901 C C   . GLY A 1 383 ? -15.003 -20.258 -6.372  1.00 46.11  ? 365  GLY A C   1 
ATOM   2902 O O   . GLY A 1 383 ? -15.525 -21.295 -5.949  1.00 46.91  ? 365  GLY A O   1 
ATOM   2903 N N   . TRP A 1 384 ? -14.772 -20.064 -7.674  1.00 42.07  ? 366  TRP A N   1 
ATOM   2904 C CA  . TRP A 1 384 ? -15.156 -21.040 -8.702  1.00 39.01  ? 366  TRP A CA  1 
ATOM   2905 C C   . TRP A 1 384 ? -14.335 -22.326 -8.575  1.00 37.40  ? 366  TRP A C   1 
ATOM   2906 O O   . TRP A 1 384 ? -13.171 -22.248 -8.206  1.00 38.58  ? 366  TRP A O   1 
ATOM   2907 C CB  . TRP A 1 384 ? -14.907 -20.467 -10.108 1.00 37.39  ? 366  TRP A CB  1 
ATOM   2908 C CG  . TRP A 1 384 ? -15.827 -19.357 -10.528 1.00 38.11  ? 366  TRP A CG  1 
ATOM   2909 C CD1 . TRP A 1 384 ? -16.906 -18.871 -9.838  1.00 41.51  ? 366  TRP A CD1 1 
ATOM   2910 C CD2 . TRP A 1 384 ? -15.773 -18.617 -11.754 1.00 37.45  ? 366  TRP A CD2 1 
ATOM   2911 N NE1 . TRP A 1 384 ? -17.517 -17.855 -10.549 1.00 42.38  ? 366  TRP A NE1 1 
ATOM   2912 C CE2 . TRP A 1 384 ? -16.845 -17.686 -11.734 1.00 40.57  ? 366  TRP A CE2 1 
ATOM   2913 C CE3 . TRP A 1 384 ? -14.911 -18.622 -12.853 1.00 34.32  ? 366  TRP A CE3 1 
ATOM   2914 C CZ2 . TRP A 1 384 ? -17.089 -16.802 -12.793 1.00 38.74  ? 366  TRP A CZ2 1 
ATOM   2915 C CZ3 . TRP A 1 384 ? -15.147 -17.727 -13.894 1.00 34.89  ? 366  TRP A CZ3 1 
ATOM   2916 C CH2 . TRP A 1 384 ? -16.228 -16.846 -13.862 1.00 37.09  ? 366  TRP A CH2 1 
ATOM   2917 N N   . ARG A 1 385 ? -14.913 -23.490 -8.865  1.00 34.75  ? 367  ARG A N   1 
ATOM   2918 C CA  . ARG A 1 385 ? -14.124 -24.718 -9.000  1.00 32.61  ? 367  ARG A CA  1 
ATOM   2919 C C   . ARG A 1 385 ? -13.305 -24.681 -10.296 1.00 30.73  ? 367  ARG A C   1 
ATOM   2920 O O   . ARG A 1 385 ? -13.704 -24.026 -11.249 1.00 30.43  ? 367  ARG A O   1 
ATOM   2921 C CB  . ARG A 1 385 ? -15.014 -25.971 -9.014  1.00 32.35  ? 367  ARG A CB  1 
ATOM   2922 C CG  . ARG A 1 385 ? -16.053 -26.074 -7.923  1.00 33.09  ? 367  ARG A CG  1 
ATOM   2923 C CD  . ARG A 1 385 ? -15.435 -26.090 -6.528  1.00 34.37  ? 367  ARG A CD  1 
ATOM   2924 N NE  . ARG A 1 385 ? -14.422 -27.139 -6.315  1.00 36.18  ? 367  ARG A NE  1 
ATOM   2925 C CZ  . ARG A 1 385 ? -14.654 -28.364 -5.818  1.00 38.01  ? 367  ARG A CZ  1 
ATOM   2926 N NH1 . ARG A 1 385 ? -15.890 -28.770 -5.510  1.00 37.17  ? 367  ARG A NH1 1 
ATOM   2927 N NH2 . ARG A 1 385 ? -13.639 -29.201 -5.632  1.00 37.58  ? 367  ARG A NH2 1 
ATOM   2928 N N   . THR A 1 386 ? -12.196 -25.416 -10.358 1.00 29.49  ? 368  THR A N   1 
ATOM   2929 C CA  . THR A 1 386 ? -11.239 -25.225 -11.446 1.00 28.51  ? 368  THR A CA  1 
ATOM   2930 C C   . THR A 1 386 ? -10.875 -26.554 -12.101 1.00 28.00  ? 368  THR A C   1 
ATOM   2931 O O   . THR A 1 386 ? -10.669 -27.563 -11.412 1.00 28.50  ? 368  THR A O   1 
ATOM   2932 C CB  . THR A 1 386 ? -9.933  -24.573 -10.956 1.00 29.51  ? 368  THR A CB  1 
ATOM   2933 O OG1 . THR A 1 386 ? -9.355  -25.415 -9.933  1.00 30.68  ? 368  THR A OG1 1 
ATOM   2934 C CG2 . THR A 1 386 ? -10.172 -23.150 -10.386 1.00 26.77  ? 368  THR A CG2 1 
ATOM   2935 N N   . PHE A 1 387 ? -10.821 -26.535 -13.431 1.00 26.16  ? 369  PHE A N   1 
ATOM   2936 C CA  . PHE A 1 387 ? -10.305 -27.629 -14.208 1.00 26.01  ? 369  PHE A CA  1 
ATOM   2937 C C   . PHE A 1 387 ? -9.125  -27.077 -15.017 1.00 25.42  ? 369  PHE A C   1 
ATOM   2938 O O   . PHE A 1 387 ? -9.303  -26.186 -15.835 1.00 25.37  ? 369  PHE A O   1 
ATOM   2939 C CB  . PHE A 1 387 ? -11.400 -28.181 -15.129 1.00 25.90  ? 369  PHE A CB  1 
ATOM   2940 C CG  . PHE A 1 387 ? -10.997 -29.400 -15.912 1.00 24.92  ? 369  PHE A CG  1 
ATOM   2941 C CD1 . PHE A 1 387 ? -11.664 -30.592 -15.740 1.00 25.79  ? 369  PHE A CD1 1 
ATOM   2942 C CD2 . PHE A 1 387 ? -9.978  -29.348 -16.855 1.00 27.15  ? 369  PHE A CD2 1 
ATOM   2943 C CE1 . PHE A 1 387 ? -11.310 -31.736 -16.483 1.00 25.90  ? 369  PHE A CE1 1 
ATOM   2944 C CE2 . PHE A 1 387 ? -9.619  -30.497 -17.615 1.00 24.72  ? 369  PHE A CE2 1 
ATOM   2945 C CZ  . PHE A 1 387 ? -10.283 -31.676 -17.421 1.00 24.78  ? 369  PHE A CZ  1 
ATOM   2946 N N   . LEU A 1 388 ? -7.918  -27.585 -14.749 1.00 25.69  ? 370  LEU A N   1 
ATOM   2947 C CA  . LEU A 1 388 ? -6.705  -27.135 -15.437 1.00 24.75  ? 370  LEU A CA  1 
ATOM   2948 C C   . LEU A 1 388 ? -6.332  -28.049 -16.551 1.00 24.17  ? 370  LEU A C   1 
ATOM   2949 O O   . LEU A 1 388 ? -6.134  -29.249 -16.348 1.00 26.91  ? 370  LEU A O   1 
ATOM   2950 C CB  . LEU A 1 388 ? -5.521  -27.030 -14.471 1.00 24.73  ? 370  LEU A CB  1 
ATOM   2951 C CG  . LEU A 1 388 ? -4.236  -26.378 -15.002 1.00 25.95  ? 370  LEU A CG  1 
ATOM   2952 C CD1 . LEU A 1 388 ? -4.457  -24.857 -15.311 1.00 24.07  ? 370  LEU A CD1 1 
ATOM   2953 C CD2 . LEU A 1 388 ? -3.098  -26.569 -14.026 1.00 25.83  ? 370  LEU A CD2 1 
ATOM   2954 N N   . VAL A 1 389 ? -6.227  -27.480 -17.735 1.00 24.63  ? 371  VAL A N   1 
ATOM   2955 C CA  . VAL A 1 389 ? -5.763  -28.165 -18.925 1.00 24.46  ? 371  VAL A CA  1 
ATOM   2956 C C   . VAL A 1 389 ? -4.254  -27.936 -18.940 1.00 25.23  ? 371  VAL A C   1 
ATOM   2957 O O   . VAL A 1 389 ? -3.780  -26.780 -18.803 1.00 24.83  ? 371  VAL A O   1 
ATOM   2958 C CB  . VAL A 1 389 ? -6.408  -27.556 -20.163 1.00 25.10  ? 371  VAL A CB  1 
ATOM   2959 C CG1 . VAL A 1 389 ? -5.848  -28.195 -21.453 1.00 26.69  ? 371  VAL A CG1 1 
ATOM   2960 C CG2 . VAL A 1 389 ? -7.934  -27.710 -20.096 1.00 23.53  ? 371  VAL A CG2 1 
ATOM   2961 N N   . ILE A 1 390 ? -3.515  -29.044 -19.016 1.00 24.94  ? 372  ILE A N   1 
ATOM   2962 C CA  . ILE A 1 390 ? -2.059  -29.053 -19.122 1.00 24.95  ? 372  ILE A CA  1 
ATOM   2963 C C   . ILE A 1 390 ? -1.733  -29.836 -20.385 1.00 26.71  ? 372  ILE A C   1 
ATOM   2964 O O   . ILE A 1 390 ? -1.661  -31.046 -20.334 1.00 27.51  ? 372  ILE A O   1 
ATOM   2965 C CB  . ILE A 1 390 ? -1.363  -29.740 -17.888 1.00 25.36  ? 372  ILE A CB  1 
ATOM   2966 C CG1 . ILE A 1 390 ? -1.971  -29.243 -16.556 1.00 24.60  ? 372  ILE A CG1 1 
ATOM   2967 C CG2 . ILE A 1 390 ? 0.138   -29.484 -17.922 1.00 24.01  ? 372  ILE A CG2 1 
ATOM   2968 C CD1 . ILE A 1 390 ? -1.377  -29.838 -15.300 1.00 24.72  ? 372  ILE A CD1 1 
ATOM   2969 N N   . PRO A 1 391 ? -1.595  -29.147 -21.547 1.00 27.68  ? 373  PRO A N   1 
ATOM   2970 C CA  . PRO A 1 391 ? -1.366  -29.870 -22.796 1.00 29.85  ? 373  PRO A CA  1 
ATOM   2971 C C   . PRO A 1 391 ? -0.149  -30.821 -22.790 1.00 31.30  ? 373  PRO A C   1 
ATOM   2972 O O   . PRO A 1 391 ? -0.206  -31.883 -23.429 1.00 34.01  ? 373  PRO A O   1 
ATOM   2973 C CB  . PRO A 1 391 ? -1.184  -28.751 -23.823 1.00 30.43  ? 373  PRO A CB  1 
ATOM   2974 C CG  . PRO A 1 391 ? -1.840  -27.556 -23.216 1.00 29.84  ? 373  PRO A CG  1 
ATOM   2975 C CD  . PRO A 1 391 ? -1.692  -27.694 -21.752 1.00 26.15  ? 373  PRO A CD  1 
ATOM   2976 N N   . GLU A 1 392 ? 0.927   -30.444 -22.087 1.00 30.88  ? 374  GLU A N   1 
ATOM   2977 C CA  . GLU A 1 392 ? 2.164   -31.268 -21.967 1.00 32.07  ? 374  GLU A CA  1 
ATOM   2978 C C   . GLU A 1 392 ? 1.967   -32.600 -21.281 1.00 32.99  ? 374  GLU A C   1 
ATOM   2979 O O   . GLU A 1 392 ? 2.815   -33.477 -21.389 1.00 35.16  ? 374  GLU A O   1 
ATOM   2980 C CB  . GLU A 1 392 ? 3.278   -30.523 -21.207 1.00 31.12  ? 374  GLU A CB  1 
ATOM   2981 C CG  . GLU A 1 392 ? 3.668   -29.235 -21.817 1.00 29.33  ? 374  GLU A CG  1 
ATOM   2982 C CD  . GLU A 1 392 ? 3.056   -28.028 -21.114 1.00 29.59  ? 374  GLU A CD  1 
ATOM   2983 O OE1 . GLU A 1 392 ? 1.848   -28.048 -20.790 1.00 26.85  ? 374  GLU A OE1 1 
ATOM   2984 O OE2 . GLU A 1 392 ? 3.811   -27.041 -20.885 1.00 30.38  ? 374  GLU A OE2 1 
ATOM   2985 N N   . LEU A 1 393 ? 0.874   -32.740 -20.541 1.00 33.47  ? 375  LEU A N   1 
ATOM   2986 C CA  . LEU A 1 393 ? 0.618   -33.938 -19.736 1.00 35.10  ? 375  LEU A CA  1 
ATOM   2987 C C   . LEU A 1 393 ? 0.565   -35.164 -20.616 1.00 37.76  ? 375  LEU A C   1 
ATOM   2988 O O   . LEU A 1 393 ? 1.007   -36.202 -20.213 1.00 40.19  ? 375  LEU A O   1 
ATOM   2989 C CB  . LEU A 1 393 ? -0.666  -33.769 -18.905 1.00 33.42  ? 375  LEU A CB  1 
ATOM   2990 C CG  . LEU A 1 393 ? -1.031  -34.799 -17.821 1.00 33.14  ? 375  LEU A CG  1 
ATOM   2991 C CD1 . LEU A 1 393 ? 0.105   -35.020 -16.868 1.00 31.68  ? 375  LEU A CD1 1 
ATOM   2992 C CD2 . LEU A 1 393 ? -2.195  -34.265 -17.078 1.00 31.72  ? 375  LEU A CD2 1 
ATOM   2993 N N   . ALA A 1 394 ? 0.082   -35.011 -21.848 1.00 40.46  ? 376  ALA A N   1 
ATOM   2994 C CA  . ALA A 1 394 ? 0.082   -36.075 -22.856 1.00 43.99  ? 376  ALA A CA  1 
ATOM   2995 C C   . ALA A 1 394 ? 1.474   -36.679 -23.088 1.00 46.82  ? 376  ALA A C   1 
ATOM   2996 O O   . ALA A 1 394 ? 1.628   -37.894 -23.025 1.00 50.47  ? 376  ALA A O   1 
ATOM   2997 C CB  . ALA A 1 394 ? -0.510  -35.567 -24.161 1.00 45.02  ? 376  ALA A CB  1 
ATOM   2998 N N   . GLN A 1 395 ? 2.492   -35.857 -23.327 1.00 46.42  ? 377  GLN A N   1 
ATOM   2999 C CA  . GLN A 1 395 ? 3.866   -36.382 -23.421 1.00 48.27  ? 377  GLN A CA  1 
ATOM   3000 C C   . GLN A 1 395 ? 4.497   -36.732 -22.055 1.00 46.62  ? 377  GLN A C   1 
ATOM   3001 O O   . GLN A 1 395 ? 5.201   -37.731 -21.944 1.00 49.00  ? 377  GLN A O   1 
ATOM   3002 C CB  . GLN A 1 395 ? 4.781   -35.459 -24.253 1.00 49.14  ? 377  GLN A CB  1 
ATOM   3003 C CG  . GLN A 1 395 ? 6.062   -36.115 -24.830 1.00 54.82  ? 377  GLN A CG  1 
ATOM   3004 C CD  . GLN A 1 395 ? 5.895   -37.525 -25.485 1.00 60.69  ? 377  GLN A CD  1 
ATOM   3005 O OE1 . GLN A 1 395 ? 4.810   -37.939 -25.938 1.00 62.76  ? 377  GLN A OE1 1 
ATOM   3006 N NE2 . GLN A 1 395 ? 7.001   -38.247 -25.550 1.00 63.95  ? 377  GLN A NE2 1 
ATOM   3007 N N   . GLU A 1 396 ? 4.249   -35.926 -21.027 1.00 43.04  ? 378  GLU A N   1 
ATOM   3008 C CA  . GLU A 1 396 ? 4.757   -36.230 -19.680 1.00 41.58  ? 378  GLU A CA  1 
ATOM   3009 C C   . GLU A 1 396 ? 4.288   -37.614 -19.206 1.00 42.42  ? 378  GLU A C   1 
ATOM   3010 O O   . GLU A 1 396 ? 5.079   -38.382 -18.664 1.00 43.37  ? 378  GLU A O   1 
ATOM   3011 C CB  . GLU A 1 396 ? 4.352   -35.151 -18.658 1.00 38.83  ? 378  GLU A CB  1 
ATOM   3012 C CG  . GLU A 1 396 ? 4.991   -33.725 -18.900 1.00 38.26  ? 378  GLU A CG  1 
ATOM   3013 C CD  . GLU A 1 396 ? 6.298   -33.467 -18.152 1.00 38.29  ? 378  GLU A CD  1 
ATOM   3014 O OE1 . GLU A 1 396 ? 6.607   -34.177 -17.148 1.00 37.44  ? 378  GLU A OE1 1 
ATOM   3015 O OE2 . GLU A 1 396 ? 7.013   -32.517 -18.546 1.00 36.81  ? 378  GLU A OE2 1 
ATOM   3016 N N   . LEU A 1 397 ? 3.008   -37.927 -19.409 1.00 41.42  ? 379  LEU A N   1 
ATOM   3017 C CA  . LEU A 1 397 ? 2.470   -39.233 -19.017 1.00 42.53  ? 379  LEU A CA  1 
ATOM   3018 C C   . LEU A 1 397 ? 3.201   -40.391 -19.695 1.00 45.15  ? 379  LEU A C   1 
ATOM   3019 O O   . LEU A 1 397 ? 3.507   -41.412 -19.027 1.00 46.54  ? 379  LEU A O   1 
ATOM   3020 C CB  . LEU A 1 397 ? 0.968   -39.328 -19.269 1.00 42.19  ? 379  LEU A CB  1 
ATOM   3021 C CG  . LEU A 1 397 ? 0.011   -38.683 -18.268 1.00 40.57  ? 379  LEU A CG  1 
ATOM   3022 C CD1 . LEU A 1 397 ? -1.386  -38.525 -18.895 1.00 39.33  ? 379  LEU A CD1 1 
ATOM   3023 C CD2 . LEU A 1 397 ? -0.050  -39.532 -17.022 1.00 39.72  ? 379  LEU A CD2 1 
ATOM   3024 N N   A HIS A 1 398 ? 3.489   -40.244 -20.991 0.50 46.19  ? 380  HIS A N   1 
ATOM   3025 N N   B HIS A 1 398 ? 3.481   -40.242 -20.997 0.50 46.06  ? 380  HIS A N   1 
ATOM   3026 C CA  A HIS A 1 398 ? 4.209   -41.283 -21.738 0.50 48.76  ? 380  HIS A CA  1 
ATOM   3027 C CA  B HIS A 1 398 ? 4.257   -41.240 -21.755 0.50 48.49  ? 380  HIS A CA  1 
ATOM   3028 C C   A HIS A 1 398 ? 5.647   -41.487 -21.217 0.50 49.57  ? 380  HIS A C   1 
ATOM   3029 C C   B HIS A 1 398 ? 5.597   -41.477 -21.082 0.50 49.15  ? 380  HIS A C   1 
ATOM   3030 O O   A HIS A 1 398 ? 6.113   -42.628 -21.130 0.50 52.21  ? 380  HIS A O   1 
ATOM   3031 O O   B HIS A 1 398 ? 5.938   -42.610 -20.753 0.50 51.25  ? 380  HIS A O   1 
ATOM   3032 C CB  A HIS A 1 398 ? 4.198   -41.007 -23.254 0.50 50.37  ? 380  HIS A CB  1 
ATOM   3033 C CB  B HIS A 1 398 ? 4.463   -40.803 -23.219 0.50 49.85  ? 380  HIS A CB  1 
ATOM   3034 C CG  A HIS A 1 398 ? 2.907   -41.356 -23.947 0.50 50.57  ? 380  HIS A CG  1 
ATOM   3035 C CG  B HIS A 1 398 ? 5.523   -41.578 -23.957 0.50 52.35  ? 380  HIS A CG  1 
ATOM   3036 N ND1 A HIS A 1 398 ? 2.627   -42.625 -24.417 0.50 52.59  ? 380  HIS A ND1 1 
ATOM   3037 N ND1 B HIS A 1 398 ? 5.297   -42.829 -24.494 0.50 54.79  ? 380  HIS A ND1 1 
ATOM   3038 C CD2 A HIS A 1 398 ? 1.840   -40.589 -24.284 0.50 47.11  ? 380  HIS A CD2 1 
ATOM   3039 C CD2 B HIS A 1 398 ? 6.806   -41.267 -24.265 0.50 52.10  ? 380  HIS A CD2 1 
ATOM   3040 C CE1 A HIS A 1 398 ? 1.438   -42.626 -24.995 0.50 52.39  ? 380  HIS A CE1 1 
ATOM   3041 C CE1 B HIS A 1 398 ? 6.396   -43.257 -25.092 0.50 57.07  ? 380  HIS A CE1 1 
ATOM   3042 N NE2 A HIS A 1 398 ? 0.941   -41.401 -24.931 0.50 48.86  ? 380  HIS A NE2 1 
ATOM   3043 N NE2 B HIS A 1 398 ? 7.327   -42.329 -24.965 0.50 56.07  ? 380  HIS A NE2 1 
ATOM   3044 N N   . VAL A 1 399 ? 6.346   -40.400 -20.872 1.00 47.38  ? 381  VAL A N   1 
ATOM   3045 C CA  . VAL A 1 399 ? 7.698   -40.507 -20.303 1.00 48.22  ? 381  VAL A CA  1 
ATOM   3046 C C   . VAL A 1 399 ? 7.646   -41.058 -18.880 1.00 48.40  ? 381  VAL A C   1 
ATOM   3047 O O   . VAL A 1 399 ? 8.424   -41.948 -18.531 1.00 51.12  ? 381  VAL A O   1 
ATOM   3048 C CB  . VAL A 1 399 ? 8.493   -39.177 -20.352 1.00 46.71  ? 381  VAL A CB  1 
ATOM   3049 C CG1 . VAL A 1 399 ? 9.946   -39.387 -19.906 1.00 45.83  ? 381  VAL A CG1 1 
ATOM   3050 C CG2 . VAL A 1 399 ? 8.452   -38.571 -21.760 1.00 47.09  ? 381  VAL A CG2 1 
ATOM   3051 N N   . TRP A 1 400 ? 6.727   -40.542 -18.067 1.00 46.45  ? 382  TRP A N   1 
ATOM   3052 C CA  . TRP A 1 400 ? 6.542   -41.026 -16.714 1.00 47.55  ? 382  TRP A CA  1 
ATOM   3053 C C   . TRP A 1 400 ? 6.518   -42.583 -16.625 1.00 51.33  ? 382  TRP A C   1 
ATOM   3054 O O   . TRP A 1 400 ? 7.252   -43.182 -15.828 1.00 52.39  ? 382  TRP A O   1 
ATOM   3055 C CB  . TRP A 1 400 ? 5.271   -40.434 -16.102 1.00 44.85  ? 382  TRP A CB  1 
ATOM   3056 C CG  . TRP A 1 400 ? 5.050   -40.903 -14.715 1.00 45.47  ? 382  TRP A CG  1 
ATOM   3057 C CD1 . TRP A 1 400 ? 4.080   -41.772 -14.278 1.00 45.41  ? 382  TRP A CD1 1 
ATOM   3058 C CD2 . TRP A 1 400 ? 5.852   -40.581 -13.567 1.00 46.66  ? 382  TRP A CD2 1 
ATOM   3059 N NE1 . TRP A 1 400 ? 4.214   -41.977 -12.926 1.00 45.86  ? 382  TRP A NE1 1 
ATOM   3060 C CE2 . TRP A 1 400 ? 5.295   -41.269 -12.465 1.00 46.26  ? 382  TRP A CE2 1 
ATOM   3061 C CE3 . TRP A 1 400 ? 6.988   -39.774 -13.362 1.00 44.30  ? 382  TRP A CE3 1 
ATOM   3062 C CZ2 . TRP A 1 400 ? 5.835   -41.177 -11.175 1.00 46.90  ? 382  TRP A CZ2 1 
ATOM   3063 C CZ3 . TRP A 1 400 ? 7.527   -39.700 -12.084 1.00 44.82  ? 382  TRP A CZ3 1 
ATOM   3064 C CH2 . TRP A 1 400 ? 6.935   -40.375 -11.003 1.00 45.51  ? 382  TRP A CH2 1 
ATOM   3065 N N   . THR A 1 401 ? 5.689   -43.212 -17.458 1.00 53.63  ? 383  THR A N   1 
ATOM   3066 C CA  . THR A 1 401 ? 5.560   -44.652 -17.459 1.00 58.21  ? 383  THR A CA  1 
ATOM   3067 C C   . THR A 1 401 ? 6.808   -45.413 -17.960 1.00 62.51  ? 383  THR A C   1 
ATOM   3068 O O   . THR A 1 401 ? 7.135   -46.469 -17.419 1.00 64.83  ? 383  THR A O   1 
ATOM   3069 C CB  . THR A 1 401 ? 4.229   -45.155 -18.094 1.00 58.91  ? 383  THR A CB  1 
ATOM   3070 O OG1 . THR A 1 401 ? 4.235   -46.595 -18.083 1.00 63.85  ? 383  THR A OG1 1 
ATOM   3071 C CG2 . THR A 1 401 ? 4.035   -44.678 -19.516 1.00 58.58  ? 383  THR A CG2 1 
ATOM   3072 N N   . ASP A 1 402 ? 7.502   -44.864 -18.959 1.00 64.32  ? 384  ASP A N   1 
ATOM   3073 C CA  . ASP A 1 402 ? 8.853   -45.306 -19.366 1.00 68.83  ? 384  ASP A CA  1 
ATOM   3074 C C   . ASP A 1 402 ? 9.938   -45.206 -18.274 1.00 69.54  ? 384  ASP A C   1 
ATOM   3075 O O   . ASP A 1 402 ? 10.891  -45.973 -18.280 1.00 72.72  ? 384  ASP A O   1 
ATOM   3076 C CB  . ASP A 1 402 ? 9.338   -44.472 -20.563 1.00 69.64  ? 384  ASP A CB  1 
ATOM   3077 C CG  . ASP A 1 402 ? 8.974   -45.081 -21.914 1.00 73.70  ? 384  ASP A CG  1 
ATOM   3078 O OD1 . ASP A 1 402 ? 8.435   -44.352 -22.783 1.00 75.79  ? 384  ASP A OD1 1 
ATOM   3079 O OD2 . ASP A 1 402 ? 9.256   -46.271 -22.123 1.00 78.77  ? 384  ASP A OD2 1 
ATOM   3080 N N   . LYS A 1 403 ? 9.817   -44.233 -17.374 1.00 67.82  ? 385  LYS A N   1 
ATOM   3081 C CA  . LYS A 1 403 ? 10.850  -43.966 -16.368 1.00 68.91  ? 385  LYS A CA  1 
ATOM   3082 C C   . LYS A 1 403 ? 10.564  -44.625 -15.031 1.00 69.95  ? 385  LYS A C   1 
ATOM   3083 O O   . LYS A 1 403 ? 11.349  -44.485 -14.095 1.00 71.05  ? 385  LYS A O   1 
ATOM   3084 C CB  . LYS A 1 403 ? 10.994  -42.459 -16.113 1.00 66.47  ? 385  LYS A CB  1 
ATOM   3085 C CG  . LYS A 1 403 ? 11.383  -41.581 -17.305 1.00 66.61  ? 385  LYS A CG  1 
ATOM   3086 C CD  . LYS A 1 403 ? 12.733  -41.951 -17.913 1.00 71.22  ? 385  LYS A CD  1 
ATOM   3087 C CE  . LYS A 1 403 ? 12.559  -42.888 -19.104 1.00 74.49  ? 385  LYS A CE  1 
ATOM   3088 N NZ  . LYS A 1 403 ? 13.863  -43.160 -19.741 1.00 77.21  ? 385  LYS A NZ  1 
ATOM   3089 N N   . SER A 1 404 ? 9.441   -45.328 -14.928 1.00 70.36  ? 386  SER A N   1 
ATOM   3090 C CA  . SER A 1 404 ? 8.979   -45.848 -13.651 1.00 70.94  ? 386  SER A CA  1 
ATOM   3091 C C   . SER A 1 404 ? 10.108  -46.519 -12.860 1.00 74.08  ? 386  SER A C   1 
ATOM   3092 O O   . SER A 1 404 ? 10.203  -46.337 -11.645 1.00 74.25  ? 386  SER A O   1 
ATOM   3093 C CB  . SER A 1 404 ? 7.796   -46.797 -13.861 1.00 72.02  ? 386  SER A CB  1 
ATOM   3094 O OG  . SER A 1 404 ? 8.176   -47.915 -14.653 1.00 75.73  ? 386  SER A OG  1 
ATOM   3095 N N   . SER A 1 405 ? 10.957  -47.281 -13.560 1.00 76.98  ? 387  SER A N   1 
ATOM   3096 C CA  . SER A 1 405 ? 12.140  -47.920 -12.983 1.00 79.66  ? 387  SER A CA  1 
ATOM   3097 C C   . SER A 1 405 ? 13.129  -46.910 -12.401 1.00 77.87  ? 387  SER A C   1 
ATOM   3098 O O   . SER A 1 405 ? 13.564  -47.050 -11.262 1.00 79.54  ? 387  SER A O   1 
ATOM   3099 C CB  . SER A 1 405 ? 12.848  -48.769 -14.037 1.00 83.32  ? 387  SER A CB  1 
ATOM   3100 O OG  . SER A 1 405 ? 12.009  -49.818 -14.481 1.00 87.19  ? 387  SER A OG  1 
ATOM   3101 N N   . LEU A 1 406 ? 13.487  -45.907 -13.193 1.00 75.06  ? 388  LEU A N   1 
ATOM   3102 C CA  . LEU A 1 406 ? 14.362  -44.818 -12.738 1.00 73.21  ? 388  LEU A CA  1 
ATOM   3103 C C   . LEU A 1 406 ? 13.860  -44.106 -11.474 1.00 70.07  ? 388  LEU A C   1 
ATOM   3104 O O   . LEU A 1 406 ? 14.642  -43.824 -10.570 1.00 70.79  ? 388  LEU A O   1 
ATOM   3105 C CB  . LEU A 1 406 ? 14.621  -43.810 -13.873 1.00 71.56  ? 388  LEU A CB  1 
ATOM   3106 C CG  . LEU A 1 406 ? 15.819  -44.086 -14.793 1.00 75.09  ? 388  LEU A CG  1 
ATOM   3107 C CD1 . LEU A 1 406 ? 15.712  -45.419 -15.571 1.00 77.98  ? 388  LEU A CD1 1 
ATOM   3108 C CD2 . LEU A 1 406 ? 16.009  -42.927 -15.738 1.00 72.90  ? 388  LEU A CD2 1 
ATOM   3109 N N   . PHE A 1 407 ? 12.561  -43.834 -11.409 1.00 66.81  ? 389  PHE A N   1 
ATOM   3110 C CA  . PHE A 1 407 ? 11.974  -43.223 -10.224 1.00 64.86  ? 389  PHE A CA  1 
ATOM   3111 C C   . PHE A 1 407 ? 11.999  -44.157 -9.015  1.00 67.00  ? 389  PHE A C   1 
ATOM   3112 O O   . PHE A 1 407 ? 12.300  -43.727 -7.907  1.00 67.24  ? 389  PHE A O   1 
ATOM   3113 C CB  . PHE A 1 407 ? 10.546  -42.757 -10.497 1.00 62.20  ? 389  PHE A CB  1 
ATOM   3114 C CG  . PHE A 1 407 ? 9.978   -41.908 -9.405  1.00 61.02  ? 389  PHE A CG  1 
ATOM   3115 C CD1 . PHE A 1 407 ? 10.182  -40.528 -9.409  1.00 61.73  ? 389  PHE A CD1 1 
ATOM   3116 C CD2 . PHE A 1 407 ? 9.243   -42.475 -8.372  1.00 61.51  ? 389  PHE A CD2 1 
ATOM   3117 C CE1 . PHE A 1 407 ? 9.658   -39.724 -8.386  1.00 61.84  ? 389  PHE A CE1 1 
ATOM   3118 C CE2 . PHE A 1 407 ? 8.717   -41.690 -7.346  1.00 62.53  ? 389  PHE A CE2 1 
ATOM   3119 C CZ  . PHE A 1 407 ? 8.925   -40.313 -7.344  1.00 60.86  ? 389  PHE A CZ  1 
ATOM   3120 N N   . GLU A 1 408 ? 11.674  -45.431 -9.235  1.00 72.40  ? 390  GLU A N   1 
ATOM   3121 C CA  . GLU A 1 408 ? 11.690  -46.446 -8.177  1.00 76.18  ? 390  GLU A CA  1 
ATOM   3122 C C   . GLU A 1 408 ? 13.072  -46.645 -7.559  1.00 74.02  ? 390  GLU A C   1 
ATOM   3123 O O   . GLU A 1 408 ? 13.183  -46.846 -6.345  1.00 74.03  ? 390  GLU A O   1 
ATOM   3124 C CB  . GLU A 1 408 ? 11.120  -47.772 -8.679  1.00 83.86  ? 390  GLU A CB  1 
ATOM   3125 C CG  . GLU A 1 408 ? 9.585   -47.806 -8.697  1.00 88.89  ? 390  GLU A CG  1 
ATOM   3126 C CD  . GLU A 1 408 ? 9.040   -49.229 -8.974  1.00 99.86  ? 390  GLU A CD  1 
ATOM   3127 O OE1 . GLU A 1 408 ? 8.607   -49.911 -7.996  1.00 105.07 ? 390  GLU A OE1 1 
ATOM   3128 O OE2 . GLU A 1 408 ? 9.047   -49.668 -10.167 1.00 104.62 ? 390  GLU A OE2 1 
ATOM   3129 N N   . GLU A 1 409 ? 14.111  -46.583 -8.392  1.00 72.80  ? 391  GLU A N   1 
ATOM   3130 C CA  . GLU A 1 409 ? 15.491  -46.591 -7.911  1.00 71.92  ? 391  GLU A CA  1 
ATOM   3131 C C   . GLU A 1 409 ? 15.789  -45.340 -7.092  1.00 66.09  ? 391  GLU A C   1 
ATOM   3132 O O   . GLU A 1 409 ? 16.413  -45.414 -6.033  1.00 66.22  ? 391  GLU A O   1 
ATOM   3133 C CB  . GLU A 1 409 ? 16.488  -46.741 -9.068  1.00 73.95  ? 391  GLU A CB  1 
ATOM   3134 C CG  . GLU A 1 409 ? 17.847  -46.030 -8.833  1.00 72.87  ? 391  GLU A CG  1 
ATOM   3135 C CD  . GLU A 1 409 ? 19.046  -46.817 -9.399  1.00 78.73  ? 391  GLU A CD  1 
ATOM   3136 O OE1 . GLU A 1 409 ? 19.023  -47.215 -10.658 1.00 81.22  ? 391  GLU A OE1 1 
ATOM   3137 O OE2 . GLU A 1 409 ? 20.034  -47.012 -8.568  1.00 82.12  ? 391  GLU A OE2 1 
ATOM   3138 N N   . LEU A 1 410 ? 15.336  -44.190 -7.573  1.00 61.89  ? 392  LEU A N   1 
ATOM   3139 C CA  . LEU A 1 410 ? 15.496  -42.947 -6.833  1.00 57.54  ? 392  LEU A CA  1 
ATOM   3140 C C   . LEU A 1 410 ? 14.907  -43.070 -5.424  1.00 57.35  ? 392  LEU A C   1 
ATOM   3141 O O   . LEU A 1 410 ? 15.520  -42.642 -4.444  1.00 56.22  ? 392  LEU A O   1 
ATOM   3142 C CB  . LEU A 1 410 ? 14.837  -41.794 -7.598  1.00 55.36  ? 392  LEU A CB  1 
ATOM   3143 C CG  . LEU A 1 410 ? 15.589  -40.480 -7.744  1.00 52.80  ? 392  LEU A CG  1 
ATOM   3144 C CD1 . LEU A 1 410 ? 17.099  -40.670 -7.870  1.00 52.73  ? 392  LEU A CD1 1 
ATOM   3145 C CD2 . LEU A 1 410 ? 15.045  -39.773 -8.955  1.00 51.90  ? 392  LEU A CD2 1 
ATOM   3146 N N   . GLN A 1 411 ? 13.728  -43.673 -5.316  1.00 59.19  ? 393  GLN A N   1 
ATOM   3147 C CA  . GLN A 1 411 ? 13.100  -43.811 -4.018  1.00 60.17  ? 393  GLN A CA  1 
ATOM   3148 C C   . GLN A 1 411 ? 13.943  -44.676 -3.108  1.00 62.01  ? 393  GLN A C   1 
ATOM   3149 O O   . GLN A 1 411 ? 14.126  -44.328 -1.945  1.00 60.93  ? 393  GLN A O   1 
ATOM   3150 C CB  . GLN A 1 411 ? 11.689  -44.375 -4.132  1.00 64.47  ? 393  GLN A CB  1 
ATOM   3151 C CG  . GLN A 1 411 ? 10.734  -43.503 -4.925  1.00 64.58  ? 393  GLN A CG  1 
ATOM   3152 C CD  . GLN A 1 411 ? 9.315   -44.023 -4.874  1.00 71.91  ? 393  GLN A CD  1 
ATOM   3153 O OE1 . GLN A 1 411 ? 8.801   -44.580 -5.854  1.00 75.61  ? 393  GLN A OE1 1 
ATOM   3154 N NE2 . GLN A 1 411 ? 8.675   -43.867 -3.717  1.00 74.29  ? 393  GLN A NE2 1 
ATOM   3155 N N   . SER A 1 412 ? 14.447  -45.797 -3.644  1.00 65.68  ? 394  SER A N   1 
ATOM   3156 C CA  . SER A 1 412 ? 15.282  -46.745 -2.906  1.00 69.07  ? 394  SER A CA  1 
ATOM   3157 C C   . SER A 1 412 ? 16.586  -46.165 -2.386  1.00 66.82  ? 394  SER A C   1 
ATOM   3158 O O   . SER A 1 412 ? 16.990  -46.468 -1.260  1.00 67.71  ? 394  SER A O   1 
ATOM   3159 C CB  . SER A 1 412 ? 15.618  -47.941 -3.783  1.00 74.40  ? 394  SER A CB  1 
ATOM   3160 O OG  . SER A 1 412 ? 14.467  -48.723 -3.959  1.00 79.65  ? 394  SER A OG  1 
ATOM   3161 N N   . LEU A 1 413 ? 17.261  -45.385 -3.233  1.00 64.99  ? 395  LEU A N   1 
ATOM   3162 C CA  . LEU A 1 413 ? 18.500  -44.710 -2.864  1.00 64.72  ? 395  LEU A CA  1 
ATOM   3163 C C   . LEU A 1 413 ? 18.232  -43.699 -1.745  1.00 62.21  ? 395  LEU A C   1 
ATOM   3164 O O   . LEU A 1 413 ? 18.958  -43.670 -0.739  1.00 63.24  ? 395  LEU A O   1 
ATOM   3165 C CB  . LEU A 1 413 ? 19.117  -44.010 -4.078  1.00 63.57  ? 395  LEU A CB  1 
ATOM   3166 C CG  . LEU A 1 413 ? 19.735  -44.897 -5.172  1.00 67.02  ? 395  LEU A CG  1 
ATOM   3167 C CD1 . LEU A 1 413 ? 20.058  -44.031 -6.380  1.00 65.07  ? 395  LEU A CD1 1 
ATOM   3168 C CD2 . LEU A 1 413 ? 20.971  -45.585 -4.686  1.00 69.65  ? 395  LEU A CD2 1 
ATOM   3169 N N   . ASP A 1 414 ? 17.181  -42.896 -1.924  1.00 59.93  ? 396  ASP A N   1 
ATOM   3170 C CA  . ASP A 1 414 ? 16.738  -41.928 -0.920  1.00 59.03  ? 396  ASP A CA  1 
ATOM   3171 C C   . ASP A 1 414 ? 16.495  -42.614 0.447   1.00 60.62  ? 396  ASP A C   1 
ATOM   3172 O O   . ASP A 1 414 ? 16.975  -42.126 1.480   1.00 59.50  ? 396  ASP A O   1 
ATOM   3173 C CB  . ASP A 1 414 ? 15.486  -41.170 -1.413  1.00 58.19  ? 396  ASP A CB  1 
ATOM   3174 C CG  . ASP A 1 414 ? 15.796  -40.117 -2.539  1.00 60.14  ? 396  ASP A CG  1 
ATOM   3175 O OD1 . ASP A 1 414 ? 16.980  -39.708 -2.721  1.00 62.83  ? 396  ASP A OD1 1 
ATOM   3176 O OD2 . ASP A 1 414 ? 14.830  -39.670 -3.237  1.00 61.36  ? 396  ASP A OD2 1 
ATOM   3177 N N   . ILE A 1 415 ? 15.812  -43.772 0.418   1.00 63.29  ? 397  ILE A N   1 
ATOM   3178 C CA  . ILE A 1 415 ? 15.447  -44.552 1.611   1.00 66.05  ? 397  ILE A CA  1 
ATOM   3179 C C   . ILE A 1 415 ? 16.688  -45.182 2.240   1.00 68.27  ? 397  ILE A C   1 
ATOM   3180 O O   . ILE A 1 415 ? 16.859  -45.162 3.463   1.00 68.93  ? 397  ILE A O   1 
ATOM   3181 C CB  . ILE A 1 415 ? 14.353  -45.649 1.272   1.00 70.23  ? 397  ILE A CB  1 
ATOM   3182 C CG1 . ILE A 1 415 ? 12.962  -45.006 1.123   1.00 70.40  ? 397  ILE A CG1 1 
ATOM   3183 C CG2 . ILE A 1 415 ? 14.318  -46.808 2.310   1.00 74.56  ? 397  ILE A CG2 1 
ATOM   3184 C CD1 . ILE A 1 415 ? 11.864  -45.957 0.630   1.00 75.47  ? 397  ILE A CD1 1 
ATOM   3185 N N   . PHE A 1 416 ? 17.541  -45.742 1.386   1.00 70.28  ? 398  PHE A N   1 
ATOM   3186 C CA  . PHE A 1 416 ? 18.805  -46.347 1.790   1.00 73.18  ? 398  PHE A CA  1 
ATOM   3187 C C   . PHE A 1 416 ? 19.790  -45.307 2.352   1.00 71.21  ? 398  PHE A C   1 
ATOM   3188 O O   . PHE A 1 416 ? 20.528  -45.622 3.289   1.00 73.41  ? 398  PHE A O   1 
ATOM   3189 C CB  . PHE A 1 416 ? 19.418  -47.090 0.601   1.00 77.10  ? 398  PHE A CB  1 
ATOM   3190 C CG  . PHE A 1 416 ? 20.667  -47.842 0.927   1.00 83.07  ? 398  PHE A CG  1 
ATOM   3191 C CD1 . PHE A 1 416 ? 20.604  -49.077 1.573   1.00 89.51  ? 398  PHE A CD1 1 
ATOM   3192 C CD2 . PHE A 1 416 ? 21.911  -47.326 0.582   1.00 84.42  ? 398  PHE A CD2 1 
ATOM   3193 C CE1 . PHE A 1 416 ? 21.761  -49.786 1.880   1.00 96.65  ? 398  PHE A CE1 1 
ATOM   3194 C CE2 . PHE A 1 416 ? 23.085  -48.030 0.887   1.00 91.88  ? 398  PHE A CE2 1 
ATOM   3195 C CZ  . PHE A 1 416 ? 23.007  -49.262 1.533   1.00 97.22  ? 398  PHE A CZ  1 
ATOM   3196 N N   . LEU A 1 417 ? 19.805  -44.091 1.776   1.00 67.14  ? 399  LEU A N   1 
ATOM   3197 C CA  . LEU A 1 417 ? 20.658  -42.996 2.261   1.00 67.00  ? 399  LEU A CA  1 
ATOM   3198 C C   . LEU A 1 417 ? 20.319  -42.629 3.707   1.00 66.74  ? 399  LEU A C   1 
ATOM   3199 O O   . LEU A 1 417 ? 21.222  -42.468 4.542   1.00 68.95  ? 399  LEU A O   1 
ATOM   3200 C CB  . LEU A 1 417 ? 20.534  -41.734 1.382   1.00 64.28  ? 399  LEU A CB  1 
ATOM   3201 C CG  . LEU A 1 417 ? 21.299  -40.461 1.797   1.00 64.22  ? 399  LEU A CG  1 
ATOM   3202 C CD1 . LEU A 1 417 ? 22.806  -40.568 1.601   1.00 67.66  ? 399  LEU A CD1 1 
ATOM   3203 C CD2 . LEU A 1 417 ? 20.772  -39.251 1.073   1.00 62.70  ? 399  LEU A CD2 1 
ATOM   3204 N N   . ALA A 1 418 ? 19.021  -42.478 3.982   1.00 64.53  ? 400  ALA A N   1 
ATOM   3205 C CA  . ALA A 1 418 ? 18.530  -42.206 5.331   1.00 64.87  ? 400  ALA A CA  1 
ATOM   3206 C C   . ALA A 1 418 ? 18.902  -43.312 6.308   1.00 68.30  ? 400  ALA A C   1 
ATOM   3207 O O   . ALA A 1 418 ? 19.131  -43.041 7.478   1.00 69.53  ? 400  ALA A O   1 
ATOM   3208 C CB  . ALA A 1 418 ? 17.014  -41.981 5.319   1.00 63.40  ? 400  ALA A CB  1 
ATOM   3209 N N   . GLU A 1 419 ? 18.965  -44.550 5.816   1.00 71.01  ? 401  GLU A N   1 
ATOM   3210 C CA  . GLU A 1 419 ? 19.361  -45.729 6.598   1.00 76.00  ? 401  GLU A CA  1 
ATOM   3211 C C   . GLU A 1 419 ? 20.832  -45.689 7.043   1.00 78.37  ? 401  GLU A C   1 
ATOM   3212 O O   . GLU A 1 419 ? 21.163  -46.124 8.149   1.00 81.10  ? 401  GLU A O   1 
ATOM   3213 C CB  . GLU A 1 419 ? 19.097  -47.003 5.775   1.00 79.52  ? 401  GLU A CB  1 
ATOM   3214 C CG  . GLU A 1 419 ? 18.981  -48.307 6.564   1.00 85.88  ? 401  GLU A CG  1 
ATOM   3215 C CD  . GLU A 1 419 ? 18.681  -49.497 5.638   1.00 92.44  ? 401  GLU A CD  1 
ATOM   3216 O OE1 . GLU A 1 419 ? 18.104  -49.262 4.538   1.00 94.86  ? 401  GLU A OE1 1 
ATOM   3217 O OE2 . GLU A 1 419 ? 19.024  -50.660 5.989   1.00 101.00 ? 401  GLU A OE2 1 
ATOM   3218 N N   . LEU A 1 420 ? 21.703  -45.172 6.180   1.00 78.38  ? 402  LEU A N   1 
ATOM   3219 C CA  . LEU A 1 420 ? 23.116  -44.983 6.501   1.00 82.47  ? 402  LEU A CA  1 
ATOM   3220 C C   . LEU A 1 420 ? 23.355  -43.920 7.575   1.00 81.68  ? 402  LEU A C   1 
ATOM   3221 O O   . LEU A 1 420 ? 24.131  -44.137 8.494   1.00 85.66  ? 402  LEU A O   1 
ATOM   3222 C CB  . LEU A 1 420 ? 23.914  -44.624 5.242   1.00 83.89  ? 402  LEU A CB  1 
ATOM   3223 C CG  . LEU A 1 420 ? 23.879  -45.551 4.022   1.00 85.93  ? 402  LEU A CG  1 
ATOM   3224 C CD1 . LEU A 1 420 ? 24.631  -44.899 2.864   1.00 87.04  ? 402  LEU A CD1 1 
ATOM   3225 C CD2 . LEU A 1 420 ? 24.427  -46.952 4.321   1.00 91.39  ? 402  LEU A CD2 1 
ATOM   3226 N N   . TYR A 1 421 ? 22.681  -42.778 7.446   1.00 77.81  ? 403  TYR A N   1 
ATOM   3227 C CA  . TYR A 1 421 ? 22.803  -41.643 8.379   1.00 77.99  ? 403  TYR A CA  1 
ATOM   3228 C C   . TYR A 1 421 ? 22.331  -41.941 9.802   1.00 78.24  ? 403  TYR A C   1 
ATOM   3229 O O   . TYR A 1 421 ? 22.763  -41.294 10.760  1.00 80.21  ? 403  TYR A O   1 
ATOM   3230 C CB  . TYR A 1 421 ? 21.972  -40.489 7.869   1.00 73.75  ? 403  TYR A CB  1 
ATOM   3231 C CG  . TYR A 1 421 ? 22.670  -39.473 7.014   1.00 75.44  ? 403  TYR A CG  1 
ATOM   3232 C CD1 . TYR A 1 421 ? 23.700  -38.681 7.518   1.00 79.40  ? 403  TYR A CD1 1 
ATOM   3233 C CD2 . TYR A 1 421 ? 22.236  -39.242 5.712   1.00 73.42  ? 403  TYR A CD2 1 
ATOM   3234 C CE1 . TYR A 1 421 ? 24.301  -37.701 6.727   1.00 83.08  ? 403  TYR A CE1 1 
ATOM   3235 C CE2 . TYR A 1 421 ? 22.821  -38.272 4.912   1.00 76.19  ? 403  TYR A CE2 1 
ATOM   3236 C CZ  . TYR A 1 421 ? 23.853  -37.497 5.418   1.00 80.93  ? 403  TYR A CZ  1 
ATOM   3237 O OH  . TYR A 1 421 ? 24.424  -36.531 4.602   1.00 83.54  ? 403  TYR A OH  1 
ATOM   3238 N N   . LYS A 1 422 ? 21.407  -42.890 9.916   1.00 77.33  ? 404  LYS A N   1 
ATOM   3239 C CA  . LYS A 1 422 ? 20.903  -43.391 11.193  1.00 78.81  ? 404  LYS A CA  1 
ATOM   3240 C C   . LYS A 1 422 ? 22.010  -44.176 11.920  1.00 83.58  ? 404  LYS A C   1 
ATOM   3241 O O   . LYS A 1 422 ? 22.008  -44.255 13.177  1.00 85.49  ? 404  LYS A O   1 
ATOM   3242 C CB  . LYS A 1 422 ? 19.711  -44.307 10.894  1.00 78.31  ? 404  LYS A CB  1 
ATOM   3243 C CG  . LYS A 1 422 ? 18.834  -44.715 12.052  1.00 80.12  ? 404  LYS A CG  1 
ATOM   3244 C CD  . LYS A 1 422 ? 17.902  -45.814 11.567  1.00 82.41  ? 404  LYS A CD  1 
ATOM   3245 C CE  . LYS A 1 422 ? 17.323  -46.598 12.731  1.00 86.45  ? 404  LYS A CE  1 
ATOM   3246 N NZ  . LYS A 1 422 ? 16.930  -47.969 12.283  1.00 92.27  ? 404  LYS A NZ  1 
ATOM   3247 N N   . HIS A 1 423 ? 22.967  -44.722 11.104  1.00 86.89  ? 405  HIS A N   1 
ATOM   3248 C CA  . HIS A 1 423 ? 24.047  -45.607 11.598  1.00 93.11  ? 405  HIS A CA  1 
ATOM   3249 C C   . HIS A 1 423 ? 23.525  -46.967 12.056  1.00 95.06  ? 405  HIS A C   1 
ATOM   3250 O O   . HIS A 1 423 ? 22.395  -47.605 11.301  1.00 93.07  ? 405  HIS A O   1 
ATOM   3251 C CB  . HIS A 1 423 ? 24.879  -44.936 12.696  1.00 96.04  ? 405  HIS A CB  1 
ATOM   3252 C CG  . HIS A 1 423 ? 25.892  -43.971 12.165  1.00 97.65  ? 405  HIS A CG  1 
ATOM   3253 N ND1 . HIS A 1 423 ? 27.263  -44.197 12.305  1.00 104.48 ? 405  HIS A ND1 1 
ATOM   3254 C CD2 . HIS A 1 423 ? 25.741  -42.794 11.484  1.00 92.63  ? 405  HIS A CD2 1 
ATOM   3255 C CE1 . HIS A 1 423 ? 27.909  -43.189 11.737  1.00 105.99 ? 405  HIS A CE1 1 
ATOM   3256 N NE2 . HIS A 1 423 ? 27.008  -42.327 11.231  1.00 98.35  ? 405  HIS A NE2 1 
ATOM   3257 N N   . ILE A 1 434 ? 32.604  -43.903 0.902   1.00 127.53 ? 416  ILE A N   1 
ATOM   3258 C CA  . ILE A 1 434 ? 31.796  -44.490 1.963   1.00 121.89 ? 416  ILE A CA  1 
ATOM   3259 C C   . ILE A 1 434 ? 30.312  -44.343 1.661   1.00 109.78 ? 416  ILE A C   1 
ATOM   3260 O O   . ILE A 1 434 ? 29.576  -45.330 1.654   1.00 107.10 ? 416  ILE A O   1 
ATOM   3261 C CB  . ILE A 1 434 ? 32.140  -43.861 3.322   1.00 123.29 ? 416  ILE A CB  1 
ATOM   3262 N N   . SER A 1 435 ? 29.902  -43.104 1.388   1.00 104.04 ? 417  SER A N   1 
ATOM   3263 C CA  . SER A 1 435 ? 28.501  -42.709 1.239   1.00 93.20  ? 417  SER A CA  1 
ATOM   3264 C C   . SER A 1 435 ? 28.306  -41.918 -0.076  1.00 90.82  ? 417  SER A C   1 
ATOM   3265 O O   . SER A 1 435 ? 27.768  -40.798 -0.084  1.00 86.00  ? 417  SER A O   1 
ATOM   3266 C CB  . SER A 1 435 ? 28.077  -41.890 2.481   1.00 89.61  ? 417  SER A CB  1 
ATOM   3267 O OG  . SER A 1 435 ? 26.749  -41.377 2.413   1.00 80.32  ? 417  SER A OG  1 
ATOM   3268 N N   . SER A 1 436 ? 28.756  -42.526 -1.179  1.00 94.78  ? 418  SER A N   1 
ATOM   3269 C CA  . SER A 1 436 ? 28.631  -41.992 -2.538  1.00 93.12  ? 418  SER A CA  1 
ATOM   3270 C C   . SER A 1 436 ? 27.309  -42.400 -3.180  1.00 85.69  ? 418  SER A C   1 
ATOM   3271 O O   . SER A 1 436 ? 27.208  -42.511 -4.402  1.00 85.39  ? 418  SER A O   1 
ATOM   3272 C CB  . SER A 1 436 ? 29.720  -42.582 -3.388  1.00 102.21 ? 418  SER A CB  1 
ATOM   3273 O OG  . SER A 1 436 ? 29.366  -43.911 -3.716  1.00 103.11 ? 418  SER A OG  1 
ATOM   3274 N N   . ILE A 1 437 ? 26.315  -42.659 -2.330  1.00 80.68  ? 419  ILE A N   1 
ATOM   3275 C CA  . ILE A 1 437 ? 24.919  -42.848 -2.720  1.00 73.77  ? 419  ILE A CA  1 
ATOM   3276 C C   . ILE A 1 437 ? 24.413  -41.516 -3.266  1.00 69.27  ? 419  ILE A C   1 
ATOM   3277 O O   . ILE A 1 437 ? 23.546  -41.483 -4.137  1.00 65.62  ? 419  ILE A O   1 
ATOM   3278 C CB  . ILE A 1 437 ? 24.064  -43.380 -1.498  1.00 70.66  ? 419  ILE A CB  1 
ATOM   3279 C CG1 . ILE A 1 437 ? 24.346  -44.870 -1.220  1.00 76.11  ? 419  ILE A CG1 1 
ATOM   3280 C CG2 . ILE A 1 437 ? 22.558  -43.133 -1.654  1.00 64.16  ? 419  ILE A CG2 1 
ATOM   3281 C CD1 . ILE A 1 437 ? 24.517  -45.785 -2.474  1.00 80.60  ? 419  ILE A CD1 1 
ATOM   3282 N N   . GLN A 1 438 ? 25.007  -40.429 -2.770  1.00 70.82  ? 420  GLN A N   1 
ATOM   3283 C CA  . GLN A 1 438 ? 24.668  -39.065 -3.162  1.00 68.25  ? 420  GLN A CA  1 
ATOM   3284 C C   . GLN A 1 438 ? 25.014  -38.784 -4.618  1.00 69.45  ? 420  GLN A C   1 
ATOM   3285 O O   . GLN A 1 438 ? 24.259  -38.095 -5.307  1.00 65.89  ? 420  GLN A O   1 
ATOM   3286 C CB  . GLN A 1 438 ? 25.352  -38.046 -2.238  1.00 71.98  ? 420  GLN A CB  1 
ATOM   3287 C CG  . GLN A 1 438 ? 25.359  -38.453 -0.752  1.00 74.74  ? 420  GLN A CG  1 
ATOM   3288 C CD  . GLN A 1 438 ? 25.339  -37.269 0.213   1.00 78.42  ? 420  GLN A CD  1 
ATOM   3289 O OE1 . GLN A 1 438 ? 24.316  -37.003 0.868   1.00 75.68  ? 420  GLN A OE1 1 
ATOM   3290 N NE2 . GLN A 1 438 ? 26.466  -36.552 0.307   1.00 84.67  ? 420  GLN A NE2 1 
ATOM   3291 N N   . ARG A 1 439 ? 26.144  -39.311 -5.085  1.00 75.29  ? 421  ARG A N   1 
ATOM   3292 C CA  . ARG A 1 439 ? 26.559  -39.137 -6.481  1.00 77.49  ? 421  ARG A CA  1 
ATOM   3293 C C   . ARG A 1 439 ? 25.713  -39.959 -7.458  1.00 73.63  ? 421  ARG A C   1 
ATOM   3294 O O   . ARG A 1 439 ? 25.430  -39.513 -8.577  1.00 72.11  ? 421  ARG A O   1 
ATOM   3295 C CB  . ARG A 1 439 ? 28.042  -39.447 -6.657  1.00 86.75  ? 421  ARG A CB  1 
ATOM   3296 C CG  . ARG A 1 439 ? 28.933  -38.230 -6.506  1.00 91.87  ? 421  ARG A CG  1 
ATOM   3297 C CD  . ARG A 1 439 ? 30.380  -38.523 -6.905  1.00 101.47 ? 421  ARG A CD  1 
ATOM   3298 N NE  . ARG A 1 439 ? 31.072  -39.341 -5.906  1.00 105.66 ? 421  ARG A NE  1 
ATOM   3299 C CZ  . ARG A 1 439 ? 31.234  -40.659 -5.992  1.00 106.83 ? 421  ARG A CZ  1 
ATOM   3300 N NH1 . ARG A 1 439 ? 30.758  -41.324 -7.039  1.00 104.25 ? 421  ARG A NH1 1 
ATOM   3301 N NH2 . ARG A 1 439 ? 31.871  -41.312 -5.031  1.00 110.37 ? 421  ARG A NH2 1 
ATOM   3302 N N   . ARG A 1 440 ? 25.315  -41.150 -7.013  1.00 72.70  ? 422  ARG A N   1 
ATOM   3303 C CA  . ARG A 1 440 ? 24.373  -42.014 -7.727  1.00 70.01  ? 422  ARG A CA  1 
ATOM   3304 C C   . ARG A 1 440 ? 22.975  -41.381 -7.809  1.00 62.64  ? 422  ARG A C   1 
ATOM   3305 O O   . ARG A 1 440 ? 22.285  -41.503 -8.822  1.00 61.04  ? 422  ARG A O   1 
ATOM   3306 C CB  . ARG A 1 440 ? 24.317  -43.381 -7.032  1.00 72.52  ? 422  ARG A CB  1 
ATOM   3307 C CG  . ARG A 1 440 ? 23.383  -44.401 -7.661  1.00 73.34  ? 422  ARG A CG  1 
ATOM   3308 C CD  . ARG A 1 440 ? 23.978  -45.049 -8.896  1.00 83.14  ? 422  ARG A CD  1 
ATOM   3309 N NE  . ARG A 1 440 ? 22.935  -45.589 -9.769  1.00 83.96  ? 422  ARG A NE  1 
ATOM   3310 C CZ  . ARG A 1 440 ? 23.064  -45.783 -11.081 1.00 88.08  ? 422  ARG A CZ  1 
ATOM   3311 N NH1 . ARG A 1 440 ? 24.199  -45.481 -11.704 1.00 93.29  ? 422  ARG A NH1 1 
ATOM   3312 N NH2 . ARG A 1 440 ? 22.044  -46.277 -11.774 1.00 87.36  ? 422  ARG A NH2 1 
ATOM   3313 N N   . ILE A 1 441 ? 22.571  -40.707 -6.730  1.00 59.58  ? 423  ILE A N   1 
ATOM   3314 C CA  . ILE A 1 441 ? 21.301  -39.987 -6.650  1.00 53.39  ? 423  ILE A CA  1 
ATOM   3315 C C   . ILE A 1 441 ? 21.336  -38.820 -7.609  1.00 52.67  ? 423  ILE A C   1 
ATOM   3316 O O   . ILE A 1 441 ? 20.345  -38.544 -8.262  1.00 49.69  ? 423  ILE A O   1 
ATOM   3317 C CB  . ILE A 1 441 ? 20.971  -39.475 -5.203  1.00 52.00  ? 423  ILE A CB  1 
ATOM   3318 C CG1 . ILE A 1 441 ? 20.416  -40.598 -4.309  1.00 51.02  ? 423  ILE A CG1 1 
ATOM   3319 C CG2 . ILE A 1 441 ? 20.005  -38.241 -5.233  1.00 47.86  ? 423  ILE A CG2 1 
ATOM   3320 C CD1 . ILE A 1 441 ? 20.104  -40.146 -2.848  1.00 49.23  ? 423  ILE A CD1 1 
ATOM   3321 N N   . LYS A 1 442 ? 22.478  -38.139 -7.670  1.00 56.55  ? 424  LYS A N   1 
ATOM   3322 C CA  . LYS A 1 442 ? 22.701  -37.030 -8.598  1.00 57.88  ? 424  LYS A CA  1 
ATOM   3323 C C   . LYS A 1 442 ? 22.676  -37.553 -10.054 1.00 58.27  ? 424  LYS A C   1 
ATOM   3324 O O   . LYS A 1 442 ? 22.062  -36.936 -10.931 1.00 56.10  ? 424  LYS A O   1 
ATOM   3325 C CB  . LYS A 1 442 ? 24.018  -36.304 -8.251  1.00 63.84  ? 424  LYS A CB  1 
ATOM   3326 C CG  . LYS A 1 442 ? 24.374  -35.119 -9.151  1.00 68.65  ? 424  LYS A CG  1 
ATOM   3327 C CD  . LYS A 1 442 ? 25.851  -35.177 -9.568  1.00 78.61  ? 424  LYS A CD  1 
ATOM   3328 C CE  . LYS A 1 442 ? 26.029  -35.038 -11.093 1.00 81.29  ? 424  LYS A CE  1 
ATOM   3329 N NZ  . LYS A 1 442 ? 26.454  -33.676 -11.524 1.00 86.87  ? 424  LYS A NZ  1 
ATOM   3330 N N   . LYS A 1 443 ? 23.308  -38.706 -10.293 1.00 61.27  ? 425  LYS A N   1 
ATOM   3331 C CA  . LYS A 1 443 ? 23.397  -39.274 -11.637 1.00 62.90  ? 425  LYS A CA  1 
ATOM   3332 C C   . LYS A 1 443 ? 22.024  -39.708 -12.165 1.00 58.32  ? 425  LYS A C   1 
ATOM   3333 O O   . LYS A 1 443 ? 21.598  -39.236 -13.214 1.00 57.37  ? 425  LYS A O   1 
ATOM   3334 C CB  . LYS A 1 443 ? 24.427  -40.415 -11.681 1.00 69.14  ? 425  LYS A CB  1 
ATOM   3335 C CG  . LYS A 1 443 ? 24.962  -40.748 -13.070 1.00 73.85  ? 425  LYS A CG  1 
ATOM   3336 C CD  . LYS A 1 443 ? 24.299  -41.998 -13.639 1.00 74.85  ? 425  LYS A CD  1 
ATOM   3337 C CE  . LYS A 1 443 ? 25.023  -42.512 -14.877 1.00 80.90  ? 425  LYS A CE  1 
ATOM   3338 N NZ  . LYS A 1 443 ? 24.967  -41.523 -15.980 1.00 80.83  ? 425  LYS A NZ  1 
ATOM   3339 N N   . VAL A 1 444 ? 21.328  -40.583 -11.428 1.00 56.67  ? 426  VAL A N   1 
ATOM   3340 C CA  . VAL A 1 444 ? 19.981  -41.079 -11.810 1.00 53.03  ? 426  VAL A CA  1 
ATOM   3341 C C   . VAL A 1 444 ? 18.973  -39.960 -12.063 1.00 49.25  ? 426  VAL A C   1 
ATOM   3342 O O   . VAL A 1 444 ? 18.163  -40.054 -12.990 1.00 49.09  ? 426  VAL A O   1 
ATOM   3343 C CB  . VAL A 1 444 ? 19.413  -42.049 -10.750 1.00 53.29  ? 426  VAL A CB  1 
ATOM   3344 C CG1 . VAL A 1 444 ? 17.909  -42.312 -10.966 1.00 49.78  ? 426  VAL A CG1 1 
ATOM   3345 C CG2 . VAL A 1 444 ? 20.205  -43.358 -10.766 1.00 56.97  ? 426  VAL A CG2 1 
ATOM   3346 N N   . THR A 1 445 ? 19.023  -38.922 -11.227 1.00 47.08  ? 427  THR A N   1 
ATOM   3347 C CA  . THR A 1 445 ? 18.181  -37.737 -11.343 1.00 44.45  ? 427  THR A CA  1 
ATOM   3348 C C   . THR A 1 445 ? 18.361  -36.999 -12.683 1.00 44.88  ? 427  THR A C   1 
ATOM   3349 O O   . THR A 1 445 ? 17.380  -36.608 -13.309 1.00 43.45  ? 427  THR A O   1 
ATOM   3350 C CB  . THR A 1 445 ? 18.462  -36.757 -10.170 1.00 44.60  ? 427  THR A CB  1 
ATOM   3351 O OG1 . THR A 1 445 ? 17.952  -37.318 -8.954  1.00 44.13  ? 427  THR A OG1 1 
ATOM   3352 C CG2 . THR A 1 445 ? 17.846  -35.372 -10.408 1.00 43.17  ? 427  THR A CG2 1 
ATOM   3353 N N   . HIS A 1 446 ? 19.616  -36.801 -13.083 1.00 47.46  ? 428  HIS A N   1 
ATOM   3354 C CA  . HIS A 1 446 ? 19.971  -36.277 -14.386 1.00 49.31  ? 428  HIS A CA  1 
ATOM   3355 C C   . HIS A 1 446 ? 19.440  -37.144 -15.520 1.00 49.07  ? 428  HIS A C   1 
ATOM   3356 O O   . HIS A 1 446 ? 18.781  -36.647 -16.423 1.00 48.64  ? 428  HIS A O   1 
ATOM   3357 C CB  . HIS A 1 446 ? 21.483  -36.147 -14.514 1.00 53.55  ? 428  HIS A CB  1 
ATOM   3358 C CG  . HIS A 1 446 ? 21.906  -35.380 -15.719 1.00 56.89  ? 428  HIS A CG  1 
ATOM   3359 N ND1 . HIS A 1 446 ? 22.353  -35.989 -16.873 1.00 59.42  ? 428  HIS A ND1 1 
ATOM   3360 C CD2 . HIS A 1 446 ? 21.933  -34.046 -15.960 1.00 59.57  ? 428  HIS A CD2 1 
ATOM   3361 C CE1 . HIS A 1 446 ? 22.654  -35.062 -17.766 1.00 62.30  ? 428  HIS A CE1 1 
ATOM   3362 N NE2 . HIS A 1 446 ? 22.408  -33.875 -17.237 1.00 61.98  ? 428  HIS A NE2 1 
ATOM   3363 N N   . ASP A 1 447 ? 19.731  -38.435 -15.474 1.00 50.65  ? 429  ASP A N   1 
ATOM   3364 C CA  . ASP A 1 447 ? 19.300  -39.353 -16.520 1.00 52.68  ? 429  ASP A CA  1 
ATOM   3365 C C   . ASP A 1 447 ? 17.790  -39.346 -16.722 1.00 50.39  ? 429  ASP A C   1 
ATOM   3366 O O   . ASP A 1 447 ? 17.313  -39.320 -17.865 1.00 50.74  ? 429  ASP A O   1 
ATOM   3367 C CB  . ASP A 1 447 ? 19.800  -40.773 -16.228 1.00 55.36  ? 429  ASP A CB  1 
ATOM   3368 C CG  . ASP A 1 447 ? 21.258  -40.933 -16.534 1.00 61.93  ? 429  ASP A CG  1 
ATOM   3369 O OD1 . ASP A 1 447 ? 21.848  -40.039 -17.191 1.00 63.06  ? 429  ASP A OD1 1 
ATOM   3370 O OD2 . ASP A 1 447 ? 21.828  -41.966 -16.126 1.00 68.86  ? 429  ASP A OD2 1 
ATOM   3371 N N   . MET A 1 448 ? 17.053  -39.375 -15.608 1.00 48.68  ? 430  MET A N   1 
ATOM   3372 C CA  . MET A 1 448 ? 15.608  -39.373 -15.649 1.00 48.36  ? 430  MET A CA  1 
ATOM   3373 C C   . MET A 1 448 ? 15.149  -38.074 -16.342 1.00 47.01  ? 430  MET A C   1 
ATOM   3374 O O   . MET A 1 448 ? 14.359  -38.105 -17.294 1.00 47.70  ? 430  MET A O   1 
ATOM   3375 C CB  . MET A 1 448 ? 15.049  -39.486 -14.231 1.00 47.51  ? 430  MET A CB  1 
ATOM   3376 C CG  . MET A 1 448 ? 13.549  -39.448 -14.168 1.00 48.76  ? 430  MET A CG  1 
ATOM   3377 S SD  . MET A 1 448 ? 12.811  -39.629 -12.527 1.00 50.69  ? 430  MET A SD  1 
ATOM   3378 C CE  . MET A 1 448 ? 11.507  -38.406 -12.743 1.00 51.91  ? 430  MET A CE  1 
ATOM   3379 N N   . ASP A 1 449 ? 15.686  -36.953 -15.869 1.00 45.74  ? 431  ASP A N   1 
ATOM   3380 C CA  . ASP A 1 449 ? 15.344  -35.623 -16.379 1.00 46.41  ? 431  ASP A CA  1 
ATOM   3381 C C   . ASP A 1 449 ? 15.548  -35.401 -17.881 1.00 46.56  ? 431  ASP A C   1 
ATOM   3382 O O   . ASP A 1 449 ? 14.715  -34.763 -18.522 1.00 46.90  ? 431  ASP A O   1 
ATOM   3383 C CB  . ASP A 1 449 ? 16.078  -34.560 -15.570 1.00 47.44  ? 431  ASP A CB  1 
ATOM   3384 C CG  . ASP A 1 449 ? 15.602  -34.499 -14.108 1.00 50.42  ? 431  ASP A CG  1 
ATOM   3385 O OD1 . ASP A 1 449 ? 14.761  -35.359 -13.675 1.00 51.20  ? 431  ASP A OD1 1 
ATOM   3386 O OD2 . ASP A 1 449 ? 16.081  -33.578 -13.391 1.00 55.08  ? 431  ASP A OD2 1 
ATOM   3387 N N   . MET A 1 450 ? 16.631  -35.954 -18.428 1.00 47.04  ? 432  MET A N   1 
ATOM   3388 C CA  . MET A 1 450 ? 17.019  -35.745 -19.828 1.00 48.74  ? 432  MET A CA  1 
ATOM   3389 C C   . MET A 1 450 ? 16.032  -36.335 -20.835 1.00 48.81  ? 432  MET A C   1 
ATOM   3390 O O   . MET A 1 450 ? 15.964  -35.905 -21.971 1.00 49.28  ? 432  MET A O   1 
ATOM   3391 C CB  . MET A 1 450 ? 18.446  -36.258 -20.072 1.00 51.02  ? 432  MET A CB  1 
ATOM   3392 C CG  . MET A 1 450 ? 19.547  -35.445 -19.367 1.00 53.59  ? 432  MET A CG  1 
ATOM   3393 S SD  . MET A 1 450 ? 19.497  -33.624 -19.646 1.00 58.28  ? 432  MET A SD  1 
ATOM   3394 C CE  . MET A 1 450 ? 18.352  -33.079 -18.362 1.00 54.39  ? 432  MET A CE  1 
ATOM   3395 N N   . CYS A 1 451 ? 15.261  -37.314 -20.384 1.00 38.77  ? 433  CYS A N   1 
ATOM   3396 C CA  . CYS A 1 451 ? 14.221  -37.942 -21.154 1.00 40.40  ? 433  CYS A CA  1 
ATOM   3397 C C   . CYS A 1 451 ? 13.077  -36.985 -21.465 1.00 37.59  ? 433  CYS A C   1 
ATOM   3398 O O   . CYS A 1 451 ? 12.303  -37.209 -22.378 1.00 37.45  ? 433  CYS A O   1 
ATOM   3399 C CB  . CYS A 1 451 ? 13.676  -39.123 -20.355 1.00 40.55  ? 433  CYS A CB  1 
ATOM   3400 S SG  . CYS A 1 451 ? 14.864  -40.444 -20.148 1.00 52.15  ? 433  CYS A SG  1 
ATOM   3401 N N   . TYR A 1 452 ? 12.957  -35.939 -20.668 1.00 36.30  ? 434  TYR A N   1 
ATOM   3402 C CA  . TYR A 1 452 ? 11.923  -34.940 -20.866 1.00 34.86  ? 434  TYR A CA  1 
ATOM   3403 C C   . TYR A 1 452 ? 12.364  -33.807 -21.765 1.00 35.04  ? 434  TYR A C   1 
ATOM   3404 O O   . TYR A 1 452 ? 11.523  -33.115 -22.296 1.00 36.43  ? 434  TYR A O   1 
ATOM   3405 C CB  . TYR A 1 452 ? 11.470  -34.376 -19.523 1.00 33.21  ? 434  TYR A CB  1 
ATOM   3406 C CG  . TYR A 1 452 ? 10.755  -35.397 -18.679 1.00 33.01  ? 434  TYR A CG  1 
ATOM   3407 C CD1 . TYR A 1 452 ? 9.385   -35.595 -18.812 1.00 30.56  ? 434  TYR A CD1 1 
ATOM   3408 C CD2 . TYR A 1 452 ? 11.458  -36.171 -17.747 1.00 35.45  ? 434  TYR A CD2 1 
ATOM   3409 C CE1 . TYR A 1 452 ? 8.721   -36.524 -18.020 1.00 34.54  ? 434  TYR A CE1 1 
ATOM   3410 C CE2 . TYR A 1 452 ? 10.808  -37.108 -16.944 1.00 36.07  ? 434  TYR A CE2 1 
ATOM   3411 C CZ  . TYR A 1 452 ? 9.443   -37.279 -17.104 1.00 34.89  ? 434  TYR A CZ  1 
ATOM   3412 O OH  . TYR A 1 452 ? 8.811   -38.201 -16.363 1.00 35.72  ? 434  TYR A OH  1 
ATOM   3413 N N   . GLY A 1 453 ? 13.666  -33.622 -21.938 1.00 35.13  ? 435  GLY A N   1 
ATOM   3414 C CA  . GLY A 1 453 ? 14.212  -32.448 -22.599 1.00 33.88  ? 435  GLY A CA  1 
ATOM   3415 C C   . GLY A 1 453 ? 15.262  -31.913 -21.658 1.00 33.70  ? 435  GLY A C   1 
ATOM   3416 O O   . GLY A 1 453 ? 15.409  -32.403 -20.551 1.00 32.43  ? 435  GLY A O   1 
ATOM   3417 N N   . MET A 1 454 ? 15.973  -30.881 -22.076 1.00 34.46  ? 436  MET A N   1 
ATOM   3418 C CA  . MET A 1 454 ? 17.113  -30.362 -21.312 1.00 35.39  ? 436  MET A CA  1 
ATOM   3419 C C   . MET A 1 454 ? 16.777  -29.751 -19.937 1.00 34.10  ? 436  MET A C   1 
ATOM   3420 O O   . MET A 1 454 ? 17.592  -29.777 -19.019 1.00 35.10  ? 436  MET A O   1 
ATOM   3421 C CB  . MET A 1 454 ? 17.843  -29.350 -22.181 1.00 36.97  ? 436  MET A CB  1 
ATOM   3422 C CG  . MET A 1 454 ? 18.309  -29.961 -23.500 1.00 40.13  ? 436  MET A CG  1 
ATOM   3423 S SD  . MET A 1 454 ? 19.740  -31.078 -23.198 1.00 46.10  ? 436  MET A SD  1 
ATOM   3424 C CE  . MET A 1 454 ? 21.035  -29.849 -23.487 1.00 45.87  ? 436  MET A CE  1 
ATOM   3425 N N   . MET A 1 455 ? 15.565  -29.251 -19.786 1.00 32.30  ? 437  MET A N   1 
ATOM   3426 C CA  . MET A 1 455 ? 15.186  -28.600 -18.546 1.00 31.86  ? 437  MET A CA  1 
ATOM   3427 C C   . MET A 1 455 ? 14.267  -29.511 -17.733 1.00 30.30  ? 437  MET A C   1 
ATOM   3428 O O   . MET A 1 455 ? 13.677  -29.082 -16.758 1.00 30.28  ? 437  MET A O   1 
ATOM   3429 C CB  . MET A 1 455 ? 14.546  -27.210 -18.825 1.00 31.24  ? 437  MET A CB  1 
ATOM   3430 C CG  . MET A 1 455 ? 15.514  -26.161 -19.374 1.00 33.49  ? 437  MET A CG  1 
ATOM   3431 S SD  . MET A 1 455 ? 16.836  -25.766 -18.175 1.00 42.87  ? 437  MET A SD  1 
ATOM   3432 C CE  . MET A 1 455 ? 16.934  -23.995 -18.204 1.00 40.85  ? 437  MET A CE  1 
ATOM   3433 N N   . GLY A 1 456 ? 14.112  -30.747 -18.183 1.00 30.33  ? 438  GLY A N   1 
ATOM   3434 C CA  . GLY A 1 456 ? 13.477  -31.788 -17.419 1.00 30.05  ? 438  GLY A CA  1 
ATOM   3435 C C   . GLY A 1 456 ? 11.979  -31.760 -17.506 1.00 30.13  ? 438  GLY A C   1 
ATOM   3436 O O   . GLY A 1 456 ? 11.405  -31.041 -18.339 1.00 30.81  ? 438  GLY A O   1 
ATOM   3437 N N   . SER A 1 457 ? 11.345  -32.551 -16.642 1.00 29.76  ? 439  SER A N   1 
ATOM   3438 C CA  . SER A 1 457 ? 9.909   -32.579 -16.490 1.00 29.12  ? 439  SER A CA  1 
ATOM   3439 C C   . SER A 1 457 ? 9.330   -31.250 -15.968 1.00 28.83  ? 439  SER A C   1 
ATOM   3440 O O   . SER A 1 457 ? 9.915   -30.583 -15.120 1.00 29.66  ? 439  SER A O   1 
ATOM   3441 C CB  . SER A 1 457 ? 9.544   -33.691 -15.494 1.00 29.67  ? 439  SER A CB  1 
ATOM   3442 O OG  . SER A 1 457 ? 8.142   -33.745 -15.290 1.00 29.16  ? 439  SER A OG  1 
ATOM   3443 N N   . LEU A 1 458 ? 8.163   -30.893 -16.476 1.00 27.44  ? 440  LEU A N   1 
ATOM   3444 C CA  . LEU A 1 458 ? 7.342   -29.836 -15.926 1.00 26.59  ? 440  LEU A CA  1 
ATOM   3445 C C   . LEU A 1 458 ? 7.069   -29.973 -14.393 1.00 26.61  ? 440  LEU A C   1 
ATOM   3446 O O   . LEU A 1 458 ? 7.028   -28.993 -13.671 1.00 26.86  ? 440  LEU A O   1 
ATOM   3447 C CB  . LEU A 1 458 ? 6.041   -29.813 -16.744 1.00 25.67  ? 440  LEU A CB  1 
ATOM   3448 C CG  . LEU A 1 458 ? 4.888   -28.849 -16.514 1.00 26.49  ? 440  LEU A CG  1 
ATOM   3449 C CD1 . LEU A 1 458 ? 5.314   -27.438 -16.692 1.00 25.72  ? 440  LEU A CD1 1 
ATOM   3450 C CD2 . LEU A 1 458 ? 3.871   -29.192 -17.516 1.00 25.75  ? 440  LEU A CD2 1 
ATOM   3451 N N   . PHE A 1 459 ? 6.957   -31.197 -13.915 1.00 26.89  ? 441  PHE A N   1 
ATOM   3452 C CA  . PHE A 1 459 ? 6.418   -31.525 -12.596 1.00 27.82  ? 441  PHE A CA  1 
ATOM   3453 C C   . PHE A 1 459 ? 7.451   -31.923 -11.525 1.00 28.78  ? 441  PHE A C   1 
ATOM   3454 O O   . PHE A 1 459 ? 7.095   -32.140 -10.350 1.00 29.07  ? 441  PHE A O   1 
ATOM   3455 C CB  . PHE A 1 459 ? 5.406   -32.681 -12.729 1.00 27.08  ? 441  PHE A CB  1 
ATOM   3456 C CG  . PHE A 1 459 ? 4.235   -32.366 -13.646 1.00 27.63  ? 441  PHE A CG  1 
ATOM   3457 C CD1 . PHE A 1 459 ? 3.302   -31.368 -13.305 1.00 29.33  ? 441  PHE A CD1 1 
ATOM   3458 C CD2 . PHE A 1 459 ? 4.063   -33.053 -14.834 1.00 24.86  ? 441  PHE A CD2 1 
ATOM   3459 C CE1 . PHE A 1 459 ? 2.210   -31.074 -14.131 1.00 25.42  ? 441  PHE A CE1 1 
ATOM   3460 C CE2 . PHE A 1 459 ? 2.995   -32.767 -15.658 1.00 24.99  ? 441  PHE A CE2 1 
ATOM   3461 C CZ  . PHE A 1 459 ? 2.061   -31.755 -15.298 1.00 26.14  ? 441  PHE A CZ  1 
ATOM   3462 N N   . ARG A 1 460 ? 8.706   -32.050 -11.924 1.00 28.69  ? 442  ARG A N   1 
ATOM   3463 C CA  . ARG A 1 460 ? 9.708   -32.546 -11.015 1.00 30.95  ? 442  ARG A CA  1 
ATOM   3464 C C   . ARG A 1 460 ? 11.072  -32.574 -11.632 1.00 32.28  ? 442  ARG A C   1 
ATOM   3465 O O   . ARG A 1 460 ? 11.214  -32.545 -12.860 1.00 33.27  ? 442  ARG A O   1 
ATOM   3466 C CB  . ARG A 1 460 ? 9.372   -33.964 -10.522 1.00 32.32  ? 442  ARG A CB  1 
ATOM   3467 C CG  . ARG A 1 460 ? 9.243   -35.013 -11.594 1.00 29.69  ? 442  ARG A CG  1 
ATOM   3468 C CD  . ARG A 1 460 ? 9.012   -36.387 -10.983 1.00 33.74  ? 442  ARG A CD  1 
ATOM   3469 N NE  . ARG A 1 460 ? 7.894   -36.440 -10.040 1.00 35.01  ? 442  ARG A NE  1 
ATOM   3470 C CZ  . ARG A 1 460 ? 8.012   -36.508 -8.715  1.00 37.03  ? 442  ARG A CZ  1 
ATOM   3471 N NH1 . ARG A 1 460 ? 6.923   -36.582 -7.967  1.00 38.70  ? 442  ARG A NH1 1 
ATOM   3472 N NH2 . ARG A 1 460 ? 9.198   -36.537 -8.130  1.00 38.89  ? 442  ARG A NH2 1 
ATOM   3473 N N   . SER A 1 461 ? 12.063  -32.611 -10.759 1.00 32.90  ? 443  SER A N   1 
ATOM   3474 C CA  . SER A 1 461 ? 13.412  -32.970 -11.108 1.00 35.14  ? 443  SER A CA  1 
ATOM   3475 C C   . SER A 1 461 ? 13.761  -34.148 -10.212 1.00 36.60  ? 443  SER A C   1 
ATOM   3476 O O   . SER A 1 461 ? 13.927  -34.000 -8.987  1.00 37.09  ? 443  SER A O   1 
ATOM   3477 C CB  . SER A 1 461 ? 14.369  -31.788 -10.903 1.00 35.42  ? 443  SER A CB  1 
ATOM   3478 O OG  . SER A 1 461 ? 15.701  -32.232 -11.076 1.00 39.57  ? 443  SER A OG  1 
ATOM   3479 N N   . GLY A 1 462 ? 13.816  -35.334 -10.810 1.00 38.06  ? 444  GLY A N   1 
ATOM   3480 C CA  . GLY A 1 462 ? 14.036  -36.554 -10.041 1.00 39.79  ? 444  GLY A CA  1 
ATOM   3481 C C   . GLY A 1 462 ? 12.946  -36.685 -8.988  1.00 40.11  ? 444  GLY A C   1 
ATOM   3482 O O   . GLY A 1 462 ? 11.773  -36.588 -9.304  1.00 38.96  ? 444  GLY A O   1 
ATOM   3483 N N   . SER A 1 463 ? 13.335  -36.844 -7.728  1.00 42.12  ? 445  SER A N   1 
ATOM   3484 C CA  . SER A 1 463 ? 12.363  -36.970 -6.640  1.00 43.14  ? 445  SER A CA  1 
ATOM   3485 C C   . SER A 1 463 ? 11.767  -35.648 -6.078  1.00 41.79  ? 445  SER A C   1 
ATOM   3486 O O   . SER A 1 463 ? 10.944  -35.671 -5.156  1.00 42.95  ? 445  SER A O   1 
ATOM   3487 C CB  . SER A 1 463 ? 12.969  -37.788 -5.500  1.00 44.78  ? 445  SER A CB  1 
ATOM   3488 O OG  . SER A 1 463 ? 13.774  -36.939 -4.695  1.00 48.25  ? 445  SER A OG  1 
ATOM   3489 N N   . ARG A 1 464 ? 12.191  -34.516 -6.621  1.00 40.70  ? 446  ARG A N   1 
ATOM   3490 C CA  . ARG A 1 464 ? 11.792  -33.218 -6.125  1.00 40.08  ? 446  ARG A CA  1 
ATOM   3491 C C   . ARG A 1 464 ? 10.756  -32.572 -7.041  1.00 37.92  ? 446  ARG A C   1 
ATOM   3492 O O   . ARG A 1 464 ? 11.008  -32.344 -8.219  1.00 37.21  ? 446  ARG A O   1 
ATOM   3493 C CB  . ARG A 1 464 ? 13.033  -32.340 -5.973  1.00 40.86  ? 446  ARG A CB  1 
ATOM   3494 C CG  . ARG A 1 464 ? 13.721  -32.538 -4.651  1.00 46.50  ? 446  ARG A CG  1 
ATOM   3495 C CD  . ARG A 1 464 ? 15.224  -32.702 -4.786  1.00 53.34  ? 446  ARG A CD  1 
ATOM   3496 N NE  . ARG A 1 464 ? 15.967  -31.490 -4.434  1.00 56.75  ? 446  ARG A NE  1 
ATOM   3497 C CZ  . ARG A 1 464 ? 16.928  -30.930 -5.176  1.00 56.94  ? 446  ARG A CZ  1 
ATOM   3498 N NH1 . ARG A 1 464 ? 17.306  -31.453 -6.344  1.00 55.15  ? 446  ARG A NH1 1 
ATOM   3499 N NH2 . ARG A 1 464 ? 17.521  -29.832 -4.732  1.00 58.05  ? 446  ARG A NH2 1 
ATOM   3500 N N   . GLN A 1 465 ? 9.575   -32.282 -6.495  1.00 37.35  ? 447  GLN A N   1 
ATOM   3501 C CA  . GLN A 1 465 ? 8.528   -31.550 -7.234  1.00 34.83  ? 447  GLN A CA  1 
ATOM   3502 C C   . GLN A 1 465 ? 8.852   -30.073 -7.508  1.00 33.23  ? 447  GLN A C   1 
ATOM   3503 O O   . GLN A 1 465 ? 9.398   -29.369 -6.652  1.00 33.22  ? 447  GLN A O   1 
ATOM   3504 C CB  . GLN A 1 465 ? 7.235   -31.612 -6.461  1.00 34.68  ? 447  GLN A CB  1 
ATOM   3505 C CG  . GLN A 1 465 ? 6.677   -32.986 -6.410  1.00 40.06  ? 447  GLN A CG  1 
ATOM   3506 C CD  . GLN A 1 465 ? 5.294   -32.974 -5.814  1.00 44.89  ? 447  GLN A CD  1 
ATOM   3507 O OE1 . GLN A 1 465 ? 5.119   -32.566 -4.671  1.00 48.12  ? 447  GLN A OE1 1 
ATOM   3508 N NE2 . GLN A 1 465 ? 4.299   -33.404 -6.588  1.00 44.99  ? 447  GLN A NE2 1 
ATOM   3509 N N   . THR A 1 466 ? 8.441   -29.600 -8.680  1.00 30.63  ? 448  THR A N   1 
ATOM   3510 C CA  . THR A 1 466 ? 8.662   -28.222 -9.070  1.00 29.64  ? 448  THR A CA  1 
ATOM   3511 C C   . THR A 1 466 ? 7.666   -27.315 -8.371  1.00 29.16  ? 448  THR A C   1 
ATOM   3512 O O   . THR A 1 466 ? 6.671   -27.781 -7.837  1.00 28.80  ? 448  THR A O   1 
ATOM   3513 C CB  . THR A 1 466 ? 8.487   -28.052 -10.579 1.00 28.65  ? 448  THR A CB  1 
ATOM   3514 O OG1 . THR A 1 466 ? 7.230   -28.630 -10.947 1.00 28.03  ? 448  THR A OG1 1 
ATOM   3515 C CG2 . THR A 1 466 ? 9.629   -28.776 -11.348 1.00 28.75  ? 448  THR A CG2 1 
ATOM   3516 N N   . LEU A 1 467 ? 7.983   -26.023 -8.354  1.00 28.76  ? 449  LEU A N   1 
ATOM   3517 C CA  . LEU A 1 467 ? 7.040   -24.987 -8.070  1.00 29.29  ? 449  LEU A CA  1 
ATOM   3518 C C   . LEU A 1 467 ? 5.734   -25.236 -8.828  1.00 28.68  ? 449  LEU A C   1 
ATOM   3519 O O   . LEU A 1 467 ? 4.666   -25.208 -8.244  1.00 28.92  ? 449  LEU A O   1 
ATOM   3520 C CB  . LEU A 1 467 ? 7.632   -23.619 -8.451  1.00 29.01  ? 449  LEU A CB  1 
ATOM   3521 C CG  . LEU A 1 467 ? 6.703   -22.423 -8.197  1.00 29.92  ? 449  LEU A CG  1 
ATOM   3522 C CD1 . LEU A 1 467 ? 6.094   -22.404 -6.762  1.00 30.41  ? 449  LEU A CD1 1 
ATOM   3523 C CD2 . LEU A 1 467 ? 7.456   -21.157 -8.488  1.00 30.80  ? 449  LEU A CD2 1 
ATOM   3524 N N   . PHE A 1 468 ? 5.833   -25.505 -10.126 1.00 28.71  ? 450  PHE A N   1 
ATOM   3525 C CA  . PHE A 1 468 ? 4.646   -25.692 -10.955 1.00 28.22  ? 450  PHE A CA  1 
ATOM   3526 C C   . PHE A 1 468 ? 3.728   -26.850 -10.464 1.00 27.82  ? 450  PHE A C   1 
ATOM   3527 O O   . PHE A 1 468 ? 2.518   -26.678 -10.365 1.00 28.03  ? 450  PHE A O   1 
ATOM   3528 C CB  . PHE A 1 468 ? 5.065   -25.877 -12.424 1.00 27.33  ? 450  PHE A CB  1 
ATOM   3529 C CG  . PHE A 1 468 ? 3.921   -25.874 -13.381 1.00 27.98  ? 450  PHE A CG  1 
ATOM   3530 C CD1 . PHE A 1 468 ? 3.500   -24.682 -13.980 1.00 31.36  ? 450  PHE A CD1 1 
ATOM   3531 C CD2 . PHE A 1 468 ? 3.240   -27.060 -13.676 1.00 26.70  ? 450  PHE A CD2 1 
ATOM   3532 C CE1 . PHE A 1 468 ? 2.424   -24.673 -14.868 1.00 31.89  ? 450  PHE A CE1 1 
ATOM   3533 C CE2 . PHE A 1 468 ? 2.154   -27.058 -14.559 1.00 25.71  ? 450  PHE A CE2 1 
ATOM   3534 C CZ  . PHE A 1 468 ? 1.751   -25.884 -15.153 1.00 28.52  ? 450  PHE A CZ  1 
ATOM   3535 N N   . ALA A 1 469 ? 4.292   -28.025 -10.202 1.00 27.42  ? 451  ALA A N   1 
ATOM   3536 C CA  . ALA A 1 469 ? 3.522   -29.142 -9.677  1.00 27.20  ? 451  ALA A CA  1 
ATOM   3537 C C   . ALA A 1 469 ? 2.770   -28.763 -8.380  1.00 28.99  ? 451  ALA A C   1 
ATOM   3538 O O   . ALA A 1 469 ? 1.573   -29.058 -8.260  1.00 28.60  ? 451  ALA A O   1 
ATOM   3539 C CB  . ALA A 1 469 ? 4.419   -30.328 -9.447  1.00 27.79  ? 451  ALA A CB  1 
ATOM   3540 N N   . SER A 1 470 ? 3.454   -28.106 -7.431  1.00 29.97  ? 452  SER A N   1 
ATOM   3541 C CA  . SER A 1 470 ? 2.813   -27.656 -6.195  1.00 32.79  ? 452  SER A CA  1 
ATOM   3542 C C   . SER A 1 470 ? 1.621   -26.736 -6.436  1.00 32.59  ? 452  SER A C   1 
ATOM   3543 O O   . SER A 1 470 ? 0.624   -26.823 -5.731  1.00 33.00  ? 452  SER A O   1 
ATOM   3544 C CB  . SER A 1 470 ? 3.807   -26.969 -5.249  1.00 34.30  ? 452  SER A CB  1 
ATOM   3545 O OG  . SER A 1 470 ? 5.025   -27.706 -5.223  1.00 38.96  ? 452  SER A OG  1 
ATOM   3546 N N   . GLN A 1 471 ? 1.744   -25.840 -7.415  1.00 32.23  ? 453  GLN A N   1 
ATOM   3547 C CA  . GLN A 1 471 ? 0.681   -24.889 -7.718  1.00 32.22  ? 453  GLN A CA  1 
ATOM   3548 C C   . GLN A 1 471 ? -0.478  -25.608 -8.398  1.00 30.77  ? 453  GLN A C   1 
ATOM   3549 O O   . GLN A 1 471 ? -1.630  -25.291 -8.149  1.00 31.35  ? 453  GLN A O   1 
ATOM   3550 C CB  . GLN A 1 471 ? 1.192   -23.766 -8.604  1.00 32.19  ? 453  GLN A CB  1 
ATOM   3551 C CG  . GLN A 1 471 ? 2.243   -22.856 -7.990  1.00 36.26  ? 453  GLN A CG  1 
ATOM   3552 C CD  . GLN A 1 471 ? 2.762   -21.882 -9.032  1.00 43.95  ? 453  GLN A CD  1 
ATOM   3553 O OE1 . GLN A 1 471 ? 2.962   -22.258 -10.210 1.00 44.67  ? 453  GLN A OE1 1 
ATOM   3554 N NE2 . GLN A 1 471 ? 2.961   -20.612 -8.629  1.00 47.05  ? 453  GLN A NE2 1 
ATOM   3555 N N   . VAL A 1 472 ? -0.190  -26.582 -9.254  1.00 29.80  ? 454  VAL A N   1 
ATOM   3556 C CA  . VAL A 1 472 ? -1.277  -27.410 -9.789  1.00 29.71  ? 454  VAL A CA  1 
ATOM   3557 C C   . VAL A 1 472 ? -2.056  -28.068 -8.654  1.00 31.63  ? 454  VAL A C   1 
ATOM   3558 O O   . VAL A 1 472 ? -3.286  -27.990 -8.634  1.00 31.76  ? 454  VAL A O   1 
ATOM   3559 C CB  . VAL A 1 472 ? -0.805  -28.462 -10.806 1.00 29.12  ? 454  VAL A CB  1 
ATOM   3560 C CG1 . VAL A 1 472 ? -1.948  -29.429 -11.148 1.00 28.18  ? 454  VAL A CG1 1 
ATOM   3561 C CG2 . VAL A 1 472 ? -0.277  -27.772 -12.045 1.00 26.14  ? 454  VAL A CG2 1 
ATOM   3562 N N   . MET A 1 473 ? -1.334  -28.667 -7.697  1.00 32.68  ? 455  MET A N   1 
ATOM   3563 C CA  . MET A 1 473 ? -1.974  -29.385 -6.601  1.00 35.36  ? 455  MET A CA  1 
ATOM   3564 C C   . MET A 1 473 ? -2.761  -28.440 -5.695  1.00 36.61  ? 455  MET A C   1 
ATOM   3565 O O   . MET A 1 473 ? -3.833  -28.795 -5.237  1.00 38.00  ? 455  MET A O   1 
ATOM   3566 C CB  . MET A 1 473 ? -0.961  -30.217 -5.813  1.00 35.26  ? 455  MET A CB  1 
ATOM   3567 C CG  . MET A 1 473 ? -0.292  -31.350 -6.609  1.00 33.97  ? 455  MET A CG  1 
ATOM   3568 S SD  . MET A 1 473 ? 1.034   -32.193 -5.671  1.00 39.17  ? 455  MET A SD  1 
ATOM   3569 C CE  . MET A 1 473 ? 0.093   -33.222 -4.544  1.00 39.02  ? 455  MET A CE  1 
ATOM   3570 N N   . ARG A 1 474 ? -2.247  -27.235 -5.470  1.00 37.37  ? 456  ARG A N   1 
ATOM   3571 C CA  . ARG A 1 474 ? -2.919  -26.258 -4.613  1.00 39.97  ? 456  ARG A CA  1 
ATOM   3572 C C   . ARG A 1 474 ? -4.132  -25.614 -5.287  1.00 38.86  ? 456  ARG A C   1 
ATOM   3573 O O   . ARG A 1 474 ? -5.136  -25.363 -4.635  1.00 40.83  ? 456  ARG A O   1 
ATOM   3574 C CB  . ARG A 1 474 ? -1.963  -25.163 -4.078  1.00 41.01  ? 456  ARG A CB  1 
ATOM   3575 C CG  . ARG A 1 474 ? -2.351  -24.711 -2.653  1.00 45.51  ? 456  ARG A CG  1 
ATOM   3576 C CD  . ARG A 1 474 ? -2.090  -23.214 -2.301  1.00 48.30  ? 456  ARG A CD  1 
ATOM   3577 N NE  . ARG A 1 474 ? -2.626  -22.812 -0.968  1.00 56.41  ? 456  ARG A NE  1 
ATOM   3578 C CZ  . ARG A 1 474 ? -3.915  -22.500 -0.663  1.00 62.44  ? 456  ARG A CZ  1 
ATOM   3579 N NH1 . ARG A 1 474 ? -4.893  -22.548 -1.576  1.00 61.82  ? 456  ARG A NH1 1 
ATOM   3580 N NH2 . ARG A 1 474 ? -4.250  -22.146 0.591   1.00 65.13  ? 456  ARG A NH2 1 
ATOM   3581 N N   . TYR A 1 475 ? -4.062  -25.379 -6.590  1.00 36.71  ? 457  TYR A N   1 
ATOM   3582 C CA  . TYR A 1 475 ? -5.036  -24.516 -7.238  1.00 36.55  ? 457  TYR A CA  1 
ATOM   3583 C C   . TYR A 1 475 ? -6.019  -25.188 -8.204  1.00 34.55  ? 457  TYR A C   1 
ATOM   3584 O O   . TYR A 1 475 ? -7.085  -24.651 -8.436  1.00 34.23  ? 457  TYR A O   1 
ATOM   3585 C CB  . TYR A 1 475 ? -4.314  -23.316 -7.884  1.00 36.86  ? 457  TYR A CB  1 
ATOM   3586 C CG  . TYR A 1 475 ? -3.671  -22.435 -6.831  1.00 40.97  ? 457  TYR A CG  1 
ATOM   3587 C CD1 . TYR A 1 475 ? -4.464  -21.726 -5.915  1.00 43.66  ? 457  TYR A CD1 1 
ATOM   3588 C CD2 . TYR A 1 475 ? -2.267  -22.303 -6.737  1.00 40.79  ? 457  TYR A CD2 1 
ATOM   3589 C CE1 . TYR A 1 475 ? -3.878  -20.897 -4.935  1.00 46.91  ? 457  TYR A CE1 1 
ATOM   3590 C CE2 . TYR A 1 475 ? -1.675  -21.472 -5.758  1.00 42.68  ? 457  TYR A CE2 1 
ATOM   3591 C CZ  . TYR A 1 475 ? -2.486  -20.784 -4.866  1.00 45.32  ? 457  TYR A CZ  1 
ATOM   3592 O OH  . TYR A 1 475 ? -1.931  -19.983 -3.891  1.00 49.55  ? 457  TYR A OH  1 
ATOM   3593 N N   . ALA A 1 476 ? -5.687  -26.363 -8.731  1.00 32.56  ? 458  ALA A N   1 
ATOM   3594 C CA  . ALA A 1 476 ? -6.588  -27.048 -9.657  1.00 31.97  ? 458  ALA A CA  1 
ATOM   3595 C C   . ALA A 1 476 ? -7.327  -28.160 -8.933  1.00 32.91  ? 458  ALA A C   1 
ATOM   3596 O O   . ALA A 1 476 ? -6.692  -29.065 -8.420  1.00 34.67  ? 458  ALA A O   1 
ATOM   3597 C CB  . ALA A 1 476 ? -5.809  -27.603 -10.870 1.00 28.96  ? 458  ALA A CB  1 
ATOM   3598 N N   . ASP A 1 477 ? -8.661  -28.093 -8.872  1.00 33.33  ? 459  ASP A N   1 
ATOM   3599 C CA  . ASP A 1 477 ? -9.472  -29.189 -8.361  1.00 33.42  ? 459  ASP A CA  1 
ATOM   3600 C C   . ASP A 1 477 ? -9.262  -30.445 -9.218  1.00 32.22  ? 459  ASP A C   1 
ATOM   3601 O O   . ASP A 1 477 ? -9.040  -31.537 -8.698  1.00 33.05  ? 459  ASP A O   1 
ATOM   3602 C CB  . ASP A 1 477 ? -10.950 -28.793 -8.365  1.00 34.45  ? 459  ASP A CB  1 
ATOM   3603 C CG  . ASP A 1 477 ? -11.275 -27.707 -7.334  1.00 37.69  ? 459  ASP A CG  1 
ATOM   3604 O OD1 . ASP A 1 477 ? -11.149 -27.963 -6.114  1.00 41.10  ? 459  ASP A OD1 1 
ATOM   3605 O OD2 . ASP A 1 477 ? -11.692 -26.601 -7.730  1.00 38.75  ? 459  ASP A OD2 1 
ATOM   3606 N N   . LEU A 1 478 ? -9.353  -30.249 -10.536 1.00 30.45  ? 460  LEU A N   1 
ATOM   3607 C CA  . LEU A 1 478 ? -9.263  -31.272 -11.570 1.00 28.92  ? 460  LEU A CA  1 
ATOM   3608 C C   . LEU A 1 478 ? -8.268  -30.791 -12.583 1.00 26.92  ? 460  LEU A C   1 
ATOM   3609 O O   . LEU A 1 478 ? -8.157  -29.585 -12.833 1.00 27.18  ? 460  LEU A O   1 
ATOM   3610 C CB  . LEU A 1 478 ? -10.612 -31.466 -12.289 1.00 28.93  ? 460  LEU A CB  1 
ATOM   3611 C CG  . LEU A 1 478 ? -11.885 -31.696 -11.467 1.00 31.16  ? 460  LEU A CG  1 
ATOM   3612 C CD1 . LEU A 1 478 ? -13.099 -31.923 -12.390 1.00 27.90  ? 460  LEU A CD1 1 
ATOM   3613 C CD2 . LEU A 1 478 ? -11.698 -32.873 -10.480 1.00 30.21  ? 460  LEU A CD2 1 
ATOM   3614 N N   . TYR A 1 479 ? -7.540  -31.724 -13.179 1.00 26.33  ? 461  TYR A N   1 
ATOM   3615 C CA  . TYR A 1 479 ? -6.649  -31.391 -14.292 1.00 25.87  ? 461  TYR A CA  1 
ATOM   3616 C C   . TYR A 1 479 ? -6.517  -32.567 -15.250 1.00 26.59  ? 461  TYR A C   1 
ATOM   3617 O O   . TYR A 1 479 ? -6.793  -33.699 -14.870 1.00 26.81  ? 461  TYR A O   1 
ATOM   3618 C CB  . TYR A 1 479 ? -5.272  -30.888 -13.783 1.00 25.20  ? 461  TYR A CB  1 
ATOM   3619 C CG  . TYR A 1 479 ? -4.365  -31.942 -13.189 1.00 24.93  ? 461  TYR A CG  1 
ATOM   3620 C CD1 . TYR A 1 479 ? -3.435  -32.614 -13.974 1.00 27.03  ? 461  TYR A CD1 1 
ATOM   3621 C CD2 . TYR A 1 479 ? -4.424  -32.255 -11.843 1.00 25.58  ? 461  TYR A CD2 1 
ATOM   3622 C CE1 . TYR A 1 479 ? -2.594  -33.591 -13.426 1.00 24.51  ? 461  TYR A CE1 1 
ATOM   3623 C CE2 . TYR A 1 479 ? -3.591  -33.189 -11.304 1.00 26.09  ? 461  TYR A CE2 1 
ATOM   3624 C CZ  . TYR A 1 479 ? -2.676  -33.851 -12.102 1.00 26.10  ? 461  TYR A CZ  1 
ATOM   3625 O OH  . TYR A 1 479 ? -1.878  -34.817 -11.543 1.00 27.26  ? 461  TYR A OH  1 
ATOM   3626 N N   . ALA A 1 480 ? -6.102  -32.279 -16.487 1.00 27.01  ? 462  ALA A N   1 
ATOM   3627 C CA  . ALA A 1 480 ? -5.928  -33.288 -17.522 1.00 28.08  ? 462  ALA A CA  1 
ATOM   3628 C C   . ALA A 1 480 ? -5.181  -32.678 -18.696 1.00 28.75  ? 462  ALA A C   1 
ATOM   3629 O O   . ALA A 1 480 ? -5.048  -31.478 -18.780 1.00 27.97  ? 462  ALA A O   1 
ATOM   3630 C CB  . ALA A 1 480 ? -7.287  -33.800 -17.993 1.00 28.85  ? 462  ALA A CB  1 
ATOM   3631 N N   . ALA A 1 481 ? -4.727  -33.528 -19.618 1.00 30.47  ? 463  ALA A N   1 
ATOM   3632 C CA  . ALA A 1 481 ? -4.063  -33.103 -20.850 1.00 30.70  ? 463  ALA A CA  1 
ATOM   3633 C C   . ALA A 1 481 ? -5.014  -32.290 -21.721 1.00 31.74  ? 463  ALA A C   1 
ATOM   3634 O O   . ALA A 1 481 ? -4.591  -31.422 -22.478 1.00 31.76  ? 463  ALA A O   1 
ATOM   3635 C CB  . ALA A 1 481 ? -3.587  -34.330 -21.634 1.00 31.60  ? 463  ALA A CB  1 
ATOM   3636 N N   . SER A 1 482 ? -6.305  -32.581 -21.586 1.00 31.94  ? 464  SER A N   1 
ATOM   3637 C CA  . SER A 1 482 ? -7.355  -31.971 -22.400 1.00 32.22  ? 464  SER A CA  1 
ATOM   3638 C C   . SER A 1 482 ? -8.694  -32.021 -21.631 1.00 31.85  ? 464  SER A C   1 
ATOM   3639 O O   . SER A 1 482 ? -8.961  -32.992 -20.925 1.00 30.54  ? 464  SER A O   1 
ATOM   3640 C CB  . SER A 1 482 ? -7.493  -32.748 -23.716 1.00 33.07  ? 464  SER A CB  1 
ATOM   3641 O OG  . SER A 1 482 ? -8.631  -32.308 -24.427 1.00 34.89  ? 464  SER A OG  1 
ATOM   3642 N N   . PHE A 1 483 ? -9.530  -30.996 -21.805 1.00 31.55  ? 465  PHE A N   1 
ATOM   3643 C CA  . PHE A 1 483 ? -10.846 -30.995 -21.191 1.00 31.31  ? 465  PHE A CA  1 
ATOM   3644 C C   . PHE A 1 483 ? -11.792 -31.955 -21.903 1.00 32.39  ? 465  PHE A C   1 
ATOM   3645 O O   . PHE A 1 483 ? -12.773 -32.385 -21.304 1.00 33.36  ? 465  PHE A O   1 
ATOM   3646 C CB  . PHE A 1 483 ? -11.454 -29.586 -21.147 1.00 32.06  ? 465  PHE A CB  1 
ATOM   3647 C CG  . PHE A 1 483 ? -12.174 -29.208 -22.386 1.00 34.30  ? 465  PHE A CG  1 
ATOM   3648 C CD1 . PHE A 1 483 ? -13.522 -29.518 -22.539 1.00 35.04  ? 465  PHE A CD1 1 
ATOM   3649 C CD2 . PHE A 1 483 ? -11.510 -28.544 -23.409 1.00 38.36  ? 465  PHE A CD2 1 
ATOM   3650 C CE1 . PHE A 1 483 ? -14.186 -29.220 -23.688 1.00 36.81  ? 465  PHE A CE1 1 
ATOM   3651 C CE2 . PHE A 1 483 ? -12.177 -28.226 -24.583 1.00 41.23  ? 465  PHE A CE2 1 
ATOM   3652 C CZ  . PHE A 1 483 ? -13.524 -28.580 -24.722 1.00 40.61  ? 465  PHE A CZ  1 
ATOM   3653 N N   . ILE A 1 484 ? -11.507 -32.304 -23.160 1.00 31.68  ? 466  ILE A N   1 
ATOM   3654 C CA  . ILE A 1 484 ? -12.275 -33.359 -23.810 1.00 33.14  ? 466  ILE A CA  1 
ATOM   3655 C C   . ILE A 1 484 ? -12.449 -34.634 -22.962 1.00 32.14  ? 466  ILE A C   1 
ATOM   3656 O O   . ILE A 1 484 ? -13.426 -35.379 -23.146 1.00 32.46  ? 466  ILE A O   1 
ATOM   3657 C CB  . ILE A 1 484 ? -11.735 -33.741 -25.240 1.00 35.27  ? 466  ILE A CB  1 
ATOM   3658 C CG1 . ILE A 1 484 ? -12.881 -34.230 -26.112 1.00 37.68  ? 466  ILE A CG1 1 
ATOM   3659 C CG2 . ILE A 1 484 ? -10.614 -34.809 -25.180 1.00 35.41  ? 466  ILE A CG2 1 
ATOM   3660 C CD1 . ILE A 1 484 ? -13.721 -33.057 -26.613 1.00 44.17  ? 466  ILE A CD1 1 
ATOM   3661 N N   . ASN A 1 485 ? -11.515 -34.870 -22.050 1.00 30.41  ? 467  ASN A N   1 
ATOM   3662 C CA  . ASN A 1 485 ? -11.557 -36.044 -21.171 1.00 30.98  ? 467  ASN A CA  1 
ATOM   3663 C C   . ASN A 1 485 ? -12.821 -36.075 -20.334 1.00 31.26  ? 467  ASN A C   1 
ATOM   3664 O O   . ASN A 1 485 ? -13.262 -37.140 -19.955 1.00 33.04  ? 467  ASN A O   1 
ATOM   3665 C CB  . ASN A 1 485 ? -10.304 -36.139 -20.269 1.00 29.55  ? 467  ASN A CB  1 
ATOM   3666 C CG  . ASN A 1 485 ? -9.033  -36.401 -21.065 1.00 29.63  ? 467  ASN A CG  1 
ATOM   3667 O OD1 . ASN A 1 485 ? -9.073  -36.503 -22.269 1.00 32.36  ? 467  ASN A OD1 1 
ATOM   3668 N ND2 . ASN A 1 485 ? -7.915  -36.528 -20.387 1.00 31.06  ? 467  ASN A ND2 1 
ATOM   3669 N N   . LEU A 1 486 ? -13.438 -34.924 -20.090 1.00 30.63  ? 468  LEU A N   1 
ATOM   3670 C CA  . LEU A 1 486 ? -14.722 -34.911 -19.399 1.00 31.09  ? 468  LEU A CA  1 
ATOM   3671 C C   . LEU A 1 486 ? -15.813 -35.738 -20.097 1.00 32.96  ? 468  LEU A C   1 
ATOM   3672 O O   . LEU A 1 486 ? -16.814 -36.121 -19.482 1.00 33.78  ? 468  LEU A O   1 
ATOM   3673 C CB  . LEU A 1 486 ? -15.205 -33.477 -19.186 1.00 30.57  ? 468  LEU A CB  1 
ATOM   3674 C CG  . LEU A 1 486 ? -14.447 -32.699 -18.092 1.00 28.80  ? 468  LEU A CG  1 
ATOM   3675 C CD1 . LEU A 1 486 ? -14.746 -31.208 -18.181 1.00 27.03  ? 468  LEU A CD1 1 
ATOM   3676 C CD2 . LEU A 1 486 ? -14.758 -33.275 -16.715 1.00 28.29  ? 468  LEU A CD2 1 
ATOM   3677 N N   . LEU A 1 487 ? -15.617 -35.999 -21.383 1.00 34.07  ? 469  LEU A N   1 
ATOM   3678 C CA  . LEU A 1 487 ? -16.626 -36.644 -22.197 1.00 36.58  ? 469  LEU A CA  1 
ATOM   3679 C C   . LEU A 1 487 ? -16.793 -38.118 -21.801 1.00 38.10  ? 469  LEU A C   1 
ATOM   3680 O O   . LEU A 1 487 ? -17.867 -38.706 -22.047 1.00 39.14  ? 469  LEU A O   1 
ATOM   3681 C CB  . LEU A 1 487 ? -16.280 -36.497 -23.689 1.00 36.87  ? 469  LEU A CB  1 
ATOM   3682 C CG  . LEU A 1 487 ? -17.220 -37.076 -24.748 1.00 39.14  ? 469  LEU A CG  1 
ATOM   3683 C CD1 . LEU A 1 487 ? -18.569 -36.361 -24.793 1.00 38.36  ? 469  LEU A CD1 1 
ATOM   3684 C CD2 . LEU A 1 487 ? -16.561 -37.159 -26.158 1.00 40.63  ? 469  LEU A CD2 1 
ATOM   3685 N N   . TYR A 1 488 ? -15.751 -38.674 -21.159 1.00 37.88  ? 470  TYR A N   1 
ATOM   3686 C CA  . TYR A 1 488 ? -15.658 -40.098 -20.845 1.00 40.17  ? 470  TYR A CA  1 
ATOM   3687 C C   . TYR A 1 488 ? -16.149 -40.395 -19.420 1.00 40.66  ? 470  TYR A C   1 
ATOM   3688 O O   . TYR A 1 488 ? -16.036 -41.521 -18.929 1.00 42.11  ? 470  TYR A O   1 
ATOM   3689 C CB  . TYR A 1 488 ? -14.220 -40.641 -21.075 1.00 40.45  ? 470  TYR A CB  1 
ATOM   3690 C CG  . TYR A 1 488 ? -13.639 -40.185 -22.389 1.00 40.94  ? 470  TYR A CG  1 
ATOM   3691 C CD1 . TYR A 1 488 ? -14.270 -40.502 -23.597 1.00 44.25  ? 470  TYR A CD1 1 
ATOM   3692 C CD2 . TYR A 1 488 ? -12.481 -39.416 -22.437 1.00 40.68  ? 470  TYR A CD2 1 
ATOM   3693 C CE1 . TYR A 1 488 ? -13.766 -40.051 -24.836 1.00 44.76  ? 470  TYR A CE1 1 
ATOM   3694 C CE2 . TYR A 1 488 ? -11.959 -38.949 -23.672 1.00 41.10  ? 470  TYR A CE2 1 
ATOM   3695 C CZ  . TYR A 1 488 ? -12.613 -39.279 -24.853 1.00 43.65  ? 470  TYR A CZ  1 
ATOM   3696 O OH  . TYR A 1 488 ? -12.123 -38.860 -26.057 1.00 44.41  ? 470  TYR A OH  1 
ATOM   3697 N N   . TYR A 1 489 ? -16.728 -39.390 -18.783 1.00 39.39  ? 471  TYR A N   1 
ATOM   3698 C CA  . TYR A 1 489 ? -17.294 -39.533 -17.461 1.00 39.71  ? 471  TYR A CA  1 
ATOM   3699 C C   . TYR A 1 489 ? -18.754 -39.098 -17.531 1.00 40.69  ? 471  TYR A C   1 
ATOM   3700 O O   . TYR A 1 489 ? -19.062 -38.106 -18.216 1.00 40.10  ? 471  TYR A O   1 
ATOM   3701 C CB  . TYR A 1 489 ? -16.542 -38.620 -16.472 1.00 38.24  ? 471  TYR A CB  1 
ATOM   3702 C CG  . TYR A 1 489 ? -15.098 -39.000 -16.269 1.00 37.25  ? 471  TYR A CG  1 
ATOM   3703 C CD1 . TYR A 1 489 ? -14.718 -39.842 -15.212 1.00 36.45  ? 471  TYR A CD1 1 
ATOM   3704 C CD2 . TYR A 1 489 ? -14.103 -38.517 -17.129 1.00 35.96  ? 471  TYR A CD2 1 
ATOM   3705 C CE1 . TYR A 1 489 ? -13.371 -40.192 -15.008 1.00 36.74  ? 471  TYR A CE1 1 
ATOM   3706 C CE2 . TYR A 1 489 ? -12.763 -38.889 -16.951 1.00 36.56  ? 471  TYR A CE2 1 
ATOM   3707 C CZ  . TYR A 1 489 ? -12.409 -39.708 -15.878 1.00 35.87  ? 471  TYR A CZ  1 
ATOM   3708 O OH  . TYR A 1 489 ? -11.094 -40.057 -15.696 1.00 37.45  ? 471  TYR A OH  1 
ATOM   3709 N N   . PRO A 1 490 ? -19.645 -39.805 -16.794 1.00 42.05  ? 472  PRO A N   1 
ATOM   3710 C CA  . PRO A 1 490 ? -21.061 -39.467 -16.726 1.00 44.13  ? 472  PRO A CA  1 
ATOM   3711 C C   . PRO A 1 490 ? -21.235 -38.129 -16.020 1.00 44.60  ? 472  PRO A C   1 
ATOM   3712 O O   . PRO A 1 490 ? -20.375 -37.749 -15.220 1.00 43.86  ? 472  PRO A O   1 
ATOM   3713 C CB  . PRO A 1 490 ? -21.647 -40.610 -15.882 1.00 45.81  ? 472  PRO A CB  1 
ATOM   3714 C CG  . PRO A 1 490 ? -20.524 -41.139 -15.114 1.00 43.35  ? 472  PRO A CG  1 
ATOM   3715 C CD  . PRO A 1 490 ? -19.326 -40.981 -15.952 1.00 42.34  ? 472  PRO A CD  1 
ATOM   3716 N N   . PHE A 1 491 ? -22.320 -37.406 -16.279 1.00 47.25  ? 473  PHE A N   1 
ATOM   3717 C CA  . PHE A 1 491 ? -22.367 -36.038 -15.721 1.00 48.85  ? 473  PHE A CA  1 
ATOM   3718 C C   . PHE A 1 491 ? -22.775 -35.901 -14.245 1.00 48.62  ? 473  PHE A C   1 
ATOM   3719 O O   . PHE A 1 491 ? -22.768 -34.799 -13.689 1.00 49.05  ? 473  PHE A O   1 
ATOM   3720 C CB  . PHE A 1 491 ? -23.062 -35.026 -16.664 1.00 51.19  ? 473  PHE A CB  1 
ATOM   3721 C CG  . PHE A 1 491 ? -22.140 -34.490 -17.748 1.00 53.88  ? 473  PHE A CG  1 
ATOM   3722 C CD1 . PHE A 1 491 ? -21.586 -33.219 -17.646 1.00 54.38  ? 473  PHE A CD1 1 
ATOM   3723 C CD2 . PHE A 1 491 ? -21.782 -35.295 -18.852 1.00 58.15  ? 473  PHE A CD2 1 
ATOM   3724 C CE1 . PHE A 1 491 ? -20.736 -32.741 -18.632 1.00 54.06  ? 473  PHE A CE1 1 
ATOM   3725 C CE2 . PHE A 1 491 ? -20.904 -34.820 -19.841 1.00 56.92  ? 473  PHE A CE2 1 
ATOM   3726 C CZ  . PHE A 1 491 ? -20.389 -33.536 -19.723 1.00 52.78  ? 473  PHE A CZ  1 
ATOM   3727 N N   . SER A 1 492 ? -23.101 -37.027 -13.615 1.00 48.54  ? 474  SER A N   1 
ATOM   3728 C CA  . SER A 1 492 ? -23.234 -37.077 -12.166 1.00 47.78  ? 474  SER A CA  1 
ATOM   3729 C C   . SER A 1 492 ? -22.018 -37.687 -11.471 1.00 44.90  ? 474  SER A C   1 
ATOM   3730 O O   . SER A 1 492 ? -22.063 -37.966 -10.274 1.00 45.05  ? 474  SER A O   1 
ATOM   3731 C CB  . SER A 1 492 ? -24.492 -37.838 -11.778 1.00 50.95  ? 474  SER A CB  1 
ATOM   3732 O OG  . SER A 1 492 ? -25.585 -36.944 -11.651 1.00 55.43  ? 474  SER A OG  1 
ATOM   3733 N N   . TYR A 1 493 ? -20.932 -37.885 -12.215 1.00 40.86  ? 475  TYR A N   1 
ATOM   3734 C CA  . TYR A 1 493 ? -19.729 -38.484 -11.650 1.00 38.19  ? 475  TYR A CA  1 
ATOM   3735 C C   . TYR A 1 493 ? -19.265 -37.715 -10.409 1.00 36.55  ? 475  TYR A C   1 
ATOM   3736 O O   . TYR A 1 493 ? -19.320 -36.471 -10.363 1.00 35.78  ? 475  TYR A O   1 
ATOM   3737 C CB  . TYR A 1 493 ? -18.606 -38.492 -12.681 1.00 36.75  ? 475  TYR A CB  1 
ATOM   3738 C CG  . TYR A 1 493 ? -17.485 -39.473 -12.376 1.00 36.09  ? 475  TYR A CG  1 
ATOM   3739 C CD1 . TYR A 1 493 ? -17.672 -40.853 -12.550 1.00 35.83  ? 475  TYR A CD1 1 
ATOM   3740 C CD2 . TYR A 1 493 ? -16.234 -39.024 -11.944 1.00 33.82  ? 475  TYR A CD2 1 
ATOM   3741 C CE1 . TYR A 1 493 ? -16.633 -41.772 -12.283 1.00 35.79  ? 475  TYR A CE1 1 
ATOM   3742 C CE2 . TYR A 1 493 ? -15.190 -39.932 -11.661 1.00 33.55  ? 475  TYR A CE2 1 
ATOM   3743 C CZ  . TYR A 1 493 ? -15.403 -41.301 -11.851 1.00 35.89  ? 475  TYR A CZ  1 
ATOM   3744 O OH  . TYR A 1 493 ? -14.388 -42.193 -11.614 1.00 36.58  ? 475  TYR A OH  1 
ATOM   3745 N N   . LEU A 1 494 ? -18.845 -38.462 -9.402  1.00 54.10  ? 476  LEU A N   1 
ATOM   3746 C CA  . LEU A 1 494 ? -18.199 -37.892 -8.246  1.00 51.89  ? 476  LEU A CA  1 
ATOM   3747 C C   . LEU A 1 494 ? -16.687 -38.088 -8.411  1.00 48.11  ? 476  LEU A C   1 
ATOM   3748 O O   . LEU A 1 494 ? -16.179 -39.209 -8.285  1.00 48.81  ? 476  LEU A O   1 
ATOM   3749 C CB  . LEU A 1 494 ? -18.745 -38.501 -6.925  1.00 54.77  ? 476  LEU A CB  1 
ATOM   3750 C CG  . LEU A 1 494 ? -18.079 -38.196 -5.564  1.00 55.65  ? 476  LEU A CG  1 
ATOM   3751 C CD1 . LEU A 1 494 ? -17.741 -36.730 -5.348  1.00 50.98  ? 476  LEU A CD1 1 
ATOM   3752 C CD2 . LEU A 1 494 ? -18.934 -38.705 -4.385  1.00 60.32  ? 476  LEU A CD2 1 
ATOM   3753 N N   . PHE A 1 495 ? -15.986 -36.995 -8.714  1.00 44.72  ? 477  PHE A N   1 
ATOM   3754 C CA  . PHE A 1 495 ? -14.535 -37.033 -8.802  1.00 42.72  ? 477  PHE A CA  1 
ATOM   3755 C C   . PHE A 1 495 ? -13.988 -37.097 -7.401  1.00 42.95  ? 477  PHE A C   1 
ATOM   3756 O O   . PHE A 1 495 ? -14.281 -36.250 -6.574  1.00 43.31  ? 477  PHE A O   1 
ATOM   3757 C CB  . PHE A 1 495 ? -13.983 -35.835 -9.572  1.00 40.85  ? 477  PHE A CB  1 
ATOM   3758 C CG  . PHE A 1 495 ? -14.227 -35.910 -11.048 1.00 39.94  ? 477  PHE A CG  1 
ATOM   3759 C CD1 . PHE A 1 495 ? -13.414 -36.702 -11.874 1.00 37.56  ? 477  PHE A CD1 1 
ATOM   3760 C CD2 . PHE A 1 495 ? -15.259 -35.171 -11.635 1.00 39.24  ? 477  PHE A CD2 1 
ATOM   3761 C CE1 . PHE A 1 495 ? -13.637 -36.771 -13.244 1.00 37.57  ? 477  PHE A CE1 1 
ATOM   3762 C CE2 . PHE A 1 495 ? -15.497 -35.245 -13.026 1.00 39.09  ? 477  PHE A CE2 1 
ATOM   3763 C CZ  . PHE A 1 495 ? -14.693 -36.057 -13.827 1.00 39.07  ? 477  PHE A CZ  1 
ATOM   3764 N N   . ARG A 1 496 ? -13.199 -38.121 -7.127  1.00 44.28  ? 478  ARG A N   1 
ATOM   3765 C CA  . ARG A 1 496 ? -12.803 -38.399 -5.769  1.00 45.92  ? 478  ARG A CA  1 
ATOM   3766 C C   . ARG A 1 496 ? -11.282 -38.291 -5.590  1.00 45.17  ? 478  ARG A C   1 
ATOM   3767 O O   . ARG A 1 496 ? -10.499 -38.979 -6.263  1.00 47.43  ? 478  ARG A O   1 
ATOM   3768 C CB  . ARG A 1 496 ? -13.347 -39.768 -5.347  1.00 48.29  ? 478  ARG A CB  1 
ATOM   3769 C CG  . ARG A 1 496 ? -13.343 -39.984 -3.834  1.00 52.16  ? 478  ARG A CG  1 
ATOM   3770 C CD  . ARG A 1 496 ? -13.806 -41.394 -3.446  1.00 56.49  ? 478  ARG A CD  1 
ATOM   3771 N NE  . ARG A 1 496 ? -12.971 -42.488 -3.971  1.00 64.42  ? 478  ARG A NE  1 
ATOM   3772 C CZ  . ARG A 1 496 ? -11.766 -42.835 -3.489  1.00 66.59  ? 478  ARG A CZ  1 
ATOM   3773 N NH1 . ARG A 1 496 ? -11.200 -42.155 -2.479  1.00 62.14  ? 478  ARG A NH1 1 
ATOM   3774 N NH2 . ARG A 1 496 ? -11.114 -43.867 -4.036  1.00 70.15  ? 478  ARG A NH2 1 
ATOM   3775 N N   . ALA A 1 497 ? -10.877 -37.387 -4.708  1.00 44.13  ? 479  ALA A N   1 
ATOM   3776 C CA  . ALA A 1 497 ? -9.484  -37.218 -4.368  1.00 43.99  ? 479  ALA A CA  1 
ATOM   3777 C C   . ALA A 1 497 ? -9.138  -38.234 -3.307  1.00 44.76  ? 479  ALA A C   1 
ATOM   3778 O O   . ALA A 1 497 ? -9.990  -38.609 -2.491  1.00 44.00  ? 479  ALA A O   1 
ATOM   3779 C CB  . ALA A 1 497 ? -9.245  -35.826 -3.846  1.00 43.20  ? 479  ALA A CB  1 
ATOM   3780 N N   . ALA A 1 498 ? -7.893  -38.694 -3.334  1.00 46.77  ? 480  ALA A N   1 
ATOM   3781 C CA  . ALA A 1 498 ? -7.349  -39.506 -2.240  1.00 48.71  ? 480  ALA A CA  1 
ATOM   3782 C C   . ALA A 1 498 ? -7.432  -38.733 -0.899  1.00 46.78  ? 480  ALA A C   1 
ATOM   3783 O O   . ALA A 1 498 ? -7.145  -37.525 -0.857  1.00 45.44  ? 480  ALA A O   1 
ATOM   3784 C CB  . ALA A 1 498 ? -5.897  -39.897 -2.549  1.00 51.38  ? 480  ALA A CB  1 
ATOM   3785 N N   . HIS A 1 499 ? -7.876  -39.417 0.162   1.00 47.50  ? 481  HIS A N   1 
ATOM   3786 C CA  . HIS A 1 499 ? -7.844  -38.867 1.528   1.00 47.00  ? 481  HIS A CA  1 
ATOM   3787 C C   . HIS A 1 499 ? -6.426  -38.501 1.882   1.00 45.48  ? 481  HIS A C   1 
ATOM   3788 O O   . HIS A 1 499 ? -5.514  -39.333 1.765   1.00 47.01  ? 481  HIS A O   1 
ATOM   3789 C CB  . HIS A 1 499 ? -8.343  -39.884 2.572   1.00 50.19  ? 481  HIS A CB  1 
ATOM   3790 C CG  . HIS A 1 499 ? -9.823  -40.114 2.534   1.00 56.48  ? 481  HIS A CG  1 
ATOM   3791 N ND1 . HIS A 1 499 ? -10.393 -41.214 1.921   1.00 64.38  ? 481  HIS A ND1 1 
ATOM   3792 C CD2 . HIS A 1 499 ? -10.853 -39.377 3.020   1.00 60.01  ? 481  HIS A CD2 1 
ATOM   3793 C CE1 . HIS A 1 499 ? -11.710 -41.144 2.035   1.00 67.82  ? 481  HIS A CE1 1 
ATOM   3794 N NE2 . HIS A 1 499 ? -12.015 -40.040 2.700   1.00 65.70  ? 481  HIS A NE2 1 
ATOM   3795 N N   . VAL A 1 500 ? -6.247  -37.256 2.317   1.00 43.68  ? 482  VAL A N   1 
ATOM   3796 C CA  . VAL A 1 500 ? -4.950  -36.753 2.730   1.00 43.06  ? 482  VAL A CA  1 
ATOM   3797 C C   . VAL A 1 500 ? -4.775  -36.961 4.233   1.00 41.94  ? 482  VAL A C   1 
ATOM   3798 O O   . VAL A 1 500 ? -5.658  -36.613 5.028   1.00 41.33  ? 482  VAL A O   1 
ATOM   3799 C CB  . VAL A 1 500 ? -4.799  -35.272 2.398   1.00 43.95  ? 482  VAL A CB  1 
ATOM   3800 C CG1 . VAL A 1 500 ? -3.425  -34.766 2.832   1.00 45.28  ? 482  VAL A CG1 1 
ATOM   3801 C CG2 . VAL A 1 500 ? -5.031  -35.021 0.882   1.00 45.66  ? 482  VAL A CG2 1 
ATOM   3802 N N   . LEU A 1 501 ? -3.643  -37.557 4.597   1.00 41.43  ? 483  LEU A N   1 
ATOM   3803 C CA  . LEU A 1 501 ? -3.278  -37.789 5.994   1.00 40.15  ? 483  LEU A CA  1 
ATOM   3804 C C   . LEU A 1 501 ? -2.013  -37.007 6.339   1.00 39.23  ? 483  LEU A C   1 
ATOM   3805 O O   . LEU A 1 501 ? -1.118  -36.854 5.505   1.00 41.41  ? 483  LEU A O   1 
ATOM   3806 C CB  . LEU A 1 501 ? -3.033  -39.277 6.236   1.00 41.51  ? 483  LEU A CB  1 
ATOM   3807 C CG  . LEU A 1 501 ? -4.181  -40.270 6.053   1.00 44.18  ? 483  LEU A CG  1 
ATOM   3808 C CD1 . LEU A 1 501 ? -3.634  -41.646 6.378   1.00 46.38  ? 483  LEU A CD1 1 
ATOM   3809 C CD2 . LEU A 1 501 ? -5.373  -39.982 6.960   1.00 42.23  ? 483  LEU A CD2 1 
ATOM   3810 N N   . MET A 1 502 ? -1.939  -36.507 7.564   1.00 36.86  ? 484  MET A N   1 
ATOM   3811 C CA  . MET A 1 502 ? -0.735  -35.889 8.051   1.00 36.45  ? 484  MET A CA  1 
ATOM   3812 C C   . MET A 1 502 ? 0.214   -37.016 8.382   1.00 35.81  ? 484  MET A C   1 
ATOM   3813 O O   . MET A 1 502 ? -0.247  -38.116 8.674   1.00 35.69  ? 484  MET A O   1 
ATOM   3814 C CB  . MET A 1 502 ? -1.034  -35.047 9.292   1.00 35.60  ? 484  MET A CB  1 
ATOM   3815 C CG  . MET A 1 502 ? -1.850  -33.803 8.968   1.00 36.91  ? 484  MET A CG  1 
ATOM   3816 S SD  . MET A 1 502 ? -2.069  -32.789 10.402  1.00 42.32  ? 484  MET A SD  1 
ATOM   3817 C CE  . MET A 1 502 ? -0.415  -32.114 10.682  1.00 39.73  ? 484  MET A CE  1 
ATOM   3818 N N   . PRO A 1 503 ? 1.541   -36.754 8.335   1.00 36.56  ? 485  PRO A N   1 
ATOM   3819 C CA  . PRO A 1 503 ? 2.539   -37.734 8.758   1.00 37.69  ? 485  PRO A CA  1 
ATOM   3820 C C   . PRO A 1 503 ? 2.186   -38.554 10.030  1.00 36.98  ? 485  PRO A C   1 
ATOM   3821 O O   . PRO A 1 503 ? 2.345   -39.772 10.005  1.00 40.21  ? 485  PRO A O   1 
ATOM   3822 C CB  . PRO A 1 503 ? 3.791   -36.892 8.954   1.00 39.10  ? 485  PRO A CB  1 
ATOM   3823 C CG  . PRO A 1 503 ? 3.622   -35.739 8.022   1.00 39.68  ? 485  PRO A CG  1 
ATOM   3824 C CD  . PRO A 1 503 ? 2.166   -35.493 7.872   1.00 37.58  ? 485  PRO A CD  1 
ATOM   3825 N N   . HIS A 1 504 ? 1.665   -37.931 11.092  1.00 35.03  ? 486  HIS A N   1 
ATOM   3826 C CA  . HIS A 1 504 ? 1.262   -38.666 12.308  1.00 35.49  ? 486  HIS A CA  1 
ATOM   3827 C C   . HIS A 1 504 ? -0.012  -39.517 12.207  1.00 37.72  ? 486  HIS A C   1 
ATOM   3828 O O   . HIS A 1 504 ? -0.331  -40.254 13.135  1.00 40.09  ? 486  HIS A O   1 
ATOM   3829 C CB  . HIS A 1 504 ? 1.152   -37.743 13.517  1.00 33.51  ? 486  HIS A CB  1 
ATOM   3830 C CG  . HIS A 1 504 ? -0.046  -36.845 13.491  1.00 33.74  ? 486  HIS A CG  1 
ATOM   3831 N ND1 . HIS A 1 504 ? -1.225  -37.156 14.138  1.00 35.54  ? 486  HIS A ND1 1 
ATOM   3832 C CD2 . HIS A 1 504 ? -0.248  -35.644 12.907  1.00 31.50  ? 486  HIS A CD2 1 
ATOM   3833 C CE1 . HIS A 1 504 ? -2.104  -36.192 13.947  1.00 34.19  ? 486  HIS A CE1 1 
ATOM   3834 N NE2 . HIS A 1 504 ? -1.534  -35.260 13.206  1.00 35.08  ? 486  HIS A NE2 1 
ATOM   3835 N N   . GLU A 1 505 ? -0.713  -39.443 11.080  1.00 38.89  ? 487  GLU A N   1 
ATOM   3836 C CA  . GLU A 1 505 ? -1.989  -40.096 10.914  1.00 41.22  ? 487  GLU A CA  1 
ATOM   3837 C C   . GLU A 1 505 ? -1.833  -41.351 10.071  1.00 46.89  ? 487  GLU A C   1 
ATOM   3838 O O   . GLU A 1 505 ? -2.785  -42.090 9.877   1.00 50.11  ? 487  GLU A O   1 
ATOM   3839 C CB  . GLU A 1 505 ? -2.970  -39.133 10.234  1.00 39.38  ? 487  GLU A CB  1 
ATOM   3840 C CG  . GLU A 1 505 ? -3.425  -37.967 11.106  1.00 35.96  ? 487  GLU A CG  1 
ATOM   3841 C CD  . GLU A 1 505 ? -4.400  -37.040 10.403  1.00 37.16  ? 487  GLU A CD  1 
ATOM   3842 O OE1 . GLU A 1 505 ? -4.329  -36.872 9.175   1.00 35.45  ? 487  GLU A OE1 1 
ATOM   3843 O OE2 . GLU A 1 505 ? -5.241  -36.443 11.084  1.00 38.88  ? 487  GLU A OE2 1 
ATOM   3844 N N   . SER A 1 506 ? -0.628  -41.580 9.566   1.00 50.12  ? 488  SER A N   1 
ATOM   3845 C CA  . SER A 1 506 ? -0.409  -42.570 8.513   1.00 57.02  ? 488  SER A CA  1 
ATOM   3846 C C   . SER A 1 506 ? 0.184   -43.871 9.046   1.00 62.19  ? 488  SER A C   1 
ATOM   3847 O O   . SER A 1 506 ? 0.613   -43.911 10.199  1.00 62.86  ? 488  SER A O   1 
ATOM   3848 C CB  . SER A 1 506 ? 0.486   -41.961 7.419   1.00 57.66  ? 488  SER A CB  1 
ATOM   3849 O OG  . SER A 1 506 ? 1.747   -41.580 7.972   1.00 60.85  ? 488  SER A OG  1 
HETATM 3850 C C1  . GOL B 2 .   ? -14.476 -6.216  -29.662 1.00 43.12  ? 1489 GOL A C1  1 
HETATM 3851 O O1  . GOL B 2 .   ? -14.193 -7.313  -28.836 1.00 35.34  ? 1489 GOL A O1  1 
HETATM 3852 C C2  . GOL B 2 .   ? -13.644 -5.020  -29.187 1.00 47.97  ? 1489 GOL A C2  1 
HETATM 3853 O O2  . GOL B 2 .   ? -12.306 -5.395  -28.888 1.00 49.46  ? 1489 GOL A O2  1 
HETATM 3854 C C3  . GOL B 2 .   ? -13.665 -3.938  -30.261 1.00 49.91  ? 1489 GOL A C3  1 
HETATM 3855 O O3  . GOL B 2 .   ? -12.461 -3.976  -30.994 1.00 51.58  ? 1489 GOL A O3  1 
HETATM 3856 C C1  . GOL C 2 .   ? -20.008 -19.000 -38.196 1.00 54.91  ? 1490 GOL A C1  1 
HETATM 3857 O O1  . GOL C 2 .   ? -20.896 -20.067 -38.472 1.00 55.48  ? 1490 GOL A O1  1 
HETATM 3858 C C2  . GOL C 2 .   ? -20.771 -17.805 -37.623 1.00 55.13  ? 1490 GOL A C2  1 
HETATM 3859 O O2  . GOL C 2 .   ? -21.477 -18.140 -36.440 1.00 52.98  ? 1490 GOL A O2  1 
HETATM 3860 C C3  . GOL C 2 .   ? -19.853 -16.576 -37.500 1.00 54.33  ? 1490 GOL A C3  1 
HETATM 3861 O O3  . GOL C 2 .   ? -20.143 -15.783 -36.368 1.00 52.44  ? 1490 GOL A O3  1 
HETATM 3862 C C1  . GOL D 2 .   ? 2.436   -11.429 -23.634 1.00 67.19  ? 1491 GOL A C1  1 
HETATM 3863 O O1  . GOL D 2 .   ? 1.446   -10.513 -24.051 1.00 68.92  ? 1491 GOL A O1  1 
HETATM 3864 C C2  . GOL D 2 .   ? 1.980   -12.831 -23.967 1.00 66.65  ? 1491 GOL A C2  1 
HETATM 3865 O O2  . GOL D 2 .   ? 2.815   -13.688 -23.225 1.00 66.70  ? 1491 GOL A O2  1 
HETATM 3866 C C3  . GOL D 2 .   ? 0.536   -13.039 -23.497 1.00 68.72  ? 1491 GOL A C3  1 
HETATM 3867 O O3  . GOL D 2 .   ? -0.404  -12.306 -24.261 1.00 69.04  ? 1491 GOL A O3  1 
HETATM 3868 C C1  . GOL E 2 .   ? 8.837   -30.506 -20.738 1.00 55.16  ? 1492 GOL A C1  1 
HETATM 3869 O O1  . GOL E 2 .   ? 9.879   -31.210 -21.365 1.00 58.62  ? 1492 GOL A O1  1 
HETATM 3870 C C2  . GOL E 2 .   ? 7.469   -31.089 -21.067 1.00 54.56  ? 1492 GOL A C2  1 
HETATM 3871 O O2  . GOL E 2 .   ? 6.549   -30.311 -20.345 1.00 50.04  ? 1492 GOL A O2  1 
HETATM 3872 C C3  . GOL E 2 .   ? 7.086   -31.050 -22.556 1.00 56.24  ? 1492 GOL A C3  1 
HETATM 3873 O O3  . GOL E 2 .   ? 8.217   -31.200 -23.398 1.00 58.88  ? 1492 GOL A O3  1 
HETATM 3874 O O   . HOH F 3 .   ? -12.706 -3.688  -34.828 1.00 59.24  ? 2001 HOH A O   1 
HETATM 3875 O O   . HOH F 3 .   ? 0.539   -31.178 -33.703 1.00 47.81  ? 2002 HOH A O   1 
HETATM 3876 O O   . HOH F 3 .   ? 4.736   -32.124 -33.859 1.00 46.27  ? 2003 HOH A O   1 
HETATM 3877 O O   . HOH F 3 .   ? -3.167  -40.082 -28.833 1.00 42.70  ? 2004 HOH A O   1 
HETATM 3878 O O   . HOH F 3 .   ? -6.439  -30.371 -36.663 1.00 48.59  ? 2005 HOH A O   1 
HETATM 3879 O O   . HOH F 3 .   ? 10.651  0.259   -29.575 1.00 42.02  ? 2006 HOH A O   1 
HETATM 3880 O O   . HOH F 3 .   ? -12.158 -34.874 -35.326 1.00 35.58  ? 2007 HOH A O   1 
HETATM 3881 O O   . HOH F 3 .   ? -3.387  -36.876 -36.466 1.00 56.89  ? 2008 HOH A O   1 
HETATM 3882 O O   . HOH F 3 .   ? -17.921 -32.794 -2.920  1.00 53.92  ? 2009 HOH A O   1 
HETATM 3883 O O   . HOH F 3 .   ? -21.339 -39.734 -31.197 1.00 52.01  ? 2010 HOH A O   1 
HETATM 3884 O O   . HOH F 3 .   ? 7.235   -24.693 -38.054 1.00 47.36  ? 2011 HOH A O   1 
HETATM 3885 O O   . HOH F 3 .   ? 8.584   -6.979  -36.626 1.00 34.61  ? 2012 HOH A O   1 
HETATM 3886 O O   . HOH F 3 .   ? 9.916   -6.865  -38.990 1.00 53.28  ? 2013 HOH A O   1 
HETATM 3887 O O   . HOH F 3 .   ? 14.873  -5.536  -39.708 1.00 56.14  ? 2014 HOH A O   1 
HETATM 3888 O O   . HOH F 3 .   ? -14.419 -44.863 -13.416 1.00 57.37  ? 2015 HOH A O   1 
HETATM 3889 O O   . HOH F 3 .   ? 13.259  0.289   -28.465 1.00 44.91  ? 2016 HOH A O   1 
HETATM 3890 O O   . HOH F 3 .   ? 8.362   -26.546 -36.260 1.00 57.02  ? 2017 HOH A O   1 
HETATM 3891 O O   . HOH F 3 .   ? -16.228 -21.714 -41.750 1.00 50.97  ? 2018 HOH A O   1 
HETATM 3892 O O   . HOH F 3 .   ? -5.236  -36.795 -18.935 1.00 35.70  ? 2019 HOH A O   1 
HETATM 3893 O O   . HOH F 3 .   ? 19.409  -5.827  -12.120 1.00 46.92  ? 2020 HOH A O   1 
HETATM 3894 O O   . HOH F 3 .   ? 20.896  -5.098  -13.700 1.00 37.13  ? 2021 HOH A O   1 
HETATM 3895 O O   . HOH F 3 .   ? -6.864  -38.690 -9.748  1.00 33.07  ? 2022 HOH A O   1 
HETATM 3896 O O   . HOH F 3 .   ? -5.740  -37.535 -5.373  1.00 37.94  ? 2023 HOH A O   1 
HETATM 3897 O O   . HOH F 3 .   ? -11.109 -33.516 -1.546  1.00 37.39  ? 2024 HOH A O   1 
HETATM 3898 O O   . HOH F 3 .   ? -18.227 -31.013 -4.765  1.00 46.19  ? 2025 HOH A O   1 
HETATM 3899 O O   . HOH F 3 .   ? -23.667 -31.601 -14.072 1.00 40.41  ? 2026 HOH A O   1 
HETATM 3900 O O   . HOH F 3 .   ? -27.730 -24.006 -14.368 1.00 52.59  ? 2027 HOH A O   1 
HETATM 3901 O O   . HOH F 3 .   ? -8.020  -15.519 -21.969 1.00 33.41  ? 2028 HOH A O   1 
HETATM 3902 O O   . HOH F 3 .   ? -5.266  -17.322 -22.477 1.00 45.09  ? 2029 HOH A O   1 
HETATM 3903 O O   . HOH F 3 .   ? 1.619   -24.758 -28.851 1.00 27.71  ? 2030 HOH A O   1 
HETATM 3904 O O   . HOH F 3 .   ? 1.891   -15.777 -15.462 1.00 53.43  ? 2031 HOH A O   1 
HETATM 3905 O O   . HOH F 3 .   ? -8.262  -28.848 -23.893 1.00 26.41  ? 2032 HOH A O   1 
HETATM 3906 O O   . HOH F 3 .   ? 6.387   -30.206 -28.826 1.00 40.23  ? 2033 HOH A O   1 
HETATM 3907 O O   . HOH F 3 .   ? 5.606   -22.543 -37.564 1.00 39.99  ? 2034 HOH A O   1 
HETATM 3908 O O   . HOH F 3 .   ? 5.137   -31.340 -36.042 1.00 40.24  ? 2035 HOH A O   1 
HETATM 3909 O O   . HOH F 3 .   ? 2.939   -28.580 -39.965 1.00 52.33  ? 2036 HOH A O   1 
HETATM 3910 O O   . HOH F 3 .   ? 3.593   -18.913 -29.089 1.00 29.03  ? 2037 HOH A O   1 
HETATM 3911 O O   . HOH F 3 .   ? 11.920  -21.397 -35.489 1.00 35.44  ? 2038 HOH A O   1 
HETATM 3912 O O   . HOH F 3 .   ? 6.407   -20.519 -38.851 1.00 51.59  ? 2039 HOH A O   1 
HETATM 3913 O O   . HOH F 3 .   ? 2.544   -3.803  -27.119 1.00 45.76  ? 2040 HOH A O   1 
HETATM 3914 O O   . HOH F 3 .   ? 7.436   -9.544  -36.195 1.00 31.32  ? 2041 HOH A O   1 
HETATM 3915 O O   . HOH F 3 .   ? 13.008  -7.629  -38.532 1.00 48.04  ? 2042 HOH A O   1 
HETATM 3916 O O   . HOH F 3 .   ? 9.144   -4.611  -29.006 1.00 27.19  ? 2043 HOH A O   1 
HETATM 3917 O O   . HOH F 3 .   ? 4.988   -17.303 -41.483 1.00 50.40  ? 2044 HOH A O   1 
HETATM 3918 O O   . HOH F 3 .   ? -2.013  -28.885 -41.933 1.00 54.36  ? 2045 HOH A O   1 
HETATM 3919 O O   . HOH F 3 .   ? 8.738   -4.277  -36.084 1.00 33.42  ? 2046 HOH A O   1 
HETATM 3920 O O   . HOH F 3 .   ? 10.919  -0.380  -36.234 1.00 50.23  ? 2047 HOH A O   1 
HETATM 3921 O O   . HOH F 3 .   ? -9.123  -29.878 -28.767 1.00 51.98  ? 2048 HOH A O   1 
HETATM 3922 O O   . HOH F 3 .   ? 17.584  -2.001  -29.719 1.00 35.82  ? 2049 HOH A O   1 
HETATM 3923 O O   . HOH F 3 .   ? 14.764  0.689   -30.426 1.00 30.77  ? 2050 HOH A O   1 
HETATM 3924 O O   . HOH F 3 .   ? 22.848  -4.508  -32.572 1.00 34.60  ? 2051 HOH A O   1 
HETATM 3925 O O   . HOH F 3 .   ? 19.548  -4.537  -36.558 1.00 52.59  ? 2052 HOH A O   1 
HETATM 3926 O O   . HOH F 3 .   ? 23.491  -6.473  -37.202 1.00 44.09  ? 2053 HOH A O   1 
HETATM 3927 O O   . HOH F 3 .   ? -8.805  -6.090  -23.915 1.00 36.70  ? 2054 HOH A O   1 
HETATM 3928 O O   . HOH F 3 .   ? -6.049  -8.298  -22.247 1.00 39.84  ? 2055 HOH A O   1 
HETATM 3929 O O   . HOH F 3 .   ? 12.292  -24.697 -35.291 1.00 41.94  ? 2056 HOH A O   1 
HETATM 3930 O O   . HOH F 3 .   ? 7.650   -26.135 -27.376 1.00 30.36  ? 2057 HOH A O   1 
HETATM 3931 O O   . HOH F 3 .   ? 10.361  -26.173 -34.120 1.00 39.71  ? 2058 HOH A O   1 
HETATM 3932 O O   . HOH F 3 .   ? 11.437  -27.648 -32.693 1.00 49.32  ? 2059 HOH A O   1 
HETATM 3933 O O   . HOH F 3 .   ? -13.777 -21.893 -40.678 1.00 42.43  ? 2060 HOH A O   1 
HETATM 3934 O O   . HOH F 3 .   ? -18.639 -22.985 -40.269 1.00 40.85  ? 2061 HOH A O   1 
HETATM 3935 O O   . HOH F 3 .   ? -23.692 -29.064 -42.952 1.00 62.42  ? 2062 HOH A O   1 
HETATM 3936 O O   . HOH F 3 .   ? -16.320 -36.746 -34.665 1.00 54.17  ? 2063 HOH A O   1 
HETATM 3937 O O   . HOH F 3 .   ? 13.151  -29.316 -21.500 1.00 27.17  ? 2064 HOH A O   1 
HETATM 3938 O O   . HOH F 3 .   ? 7.889   -27.891 -23.011 1.00 39.15  ? 2065 HOH A O   1 
HETATM 3939 O O   . HOH F 3 .   ? -28.821 -32.073 -33.451 1.00 51.23  ? 2066 HOH A O   1 
HETATM 3940 O O   . HOH F 3 .   ? -25.106 -42.330 -33.996 1.00 35.78  ? 2067 HOH A O   1 
HETATM 3941 O O   . HOH F 3 .   ? 9.670   -21.697 -18.884 1.00 32.23  ? 2068 HOH A O   1 
HETATM 3942 O O   . HOH F 3 .   ? 6.803   -22.554 -12.176 1.00 31.91  ? 2069 HOH A O   1 
HETATM 3943 O O   . HOH F 3 .   ? 10.646  -23.779 -11.773 1.00 24.57  ? 2070 HOH A O   1 
HETATM 3944 O O   . HOH F 3 .   ? -5.049  -7.387  -19.360 1.00 63.01  ? 2071 HOH A O   1 
HETATM 3945 O O   . HOH F 3 .   ? 17.855  -7.661  -11.513 1.00 54.09  ? 2072 HOH A O   1 
HETATM 3946 O O   . HOH F 3 .   ? 21.078  -7.773  -14.843 1.00 28.54  ? 2073 HOH A O   1 
HETATM 3947 O O   . HOH F 3 .   ? 20.110  -17.928 -20.015 1.00 23.16  ? 2074 HOH A O   1 
HETATM 3948 O O   . HOH F 3 .   ? -14.153 2.572   -17.858 1.00 45.87  ? 2075 HOH A O   1 
HETATM 3949 O O   . HOH F 3 .   ? 11.135  -30.903 -3.298  1.00 48.80  ? 2076 HOH A O   1 
HETATM 3950 O O   . HOH F 3 .   ? 7.654   -27.869 -4.953  1.00 30.40  ? 2077 HOH A O   1 
HETATM 3951 O O   . HOH F 3 .   ? 19.405  -20.628 -19.840 1.00 28.22  ? 2078 HOH A O   1 
HETATM 3952 O O   . HOH F 3 .   ? 25.500  -21.122 -23.519 1.00 30.40  ? 2079 HOH A O   1 
HETATM 3953 O O   . HOH F 3 .   ? 26.592  -19.359 -21.882 1.00 57.81  ? 2080 HOH A O   1 
HETATM 3954 O O   . HOH F 3 .   ? 25.815  -27.986 -20.234 1.00 31.21  ? 2081 HOH A O   1 
HETATM 3955 O O   . HOH F 3 .   ? 21.898  -27.193 -13.114 1.00 32.83  ? 2082 HOH A O   1 
HETATM 3956 O O   . HOH F 3 .   ? 21.336  -14.831 -5.693  1.00 49.08  ? 2083 HOH A O   1 
HETATM 3957 O O   . HOH F 3 .   ? 18.890  -15.636 -4.703  1.00 45.06  ? 2084 HOH A O   1 
HETATM 3958 O O   . HOH F 3 .   ? 11.105  -18.792 -3.621  1.00 38.98  ? 2085 HOH A O   1 
HETATM 3959 O O   . HOH F 3 .   ? 16.663  -14.710 -3.726  1.00 36.91  ? 2086 HOH A O   1 
HETATM 3960 O O   . HOH F 3 .   ? 7.239   -17.553 -1.630  1.00 52.53  ? 2087 HOH A O   1 
HETATM 3961 O O   . HOH F 3 .   ? 10.242  -7.447  -5.679  1.00 53.34  ? 2088 HOH A O   1 
HETATM 3962 O O   . HOH F 3 .   ? 8.103   -10.767 -12.145 1.00 48.56  ? 2089 HOH A O   1 
HETATM 3963 O O   . HOH F 3 .   ? 3.783   -13.542 -19.113 1.00 51.16  ? 2090 HOH A O   1 
HETATM 3964 O O   . HOH F 3 .   ? 6.546   -13.556 -12.278 1.00 30.70  ? 2091 HOH A O   1 
HETATM 3965 O O   . HOH F 3 .   ? 4.916   -14.105 -13.890 1.00 47.75  ? 2092 HOH A O   1 
HETATM 3966 O O   . HOH F 3 .   ? 7.012   -21.323 -20.545 1.00 33.92  ? 2093 HOH A O   1 
HETATM 3967 O O   . HOH F 3 .   ? 3.131   -20.963 -27.261 1.00 22.32  ? 2094 HOH A O   1 
HETATM 3968 O O   . HOH F 3 .   ? -1.277  -29.113 -2.135  1.00 44.62  ? 2095 HOH A O   1 
HETATM 3969 O O   . HOH F 3 .   ? 7.118   -15.980 -25.403 1.00 34.15  ? 2096 HOH A O   1 
HETATM 3970 O O   . HOH F 3 .   ? 4.188   -15.531 -17.281 1.00 42.99  ? 2097 HOH A O   1 
HETATM 3971 O O   . HOH F 3 .   ? 18.927  -21.530 -31.993 1.00 33.73  ? 2098 HOH A O   1 
HETATM 3972 O O   . HOH F 3 .   ? 18.991  -25.376 -29.068 1.00 33.15  ? 2099 HOH A O   1 
HETATM 3973 O O   . HOH F 3 .   ? -10.723 -40.600 -11.656 1.00 52.76  ? 2100 HOH A O   1 
HETATM 3974 O O   . HOH F 3 .   ? 22.445  -18.810 -29.295 1.00 25.17  ? 2101 HOH A O   1 
HETATM 3975 O O   . HOH F 3 .   ? 26.627  -18.758 -30.271 1.00 47.03  ? 2102 HOH A O   1 
HETATM 3976 O O   . HOH F 3 .   ? 31.594  -13.166 -25.375 1.00 49.22  ? 2103 HOH A O   1 
HETATM 3977 O O   . HOH F 3 .   ? 33.396  -5.988  -26.381 1.00 42.99  ? 2104 HOH A O   1 
HETATM 3978 O O   . HOH F 3 .   ? 28.003  -5.054  -32.493 1.00 47.27  ? 2105 HOH A O   1 
HETATM 3979 O O   . HOH F 3 .   ? 34.330  -12.152 -22.343 1.00 52.35  ? 2106 HOH A O   1 
HETATM 3980 O O   . HOH F 3 .   ? 25.877  -14.326 -14.839 1.00 35.70  ? 2107 HOH A O   1 
HETATM 3981 O O   . HOH F 3 .   ? 28.034  -7.167  -14.061 1.00 39.24  ? 2108 HOH A O   1 
HETATM 3982 O O   . HOH F 3 .   ? 25.848  -3.275  -29.036 1.00 36.22  ? 2109 HOH A O   1 
HETATM 3983 O O   . HOH F 3 .   ? 19.948  -3.083  -15.163 1.00 34.81  ? 2110 HOH A O   1 
HETATM 3984 O O   . HOH F 3 .   ? 21.271  -2.159  -19.762 1.00 38.58  ? 2111 HOH A O   1 
HETATM 3985 O O   . HOH F 3 .   ? 12.720  -4.316  -16.717 1.00 51.68  ? 2112 HOH A O   1 
HETATM 3986 O O   . HOH F 3 .   ? 11.109  -4.977  -27.835 1.00 31.70  ? 2113 HOH A O   1 
HETATM 3987 O O   . HOH F 3 .   ? 9.305   -1.556  -21.259 1.00 53.71  ? 2114 HOH A O   1 
HETATM 3988 O O   . HOH F 3 .   ? 5.492   -4.072  -26.424 1.00 42.81  ? 2115 HOH A O   1 
HETATM 3989 O O   . HOH F 3 .   ? 4.424   -0.678  -32.922 1.00 45.95  ? 2116 HOH A O   1 
HETATM 3990 O O   . HOH F 3 .   ? -1.036  -10.703 -33.161 1.00 46.01  ? 2117 HOH A O   1 
HETATM 3991 O O   . HOH F 3 .   ? 3.912   -16.526 -27.674 1.00 35.69  ? 2118 HOH A O   1 
HETATM 3992 O O   . HOH F 3 .   ? -2.148  -10.014 -36.191 1.00 34.92  ? 2119 HOH A O   1 
HETATM 3993 O O   . HOH F 3 .   ? 4.780   -9.643  -36.405 1.00 40.70  ? 2120 HOH A O   1 
HETATM 3994 O O   . HOH F 3 .   ? -3.796  -15.169 -28.677 1.00 41.96  ? 2121 HOH A O   1 
HETATM 3995 O O   . HOH F 3 .   ? 0.213   -18.428 -41.799 1.00 36.54  ? 2122 HOH A O   1 
HETATM 3996 O O   . HOH F 3 .   ? 2.996   -16.308 -44.188 1.00 51.79  ? 2123 HOH A O   1 
HETATM 3997 O O   . HOH F 3 .   ? -2.853  -20.964 -46.223 1.00 45.62  ? 2124 HOH A O   1 
HETATM 3998 O O   . HOH F 3 .   ? 0.860   -20.583 -43.146 1.00 40.68  ? 2125 HOH A O   1 
HETATM 3999 O O   . HOH F 3 .   ? -2.278  -26.224 -43.683 1.00 49.07  ? 2126 HOH A O   1 
HETATM 4000 O O   . HOH F 3 .   ? -7.241  -20.872 -42.143 1.00 39.55  ? 2127 HOH A O   1 
HETATM 4001 O O   . HOH F 3 .   ? -9.327  -22.159 -42.552 1.00 47.88  ? 2128 HOH A O   1 
HETATM 4002 O O   . HOH F 3 .   ? 0.974   -28.433 -37.896 1.00 37.12  ? 2129 HOH A O   1 
HETATM 4003 O O   . HOH F 3 .   ? 2.696   -18.826 -40.934 1.00 38.96  ? 2130 HOH A O   1 
HETATM 4004 O O   . HOH F 3 .   ? -8.287  -27.079 -30.263 1.00 28.01  ? 2131 HOH A O   1 
HETATM 4005 O O   . HOH F 3 .   ? -10.832 -33.235 -37.457 1.00 57.25  ? 2132 HOH A O   1 
HETATM 4006 O O   . HOH F 3 .   ? -10.008 -36.139 -28.560 1.00 46.32  ? 2133 HOH A O   1 
HETATM 4007 O O   . HOH F 3 .   ? -12.872 -28.710 -32.427 1.00 29.18  ? 2134 HOH A O   1 
HETATM 4008 O O   . HOH F 3 .   ? -23.207 -26.439 -25.894 1.00 34.11  ? 2135 HOH A O   1 
HETATM 4009 O O   . HOH F 3 .   ? -27.182 -36.694 -24.434 1.00 59.07  ? 2136 HOH A O   1 
HETATM 4010 O O   . HOH F 3 .   ? -8.768  -16.957 -24.390 1.00 28.04  ? 2137 HOH A O   1 
HETATM 4011 O O   . HOH F 3 .   ? -8.310  -8.850  -22.688 1.00 33.68  ? 2138 HOH A O   1 
HETATM 4012 O O   . HOH F 3 .   ? -5.867  -15.035 -21.142 1.00 50.81  ? 2139 HOH A O   1 
HETATM 4013 O O   . HOH F 3 .   ? -8.195  -9.706  -33.722 1.00 40.74  ? 2140 HOH A O   1 
HETATM 4014 O O   . HOH F 3 .   ? -20.501 -12.866 -35.717 1.00 44.03  ? 2141 HOH A O   1 
HETATM 4015 O O   . HOH F 3 .   ? -13.929 -12.316 -37.487 1.00 42.35  ? 2142 HOH A O   1 
HETATM 4016 O O   . HOH F 3 .   ? -2.630  -16.435 -32.222 1.00 32.25  ? 2143 HOH A O   1 
HETATM 4017 O O   . HOH F 3 .   ? -16.288 -11.512 -36.997 1.00 41.47  ? 2144 HOH A O   1 
HETATM 4018 O O   . HOH F 3 .   ? -12.588 -19.336 -39.249 1.00 26.71  ? 2145 HOH A O   1 
HETATM 4019 O O   . HOH F 3 .   ? -18.311 -23.286 -37.637 1.00 27.54  ? 2146 HOH A O   1 
HETATM 4020 O O   . HOH F 3 .   ? -16.950 -16.210 -39.089 1.00 53.65  ? 2147 HOH A O   1 
HETATM 4021 O O   . HOH F 3 .   ? -7.457  -29.484 -38.885 1.00 47.77  ? 2148 HOH A O   1 
HETATM 4022 O O   . HOH F 3 .   ? -16.982 -28.833 -43.313 1.00 54.50  ? 2149 HOH A O   1 
HETATM 4023 O O   . HOH F 3 .   ? -19.365 -25.727 -41.509 1.00 40.83  ? 2150 HOH A O   1 
HETATM 4024 O O   . HOH F 3 .   ? -14.242 -30.465 -40.908 1.00 47.45  ? 2151 HOH A O   1 
HETATM 4025 O O   . HOH F 3 .   ? -21.288 -27.123 -42.516 1.00 47.17  ? 2152 HOH A O   1 
HETATM 4026 O O   . HOH F 3 .   ? -22.215 -34.313 -43.486 1.00 43.20  ? 2153 HOH A O   1 
HETATM 4027 O O   . HOH F 3 .   ? -16.138 -35.471 -36.925 1.00 47.33  ? 2154 HOH A O   1 
HETATM 4028 O O   . HOH F 3 .   ? -20.155 -28.296 -35.383 1.00 25.63  ? 2155 HOH A O   1 
HETATM 4029 O O   . HOH F 3 .   ? -26.665 -34.042 -32.356 1.00 50.14  ? 2156 HOH A O   1 
HETATM 4030 O O   . HOH F 3 .   ? -23.729 -39.806 -35.037 1.00 33.30  ? 2157 HOH A O   1 
HETATM 4031 O O   . HOH F 3 .   ? -22.433 -35.682 -40.790 1.00 36.72  ? 2158 HOH A O   1 
HETATM 4032 O O   . HOH F 3 .   ? -28.311 -29.804 -35.014 1.00 32.88  ? 2159 HOH A O   1 
HETATM 4033 O O   . HOH F 3 .   ? -25.858 -28.825 -41.717 1.00 32.43  ? 2160 HOH A O   1 
HETATM 4034 O O   . HOH F 3 .   ? -26.824 -26.088 -40.877 1.00 44.34  ? 2161 HOH A O   1 
HETATM 4035 O O   . HOH F 3 .   ? -28.152 -29.827 -31.254 1.00 44.59  ? 2162 HOH A O   1 
HETATM 4036 O O   . HOH F 3 .   ? -25.567 -26.881 -27.142 1.00 34.52  ? 2163 HOH A O   1 
HETATM 4037 O O   . HOH F 3 .   ? -19.654 -21.566 -36.183 1.00 26.41  ? 2164 HOH A O   1 
HETATM 4038 O O   . HOH F 3 .   ? -24.991 -17.017 -34.695 1.00 49.78  ? 2165 HOH A O   1 
HETATM 4039 O O   . HOH F 3 .   ? -26.190 -18.637 -32.850 1.00 43.11  ? 2166 HOH A O   1 
HETATM 4040 O O   . HOH F 3 .   ? -22.216 -27.235 -34.958 1.00 19.96  ? 2167 HOH A O   1 
HETATM 4041 O O   . HOH F 3 .   ? -27.701 -20.074 -26.441 1.00 57.66  ? 2168 HOH A O   1 
HETATM 4042 O O   . HOH F 3 .   ? -9.124  -7.785  -26.191 1.00 37.27  ? 2169 HOH A O   1 
HETATM 4043 O O   . HOH F 3 .   ? -12.075 -4.955  -21.970 1.00 35.62  ? 2170 HOH A O   1 
HETATM 4044 O O   . HOH F 3 .   ? -12.381 -7.017  -17.374 1.00 31.01  ? 2171 HOH A O   1 
HETATM 4045 O O   . HOH F 3 .   ? -5.287  -7.653  -16.213 1.00 48.76  ? 2172 HOH A O   1 
HETATM 4046 O O   . HOH F 3 .   ? -15.193 -1.691  -12.355 1.00 51.49  ? 2173 HOH A O   1 
HETATM 4047 O O   . HOH F 3 .   ? -17.285 -4.942  -13.396 1.00 43.34  ? 2174 HOH A O   1 
HETATM 4048 O O   . HOH F 3 .   ? -14.726 -2.789  -20.305 1.00 50.08  ? 2175 HOH A O   1 
HETATM 4049 O O   . HOH F 3 .   ? -13.633 -0.072  -16.900 1.00 39.21  ? 2176 HOH A O   1 
HETATM 4050 O O   . HOH F 3 .   ? -22.365 -1.760  -18.299 1.00 44.70  ? 2177 HOH A O   1 
HETATM 4051 O O   . HOH F 3 .   ? -19.886 -3.156  -15.170 1.00 40.02  ? 2178 HOH A O   1 
HETATM 4052 O O   . HOH F 3 .   ? -16.806 2.348   -27.228 1.00 35.91  ? 2179 HOH A O   1 
HETATM 4053 O O   . HOH F 3 .   ? -24.068 -8.139  -28.613 1.00 33.88  ? 2180 HOH A O   1 
HETATM 4054 O O   . HOH F 3 .   ? -24.981 -6.810  -32.746 1.00 42.00  ? 2181 HOH A O   1 
HETATM 4055 O O   . HOH F 3 .   ? -13.237 -7.236  -32.513 1.00 37.89  ? 2182 HOH A O   1 
HETATM 4056 O O   . HOH F 3 .   ? -19.418 1.621   -36.710 1.00 54.37  ? 2183 HOH A O   1 
HETATM 4057 O O   . HOH F 3 .   ? -18.912 0.045   -39.143 1.00 58.41  ? 2184 HOH A O   1 
HETATM 4058 O O   . HOH F 3 .   ? -20.659 0.737   -32.232 1.00 32.13  ? 2185 HOH A O   1 
HETATM 4059 O O   . HOH F 3 .   ? -24.011 1.801   -30.762 1.00 38.43  ? 2186 HOH A O   1 
HETATM 4060 O O   . HOH F 3 .   ? -21.019 -1.494  -24.868 1.00 27.87  ? 2187 HOH A O   1 
HETATM 4061 O O   . HOH F 3 .   ? -24.045 -13.913 -31.243 1.00 45.00  ? 2188 HOH A O   1 
HETATM 4062 O O   . HOH F 3 .   ? -23.807 -13.533 -23.961 1.00 40.80  ? 2189 HOH A O   1 
HETATM 4063 O O   . HOH F 3 .   ? -24.901 -15.153 -26.806 1.00 43.00  ? 2190 HOH A O   1 
HETATM 4064 O O   . HOH F 3 .   ? -14.374 -4.054  -23.039 1.00 38.54  ? 2191 HOH A O   1 
HETATM 4065 O O   . HOH F 3 .   ? -20.900 -12.941 -7.403  1.00 58.24  ? 2192 HOH A O   1 
HETATM 4066 O O   . HOH F 3 .   ? -29.922 -12.879 -15.717 1.00 50.67  ? 2193 HOH A O   1 
HETATM 4067 O O   . HOH F 3 .   ? -7.661  -19.775 -17.993 1.00 27.16  ? 2194 HOH A O   1 
HETATM 4068 O O   . HOH F 3 .   ? -0.830  -21.051 -20.183 1.00 35.00  ? 2195 HOH A O   1 
HETATM 4069 O O   . HOH F 3 .   ? -3.204  -18.078 -20.061 1.00 48.33  ? 2196 HOH A O   1 
HETATM 4070 O O   . HOH F 3 .   ? -0.340  -21.124 -17.536 1.00 55.40  ? 2197 HOH A O   1 
HETATM 4071 O O   . HOH F 3 .   ? -18.126 -28.083 -6.320  1.00 46.67  ? 2198 HOH A O   1 
HETATM 4072 O O   . HOH F 3 .   ? -1.613  -25.536 -17.958 1.00 27.50  ? 2199 HOH A O   1 
HETATM 4073 O O   . HOH F 3 .   ? 9.200   -36.440 -24.160 1.00 50.52  ? 2200 HOH A O   1 
HETATM 4074 O O   . HOH F 3 .   ? 15.852  -39.575 1.248   1.00 53.60  ? 2201 HOH A O   1 
HETATM 4075 O O   . HOH F 3 .   ? 18.611  -41.237 9.078   1.00 39.24  ? 2202 HOH A O   1 
HETATM 4076 O O   . HOH F 3 .   ? 23.832  -40.279 13.109  1.00 53.83  ? 2203 HOH A O   1 
HETATM 4077 O O   . HOH F 3 .   ? 27.279  -40.253 9.992   1.00 61.26  ? 2204 HOH A O   1 
HETATM 4078 O O   . HOH F 3 .   ? 16.156  -36.639 -7.016  1.00 38.48  ? 2205 HOH A O   1 
HETATM 4079 O O   . HOH F 3 .   ? 18.637  -39.621 -20.146 1.00 47.74  ? 2206 HOH A O   1 
HETATM 4080 O O   . HOH F 3 .   ? 19.061  -32.630 -13.390 1.00 44.90  ? 2207 HOH A O   1 
HETATM 4081 O O   . HOH F 3 .   ? 15.005  -31.583 -14.485 1.00 41.04  ? 2208 HOH A O   1 
HETATM 4082 O O   . HOH F 3 .   ? 12.596  -34.236 -14.688 1.00 41.81  ? 2209 HOH A O   1 
HETATM 4083 O O   . HOH F 3 .   ? 17.383  -33.931 -22.885 1.00 35.84  ? 2210 HOH A O   1 
HETATM 4084 O O   . HOH F 3 .   ? 17.097  -30.745 -16.399 1.00 36.53  ? 2211 HOH A O   1 
HETATM 4085 O O   . HOH F 3 .   ? 8.255   -26.556 -14.108 1.00 24.51  ? 2212 HOH A O   1 
HETATM 4086 O O   . HOH F 3 .   ? 5.332   -33.873 -9.130  1.00 26.71  ? 2213 HOH A O   1 
HETATM 4087 O O   . HOH F 3 .   ? 16.003  -33.515 -7.531  1.00 35.96  ? 2214 HOH A O   1 
HETATM 4088 O O   . HOH F 3 .   ? 8.501   -37.076 -5.395  1.00 44.63  ? 2215 HOH A O   1 
HETATM 4089 O O   . HOH F 3 .   ? 16.459  -37.487 -4.341  1.00 47.84  ? 2216 HOH A O   1 
HETATM 4090 O O   . HOH F 3 .   ? 8.991   -32.529 -3.473  1.00 37.27  ? 2217 HOH A O   1 
HETATM 4091 O O   . HOH F 3 .   ? 8.295   -25.057 -11.751 1.00 25.86  ? 2218 HOH A O   1 
HETATM 4092 O O   . HOH F 3 .   ? 0.925   -27.983 -3.294  1.00 45.22  ? 2219 HOH A O   1 
HETATM 4093 O O   . HOH F 3 .   ? 4.616   -21.236 -11.603 1.00 38.57  ? 2220 HOH A O   1 
HETATM 4094 O O   . HOH F 3 .   ? -11.511 -26.610 -3.521  1.00 44.89  ? 2221 HOH A O   1 
HETATM 4095 O O   . HOH F 3 .   ? -10.917 -24.326 -6.358  1.00 47.73  ? 2222 HOH A O   1 
HETATM 4096 O O   . HOH F 3 .   ? -5.446  -29.717 -24.490 1.00 37.94  ? 2223 HOH A O   1 
HETATM 4097 O O   . HOH F 3 .   ? -6.870  -31.167 -27.119 1.00 57.47  ? 2224 HOH A O   1 
HETATM 4098 O O   . HOH F 3 .   ? -7.102  -36.492 -25.138 1.00 53.37  ? 2225 HOH A O   1 
HETATM 4099 O O   . HOH F 3 .   ? -10.004 -37.797 -26.429 1.00 45.40  ? 2226 HOH A O   1 
HETATM 4100 O O   . HOH F 3 .   ? -10.689 -42.057 -13.984 1.00 49.17  ? 2227 HOH A O   1 
HETATM 4101 O O   . HOH F 3 .   ? -21.698 -35.961 -8.516  1.00 35.28  ? 2228 HOH A O   1 
HETATM 4102 O O   . HOH F 3 .   ? -25.595 -36.589 -15.837 1.00 61.40  ? 2229 HOH A O   1 
HETATM 4103 O O   . HOH F 3 .   ? -12.104 -40.285 -9.363  1.00 43.48  ? 2230 HOH A O   1 
HETATM 4104 O O   . HOH F 3 .   ? -8.832  -35.273 2.546   1.00 46.69  ? 2231 HOH A O   1 
HETATM 4105 O O   . HOH F 3 .   ? -4.941  -36.342 13.707  1.00 36.12  ? 2232 HOH A O   1 
HETATM 4106 O O   . HOH F 3 .   ? -12.991 -1.418  -32.346 1.00 38.75  ? 2233 HOH A O   1 
HETATM 4107 O O   . HOH F 3 .   ? 1.605   -15.160 -21.277 1.00 37.09  ? 2234 HOH A O   1 
HETATM 4108 O O   . HOH F 3 .   ? 6.519   -27.606 -20.562 1.00 26.35  ? 2235 HOH A O   1 
HETATM 4109 O O   . HOH F 3 .   ? 11.428  -30.092 -23.474 1.00 44.66  ? 2236 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . THR A 21  ? 1.0939 0.9625 1.3645 0.1715  0.4587  -0.0395 3   THR A N   
2    C CA  . THR A 21  ? 1.0609 0.8934 1.1793 0.1418  0.3770  -0.0350 3   THR A CA  
3    C C   . THR A 21  ? 0.9425 0.9224 1.0564 0.1341  0.2968  -0.0071 3   THR A C   
4    O O   . THR A 21  ? 0.8616 0.9906 1.0975 0.1624  0.2574  0.0510  3   THR A O   
5    C CB  . THR A 21  ? 1.0753 0.8708 1.2250 0.1674  0.3565  0.0074  3   THR A CB  
6    O OG1 . THR A 21  ? 1.1975 0.8580 1.3752 0.1742  0.4502  -0.0181 3   THR A OG1 
7    C CG2 . THR A 21  ? 1.0662 0.8015 1.0585 0.1277  0.2897  -0.0020 3   THR A CG2 
8    N N   . SER A 22  ? 0.9445 0.8748 0.9121 0.0894  0.2776  -0.0468 4   SER A N   
9    C CA  . SER A 22  ? 0.8596 0.8911 0.8031 0.0727  0.2208  -0.0321 4   SER A CA  
10   C C   . SER A 22  ? 0.8136 0.8628 0.7455 0.0793  0.1553  0.0093  4   SER A C   
11   O O   . SER A 22  ? 0.8471 0.8079 0.7519 0.0872  0.1486  0.0166  4   SER A O   
12   C CB  . SER A 22  ? 0.8974 0.8495 0.7000 0.0290  0.2324  -0.0807 4   SER A CB  
13   O OG  . SER A 22  ? 0.8903 0.7764 0.5940 0.0131  0.1842  -0.0716 4   SER A OG  
14   N N   . TRP A 23  ? 0.7428 0.9008 0.6889 0.0665  0.1154  0.0302  5   TRP A N   
15   C CA  . TRP A 23  ? 0.7107 0.8783 0.6373 0.0627  0.0644  0.0597  5   TRP A CA  
16   C C   . TRP A 23  ? 0.7450 0.7878 0.5650 0.0464  0.0521  0.0375  5   TRP A C   
17   O O   . TRP A 23  ? 0.7484 0.7579 0.5642 0.0521  0.0215  0.0584  5   TRP A O   
18   C CB  . TRP A 23  ? 0.6503 0.9461 0.5979 0.0359  0.0398  0.0767  5   TRP A CB  
19   C CG  . TRP A 23  ? 0.6546 0.9694 0.5485 -0.0040 0.0680  0.0340  5   TRP A CG  
20   C CD1 . TRP A 23  ? 0.6381 1.0555 0.5682 -0.0266 0.0896  0.0227  5   TRP A CD1 
21   C CD2 . TRP A 23  ? 0.6691 0.9002 0.4746 -0.0271 0.0807  0.0027  5   TRP A CD2 
22   N NE1 . TRP A 23  ? 0.6511 1.0391 0.5052 -0.0664 0.1224  -0.0227 5   TRP A NE1 
23   C CE2 . TRP A 23  ? 0.6768 0.9474 0.4591 -0.0626 0.1195  -0.0316 5   TRP A CE2 
24   C CE3 . TRP A 23  ? 0.7018 0.8337 0.4579 -0.0212 0.0632  0.0062  5   TRP A CE3 
25   C CZ2 . TRP A 23  ? 0.7092 0.9056 0.4184 -0.0869 0.1497  -0.0613 5   TRP A CZ2 
26   C CZ3 . TRP A 23  ? 0.7231 0.7964 0.4222 -0.0411 0.0842  -0.0139 5   TRP A CZ3 
27   C CH2 . TRP A 23  ? 0.7226 0.8207 0.3982 -0.0708 0.1311  -0.0468 5   TRP A CH2 
28   N N   . SER A 24  ? 0.7800 0.7584 0.5192 0.0239  0.0735  0.0014  6   SER A N   
29   C CA  . SER A 24  ? 0.8336 0.7099 0.4802 0.0058  0.0509  -0.0032 6   SER A CA  
30   C C   . SER A 24  ? 0.9390 0.7036 0.5261 -0.0020 0.0526  -0.0122 6   SER A C   
31   O O   . SER A 24  ? 0.9795 0.6835 0.5054 -0.0215 0.0143  -0.0008 6   SER A O   
32   C CB  . SER A 24  ? 0.8564 0.6962 0.4321 -0.0178 0.0706  -0.0259 6   SER A CB  
33   O OG  . SER A 24  ? 0.8967 0.6634 0.4089 -0.0321 0.1119  -0.0601 6   SER A OG  
34   N N   . ASP A 25  ? 0.9897 0.7293 0.5996 0.0067  0.1018  -0.0328 7   ASP A N   
35   C CA  . ASP A 25  ? 1.0999 0.7318 0.6670 -0.0060 0.1236  -0.0470 7   ASP A CA  
36   C C   . ASP A 25  ? 1.0764 0.7277 0.6985 0.0120  0.0905  -0.0130 7   ASP A C   
37   O O   . ASP A 25  ? 1.1476 0.7125 0.6974 -0.0183 0.0770  -0.0195 7   ASP A O   
38   C CB  . ASP A 25  ? 1.1570 0.7592 0.7729 0.0065  0.2041  -0.0754 7   ASP A CB  
39   C CG  . ASP A 25  ? 1.2311 0.7782 0.7694 -0.0247 0.2518  -0.1216 7   ASP A CG  
40   O OD1 . ASP A 25  ? 1.3088 0.7660 0.7013 -0.0727 0.2348  -0.1399 7   ASP A OD1 
41   O OD2 . ASP A 25  ? 1.2338 0.8314 0.8626 -0.0030 0.3061  -0.1350 7   ASP A OD2 
42   N N   . ARG A 26  ? 0.9935 0.7580 0.7336 0.0519  0.0776  0.0235  8   ARG A N   
43   C CA  . ARG A 26  ? 0.9706 0.7620 0.7644 0.0689  0.0461  0.0616  8   ARG A CA  
44   C C   . ARG A 26  ? 0.9571 0.7412 0.6964 0.0428  -0.0112 0.0695  8   ARG A C   
45   O O   . ARG A 26  ? 0.9882 0.7228 0.7101 0.0307  -0.0280 0.0760  8   ARG A O   
46   C CB  . ARG A 26  ? 0.8860 0.8099 0.7968 0.1039  0.0353  0.1062  8   ARG A CB  
47   C CG  . ARG A 26  ? 0.8934 0.8665 0.8993 0.1349  0.0804  0.1161  8   ARG A CG  
48   C CD  . ARG A 26  ? 0.9602 0.8836 1.0445 0.1698  0.1181  0.1418  8   ARG A CD  
49   N NE  . ARG A 26  ? 0.9767 0.9514 1.1858 0.2067  0.1675  0.1591  8   ARG A NE  
50   C CZ  . ARG A 26  ? 1.0557 0.9783 1.3632 0.2450  0.2258  0.1802  8   ARG A CZ  
51   N NH1 . ARG A 26  ? 1.1205 0.9284 1.3942 0.2441  0.2440  0.1796  8   ARG A NH1 
52   N NH2 . ARG A 26  ? 1.0619 1.0466 1.5132 0.2832  0.2725  0.2026  8   ARG A NH2 
53   N N   . LEU A 27  ? 0.9135 0.7458 0.6370 0.0329  -0.0332 0.0686  9   LEU A N   
54   C CA  . LEU A 27  ? 0.8995 0.7333 0.6038 0.0150  -0.0778 0.0817  9   LEU A CA  
55   C C   . LEU A 27  ? 0.9897 0.7288 0.6038 -0.0186 -0.1003 0.0727  9   LEU A C   
56   O O   . LEU A 27  ? 1.0013 0.7323 0.6175 -0.0346 -0.1411 0.0910  9   LEU A O   
57   C CB  . LEU A 27  ? 0.8535 0.7439 0.5709 0.0133  -0.0742 0.0810  9   LEU A CB  
58   C CG  . LEU A 27  ? 0.7974 0.7896 0.5789 0.0225  -0.0552 0.0863  9   LEU A CG  
59   C CD1 . LEU A 27  ? 0.8069 0.8244 0.5718 0.0063  -0.0299 0.0676  9   LEU A CD1 
60   C CD2 . LEU A 27  ? 0.7453 0.7860 0.5800 0.0225  -0.0772 0.1131  9   LEU A CD2 
61   N N   . GLN A 28  ? 1.0533 0.7264 0.5851 -0.0376 -0.0748 0.0460  10  GLN A N   
62   C CA  . GLN A 28  ? 1.1671 0.7420 0.5821 -0.0872 -0.0934 0.0363  10  GLN A CA  
63   C C   . GLN A 28  ? 1.2479 0.7509 0.6242 -0.1153 -0.0804 0.0191  10  GLN A C   
64   O O   . GLN A 28  ? 1.3317 0.7847 0.6262 -0.1679 -0.1196 0.0234  10  GLN A O   
65   C CB  . GLN A 28  ? 1.2442 0.7539 0.5630 -0.1106 -0.0590 0.0078  10  GLN A CB  
66   C CG  . GLN A 28  ? 1.3837 0.7971 0.5564 -0.1768 -0.0900 0.0077  10  GLN A CG  
67   C CD  . GLN A 28  ? 1.3664 0.8242 0.5525 -0.1843 -0.1718 0.0641  10  GLN A CD  
68   O OE1 . GLN A 28  ? 1.3612 0.8436 0.5629 -0.1674 -0.1828 0.0887  10  GLN A OE1 
69   N NE2 . GLN A 28  ? 1.3582 0.8273 0.5516 -0.2094 -0.2236 0.0867  10  GLN A NE2 
70   N N   . ASN A 29  ? 1.2303 0.7290 0.6677 -0.0853 -0.0247 0.0041  11  ASN A N   
71   C CA  . ASN A 29  ? 1.3131 0.7348 0.7334 -0.1059 0.0049  -0.0112 11  ASN A CA  
72   C C   . ASN A 29  ? 1.2734 0.7332 0.7298 -0.1111 -0.0493 0.0185  11  ASN A C   
73   O O   . ASN A 29  ? 1.3638 0.7554 0.7456 -0.1660 -0.0601 0.0048  11  ASN A O   
74   C CB  . ASN A 29  ? 1.3095 0.7218 0.8214 -0.0594 0.0825  -0.0186 11  ASN A CB  
75   C CG  . ASN A 29  ? 1.3962 0.7390 0.8733 -0.0680 0.1592  -0.0609 11  ASN A CG  
76   O OD1 . ASN A 29  ? 1.4862 0.7479 0.8310 -0.1258 0.1661  -0.0966 11  ASN A OD1 
77   N ND2 . ASN A 29  ? 1.3611 0.7405 0.9640 -0.0127 0.2169  -0.0517 11  ASN A ND2 
78   N N   . ALA A 30  ? 1.1502 0.7176 0.7140 -0.0640 -0.0781 0.0545  12  ALA A N   
79   C CA  . ALA A 30  ? 1.1094 0.7223 0.7216 -0.0673 -0.1232 0.0814  12  ALA A CA  
80   C C   . ALA A 30  ? 1.1260 0.7571 0.7033 -0.1061 -0.1884 0.0946  12  ALA A C   
81   O O   . ALA A 30  ? 1.1445 0.7818 0.7321 -0.1345 -0.2239 0.1058  12  ALA A O   
82   C CB  . ALA A 30  ? 0.9853 0.6983 0.7042 -0.0193 -0.1256 0.1114  12  ALA A CB  
83   N N   . ALA A 31  ? 1.1249 0.7677 0.6713 -0.1069 -0.2026 0.0984  13  ALA A N   
84   C CA  . ALA A 31  ? 1.1593 0.8191 0.6831 -0.1373 -0.2649 0.1266  13  ALA A CA  
85   C C   . ALA A 31  ? 1.3043 0.8929 0.7090 -0.2112 -0.2988 0.1205  13  ALA A C   
86   O O   . ALA A 31  ? 1.3342 0.9589 0.7439 -0.2431 -0.3674 0.1585  13  ALA A O   
87   C CB  . ALA A 31  ? 1.1303 0.8050 0.6475 -0.1170 -0.2596 0.1360  13  ALA A CB  
88   N N   . ASP A 32  ? 1.4145 0.9049 0.7183 -0.2438 -0.2474 0.0746  14  ASP A N   
89   C CA  . ASP A 32  ? 1.5915 0.9950 0.7518 -0.3356 -0.2623 0.0542  14  ASP A CA  
90   C C   . ASP A 32  ? 1.6298 1.0309 0.8067 -0.3710 -0.2737 0.0487  14  ASP A C   
91   O O   . ASP A 32  ? 1.7672 1.1216 0.8325 -0.4614 -0.3026 0.0383  14  ASP A O   
92   C CB  . ASP A 32  ? 1.7112 0.9890 0.7506 -0.3674 -0.1794 -0.0040 14  ASP A CB  
93   C CG  . ASP A 32  ? 1.7053 0.9740 0.7074 -0.3489 -0.1649 -0.0054 14  ASP A CG  
94   O OD1 . ASP A 32  ? 1.6837 1.0045 0.6799 -0.3507 -0.2319 0.0389  14  ASP A OD1 
95   O OD2 . ASP A 32  ? 1.7217 0.9300 0.7118 -0.3312 -0.0804 -0.0486 14  ASP A OD2 
96   N N   . MET A 33  ? 1.5253 0.9743 0.8296 -0.3091 -0.2494 0.0551  15  MET A N   
97   C CA  . MET A 33  ? 1.5447 1.0011 0.8855 -0.3325 -0.2582 0.0548  15  MET A CA  
98   C C   . MET A 33  ? 1.5159 1.0713 0.9086 -0.3604 -0.3514 0.0993  15  MET A C   
99   O O   . MET A 33  ? 1.4053 1.0533 0.8995 -0.3106 -0.3882 0.1407  15  MET A O   
100  C CB  . MET A 33  ? 1.4395 0.9263 0.9018 -0.2565 -0.2121 0.0612  15  MET A CB  
101  C CG  . MET A 33  ? 1.5355 0.9190 0.9749 -0.2526 -0.1255 0.0277  15  MET A CG  
102  S SD  . MET A 33  ? 1.7068 0.9647 1.0417 -0.2706 -0.0435 -0.0202 15  MET A SD  
103  C CE  . MET A 33  ? 1.7959 0.9192 1.1179 -0.2908 0.0570  -0.0560 15  MET A CE  
104  N N   . PRO A 34  ? 1.6270 1.1644 0.9569 -0.4452 -0.3849 0.0915  16  PRO A N   
105  C CA  . PRO A 34  ? 1.5820 1.2338 1.0128 -0.4617 -0.4649 0.1372  16  PRO A CA  
106  C C   . PRO A 34  ? 1.4590 1.1588 1.0341 -0.4017 -0.4339 0.1398  16  PRO A C   
107  O O   . PRO A 34  ? 1.4450 1.0773 1.0119 -0.3691 -0.3591 0.1074  16  PRO A O   
108  C CB  . PRO A 34  ? 1.7496 1.3625 1.0590 -0.5809 -0.4968 0.1173  16  PRO A CB  
109  C CG  . PRO A 34  ? 1.8630 1.3210 1.0362 -0.6124 -0.3994 0.0466  16  PRO A CG  
110  C CD  . PRO A 34  ? 1.8083 1.2227 0.9760 -0.5381 -0.3461 0.0387  16  PRO A CD  
111  N N   . ALA A 35  ? 1.3779 1.1917 1.0892 -0.3880 -0.4872 0.1826  17  ALA A N   
112  C CA  . ALA A 35  ? 1.2806 1.1353 1.1166 -0.3465 -0.4553 0.1823  17  ALA A CA  
113  C C   . ALA A 35  ? 1.3490 1.1889 1.1755 -0.4103 -0.4555 0.1606  17  ALA A C   
114  O O   . ALA A 35  ? 1.3848 1.2976 1.2510 -0.4676 -0.5208 0.1826  17  ALA A O   
115  C CB  . ALA A 35  ? 1.1692 1.1393 1.1685 -0.3015 -0.4871 0.2292  17  ALA A CB  
116  N N   . ASN A 36  ? 1.3752 1.1234 1.1541 -0.4028 -0.3825 0.1224  18  ASN A N   
117  C CA  . ASN A 36  ? 1.4246 1.1547 1.2171 -0.4494 -0.3646 0.1018  18  ASN A CA  
118  C C   . ASN A 36  ? 1.3123 1.1131 1.2485 -0.3978 -0.3513 0.1227  18  ASN A C   
119  O O   . ASN A 36  ? 1.2540 1.0239 1.2055 -0.3362 -0.2984 0.1245  18  ASN A O   
120  C CB  . ASN A 36  ? 1.5325 1.1153 1.2092 -0.4717 -0.2837 0.0555  18  ASN A CB  
121  C CG  . ASN A 36  ? 1.6144 1.1634 1.2773 -0.5436 -0.2654 0.0277  18  ASN A CG  
122  O OD1 . ASN A 36  ? 1.5303 1.1068 1.2816 -0.5203 -0.2472 0.0366  18  ASN A OD1 
123  N ND2 . ASN A 36  ? 1.7563 1.2403 1.2958 -0.6422 -0.2653 -0.0099 18  ASN A ND2 
124  N N   . MET A 37  ? 1.2922 1.1929 1.3350 -0.4302 -0.3996 0.1411  19  MET A N   
125  C CA  . MET A 37  ? 1.1888 1.1683 1.3845 -0.3895 -0.3866 0.1606  19  MET A CA  
126  C C   . MET A 37  ? 1.2189 1.1775 1.4456 -0.4211 -0.3466 0.1373  19  MET A C   
127  O O   . MET A 37  ? 1.1509 1.1674 1.4984 -0.4039 -0.3282 0.1461  19  MET A O   
128  C CB  . MET A 37  ? 1.1307 1.2423 1.4708 -0.3861 -0.4514 0.2049  19  MET A CB  
129  C CG  . MET A 37  ? 1.0732 1.2031 1.4141 -0.3331 -0.4697 0.2346  19  MET A CG  
130  S SD  . MET A 37  ? 0.9575 1.0510 1.3063 -0.2523 -0.3912 0.2240  19  MET A SD  
131  C CE  . MET A 37  ? 0.8651 1.0573 1.4241 -0.2345 -0.3702 0.2445  19  MET A CE  
132  N N   . ASP A 38  ? 1.3359 1.1992 1.4484 -0.4720 -0.3217 0.1035  20  ASP A N   
133  C CA  . ASP A 38  ? 1.3904 1.2002 1.5033 -0.5008 -0.2683 0.0782  20  ASP A CA  
134  C C   . ASP A 38  ? 1.3336 1.1081 1.4704 -0.4338 -0.2078 0.0901  20  ASP A C   
135  O O   . ASP A 38  ? 1.2967 1.0376 1.3897 -0.3754 -0.1907 0.1055  20  ASP A O   
136  C CB  . ASP A 38  ? 1.5339 1.2140 1.5016 -0.5580 -0.2302 0.0384  20  ASP A CB  
137  C CG  . ASP A 38  ? 1.6082 1.2329 1.5747 -0.6075 -0.1789 0.0099  20  ASP A CG  
138  O OD1 . ASP A 38  ? 1.5956 1.3070 1.6420 -0.6654 -0.2127 0.0033  20  ASP A OD1 
139  O OD2 . ASP A 38  ? 1.6672 1.1606 1.5596 -0.5882 -0.1021 -0.0024 20  ASP A OD2 
140  N N   . LYS A 39  ? 1.3397 1.1281 1.5430 -0.4517 -0.1779 0.0840  21  LYS A N   
141  C CA  . LYS A 39  ? 1.3119 1.0767 1.5312 -0.4105 -0.1254 0.0978  21  LYS A CA  
142  C C   . LYS A 39  ? 1.3474 1.0149 1.4613 -0.3608 -0.0877 0.1163  21  LYS A C   
143  O O   . LYS A 39  ? 1.2787 0.9772 1.3986 -0.3117 -0.0887 0.1419  21  LYS A O   
144  C CB  . LYS A 39  ? 1.3610 1.1075 1.6172 -0.4584 -0.0848 0.0786  21  LYS A CB  
145  C CG  . LYS A 39  ? 1.3259 1.0801 1.6205 -0.4397 -0.0393 0.0906  21  LYS A CG  
146  C CD  . LYS A 39  ? 1.3618 1.1196 1.7194 -0.4971 -0.0021 0.0651  21  LYS A CD  
147  C CE  . LYS A 39  ? 1.4819 1.1083 1.7301 -0.5231 0.0504  0.0573  21  LYS A CE  
148  N NZ  . LYS A 39  ? 1.5552 1.1295 1.7495 -0.5603 0.0388  0.0334  21  LYS A NZ  
149  N N   . HIS A 40  ? 1.4640 1.0177 1.4924 -0.3770 -0.0507 0.1053  22  HIS A N   
150  C CA  . HIS A 40  ? 1.5168 0.9765 1.4761 -0.3260 -0.0078 0.1339  22  HIS A CA  
151  C C   . HIS A 40  ? 1.5131 0.9582 1.4327 -0.2898 -0.0212 0.1373  22  HIS A C   
152  O O   . HIS A 40  ? 1.5303 0.9288 1.4279 -0.2367 0.0077  0.1696  22  HIS A O   
153  C CB  . HIS A 40  ? 1.6508 0.9789 1.5555 -0.3510 0.0572  0.1269  22  HIS A CB  
154  C CG  . HIS A 40  ? 1.6765 1.0009 1.6057 -0.3785 0.0825  0.1317  22  HIS A CG  
155  N ND1 . HIS A 40  ? 1.7432 1.0411 1.6767 -0.4495 0.1020  0.0900  22  HIS A ND1 
156  C CD2 . HIS A 40  ? 1.6523 0.9972 1.5948 -0.3554 0.0932  0.1704  22  HIS A CD2 
157  C CE1 . HIS A 40  ? 1.7550 1.0506 1.7098 -0.4627 0.1294  0.1010  22  HIS A CE1 
158  N NE2 . HIS A 40  ? 1.7098 1.0296 1.6623 -0.4093 0.1247  0.1498  22  HIS A NE2 
159  N N   . ALA A 41  ? 1.5016 0.9907 1.4173 -0.3213 -0.0657 0.1093  23  ALA A N   
160  C CA  . ALA A 41  ? 1.4882 0.9781 1.3673 -0.2922 -0.0828 0.1107  23  ALA A CA  
161  C C   . ALA A 41  ? 1.3717 0.9464 1.3025 -0.2292 -0.1041 0.1465  23  ALA A C   
162  O O   . ALA A 41  ? 1.3691 0.9183 1.2790 -0.1804 -0.0829 0.1667  23  ALA A O   
163  C CB  . ALA A 41  ? 1.5060 1.0353 1.3624 -0.3487 -0.1363 0.0834  23  ALA A CB  
164  N N   . LEU A 42  ? 1.2887 0.9628 1.2944 -0.2353 -0.1376 0.1528  24  LEU A N   
165  C CA  . LEU A 42  ? 1.1921 0.9431 1.2412 -0.1934 -0.1473 0.1763  24  LEU A CA  
166  C C   . LEU A 42  ? 1.1934 0.9259 1.2267 -0.1664 -0.1108 0.2061  24  LEU A C   
167  O O   . LEU A 42  ? 1.1471 0.9177 1.1749 -0.1331 -0.1128 0.2279  24  LEU A O   
168  C CB  . LEU A 42  ? 1.1234 0.9674 1.2693 -0.2123 -0.1707 0.1719  24  LEU A CB  
169  C CG  . LEU A 42  ? 1.1077 1.0061 1.3043 -0.2360 -0.2222 0.1650  24  LEU A CG  
170  C CD1 . LEU A 42  ? 1.0470 1.0347 1.3791 -0.2438 -0.2258 0.1716  24  LEU A CD1 
171  C CD2 . LEU A 42  ? 1.0850 0.9882 1.2375 -0.2100 -0.2509 0.1722  24  LEU A CD2 
172  N N   . LYS A 43  ? 1.2583 0.9349 1.2795 -0.1882 -0.0802 0.2103  25  LYS A N   
173  C CA  . LYS A 43  ? 1.2921 0.9409 1.2865 -0.1710 -0.0506 0.2518  25  LYS A CA  
174  C C   . LYS A 43  ? 1.3284 0.9340 1.2912 -0.1197 -0.0394 0.2901  25  LYS A C   
175  O O   . LYS A 43  ? 1.3003 0.9565 1.2634 -0.0911 -0.0489 0.3324  25  LYS A O   
176  C CB  . LYS A 43  ? 1.3710 0.9535 1.3548 -0.2093 -0.0163 0.2480  25  LYS A CB  
177  C CG  . LYS A 43  ? 1.4177 0.9841 1.3703 -0.2079 0.0071  0.2964  25  LYS A CG  
178  C CD  . LYS A 43  ? 1.4963 1.0015 1.4372 -0.2563 0.0442  0.2847  25  LYS A CD  
179  C CE  . LYS A 43  ? 1.4429 1.0173 1.4333 -0.3057 0.0457  0.2456  25  LYS A CE  
180  N NZ  . LYS A 43  ? 1.5077 1.0282 1.4721 -0.3540 0.0902  0.2462  25  LYS A NZ  
181  N N   . LYS A 44  ? 1.3976 0.9146 1.3391 -0.1142 -0.0151 0.2741  26  LYS A N   
182  C CA  . LYS A 44  ? 1.4471 0.9104 1.3855 -0.0626 0.0142  0.3089  26  LYS A CA  
183  C C   . LYS A 44  ? 1.3770 0.9030 1.3280 -0.0293 -0.0103 0.3061  26  LYS A C   
184  O O   . LYS A 44  ? 1.3910 0.9119 1.3675 0.0197  0.0078  0.3455  26  LYS A O   
185  C CB  . LYS A 44  ? 1.5704 0.8946 1.4803 -0.0754 0.0734  0.2847  26  LYS A CB  
186  C CG  . LYS A 44  ? 1.6637 0.9069 1.5559 -0.1109 0.1109  0.2852  26  LYS A CG  
187  C CD  . LYS A 44  ? 1.6669 0.9295 1.5782 -0.0853 0.1117  0.3570  26  LYS A CD  
188  C CE  . LYS A 44  ? 1.7453 0.9464 1.6876 -0.0207 0.1519  0.4309  26  LYS A CE  
189  N NZ  . LYS A 44  ? 1.8947 0.9393 1.8238 -0.0276 0.2306  0.4333  26  LYS A NZ  
190  N N   . TYR A 45  ? 1.3050 0.8924 1.2497 -0.0551 -0.0492 0.2650  27  TYR A N   
191  C CA  . TYR A 45  ? 1.2433 0.8841 1.1891 -0.0332 -0.0713 0.2555  27  TYR A CA  
192  C C   . TYR A 45  ? 1.1627 0.9045 1.1379 -0.0071 -0.0912 0.2922  27  TYR A C   
193  O O   . TYR A 45  ? 1.1405 0.9109 1.1264 0.0268  -0.0893 0.3086  27  TYR A O   
194  C CB  . TYR A 45  ? 1.2151 0.8819 1.1465 -0.0718 -0.1071 0.2111  27  TYR A CB  
195  C CG  . TYR A 45  ? 1.2221 0.8780 1.1186 -0.0646 -0.1138 0.1899  27  TYR A CG  
196  C CD1 . TYR A 45  ? 1.3231 0.8793 1.1695 -0.0685 -0.0742 0.1699  27  TYR A CD1 
197  C CD2 . TYR A 45  ? 1.1474 0.8787 1.0561 -0.0595 -0.1482 0.1865  27  TYR A CD2 
198  C CE1 . TYR A 45  ? 1.3529 0.8877 1.1528 -0.0724 -0.0722 0.1450  27  TYR A CE1 
199  C CE2 . TYR A 45  ? 1.1716 0.8835 1.0357 -0.0579 -0.1520 0.1677  27  TYR A CE2 
200  C CZ  . TYR A 45  ? 1.2698 0.8848 1.0748 -0.0669 -0.1158 0.1460  27  TYR A CZ  
201  O OH  . TYR A 45  ? 1.2968 0.8821 1.0446 -0.0751 -0.1115 0.1226  27  TYR A OH  
202  N N   . ARG A 46  ? 1.1295 0.9230 1.1147 -0.0329 -0.1041 0.3002  28  ARG A N   
203  C CA  . ARG A 46  ? 1.0875 0.9672 1.0764 -0.0333 -0.1148 0.3310  28  ARG A CA  
204  C C   . ARG A 46  ? 1.1590 1.0390 1.1423 -0.0180 -0.1085 0.3986  28  ARG A C   
205  O O   . ARG A 46  ? 1.1696 1.1065 1.1315 -0.0468 -0.1179 0.4274  28  ARG A O   
206  C CB  . ARG A 46  ? 1.0410 0.9615 1.0379 -0.0792 -0.1156 0.3037  28  ARG A CB  
207  C CG  . ARG A 46  ? 1.0659 0.9422 1.0609 -0.1119 -0.0974 0.3054  28  ARG A CG  
208  C CD  . ARG A 46  ? 0.9773 0.8890 1.0034 -0.1558 -0.0844 0.2724  28  ARG A CD  
209  N NE  . ARG A 46  ? 1.0244 0.9058 1.0334 -0.1950 -0.0576 0.2809  28  ARG A NE  
210  C CZ  . ARG A 46  ? 1.0443 0.8927 1.0913 -0.2228 -0.0411 0.2532  28  ARG A CZ  
211  N NH1 . ARG A 46  ? 1.0094 0.8632 1.1178 -0.2182 -0.0581 0.2218  28  ARG A NH1 
212  N NH2 . ARG A 46  ? 1.1099 0.9244 1.1310 -0.2621 -0.0098 0.2600  28  ARG A NH2 
213  N N   . ARG A 47  ? 1.2274 1.0380 1.2288 0.0210  -0.0881 0.4270  29  ARG A N   
214  C CA  . ARG A 47  ? 1.2864 1.1114 1.3150 0.0554  -0.0868 0.5096  29  ARG A CA  
215  C C   . ARG A 47  ? 1.2425 1.1342 1.3161 0.0955  -0.0975 0.5256  29  ARG A C   
216  O O   . ARG A 47  ? 1.2451 1.2252 1.3497 0.1105  -0.1224 0.5933  29  ARG A O   
217  C CB  . ARG A 47  ? 1.3918 1.0965 1.4438 0.0855  -0.0416 0.5359  29  ARG A CB  
218  C CG  . ARG A 47  ? 1.4759 1.0992 1.4878 0.0481  -0.0203 0.5268  29  ARG A CG  
219  C CD  . ARG A 47  ? 1.5261 1.2072 1.5040 0.0148  -0.0471 0.5756  29  ARG A CD  
220  N NE  . ARG A 47  ? 1.4872 1.2014 1.4245 -0.0461 -0.0578 0.5107  29  ARG A NE  
221  C CZ  . ARG A 47  ? 1.5377 1.1913 1.4515 -0.0885 -0.0341 0.4768  29  ARG A CZ  
222  N NH1 . ARG A 47  ? 1.6371 1.1853 1.5433 -0.0829 0.0016  0.4975  29  ARG A NH1 
223  N NH2 . ARG A 47  ? 1.4855 1.1820 1.3943 -0.1372 -0.0385 0.4222  29  ARG A NH2 
224  N N   . GLU A 48  ? 1.2088 1.0594 1.2831 0.1055  -0.0798 0.4647  30  GLU A N   
225  C CA  . GLU A 48  ? 1.1791 1.0670 1.2943 0.1410  -0.0743 0.4652  30  GLU A CA  
226  C C   . GLU A 48  ? 1.0841 1.0939 1.1817 0.1169  -0.1139 0.4563  30  GLU A C   
227  O O   . GLU A 48  ? 1.0342 1.0528 1.0833 0.0774  -0.1262 0.4060  30  GLU A O   
228  C CB  . GLU A 48  ? 1.2037 0.9937 1.2946 0.1406  -0.0389 0.3970  30  GLU A CB  
229  C CG  . GLU A 48  ? 1.2530 1.0248 1.3980 0.1837  0.0000  0.4023  30  GLU A CG  
230  C CD  . GLU A 48  ? 1.3200 0.9891 1.4067 0.1619  0.0363  0.3266  30  GLU A CD  
231  O OE1 . GLU A 48  ? 1.3026 0.9933 1.3888 0.1684  0.0443  0.3010  30  GLU A OE1 
232  O OE2 . GLU A 48  ? 1.3940 0.9617 1.4255 0.1286  0.0561  0.2922  30  GLU A OE2 
233  N N   . ALA A 49  ? 1.0646 1.1703 1.2119 0.1383  -0.1296 0.5089  31  ALA A N   
234  C CA  . ALA A 49  ? 1.0015 1.2298 1.1231 0.1008  -0.1635 0.5091  31  ALA A CA  
235  C C   . ALA A 49  ? 0.9340 1.1570 1.0135 0.0790  -0.1548 0.4291  31  ALA A C   
236  O O   . ALA A 49  ? 0.8921 1.1527 0.9235 0.0318  -0.1633 0.4010  31  ALA A O   
237  C CB  . ALA A 49  ? 1.0079 1.3479 1.2019 0.1252  -0.1841 0.5793  31  ALA A CB  
238  N N   . TYR A 50  ? 0.9397 1.1024 1.0354 0.1103  -0.1298 0.3939  32  TYR A N   
239  C CA  . TYR A 50  ? 0.9103 1.0633 0.9678 0.0960  -0.1222 0.3312  32  TYR A CA  
240  C C   . TYR A 50  ? 0.8967 1.0020 0.9020 0.0617  -0.1292 0.2872  32  TYR A C   
241  O O   . TYR A 50  ? 0.8521 0.9670 0.8320 0.0443  -0.1291 0.2507  32  TYR A O   
242  C CB  . TYR A 50  ? 0.9481 1.0307 1.0225 0.1296  -0.0884 0.3089  32  TYR A CB  
243  C CG  . TYR A 50  ? 1.0116 1.1093 1.1773 0.1762  -0.0666 0.3641  32  TYR A CG  
244  C CD1 . TYR A 50  ? 0.9936 1.2010 1.2307 0.1947  -0.0707 0.3981  32  TYR A CD1 
245  C CD2 . TYR A 50  ? 1.0861 1.0927 1.2811 0.2010  -0.0385 0.3881  32  TYR A CD2 
246  C CE1 . TYR A 50  ? 1.0305 1.2670 1.3867 0.2448  -0.0527 0.4643  32  TYR A CE1 
247  C CE2 . TYR A 50  ? 1.1332 1.1478 1.4371 0.2521  -0.0093 0.4493  32  TYR A CE2 
248  C CZ  . TYR A 50  ? 1.1007 1.2355 1.4952 0.2779  -0.0191 0.4921  32  TYR A CZ  
249  O OH  . TYR A 50  ? 1.1455 1.3008 1.6800 0.3353  0.0085  0.5657  32  TYR A OH  
250  N N   . HIS A 51  ? 0.7092 0.2207 0.4757 -0.0557 -0.0457 0.0259  33  HIS A N   
251  C CA  . HIS A 51  ? 0.7212 0.2407 0.4842 -0.0629 -0.0465 0.0286  33  HIS A CA  
252  C C   . HIS A 51  ? 0.7174 0.2525 0.4821 -0.0675 -0.0467 0.0414  33  HIS A C   
253  O O   . HIS A 51  ? 0.7325 0.2746 0.4974 -0.0740 -0.0475 0.0454  33  HIS A O   
254  C CB  . HIS A 51  ? 0.7431 0.2472 0.5106 -0.0688 -0.0516 0.0269  33  HIS A CB  
255  C CG  . HIS A 51  ? 0.7852 0.2759 0.5489 -0.0660 -0.0508 0.0128  33  HIS A CG  
256  N ND1 . HIS A 51  ? 0.8657 0.3373 0.6363 -0.0650 -0.0535 0.0075  33  HIS A ND1 
257  C CD2 . HIS A 51  ? 0.8047 0.2992 0.5586 -0.0641 -0.0473 0.0029  33  HIS A CD2 
258  C CE1 . HIS A 51  ? 0.8686 0.3334 0.6323 -0.0628 -0.0509 -0.0063 33  HIS A CE1 
259  N NE2 . HIS A 51  ? 0.8543 0.3332 0.6072 -0.0626 -0.0474 -0.0085 33  HIS A NE2 
260  N N   . ARG A 52  ? 0.6980 0.2387 0.4642 -0.0647 -0.0463 0.0481  34  ARG A N   
261  C CA  . ARG A 52  ? 0.6994 0.2558 0.4653 -0.0695 -0.0460 0.0597  34  ARG A CA  
262  C C   . ARG A 52  ? 0.6559 0.2304 0.4142 -0.0664 -0.0396 0.0555  34  ARG A C   
263  O O   . ARG A 52  ? 0.6250 0.1986 0.3796 -0.0599 -0.0364 0.0459  34  ARG A O   
264  C CB  . ARG A 52  ? 0.7063 0.2607 0.4773 -0.0695 -0.0499 0.0706  34  ARG A CB  
265  C CG  . ARG A 52  ? 0.7536 0.2912 0.5357 -0.0733 -0.0568 0.0774  34  ARG A CG  
266  C CD  . ARG A 52  ? 0.7887 0.3264 0.5779 -0.0743 -0.0618 0.0917  34  ARG A CD  
267  N NE  . ARG A 52  ? 0.8843 0.4442 0.6659 -0.0779 -0.0598 0.1015  34  ARG A NE  
268  C CZ  . ARG A 52  ? 0.9101 0.4761 0.6929 -0.0780 -0.0629 0.1123  34  ARG A CZ  
269  N NH1 . ARG A 52  ? 0.8933 0.4450 0.6871 -0.0741 -0.0685 0.1159  34  ARG A NH1 
270  N NH2 . ARG A 52  ? 0.8998 0.4874 0.6732 -0.0822 -0.0604 0.1194  34  ARG A NH2 
271  N N   . VAL A 53  ? 0.6433 0.2343 0.4003 -0.0715 -0.0377 0.0629  35  VAL A N   
272  C CA  . VAL A 53  ? 0.6150 0.2248 0.3665 -0.0697 -0.0317 0.0606  35  VAL A CA  
273  C C   . VAL A 53  ? 0.6176 0.2350 0.3667 -0.0714 -0.0330 0.0701  35  VAL A C   
274  O O   . VAL A 53  ? 0.6352 0.2537 0.3870 -0.0779 -0.0365 0.0815  35  VAL A O   
275  C CB  . VAL A 53  ? 0.6143 0.2384 0.3671 -0.0749 -0.0279 0.0615  35  VAL A CB  
276  C CG1 . VAL A 53  ? 0.5896 0.2344 0.3383 -0.0733 -0.0207 0.0583  35  VAL A CG1 
277  C CG2 . VAL A 53  ? 0.5574 0.1740 0.3131 -0.0738 -0.0283 0.0538  35  VAL A CG2 
278  N N   . PHE A 54  ? 0.6071 0.2299 0.3515 -0.0662 -0.0309 0.0661  36  PHE A N   
279  C CA  . PHE A 54  ? 0.6054 0.2374 0.3462 -0.0682 -0.0327 0.0748  36  PHE A CA  
280  C C   . PHE A 54  ? 0.5988 0.2536 0.3318 -0.0717 -0.0268 0.0745  36  PHE A C   
281  O O   . PHE A 54  ? 0.5877 0.2499 0.3193 -0.0692 -0.0207 0.0646  36  PHE A O   
282  C CB  . PHE A 54  ? 0.6032 0.2270 0.3447 -0.0611 -0.0350 0.0711  36  PHE A CB  
283  C CG  . PHE A 54  ? 0.6091 0.2111 0.3593 -0.0575 -0.0396 0.0701  36  PHE A CG  
284  C CD1 . PHE A 54  ? 0.5997 0.1921 0.3575 -0.0605 -0.0463 0.0814  36  PHE A CD1 
285  C CD2 . PHE A 54  ? 0.6262 0.2177 0.3778 -0.0516 -0.0371 0.0578  36  PHE A CD2 
286  C CE1 . PHE A 54  ? 0.6237 0.1957 0.3912 -0.0570 -0.0500 0.0788  36  PHE A CE1 
287  C CE2 . PHE A 54  ? 0.6228 0.1949 0.3818 -0.0485 -0.0404 0.0551  36  PHE A CE2 
288  C CZ  . PHE A 54  ? 0.5977 0.1597 0.3651 -0.0509 -0.0465 0.0646  36  PHE A CZ  
289  N N   . VAL A 55  ? 0.6192 0.2857 0.3477 -0.0778 -0.0284 0.0856  37  VAL A N   
290  C CA  . VAL A 55  ? 0.6107 0.3001 0.3317 -0.0832 -0.0222 0.0861  37  VAL A CA  
291  C C   . VAL A 55  ? 0.6164 0.3188 0.3275 -0.0840 -0.0225 0.0880  37  VAL A C   
292  O O   . VAL A 55  ? 0.6241 0.3257 0.3337 -0.0877 -0.0290 0.1006  37  VAL A O   
293  C CB  . VAL A 55  ? 0.6216 0.3176 0.3448 -0.0926 -0.0231 0.0988  37  VAL A CB  
294  C CG1 . VAL A 55  ? 0.6214 0.3420 0.3380 -0.0980 -0.0150 0.0976  37  VAL A CG1 
295  C CG2 . VAL A 55  ? 0.6161 0.2970 0.3499 -0.0925 -0.0251 0.0980  37  VAL A CG2 
296  N N   . ASN A 56  ? 0.6009 0.3150 0.3062 -0.0810 -0.0159 0.0758  38  ASN A N   
297  C CA  . ASN A 56  ? 0.5993 0.3291 0.2935 -0.0832 -0.0152 0.0757  38  ASN A CA  
298  C C   . ASN A 56  ? 0.6111 0.3642 0.2963 -0.0919 -0.0095 0.0790  38  ASN A C   
299  O O   . ASN A 56  ? 0.6159 0.3831 0.2901 -0.0979 -0.0113 0.0861  38  ASN A O   
300  C CB  . ASN A 56  ? 0.5841 0.3149 0.2772 -0.0760 -0.0109 0.0597  38  ASN A CB  
301  C CG  . ASN A 56  ? 0.5963 0.3080 0.2963 -0.0680 -0.0161 0.0569  38  ASN A CG  
302  O OD1 . ASN A 56  ? 0.6884 0.3927 0.3940 -0.0615 -0.0129 0.0456  38  ASN A OD1 
303  N ND2 . ASN A 56  ? 0.5895 0.2935 0.2906 -0.0686 -0.0240 0.0676  38  ASN A ND2 
304  N N   . ARG A 57  ? 0.6064 0.3649 0.2963 -0.0926 -0.0023 0.0732  39  ARG A N   
305  C CA  . ARG A 57  ? 0.6173 0.3985 0.3013 -0.1000 0.0052  0.0739  39  ARG A CA  
306  C C   . ARG A 57  ? 0.6169 0.3964 0.3113 -0.1028 0.0074  0.0786  39  ARG A C   
307  O O   . ARG A 57  ? 0.6165 0.3849 0.3219 -0.0971 0.0088  0.0709  39  ARG A O   
308  C CB  . ARG A 57  ? 0.6154 0.4096 0.2966 -0.0965 0.0146  0.0564  39  ARG A CB  
309  C CG  . ARG A 57  ? 0.6434 0.4510 0.3100 -0.0989 0.0148  0.0532  39  ARG A CG  
310  C CD  . ARG A 57  ? 0.6963 0.5146 0.3627 -0.0952 0.0242  0.0343  39  ARG A CD  
311  N NE  . ARG A 57  ? 0.7634 0.5641 0.4421 -0.0850 0.0236  0.0235  39  ARG A NE  
312  C CZ  . ARG A 57  ? 0.7803 0.5664 0.4593 -0.0796 0.0168  0.0226  39  ARG A CZ  
313  N NH1 . ARG A 57  ? 0.7699 0.5561 0.4391 -0.0828 0.0094  0.0319  39  ARG A NH1 
314  N NH2 . ARG A 57  ? 0.7523 0.5245 0.4424 -0.0712 0.0171  0.0133  39  ARG A NH2 
315  N N   . SER A 58  ? 0.6204 0.4130 0.3112 -0.1123 0.0078  0.0913  40  SER A N   
316  C CA  . SER A 58  ? 0.6169 0.4089 0.3181 -0.1165 0.0088  0.0981  40  SER A CA  
317  C C   . SER A 58  ? 0.6120 0.4096 0.3229 -0.1125 0.0176  0.0849  40  SER A C   
318  O O   . SER A 58  ? 0.6261 0.4372 0.3340 -0.1097 0.0260  0.0719  40  SER A O   
319  C CB  . SER A 58  ? 0.6317 0.4424 0.3264 -0.1283 0.0096  0.1135  40  SER A CB  
320  O OG  . SER A 58  ? 0.6037 0.4066 0.2926 -0.1317 -0.0005 0.1278  40  SER A OG  
321  N N   . LEU A 59  ? 0.5999 0.3864 0.3237 -0.1122 0.0152  0.0877  41  LEU A N   
322  C CA  . LEU A 59  ? 0.5991 0.3901 0.3347 -0.1084 0.0221  0.0769  41  LEU A CA  
323  C C   . LEU A 59  ? 0.5996 0.3888 0.3470 -0.1139 0.0200  0.0864  41  LEU A C   
324  O O   . LEU A 59  ? 0.5988 0.3686 0.3505 -0.1140 0.0112  0.0926  41  LEU A O   
325  C CB  . LEU A 59  ? 0.5714 0.3453 0.3118 -0.0981 0.0200  0.0644  41  LEU A CB  
326  C CG  . LEU A 59  ? 0.5575 0.3320 0.3116 -0.0926 0.0248  0.0533  41  LEU A CG  
327  C CD1 . LEU A 59  ? 0.5111 0.2762 0.2646 -0.0834 0.0248  0.0408  41  LEU A CD1 
328  C CD2 . LEU A 59  ? 0.5151 0.2774 0.2808 -0.0939 0.0194  0.0589  41  LEU A CD2 
329  N N   . ALA A 60  ? 0.6132 0.4237 0.3660 -0.1189 0.0282  0.0871  42  ALA A N   
330  C CA  . ALA A 60  ? 0.6295 0.4416 0.3962 -0.1240 0.0273  0.0949  42  ALA A CA  
331  C C   . ALA A 60  ? 0.6243 0.4278 0.4058 -0.1174 0.0273  0.0852  42  ALA A C   
332  O O   . ALA A 60  ? 0.6280 0.4453 0.4176 -0.1139 0.0358  0.0754  42  ALA A O   
333  C CB  . ALA A 60  ? 0.6222 0.4624 0.3904 -0.1320 0.0368  0.0997  42  ALA A CB  
334  N N   . MET A 61  ? 0.6419 0.4228 0.4274 -0.1159 0.0176  0.0880  43  MET A N   
335  C CA  . MET A 61  ? 0.6458 0.4182 0.4439 -0.1113 0.0157  0.0813  43  MET A CA  
336  C C   . MET A 61  ? 0.6562 0.4451 0.4707 -0.1150 0.0206  0.0831  43  MET A C   
337  O O   . MET A 61  ? 0.6480 0.4384 0.4742 -0.1101 0.0225  0.0754  43  MET A O   
338  C CB  . MET A 61  ? 0.6438 0.3912 0.4415 -0.1116 0.0044  0.0853  43  MET A CB  
339  C CG  . MET A 61  ? 0.6964 0.4263 0.4843 -0.1041 0.0006  0.0780  43  MET A CG  
340  S SD  . MET A 61  ? 0.7569 0.4875 0.5491 -0.0942 0.0050  0.0629  43  MET A SD  
341  C CE  . MET A 61  ? 0.7186 0.4294 0.5165 -0.0938 -0.0041 0.0626  43  MET A CE  
342  N N   . GLU A 62  ? 0.6781 0.4800 0.4948 -0.1239 0.0224  0.0941  44  GLU A N   
343  C CA  . GLU A 62  ? 0.6965 0.5159 0.5302 -0.1281 0.0274  0.0970  44  GLU A CA  
344  C C   . GLU A 62  ? 0.6939 0.5353 0.5342 -0.1234 0.0401  0.0860  44  GLU A C   
345  O O   . GLU A 62  ? 0.6990 0.5529 0.5578 -0.1233 0.0445  0.0842  44  GLU A O   
346  C CB  . GLU A 62  ? 0.7197 0.5495 0.5540 -0.1393 0.0270  0.1120  44  GLU A CB  
347  C CG  . GLU A 62  ? 0.7561 0.5990 0.6105 -0.1448 0.0288  0.1175  44  GLU A CG  
348  C CD  . GLU A 62  ? 0.8450 0.7141 0.7013 -0.1534 0.0376  0.1263  44  GLU A CD  
349  O OE1 . GLU A 62  ? 0.8651 0.7489 0.7093 -0.1527 0.0463  0.1225  44  GLU A OE1 
350  O OE2 . GLU A 62  ? 0.8677 0.7434 0.7372 -0.1614 0.0355  0.1371  44  GLU A OE2 
351  N N   . LYS A 63  ? 0.6939 0.5400 0.5207 -0.1195 0.0457  0.0781  45  LYS A N   
352  C CA  . LYS A 63  ? 0.6893 0.5558 0.5220 -0.1153 0.0583  0.0659  45  LYS A CA  
353  C C   . LYS A 63  ? 0.6593 0.5160 0.4993 -0.1045 0.0584  0.0519  45  LYS A C   
354  O O   . LYS A 63  ? 0.6508 0.5219 0.5000 -0.0999 0.0682  0.0406  45  LYS A O   
355  C CB  . LYS A 63  ? 0.7094 0.5914 0.5243 -0.1188 0.0656  0.0647  45  LYS A CB  
356  C CG  . LYS A 63  ? 0.7405 0.6380 0.5511 -0.1305 0.0673  0.0795  45  LYS A CG  
357  C CD  . LYS A 63  ? 0.7501 0.6641 0.5405 -0.1349 0.0739  0.0791  45  LYS A CD  
358  C CE  . LYS A 63  ? 0.8054 0.7279 0.5872 -0.1473 0.0709  0.0981  45  LYS A CE  
359  N NZ  . LYS A 63  ? 0.8128 0.7466 0.5716 -0.1521 0.0732  0.1006  45  LYS A NZ  
360  N N   . ILE A 64  ? 0.6334 0.4662 0.4707 -0.1007 0.0478  0.0528  46  ILE A N   
361  C CA  . ILE A 64  ? 0.6020 0.4249 0.4458 -0.0915 0.0468  0.0418  46  ILE A CA  
362  C C   . ILE A 64  ? 0.6070 0.4350 0.4752 -0.0897 0.0471  0.0412  46  ILE A C   
363  O O   . ILE A 64  ? 0.6206 0.4419 0.4951 -0.0938 0.0397  0.0500  46  ILE A O   
364  C CB  . ILE A 64  ? 0.5830 0.3800 0.4133 -0.0882 0.0362  0.0424  46  ILE A CB  
365  C CG1 . ILE A 64  ? 0.5568 0.3503 0.3668 -0.0881 0.0364  0.0413  46  ILE A CG1 
366  C CG2 . ILE A 64  ? 0.5608 0.3476 0.3996 -0.0802 0.0339  0.0339  46  ILE A CG2 
367  C CD1 . ILE A 64  ? 0.4822 0.2894 0.2884 -0.0839 0.0459  0.0294  46  ILE A CD1 
368  N N   . LYS A 65  ? 0.6095 0.4495 0.4925 -0.0837 0.0553  0.0307  47  LYS A N   
369  C CA  . LYS A 65  ? 0.6119 0.4573 0.5208 -0.0811 0.0554  0.0302  47  LYS A CA  
370  C C   . LYS A 65  ? 0.5917 0.4203 0.5070 -0.0742 0.0478  0.0266  47  LYS A C   
371  O O   . LYS A 65  ? 0.5912 0.4204 0.5252 -0.0739 0.0437  0.0305  47  LYS A O   
372  C CB  . LYS A 65  ? 0.6228 0.4924 0.5498 -0.0785 0.0692  0.0213  47  LYS A CB  
373  C CG  . LYS A 65  ? 0.6861 0.5772 0.6116 -0.0862 0.0778  0.0258  47  LYS A CG  
374  C CD  . LYS A 65  ? 0.7550 0.6444 0.6837 -0.0947 0.0701  0.0416  47  LYS A CD  
375  C CE  . LYS A 65  ? 0.8116 0.7130 0.7259 -0.1042 0.0741  0.0499  47  LYS A CE  
376  N NZ  . LYS A 65  ? 0.8211 0.7093 0.7297 -0.1120 0.0622  0.0652  47  LYS A NZ  
377  N N   . CYS A 66  ? 0.5735 0.3891 0.4745 -0.0692 0.0462  0.0198  48  CYS A N   
378  C CA  . CYS A 66  ? 0.5659 0.3668 0.4709 -0.0632 0.0397  0.0168  48  CYS A CA  
379  C C   . CYS A 66  ? 0.5447 0.3266 0.4264 -0.0624 0.0334  0.0166  48  CYS A C   
380  O O   . CYS A 66  ? 0.5465 0.3287 0.4122 -0.0627 0.0368  0.0134  48  CYS A O   
381  C CB  . CYS A 66  ? 0.5743 0.3824 0.4946 -0.0553 0.0470  0.0050  48  CYS A CB  
382  S SG  . CYS A 66  ? 0.6660 0.4990 0.6174 -0.0541 0.0580  0.0009  48  CYS A SG  
383  N N   . PHE A 67  ? 0.5293 0.2961 0.4102 -0.0612 0.0244  0.0197  49  PHE A N   
384  C CA  . PHE A 67  ? 0.5260 0.2747 0.3879 -0.0595 0.0186  0.0186  49  PHE A CA  
385  C C   . PHE A 67  ? 0.5081 0.2514 0.3772 -0.0527 0.0176  0.0127  49  PHE A C   
386  O O   . PHE A 67  ? 0.4986 0.2418 0.3818 -0.0522 0.0137  0.0156  49  PHE A O   
387  C CB  . PHE A 67  ? 0.5162 0.2511 0.3688 -0.0649 0.0090  0.0270  49  PHE A CB  
388  C CG  . PHE A 67  ? 0.5349 0.2739 0.3834 -0.0722 0.0087  0.0343  49  PHE A CG  
389  C CD1 . PHE A 67  ? 0.5534 0.2854 0.3846 -0.0745 0.0080  0.0363  49  PHE A CD1 
390  C CD2 . PHE A 67  ? 0.5279 0.2782 0.3915 -0.0772 0.0087  0.0404  49  PHE A CD2 
391  C CE1 . PHE A 67  ? 0.5345 0.2703 0.3632 -0.0818 0.0072  0.0446  49  PHE A CE1 
392  C CE2 . PHE A 67  ? 0.5526 0.3071 0.4131 -0.0847 0.0083  0.0482  49  PHE A CE2 
393  C CZ  . PHE A 67  ? 0.5515 0.2983 0.3945 -0.0871 0.0074  0.0505  49  PHE A CZ  
394  N N   . GLY A 68  ? 0.5065 0.2462 0.3670 -0.0481 0.0208  0.0052  50  GLY A N   
395  C CA  . GLY A 68  ? 0.4882 0.2231 0.3565 -0.0419 0.0201  -0.0002 50  GLY A CA  
396  C C   . GLY A 68  ? 0.5008 0.2192 0.3518 -0.0409 0.0141  0.0005  50  GLY A C   
397  O O   . GLY A 68  ? 0.5095 0.2222 0.3433 -0.0429 0.0134  0.0014  50  GLY A O   
398  N N   . PHE A 69  ? 0.4950 0.2066 0.3517 -0.0380 0.0100  0.0006  51  PHE A N   
399  C CA  . PHE A 69  ? 0.4931 0.1902 0.3347 -0.0373 0.0047  0.0014  51  PHE A CA  
400  C C   . PHE A 69  ? 0.4921 0.1869 0.3398 -0.0320 0.0053  -0.0030 51  PHE A C   
401  O O   . PHE A 69  ? 0.4871 0.1872 0.3529 -0.0301 0.0053  -0.0025 51  PHE A O   
402  C CB  . PHE A 69  ? 0.5028 0.1927 0.3418 -0.0415 -0.0030 0.0086  51  PHE A CB  
403  C CG  . PHE A 69  ? 0.4937 0.1811 0.3240 -0.0474 -0.0057 0.0133  51  PHE A CG  
404  C CD1 . PHE A 69  ? 0.4999 0.1752 0.3121 -0.0490 -0.0083 0.0133  51  PHE A CD1 
405  C CD2 . PHE A 69  ? 0.4730 0.1701 0.3152 -0.0514 -0.0059 0.0181  51  PHE A CD2 
406  C CE1 . PHE A 69  ? 0.4971 0.1689 0.3033 -0.0547 -0.0114 0.0179  51  PHE A CE1 
407  C CE2 . PHE A 69  ? 0.4638 0.1586 0.2995 -0.0576 -0.0089 0.0231  51  PHE A CE2 
408  C CZ  . PHE A 69  ? 0.5239 0.2056 0.3416 -0.0594 -0.0118 0.0230  51  PHE A CZ  
409  N N   . ASN A 70  ? 0.4903 0.1770 0.3244 -0.0298 0.0054  -0.0066 52  ASN A N   
410  C CA  . ASN A 70  ? 0.4892 0.1702 0.3250 -0.0262 0.0038  -0.0084 52  ASN A CA  
411  C C   . ASN A 70  ? 0.4958 0.1679 0.3238 -0.0291 -0.0028 -0.0021 52  ASN A C   
412  O O   . ASN A 70  ? 0.4741 0.1422 0.2920 -0.0332 -0.0056 0.0012  52  ASN A O   
413  C CB  . ASN A 70  ? 0.4923 0.1691 0.3167 -0.0232 0.0062  -0.0140 52  ASN A CB  
414  C CG  . ASN A 70  ? 0.5084 0.1822 0.3388 -0.0193 0.0059  -0.0167 52  ASN A CG  
415  O OD1 . ASN A 70  ? 0.5140 0.1929 0.3615 -0.0173 0.0070  -0.0179 52  ASN A OD1 
416  N ND2 . ASN A 70  ? 0.4960 0.1614 0.3140 -0.0182 0.0042  -0.0170 52  ASN A ND2 
417  N N   . MET A 71  ? 0.4938 0.1635 0.3268 -0.0275 -0.0053 -0.0006 53  MET A N   
418  C CA  . MET A 71  ? 0.5118 0.1745 0.3348 -0.0308 -0.0109 0.0043  53  MET A CA  
419  C C   . MET A 71  ? 0.5198 0.1730 0.3255 -0.0296 -0.0105 0.0010  53  MET A C   
420  O O   . MET A 71  ? 0.5307 0.1768 0.3223 -0.0325 -0.0124 0.0012  53  MET A O   
421  C CB  . MET A 71  ? 0.5039 0.1704 0.3401 -0.0312 -0.0145 0.0097  53  MET A CB  
422  C CG  . MET A 71  ? 0.5107 0.1735 0.3366 -0.0368 -0.0210 0.0159  53  MET A CG  
423  S SD  . MET A 71  ? 0.5642 0.2324 0.4035 -0.0385 -0.0265 0.0246  53  MET A SD  
424  C CE  . MET A 71  ? 0.4998 0.1655 0.3413 -0.0328 -0.0223 0.0207  53  MET A CE  
425  N N   . ASP A 72  ? 0.5337 0.1865 0.3421 -0.0255 -0.0082 -0.0020 54  ASP A N   
426  C CA  . ASP A 72  ? 0.5649 0.2103 0.3606 -0.0238 -0.0076 -0.0046 54  ASP A CA  
427  C C   . ASP A 72  ? 0.5711 0.2114 0.3552 -0.0231 -0.0057 -0.0084 54  ASP A C   
428  O O   . ASP A 72  ? 0.5866 0.2309 0.3740 -0.0216 -0.0031 -0.0109 54  ASP A O   
429  C CB  . ASP A 72  ? 0.5745 0.2223 0.3787 -0.0194 -0.0050 -0.0074 54  ASP A CB  
430  C CG  . ASP A 72  ? 0.6169 0.2686 0.4334 -0.0199 -0.0072 -0.0027 54  ASP A CG  
431  O OD1 . ASP A 72  ? 0.6745 0.3258 0.4879 -0.0238 -0.0112 0.0033  54  ASP A OD1 
432  O OD2 . ASP A 72  ? 0.7016 0.3567 0.5315 -0.0167 -0.0053 -0.0047 54  ASP A OD2 
433  N N   . TYR A 73  ? 0.5668 0.1987 0.3379 -0.0242 -0.0070 -0.0089 55  TYR A N   
434  C CA  . TYR A 73  ? 0.5504 0.1756 0.3120 -0.0235 -0.0063 -0.0113 55  TYR A CA  
435  C C   . TYR A 73  ? 0.5571 0.1830 0.3183 -0.0265 -0.0073 -0.0093 55  TYR A C   
436  O O   . TYR A 73  ? 0.5766 0.1982 0.3323 -0.0261 -0.0071 -0.0098 55  TYR A O   
437  C CB  . TYR A 73  ? 0.5373 0.1628 0.2997 -0.0186 -0.0034 -0.0148 55  TYR A CB  
438  C CG  . TYR A 73  ? 0.5413 0.1630 0.3005 -0.0163 -0.0025 -0.0167 55  TYR A CG  
439  C CD1 . TYR A 73  ? 0.5115 0.1246 0.2610 -0.0167 -0.0028 -0.0183 55  TYR A CD1 
440  C CD2 . TYR A 73  ? 0.5051 0.1320 0.2722 -0.0137 -0.0009 -0.0174 55  TYR A CD2 
441  C CE1 . TYR A 73  ? 0.5195 0.1307 0.2665 -0.0144 -0.0008 -0.0207 55  TYR A CE1 
442  C CE2 . TYR A 73  ? 0.5041 0.1289 0.2687 -0.0119 0.0004  -0.0185 55  TYR A CE2 
443  C CZ  . TYR A 73  ? 0.5162 0.1339 0.2705 -0.0123 0.0008  -0.0202 55  TYR A CZ  
444  O OH  . TYR A 73  ? 0.5216 0.1388 0.2739 -0.0106 0.0032  -0.0218 55  TYR A OH  
445  N N   . THR A 74  ? 0.5474 0.1789 0.3151 -0.0299 -0.0089 -0.0059 56  THR A N   
446  C CA  . THR A 74  ? 0.5423 0.1766 0.3114 -0.0335 -0.0096 -0.0031 56  THR A CA  
447  C C   . THR A 74  ? 0.5516 0.1825 0.3185 -0.0390 -0.0143 0.0006  56  THR A C   
448  O O   . THR A 74  ? 0.5756 0.1981 0.3340 -0.0421 -0.0168 0.0009  56  THR A O   
449  C CB  . THR A 74  ? 0.5284 0.1753 0.3104 -0.0322 -0.0061 -0.0033 56  THR A CB  
450  O OG1 . THR A 74  ? 0.5099 0.1591 0.2926 -0.0276 -0.0024 -0.0079 56  THR A OG1 
451  C CG2 . THR A 74  ? 0.5068 0.1589 0.2900 -0.0358 -0.0053 -0.0006 56  THR A CG2 
452  N N   . LEU A 75  ? 0.5465 0.1840 0.3222 -0.0405 -0.0160 0.0034  57  LEU A N   
453  C CA  . LEU A 75  ? 0.5503 0.1860 0.3237 -0.0464 -0.0217 0.0073  57  LEU A CA  
454  C C   . LEU A 75  ? 0.5512 0.1803 0.3141 -0.0466 -0.0235 0.0053  57  LEU A C   
455  O O   . LEU A 75  ? 0.5745 0.1964 0.3264 -0.0513 -0.0271 0.0047  57  LEU A O   
456  C CB  . LEU A 75  ? 0.5354 0.1825 0.3249 -0.0478 -0.0233 0.0125  57  LEU A CB  
457  C CG  . LEU A 75  ? 0.5441 0.2000 0.3455 -0.0483 -0.0208 0.0142  57  LEU A CG  
458  C CD1 . LEU A 75  ? 0.5228 0.1903 0.3439 -0.0470 -0.0204 0.0172  57  LEU A CD1 
459  C CD2 . LEU A 75  ? 0.5530 0.2064 0.3500 -0.0549 -0.0247 0.0178  57  LEU A CD2 
460  N N   . ALA A 76  ? 0.5349 0.1665 0.3009 -0.0420 -0.0207 0.0039  58  ALA A N   
461  C CA  . ALA A 76  ? 0.5523 0.1800 0.3093 -0.0419 -0.0210 0.0023  58  ALA A CA  
462  C C   . ALA A 76  ? 0.5541 0.1750 0.3036 -0.0370 -0.0166 -0.0039 58  ALA A C   
463  O O   . ALA A 76  ? 0.5588 0.1830 0.3145 -0.0321 -0.0132 -0.0053 58  ALA A O   
464  C CB  . ALA A 76  ? 0.5281 0.1644 0.2963 -0.0409 -0.0217 0.0068  58  ALA A CB  
465  N N   . VAL A 77  ? 0.5769 0.1884 0.3149 -0.0385 -0.0170 -0.0076 59  VAL A N   
466  C CA  . VAL A 77  ? 0.5901 0.1944 0.3224 -0.0340 -0.0133 -0.0131 59  VAL A CA  
467  C C   . VAL A 77  ? 0.5886 0.1915 0.3135 -0.0337 -0.0118 -0.0161 59  VAL A C   
468  O O   . VAL A 77  ? 0.6031 0.2019 0.3179 -0.0382 -0.0136 -0.0182 59  VAL A O   
469  C CB  . VAL A 77  ? 0.6089 0.2029 0.3352 -0.0355 -0.0146 -0.0157 59  VAL A CB  
470  C CG1 . VAL A 77  ? 0.6229 0.2099 0.3469 -0.0303 -0.0112 -0.0205 59  VAL A CG1 
471  C CG2 . VAL A 77  ? 0.6254 0.2225 0.3587 -0.0367 -0.0158 -0.0114 59  VAL A CG2 
472  N N   . TYR A 78  ? 0.5819 0.1892 0.3117 -0.0292 -0.0084 -0.0165 60  TYR A N   
473  C CA  . TYR A 78  ? 0.5875 0.1957 0.3116 -0.0288 -0.0061 -0.0185 60  TYR A CA  
474  C C   . TYR A 78  ? 0.6021 0.2013 0.3180 -0.0266 -0.0029 -0.0257 60  TYR A C   
475  O O   . TYR A 78  ? 0.5937 0.1883 0.3136 -0.0223 -0.0015 -0.0279 60  TYR A O   
476  C CB  . TYR A 78  ? 0.5751 0.1908 0.3095 -0.0249 -0.0038 -0.0160 60  TYR A CB  
477  C CG  . TYR A 78  ? 0.5596 0.1833 0.3050 -0.0267 -0.0068 -0.0095 60  TYR A CG  
478  C CD1 . TYR A 78  ? 0.5506 0.1793 0.2951 -0.0316 -0.0100 -0.0040 60  TYR A CD1 
479  C CD2 . TYR A 78  ? 0.5573 0.1840 0.3146 -0.0238 -0.0065 -0.0089 60  TYR A CD2 
480  C CE1 . TYR A 78  ? 0.5856 0.2215 0.3436 -0.0330 -0.0133 0.0027  60  TYR A CE1 
481  C CE2 . TYR A 78  ? 0.5683 0.2022 0.3386 -0.0247 -0.0086 -0.0041 60  TYR A CE2 
482  C CZ  . TYR A 78  ? 0.5973 0.2353 0.3693 -0.0290 -0.0122 0.0021  60  TYR A CZ  
483  O OH  . TYR A 78  ? 0.5709 0.2157 0.3588 -0.0297 -0.0147 0.0074  60  TYR A OH  
484  N N   . LYS A 79  ? 0.6129 0.2102 0.3177 -0.0297 -0.0018 -0.0295 61  LYS A N   
485  C CA  . LYS A 79  ? 0.6211 0.2098 0.3196 -0.0276 0.0020  -0.0380 61  LYS A CA  
486  C C   . LYS A 79  ? 0.6216 0.2121 0.3261 -0.0209 0.0075  -0.0404 61  LYS A C   
487  O O   . LYS A 79  ? 0.6204 0.2196 0.3282 -0.0200 0.0094  -0.0372 61  LYS A O   
488  C CB  . LYS A 79  ? 0.6404 0.2280 0.3247 -0.0332 0.0025  -0.0429 61  LYS A CB  
489  C CG  . LYS A 79  ? 0.6502 0.2319 0.3281 -0.0395 -0.0029 -0.0435 61  LYS A CG  
490  C CD  . LYS A 79  ? 0.6722 0.2554 0.3351 -0.0467 -0.0037 -0.0473 61  LYS A CD  
491  C CE  . LYS A 79  ? 0.7272 0.3067 0.3860 -0.0538 -0.0108 -0.0457 61  LYS A CE  
492  N NZ  . LYS A 79  ? 0.7582 0.3365 0.3999 -0.0619 -0.0121 -0.0523 61  LYS A NZ  
493  N N   . SER A 80  ? 0.6187 0.2010 0.3264 -0.0165 0.0094  -0.0453 62  SER A N   
494  C CA  . SER A 80  ? 0.6217 0.2053 0.3372 -0.0100 0.0138  -0.0473 62  SER A CA  
495  C C   . SER A 80  ? 0.6288 0.2062 0.3400 -0.0084 0.0189  -0.0565 62  SER A C   
496  O O   . SER A 80  ? 0.6385 0.2063 0.3448 -0.0104 0.0178  -0.0616 62  SER A O   
497  C CB  . SER A 80  ? 0.6077 0.1870 0.3327 -0.0061 0.0114  -0.0447 62  SER A CB  
498  O OG  . SER A 80  ? 0.6427 0.2238 0.3763 0.0000  0.0147  -0.0461 62  SER A OG  
499  N N   . PRO A 81  ? 0.6329 0.2158 0.3474 -0.0046 0.0247  -0.0593 63  PRO A N   
500  C CA  . PRO A 81  ? 0.6048 0.1986 0.3268 -0.0021 0.0264  -0.0540 63  PRO A CA  
501  C C   . PRO A 81  ? 0.6027 0.2068 0.3185 -0.0072 0.0267  -0.0498 63  PRO A C   
502  O O   . PRO A 81  ? 0.6052 0.2176 0.3286 -0.0055 0.0278  -0.0452 63  PRO A O   
503  C CB  . PRO A 81  ? 0.6117 0.2061 0.3405 0.0036  0.0330  -0.0598 63  PRO A CB  
504  C CG  . PRO A 81  ? 0.6295 0.2160 0.3491 0.0022  0.0369  -0.0701 63  PRO A CG  
505  C CD  . PRO A 81  ? 0.6314 0.2087 0.3439 -0.0023 0.0307  -0.0697 63  PRO A CD  
506  N N   . GLU A 82  ? 0.6104 0.2143 0.3133 -0.0136 0.0252  -0.0505 64  GLU A N   
507  C CA  . GLU A 82  ? 0.6086 0.2230 0.3050 -0.0193 0.0249  -0.0453 64  GLU A CA  
508  C C   . GLU A 82  ? 0.5975 0.2192 0.3044 -0.0197 0.0206  -0.0349 64  GLU A C   
509  O O   . GLU A 82  ? 0.5890 0.2203 0.2993 -0.0208 0.0221  -0.0298 64  GLU A O   
510  C CB  . GLU A 82  ? 0.6212 0.2337 0.3026 -0.0271 0.0217  -0.0467 64  GLU A CB  
511  C CG  . GLU A 82  ? 0.6896 0.2991 0.3574 -0.0291 0.0272  -0.0578 64  GLU A CG  
512  C CD  . GLU A 82  ? 0.7499 0.3451 0.4190 -0.0254 0.0281  -0.0675 64  GLU A CD  
513  O OE1 . GLU A 82  ? 0.7358 0.3239 0.4147 -0.0223 0.0238  -0.0644 64  GLU A OE1 
514  O OE2 . GLU A 82  ? 0.8206 0.4119 0.4813 -0.0262 0.0333  -0.0784 64  GLU A OE2 
515  N N   . TYR A 83  ? 0.5742 0.1920 0.2870 -0.0192 0.0154  -0.0317 65  TYR A N   
516  C CA  . TYR A 83  ? 0.5633 0.1876 0.2867 -0.0196 0.0118  -0.0236 65  TYR A CA  
517  C C   . TYR A 83  ? 0.5520 0.1798 0.2885 -0.0139 0.0143  -0.0230 65  TYR A C   
518  O O   . TYR A 83  ? 0.5481 0.1833 0.2922 -0.0147 0.0140  -0.0176 65  TYR A O   
519  C CB  . TYR A 83  ? 0.5515 0.1725 0.2779 -0.0210 0.0065  -0.0212 65  TYR A CB  
520  C CG  . TYR A 83  ? 0.5370 0.1649 0.2759 -0.0215 0.0032  -0.0139 65  TYR A CG  
521  C CD1 . TYR A 83  ? 0.4638 0.0980 0.2030 -0.0268 -0.0001 -0.0070 65  TYR A CD1 
522  C CD2 . TYR A 83  ? 0.4944 0.1225 0.2453 -0.0172 0.0031  -0.0142 65  TYR A CD2 
523  C CE1 . TYR A 83  ? 0.4809 0.1204 0.2345 -0.0268 -0.0031 -0.0007 65  TYR A CE1 
524  C CE2 . TYR A 83  ? 0.4861 0.1198 0.2498 -0.0174 0.0008  -0.0094 65  TYR A CE2 
525  C CZ  . TYR A 83  ? 0.5108 0.1495 0.2771 -0.0217 -0.0022 -0.0028 65  TYR A CZ  
526  O OH  . TYR A 83  ? 0.5400 0.1837 0.3226 -0.0213 -0.0045 0.0017  65  TYR A OH  
527  N N   . GLU A 84  ? 0.5478 0.1703 0.2875 -0.0087 0.0164  -0.0280 66  GLU A N   
528  C CA  . GLU A 84  ? 0.5402 0.1662 0.2913 -0.0038 0.0184  -0.0280 66  GLU A CA  
529  C C   . GLU A 84  ? 0.5403 0.1732 0.2920 -0.0040 0.0231  -0.0275 66  GLU A C   
530  O O   . GLU A 84  ? 0.5220 0.1615 0.2841 -0.0030 0.0234  -0.0238 66  GLU A O   
531  C CB  . GLU A 84  ? 0.5374 0.1572 0.2909 0.0012  0.0194  -0.0327 66  GLU A CB  
532  C CG  . GLU A 84  ? 0.5686 0.1828 0.3220 0.0013  0.0151  -0.0322 66  GLU A CG  
533  C CD  . GLU A 84  ? 0.6245 0.2297 0.3683 -0.0006 0.0145  -0.0354 66  GLU A CD  
534  O OE1 . GLU A 84  ? 0.5845 0.1893 0.3198 -0.0053 0.0139  -0.0353 66  GLU A OE1 
535  O OE2 . GLU A 84  ? 0.6392 0.2378 0.3848 0.0024  0.0142  -0.0377 66  GLU A OE2 
536  N N   . SER A 85  ? 0.5473 0.1789 0.2880 -0.0056 0.0269  -0.0318 67  SER A N   
537  C CA  . SER A 85  ? 0.5650 0.2044 0.3041 -0.0066 0.0325  -0.0319 67  SER A CA  
538  C C   . SER A 85  ? 0.5667 0.2155 0.3060 -0.0122 0.0304  -0.0231 67  SER A C   
539  O O   . SER A 85  ? 0.5662 0.2234 0.3134 -0.0121 0.0328  -0.0190 67  SER A O   
540  C CB  . SER A 85  ? 0.5740 0.2102 0.3001 -0.0076 0.0376  -0.0400 67  SER A CB  
541  O OG  . SER A 85  ? 0.6166 0.2623 0.3426 -0.0080 0.0442  -0.0406 67  SER A OG  
542  N N   . LEU A 86  ? 0.5795 0.2272 0.3127 -0.0172 0.0252  -0.0191 68  LEU A N   
543  C CA  . LEU A 86  ? 0.5870 0.2429 0.3240 -0.0223 0.0216  -0.0091 68  LEU A CA  
544  C C   . LEU A 86  ? 0.5719 0.2300 0.3282 -0.0192 0.0189  -0.0038 68  LEU A C   
545  O O   . LEU A 86  ? 0.5741 0.2399 0.3387 -0.0212 0.0188  0.0032  68  LEU A O   
546  C CB  . LEU A 86  ? 0.5968 0.2512 0.3253 -0.0282 0.0158  -0.0055 68  LEU A CB  
547  C CG  . LEU A 86  ? 0.6113 0.2740 0.3468 -0.0335 0.0105  0.0065  68  LEU A CG  
548  C CD1 . LEU A 86  ? 0.5898 0.2628 0.3184 -0.0387 0.0133  0.0118  68  LEU A CD1 
549  C CD2 . LEU A 86  ? 0.6036 0.2641 0.3337 -0.0382 0.0041  0.0095  68  LEU A CD2 
550  N N   . GLY A 87  ? 0.5616 0.2133 0.3251 -0.0150 0.0166  -0.0072 69  GLY A N   
551  C CA  . GLY A 87  ? 0.5360 0.1893 0.3165 -0.0121 0.0145  -0.0049 69  GLY A CA  
552  C C   . GLY A 87  ? 0.5386 0.1963 0.3270 -0.0093 0.0184  -0.0056 69  GLY A C   
553  O O   . GLY A 87  ? 0.5323 0.1951 0.3340 -0.0100 0.0171  -0.0003 69  GLY A O   
554  N N   . PHE A 88  ? 0.5374 0.1929 0.3197 -0.0060 0.0228  -0.0118 70  PHE A N   
555  C CA  . PHE A 88  ? 0.5335 0.1937 0.3240 -0.0028 0.0268  -0.0130 70  PHE A CA  
556  C C   . PHE A 88  ? 0.5511 0.2210 0.3438 -0.0067 0.0296  -0.0067 70  PHE A C   
557  O O   . PHE A 88  ? 0.5554 0.2307 0.3621 -0.0065 0.0292  -0.0025 70  PHE A O   
558  C CB  . PHE A 88  ? 0.5353 0.1915 0.3192 0.0012  0.0314  -0.0205 70  PHE A CB  
559  C CG  . PHE A 88  ? 0.5083 0.1704 0.3020 0.0047  0.0359  -0.0217 70  PHE A CG  
560  C CD1 . PHE A 88  ? 0.4900 0.1518 0.2965 0.0089  0.0336  -0.0225 70  PHE A CD1 
561  C CD2 . PHE A 88  ? 0.5281 0.1970 0.3180 0.0034  0.0425  -0.0221 70  PHE A CD2 
562  C CE1 . PHE A 88  ? 0.4716 0.1395 0.2888 0.0119  0.0371  -0.0230 70  PHE A CE1 
563  C CE2 . PHE A 88  ? 0.5153 0.1909 0.3164 0.0068  0.0472  -0.0229 70  PHE A CE2 
564  C CZ  . PHE A 88  ? 0.5014 0.1762 0.3170 0.0112  0.0441  -0.0230 70  PHE A CZ  
565  N N   . GLU A 89  ? 0.5687 0.2413 0.3474 -0.0111 0.0322  -0.0057 71  GLU A N   
566  C CA  . GLU A 89  ? 0.5999 0.2833 0.3779 -0.0159 0.0351  0.0011  71  GLU A CA  
567  C C   . GLU A 89  ? 0.5667 0.2548 0.3557 -0.0204 0.0293  0.0124  71  GLU A C   
568  O O   . GLU A 89  ? 0.5521 0.2485 0.3504 -0.0224 0.0307  0.0190  71  GLU A O   
569  C CB  . GLU A 89  ? 0.6166 0.3031 0.3747 -0.0204 0.0395  -0.0015 71  GLU A CB  
570  C CG  . GLU A 89  ? 0.6907 0.3713 0.4351 -0.0241 0.0350  -0.0022 71  GLU A CG  
571  C CD  . GLU A 89  ? 0.7286 0.4132 0.4521 -0.0294 0.0396  -0.0062 71  GLU A CD  
572  O OE1 . GLU A 89  ? 0.7778 0.4554 0.4917 -0.0267 0.0435  -0.0174 71  GLU A OE1 
573  O OE2 . GLU A 89  ? 0.8488 0.5440 0.5662 -0.0367 0.0392  0.0021  71  GLU A OE2 
574  N N   . LEU A 90  ? 0.5518 0.2345 0.3424 -0.0216 0.0229  0.0148  72  LEU A N   
575  C CA  . LEU A 90  ? 0.5330 0.2189 0.3378 -0.0249 0.0172  0.0251  72  LEU A CA  
576  C C   . LEU A 90  ? 0.5272 0.2119 0.3532 -0.0208 0.0159  0.0247  72  LEU A C   
577  O O   . LEU A 90  ? 0.5036 0.1932 0.3445 -0.0233 0.0135  0.0331  72  LEU A O   
578  C CB  . LEU A 90  ? 0.5261 0.2071 0.3290 -0.0266 0.0113  0.0269  72  LEU A CB  
579  C CG  . LEU A 90  ? 0.5195 0.2025 0.3037 -0.0324 0.0103  0.0293  72  LEU A CG  
580  C CD1 . LEU A 90  ? 0.4726 0.1497 0.2587 -0.0325 0.0044  0.0293  72  LEU A CD1 
581  C CD2 . LEU A 90  ? 0.4913 0.1853 0.2744 -0.0399 0.0090  0.0415  72  LEU A CD2 
582  N N   . THR A 91  ? 0.5267 0.2052 0.3538 -0.0149 0.0171  0.0151  73  THR A N   
583  C CA  . THR A 91  ? 0.5229 0.2004 0.3671 -0.0113 0.0160  0.0125  73  THR A CA  
584  C C   . THR A 91  ? 0.5235 0.2081 0.3741 -0.0112 0.0199  0.0146  73  THR A C   
585  O O   . THR A 91  ? 0.5397 0.2271 0.4074 -0.0118 0.0178  0.0182  73  THR A O   
586  C CB  . THR A 91  ? 0.5180 0.1885 0.3589 -0.0061 0.0158  0.0025  73  THR A CB  
587  O OG1 . THR A 91  ? 0.5198 0.1850 0.3550 -0.0066 0.0128  0.0011  73  THR A OG1 
588  C CG2 . THR A 91  ? 0.5074 0.1778 0.3643 -0.0034 0.0139  -0.0007 73  THR A CG2 
589  N N   . VAL A 92  ? 0.5179 0.2058 0.3562 -0.0107 0.0257  0.0119  74  VAL A N   
590  C CA  . VAL A 92  ? 0.5121 0.2086 0.3567 -0.0108 0.0305  0.0141  74  VAL A CA  
591  C C   . VAL A 92  ? 0.5408 0.2460 0.3925 -0.0171 0.0297  0.0259  74  VAL A C   
592  O O   . VAL A 92  ? 0.5352 0.2461 0.4031 -0.0181 0.0295  0.0309  74  VAL A O   
593  C CB  . VAL A 92  ? 0.5153 0.2143 0.3453 -0.0090 0.0382  0.0082  74  VAL A CB  
594  C CG1 . VAL A 92  ? 0.4854 0.1967 0.3195 -0.0114 0.0442  0.0128  74  VAL A CG1 
595  C CG2 . VAL A 92  ? 0.4485 0.1411 0.2798 -0.0023 0.0389  -0.0012 74  VAL A CG2 
596  N N   . GLU A 93  ? 0.5626 0.2693 0.4027 -0.0221 0.0285  0.0313  75  GLU A N   
597  C CA  . GLU A 93  ? 0.5926 0.3082 0.4373 -0.0291 0.0269  0.0443  75  GLU A CA  
598  C C   . GLU A 93  ? 0.5635 0.2767 0.4317 -0.0300 0.0196  0.0516  75  GLU A C   
599  O O   . GLU A 93  ? 0.5551 0.2755 0.4370 -0.0340 0.0187  0.0618  75  GLU A O   
600  C CB  . GLU A 93  ? 0.5972 0.3151 0.4216 -0.0343 0.0268  0.0473  75  GLU A CB  
601  C CG  . GLU A 93  ? 0.6766 0.3991 0.5057 -0.0415 0.0204  0.0614  75  GLU A CG  
602  C CD  . GLU A 93  ? 0.6972 0.4186 0.5062 -0.0456 0.0181  0.0616  75  GLU A CD  
603  O OE1 . GLU A 93  ? 0.8094 0.5305 0.5976 -0.0450 0.0239  0.0522  75  GLU A OE1 
604  O OE2 . GLU A 93  ? 0.7607 0.4814 0.5762 -0.0492 0.0105  0.0708  75  GLU A OE2 
605  N N   . ARG A 94  ? 0.5497 0.2527 0.4238 -0.0261 0.0150  0.0457  76  ARG A N   
606  C CA  . ARG A 94  ? 0.5369 0.2361 0.4347 -0.0257 0.0090  0.0489  76  ARG A CA  
607  C C   . ARG A 94  ? 0.5378 0.2385 0.4517 -0.0234 0.0102  0.0462  76  ARG A C   
608  O O   . ARG A 94  ? 0.5331 0.2365 0.4667 -0.0263 0.0071  0.0539  76  ARG A O   
609  C CB  . ARG A 94  ? 0.5263 0.2156 0.4251 -0.0217 0.0054  0.0408  76  ARG A CB  
610  C CG  . ARG A 94  ? 0.5001 0.1849 0.4237 -0.0203 0.0005  0.0402  76  ARG A CG  
611  C CD  . ARG A 94  ? 0.5163 0.2045 0.4576 -0.0253 -0.0041 0.0538  76  ARG A CD  
612  N NE  . ARG A 94  ? 0.5155 0.1985 0.4832 -0.0236 -0.0083 0.0517  76  ARG A NE  
613  C CZ  . ARG A 94  ? 0.5407 0.2242 0.5307 -0.0269 -0.0134 0.0624  76  ARG A CZ  
614  N NH1 . ARG A 94  ? 0.5344 0.2245 0.5229 -0.0327 -0.0155 0.0777  76  ARG A NH1 
615  N NH2 . ARG A 94  ? 0.5073 0.1847 0.5216 -0.0247 -0.0165 0.0577  76  ARG A NH2 
616  N N   . LEU A 95  ? 0.5327 0.2322 0.4392 -0.0188 0.0143  0.0360  77  LEU A N   
617  C CA  . LEU A 95  ? 0.5235 0.2259 0.4441 -0.0170 0.0151  0.0337  77  LEU A CA  
618  C C   . LEU A 95  ? 0.5290 0.2425 0.4567 -0.0216 0.0182  0.0439  77  LEU A C   
619  O O   . LEU A 95  ? 0.5261 0.2419 0.4743 -0.0237 0.0153  0.0489  77  LEU A O   
620  C CB  . LEU A 95  ? 0.5156 0.2156 0.4272 -0.0115 0.0182  0.0225  77  LEU A CB  
621  C CG  . LEU A 95  ? 0.5079 0.1984 0.4161 -0.0075 0.0147  0.0128  77  LEU A CG  
622  C CD1 . LEU A 95  ? 0.4703 0.1598 0.3674 -0.0030 0.0178  0.0049  77  LEU A CD1 
623  C CD2 . LEU A 95  ? 0.4658 0.1533 0.3933 -0.0075 0.0095  0.0102  77  LEU A CD2 
624  N N   . VAL A 96  ? 0.5336 0.2544 0.4450 -0.0236 0.0240  0.0470  78  VAL A N   
625  C CA  . VAL A 96  ? 0.5415 0.2750 0.4579 -0.0290 0.0276  0.0577  78  VAL A CA  
626  C C   . VAL A 96  ? 0.5496 0.2853 0.4814 -0.0355 0.0215  0.0717  78  VAL A C   
627  O O   . VAL A 96  ? 0.5550 0.2962 0.5058 -0.0385 0.0203  0.0794  78  VAL A O   
628  C CB  . VAL A 96  ? 0.5419 0.2835 0.4363 -0.0305 0.0356  0.0570  78  VAL A CB  
629  C CG1 . VAL A 96  ? 0.5519 0.3093 0.4496 -0.0372 0.0403  0.0687  78  VAL A CG1 
630  C CG2 . VAL A 96  ? 0.5294 0.2680 0.4164 -0.0235 0.0409  0.0438  78  VAL A CG2 
631  N N   . SER A 97  ? 0.5637 0.2943 0.4899 -0.0373 0.0169  0.0751  79  SER A N   
632  C CA  . SER A 97  ? 0.5740 0.3058 0.5155 -0.0430 0.0103  0.0890  79  SER A CA  
633  C C   . SER A 97  ? 0.5721 0.2973 0.5432 -0.0416 0.0044  0.0892  79  SER A C   
634  O O   . SER A 97  ? 0.5642 0.2929 0.5543 -0.0468 0.0001  0.1023  79  SER A O   
635  C CB  . SER A 97  ? 0.5765 0.3035 0.5064 -0.0441 0.0064  0.0905  79  SER A CB  
636  O OG  . SER A 97  ? 0.6179 0.3390 0.5685 -0.0451 -0.0017 0.0968  79  SER A OG  
637  N N   . ILE A 98  ? 0.5635 0.2797 0.5386 -0.0351 0.0041  0.0750  80  ILE A N   
638  C CA  . ILE A 98  ? 0.5575 0.2679 0.5589 -0.0338 -0.0008 0.0722  80  ILE A CA  
639  C C   . ILE A 98  ? 0.5583 0.2733 0.5697 -0.0333 0.0015  0.0693  80  ILE A C   
640  O O   . ILE A 98  ? 0.5529 0.2628 0.5847 -0.0325 -0.0026 0.0649  80  ILE A O   
641  C CB  . ILE A 98  ? 0.5546 0.2529 0.5594 -0.0287 -0.0044 0.0599  80  ILE A CB  
642  C CG1 . ILE A 98  ? 0.5279 0.2232 0.5124 -0.0230 -0.0004 0.0456  80  ILE A CG1 
643  C CG2 . ILE A 98  ? 0.5615 0.2563 0.5671 -0.0303 -0.0083 0.0662  80  ILE A CG2 
644  C CD1 . ILE A 98  ? 0.5006 0.1948 0.4927 -0.0201 -0.0002 0.0357  80  ILE A CD1 
645  N N   . GLY A 99  ? 0.5501 0.2752 0.5485 -0.0341 0.0081  0.0713  81  GLY A N   
646  C CA  . GLY A 99  ? 0.5533 0.2857 0.5649 -0.0350 0.0102  0.0724  81  GLY A CA  
647  C C   . GLY A 99  ? 0.5589 0.2951 0.5588 -0.0301 0.0161  0.0625  81  GLY A C   
648  O O   . GLY A 99  ? 0.5617 0.3056 0.5733 -0.0309 0.0181  0.0641  81  GLY A O   
649  N N   . TYR A 100 ? 0.5428 0.2738 0.5220 -0.0253 0.0185  0.0530  82  TYR A N   
650  C CA  . TYR A 100 ? 0.5477 0.2817 0.5158 -0.0204 0.0241  0.0445  82  TYR A CA  
651  C C   . TYR A 100 ? 0.5609 0.3084 0.5223 -0.0227 0.0326  0.0507  82  TYR A C   
652  O O   . TYR A 100 ? 0.5831 0.3362 0.5384 -0.0280 0.0345  0.0601  82  TYR A O   
653  C CB  . TYR A 100 ? 0.5305 0.2547 0.4800 -0.0152 0.0239  0.0338  82  TYR A CB  
654  C CG  . TYR A 100 ? 0.5106 0.2260 0.4682 -0.0119 0.0178  0.0249  82  TYR A CG  
655  C CD1 . TYR A 100 ? 0.5070 0.2151 0.4748 -0.0135 0.0115  0.0246  82  TYR A CD1 
656  C CD2 . TYR A 100 ? 0.5237 0.2390 0.4798 -0.0074 0.0183  0.0167  82  TYR A CD2 
657  C CE1 . TYR A 100 ? 0.5179 0.2193 0.4923 -0.0111 0.0067  0.0150  82  TYR A CE1 
658  C CE2 . TYR A 100 ? 0.5001 0.2093 0.4618 -0.0055 0.0126  0.0088  82  TYR A CE2 
659  C CZ  . TYR A 100 ? 0.5351 0.2377 0.5048 -0.0075 0.0072  0.0073  82  TYR A CZ  
660  O OH  . TYR A 100 ? 0.5349 0.2329 0.5086 -0.0062 0.0024  -0.0018 82  TYR A OH  
661  N N   . PRO A 101 ? 0.5619 0.3158 0.5262 -0.0192 0.0375  0.0461  83  PRO A N   
662  C CA  . PRO A 101 ? 0.5723 0.3406 0.5330 -0.0212 0.0467  0.0507  83  PRO A CA  
663  C C   . PRO A 101 ? 0.5860 0.3549 0.5218 -0.0207 0.0532  0.0477  83  PRO A C   
664  O O   . PRO A 101 ? 0.5818 0.3398 0.5039 -0.0167 0.0515  0.0393  83  PRO A O   
665  C CB  . PRO A 101 ? 0.5696 0.3421 0.5402 -0.0157 0.0496  0.0439  83  PRO A CB  
666  C CG  . PRO A 101 ? 0.5602 0.3193 0.5289 -0.0104 0.0429  0.0341  83  PRO A CG  
667  C CD  . PRO A 101 ? 0.5480 0.2975 0.5197 -0.0137 0.0347  0.0366  83  PRO A CD  
668  N N   . GLN A 102 ? 0.6003 0.3828 0.5305 -0.0254 0.0609  0.0543  84  GLN A N   
669  C CA  . GLN A 102 ? 0.6243 0.4102 0.5306 -0.0267 0.0679  0.0516  84  GLN A CA  
670  C C   . GLN A 102 ? 0.6171 0.3975 0.5111 -0.0191 0.0733  0.0371  84  GLN A C   
671  O O   . GLN A 102 ? 0.6173 0.3942 0.4907 -0.0194 0.0761  0.0321  84  GLN A O   
672  C CB  . GLN A 102 ? 0.6496 0.4544 0.5544 -0.0333 0.0764  0.0604  84  GLN A CB  
673  C CG  . GLN A 102 ? 0.7033 0.5143 0.6154 -0.0425 0.0712  0.0770  84  GLN A CG  
674  C CD  . GLN A 102 ? 0.7871 0.5931 0.6808 -0.0474 0.0667  0.0814  84  GLN A CD  
675  O OE1 . GLN A 102 ? 0.8440 0.6537 0.7145 -0.0488 0.0726  0.0769  84  GLN A OE1 
676  N NE2 . GLN A 102 ? 0.7922 0.5902 0.6975 -0.0502 0.0562  0.0902  84  GLN A NE2 
677  N N   . GLU A 103 ? 0.6063 0.3860 0.5141 -0.0127 0.0742  0.0308  85  GLU A N   
678  C CA  . GLU A 103 ? 0.6098 0.3853 0.5103 -0.0053 0.0795  0.0185  85  GLU A CA  
679  C C   . GLU A 103 ? 0.5934 0.3525 0.4803 -0.0022 0.0737  0.0115  85  GLU A C   
680  O O   . GLU A 103 ? 0.6031 0.3576 0.4790 0.0020  0.0781  0.0023  85  GLU A O   
681  C CB  . GLU A 103 ? 0.6072 0.3864 0.5282 0.0005  0.0803  0.0154  85  GLU A CB  
682  C CG  . GLU A 103 ? 0.6368 0.4343 0.5717 -0.0016 0.0885  0.0207  85  GLU A CG  
683  C CD  . GLU A 103 ? 0.6914 0.4949 0.6435 -0.0076 0.0826  0.0326  85  GLU A CD  
684  O OE1 . GLU A 103 ? 0.6980 0.4940 0.6466 -0.0122 0.0747  0.0382  85  GLU A OE1 
685  O OE2 . GLU A 103 ? 0.7130 0.5286 0.6842 -0.0077 0.0856  0.0364  85  GLU A OE2 
686  N N   . LEU A 104 ? 0.5704 0.3209 0.4591 -0.0045 0.0641  0.0157  86  LEU A N   
687  C CA  . LEU A 104 ? 0.5656 0.3019 0.4416 -0.0027 0.0586  0.0104  86  LEU A CA  
688  C C   . LEU A 104 ? 0.5806 0.3151 0.4340 -0.0052 0.0626  0.0079  86  LEU A C   
689  O O   . LEU A 104 ? 0.5733 0.2972 0.4153 -0.0021 0.0610  0.0006  86  LEU A O   
690  C CB  . LEU A 104 ? 0.5575 0.2875 0.4408 -0.0056 0.0491  0.0157  86  LEU A CB  
691  C CG  . LEU A 104 ? 0.5392 0.2621 0.4355 -0.0017 0.0422  0.0118  86  LEU A CG  
692  C CD1 . LEU A 104 ? 0.4841 0.2154 0.4011 -0.0018 0.0420  0.0151  86  LEU A CD1 
693  C CD2 . LEU A 104 ? 0.5248 0.2397 0.4221 -0.0043 0.0347  0.0140  86  LEU A CD2 
694  N N   . LEU A 105 ? 0.5893 0.3346 0.4363 -0.0114 0.0672  0.0143  87  LEU A N   
695  C CA  . LEU A 105 ? 0.6041 0.3499 0.4286 -0.0153 0.0707  0.0123  87  LEU A CA  
696  C C   . LEU A 105 ? 0.6171 0.3618 0.4307 -0.0107 0.0794  -0.0003 87  LEU A C   
697  O O   . LEU A 105 ? 0.6279 0.3690 0.4224 -0.0128 0.0812  -0.0054 87  LEU A O   
698  C CB  . LEU A 105 ? 0.6064 0.3663 0.4265 -0.0242 0.0733  0.0234  87  LEU A CB  
699  C CG  . LEU A 105 ? 0.6043 0.3640 0.4349 -0.0296 0.0640  0.0370  87  LEU A CG  
700  C CD1 . LEU A 105 ? 0.6172 0.3932 0.4464 -0.0385 0.0672  0.0497  87  LEU A CD1 
701  C CD2 . LEU A 105 ? 0.5676 0.3156 0.3888 -0.0310 0.0557  0.0375  87  LEU A CD2 
702  N N   . SER A 106 ? 0.6128 0.3607 0.4400 -0.0046 0.0843  -0.0053 88  SER A N   
703  C CA  . SER A 106 ? 0.6239 0.3702 0.4454 0.0007  0.0925  -0.0175 88  SER A CA  
704  C C   . SER A 106 ? 0.6060 0.3363 0.4302 0.0079  0.0870  -0.0251 88  SER A C   
705  O O   . SER A 106 ? 0.6089 0.3356 0.4326 0.0131  0.0924  -0.0347 88  SER A O   
706  C CB  . SER A 106 ? 0.6355 0.3955 0.4722 0.0035  0.1016  -0.0185 88  SER A CB  
707  O OG  . SER A 106 ? 0.6557 0.4134 0.5144 0.0089  0.0965  -0.0163 88  SER A OG  
708  N N   . PHE A 107 ? 0.5820 0.3032 0.4103 0.0079  0.0767  -0.0206 89  PHE A N   
709  C CA  . PHE A 107 ? 0.5720 0.2789 0.3987 0.0128  0.0710  -0.0263 89  PHE A CA  
710  C C   . PHE A 107 ? 0.5906 0.2891 0.3966 0.0104  0.0715  -0.0317 89  PHE A C   
711  O O   . PHE A 107 ? 0.5989 0.3010 0.3920 0.0039  0.0718  -0.0281 89  PHE A O   
712  C CB  . PHE A 107 ? 0.5441 0.2452 0.3778 0.0122  0.0608  -0.0208 89  PHE A CB  
713  C CG  . PHE A 107 ? 0.5357 0.2432 0.3896 0.0138  0.0583  -0.0164 89  PHE A CG  
714  C CD1 . PHE A 107 ? 0.5245 0.2415 0.3913 0.0169  0.0643  -0.0172 89  PHE A CD1 
715  C CD2 . PHE A 107 ? 0.4546 0.1587 0.3156 0.0123  0.0499  -0.0123 89  PHE A CD2 
716  C CE1 . PHE A 107 ? 0.5123 0.2354 0.3984 0.0178  0.0610  -0.0129 89  PHE A CE1 
717  C CE2 . PHE A 107 ? 0.4722 0.1816 0.3513 0.0132  0.0469  -0.0093 89  PHE A CE2 
718  C CZ  . PHE A 107 ? 0.4798 0.1987 0.3715 0.0157  0.0520  -0.0091 89  PHE A CZ  
719  N N   . ALA A 108 ? 0.5908 0.2784 0.3942 0.0152  0.0709  -0.0395 90  ALA A N   
720  C CA  . ALA A 108 ? 0.6099 0.2880 0.3955 0.0127  0.0696  -0.0442 90  ALA A CA  
721  C C   . ALA A 108 ? 0.6070 0.2722 0.3961 0.0167  0.0624  -0.0458 90  ALA A C   
722  O O   . ALA A 108 ? 0.6153 0.2788 0.4180 0.0224  0.0617  -0.0469 90  ALA A O   
723  C CB  . ALA A 108 ? 0.6215 0.3005 0.3979 0.0133  0.0790  -0.0543 90  ALA A CB  
724  N N   . TYR A 109 ? 0.6073 0.2647 0.3846 0.0131  0.0567  -0.0448 91  TYR A N   
725  C CA  . TYR A 109 ? 0.5897 0.2368 0.3697 0.0155  0.0496  -0.0445 91  TYR A CA  
726  C C   . TYR A 109 ? 0.5964 0.2340 0.3768 0.0202  0.0517  -0.0523 91  TYR A C   
727  O O   . TYR A 109 ? 0.5965 0.2311 0.3676 0.0193  0.0567  -0.0593 91  TYR A O   
728  C CB  . TYR A 109 ? 0.5777 0.2208 0.3469 0.0101  0.0436  -0.0408 91  TYR A CB  
729  C CG  . TYR A 109 ? 0.5771 0.2112 0.3483 0.0119  0.0371  -0.0404 91  TYR A CG  
730  C CD1 . TYR A 109 ? 0.5458 0.1821 0.3272 0.0132  0.0323  -0.0359 91  TYR A CD1 
731  C CD2 . TYR A 109 ? 0.5474 0.1715 0.3105 0.0119  0.0359  -0.0448 91  TYR A CD2 
732  C CE1 . TYR A 109 ? 0.5533 0.1835 0.3351 0.0142  0.0272  -0.0356 91  TYR A CE1 
733  C CE2 . TYR A 109 ? 0.5402 0.1577 0.3051 0.0129  0.0303  -0.0433 91  TYR A CE2 
734  C CZ  . TYR A 109 ? 0.5712 0.1925 0.3448 0.0139  0.0262  -0.0386 91  TYR A CZ  
735  O OH  . TYR A 109 ? 0.5800 0.1964 0.3539 0.0142  0.0211  -0.0370 91  TYR A OH  
736  N N   . ASP A 110 ? 0.5949 0.2285 0.3869 0.0249  0.0476  -0.0510 92  ASP A N   
737  C CA  . ASP A 110 ? 0.6237 0.2482 0.4207 0.0298  0.0480  -0.0561 92  ASP A CA  
738  C C   . ASP A 110 ? 0.6153 0.2313 0.4096 0.0288  0.0397  -0.0524 92  ASP A C   
739  O O   . ASP A 110 ? 0.6167 0.2355 0.4181 0.0295  0.0343  -0.0467 92  ASP A O   
740  C CB  . ASP A 110 ? 0.6231 0.2526 0.4387 0.0360  0.0502  -0.0558 92  ASP A CB  
741  C CG  . ASP A 110 ? 0.6949 0.3164 0.5186 0.0416  0.0530  -0.0620 92  ASP A CG  
742  O OD1 . ASP A 110 ? 0.6936 0.3033 0.5134 0.0416  0.0489  -0.0634 92  ASP A OD1 
743  O OD2 . ASP A 110 ? 0.7744 0.4021 0.6106 0.0460  0.0595  -0.0653 92  ASP A OD2 
744  N N   . SER A 111 ? 0.6109 0.2173 0.3943 0.0263  0.0386  -0.0557 93  SER A N   
745  C CA  . SER A 111 ? 0.6141 0.2132 0.3944 0.0245  0.0314  -0.0520 93  SER A CA  
746  C C   . SER A 111 ? 0.6143 0.2080 0.4068 0.0293  0.0280  -0.0503 93  SER A C   
747  O O   . SER A 111 ? 0.6120 0.2032 0.4041 0.0279  0.0217  -0.0450 93  SER A O   
748  C CB  . SER A 111 ? 0.6253 0.2160 0.3919 0.0201  0.0310  -0.0558 93  SER A CB  
749  O OG  . SER A 111 ? 0.6351 0.2173 0.4041 0.0230  0.0347  -0.0633 93  SER A OG  
750  N N   . THR A 112 ? 0.6227 0.2154 0.4269 0.0348  0.0321  -0.0541 94  THR A N   
751  C CA  . THR A 112 ? 0.6288 0.2179 0.4476 0.0394  0.0278  -0.0502 94  THR A CA  
752  C C   . THR A 112 ? 0.6268 0.2258 0.4552 0.0406  0.0232  -0.0426 94  THR A C   
753  O O   . THR A 112 ? 0.6606 0.2577 0.4993 0.0430  0.0177  -0.0374 94  THR A O   
754  C CB  . THR A 112 ? 0.6341 0.2191 0.4669 0.0455  0.0328  -0.0560 94  THR A CB  
755  O OG1 . THR A 112 ? 0.6400 0.2363 0.4826 0.0489  0.0379  -0.0568 94  THR A OG1 
756  C CG2 . THR A 112 ? 0.6425 0.2179 0.4670 0.0446  0.0387  -0.0665 94  THR A CG2 
757  N N   . PHE A 113 ? 0.5854 0.1948 0.4116 0.0388  0.0247  -0.0414 95  PHE A N   
758  C CA  . PHE A 113 ? 0.5606 0.1786 0.3960 0.0394  0.0199  -0.0354 95  PHE A CA  
759  C C   . PHE A 113 ? 0.5581 0.1769 0.3850 0.0348  0.0129  -0.0306 95  PHE A C   
760  O O   . PHE A 113 ? 0.5535 0.1733 0.3854 0.0352  0.0068  -0.0255 95  PHE A O   
761  C CB  . PHE A 113 ? 0.5364 0.1656 0.3785 0.0401  0.0241  -0.0360 95  PHE A CB  
762  C CG  . PHE A 113 ? 0.5159 0.1538 0.3662 0.0395  0.0184  -0.0306 95  PHE A CG  
763  C CD1 . PHE A 113 ? 0.5074 0.1504 0.3742 0.0435  0.0164  -0.0278 95  PHE A CD1 
764  C CD2 . PHE A 113 ? 0.4688 0.1102 0.3113 0.0346  0.0148  -0.0289 95  PHE A CD2 
765  C CE1 . PHE A 113 ? 0.4997 0.1514 0.3730 0.0419  0.0103  -0.0232 95  PHE A CE1 
766  C CE2 . PHE A 113 ? 0.4803 0.1295 0.3296 0.0335  0.0097  -0.0257 95  PHE A CE2 
767  C CZ  . PHE A 113 ? 0.4739 0.1284 0.3376 0.0367  0.0072  -0.0229 95  PHE A CZ  
768  N N   . PRO A 114 ? 0.5547 0.1740 0.3693 0.0302  0.0137  -0.0318 96  PRO A N   
769  C CA  . PRO A 114 ? 0.5626 0.1855 0.3727 0.0265  0.0082  -0.0282 96  PRO A CA  
770  C C   . PRO A 114 ? 0.5782 0.1944 0.3819 0.0246  0.0037  -0.0255 96  PRO A C   
771  O O   . PRO A 114 ? 0.6084 0.2155 0.4084 0.0249  0.0050  -0.0269 96  PRO A O   
772  C CB  . PRO A 114 ? 0.5478 0.1733 0.3507 0.0229  0.0107  -0.0302 96  PRO A CB  
773  C CG  . PRO A 114 ? 0.5222 0.1427 0.3198 0.0230  0.0158  -0.0336 96  PRO A CG  
774  C CD  . PRO A 114 ? 0.5553 0.1732 0.3606 0.0278  0.0189  -0.0358 96  PRO A CD  
775  N N   . THR A 115 ? 0.5647 0.1858 0.3680 0.0225  -0.0015 -0.0215 97  THR A N   
776  C CA  . THR A 115 ? 0.5476 0.1654 0.3437 0.0194  -0.0055 -0.0179 97  THR A CA  
777  C C   . THR A 115 ? 0.5293 0.1547 0.3191 0.0153  -0.0060 -0.0191 97  THR A C   
778  O O   . THR A 115 ? 0.5157 0.1485 0.3100 0.0156  -0.0056 -0.0210 97  THR A O   
779  C CB  . THR A 115 ? 0.5548 0.1734 0.3575 0.0206  -0.0111 -0.0117 97  THR A CB  
780  O OG1 . THR A 115 ? 0.6019 0.2114 0.4129 0.0249  -0.0099 -0.0115 97  THR A OG1 
781  C CG2 . THR A 115 ? 0.5548 0.1737 0.3494 0.0158  -0.0158 -0.0063 97  THR A CG2 
782  N N   . ARG A 116 ? 0.5241 0.1476 0.3051 0.0115  -0.0063 -0.0187 98  ARG A N   
783  C CA  . ARG A 116 ? 0.5229 0.1536 0.2999 0.0081  -0.0058 -0.0208 98  ARG A CA  
784  C C   . ARG A 116 ? 0.5185 0.1580 0.2948 0.0060  -0.0096 -0.0191 98  ARG A C   
785  O O   . ARG A 116 ? 0.5170 0.1563 0.2927 0.0057  -0.0135 -0.0139 98  ARG A O   
786  C CB  . ARG A 116 ? 0.5081 0.1351 0.2779 0.0049  -0.0046 -0.0207 98  ARG A CB  
787  C CG  . ARG A 116 ? 0.5347 0.1690 0.3033 0.0021  -0.0032 -0.0236 98  ARG A CG  
788  C CD  . ARG A 116 ? 0.4793 0.1096 0.2455 0.0004  -0.0012 -0.0241 98  ARG A CD  
789  N NE  . ARG A 116 ? 0.5125 0.1373 0.2725 -0.0020 -0.0027 -0.0205 98  ARG A NE  
790  C CZ  . ARG A 116 ? 0.4954 0.1241 0.2524 -0.0058 -0.0030 -0.0190 98  ARG A CZ  
791  N NH1 . ARG A 116 ? 0.4288 0.0666 0.1883 -0.0070 -0.0012 -0.0218 98  ARG A NH1 
792  N NH2 . ARG A 116 ? 0.4698 0.0931 0.2224 -0.0083 -0.0046 -0.0151 98  ARG A NH2 
793  N N   . GLY A 117 ? 0.5267 0.1742 0.3039 0.0044  -0.0088 -0.0234 99  GLY A N   
794  C CA  . GLY A 117 ? 0.5175 0.1744 0.2917 0.0014  -0.0121 -0.0234 99  GLY A CA  
795  C C   . GLY A 117 ? 0.5231 0.1853 0.3037 0.0026  -0.0154 -0.0232 99  GLY A C   
796  O O   . GLY A 117 ? 0.5378 0.2084 0.3146 -0.0007 -0.0191 -0.0229 99  GLY A O   
797  N N   . LEU A 118 ? 0.5198 0.1783 0.3097 0.0068  -0.0141 -0.0236 100 LEU A N   
798  C CA  . LEU A 118 ? 0.5129 0.1774 0.3113 0.0079  -0.0173 -0.0234 100 LEU A CA  
799  C C   . LEU A 118 ? 0.5133 0.1852 0.3133 0.0052  -0.0172 -0.0300 100 LEU A C   
800  O O   . LEU A 118 ? 0.5013 0.1721 0.3005 0.0043  -0.0133 -0.0351 100 LEU A O   
801  C CB  . LEU A 118 ? 0.4936 0.1537 0.3028 0.0129  -0.0149 -0.0224 100 LEU A CB  
802  C CG  . LEU A 118 ? 0.5310 0.1830 0.3408 0.0161  -0.0146 -0.0177 100 LEU A CG  
803  C CD1 . LEU A 118 ? 0.4755 0.1245 0.2960 0.0210  -0.0107 -0.0185 100 LEU A CD1 
804  C CD2 . LEU A 118 ? 0.4659 0.1198 0.2751 0.0150  -0.0212 -0.0107 100 LEU A CD2 
805  N N   . VAL A 119 ? 0.5181 0.1976 0.3223 0.0039  -0.0218 -0.0300 101 VAL A N   
806  C CA  . VAL A 119 ? 0.5117 0.1978 0.3187 0.0011  -0.0223 -0.0372 101 VAL A CA  
807  C C   . VAL A 119 ? 0.5135 0.1995 0.3347 0.0039  -0.0221 -0.0373 101 VAL A C   
808  O O   . VAL A 119 ? 0.5203 0.2077 0.3479 0.0061  -0.0251 -0.0319 101 VAL A O   
809  C CB  . VAL A 119 ? 0.5242 0.2204 0.3243 -0.0039 -0.0283 -0.0377 101 VAL A CB  
810  C CG1 . VAL A 119 ? 0.4935 0.1961 0.2959 -0.0074 -0.0284 -0.0477 101 VAL A CG1 
811  C CG2 . VAL A 119 ? 0.5139 0.2115 0.2991 -0.0072 -0.0287 -0.0347 101 VAL A CG2 
812  N N   . PHE A 120 ? 0.5012 0.1857 0.3291 0.0040  -0.0185 -0.0426 102 PHE A N   
813  C CA  . PHE A 120 ? 0.5010 0.1880 0.3431 0.0050  -0.0191 -0.0431 102 PHE A CA  
814  C C   . PHE A 120 ? 0.5113 0.2061 0.3577 0.0009  -0.0239 -0.0490 102 PHE A C   
815  O O   . PHE A 120 ? 0.4981 0.1940 0.3423 -0.0023 -0.0232 -0.0568 102 PHE A O   
816  C CB  . PHE A 120 ? 0.4898 0.1717 0.3396 0.0069  -0.0137 -0.0437 102 PHE A CB  
817  C CG  . PHE A 120 ? 0.4609 0.1455 0.3252 0.0081  -0.0136 -0.0415 102 PHE A CG  
818  C CD1 . PHE A 120 ? 0.4589 0.1436 0.3272 0.0117  -0.0122 -0.0356 102 PHE A CD1 
819  C CD2 . PHE A 120 ? 0.4545 0.1421 0.3302 0.0056  -0.0149 -0.0456 102 PHE A CD2 
820  C CE1 . PHE A 120 ? 0.4666 0.1557 0.3495 0.0127  -0.0115 -0.0333 102 PHE A CE1 
821  C CE2 . PHE A 120 ? 0.4416 0.1327 0.3318 0.0061  -0.0151 -0.0427 102 PHE A CE2 
822  C CZ  . PHE A 120 ? 0.4587 0.1512 0.3522 0.0096  -0.0131 -0.0362 102 PHE A CZ  
823  N N   . ASP A 121 ? 0.5226 0.2230 0.3760 0.0008  -0.0287 -0.0454 103 ASP A N   
824  C CA  . ASP A 121 ? 0.5292 0.2373 0.3877 -0.0035 -0.0341 -0.0503 103 ASP A CA  
825  C C   . ASP A 121 ? 0.5329 0.2397 0.4083 -0.0028 -0.0321 -0.0525 103 ASP A C   
826  O O   . ASP A 121 ? 0.5460 0.2538 0.4328 0.0000  -0.0317 -0.0464 103 ASP A O   
827  C CB  . ASP A 121 ? 0.5279 0.2433 0.3876 -0.0042 -0.0411 -0.0438 103 ASP A CB  
828  C CG  . ASP A 121 ? 0.5437 0.2684 0.4069 -0.0099 -0.0481 -0.0488 103 ASP A CG  
829  O OD1 . ASP A 121 ? 0.5295 0.2540 0.3965 -0.0128 -0.0470 -0.0580 103 ASP A OD1 
830  O OD2 . ASP A 121 ? 0.5690 0.3014 0.4326 -0.0117 -0.0553 -0.0435 103 ASP A OD2 
831  N N   . THR A 122 ? 0.5307 0.2355 0.4090 -0.0053 -0.0304 -0.0607 104 THR A N   
832  C CA  . THR A 122 ? 0.5252 0.2283 0.4211 -0.0053 -0.0290 -0.0619 104 THR A CA  
833  C C   . THR A 122 ? 0.5302 0.2404 0.4384 -0.0084 -0.0350 -0.0629 104 THR A C   
834  O O   . THR A 122 ? 0.5376 0.2475 0.4619 -0.0082 -0.0343 -0.0607 104 THR A O   
835  C CB  . THR A 122 ? 0.5315 0.2304 0.4309 -0.0074 -0.0267 -0.0709 104 THR A CB  
836  O OG1 . THR A 122 ? 0.5191 0.2228 0.4130 -0.0120 -0.0306 -0.0810 104 THR A OG1 
837  C CG2 . THR A 122 ? 0.4951 0.1875 0.3862 -0.0048 -0.0209 -0.0698 104 THR A CG2 
838  N N   . LEU A 123 ? 0.5329 0.2500 0.4337 -0.0120 -0.0413 -0.0657 105 LEU A N   
839  C CA  . LEU A 123 ? 0.5362 0.2612 0.4485 -0.0153 -0.0481 -0.0656 105 LEU A CA  
840  C C   . LEU A 123 ? 0.5336 0.2618 0.4565 -0.0113 -0.0485 -0.0540 105 LEU A C   
841  O O   . LEU A 123 ? 0.5250 0.2550 0.4654 -0.0112 -0.0483 -0.0516 105 LEU A O   
842  C CB  . LEU A 123 ? 0.5469 0.2799 0.4471 -0.0210 -0.0555 -0.0709 105 LEU A CB  
843  C CG  . LEU A 123 ? 0.5596 0.3015 0.4706 -0.0261 -0.0640 -0.0723 105 LEU A CG  
844  C CD1 . LEU A 123 ? 0.5897 0.3283 0.5174 -0.0285 -0.0633 -0.0800 105 LEU A CD1 
845  C CD2 . LEU A 123 ? 0.5647 0.3155 0.4605 -0.0327 -0.0714 -0.0777 105 LEU A CD2 
846  N N   . TYR A 124 ? 0.5297 0.2585 0.4434 -0.0079 -0.0483 -0.0470 106 TYR A N   
847  C CA  . TYR A 124 ? 0.5149 0.2472 0.4393 -0.0036 -0.0484 -0.0370 106 TYR A CA  
848  C C   . TYR A 124 ? 0.5024 0.2282 0.4292 0.0028  -0.0397 -0.0319 106 TYR A C   
849  O O   . TYR A 124 ? 0.4896 0.2188 0.4277 0.0067  -0.0383 -0.0251 106 TYR A O   
850  C CB  . TYR A 124 ? 0.5250 0.2632 0.4425 -0.0040 -0.0553 -0.0317 106 TYR A CB  
851  C CG  . TYR A 124 ? 0.5448 0.2927 0.4624 -0.0110 -0.0650 -0.0351 106 TYR A CG  
852  C CD1 . TYR A 124 ? 0.5542 0.3077 0.4886 -0.0138 -0.0684 -0.0367 106 TYR A CD1 
853  C CD2 . TYR A 124 ? 0.5617 0.3138 0.4624 -0.0156 -0.0709 -0.0365 106 TYR A CD2 
854  C CE1 . TYR A 124 ? 0.5939 0.3563 0.5281 -0.0210 -0.0779 -0.0408 106 TYR A CE1 
855  C CE2 . TYR A 124 ? 0.6070 0.3689 0.5058 -0.0229 -0.0800 -0.0402 106 TYR A CE2 
856  C CZ  . TYR A 124 ? 0.5914 0.3581 0.5069 -0.0256 -0.0836 -0.0429 106 TYR A CZ  
857  O OH  . TYR A 124 ? 0.6009 0.3774 0.5142 -0.0336 -0.0931 -0.0475 106 TYR A OH  
858  N N   . GLY A 125 ? 0.4894 0.2068 0.4061 0.0037  -0.0337 -0.0352 107 GLY A N   
859  C CA  . GLY A 125 ? 0.4798 0.1914 0.3965 0.0087  -0.0257 -0.0311 107 GLY A CA  
860  C C   . GLY A 125 ? 0.4927 0.2013 0.4010 0.0130  -0.0244 -0.0265 107 GLY A C   
861  O O   . GLY A 125 ? 0.4930 0.1992 0.4050 0.0174  -0.0184 -0.0230 107 GLY A O   
862  N N   . ASN A 126 ? 0.4832 0.1923 0.3806 0.0113  -0.0298 -0.0267 108 ASN A N   
863  C CA  . ASN A 126 ? 0.4830 0.1886 0.3732 0.0145  -0.0299 -0.0219 108 ASN A CA  
864  C C   . ASN A 126 ? 0.4835 0.1810 0.3569 0.0138  -0.0267 -0.0246 108 ASN A C   
865  O O   . ASN A 126 ? 0.4852 0.1828 0.3503 0.0098  -0.0276 -0.0299 108 ASN A O   
866  C CB  . ASN A 126 ? 0.4892 0.2018 0.3789 0.0122  -0.0390 -0.0178 108 ASN A CB  
867  C CG  . ASN A 126 ? 0.4849 0.2071 0.3924 0.0122  -0.0437 -0.0144 108 ASN A CG  
868  O OD1 . ASN A 126 ? 0.5260 0.2489 0.4481 0.0165  -0.0395 -0.0119 108 ASN A OD1 
869  N ND2 . ASN A 126 ? 0.3990 0.1295 0.3052 0.0070  -0.0525 -0.0143 108 ASN A ND2 
870  N N   . LEU A 127 ? 0.4836 0.1741 0.3531 0.0178  -0.0230 -0.0212 109 LEU A N   
871  C CA  . LEU A 127 ? 0.4857 0.1697 0.3399 0.0169  -0.0224 -0.0214 109 LEU A CA  
872  C C   . LEU A 127 ? 0.4967 0.1830 0.3469 0.0158  -0.0291 -0.0157 109 LEU A C   
873  O O   . LEU A 127 ? 0.4959 0.1835 0.3561 0.0190  -0.0319 -0.0097 109 LEU A O   
874  C CB  . LEU A 127 ? 0.4862 0.1608 0.3374 0.0205  -0.0155 -0.0212 109 LEU A CB  
875  C CG  . LEU A 127 ? 0.4775 0.1491 0.3276 0.0202  -0.0092 -0.0253 109 LEU A CG  
876  C CD1 . LEU A 127 ? 0.4914 0.1570 0.3415 0.0239  -0.0033 -0.0245 109 LEU A CD1 
877  C CD2 . LEU A 127 ? 0.4567 0.1260 0.2958 0.0164  -0.0089 -0.0292 109 LEU A CD2 
878  N N   . LEU A 128 ? 0.5083 0.1960 0.3448 0.0112  -0.0317 -0.0172 110 LEU A N   
879  C CA  . LEU A 128 ? 0.5170 0.2091 0.3472 0.0082  -0.0387 -0.0112 110 LEU A CA  
880  C C   . LEU A 128 ? 0.5219 0.2073 0.3395 0.0073  -0.0367 -0.0095 110 LEU A C   
881  O O   . LEU A 128 ? 0.5259 0.2083 0.3354 0.0059  -0.0318 -0.0154 110 LEU A O   
882  C CB  . LEU A 128 ? 0.5167 0.2194 0.3403 0.0018  -0.0436 -0.0151 110 LEU A CB  
883  C CG  . LEU A 128 ? 0.5345 0.2443 0.3696 0.0009  -0.0463 -0.0187 110 LEU A CG  
884  C CD1 . LEU A 128 ? 0.4967 0.2161 0.3225 -0.0064 -0.0506 -0.0251 110 LEU A CD1 
885  C CD2 . LEU A 128 ? 0.5092 0.2228 0.3583 0.0037  -0.0517 -0.0100 110 LEU A CD2 
886  N N   . LYS A 129 ? 0.5276 0.2108 0.3456 0.0081  -0.0407 -0.0009 111 LYS A N   
887  C CA  . LYS A 129 ? 0.5388 0.2185 0.3447 0.0052  -0.0412 0.0026  111 LYS A CA  
888  C C   . LYS A 129 ? 0.5458 0.2368 0.3432 -0.0013 -0.0490 0.0081  111 LYS A C   
889  O O   . LYS A 129 ? 0.5511 0.2478 0.3561 -0.0015 -0.0561 0.0152  111 LYS A O   
890  C CB  . LYS A 129 ? 0.5474 0.2166 0.3606 0.0099  -0.0409 0.0092  111 LYS A CB  
891  C CG  . LYS A 129 ? 0.5735 0.2355 0.3763 0.0077  -0.0397 0.0117  111 LYS A CG  
892  C CD  . LYS A 129 ? 0.5972 0.2508 0.4100 0.0110  -0.0430 0.0205  111 LYS A CD  
893  C CE  . LYS A 129 ? 0.5869 0.2279 0.3965 0.0126  -0.0379 0.0180  111 LYS A CE  
894  N NZ  . LYS A 129 ? 0.5496 0.1798 0.3720 0.0170  -0.0395 0.0233  111 LYS A NZ  
895  N N   . VAL A 130 ? 0.5451 0.2403 0.3273 -0.0069 -0.0478 0.0052  112 VAL A N   
896  C CA  . VAL A 130 ? 0.5597 0.2680 0.3308 -0.0143 -0.0541 0.0088  112 VAL A CA  
897  C C   . VAL A 130 ? 0.5717 0.2808 0.3298 -0.0189 -0.0543 0.0145  112 VAL A C   
898  O O   . VAL A 130 ? 0.5603 0.2603 0.3167 -0.0169 -0.0485 0.0127  112 VAL A O   
899  C CB  . VAL A 130 ? 0.5538 0.2720 0.3186 -0.0185 -0.0527 -0.0028 112 VAL A CB  
900  C CG1 . VAL A 130 ? 0.5364 0.2540 0.3155 -0.0146 -0.0531 -0.0070 112 VAL A CG1 
901  C CG2 . VAL A 130 ? 0.5264 0.2418 0.2837 -0.0191 -0.0441 -0.0131 112 VAL A CG2 
902  N N   . ASP A 131 ? 0.5892 0.3099 0.3384 -0.0257 -0.0613 0.0222  113 ASP A N   
903  C CA  . ASP A 131 ? 0.6111 0.3360 0.3465 -0.0317 -0.0613 0.0277  113 ASP A CA  
904  C C   . ASP A 131 ? 0.6221 0.3582 0.3422 -0.0376 -0.0562 0.0160  113 ASP A C   
905  O O   . ASP A 131 ? 0.6095 0.3480 0.3317 -0.0364 -0.0532 0.0039  113 ASP A O   
906  C CB  . ASP A 131 ? 0.6351 0.3666 0.3696 -0.0363 -0.0716 0.0440  113 ASP A CB  
907  C CG  . ASP A 131 ? 0.6826 0.4315 0.4090 -0.0433 -0.0790 0.0454  113 ASP A CG  
908  O OD1 . ASP A 131 ? 0.7223 0.4794 0.4413 -0.0458 -0.0758 0.0324  113 ASP A OD1 
909  O OD2 . ASP A 131 ? 0.7298 0.4846 0.4578 -0.0468 -0.0887 0.0601  113 ASP A OD2 
910  N N   . ALA A 132 ? 0.6349 0.3779 0.3413 -0.0438 -0.0547 0.0193  114 ALA A N   
911  C CA  . ALA A 132 ? 0.6417 0.3963 0.3344 -0.0493 -0.0484 0.0073  114 ALA A CA  
912  C C   . ALA A 132 ? 0.6514 0.4215 0.3350 -0.0554 -0.0522 0.0016  114 ALA A C   
913  O O   . ALA A 132 ? 0.6667 0.4450 0.3424 -0.0586 -0.0463 -0.0119 114 ALA A O   
914  C CB  . ALA A 132 ? 0.6469 0.4073 0.3274 -0.0551 -0.0458 0.0134  114 ALA A CB  
915  N N   . TYR A 133 ? 0.6581 0.4327 0.3438 -0.0573 -0.0621 0.0115  115 TYR A N   
916  C CA  . TYR A 133 ? 0.6711 0.4620 0.3466 -0.0647 -0.0677 0.0077  115 TYR A CA  
917  C C   . TYR A 133 ? 0.6602 0.4479 0.3488 -0.0604 -0.0705 0.0004  115 TYR A C   
918  O O   . TYR A 133 ? 0.6726 0.4727 0.3552 -0.0663 -0.0762 -0.0030 115 TYR A O   
919  C CB  . TYR A 133 ? 0.6932 0.4960 0.3594 -0.0725 -0.0781 0.0252  115 TYR A CB  
920  C CG  . TYR A 133 ? 0.7168 0.5271 0.3670 -0.0789 -0.0741 0.0296  115 TYR A CG  
921  C CD1 . TYR A 133 ? 0.7321 0.5602 0.3620 -0.0882 -0.0705 0.0204  115 TYR A CD1 
922  C CD2 . TYR A 133 ? 0.7026 0.5019 0.3587 -0.0758 -0.0727 0.0410  115 TYR A CD2 
923  C CE1 . TYR A 133 ? 0.7594 0.5961 0.3752 -0.0943 -0.0655 0.0234  115 TYR A CE1 
924  C CE2 . TYR A 133 ? 0.7126 0.5194 0.3553 -0.0821 -0.0684 0.0448  115 TYR A CE2 
925  C CZ  . TYR A 133 ? 0.7601 0.5862 0.3826 -0.0913 -0.0646 0.0362  115 TYR A CZ  
926  O OH  . TYR A 133 ? 0.7860 0.6224 0.3949 -0.0982 -0.0595 0.0395  115 TYR A OH  
927  N N   . GLY A 134 ? 0.6384 0.4103 0.3442 -0.0509 -0.0663 -0.0023 116 GLY A N   
928  C CA  . GLY A 134 ? 0.6252 0.3933 0.3453 -0.0464 -0.0676 -0.0090 116 GLY A CA  
929  C C   . GLY A 134 ? 0.6272 0.3919 0.3624 -0.0425 -0.0759 0.0038  116 GLY A C   
930  O O   . GLY A 134 ? 0.6318 0.3943 0.3805 -0.0388 -0.0772 -0.0002 116 GLY A O   
931  N N   . ASN A 135 ? 0.6283 0.3928 0.3632 -0.0432 -0.0815 0.0192  117 ASN A N   
932  C CA  . ASN A 135 ? 0.6332 0.3953 0.3846 -0.0394 -0.0897 0.0322  117 ASN A CA  
933  C C   . ASN A 135 ? 0.6144 0.3600 0.3843 -0.0288 -0.0838 0.0306  117 ASN A C   
934  O O   . ASN A 135 ? 0.6104 0.3451 0.3788 -0.0253 -0.0764 0.0282  117 ASN A O   
935  C CB  . ASN A 135 ? 0.6442 0.4101 0.3918 -0.0434 -0.0976 0.0498  117 ASN A CB  
936  C CG  . ASN A 135 ? 0.6842 0.4689 0.4112 -0.0552 -0.1041 0.0531  117 ASN A CG  
937  O OD1 . ASN A 135 ? 0.7144 0.5114 0.4386 -0.0602 -0.1107 0.0513  117 ASN A OD1 
938  N ND2 . ASN A 135 ? 0.6954 0.4831 0.4077 -0.0604 -0.1023 0.0582  117 ASN A ND2 
939  N N   . LEU A 136 ? 0.6155 0.3603 0.4028 -0.0242 -0.0869 0.0318  118 LEU A N   
940  C CA  . LEU A 136 ? 0.6134 0.3452 0.4183 -0.0147 -0.0807 0.0291  118 LEU A CA  
941  C C   . LEU A 136 ? 0.6159 0.3388 0.4315 -0.0098 -0.0826 0.0409  118 LEU A C   
942  O O   . LEU A 136 ? 0.6268 0.3550 0.4499 -0.0111 -0.0918 0.0532  118 LEU A O   
943  C CB  . LEU A 136 ? 0.6055 0.3421 0.4267 -0.0122 -0.0839 0.0275  118 LEU A CB  
944  C CG  . LEU A 136 ? 0.6371 0.3731 0.4625 -0.0106 -0.0778 0.0144  118 LEU A CG  
945  C CD1 . LEU A 136 ? 0.6374 0.3770 0.4455 -0.0166 -0.0739 0.0019  118 LEU A CD1 
946  C CD2 . LEU A 136 ? 0.6222 0.3676 0.4625 -0.0111 -0.0851 0.0173  118 LEU A CD2 
947  N N   . LEU A 137 ? 0.6078 0.3170 0.4254 -0.0044 -0.0743 0.0372  119 LEU A N   
948  C CA  . LEU A 137 ? 0.6033 0.3019 0.4322 0.0006  -0.0751 0.0462  119 LEU A CA  
949  C C   . LEU A 137 ? 0.5981 0.2890 0.4472 0.0096  -0.0705 0.0428  119 LEU A C   
950  O O   . LEU A 137 ? 0.5990 0.2862 0.4650 0.0141  -0.0741 0.0510  119 LEU A O   
951  C CB  . LEU A 137 ? 0.5952 0.2839 0.4123 -0.0003 -0.0698 0.0449  119 LEU A CB  
952  C CG  . LEU A 137 ? 0.5861 0.2829 0.3831 -0.0091 -0.0723 0.0479  119 LEU A CG  
953  C CD1 . LEU A 137 ? 0.5576 0.2444 0.3462 -0.0093 -0.0661 0.0458  119 LEU A CD1 
954  C CD2 . LEU A 137 ? 0.5787 0.2842 0.3766 -0.0141 -0.0835 0.0631  119 LEU A CD2 
955  N N   . VAL A 138 ? 0.5848 0.2740 0.4329 0.0119  -0.0625 0.0311  120 VAL A N   
956  C CA  . VAL A 138 ? 0.5765 0.2598 0.4407 0.0194  -0.0562 0.0265  120 VAL A CA  
957  C C   . VAL A 138 ? 0.5804 0.2707 0.4442 0.0182  -0.0531 0.0177  120 VAL A C   
958  O O   . VAL A 138 ? 0.5680 0.2602 0.4178 0.0138  -0.0507 0.0109  120 VAL A O   
959  C CB  . VAL A 138 ? 0.5786 0.2475 0.4400 0.0236  -0.0473 0.0212  120 VAL A CB  
960  C CG1 . VAL A 138 ? 0.5872 0.2519 0.4639 0.0307  -0.0403 0.0164  120 VAL A CG1 
961  C CG2 . VAL A 138 ? 0.5499 0.2107 0.4112 0.0239  -0.0504 0.0289  120 VAL A CG2 
962  N N   . CYS A 139 ? 0.5940 0.2886 0.4754 0.0221  -0.0533 0.0182  121 CYS A N   
963  C CA  . CYS A 139 ? 0.5744 0.2747 0.4590 0.0213  -0.0502 0.0109  121 CYS A CA  
964  C C   . CYS A 139 ? 0.5572 0.2538 0.4581 0.0283  -0.0425 0.0086  121 CYS A C   
965  O O   . CYS A 139 ? 0.5453 0.2428 0.4630 0.0331  -0.0438 0.0140  121 CYS A O   
966  C CB  . CYS A 139 ? 0.5818 0.2955 0.4714 0.0167  -0.0595 0.0142  121 CYS A CB  
967  S SG  . CYS A 139 ? 0.6255 0.3457 0.5222 0.0151  -0.0566 0.0055  121 CYS A SG  
968  N N   . ALA A 140 ? 0.5464 0.2394 0.4426 0.0287  -0.0344 0.0008  122 ALA A N   
969  C CA  . ALA A 140 ? 0.5315 0.2232 0.4404 0.0339  -0.0264 -0.0019 122 ALA A CA  
970  C C   . ALA A 140 ? 0.5240 0.2215 0.4349 0.0312  -0.0236 -0.0067 122 ALA A C   
971  O O   . ALA A 140 ? 0.5269 0.2223 0.4252 0.0272  -0.0227 -0.0113 122 ALA A O   
972  C CB  . ALA A 140 ? 0.5192 0.1996 0.4209 0.0371  -0.0183 -0.0054 122 ALA A CB  
973  N N   . HIS A 141 ? 0.5206 0.2255 0.4492 0.0336  -0.0224 -0.0052 123 HIS A N   
974  C CA  . HIS A 141 ? 0.5195 0.2296 0.4538 0.0316  -0.0189 -0.0085 123 HIS A CA  
975  C C   . HIS A 141 ? 0.5176 0.2252 0.4571 0.0360  -0.0082 -0.0102 123 HIS A C   
976  O O   . HIS A 141 ? 0.5297 0.2405 0.4832 0.0409  -0.0055 -0.0078 123 HIS A O   
977  C CB  . HIS A 141 ? 0.5173 0.2392 0.4692 0.0305  -0.0252 -0.0047 123 HIS A CB  
978  C CG  . HIS A 141 ? 0.5455 0.2732 0.5054 0.0275  -0.0232 -0.0072 123 HIS A CG  
979  N ND1 . HIS A 141 ? 0.5454 0.2729 0.4973 0.0215  -0.0265 -0.0116 123 HIS A ND1 
980  C CD2 . HIS A 141 ? 0.5652 0.2994 0.5416 0.0294  -0.0179 -0.0057 123 HIS A CD2 
981  C CE1 . HIS A 141 ? 0.5494 0.2818 0.5134 0.0198  -0.0242 -0.0122 123 HIS A CE1 
982  N NE2 . HIS A 141 ? 0.5389 0.2761 0.5172 0.0243  -0.0189 -0.0082 123 HIS A NE2 
983  N N   . GLY A 142 ? 0.5157 0.2188 0.4447 0.0342  -0.0022 -0.0141 124 GLY A N   
984  C CA  . GLY A 142 ? 0.4998 0.2001 0.4282 0.0374  0.0078  -0.0160 124 GLY A CA  
985  C C   . GLY A 142 ? 0.5206 0.2128 0.4447 0.0419  0.0094  -0.0166 124 GLY A C   
986  O O   . GLY A 142 ? 0.5151 0.1994 0.4262 0.0407  0.0055  -0.0169 124 GLY A O   
987  N N   . PHE A 143 ? 0.5119 0.2064 0.4482 0.0472  0.0153  -0.0170 125 PHE A N   
988  C CA  . PHE A 143 ? 0.5273 0.2137 0.4637 0.0519  0.0166  -0.0180 125 PHE A CA  
989  C C   . PHE A 143 ? 0.5346 0.2243 0.4893 0.0561  0.0107  -0.0129 125 PHE A C   
990  O O   . PHE A 143 ? 0.5516 0.2353 0.5129 0.0611  0.0127  -0.0136 125 PHE A O   
991  C CB  . PHE A 143 ? 0.5239 0.2077 0.4590 0.0550  0.0280  -0.0240 125 PHE A CB  
992  C CG  . PHE A 143 ? 0.5215 0.2022 0.4376 0.0502  0.0325  -0.0276 125 PHE A CG  
993  C CD1 . PHE A 143 ? 0.5130 0.1846 0.4112 0.0464  0.0282  -0.0280 125 PHE A CD1 
994  C CD2 . PHE A 143 ? 0.5183 0.2063 0.4353 0.0490  0.0408  -0.0295 125 PHE A CD2 
995  C CE1 . PHE A 143 ? 0.4926 0.1620 0.3757 0.0421  0.0317  -0.0303 125 PHE A CE1 
996  C CE2 . PHE A 143 ? 0.5235 0.2093 0.4235 0.0440  0.0437  -0.0310 125 PHE A CE2 
997  C CZ  . PHE A 143 ? 0.4944 0.1707 0.3784 0.0408  0.0389  -0.0314 125 PHE A CZ  
998  N N   A ASN A 144 ? 0.5316 0.2308 0.4957 0.0537  0.0032  -0.0078 126 ASN A N   
999  N N   B ASN A 144 ? 0.5303 0.2292 0.4940 0.0537  0.0030  -0.0078 126 ASN A N   
1000 C CA  A ASN A 144 ? 0.5381 0.2424 0.5199 0.0564  -0.0046 -0.0011 126 ASN A CA  
1001 C CA  B ASN A 144 ? 0.5356 0.2394 0.5172 0.0566  -0.0043 -0.0012 126 ASN A CA  
1002 C C   A ASN A 144 ? 0.5429 0.2435 0.5127 0.0522  -0.0155 0.0035  126 ASN A C   
1003 C C   B ASN A 144 ? 0.5414 0.2424 0.5121 0.0523  -0.0156 0.0038  126 ASN A C   
1004 O O   A ASN A 144 ? 0.5329 0.2357 0.4892 0.0459  -0.0199 0.0027  126 ASN A O   
1005 O O   B ASN A 144 ? 0.5315 0.2357 0.4902 0.0460  -0.0205 0.0033  126 ASN A O   
1006 C CB  A ASN A 144 ? 0.5394 0.2580 0.5391 0.0555  -0.0072 0.0024  126 ASN A CB  
1007 C CB  B ASN A 144 ? 0.5358 0.2539 0.5369 0.0566  -0.0058 0.0020  126 ASN A CB  
1008 C CG  A ASN A 144 ? 0.5555 0.2811 0.5753 0.0580  -0.0162 0.0105  126 ASN A CG  
1009 C CG  B ASN A 144 ? 0.5419 0.2650 0.5555 0.0607  0.0061  -0.0020 126 ASN A CG  
1010 O OD1 A ASN A 144 ? 0.5969 0.3179 0.6268 0.0635  -0.0162 0.0131  126 ASN A OD1 
1011 O OD1 B ASN A 144 ? 0.5395 0.2604 0.5642 0.0672  0.0123  -0.0038 126 ASN A OD1 
1012 N ND2 A ASN A 144 ? 0.5573 0.2938 0.5839 0.0535  -0.0245 0.0148  126 ASN A ND2 
1013 N ND2 B ASN A 144 ? 0.5407 0.2706 0.5525 0.0568  0.0096  -0.0036 126 ASN A ND2 
1014 N N   . PHE A 145 ? 1.0370 0.7050 0.7660 0.1636  0.2926  -0.0049 127 PHE A N   
1015 C CA  . PHE A 145 ? 1.0526 0.7228 0.7510 0.0549  0.2580  -0.0260 127 PHE A CA  
1016 C C   . PHE A 145 ? 1.0264 0.7851 0.7985 0.0929  0.2460  0.0289  127 PHE A C   
1017 O O   . PHE A 145 ? 1.1690 0.8328 0.8548 0.1971  0.2524  0.0793  127 PHE A O   
1018 C CB  . PHE A 145 ? 1.3089 0.7119 0.7533 -0.0046 0.2563  -0.0501 127 PHE A CB  
1019 C CG  . PHE A 145 ? 1.3151 0.7081 0.7402 -0.0806 0.2357  -0.1306 127 PHE A CG  
1020 C CD1 . PHE A 145 ? 1.3480 0.6747 0.7367 0.0174  0.2354  -0.1403 127 PHE A CD1 
1021 C CD2 . PHE A 145 ? 1.3026 0.7751 0.7530 -0.2421 0.2163  -0.2027 127 PHE A CD2 
1022 C CE1 . PHE A 145 ? 1.3699 0.6847 0.7260 -0.0295 0.1889  -0.2254 127 PHE A CE1 
1023 C CE2 . PHE A 145 ? 1.3205 0.8535 0.7979 -0.3014 0.1767  -0.2924 127 PHE A CE2 
1024 C CZ  . PHE A 145 ? 1.3668 0.8093 0.7873 -0.1865 0.1491  -0.3062 127 PHE A CZ  
1025 N N   . ILE A 146 ? 0.8697 0.8147 0.7944 0.0264  0.2181  0.0118  128 ILE A N   
1026 C CA  . ILE A 146 ? 0.8563 0.8907 0.8463 0.0390  0.1793  0.0456  128 ILE A CA  
1027 C C   . ILE A 146 ? 1.0791 0.9120 0.8452 0.0057  0.1668  0.0507  128 ILE A C   
1028 O O   . ILE A 146 ? 1.1547 0.8863 0.8031 -0.1049 0.1920  0.0092  128 ILE A O   
1029 C CB  . ILE A 146 ? 0.6775 0.8892 0.8140 -0.0363 0.1497  0.0143  128 ILE A CB  
1030 C CG1 . ILE A 146 ? 0.5509 0.8541 0.7991 -0.0309 0.1727  -0.0080 128 ILE A CG1 
1031 C CG2 . ILE A 146 ? 0.6655 0.9730 0.8809 -0.0183 0.0910  0.0465  128 ILE A CG2 
1032 C CD1 . ILE A 146 ? 0.5352 0.8892 0.8802 0.0468  0.2102  0.0392  128 ILE A CD1 
1033 N N   . ARG A 147 ? 1.2234 0.9964 0.9181 0.0996  0.1295  0.0964  129 ARG A N   
1034 C CA  . ARG A 147 ? 1.5040 1.0192 0.9166 0.0773  0.1162  0.1046  129 ARG A CA  
1035 C C   . ARG A 147 ? 1.5623 1.1161 0.9701 0.1465  0.0375  0.1293  129 ARG A C   
1036 O O   . ARG A 147 ? 1.3986 1.2079 1.0503 0.2184  -0.0171 0.1414  129 ARG A O   
1037 C CB  . ARG A 147 ? 1.8261 1.0078 0.9314 0.1399  0.1448  0.1261  129 ARG A CB  
1038 C CG  . ARG A 147 ? 1.9196 1.1047 1.0254 0.3492  0.1212  0.1708  129 ARG A CG  
1039 C CD  . ARG A 147 ? 2.2856 1.0764 1.0257 0.4064  0.1570  0.1838  129 ARG A CD  
1040 N NE  . ARG A 147 ? 2.2196 1.0295 1.0254 0.3853  0.2091  0.1661  129 ARG A NE  
1041 C CZ  . ARG A 147 ? 2.1531 0.9327 0.9626 0.2124  0.2391  0.1162  129 ARG A CZ  
1042 N NH1 . ARG A 147 ? 2.1325 0.9029 0.9184 0.0287  0.2431  0.0775  129 ARG A NH1 
1043 N NH2 . ARG A 147 ? 2.1187 0.8922 0.9564 0.2342  0.2651  0.0996  129 ARG A NH2 
1044 N N   . GLY A 148 ? 1.8321 1.1202 0.9470 0.1098  0.0331  0.1317  130 GLY A N   
1045 C CA  . GLY A 148 ? 2.0012 1.2200 0.9990 0.1987  -0.0555 0.1522  130 GLY A CA  
1046 C C   . GLY A 148 ? 1.7532 1.2991 1.0528 0.2164  -0.1427 0.1432  130 GLY A C   
1047 O O   . GLY A 148 ? 1.5569 1.2387 0.9926 0.0963  -0.1226 0.1142  130 GLY A O   
1048 N N   . PRO A 149 ? 1.7947 1.4686 1.1895 0.3697  -0.2462 0.1619  131 PRO A N   
1049 C CA  . PRO A 149 ? 1.6313 1.6050 1.2969 0.3768  -0.3538 0.1488  131 PRO A CA  
1050 C C   . PRO A 149 ? 1.2890 1.5502 1.2846 0.2484  -0.3148 0.1290  131 PRO A C   
1051 O O   . PRO A 149 ? 1.2254 1.5649 1.2907 0.1695  -0.3724 0.1076  131 PRO A O   
1052 C CB  . PRO A 149 ? 1.7070 1.8516 1.4924 0.5670  -0.4389 0.1645  131 PRO A CB  
1053 C CG  . PRO A 149 ? 2.0571 1.8307 1.4523 0.6968  -0.4174 0.1874  131 PRO A CG  
1054 C CD  . PRO A 149 ? 2.0498 1.5827 1.2769 0.5569  -0.2733 0.1901  131 PRO A CD  
1055 N N   . GLU A 150 ? 1.1305 1.4908 1.2688 0.2370  -0.2218 0.1353  132 GLU A N   
1056 C CA  . GLU A 150 ? 0.8789 1.4509 1.2680 0.1365  -0.1822 0.1191  132 GLU A CA  
1057 C C   . GLU A 150 ? 0.7993 1.2630 1.0940 0.0125  -0.1342 0.0842  132 GLU A C   
1058 O O   . GLU A 150 ? 0.6725 1.2440 1.0889 -0.0602 -0.1384 0.0639  132 GLU A O   
1059 C CB  . GLU A 150 ? 0.7942 1.4855 1.3342 0.1876  -0.0983 0.1383  132 GLU A CB  
1060 C CG  . GLU A 150 ? 0.9778 1.4806 1.3254 0.3066  -0.0525 0.1611  132 GLU A CG  
1061 C CD  . GLU A 150 ? 0.9365 1.4164 1.3071 0.3144  0.0543  0.1658  132 GLU A CD  
1062 O OE1 . GLU A 150 ? 1.0177 1.2631 1.1819 0.2758  0.0996  0.1500  132 GLU A OE1 
1063 O OE2 . GLU A 150 ? 0.8445 1.5387 1.4322 0.3512  0.0945  0.1817  132 GLU A OE2 
1064 N N   . THR A 151 ? 0.9056 1.1563 0.9720 -0.0097 -0.0870 0.0732  133 THR A N   
1065 C CA  . THR A 151 ? 0.8591 1.0606 0.8488 -0.1111 -0.0430 0.0302  133 THR A CA  
1066 C C   . THR A 151 ? 0.9057 1.0955 0.8373 -0.1396 -0.1091 0.0180  133 THR A C   
1067 O O   . THR A 151 ? 0.8168 1.0698 0.7890 -0.1885 -0.1055 -0.0159 133 THR A O   
1068 C CB  . THR A 151 ? 1.0159 1.0226 0.7908 -0.1569 0.0320  0.0177  133 THR A CB  
1069 O OG1 . THR A 151 ? 0.9855 0.9802 0.7907 -0.1493 0.0855  0.0141  133 THR A OG1 
1070 C CG2 . THR A 151 ? 0.9933 1.0228 0.7258 -0.2555 0.0795  -0.0329 133 THR A CG2 
1071 N N   . ARG A 152 ? 1.0870 1.1614 0.8822 -0.0877 -0.1780 0.0431  134 ARG A N   
1072 C CA  . ARG A 152 ? 1.2034 1.2008 0.8748 -0.0967 -0.2552 0.0335  134 ARG A CA  
1073 C C   . ARG A 152 ? 1.0831 1.2522 0.9422 -0.1156 -0.3508 0.0216  134 ARG A C   
1074 O O   . ARG A 152 ? 1.1854 1.2738 0.9290 -0.1392 -0.4121 0.0034  134 ARG A O   
1075 C CB  . ARG A 152 ? 1.4878 1.2841 0.9303 -0.0101 -0.3250 0.0608  134 ARG A CB  
1076 C CG  . ARG A 152 ? 1.7211 1.2350 0.8652 -0.0186 -0.2266 0.0736  134 ARG A CG  
1077 C CD  . ARG A 152 ? 2.0456 1.3265 0.9375 0.1104  -0.3091 0.1051  134 ARG A CD  
1078 N NE  . ARG A 152 ? 2.3592 1.2859 0.8937 0.0946  -0.2112 0.1226  134 ARG A NE  
1079 C CZ  . ARG A 152 ? 2.6767 1.2878 0.8539 0.0353  -0.1516 0.1232  134 ARG A CZ  
1080 N NH1 . ARG A 152 ? 2.7065 1.3146 0.8310 0.0102  -0.1823 0.1072  134 ARG A NH1 
1081 N NH2 . ARG A 152 ? 3.0002 1.2637 0.8363 -0.0061 -0.0518 0.1403  134 ARG A NH2 
1082 N N   . GLU A 153 ? 0.9088 1.2842 1.0252 -0.1144 -0.3557 0.0316  135 GLU A N   
1083 C CA  . GLU A 153 ? 0.8251 1.3436 1.1113 -0.1778 -0.4172 0.0185  135 GLU A CA  
1084 C C   . GLU A 153 ? 0.7817 1.2173 0.9828 -0.2471 -0.3678 -0.0155 135 GLU A C   
1085 O O   . GLU A 153 ? 0.8631 1.2524 1.0152 -0.2977 -0.4404 -0.0342 135 GLU A O   
1086 C CB  . GLU A 153 ? 0.6950 1.4492 1.2631 -0.1749 -0.3957 0.0394  135 GLU A CB  
1087 C CG  . GLU A 153 ? 0.6972 1.6107 1.4487 -0.2697 -0.4691 0.0288  135 GLU A CG  
1088 C CD  . GLU A 153 ? 0.6622 1.8809 1.7141 -0.2460 -0.4964 0.0474  135 GLU A CD  
1089 O OE1 . GLU A 153 ? 0.5830 1.9004 1.7431 -0.1815 -0.3954 0.0726  135 GLU A OE1 
1090 O OE2 . GLU A 153 ? 0.7331 2.1087 1.9170 -0.2887 -0.6218 0.0313  135 GLU A OE2 
1091 N N   . GLN A 154 ? 0.6869 1.0930 0.8496 -0.2387 -0.2574 -0.0299 136 GLN A N   
1092 C CA  . GLN A 154 ? 0.6569 1.0110 0.7346 -0.2601 -0.2140 -0.0736 136 GLN A CA  
1093 C C   . GLN A 154 ? 0.7511 1.0181 0.6461 -0.2459 -0.1727 -0.1061 136 GLN A C   
1094 O O   . GLN A 154 ? 0.7927 1.0203 0.5843 -0.2361 -0.1644 -0.1479 136 GLN A O   
1095 C CB  . GLN A 154 ? 0.5259 0.9441 0.6987 -0.2487 -0.1332 -0.0846 136 GLN A CB  
1096 C CG  . GLN A 154 ? 0.4739 0.9527 0.7890 -0.2742 -0.1362 -0.0589 136 GLN A CG  
1097 C CD  . GLN A 154 ? 0.3853 0.8744 0.7385 -0.2404 -0.0498 -0.0645 136 GLN A CD  
1098 O OE1 . GLN A 154 ? 0.3203 0.8024 0.6334 -0.2021 -0.0075 -0.0855 136 GLN A OE1 
1099 N NE2 . GLN A 154 ? 0.3551 0.8416 0.7641 -0.2653 -0.0227 -0.0490 136 GLN A NE2 
1100 N N   . TYR A 155 ? 0.7449 0.4518 0.5594 -0.0499 -0.2034 0.0377  137 TYR A N   
1101 C CA  . TYR A 155 ? 0.7735 0.4760 0.5412 -0.0550 -0.1988 0.0385  137 TYR A CA  
1102 C C   . TYR A 155 ? 0.8239 0.5336 0.5738 -0.0670 -0.2237 0.0566  137 TYR A C   
1103 O O   . TYR A 155 ? 0.8272 0.5402 0.5912 -0.0643 -0.2306 0.0771  137 TYR A O   
1104 C CB  . TYR A 155 ? 0.7349 0.4328 0.5103 -0.0438 -0.1800 0.0428  137 TYR A CB  
1105 C CG  . TYR A 155 ? 0.6835 0.3758 0.4785 -0.0329 -0.1582 0.0276  137 TYR A CG  
1106 C CD1 . TYR A 155 ? 0.6293 0.3143 0.3976 -0.0335 -0.1425 0.0087  137 TYR A CD1 
1107 C CD2 . TYR A 155 ? 0.6286 0.3239 0.4696 -0.0225 -0.1535 0.0321  137 TYR A CD2 
1108 C CE1 . TYR A 155 ? 0.6336 0.3139 0.4200 -0.0245 -0.1247 -0.0025 137 TYR A CE1 
1109 C CE2 . TYR A 155 ? 0.6150 0.3065 0.4704 -0.0142 -0.1342 0.0195  137 TYR A CE2 
1110 C CZ  . TYR A 155 ? 0.6239 0.3078 0.4516 -0.0155 -0.1210 0.0036  137 TYR A CZ  
1111 O OH  . TYR A 155 ? 0.6007 0.2813 0.4432 -0.0082 -0.1042 -0.0060 137 TYR A OH  
1112 N N   . PRO A 156 ? 0.8708 0.5829 0.5905 -0.0808 -0.2381 0.0492  138 PRO A N   
1113 C CA  . PRO A 156 ? 0.9153 0.6366 0.6219 -0.0943 -0.2668 0.0668  138 PRO A CA  
1114 C C   . PRO A 156 ? 0.9415 0.6654 0.6281 -0.0978 -0.2726 0.0888  138 PRO A C   
1115 O O   . PRO A 156 ? 0.9650 0.6965 0.6762 -0.0995 -0.2938 0.1132  138 PRO A O   
1116 C CB  . PRO A 156 ? 0.9478 0.6678 0.6087 -0.1092 -0.2725 0.0476  138 PRO A CB  
1117 C CG  . PRO A 156 ? 0.9198 0.6316 0.5976 -0.1014 -0.2546 0.0237  138 PRO A CG  
1118 C CD  . PRO A 156 ? 0.8754 0.5810 0.5722 -0.0852 -0.2287 0.0230  138 PRO A CD  
1119 N N   . ASN A 157 ? 0.9442 0.6628 0.5910 -0.0991 -0.2548 0.0822  139 ASN A N   
1120 C CA  . ASN A 157 ? 0.9613 0.6829 0.5902 -0.1038 -0.2607 0.1051  139 ASN A CA  
1121 C C   . ASN A 157 ? 0.9193 0.6348 0.5777 -0.0887 -0.2422 0.1118  139 ASN A C   
1122 O O   . ASN A 157 ? 0.9303 0.6455 0.5701 -0.0916 -0.2392 0.1254  139 ASN A O   
1123 C CB  . ASN A 157 ? 1.0059 0.7289 0.5675 -0.1191 -0.2570 0.0981  139 ASN A CB  
1124 C CG  . ASN A 157 ? 1.0785 0.8101 0.6062 -0.1382 -0.2834 0.1018  139 ASN A CG  
1125 O OD1 . ASN A 157 ? 1.0982 0.8294 0.6232 -0.1423 -0.2883 0.0830  139 ASN A OD1 
1126 N ND2 . ASN A 157 ? 1.0988 0.8383 0.5990 -0.1512 -0.3008 0.1261  139 ASN A ND2 
1127 N N   . LYS A 158 ? 0.8717 0.5833 0.5764 -0.0740 -0.2312 0.1030  140 LYS A N   
1128 C CA  . LYS A 158 ? 0.8370 0.5414 0.5648 -0.0594 -0.2081 0.0989  140 LYS A CA  
1129 C C   . LYS A 158 ? 0.8234 0.5220 0.5103 -0.0606 -0.1857 0.0838  140 LYS A C   
1130 O O   . LYS A 158 ? 0.8075 0.5031 0.4908 -0.0573 -0.1752 0.0912  140 LYS A O   
1131 C CB  . LYS A 158 ? 0.8335 0.5382 0.5940 -0.0537 -0.2152 0.1228  140 LYS A CB  
1132 C CG  . LYS A 158 ? 0.8457 0.5554 0.6624 -0.0472 -0.2305 0.1342  140 LYS A CG  
1133 C CD  . LYS A 158 ? 0.8386 0.5457 0.6911 -0.0396 -0.2331 0.1539  140 LYS A CD  
1134 C CE  . LYS A 158 ? 0.8947 0.6085 0.8047 -0.0344 -0.2514 0.1677  140 LYS A CE  
1135 N NZ  . LYS A 158 ? 0.9064 0.6198 0.8414 -0.0344 -0.2675 0.1955  140 LYS A NZ  
1136 N N   . PHE A 159 ? 0.8203 0.5173 0.4805 -0.0650 -0.1783 0.0622  141 PHE A N   
1137 C CA  . PHE A 159 ? 0.8238 0.5174 0.4434 -0.0682 -0.1594 0.0475  141 PHE A CA  
1138 C C   . PHE A 159 ? 0.8069 0.4942 0.4300 -0.0622 -0.1425 0.0211  141 PHE A C   
1139 O O   . PHE A 159 ? 0.7988 0.4857 0.4321 -0.0639 -0.1506 0.0116  141 PHE A O   
1140 C CB  . PHE A 159 ? 0.8673 0.5668 0.4349 -0.0856 -0.1701 0.0503  141 PHE A CB  
1141 C CG  . PHE A 159 ? 0.8703 0.5676 0.3965 -0.0900 -0.1502 0.0279  141 PHE A CG  
1142 C CD1 . PHE A 159 ? 0.8592 0.5576 0.3631 -0.0910 -0.1345 0.0313  141 PHE A CD1 
1143 C CD2 . PHE A 159 ? 0.8580 0.5519 0.3722 -0.0929 -0.1465 0.0028  141 PHE A CD2 
1144 C CE1 . PHE A 159 ? 0.8740 0.5719 0.3449 -0.0942 -0.1146 0.0099  141 PHE A CE1 
1145 C CE2 . PHE A 159 ? 0.8640 0.5554 0.3460 -0.0956 -0.1268 -0.0197 141 PHE A CE2 
1146 C CZ  . PHE A 159 ? 0.8965 0.5907 0.3570 -0.0961 -0.1104 -0.0162 141 PHE A CZ  
1147 N N   . ILE A 160 ? 0.7999 0.4824 0.4175 -0.0554 -0.1200 0.0107  142 ILE A N   
1148 C CA  . ILE A 160 ? 0.8016 0.4779 0.4182 -0.0511 -0.1040 -0.0135 142 ILE A CA  
1149 C C   . ILE A 160 ? 0.8300 0.5056 0.4095 -0.0554 -0.0878 -0.0263 142 ILE A C   
1150 O O   . ILE A 160 ? 0.8392 0.5180 0.4047 -0.0566 -0.0813 -0.0161 142 ILE A O   
1151 C CB  . ILE A 160 ? 0.7605 0.4317 0.4165 -0.0366 -0.0908 -0.0167 142 ILE A CB  
1152 C CG1 . ILE A 160 ? 0.7364 0.4071 0.3954 -0.0300 -0.0769 -0.0091 142 ILE A CG1 
1153 C CG2 . ILE A 160 ? 0.7490 0.4222 0.4436 -0.0323 -0.1036 -0.0074 142 ILE A CG2 
1154 C CD1 . ILE A 160 ? 0.6811 0.3468 0.3624 -0.0190 -0.0603 -0.0186 142 ILE A CD1 
1155 N N   . GLN A 161 ? 0.8514 0.5228 0.4175 -0.0579 -0.0808 -0.0490 143 GLN A N   
1156 C CA  . GLN A 161 ? 0.8811 0.5519 0.4184 -0.0604 -0.0623 -0.0652 143 GLN A CA  
1157 C C   . GLN A 161 ? 0.8610 0.5257 0.4254 -0.0470 -0.0428 -0.0745 143 GLN A C   
1158 O O   . GLN A 161 ? 0.8584 0.5161 0.4419 -0.0421 -0.0396 -0.0887 143 GLN A O   
1159 C CB  . GLN A 161 ? 0.9232 0.5925 0.4308 -0.0712 -0.0652 -0.0865 143 GLN A CB  
1160 C CG  . GLN A 161 ? 0.9367 0.6055 0.4169 -0.0735 -0.0437 -0.1083 143 GLN A CG  
1161 C CD  . GLN A 161 ? 0.9402 0.6173 0.4010 -0.0748 -0.0316 -0.0971 143 GLN A CD  
1162 O OE1 . GLN A 161 ? 0.8997 0.5757 0.3819 -0.0641 -0.0159 -0.0949 143 GLN A OE1 
1163 N NE2 . GLN A 161 ? 0.9245 0.6106 0.3455 -0.0889 -0.0398 -0.0883 143 GLN A NE2 
1164 N N   . ARG A 162 ? 0.8644 0.5319 0.4318 -0.0419 -0.0310 -0.0652 144 ARG A N   
1165 C CA  . ARG A 162 ? 0.8546 0.5179 0.4499 -0.0296 -0.0152 -0.0700 144 ARG A CA  
1166 C C   . ARG A 162 ? 0.8806 0.5393 0.4736 -0.0272 0.0006  -0.0937 144 ARG A C   
1167 O O   . ARG A 162 ? 0.8700 0.5233 0.4912 -0.0176 0.0085  -0.0991 144 ARG A O   
1168 C CB  . ARG A 162 ? 0.8419 0.5097 0.4399 -0.0264 -0.0072 -0.0554 144 ARG A CB  
1169 C CG  . ARG A 162 ? 0.8686 0.5414 0.4428 -0.0298 0.0098  -0.0634 144 ARG A CG  
1170 C CD  . ARG A 162 ? 0.8405 0.5168 0.4261 -0.0252 0.0190  -0.0508 144 ARG A CD  
1171 N NE  . ARG A 162 ? 0.9070 0.5897 0.4704 -0.0346 0.0116  -0.0334 144 ARG A NE  
1172 C CZ  . ARG A 162 ? 0.9273 0.6179 0.4651 -0.0420 0.0218  -0.0316 144 ARG A CZ  
1173 N NH1 . ARG A 162 ? 0.9404 0.6341 0.4752 -0.0397 0.0414  -0.0473 144 ARG A NH1 
1174 N NH2 . ARG A 162 ? 0.9241 0.6202 0.4422 -0.0517 0.0124  -0.0128 144 ARG A NH2 
1175 N N   . ASP A 163 ? 0.9278 0.5889 0.4880 -0.0362 0.0049  -0.1076 145 ASP A N   
1176 C CA  . ASP A 163 ? 0.9510 0.6080 0.5093 -0.0343 0.0210  -0.1321 145 ASP A CA  
1177 C C   . ASP A 163 ? 0.9471 0.5943 0.5158 -0.0348 0.0142  -0.1488 145 ASP A C   
1178 O O   . ASP A 163 ? 0.9610 0.6029 0.5300 -0.0339 0.0260  -0.1711 145 ASP A O   
1179 C CB  . ASP A 163 ? 0.9995 0.6645 0.5176 -0.0441 0.0322  -0.1421 145 ASP A CB  
1180 C CG  . ASP A 163 ? 1.0317 0.7059 0.5470 -0.0420 0.0450  -0.1293 145 ASP A CG  
1181 O OD1 . ASP A 163 ? 1.0534 0.7259 0.6010 -0.0311 0.0499  -0.1201 145 ASP A OD1 
1182 O OD2 . ASP A 163 ? 1.0914 0.7751 0.5711 -0.0524 0.0496  -0.1280 145 ASP A OD2 
1183 N N   . ASP A 164 ? 0.9204 0.5654 0.5001 -0.0366 -0.0046 -0.1382 146 ASP A N   
1184 C CA  . ASP A 164 ? 0.8907 0.5263 0.4932 -0.0348 -0.0117 -0.1483 146 ASP A CA  
1185 C C   . ASP A 164 ? 0.8444 0.4758 0.4865 -0.0219 -0.0045 -0.1416 146 ASP A C   
1186 O O   . ASP A 164 ? 0.8138 0.4461 0.4784 -0.0181 -0.0136 -0.1261 146 ASP A O   
1187 C CB  . ASP A 164 ? 0.8953 0.5330 0.4959 -0.0423 -0.0342 -0.1378 146 ASP A CB  
1188 C CG  . ASP A 164 ? 0.8866 0.5155 0.5093 -0.0429 -0.0424 -0.1488 146 ASP A CG  
1189 O OD1 . ASP A 164 ? 0.8605 0.4801 0.5008 -0.0375 -0.0317 -0.1640 146 ASP A OD1 
1190 O OD2 . ASP A 164 ? 0.9102 0.5417 0.5353 -0.0491 -0.0608 -0.1410 146 ASP A OD2 
1191 N N   . THR A 165 ? 0.8398 0.4677 0.4902 -0.0156 0.0125  -0.1532 147 THR A N   
1192 C CA  . THR A 165 ? 0.8092 0.4348 0.4931 -0.0043 0.0204  -0.1461 147 THR A CA  
1193 C C   . THR A 165 ? 0.7929 0.4096 0.5080 -0.0007 0.0144  -0.1479 147 THR A C   
1194 O O   . THR A 165 ? 0.7800 0.3962 0.5212 0.0069  0.0169  -0.1374 147 THR A O   
1195 C CB  . THR A 165 ? 0.8081 0.4340 0.4954 0.0012  0.0392  -0.1566 147 THR A CB  
1196 O OG1 . THR A 165 ? 0.8662 0.4858 0.5465 -0.0019 0.0456  -0.1803 147 THR A OG1 
1197 C CG2 . THR A 165 ? 0.8188 0.4558 0.4827 -0.0011 0.0465  -0.1486 147 THR A CG2 
1198 N N   . GLU A 166 ? 0.8052 0.4155 0.5168 -0.0071 0.0060  -0.1601 148 GLU A N   
1199 C CA  . GLU A 166 ? 0.8090 0.4111 0.5500 -0.0058 -0.0014 -0.1603 148 GLU A CA  
1200 C C   . GLU A 166 ? 0.7691 0.3773 0.5211 -0.0069 -0.0148 -0.1411 148 GLU A C   
1201 O O   . GLU A 166 ? 0.7658 0.3713 0.5468 -0.0037 -0.0178 -0.1343 148 GLU A O   
1202 C CB  . GLU A 166 ? 0.8371 0.4295 0.5727 -0.0130 -0.0059 -0.1818 148 GLU A CB  
1203 C CG  . GLU A 166 ? 0.8861 0.4684 0.6333 -0.0082 0.0088  -0.2015 148 GLU A CG  
1204 C CD  . GLU A 166 ? 0.9493 0.5212 0.6882 -0.0158 0.0063  -0.2266 148 GLU A CD  
1205 O OE1 . GLU A 166 ? 1.0616 0.6372 0.7688 -0.0265 -0.0029 -0.2329 148 GLU A OE1 
1206 O OE2 . GLU A 166 ? 1.0460 0.6054 0.8106 -0.0116 0.0130  -0.2408 148 GLU A OE2 
1207 N N   . ARG A 167 ? 0.7434 0.3605 0.4743 -0.0115 -0.0225 -0.1317 149 ARG A N   
1208 C CA  . ARG A 167 ? 0.6951 0.3188 0.4396 -0.0120 -0.0346 -0.1145 149 ARG A CA  
1209 C C   . ARG A 167 ? 0.6601 0.2909 0.4117 -0.0048 -0.0289 -0.0978 149 ARG A C   
1210 O O   . ARG A 167 ? 0.6292 0.2631 0.4050 -0.0007 -0.0309 -0.0868 149 ARG A O   
1211 C CB  . ARG A 167 ? 0.7141 0.3427 0.4377 -0.0221 -0.0504 -0.1131 149 ARG A CB  
1212 C CG  . ARG A 167 ? 0.6927 0.3284 0.4358 -0.0226 -0.0639 -0.0966 149 ARG A CG  
1213 C CD  . ARG A 167 ? 0.6905 0.3316 0.4145 -0.0330 -0.0813 -0.0939 149 ARG A CD  
1214 N NE  . ARG A 167 ? 0.6929 0.3433 0.4358 -0.0315 -0.0923 -0.0742 149 ARG A NE  
1215 C CZ  . ARG A 167 ? 0.7085 0.3658 0.4443 -0.0393 -0.1105 -0.0655 149 ARG A CZ  
1216 N NH1 . ARG A 167 ? 0.7076 0.3638 0.4126 -0.0506 -0.1200 -0.0749 149 ARG A NH1 
1217 N NH2 . ARG A 167 ? 0.7063 0.3721 0.4665 -0.0363 -0.1192 -0.0476 149 ARG A NH2 
1218 N N   . PHE A 168 ? 0.6435 0.2773 0.3739 -0.0041 -0.0213 -0.0970 150 PHE A N   
1219 C CA  . PHE A 168 ? 0.6121 0.2524 0.3450 0.0003  -0.0186 -0.0819 150 PHE A CA  
1220 C C   . PHE A 168 ? 0.6001 0.2389 0.3391 0.0074  -0.0033 -0.0840 150 PHE A C   
1221 O O   . PHE A 168 ? 0.6095 0.2459 0.3364 0.0071  0.0059  -0.0954 150 PHE A O   
1222 C CB  . PHE A 168 ? 0.6118 0.2579 0.3173 -0.0059 -0.0240 -0.0752 150 PHE A CB  
1223 C CG  . PHE A 168 ? 0.6079 0.2571 0.3072 -0.0137 -0.0419 -0.0698 150 PHE A CG  
1224 C CD1 . PHE A 168 ? 0.5606 0.2137 0.2840 -0.0116 -0.0525 -0.0562 150 PHE A CD1 
1225 C CD2 . PHE A 168 ? 0.6268 0.2762 0.2964 -0.0239 -0.0484 -0.0787 150 PHE A CD2 
1226 C CE1 . PHE A 168 ? 0.5395 0.1969 0.2614 -0.0187 -0.0702 -0.0499 150 PHE A CE1 
1227 C CE2 . PHE A 168 ? 0.6195 0.2728 0.2833 -0.0321 -0.0672 -0.0725 150 PHE A CE2 
1228 C CZ  . PHE A 168 ? 0.6071 0.2645 0.2993 -0.0292 -0.0787 -0.0572 150 PHE A CZ  
1229 N N   . TYR A 169 ? 0.5751 0.2160 0.3343 0.0136  -0.0006 -0.0738 151 TYR A N   
1230 C CA  . TYR A 169 ? 0.5696 0.2104 0.3354 0.0195  0.0115  -0.0736 151 TYR A CA  
1231 C C   . TYR A 169 ? 0.5560 0.2025 0.3197 0.0214  0.0129  -0.0614 151 TYR A C   
1232 O O   . TYR A 169 ? 0.5226 0.1716 0.2983 0.0227  0.0075  -0.0522 151 TYR A O   
1233 C CB  . TYR A 169 ? 0.5763 0.2140 0.3672 0.0239  0.0135  -0.0733 151 TYR A CB  
1234 C CG  . TYR A 169 ? 0.5747 0.2121 0.3737 0.0291  0.0241  -0.0738 151 TYR A CG  
1235 C CD1 . TYR A 169 ? 0.5986 0.2307 0.4015 0.0306  0.0304  -0.0847 151 TYR A CD1 
1236 C CD2 . TYR A 169 ? 0.5524 0.1946 0.3572 0.0324  0.0271  -0.0640 151 TYR A CD2 
1237 C CE1 . TYR A 169 ? 0.5970 0.2299 0.4116 0.0356  0.0385  -0.0837 151 TYR A CE1 
1238 C CE2 . TYR A 169 ? 0.5828 0.2258 0.3956 0.0362  0.0347  -0.0635 151 TYR A CE2 
1239 C CZ  . TYR A 169 ? 0.6043 0.2431 0.4228 0.0379  0.0399  -0.0724 151 TYR A CZ  
1240 O OH  . TYR A 169 ? 0.6415 0.2821 0.4723 0.0420  0.0461  -0.0704 151 TYR A OH  
1241 N N   . ILE A 170 ? 0.5718 0.2204 0.3225 0.0214  0.0209  -0.0622 152 ILE A N   
1242 C CA  . ILE A 170 ? 0.5755 0.2284 0.3243 0.0221  0.0221  -0.0511 152 ILE A CA  
1243 C C   . ILE A 170 ? 0.5766 0.2300 0.3435 0.0280  0.0290  -0.0486 152 ILE A C   
1244 O O   . ILE A 170 ? 0.5817 0.2346 0.3532 0.0306  0.0371  -0.0548 152 ILE A O   
1245 C CB  . ILE A 170 ? 0.5951 0.2514 0.3213 0.0176  0.0272  -0.0515 152 ILE A CB  
1246 C CG1 . ILE A 170 ? 0.6137 0.2702 0.3174 0.0099  0.0193  -0.0546 152 ILE A CG1 
1247 C CG2 . ILE A 170 ? 0.5689 0.2286 0.2963 0.0175  0.0271  -0.0382 152 ILE A CG2 
1248 C CD1 . ILE A 170 ? 0.6671 0.3279 0.3437 0.0037  0.0260  -0.0585 152 ILE A CD1 
1249 N N   . LEU A 171 ? 0.5682 0.2228 0.3466 0.0299  0.0252  -0.0399 153 LEU A N   
1250 C CA  . LEU A 171 ? 0.5479 0.2034 0.3419 0.0340  0.0294  -0.0378 153 LEU A CA  
1251 C C   . LEU A 171 ? 0.5537 0.2113 0.3455 0.0342  0.0336  -0.0330 153 LEU A C   
1252 O O   . LEU A 171 ? 0.5341 0.1921 0.3332 0.0349  0.0321  -0.0278 153 LEU A O   
1253 C CB  . LEU A 171 ? 0.5405 0.1966 0.3483 0.0351  0.0245  -0.0343 153 LEU A CB  
1254 C CG  . LEU A 171 ? 0.5454 0.2004 0.3605 0.0348  0.0220  -0.0384 153 LEU A CG  
1255 C CD1 . LEU A 171 ? 0.5157 0.1732 0.3426 0.0344  0.0159  -0.0348 153 LEU A CD1 
1256 C CD2 . LEU A 171 ? 0.5388 0.1937 0.3628 0.0368  0.0276  -0.0401 153 LEU A CD2 
1257 N N   . ASN A 172 ? 0.5775 0.2365 0.3618 0.0336  0.0401  -0.0366 154 ASN A N   
1258 C CA  . ASN A 172 ? 0.5890 0.2512 0.3675 0.0320  0.0451  -0.0329 154 ASN A CA  
1259 C C   . ASN A 172 ? 0.5655 0.2301 0.3567 0.0341  0.0491  -0.0301 154 ASN A C   
1260 O O   . ASN A 172 ? 0.5631 0.2297 0.3532 0.0321  0.0509  -0.0248 154 ASN A O   
1261 C CB  . ASN A 172 ? 0.6156 0.2800 0.3850 0.0311  0.0527  -0.0411 154 ASN A CB  
1262 C CG  . ASN A 172 ? 0.6701 0.3374 0.4213 0.0259  0.0542  -0.0385 154 ASN A CG  
1263 O OD1 . ASN A 172 ? 0.7319 0.4013 0.4704 0.0234  0.0599  -0.0460 154 ASN A OD1 
1264 N ND2 . ASN A 172 ? 0.7319 0.3991 0.4812 0.0233  0.0486  -0.0274 154 ASN A ND2 
1265 N N   . THR A 173 ? 0.5448 0.2095 0.3476 0.0373  0.0501  -0.0333 155 THR A N   
1266 C CA  . THR A 173 ? 0.5286 0.1969 0.3422 0.0383  0.0529  -0.0312 155 THR A CA  
1267 C C   . THR A 173 ? 0.5079 0.1751 0.3272 0.0381  0.0485  -0.0282 155 THR A C   
1268 O O   . THR A 173 ? 0.5155 0.1800 0.3345 0.0384  0.0448  -0.0287 155 THR A O   
1269 C CB  . THR A 173 ? 0.5228 0.1930 0.3468 0.0411  0.0561  -0.0350 155 THR A CB  
1270 O OG1 . THR A 173 ? 0.5415 0.2088 0.3706 0.0421  0.0516  -0.0351 155 THR A OG1 
1271 C CG2 . THR A 173 ? 0.5063 0.1763 0.3263 0.0418  0.0618  -0.0420 155 THR A CG2 
1272 N N   . LEU A 174 ? 0.5028 0.1729 0.3281 0.0371  0.0493  -0.0261 156 LEU A N   
1273 C CA  . LEU A 174 ? 0.4851 0.1550 0.3142 0.0361  0.0464  -0.0259 156 LEU A CA  
1274 C C   . LEU A 174 ? 0.4858 0.1575 0.3172 0.0366  0.0450  -0.0270 156 LEU A C   
1275 O O   . LEU A 174 ? 0.4842 0.1559 0.3151 0.0355  0.0439  -0.0283 156 LEU A O   
1276 C CB  . LEU A 174 ? 0.4959 0.1687 0.3297 0.0336  0.0467  -0.0242 156 LEU A CB  
1277 C CG  . LEU A 174 ? 0.5105 0.1806 0.3442 0.0317  0.0472  -0.0216 156 LEU A CG  
1278 C CD1 . LEU A 174 ? 0.5210 0.1962 0.3609 0.0293  0.0494  -0.0188 156 LEU A CD1 
1279 C CD2 . LEU A 174 ? 0.4505 0.1154 0.2870 0.0306  0.0443  -0.0232 156 LEU A CD2 
1280 N N   . PHE A 175 ? 0.4869 0.1603 0.3224 0.0381  0.0457  -0.0263 157 PHE A N   
1281 C CA  . PHE A 175 ? 0.4918 0.1659 0.3309 0.0380  0.0436  -0.0250 157 PHE A CA  
1282 C C   . PHE A 175 ? 0.4954 0.1658 0.3319 0.0387  0.0429  -0.0272 157 PHE A C   
1283 O O   . PHE A 175 ? 0.5007 0.1724 0.3398 0.0374  0.0414  -0.0254 157 PHE A O   
1284 C CB  . PHE A 175 ? 0.4913 0.1667 0.3409 0.0400  0.0437  -0.0230 157 PHE A CB  
1285 C CG  . PHE A 175 ? 0.4949 0.1763 0.3520 0.0388  0.0423  -0.0187 157 PHE A CG  
1286 C CD1 . PHE A 175 ? 0.4846 0.1703 0.3382 0.0345  0.0381  -0.0148 157 PHE A CD1 
1287 C CD2 . PHE A 175 ? 0.5326 0.2165 0.4009 0.0413  0.0452  -0.0189 157 PHE A CD2 
1288 C CE1 . PHE A 175 ? 0.4987 0.1906 0.3592 0.0322  0.0346  -0.0102 157 PHE A CE1 
1289 C CE2 . PHE A 175 ? 0.5811 0.2721 0.4604 0.0399  0.0425  -0.0138 157 PHE A CE2 
1290 C CZ  . PHE A 175 ? 0.4976 0.1923 0.3725 0.0350  0.0362  -0.0089 157 PHE A CZ  
1291 N N   . ASN A 176 ? 0.5046 0.1715 0.3363 0.0397  0.0432  -0.0301 158 ASN A N   
1292 C CA  . ASN A 176 ? 0.5027 0.1668 0.3334 0.0398  0.0407  -0.0318 158 ASN A CA  
1293 C C   . ASN A 176 ? 0.4915 0.1570 0.3240 0.0390  0.0397  -0.0312 158 ASN A C   
1294 O O   . ASN A 176 ? 0.4993 0.1645 0.3354 0.0390  0.0374  -0.0317 158 ASN A O   
1295 C CB  . ASN A 176 ? 0.5018 0.1626 0.3249 0.0399  0.0397  -0.0343 158 ASN A CB  
1296 C CG  . ASN A 176 ? 0.5154 0.1743 0.3372 0.0407  0.0423  -0.0388 158 ASN A CG  
1297 O OD1 . ASN A 176 ? 0.5476 0.2063 0.3604 0.0401  0.0446  -0.0413 158 ASN A OD1 
1298 N ND2 . ASN A 176 ? 0.4742 0.1318 0.3055 0.0417  0.0421  -0.0400 158 ASN A ND2 
1299 N N   . LEU A 177 ? 0.4893 0.1565 0.3217 0.0383  0.0414  -0.0309 159 LEU A N   
1300 C CA  . LEU A 177 ? 0.4971 0.1649 0.3345 0.0382  0.0418  -0.0328 159 LEU A CA  
1301 C C   . LEU A 177 ? 0.4979 0.1702 0.3403 0.0372  0.0437  -0.0343 159 LEU A C   
1302 O O   . LEU A 177 ? 0.4925 0.1654 0.3431 0.0383  0.0430  -0.0353 159 LEU A O   
1303 C CB  . LEU A 177 ? 0.5082 0.1755 0.3458 0.0371  0.0434  -0.0343 159 LEU A CB  
1304 C CG  . LEU A 177 ? 0.5194 0.1821 0.3566 0.0376  0.0414  -0.0315 159 LEU A CG  
1305 C CD1 . LEU A 177 ? 0.5035 0.1655 0.3426 0.0356  0.0427  -0.0330 159 LEU A CD1 
1306 C CD2 . LEU A 177 ? 0.5159 0.1750 0.3595 0.0392  0.0378  -0.0295 159 LEU A CD2 
1307 N N   . PRO A 178 ? 0.5004 0.1771 0.3393 0.0345  0.0458  -0.0332 160 PRO A N   
1308 C CA  . PRO A 178 ? 0.4964 0.1787 0.3385 0.0322  0.0485  -0.0331 160 PRO A CA  
1309 C C   . PRO A 178 ? 0.4958 0.1771 0.3459 0.0332  0.0461  -0.0311 160 PRO A C   
1310 O O   . PRO A 178 ? 0.4916 0.1773 0.3498 0.0325  0.0484  -0.0323 160 PRO A O   
1311 C CB  . PRO A 178 ? 0.5057 0.1920 0.3410 0.0282  0.0483  -0.0284 160 PRO A CB  
1312 C CG  . PRO A 178 ? 0.5092 0.1931 0.3398 0.0287  0.0461  -0.0279 160 PRO A CG  
1313 C CD  . PRO A 178 ? 0.5045 0.1821 0.3379 0.0330  0.0449  -0.0302 160 PRO A CD  
1314 N N   . GLU A 179 ? 0.5036 0.1796 0.3526 0.0345  0.0419  -0.0291 161 GLU A N   
1315 C CA  . GLU A 179 ? 0.5175 0.1917 0.3736 0.0343  0.0386  -0.0285 161 GLU A CA  
1316 C C   . GLU A 179 ? 0.5170 0.1897 0.3771 0.0360  0.0350  -0.0309 161 GLU A C   
1317 O O   . GLU A 179 ? 0.5305 0.2048 0.3999 0.0350  0.0323  -0.0305 161 GLU A O   
1318 C CB  . GLU A 179 ? 0.5337 0.2024 0.3887 0.0346  0.0360  -0.0277 161 GLU A CB  
1319 C CG  . GLU A 179 ? 0.5451 0.2075 0.3956 0.0365  0.0329  -0.0322 161 GLU A CG  
1320 C CD  . GLU A 179 ? 0.5689 0.2266 0.4197 0.0376  0.0334  -0.0341 161 GLU A CD  
1321 O OE1 . GLU A 179 ? 0.5862 0.2389 0.4416 0.0370  0.0309  -0.0376 161 GLU A OE1 
1322 O OE2 . GLU A 179 ? 0.5971 0.2561 0.4461 0.0390  0.0364  -0.0326 161 GLU A OE2 
1323 N N   . THR A 180 ? 0.5070 0.1773 0.3620 0.0379  0.0342  -0.0319 162 THR A N   
1324 C CA  . THR A 180 ? 0.4951 0.1649 0.3559 0.0390  0.0297  -0.0314 162 THR A CA  
1325 C C   . THR A 180 ? 0.4820 0.1580 0.3594 0.0395  0.0321  -0.0321 162 THR A C   
1326 O O   . THR A 180 ? 0.4762 0.1547 0.3656 0.0394  0.0275  -0.0309 162 THR A O   
1327 C CB  . THR A 180 ? 0.4989 0.1651 0.3533 0.0402  0.0291  -0.0302 162 THR A CB  
1328 O OG1 . THR A 180 ? 0.4810 0.1437 0.3215 0.0393  0.0283  -0.0300 162 THR A OG1 
1329 C CG2 . THR A 180 ? 0.5010 0.1665 0.3644 0.0412  0.0229  -0.0270 162 THR A CG2 
1330 N N   . TYR A 181 ? 0.4688 0.1482 0.3474 0.0396  0.0394  -0.0349 163 TYR A N   
1331 C CA  . TYR A 181 ? 0.4518 0.1388 0.3450 0.0396  0.0453  -0.0382 163 TYR A CA  
1332 C C   . TYR A 181 ? 0.4490 0.1428 0.3476 0.0365  0.0475  -0.0363 163 TYR A C   
1333 O O   . TYR A 181 ? 0.4524 0.1525 0.3683 0.0367  0.0487  -0.0368 163 TYR A O   
1334 C CB  . TYR A 181 ? 0.4386 0.1277 0.3271 0.0390  0.0533  -0.0438 163 TYR A CB  
1335 C CG  . TYR A 181 ? 0.4277 0.1249 0.3314 0.0391  0.0616  -0.0499 163 TYR A CG  
1336 C CD1 . TYR A 181 ? 0.4415 0.1390 0.3678 0.0434  0.0606  -0.0522 163 TYR A CD1 
1337 C CD2 . TYR A 181 ? 0.3884 0.0943 0.2855 0.0346  0.0705  -0.0529 163 TYR A CD2 
1338 C CE1 . TYR A 181 ? 0.4320 0.1382 0.3770 0.0443  0.0702  -0.0597 163 TYR A CE1 
1339 C CE2 . TYR A 181 ? 0.4070 0.1223 0.3175 0.0342  0.0806  -0.0603 163 TYR A CE2 
1340 C CZ  . TYR A 181 ? 0.4333 0.1488 0.3691 0.0396  0.0813  -0.0646 163 TYR A CZ  
1341 O OH  . TYR A 181 ? 0.4334 0.1594 0.3861 0.0396  0.0931  -0.0734 163 TYR A OH  
1342 N N   . LEU A 182 ? 0.4570 0.1496 0.3437 0.0334  0.0477  -0.0332 164 LEU A N   
1343 C CA  . LEU A 182 ? 0.4537 0.1516 0.3461 0.0295  0.0491  -0.0294 164 LEU A CA  
1344 C C   . LEU A 182 ? 0.4616 0.1581 0.3675 0.0295  0.0421  -0.0276 164 LEU A C   
1345 O O   . LEU A 182 ? 0.4661 0.1701 0.3865 0.0268  0.0442  -0.0257 164 LEU A O   
1346 C CB  . LEU A 182 ? 0.4644 0.1590 0.3446 0.0267  0.0482  -0.0247 164 LEU A CB  
1347 C CG  . LEU A 182 ? 0.4434 0.1422 0.3298 0.0216  0.0490  -0.0182 164 LEU A CG  
1348 C CD1 . LEU A 182 ? 0.4262 0.1378 0.3180 0.0177  0.0579  -0.0181 164 LEU A CD1 
1349 C CD2 . LEU A 182 ? 0.4574 0.1520 0.3350 0.0196  0.0465  -0.0121 164 LEU A CD2 
1350 N N   . LEU A 183 ? 0.4565 0.1446 0.3573 0.0317  0.0339  -0.0284 165 LEU A N   
1351 C CA  . LEU A 183 ? 0.4565 0.1428 0.3659 0.0305  0.0255  -0.0278 165 LEU A CA  
1352 C C   . LEU A 183 ? 0.4627 0.1565 0.3915 0.0315  0.0239  -0.0274 165 LEU A C   
1353 O O   . LEU A 183 ? 0.4725 0.1712 0.4172 0.0289  0.0208  -0.0256 165 LEU A O   
1354 C CB  . LEU A 183 ? 0.4564 0.1333 0.3512 0.0315  0.0180  -0.0299 165 LEU A CB  
1355 C CG  . LEU A 183 ? 0.4471 0.1165 0.3296 0.0307  0.0187  -0.0318 165 LEU A CG  
1356 C CD1 . LEU A 183 ? 0.3933 0.0564 0.2594 0.0321  0.0160  -0.0351 165 LEU A CD1 
1357 C CD2 . LEU A 183 ? 0.4448 0.1115 0.3359 0.0272  0.0151  -0.0323 165 LEU A CD2 
1358 N N   . ALA A 184 ? 0.4595 0.1541 0.3902 0.0353  0.0254  -0.0287 166 ALA A N   
1359 C CA  . ALA A 184 ? 0.4635 0.1657 0.4182 0.0377  0.0255  -0.0286 166 ALA A CA  
1360 C C   . ALA A 184 ? 0.4622 0.1762 0.4343 0.0363  0.0363  -0.0305 166 ALA A C   
1361 O O   . ALA A 184 ? 0.4541 0.1763 0.4502 0.0359  0.0344  -0.0289 166 ALA A O   
1362 C CB  . ALA A 184 ? 0.4532 0.1518 0.4079 0.0421  0.0266  -0.0302 166 ALA A CB  
1363 N N   . CYS A 185 ? 0.4669 0.1832 0.4267 0.0347  0.0474  -0.0334 167 CYS A N   
1364 C CA  . CYS A 185 ? 0.4819 0.2107 0.4516 0.0315  0.0594  -0.0350 167 CYS A CA  
1365 C C   . CYS A 185 ? 0.4801 0.2142 0.4601 0.0265  0.0570  -0.0291 167 CYS A C   
1366 O O   . CYS A 185 ? 0.4863 0.2326 0.4878 0.0249  0.0631  -0.0290 167 CYS A O   
1367 C CB  . CYS A 185 ? 0.4940 0.2233 0.4410 0.0280  0.0680  -0.0363 167 CYS A CB  
1368 S SG  . CYS A 185 ? 0.5030 0.2296 0.4393 0.0312  0.0745  -0.0452 167 CYS A SG  
1369 N N   . LEU A 186 ? 0.4775 0.2024 0.4439 0.0240  0.0490  -0.0246 168 LEU A N   
1370 C CA  . LEU A 186 ? 0.4806 0.2070 0.4577 0.0190  0.0445  -0.0192 168 LEU A CA  
1371 C C   . LEU A 186 ? 0.4809 0.2099 0.4806 0.0195  0.0353  -0.0188 168 LEU A C   
1372 O O   . LEU A 186 ? 0.4900 0.2293 0.5115 0.0158  0.0376  -0.0159 168 LEU A O   
1373 C CB  . LEU A 186 ? 0.4889 0.2029 0.4488 0.0169  0.0382  -0.0165 168 LEU A CB  
1374 C CG  . LEU A 186 ? 0.4716 0.1843 0.4145 0.0148  0.0446  -0.0132 168 LEU A CG  
1375 C CD1 . LEU A 186 ? 0.4544 0.1535 0.3867 0.0156  0.0366  -0.0127 168 LEU A CD1 
1376 C CD2 . LEU A 186 ? 0.4472 0.1698 0.3986 0.0079  0.0513  -0.0058 168 LEU A CD2 
1377 N N   . VAL A 187 ? 0.4786 0.1997 0.4741 0.0230  0.0244  -0.0208 169 VAL A N   
1378 C CA  . VAL A 187 ? 0.4774 0.2023 0.4942 0.0225  0.0134  -0.0190 169 VAL A CA  
1379 C C   . VAL A 187 ? 0.4727 0.2129 0.5207 0.0246  0.0203  -0.0187 169 VAL A C   
1380 O O   . VAL A 187 ? 0.4812 0.2311 0.5556 0.0217  0.0174  -0.0157 169 VAL A O   
1381 C CB  . VAL A 187 ? 0.4802 0.1958 0.4847 0.0249  0.0004  -0.0195 169 VAL A CB  
1382 C CG1 . VAL A 187 ? 0.4803 0.2020 0.5081 0.0238  -0.0122 -0.0159 169 VAL A CG1 
1383 C CG2 . VAL A 187 ? 0.4839 0.1867 0.4618 0.0222  -0.0051 -0.0218 169 VAL A CG2 
1384 N N   . ASP A 188 ? 0.4589 0.2015 0.5058 0.0295  0.0301  -0.0226 170 ASP A N   
1385 C CA  . ASP A 188 ? 0.4581 0.2149 0.5347 0.0324  0.0403  -0.0254 170 ASP A CA  
1386 C C   . ASP A 188 ? 0.4544 0.2251 0.5429 0.0269  0.0533  -0.0249 170 ASP A C   
1387 O O   . ASP A 188 ? 0.4478 0.2323 0.5689 0.0266  0.0566  -0.0243 170 ASP A O   
1388 C CB  . ASP A 188 ? 0.4495 0.2034 0.5180 0.0379  0.0496  -0.0323 170 ASP A CB  
1389 C CG  . ASP A 188 ? 0.4770 0.2450 0.5743 0.0408  0.0640  -0.0389 170 ASP A CG  
1390 O OD1 . ASP A 188 ? 0.4822 0.2559 0.6133 0.0451  0.0592  -0.0380 170 ASP A OD1 
1391 O OD2 . ASP A 188 ? 0.4489 0.2229 0.5355 0.0384  0.0801  -0.0453 170 ASP A OD2 
1392 N N   . PHE A 189 ? 0.4581 0.2259 0.5216 0.0222  0.0603  -0.0240 171 PHE A N   
1393 C CA  . PHE A 189 ? 0.4685 0.2496 0.5395 0.0155  0.0724  -0.0211 171 PHE A CA  
1394 C C   . PHE A 189 ? 0.4788 0.2643 0.5723 0.0101  0.0639  -0.0136 171 PHE A C   
1395 O O   . PHE A 189 ? 0.4775 0.2790 0.5997 0.0076  0.0711  -0.0123 171 PHE A O   
1396 C CB  . PHE A 189 ? 0.4655 0.2419 0.5046 0.0106  0.0786  -0.0187 171 PHE A CB  
1397 C CG  . PHE A 189 ? 0.4654 0.2536 0.5099 0.0018  0.0873  -0.0116 171 PHE A CG  
1398 C CD1 . PHE A 189 ? 0.4589 0.2660 0.5155 -0.0012 0.1046  -0.0145 171 PHE A CD1 
1399 C CD2 . PHE A 189 ? 0.4890 0.2696 0.5285 -0.0042 0.0786  -0.0018 171 PHE A CD2 
1400 C CE1 . PHE A 189 ? 0.4700 0.2899 0.5315 -0.0109 0.1133  -0.0060 171 PHE A CE1 
1401 C CE2 . PHE A 189 ? 0.4263 0.2179 0.4736 -0.0136 0.0858  0.0076  171 PHE A CE2 
1402 C CZ  . PHE A 189 ? 0.4720 0.2835 0.5290 -0.0173 0.1028  0.0065  171 PHE A CZ  
1403 N N   . PHE A 190 ? 0.4813 0.2527 0.5629 0.0081  0.0491  -0.0098 172 PHE A N   
1404 C CA  . PHE A 190 ? 0.4950 0.2676 0.5963 0.0025  0.0389  -0.0044 172 PHE A CA  
1405 C C   . PHE A 190 ? 0.5045 0.2859 0.6385 0.0045  0.0302  -0.0046 172 PHE A C   
1406 O O   . PHE A 190 ? 0.5150 0.3057 0.6757 -0.0010 0.0273  -0.0001 172 PHE A O   
1407 C CB  . PHE A 190 ? 0.4879 0.2419 0.5676 0.0005  0.0258  -0.0038 172 PHE A CB  
1408 C CG  . PHE A 190 ? 0.4982 0.2459 0.5578 -0.0031 0.0324  -0.0001 172 PHE A CG  
1409 C CD1 . PHE A 190 ? 0.4644 0.2201 0.5364 -0.0108 0.0389  0.0079  172 PHE A CD1 
1410 C CD2 . PHE A 190 ? 0.4877 0.2221 0.5181 0.0006  0.0314  -0.0032 172 PHE A CD2 
1411 C CE1 . PHE A 190 ? 0.4804 0.2302 0.5357 -0.0149 0.0430  0.0142  172 PHE A CE1 
1412 C CE2 . PHE A 190 ? 0.4746 0.2039 0.4904 -0.0026 0.0358  0.0018  172 PHE A CE2 
1413 C CZ  . PHE A 190 ? 0.4916 0.2281 0.5197 -0.0104 0.0408  0.0111  172 PHE A CZ  
1414 N N   . THR A 191 ? 0.5208 0.2995 0.6547 0.0118  0.0253  -0.0086 173 THR A N   
1415 C CA  . THR A 191 ? 0.5356 0.3222 0.7013 0.0146  0.0149  -0.0072 173 THR A CA  
1416 C C   . THR A 191 ? 0.5335 0.3406 0.7374 0.0167  0.0289  -0.0081 173 THR A C   
1417 O O   . THR A 191 ? 0.5294 0.3480 0.7701 0.0164  0.0219  -0.0046 173 THR A O   
1418 C CB  . THR A 191 ? 0.5372 0.3129 0.6892 0.0215  0.0048  -0.0090 173 THR A CB  
1419 O OG1 . THR A 191 ? 0.5960 0.3567 0.7213 0.0182  -0.0111 -0.0078 173 THR A OG1 
1420 C CG2 . THR A 191 ? 0.5601 0.3457 0.7486 0.0257  -0.0031 -0.0061 173 THR A CG2 
1421 N N   . ASN A 192 ? 0.5400 0.3525 0.7358 0.0188  0.0488  -0.0136 174 ASN A N   
1422 C CA  . ASN A 192 ? 0.5520 0.3844 0.7824 0.0214  0.0655  -0.0179 174 ASN A CA  
1423 C C   . ASN A 192 ? 0.5543 0.4024 0.7909 0.0135  0.0828  -0.0163 174 ASN A C   
1424 O O   . ASN A 192 ? 0.5628 0.4307 0.8339 0.0139  0.0964  -0.0190 174 ASN A O   
1425 C CB  . ASN A 192 ? 0.5473 0.3774 0.7719 0.0296  0.0762  -0.0277 174 ASN A CB  
1426 C CG  . ASN A 192 ? 0.5713 0.3908 0.8048 0.0373  0.0594  -0.0267 174 ASN A CG  
1427 O OD1 . ASN A 192 ? 0.5571 0.3594 0.7587 0.0393  0.0512  -0.0269 174 ASN A OD1 
1428 N ND2 . ASN A 192 ? 0.5896 0.4201 0.8679 0.0408  0.0533  -0.0240 174 ASN A ND2 
1429 N N   . CYS A 193 ? 0.5532 0.3931 0.7586 0.0063  0.0827  -0.0114 175 CYS A N   
1430 C CA  . CYS A 193 ? 0.5590 0.4126 0.7681 -0.0030 0.0966  -0.0062 175 CYS A CA  
1431 C C   . CYS A 193 ? 0.5580 0.4197 0.8012 -0.0093 0.0872  0.0026  175 CYS A C   
1432 O O   . CYS A 193 ? 0.5563 0.4042 0.7958 -0.0107 0.0678  0.0068  175 CYS A O   
1433 C CB  . CYS A 193 ? 0.5553 0.3966 0.7228 -0.0088 0.0978  -0.0016 175 CYS A CB  
1434 S SG  . CYS A 193 ? 0.5811 0.4392 0.7522 -0.0221 0.1131  0.0089  175 CYS A SG  
1435 N N   . PRO A 194 ? 0.5633 0.4483 0.8405 -0.0134 0.1016  0.0043  176 PRO A N   
1436 C CA  . PRO A 194 ? 0.5619 0.4591 0.8780 -0.0203 0.0955  0.0130  176 PRO A CA  
1437 C C   . PRO A 194 ? 0.5665 0.4588 0.8737 -0.0324 0.0908  0.0247  176 PRO A C   
1438 O O   . PRO A 194 ? 0.5641 0.4640 0.9041 -0.0385 0.0829  0.0314  176 PRO A O   
1439 C CB  . PRO A 194 ? 0.5640 0.4895 0.9165 -0.0203 0.1178  0.0095  176 PRO A CB  
1440 C CG  . PRO A 194 ? 0.5750 0.5002 0.9121 -0.0111 0.1315  -0.0036 176 PRO A CG  
1441 C CD  . PRO A 194 ? 0.5698 0.4725 0.8524 -0.0113 0.1265  -0.0040 176 PRO A CD  
1442 N N   . ARG A 195 ? 0.5671 0.4475 0.8346 -0.0362 0.0950  0.0277  177 ARG A N   
1443 C CA  . ARG A 195 ? 0.5781 0.4465 0.8369 -0.0457 0.0848  0.0387  177 ARG A CA  
1444 C C   . ARG A 195 ? 0.5710 0.4185 0.8297 -0.0433 0.0596  0.0367  177 ARG A C   
1445 O O   . ARG A 195 ? 0.5782 0.4181 0.8462 -0.0511 0.0485  0.0436  177 ARG A O   
1446 C CB  . ARG A 195 ? 0.5810 0.4385 0.7980 -0.0485 0.0912  0.0427  177 ARG A CB  
1447 C CG  . ARG A 195 ? 0.6212 0.4979 0.8343 -0.0575 0.1127  0.0505  177 ARG A CG  
1448 C CD  . ARG A 195 ? 0.6171 0.4823 0.7974 -0.0647 0.1121  0.0617  177 ARG A CD  
1449 N NE  . ARG A 195 ? 0.6402 0.4866 0.7833 -0.0572 0.1059  0.0553  177 ARG A NE  
1450 C CZ  . ARG A 195 ? 0.6425 0.4932 0.7588 -0.0532 0.1176  0.0479  177 ARG A CZ  
1451 N NH1 . ARG A 195 ? 0.6430 0.5161 0.7631 -0.0559 0.1377  0.0440  177 ARG A NH1 
1452 N NH2 . ARG A 195 ? 0.5918 0.4248 0.6784 -0.0470 0.1096  0.0433  177 ARG A NH2 
1453 N N   . TYR A 196 ? 0.5638 0.4021 0.8111 -0.0333 0.0510  0.0271  178 TYR A N   
1454 C CA  . TYR A 196 ? 0.5625 0.3795 0.7956 -0.0310 0.0296  0.0235  178 TYR A CA  
1455 C C   . TYR A 196 ? 0.5637 0.3862 0.8243 -0.0281 0.0153  0.0206  178 TYR A C   
1456 O O   . TYR A 196 ? 0.5593 0.3986 0.8446 -0.0236 0.0226  0.0193  178 TYR A O   
1457 C CB  . TYR A 196 ? 0.5533 0.3539 0.7449 -0.0233 0.0301  0.0169  178 TYR A CB  
1458 C CG  . TYR A 196 ? 0.5529 0.3504 0.7196 -0.0265 0.0430  0.0212  178 TYR A CG  
1459 C CD1 . TYR A 196 ? 0.5434 0.3264 0.6983 -0.0323 0.0363  0.0267  178 TYR A CD1 
1460 C CD2 . TYR A 196 ? 0.5285 0.3379 0.6854 -0.0244 0.0615  0.0199  178 TYR A CD2 
1461 C CE1 . TYR A 196 ? 0.5643 0.3452 0.6990 -0.0358 0.0462  0.0334  178 TYR A CE1 
1462 C CE2 . TYR A 196 ? 0.5214 0.3296 0.6543 -0.0288 0.0715  0.0252  178 TYR A CE2 
1463 C CZ  . TYR A 196 ? 0.5753 0.3696 0.6976 -0.0345 0.0632  0.0333  178 TYR A CZ  
1464 O OH  . TYR A 196 ? 0.5968 0.3909 0.6973 -0.0392 0.0715  0.0410  178 TYR A OH  
1465 N N   . THR A 197 ? 0.5708 0.3793 0.8282 -0.0313 -0.0052 0.0195  179 THR A N   
1466 C CA  . THR A 197 ? 0.5779 0.3896 0.8548 -0.0298 -0.0228 0.0178  179 THR A CA  
1467 C C   . THR A 197 ? 0.5779 0.3698 0.8178 -0.0249 -0.0358 0.0110  179 THR A C   
1468 O O   . THR A 197 ? 0.5804 0.3549 0.7907 -0.0269 -0.0384 0.0075  179 THR A O   
1469 C CB  . THR A 197 ? 0.5887 0.4035 0.8943 -0.0402 -0.0370 0.0220  179 THR A CB  
1470 O OG1 . THR A 197 ? 0.5935 0.4280 0.9334 -0.0454 -0.0225 0.0295  179 THR A OG1 
1471 C CG2 . THR A 197 ? 0.6063 0.4265 0.9334 -0.0401 -0.0577 0.0216  179 THR A CG2 
1472 N N   . SER A 198 ? 0.5796 0.3750 0.8227 -0.0184 -0.0428 0.0097  180 SER A N   
1473 C CA  . SER A 198 ? 0.5920 0.3708 0.7997 -0.0147 -0.0543 0.0049  180 SER A CA  
1474 C C   . SER A 198 ? 0.6047 0.3752 0.8080 -0.0222 -0.0773 0.0033  180 SER A C   
1475 O O   . SER A 198 ? 0.6113 0.3927 0.8469 -0.0277 -0.0889 0.0075  180 SER A O   
1476 C CB  . SER A 198 ? 0.5893 0.3745 0.8036 -0.0060 -0.0544 0.0061  180 SER A CB  
1477 O OG  . SER A 198 ? 0.6105 0.4006 0.8231 0.0008  -0.0332 0.0042  180 SER A OG  
1478 N N   . CYS A 199 ? 0.6124 0.3642 0.7761 -0.0230 -0.0833 -0.0035 181 CYS A N   
1479 C CA  . CYS A 199 ? 0.6370 0.3792 0.7863 -0.0302 -0.1044 -0.0082 181 CYS A CA  
1480 C C   . CYS A 199 ? 0.6330 0.3658 0.7455 -0.0256 -0.1091 -0.0113 181 CYS A C   
1481 O O   . CYS A 199 ? 0.6148 0.3467 0.7151 -0.0174 -0.0960 -0.0103 181 CYS A O   
1482 C CB  . CYS A 199 ? 0.6517 0.3792 0.7883 -0.0371 -0.1047 -0.0159 181 CYS A CB  
1483 S SG  . CYS A 199 ? 0.7074 0.4434 0.8859 -0.0446 -0.0998 -0.0105 181 CYS A SG  
1484 N N   . GLU A 200 ? 0.6471 0.3734 0.7409 -0.0320 -0.1278 -0.0152 182 GLU A N   
1485 C CA  . GLU A 200 ? 0.6484 0.3664 0.7043 -0.0298 -0.1324 -0.0174 182 GLU A CA  
1486 C C   . GLU A 200 ? 0.6262 0.3296 0.6477 -0.0255 -0.1169 -0.0263 182 GLU A C   
1487 O O   . GLU A 200 ? 0.6229 0.3238 0.6240 -0.0195 -0.1108 -0.0247 182 GLU A O   
1488 C CB  . GLU A 200 ? 0.6836 0.3981 0.7217 -0.0400 -0.1551 -0.0210 182 GLU A CB  
1489 C CG  . GLU A 200 ? 0.7581 0.4857 0.8123 -0.0413 -0.1727 -0.0085 182 GLU A CG  
1490 C CD  . GLU A 200 ? 0.8443 0.5663 0.8584 -0.0459 -0.1866 -0.0084 182 GLU A CD  
1491 O OE1 . GLU A 200 ? 0.8936 0.6086 0.8816 -0.0563 -0.1990 -0.0177 182 GLU A OE1 
1492 O OE2 . GLU A 200 ? 0.8460 0.5708 0.8548 -0.0396 -0.1848 0.0010  182 GLU A OE2 
1493 N N   . THR A 201 ? 0.6004 0.2943 0.6194 -0.0287 -0.1111 -0.0348 183 THR A N   
1494 C CA  . THR A 201 ? 0.5811 0.2601 0.5700 -0.0260 -0.0999 -0.0444 183 THR A CA  
1495 C C   . THR A 201 ? 0.5636 0.2410 0.5647 -0.0210 -0.0820 -0.0423 183 THR A C   
1496 O O   . THR A 201 ? 0.5623 0.2275 0.5463 -0.0191 -0.0736 -0.0493 183 THR A O   
1497 C CB  . THR A 201 ? 0.5970 0.2627 0.5678 -0.0343 -0.1094 -0.0584 183 THR A CB  
1498 O OG1 . THR A 201 ? 0.5802 0.2468 0.5798 -0.0410 -0.1159 -0.0589 183 THR A OG1 
1499 C CG2 . THR A 201 ? 0.5955 0.2619 0.5421 -0.0403 -0.1259 -0.0617 183 THR A CG2 
1500 N N   . GLY A 202 ? 0.5358 0.2264 0.5667 -0.0192 -0.0762 -0.0324 184 GLY A N   
1501 C CA  . GLY A 202 ? 0.5160 0.2084 0.5586 -0.0167 -0.0603 -0.0282 184 GLY A CA  
1502 C C   . GLY A 202 ? 0.5100 0.2195 0.5890 -0.0186 -0.0576 -0.0190 184 GLY A C   
1503 O O   . GLY A 202 ? 0.5007 0.2218 0.5943 -0.0171 -0.0627 -0.0152 184 GLY A O   
1504 N N   . PHE A 203 ? 0.5219 0.2335 0.6179 -0.0223 -0.0496 -0.0149 185 PHE A N   
1505 C CA  . PHE A 203 ? 0.5237 0.2541 0.6537 -0.0242 -0.0422 -0.0058 185 PHE A CA  
1506 C C   . PHE A 203 ? 0.5390 0.2682 0.6860 -0.0321 -0.0391 -0.0011 185 PHE A C   
1507 O O   . PHE A 203 ? 0.5534 0.2671 0.6848 -0.0336 -0.0385 -0.0035 185 PHE A O   
1508 C CB  . PHE A 203 ? 0.5036 0.2445 0.6299 -0.0170 -0.0246 -0.0024 185 PHE A CB  
1509 C CG  . PHE A 203 ? 0.4958 0.2276 0.5970 -0.0151 -0.0128 -0.0024 185 PHE A CG  
1510 C CD1 . PHE A 203 ? 0.4496 0.1685 0.5192 -0.0093 -0.0134 -0.0083 185 PHE A CD1 
1511 C CD2 . PHE A 203 ? 0.4812 0.2176 0.5917 -0.0202 -0.0023 0.0050  185 PHE A CD2 
1512 C CE1 . PHE A 203 ? 0.4577 0.1691 0.5076 -0.0078 -0.0042 -0.0075 185 PHE A CE1 
1513 C CE2 . PHE A 203 ? 0.4399 0.1682 0.5286 -0.0194 0.0058  0.0072  185 PHE A CE2 
1514 C CZ  . PHE A 203 ? 0.4567 0.1725 0.5162 -0.0127 0.0046  0.0005  185 PHE A CZ  
1515 N N   . LYS A 204 ? 0.5408 0.2864 0.7226 -0.0372 -0.0372 0.0063  186 LYS A N   
1516 C CA  . LYS A 204 ? 0.5570 0.3030 0.7593 -0.0463 -0.0353 0.0129  186 LYS A CA  
1517 C C   . LYS A 204 ? 0.5543 0.3166 0.7677 -0.0471 -0.0157 0.0232  186 LYS A C   
1518 O O   . LYS A 204 ? 0.5508 0.3294 0.7707 -0.0422 -0.0057 0.0239  186 LYS A O   
1519 C CB  . LYS A 204 ? 0.5581 0.3098 0.7933 -0.0545 -0.0500 0.0137  186 LYS A CB  
1520 C CG  . LYS A 204 ? 0.5906 0.3283 0.8118 -0.0553 -0.0706 0.0027  186 LYS A CG  
1521 C CD  . LYS A 204 ? 0.6063 0.3487 0.8581 -0.0651 -0.0876 0.0029  186 LYS A CD  
1522 C CE  . LYS A 204 ? 0.6915 0.4187 0.9503 -0.0743 -0.0923 0.0010  186 LYS A CE  
1523 N NZ  . LYS A 204 ? 0.7314 0.4584 1.0135 -0.0846 -0.1126 -0.0028 186 LYS A NZ  
1524 N N   . ASP A 205 ? 0.5677 0.3251 0.7821 -0.0534 -0.0100 0.0309  187 ASP A N   
1525 C CA  . ASP A 205 ? 0.5778 0.3526 0.8062 -0.0586 0.0067  0.0430  187 ASP A CA  
1526 C C   . ASP A 205 ? 0.5924 0.3699 0.8544 -0.0704 0.0009  0.0519  187 ASP A C   
1527 O O   . ASP A 205 ? 0.6142 0.3776 0.8750 -0.0763 -0.0031 0.0575  187 ASP A O   
1528 C CB  . ASP A 205 ? 0.5830 0.3505 0.7822 -0.0573 0.0173  0.0480  187 ASP A CB  
1529 C CG  . ASP A 205 ? 0.5923 0.3761 0.8017 -0.0659 0.0328  0.0627  187 ASP A CG  
1530 O OD1 . ASP A 205 ? 0.6042 0.4082 0.8417 -0.0715 0.0400  0.0680  187 ASP A OD1 
1531 O OD2 . ASP A 205 ? 0.6411 0.4185 0.8300 -0.0677 0.0379  0.0700  187 ASP A OD2 
1532 N N   . GLY A 206 ? 0.5897 0.3850 0.8853 -0.0737 -0.0007 0.0533  188 GLY A N   
1533 C CA  . GLY A 206 ? 0.6017 0.3992 0.9327 -0.0852 -0.0095 0.0601  188 GLY A CA  
1534 C C   . GLY A 206 ? 0.6064 0.3812 0.9326 -0.0860 -0.0321 0.0495  188 GLY A C   
1535 O O   . GLY A 206 ? 0.6090 0.3818 0.9280 -0.0803 -0.0432 0.0389  188 GLY A O   
1536 N N   A ASP A 207 ? 0.6178 0.3751 0.9478 -0.0934 -0.0395 0.0520  189 ASP A N   
1537 N N   B ASP A 207 ? 0.6188 0.3766 0.9488 -0.0935 -0.0384 0.0528  189 ASP A N   
1538 C CA  A ASP A 207 ? 0.6218 0.3564 0.9456 -0.0947 -0.0597 0.0387  189 ASP A CA  
1539 C CA  B ASP A 207 ? 0.6253 0.3593 0.9513 -0.0960 -0.0581 0.0411  189 ASP A CA  
1540 C C   A ASP A 207 ? 0.6142 0.3260 0.8974 -0.0864 -0.0600 0.0287  189 ASP A C   
1541 C C   B ASP A 207 ? 0.6183 0.3286 0.9069 -0.0888 -0.0579 0.0328  189 ASP A C   
1542 O O   A ASP A 207 ? 0.6291 0.3215 0.9010 -0.0864 -0.0737 0.0151  189 ASP A O   
1543 O O   B ASP A 207 ? 0.6353 0.3235 0.9213 -0.0916 -0.0694 0.0242  189 ASP A O   
1544 C CB  A ASP A 207 ? 0.6373 0.3638 0.9936 -0.1077 -0.0699 0.0434  189 ASP A CB  
1545 C CB  B ASP A 207 ? 0.6397 0.3693 1.0018 -0.1095 -0.0662 0.0482  189 ASP A CB  
1546 C CG  A ASP A 207 ? 0.6439 0.3879 1.0393 -0.1159 -0.0795 0.0456  189 ASP A CG  
1547 C CG  B ASP A 207 ? 0.6549 0.3857 1.0262 -0.1153 -0.0527 0.0659  189 ASP A CG  
1548 O OD1 A ASP A 207 ? 0.6708 0.4054 1.0906 -0.1264 -0.0933 0.0444  189 ASP A OD1 
1549 O OD1 B ASP A 207 ? 0.6525 0.3736 0.9963 -0.1096 -0.0441 0.0682  189 ASP A OD1 
1550 O OD2 A ASP A 207 ? 0.6379 0.4049 1.0427 -0.1120 -0.0741 0.0482  189 ASP A OD2 
1551 O OD2 B ASP A 207 ? 0.6609 0.4026 1.0682 -0.1266 -0.0516 0.0787  189 ASP A OD2 
1552 N N   . LEU A 208 ? 0.5958 0.3113 0.8576 -0.0798 -0.0444 0.0346  190 LEU A N   
1553 C CA  . LEU A 208 ? 0.5794 0.2763 0.8069 -0.0719 -0.0430 0.0272  190 LEU A CA  
1554 C C   . LEU A 208 ? 0.5634 0.2601 0.7645 -0.0625 -0.0464 0.0140  190 LEU A C   
1555 O O   . LEU A 208 ? 0.5561 0.2692 0.7531 -0.0577 -0.0379 0.0169  190 LEU A O   
1556 C CB  . LEU A 208 ? 0.5594 0.2624 0.7756 -0.0700 -0.0264 0.0403  190 LEU A CB  
1557 C CG  . LEU A 208 ? 0.5686 0.2636 0.7975 -0.0775 -0.0239 0.0545  190 LEU A CG  
1558 C CD1 . LEU A 208 ? 0.5823 0.2704 0.8458 -0.0884 -0.0347 0.0580  190 LEU A CD1 
1559 C CD2 . LEU A 208 ? 0.4997 0.2145 0.7262 -0.0804 -0.0071 0.0715  190 LEU A CD2 
1560 N N   . PHE A 209 ? 0.5679 0.2465 0.7523 -0.0606 -0.0585 -0.0006 191 PHE A N   
1561 C CA  . PHE A 209 ? 0.5552 0.2319 0.7098 -0.0525 -0.0612 -0.0117 191 PHE A CA  
1562 C C   . PHE A 209 ? 0.5576 0.2224 0.6809 -0.0441 -0.0526 -0.0158 191 PHE A C   
1563 O O   . PHE A 209 ? 0.5670 0.2144 0.6859 -0.0447 -0.0540 -0.0207 191 PHE A O   
1564 C CB  . PHE A 209 ? 0.5686 0.2363 0.7188 -0.0564 -0.0791 -0.0255 191 PHE A CB  
1565 C CG  . PHE A 209 ? 0.5719 0.2365 0.6878 -0.0494 -0.0822 -0.0356 191 PHE A CG  
1566 C CD1 . PHE A 209 ? 0.5685 0.2490 0.6822 -0.0454 -0.0827 -0.0310 191 PHE A CD1 
1567 C CD2 . PHE A 209 ? 0.5707 0.2167 0.6589 -0.0471 -0.0837 -0.0490 191 PHE A CD2 
1568 C CE1 . PHE A 209 ? 0.5632 0.2408 0.6466 -0.0399 -0.0859 -0.0376 191 PHE A CE1 
1569 C CE2 . PHE A 209 ? 0.5719 0.2167 0.6285 -0.0419 -0.0853 -0.0567 191 PHE A CE2 
1570 C CZ  . PHE A 209 ? 0.5750 0.2353 0.6283 -0.0387 -0.0870 -0.0499 191 PHE A CZ  
1571 N N   . MET A 210 ? 0.5420 0.2164 0.6472 -0.0364 -0.0441 -0.0140 192 MET A N   
1572 C CA  . MET A 210 ? 0.5358 0.2019 0.6125 -0.0287 -0.0368 -0.0176 192 MET A CA  
1573 C C   . MET A 210 ? 0.5389 0.2040 0.5925 -0.0236 -0.0424 -0.0277 192 MET A C   
1574 O O   . MET A 210 ? 0.5251 0.2035 0.5820 -0.0219 -0.0432 -0.0247 192 MET A O   
1575 C CB  . MET A 210 ? 0.5255 0.2042 0.5999 -0.0253 -0.0219 -0.0062 192 MET A CB  
1576 C CG  . MET A 210 ? 0.5191 0.1914 0.5658 -0.0178 -0.0147 -0.0087 192 MET A CG  
1577 S SD  . MET A 210 ? 0.5506 0.2048 0.5972 -0.0189 -0.0150 -0.0074 192 MET A SD  
1578 C CE  . MET A 210 ? 0.5248 0.1790 0.5445 -0.0106 -0.0053 -0.0063 192 MET A CE  
1579 N N   . SER A 211 ? 0.5448 0.1947 0.5771 -0.0217 -0.0463 -0.0393 193 SER A N   
1580 C CA  . SER A 211 ? 0.5498 0.1993 0.5566 -0.0180 -0.0505 -0.0472 193 SER A CA  
1581 C C   . SER A 211 ? 0.5454 0.1991 0.5348 -0.0097 -0.0388 -0.0430 193 SER A C   
1582 O O   . SER A 211 ? 0.5428 0.1948 0.5328 -0.0069 -0.0285 -0.0382 193 SER A O   
1583 C CB  . SER A 211 ? 0.5708 0.2044 0.5594 -0.0203 -0.0577 -0.0627 193 SER A CB  
1584 O OG  . SER A 211 ? 0.5618 0.1835 0.5429 -0.0161 -0.0487 -0.0672 193 SER A OG  
1585 N N   . TYR A 212 ? 0.5488 0.2079 0.5238 -0.0068 -0.0416 -0.0440 194 TYR A N   
1586 C CA  . TYR A 212 ? 0.5475 0.2081 0.5036 0.0004  -0.0326 -0.0424 194 TYR A CA  
1587 C C   . TYR A 212 ? 0.5525 0.2007 0.4873 0.0032  -0.0277 -0.0501 194 TYR A C   
1588 O O   . TYR A 212 ? 0.5529 0.2019 0.4785 0.0085  -0.0182 -0.0473 194 TYR A O   
1589 C CB  . TYR A 212 ? 0.5328 0.1995 0.4797 0.0018  -0.0391 -0.0414 194 TYR A CB  
1590 C CG  . TYR A 212 ? 0.5441 0.2245 0.5155 0.0017  -0.0412 -0.0331 194 TYR A CG  
1591 C CD1 . TYR A 212 ? 0.5167 0.2062 0.5041 0.0048  -0.0290 -0.0268 194 TYR A CD1 
1592 C CD2 . TYR A 212 ? 0.5459 0.2317 0.5257 -0.0018 -0.0552 -0.0315 194 TYR A CD2 
1593 C CE1 . TYR A 212 ? 0.5031 0.2066 0.5163 0.0051  -0.0286 -0.0210 194 TYR A CE1 
1594 C CE2 . TYR A 212 ? 0.5284 0.2282 0.5370 -0.0010 -0.0568 -0.0237 194 TYR A CE2 
1595 C CZ  . TYR A 212 ? 0.5271 0.2357 0.5533 0.0029  -0.0423 -0.0194 194 TYR A CZ  
1596 O OH  . TYR A 212 ? 0.5462 0.2697 0.6039 0.0040  -0.0414 -0.0137 194 TYR A OH  
1597 N N   . ARG A 213 ? 0.5664 0.2040 0.4944 -0.0005 -0.0341 -0.0608 195 ARG A N   
1598 C CA  . ARG A 213 ? 0.5725 0.1984 0.4864 0.0021  -0.0286 -0.0703 195 ARG A CA  
1599 C C   . ARG A 213 ? 0.5545 0.1758 0.4849 0.0044  -0.0209 -0.0657 195 ARG A C   
1600 O O   . ARG A 213 ? 0.5388 0.1583 0.4615 0.0096  -0.0128 -0.0649 195 ARG A O   
1601 C CB  . ARG A 213 ? 0.6029 0.2186 0.5081 -0.0032 -0.0364 -0.0854 195 ARG A CB  
1602 C CG  . ARG A 213 ? 0.6560 0.2619 0.5452 0.0001  -0.0288 -0.0975 195 ARG A CG  
1603 C CD  . ARG A 213 ? 0.7919 0.3893 0.6684 -0.0059 -0.0354 -0.1147 195 ARG A CD  
1604 N NE  . ARG A 213 ? 0.8891 0.4825 0.7414 -0.0033 -0.0273 -0.1268 195 ARG A NE  
1605 C CZ  . ARG A 213 ? 0.9266 0.5084 0.7801 -0.0027 -0.0215 -0.1431 195 ARG A CZ  
1606 N NH1 . ARG A 213 ? 0.9255 0.4962 0.8043 -0.0044 -0.0242 -0.1490 195 ARG A NH1 
1607 N NH2 . ARG A 213 ? 0.9391 0.5206 0.7707 -0.0004 -0.0123 -0.1537 195 ARG A NH2 
1608 N N   . SER A 214 ? 0.5541 0.1739 0.5083 -0.0002 -0.0244 -0.0614 196 SER A N   
1609 C CA  . SER A 214 ? 0.5465 0.1642 0.5176 0.0006  -0.0184 -0.0521 196 SER A CA  
1610 C C   . SER A 214 ? 0.5278 0.1574 0.4934 0.0045  -0.0097 -0.0398 196 SER A C   
1611 O O   . SER A 214 ? 0.5376 0.1652 0.5021 0.0076  -0.0038 -0.0350 196 SER A O   
1612 C CB  . SER A 214 ? 0.5382 0.1553 0.5361 -0.0063 -0.0233 -0.0457 196 SER A CB  
1613 O OG  . SER A 214 ? 0.5929 0.1963 0.5984 -0.0102 -0.0312 -0.0580 196 SER A OG  
1614 N N   . MET A 215 ? 0.5160 0.1581 0.4802 0.0039  -0.0094 -0.0353 197 MET A N   
1615 C CA  . MET A 215 ? 0.5328 0.1862 0.4923 0.0068  -0.0007 -0.0265 197 MET A CA  
1616 C C   . MET A 215 ? 0.5251 0.1759 0.4628 0.0131  0.0038  -0.0304 197 MET A C   
1617 O O   . MET A 215 ? 0.5209 0.1742 0.4547 0.0150  0.0104  -0.0246 197 MET A O   
1618 C CB  . MET A 215 ? 0.5136 0.1804 0.4809 0.0055  -0.0011 -0.0233 197 MET A CB  
1619 C CG  . MET A 215 ? 0.5196 0.1988 0.4854 0.0076  0.0093  -0.0166 197 MET A CG  
1620 S SD  . MET A 215 ? 0.5623 0.2544 0.5371 0.0095  0.0090  -0.0176 197 MET A SD  
1621 C CE  . MET A 215 ? 0.5004 0.1843 0.4515 0.0155  0.0048  -0.0245 197 MET A CE  
1622 N N   . PHE A 216 ? 0.5296 0.1764 0.4531 0.0150  -0.0002 -0.0393 198 PHE A N   
1623 C CA  . PHE A 216 ? 0.5356 0.1795 0.4400 0.0199  0.0040  -0.0434 198 PHE A CA  
1624 C C   . PHE A 216 ? 0.5430 0.1788 0.4492 0.0220  0.0080  -0.0451 198 PHE A C   
1625 O O   . PHE A 216 ? 0.5378 0.1756 0.4378 0.0255  0.0137  -0.0418 198 PHE A O   
1626 C CB  . PHE A 216 ? 0.5398 0.1806 0.4285 0.0195  -0.0014 -0.0521 198 PHE A CB  
1627 C CG  . PHE A 216 ? 0.5612 0.1982 0.4318 0.0232  0.0037  -0.0573 198 PHE A CG  
1628 C CD1 . PHE A 216 ? 0.5662 0.2090 0.4271 0.0265  0.0083  -0.0525 198 PHE A CD1 
1629 C CD2 . PHE A 216 ? 0.5884 0.2161 0.4543 0.0231  0.0049  -0.0679 198 PHE A CD2 
1630 C CE1 . PHE A 216 ? 0.5580 0.1985 0.4048 0.0292  0.0135  -0.0563 198 PHE A CE1 
1631 C CE2 . PHE A 216 ? 0.5792 0.2056 0.4314 0.0264  0.0114  -0.0729 198 PHE A CE2 
1632 C CZ  . PHE A 216 ? 0.5552 0.1884 0.3981 0.0291  0.0155  -0.0661 198 PHE A CZ  
1633 N N   . GLN A 217 ? 0.5505 0.1768 0.4678 0.0197  0.0044  -0.0502 199 GLN A N   
1634 C CA  . GLN A 217 ? 0.5596 0.1773 0.4858 0.0223  0.0075  -0.0515 199 GLN A CA  
1635 C C   . GLN A 217 ? 0.5450 0.1671 0.4833 0.0222  0.0103  -0.0369 199 GLN A C   
1636 O O   . GLN A 217 ? 0.5374 0.1586 0.4760 0.0259  0.0138  -0.0341 199 GLN A O   
1637 C CB  . GLN A 217 ? 0.5631 0.1681 0.5022 0.0198  0.0028  -0.0618 199 GLN A CB  
1638 C CG  . GLN A 217 ? 0.6055 0.1999 0.5557 0.0242  0.0067  -0.0677 199 GLN A CG  
1639 C CD  . GLN A 217 ? 0.6841 0.2799 0.6157 0.0294  0.0137  -0.0772 199 GLN A CD  
1640 O OE1 . GLN A 217 ? 0.7022 0.2975 0.6149 0.0282  0.0138  -0.0895 199 GLN A OE1 
1641 N NE2 . GLN A 217 ? 0.6573 0.2562 0.5941 0.0343  0.0189  -0.0702 199 GLN A NE2 
1642 N N   . ASP A 218 ? 0.5534 0.1816 0.5016 0.0173  0.0086  -0.0271 200 ASP A N   
1643 C CA  . ASP A 218 ? 0.5685 0.2041 0.5218 0.0154  0.0118  -0.0121 200 ASP A CA  
1644 C C   . ASP A 218 ? 0.5585 0.2033 0.4937 0.0185  0.0175  -0.0095 200 ASP A C   
1645 O O   . ASP A 218 ? 0.5710 0.2177 0.5064 0.0187  0.0189  -0.0010 200 ASP A O   
1646 C CB  . ASP A 218 ? 0.5668 0.2106 0.5310 0.0086  0.0114  -0.0028 200 ASP A CB  
1647 C CG  . ASP A 218 ? 0.6200 0.2546 0.6061 0.0041  0.0051  -0.0029 200 ASP A CG  
1648 O OD1 . ASP A 218 ? 0.6684 0.2891 0.6635 0.0061  0.0014  -0.0086 200 ASP A OD1 
1649 O OD2 . ASP A 218 ? 0.6483 0.2896 0.6451 -0.0016 0.0041  0.0018  200 ASP A OD2 
1650 N N   . VAL A 219 ? 0.5437 0.1939 0.4652 0.0204  0.0195  -0.0158 201 VAL A N   
1651 C CA  . VAL A 219 ? 0.5398 0.1972 0.4461 0.0231  0.0244  -0.0148 201 VAL A CA  
1652 C C   . VAL A 219 ? 0.5461 0.1979 0.4462 0.0276  0.0252  -0.0181 201 VAL A C   
1653 O O   . VAL A 219 ? 0.5528 0.2088 0.4489 0.0280  0.0274  -0.0125 201 VAL A O   
1654 C CB  . VAL A 219 ? 0.5313 0.1938 0.4291 0.0244  0.0254  -0.0205 201 VAL A CB  
1655 C CG1 . VAL A 219 ? 0.5206 0.1875 0.4047 0.0274  0.0299  -0.0213 201 VAL A CG1 
1656 C CG2 . VAL A 219 ? 0.5219 0.1932 0.4301 0.0206  0.0265  -0.0165 201 VAL A CG2 
1657 N N   . ARG A 220 ? 0.5542 0.1977 0.4539 0.0302  0.0234  -0.0278 202 ARG A N   
1658 C CA  . ARG A 220 ? 0.5616 0.2005 0.4579 0.0345  0.0257  -0.0336 202 ARG A CA  
1659 C C   . ARG A 220 ? 0.5614 0.1973 0.4740 0.0354  0.0253  -0.0270 202 ARG A C   
1660 O O   . ARG A 220 ? 0.5546 0.1940 0.4662 0.0379  0.0274  -0.0235 202 ARG A O   
1661 C CB  . ARG A 220 ? 0.5839 0.2149 0.4771 0.0349  0.0242  -0.0464 202 ARG A CB  
1662 C CG  . ARG A 220 ? 0.6129 0.2412 0.4969 0.0384  0.0287  -0.0562 202 ARG A CG  
1663 C CD  . ARG A 220 ? 0.5540 0.1886 0.4183 0.0386  0.0307  -0.0568 202 ARG A CD  
1664 N NE  . ARG A 220 ? 0.5925 0.2344 0.4552 0.0400  0.0333  -0.0477 202 ARG A NE  
1665 C CZ  . ARG A 220 ? 0.5898 0.2336 0.4593 0.0425  0.0366  -0.0443 202 ARG A CZ  
1666 N NH1 . ARG A 220 ? 0.5593 0.1983 0.4416 0.0450  0.0386  -0.0484 202 ARG A NH1 
1667 N NH2 . ARG A 220 ? 0.5757 0.2264 0.4413 0.0423  0.0376  -0.0370 202 ARG A NH2 
1668 N N   . ASP A 221 ? 0.5640 0.1939 0.4937 0.0329  0.0214  -0.0238 203 ASP A N   
1669 C CA  . ASP A 221 ? 0.5606 0.1876 0.5102 0.0325  0.0186  -0.0132 203 ASP A CA  
1670 C C   . ASP A 221 ? 0.5572 0.1949 0.5016 0.0293  0.0181  0.0022  203 ASP A C   
1671 O O   . ASP A 221 ? 0.5582 0.1966 0.5123 0.0305  0.0159  0.0105  203 ASP A O   
1672 C CB  . ASP A 221 ? 0.5818 0.2019 0.5494 0.0281  0.0138  -0.0095 203 ASP A CB  
1673 C CG  . ASP A 221 ? 0.6146 0.2212 0.5937 0.0303  0.0126  -0.0245 203 ASP A CG  
1674 O OD1 . ASP A 221 ? 0.5946 0.1977 0.5673 0.0354  0.0166  -0.0380 203 ASP A OD1 
1675 O OD2 . ASP A 221 ? 0.6434 0.2433 0.6381 0.0261  0.0079  -0.0229 203 ASP A OD2 
1676 N N   . ALA A 222 ? 0.5430 0.1897 0.4740 0.0248  0.0198  0.0060  204 ALA A N   
1677 C CA  . ALA A 222 ? 0.5317 0.1896 0.4534 0.0203  0.0207  0.0181  204 ALA A CA  
1678 C C   . ALA A 222 ? 0.5228 0.1858 0.4303 0.0233  0.0230  0.0150  204 ALA A C   
1679 O O   . ALA A 222 ? 0.5220 0.1906 0.4276 0.0208  0.0207  0.0247  204 ALA A O   
1680 C CB  . ALA A 222 ? 0.5235 0.1901 0.4370 0.0150  0.0242  0.0197  204 ALA A CB  
1681 N N   . VAL A 223 ? 0.5180 0.1794 0.4157 0.0277  0.0265  0.0027  205 VAL A N   
1682 C CA  . VAL A 223 ? 0.5191 0.1837 0.4070 0.0307  0.0286  -0.0006 205 VAL A CA  
1683 C C   . VAL A 223 ? 0.5359 0.1974 0.4374 0.0340  0.0262  0.0021  205 VAL A C   
1684 O O   . VAL A 223 ? 0.5447 0.2122 0.4445 0.0330  0.0244  0.0084  205 VAL A O   
1685 C CB  . VAL A 223 ? 0.5148 0.1778 0.3913 0.0341  0.0324  -0.0123 205 VAL A CB  
1686 C CG1 . VAL A 223 ? 0.4867 0.1531 0.3558 0.0360  0.0343  -0.0138 205 VAL A CG1 
1687 C CG2 . VAL A 223 ? 0.4703 0.1372 0.3391 0.0316  0.0340  -0.0141 205 VAL A CG2 
1688 N N   . ASP A 224 ? 0.5472 0.1996 0.4637 0.0376  0.0258  -0.0031 206 ASP A N   
1689 C CA  . ASP A 224 ? 0.5535 0.2026 0.4898 0.0418  0.0245  -0.0018 206 ASP A CA  
1690 C C   . ASP A 224 ? 0.5474 0.2002 0.4967 0.0385  0.0175  0.0149  206 ASP A C   
1691 O O   . ASP A 224 ? 0.5523 0.2088 0.5120 0.0404  0.0151  0.0203  206 ASP A O   
1692 C CB  . ASP A 224 ? 0.5709 0.2084 0.5240 0.0455  0.0257  -0.0116 206 ASP A CB  
1693 C CG  . ASP A 224 ? 0.6116 0.2462 0.5523 0.0487  0.0324  -0.0285 206 ASP A CG  
1694 O OD1 . ASP A 224 ? 0.6582 0.2993 0.5796 0.0484  0.0358  -0.0310 206 ASP A OD1 
1695 O OD2 . ASP A 224 ? 0.6536 0.2791 0.6036 0.0506  0.0341  -0.0395 206 ASP A OD2 
1696 N N   . TRP A 225 ? 0.5416 0.1939 0.4919 0.0329  0.0138  0.0241  207 TRP A N   
1697 C CA  . TRP A 225 ? 0.5396 0.1957 0.5009 0.0279  0.0060  0.0428  207 TRP A CA  
1698 C C   . TRP A 225 ? 0.5409 0.2099 0.4834 0.0230  0.0041  0.0512  207 TRP A C   
1699 O O   . TRP A 225 ? 0.5459 0.2189 0.4983 0.0220  -0.0027 0.0625  207 TRP A O   
1700 C CB  . TRP A 225 ? 0.5451 0.1986 0.5107 0.0218  0.0036  0.0511  207 TRP A CB  
1701 C CG  . TRP A 225 ? 0.5625 0.2203 0.5377 0.0149  -0.0048 0.0732  207 TRP A CG  
1702 C CD1 . TRP A 225 ? 0.5706 0.2204 0.5756 0.0154  -0.0125 0.0845  207 TRP A CD1 
1703 C CD2 . TRP A 225 ? 0.5556 0.2271 0.5098 0.0055  -0.0068 0.0869  207 TRP A CD2 
1704 N NE1 . TRP A 225 ? 0.6033 0.2612 0.6072 0.0066  -0.0204 0.1070  207 TRP A NE1 
1705 C CE2 . TRP A 225 ? 0.5885 0.2604 0.5590 -0.0001 -0.0166 0.1081  207 TRP A CE2 
1706 C CE3 . TRP A 225 ? 0.5682 0.2514 0.4919 0.0009  -0.0009 0.0824  207 TRP A CE3 
1707 C CZ2 . TRP A 225 ? 0.6025 0.2874 0.5554 -0.0112 -0.0210 0.1259  207 TRP A CZ2 
1708 C CZ3 . TRP A 225 ? 0.5705 0.2660 0.4777 -0.0094 -0.0037 0.0969  207 TRP A CZ3 
1709 C CH2 . TRP A 225 ? 0.6004 0.2974 0.5200 -0.0159 -0.0139 0.1189  207 TRP A CH2 
1710 N N   . VAL A 226 ? 0.5384 0.2138 0.4556 0.0200  0.0097  0.0447  208 VAL A N   
1711 C CA  . VAL A 226 ? 0.5397 0.2261 0.4367 0.0151  0.0092  0.0478  208 VAL A CA  
1712 C C   . VAL A 226 ? 0.5474 0.2355 0.4508 0.0192  0.0064  0.0466  208 VAL A C   
1713 O O   . VAL A 226 ? 0.5474 0.2434 0.4477 0.0143  -0.0002 0.0570  208 VAL A O   
1714 C CB  . VAL A 226 ? 0.5369 0.2267 0.4121 0.0139  0.0176  0.0359  208 VAL A CB  
1715 C CG1 . VAL A 226 ? 0.5431 0.2400 0.4018 0.0122  0.0187  0.0317  208 VAL A CG1 
1716 C CG2 . VAL A 226 ? 0.5101 0.2047 0.3780 0.0070  0.0201  0.0410  208 VAL A CG2 
1717 N N   . HIS A 227 ? 0.5529 0.2345 0.4654 0.0271  0.0112  0.0345  209 HIS A N   
1718 C CA  . HIS A 227 ? 0.5807 0.2645 0.5030 0.0314  0.0107  0.0322  209 HIS A CA  
1719 C C   . HIS A 227 ? 0.6122 0.2956 0.5640 0.0340  0.0036  0.0427  209 HIS A C   
1720 O O   . HIS A 227 ? 0.6187 0.3100 0.5766 0.0324  -0.0024 0.0505  209 HIS A O   
1721 C CB  . HIS A 227 ? 0.5787 0.2573 0.4994 0.0380  0.0196  0.0163  209 HIS A CB  
1722 C CG  . HIS A 227 ? 0.5571 0.2385 0.4541 0.0359  0.0242  0.0088  209 HIS A CG  
1723 N ND1 . HIS A 227 ? 0.5823 0.2688 0.4744 0.0358  0.0254  0.0064  209 HIS A ND1 
1724 C CD2 . HIS A 227 ? 0.5739 0.2537 0.4546 0.0338  0.0274  0.0039  209 HIS A CD2 
1725 C CE1 . HIS A 227 ? 0.5666 0.2531 0.4403 0.0338  0.0289  0.0002  209 HIS A CE1 
1726 N NE2 . HIS A 227 ? 0.5618 0.2446 0.4291 0.0330  0.0303  -0.0015 209 HIS A NE2 
1727 N N   . TYR A 228 ? 0.6308 0.3050 0.6029 0.0376  0.0034  0.0428  210 TYR A N   
1728 C CA  . TYR A 228 ? 0.6685 0.3399 0.6754 0.0419  -0.0022 0.0504  210 TYR A CA  
1729 C C   . TYR A 228 ? 0.6731 0.3466 0.6915 0.0358  -0.0145 0.0719  210 TYR A C   
1730 O O   . TYR A 228 ? 0.6835 0.3594 0.7286 0.0375  -0.0225 0.0831  210 TYR A O   
1731 C CB  . TYR A 228 ? 0.7101 0.3686 0.7379 0.0489  0.0036  0.0386  210 TYR A CB  
1732 C CG  . TYR A 228 ? 0.7661 0.4202 0.7862 0.0548  0.0157  0.0170  210 TYR A CG  
1733 C CD1 . TYR A 228 ? 0.7660 0.4256 0.7566 0.0532  0.0218  0.0087  210 TYR A CD1 
1734 C CD2 . TYR A 228 ? 0.8402 0.4837 0.8831 0.0612  0.0209  0.0047  210 TYR A CD2 
1735 C CE1 . TYR A 228 ? 0.7983 0.4545 0.7804 0.0571  0.0317  -0.0084 210 TYR A CE1 
1736 C CE2 . TYR A 228 ? 0.8539 0.4942 0.8855 0.0649  0.0322  -0.0154 210 TYR A CE2 
1737 C CZ  . TYR A 228 ? 0.8237 0.4711 0.8239 0.0624  0.0371  -0.0204 210 TYR A CZ  
1738 O OH  . TYR A 228 ? 0.8392 0.4847 0.8258 0.0645  0.0470  -0.0373 210 TYR A OH  
1739 N N   A LYS A 229 ? 0.6728 0.3458 0.6735 0.0285  -0.0158 0.0781  211 LYS A N   
1740 N N   B LYS A 229 ? 0.6741 0.3474 0.6747 0.0284  -0.0160 0.0784  211 LYS A N   
1741 C CA  A LYS A 229 ? 0.6827 0.3567 0.6932 0.0213  -0.0265 0.0996  211 LYS A CA  
1742 C CA  B LYS A 229 ? 0.6847 0.3600 0.6948 0.0212  -0.0272 0.1004  211 LYS A CA  
1743 C C   A LYS A 229 ? 0.6896 0.3751 0.6672 0.0093  -0.0291 0.1106  211 LYS A C   
1744 C C   B LYS A 229 ? 0.6908 0.3787 0.6676 0.0094  -0.0303 0.1112  211 LYS A C   
1745 O O   A LYS A 229 ? 0.7048 0.3941 0.6858 0.0012  -0.0384 0.1309  211 LYS A O   
1746 O O   B LYS A 229 ? 0.7070 0.4019 0.6858 0.0017  -0.0415 0.1316  211 LYS A O   
1747 C CB  A LYS A 229 ? 0.6871 0.3478 0.7173 0.0232  -0.0255 0.0987  211 LYS A CB  
1748 C CB  B LYS A 229 ? 0.6920 0.3550 0.7195 0.0218  -0.0267 0.1015  211 LYS A CB  
1749 C CG  A LYS A 229 ? 0.6933 0.3425 0.7671 0.0318  -0.0286 0.0980  211 LYS A CG  
1750 C CG  B LYS A 229 ? 0.6980 0.3481 0.7675 0.0313  -0.0281 0.0975  211 LYS A CG  
1751 C CD  A LYS A 229 ? 0.6999 0.3347 0.7933 0.0322  -0.0286 0.0967  211 LYS A CD  
1752 C CD  B LYS A 229 ? 0.6996 0.3414 0.7688 0.0402  -0.0156 0.0711  211 LYS A CD  
1753 C CE  A LYS A 229 ? 0.7360 0.3689 0.8530 0.0258  -0.0418 0.1231  211 LYS A CE  
1754 C CE  B LYS A 229 ? 0.7094 0.3407 0.8193 0.0498  -0.0145 0.0634  211 LYS A CE  
1755 N NZ  A LYS A 229 ? 0.7297 0.3464 0.8744 0.0268  -0.0429 0.1221  211 LYS A NZ  
1756 N NZ  B LYS A 229 ? 0.6923 0.3309 0.8125 0.0563  -0.0115 0.0581  211 LYS A NZ  
1757 N N   . GLY A 230 ? 0.6775 0.3686 0.6243 0.0076  -0.0206 0.0974  212 GLY A N   
1758 C CA  . GLY A 230 ? 0.6768 0.3793 0.5921 -0.0033 -0.0202 0.1032  212 GLY A CA  
1759 C C   . GLY A 230 ? 0.6792 0.3930 0.5752 -0.0081 -0.0239 0.1042  212 GLY A C   
1760 O O   . GLY A 230 ? 0.6791 0.3940 0.5901 -0.0043 -0.0304 0.1066  212 GLY A O   
1761 N N   . SER A 231 ? 0.6659 0.3887 0.5305 -0.0164 -0.0193 0.1008  213 SER A N   
1762 C CA  . SER A 231 ? 0.6773 0.4112 0.5222 -0.0238 -0.0250 0.1036  213 SER A CA  
1763 C C   . SER A 231 ? 0.6478 0.3818 0.4809 -0.0199 -0.0185 0.0845  213 SER A C   
1764 O O   . SER A 231 ? 0.6550 0.3979 0.4678 -0.0275 -0.0216 0.0834  213 SER A O   
1765 C CB  . SER A 231 ? 0.7025 0.4483 0.5193 -0.0383 -0.0267 0.1146  213 SER A CB  
1766 O OG  . SER A 231 ? 0.7303 0.4777 0.5270 -0.0400 -0.0126 0.1004  213 SER A OG  
1767 N N   . LEU A 232 ? 0.6102 0.3344 0.4560 -0.0090 -0.0104 0.0702  214 LEU A N   
1768 C CA  . LEU A 232 ? 0.5975 0.3209 0.4337 -0.0057 -0.0040 0.0537  214 LEU A CA  
1769 C C   . LEU A 232 ? 0.5968 0.3258 0.4364 -0.0075 -0.0122 0.0566  214 LEU A C   
1770 O O   . LEU A 232 ? 0.5932 0.3273 0.4141 -0.0131 -0.0119 0.0499  214 LEU A O   
1771 C CB  . LEU A 232 ? 0.5717 0.2845 0.4205 0.0052  0.0048  0.0408  214 LEU A CB  
1772 C CG  . LEU A 232 ? 0.5740 0.2847 0.4151 0.0086  0.0112  0.0259  214 LEU A CG  
1773 C CD1 . LEU A 232 ? 0.5114 0.2250 0.3301 0.0036  0.0170  0.0166  214 LEU A CD1 
1774 C CD2 . LEU A 232 ? 0.5562 0.2577 0.4092 0.0179  0.0177  0.0168  214 LEU A CD2 
1775 N N   . LYS A 233 ? 0.5889 0.3169 0.4552 -0.0027 -0.0191 0.0655  215 LYS A N   
1776 C CA  . LYS A 233 ? 0.5960 0.3306 0.4733 -0.0039 -0.0280 0.0705  215 LYS A CA  
1777 C C   . LYS A 233 ? 0.6165 0.3626 0.4756 -0.0167 -0.0398 0.0822  215 LYS A C   
1778 O O   . LYS A 233 ? 0.6207 0.3731 0.4701 -0.0218 -0.0441 0.0786  215 LYS A O   
1779 C CB  . LYS A 233 ? 0.5924 0.3248 0.5066 0.0037  -0.0329 0.0797  215 LYS A CB  
1780 C CG  . LYS A 233 ? 0.5931 0.3175 0.5243 0.0151  -0.0215 0.0656  215 LYS A CG  
1781 C CD  . LYS A 233 ? 0.6490 0.3719 0.6187 0.0226  -0.0248 0.0724  215 LYS A CD  
1782 C CE  . LYS A 233 ? 0.7194 0.4369 0.7022 0.0324  -0.0121 0.0568  215 LYS A CE  
1783 N NZ  . LYS A 233 ? 0.7414 0.4499 0.7017 0.0344  -0.0005 0.0424  215 LYS A NZ  
1784 N N   . GLU A 234 ? 0.6255 0.3742 0.4787 -0.0228 -0.0451 0.0961  216 GLU A N   
1785 C CA  . GLU A 234 ? 0.6580 0.4186 0.4914 -0.0367 -0.0571 0.1101  216 GLU A CA  
1786 C C   . GLU A 234 ? 0.6402 0.4058 0.4360 -0.0452 -0.0507 0.0958  216 GLU A C   
1787 O O   . GLU A 234 ? 0.6599 0.4342 0.4414 -0.0540 -0.0592 0.0966  216 GLU A O   
1788 C CB  . GLU A 234 ? 0.6661 0.4276 0.4997 -0.0417 -0.0614 0.1278  216 GLU A CB  
1789 C CG  . GLU A 234 ? 0.7347 0.5095 0.5393 -0.0582 -0.0715 0.1422  216 GLU A CG  
1790 C CD  . GLU A 234 ? 0.7671 0.5434 0.5763 -0.0641 -0.0778 0.1647  216 GLU A CD  
1791 O OE1 . GLU A 234 ? 0.8214 0.5879 0.6468 -0.0569 -0.0695 0.1638  216 GLU A OE1 
1792 O OE2 . GLU A 234 ? 0.8514 0.6392 0.6479 -0.0771 -0.0922 0.1843  216 GLU A OE2 
1793 N N   . LYS A 235 ? 0.6199 0.3799 0.4024 -0.0425 -0.0358 0.0818  217 LYS A N   
1794 C CA  . LYS A 235 ? 0.6216 0.3850 0.3733 -0.0489 -0.0270 0.0653  217 LYS A CA  
1795 C C   . LYS A 235 ? 0.5984 0.3582 0.3513 -0.0452 -0.0245 0.0487  217 LYS A C   
1796 O O   . LYS A 235 ? 0.6028 0.3672 0.3329 -0.0534 -0.0236 0.0382  217 LYS A O   
1797 C CB  . LYS A 235 ? 0.6216 0.3809 0.3660 -0.0461 -0.0123 0.0566  217 LYS A CB  
1798 C CG  . LYS A 235 ? 0.6692 0.4354 0.4045 -0.0545 -0.0144 0.0728  217 LYS A CG  
1799 C CD  . LYS A 235 ? 0.7311 0.4963 0.4587 -0.0536 0.0007  0.0634  217 LYS A CD  
1800 C CE  . LYS A 235 ? 0.7732 0.5449 0.4975 -0.0617 -0.0012 0.0821  217 LYS A CE  
1801 N NZ  . LYS A 235 ? 0.7889 0.5738 0.4904 -0.0767 -0.0117 0.0975  217 LYS A NZ  
1802 N N   . THR A 236 ? 0.5672 0.3190 0.3469 -0.0339 -0.0234 0.0464  218 THR A N   
1803 C CA  . THR A 236 ? 0.5664 0.3155 0.3520 -0.0309 -0.0225 0.0347  218 THR A CA  
1804 C C   . THR A 236 ? 0.5847 0.3435 0.3682 -0.0399 -0.0367 0.0415  218 THR A C   
1805 O O   . THR A 236 ? 0.5951 0.3558 0.3639 -0.0463 -0.0375 0.0308  218 THR A O   
1806 C CB  . THR A 236 ? 0.5325 0.2734 0.3470 -0.0180 -0.0181 0.0336  218 THR A CB  
1807 O OG1 . THR A 236 ? 0.5379 0.2704 0.3522 -0.0112 -0.0069 0.0274  218 THR A OG1 
1808 C CG2 . THR A 236 ? 0.5047 0.2432 0.3254 -0.0157 -0.0157 0.0230  218 THR A CG2 
1809 N N   . VAL A 237 ? 0.5912 0.3554 0.3927 -0.0402 -0.0485 0.0597  219 VAL A N   
1810 C CA  . VAL A 237 ? 0.6089 0.3830 0.4199 -0.0465 -0.0645 0.0708  219 VAL A CA  
1811 C C   . VAL A 237 ? 0.6541 0.4390 0.4321 -0.0631 -0.0750 0.0753  219 VAL A C   
1812 O O   . VAL A 237 ? 0.6721 0.4653 0.4486 -0.0713 -0.0878 0.0785  219 VAL A O   
1813 C CB  . VAL A 237 ? 0.6112 0.3861 0.4582 -0.0391 -0.0719 0.0891  219 VAL A CB  
1814 C CG1 . VAL A 237 ? 0.6044 0.3905 0.4530 -0.0489 -0.0906 0.1112  219 VAL A CG1 
1815 C CG2 . VAL A 237 ? 0.5765 0.3479 0.4588 -0.0274 -0.0677 0.0841  219 VAL A CG2 
1816 N N   . GLU A 238 ? 0.6709 0.4568 0.4216 -0.0690 -0.0692 0.0749  220 GLU A N   
1817 C CA  . GLU A 238 ? 0.7206 0.5174 0.4341 -0.0858 -0.0759 0.0755  220 GLU A CA  
1818 C C   . GLU A 238 ? 0.7148 0.5093 0.4031 -0.0903 -0.0660 0.0502  220 GLU A C   
1819 O O   . GLU A 238 ? 0.7464 0.5497 0.4038 -0.1047 -0.0713 0.0462  220 GLU A O   
1820 C CB  . GLU A 238 ? 0.7352 0.5373 0.4292 -0.0928 -0.0745 0.0877  220 GLU A CB  
1821 C CG  . GLU A 238 ? 0.7660 0.5611 0.4486 -0.0877 -0.0539 0.0729  220 GLU A CG  
1822 C CD  . GLU A 238 ? 0.7921 0.5944 0.4569 -0.0961 -0.0523 0.0870  220 GLU A CD  
1823 O OE1 . GLU A 238 ? 0.8516 0.6601 0.5237 -0.1015 -0.0672 0.1117  220 GLU A OE1 
1824 O OE2 . GLU A 238 ? 0.8255 0.6277 0.4722 -0.0974 -0.0361 0.0742  220 GLU A OE2 
1825 N N   . ASN A 239 ? 0.6830 0.4655 0.3851 -0.0786 -0.0522 0.0332  221 ASN A N   
1826 C CA  . ASN A 239 ? 0.6766 0.4547 0.3626 -0.0814 -0.0432 0.0098  221 ASN A CA  
1827 C C   . ASN A 239 ? 0.6467 0.4135 0.3592 -0.0698 -0.0378 -0.0001 221 ASN A C   
1828 O O   . ASN A 239 ? 0.6265 0.3833 0.3426 -0.0615 -0.0236 -0.0130 221 ASN A O   
1829 C CB  . ASN A 239 ? 0.6846 0.4608 0.3485 -0.0824 -0.0271 -0.0031 221 ASN A CB  
1830 C CG  . ASN A 239 ? 0.7288 0.5062 0.3661 -0.0921 -0.0214 -0.0255 221 ASN A CG  
1831 O OD1 . ASN A 239 ? 0.7359 0.5095 0.3773 -0.0940 -0.0260 -0.0364 221 ASN A OD1 
1832 N ND2 . ASN A 239 ? 0.7429 0.5255 0.3544 -0.0984 -0.0105 -0.0333 221 ASN A ND2 
1833 N N   . LEU A 240 ? 0.6428 0.4123 0.3744 -0.0701 -0.0497 0.0071  222 LEU A N   
1834 C CA  . LEU A 240 ? 0.6185 0.3796 0.3778 -0.0600 -0.0454 0.0018  222 LEU A CA  
1835 C C   . LEU A 240 ? 0.6363 0.3890 0.3881 -0.0617 -0.0378 -0.0191 222 LEU A C   
1836 O O   . LEU A 240 ? 0.6160 0.3584 0.3842 -0.0522 -0.0282 -0.0262 222 LEU A O   
1837 C CB  . LEU A 240 ? 0.6069 0.3758 0.3910 -0.0608 -0.0596 0.0160  222 LEU A CB  
1838 C CG  . LEU A 240 ? 0.5891 0.3625 0.3945 -0.0541 -0.0642 0.0357  222 LEU A CG  
1839 C CD1 . LEU A 240 ? 0.6051 0.3901 0.4324 -0.0583 -0.0815 0.0517  222 LEU A CD1 
1840 C CD2 . LEU A 240 ? 0.5143 0.2782 0.3428 -0.0392 -0.0512 0.0338  222 LEU A CD2 
1841 N N   . GLU A 241 ? 0.6665 0.4234 0.3931 -0.0744 -0.0423 -0.0290 223 GLU A N   
1842 C CA  . GLU A 241 ? 0.6928 0.4410 0.4121 -0.0772 -0.0354 -0.0508 223 GLU A CA  
1843 C C   . GLU A 241 ? 0.6692 0.4070 0.3860 -0.0686 -0.0177 -0.0635 223 GLU A C   
1844 O O   . GLU A 241 ? 0.6727 0.3992 0.4026 -0.0632 -0.0105 -0.0756 223 GLU A O   
1845 C CB  . GLU A 241 ? 0.7332 0.4887 0.4240 -0.0938 -0.0438 -0.0608 223 GLU A CB  
1846 C CG  . GLU A 241 ? 0.8084 0.5737 0.5061 -0.1030 -0.0636 -0.0492 223 GLU A CG  
1847 C CD  . GLU A 241 ? 0.9331 0.7133 0.6267 -0.1075 -0.0775 -0.0248 223 GLU A CD  
1848 O OE1 . GLU A 241 ? 0.9127 0.6953 0.5973 -0.1039 -0.0718 -0.0156 223 GLU A OE1 
1849 O OE2 . GLU A 241 ? 0.9708 0.7605 0.6731 -0.1153 -0.0953 -0.0140 223 GLU A OE2 
1850 N N   . LYS A 242 ? 0.6585 0.4005 0.3622 -0.0673 -0.0116 -0.0589 224 LYS A N   
1851 C CA  . LYS A 242 ? 0.6453 0.3798 0.3502 -0.0591 0.0041  -0.0687 224 LYS A CA  
1852 C C   . LYS A 242 ? 0.6138 0.3395 0.3458 -0.0446 0.0091  -0.0612 224 LYS A C   
1853 O O   . LYS A 242 ? 0.6091 0.3258 0.3493 -0.0373 0.0197  -0.0710 224 LYS A O   
1854 C CB  . LYS A 242 ? 0.6625 0.4064 0.3450 -0.0641 0.0086  -0.0650 224 LYS A CB  
1855 C CG  . LYS A 242 ? 0.6611 0.4000 0.3485 -0.0557 0.0240  -0.0721 224 LYS A CG  
1856 C CD  . LYS A 242 ? 0.7165 0.4663 0.3806 -0.0629 0.0301  -0.0707 224 LYS A CD  
1857 C CE  . LYS A 242 ? 0.7165 0.4620 0.3927 -0.0534 0.0445  -0.0757 224 LYS A CE  
1858 N NZ  . LYS A 242 ? 0.7609 0.5175 0.4179 -0.0602 0.0533  -0.0760 224 LYS A NZ  
1859 N N   . TYR A 243 ? 0.5912 0.3201 0.3378 -0.0408 0.0013  -0.0442 225 TYR A N   
1860 C CA  . TYR A 243 ? 0.5535 0.2765 0.3197 -0.0287 0.0064  -0.0370 225 TYR A CA  
1861 C C   . TYR A 243 ? 0.5346 0.2526 0.3235 -0.0227 0.0046  -0.0338 225 TYR A C   
1862 O O   . TYR A 243 ? 0.5249 0.2368 0.3264 -0.0136 0.0108  -0.0320 225 TYR A O   
1863 C CB  . TYR A 243 ? 0.5456 0.2751 0.3126 -0.0275 0.0026  -0.0213 225 TYR A CB  
1864 C CG  . TYR A 243 ? 0.5539 0.2870 0.3022 -0.0312 0.0082  -0.0226 225 TYR A CG  
1865 C CD1 . TYR A 243 ? 0.5394 0.2663 0.2873 -0.0257 0.0205  -0.0327 225 TYR A CD1 
1866 C CD2 . TYR A 243 ? 0.5377 0.2815 0.2699 -0.0409 0.0009  -0.0127 225 TYR A CD2 
1867 C CE1 . TYR A 243 ? 0.5311 0.2633 0.2644 -0.0296 0.0270  -0.0342 225 TYR A CE1 
1868 C CE2 . TYR A 243 ? 0.5833 0.3320 0.2976 -0.0456 0.0074  -0.0130 225 TYR A CE2 
1869 C CZ  . TYR A 243 ? 0.5632 0.3063 0.2790 -0.0396 0.0213  -0.0246 225 TYR A CZ  
1870 O OH  . TYR A 243 ? 0.5939 0.3437 0.2951 -0.0444 0.0290  -0.0250 225 TYR A OH  
1871 N N   . VAL A 244 ? 0.5366 0.2584 0.3302 -0.0287 -0.0039 -0.0332 226 VAL A N   
1872 C CA  . VAL A 244 ? 0.5204 0.2409 0.3370 -0.0247 -0.0058 -0.0281 226 VAL A CA  
1873 C C   . VAL A 244 ? 0.5384 0.2553 0.3582 -0.0307 -0.0085 -0.0375 226 VAL A C   
1874 O O   . VAL A 244 ? 0.5649 0.2862 0.3736 -0.0408 -0.0164 -0.0423 226 VAL A O   
1875 C CB  . VAL A 244 ? 0.5104 0.2419 0.3409 -0.0251 -0.0154 -0.0123 226 VAL A CB  
1876 C CG1 . VAL A 244 ? 0.4805 0.2131 0.3371 -0.0203 -0.0146 -0.0075 226 VAL A CG1 
1877 C CG2 . VAL A 244 ? 0.5145 0.2477 0.3441 -0.0197 -0.0135 -0.0035 226 VAL A CG2 
1878 N N   . VAL A 245 ? 0.5425 0.2512 0.3770 -0.0255 -0.0024 -0.0400 227 VAL A N   
1879 C CA  . VAL A 245 ? 0.5492 0.2534 0.3934 -0.0306 -0.0051 -0.0461 227 VAL A CA  
1880 C C   . VAL A 245 ? 0.5611 0.2762 0.4193 -0.0362 -0.0155 -0.0369 227 VAL A C   
1881 O O   . VAL A 245 ? 0.5453 0.2680 0.4178 -0.0313 -0.0157 -0.0246 227 VAL A O   
1882 C CB  . VAL A 245 ? 0.5451 0.2394 0.4044 -0.0235 0.0033  -0.0454 227 VAL A CB  
1883 C CG1 . VAL A 245 ? 0.5574 0.2463 0.4313 -0.0294 0.0002  -0.0492 227 VAL A CG1 
1884 C CG2 . VAL A 245 ? 0.5433 0.2278 0.3934 -0.0174 0.0121  -0.0524 227 VAL A CG2 
1885 N N   . LYS A 246 ? 0.5810 0.2973 0.4368 -0.0466 -0.0242 -0.0437 228 LYS A N   
1886 C CA  . LYS A 246 ? 0.5849 0.3116 0.4569 -0.0537 -0.0357 -0.0362 228 LYS A CA  
1887 C C   . LYS A 246 ? 0.5856 0.3043 0.4726 -0.0577 -0.0354 -0.0429 228 LYS A C   
1888 O O   . LYS A 246 ? 0.6009 0.3085 0.4777 -0.0616 -0.0336 -0.0574 228 LYS A O   
1889 C CB  . LYS A 246 ? 0.6061 0.3414 0.4598 -0.0652 -0.0490 -0.0386 228 LYS A CB  
1890 C CG  . LYS A 246 ? 0.5995 0.3505 0.4697 -0.0696 -0.0627 -0.0237 228 LYS A CG  
1891 C CD  . LYS A 246 ? 0.6235 0.3820 0.4754 -0.0841 -0.0781 -0.0274 228 LYS A CD  
1892 C CE  . LYS A 246 ? 0.6106 0.3855 0.4722 -0.0871 -0.0922 -0.0094 228 LYS A CE  
1893 N NZ  . LYS A 246 ? 0.6752 0.4577 0.5080 -0.1014 -0.1067 -0.0114 228 LYS A NZ  
1894 N N   . ASP A 247 ? 0.5805 0.3050 0.4940 -0.0568 -0.0362 -0.0326 229 ASP A N   
1895 C CA  . ASP A 247 ? 0.5875 0.3050 0.5192 -0.0607 -0.0352 -0.0355 229 ASP A CA  
1896 C C   . ASP A 247 ? 0.5766 0.3077 0.5324 -0.0675 -0.0449 -0.0261 229 ASP A C   
1897 O O   . ASP A 247 ? 0.5740 0.3170 0.5474 -0.0621 -0.0422 -0.0131 229 ASP A O   
1898 C CB  . ASP A 247 ? 0.5822 0.2923 0.5241 -0.0512 -0.0215 -0.0300 229 ASP A CB  
1899 C CG  . ASP A 247 ? 0.6232 0.3244 0.5842 -0.0560 -0.0202 -0.0309 229 ASP A CG  
1900 O OD1 . ASP A 247 ? 0.6238 0.3252 0.5956 -0.0661 -0.0295 -0.0349 229 ASP A OD1 
1901 O OD2 . ASP A 247 ? 0.6640 0.3581 0.6298 -0.0501 -0.0104 -0.0262 229 ASP A OD2 
1902 N N   . GLY A 248 ? 0.5734 0.3026 0.5329 -0.0791 -0.0553 -0.0337 230 GLY A N   
1903 C CA  . GLY A 248 ? 0.5747 0.3174 0.5589 -0.0874 -0.0668 -0.0256 230 GLY A CA  
1904 C C   . GLY A 248 ? 0.5681 0.3152 0.5854 -0.0849 -0.0597 -0.0145 230 GLY A C   
1905 O O   . GLY A 248 ? 0.5600 0.3220 0.6033 -0.0897 -0.0669 -0.0049 230 GLY A O   
1906 N N   . LYS A 249 ? 0.5746 0.3095 0.5913 -0.0780 -0.0458 -0.0151 231 LYS A N   
1907 C CA  . LYS A 249 ? 0.5781 0.3169 0.6212 -0.0759 -0.0363 -0.0037 231 LYS A CA  
1908 C C   . LYS A 249 ? 0.5753 0.3285 0.6269 -0.0661 -0.0264 0.0083  231 LYS A C   
1909 O O   . LYS A 249 ? 0.5750 0.3367 0.6494 -0.0654 -0.0182 0.0181  231 LYS A O   
1910 C CB  . LYS A 249 ? 0.5774 0.2973 0.6147 -0.0737 -0.0269 -0.0077 231 LYS A CB  
1911 C CG  . LYS A 249 ? 0.6018 0.3075 0.6444 -0.0843 -0.0355 -0.0185 231 LYS A CG  
1912 C CD  . LYS A 249 ? 0.6051 0.2924 0.6513 -0.0823 -0.0275 -0.0190 231 LYS A CD  
1913 C CE  . LYS A 249 ? 0.6150 0.2918 0.6374 -0.0716 -0.0189 -0.0236 231 LYS A CE  
1914 N NZ  . LYS A 249 ? 0.6707 0.3439 0.6685 -0.0707 -0.0237 -0.0394 231 LYS A NZ  
1915 N N   . LEU A 250 ? 0.5490 0.1926 0.3962 -0.0281 -0.0597 -0.0101 232 LEU A N   
1916 C CA  . LEU A 250 ? 0.5488 0.2068 0.3990 -0.0295 -0.0573 -0.0057 232 LEU A CA  
1917 C C   . LEU A 250 ? 0.5443 0.2093 0.3953 -0.0383 -0.0547 -0.0025 232 LEU A C   
1918 O O   . LEU A 250 ? 0.5615 0.2284 0.4109 -0.0414 -0.0527 0.0021  232 LEU A O   
1919 C CB  . LEU A 250 ? 0.5323 0.2049 0.3899 -0.0243 -0.0549 -0.0094 232 LEU A CB  
1920 C CG  . LEU A 250 ? 0.5405 0.2271 0.4016 -0.0265 -0.0524 -0.0066 232 LEU A CG  
1921 C CD1 . LEU A 250 ? 0.5546 0.2399 0.4136 -0.0247 -0.0540 -0.0029 232 LEU A CD1 
1922 C CD2 . LEU A 250 ? 0.5250 0.2221 0.3916 -0.0240 -0.0498 -0.0100 232 LEU A CD2 
1923 N N   . PRO A 251 ? 0.5449 0.2145 0.3987 -0.0421 -0.0549 -0.0058 233 PRO A N   
1924 C CA  . PRO A 251 ? 0.5313 0.2099 0.3911 -0.0495 -0.0541 -0.0038 233 PRO A CA  
1925 C C   . PRO A 251 ? 0.5491 0.2192 0.4076 -0.0574 -0.0530 -0.0004 233 PRO A C   
1926 O O   . PRO A 251 ? 0.5541 0.2346 0.4200 -0.0631 -0.0494 0.0019  233 PRO A O   
1927 C CB  . PRO A 251 ? 0.5435 0.2238 0.4037 -0.0514 -0.0578 -0.0085 233 PRO A CB  
1928 C CG  . PRO A 251 ? 0.5533 0.2319 0.4073 -0.0440 -0.0571 -0.0121 233 PRO A CG  
1929 C CD  . PRO A 251 ? 0.5492 0.2171 0.4006 -0.0397 -0.0561 -0.0120 233 PRO A CD  
1930 N N   . LEU A 252 ? 0.5533 0.2043 0.4035 -0.0581 -0.0556 -0.0006 234 LEU A N   
1931 C CA  . LEU A 252 ? 0.5609 0.1984 0.4066 -0.0667 -0.0546 0.0039  234 LEU A CA  
1932 C C   . LEU A 252 ? 0.5627 0.1973 0.4008 -0.0676 -0.0503 0.0112  234 LEU A C   
1933 O O   . LEU A 252 ? 0.5552 0.1941 0.3947 -0.0768 -0.0445 0.0148  234 LEU A O   
1934 C CB  . LEU A 252 ? 0.5878 0.2014 0.4251 -0.0662 -0.0598 0.0016  234 LEU A CB  
1935 C CG  . LEU A 252 ? 0.5869 0.1806 0.4169 -0.0762 -0.0595 0.0074  234 LEU A CG  
1936 C CD1 . LEU A 252 ? 0.5755 0.1794 0.4161 -0.0902 -0.0563 0.0073  234 LEU A CD1 
1937 C CD2 . LEU A 252 ? 0.6150 0.1810 0.4358 -0.0724 -0.0660 0.0050  234 LEU A CD2 
1938 N N   . LEU A 253 ? 0.5736 0.2022 0.4038 -0.0583 -0.0529 0.0125  235 LEU A N   
1939 C CA  . LEU A 253 ? 0.5861 0.2115 0.4054 -0.0585 -0.0504 0.0188  235 LEU A CA  
1940 C C   . LEU A 253 ? 0.5757 0.2227 0.4022 -0.0616 -0.0429 0.0182  235 LEU A C   
1941 O O   . LEU A 253 ? 0.5917 0.2379 0.4110 -0.0689 -0.0363 0.0225  235 LEU A O   
1942 C CB  . LEU A 253 ? 0.5803 0.1996 0.3938 -0.0469 -0.0570 0.0187  235 LEU A CB  
1943 C CG  . LEU A 253 ? 0.6033 0.2148 0.4007 -0.0464 -0.0578 0.0250  235 LEU A CG  
1944 C CD1 . LEU A 253 ? 0.6057 0.1966 0.3846 -0.0568 -0.0552 0.0335  235 LEU A CD1 
1945 C CD2 . LEU A 253 ? 0.6084 0.2112 0.4030 -0.0349 -0.0680 0.0244  235 LEU A CD2 
1946 N N   . LEU A 254 ? 0.5552 0.2200 0.3949 -0.0563 -0.0433 0.0128  236 LEU A N   
1947 C CA  . LEU A 254 ? 0.5440 0.2271 0.3919 -0.0569 -0.0376 0.0113  236 LEU A CA  
1948 C C   . LEU A 254 ? 0.5437 0.2372 0.4023 -0.0664 -0.0313 0.0110  236 LEU A C   
1949 O O   . LEU A 254 ? 0.5553 0.2581 0.4157 -0.0691 -0.0239 0.0112  236 LEU A O   
1950 C CB  . LEU A 254 ? 0.5200 0.2161 0.3785 -0.0496 -0.0403 0.0066  236 LEU A CB  
1951 C CG  . LEU A 254 ? 0.5482 0.2409 0.4020 -0.0412 -0.0444 0.0056  236 LEU A CG  
1952 C CD1 . LEU A 254 ? 0.5355 0.2416 0.3990 -0.0371 -0.0442 0.0022  236 LEU A CD1 
1953 C CD2 . LEU A 254 ? 0.5792 0.2632 0.4204 -0.0393 -0.0452 0.0086  236 LEU A CD2 
1954 N N   . SER A 255 ? 0.5411 0.2341 0.4081 -0.0713 -0.0343 0.0094  237 SER A N   
1955 C CA  . SER A 255 ? 0.5554 0.2598 0.4368 -0.0812 -0.0297 0.0084  237 SER A CA  
1956 C C   . SER A 255 ? 0.5812 0.2751 0.4524 -0.0916 -0.0217 0.0138  237 SER A C   
1957 O O   . SER A 255 ? 0.5931 0.3011 0.4747 -0.0990 -0.0125 0.0132  237 SER A O   
1958 C CB  . SER A 255 ? 0.5713 0.2754 0.4621 -0.0845 -0.0371 0.0049  237 SER A CB  
1959 O OG  . SER A 255 ? 0.6063 0.2873 0.4822 -0.0851 -0.0418 0.0064  237 SER A OG  
1960 N N   . ARG A 256 ? 0.5962 0.2651 0.4468 -0.0920 -0.0248 0.0190  238 ARG A N   
1961 C CA  . ARG A 256 ? 0.6360 0.2889 0.4695 -0.1018 -0.0179 0.0264  238 ARG A CA  
1962 C C   . ARG A 256 ? 0.6408 0.3000 0.4635 -0.1008 -0.0091 0.0285  238 ARG A C   
1963 O O   . ARG A 256 ? 0.6493 0.3102 0.4675 -0.1118 0.0023  0.0314  238 ARG A O   
1964 C CB  . ARG A 256 ? 0.6394 0.2608 0.4519 -0.0999 -0.0259 0.0320  238 ARG A CB  
1965 C CG  . ARG A 256 ? 0.6653 0.2752 0.4842 -0.1043 -0.0319 0.0299  238 ARG A CG  
1966 C CD  . ARG A 256 ? 0.7367 0.3110 0.5340 -0.1048 -0.0382 0.0365  238 ARG A CD  
1967 N NE  . ARG A 256 ? 0.8460 0.4030 0.6192 -0.1097 -0.0338 0.0467  238 ARG A NE  
1968 C CZ  . ARG A 256 ? 0.8954 0.4300 0.6538 -0.1235 -0.0298 0.0549  238 ARG A CZ  
1969 N NH1 . ARG A 256 ? 0.8926 0.4199 0.6607 -0.1340 -0.0299 0.0534  238 ARG A NH1 
1970 N NH2 . ARG A 256 ? 0.9019 0.4193 0.6336 -0.1277 -0.0260 0.0648  238 ARG A NH2 
1971 N N   . MET A 257 ? 0.6267 0.2893 0.4450 -0.0886 -0.0138 0.0263  239 MET A N   
1972 C CA  . MET A 257 ? 0.6507 0.3192 0.4586 -0.0867 -0.0070 0.0261  239 MET A CA  
1973 C C   . MET A 257 ? 0.6478 0.3424 0.4756 -0.0902 0.0044  0.0199  239 MET A C   
1974 O O   . MET A 257 ? 0.6654 0.3631 0.4838 -0.0958 0.0160  0.0203  239 MET A O   
1975 C CB  . MET A 257 ? 0.6312 0.3003 0.4360 -0.0733 -0.0158 0.0232  239 MET A CB  
1976 C CG  . MET A 257 ? 0.6547 0.3004 0.4390 -0.0684 -0.0260 0.0286  239 MET A CG  
1977 S SD  . MET A 257 ? 0.6515 0.3054 0.4446 -0.0542 -0.0358 0.0228  239 MET A SD  
1978 C CE  . MET A 257 ? 0.6403 0.2681 0.4108 -0.0490 -0.0478 0.0290  239 MET A CE  
1979 N N   . LYS A 258 ? 0.6330 0.3457 0.4873 -0.0863 0.0007  0.0139  240 LYS A N   
1980 C CA  . LYS A 258 ? 0.6484 0.3869 0.5277 -0.0876 0.0083  0.0073  240 LYS A CA  
1981 C C   . LYS A 258 ? 0.6638 0.4111 0.5541 -0.1017 0.0196  0.0076  240 LYS A C   
1982 O O   . LYS A 258 ? 0.6712 0.4402 0.5803 -0.1037 0.0297  0.0018  240 LYS A O   
1983 C CB  . LYS A 258 ? 0.6233 0.3746 0.5250 -0.0795 -0.0020 0.0023  240 LYS A CB  
1984 C CG  . LYS A 258 ? 0.6450 0.4204 0.5711 -0.0749 0.0018  -0.0050 240 LYS A CG  
1985 C CD  . LYS A 258 ? 0.6403 0.4165 0.5693 -0.0626 -0.0079 -0.0074 240 LYS A CD  
1986 C CE  . LYS A 258 ? 0.6563 0.4500 0.6128 -0.0591 -0.0139 -0.0121 240 LYS A CE  
1987 N NZ  . LYS A 258 ? 0.6663 0.4790 0.6431 -0.0556 -0.0066 -0.0187 240 LYS A NZ  
1988 N N   . GLU A 259 ? 0.6871 0.4175 0.5671 -0.1116 0.0186  0.0137  241 GLU A N   
1989 C CA  . GLU A 259 ? 0.7155 0.4498 0.6013 -0.1279 0.0310  0.0156  241 GLU A CA  
1990 C C   . GLU A 259 ? 0.7319 0.4612 0.5958 -0.1346 0.0467  0.0189  241 GLU A C   
1991 O O   . GLU A 259 ? 0.7359 0.4813 0.6123 -0.1460 0.0623  0.0165  241 GLU A O   
1992 C CB  . GLU A 259 ? 0.7326 0.4434 0.6079 -0.1371 0.0249  0.0222  241 GLU A CB  
1993 C CG  . GLU A 259 ? 0.7510 0.4712 0.6522 -0.1382 0.0148  0.0172  241 GLU A CG  
1994 C CD  . GLU A 259 ? 0.7793 0.4702 0.6650 -0.1417 0.0046  0.0220  241 GLU A CD  
1995 O OE1 . GLU A 259 ? 0.8543 0.5203 0.7168 -0.1505 0.0090  0.0302  241 GLU A OE1 
1996 O OE2 . GLU A 259 ? 0.8056 0.4971 0.7009 -0.1356 -0.0078 0.0173  241 GLU A OE2 
1997 N N   . VAL A 260 ? 0.7374 0.4449 0.5684 -0.1281 0.0428  0.0241  242 VAL A N   
1998 C CA  . VAL A 260 ? 0.7503 0.4453 0.5505 -0.1354 0.0553  0.0290  242 VAL A CA  
1999 C C   . VAL A 260 ? 0.7435 0.4490 0.5368 -0.1261 0.0603  0.0226  242 VAL A C   
2000 O O   . VAL A 260 ? 0.7670 0.4667 0.5362 -0.1327 0.0732  0.0241  242 VAL A O   
2001 C CB  . VAL A 260 ? 0.7838 0.4399 0.5444 -0.1384 0.0472  0.0414  242 VAL A CB  
2002 C CG1 . VAL A 260 ? 0.8086 0.4506 0.5729 -0.1506 0.0457  0.0476  242 VAL A CG1 
2003 C CG2 . VAL A 260 ? 0.7421 0.3847 0.4926 -0.1221 0.0286  0.0421  242 VAL A CG2 
2004 N N   . GLY A 261 ? 0.7017 0.4210 0.5142 -0.1118 0.0506  0.0153  243 GLY A N   
2005 C CA  . GLY A 261 ? 0.6869 0.4150 0.4955 -0.1026 0.0539  0.0080  243 GLY A CA  
2006 C C   . GLY A 261 ? 0.6532 0.3975 0.4897 -0.0892 0.0436  0.0005  243 GLY A C   
2007 O O   . GLY A 261 ? 0.6431 0.3942 0.5020 -0.0878 0.0355  0.0005  243 GLY A O   
2008 N N   . LYS A 262 ? 0.6339 0.3820 0.4671 -0.0799 0.0433  -0.0059 244 LYS A N   
2009 C CA  . LYS A 262 ? 0.6062 0.3637 0.4608 -0.0677 0.0324  -0.0113 244 LYS A CA  
2010 C C   . LYS A 262 ? 0.5852 0.3253 0.4254 -0.0611 0.0170  -0.0065 244 LYS A C   
2011 O O   . LYS A 262 ? 0.5984 0.3206 0.4108 -0.0623 0.0143  -0.0018 244 LYS A O   
2012 C CB  . LYS A 262 ? 0.6119 0.3815 0.4744 -0.0606 0.0389  -0.0217 244 LYS A CB  
2013 C CG  . LYS A 262 ? 0.6564 0.4416 0.5268 -0.0669 0.0575  -0.0280 244 LYS A CG  
2014 C CD  . LYS A 262 ? 0.7195 0.5275 0.6249 -0.0587 0.0600  -0.0388 244 LYS A CD  
2015 C CE  . LYS A 262 ? 0.7691 0.5957 0.6855 -0.0646 0.0805  -0.0469 244 LYS A CE  
2016 N NZ  . LYS A 262 ? 0.7958 0.6460 0.7521 -0.0547 0.0811  -0.0582 244 LYS A NZ  
2017 N N   . VAL A 263 ? 0.5441 0.2900 0.4034 -0.0543 0.0069  -0.0079 245 VAL A N   
2018 C CA  . VAL A 263 ? 0.5150 0.2496 0.3672 -0.0481 -0.0057 -0.0052 245 VAL A CA  
2019 C C   . VAL A 263 ? 0.4990 0.2404 0.3627 -0.0396 -0.0097 -0.0111 245 VAL A C   
2020 O O   . VAL A 263 ? 0.4919 0.2463 0.3763 -0.0370 -0.0082 -0.0153 245 VAL A O   
2021 C CB  . VAL A 263 ? 0.5106 0.2418 0.3703 -0.0495 -0.0131 -0.0008 245 VAL A CB  
2022 C CG1 . VAL A 263 ? 0.4719 0.1932 0.3253 -0.0434 -0.0236 0.0008  245 VAL A CG1 
2023 C CG2 . VAL A 263 ? 0.5192 0.2410 0.3683 -0.0589 -0.0092 0.0048  245 VAL A CG2 
2024 N N   . PHE A 264 ? 0.4840 0.2159 0.3350 -0.0355 -0.0157 -0.0113 246 PHE A N   
2025 C CA  . PHE A 264 ? 0.4616 0.1962 0.3217 -0.0291 -0.0202 -0.0160 246 PHE A CA  
2026 C C   . PHE A 264 ? 0.4563 0.1832 0.3129 -0.0264 -0.0302 -0.0136 246 PHE A C   
2027 O O   . PHE A 264 ? 0.4468 0.1655 0.2915 -0.0275 -0.0343 -0.0099 246 PHE A O   
2028 C CB  . PHE A 264 ? 0.4757 0.2113 0.3299 -0.0271 -0.0143 -0.0233 246 PHE A CB  
2029 C CG  . PHE A 264 ? 0.4816 0.2049 0.3108 -0.0279 -0.0165 -0.0236 246 PHE A CG  
2030 C CD1 . PHE A 264 ? 0.4891 0.2064 0.3155 -0.0241 -0.0253 -0.0263 246 PHE A CD1 
2031 C CD2 . PHE A 264 ? 0.5091 0.2262 0.3168 -0.0333 -0.0101 -0.0214 246 PHE A CD2 
2032 C CE1 . PHE A 264 ? 0.4851 0.1917 0.2893 -0.0246 -0.0300 -0.0274 246 PHE A CE1 
2033 C CE2 . PHE A 264 ? 0.5363 0.2400 0.3174 -0.0338 -0.0143 -0.0214 246 PHE A CE2 
2034 C CZ  . PHE A 264 ? 0.5313 0.2305 0.3115 -0.0289 -0.0251 -0.0249 246 PHE A CZ  
2035 N N   . LEU A 265 ? 0.4511 0.1808 0.3199 -0.0229 -0.0339 -0.0158 247 LEU A N   
2036 C CA  . LEU A 265 ? 0.4506 0.1763 0.3204 -0.0214 -0.0408 -0.0151 247 LEU A CA  
2037 C C   . LEU A 265 ? 0.4569 0.1801 0.3266 -0.0193 -0.0424 -0.0207 247 LEU A C   
2038 O O   . LEU A 265 ? 0.4466 0.1714 0.3237 -0.0173 -0.0400 -0.0241 247 LEU A O   
2039 C CB  . LEU A 265 ? 0.4387 0.1672 0.3198 -0.0215 -0.0427 -0.0124 247 LEU A CB  
2040 C CG  . LEU A 265 ? 0.4658 0.1921 0.3489 -0.0216 -0.0469 -0.0118 247 LEU A CG  
2041 C CD1 . LEU A 265 ? 0.4597 0.1844 0.3380 -0.0218 -0.0488 -0.0099 247 LEU A CD1 
2042 C CD2 . LEU A 265 ? 0.4387 0.1652 0.3283 -0.0224 -0.0472 -0.0097 247 LEU A CD2 
2043 N N   . ALA A 266 ? 0.4762 0.1949 0.3385 -0.0194 -0.0475 -0.0222 248 ALA A N   
2044 C CA  . ALA A 266 ? 0.4909 0.2065 0.3556 -0.0186 -0.0509 -0.0279 248 ALA A CA  
2045 C C   . ALA A 266 ? 0.4916 0.2083 0.3639 -0.0200 -0.0573 -0.0269 248 ALA A C   
2046 O O   . ALA A 266 ? 0.5083 0.2253 0.3763 -0.0198 -0.0622 -0.0260 248 ALA A O   
2047 C CB  . ALA A 266 ? 0.5015 0.2116 0.3497 -0.0181 -0.0510 -0.0336 248 ALA A CB  
2048 N N   . THR A 267 ? 0.4952 0.2124 0.3795 -0.0215 -0.0571 -0.0267 249 THR A N   
2049 C CA  . THR A 267 ? 0.4922 0.2130 0.3866 -0.0245 -0.0603 -0.0263 249 THR A CA  
2050 C C   . THR A 267 ? 0.4934 0.2103 0.3953 -0.0280 -0.0626 -0.0302 249 THR A C   
2051 O O   . THR A 267 ? 0.4960 0.2051 0.3965 -0.0275 -0.0610 -0.0315 249 THR A O   
2052 C CB  . THR A 267 ? 0.4805 0.2056 0.3806 -0.0256 -0.0563 -0.0208 249 THR A CB  
2053 O OG1 . THR A 267 ? 0.4907 0.2210 0.4021 -0.0292 -0.0565 -0.0216 249 THR A OG1 
2054 C CG2 . THR A 267 ? 0.4844 0.2053 0.3841 -0.0261 -0.0526 -0.0174 249 THR A CG2 
2055 N N   . ASN A 268 ? 0.4899 0.2119 0.4016 -0.0314 -0.0666 -0.0327 250 ASN A N   
2056 C CA  . ASN A 268 ? 0.4912 0.2099 0.4128 -0.0372 -0.0681 -0.0359 250 ASN A CA  
2057 C C   . ASN A 268 ? 0.4912 0.2077 0.4196 -0.0425 -0.0617 -0.0306 250 ASN A C   
2058 O O   . ASN A 268 ? 0.4967 0.2046 0.4290 -0.0479 -0.0617 -0.0313 250 ASN A O   
2059 C CB  . ASN A 268 ? 0.4891 0.2167 0.4224 -0.0402 -0.0750 -0.0411 250 ASN A CB  
2060 C CG  . ASN A 268 ? 0.5198 0.2425 0.4434 -0.0377 -0.0840 -0.0478 250 ASN A CG  
2061 O OD1 . ASN A 268 ? 0.5514 0.2661 0.4572 -0.0331 -0.0832 -0.0482 250 ASN A OD1 
2062 N ND2 . ASN A 268 ? 0.5213 0.2491 0.4562 -0.0415 -0.0924 -0.0538 250 ASN A ND2 
2063 N N   . SER A 269 ? 0.4891 0.2111 0.4165 -0.0416 -0.0565 -0.0252 251 SER A N   
2064 C CA  . SER A 269 ? 0.5067 0.2248 0.4343 -0.0469 -0.0502 -0.0195 251 SER A CA  
2065 C C   . SER A 269 ? 0.4986 0.2013 0.4166 -0.0458 -0.0506 -0.0155 251 SER A C   
2066 O O   . SER A 269 ? 0.5005 0.1999 0.4131 -0.0392 -0.0534 -0.0168 251 SER A O   
2067 C CB  . SER A 269 ? 0.4966 0.2221 0.4210 -0.0450 -0.0454 -0.0160 251 SER A CB  
2068 O OG  . SER A 269 ? 0.5699 0.3087 0.5048 -0.0436 -0.0461 -0.0203 251 SER A OG  
2069 N N   . ASP A 270 ? 0.5111 0.2043 0.4270 -0.0522 -0.0476 -0.0103 252 ASP A N   
2070 C CA  . ASP A 270 ? 0.5319 0.2085 0.4385 -0.0501 -0.0501 -0.0053 252 ASP A CA  
2071 C C   . ASP A 270 ? 0.5221 0.2009 0.4199 -0.0452 -0.0496 -0.0004 252 ASP A C   
2072 O O   . ASP A 270 ? 0.5190 0.2100 0.4166 -0.0448 -0.0463 -0.0009 252 ASP A O   
2073 C CB  . ASP A 270 ? 0.5605 0.2221 0.4640 -0.0597 -0.0480 0.0002  252 ASP A CB  
2074 C CG  . ASP A 270 ? 0.5994 0.2653 0.4971 -0.0675 -0.0399 0.0058  252 ASP A CG  
2075 O OD1 . ASP A 270 ? 0.6398 0.3116 0.5298 -0.0640 -0.0380 0.0083  252 ASP A OD1 
2076 O OD2 . ASP A 270 ? 0.7131 0.3759 0.6139 -0.0781 -0.0346 0.0073  252 ASP A OD2 
2077 N N   . TYR A 271 ? 0.5221 0.1885 0.4136 -0.0414 -0.0541 0.0039  253 TYR A N   
2078 C CA  . TYR A 271 ? 0.5271 0.1960 0.4126 -0.0367 -0.0561 0.0074  253 TYR A CA  
2079 C C   . TYR A 271 ? 0.5318 0.1997 0.4052 -0.0423 -0.0527 0.0135  253 TYR A C   
2080 O O   . TYR A 271 ? 0.5433 0.2205 0.4142 -0.0400 -0.0521 0.0130  253 TYR A O   
2081 C CB  . TYR A 271 ? 0.5415 0.1994 0.4274 -0.0298 -0.0638 0.0094  253 TYR A CB  
2082 C CG  . TYR A 271 ? 0.5387 0.2037 0.4228 -0.0251 -0.0671 0.0116  253 TYR A CG  
2083 C CD1 . TYR A 271 ? 0.5144 0.1961 0.4067 -0.0212 -0.0648 0.0062  253 TYR A CD1 
2084 C CD2 . TYR A 271 ? 0.5499 0.2036 0.4224 -0.0258 -0.0731 0.0193  253 TYR A CD2 
2085 C CE1 . TYR A 271 ? 0.5321 0.2208 0.4248 -0.0186 -0.0679 0.0076  253 TYR A CE1 
2086 C CE2 . TYR A 271 ? 0.5370 0.1977 0.4090 -0.0222 -0.0779 0.0203  253 TYR A CE2 
2087 C CZ  . TYR A 271 ? 0.5283 0.2073 0.4122 -0.0189 -0.0751 0.0141  253 TYR A CZ  
2088 O OH  . TYR A 271 ? 0.5446 0.2307 0.4299 -0.0169 -0.0799 0.0147  253 TYR A OH  
2089 N N   . LYS A 272 ? 0.5366 0.1925 0.4011 -0.0505 -0.0499 0.0187  254 LYS A N   
2090 C CA  . LYS A 272 ? 0.5589 0.2121 0.4078 -0.0567 -0.0450 0.0240  254 LYS A CA  
2091 C C   . LYS A 272 ? 0.5432 0.2146 0.3976 -0.0591 -0.0360 0.0183  254 LYS A C   
2092 O O   . LYS A 272 ? 0.5480 0.2223 0.3922 -0.0591 -0.0338 0.0190  254 LYS A O   
2093 C CB  . LYS A 272 ? 0.5905 0.2257 0.4267 -0.0668 -0.0418 0.0312  254 LYS A CB  
2094 C CG  . LYS A 272 ? 0.6742 0.2855 0.4956 -0.0643 -0.0523 0.0399  254 LYS A CG  
2095 C CD  . LYS A 272 ? 0.7628 0.3520 0.5714 -0.0754 -0.0494 0.0477  254 LYS A CD  
2096 C CE  . LYS A 272 ? 0.8414 0.4027 0.6295 -0.0733 -0.0610 0.0585  254 LYS A CE  
2097 N NZ  . LYS A 272 ? 0.8838 0.4439 0.6511 -0.0717 -0.0644 0.0633  254 LYS A NZ  
2098 N N   . TYR A 273 ? 0.5257 0.2083 0.3965 -0.0610 -0.0319 0.0124  255 TYR A N   
2099 C CA  . TYR A 273 ? 0.5103 0.2102 0.3904 -0.0611 -0.0255 0.0063  255 TYR A CA  
2100 C C   . TYR A 273 ? 0.4918 0.1996 0.3734 -0.0519 -0.0301 0.0031  255 TYR A C   
2101 O O   . TYR A 273 ? 0.4890 0.2028 0.3673 -0.0509 -0.0264 0.0012  255 TYR A O   
2102 C CB  . TYR A 273 ? 0.4906 0.2010 0.3903 -0.0643 -0.0232 0.0004  255 TYR A CB  
2103 C CG  . TYR A 273 ? 0.4918 0.2209 0.4048 -0.0633 -0.0178 -0.0063 255 TYR A CG  
2104 C CD1 . TYR A 273 ? 0.4900 0.2248 0.4017 -0.0694 -0.0066 -0.0069 255 TYR A CD1 
2105 C CD2 . TYR A 273 ? 0.4714 0.2114 0.3971 -0.0557 -0.0239 -0.0122 255 TYR A CD2 
2106 C CE1 . TYR A 273 ? 0.4830 0.2356 0.4105 -0.0668 -0.0019 -0.0146 255 TYR A CE1 
2107 C CE2 . TYR A 273 ? 0.4414 0.1964 0.3806 -0.0531 -0.0212 -0.0182 255 TYR A CE2 
2108 C CZ  . TYR A 273 ? 0.4835 0.2458 0.4259 -0.0579 -0.0102 -0.0200 255 TYR A CZ  
2109 O OH  . TYR A 273 ? 0.4779 0.2563 0.4375 -0.0537 -0.0075 -0.0276 255 TYR A OH  
2110 N N   . THR A 274 ? 0.4831 0.1896 0.3689 -0.0458 -0.0373 0.0021  256 THR A N   
2111 C CA  . THR A 274 ? 0.4656 0.1785 0.3529 -0.0391 -0.0406 -0.0004 256 THR A CA  
2112 C C   . THR A 274 ? 0.4679 0.1773 0.3442 -0.0382 -0.0417 0.0029  256 THR A C   
2113 O O   . THR A 274 ? 0.4591 0.1738 0.3345 -0.0365 -0.0407 0.0008  256 THR A O   
2114 C CB  . THR A 274 ? 0.4685 0.1792 0.3600 -0.0344 -0.0458 -0.0018 256 THR A CB  
2115 O OG1 . THR A 274 ? 0.4561 0.1680 0.3552 -0.0357 -0.0461 -0.0058 256 THR A OG1 
2116 C CG2 . THR A 274 ? 0.4315 0.1484 0.3234 -0.0294 -0.0473 -0.0038 256 THR A CG2 
2117 N N   . ASP A 275 ? 0.4905 0.1893 0.3581 -0.0395 -0.0451 0.0082  257 ASP A N   
2118 C CA  . ASP A 275 ? 0.4929 0.1870 0.3487 -0.0391 -0.0489 0.0115  257 ASP A CA  
2119 C C   . ASP A 275 ? 0.5105 0.2044 0.3539 -0.0439 -0.0427 0.0110  257 ASP A C   
2120 O O   . ASP A 275 ? 0.4851 0.1814 0.3236 -0.0425 -0.0440 0.0090  257 ASP A O   
2121 C CB  . ASP A 275 ? 0.5077 0.1882 0.3562 -0.0389 -0.0559 0.0176  257 ASP A CB  
2122 C CG  . ASP A 275 ? 0.5272 0.2041 0.3668 -0.0368 -0.0639 0.0205  257 ASP A CG  
2123 O OD1 . ASP A 275 ? 0.4972 0.1838 0.3416 -0.0347 -0.0649 0.0168  257 ASP A OD1 
2124 O OD2 . ASP A 275 ? 0.6102 0.2731 0.4372 -0.0378 -0.0703 0.0268  257 ASP A OD2 
2125 N N   . LYS A 276 ? 0.5207 0.2117 0.3594 -0.0500 -0.0352 0.0120  258 LYS A N   
2126 C CA  . LYS A 276 ? 0.5458 0.2388 0.3745 -0.0544 -0.0265 0.0095  258 LYS A CA  
2127 C C   . LYS A 276 ? 0.5259 0.2320 0.3670 -0.0498 -0.0235 0.0016  258 LYS A C   
2128 O O   . LYS A 276 ? 0.5466 0.2519 0.3786 -0.0490 -0.0223 -0.0013 258 LYS A O   
2129 C CB  . LYS A 276 ? 0.5625 0.2538 0.3887 -0.0628 -0.0163 0.0107  258 LYS A CB  
2130 C CG  . LYS A 276 ? 0.6379 0.3105 0.4397 -0.0695 -0.0171 0.0195  258 LYS A CG  
2131 C CD  . LYS A 276 ? 0.7561 0.4270 0.5569 -0.0799 -0.0052 0.0210  258 LYS A CD  
2132 C CE  . LYS A 276 ? 0.8501 0.4989 0.6346 -0.0861 -0.0096 0.0317  258 LYS A CE  
2133 N NZ  . LYS A 276 ? 0.9356 0.5667 0.6854 -0.0914 -0.0090 0.0387  258 LYS A NZ  
2134 N N   . ILE A 277 ? 0.5024 0.2183 0.3626 -0.0467 -0.0235 -0.0020 259 ILE A N   
2135 C CA  . ILE A 277 ? 0.4885 0.2139 0.3601 -0.0414 -0.0230 -0.0083 259 ILE A CA  
2136 C C   . ILE A 277 ? 0.4774 0.1993 0.3447 -0.0368 -0.0299 -0.0079 259 ILE A C   
2137 O O   . ILE A 277 ? 0.4690 0.1903 0.3331 -0.0350 -0.0289 -0.0114 259 ILE A O   
2138 C CB  . ILE A 277 ? 0.4825 0.2168 0.3728 -0.0391 -0.0247 -0.0112 259 ILE A CB  
2139 C CG1 . ILE A 277 ? 0.4708 0.2115 0.3700 -0.0450 -0.0172 -0.0131 259 ILE A CG1 
2140 C CG2 . ILE A 277 ? 0.4649 0.2048 0.3640 -0.0322 -0.0280 -0.0159 259 ILE A CG2 
2141 C CD1 . ILE A 277 ? 0.4315 0.1819 0.3376 -0.0456 -0.0081 -0.0194 259 ILE A CD1 
2142 N N   . MET A 278 ? 0.4749 0.1942 0.3431 -0.0354 -0.0362 -0.0042 260 MET A N   
2143 C CA  . MET A 278 ? 0.4753 0.1937 0.3427 -0.0328 -0.0412 -0.0040 260 MET A CA  
2144 C C   . MET A 278 ? 0.4807 0.1934 0.3360 -0.0349 -0.0433 -0.0032 260 MET A C   
2145 O O   . MET A 278 ? 0.4791 0.1911 0.3340 -0.0342 -0.0454 -0.0052 260 MET A O   
2146 C CB  . MET A 278 ? 0.4662 0.1856 0.3394 -0.0311 -0.0455 -0.0017 260 MET A CB  
2147 C CG  . MET A 278 ? 0.4653 0.1887 0.3470 -0.0289 -0.0448 -0.0036 260 MET A CG  
2148 S SD  . MET A 278 ? 0.5148 0.2403 0.3983 -0.0262 -0.0451 -0.0063 260 MET A SD  
2149 C CE  . MET A 278 ? 0.5035 0.2276 0.3841 -0.0267 -0.0466 -0.0043 260 MET A CE  
2150 N N   . THR A 279 ? 0.4866 0.1932 0.3305 -0.0381 -0.0439 0.0000  261 THR A N   
2151 C CA  . THR A 279 ? 0.4992 0.1989 0.3277 -0.0405 -0.0473 0.0003  261 THR A CA  
2152 C C   . THR A 279 ? 0.5060 0.2048 0.3279 -0.0413 -0.0410 -0.0059 261 THR A C   
2153 O O   . THR A 279 ? 0.5201 0.2153 0.3362 -0.0415 -0.0446 -0.0088 261 THR A O   
2154 C CB  . THR A 279 ? 0.5128 0.2026 0.3247 -0.0441 -0.0495 0.0057  261 THR A CB  
2155 O OG1 . THR A 279 ? 0.5452 0.2340 0.3649 -0.0417 -0.0570 0.0106  261 THR A OG1 
2156 C CG2 . THR A 279 ? 0.5154 0.1961 0.3063 -0.0469 -0.0544 0.0055  261 THR A CG2 
2157 N N   . TYR A 280 ? 0.5058 0.2082 0.3303 -0.0418 -0.0317 -0.0088 262 TYR A N   
2158 C CA  . TYR A 280 ? 0.5070 0.2105 0.3298 -0.0407 -0.0247 -0.0166 262 TYR A CA  
2159 C C   . TYR A 280 ? 0.4874 0.1922 0.3219 -0.0353 -0.0286 -0.0205 262 TYR A C   
2160 O O   . TYR A 280 ? 0.4895 0.1888 0.3178 -0.0344 -0.0282 -0.0258 262 TYR A O   
2161 C CB  . TYR A 280 ? 0.5006 0.2122 0.3313 -0.0419 -0.0137 -0.0197 262 TYR A CB  
2162 C CG  . TYR A 280 ? 0.5025 0.2199 0.3422 -0.0377 -0.0066 -0.0295 262 TYR A CG  
2163 C CD1 . TYR A 280 ? 0.4891 0.2025 0.3143 -0.0397 0.0016  -0.0360 262 TYR A CD1 
2164 C CD2 . TYR A 280 ? 0.4588 0.1849 0.3210 -0.0313 -0.0087 -0.0327 262 TYR A CD2 
2165 C CE1 . TYR A 280 ? 0.4877 0.2068 0.3242 -0.0343 0.0085  -0.0466 262 TYR A CE1 
2166 C CE2 . TYR A 280 ? 0.4754 0.2063 0.3484 -0.0258 -0.0040 -0.0418 262 TYR A CE2 
2167 C CZ  . TYR A 280 ? 0.4954 0.2235 0.3574 -0.0269 0.0051  -0.0492 262 TYR A CZ  
2168 O OH  . TYR A 280 ? 0.5217 0.2550 0.3977 -0.0198 0.0099  -0.0598 262 TYR A OH  
2169 N N   . LEU A 281 ? 0.4742 0.1840 0.3230 -0.0324 -0.0325 -0.0178 263 LEU A N   
2170 C CA  . LEU A 281 ? 0.4592 0.1673 0.3155 -0.0283 -0.0361 -0.0196 263 LEU A CA  
2171 C C   . LEU A 281 ? 0.4787 0.1791 0.3279 -0.0307 -0.0420 -0.0182 263 LEU A C   
2172 O O   . LEU A 281 ? 0.4934 0.1873 0.3436 -0.0291 -0.0439 -0.0207 263 LEU A O   
2173 C CB  . LEU A 281 ? 0.4485 0.1621 0.3168 -0.0257 -0.0386 -0.0165 263 LEU A CB  
2174 C CG  . LEU A 281 ? 0.4131 0.1352 0.2935 -0.0229 -0.0358 -0.0187 263 LEU A CG  
2175 C CD1 . LEU A 281 ? 0.4065 0.1302 0.2925 -0.0211 -0.0410 -0.0155 263 LEU A CD1 
2176 C CD2 . LEU A 281 ? 0.4212 0.1449 0.3093 -0.0180 -0.0334 -0.0254 263 LEU A CD2 
2177 N N   . PHE A 282 ? 0.4759 0.1764 0.3194 -0.0346 -0.0457 -0.0145 264 PHE A N   
2178 C CA  . PHE A 282 ? 0.4860 0.1826 0.3266 -0.0379 -0.0522 -0.0139 264 PHE A CA  
2179 C C   . PHE A 282 ? 0.5080 0.1973 0.3330 -0.0410 -0.0544 -0.0173 264 PHE A C   
2180 O O   . PHE A 282 ? 0.5102 0.1962 0.3327 -0.0444 -0.0612 -0.0180 264 PHE A O   
2181 C CB  . PHE A 282 ? 0.4699 0.1738 0.3195 -0.0390 -0.0566 -0.0089 264 PHE A CB  
2182 C CG  . PHE A 282 ? 0.4913 0.2000 0.3524 -0.0373 -0.0544 -0.0071 264 PHE A CG  
2183 C CD1 . PHE A 282 ? 0.4996 0.2083 0.3660 -0.0402 -0.0558 -0.0065 264 PHE A CD1 
2184 C CD2 . PHE A 282 ? 0.5034 0.2153 0.3681 -0.0337 -0.0506 -0.0062 264 PHE A CD2 
2185 C CE1 . PHE A 282 ? 0.5103 0.2210 0.3819 -0.0397 -0.0527 -0.0044 264 PHE A CE1 
2186 C CE2 . PHE A 282 ? 0.5093 0.2235 0.3798 -0.0324 -0.0494 -0.0049 264 PHE A CE2 
2187 C CZ  . PHE A 282 ? 0.4913 0.2041 0.3633 -0.0354 -0.0500 -0.0037 264 PHE A CZ  
2188 N N   . ASP A 283 ? 0.5251 0.2118 0.3392 -0.0405 -0.0481 -0.0202 265 ASP A N   
2189 C CA  . ASP A 283 ? 0.5599 0.2378 0.3532 -0.0439 -0.0490 -0.0237 265 ASP A CA  
2190 C C   . ASP A 283 ? 0.5677 0.2367 0.3550 -0.0437 -0.0486 -0.0322 265 ASP A C   
2191 O O   . ASP A 283 ? 0.5726 0.2385 0.3550 -0.0413 -0.0402 -0.0394 265 ASP A O   
2192 C CB  . ASP A 283 ? 0.5759 0.2534 0.3563 -0.0453 -0.0405 -0.0233 265 ASP A CB  
2193 C CG  . ASP A 283 ? 0.6489 0.3148 0.4011 -0.0498 -0.0406 -0.0268 265 ASP A CG  
2194 O OD1 . ASP A 283 ? 0.6487 0.3076 0.3904 -0.0524 -0.0519 -0.0262 265 ASP A OD1 
2195 O OD2 . ASP A 283 ? 0.7228 0.3872 0.4632 -0.0512 -0.0292 -0.0306 265 ASP A OD2 
2196 N N   . PHE A 284 ? 0.5732 0.2381 0.3624 -0.0466 -0.0579 -0.0322 266 PHE A N   
2197 C CA  . PHE A 284 ? 0.5799 0.2333 0.3631 -0.0479 -0.0602 -0.0400 266 PHE A CA  
2198 C C   . PHE A 284 ? 0.6006 0.2499 0.3734 -0.0542 -0.0714 -0.0400 266 PHE A C   
2199 O O   . PHE A 284 ? 0.6001 0.2576 0.3779 -0.0559 -0.0778 -0.0332 266 PHE A O   
2200 C CB  . PHE A 284 ? 0.5757 0.2273 0.3761 -0.0464 -0.0611 -0.0393 266 PHE A CB  
2201 C CG  . PHE A 284 ? 0.5594 0.2138 0.3698 -0.0394 -0.0534 -0.0394 266 PHE A CG  
2202 C CD1 . PHE A 284 ? 0.5834 0.2296 0.3909 -0.0342 -0.0482 -0.0480 266 PHE A CD1 
2203 C CD2 . PHE A 284 ? 0.5143 0.1797 0.3378 -0.0373 -0.0521 -0.0321 266 PHE A CD2 
2204 C CE1 . PHE A 284 ? 0.5857 0.2365 0.4062 -0.0266 -0.0431 -0.0486 266 PHE A CE1 
2205 C CE2 . PHE A 284 ? 0.5221 0.1906 0.3550 -0.0310 -0.0474 -0.0325 266 PHE A CE2 
2206 C CZ  . PHE A 284 ? 0.5271 0.1892 0.3599 -0.0254 -0.0436 -0.0404 266 PHE A CZ  
2207 N N   . PRO A 285 ? 0.6239 0.2602 0.3826 -0.0571 -0.0748 -0.0484 267 PRO A N   
2208 C CA  . PRO A 285 ? 0.6493 0.2830 0.4005 -0.0635 -0.0881 -0.0486 267 PRO A CA  
2209 C C   . PRO A 285 ? 0.6452 0.2840 0.4198 -0.0677 -0.0953 -0.0464 267 PRO A C   
2210 O O   . PRO A 285 ? 0.6731 0.3047 0.4454 -0.0737 -0.1040 -0.0516 267 PRO A O   
2211 C CB  . PRO A 285 ? 0.6758 0.2922 0.4015 -0.0656 -0.0885 -0.0599 267 PRO A CB  
2212 C CG  . PRO A 285 ? 0.6718 0.2818 0.4038 -0.0606 -0.0777 -0.0663 267 PRO A CG  
2213 C CD  . PRO A 285 ? 0.6407 0.2642 0.3899 -0.0544 -0.0680 -0.0589 267 PRO A CD  
2214 N N   . HIS A 286 ? 0.6175 0.2685 0.4135 -0.0655 -0.0912 -0.0391 268 HIS A N   
2215 C CA  . HIS A 286 ? 0.5961 0.2517 0.4128 -0.0706 -0.0941 -0.0370 268 HIS A CA  
2216 C C   . HIS A 286 ? 0.5649 0.2339 0.3987 -0.0671 -0.0875 -0.0292 268 HIS A C   
2217 O O   . HIS A 286 ? 0.5537 0.2259 0.3837 -0.0606 -0.0812 -0.0265 268 HIS A O   
2218 C CB  . HIS A 286 ? 0.6038 0.2427 0.4180 -0.0733 -0.0922 -0.0425 268 HIS A CB  
2219 C CG  . HIS A 286 ? 0.6024 0.2335 0.4138 -0.0658 -0.0823 -0.0427 268 HIS A CG  
2220 N ND1 . HIS A 286 ? 0.5982 0.2372 0.4216 -0.0619 -0.0762 -0.0355 268 HIS A ND1 
2221 C CD2 . HIS A 286 ? 0.5823 0.1988 0.3814 -0.0608 -0.0783 -0.0502 268 HIS A CD2 
2222 C CE1 . HIS A 286 ? 0.5969 0.2269 0.4164 -0.0548 -0.0706 -0.0379 268 HIS A CE1 
2223 N NE2 . HIS A 286 ? 0.6426 0.2599 0.4494 -0.0536 -0.0712 -0.0470 268 HIS A NE2 
2224 N N   . GLY A 287 ? 0.5542 0.2314 0.4065 -0.0724 -0.0887 -0.0263 269 GLY A N   
2225 C CA  . GLY A 287 ? 0.5358 0.2254 0.4031 -0.0704 -0.0822 -0.0201 269 GLY A CA  
2226 C C   . GLY A 287 ? 0.5467 0.2258 0.4127 -0.0709 -0.0749 -0.0183 269 GLY A C   
2227 O O   . GLY A 287 ? 0.5444 0.2089 0.3976 -0.0670 -0.0731 -0.0209 269 GLY A O   
2228 N N   . PRO A 288 ? 0.5545 0.2402 0.4331 -0.0758 -0.0707 -0.0140 270 PRO A N   
2229 C CA  . PRO A 288 ? 0.5628 0.2344 0.4349 -0.0765 -0.0649 -0.0105 270 PRO A CA  
2230 C C   . PRO A 288 ? 0.5889 0.2376 0.4490 -0.0777 -0.0682 -0.0142 270 PRO A C   
2231 O O   . PRO A 288 ? 0.6067 0.2426 0.4567 -0.0702 -0.0666 -0.0142 270 PRO A O   
2232 C CB  . PRO A 288 ? 0.5537 0.2338 0.4385 -0.0858 -0.0602 -0.0065 270 PRO A CB  
2233 C CG  . PRO A 288 ? 0.5344 0.2382 0.4359 -0.0851 -0.0610 -0.0077 270 PRO A CG  
2234 C CD  . PRO A 288 ? 0.5356 0.2408 0.4338 -0.0806 -0.0705 -0.0124 270 PRO A CD  
2235 N N   . LYS A 289 ? 0.6018 0.2453 0.4645 -0.0865 -0.0735 -0.0181 271 LYS A N   
2236 C CA  . LYS A 289 ? 0.6150 0.2341 0.4665 -0.0886 -0.0772 -0.0229 271 LYS A CA  
2237 C C   . LYS A 289 ? 0.6100 0.2275 0.4539 -0.0869 -0.0839 -0.0320 271 LYS A C   
2238 O O   . LYS A 289 ? 0.5959 0.2297 0.4455 -0.0889 -0.0882 -0.0331 271 LYS A O   
2239 C CB  . LYS A 289 ? 0.6340 0.2427 0.4916 -0.1025 -0.0783 -0.0211 271 LYS A CB  
2240 C CG  . LYS A 289 ? 0.6474 0.2638 0.5142 -0.1097 -0.0704 -0.0117 271 LYS A CG  
2241 C CD  . LYS A 289 ? 0.6747 0.2749 0.5433 -0.1252 -0.0687 -0.0081 271 LYS A CD  
2242 C CE  . LYS A 289 ? 0.7330 0.3289 0.6105 -0.1378 -0.0764 -0.0154 271 LYS A CE  
2243 N NZ  . LYS A 289 ? 0.6639 0.2788 0.5652 -0.1545 -0.0745 -0.0150 271 LYS A NZ  
2244 N N   . PRO A 290 ? 0.6248 0.2215 0.4547 -0.0830 -0.0854 -0.0390 272 PRO A N   
2245 C CA  . PRO A 290 ? 0.6236 0.2165 0.4432 -0.0848 -0.0921 -0.0486 272 PRO A CA  
2246 C C   . PRO A 290 ? 0.6228 0.2186 0.4509 -0.0978 -0.1009 -0.0504 272 PRO A C   
2247 O O   . PRO A 290 ? 0.6231 0.2127 0.4618 -0.1073 -0.1012 -0.0474 272 PRO A O   
2248 C CB  . PRO A 290 ? 0.6467 0.2143 0.4522 -0.0794 -0.0911 -0.0571 272 PRO A CB  
2249 C CG  . PRO A 290 ? 0.6468 0.2119 0.4562 -0.0698 -0.0837 -0.0513 272 PRO A CG  
2250 C CD  . PRO A 290 ? 0.6276 0.2032 0.4503 -0.0764 -0.0823 -0.0396 272 PRO A CD  
2251 N N   . GLY A 291 ? 0.6215 0.2262 0.4444 -0.0990 -0.1086 -0.0551 273 GLY A N   
2252 C CA  . GLY A 291 ? 0.6135 0.2242 0.4463 -0.1103 -0.1199 -0.0582 273 GLY A CA  
2253 C C   . GLY A 291 ? 0.5947 0.2334 0.4495 -0.1121 -0.1220 -0.0515 273 GLY A C   
2254 O O   . GLY A 291 ? 0.6076 0.2569 0.4717 -0.1184 -0.1336 -0.0546 273 GLY A O   
2255 N N   . SER A 292 ? 0.5610 0.2115 0.4248 -0.1061 -0.1119 -0.0431 274 SER A N   
2256 C CA  . SER A 292 ? 0.5334 0.2099 0.4181 -0.1054 -0.1122 -0.0377 274 SER A CA  
2257 C C   . SER A 292 ? 0.5352 0.2200 0.4107 -0.0958 -0.1162 -0.0366 274 SER A C   
2258 O O   . SER A 292 ? 0.5294 0.2022 0.3825 -0.0887 -0.1130 -0.0376 274 SER A O   
2259 C CB  . SER A 292 ? 0.5153 0.1982 0.4113 -0.1043 -0.0991 -0.0302 274 SER A CB  
2260 O OG  . SER A 292 ? 0.4783 0.1560 0.3600 -0.0934 -0.0921 -0.0271 274 SER A OG  
2261 N N   . SER A 293 ? 0.5316 0.2367 0.4254 -0.0955 -0.1229 -0.0345 275 SER A N   
2262 C CA  . SER A 293 ? 0.5344 0.2438 0.4186 -0.0869 -0.1284 -0.0321 275 SER A CA  
2263 C C   . SER A 293 ? 0.5215 0.2308 0.4002 -0.0784 -0.1156 -0.0264 275 SER A C   
2264 O O   . SER A 293 ? 0.5128 0.2301 0.4069 -0.0783 -0.1057 -0.0231 275 SER A O   
2265 C CB  . SER A 293 ? 0.5270 0.2575 0.4355 -0.0868 -0.1399 -0.0312 275 SER A CB  
2266 O OG  . SER A 293 ? 0.5566 0.2886 0.4710 -0.0946 -0.1546 -0.0372 275 SER A OG  
2267 N N   . HIS A 294 ? 0.5171 0.2173 0.3732 -0.0723 -0.1158 -0.0253 276 HIS A N   
2268 C CA  . HIS A 294 ? 0.5137 0.2147 0.3658 -0.0650 -0.1056 -0.0204 276 HIS A CA  
2269 C C   . HIS A 294 ? 0.5099 0.2278 0.3832 -0.0614 -0.1071 -0.0156 276 HIS A C   
2270 O O   . HIS A 294 ? 0.5058 0.2319 0.3887 -0.0616 -0.1188 -0.0156 276 HIS A O   
2271 C CB  . HIS A 294 ? 0.5274 0.2167 0.3525 -0.0616 -0.1060 -0.0204 276 HIS A CB  
2272 C CG  . HIS A 294 ? 0.5072 0.1979 0.3298 -0.0557 -0.0962 -0.0156 276 HIS A CG  
2273 N ND1 . HIS A 294 ? 0.5176 0.2123 0.3407 -0.0522 -0.0997 -0.0100 276 HIS A ND1 
2274 C CD2 . HIS A 294 ? 0.4906 0.1781 0.3105 -0.0530 -0.0843 -0.0163 276 HIS A CD2 
2275 C CE1 . HIS A 294 ? 0.5429 0.2368 0.3636 -0.0488 -0.0894 -0.0075 276 HIS A CE1 
2276 N NE2 . HIS A 294 ? 0.5356 0.2267 0.3554 -0.0491 -0.0803 -0.0114 276 HIS A NE2 
2277 N N   . ARG A 295 ? 0.5078 0.2309 0.3896 -0.0578 -0.0964 -0.0125 277 ARG A N   
2278 C CA  . ARG A 295 ? 0.5204 0.2562 0.4178 -0.0527 -0.0969 -0.0092 277 ARG A CA  
2279 C C   . ARG A 295 ? 0.5116 0.2421 0.3990 -0.0468 -0.0898 -0.0057 277 ARG A C   
2280 O O   . ARG A 295 ? 0.5154 0.2375 0.3905 -0.0468 -0.0820 -0.0061 277 ARG A O   
2281 C CB  . ARG A 295 ? 0.5139 0.2660 0.4379 -0.0550 -0.0925 -0.0103 277 ARG A CB  
2282 C CG  . ARG A 295 ? 0.5513 0.3004 0.4760 -0.0616 -0.0840 -0.0114 277 ARG A CG  
2283 C CD  . ARG A 295 ? 0.5934 0.3600 0.5441 -0.0664 -0.0808 -0.0128 277 ARG A CD  
2284 N NE  . ARG A 295 ? 0.6390 0.4006 0.5871 -0.0726 -0.0696 -0.0116 277 ARG A NE  
2285 C CZ  . ARG A 295 ? 0.6379 0.3992 0.5827 -0.0704 -0.0588 -0.0089 277 ARG A CZ  
2286 N NH1 . ARG A 295 ? 0.5808 0.3472 0.5260 -0.0620 -0.0566 -0.0082 277 ARG A NH1 
2287 N NH2 . ARG A 295 ? 0.6156 0.3687 0.5540 -0.0773 -0.0510 -0.0068 277 ARG A NH2 
2288 N N   . PRO A 296 ? 0.5107 0.2461 0.4051 -0.0415 -0.0933 -0.0029 278 PRO A N   
2289 C CA  . PRO A 296 ? 0.4965 0.2262 0.3827 -0.0371 -0.0877 0.0002  278 PRO A CA  
2290 C C   . PRO A 296 ? 0.4794 0.2127 0.3714 -0.0367 -0.0761 -0.0009 278 PRO A C   
2291 O O   . PRO A 296 ? 0.4692 0.2114 0.3749 -0.0384 -0.0728 -0.0028 278 PRO A O   
2292 C CB  . PRO A 296 ? 0.5024 0.2377 0.4021 -0.0317 -0.0947 0.0022  278 PRO A CB  
2293 C CG  . PRO A 296 ? 0.5140 0.2548 0.4221 -0.0326 -0.1074 0.0010  278 PRO A CG  
2294 C CD  . PRO A 296 ? 0.5110 0.2577 0.4243 -0.0393 -0.1039 -0.0032 278 PRO A CD  
2295 N N   . TRP A 297 ? 0.4605 0.1867 0.3416 -0.0352 -0.0702 0.0003  279 TRP A N   
2296 C CA  . TRP A 297 ? 0.4452 0.1736 0.3300 -0.0342 -0.0620 -0.0008 279 TRP A CA  
2297 C C   . TRP A 297 ? 0.4388 0.1763 0.3381 -0.0317 -0.0600 -0.0013 279 TRP A C   
2298 O O   . TRP A 297 ? 0.4296 0.1701 0.3319 -0.0326 -0.0543 -0.0025 279 TRP A O   
2299 C CB  . TRP A 297 ? 0.4394 0.1615 0.3146 -0.0329 -0.0576 -0.0003 279 TRP A CB  
2300 C CG  . TRP A 297 ? 0.4294 0.1495 0.3041 -0.0309 -0.0585 0.0021  279 TRP A CG  
2301 C CD1 . TRP A 297 ? 0.4380 0.1506 0.3022 -0.0322 -0.0615 0.0049  279 TRP A CD1 
2302 C CD2 . TRP A 297 ? 0.4326 0.1552 0.3155 -0.0281 -0.0565 0.0018  279 TRP A CD2 
2303 N NE1 . TRP A 297 ? 0.4433 0.1527 0.3095 -0.0306 -0.0617 0.0073  279 TRP A NE1 
2304 C CE2 . TRP A 297 ? 0.4545 0.1702 0.3331 -0.0278 -0.0588 0.0047  279 TRP A CE2 
2305 C CE3 . TRP A 297 ? 0.4004 0.1283 0.2908 -0.0263 -0.0530 -0.0007 279 TRP A CE3 
2306 C CZ2 . TRP A 297 ? 0.4485 0.1623 0.3329 -0.0256 -0.0582 0.0044  279 TRP A CZ2 
2307 C CZ3 . TRP A 297 ? 0.4229 0.1502 0.3175 -0.0237 -0.0523 -0.0018 279 TRP A CZ3 
2308 C CH2 . TRP A 297 ? 0.4361 0.1564 0.3292 -0.0232 -0.0552 0.0004  279 TRP A CH2 
2309 N N   . GLN A 298 ? 0.4392 0.1793 0.3459 -0.0282 -0.0649 -0.0006 280 GLN A N   
2310 C CA  . GLN A 298 ? 0.4356 0.1841 0.3571 -0.0243 -0.0623 -0.0030 280 GLN A CA  
2311 C C   . GLN A 298 ? 0.4352 0.1967 0.3714 -0.0268 -0.0588 -0.0062 280 GLN A C   
2312 O O   . GLN A 298 ? 0.4416 0.2095 0.3847 -0.0257 -0.0515 -0.0092 280 GLN A O   
2313 C CB  . GLN A 298 ? 0.4386 0.1853 0.3670 -0.0186 -0.0697 -0.0021 280 GLN A CB  
2314 C CG  . GLN A 298 ? 0.4344 0.1668 0.3489 -0.0175 -0.0709 0.0015  280 GLN A CG  
2315 C CD  . GLN A 298 ? 0.4763 0.1983 0.3748 -0.0205 -0.0773 0.0064  280 GLN A CD  
2316 O OE1 . GLN A 298 ? 0.4823 0.2063 0.3758 -0.0241 -0.0790 0.0062  280 GLN A OE1 
2317 N NE2 . GLN A 298 ? 0.4680 0.1770 0.3562 -0.0199 -0.0805 0.0108  280 GLN A NE2 
2318 N N   . SER A 299 ? 0.4357 0.2008 0.3758 -0.0311 -0.0635 -0.0060 281 SER A N   
2319 C CA  . SER A 299 ? 0.4374 0.2156 0.3934 -0.0360 -0.0598 -0.0090 281 SER A CA  
2320 C C   . SER A 299 ? 0.4366 0.2118 0.3843 -0.0416 -0.0489 -0.0086 281 SER A C   
2321 O O   . SER A 299 ? 0.4572 0.2426 0.4165 -0.0468 -0.0424 -0.0105 281 SER A O   
2322 C CB  . SER A 299 ? 0.4427 0.2233 0.4037 -0.0407 -0.0689 -0.0092 281 SER A CB  
2323 O OG  . SER A 299 ? 0.4432 0.2102 0.3851 -0.0458 -0.0689 -0.0075 281 SER A OG  
2324 N N   . TYR A 300 ? 0.4319 0.1933 0.3601 -0.0409 -0.0470 -0.0060 282 TYR A N   
2325 C CA  . TYR A 300 ? 0.4396 0.1940 0.3566 -0.0451 -0.0399 -0.0044 282 TYR A CA  
2326 C C   . TYR A 300 ? 0.4476 0.2036 0.3610 -0.0427 -0.0325 -0.0054 282 TYR A C   
2327 O O   . TYR A 300 ? 0.4479 0.1971 0.3493 -0.0463 -0.0272 -0.0035 282 TYR A O   
2328 C CB  . TYR A 300 ? 0.4465 0.1857 0.3467 -0.0445 -0.0433 -0.0021 282 TYR A CB  
2329 C CG  . TYR A 300 ? 0.4523 0.1864 0.3510 -0.0484 -0.0486 -0.0024 282 TYR A CG  
2330 C CD1 . TYR A 300 ? 0.4525 0.1777 0.3460 -0.0545 -0.0473 -0.0014 282 TYR A CD1 
2331 C CD2 . TYR A 300 ? 0.4313 0.1669 0.3314 -0.0465 -0.0555 -0.0036 282 TYR A CD2 
2332 C CE1 . TYR A 300 ? 0.4805 0.1991 0.3720 -0.0583 -0.0529 -0.0032 282 TYR A CE1 
2333 C CE2 . TYR A 300 ? 0.4206 0.1506 0.3165 -0.0501 -0.0609 -0.0051 282 TYR A CE2 
2334 C CZ  . TYR A 300 ? 0.4887 0.2108 0.3812 -0.0558 -0.0596 -0.0056 282 TYR A CZ  
2335 O OH  . TYR A 300 ? 0.4986 0.2137 0.3858 -0.0591 -0.0659 -0.0086 282 TYR A OH  
2336 N N   . PHE A 301 ? 0.4528 0.2156 0.3747 -0.0368 -0.0328 -0.0084 283 PHE A N   
2337 C CA  . PHE A 301 ? 0.4667 0.2287 0.3828 -0.0337 -0.0269 -0.0110 283 PHE A CA  
2338 C C   . PHE A 301 ? 0.4717 0.2479 0.4054 -0.0317 -0.0215 -0.0166 283 PHE A C   
2339 O O   . PHE A 301 ? 0.4764 0.2606 0.4276 -0.0279 -0.0269 -0.0184 283 PHE A O   
2340 C CB  . PHE A 301 ? 0.4572 0.2108 0.3663 -0.0280 -0.0323 -0.0109 283 PHE A CB  
2341 C CG  . PHE A 301 ? 0.4633 0.2063 0.3594 -0.0293 -0.0364 -0.0070 283 PHE A CG  
2342 C CD1 . PHE A 301 ? 0.4796 0.2150 0.3622 -0.0299 -0.0350 -0.0062 283 PHE A CD1 
2343 C CD2 . PHE A 301 ? 0.4459 0.1865 0.3432 -0.0296 -0.0418 -0.0049 283 PHE A CD2 
2344 C CE1 . PHE A 301 ? 0.4904 0.2180 0.3657 -0.0296 -0.0393 -0.0039 283 PHE A CE1 
2345 C CE2 . PHE A 301 ? 0.4322 0.1648 0.3200 -0.0301 -0.0437 -0.0033 283 PHE A CE2 
2346 C CZ  . PHE A 301 ? 0.4677 0.1948 0.3471 -0.0295 -0.0426 -0.0030 283 PHE A CZ  
2347 N N   . ASP A 302 ? 0.4782 0.2574 0.4070 -0.0341 -0.0110 -0.0196 284 ASP A N   
2348 C CA  . ASP A 302 ? 0.4810 0.2745 0.4270 -0.0307 -0.0036 -0.0273 284 ASP A CA  
2349 C C   . ASP A 302 ? 0.4778 0.2661 0.4233 -0.0214 -0.0071 -0.0319 284 ASP A C   
2350 O O   . ASP A 302 ? 0.4736 0.2715 0.4373 -0.0154 -0.0051 -0.0388 284 ASP A O   
2351 C CB  . ASP A 302 ? 0.4996 0.2971 0.4372 -0.0376 0.0110  -0.0297 284 ASP A CB  
2352 C CG  . ASP A 302 ? 0.5077 0.3102 0.4491 -0.0482 0.0153  -0.0253 284 ASP A CG  
2353 O OD1 . ASP A 302 ? 0.5381 0.3586 0.5063 -0.0499 0.0174  -0.0288 284 ASP A OD1 
2354 O OD2 . ASP A 302 ? 0.5320 0.3199 0.4510 -0.0550 0.0158  -0.0186 284 ASP A OD2 
2355 N N   . LEU A 303 ? 0.4764 0.2494 0.4029 -0.0204 -0.0125 -0.0288 285 LEU A N   
2356 C CA  . LEU A 303 ? 0.4798 0.2456 0.4040 -0.0138 -0.0155 -0.0333 285 LEU A CA  
2357 C C   . LEU A 303 ? 0.4734 0.2265 0.3861 -0.0145 -0.0247 -0.0273 285 LEU A C   
2358 O O   . LEU A 303 ? 0.4763 0.2245 0.3755 -0.0191 -0.0254 -0.0227 285 LEU A O   
2359 C CB  . LEU A 303 ? 0.4811 0.2439 0.3908 -0.0142 -0.0067 -0.0397 285 LEU A CB  
2360 C CG  . LEU A 303 ? 0.5011 0.2552 0.4077 -0.0081 -0.0094 -0.0464 285 LEU A CG  
2361 C CD1 . LEU A 303 ? 0.5112 0.2681 0.4115 -0.0070 0.0018  -0.0562 285 LEU A CD1 
2362 C CD2 . LEU A 303 ? 0.4978 0.2377 0.3875 -0.0098 -0.0179 -0.0427 285 LEU A CD2 
2363 N N   . ILE A 304 ? 0.4669 0.2150 0.3865 -0.0101 -0.0316 -0.0274 286 ILE A N   
2364 C CA  . ILE A 304 ? 0.4614 0.1993 0.3733 -0.0114 -0.0384 -0.0228 286 ILE A CA  
2365 C C   . ILE A 304 ? 0.4754 0.2047 0.3868 -0.0083 -0.0405 -0.0272 286 ILE A C   
2366 O O   . ILE A 304 ? 0.4865 0.2142 0.4083 -0.0032 -0.0418 -0.0306 286 ILE A O   
2367 C CB  . ILE A 304 ? 0.4585 0.1955 0.3765 -0.0117 -0.0446 -0.0170 286 ILE A CB  
2368 C CG1 . ILE A 304 ? 0.4648 0.2095 0.3842 -0.0152 -0.0435 -0.0140 286 ILE A CG1 
2369 C CG2 . ILE A 304 ? 0.4317 0.1590 0.3410 -0.0143 -0.0485 -0.0131 286 ILE A CG2 
2370 C CD1 . ILE A 304 ? 0.4498 0.1960 0.3763 -0.0147 -0.0503 -0.0105 286 ILE A CD1 
2371 N N   . LEU A 305 ? 0.4805 0.2036 0.3809 -0.0110 -0.0418 -0.0278 287 LEU A N   
2372 C CA  . LEU A 305 ? 0.4855 0.1994 0.3844 -0.0099 -0.0445 -0.0326 287 LEU A CA  
2373 C C   . LEU A 305 ? 0.4782 0.1873 0.3752 -0.0146 -0.0494 -0.0285 287 LEU A C   
2374 O O   . LEU A 305 ? 0.4693 0.1823 0.3612 -0.0175 -0.0500 -0.0263 287 LEU A O   
2375 C CB  . LEU A 305 ? 0.4975 0.2107 0.3859 -0.0092 -0.0408 -0.0402 287 LEU A CB  
2376 C CG  . LEU A 305 ? 0.5570 0.2597 0.4430 -0.0080 -0.0440 -0.0476 287 LEU A CG  
2377 C CD1 . LEU A 305 ? 0.5826 0.2844 0.4631 -0.0041 -0.0380 -0.0576 287 LEU A CD1 
2378 C CD2 . LEU A 305 ? 0.5452 0.2442 0.4229 -0.0129 -0.0500 -0.0470 287 LEU A CD2 
2379 N N   . VAL A 306 ? 0.4722 0.1726 0.3746 -0.0153 -0.0527 -0.0276 288 VAL A N   
2380 C CA  . VAL A 306 ? 0.4774 0.1743 0.3804 -0.0213 -0.0551 -0.0245 288 VAL A CA  
2381 C C   . VAL A 306 ? 0.4939 0.1814 0.3982 -0.0232 -0.0583 -0.0305 288 VAL A C   
2382 O O   . VAL A 306 ? 0.4909 0.1728 0.3939 -0.0188 -0.0585 -0.0370 288 VAL A O   
2383 C CB  . VAL A 306 ? 0.4831 0.1760 0.3877 -0.0237 -0.0554 -0.0165 288 VAL A CB  
2384 C CG1 . VAL A 306 ? 0.4376 0.1395 0.3399 -0.0222 -0.0535 -0.0125 288 VAL A CG1 
2385 C CG2 . VAL A 306 ? 0.4871 0.1663 0.3941 -0.0207 -0.0589 -0.0152 288 VAL A CG2 
2386 N N   . ASP A 307 ? 0.4990 0.1855 0.4070 -0.0300 -0.0601 -0.0296 289 ASP A N   
2387 C CA  . ASP A 307 ? 0.5157 0.1931 0.4270 -0.0341 -0.0640 -0.0356 289 ASP A CA  
2388 C C   . ASP A 307 ? 0.5242 0.2019 0.4288 -0.0303 -0.0667 -0.0449 289 ASP A C   
2389 O O   . ASP A 307 ? 0.5367 0.2026 0.4395 -0.0291 -0.0690 -0.0518 289 ASP A O   
2390 C CB  . ASP A 307 ? 0.5214 0.1809 0.4341 -0.0342 -0.0652 -0.0345 289 ASP A CB  
2391 C CG  . ASP A 307 ? 0.5618 0.2168 0.4742 -0.0367 -0.0631 -0.0242 289 ASP A CG  
2392 O OD1 . ASP A 307 ? 0.6163 0.2739 0.5310 -0.0452 -0.0608 -0.0197 289 ASP A OD1 
2393 O OD2 . ASP A 307 ? 0.5769 0.2263 0.4870 -0.0304 -0.0640 -0.0210 289 ASP A OD2 
2394 N N   . ALA A 308 ? 0.5198 0.2086 0.4187 -0.0285 -0.0667 -0.0450 290 ALA A N   
2395 C CA  . ALA A 308 ? 0.5471 0.2354 0.4329 -0.0250 -0.0683 -0.0517 290 ALA A CA  
2396 C C   . ALA A 308 ? 0.5780 0.2611 0.4618 -0.0285 -0.0761 -0.0599 290 ALA A C   
2397 O O   . ALA A 308 ? 0.6158 0.2916 0.4864 -0.0260 -0.0773 -0.0679 290 ALA A O   
2398 C CB  . ALA A 308 ? 0.5334 0.2316 0.4113 -0.0233 -0.0673 -0.0473 290 ALA A CB  
2399 N N   . ARG A 309 ? 0.5867 0.2737 0.4838 -0.0347 -0.0810 -0.0590 291 ARG A N   
2400 C CA  . ARG A 309 ? 0.6132 0.2973 0.5130 -0.0395 -0.0904 -0.0673 291 ARG A CA  
2401 C C   . ARG A 309 ? 0.6146 0.3023 0.4998 -0.0366 -0.0981 -0.0716 291 ARG A C   
2402 O O   . ARG A 309 ? 0.6343 0.3134 0.5077 -0.0369 -0.1046 -0.0804 291 ARG A O   
2403 C CB  . ARG A 309 ? 0.6305 0.2976 0.5279 -0.0411 -0.0916 -0.0750 291 ARG A CB  
2404 C CG  . ARG A 309 ? 0.6799 0.3374 0.5866 -0.0427 -0.0856 -0.0699 291 ARG A CG  
2405 C CD  . ARG A 309 ? 0.7526 0.4012 0.6727 -0.0525 -0.0892 -0.0713 291 ARG A CD  
2406 N NE  . ARG A 309 ? 0.8505 0.4949 0.7703 -0.0569 -0.0985 -0.0825 291 ARG A NE  
2407 C CZ  . ARG A 309 ? 0.8770 0.5024 0.7935 -0.0587 -0.1025 -0.0912 291 ARG A CZ  
2408 N NH1 . ARG A 309 ? 0.9156 0.5228 0.8300 -0.0555 -0.0983 -0.0900 291 ARG A NH1 
2409 N NH2 . ARG A 309 ? 0.8886 0.5119 0.8039 -0.0633 -0.1123 -0.1019 291 ARG A NH2 
2410 N N   . LYS A 310 ? 0.5981 0.2960 0.4816 -0.0335 -0.0978 -0.0652 292 LYS A N   
2411 C CA  . LYS A 310 ? 0.6089 0.3085 0.4791 -0.0311 -0.1075 -0.0670 292 LYS A CA  
2412 C C   . LYS A 310 ? 0.6091 0.3159 0.4965 -0.0355 -0.1203 -0.0722 292 LYS A C   
2413 O O   . LYS A 310 ? 0.6027 0.3206 0.5160 -0.0397 -0.1184 -0.0703 292 LYS A O   
2414 C CB  . LYS A 310 ? 0.5862 0.2921 0.4521 -0.0267 -0.1046 -0.0582 292 LYS A CB  
2415 C CG  . LYS A 310 ? 0.5942 0.2970 0.4527 -0.0244 -0.0913 -0.0530 292 LYS A CG  
2416 C CD  . LYS A 310 ? 0.6068 0.3110 0.4547 -0.0212 -0.0883 -0.0458 292 LYS A CD  
2417 C CE  . LYS A 310 ? 0.6174 0.3308 0.4825 -0.0210 -0.0860 -0.0396 292 LYS A CE  
2418 N NZ  . LYS A 310 ? 0.6042 0.3156 0.4582 -0.0187 -0.0804 -0.0330 292 LYS A NZ  
2419 N N   . PRO A 311 ? 0.6216 0.3233 0.4948 -0.0350 -0.1333 -0.0789 293 PRO A N   
2420 C CA  . PRO A 311 ? 0.6358 0.3245 0.4740 -0.0308 -0.1356 -0.0805 293 PRO A CA  
2421 C C   . PRO A 311 ? 0.6579 0.3313 0.4763 -0.0317 -0.1305 -0.0891 293 PRO A C   
2422 O O   . PRO A 311 ? 0.6812 0.3445 0.4691 -0.0288 -0.1286 -0.0908 293 PRO A O   
2423 C CB  . PRO A 311 ? 0.6559 0.3464 0.4897 -0.0303 -0.1548 -0.0839 293 PRO A CB  
2424 C CG  . PRO A 311 ? 0.6408 0.3415 0.5069 -0.0368 -0.1627 -0.0910 293 PRO A CG  
2425 C CD  . PRO A 311 ? 0.6225 0.3320 0.5148 -0.0398 -0.1476 -0.0857 293 PRO A CD  
2426 N N   . LEU A 312 ? 0.6490 0.3192 0.4833 -0.0358 -0.1281 -0.0949 294 LEU A N   
2427 C CA  . LEU A 312 ? 0.6696 0.3242 0.4887 -0.0352 -0.1229 -0.1042 294 LEU A CA  
2428 C C   . LEU A 312 ? 0.6607 0.3121 0.4645 -0.0292 -0.1076 -0.1012 294 LEU A C   
2429 O O   . LEU A 312 ? 0.6812 0.3215 0.4635 -0.0267 -0.1032 -0.1097 294 LEU A O   
2430 C CB  . LEU A 312 ? 0.6721 0.3214 0.5138 -0.0403 -0.1220 -0.1085 294 LEU A CB  
2431 C CG  . LEU A 312 ? 0.6881 0.3191 0.5205 -0.0390 -0.1177 -0.1190 294 LEU A CG  
2432 C CD1 . LEU A 312 ? 0.7348 0.3536 0.5454 -0.0405 -0.1280 -0.1328 294 LEU A CD1 
2433 C CD2 . LEU A 312 ? 0.6819 0.3057 0.5385 -0.0438 -0.1157 -0.1183 294 LEU A CD2 
2434 N N   . PHE A 313 ? 0.6298 0.2918 0.4464 -0.0273 -0.0995 -0.0901 295 PHE A N   
2435 C CA  . PHE A 313 ? 0.6134 0.2770 0.4215 -0.0227 -0.0863 -0.0857 295 PHE A CA  
2436 C C   . PHE A 313 ? 0.6340 0.2927 0.4107 -0.0209 -0.0837 -0.0880 295 PHE A C   
2437 O O   . PHE A 313 ? 0.6429 0.2997 0.4099 -0.0182 -0.0713 -0.0910 295 PHE A O   
2438 C CB  . PHE A 313 ? 0.5819 0.2577 0.4049 -0.0225 -0.0833 -0.0736 295 PHE A CB  
2439 C CG  . PHE A 313 ? 0.5820 0.2616 0.4020 -0.0190 -0.0707 -0.0686 295 PHE A CG  
2440 C CD1 . PHE A 313 ? 0.5692 0.2487 0.4020 -0.0165 -0.0625 -0.0700 295 PHE A CD1 
2441 C CD2 . PHE A 313 ? 0.5734 0.2566 0.3801 -0.0187 -0.0682 -0.0621 295 PHE A CD2 
2442 C CE1 . PHE A 313 ? 0.5613 0.2474 0.3962 -0.0135 -0.0524 -0.0660 295 PHE A CE1 
2443 C CE2 . PHE A 313 ? 0.5687 0.2567 0.3757 -0.0172 -0.0567 -0.0578 295 PHE A CE2 
2444 C CZ  . PHE A 313 ? 0.5569 0.2481 0.3795 -0.0146 -0.0488 -0.0604 295 PHE A CZ  
2445 N N   . PHE A 314 ? 0.6471 0.3039 0.4086 -0.0227 -0.0953 -0.0865 296 PHE A N   
2446 C CA  . PHE A 314 ? 0.6703 0.3187 0.3962 -0.0224 -0.0951 -0.0865 296 PHE A CA  
2447 C C   . PHE A 314 ? 0.7139 0.3482 0.4125 -0.0233 -0.0973 -0.0996 296 PHE A C   
2448 O O   . PHE A 314 ? 0.7415 0.3669 0.4058 -0.0237 -0.0928 -0.1008 296 PHE A O   
2449 C CB  . PHE A 314 ? 0.6818 0.3315 0.4022 -0.0228 -0.1089 -0.0781 296 PHE A CB  
2450 C CG  . PHE A 314 ? 0.6422 0.3024 0.3806 -0.0213 -0.1039 -0.0659 296 PHE A CG  
2451 C CD1 . PHE A 314 ? 0.6437 0.3036 0.3718 -0.0211 -0.0897 -0.0598 296 PHE A CD1 
2452 C CD2 . PHE A 314 ? 0.6280 0.2990 0.3946 -0.0208 -0.1125 -0.0619 296 PHE A CD2 
2453 C CE1 . PHE A 314 ? 0.6466 0.3148 0.3909 -0.0204 -0.0857 -0.0496 296 PHE A CE1 
2454 C CE2 . PHE A 314 ? 0.6234 0.3027 0.4049 -0.0192 -0.1074 -0.0522 296 PHE A CE2 
2455 C CZ  . PHE A 314 ? 0.6279 0.3045 0.3971 -0.0190 -0.0949 -0.0461 296 PHE A CZ  
2456 N N   . GLY A 315 ? 0.7121 0.3431 0.4245 -0.0242 -0.1031 -0.1096 297 GLY A N   
2457 C CA  . GLY A 315 ? 0.7554 0.3717 0.4453 -0.0248 -0.1048 -0.1243 297 GLY A CA  
2458 C C   . GLY A 315 ? 0.7609 0.3746 0.4618 -0.0214 -0.0899 -0.1327 297 GLY A C   
2459 O O   . GLY A 315 ? 0.7586 0.3772 0.4579 -0.0180 -0.0738 -0.1304 297 GLY A O   
2460 N N   A GLU A 316 ? 0.7683 0.3738 0.4823 -0.0225 -0.0962 -0.1426 298 GLU A N   
2461 N N   B GLU A 316 ? 0.7681 0.3734 0.4819 -0.0224 -0.0957 -0.1428 298 GLU A N   
2462 C CA  A GLU A 316 ? 0.7758 0.3746 0.5008 -0.0181 -0.0852 -0.1518 298 GLU A CA  
2463 C CA  B GLU A 316 ? 0.7736 0.3730 0.4987 -0.0176 -0.0838 -0.1515 298 GLU A CA  
2464 C C   A GLU A 316 ? 0.7377 0.3470 0.4968 -0.0151 -0.0775 -0.1415 298 GLU A C   
2465 C C   B GLU A 316 ? 0.7361 0.3469 0.4943 -0.0147 -0.0761 -0.1406 298 GLU A C   
2466 O O   A GLU A 316 ? 0.7385 0.3455 0.5072 -0.0092 -0.0668 -0.1462 298 GLU A O   
2467 O O   B GLU A 316 ? 0.7359 0.3466 0.5029 -0.0086 -0.0641 -0.1440 298 GLU A O   
2468 C CB  A GLU A 316 ? 0.8019 0.3835 0.5257 -0.0206 -0.0953 -0.1666 298 GLU A CB  
2469 C CB  B GLU A 316 ? 0.7964 0.3791 0.5245 -0.0196 -0.0930 -0.1656 298 GLU A CB  
2470 C CG  A GLU A 316 ? 0.8065 0.3889 0.5537 -0.0280 -0.1116 -0.1628 298 GLU A CG  
2471 C CG  B GLU A 316 ? 0.8429 0.4128 0.5392 -0.0236 -0.1046 -0.1776 298 GLU A CG  
2472 C CD  A GLU A 316 ? 0.8362 0.4199 0.5684 -0.0341 -0.1291 -0.1640 298 GLU A CD  
2473 C CD  B GLU A 316 ? 0.8975 0.4578 0.5578 -0.0193 -0.0930 -0.1898 298 GLU A CD  
2474 O OE1 A GLU A 316 ? 0.8259 0.4010 0.5641 -0.0400 -0.1424 -0.1730 298 GLU A OE1 
2475 O OE1 B GLU A 316 ? 0.9019 0.4701 0.5431 -0.0180 -0.0833 -0.1831 298 GLU A OE1 
2476 O OE2 A GLU A 316 ? 0.8112 0.4037 0.5277 -0.0331 -0.1308 -0.1558 298 GLU A OE2 
2477 O OE2 B GLU A 316 ? 0.9531 0.4969 0.6029 -0.0181 -0.0931 -0.2067 298 GLU A OE2 
2478 N N   . GLY A 317 ? 0.7096 0.3302 0.4862 -0.0188 -0.0835 -0.1281 299 GLY A N   
2479 C CA  . GLY A 317 ? 0.6800 0.3093 0.4842 -0.0172 -0.0780 -0.1176 299 GLY A CA  
2480 C C   . GLY A 317 ? 0.6886 0.3056 0.5108 -0.0172 -0.0800 -0.1226 299 GLY A C   
2481 O O   . GLY A 317 ? 0.7194 0.3226 0.5364 -0.0201 -0.0875 -0.1333 299 GLY A O   
2482 N N   . THR A 318 ? 0.6613 0.2809 0.5028 -0.0141 -0.0743 -0.1150 300 THR A N   
2483 C CA  . THR A 318 ? 0.6541 0.2584 0.5109 -0.0131 -0.0762 -0.1175 300 THR A CA  
2484 C C   . THR A 318 ? 0.6418 0.2472 0.5042 -0.0026 -0.0664 -0.1190 300 THR A C   
2485 O O   . THR A 318 ? 0.6263 0.2464 0.4833 0.0010  -0.0583 -0.1169 300 THR A O   
2486 C CB  . THR A 318 ? 0.6370 0.2429 0.5123 -0.0200 -0.0806 -0.1043 300 THR A CB  
2487 O OG1 . THR A 318 ? 0.6103 0.2309 0.4915 -0.0171 -0.0745 -0.0925 300 THR A OG1 
2488 C CG2 . THR A 318 ? 0.6233 0.2347 0.4999 -0.0303 -0.0889 -0.1027 300 THR A CG2 
2489 N N   . VAL A 319 ? 0.6417 0.2316 0.5162 0.0023  -0.0674 -0.1228 301 VAL A N   
2490 C CA  . VAL A 319 ? 0.6306 0.2241 0.5163 0.0137  -0.0598 -0.1242 301 VAL A CA  
2491 C C   . VAL A 319 ? 0.5954 0.2076 0.4914 0.0144  -0.0565 -0.1095 301 VAL A C   
2492 O O   . VAL A 319 ? 0.5837 0.1981 0.4832 0.0073  -0.0615 -0.0966 301 VAL A O   
2493 C CB  . VAL A 319 ? 0.6403 0.2113 0.5389 0.0198  -0.0646 -0.1290 301 VAL A CB  
2494 C CG1 . VAL A 319 ? 0.6338 0.2107 0.5480 0.0333  -0.0587 -0.1318 301 VAL A CG1 
2495 C CG2 . VAL A 319 ? 0.7096 0.2620 0.5968 0.0199  -0.0669 -0.1460 301 VAL A CG2 
2496 N N   . LEU A 320 ? 0.5779 0.2041 0.4791 0.0223  -0.0475 -0.1126 302 LEU A N   
2497 C CA  . LEU A 320 ? 0.5405 0.1836 0.4527 0.0231  -0.0451 -0.1008 302 LEU A CA  
2498 C C   . LEU A 320 ? 0.5334 0.1675 0.4641 0.0283  -0.0521 -0.0940 302 LEU A C   
2499 O O   . LEU A 320 ? 0.5396 0.1650 0.4827 0.0382  -0.0530 -0.1017 302 LEU A O   
2500 C CB  . LEU A 320 ? 0.5287 0.1911 0.4428 0.0282  -0.0329 -0.1064 302 LEU A CB  
2501 C CG  . LEU A 320 ? 0.4974 0.1781 0.4226 0.0272  -0.0311 -0.0946 302 LEU A CG  
2502 C CD1 . LEU A 320 ? 0.4799 0.1669 0.3905 0.0171  -0.0322 -0.0840 302 LEU A CD1 
2503 C CD2 . LEU A 320 ? 0.5172 0.2162 0.4523 0.0327  -0.0189 -0.1021 302 LEU A CD2 
2504 N N   . ARG A 321 ? 0.5174 0.1527 0.4487 0.0220  -0.0575 -0.0797 303 ARG A N   
2505 C CA  . ARG A 321 ? 0.5313 0.1572 0.4738 0.0252  -0.0650 -0.0705 303 ARG A CA  
2506 C C   . ARG A 321 ? 0.5229 0.1670 0.4713 0.0256  -0.0640 -0.0608 303 ARG A C   
2507 O O   . ARG A 321 ? 0.5206 0.1839 0.4657 0.0229  -0.0568 -0.0612 303 ARG A O   
2508 C CB  . ARG A 321 ? 0.5381 0.1438 0.4731 0.0161  -0.0725 -0.0623 303 ARG A CB  
2509 C CG  . ARG A 321 ? 0.5417 0.1283 0.4720 0.0138  -0.0749 -0.0721 303 ARG A CG  
2510 C CD  . ARG A 321 ? 0.5986 0.1656 0.5386 0.0251  -0.0791 -0.0798 303 ARG A CD  
2511 N NE  . ARG A 321 ? 0.6308 0.1825 0.5774 0.0280  -0.0877 -0.0682 303 ARG A NE  
2512 C CZ  . ARG A 321 ? 0.6678 0.1923 0.6090 0.0215  -0.0953 -0.0610 303 ARG A CZ  
2513 N NH1 . ARG A 321 ? 0.6169 0.1300 0.5503 0.0112  -0.0951 -0.0650 303 ARG A NH1 
2514 N NH2 . ARG A 321 ? 0.6757 0.1836 0.6183 0.0243  -0.1038 -0.0492 303 ARG A NH2 
2515 N N   . GLN A 322 ? 0.5383 0.1737 0.4930 0.0280  -0.0722 -0.0517 304 GLN A N   
2516 C CA  . GLN A 322 ? 0.5311 0.1810 0.4921 0.0293  -0.0738 -0.0439 304 GLN A CA  
2517 C C   . GLN A 322 ? 0.5344 0.1688 0.4860 0.0238  -0.0827 -0.0299 304 GLN A C   
2518 O O   . GLN A 322 ? 0.5483 0.1592 0.4972 0.0247  -0.0901 -0.0269 304 GLN A O   
2519 C CB  . GLN A 322 ? 0.5429 0.1996 0.5255 0.0425  -0.0758 -0.0507 304 GLN A CB  
2520 C CG  . GLN A 322 ? 0.5631 0.2383 0.5563 0.0441  -0.0778 -0.0454 304 GLN A CG  
2521 C CD  . GLN A 322 ? 0.5858 0.2729 0.6062 0.0572  -0.0791 -0.0543 304 GLN A CD  
2522 O OE1 . GLN A 322 ? 0.5936 0.2816 0.6242 0.0644  -0.0731 -0.0670 304 GLN A OE1 
2523 N NE2 . GLN A 322 ? 0.5872 0.2846 0.6206 0.0604  -0.0870 -0.0487 304 GLN A NE2 
2524 N N   . VAL A 323 ? 0.5128 0.1585 0.4576 0.0175  -0.0817 -0.0217 305 VAL A N   
2525 C CA  . VAL A 323 ? 0.5188 0.1509 0.4501 0.0108  -0.0877 -0.0091 305 VAL A CA  
2526 C C   . VAL A 323 ? 0.5428 0.1722 0.4792 0.0177  -0.0981 -0.0031 305 VAL A C   
2527 O O   . VAL A 323 ? 0.5499 0.1986 0.4999 0.0235  -0.0981 -0.0069 305 VAL A O   
2528 C CB  . VAL A 323 ? 0.5110 0.1559 0.4311 0.0008  -0.0809 -0.0048 305 VAL A CB  
2529 C CG1 . VAL A 323 ? 0.5157 0.1477 0.4195 -0.0072 -0.0844 0.0072  305 VAL A CG1 
2530 C CG2 . VAL A 323 ? 0.4686 0.1187 0.3864 -0.0047 -0.0731 -0.0111 305 VAL A CG2 
2531 N N   . ASP A 324 ? 0.5637 0.2454 0.5096 -0.0839 -0.1133 -0.0672 306 ASP A N   
2532 C CA  . ASP A 324 ? 0.6236 0.2790 0.5383 -0.1040 -0.1392 -0.0596 306 ASP A CA  
2533 C C   . ASP A 324 ? 0.6939 0.2787 0.5243 -0.1159 -0.1266 -0.0618 306 ASP A C   
2534 O O   . ASP A 324 ? 0.7292 0.2750 0.5199 -0.1056 -0.1039 -0.0607 306 ASP A O   
2535 C CB  . ASP A 324 ? 0.6303 0.2837 0.5502 -0.0990 -0.1529 -0.0532 306 ASP A CB  
2536 C CG  . ASP A 324 ? 0.6954 0.3178 0.5793 -0.1216 -0.1863 -0.0424 306 ASP A CG  
2537 O OD1 . ASP A 324 ? 0.8037 0.3976 0.6512 -0.1446 -0.2030 -0.0394 306 ASP A OD1 
2538 O OD2 . ASP A 324 ? 0.7612 0.3828 0.6504 -0.1192 -0.2011 -0.0348 306 ASP A OD2 
2539 N N   . THR A 325 ? 0.7210 0.2831 0.5222 -0.1363 -0.1384 -0.0620 307 THR A N   
2540 C CA  . THR A 325 ? 0.7954 0.2771 0.5050 -0.1439 -0.1198 -0.0666 307 THR A CA  
2541 C C   . THR A 325 ? 0.9041 0.2985 0.5155 -0.1570 -0.1311 -0.0629 307 THR A C   
2542 O O   . THR A 325 ? 0.9868 0.2965 0.5052 -0.1557 -0.1045 -0.0664 307 THR A O   
2543 C CB  . THR A 325 ? 0.8089 0.2797 0.5065 -0.1623 -0.1267 -0.0691 307 THR A CB  
2544 O OG1 . THR A 325 ? 0.8312 0.3071 0.5386 -0.1923 -0.1756 -0.0586 307 THR A OG1 
2545 C CG2 . THR A 325 ? 0.6872 0.2288 0.4629 -0.1452 -0.1058 -0.0726 307 THR A CG2 
2546 N N   . LYS A 326 ? 0.9156 0.3209 0.5386 -0.1675 -0.1670 -0.0546 308 LYS A N   
2547 C CA  . LYS A 326 ? 1.0303 0.3446 0.5491 -0.1766 -0.1745 -0.0505 308 LYS A CA  
2548 C C   . LYS A 326 ? 1.0160 0.3204 0.5271 -0.1476 -0.1342 -0.0481 308 LYS A C   
2549 O O   . LYS A 326 ? 1.1096 0.3239 0.5199 -0.1452 -0.1155 -0.0451 308 LYS A O   
2550 C CB  . LYS A 326 ? 1.0890 0.3854 0.5880 -0.2088 -0.2370 -0.0382 308 LYS A CB  
2551 C CG  . LYS A 326 ? 1.0460 0.4464 0.6698 -0.2121 -0.2732 -0.0248 308 LYS A CG  
2552 C CD  . LYS A 326 ? 1.1554 0.5390 0.7704 -0.2536 -0.3371 -0.0067 308 LYS A CD  
2553 C CE  . LYS A 326 ? 1.1534 0.5809 0.8267 -0.2650 -0.3410 -0.0043 308 LYS A CE  
2554 N NZ  . LYS A 326 ? 1.2594 0.6023 0.8443 -0.3056 -0.3764 -0.0007 308 LYS A NZ  
2555 N N   . THR A 327 ? 0.9169 0.3065 0.5300 -0.1255 -0.1194 -0.0471 309 THR A N   
2556 C CA  . THR A 327 ? 0.8929 0.2818 0.5168 -0.1016 -0.0869 -0.0389 309 THR A CA  
2557 C C   . THR A 327 ? 0.8511 0.2591 0.5103 -0.0792 -0.0408 -0.0365 309 THR A C   
2558 O O   . THR A 327 ? 0.8791 0.2698 0.5364 -0.0606 -0.0059 -0.0223 309 THR A O   
2559 C CB  . THR A 327 ? 0.8274 0.2831 0.5326 -0.0958 -0.1109 -0.0338 309 THR A CB  
2560 O OG1 . THR A 327 ? 0.7322 0.2658 0.5266 -0.0910 -0.1213 -0.0410 309 THR A OG1 
2561 C CG2 . THR A 327 ? 0.8490 0.2834 0.5229 -0.1154 -0.1542 -0.0286 309 THR A CG2 
2562 N N   . GLY A 328 ? 0.7965 0.2420 0.4939 -0.0810 -0.0410 -0.0456 310 GLY A N   
2563 C CA  . GLY A 328 ? 0.7388 0.2135 0.4838 -0.0622 -0.0071 -0.0404 310 GLY A CA  
2564 C C   . GLY A 328 ? 0.6643 0.2120 0.5037 -0.0513 -0.0170 -0.0357 310 GLY A C   
2565 O O   . GLY A 328 ? 0.6472 0.2189 0.5308 -0.0393 0.0021  -0.0264 310 GLY A O   
2566 N N   . LYS A 329 ? 0.6252 0.2020 0.4926 -0.0564 -0.0493 -0.0400 311 LYS A N   
2567 C CA  . LYS A 329 ? 0.5637 0.1894 0.5006 -0.0477 -0.0626 -0.0377 311 LYS A CA  
2568 C C   . LYS A 329 ? 0.5269 0.1932 0.4977 -0.0492 -0.0831 -0.0525 311 LYS A C   
2569 O O   . LYS A 329 ? 0.5424 0.2099 0.4973 -0.0587 -0.0922 -0.0603 311 LYS A O   
2570 C CB  . LYS A 329 ? 0.5729 0.1934 0.5115 -0.0481 -0.0793 -0.0313 311 LYS A CB  
2571 C CG  . LYS A 329 ? 0.5899 0.1672 0.4939 -0.0432 -0.0549 -0.0131 311 LYS A CG  
2572 C CD  . LYS A 329 ? 0.6455 0.2090 0.5330 -0.0477 -0.0758 -0.0094 311 LYS A CD  
2573 C CE  . LYS A 329 ? 0.7008 0.2115 0.5418 -0.0408 -0.0463 0.0105  311 LYS A CE  
2574 N NZ  . LYS A 329 ? 0.7778 0.2880 0.6246 -0.0425 -0.0676 0.0176  311 LYS A NZ  
2575 N N   . LEU A 330 ? 0.4888 0.1814 0.5022 -0.0405 -0.0912 -0.0538 312 LEU A N   
2576 C CA  . LEU A 330 ? 0.4728 0.1892 0.5037 -0.0365 -0.1030 -0.0669 312 LEU A CA  
2577 C C   . LEU A 330 ? 0.4788 0.2059 0.5191 -0.0358 -0.1200 -0.0691 312 LEU A C   
2578 O O   . LEU A 330 ? 0.4894 0.2092 0.5331 -0.0354 -0.1309 -0.0630 312 LEU A O   
2579 C CB  . LEU A 330 ? 0.4551 0.1747 0.5058 -0.0278 -0.1100 -0.0687 312 LEU A CB  
2580 C CG  . LEU A 330 ? 0.4673 0.1839 0.5245 -0.0293 -0.1010 -0.0601 312 LEU A CG  
2581 C CD1 . LEU A 330 ? 0.4224 0.1313 0.4871 -0.0266 -0.1204 -0.0615 312 LEU A CD1 
2582 C CD2 . LEU A 330 ? 0.4417 0.1622 0.4824 -0.0316 -0.0812 -0.0645 312 LEU A CD2 
2583 N N   . LYS A 331 ? 0.4823 0.2293 0.5341 -0.0350 -0.1207 -0.0732 313 LYS A N   
2584 C CA  . LYS A 331 ? 0.4818 0.2480 0.5623 -0.0290 -0.1328 -0.0682 313 LYS A CA  
2585 C C   . LYS A 331 ? 0.4809 0.2420 0.5725 -0.0088 -0.1309 -0.0740 313 LYS A C   
2586 O O   . LYS A 331 ? 0.4836 0.2290 0.5592 -0.0021 -0.1236 -0.0831 313 LYS A O   
2587 C CB  . LYS A 331 ? 0.4692 0.2628 0.5733 -0.0318 -0.1291 -0.0629 313 LYS A CB  
2588 C CG  . LYS A 331 ? 0.5090 0.3025 0.6073 -0.0563 -0.1475 -0.0510 313 LYS A CG  
2589 C CD  . LYS A 331 ? 0.5381 0.3574 0.6631 -0.0632 -0.1435 -0.0434 313 LYS A CD  
2590 C CE  . LYS A 331 ? 0.5875 0.3883 0.6870 -0.0946 -0.1655 -0.0346 313 LYS A CE  
2591 N NZ  . LYS A 331 ? 0.6077 0.4280 0.7456 -0.1100 -0.1996 -0.0104 313 LYS A NZ  
2592 N N   . ILE A 332 ? 0.4926 0.2589 0.6059 0.0003  -0.1400 -0.0673 314 ILE A N   
2593 C CA  . ILE A 332 ? 0.5105 0.2592 0.6236 0.0231  -0.1339 -0.0733 314 ILE A CA  
2594 C C   . ILE A 332 ? 0.5186 0.2842 0.6509 0.0409  -0.1122 -0.0699 314 ILE A C   
2595 O O   . ILE A 332 ? 0.5184 0.3142 0.6952 0.0470  -0.1100 -0.0528 314 ILE A O   
2596 C CB  . ILE A 332 ? 0.5220 0.2601 0.6475 0.0300  -0.1480 -0.0663 314 ILE A CB  
2597 C CG1 . ILE A 332 ? 0.5014 0.2252 0.6128 0.0127  -0.1650 -0.0641 314 ILE A CG1 
2598 C CG2 . ILE A 332 ? 0.5497 0.2504 0.6578 0.0550  -0.1393 -0.0747 314 ILE A CG2 
2599 C CD1 . ILE A 332 ? 0.4506 0.1487 0.5391 0.0080  -0.1663 -0.0716 314 ILE A CD1 
2600 N N   . GLY A 333 ? 0.5431 0.2888 0.6449 0.0493  -0.0957 -0.0818 315 GLY A N   
2601 C CA  . GLY A 333 ? 0.5665 0.3258 0.6817 0.0667  -0.0676 -0.0763 315 GLY A CA  
2602 C C   . GLY A 333 ? 0.5573 0.3404 0.6752 0.0498  -0.0625 -0.0761 315 GLY A C   
2603 O O   . GLY A 333 ? 0.5256 0.3206 0.6437 0.0247  -0.0798 -0.0761 315 GLY A O   
2604 N N   . THR A 334 ? 0.5877 0.3684 0.6994 0.0659  -0.0349 -0.0753 316 THR A N   
2605 C CA  . THR A 334 ? 0.5821 0.3826 0.6968 0.0531  -0.0262 -0.0737 316 THR A CA  
2606 C C   . THR A 334 ? 0.5995 0.4355 0.7655 0.0672  0.0007  -0.0517 316 THR A C   
2607 O O   . THR A 334 ? 0.6242 0.4467 0.7928 0.0988  0.0292  -0.0448 316 THR A O   
2608 C CB  . THR A 334 ? 0.6020 0.3604 0.6551 0.0573  -0.0187 -0.0912 316 THR A CB  
2609 O OG1 . THR A 334 ? 0.5959 0.3263 0.6186 0.0453  -0.0449 -0.1027 316 THR A OG1 
2610 C CG2 . THR A 334 ? 0.5928 0.3717 0.6498 0.0420  -0.0111 -0.0888 316 THR A CG2 
2611 N N   . TYR A 335 ? 0.5925 0.4689 0.7989 0.0441  -0.0074 -0.0375 317 TYR A N   
2612 C CA  . TYR A 335 ? 0.6282 0.5466 0.8982 0.0511  0.0142  -0.0094 317 TYR A CA  
2613 C C   . TYR A 335 ? 0.6744 0.5691 0.9112 0.0779  0.0564  -0.0145 317 TYR A C   
2614 O O   . TYR A 335 ? 0.6678 0.5382 0.8535 0.0692  0.0576  -0.0321 317 TYR A O   
2615 C CB  . TYR A 335 ? 0.6095 0.5618 0.9158 0.0141  -0.0111 0.0054  317 TYR A CB  
2616 C CG  . TYR A 335 ? 0.6227 0.6229 1.0071 0.0178  0.0082  0.0409  317 TYR A CG  
2617 C CD1 . TYR A 335 ? 0.6317 0.6741 1.1007 0.0343  0.0175  0.0765  317 TYR A CD1 
2618 C CD2 . TYR A 335 ? 0.6277 0.6330 1.0093 0.0065  0.0198  0.0436  317 TYR A CD2 
2619 C CE1 . TYR A 335 ? 0.6386 0.7317 1.1959 0.0389  0.0379  0.1178  317 TYR A CE1 
2620 C CE2 . TYR A 335 ? 0.6301 0.6824 1.0925 0.0094  0.0388  0.0815  317 TYR A CE2 
2621 C CZ  . TYR A 335 ? 0.6356 0.7341 1.1900 0.0255  0.0481  0.1204  317 TYR A CZ  
2622 O OH  . TYR A 335 ? 0.6494 0.8025 1.3023 0.0292  0.0693  0.1674  317 TYR A OH  
2623 N N   . THR A 336 ? 0.7444 0.6402 1.0066 0.1131  0.0936  0.0034  318 THR A N   
2624 C CA  . THR A 336 ? 0.8335 0.6849 1.0421 0.1466  0.1403  -0.0018 318 THR A CA  
2625 C C   . THR A 336 ? 0.8402 0.7240 1.0809 0.1408  0.1624  0.0163  318 THR A C   
2626 O O   . THR A 336 ? 0.8697 0.7141 1.0418 0.1432  0.1749  -0.0013 318 THR A O   
2627 C CB  . THR A 336 ? 0.8979 0.7261 1.1137 0.1932  0.1840  0.0144  318 THR A CB  
2628 O OG1 . THR A 336 ? 0.8728 0.7715 1.2039 0.1930  0.1816  0.0526  318 THR A OG1 
2629 C CG2 . THR A 336 ? 0.9549 0.7068 1.0821 0.2053  0.1707  -0.0165 318 THR A CG2 
2630 N N   . GLY A 337 ? 0.8158 0.7712 1.1635 0.1282  0.1598  0.0538  319 GLY A N   
2631 C CA  . GLY A 337 ? 0.8174 0.8129 1.2245 0.1293  0.1886  0.0856  319 GLY A CA  
2632 C C   . GLY A 337 ? 0.8047 0.7967 1.1805 0.0992  0.1732  0.0719  319 GLY A C   
2633 O O   . GLY A 337 ? 0.8000 0.7482 1.0929 0.0850  0.1499  0.0347  319 GLY A O   
2634 N N   . PRO A 338 ? 0.8015 0.8406 1.2508 0.0902  0.1881  0.1067  320 PRO A N   
2635 C CA  . PRO A 338 ? 0.7908 0.8250 1.2149 0.0634  0.1785  0.0982  320 PRO A CA  
2636 C C   . PRO A 338 ? 0.7574 0.7903 1.1674 0.0154  0.1192  0.0809  320 PRO A C   
2637 O O   . PRO A 338 ? 0.7426 0.7922 1.1842 -0.0029 0.0825  0.0863  320 PRO A O   
2638 C CB  . PRO A 338 ? 0.7937 0.8863 1.3227 0.0642  0.2055  0.1498  320 PRO A CB  
2639 C CG  . PRO A 338 ? 0.8162 0.9319 1.4065 0.1066  0.2488  0.1825  320 PRO A CG  
2640 C CD  . PRO A 338 ? 0.8026 0.9036 1.3717 0.1064  0.2172  0.1620  320 PRO A CD  
2641 N N   . LEU A 339 ? 0.7573 0.7630 1.1135 -0.0021 0.1135  0.0617  321 LEU A N   
2642 C CA  . LEU A 339 ? 0.7426 0.7319 1.0722 -0.0433 0.0691  0.0473  321 LEU A CA  
2643 C C   . LEU A 339 ? 0.7417 0.7650 1.1427 -0.0809 0.0308  0.0781  321 LEU A C   
2644 O O   . LEU A 339 ? 0.7526 0.8110 1.2209 -0.0928 0.0359  0.1119  321 LEU A O   
2645 C CB  . LEU A 339 ? 0.7495 0.7098 1.0279 -0.0504 0.0808  0.0334  321 LEU A CB  
2646 C CG  . LEU A 339 ? 0.7350 0.6522 0.9497 -0.0766 0.0522  0.0081  321 LEU A CG  
2647 C CD1 . LEU A 339 ? 0.7127 0.5985 0.8697 -0.0601 0.0493  -0.0204 321 LEU A CD1 
2648 C CD2 . LEU A 339 ? 0.7454 0.6432 0.9315 -0.0824 0.0678  0.0053  321 LEU A CD2 
2649 N N   . GLN A 340 ? 0.7403 0.7475 1.1224 -0.1014 -0.0101 0.0682  322 GLN A N   
2650 C CA  . GLN A 340 ? 0.7578 0.7721 1.1754 -0.1446 -0.0608 0.0914  322 GLN A CA  
2651 C C   . GLN A 340 ? 0.7768 0.7231 1.0968 -0.1698 -0.0936 0.0597  322 GLN A C   
2652 O O   . GLN A 340 ? 0.7729 0.6878 1.0295 -0.1500 -0.0796 0.0283  322 GLN A O   
2653 C CB  . GLN A 340 ? 0.7555 0.8174 1.2556 -0.1404 -0.0771 0.1224  322 GLN A CB  
2654 C CG  . GLN A 340 ? 0.7523 0.7967 1.2119 -0.1145 -0.0718 0.0969  322 GLN A CG  
2655 C CD  . GLN A 340 ? 0.7840 0.8693 1.3210 -0.1144 -0.0940 0.1285  322 GLN A CD  
2656 O OE1 . GLN A 340 ? 0.8006 0.8619 1.3016 -0.1211 -0.1217 0.1146  322 GLN A OE1 
2657 N NE2 . GLN A 340 ? 0.7894 0.9383 1.4394 -0.1054 -0.0798 0.1760  322 GLN A NE2 
2658 N N   . HIS A 341 ? 0.8101 0.7269 1.1153 -0.2135 -0.1369 0.0711  323 HIS A N   
2659 C CA  . HIS A 341 ? 0.8430 0.6763 1.0373 -0.2339 -0.1572 0.0421  323 HIS A CA  
2660 C C   . HIS A 341 ? 0.8295 0.6427 0.9952 -0.2359 -0.1831 0.0352  323 HIS A C   
2661 O O   . HIS A 341 ? 0.8103 0.6726 1.0478 -0.2342 -0.2003 0.0586  323 HIS A O   
2662 C CB  . HIS A 341 ? 0.9226 0.7065 1.0849 -0.2803 -0.1934 0.0539  323 HIS A CB  
2663 C CG  . HIS A 341 ? 1.0076 0.7682 1.1710 -0.3230 -0.2573 0.0768  323 HIS A CG  
2664 N ND1 . HIS A 341 ? 1.0718 0.7651 1.1470 -0.3335 -0.2833 0.0593  323 HIS A ND1 
2665 C CD2 . HIS A 341 ? 1.0682 0.8603 1.3097 -0.3600 -0.3037 0.1199  323 HIS A CD2 
2666 C CE1 . HIS A 341 ? 1.1555 0.8344 1.2445 -0.3757 -0.3460 0.0878  323 HIS A CE1 
2667 N NE2 . HIS A 341 ? 1.1523 0.8930 1.3471 -0.3943 -0.3626 0.1265  323 HIS A NE2 
2668 N N   . GLY A 342 ? 0.8384 0.5786 0.9018 -0.2372 -0.1820 0.0066  324 GLY A N   
2669 C CA  . GLY A 342 ? 0.8216 0.5342 0.8472 -0.2380 -0.2021 -0.0001 324 GLY A CA  
2670 C C   . GLY A 342 ? 0.7464 0.4752 0.7673 -0.1978 -0.1647 -0.0211 324 GLY A C   
2671 O O   . GLY A 342 ? 0.7684 0.4550 0.7322 -0.1942 -0.1669 -0.0339 324 GLY A O   
2672 N N   . ILE A 343 ? 0.6678 0.4508 0.7442 -0.1689 -0.1315 -0.0223 325 ILE A N   
2673 C CA  . ILE A 343 ? 0.6078 0.4045 0.6843 -0.1344 -0.1041 -0.0384 325 ILE A CA  
2674 C C   . ILE A 343 ? 0.5959 0.3531 0.6129 -0.1236 -0.0785 -0.0591 325 ILE A C   
2675 O O   . ILE A 343 ? 0.6074 0.3495 0.6061 -0.1291 -0.0652 -0.0612 325 ILE A O   
2676 C CB  . ILE A 343 ? 0.5713 0.4251 0.7158 -0.1078 -0.0812 -0.0295 325 ILE A CB  
2677 C CG1 . ILE A 343 ? 0.5809 0.4769 0.7944 -0.1083 -0.0995 -0.0048 325 ILE A CG1 
2678 C CG2 . ILE A 343 ? 0.5426 0.3895 0.6651 -0.0769 -0.0578 -0.0487 325 ILE A CG2 
2679 C CD1 . ILE A 343 ? 0.5785 0.5257 0.8645 -0.0834 -0.0713 0.0148  325 ILE A CD1 
2680 N N   . VAL A 344 ? 0.5677 0.3104 0.5625 -0.1085 -0.0720 -0.0697 326 VAL A N   
2681 C CA  . VAL A 344 ? 0.5479 0.2643 0.5082 -0.0957 -0.0487 -0.0800 326 VAL A CA  
2682 C C   . VAL A 344 ? 0.5089 0.2535 0.4991 -0.0720 -0.0424 -0.0839 326 VAL A C   
2683 O O   . VAL A 344 ? 0.5022 0.2552 0.5059 -0.0668 -0.0549 -0.0833 326 VAL A O   
2684 C CB  . VAL A 344 ? 0.5913 0.2516 0.4934 -0.1035 -0.0487 -0.0815 326 VAL A CB  
2685 C CG1 . VAL A 344 ? 0.5974 0.2401 0.4850 -0.0857 -0.0202 -0.0825 326 VAL A CG1 
2686 C CG2 . VAL A 344 ? 0.6487 0.2583 0.4977 -0.1290 -0.0588 -0.0798 326 VAL A CG2 
2687 N N   . TYR A 345 ? 0.4883 0.2402 0.4826 -0.0595 -0.0265 -0.0870 327 TYR A N   
2688 C CA  . TYR A 345 ? 0.4649 0.2247 0.4691 -0.0412 -0.0267 -0.0907 327 TYR A CA  
2689 C C   . TYR A 345 ? 0.4501 0.1917 0.4449 -0.0382 -0.0264 -0.0875 327 TYR A C   
2690 O O   . TYR A 345 ? 0.4656 0.1895 0.4472 -0.0438 -0.0146 -0.0815 327 TYR A O   
2691 C CB  . TYR A 345 ? 0.4675 0.2342 0.4708 -0.0309 -0.0141 -0.0925 327 TYR A CB  
2692 C CG  . TYR A 345 ? 0.4830 0.2732 0.5093 -0.0275 -0.0069 -0.0883 327 TYR A CG  
2693 C CD1 . TYR A 345 ? 0.4857 0.2866 0.5299 -0.0128 -0.0082 -0.0870 327 TYR A CD1 
2694 C CD2 . TYR A 345 ? 0.4734 0.2748 0.5096 -0.0378 0.0035  -0.0811 327 TYR A CD2 
2695 C CE1 . TYR A 345 ? 0.4798 0.3076 0.5600 -0.0055 0.0053  -0.0744 327 TYR A CE1 
2696 C CE2 . TYR A 345 ? 0.4950 0.3258 0.5698 -0.0348 0.0119  -0.0683 327 TYR A CE2 
2697 C CZ  . TYR A 345 ? 0.4883 0.3350 0.5891 -0.0170 0.0150  -0.0630 327 TYR A CZ  
2698 O OH  . TYR A 345 ? 0.4883 0.3686 0.6406 -0.0102 0.0297  -0.0422 327 TYR A OH  
2699 N N   . SER A 346 ? 0.4378 0.1791 0.4396 -0.0286 -0.0380 -0.0883 328 SER A N   
2700 C CA  . SER A 346 ? 0.4353 0.1669 0.4466 -0.0280 -0.0458 -0.0776 328 SER A CA  
2701 C C   . SER A 346 ? 0.4549 0.1760 0.4592 -0.0223 -0.0632 -0.0791 328 SER A C   
2702 O O   . SER A 346 ? 0.4777 0.1893 0.4643 -0.0149 -0.0705 -0.0908 328 SER A O   
2703 C CB  . SER A 346 ? 0.4203 0.1500 0.4419 -0.0298 -0.0551 -0.0742 328 SER A CB  
2704 O OG  . SER A 346 ? 0.4441 0.1692 0.4876 -0.0295 -0.0636 -0.0582 328 SER A OG  
2705 N N   . GLY A 347 ? 0.4596 0.1751 0.4732 -0.0254 -0.0699 -0.0647 329 GLY A N   
2706 C CA  . GLY A 347 ? 0.5012 0.1926 0.4963 -0.0259 -0.0968 -0.0631 329 GLY A CA  
2707 C C   . GLY A 347 ? 0.5274 0.2029 0.4791 -0.0190 -0.0877 -0.0763 329 GLY A C   
2708 O O   . GLY A 347 ? 0.5281 0.2175 0.4837 -0.0191 -0.0672 -0.0733 329 GLY A O   
2709 N N   . GLY A 348 ? 0.5697 0.2083 0.4742 -0.0113 -0.0996 -0.0895 330 GLY A N   
2710 C CA  . GLY A 348 ? 0.5977 0.2111 0.4514 0.0001  -0.0839 -0.0999 330 GLY A CA  
2711 C C   . GLY A 348 ? 0.6369 0.2269 0.4658 -0.0074 -0.0995 -0.0895 330 GLY A C   
2712 O O   . GLY A 348 ? 0.6447 0.2240 0.4870 -0.0217 -0.1347 -0.0734 330 GLY A O   
2713 N N   . SER A 349 ? 0.6469 0.2318 0.4473 0.0010  -0.0754 -0.0935 331 SER A N   
2714 C CA  . SER A 349 ? 0.6738 0.2316 0.4422 -0.0050 -0.0897 -0.0830 331 SER A CA  
2715 C C   . SER A 349 ? 0.6535 0.2371 0.4305 0.0004  -0.0540 -0.0813 331 SER A C   
2716 O O   . SER A 349 ? 0.6118 0.2255 0.4098 0.0084  -0.0207 -0.0889 331 SER A O   
2717 C CB  . SER A 349 ? 0.7679 0.2441 0.4399 0.0009  -0.1102 -0.0921 331 SER A CB  
2718 O OG  . SER A 349 ? 0.7724 0.2287 0.3965 0.0230  -0.0691 -0.1060 331 SER A OG  
2719 N N   . SER A 350 ? 0.6726 0.2441 0.4368 -0.0058 -0.0639 -0.0680 332 SER A N   
2720 C CA  . SER A 350 ? 0.6730 0.2644 0.4428 -0.0011 -0.0302 -0.0658 332 SER A CA  
2721 C C   . SER A 350 ? 0.7297 0.2926 0.4418 0.0163  -0.0012 -0.0786 332 SER A C   
2722 O O   . SER A 350 ? 0.7079 0.2990 0.4412 0.0213  0.0334  -0.0777 332 SER A O   
2723 C CB  . SER A 350 ? 0.6734 0.2604 0.4487 -0.0102 -0.0454 -0.0451 332 SER A CB  
2724 O OG  . SER A 350 ? 0.7522 0.2804 0.4592 -0.0126 -0.0786 -0.0416 332 SER A OG  
2725 N N   . ASP A 351 ? 0.8225 0.3237 0.4604 0.0261  -0.0136 -0.0878 333 ASP A N   
2726 C CA  . ASP A 351 ? 0.9061 0.3691 0.4829 0.0497  0.0225  -0.0968 333 ASP A CA  
2727 C C   . ASP A 351 ? 0.8733 0.3840 0.5069 0.0614  0.0555  -0.1009 333 ASP A C   
2728 O O   . ASP A 351 ? 0.8925 0.4131 0.5296 0.0786  0.0979  -0.0966 333 ASP A O   
2729 C CB  . ASP A 351 ? 1.0148 0.3787 0.4793 0.0593  0.0022  -0.1065 333 ASP A CB  
2730 C CG  . ASP A 351 ? 1.1043 0.4015 0.4870 0.0498  -0.0280 -0.0994 333 ASP A CG  
2731 O OD1 . ASP A 351 ? 1.0752 0.3988 0.4774 0.0455  -0.0166 -0.0874 333 ASP A OD1 
2732 O OD2 . ASP A 351 ? 1.1616 0.3727 0.4550 0.0446  -0.0676 -0.1044 333 ASP A OD2 
2733 N N   . THR A 352 ? 0.8437 0.3842 0.5261 0.0519  0.0354  -0.1047 334 THR A N   
2734 C CA  . THR A 352 ? 0.8241 0.4103 0.5640 0.0595  0.0584  -0.1050 334 THR A CA  
2735 C C   . THR A 352 ? 0.7566 0.4083 0.5689 0.0474  0.0764  -0.0941 334 THR A C   
2736 O O   . THR A 352 ? 0.7496 0.4327 0.6001 0.0555  0.1046  -0.0856 334 THR A O   
2737 C CB  . THR A 352 ? 0.8040 0.3944 0.5649 0.0532  0.0308  -0.1116 334 THR A CB  
2738 O OG1 . THR A 352 ? 0.9039 0.4301 0.5974 0.0722  0.0306  -0.1210 334 THR A OG1 
2739 C CG2 . THR A 352 ? 0.7706 0.4211 0.6064 0.0506  0.0432  -0.1070 334 THR A CG2 
2740 N N   . ILE A 353 ? 0.7227 0.3894 0.5531 0.0283  0.0600  -0.0907 335 ILE A N   
2741 C CA  . ILE A 353 ? 0.6783 0.3838 0.5536 0.0157  0.0749  -0.0822 335 ILE A CA  
2742 C C   . ILE A 353 ? 0.7027 0.4091 0.5697 0.0252  0.1069  -0.0734 335 ILE A C   
2743 O O   . ILE A 353 ? 0.6805 0.4223 0.5945 0.0204  0.1241  -0.0634 335 ILE A O   
2744 C CB  . ILE A 353 ? 0.6686 0.3737 0.5509 0.0003  0.0590  -0.0784 335 ILE A CB  
2745 C CG1 . ILE A 353 ? 0.6337 0.3498 0.5434 -0.0090 0.0401  -0.0805 335 ILE A CG1 
2746 C CG2 . ILE A 353 ? 0.6426 0.3634 0.5441 -0.0097 0.0773  -0.0706 335 ILE A CG2 
2747 C CD1 . ILE A 353 ? 0.5896 0.3116 0.5191 -0.0211 0.0439  -0.0728 335 ILE A CD1 
2748 N N   . CYS A 354 ? 0.7552 0.4197 0.5625 0.0368  0.1123  -0.0736 336 CYS A N   
2749 C CA  . CYS A 354 ? 0.8039 0.4601 0.5927 0.0504  0.1480  -0.0635 336 CYS A CA  
2750 C C   . CYS A 354 ? 0.8093 0.4807 0.6219 0.0699  0.1817  -0.0553 336 CYS A C   
2751 O O   . CYS A 354 ? 0.7989 0.5040 0.6571 0.0712  0.2108  -0.0374 336 CYS A O   
2752 C CB  . CYS A 354 ? 0.8840 0.4728 0.5810 0.0633  0.1454  -0.0669 336 CYS A CB  
2753 S SG  . CYS A 354 ? 0.9484 0.5290 0.6355 0.0428  0.1134  -0.0625 336 CYS A SG  
2754 N N   . ASP A 355 ? 0.8337 0.4778 0.6181 0.0861  0.1787  -0.0644 337 ASP A N   
2755 C CA  . ASP A 355 ? 0.8516 0.5077 0.6630 0.1102  0.2149  -0.0524 337 ASP A CA  
2756 C C   . ASP A 355 ? 0.7714 0.5075 0.6940 0.0937  0.2137  -0.0353 337 ASP A C   
2757 O O   . ASP A 355 ? 0.7708 0.5427 0.7493 0.1019  0.2469  -0.0098 337 ASP A O   
2758 C CB  . ASP A 355 ? 0.9043 0.5064 0.6578 0.1301  0.2091  -0.0669 337 ASP A CB  
2759 C CG  . ASP A 355 ? 1.0219 0.5252 0.6479 0.1463  0.2101  -0.0800 337 ASP A CG  
2760 O OD1 . ASP A 355 ? 1.0754 0.5522 0.6585 0.1552  0.2354  -0.0724 337 ASP A OD1 
2761 O OD2 . ASP A 355 ? 1.0806 0.5264 0.6437 0.1479  0.1820  -0.0968 337 ASP A OD2 
2762 N N   . LEU A 356 ? 0.7116 0.4707 0.6637 0.0692  0.1740  -0.0459 338 LEU A N   
2763 C CA  . LEU A 356 ? 0.6560 0.4737 0.6925 0.0458  0.1601  -0.0322 338 LEU A CA  
2764 C C   . LEU A 356 ? 0.6345 0.4803 0.7092 0.0250  0.1655  -0.0159 338 LEU A C   
2765 O O   . LEU A 356 ? 0.6174 0.5076 0.7655 0.0155  0.1701  0.0091  338 LEU A O   
2766 C CB  . LEU A 356 ? 0.6199 0.4365 0.6542 0.0248  0.1194  -0.0487 338 LEU A CB  
2767 C CG  . LEU A 356 ? 0.6244 0.4261 0.6454 0.0395  0.1096  -0.0585 338 LEU A CG  
2768 C CD1 . LEU A 356 ? 0.6091 0.4070 0.6250 0.0194  0.0739  -0.0718 338 LEU A CD1 
2769 C CD2 . LEU A 356 ? 0.6324 0.4713 0.7172 0.0505  0.1242  -0.0380 338 LEU A CD2 
2770 N N   . LEU A 357 ? 0.6413 0.4611 0.6716 0.0168  0.1624  -0.0259 339 LEU A N   
2771 C CA  . LEU A 357 ? 0.6405 0.4775 0.6990 -0.0033 0.1674  -0.0117 339 LEU A CA  
2772 C C   . LEU A 357 ? 0.6768 0.5216 0.7474 0.0139  0.2079  0.0100  339 LEU A C   
2773 O O   . LEU A 357 ? 0.6721 0.5387 0.7826 -0.0031 0.2137  0.0287  339 LEU A O   
2774 C CB  . LEU A 357 ? 0.6308 0.4376 0.6452 -0.0184 0.1511  -0.0267 339 LEU A CB  
2775 C CG  . LEU A 357 ? 0.6271 0.4228 0.6314 -0.0332 0.1200  -0.0424 339 LEU A CG  
2776 C CD1 . LEU A 357 ? 0.6423 0.4064 0.6055 -0.0355 0.1155  -0.0509 339 LEU A CD1 
2777 C CD2 . LEU A 357 ? 0.6105 0.4211 0.6516 -0.0603 0.1017  -0.0358 339 LEU A CD2 
2778 N N   . GLY A 358 ? 0.7287 0.5470 0.7579 0.0478  0.2371  0.0090  340 GLY A N   
2779 C CA  . GLY A 358 ? 0.7827 0.5964 0.8094 0.0709  0.2848  0.0310  340 GLY A CA  
2780 C C   . GLY A 358 ? 0.8135 0.5980 0.7905 0.0655  0.2907  0.0280  340 GLY A C   
2781 O O   . GLY A 358 ? 0.8394 0.6347 0.8370 0.0721  0.3249  0.0518  340 GLY A O   
2782 N N   . ALA A 359 ? 0.8203 0.5695 0.7376 0.0545  0.2589  0.0033  341 ALA A N   
2783 C CA  . ALA A 359 ? 0.8536 0.5734 0.7242 0.0508  0.2618  0.0031  341 ALA A CA  
2784 C C   . ALA A 359 ? 0.8887 0.5518 0.6733 0.0574  0.2372  -0.0171 341 ALA A C   
2785 O O   . ALA A 359 ? 0.8643 0.5282 0.6519 0.0469  0.2028  -0.0319 341 ALA A O   
2786 C CB  . ALA A 359 ? 0.8077 0.5560 0.7256 0.0189  0.2425  0.0065  341 ALA A CB  
2787 N N   . LYS A 360 ? 0.9525 0.5652 0.6629 0.0722  0.2516  -0.0139 342 LYS A N   
2788 C CA  . LYS A 360 ? 1.0033 0.5539 0.6273 0.0739  0.2193  -0.0269 342 LYS A CA  
2789 C C   . LYS A 360 ? 0.9905 0.5326 0.6032 0.0576  0.1969  -0.0208 342 LYS A C   
2790 O O   . LYS A 360 ? 0.9775 0.5411 0.6185 0.0524  0.2179  -0.0076 342 LYS A O   
2791 C CB  . LYS A 360 ? 1.1217 0.5947 0.6407 0.1028  0.2415  -0.0288 342 LYS A CB  
2792 C CG  . LYS A 360 ? 1.1651 0.6178 0.6657 0.1203  0.2470  -0.0401 342 LYS A CG  
2793 C CD  . LYS A 360 ? 1.3103 0.6934 0.7239 0.1573  0.2978  -0.0345 342 LYS A CD  
2794 C CE  . LYS A 360 ? 1.3341 0.7191 0.7655 0.1799  0.3221  -0.0371 342 LYS A CE  
2795 N NZ  . LYS A 360 ? 1.4467 0.7612 0.7981 0.2234  0.3860  -0.0264 342 LYS A NZ  
2796 N N   . GLY A 361 ? 0.9881 0.5012 0.5681 0.0489  0.1529  -0.0266 343 GLY A N   
2797 C CA  . GLY A 361 ? 0.9947 0.4856 0.5508 0.0387  0.1276  -0.0147 343 GLY A CA  
2798 C C   . GLY A 361 ? 0.9360 0.4666 0.5500 0.0282  0.1421  -0.0009 343 GLY A C   
2799 O O   . GLY A 361 ? 0.8635 0.4373 0.5476 0.0156  0.1374  -0.0007 343 GLY A O   
2800 N N   . LYS A 362 ? 0.9802 0.4862 0.5549 0.0346  0.1623  0.0108  344 LYS A N   
2801 C CA  . LYS A 362 ? 0.9542 0.4826 0.5682 0.0255  0.1744  0.0261  344 LYS A CA  
2802 C C   . LYS A 362 ? 0.8860 0.4635 0.5712 0.0180  0.2060  0.0255  344 LYS A C   
2803 O O   . LYS A 362 ? 0.8684 0.4587 0.5860 0.0079  0.2149  0.0355  344 LYS A O   
2804 C CB  . LYS A 362 ? 1.0399 0.5219 0.5837 0.0350  0.1868  0.0399  344 LYS A CB  
2805 C CG  . LYS A 362 ? 1.1209 0.5538 0.6055 0.0314  0.1416  0.0498  344 LYS A CG  
2806 C CD  . LYS A 362 ? 1.2614 0.6106 0.6203 0.0456  0.1400  0.0489  344 LYS A CD  
2807 C CE  . LYS A 362 ? 1.2637 0.5745 0.5674 0.0543  0.1290  0.0286  344 LYS A CE  
2808 N NZ  . LYS A 362 ? 1.2717 0.5532 0.5530 0.0388  0.0642  0.0283  344 LYS A NZ  
2809 N N   . ASP A 363 ? 0.8643 0.4630 0.5708 0.0219  0.2200  0.0163  345 ASP A N   
2810 C CA  . ASP A 363 ? 0.8076 0.4512 0.5850 0.0088  0.2361  0.0184  345 ASP A CA  
2811 C C   . ASP A 363 ? 0.7333 0.3937 0.5487 -0.0079 0.2103  0.0080  345 ASP A C   
2812 O O   . ASP A 363 ? 0.6902 0.3706 0.5487 -0.0246 0.2137  0.0091  345 ASP A O   
2813 C CB  . ASP A 363 ? 0.8283 0.4911 0.6235 0.0198  0.2559  0.0184  345 ASP A CB  
2814 C CG  . ASP A 363 ? 0.9290 0.5706 0.6866 0.0426  0.2954  0.0332  345 ASP A CG  
2815 O OD1 . ASP A 363 ? 0.9825 0.6116 0.7253 0.0421  0.3123  0.0473  345 ASP A OD1 
2816 O OD2 . ASP A 363 ? 1.0230 0.6555 0.7628 0.0636  0.3137  0.0322  345 ASP A OD2 
2817 N N   . ILE A 364 ? 0.5620 0.4266 0.4015 -0.0069 0.0794  -0.0013 346 ILE A N   
2818 C CA  . ILE A 364 ? 0.5252 0.3628 0.3654 -0.0207 0.0567  -0.0102 346 ILE A CA  
2819 C C   . ILE A 364 ? 0.5136 0.3309 0.3231 -0.0306 0.0459  -0.0145 346 ILE A C   
2820 O O   . ILE A 364 ? 0.5148 0.3280 0.2931 -0.0230 0.0494  -0.0248 346 ILE A O   
2821 C CB  . ILE A 364 ? 0.5247 0.3495 0.3673 -0.0113 0.0524  -0.0287 346 ILE A CB  
2822 C CG1 . ILE A 364 ? 0.5266 0.3709 0.4094 -0.0022 0.0621  -0.0206 346 ILE A CG1 
2823 C CG2 . ILE A 364 ? 0.5039 0.3056 0.3459 -0.0239 0.0318  -0.0321 346 ILE A CG2 
2824 C CD1 . ILE A 364 ? 0.5491 0.3798 0.4471 0.0064  0.0573  -0.0343 346 ILE A CD1 
2825 N N   . LEU A 365 ? 0.5065 0.3129 0.3262 -0.0466 0.0323  -0.0070 347 LEU A N   
2826 C CA  . LEU A 365 ? 0.5029 0.2868 0.2987 -0.0543 0.0214  -0.0132 347 LEU A CA  
2827 C C   . LEU A 365 ? 0.5019 0.2697 0.2950 -0.0567 0.0081  -0.0232 347 LEU A C   
2828 O O   . LEU A 365 ? 0.5035 0.2722 0.3130 -0.0633 -0.0014 -0.0188 347 LEU A O   
2829 C CB  . LEU A 365 ? 0.5067 0.2859 0.3125 -0.0677 0.0164  -0.0016 347 LEU A CB  
2830 C CG  . LEU A 365 ? 0.5116 0.2677 0.2957 -0.0732 0.0090  -0.0069 347 LEU A CG  
2831 C CD1 . LEU A 365 ? 0.4777 0.2340 0.2378 -0.0648 0.0171  -0.0076 347 LEU A CD1 
2832 C CD2 . LEU A 365 ? 0.4952 0.2430 0.2975 -0.0860 0.0033  0.0011  347 LEU A CD2 
2833 N N   . TYR A 366 ? 0.5083 0.2640 0.2821 -0.0513 0.0066  -0.0346 348 TYR A N   
2834 C CA  . TYR A 366 ? 0.5054 0.2472 0.2794 -0.0529 -0.0036 -0.0391 348 TYR A CA  
2835 C C   . TYR A 366 ? 0.4841 0.2123 0.2399 -0.0593 -0.0086 -0.0374 348 TYR A C   
2836 O O   . TYR A 366 ? 0.4771 0.2015 0.2183 -0.0582 -0.0056 -0.0393 348 TYR A O   
2837 C CB  . TYR A 366 ? 0.5160 0.2529 0.2914 -0.0435 -0.0030 -0.0518 348 TYR A CB  
2838 C CG  . TYR A 366 ? 0.5620 0.2864 0.3472 -0.0451 -0.0121 -0.0517 348 TYR A CG  
2839 C CD1 . TYR A 366 ? 0.5826 0.3096 0.3900 -0.0459 -0.0161 -0.0420 348 TYR A CD1 
2840 C CD2 . TYR A 366 ? 0.5939 0.3076 0.3705 -0.0455 -0.0166 -0.0572 348 TYR A CD2 
2841 C CE1 . TYR A 366 ? 0.5942 0.3137 0.4139 -0.0462 -0.0220 -0.0358 348 TYR A CE1 
2842 C CE2 . TYR A 366 ? 0.5949 0.3005 0.3878 -0.0470 -0.0229 -0.0521 348 TYR A CE2 
2843 C CZ  . TYR A 366 ? 0.5798 0.2884 0.3940 -0.0469 -0.0244 -0.0405 348 TYR A CZ  
2844 O OH  . TYR A 366 ? 0.5830 0.2871 0.4172 -0.0473 -0.0285 -0.0301 348 TYR A OH  
2845 N N   . ILE A 367 ? 0.4772 0.2006 0.2336 -0.0643 -0.0157 -0.0332 349 ILE A N   
2846 C CA  . ILE A 367 ? 0.4847 0.1958 0.2236 -0.0676 -0.0182 -0.0327 349 ILE A CA  
2847 C C   . ILE A 367 ? 0.4986 0.2063 0.2368 -0.0634 -0.0204 -0.0298 349 ILE A C   
2848 O O   . ILE A 367 ? 0.5065 0.2208 0.2532 -0.0623 -0.0247 -0.0237 349 ILE A O   
2849 C CB  . ILE A 367 ? 0.5058 0.2161 0.2423 -0.0750 -0.0248 -0.0321 349 ILE A CB  
2850 C CG1 . ILE A 367 ? 0.4978 0.2135 0.2485 -0.0805 -0.0222 -0.0298 349 ILE A CG1 
2851 C CG2 . ILE A 367 ? 0.5050 0.2001 0.2197 -0.0757 -0.0265 -0.0366 349 ILE A CG2 
2852 C CD1 . ILE A 367 ? 0.4950 0.2147 0.2593 -0.0897 -0.0332 -0.0291 349 ILE A CD1 
2853 N N   . GLY A 368 ? 0.5089 0.2097 0.2422 -0.0608 -0.0174 -0.0301 350 GLY A N   
2854 C CA  . GLY A 368 ? 0.5177 0.2180 0.2598 -0.0572 -0.0180 -0.0229 350 GLY A CA  
2855 C C   . GLY A 368 ? 0.5460 0.2404 0.2808 -0.0554 -0.0137 -0.0197 350 GLY A C   
2856 O O   . GLY A 368 ? 0.5409 0.2299 0.2638 -0.0566 -0.0110 -0.0239 350 GLY A O   
2857 N N   . ASP A 369 ? 0.5662 0.2636 0.3145 -0.0520 -0.0122 -0.0088 351 ASP A N   
2858 C CA  . ASP A 369 ? 0.6042 0.3001 0.3542 -0.0490 -0.0068 -0.0017 351 ASP A CA  
2859 C C   . ASP A 369 ? 0.6179 0.3153 0.3954 -0.0508 -0.0133 -0.0009 351 ASP A C   
2860 O O   . ASP A 369 ? 0.6246 0.3244 0.4122 -0.0490 -0.0108 0.0075  351 ASP A O   
2861 C CB  . ASP A 369 ? 0.6131 0.3162 0.3628 -0.0424 0.0014  0.0140  351 ASP A CB  
2862 C CG  . ASP A 369 ? 0.6069 0.3196 0.3893 -0.0420 -0.0013 0.0289  351 ASP A CG  
2863 O OD1 . ASP A 369 ? 0.6341 0.3469 0.4255 -0.0452 -0.0087 0.0245  351 ASP A OD1 
2864 O OD2 . ASP A 369 ? 0.6036 0.3245 0.4088 -0.0381 0.0047  0.0470  351 ASP A OD2 
2865 N N   . HIS A 370 ? 0.6396 0.3360 0.4310 -0.0538 -0.0226 -0.0107 352 HIS A N   
2866 C CA  . HIS A 370 ? 0.6656 0.3615 0.4825 -0.0559 -0.0331 -0.0150 352 HIS A CA  
2867 C C   . HIS A 370 ? 0.6919 0.3855 0.4960 -0.0566 -0.0417 -0.0356 352 HIS A C   
2868 O O   . HIS A 370 ? 0.7027 0.3949 0.4967 -0.0548 -0.0402 -0.0463 352 HIS A O   
2869 C CB  . HIS A 370 ? 0.6741 0.3695 0.5321 -0.0569 -0.0381 -0.0069 352 HIS A CB  
2870 C CG  . HIS A 370 ? 0.7101 0.4026 0.6022 -0.0611 -0.0529 -0.0129 352 HIS A CG  
2871 N ND1 . HIS A 370 ? 0.7295 0.4284 0.6325 -0.0632 -0.0565 -0.0047 352 HIS A ND1 
2872 C CD2 . HIS A 370 ? 0.7170 0.4004 0.6367 -0.0636 -0.0671 -0.0286 352 HIS A CD2 
2873 C CE1 . HIS A 370 ? 0.7434 0.4389 0.6798 -0.0685 -0.0749 -0.0145 352 HIS A CE1 
2874 N NE2 . HIS A 370 ? 0.7359 0.4198 0.6815 -0.0687 -0.0818 -0.0312 352 HIS A NE2 
2875 N N   . ILE A 371 ? 0.7193 0.4160 0.5259 -0.0579 -0.0505 -0.0391 353 ILE A N   
2876 C CA  . ILE A 371 ? 0.7477 0.4471 0.5388 -0.0568 -0.0618 -0.0580 353 ILE A CA  
2877 C C   . ILE A 371 ? 0.7615 0.4535 0.5750 -0.0574 -0.0769 -0.0776 353 ILE A C   
2878 O O   . ILE A 371 ? 0.7747 0.4641 0.6224 -0.0622 -0.0908 -0.0767 353 ILE A O   
2879 C CB  . ILE A 371 ? 0.7541 0.4629 0.5444 -0.0582 -0.0698 -0.0507 353 ILE A CB  
2880 C CG1 . ILE A 371 ? 0.7254 0.4373 0.5030 -0.0565 -0.0545 -0.0315 353 ILE A CG1 
2881 C CG2 . ILE A 371 ? 0.7674 0.4846 0.5338 -0.0557 -0.0839 -0.0691 353 ILE A CG2 
2882 C CD1 . ILE A 371 ? 0.7453 0.4681 0.5179 -0.0553 -0.0596 -0.0231 353 ILE A CD1 
2883 N N   . PHE A 372 ? 0.7780 0.4659 0.5776 -0.0521 -0.0745 -0.0953 354 PHE A N   
2884 C CA  . PHE A 372 ? 0.8172 0.4933 0.6397 -0.0505 -0.0884 -0.1186 354 PHE A CA  
2885 C C   . PHE A 372 ? 0.8504 0.5283 0.6496 -0.0464 -0.1047 -0.1477 354 PHE A C   
2886 O O   . PHE A 372 ? 0.8551 0.5482 0.6163 -0.0438 -0.1046 -0.1467 354 PHE A O   
2887 C CB  . PHE A 372 ? 0.8263 0.4952 0.6570 -0.0448 -0.0778 -0.1237 354 PHE A CB  
2888 C CG  . PHE A 372 ? 0.8122 0.4789 0.6752 -0.0488 -0.0699 -0.0984 354 PHE A CG  
2889 C CD1 . PHE A 372 ? 0.7895 0.4464 0.7038 -0.0532 -0.0789 -0.0908 354 PHE A CD1 
2890 C CD2 . PHE A 372 ? 0.8171 0.4935 0.6603 -0.0480 -0.0545 -0.0808 354 PHE A CD2 
2891 C CE1 . PHE A 372 ? 0.7775 0.4380 0.7186 -0.0547 -0.0702 -0.0629 354 PHE A CE1 
2892 C CE2 . PHE A 372 ? 0.7944 0.4728 0.6594 -0.0501 -0.0490 -0.0581 354 PHE A CE2 
2893 C CZ  . PHE A 372 ? 0.7897 0.4618 0.7016 -0.0524 -0.0556 -0.0475 354 PHE A CZ  
2894 N N   . GLN A 382 ? 1.0181 0.8300 0.5946 0.1444  0.0977  -0.2629 364 GLN A N   
2895 C CA  . GLN A 382 ? 0.9653 0.7532 0.5768 0.1152  0.0726  -0.2476 364 GLN A CA  
2896 C C   . GLN A 382 ? 0.9225 0.7330 0.5271 0.0981  0.0749  -0.2056 364 GLN A C   
2897 O O   . GLN A 382 ? 0.9438 0.7877 0.5160 0.1087  0.0935  -0.1895 364 GLN A O   
2898 C CB  . GLN A 382 ? 0.9921 0.7494 0.5884 0.1090  0.0414  -0.2829 364 GLN A CB  
2899 N N   . GLY A 383 ? 0.8528 0.6458 0.4919 0.0741  0.0588  -0.1870 365 GLY A N   
2900 C CA  . GLY A 383 ? 0.8134 0.6102 0.4418 0.0559  0.0482  -0.1635 365 GLY A CA  
2901 C C   . GLY A 383 ? 0.7633 0.5680 0.4206 0.0393  0.0538  -0.1256 365 GLY A C   
2902 O O   . GLY A 383 ? 0.7681 0.5980 0.4162 0.0410  0.0686  -0.1024 365 GLY A O   
2903 N N   . TRP A 384 ? 0.7073 0.4919 0.3993 0.0238  0.0414  -0.1190 366 TRP A N   
2904 C CA  . TRP A 384 ? 0.6593 0.4480 0.3750 0.0085  0.0424  -0.0902 366 TRP A CA  
2905 C C   . TRP A 384 ? 0.6449 0.4359 0.3404 -0.0015 0.0382  -0.0755 366 TRP A C   
2906 O O   . TRP A 384 ? 0.6701 0.4519 0.3439 -0.0020 0.0271  -0.0863 366 TRP A O   
2907 C CB  . TRP A 384 ? 0.6353 0.4032 0.3820 -0.0030 0.0285  -0.0891 366 TRP A CB  
2908 C CG  . TRP A 384 ? 0.6338 0.4006 0.4134 0.0041  0.0320  -0.0935 366 TRP A CG  
2909 C CD1 . TRP A 384 ? 0.6693 0.4507 0.4571 0.0199  0.0479  -0.0990 366 TRP A CD1 
2910 C CD2 . TRP A 384 ? 0.6193 0.3725 0.4313 -0.0025 0.0213  -0.0888 366 TRP A CD2 
2911 N NE1 . TRP A 384 ? 0.6692 0.4445 0.4964 0.0232  0.0466  -0.0991 366 TRP A NE1 
2912 C CE2 . TRP A 384 ? 0.6467 0.4057 0.4892 0.0091  0.0297  -0.0913 366 TRP A CE2 
2913 C CE3 . TRP A 384 ? 0.5820 0.3213 0.4008 -0.0149 0.0071  -0.0807 366 TRP A CE3 
2914 C CZ2 . TRP A 384 ? 0.6129 0.3645 0.4944 0.0071  0.0223  -0.0832 366 TRP A CZ2 
2915 C CZ3 . TRP A 384 ? 0.5795 0.3135 0.4324 -0.0160 0.0012  -0.0726 366 TRP A CZ3 
2916 C CH2 . TRP A 384 ? 0.5948 0.3351 0.4795 -0.0058 0.0077  -0.0727 366 TRP A CH2 
2917 N N   . ARG A 385 ? 0.6034 0.4058 0.3113 -0.0094 0.0456  -0.0510 367 ARG A N   
2918 C CA  . ARG A 385 ? 0.5804 0.3782 0.2804 -0.0201 0.0404  -0.0365 367 ARG A CA  
2919 C C   . ARG A 385 ? 0.5616 0.3341 0.2720 -0.0328 0.0247  -0.0404 367 ARG A C   
2920 O O   . ARG A 385 ? 0.5541 0.3185 0.2837 -0.0362 0.0198  -0.0446 367 ARG A O   
2921 C CB  . ARG A 385 ? 0.5654 0.3782 0.2855 -0.0260 0.0512  -0.0102 367 ARG A CB  
2922 C CG  . ARG A 385 ? 0.5641 0.4082 0.2851 -0.0134 0.0714  0.0025  367 ARG A CG  
2923 C CD  . ARG A 385 ? 0.5888 0.4490 0.2680 0.0012  0.0786  0.0002  367 ARG A CD  
2924 N NE  . ARG A 385 ? 0.6170 0.4735 0.2843 -0.0054 0.0723  0.0140  367 ARG A NE  
2925 C CZ  . ARG A 385 ? 0.6309 0.5052 0.3079 -0.0067 0.0834  0.0447  367 ARG A CZ  
2926 N NH1 . ARG A 385 ? 0.6037 0.5026 0.3060 -0.0035 0.1017  0.0676  367 ARG A NH1 
2927 N NH2 . ARG A 385 ? 0.6301 0.4990 0.2987 -0.0110 0.0767  0.0561  367 ARG A NH2 
2928 N N   . THR A 386 ? 0.5528 0.3159 0.2520 -0.0382 0.0184  -0.0358 368 THR A N   
2929 C CA  . THR A 386 ? 0.5454 0.2881 0.2499 -0.0456 0.0067  -0.0405 368 THR A CA  
2930 C C   . THR A 386 ? 0.5407 0.2740 0.2492 -0.0541 0.0064  -0.0276 368 THR A C   
2931 O O   . THR A 386 ? 0.5469 0.2856 0.2505 -0.0538 0.0115  -0.0162 368 THR A O   
2932 C CB  . THR A 386 ? 0.5639 0.3014 0.2558 -0.0418 -0.0026 -0.0518 368 THR A CB  
2933 O OG1 . THR A 386 ? 0.5814 0.3293 0.2550 -0.0388 -0.0010 -0.0441 368 THR A OG1 
2934 C CG2 . THR A 386 ? 0.5289 0.2682 0.2200 -0.0334 -0.0060 -0.0714 368 THR A CG2 
2935 N N   . PHE A 387 ? 0.5190 0.2387 0.2363 -0.0603 0.0009  -0.0295 369 PHE A N   
2936 C CA  . PHE A 387 ? 0.5218 0.2275 0.2390 -0.0657 -0.0003 -0.0247 369 PHE A CA  
2937 C C   . PHE A 387 ? 0.5196 0.2150 0.2312 -0.0637 -0.0049 -0.0293 369 PHE A C   
2938 O O   . PHE A 387 ? 0.5179 0.2130 0.2332 -0.0635 -0.0088 -0.0329 369 PHE A O   
2939 C CB  . PHE A 387 ? 0.5177 0.2196 0.2467 -0.0733 -0.0030 -0.0241 369 PHE A CB  
2940 C CG  . PHE A 387 ? 0.5118 0.1953 0.2396 -0.0780 -0.0053 -0.0251 369 PHE A CG  
2941 C CD1 . PHE A 387 ? 0.5187 0.1978 0.2634 -0.0847 -0.0047 -0.0195 369 PHE A CD1 
2942 C CD2 . PHE A 387 ? 0.5492 0.2196 0.2628 -0.0747 -0.0071 -0.0315 369 PHE A CD2 
2943 C CE1 . PHE A 387 ? 0.5270 0.1836 0.2737 -0.0884 -0.0080 -0.0253 369 PHE A CE1 
2944 C CE2 . PHE A 387 ? 0.5262 0.1773 0.2358 -0.0760 -0.0076 -0.0369 369 PHE A CE2 
2945 C CZ  . PHE A 387 ? 0.5246 0.1665 0.2503 -0.0829 -0.0091 -0.0362 369 PHE A CZ  
2946 N N   . LEU A 388 ? 0.5260 0.2165 0.2336 -0.0613 -0.0036 -0.0251 370 LEU A N   
2947 C CA  . LEU A 388 ? 0.5154 0.2005 0.2246 -0.0584 -0.0053 -0.0246 370 LEU A CA  
2948 C C   . LEU A 388 ? 0.5139 0.1860 0.2184 -0.0576 -0.0004 -0.0230 370 LEU A C   
2949 O O   . LEU A 388 ? 0.5515 0.2152 0.2558 -0.0574 0.0039  -0.0202 370 LEU A O   
2950 C CB  . LEU A 388 ? 0.5120 0.2031 0.2247 -0.0552 -0.0080 -0.0201 370 LEU A CB  
2951 C CG  . LEU A 388 ? 0.5230 0.2139 0.2492 -0.0529 -0.0107 -0.0159 370 LEU A CG  
2952 C CD1 . LEU A 388 ? 0.4940 0.1877 0.2329 -0.0540 -0.0173 -0.0214 370 LEU A CD1 
2953 C CD2 . LEU A 388 ? 0.5162 0.2151 0.2499 -0.0512 -0.0160 -0.0097 370 LEU A CD2 
2954 N N   . VAL A 389 ? 0.5213 0.1921 0.2223 -0.0555 -0.0005 -0.0244 371 VAL A N   
2955 C CA  . VAL A 389 ? 0.5266 0.1874 0.2155 -0.0508 0.0053  -0.0257 371 VAL A CA  
2956 C C   . VAL A 389 ? 0.5318 0.1965 0.2303 -0.0434 0.0121  -0.0152 371 VAL A C   
2957 O O   . VAL A 389 ? 0.5177 0.1940 0.2317 -0.0431 0.0093  -0.0073 371 VAL A O   
2958 C CB  . VAL A 389 ? 0.5372 0.2023 0.2143 -0.0501 0.0020  -0.0287 371 VAL A CB  
2959 C CG1 . VAL A 389 ? 0.5671 0.2249 0.2222 -0.0415 0.0091  -0.0323 371 VAL A CG1 
2960 C CG2 . VAL A 389 ? 0.5175 0.1830 0.1937 -0.0585 -0.0073 -0.0366 371 VAL A CG2 
2961 N N   . ILE A 390 ? 0.5320 0.1867 0.2288 -0.0379 0.0204  -0.0141 372 ILE A N   
2962 C CA  . ILE A 390 ? 0.5260 0.1857 0.2364 -0.0293 0.0292  -0.0017 372 ILE A CA  
2963 C C   . ILE A 390 ? 0.5578 0.2065 0.2505 -0.0182 0.0424  -0.0068 372 ILE A C   
2964 O O   . ILE A 390 ? 0.5746 0.2066 0.2639 -0.0148 0.0474  -0.0140 372 ILE A O   
2965 C CB  . ILE A 390 ? 0.5249 0.1853 0.2534 -0.0296 0.0283  0.0066  372 ILE A CB  
2966 C CG1 . ILE A 390 ? 0.5110 0.1809 0.2430 -0.0389 0.0150  0.0056  372 ILE A CG1 
2967 C CG2 . ILE A 390 ? 0.4959 0.1682 0.2480 -0.0223 0.0339  0.0228  372 ILE A CG2 
2968 C CD1 . ILE A 390 ? 0.5063 0.1833 0.2497 -0.0385 0.0118  0.0159  372 ILE A CD1 
2969 N N   . PRO A 391 ? 0.5711 0.2292 0.2514 -0.0113 0.0482  -0.0036 373 PRO A N   
2970 C CA  . PRO A 391 ? 0.6106 0.2603 0.2633 0.0022  0.0612  -0.0124 373 PRO A CA  
2971 C C   . PRO A 391 ? 0.6281 0.2701 0.2909 0.0155  0.0778  -0.0084 373 PRO A C   
2972 O O   . PRO A 391 ? 0.6764 0.2990 0.3169 0.0250  0.0856  -0.0259 373 PRO A O   
2973 C CB  . PRO A 391 ? 0.6136 0.2848 0.2577 0.0092  0.0667  0.0009  373 PRO A CB  
2974 C CG  . PRO A 391 ? 0.5957 0.2782 0.2599 -0.0045 0.0516  0.0087  373 PRO A CG  
2975 C CD  . PRO A 391 ? 0.5419 0.2187 0.2331 -0.0145 0.0432  0.0084  373 PRO A CD  
2976 N N   . GLU A 392 ? 0.6059 0.2627 0.3048 0.0166  0.0818  0.0132  374 GLU A N   
2977 C CA  . GLU A 392 ? 0.6147 0.2696 0.3342 0.0295  0.0974  0.0230  374 GLU A CA  
2978 C C   . GLU A 392 ? 0.6328 0.2640 0.3565 0.0280  0.0954  0.0119  374 GLU A C   
2979 O O   . GLU A 392 ? 0.6585 0.2820 0.3955 0.0413  0.1100  0.0157  374 GLU A O   
2980 C CB  . GLU A 392 ? 0.5793 0.2587 0.3445 0.0271  0.0955  0.0502  374 GLU A CB  
2981 C CG  . GLU A 392 ? 0.5445 0.2476 0.3224 0.0285  0.0986  0.0673  374 GLU A CG  
2982 C CD  . GLU A 392 ? 0.5410 0.2518 0.3317 0.0107  0.0766  0.0683  374 GLU A CD  
2983 O OE1 . GLU A 392 ? 0.5187 0.2164 0.2850 0.0008  0.0638  0.0497  374 GLU A OE1 
2984 O OE2 . GLU A 392 ? 0.5312 0.2615 0.3618 0.0072  0.0723  0.0881  374 GLU A OE2 
2985 N N   . LEU A 393 ? 0.6439 0.2653 0.3624 0.0128  0.0787  0.0020  375 LEU A N   
2986 C CA  . LEU A 393 ? 0.6664 0.2693 0.3978 0.0093  0.0759  -0.0013 375 LEU A CA  
2987 C C   . LEU A 393 ? 0.7140 0.2873 0.4334 0.0204  0.0872  -0.0205 375 LEU A C   
2988 O O   . LEU A 393 ? 0.7421 0.3008 0.4841 0.0260  0.0938  -0.0166 375 LEU A O   
2989 C CB  . LEU A 393 ? 0.6465 0.2491 0.3741 -0.0079 0.0586  -0.0060 375 LEU A CB  
2990 C CG  . LEU A 393 ? 0.6396 0.2326 0.3870 -0.0138 0.0547  0.0003  375 LEU A CG  
2991 C CD1 . LEU A 393 ? 0.6073 0.2143 0.3823 -0.0085 0.0578  0.0238  375 LEU A CD1 
2992 C CD2 . LEU A 393 ? 0.6199 0.2237 0.3617 -0.0278 0.0414  0.0000  375 LEU A CD2 
2993 N N   . ALA A 394 ? 0.7627 0.3282 0.4465 0.0252  0.0893  -0.0413 376 ALA A N   
2994 C CA  . ALA A 394 ? 0.8238 0.3604 0.4872 0.0386  0.0990  -0.0668 376 ALA A CA  
2995 C C   . ALA A 394 ? 0.8554 0.3885 0.5349 0.0602  0.1225  -0.0589 376 ALA A C   
2996 O O   . ALA A 394 ? 0.9066 0.4109 0.6003 0.0673  0.1286  -0.0704 376 ALA A O   
2997 C CB  . ALA A 394 ? 0.8518 0.3913 0.4673 0.0426  0.0963  -0.0869 376 ALA A CB  
2998 N N   . GLN A 395 ? 0.8389 0.4011 0.5238 0.0710  0.1361  -0.0372 377 GLN A N   
2999 C CA  . GLN A 395 ? 0.8527 0.4177 0.5637 0.0917  0.1595  -0.0231 377 GLN A CA  
3000 C C   . GLN A 395 ? 0.8117 0.3830 0.5767 0.0855  0.1554  0.0030  377 GLN A C   
3001 O O   . GLN A 395 ? 0.8379 0.3952 0.6287 0.0993  0.1694  0.0065  377 GLN A O   
3002 C CB  . GLN A 395 ? 0.8550 0.4523 0.5597 0.1073  0.1783  -0.0053 377 GLN A CB  
3003 C CG  . GLN A 395 ? 0.9219 0.5204 0.6406 0.1359  0.2095  0.0017  377 GLN A CG  
3004 C CD  . GLN A 395 ? 1.0183 0.5754 0.7122 0.1539  0.2223  -0.0341 377 GLN A CD  
3005 O OE1 . GLN A 395 ? 1.0676 0.5963 0.7206 0.1482  0.2094  -0.0694 377 GLN A OE1 
3006 N NE2 . GLN A 395 ? 1.0509 0.6048 0.7741 0.1764  0.2470  -0.0252 377 GLN A NE2 
3007 N N   . GLU A 396 ? 0.7540 0.3466 0.5350 0.0664  0.1362  0.0208  378 GLU A N   
3008 C CA  . GLU A 396 ? 0.7178 0.3204 0.5415 0.0602  0.1282  0.0448  378 GLU A CA  
3009 C C   . GLU A 396 ? 0.7348 0.3070 0.5700 0.0596  0.1272  0.0369  378 GLU A C   
3010 O O   . GLU A 396 ? 0.7345 0.3061 0.6073 0.0681  0.1344  0.0551  378 GLU A O   
3011 C CB  . GLU A 396 ? 0.6738 0.3009 0.5006 0.0403  0.1052  0.0566  378 GLU A CB  
3012 C CG  . GLU A 396 ? 0.6538 0.3118 0.4882 0.0389  0.1030  0.0703  378 GLU A CG  
3013 C CD  . GLU A 396 ? 0.6293 0.3147 0.5107 0.0410  0.1002  0.0996  378 GLU A CD  
3014 O OE1 . GLU A 396 ? 0.6103 0.2977 0.5145 0.0398  0.0936  0.1117  378 GLU A OE1 
3015 O OE2 . GLU A 396 ? 0.5969 0.3049 0.4968 0.0430  0.1029  0.1132  378 GLU A OE2 
3016 N N   . LEU A 397 ? 0.7385 0.2870 0.5484 0.0492  0.1176  0.0129  379 LEU A N   
3017 C CA  . LEU A 397 ? 0.7565 0.2743 0.5853 0.0466  0.1157  0.0064  379 LEU A CA  
3018 C C   . LEU A 397 ? 0.7939 0.2824 0.6391 0.0674  0.1356  -0.0037 379 LEU A C   
3019 O O   . LEU A 397 ? 0.8020 0.2770 0.6892 0.0710  0.1393  0.0107  379 LEU A O   
3020 C CB  . LEU A 397 ? 0.7666 0.2651 0.5713 0.0313  0.1012  -0.0182 379 LEU A CB  
3021 C CG  . LEU A 397 ? 0.7395 0.2587 0.5433 0.0110  0.0831  -0.0060 379 LEU A CG  
3022 C CD1 . LEU A 397 ? 0.7372 0.2429 0.5144 -0.0011 0.0709  -0.0320 379 LEU A CD1 
3023 C CD2 . LEU A 397 ? 0.7158 0.2346 0.5587 0.0061  0.0806  0.0180  379 LEU A CD2 
3024 N N   A HIS A 398 ? 0.8205 0.3005 0.6339 0.0829  0.1494  -0.0268 380 HIS A N   
3025 N N   B HIS A 398 ? 0.8191 0.2990 0.6322 0.0828  0.1494  -0.0270 380 HIS A N   
3026 C CA  A HIS A 398 ? 0.8595 0.3112 0.6819 0.1071  0.1716  -0.0418 380 HIS A CA  
3027 C CA  B HIS A 398 ? 0.8557 0.3091 0.6777 0.1077  0.1722  -0.0410 380 HIS A CA  
3028 C C   A HIS A 398 ? 0.8474 0.3185 0.7177 0.1230  0.1891  -0.0075 380 HIS A C   
3029 C C   B HIS A 398 ? 0.8407 0.3130 0.7138 0.1206  0.1869  -0.0052 380 HIS A C   
3030 O O   A HIS A 398 ? 0.8776 0.3234 0.7827 0.1369  0.2018  -0.0074 380 HIS A O   
3031 O O   B HIS A 398 ? 0.8620 0.3108 0.7744 0.1298  0.1950  -0.0008 380 HIS A O   
3032 C CB  A HIS A 398 ? 0.9003 0.3449 0.6687 0.1233  0.1839  -0.0739 380 HIS A CB  
3033 C CB  B HIS A 398 ? 0.8894 0.3438 0.6607 0.1254  0.1872  -0.0661 380 HIS A CB  
3034 C CG  A HIS A 398 ? 0.9269 0.3393 0.6552 0.1143  0.1682  -0.1157 380 HIS A CG  
3035 C CG  B HIS A 398 ? 0.9237 0.3630 0.7023 0.1566  0.2168  -0.0746 380 HIS A CG  
3036 N ND1 A HIS A 398 ? 0.9677 0.3323 0.6981 0.1228  0.1700  -0.1501 380 HIS A ND1 
3037 N ND1 B HIS A 398 ? 0.9719 0.3629 0.7469 0.1694  0.2233  -0.1103 380 HIS A ND1 
3038 C CD2 A HIS A 398 ? 0.8930 0.3149 0.5820 0.0979  0.1489  -0.1288 380 HIS A CD2 
3039 C CD2 B HIS A 398 ? 0.9071 0.3732 0.6992 0.1787  0.2423  -0.0527 380 HIS A CD2 
3040 C CE1 A HIS A 398 ? 0.9832 0.3303 0.6770 0.1103  0.1499  -0.1833 380 HIS A CE1 
3041 C CE1 B HIS A 398 ? 0.9997 0.3875 0.7813 0.2001  0.2534  -0.1120 380 HIS A CE1 
3042 N NE2 A HIS A 398 ? 0.9351 0.3182 0.6031 0.0956  0.1375  -0.1694 380 HIS A NE2 
3043 N NE2 B HIS A 398 ? 0.9673 0.4026 0.7606 0.2063  0.2664  -0.0750 380 HIS A NE2 
3044 N N   . VAL A 399 ? 0.8023 0.3174 0.6804 0.1206  0.1886  0.0218  381 VAL A N   
3045 C CA  . VAL A 399 ? 0.7874 0.3273 0.7173 0.1326  0.2003  0.0580  381 VAL A CA  
3046 C C   . VAL A 399 ? 0.7744 0.3175 0.7472 0.1202  0.1845  0.0837  381 VAL A C   
3047 O O   . VAL A 399 ? 0.7949 0.3333 0.8140 0.1338  0.1959  0.1023  381 VAL A O   
3048 C CB  . VAL A 399 ? 0.7512 0.3379 0.6857 0.1320  0.2011  0.0826  381 VAL A CB  
3049 C CG1 . VAL A 399 ? 0.7114 0.3241 0.7059 0.1462  0.2136  0.1192  381 VAL A CG1 
3050 C CG2 . VAL A 399 ? 0.7700 0.3588 0.6604 0.1442  0.2175  0.0630  381 VAL A CG2 
3051 N N   . TRP A 400 ? 0.7513 0.3046 0.7090 0.0965  0.1599  0.0864  382 TRP A N   
3052 C CA  . TRP A 400 ? 0.7525 0.3131 0.7412 0.0856  0.1453  0.1115  382 TRP A CA  
3053 C C   . TRP A 400 ? 0.8000 0.3246 0.8256 0.0959  0.1563  0.1127  382 TRP A C   
3054 O O   . TRP A 400 ? 0.7937 0.3300 0.8669 0.1026  0.1586  0.1454  382 TRP A O   
3055 C CB  . TRP A 400 ? 0.7264 0.2934 0.6841 0.0624  0.1230  0.1045  382 TRP A CB  
3056 C CG  . TRP A 400 ? 0.7214 0.3014 0.7048 0.0536  0.1106  0.1326  382 TRP A CG  
3057 C CD1 . TRP A 400 ? 0.7244 0.2837 0.7173 0.0459  0.1070  0.1330  382 TRP A CD1 
3058 C CD2 . TRP A 400 ? 0.7156 0.3358 0.7216 0.0527  0.0999  0.1678  382 TRP A CD2 
3059 N NE1 . TRP A 400 ? 0.7133 0.3000 0.7291 0.0418  0.0976  0.1691  382 TRP A NE1 
3060 C CE2 . TRP A 400 ? 0.7043 0.3285 0.7250 0.0461  0.0917  0.1890  382 TRP A CE2 
3061 C CE3 . TRP A 400 ? 0.6700 0.3253 0.6878 0.0565  0.0950  0.1847  382 TRP A CE3 
3062 C CZ2 . TRP A 400 ? 0.6937 0.3572 0.7312 0.0450  0.0786  0.2248  382 TRP A CZ2 
3063 C CZ3 . TRP A 400 ? 0.6575 0.3487 0.6967 0.0533  0.0788  0.2173  382 TRP A CZ3 
3064 C CH2 . TRP A 400 ? 0.6633 0.3593 0.7067 0.0482  0.0704  0.2359  382 TRP A CH2 
3065 N N   . THR A 401 ? 0.8499 0.3311 0.8566 0.0969  0.1613  0.0773  383 THR A N   
3066 C CA  . THR A 401 ? 0.9089 0.3490 0.9539 0.1050  0.1697  0.0727  383 THR A CA  
3067 C C   . THR A 401 ? 0.9560 0.3819 1.0370 0.1332  0.1952  0.0764  383 THR A C   
3068 O O   . THR A 401 ? 0.9722 0.3827 1.1082 0.1407  0.2011  0.0964  383 THR A O   
3069 C CB  . THR A 401 ? 0.9399 0.3359 0.9624 0.0946  0.1618  0.0325  383 THR A CB  
3070 O OG1 . THR A 401 ? 1.0006 0.3532 1.0724 0.1032  0.1697  0.0289  383 THR A OG1 
3071 C CG2 . THR A 401 ? 0.9594 0.3407 0.9258 0.1020  0.1673  -0.0114 383 THR A CG2 
3072 N N   . ASP A 402 ? 0.9852 0.4194 1.0392 0.1498  0.2117  0.0611  384 ASP A N   
3073 C CA  . ASP A 402 ? 1.0301 0.4664 1.1186 0.1789  0.2391  0.0725  384 ASP A CA  
3074 C C   . ASP A 402 ? 1.0057 0.4848 1.1518 0.1813  0.2380  0.1263  384 ASP A C   
3075 O O   . ASP A 402 ? 1.0308 0.5051 1.2271 0.2032  0.2574  0.1432  384 ASP A O   
3076 C CB  . ASP A 402 ? 1.0500 0.5014 1.0945 0.1941  0.2566  0.0541  384 ASP A CB  
3077 C CG  . ASP A 402 ? 1.1302 0.5355 1.1345 0.2124  0.2735  0.0030  384 ASP A CG  
3078 O OD1 . ASP A 402 ? 1.1763 0.5849 1.1185 0.2094  0.2708  -0.0244 384 ASP A OD1 
3079 O OD2 . ASP A 402 ? 1.1971 0.5639 1.2318 0.2313  0.2892  -0.0101 384 ASP A OD2 
3080 N N   . LYS A 403 ? 0.9722 0.4939 1.1108 0.1601  0.2148  0.1515  385 LYS A N   
3081 C CA  . LYS A 403 ? 0.9548 0.5230 1.1403 0.1605  0.2077  0.1993  385 LYS A CA  
3082 C C   . LYS A 403 ? 0.9549 0.5288 1.1743 0.1495  0.1903  0.2298  385 LYS A C   
3083 O O   . LYS A 403 ? 0.9431 0.5573 1.1991 0.1492  0.1801  0.2704  385 LYS A O   
3084 C CB  . LYS A 403 ? 0.9174 0.5314 1.0769 0.1447  0.1896  0.2083  385 LYS A CB  
3085 C CG  . LYS A 403 ? 0.9251 0.5475 1.0582 0.1538  0.2050  0.1910  385 LYS A CG  
3086 C CD  . LYS A 403 ? 0.9656 0.5979 1.1427 0.1820  0.2343  0.2077  385 LYS A CD  
3087 C CE  . LYS A 403 ? 1.0286 0.6141 1.1875 0.2058  0.2646  0.1731  385 LYS A CE  
3088 N NZ  . LYS A 403 ? 1.0458 0.6442 1.2435 0.2365  0.2973  0.1885  385 LYS A NZ  
3089 N N   . SER A 404 ? 0.9756 0.5129 1.1849 0.1405  0.1858  0.2130  386 SER A N   
3090 C CA  . SER A 404 ? 0.9710 0.5181 1.2062 0.1282  0.1696  0.2446  386 SER A CA  
3091 C C   . SER A 404 ? 0.9806 0.5514 1.2824 0.1424  0.1738  0.2931  386 SER A C   
3092 O O   . SER A 404 ? 0.9657 0.5768 1.2786 0.1330  0.1549  0.3309  386 SER A O   
3093 C CB  . SER A 404 ? 1.0006 0.4980 1.2379 0.1220  0.1715  0.2228  386 SER A CB  
3094 O OG  . SER A 404 ? 1.0506 0.5015 1.3254 0.1424  0.1938  0.2072  386 SER A OG  
3095 N N   . SER A 405 ? 1.0111 0.5587 1.3552 0.1666  0.1986  0.2915  387 SER A N   
3096 C CA  . SER A 405 ? 1.0141 0.5838 1.4288 0.1840  0.2061  0.3375  387 SER A CA  
3097 C C   . SER A 405 ? 0.9684 0.6023 1.3881 0.1811  0.1914  0.3698  387 SER A C   
3098 O O   . SER A 405 ? 0.9652 0.6377 1.4194 0.1782  0.1751  0.4151  387 SER A O   
3099 C CB  . SER A 405 ? 1.0607 0.5917 1.5132 0.2134  0.2393  0.3214  387 SER A CB  
3100 O OG  . SER A 405 ? 1.1284 0.5973 1.5872 0.2163  0.2492  0.2919  387 SER A OG  
3101 N N   . LEU A 406 ? 0.9393 0.5853 1.3274 0.1821  0.1962  0.3476  388 LEU A N   
3102 C CA  . LEU A 406 ? 0.8941 0.5981 1.2893 0.1759  0.1793  0.3730  388 LEU A CA  
3103 C C   . LEU A 406 ? 0.8514 0.5922 1.2187 0.1505  0.1419  0.3885  388 LEU A C   
3104 O O   . LEU A 406 ? 0.8347 0.6231 1.2321 0.1478  0.1221  0.4253  388 LEU A O   
3105 C CB  . LEU A 406 ? 0.8826 0.5895 1.2470 0.1788  0.1913  0.3450  388 LEU A CB  
3106 C CG  . LEU A 406 ? 0.9114 0.6209 1.3207 0.2071  0.2239  0.3530  388 LEU A CG  
3107 C CD1 . LEU A 406 ? 0.9611 0.6166 1.3850 0.2323  0.2572  0.3329  388 LEU A CD1 
3108 C CD2 . LEU A 406 ? 0.8897 0.6135 1.2667 0.2065  0.2318  0.3343  388 LEU A CD2 
3109 N N   . PHE A 407 ? 0.8362 0.5562 1.1462 0.1333  0.1320  0.3601  389 PHE A N   
3110 C CA  . PHE A 407 ? 0.8117 0.5633 1.0895 0.1128  0.1009  0.3710  389 PHE A CA  
3111 C C   . PHE A 407 ? 0.8219 0.5907 1.1331 0.1150  0.0917  0.4135  389 PHE A C   
3112 O O   . PHE A 407 ? 0.8101 0.6261 1.1185 0.1076  0.0661  0.4409  389 PHE A O   
3113 C CB  . PHE A 407 ? 0.8078 0.5335 1.0220 0.0966  0.0967  0.3323  389 PHE A CB  
3114 C CG  . PHE A 407 ? 0.7948 0.5545 0.9692 0.0781  0.0678  0.3371  389 PHE A CG  
3115 C CD1 . PHE A 407 ? 0.8053 0.5902 0.9502 0.0676  0.0504  0.3223  389 PHE A CD1 
3116 C CD2 . PHE A 407 ? 0.8006 0.5676 0.9688 0.0727  0.0591  0.3567  389 PHE A CD2 
3117 C CE1 . PHE A 407 ? 0.8102 0.6237 0.9159 0.0527  0.0237  0.3213  389 PHE A CE1 
3118 C CE2 . PHE A 407 ? 0.8165 0.6173 0.9419 0.0593  0.0350  0.3594  389 PHE A CE2 
3119 C CZ  . PHE A 407 ? 0.7994 0.6218 0.8913 0.0498  0.0167  0.3388  389 PHE A CZ  
3120 N N   . GLU A 408 ? 1.4034 0.5088 0.8388 -0.1604 0.1461  0.0059  390 GLU A N   
3121 C CA  . GLU A 408 ? 1.5437 0.5019 0.8486 -0.1941 0.1466  0.0090  390 GLU A CA  
3122 C C   . GLU A 408 ? 1.5642 0.4100 0.8381 -0.0870 0.1571  0.0051  390 GLU A C   
3123 O O   . GLU A 408 ? 1.5800 0.3960 0.8366 -0.0805 0.1605  0.0102  390 GLU A O   
3124 C CB  . GLU A 408 ? 1.7772 0.5443 0.8649 -0.2968 0.1335  0.0073  390 GLU A CB  
3125 C CG  . GLU A 408 ? 1.7893 0.6990 0.8892 -0.4415 0.1196  0.0219  390 GLU A CG  
3126 C CD  . GLU A 408 ? 2.0901 0.7740 0.9301 -0.5792 0.0996  0.0247  390 GLU A CD  
3127 O OE1 . GLU A 408 ? 2.2176 0.8263 0.9485 -0.6652 0.0963  0.0383  390 GLU A OE1 
3128 O OE2 . GLU A 408 ? 2.2297 0.7924 0.9531 -0.6077 0.0853  0.0144  390 GLU A OE2 
3129 N N   . GLU A 409 ? 1.5632 0.3714 0.8314 -0.0011 0.1627  -0.0007 391 GLU A N   
3130 C CA  . GLU A 409 ? 1.5586 0.3435 0.8304 0.1112  0.1726  0.0022  391 GLU A CA  
3131 C C   . GLU A 409 ? 1.3579 0.3335 0.8198 0.1352  0.1718  0.0105  391 GLU A C   
3132 O O   . GLU A 409 ? 1.3621 0.3300 0.8241 0.1782  0.1730  0.0154  391 GLU A O   
3133 C CB  . GLU A 409 ? 1.6070 0.3638 0.8391 0.1973  0.1807  0.0011  391 GLU A CB  
3134 C CG  . GLU A 409 ? 1.5032 0.4102 0.8554 0.2973  0.1890  0.0143  391 GLU A CG  
3135 C CD  . GLU A 409 ? 1.6435 0.4779 0.8701 0.4173  0.2030  0.0198  391 GLU A CD  
3136 O OE1 . GLU A 409 ? 1.7318 0.4880 0.8662 0.4371  0.2086  0.0143  391 GLU A OE1 
3137 O OE2 . GLU A 409 ? 1.6778 0.5485 0.8938 0.5024  0.2084  0.0315  391 GLU A OE2 
3138 N N   . LEU A 410 ? 1.2087 0.3349 0.8078 0.1091  0.1673  0.0121  392 LEU A N   
3139 C CA  . LEU A 410 ? 1.0662 0.3231 0.7971 0.1233  0.1617  0.0189  392 LEU A CA  
3140 C C   . LEU A 410 ? 1.0708 0.3173 0.7909 0.0978  0.1596  0.0202  392 LEU A C   
3141 O O   . LEU A 410 ? 1.0363 0.3062 0.7935 0.1318  0.1552  0.0247  392 LEU A O   
3142 C CB  . LEU A 410 ? 0.9716 0.3393 0.7927 0.1010  0.1567  0.0192  392 LEU A CB  
3143 C CG  . LEU A 410 ? 0.8848 0.3304 0.7910 0.1325  0.1495  0.0270  392 LEU A CG  
3144 C CD1 . LEU A 410 ? 0.8818 0.3319 0.7900 0.1750  0.1512  0.0368  392 LEU A CD1 
3145 C CD2 . LEU A 410 ? 0.8472 0.3418 0.7831 0.1207  0.1485  0.0258  392 LEU A CD2 
3146 N N   . GLN A 411 ? 1.1219 0.3427 0.7843 0.0305  0.1614  0.0193  393 GLN A N   
3147 C CA  . GLN A 411 ? 1.1349 0.3666 0.7847 0.0014  0.1627  0.0253  393 GLN A CA  
3148 C C   . GLN A 411 ? 1.2350 0.3288 0.7923 0.0341  0.1655  0.0249  393 GLN A C   
3149 O O   . GLN A 411 ? 1.2010 0.3221 0.7919 0.0586  0.1644  0.0288  393 GLN A O   
3150 C CB  . GLN A 411 ? 1.1964 0.4587 0.7946 -0.0953 0.1637  0.0320  393 GLN A CB  
3151 C CG  . GLN A 411 ? 1.1082 0.5473 0.7984 -0.1157 0.1609  0.0360  393 GLN A CG  
3152 C CD  . GLN A 411 ? 1.1811 0.7170 0.8341 -0.2181 0.1601  0.0507  393 GLN A CD  
3153 O OE1 . GLN A 411 ? 1.2479 0.7791 0.8457 -0.2916 0.1522  0.0516  393 GLN A OE1 
3154 N NE2 . GLN A 411 ? 1.1709 0.8060 0.8456 -0.2304 0.1670  0.0655  393 GLN A NE2 
3155 N N   . SER A 412 ? 1.3805 0.3140 0.8008 0.0448  0.1684  0.0202  394 SER A N   
3156 C CA  . SER A 412 ? 1.5198 0.2951 0.8093 0.0987  0.1722  0.0203  394 SER A CA  
3157 C C   . SER A 412 ? 1.4360 0.2921 0.8106 0.1984  0.1708  0.0240  394 SER A C   
3158 O O   . SER A 412 ? 1.4757 0.2876 0.8092 0.2328  0.1706  0.0275  394 SER A O   
3159 C CB  . SER A 412 ? 1.7201 0.2915 0.8153 0.1175  0.1752  0.0143  394 SER A CB  
3160 O OG  . SER A 412 ? 1.8735 0.3202 0.8325 0.0034  0.1703  0.0139  394 SER A OG  
3161 N N   . LEU A 413 ? 1.3377 0.3142 0.8174 0.2371  0.1685  0.0259  395 LEU A N   
3162 C CA  . LEU A 413 ? 1.2639 0.3614 0.8336 0.3041  0.1620  0.0360  395 LEU A CA  
3163 C C   . LEU A 413 ? 1.1699 0.3545 0.8393 0.2718  0.1485  0.0385  395 LEU A C   
3164 O O   . LEU A 413 ? 1.1752 0.3808 0.8470 0.3091  0.1407  0.0448  395 LEU A O   
3165 C CB  . LEU A 413 ? 1.1811 0.3985 0.8358 0.3216  0.1613  0.0426  395 LEU A CB  
3166 C CG  . LEU A 413 ? 1.2768 0.4360 0.8336 0.3868  0.1754  0.0442  395 LEU A CG  
3167 C CD1 . LEU A 413 ? 1.1731 0.4671 0.8320 0.3797  0.1756  0.0520  395 LEU A CD1 
3168 C CD2 . LEU A 413 ? 1.3338 0.4953 0.8172 0.4937  0.1811  0.0561  395 LEU A CD2 
3169 N N   . ASP A 414 ? 1.1045 0.3352 0.8375 0.2125  0.1454  0.0342  396 ASP A N   
3170 C CA  . ASP A 414 ? 1.0573 0.3395 0.8461 0.1950  0.1344  0.0353  396 ASP A CA  
3171 C C   . ASP A 414 ? 1.1220 0.3348 0.8464 0.1983  0.1382  0.0354  396 ASP A C   
3172 O O   . ASP A 414 ? 1.0949 0.3269 0.8390 0.2211  0.1257  0.0384  396 ASP A O   
3173 C CB  . ASP A 414 ? 1.0155 0.3512 0.8442 0.1561  0.1364  0.0323  396 ASP A CB  
3174 C CG  . ASP A 414 ? 1.0002 0.3963 0.8886 0.1596  0.1278  0.0335  396 ASP A CG  
3175 O OD1 . ASP A 414 ? 1.0185 0.4362 0.9324 0.1764  0.1164  0.0402  396 ASP A OD1 
3176 O OD2 . ASP A 414 ? 0.9972 0.4325 0.9016 0.1425  0.1317  0.0311  396 ASP A OD2 
3177 N N   . ILE A 415 ? 1.2192 0.3374 0.8481 0.1680  0.1527  0.0337  397 ILE A N   
3178 C CA  . ILE A 415 ? 1.3125 0.3438 0.8533 0.1548  0.1590  0.0368  397 ILE A CA  
3179 C C   . ILE A 415 ? 1.3918 0.3391 0.8631 0.2267  0.1558  0.0377  397 ILE A C   
3180 O O   . ILE A 415 ? 1.4085 0.3433 0.8670 0.2466  0.1518  0.0407  397 ILE A O   
3181 C CB  . ILE A 415 ? 1.4360 0.3723 0.8602 0.0742  0.1712  0.0394  397 ILE A CB  
3182 C CG1 . ILE A 415 ? 1.3640 0.4456 0.8651 0.0047  0.1745  0.0464  397 ILE A CG1 
3183 C CG2 . ILE A 415 ? 1.5965 0.3709 0.8654 0.0605  0.1775  0.0447  397 ILE A CG2 
3184 C CD1 . ILE A 415 ? 1.4738 0.5175 0.8761 -0.1020 0.1800  0.0547  397 ILE A CD1 
3185 N N   . PHE A 416 ? 1.4504 0.3507 0.8692 0.2762  0.1582  0.0367  398 PHE A N   
3186 C CA  . PHE A 416 ? 1.5258 0.3826 0.8720 0.3715  0.1571  0.0414  398 PHE A CA  
3187 C C   . PHE A 416 ? 1.3980 0.4308 0.8769 0.4096  0.1388  0.0500  398 PHE A C   
3188 O O   . PHE A 416 ? 1.4402 0.4700 0.8792 0.4681  0.1328  0.0560  398 PHE A O   
3189 C CB  . PHE A 416 ? 1.6285 0.4195 0.8815 0.4303  0.1667  0.0412  398 PHE A CB  
3190 C CG  . PHE A 416 ? 1.7529 0.5045 0.8991 0.5554  0.1700  0.0494  398 PHE A CG  
3191 C CD1 . PHE A 416 ? 1.9816 0.5062 0.9131 0.5977  0.1781  0.0468  398 PHE A CD1 
3192 C CD2 . PHE A 416 ? 1.6717 0.6205 0.9155 0.6329  0.1648  0.0635  398 PHE A CD2 
3193 C CE1 . PHE A 416 ? 2.1259 0.6116 0.9347 0.7395  0.1824  0.0555  398 PHE A CE1 
3194 C CE2 . PHE A 416 ? 1.7950 0.7556 0.9405 0.7672  0.1692  0.0762  398 PHE A CE2 
3195 C CZ  . PHE A 416 ? 2.0153 0.7392 0.9394 0.8327  0.1788  0.0708  398 PHE A CZ  
3196 N N   . LEU A 417 ? 1.2546 0.4276 0.8690 0.3708  0.1270  0.0520  399 LEU A N   
3197 C CA  . LEU A 417 ? 1.1719 0.4888 0.8851 0.3722  0.1022  0.0624  399 LEU A CA  
3198 C C   . LEU A 417 ? 1.1805 0.4668 0.8884 0.3549  0.0891  0.0591  399 LEU A C   
3199 O O   . LEU A 417 ? 1.1868 0.5317 0.9013 0.3830  0.0702  0.0679  399 LEU A O   
3200 C CB  . LEU A 417 ? 1.0740 0.4835 0.8848 0.3166  0.0905  0.0647  399 LEU A CB  
3201 C CG  . LEU A 417 ? 1.0161 0.5329 0.8909 0.2833  0.0579  0.0770  399 LEU A CG  
3202 C CD1 . LEU A 417 ? 0.9978 0.6696 0.9033 0.3127  0.0462  0.1000  399 LEU A CD1 
3203 C CD2 . LEU A 417 ? 0.9839 0.5027 0.8955 0.2234  0.0483  0.0748  399 LEU A CD2 
3204 N N   . ALA A 418 ? 1.1803 0.3964 0.8752 0.3108  0.0985  0.0492  400 ALA A N   
3205 C CA  . ALA A 418 ? 1.2034 0.3840 0.8774 0.3036  0.0924  0.0468  400 ALA A CA  
3206 C C   . ALA A 418 ? 1.3034 0.4039 0.8879 0.3465  0.0990  0.0492  400 ALA A C   
3207 O O   . ALA A 418 ? 1.3224 0.4220 0.8974 0.3614  0.0853  0.0506  400 ALA A O   
3208 C CB  . ALA A 418 ? 1.1923 0.3528 0.8638 0.2610  0.1082  0.0422  400 ALA A CB  
3209 N N   . GLU A 419 ? 1.3982 0.4079 0.8921 0.3699  0.1182  0.0494  401 GLU A N   
3210 C CA  . GLU A 419 ? 1.5464 0.4342 0.9069 0.4246  0.1261  0.0522  401 GLU A CA  
3211 C C   . GLU A 419 ? 1.5439 0.5176 0.9160 0.5111  0.1083  0.0608  401 GLU A C   
3212 O O   . GLU A 419 ? 1.6181 0.5427 0.9208 0.5559  0.1043  0.0638  401 GLU A O   
3213 C CB  . GLU A 419 ? 1.6933 0.4205 0.9077 0.4305  0.1471  0.0500  401 GLU A CB  
3214 C CG  . GLU A 419 ? 1.9121 0.4269 0.9240 0.4561  0.1589  0.0518  401 GLU A CG  
3215 C CD  . GLU A 419 ? 2.1277 0.4347 0.9498 0.4467  0.1736  0.0490  401 GLU A CD  
3216 O OE1 . GLU A 419 ? 2.1311 0.4714 1.0019 0.3825  0.1762  0.0448  401 GLU A OE1 
3217 O OE2 . GLU A 419 ? 2.3813 0.4728 0.9834 0.5057  0.1803  0.0508  401 GLU A OE2 
3218 N N   . LEU A 420 ? 1.4663 0.5875 0.9244 0.5316  0.0973  0.0684  402 LEU A N   
3219 C CA  . LEU A 420 ? 1.4533 0.7325 0.9479 0.5972  0.0770  0.0845  402 LEU A CA  
3220 C C   . LEU A 420 ? 1.3848 0.7606 0.9582 0.5518  0.0439  0.0881  402 LEU A C   
3221 O O   . LEU A 420 ? 1.4265 0.8550 0.9730 0.6028  0.0287  0.0973  402 LEU A O   
3222 C CB  . LEU A 420 ? 1.3902 0.8349 0.9623 0.6099  0.0744  0.0980  402 LEU A CB  
3223 C CG  . LEU A 420 ? 1.4692 0.8368 0.9588 0.6663  0.1032  0.0962  402 LEU A CG  
3224 C CD1 . LEU A 420 ? 1.3799 0.9506 0.9766 0.6628  0.0983  0.1128  402 LEU A CD1 
3225 C CD2 . LEU A 420 ? 1.6354 0.8899 0.9472 0.7979  0.1200  0.1001  402 LEU A CD2 
3226 N N   . TYR A 421 ? 1.3083 0.6923 0.9559 0.4626  0.0315  0.0810  403 TYR A N   
3227 C CA  . TYR A 421 ? 1.2862 0.7091 0.9679 0.4123  -0.0036 0.0819  403 TYR A CA  
3228 C C   . TYR A 421 ? 1.3493 0.6629 0.9607 0.4324  -0.0035 0.0734  403 TYR A C   
3229 O O   . TYR A 421 ? 1.3648 0.7089 0.9738 0.4174  -0.0357 0.0763  403 TYR A O   
3230 C CB  . TYR A 421 ? 1.2312 0.6205 0.9505 0.3374  -0.0098 0.0733  403 TYR A CB  
3231 C CG  . TYR A 421 ? 1.1954 0.6963 0.9747 0.2819  -0.0356 0.0857  403 TYR A CG  
3232 C CD1 . TYR A 421 ? 1.2110 0.8077 0.9981 0.2375  -0.0796 0.1013  403 TYR A CD1 
3233 C CD2 . TYR A 421 ? 1.1572 0.6606 0.9720 0.2585  -0.0191 0.0835  403 TYR A CD2 
3234 C CE1 . TYR A 421 ? 1.2162 0.9039 1.0367 0.1606  -0.1060 0.1173  403 TYR A CE1 
3235 C CE2 . TYR A 421 ? 1.1509 0.7391 1.0049 0.1987  -0.0418 0.0969  403 TYR A CE2 
3236 C CZ  . TYR A 421 ? 1.1821 0.8585 1.0343 0.1440  -0.0851 0.1151  403 TYR A CZ  
3237 O OH  . TYR A 421 ? 1.1840 0.9356 1.0546 0.0626  -0.1093 0.1331  403 TYR A OH  
3238 N N   . LYS A 422 ? 1.4051 0.5856 0.9474 0.4540  0.0310  0.0646  404 LYS A N   
3239 C CA  . LYS A 422 ? 1.4876 0.5588 0.9479 0.4736  0.0393  0.0605  404 LYS A CA  
3240 C C   . LYS A 422 ? 1.5651 0.6481 0.9626 0.5527  0.0300  0.0692  404 LYS A C   
3241 O O   . LYS A 422 ? 1.6220 0.6576 0.9685 0.5721  0.0212  0.0685  404 LYS A O   
3242 C CB  . LYS A 422 ? 1.5481 0.4902 0.9373 0.4548  0.0779  0.0561  404 LYS A CB  
3243 C CG  . LYS A 422 ? 1.6319 0.4711 0.9411 0.4440  0.0930  0.0563  404 LYS A CG  
3244 C CD  . LYS A 422 ? 1.7304 0.4540 0.9469 0.4061  0.1261  0.0592  404 LYS A CD  
3245 C CE  . LYS A 422 ? 1.8626 0.4650 0.9573 0.3972  0.1424  0.0665  404 LYS A CE  
3246 N NZ  . LYS A 422 ? 2.0453 0.4783 0.9824 0.3659  0.1650  0.0722  404 LYS A NZ  
3247 N N   . HIS A 423 ? 1.5820 0.7415 0.9778 0.6098  0.0323  0.0791  405 HIS A N   
3248 C CA  . HIS A 423 ? 1.6781 0.8661 0.9937 0.7175  0.0291  0.0909  405 HIS A CA  
3249 C C   . HIS A 423 ? 1.8396 0.7961 0.9761 0.7751  0.0598  0.0851  405 HIS A C   
3250 O O   . HIS A 423 ? 1.9033 0.6737 0.9590 0.7282  0.0924  0.0754  405 HIS A O   
3251 C CB  . HIS A 423 ? 1.6532 0.9805 1.0155 0.7217  -0.0106 0.1002  405 HIS A CB  
3252 C CG  . HIS A 423 ? 1.5499 1.1249 1.0353 0.6847  -0.0452 0.1172  405 HIS A CG  
3253 N ND1 . HIS A 423 ? 1.5607 1.3496 1.0596 0.7552  -0.0655 0.1417  405 HIS A ND1 
3254 C CD2 . HIS A 423 ? 1.4284 1.0775 1.0136 0.5812  -0.0635 0.1176  405 HIS A CD2 
3255 C CE1 . HIS A 423 ? 1.4713 1.4722 1.0836 0.6774  -0.0961 0.1588  405 HIS A CE1 
3256 N NE2 . HIS A 423 ? 1.3954 1.2910 1.0503 0.5701  -0.0957 0.1432  405 HIS A NE2 
3257 N N   . ILE A 434 ? 1.1347 2.6027 1.1081 0.9709  0.0561  0.3486  416 ILE A N   
3258 C CA  . ILE A 434 ? 1.2056 2.3554 1.0703 1.0036  0.0560  0.3084  416 ILE A CA  
3259 C C   . ILE A 434 ? 1.1851 1.9687 1.0172 0.9109  0.0669  0.2616  416 ILE A C   
3260 O O   . ILE A 434 ? 1.2943 1.7903 0.9849 0.9902  0.0941  0.2318  416 ILE A O   
3261 C CB  . ILE A 434 ? 1.1648 2.4296 1.0903 0.9214  0.0109  0.3178  416 ILE A CB  
3262 N N   . SER A 435 ? 1.0682 1.8708 1.0141 0.7418  0.0439  0.2591  417 SER A N   
3263 C CA  . SER A 435 ? 1.0302 1.5451 0.9657 0.6437  0.0470  0.2202  417 SER A CA  
3264 C C   . SER A 435 ? 0.9595 1.5228 0.9683 0.5587  0.0508  0.2261  417 SER A C   
3265 O O   . SER A 435 ? 0.8997 1.4080 0.9601 0.4268  0.0283  0.2184  417 SER A O   
3266 C CB  . SER A 435 ? 1.0013 1.4414 0.9620 0.5378  0.0111  0.2078  417 SER A CB  
3267 O OG  . SER A 435 ? 0.9642 1.1713 0.9163 0.4535  0.0130  0.1761  417 SER A OG  
3268 N N   . SER A 436 ? 0.9872 1.6376 0.9765 0.6484  0.0802  0.2402  418 SER A N   
3269 C CA  . SER A 436 ? 0.9337 1.6292 0.9750 0.5951  0.0909  0.2471  418 SER A CA  
3270 C C   . SER A 436 ? 0.9614 1.3617 0.9326 0.5954  0.1145  0.2072  418 SER A C   
3271 O O   . SER A 436 ? 0.9611 1.3581 0.9253 0.6130  0.1350  0.2082  418 SER A O   
3272 C CB  . SER A 436 ? 0.9743 1.9011 1.0081 0.7133  0.1149  0.2816  418 SER A CB  
3273 O OG  . SER A 436 ? 1.1023 1.8268 0.9885 0.8607  0.1502  0.2591  418 SER A OG  
3274 N N   . ILE A 437 ? 0.9932 1.1642 0.9079 0.5750  0.1110  0.1752  419 ILE A N   
3275 C CA  . ILE A 437 ? 1.0039 0.9304 0.8687 0.5358  0.1242  0.1413  419 ILE A CA  
3276 C C   . ILE A 437 ? 0.9044 0.8618 0.8657 0.4178  0.1089  0.1402  419 ILE A C   
3277 O O   . ILE A 437 ? 0.8966 0.7507 0.8459 0.3921  0.1216  0.1240  419 ILE A O   
3278 C CB  . ILE A 437 ? 1.0560 0.7850 0.8436 0.5328  0.1222  0.1171  419 ILE A CB  
3279 C CG1 . ILE A 437 ? 1.2170 0.8262 0.8484 0.6533  0.1424  0.1139  419 ILE A CG1 
3280 C CG2 . ILE A 437 ? 1.0316 0.5935 0.8128 0.4503  0.1257  0.0912  419 ILE A CG2 
3281 C CD1 . ILE A 437 ? 1.3355 0.8718 0.8549 0.7380  0.1687  0.1135  419 ILE A CD1 
3282 N N   . GLN A 438 ? 0.8540 0.9477 0.8890 0.3473  0.0790  0.1595  420 GLN A N   
3283 C CA  . GLN A 438 ? 0.8068 0.8979 0.8884 0.2372  0.0584  0.1619  420 GLN A CA  
3284 C C   . GLN A 438 ? 0.7779 0.9666 0.8944 0.2241  0.0707  0.1787  420 GLN A C   
3285 O O   . GLN A 438 ? 0.7633 0.8604 0.8797 0.1701  0.0703  0.1676  420 GLN A O   
3286 C CB  . GLN A 438 ? 0.8169 0.9977 0.9203 0.1560  0.0174  0.1815  420 GLN A CB  
3287 C CG  . GLN A 438 ? 0.8776 1.0129 0.9493 0.1864  0.0048  0.1720  420 GLN A CG  
3288 C CD  . GLN A 438 ? 0.9480 1.0349 0.9968 0.0896  -0.0383 0.1735  420 GLN A CD  
3289 O OE1 . GLN A 438 ? 0.9924 0.8930 0.9900 0.0830  -0.0413 0.1473  420 GLN A OE1 
3290 N NE2 . GLN A 438 ? 0.9634 1.2202 1.0336 0.0119  -0.0731 0.2069  420 GLN A NE2 
3291 N N   . ARG A 439 ? 0.7797 1.1630 0.9180 0.2841  0.0830  0.2074  421 ARG A N   
3292 C CA  . ARG A 439 ? 0.7588 1.2587 0.9269 0.2844  0.0991  0.2278  421 ARG A CA  
3293 C C   . ARG A 439 ? 0.7830 1.1208 0.8938 0.3538  0.1322  0.2003  421 ARG A C   
3294 O O   . ARG A 439 ? 0.7614 1.0903 0.8880 0.3198  0.1401  0.2011  421 ARG A O   
3295 C CB  . ARG A 439 ? 0.7643 1.5620 0.9696 0.3396  0.1045  0.2728  421 ARG A CB  
3296 C CG  . ARG A 439 ? 0.7312 1.7515 1.0081 0.2103  0.0699  0.3149  421 ARG A CG  
3297 C CD  . ARG A 439 ? 0.7143 2.0987 1.0424 0.2609  0.0795  0.3688  421 ARG A CD  
3298 N NE  . ARG A 439 ? 0.7251 2.2454 1.0439 0.3640  0.0783  0.3799  421 ARG A NE  
3299 C CZ  . ARG A 439 ? 0.7640 2.2771 1.0179 0.5479  0.1137  0.3723  421 ARG A CZ  
3300 N NH1 . ARG A 439 ? 0.8004 2.1710 0.9896 0.6390  0.1508  0.3529  421 ARG A NH1 
3301 N NH2 . ARG A 439 ? 0.7789 2.4068 1.0080 0.6435  0.1096  0.3839  421 ARG A NH2 
3302 N N   . ARG A 440 ? 0.8465 1.0432 0.8724 0.4420  0.1482  0.1772  422 ARG A N   
3303 C CA  . ARG A 440 ? 0.9108 0.9049 0.8444 0.4839  0.1709  0.1481  422 ARG A CA  
3304 C C   . ARG A 440 ? 0.8602 0.7069 0.8128 0.3876  0.1610  0.1214  422 ARG A C   
3305 O O   . ARG A 440 ? 0.8753 0.6420 0.8018 0.3777  0.1722  0.1081  422 ARG A O   
3306 C CB  . ARG A 440 ? 1.0343 0.8848 0.8364 0.5789  0.1830  0.1339  422 ARG A CB  
3307 C CG  . ARG A 440 ? 1.1732 0.7805 0.8329 0.6045  0.1999  0.1062  422 ARG A CG  
3308 C CD  . ARG A 440 ? 1.3238 0.9386 0.8967 0.7016  0.2224  0.1153  422 ARG A CD  
3309 N NE  . ARG A 440 ? 1.4434 0.8399 0.9067 0.6739  0.2288  0.0890  422 ARG A NE  
3310 C CZ  . ARG A 440 ? 1.5160 0.9011 0.9297 0.7122  0.2429  0.0906  422 ARG A CZ  
3311 N NH1 . ARG A 440 ? 1.4934 1.0878 0.9635 0.7864  0.2566  0.1197  422 ARG A NH1 
3312 N NH2 . ARG A 440 ? 1.6123 0.7903 0.9166 0.6696  0.2419  0.0658  422 ARG A NH2 
3313 N N   . ILE A 441 ? 0.8176 0.6400 0.8064 0.3265  0.1397  0.1154  423 ILE A N   
3314 C CA  . ILE A 441 ? 0.7695 0.4883 0.7706 0.2564  0.1303  0.0957  423 ILE A CA  
3315 C C   . ILE A 441 ? 0.7249 0.5021 0.7744 0.2036  0.1224  0.1062  423 ILE A C   
3316 O O   . ILE A 441 ? 0.7140 0.4197 0.7542 0.1828  0.1269  0.0916  423 ILE A O   
3317 C CB  . ILE A 441 ? 0.7631 0.4432 0.7693 0.2231  0.1099  0.0900  423 ILE A CB  
3318 C CG1 . ILE A 441 ? 0.8078 0.3812 0.7494 0.2586  0.1206  0.0739  423 ILE A CG1 
3319 C CG2 . ILE A 441 ? 0.7253 0.3510 0.7420 0.1643  0.0959  0.0812  423 ILE A CG2 
3320 C CD1 . ILE A 441 ? 0.7955 0.3369 0.7379 0.2359  0.1035  0.0696  423 ILE A CD1 
3321 N N   . LYS A 442 ? 0.7145 0.6287 0.8053 0.1768  0.1090  0.1347  424 LYS A N   
3322 C CA  . LYS A 442 ? 0.7074 0.6714 0.8204 0.1146  0.1001  0.1517  424 LYS A CA  
3323 C C   . LYS A 442 ? 0.7026 0.6940 0.8175 0.1563  0.1273  0.1525  424 LYS A C   
3324 O O   . LYS A 442 ? 0.6962 0.6318 0.8036 0.1251  0.1284  0.1465  424 LYS A O   
3325 C CB  . LYS A 442 ? 0.7197 0.8438 0.8622 0.0546  0.0763  0.1892  424 LYS A CB  
3326 C CG  . LYS A 442 ? 0.7677 0.9342 0.9064 -0.0340 0.0630  0.2142  424 LYS A CG  
3327 C CD  . LYS A 442 ? 0.7890 1.2172 0.9806 -0.0543 0.0643  0.2609  424 LYS A CD  
3328 C CE  . LYS A 442 ? 0.7951 1.2932 1.0003 -0.0553 0.0864  0.2779  424 LYS A CE  
3329 N NZ  . LYS A 442 ? 0.8663 1.3916 1.0425 -0.1903 0.0607  0.3103  424 LYS A NZ  
3330 N N   . LYS A 443 ? 0.7221 0.7811 0.8250 0.2387  0.1491  0.1587  425 LYS A N   
3331 C CA  . LYS A 443 ? 0.7464 0.8194 0.8243 0.2922  0.1746  0.1604  425 LYS A CA  
3332 C C   . LYS A 443 ? 0.7697 0.6551 0.7912 0.2943  0.1825  0.1250  425 LYS A C   
3333 O O   . LYS A 443 ? 0.7600 0.6308 0.7889 0.2683  0.1859  0.1225  425 LYS A O   
3334 C CB  . LYS A 443 ? 0.8068 0.9755 0.8445 0.4036  0.1955  0.1765  425 LYS A CB  
3335 C CG  . LYS A 443 ? 0.8471 1.0975 0.8614 0.4668  0.2210  0.1928  425 LYS A CG  
3336 C CD  . LYS A 443 ? 0.9731 1.0177 0.8530 0.5499  0.2405  0.1624  425 LYS A CD  
3337 C CE  . LYS A 443 ? 1.0442 1.1634 0.8661 0.6481  0.2679  0.1803  425 LYS A CE  
3338 N NZ  . LYS A 443 ? 0.9856 1.1975 0.8879 0.5796  0.2692  0.1938  425 LYS A NZ  
3339 N N   . VAL A 444 ? 0.8135 0.5663 0.7733 0.3155  0.1833  0.1010  426 VAL A N   
3340 C CA  . VAL A 444 ? 0.8387 0.4391 0.7372 0.2950  0.1860  0.0725  426 VAL A CA  
3341 C C   . VAL A 444 ? 0.7712 0.3744 0.7258 0.2259  0.1734  0.0650  426 VAL A C   
3342 O O   . VAL A 444 ? 0.7914 0.3518 0.7219 0.2117  0.1769  0.0530  426 VAL A O   
3343 C CB  . VAL A 444 ? 0.9097 0.3845 0.7307 0.2998  0.1843  0.0556  426 VAL A CB  
3344 C CG1 . VAL A 444 ? 0.9142 0.2851 0.6921 0.2399  0.1801  0.0342  426 VAL A CG1 
3345 C CG2 . VAL A 444 ? 1.0205 0.4233 0.7207 0.3880  0.1991  0.0580  426 VAL A CG2 
3346 N N   . THR A 445 ? 0.7127 0.3563 0.7200 0.1909  0.1570  0.0724  427 THR A N   
3347 C CA  . THR A 445 ? 0.6790 0.3062 0.7037 0.1503  0.1442  0.0682  427 THR A CA  
3348 C C   . THR A 445 ? 0.6712 0.3294 0.7044 0.1387  0.1464  0.0784  427 THR A C   
3349 O O   . THR A 445 ? 0.6694 0.2941 0.6875 0.1336  0.1458  0.0676  427 THR A O   
3350 C CB  . THR A 445 ? 0.6786 0.3042 0.7116 0.1240  0.1232  0.0768  427 THR A CB  
3351 O OG1 . THR A 445 ? 0.6905 0.2757 0.7104 0.1358  0.1220  0.0641  427 THR A OG1 
3352 C CG2 . THR A 445 ? 0.6876 0.2626 0.6900 0.1000  0.1085  0.0770  427 THR A CG2 
3353 N N   . HIS A 446 ? 0.6691 0.4102 0.7241 0.1353  0.1489  0.1027  428 HIS A N   
3354 C CA  . HIS A 446 ? 0.6768 0.4614 0.7353 0.1237  0.1555  0.1179  428 HIS A CA  
3355 C C   . HIS A 446 ? 0.6913 0.4469 0.7262 0.1658  0.1749  0.1023  428 HIS A C   
3356 O O   . HIS A 446 ? 0.7010 0.4248 0.7223 0.1545  0.1747  0.0962  428 HIS A O   
3357 C CB  . HIS A 446 ? 0.6719 0.6001 0.7626 0.1126  0.1582  0.1535  428 HIS A CB  
3358 C CG  . HIS A 446 ? 0.6959 0.6795 0.7864 0.0787  0.1623  0.1768  428 HIS A CG  
3359 N ND1 . HIS A 446 ? 0.6993 0.7624 0.7960 0.1263  0.1875  0.1871  428 HIS A ND1 
3360 C CD2 . HIS A 446 ? 0.7515 0.7002 0.8118 0.0027  0.1441  0.1927  428 HIS A CD2 
3361 C CE1 . HIS A 446 ? 0.7242 0.8262 0.8166 0.0761  0.1866  0.2103  428 HIS A CE1 
3362 N NE2 . HIS A 446 ? 0.7565 0.7793 0.8191 -0.0037 0.1594  0.2143  428 HIS A NE2 
3363 N N   . ASP A 447 ? 0.7235 0.4714 0.7294 0.2170  0.1893  0.0959  429 ASP A N   
3364 C CA  . ASP A 447 ? 0.7926 0.4743 0.7345 0.2525  0.2032  0.0807  429 ASP A CA  
3365 C C   . ASP A 447 ? 0.8003 0.3960 0.7183 0.2143  0.1927  0.0552  429 ASP A C   
3366 O O   . ASP A 447 ? 0.8184 0.3971 0.7125 0.2117  0.1952  0.0488  429 ASP A O   
3367 C CB  . ASP A 447 ? 0.8730 0.4990 0.7316 0.3190  0.2160  0.0761  429 ASP A CB  
3368 C CG  . ASP A 447 ? 0.9133 0.6625 0.7774 0.3882  0.2334  0.1049  429 ASP A CG  
3369 O OD1 . ASP A 447 ? 0.8602 0.7431 0.7928 0.3694  0.2371  0.1297  429 ASP A OD1 
3370 O OD2 . ASP A 447 ? 1.0370 0.7559 0.8235 0.4653  0.2440  0.1062  429 ASP A OD2 
3371 N N   . MET A 448 ? 0.7868 0.3514 0.7113 0.1863  0.1809  0.0440  430 MET A N   
3372 C CA  . MET A 448 ? 0.7955 0.3359 0.7063 0.1496  0.1712  0.0273  430 MET A CA  
3373 C C   . MET A 448 ? 0.7475 0.3414 0.6972 0.1440  0.1651  0.0320  430 MET A C   
3374 O O   . MET A 448 ? 0.7599 0.3621 0.6904 0.1366  0.1633  0.0241  430 MET A O   
3375 C CB  . MET A 448 ? 0.7841 0.3179 0.7031 0.1286  0.1633  0.0225  430 MET A CB  
3376 C CG  . MET A 448 ? 0.7904 0.3575 0.7047 0.0915  0.1548  0.0134  430 MET A CG  
3377 S SD  . MET A 448 ? 0.8063 0.3939 0.7259 0.0683  0.1500  0.0131  430 MET A SD  
3378 C CE  . MET A 448 ? 0.7666 0.4805 0.7255 0.0804  0.1431  0.0166  430 MET A CE  
3379 N N   . ASP A 449 ? 0.7143 0.3281 0.6956 0.1461  0.1594  0.0460  431 ASP A N   
3380 C CA  . ASP A 449 ? 0.7264 0.3389 0.6982 0.1471  0.1514  0.0523  431 ASP A CA  
3381 C C   . ASP A 449 ? 0.7298 0.3507 0.6886 0.1529  0.1590  0.0581  431 ASP A C   
3382 O O   . ASP A 449 ? 0.7452 0.3593 0.6775 0.1653  0.1541  0.0537  431 ASP A O   
3383 C CB  . ASP A 449 ? 0.7529 0.3355 0.7141 0.1315  0.1392  0.0684  431 ASP A CB  
3384 C CG  . ASP A 449 ? 0.8010 0.3590 0.7558 0.1362  0.1289  0.0604  431 ASP A CG  
3385 O OD1 . ASP A 449 ? 0.7965 0.3813 0.7676 0.1469  0.1343  0.0457  431 ASP A OD1 
3386 O OD2 . ASP A 449 ? 0.8898 0.3949 0.8081 0.1207  0.1135  0.0710  431 ASP A OD2 
3387 N N   . MET A 450 ? 0.7238 0.3697 0.6937 0.1558  0.1723  0.0694  432 MET A N   
3388 C CA  . MET A 450 ? 0.7438 0.4079 0.7002 0.1642  0.1829  0.0799  432 MET A CA  
3389 C C   . MET A 450 ? 0.7630 0.4042 0.6874 0.1804  0.1851  0.0596  432 MET A C   
3390 O O   . MET A 450 ? 0.7743 0.4181 0.6801 0.1882  0.1889  0.0641  432 MET A O   
3391 C CB  . MET A 450 ? 0.7449 0.4762 0.7175 0.1791  0.1999  0.1016  432 MET A CB  
3392 C CG  . MET A 450 ? 0.7436 0.5436 0.7489 0.1414  0.1936  0.1320  432 MET A CG  
3393 S SD  . MET A 450 ? 0.8330 0.5834 0.7981 0.0742  0.1751  0.1518  432 MET A SD  
3394 C CE  . MET A 450 ? 0.8361 0.4661 0.7643 0.0716  0.1507  0.1274  432 MET A CE  
3395 N N   . CYS A 451 ? 0.6584 0.2469 0.5676 0.1288  0.0870  -0.0211 433 CYS A N   
3396 C CA  . CYS A 451 ? 0.6962 0.2655 0.5732 0.1263  0.0909  -0.0366 433 CYS A CA  
3397 C C   . CYS A 451 ? 0.6770 0.2472 0.5040 0.1140  0.0880  -0.0333 433 CYS A C   
3398 O O   . CYS A 451 ? 0.6886 0.2503 0.4840 0.1106  0.0941  -0.0468 433 CYS A O   
3399 C CB  . CYS A 451 ? 0.7010 0.2472 0.5925 0.1278  0.0741  -0.0328 433 CYS A CB  
3400 S SG  . CYS A 451 ? 0.8288 0.3681 0.7847 0.1435  0.0764  -0.0377 433 CYS A SG  
3401 N N   . TYR A 452 ? 0.6584 0.2395 0.4813 0.1072  0.0773  -0.0159 434 TYR A N   
3402 C CA  . TYR A 452 ? 0.6521 0.2351 0.4375 0.0965  0.0736  -0.0113 434 TYR A CA  
3403 C C   . TYR A 452 ? 0.6512 0.2523 0.4280 0.0940  0.0880  -0.0099 434 TYR A C   
3404 O O   . TYR A 452 ? 0.6788 0.2804 0.4250 0.0864  0.0878  -0.0077 434 TYR A O   
3405 C CB  . TYR A 452 ? 0.6296 0.2151 0.4170 0.0901  0.0552  0.0038  434 TYR A CB  
3406 C CG  . TYR A 452 ? 0.6325 0.2023 0.4193 0.0891  0.0409  0.0067  434 TYR A CG  
3407 C CD1 . TYR A 452 ? 0.6156 0.1726 0.3732 0.0821  0.0353  0.0039  434 TYR A CD1 
3408 C CD2 . TYR A 452 ? 0.6529 0.2223 0.4717 0.0946  0.0322  0.0147  434 TYR A CD2 
3409 C CE1 . TYR A 452 ? 0.6694 0.2137 0.4294 0.0797  0.0229  0.0092  434 TYR A CE1 
3410 C CE2 . TYR A 452 ? 0.6646 0.2211 0.4846 0.0923  0.0186  0.0222  434 TYR A CE2 
3411 C CZ  . TYR A 452 ? 0.6637 0.2076 0.4542 0.0846  0.0151  0.0191  434 TYR A CZ  
3412 O OH  . TYR A 452 ? 0.6769 0.2092 0.4712 0.0813  0.0033  0.0281  434 TYR A OH  
3413 N N   . GLY A 453 ? 0.6372 0.2540 0.4438 0.0999  0.0999  -0.0093 435 GLY A N   
3414 C CA  . GLY A 453 ? 0.6145 0.2514 0.4213 0.0962  0.1126  -0.0024 435 GLY A CA  
3415 C C   . GLY A 453 ? 0.5935 0.2444 0.4427 0.0980  0.1072  0.0084  435 GLY A C   
3416 O O   . GLY A 453 ? 0.5723 0.2180 0.4418 0.1011  0.0925  0.0110  435 GLY A O   
3417 N N   . MET A 454 ? 0.5920 0.2622 0.4552 0.0949  0.1178  0.0164  436 MET A N   
3418 C CA  . MET A 454 ? 0.5831 0.2696 0.4920 0.0962  0.1141  0.0248  436 MET A CA  
3419 C C   . MET A 454 ? 0.5647 0.2489 0.4820 0.0903  0.0906  0.0327  436 MET A C   
3420 O O   . MET A 454 ? 0.5624 0.2565 0.5145 0.0926  0.0809  0.0360  436 MET A O   
3421 C CB  . MET A 454 ? 0.5919 0.2993 0.5136 0.0921  0.1318  0.0325  436 MET A CB  
3422 C CG  . MET A 454 ? 0.6315 0.3482 0.5450 0.0976  0.1576  0.0231  436 MET A CG  
3423 S SD  . MET A 454 ? 0.6858 0.4129 0.6528 0.1121  0.1661  0.0122  436 MET A SD  
3424 C CE  . MET A 454 ? 0.6580 0.4179 0.6668 0.1074  0.1807  0.0267  436 MET A CE  
3425 N N   . MET A 455 ? 0.5562 0.2292 0.4420 0.0827  0.0812  0.0342  437 MET A N   
3426 C CA  . MET A 455 ? 0.5484 0.2221 0.4399 0.0766  0.0618  0.0377  437 MET A CA  
3427 C C   . MET A 455 ? 0.5408 0.2002 0.4103 0.0772  0.0476  0.0339  437 MET A C   
3428 O O   . MET A 455 ? 0.5422 0.2023 0.4058 0.0714  0.0331  0.0345  437 MET A O   
3429 C CB  . MET A 455 ? 0.5430 0.2177 0.4262 0.0673  0.0614  0.0425  437 MET A CB  
3430 C CG  . MET A 455 ? 0.5559 0.2466 0.4701 0.0643  0.0721  0.0507  437 MET A CG  
3431 S SD  . MET A 455 ? 0.6511 0.3601 0.6175 0.0641  0.0613  0.0507  437 MET A SD  
3432 C CE  . MET A 455 ? 0.6137 0.3306 0.6078 0.0534  0.0595  0.0573  437 MET A CE  
3433 N N   . GLY A 456 ? 0.5491 0.1963 0.4071 0.0837  0.0529  0.0291  438 GLY A N   
3434 C CA  . GLY A 456 ? 0.5533 0.1877 0.4008 0.0849  0.0402  0.0285  438 GLY A CA  
3435 C C   . GLY A 456 ? 0.5712 0.1919 0.3816 0.0783  0.0356  0.0261  438 GLY A C   
3436 O O   . GLY A 456 ? 0.5867 0.2059 0.3780 0.0742  0.0428  0.0240  438 GLY A O   
3437 N N   . SER A 457 ? 0.5719 0.1843 0.3747 0.0770  0.0231  0.0286  439 SER A N   
3438 C CA  . SER A 457 ? 0.5769 0.1794 0.3502 0.0700  0.0170  0.0274  439 SER A CA  
3439 C C   . SER A 457 ? 0.5720 0.1858 0.3377 0.0620  0.0114  0.0282  439 SER A C   
3440 O O   . SER A 457 ? 0.5718 0.2008 0.3542 0.0601  0.0052  0.0305  439 SER A O   
3441 C CB  . SER A 457 ? 0.5857 0.1818 0.3597 0.0694  0.0048  0.0338  439 SER A CB  
3442 O OG  . SER A 457 ? 0.5901 0.1791 0.3388 0.0619  -0.0003 0.0333  439 SER A OG  
3443 N N   . LEU A 458 ? 0.5642 0.1707 0.3077 0.0572  0.0129  0.0250  440 LEU A N   
3444 C CA  . LEU A 458 ? 0.5525 0.1666 0.2913 0.0503  0.0069  0.0238  440 LEU A CA  
3445 C C   . LEU A 458 ? 0.5489 0.1736 0.2886 0.0459  -0.0048 0.0245  440 LEU A C   
3446 O O   . LEU A 458 ? 0.5449 0.1833 0.2924 0.0417  -0.0091 0.0203  440 LEU A O   
3447 C CB  . LEU A 458 ? 0.5518 0.1549 0.2685 0.0470  0.0089  0.0217  440 LEU A CB  
3448 C CG  . LEU A 458 ? 0.5621 0.1693 0.2750 0.0409  0.0043  0.0197  440 LEU A CG  
3449 C CD1 . LEU A 458 ? 0.5430 0.1589 0.2752 0.0402  0.0066  0.0204  440 LEU A CD1 
3450 C CD2 . LEU A 458 ? 0.5632 0.1589 0.2563 0.0394  0.0057  0.0198  440 LEU A CD2 
3451 N N   . PHE A 459 ? 0.5563 0.1758 0.2898 0.0466  -0.0097 0.0298  441 PHE A N   
3452 C CA  . PHE A 459 ? 0.5671 0.1970 0.2930 0.0405  -0.0198 0.0340  441 PHE A CA  
3453 C C   . PHE A 459 ? 0.5700 0.2143 0.3093 0.0414  -0.0291 0.0426  441 PHE A C   
3454 O O   . PHE A 459 ? 0.5721 0.2305 0.3021 0.0350  -0.0381 0.0482  441 PHE A O   
3455 C CB  . PHE A 459 ? 0.5676 0.1828 0.2784 0.0383  -0.0208 0.0389  441 PHE A CB  
3456 C CG  . PHE A 459 ? 0.5829 0.1873 0.2796 0.0358  -0.0153 0.0314  441 PHE A CG  
3457 C CD1 . PHE A 459 ? 0.6027 0.2182 0.2935 0.0299  -0.0159 0.0256  441 PHE A CD1 
3458 C CD2 . PHE A 459 ? 0.5561 0.1411 0.2474 0.0393  -0.0102 0.0289  441 PHE A CD2 
3459 C CE1 . PHE A 459 ? 0.5587 0.1661 0.2411 0.0279  -0.0130 0.0210  441 PHE A CE1 
3460 C CE2 . PHE A 459 ? 0.5646 0.1428 0.2423 0.0361  -0.0079 0.0234  441 PHE A CE2 
3461 C CZ  . PHE A 459 ? 0.5764 0.1660 0.2509 0.0305  -0.0101 0.0211  441 PHE A CZ  
3462 N N   . ARG A 460 ? 0.5620 0.2052 0.3229 0.0487  -0.0270 0.0449  442 ARG A N   
3463 C CA  . ARG A 460 ? 0.5805 0.2367 0.3587 0.0504  -0.0375 0.0553  442 ARG A CA  
3464 C C   . ARG A 460 ? 0.5876 0.2434 0.3956 0.0593  -0.0328 0.0556  442 ARG A C   
3465 O O   . ARG A 460 ? 0.6031 0.2455 0.4152 0.0649  -0.0192 0.0490  442 ARG A O   
3466 C CB  . ARG A 460 ? 0.6019 0.2502 0.3761 0.0502  -0.0451 0.0701  442 ARG A CB  
3467 C CG  . ARG A 460 ? 0.5754 0.1969 0.3559 0.0572  -0.0370 0.0700  442 ARG A CG  
3468 C CD  . ARG A 460 ? 0.6274 0.2408 0.4137 0.0565  -0.0466 0.0867  442 ARG A CD  
3469 N NE  . ARG A 460 ? 0.6485 0.2710 0.4106 0.0452  -0.0540 0.0951  442 ARG A NE  
3470 C CZ  . ARG A 460 ? 0.6680 0.3128 0.4261 0.0385  -0.0668 0.1105  442 ARG A CZ  
3471 N NH1 . ARG A 460 ? 0.6938 0.3484 0.4281 0.0278  -0.0700 0.1170  442 ARG A NH1 
3472 N NH2 . ARG A 460 ? 0.6800 0.3399 0.4577 0.0420  -0.0767 0.1203  442 ARG A NH2 
3473 N N   . SER A 461 ? 0.5826 0.2564 0.4111 0.0600  -0.0440 0.0633  443 SER A N   
3474 C CA  . SER A 461 ? 0.5984 0.2745 0.4624 0.0691  -0.0424 0.0677  443 SER A CA  
3475 C C   . SER A 461 ? 0.6114 0.2912 0.4880 0.0711  -0.0575 0.0855  443 SER A C   
3476 O O   . SER A 461 ? 0.6113 0.3127 0.4853 0.0647  -0.0741 0.0947  443 SER A O   
3477 C CB  . SER A 461 ? 0.5877 0.2849 0.4732 0.0674  -0.0442 0.0622  443 SER A CB  
3478 O OG  . SER A 461 ? 0.6252 0.3288 0.5497 0.0759  -0.0445 0.0686  443 SER A OG  
3479 N N   . GLY A 462 ? 0.6322 0.2917 0.5223 0.0794  -0.0524 0.0903  444 GLY A N   
3480 C CA  . GLY A 462 ? 0.6487 0.3070 0.5559 0.0816  -0.0671 0.1104  444 GLY A CA  
3481 C C   . GLY A 462 ? 0.6619 0.3266 0.5354 0.0696  -0.0793 0.1218  444 GLY A C   
3482 O O   . GLY A 462 ? 0.6612 0.3139 0.5051 0.0642  -0.0716 0.1139  444 GLY A O   
3483 N N   . SER A 463 ? 0.6784 0.3661 0.5559 0.0646  -0.0982 0.1404  445 SER A N   
3484 C CA  . SER A 463 ? 0.6983 0.3988 0.5421 0.0519  -0.1089 0.1530  445 SER A CA  
3485 C C   . SER A 463 ? 0.6855 0.4091 0.4934 0.0406  -0.1079 0.1372  445 SER A C   
3486 O O   . SER A 463 ? 0.7049 0.4439 0.4829 0.0296  -0.1142 0.1443  445 SER A O   
3487 C CB  . SER A 463 ? 0.7078 0.4262 0.5674 0.0499  -0.1306 0.1828  445 SER A CB  
3488 O OG  . SER A 463 ? 0.7406 0.4925 0.6003 0.0457  -0.1430 0.1818  445 SER A OG  
3489 N N   . ARG A 464 ? 0.6685 0.3953 0.4825 0.0432  -0.0994 0.1160  446 ARG A N   
3490 C CA  . ARG A 464 ? 0.6613 0.4083 0.4531 0.0341  -0.0990 0.0985  446 ARG A CA  
3491 C C   . ARG A 464 ? 0.6455 0.3740 0.4213 0.0337  -0.0816 0.0797  446 ARG A C   
3492 O O   . ARG A 464 ? 0.6378 0.3476 0.4284 0.0412  -0.0694 0.0712  446 ARG A O   
3493 C CB  . ARG A 464 ? 0.6565 0.4220 0.4738 0.0358  -0.1049 0.0901  446 ARG A CB  
3494 C CG  . ARG A 464 ? 0.7168 0.5137 0.5362 0.0300  -0.1266 0.1038  446 ARG A CG  
3495 C CD  . ARG A 464 ? 0.7866 0.5902 0.6497 0.0381  -0.1351 0.1120  446 ARG A CD  
3496 N NE  . ARG A 464 ? 0.8176 0.6450 0.6938 0.0335  -0.1414 0.0957  446 ARG A NE  
3497 C CZ  . ARG A 464 ? 0.8084 0.6326 0.7224 0.0400  -0.1349 0.0870  446 ARG A CZ  
3498 N NH1 . ARG A 464 ? 0.7849 0.5855 0.7249 0.0519  -0.1202 0.0914  446 ARG A NH1 
3499 N NH2 . ARG A 464 ? 0.8107 0.6575 0.7375 0.0337  -0.1427 0.0725  446 ARG A NH2 
3500 N N   . GLN A 465 ? 0.6456 0.3820 0.3915 0.0245  -0.0806 0.0741  447 GLN A N   
3501 C CA  . GLN A 465 ? 0.6221 0.3454 0.3559 0.0233  -0.0667 0.0566  447 GLN A CA  
3502 C C   . GLN A 465 ? 0.5955 0.3256 0.3416 0.0234  -0.0622 0.0362  447 GLN A C   
3503 O O   . GLN A 465 ? 0.5857 0.3396 0.3371 0.0187  -0.0707 0.0284  447 GLN A O   
3504 C CB  . GLN A 465 ? 0.6259 0.3607 0.3310 0.0136  -0.0670 0.0558  447 GLN A CB  
3505 C CG  . GLN A 465 ? 0.7009 0.4239 0.3970 0.0125  -0.0687 0.0759  447 GLN A CG  
3506 C CD  . GLN A 465 ? 0.7669 0.5012 0.4374 0.0024  -0.0654 0.0743  447 GLN A CD  
3507 O OE1 . GLN A 465 ? 0.8031 0.5678 0.4574 -0.0063 -0.0700 0.0716  447 GLN A OE1 
3508 N NE2 . GLN A 465 ? 0.7765 0.4890 0.4438 0.0031  -0.0569 0.0744  447 GLN A NE2 
3509 N N   . THR A 466 ? 0.5676 0.2778 0.3184 0.0274  -0.0497 0.0277  448 THR A N   
3510 C CA  . THR A 466 ? 0.5487 0.2614 0.3160 0.0273  -0.0449 0.0124  448 THR A CA  
3511 C C   . THR A 466 ? 0.5418 0.2678 0.2986 0.0195  -0.0454 -0.0038 448 THR A C   
3512 O O   . THR A 466 ? 0.5431 0.2739 0.2770 0.0150  -0.0459 -0.0028 448 THR A O   
3513 C CB  . THR A 466 ? 0.5419 0.2310 0.3156 0.0332  -0.0321 0.0130  448 THR A CB  
3514 O OG1 . THR A 466 ? 0.5462 0.2217 0.2971 0.0322  -0.0279 0.0152  448 THR A OG1 
3515 C CG2 . THR A 466 ? 0.5412 0.2209 0.3304 0.0414  -0.0283 0.0236  448 THR A CG2 
3516 N N   . LEU A 467 ? 0.5272 0.2603 0.3053 0.0180  -0.0450 -0.0192 449 LEU A N   
3517 C CA  . LEU A 467 ? 0.5313 0.2703 0.3113 0.0133  -0.0421 -0.0380 449 LEU A CA  
3518 C C   . LEU A 467 ? 0.5338 0.2553 0.3005 0.0150  -0.0332 -0.0342 449 LEU A C   
3519 O O   . LEU A 467 ? 0.5384 0.2690 0.2913 0.0105  -0.0319 -0.0425 449 LEU A O   
3520 C CB  . LEU A 467 ? 0.5162 0.2537 0.3323 0.0139  -0.0409 -0.0504 449 LEU A CB  
3521 C CG  . LEU A 467 ? 0.5220 0.2634 0.3516 0.0102  -0.0381 -0.0720 449 LEU A CG  
3522 C CD1 . LEU A 467 ? 0.5256 0.2935 0.3363 0.0030  -0.0425 -0.0910 449 LEU A CD1 
3523 C CD2 . LEU A 467 ? 0.5198 0.2592 0.3915 0.0100  -0.0392 -0.0818 449 LEU A CD2 
3524 N N   . PHE A 468 ? 0.5404 0.2394 0.3110 0.0209  -0.0270 -0.0221 450 PHE A N   
3525 C CA  . PHE A 468 ? 0.5432 0.2265 0.3027 0.0220  -0.0208 -0.0185 450 PHE A CA  
3526 C C   . PHE A 468 ? 0.5468 0.2316 0.2789 0.0189  -0.0220 -0.0129 450 PHE A C   
3527 O O   . PHE A 468 ? 0.5507 0.2374 0.2770 0.0157  -0.0196 -0.0185 450 PHE A O   
3528 C CB  . PHE A 468 ? 0.5373 0.2005 0.3007 0.0279  -0.0147 -0.0065 450 PHE A CB  
3529 C CG  . PHE A 468 ? 0.5532 0.2027 0.3072 0.0282  -0.0105 -0.0034 450 PHE A CG  
3530 C CD1 . PHE A 468 ? 0.5907 0.2374 0.3632 0.0279  -0.0086 -0.0060 450 PHE A CD1 
3531 C CD2 . PHE A 468 ? 0.5481 0.1878 0.2784 0.0282  -0.0102 0.0029  450 PHE A CD2 
3532 C CE1 . PHE A 468 ? 0.6034 0.2399 0.3683 0.0278  -0.0074 -0.0009 450 PHE A CE1 
3533 C CE2 . PHE A 468 ? 0.5419 0.1711 0.2640 0.0276  -0.0085 0.0050  450 PHE A CE2 
3534 C CZ  . PHE A 468 ? 0.5723 0.2011 0.3101 0.0275  -0.0076 0.0038  450 PHE A CZ  
3535 N N   . ALA A 469 ? 0.5460 0.2295 0.2663 0.0199  -0.0258 -0.0004 451 ALA A N   
3536 C CA  . ALA A 469 ? 0.5497 0.2347 0.2493 0.0158  -0.0279 0.0083  451 ALA A CA  
3537 C C   . ALA A 469 ? 0.5670 0.2780 0.2565 0.0074  -0.0297 -0.0008 451 ALA A C   
3538 O O   . ALA A 469 ? 0.5653 0.2777 0.2437 0.0030  -0.0262 -0.0006 451 ALA A O   
3539 C CB  . ALA A 469 ? 0.5588 0.2405 0.2564 0.0183  -0.0337 0.0241  451 ALA A CB  
3540 N N   . SER A 470 ? 0.5705 0.3039 0.2644 0.0045  -0.0347 -0.0103 452 SER A N   
3541 C CA  . SER A 470 ? 0.6004 0.3629 0.2828 -0.0039 -0.0349 -0.0238 452 SER A CA  
3542 C C   . SER A 470 ? 0.5946 0.3575 0.2863 -0.0048 -0.0259 -0.0422 452 SER A C   
3543 O O   . SER A 470 ? 0.5980 0.3787 0.2770 -0.0110 -0.0217 -0.0482 452 SER A O   
3544 C CB  . SER A 470 ? 0.6097 0.3965 0.2972 -0.0070 -0.0426 -0.0361 452 SER A CB  
3545 O OG  . SER A 470 ? 0.6692 0.4533 0.3579 -0.0042 -0.0520 -0.0182 452 SER A OG  
3546 N N   . GLN A 471 ? 0.5875 0.3328 0.3041 0.0013  -0.0230 -0.0497 453 GLN A N   
3547 C CA  . GLN A 471 ? 0.5820 0.3260 0.3162 0.0018  -0.0165 -0.0651 453 GLN A CA  
3548 C C   . GLN A 471 ? 0.5714 0.3021 0.2957 0.0021  -0.0123 -0.0532 453 GLN A C   
3549 O O   . GLN A 471 ? 0.5737 0.3143 0.3033 -0.0005 -0.0074 -0.0632 453 GLN A O   
3550 C CB  . GLN A 471 ? 0.5759 0.3046 0.3424 0.0074  -0.0164 -0.0706 453 GLN A CB  
3551 C CG  . GLN A 471 ? 0.6169 0.3579 0.4030 0.0063  -0.0207 -0.0858 453 GLN A CG  
3552 C CD  . GLN A 471 ? 0.7088 0.4313 0.5296 0.0112  -0.0203 -0.0841 453 GLN A CD  
3553 O OE1 . GLN A 471 ? 0.7255 0.4276 0.5440 0.0157  -0.0184 -0.0643 453 GLN A OE1 
3554 N NE2 . GLN A 471 ? 0.7344 0.4648 0.5886 0.0098  -0.0216 -0.1049 453 GLN A NE2 
3555 N N   . VAL A 472 ? 0.5699 0.2796 0.2828 0.0052  -0.0144 -0.0337 454 VAL A N   
3556 C CA  . VAL A 472 ? 0.5758 0.2748 0.2781 0.0037  -0.0124 -0.0238 454 VAL A CA  
3557 C C   . VAL A 472 ? 0.5986 0.3183 0.2850 -0.0044 -0.0107 -0.0229 454 VAL A C   
3558 O O   . VAL A 472 ? 0.5969 0.3227 0.2871 -0.0076 -0.0063 -0.0273 454 VAL A O   
3559 C CB  . VAL A 472 ? 0.5800 0.2543 0.2721 0.0076  -0.0148 -0.0070 454 VAL A CB  
3560 C CG1 . VAL A 472 ? 0.5745 0.2403 0.2561 0.0039  -0.0146 0.0010  454 VAL A CG1 
3561 C CG2 . VAL A 472 ? 0.5434 0.2013 0.2484 0.0142  -0.0138 -0.0072 454 VAL A CG2 
3562 N N   . MET A 473 ? 0.6125 0.3458 0.2833 -0.0081 -0.0145 -0.0160 455 MET A N   
3563 C CA  . MET A 473 ? 0.6451 0.4008 0.2975 -0.0173 -0.0131 -0.0095 455 MET A CA  
3564 C C   . MET A 473 ? 0.6498 0.4363 0.3047 -0.0226 -0.0057 -0.0310 455 MET A C   
3565 O O   . MET A 473 ? 0.6647 0.4665 0.3128 -0.0294 0.0005  -0.0296 455 MET A O   
3566 C CB  . MET A 473 ? 0.6462 0.4109 0.2826 -0.0203 -0.0211 0.0068  455 MET A CB  
3567 C CG  . MET A 473 ? 0.6388 0.3744 0.2776 -0.0149 -0.0273 0.0279  455 MET A CG  
3568 S SD  . MET A 473 ? 0.7034 0.4506 0.3343 -0.0165 -0.0391 0.0480  455 MET A SD  
3569 C CE  . MET A 473 ? 0.7011 0.4700 0.3116 -0.0296 -0.0398 0.0682  455 MET A CE  
3570 N N   . ARG A 474 ? 0.6518 0.4474 0.3204 -0.0197 -0.0055 -0.0524 456 ARG A N   
3571 C CA  . ARG A 474 ? 0.6726 0.4974 0.3485 -0.0238 0.0024  -0.0789 456 ARG A CA  
3572 C C   . ARG A 474 ? 0.6523 0.4692 0.3551 -0.0201 0.0103  -0.0904 456 ARG A C   
3573 O O   . ARG A 474 ? 0.6680 0.5092 0.3740 -0.0247 0.0195  -0.1046 456 ARG A O   
3574 C CB  . ARG A 474 ? 0.6779 0.5156 0.3648 -0.0226 -0.0011 -0.1016 456 ARG A CB  
3575 C CG  . ARG A 474 ? 0.7247 0.6048 0.3997 -0.0312 0.0050  -0.1260 456 ARG A CG  
3576 C CD  . ARG A 474 ? 0.7467 0.6386 0.4497 -0.0292 0.0067  -0.1630 456 ARG A CD  
3577 N NE  . ARG A 474 ? 0.8392 0.7746 0.5295 -0.0377 0.0152  -0.1915 456 ARG A NE  
3578 C CZ  . ARG A 474 ? 0.9063 0.8601 0.6060 -0.0395 0.0297  -0.2097 456 ARG A CZ  
3579 N NH1 . ARG A 474 ? 0.8977 0.8301 0.6212 -0.0336 0.0358  -0.2010 456 ARG A NH1 
3580 N NH2 . ARG A 474 ? 0.9307 0.9281 0.6157 -0.0477 0.0385  -0.2380 456 ARG A NH2 
3581 N N   . TYR A 475 ? 0.6290 0.4147 0.3513 -0.0123 0.0066  -0.0831 457 TYR A N   
3582 C CA  . TYR A 475 ? 0.6182 0.3977 0.3726 -0.0080 0.0108  -0.0942 457 TYR A CA  
3583 C C   . TYR A 475 ? 0.5982 0.3610 0.3537 -0.0074 0.0100  -0.0773 457 TYR A C   
3584 O O   . TYR A 475 ? 0.5843 0.3516 0.3647 -0.0061 0.0138  -0.0857 457 TYR A O   
3585 C CB  . TYR A 475 ? 0.6173 0.3811 0.4021 -0.0006 0.0067  -0.1032 457 TYR A CB  
3586 C CG  . TYR A 475 ? 0.6592 0.4439 0.4535 -0.0024 0.0081  -0.1282 457 TYR A CG  
3587 C CD1 . TYR A 475 ? 0.6791 0.4904 0.4892 -0.0051 0.0165  -0.1561 457 TYR A CD1 
3588 C CD2 . TYR A 475 ? 0.6600 0.4400 0.4498 -0.0017 0.0012  -0.1264 457 TYR A CD2 
3589 C CE1 . TYR A 475 ? 0.7105 0.5427 0.5292 -0.0075 0.0174  -0.1841 457 TYR A CE1 
3590 C CE2 . TYR A 475 ? 0.6737 0.4743 0.4738 -0.0045 0.0005  -0.1519 457 TYR A CE2 
3591 C CZ  . TYR A 475 ? 0.6943 0.5206 0.5071 -0.0076 0.0083  -0.1815 457 TYR A CZ  
3592 O OH  . TYR A 475 ? 0.7377 0.5858 0.5592 -0.0111 0.0074  -0.2108 457 TYR A OH  
3593 N N   . ALA A 476 ? 0.5866 0.3318 0.3187 -0.0084 0.0048  -0.0552 458 ALA A N   
3594 C CA  . ALA A 476 ? 0.5843 0.3139 0.3167 -0.0090 0.0025  -0.0418 458 ALA A CA  
3595 C C   . ALA A 476 ? 0.5968 0.3407 0.3129 -0.0179 0.0061  -0.0333 458 ALA A C   
3596 O O   . ALA A 476 ? 0.6265 0.3710 0.3198 -0.0217 0.0042  -0.0215 458 ALA A O   
3597 C CB  . ALA A 476 ? 0.5598 0.2591 0.2814 -0.0043 -0.0051 -0.0262 458 ALA A CB  
3598 N N   . ASP A 477 ? 0.5930 0.3493 0.3242 -0.0216 0.0109  -0.0375 459 ASP A N   
3599 C CA  . ASP A 477 ? 0.5936 0.3619 0.3143 -0.0312 0.0144  -0.0260 459 ASP A CA  
3600 C C   . ASP A 477 ? 0.5924 0.3318 0.2999 -0.0324 0.0051  -0.0053 459 ASP A C   
3601 O O   . ASP A 477 ? 0.6083 0.3484 0.2990 -0.0388 0.0044  0.0095  459 ASP A O   
3602 C CB  . ASP A 477 ? 0.5920 0.3773 0.3397 -0.0337 0.0208  -0.0350 459 ASP A CB  
3603 C CG  . ASP A 477 ? 0.6168 0.4355 0.3799 -0.0336 0.0330  -0.0588 459 ASP A CG  
3604 O OD1 . ASP A 477 ? 0.6571 0.5034 0.4011 -0.0409 0.0416  -0.0620 459 ASP A OD1 
3605 O OD2 . ASP A 477 ? 0.6191 0.4383 0.4149 -0.0267 0.0340  -0.0748 459 ASP A OD2 
3606 N N   . LEU A 478 ? 0.5748 0.2901 0.2922 -0.0264 -0.0021 -0.0049 460 LEU A N   
3607 C CA  . LEU A 478 ? 0.5676 0.2555 0.2758 -0.0267 -0.0108 0.0077  460 LEU A CA  
3608 C C   . LEU A 478 ? 0.5510 0.2178 0.2543 -0.0175 -0.0159 0.0056  460 LEU A C   
3609 O O   . LEU A 478 ? 0.5484 0.2193 0.2649 -0.0119 -0.0150 -0.0032 460 LEU A O   
3610 C CB  . LEU A 478 ? 0.5630 0.2489 0.2874 -0.0306 -0.0148 0.0086  460 LEU A CB  
3611 C CG  . LEU A 478 ? 0.5778 0.2888 0.3175 -0.0398 -0.0084 0.0089  460 LEU A CG  
3612 C CD1 . LEU A 478 ? 0.5318 0.2375 0.2908 -0.0431 -0.0158 0.0107  460 LEU A CD1 
3613 C CD2 . LEU A 478 ? 0.5686 0.2862 0.2929 -0.0489 -0.0043 0.0223  460 LEU A CD2 
3614 N N   . TYR A 479 ? 0.5559 0.2009 0.2438 -0.0161 -0.0205 0.0138  461 TYR A N   
3615 C CA  . TYR A 479 ? 0.5583 0.1849 0.2400 -0.0083 -0.0236 0.0124  461 TYR A CA  
3616 C C   . TYR A 479 ? 0.5790 0.1828 0.2484 -0.0089 -0.0288 0.0169  461 TYR A C   
3617 O O   . TYR A 479 ? 0.5839 0.1829 0.2516 -0.0144 -0.0302 0.0224  461 TYR A O   
3618 C CB  . TYR A 479 ? 0.5498 0.1796 0.2282 -0.0027 -0.0198 0.0107  461 TYR A CB  
3619 C CG  . TYR A 479 ? 0.5517 0.1766 0.2189 -0.0032 -0.0199 0.0185  461 TYR A CG  
3620 C CD1 . TYR A 479 ? 0.5874 0.1920 0.2477 0.0019  -0.0216 0.0221  461 TYR A CD1 
3621 C CD2 . TYR A 479 ? 0.5547 0.1975 0.2198 -0.0087 -0.0183 0.0229  461 TYR A CD2 
3622 C CE1 . TYR A 479 ? 0.5579 0.1576 0.2158 0.0026  -0.0227 0.0303  461 TYR A CE1 
3623 C CE2 . TYR A 479 ? 0.5646 0.2039 0.2228 -0.0091 -0.0207 0.0340  461 TYR A CE2 
3624 C CZ  . TYR A 479 ? 0.5725 0.1890 0.2302 -0.0029 -0.0235 0.0379  461 TYR A CZ  
3625 O OH  . TYR A 479 ? 0.5883 0.2010 0.2465 -0.0026 -0.0269 0.0502  461 TYR A OH  
3626 N N   . ALA A 480 ? 0.5910 0.1821 0.2532 -0.0038 -0.0312 0.0143  462 ALA A N   
3627 C CA  . ALA A 480 ? 0.6155 0.1870 0.2644 -0.0039 -0.0350 0.0130  462 ALA A CA  
3628 C C   . ALA A 480 ? 0.6296 0.1954 0.2673 0.0023  -0.0339 0.0103  462 ALA A C   
3629 O O   . ALA A 480 ? 0.6142 0.1900 0.2584 0.0053  -0.0324 0.0124  462 ALA A O   
3630 C CB  . ALA A 480 ? 0.6249 0.1944 0.2768 -0.0114 -0.0428 0.0117  462 ALA A CB  
3631 N N   . ALA A 481 ? 0.6614 0.2121 0.2844 0.0037  -0.0341 0.0054  463 ALA A N   
3632 C CA  . ALA A 481 ? 0.6702 0.2187 0.2777 0.0080  -0.0315 0.0027  463 ALA A CA  
3633 C C   . ALA A 481 ? 0.6821 0.2391 0.2847 0.0043  -0.0392 0.0059  463 ALA A C   
3634 O O   . ALA A 481 ? 0.6827 0.2457 0.2782 0.0069  -0.0375 0.0109  463 ALA A O   
3635 C CB  . ALA A 481 ? 0.6917 0.2245 0.2847 0.0091  -0.0297 -0.0081 463 ALA A CB  
3636 N N   . SER A 482 ? 0.6817 0.2407 0.2913 -0.0023 -0.0483 0.0054  464 SER A N   
3637 C CA  . SER A 482 ? 0.6824 0.2503 0.2917 -0.0065 -0.0589 0.0094  464 SER A CA  
3638 C C   . SER A 482 ? 0.6672 0.2429 0.3001 -0.0123 -0.0654 0.0108  464 SER A C   
3639 O O   . SER A 482 ? 0.6505 0.2208 0.2890 -0.0161 -0.0641 0.0068  464 SER A O   
3640 C CB  . SER A 482 ? 0.7043 0.2650 0.2872 -0.0104 -0.0656 0.0015  464 SER A CB  
3641 O OG  . SER A 482 ? 0.7238 0.2949 0.3072 -0.0160 -0.0793 0.0065  464 SER A OG  
3642 N N   . PHE A 483 ? 0.6532 0.2427 0.3030 -0.0130 -0.0722 0.0178  465 PHE A N   
3643 C CA  . PHE A 483 ? 0.6378 0.2383 0.3137 -0.0182 -0.0774 0.0181  465 PHE A CA  
3644 C C   . PHE A 483 ? 0.6548 0.2516 0.3244 -0.0266 -0.0898 0.0145  465 PHE A C   
3645 O O   . PHE A 483 ? 0.6581 0.2612 0.3480 -0.0325 -0.0922 0.0134  465 PHE A O   
3646 C CB  . PHE A 483 ? 0.6324 0.2488 0.3369 -0.0152 -0.0810 0.0253  465 PHE A CB  
3647 C CG  . PHE A 483 ? 0.6591 0.2804 0.3637 -0.0176 -0.0965 0.0334  465 PHE A CG  
3648 C CD1 . PHE A 483 ? 0.6599 0.2901 0.3815 -0.0241 -0.1083 0.0335  465 PHE A CD1 
3649 C CD2 . PHE A 483 ? 0.7167 0.3361 0.4048 -0.0144 -0.1001 0.0428  465 PHE A CD2 
3650 C CE1 . PHE A 483 ? 0.6803 0.3171 0.4011 -0.0272 -0.1254 0.0420  465 PHE A CE1 
3651 C CE2 . PHE A 483 ? 0.7518 0.3788 0.4360 -0.0179 -0.1164 0.0534  465 PHE A CE2 
3652 C CZ  . PHE A 483 ? 0.7357 0.3714 0.4358 -0.0243 -0.1302 0.0526  465 PHE A CZ  
3653 N N   . ILE A 484 ? 0.6576 0.2464 0.2997 -0.0279 -0.0971 0.0117  466 ILE A N   
3654 C CA  . ILE A 484 ? 0.6804 0.2641 0.3145 -0.0367 -0.1091 0.0035  466 ILE A CA  
3655 C C   . ILE A 484 ? 0.6681 0.2402 0.3129 -0.0417 -0.1047 -0.0043 466 ILE A C   
3656 O O   . ILE A 484 ? 0.6689 0.2404 0.3239 -0.0507 -0.1151 -0.0089 466 ILE A O   
3657 C CB  . ILE A 484 ? 0.7224 0.2990 0.3185 -0.0378 -0.1148 -0.0045 466 ILE A CB  
3658 C CG1 . ILE A 484 ? 0.7524 0.3342 0.3451 -0.0478 -0.1336 -0.0100 466 ILE A CG1 
3659 C CG2 . ILE A 484 ? 0.7369 0.2939 0.3146 -0.0350 -0.1032 -0.0185 466 ILE A CG2 
3660 C CD1 . ILE A 484 ? 0.8238 0.4265 0.4278 -0.0489 -0.1474 0.0059  466 ILE A CD1 
3661 N N   . ASN A 485 ? 0.6488 0.2130 0.2938 -0.0366 -0.0908 -0.0038 467 ASN A N   
3662 C CA  . ASN A 485 ? 0.6555 0.2093 0.3123 -0.0412 -0.0866 -0.0056 467 ASN A CA  
3663 C C   . ASN A 485 ? 0.6445 0.2128 0.3305 -0.0491 -0.0890 0.0011  467 ASN A C   
3664 O O   . ASN A 485 ? 0.6652 0.2266 0.3635 -0.0570 -0.0908 0.0010  467 ASN A O   
3665 C CB  . ASN A 485 ? 0.6407 0.1882 0.2940 -0.0341 -0.0730 -0.0021 467 ASN A CB  
3666 C CG  . ASN A 485 ? 0.6545 0.1866 0.2847 -0.0269 -0.0691 -0.0103 467 ASN A CG  
3667 O OD1 . ASN A 485 ? 0.6964 0.2238 0.3094 -0.0276 -0.0750 -0.0196 467 ASN A OD1 
3668 N ND2 . ASN A 485 ? 0.6743 0.2012 0.3046 -0.0205 -0.0591 -0.0073 467 ASN A ND2 
3669 N N   . LEU A 486 ? 0.6245 0.2136 0.3256 -0.0475 -0.0890 0.0068  468 LEU A N   
3670 C CA  . LEU A 486 ? 0.6140 0.2210 0.3462 -0.0549 -0.0902 0.0111  468 LEU A CA  
3671 C C   . LEU A 486 ? 0.6349 0.2394 0.3779 -0.0655 -0.1048 0.0079  468 LEU A C   
3672 O O   . LEU A 486 ? 0.6322 0.2484 0.4027 -0.0740 -0.1049 0.0116  468 LEU A O   
3673 C CB  . LEU A 486 ? 0.5935 0.2227 0.3455 -0.0497 -0.0884 0.0144  468 LEU A CB  
3674 C CG  . LEU A 486 ? 0.5675 0.2054 0.3212 -0.0424 -0.0728 0.0150  468 LEU A CG  
3675 C CD1 . LEU A 486 ? 0.5328 0.1866 0.3078 -0.0355 -0.0731 0.0150  468 LEU A CD1 
3676 C CD2 . LEU A 486 ? 0.5531 0.2031 0.3187 -0.0485 -0.0614 0.0170  468 LEU A CD2 
3677 N N   . LEU A 487 ? 0.6605 0.2521 0.3820 -0.0658 -0.1169 0.0002  469 LEU A N   
3678 C CA  . LEU A 487 ? 0.6898 0.2810 0.4191 -0.0760 -0.1339 -0.0057 469 LEU A CA  
3679 C C   . LEU A 487 ? 0.7107 0.2860 0.4511 -0.0854 -0.1336 -0.0107 469 LEU A C   
3680 O O   . LEU A 487 ? 0.7155 0.2943 0.4772 -0.0965 -0.1457 -0.0134 469 LEU A O   
3681 C CB  . LEU A 487 ? 0.7063 0.2913 0.4034 -0.0743 -0.1465 -0.0143 469 LEU A CB  
3682 C CG  . LEU A 487 ? 0.7345 0.3213 0.4314 -0.0851 -0.1674 -0.0236 469 LEU A CG  
3683 C CD1 . LEU A 487 ? 0.7057 0.3176 0.4342 -0.0897 -0.1805 -0.0132 469 LEU A CD1 
3684 C CD2 . LEU A 487 ? 0.7703 0.3498 0.4234 -0.0838 -0.1758 -0.0357 469 LEU A CD2 
3685 N N   . TYR A 488 ? 0.7164 0.2755 0.4473 -0.0813 -0.1207 -0.0100 470 TYR A N   
3686 C CA  . TYR A 488 ? 0.7484 0.2873 0.4906 -0.0885 -0.1206 -0.0127 470 TYR A CA  
3687 C C   . TYR A 488 ? 0.7410 0.2911 0.5127 -0.0950 -0.1112 0.0042  470 TYR A C   
3688 O O   . TYR A 488 ? 0.7595 0.2948 0.5455 -0.1013 -0.1096 0.0089  470 TYR A O   
3689 C CB  . TYR A 488 ? 0.7678 0.2820 0.4871 -0.0802 -0.1141 -0.0209 470 TYR A CB  
3690 C CG  . TYR A 488 ? 0.7864 0.2965 0.4727 -0.0734 -0.1186 -0.0360 470 TYR A CG  
3691 C CD1 . TYR A 488 ? 0.8317 0.3398 0.5099 -0.0802 -0.1341 -0.0515 470 TYR A CD1 
3692 C CD2 . TYR A 488 ? 0.7905 0.3018 0.4532 -0.0613 -0.1080 -0.0342 470 TYR A CD2 
3693 C CE1 . TYR A 488 ? 0.8494 0.3592 0.4921 -0.0754 -0.1381 -0.0638 470 TYR A CE1 
3694 C CE2 . TYR A 488 ? 0.8061 0.3178 0.4375 -0.0562 -0.1107 -0.0452 470 TYR A CE2 
3695 C CZ  . TYR A 488 ? 0.8423 0.3541 0.4620 -0.0635 -0.1253 -0.0593 470 TYR A CZ  
3696 O OH  . TYR A 488 ? 0.8620 0.3783 0.4470 -0.0601 -0.1277 -0.0687 470 TYR A OH  
3697 N N   . TYR A 489 ? 0.7121 0.2897 0.4948 -0.0940 -0.1051 0.0133  471 TYR A N   
3698 C CA  . TYR A 489 ? 0.7017 0.2980 0.5092 -0.1009 -0.0944 0.0279  471 TYR A CA  
3699 C C   . TYR A 489 ? 0.6957 0.3171 0.5332 -0.1083 -0.0998 0.0288  471 TYR A C   
3700 O O   . TYR A 489 ? 0.6853 0.3173 0.5210 -0.1025 -0.1064 0.0223  471 TYR A O   
3701 C CB  . TYR A 489 ? 0.6825 0.2937 0.4768 -0.0916 -0.0784 0.0344  471 TYR A CB  
3702 C CG  . TYR A 489 ? 0.6849 0.2758 0.4548 -0.0843 -0.0732 0.0358  471 TYR A CG  
3703 C CD1 . TYR A 489 ? 0.6739 0.2624 0.4487 -0.0892 -0.0660 0.0500  471 TYR A CD1 
3704 C CD2 . TYR A 489 ? 0.6819 0.2582 0.4262 -0.0730 -0.0757 0.0252  471 TYR A CD2 
3705 C CE1 . TYR A 489 ? 0.6891 0.2602 0.4466 -0.0818 -0.0627 0.0529  471 TYR A CE1 
3706 C CE2 . TYR A 489 ? 0.7008 0.2602 0.4281 -0.0659 -0.0705 0.0262  471 TYR A CE2 
3707 C CZ  . TYR A 489 ? 0.6902 0.2469 0.4257 -0.0699 -0.0647 0.0398  471 TYR A CZ  
3708 O OH  . TYR A 489 ? 0.7191 0.2608 0.4430 -0.0624 -0.0612 0.0421  471 TYR A OH  
3709 N N   . PRO A 490 ? 0.6988 0.3319 0.5671 -0.1212 -0.0966 0.0390  472 PRO A N   
3710 C CA  . PRO A 490 ? 0.7039 0.3647 0.6080 -0.1290 -0.0995 0.0410  472 PRO A CA  
3711 C C   . PRO A 490 ? 0.6977 0.3896 0.6073 -0.1208 -0.0856 0.0421  472 PRO A C   
3712 O O   . PRO A 490 ? 0.6940 0.3888 0.5835 -0.1138 -0.0711 0.0450  472 PRO A O   
3713 C CB  . PRO A 490 ? 0.7145 0.3797 0.6466 -0.1444 -0.0940 0.0549  472 PRO A CB  
3714 C CG  . PRO A 490 ? 0.6956 0.3460 0.6056 -0.1421 -0.0830 0.0648  472 PRO A CG  
3715 C CD  . PRO A 490 ? 0.7041 0.3261 0.5787 -0.1294 -0.0897 0.0521  472 PRO A CD  
3716 N N   . PHE A 491 ? 0.7133 0.4290 0.6530 -0.1214 -0.0902 0.0389  473 PHE A N   
3717 C CA  . PHE A 491 ? 0.7223 0.4638 0.6701 -0.1111 -0.0776 0.0356  473 PHE A CA  
3718 C C   . PHE A 491 ? 0.7022 0.4759 0.6691 -0.1155 -0.0548 0.0406  473 PHE A C   
3719 O O   . PHE A 491 ? 0.6979 0.4935 0.6722 -0.1070 -0.0424 0.0337  473 PHE A O   
3720 C CB  . PHE A 491 ? 0.7411 0.4929 0.7111 -0.1048 -0.0917 0.0294  473 PHE A CB  
3721 C CG  . PHE A 491 ? 0.7941 0.5225 0.7307 -0.0940 -0.1043 0.0249  473 PHE A CG  
3722 C CD1 . PHE A 491 ? 0.8002 0.5338 0.7321 -0.0808 -0.0978 0.0221  473 PHE A CD1 
3723 C CD2 . PHE A 491 ? 0.8659 0.5675 0.7758 -0.0978 -0.1213 0.0227  473 PHE A CD2 
3724 C CE1 . PHE A 491 ? 0.8123 0.5266 0.7151 -0.0724 -0.1082 0.0212  473 PHE A CE1 
3725 C CE2 . PHE A 491 ? 0.8675 0.5518 0.7436 -0.0888 -0.1303 0.0191  473 PHE A CE2 
3726 C CZ  . PHE A 491 ? 0.8138 0.5051 0.6867 -0.0765 -0.1235 0.0205  473 PHE A CZ  
3727 N N   . SER A 492 ? 0.6974 0.4745 0.6722 -0.1292 -0.0491 0.0523  474 SER A N   
3728 C CA  . SER A 492 ? 0.6763 0.4831 0.6561 -0.1351 -0.0263 0.0605  474 SER A CA  
3729 C C   . SER A 492 ? 0.6578 0.4491 0.5988 -0.1356 -0.0189 0.0707  474 SER A C   
3730 O O   . SER A 492 ? 0.6524 0.4673 0.5917 -0.1433 -0.0023 0.0821  474 SER A O   
3731 C CB  . SER A 492 ? 0.6956 0.5250 0.7154 -0.1517 -0.0226 0.0717  474 SER A CB  
3732 O OG  . SER A 492 ? 0.7273 0.5925 0.7864 -0.1500 -0.0158 0.0629  474 SER A OG  
3733 N N   . TYR A 493 ? 0.6290 0.3837 0.5398 -0.1275 -0.0310 0.0673  475 TYR A N   
3734 C CA  . TYR A 493 ? 0.6112 0.3495 0.4905 -0.1267 -0.0265 0.0774  475 TYR A CA  
3735 C C   . TYR A 493 ? 0.5863 0.3534 0.4491 -0.1227 -0.0080 0.0777  475 TYR A C   
3736 O O   . TYR A 493 ? 0.5704 0.3546 0.4345 -0.1132 -0.0020 0.0621  475 TYR A O   
3737 C CB  . TYR A 493 ? 0.6145 0.3151 0.4667 -0.1154 -0.0396 0.0684  475 TYR A CB  
3738 C CG  . TYR A 493 ? 0.6212 0.2974 0.4527 -0.1160 -0.0402 0.0798  475 TYR A CG  
3739 C CD1 . TYR A 493 ? 0.6198 0.2753 0.4661 -0.1267 -0.0483 0.0909  475 TYR A CD1 
3740 C CD2 . TYR A 493 ? 0.6030 0.2762 0.4058 -0.1059 -0.0342 0.0793  475 TYR A CD2 
3741 C CE1 . TYR A 493 ? 0.6310 0.2627 0.4661 -0.1262 -0.0499 0.1023  475 TYR A CE1 
3742 C CE2 . TYR A 493 ? 0.6111 0.2633 0.4005 -0.1057 -0.0360 0.0912  475 TYR A CE2 
3743 C CZ  . TYR A 493 ? 0.6420 0.2728 0.4488 -0.1153 -0.0439 0.1029  475 TYR A CZ  
3744 O OH  . TYR A 493 ? 0.6599 0.2685 0.4613 -0.1140 -0.0469 0.1149  475 TYR A OH  
3745 N N   . LEU A 494 ? 0.9391 0.5862 0.5304 -0.2569 -0.1626 0.1687  476 LEU A N   
3746 C CA  . LEU A 494 ? 0.8947 0.5737 0.5033 -0.2254 -0.1473 0.1500  476 LEU A CA  
3747 C C   . LEU A 494 ? 0.8850 0.4580 0.4850 -0.2103 -0.1454 0.1235  476 LEU A C   
3748 O O   . LEU A 494 ? 0.9230 0.4343 0.4974 -0.2264 -0.1707 0.1286  476 LEU A O   
3749 C CB  . LEU A 494 ? 0.8952 0.6816 0.5041 -0.2592 -0.1597 0.1859  476 LEU A CB  
3750 C CG  . LEU A 494 ? 0.8885 0.7140 0.5118 -0.2336 -0.1488 0.1720  476 LEU A CG  
3751 C CD1 . LEU A 494 ? 0.8196 0.6564 0.4610 -0.1579 -0.1288 0.1223  476 LEU A CD1 
3752 C CD2 . LEU A 494 ? 0.8910 0.8858 0.5150 -0.2781 -0.1619 0.2171  476 LEU A CD2 
3753 N N   . PHE A 495 ? 0.8443 0.4011 0.4537 -0.1811 -0.1285 0.0963  477 PHE A N   
3754 C CA  . PHE A 495 ? 0.8327 0.3532 0.4372 -0.1726 -0.1234 0.0753  477 PHE A CA  
3755 C C   . PHE A 495 ? 0.8287 0.3616 0.4417 -0.1607 -0.1200 0.0714  477 PHE A C   
3756 O O   . PHE A 495 ? 0.8192 0.3833 0.4433 -0.1451 -0.1160 0.0707  477 PHE A O   
3757 C CB  . PHE A 495 ? 0.8116 0.3287 0.4117 -0.1764 -0.1196 0.0679  477 PHE A CB  
3758 C CG  . PHE A 495 ? 0.8039 0.3200 0.3937 -0.1934 -0.1224 0.0713  477 PHE A CG  
3759 C CD1 . PHE A 495 ? 0.7673 0.3120 0.3476 -0.1905 -0.1212 0.0547  477 PHE A CD1 
3760 C CD2 . PHE A 495 ? 0.8027 0.3014 0.3869 -0.2003 -0.1320 0.0831  477 PHE A CD2 
3761 C CE1 . PHE A 495 ? 0.7645 0.3282 0.3347 -0.2007 -0.1243 0.0542  477 PHE A CE1 
3762 C CE2 . PHE A 495 ? 0.8039 0.3026 0.3789 -0.2196 -0.1341 0.0885  477 PHE A CE2 
3763 C CZ  . PHE A 495 ? 0.7931 0.3279 0.3634 -0.2229 -0.1276 0.0762  477 PHE A CZ  
3764 N N   . ARG A 496 ? 0.8596 0.3636 0.4591 -0.1574 -0.1311 0.0622  478 ARG A N   
3765 C CA  . ARG A 496 ? 0.8776 0.3861 0.4810 -0.1524 -0.1335 0.0639  478 ARG A CA  
3766 C C   . ARG A 496 ? 0.8688 0.3757 0.4715 -0.1266 -0.1252 0.0328  478 ARG A C   
3767 O O   . ARG A 496 ? 0.9086 0.4047 0.4888 -0.1050 -0.1399 0.0056  478 ARG A O   
3768 C CB  . ARG A 496 ? 0.9320 0.3988 0.5040 -0.1812 -0.1745 0.0898  478 ARG A CB  
3769 C CG  . ARG A 496 ? 0.9693 0.4670 0.5454 -0.1969 -0.1803 0.1100  478 ARG A CG  
3770 C CD  . ARG A 496 ? 1.0625 0.4985 0.5853 -0.2521 -0.2450 0.1519  478 ARG A CD  
3771 N NE  . ARG A 496 ? 1.2353 0.5176 0.6949 -0.2298 -0.3055 0.1243  478 ARG A NE  
3772 C CZ  . ARG A 496 ? 1.2887 0.5130 0.7284 -0.1848 -0.3228 0.0858  478 ARG A CZ  
3773 N NH1 . ARG A 496 ? 1.1926 0.4913 0.6771 -0.1706 -0.2764 0.0783  478 ARG A NH1 
3774 N NH2 . ARG A 496 ? 1.4021 0.4941 0.7691 -0.1421 -0.3950 0.0468  478 ARG A NH2 
3775 N N   . ALA A 497 ? 0.8400 0.3746 0.4620 -0.1217 -0.1076 0.0323  479 ALA A N   
3776 C CA  . ALA A 497 ? 0.8314 0.3861 0.4539 -0.1088 -0.1000 0.0121  479 ALA A CA  
3777 C C   . ALA A 497 ? 0.8519 0.3816 0.4670 -0.0918 -0.1128 0.0039  479 ALA A C   
3778 O O   . ALA A 497 ? 0.8476 0.3605 0.4635 -0.1061 -0.1232 0.0272  479 ALA A O   
3779 C CB  . ALA A 497 ? 0.8159 0.3792 0.4463 -0.1184 -0.0939 0.0206  479 ALA A CB  
3780 N N   . ALA A 498 ? 0.8762 0.4228 0.4782 -0.0636 -0.1186 -0.0278 480 ALA A N   
3781 C CA  . ALA A 498 ? 0.9178 0.4281 0.5050 -0.0415 -0.1386 -0.0410 480 ALA A CA  
3782 C C   . ALA A 498 ? 0.8770 0.4053 0.4951 -0.0592 -0.1145 -0.0188 480 ALA A C   
3783 O O   . ALA A 498 ? 0.8388 0.4096 0.4780 -0.0675 -0.0900 -0.0151 480 ALA A O   
3784 C CB  . ALA A 498 ? 0.9400 0.5039 0.5084 0.0096  -0.1473 -0.0914 480 ALA A CB  
3785 N N   . HIS A 499 ? 0.9011 0.3931 0.5105 -0.0699 -0.1344 -0.0007 481 HIS A N   
3786 C CA  . HIS A 499 ? 0.8739 0.4036 0.5083 -0.0736 -0.1162 0.0112  481 HIS A CA  
3787 C C   . HIS A 499 ? 0.8479 0.3909 0.4894 -0.0462 -0.1013 -0.0184 481 HIS A C   
3788 O O   . HIS A 499 ? 0.8826 0.4036 0.5000 -0.0204 -0.1207 -0.0460 481 HIS A O   
3789 C CB  . HIS A 499 ? 0.9278 0.4373 0.5419 -0.1023 -0.1491 0.0411  481 HIS A CB  
3790 C CG  . HIS A 499 ? 0.9936 0.5490 0.6034 -0.1507 -0.1634 0.0871  481 HIS A CG  
3791 N ND1 . HIS A 499 ? 1.1332 0.6178 0.6953 -0.1928 -0.2157 0.1151  481 HIS A ND1 
3792 C CD2 . HIS A 499 ? 0.9855 0.6690 0.6257 -0.1597 -0.1405 0.1074  481 HIS A CD2 
3793 C CE1 . HIS A 499 ? 1.1416 0.7238 0.7113 -0.2432 -0.2169 0.1621  481 HIS A CE1 
3794 N NE2 . HIS A 499 ? 1.0514 0.7736 0.6711 -0.2160 -0.1686 0.1530  481 HIS A NE2 
3795 N N   . VAL A 500 ? 0.8060 0.3840 0.4697 -0.0466 -0.0790 -0.0159 482 VAL A N   
3796 C CA  . VAL A 500 ? 0.7895 0.3899 0.4566 -0.0388 -0.0694 -0.0311 482 VAL A CA  
3797 C C   . VAL A 500 ? 0.7739 0.3690 0.4506 -0.0256 -0.0681 -0.0314 482 VAL A C   
3798 O O   . VAL A 500 ? 0.7591 0.3651 0.4462 -0.0236 -0.0683 -0.0179 482 VAL A O   
3799 C CB  . VAL A 500 ? 0.8012 0.4051 0.4636 -0.0604 -0.0720 -0.0196 482 VAL A CB  
3800 C CG1 . VAL A 500 ? 0.8093 0.4452 0.4661 -0.0744 -0.0722 -0.0213 482 VAL A CG1 
3801 C CG2 . VAL A 500 ? 0.8234 0.4388 0.4727 -0.0865 -0.0776 -0.0104 482 VAL A CG2 
3802 N N   . LEU A 501 ? 0.7677 0.3687 0.4380 -0.0094 -0.0697 -0.0515 483 LEU A N   
3803 C CA  . LEU A 501 ? 0.7517 0.3454 0.4283 0.0012  -0.0698 -0.0528 483 LEU A CA  
3804 C C   . LEU A 501 ? 0.7240 0.3580 0.4087 0.0062  -0.0551 -0.0660 483 LEU A C   
3805 O O   . LEU A 501 ? 0.7354 0.4258 0.4123 0.0027  -0.0518 -0.0786 483 LEU A O   
3806 C CB  . LEU A 501 ? 0.7965 0.3383 0.4424 0.0165  -0.1035 -0.0649 483 LEU A CB  
3807 C CG  . LEU A 501 ? 0.8621 0.3394 0.4773 -0.0105 -0.1437 -0.0378 483 LEU A CG  
3808 C CD1 . LEU A 501 ? 0.9426 0.3203 0.4993 0.0070  -0.2069 -0.0537 483 LEU A CD1 
3809 C CD2 . LEU A 501 ? 0.8145 0.3399 0.4502 -0.0534 -0.1356 0.0087  483 LEU A CD2 
3810 N N   . MET A 502 ? 0.6920 0.3199 0.3885 0.0096  -0.0503 -0.0603 484 MET A N   
3811 C CA  . MET A 502 ? 0.6778 0.3321 0.3749 0.0070  -0.0451 -0.0671 484 MET A CA  
3812 C C   . MET A 502 ? 0.6624 0.3418 0.3562 0.0340  -0.0440 -0.0931 484 MET A C   
3813 O O   . MET A 502 ? 0.6804 0.3120 0.3636 0.0517  -0.0605 -0.0987 484 MET A O   
3814 C CB  . MET A 502 ? 0.6750 0.3006 0.3772 0.0158  -0.0506 -0.0605 484 MET A CB  
3815 C CG  . MET A 502 ? 0.7120 0.2956 0.3949 0.0135  -0.0761 -0.0517 484 MET A CG  
3816 S SD  . MET A 502 ? 0.7965 0.3464 0.4650 0.0553  -0.1043 -0.0659 484 MET A SD  
3817 C CE  . MET A 502 ? 0.7843 0.2973 0.4279 0.0160  -0.1229 -0.0550 484 MET A CE  
3818 N N   . PRO A 503 ? 0.6470 0.4035 0.3386 0.0340  -0.0372 -0.1069 485 PRO A N   
3819 C CA  . PRO A 503 ? 0.6519 0.4458 0.3343 0.0793  -0.0432 -0.1445 485 PRO A CA  
3820 C C   . PRO A 503 ? 0.6767 0.3733 0.3549 0.1024  -0.0589 -0.1478 485 PRO A C   
3821 O O   . PRO A 503 ? 0.7443 0.3946 0.3888 0.1426  -0.0946 -0.1767 485 PRO A O   
3822 C CB  . PRO A 503 ? 0.6302 0.5362 0.3194 0.0556  -0.0287 -0.1400 485 PRO A CB  
3823 C CG  . PRO A 503 ? 0.6259 0.5716 0.3103 -0.0099 -0.0292 -0.1012 485 PRO A CG  
3824 C CD  . PRO A 503 ? 0.6405 0.4608 0.3266 -0.0169 -0.0363 -0.0824 485 PRO A CD  
3825 N N   . HIS A 504 ? 0.6559 0.3196 0.3553 0.0789  -0.0466 -0.1194 486 HIS A N   
3826 C CA  . HIS A 504 ? 0.6810 0.2912 0.3764 0.0833  -0.0620 -0.1105 486 HIS A CA  
3827 C C   . HIS A 504 ? 0.7337 0.2903 0.4093 0.0598  -0.0917 -0.0836 486 HIS A C   
3828 O O   . HIS A 504 ? 0.7803 0.3039 0.4389 0.0414  -0.1189 -0.0627 486 HIS A O   
3829 C CB  . HIS A 504 ? 0.6392 0.2729 0.3611 0.0754  -0.0421 -0.0951 486 HIS A CB  
3830 C CG  . HIS A 504 ? 0.6320 0.2834 0.3664 0.0655  -0.0367 -0.0758 486 HIS A CG  
3831 N ND1 . HIS A 504 ? 0.6407 0.3290 0.3808 0.0582  -0.0428 -0.0549 486 HIS A ND1 
3832 C CD2 . HIS A 504 ? 0.6057 0.2538 0.3374 0.0651  -0.0375 -0.0764 486 HIS A CD2 
3833 C CE1 . HIS A 504 ? 0.6090 0.3353 0.3548 0.0731  -0.0417 -0.0560 486 HIS A CE1 
3834 N NE2 . HIS A 504 ? 0.6410 0.3157 0.3762 0.0801  -0.0448 -0.0705 486 HIS A NE2 
3835 N N   . GLU A 505 ? 0.7508 0.3048 0.4220 0.0485  -0.0934 -0.0766 487 GLU A N   
3836 C CA  . GLU A 505 ? 0.7968 0.3204 0.4490 0.0120  -0.1219 -0.0416 487 GLU A CA  
3837 C C   . GLU A 505 ? 0.9215 0.3447 0.5152 0.0218  -0.1794 -0.0564 487 GLU A C   
3838 O O   . GLU A 505 ? 0.9930 0.3602 0.5507 -0.0198 -0.2242 -0.0217 487 GLU A O   
3839 C CB  . GLU A 505 ? 0.7450 0.3266 0.4247 -0.0003 -0.0934 -0.0273 487 GLU A CB  
3840 C CG  . GLU A 505 ? 0.6639 0.3258 0.3768 0.0083  -0.0664 -0.0213 487 GLU A CG  
3841 C CD  . GLU A 505 ? 0.6635 0.3632 0.3851 0.0155  -0.0588 -0.0199 487 GLU A CD  
3842 O OE1 . GLU A 505 ? 0.6581 0.3175 0.3714 0.0112  -0.0590 -0.0261 487 GLU A OE1 
3843 O OE2 . GLU A 505 ? 0.6542 0.4366 0.3865 0.0340  -0.0578 -0.0182 487 GLU A OE2 
3844 N N   . SER A 506 ? 0.9719 0.3850 0.5475 0.0803  -0.1877 -0.1103 488 SER A N   
3845 C CA  . SER A 506 ? 1.1040 0.4442 0.6184 0.1234  -0.2467 -0.1485 488 SER A CA  
3846 C C   . SER A 506 ? 1.2397 0.4494 0.6737 0.1656  -0.3354 -0.1794 488 SER A C   
3847 O O   . SER A 506 ? 1.2497 0.4502 0.6884 0.1595  -0.3353 -0.1721 488 SER A O   
3848 C CB  . SER A 506 ? 1.0629 0.5277 0.6001 0.1736  -0.2078 -0.1972 488 SER A CB  
3849 O OG  . SER A 506 ? 1.0649 0.6249 0.6221 0.2063  -0.1810 -0.2273 488 SER A OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -17 ?   ?   ?   A . n 
A 1 2   SER 2   -16 ?   ?   ?   A . n 
A 1 3   SER 3   -15 ?   ?   ?   A . n 
A 1 4   HIS 4   -14 ?   ?   ?   A . n 
A 1 5   HIS 5   -13 ?   ?   ?   A . n 
A 1 6   HIS 6   -12 ?   ?   ?   A . n 
A 1 7   HIS 7   -11 ?   ?   ?   A . n 
A 1 8   HIS 8   -10 ?   ?   ?   A . n 
A 1 9   HIS 9   -9  ?   ?   ?   A . n 
A 1 10  SER 10  -8  ?   ?   ?   A . n 
A 1 11  SER 11  -7  ?   ?   ?   A . n 
A 1 12  GLY 12  -6  ?   ?   ?   A . n 
A 1 13  LEU 13  -5  ?   ?   ?   A . n 
A 1 14  VAL 14  -4  ?   ?   ?   A . n 
A 1 15  PRO 15  -3  ?   ?   ?   A . n 
A 1 16  ARG 16  -2  ?   ?   ?   A . n 
A 1 17  GLY 17  -1  ?   ?   ?   A . n 
A 1 18  SER 18  0   ?   ?   ?   A . n 
A 1 19  MET 19  1   ?   ?   ?   A . n 
A 1 20  SER 20  2   ?   ?   ?   A . n 
A 1 21  THR 21  3   3   THR THR A . n 
A 1 22  SER 22  4   4   SER SER A . n 
A 1 23  TRP 23  5   5   TRP TRP A . n 
A 1 24  SER 24  6   6   SER SER A . n 
A 1 25  ASP 25  7   7   ASP ASP A . n 
A 1 26  ARG 26  8   8   ARG ARG A . n 
A 1 27  LEU 27  9   9   LEU LEU A . n 
A 1 28  GLN 28  10  10  GLN GLN A . n 
A 1 29  ASN 29  11  11  ASN ASN A . n 
A 1 30  ALA 30  12  12  ALA ALA A . n 
A 1 31  ALA 31  13  13  ALA ALA A . n 
A 1 32  ASP 32  14  14  ASP ASP A . n 
A 1 33  MET 33  15  15  MET MET A . n 
A 1 34  PRO 34  16  16  PRO PRO A . n 
A 1 35  ALA 35  17  17  ALA ALA A . n 
A 1 36  ASN 36  18  18  ASN ASN A . n 
A 1 37  MET 37  19  19  MET MET A . n 
A 1 38  ASP 38  20  20  ASP ASP A . n 
A 1 39  LYS 39  21  21  LYS LYS A . n 
A 1 40  HIS 40  22  22  HIS HIS A . n 
A 1 41  ALA 41  23  23  ALA ALA A . n 
A 1 42  LEU 42  24  24  LEU LEU A . n 
A 1 43  LYS 43  25  25  LYS LYS A . n 
A 1 44  LYS 44  26  26  LYS LYS A . n 
A 1 45  TYR 45  27  27  TYR TYR A . n 
A 1 46  ARG 46  28  28  ARG ARG A . n 
A 1 47  ARG 47  29  29  ARG ARG A . n 
A 1 48  GLU 48  30  30  GLU GLU A . n 
A 1 49  ALA 49  31  31  ALA ALA A . n 
A 1 50  TYR 50  32  32  TYR TYR A . n 
A 1 51  HIS 51  33  33  HIS HIS A . n 
A 1 52  ARG 52  34  34  ARG ARG A . n 
A 1 53  VAL 53  35  35  VAL VAL A . n 
A 1 54  PHE 54  36  36  PHE PHE A . n 
A 1 55  VAL 55  37  37  VAL VAL A . n 
A 1 56  ASN 56  38  38  ASN ASN A . n 
A 1 57  ARG 57  39  39  ARG ARG A . n 
A 1 58  SER 58  40  40  SER SER A . n 
A 1 59  LEU 59  41  41  LEU LEU A . n 
A 1 60  ALA 60  42  42  ALA ALA A . n 
A 1 61  MET 61  43  43  MET MET A . n 
A 1 62  GLU 62  44  44  GLU GLU A . n 
A 1 63  LYS 63  45  45  LYS LYS A . n 
A 1 64  ILE 64  46  46  ILE ILE A . n 
A 1 65  LYS 65  47  47  LYS LYS A . n 
A 1 66  CYS 66  48  48  CYS CYS A . n 
A 1 67  PHE 67  49  49  PHE PHE A . n 
A 1 68  GLY 68  50  50  GLY GLY A . n 
A 1 69  PHE 69  51  51  PHE PHE A . n 
A 1 70  ASN 70  52  52  ASN ASN A . n 
A 1 71  MET 71  53  53  MET MET A . n 
A 1 72  ASP 72  54  54  ASP ASP A . n 
A 1 73  TYR 73  55  55  TYR TYR A . n 
A 1 74  THR 74  56  56  THR THR A . n 
A 1 75  LEU 75  57  57  LEU LEU A . n 
A 1 76  ALA 76  58  58  ALA ALA A . n 
A 1 77  VAL 77  59  59  VAL VAL A . n 
A 1 78  TYR 78  60  60  TYR TYR A . n 
A 1 79  LYS 79  61  61  LYS LYS A . n 
A 1 80  SER 80  62  62  SER SER A . n 
A 1 81  PRO 81  63  63  PRO PRO A . n 
A 1 82  GLU 82  64  64  GLU GLU A . n 
A 1 83  TYR 83  65  65  TYR TYR A . n 
A 1 84  GLU 84  66  66  GLU GLU A . n 
A 1 85  SER 85  67  67  SER SER A . n 
A 1 86  LEU 86  68  68  LEU LEU A . n 
A 1 87  GLY 87  69  69  GLY GLY A . n 
A 1 88  PHE 88  70  70  PHE PHE A . n 
A 1 89  GLU 89  71  71  GLU GLU A . n 
A 1 90  LEU 90  72  72  LEU LEU A . n 
A 1 91  THR 91  73  73  THR THR A . n 
A 1 92  VAL 92  74  74  VAL VAL A . n 
A 1 93  GLU 93  75  75  GLU GLU A . n 
A 1 94  ARG 94  76  76  ARG ARG A . n 
A 1 95  LEU 95  77  77  LEU LEU A . n 
A 1 96  VAL 96  78  78  VAL VAL A . n 
A 1 97  SER 97  79  79  SER SER A . n 
A 1 98  ILE 98  80  80  ILE ILE A . n 
A 1 99  GLY 99  81  81  GLY GLY A . n 
A 1 100 TYR 100 82  82  TYR TYR A . n 
A 1 101 PRO 101 83  83  PRO PRO A . n 
A 1 102 GLN 102 84  84  GLN GLN A . n 
A 1 103 GLU 103 85  85  GLU GLU A . n 
A 1 104 LEU 104 86  86  LEU LEU A . n 
A 1 105 LEU 105 87  87  LEU LEU A . n 
A 1 106 SER 106 88  88  SER SER A . n 
A 1 107 PHE 107 89  89  PHE PHE A . n 
A 1 108 ALA 108 90  90  ALA ALA A . n 
A 1 109 TYR 109 91  91  TYR TYR A . n 
A 1 110 ASP 110 92  92  ASP ASP A . n 
A 1 111 SER 111 93  93  SER SER A . n 
A 1 112 THR 112 94  94  THR THR A . n 
A 1 113 PHE 113 95  95  PHE PHE A . n 
A 1 114 PRO 114 96  96  PRO PRO A . n 
A 1 115 THR 115 97  97  THR THR A . n 
A 1 116 ARG 116 98  98  ARG ARG A . n 
A 1 117 GLY 117 99  99  GLY GLY A . n 
A 1 118 LEU 118 100 100 LEU LEU A . n 
A 1 119 VAL 119 101 101 VAL VAL A . n 
A 1 120 PHE 120 102 102 PHE PHE A . n 
A 1 121 ASP 121 103 103 ASP ASP A . n 
A 1 122 THR 122 104 104 THR THR A . n 
A 1 123 LEU 123 105 105 LEU LEU A . n 
A 1 124 TYR 124 106 106 TYR TYR A . n 
A 1 125 GLY 125 107 107 GLY GLY A . n 
A 1 126 ASN 126 108 108 ASN ASN A . n 
A 1 127 LEU 127 109 109 LEU LEU A . n 
A 1 128 LEU 128 110 110 LEU LEU A . n 
A 1 129 LYS 129 111 111 LYS LYS A . n 
A 1 130 VAL 130 112 112 VAL VAL A . n 
A 1 131 ASP 131 113 113 ASP ASP A . n 
A 1 132 ALA 132 114 114 ALA ALA A . n 
A 1 133 TYR 133 115 115 TYR TYR A . n 
A 1 134 GLY 134 116 116 GLY GLY A . n 
A 1 135 ASN 135 117 117 ASN ASN A . n 
A 1 136 LEU 136 118 118 LEU LEU A . n 
A 1 137 LEU 137 119 119 LEU LEU A . n 
A 1 138 VAL 138 120 120 VAL VAL A . n 
A 1 139 CYS 139 121 121 CYS CYS A . n 
A 1 140 ALA 140 122 122 ALA ALA A . n 
A 1 141 HIS 141 123 123 HIS HIS A . n 
A 1 142 GLY 142 124 124 GLY GLY A . n 
A 1 143 PHE 143 125 125 PHE PHE A . n 
A 1 144 ASN 144 126 126 ASN ASN A . n 
A 1 145 PHE 145 127 127 PHE PHE A . n 
A 1 146 ILE 146 128 128 ILE ILE A . n 
A 1 147 ARG 147 129 129 ARG ARG A . n 
A 1 148 GLY 148 130 130 GLY GLY A . n 
A 1 149 PRO 149 131 131 PRO PRO A . n 
A 1 150 GLU 150 132 132 GLU GLU A . n 
A 1 151 THR 151 133 133 THR THR A . n 
A 1 152 ARG 152 134 134 ARG ARG A . n 
A 1 153 GLU 153 135 135 GLU GLU A . n 
A 1 154 GLN 154 136 136 GLN GLN A . n 
A 1 155 TYR 155 137 137 TYR TYR A . n 
A 1 156 PRO 156 138 138 PRO PRO A . n 
A 1 157 ASN 157 139 139 ASN ASN A . n 
A 1 158 LYS 158 140 140 LYS LYS A . n 
A 1 159 PHE 159 141 141 PHE PHE A . n 
A 1 160 ILE 160 142 142 ILE ILE A . n 
A 1 161 GLN 161 143 143 GLN GLN A . n 
A 1 162 ARG 162 144 144 ARG ARG A . n 
A 1 163 ASP 163 145 145 ASP ASP A . n 
A 1 164 ASP 164 146 146 ASP ASP A . n 
A 1 165 THR 165 147 147 THR THR A . n 
A 1 166 GLU 166 148 148 GLU GLU A . n 
A 1 167 ARG 167 149 149 ARG ARG A . n 
A 1 168 PHE 168 150 150 PHE PHE A . n 
A 1 169 TYR 169 151 151 TYR TYR A . n 
A 1 170 ILE 170 152 152 ILE ILE A . n 
A 1 171 LEU 171 153 153 LEU LEU A . n 
A 1 172 ASN 172 154 154 ASN ASN A . n 
A 1 173 THR 173 155 155 THR THR A . n 
A 1 174 LEU 174 156 156 LEU LEU A . n 
A 1 175 PHE 175 157 157 PHE PHE A . n 
A 1 176 ASN 176 158 158 ASN ASN A . n 
A 1 177 LEU 177 159 159 LEU LEU A . n 
A 1 178 PRO 178 160 160 PRO PRO A . n 
A 1 179 GLU 179 161 161 GLU GLU A . n 
A 1 180 THR 180 162 162 THR THR A . n 
A 1 181 TYR 181 163 163 TYR TYR A . n 
A 1 182 LEU 182 164 164 LEU LEU A . n 
A 1 183 LEU 183 165 165 LEU LEU A . n 
A 1 184 ALA 184 166 166 ALA ALA A . n 
A 1 185 CYS 185 167 167 CYS CYS A . n 
A 1 186 LEU 186 168 168 LEU LEU A . n 
A 1 187 VAL 187 169 169 VAL VAL A . n 
A 1 188 ASP 188 170 170 ASP ASP A . n 
A 1 189 PHE 189 171 171 PHE PHE A . n 
A 1 190 PHE 190 172 172 PHE PHE A . n 
A 1 191 THR 191 173 173 THR THR A . n 
A 1 192 ASN 192 174 174 ASN ASN A . n 
A 1 193 CYS 193 175 175 CYS CYS A . n 
A 1 194 PRO 194 176 176 PRO PRO A . n 
A 1 195 ARG 195 177 177 ARG ARG A . n 
A 1 196 TYR 196 178 178 TYR TYR A . n 
A 1 197 THR 197 179 179 THR THR A . n 
A 1 198 SER 198 180 180 SER SER A . n 
A 1 199 CYS 199 181 181 CYS CYS A . n 
A 1 200 GLU 200 182 182 GLU GLU A . n 
A 1 201 THR 201 183 183 THR THR A . n 
A 1 202 GLY 202 184 184 GLY GLY A . n 
A 1 203 PHE 203 185 185 PHE PHE A . n 
A 1 204 LYS 204 186 186 LYS LYS A . n 
A 1 205 ASP 205 187 187 ASP ASP A . n 
A 1 206 GLY 206 188 188 GLY GLY A . n 
A 1 207 ASP 207 189 189 ASP ASP A . n 
A 1 208 LEU 208 190 190 LEU LEU A . n 
A 1 209 PHE 209 191 191 PHE PHE A . n 
A 1 210 MET 210 192 192 MET MET A . n 
A 1 211 SER 211 193 193 SER SER A . n 
A 1 212 TYR 212 194 194 TYR TYR A . n 
A 1 213 ARG 213 195 195 ARG ARG A . n 
A 1 214 SER 214 196 196 SER SER A . n 
A 1 215 MET 215 197 197 MET MET A . n 
A 1 216 PHE 216 198 198 PHE PHE A . n 
A 1 217 GLN 217 199 199 GLN GLN A . n 
A 1 218 ASP 218 200 200 ASP ASP A . n 
A 1 219 VAL 219 201 201 VAL VAL A . n 
A 1 220 ARG 220 202 202 ARG ARG A . n 
A 1 221 ASP 221 203 203 ASP ASP A . n 
A 1 222 ALA 222 204 204 ALA ALA A . n 
A 1 223 VAL 223 205 205 VAL VAL A . n 
A 1 224 ASP 224 206 206 ASP ASP A . n 
A 1 225 TRP 225 207 207 TRP TRP A . n 
A 1 226 VAL 226 208 208 VAL VAL A . n 
A 1 227 HIS 227 209 209 HIS HIS A . n 
A 1 228 TYR 228 210 210 TYR TYR A . n 
A 1 229 LYS 229 211 211 LYS LYS A . n 
A 1 230 GLY 230 212 212 GLY GLY A . n 
A 1 231 SER 231 213 213 SER SER A . n 
A 1 232 LEU 232 214 214 LEU LEU A . n 
A 1 233 LYS 233 215 215 LYS LYS A . n 
A 1 234 GLU 234 216 216 GLU GLU A . n 
A 1 235 LYS 235 217 217 LYS LYS A . n 
A 1 236 THR 236 218 218 THR THR A . n 
A 1 237 VAL 237 219 219 VAL VAL A . n 
A 1 238 GLU 238 220 220 GLU GLU A . n 
A 1 239 ASN 239 221 221 ASN ASN A . n 
A 1 240 LEU 240 222 222 LEU LEU A . n 
A 1 241 GLU 241 223 223 GLU GLU A . n 
A 1 242 LYS 242 224 224 LYS LYS A . n 
A 1 243 TYR 243 225 225 TYR TYR A . n 
A 1 244 VAL 244 226 226 VAL VAL A . n 
A 1 245 VAL 245 227 227 VAL VAL A . n 
A 1 246 LYS 246 228 228 LYS LYS A . n 
A 1 247 ASP 247 229 229 ASP ASP A . n 
A 1 248 GLY 248 230 230 GLY GLY A . n 
A 1 249 LYS 249 231 231 LYS LYS A . n 
A 1 250 LEU 250 232 232 LEU LEU A . n 
A 1 251 PRO 251 233 233 PRO PRO A . n 
A 1 252 LEU 252 234 234 LEU LEU A . n 
A 1 253 LEU 253 235 235 LEU LEU A . n 
A 1 254 LEU 254 236 236 LEU LEU A . n 
A 1 255 SER 255 237 237 SER SER A . n 
A 1 256 ARG 256 238 238 ARG ARG A . n 
A 1 257 MET 257 239 239 MET MET A . n 
A 1 258 LYS 258 240 240 LYS LYS A . n 
A 1 259 GLU 259 241 241 GLU GLU A . n 
A 1 260 VAL 260 242 242 VAL VAL A . n 
A 1 261 GLY 261 243 243 GLY GLY A . n 
A 1 262 LYS 262 244 244 LYS LYS A . n 
A 1 263 VAL 263 245 245 VAL VAL A . n 
A 1 264 PHE 264 246 246 PHE PHE A . n 
A 1 265 LEU 265 247 247 LEU LEU A . n 
A 1 266 ALA 266 248 248 ALA ALA A . n 
A 1 267 THR 267 249 249 THR THR A . n 
A 1 268 ASN 268 250 250 ASN ASN A . n 
A 1 269 SER 269 251 251 SER SER A . n 
A 1 270 ASP 270 252 252 ASP ASP A . n 
A 1 271 TYR 271 253 253 TYR TYR A . n 
A 1 272 LYS 272 254 254 LYS LYS A . n 
A 1 273 TYR 273 255 255 TYR TYR A . n 
A 1 274 THR 274 256 256 THR THR A . n 
A 1 275 ASP 275 257 257 ASP ASP A . n 
A 1 276 LYS 276 258 258 LYS LYS A . n 
A 1 277 ILE 277 259 259 ILE ILE A . n 
A 1 278 MET 278 260 260 MET MET A . n 
A 1 279 THR 279 261 261 THR THR A . n 
A 1 280 TYR 280 262 262 TYR TYR A . n 
A 1 281 LEU 281 263 263 LEU LEU A . n 
A 1 282 PHE 282 264 264 PHE PHE A . n 
A 1 283 ASP 283 265 265 ASP ASP A . n 
A 1 284 PHE 284 266 266 PHE PHE A . n 
A 1 285 PRO 285 267 267 PRO PRO A . n 
A 1 286 HIS 286 268 268 HIS HIS A . n 
A 1 287 GLY 287 269 269 GLY GLY A . n 
A 1 288 PRO 288 270 270 PRO PRO A . n 
A 1 289 LYS 289 271 271 LYS LYS A . n 
A 1 290 PRO 290 272 272 PRO PRO A . n 
A 1 291 GLY 291 273 273 GLY GLY A . n 
A 1 292 SER 292 274 274 SER SER A . n 
A 1 293 SER 293 275 275 SER SER A . n 
A 1 294 HIS 294 276 276 HIS HIS A . n 
A 1 295 ARG 295 277 277 ARG ARG A . n 
A 1 296 PRO 296 278 278 PRO PRO A . n 
A 1 297 TRP 297 279 279 TRP TRP A . n 
A 1 298 GLN 298 280 280 GLN GLN A . n 
A 1 299 SER 299 281 281 SER SER A . n 
A 1 300 TYR 300 282 282 TYR TYR A . n 
A 1 301 PHE 301 283 283 PHE PHE A . n 
A 1 302 ASP 302 284 284 ASP ASP A . n 
A 1 303 LEU 303 285 285 LEU LEU A . n 
A 1 304 ILE 304 286 286 ILE ILE A . n 
A 1 305 LEU 305 287 287 LEU LEU A . n 
A 1 306 VAL 306 288 288 VAL VAL A . n 
A 1 307 ASP 307 289 289 ASP ASP A . n 
A 1 308 ALA 308 290 290 ALA ALA A . n 
A 1 309 ARG 309 291 291 ARG ARG A . n 
A 1 310 LYS 310 292 292 LYS LYS A . n 
A 1 311 PRO 311 293 293 PRO PRO A . n 
A 1 312 LEU 312 294 294 LEU LEU A . n 
A 1 313 PHE 313 295 295 PHE PHE A . n 
A 1 314 PHE 314 296 296 PHE PHE A . n 
A 1 315 GLY 315 297 297 GLY GLY A . n 
A 1 316 GLU 316 298 298 GLU GLU A . n 
A 1 317 GLY 317 299 299 GLY GLY A . n 
A 1 318 THR 318 300 300 THR THR A . n 
A 1 319 VAL 319 301 301 VAL VAL A . n 
A 1 320 LEU 320 302 302 LEU LEU A . n 
A 1 321 ARG 321 303 303 ARG ARG A . n 
A 1 322 GLN 322 304 304 GLN GLN A . n 
A 1 323 VAL 323 305 305 VAL VAL A . n 
A 1 324 ASP 324 306 306 ASP ASP A . n 
A 1 325 THR 325 307 307 THR THR A . n 
A 1 326 LYS 326 308 308 LYS LYS A . n 
A 1 327 THR 327 309 309 THR THR A . n 
A 1 328 GLY 328 310 310 GLY GLY A . n 
A 1 329 LYS 329 311 311 LYS LYS A . n 
A 1 330 LEU 330 312 312 LEU LEU A . n 
A 1 331 LYS 331 313 313 LYS LYS A . n 
A 1 332 ILE 332 314 314 ILE ILE A . n 
A 1 333 GLY 333 315 315 GLY GLY A . n 
A 1 334 THR 334 316 316 THR THR A . n 
A 1 335 TYR 335 317 317 TYR TYR A . n 
A 1 336 THR 336 318 318 THR THR A . n 
A 1 337 GLY 337 319 319 GLY GLY A . n 
A 1 338 PRO 338 320 320 PRO PRO A . n 
A 1 339 LEU 339 321 321 LEU LEU A . n 
A 1 340 GLN 340 322 322 GLN GLN A . n 
A 1 341 HIS 341 323 323 HIS HIS A . n 
A 1 342 GLY 342 324 324 GLY GLY A . n 
A 1 343 ILE 343 325 325 ILE ILE A . n 
A 1 344 VAL 344 326 326 VAL VAL A . n 
A 1 345 TYR 345 327 327 TYR TYR A . n 
A 1 346 SER 346 328 328 SER SER A . n 
A 1 347 GLY 347 329 329 GLY GLY A . n 
A 1 348 GLY 348 330 330 GLY GLY A . n 
A 1 349 SER 349 331 331 SER SER A . n 
A 1 350 SER 350 332 332 SER SER A . n 
A 1 351 ASP 351 333 333 ASP ASP A . n 
A 1 352 THR 352 334 334 THR THR A . n 
A 1 353 ILE 353 335 335 ILE ILE A . n 
A 1 354 CYS 354 336 336 CYS CYS A . n 
A 1 355 ASP 355 337 337 ASP ASP A . n 
A 1 356 LEU 356 338 338 LEU LEU A . n 
A 1 357 LEU 357 339 339 LEU LEU A . n 
A 1 358 GLY 358 340 340 GLY GLY A . n 
A 1 359 ALA 359 341 341 ALA ALA A . n 
A 1 360 LYS 360 342 342 LYS LYS A . n 
A 1 361 GLY 361 343 343 GLY GLY A . n 
A 1 362 LYS 362 344 344 LYS LYS A . n 
A 1 363 ASP 363 345 345 ASP ASP A . n 
A 1 364 ILE 364 346 346 ILE ILE A . n 
A 1 365 LEU 365 347 347 LEU LEU A . n 
A 1 366 TYR 366 348 348 TYR TYR A . n 
A 1 367 ILE 367 349 349 ILE ILE A . n 
A 1 368 GLY 368 350 350 GLY GLY A . n 
A 1 369 ASP 369 351 351 ASP ASP A . n 
A 1 370 HIS 370 352 352 HIS HIS A . n 
A 1 371 ILE 371 353 353 ILE ILE A . n 
A 1 372 PHE 372 354 354 PHE PHE A . n 
A 1 373 GLY 373 355 ?   ?   ?   A . n 
A 1 374 ASP 374 356 ?   ?   ?   A . n 
A 1 375 ILE 375 357 ?   ?   ?   A . n 
A 1 376 LEU 376 358 ?   ?   ?   A . n 
A 1 377 LYS 377 359 ?   ?   ?   A . n 
A 1 378 SER 378 360 ?   ?   ?   A . n 
A 1 379 LYS 379 361 ?   ?   ?   A . n 
A 1 380 LYS 380 362 ?   ?   ?   A . n 
A 1 381 ARG 381 363 ?   ?   ?   A . n 
A 1 382 GLN 382 364 364 GLN GLN A . n 
A 1 383 GLY 383 365 365 GLY GLY A . n 
A 1 384 TRP 384 366 366 TRP TRP A . n 
A 1 385 ARG 385 367 367 ARG ARG A . n 
A 1 386 THR 386 368 368 THR THR A . n 
A 1 387 PHE 387 369 369 PHE PHE A . n 
A 1 388 LEU 388 370 370 LEU LEU A . n 
A 1 389 VAL 389 371 371 VAL VAL A . n 
A 1 390 ILE 390 372 372 ILE ILE A . n 
A 1 391 PRO 391 373 373 PRO PRO A . n 
A 1 392 GLU 392 374 374 GLU GLU A . n 
A 1 393 LEU 393 375 375 LEU LEU A . n 
A 1 394 ALA 394 376 376 ALA ALA A . n 
A 1 395 GLN 395 377 377 GLN GLN A . n 
A 1 396 GLU 396 378 378 GLU GLU A . n 
A 1 397 LEU 397 379 379 LEU LEU A . n 
A 1 398 HIS 398 380 380 HIS HIS A . n 
A 1 399 VAL 399 381 381 VAL VAL A . n 
A 1 400 TRP 400 382 382 TRP TRP A . n 
A 1 401 THR 401 383 383 THR THR A . n 
A 1 402 ASP 402 384 384 ASP ASP A . n 
A 1 403 LYS 403 385 385 LYS LYS A . n 
A 1 404 SER 404 386 386 SER SER A . n 
A 1 405 SER 405 387 387 SER SER A . n 
A 1 406 LEU 406 388 388 LEU LEU A . n 
A 1 407 PHE 407 389 389 PHE PHE A . n 
A 1 408 GLU 408 390 390 GLU GLU A . n 
A 1 409 GLU 409 391 391 GLU GLU A . n 
A 1 410 LEU 410 392 392 LEU LEU A . n 
A 1 411 GLN 411 393 393 GLN GLN A . n 
A 1 412 SER 412 394 394 SER SER A . n 
A 1 413 LEU 413 395 395 LEU LEU A . n 
A 1 414 ASP 414 396 396 ASP ASP A . n 
A 1 415 ILE 415 397 397 ILE ILE A . n 
A 1 416 PHE 416 398 398 PHE PHE A . n 
A 1 417 LEU 417 399 399 LEU LEU A . n 
A 1 418 ALA 418 400 400 ALA ALA A . n 
A 1 419 GLU 419 401 401 GLU GLU A . n 
A 1 420 LEU 420 402 402 LEU LEU A . n 
A 1 421 TYR 421 403 403 TYR TYR A . n 
A 1 422 LYS 422 404 404 LYS LYS A . n 
A 1 423 HIS 423 405 405 HIS HIS A . n 
A 1 424 LEU 424 406 ?   ?   ?   A . n 
A 1 425 ASP 425 407 ?   ?   ?   A . n 
A 1 426 SER 426 408 ?   ?   ?   A . n 
A 1 427 SER 427 409 ?   ?   ?   A . n 
A 1 428 SER 428 410 ?   ?   ?   A . n 
A 1 429 ASN 429 411 ?   ?   ?   A . n 
A 1 430 GLU 430 412 ?   ?   ?   A . n 
A 1 431 ARG 431 413 ?   ?   ?   A . n 
A 1 432 PRO 432 414 ?   ?   ?   A . n 
A 1 433 ASP 433 415 ?   ?   ?   A . n 
A 1 434 ILE 434 416 416 ILE ILE A . n 
A 1 435 SER 435 417 417 SER SER A . n 
A 1 436 SER 436 418 418 SER SER A . n 
A 1 437 ILE 437 419 419 ILE ILE A . n 
A 1 438 GLN 438 420 420 GLN GLN A . n 
A 1 439 ARG 439 421 421 ARG ARG A . n 
A 1 440 ARG 440 422 422 ARG ARG A . n 
A 1 441 ILE 441 423 423 ILE ILE A . n 
A 1 442 LYS 442 424 424 LYS LYS A . n 
A 1 443 LYS 443 425 425 LYS LYS A . n 
A 1 444 VAL 444 426 426 VAL VAL A . n 
A 1 445 THR 445 427 427 THR THR A . n 
A 1 446 HIS 446 428 428 HIS HIS A . n 
A 1 447 ASP 447 429 429 ASP ASP A . n 
A 1 448 MET 448 430 430 MET MET A . n 
A 1 449 ASP 449 431 431 ASP ASP A . n 
A 1 450 MET 450 432 432 MET MET A . n 
A 1 451 CYS 451 433 433 CYS CYS A . n 
A 1 452 TYR 452 434 434 TYR TYR A . n 
A 1 453 GLY 453 435 435 GLY GLY A . n 
A 1 454 MET 454 436 436 MET MET A . n 
A 1 455 MET 455 437 437 MET MET A . n 
A 1 456 GLY 456 438 438 GLY GLY A . n 
A 1 457 SER 457 439 439 SER SER A . n 
A 1 458 LEU 458 440 440 LEU LEU A . n 
A 1 459 PHE 459 441 441 PHE PHE A . n 
A 1 460 ARG 460 442 442 ARG ARG A . n 
A 1 461 SER 461 443 443 SER SER A . n 
A 1 462 GLY 462 444 444 GLY GLY A . n 
A 1 463 SER 463 445 445 SER SER A . n 
A 1 464 ARG 464 446 446 ARG ARG A . n 
A 1 465 GLN 465 447 447 GLN GLN A . n 
A 1 466 THR 466 448 448 THR THR A . n 
A 1 467 LEU 467 449 449 LEU LEU A . n 
A 1 468 PHE 468 450 450 PHE PHE A . n 
A 1 469 ALA 469 451 451 ALA ALA A . n 
A 1 470 SER 470 452 452 SER SER A . n 
A 1 471 GLN 471 453 453 GLN GLN A . n 
A 1 472 VAL 472 454 454 VAL VAL A . n 
A 1 473 MET 473 455 455 MET MET A . n 
A 1 474 ARG 474 456 456 ARG ARG A . n 
A 1 475 TYR 475 457 457 TYR TYR A . n 
A 1 476 ALA 476 458 458 ALA ALA A . n 
A 1 477 ASP 477 459 459 ASP ASP A . n 
A 1 478 LEU 478 460 460 LEU LEU A . n 
A 1 479 TYR 479 461 461 TYR TYR A . n 
A 1 480 ALA 480 462 462 ALA ALA A . n 
A 1 481 ALA 481 463 463 ALA ALA A . n 
A 1 482 SER 482 464 464 SER SER A . n 
A 1 483 PHE 483 465 465 PHE PHE A . n 
A 1 484 ILE 484 466 466 ILE ILE A . n 
A 1 485 ASN 485 467 467 ASN ASN A . n 
A 1 486 LEU 486 468 468 LEU LEU A . n 
A 1 487 LEU 487 469 469 LEU LEU A . n 
A 1 488 TYR 488 470 470 TYR TYR A . n 
A 1 489 TYR 489 471 471 TYR TYR A . n 
A 1 490 PRO 490 472 472 PRO PRO A . n 
A 1 491 PHE 491 473 473 PHE PHE A . n 
A 1 492 SER 492 474 474 SER SER A . n 
A 1 493 TYR 493 475 475 TYR TYR A . n 
A 1 494 LEU 494 476 476 LEU LEU A . n 
A 1 495 PHE 495 477 477 PHE PHE A . n 
A 1 496 ARG 496 478 478 ARG ARG A . n 
A 1 497 ALA 497 479 479 ALA ALA A . n 
A 1 498 ALA 498 480 480 ALA ALA A . n 
A 1 499 HIS 499 481 481 HIS HIS A . n 
A 1 500 VAL 500 482 482 VAL VAL A . n 
A 1 501 LEU 501 483 483 LEU LEU A . n 
A 1 502 MET 502 484 484 MET MET A . n 
A 1 503 PRO 503 485 485 PRO PRO A . n 
A 1 504 HIS 504 486 486 HIS HIS A . n 
A 1 505 GLU 505 487 487 GLU GLU A . n 
A 1 506 SER 506 488 488 SER SER A . n 
A 1 507 THR 507 489 ?   ?   ?   A . n 
A 1 508 VAL 508 490 ?   ?   ?   A . n 
A 1 509 GLU 509 491 ?   ?   ?   A . n 
A 1 510 HIS 510 492 ?   ?   ?   A . n 
A 1 511 THR 511 493 ?   ?   ?   A . n 
A 1 512 HIS 512 494 ?   ?   ?   A . n 
A 1 513 VAL 513 495 ?   ?   ?   A . n 
A 1 514 ASP 514 496 ?   ?   ?   A . n 
A 1 515 ILE 515 497 ?   ?   ?   A . n 
A 1 516 ASN 516 498 ?   ?   ?   A . n 
A 1 517 GLU 517 499 ?   ?   ?   A . n 
A 1 518 MET 518 500 ?   ?   ?   A . n 
A 1 519 GLU 519 501 ?   ?   ?   A . n 
A 1 520 SER 520 502 ?   ?   ?   A . n 
A 1 521 PRO 521 503 ?   ?   ?   A . n 
A 1 522 LEU 522 504 ?   ?   ?   A . n 
A 1 523 ALA 523 505 ?   ?   ?   A . n 
A 1 524 THR 524 506 ?   ?   ?   A . n 
A 1 525 ARG 525 507 ?   ?   ?   A . n 
A 1 526 ASN 526 508 ?   ?   ?   A . n 
A 1 527 ARG 527 509 ?   ?   ?   A . n 
A 1 528 THR 528 510 ?   ?   ?   A . n 
A 1 529 SER 529 511 ?   ?   ?   A . n 
A 1 530 VAL 530 512 ?   ?   ?   A . n 
A 1 531 ASP 531 513 ?   ?   ?   A . n 
A 1 532 PHE 532 514 ?   ?   ?   A . n 
A 1 533 LYS 533 515 ?   ?   ?   A . n 
A 1 534 ASP 534 516 ?   ?   ?   A . n 
A 1 535 THR 535 517 ?   ?   ?   A . n 
A 1 536 ASP 536 518 ?   ?   ?   A . n 
A 1 537 TYR 537 519 ?   ?   ?   A . n 
A 1 538 LYS 538 520 ?   ?   ?   A . n 
A 1 539 ARG 539 521 ?   ?   ?   A . n 
A 1 540 HIS 540 522 ?   ?   ?   A . n 
A 1 541 GLN 541 523 ?   ?   ?   A . n 
A 1 542 LEU 542 524 ?   ?   ?   A . n 
A 1 543 THR 543 525 ?   ?   ?   A . n 
A 1 544 ARG 544 526 ?   ?   ?   A . n 
A 1 545 SER 545 527 ?   ?   ?   A . n 
A 1 546 ILE 546 528 ?   ?   ?   A . n 
A 1 547 SER 547 529 ?   ?   ?   A . n 
A 1 548 GLU 548 530 ?   ?   ?   A . n 
A 1 549 ILE 549 531 ?   ?   ?   A . n 
A 1 550 LYS 550 532 ?   ?   ?   A . n 
A 1 551 PRO 551 533 ?   ?   ?   A . n 
A 1 552 PRO 552 534 ?   ?   ?   A . n 
A 1 553 ASN 553 535 ?   ?   ?   A . n 
A 1 554 LEU 554 536 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1   1489 1489 GOL GOL A . 
C 2 GOL 1   1490 1490 GOL GOL A . 
D 2 GOL 1   1491 1491 GOL GOL A . 
E 2 GOL 1   1492 1492 GOL GOL A . 
F 3 HOH 1   2001 2001 HOH HOH A . 
F 3 HOH 2   2002 2002 HOH HOH A . 
F 3 HOH 3   2003 2003 HOH HOH A . 
F 3 HOH 4   2004 2004 HOH HOH A . 
F 3 HOH 5   2005 2005 HOH HOH A . 
F 3 HOH 6   2006 2006 HOH HOH A . 
F 3 HOH 7   2007 2007 HOH HOH A . 
F 3 HOH 8   2008 2008 HOH HOH A . 
F 3 HOH 9   2009 2009 HOH HOH A . 
F 3 HOH 10  2010 2010 HOH HOH A . 
F 3 HOH 11  2011 2011 HOH HOH A . 
F 3 HOH 12  2012 2012 HOH HOH A . 
F 3 HOH 13  2013 2013 HOH HOH A . 
F 3 HOH 14  2014 2014 HOH HOH A . 
F 3 HOH 15  2015 2015 HOH HOH A . 
F 3 HOH 16  2016 2016 HOH HOH A . 
F 3 HOH 17  2017 2017 HOH HOH A . 
F 3 HOH 18  2018 2018 HOH HOH A . 
F 3 HOH 19  2019 2019 HOH HOH A . 
F 3 HOH 20  2020 2020 HOH HOH A . 
F 3 HOH 21  2021 2021 HOH HOH A . 
F 3 HOH 22  2022 2022 HOH HOH A . 
F 3 HOH 23  2023 2023 HOH HOH A . 
F 3 HOH 24  2024 2024 HOH HOH A . 
F 3 HOH 25  2025 2025 HOH HOH A . 
F 3 HOH 26  2026 2026 HOH HOH A . 
F 3 HOH 27  2027 2027 HOH HOH A . 
F 3 HOH 28  2028 2028 HOH HOH A . 
F 3 HOH 29  2029 2029 HOH HOH A . 
F 3 HOH 30  2030 2030 HOH HOH A . 
F 3 HOH 31  2031 2031 HOH HOH A . 
F 3 HOH 32  2032 2032 HOH HOH A . 
F 3 HOH 33  2033 2033 HOH HOH A . 
F 3 HOH 34  2034 2034 HOH HOH A . 
F 3 HOH 35  2035 2035 HOH HOH A . 
F 3 HOH 36  2036 2036 HOH HOH A . 
F 3 HOH 37  2037 2037 HOH HOH A . 
F 3 HOH 38  2038 2038 HOH HOH A . 
F 3 HOH 39  2039 2039 HOH HOH A . 
F 3 HOH 40  2040 2040 HOH HOH A . 
F 3 HOH 41  2041 2041 HOH HOH A . 
F 3 HOH 42  2042 2042 HOH HOH A . 
F 3 HOH 43  2043 2043 HOH HOH A . 
F 3 HOH 44  2044 2044 HOH HOH A . 
F 3 HOH 45  2045 2045 HOH HOH A . 
F 3 HOH 46  2046 2046 HOH HOH A . 
F 3 HOH 47  2047 2047 HOH HOH A . 
F 3 HOH 48  2048 2048 HOH HOH A . 
F 3 HOH 49  2049 2049 HOH HOH A . 
F 3 HOH 50  2050 2050 HOH HOH A . 
F 3 HOH 51  2051 2051 HOH HOH A . 
F 3 HOH 52  2052 2052 HOH HOH A . 
F 3 HOH 53  2053 2053 HOH HOH A . 
F 3 HOH 54  2054 2054 HOH HOH A . 
F 3 HOH 55  2055 2055 HOH HOH A . 
F 3 HOH 56  2056 2056 HOH HOH A . 
F 3 HOH 57  2057 2057 HOH HOH A . 
F 3 HOH 58  2058 2058 HOH HOH A . 
F 3 HOH 59  2059 2059 HOH HOH A . 
F 3 HOH 60  2060 2060 HOH HOH A . 
F 3 HOH 61  2061 2061 HOH HOH A . 
F 3 HOH 62  2062 2062 HOH HOH A . 
F 3 HOH 63  2063 2063 HOH HOH A . 
F 3 HOH 64  2064 2064 HOH HOH A . 
F 3 HOH 65  2065 2065 HOH HOH A . 
F 3 HOH 66  2066 2066 HOH HOH A . 
F 3 HOH 67  2067 2067 HOH HOH A . 
F 3 HOH 68  2068 2068 HOH HOH A . 
F 3 HOH 69  2069 2069 HOH HOH A . 
F 3 HOH 70  2070 2070 HOH HOH A . 
F 3 HOH 71  2071 2071 HOH HOH A . 
F 3 HOH 72  2072 2072 HOH HOH A . 
F 3 HOH 73  2073 2073 HOH HOH A . 
F 3 HOH 74  2074 2074 HOH HOH A . 
F 3 HOH 75  2075 2075 HOH HOH A . 
F 3 HOH 76  2076 2076 HOH HOH A . 
F 3 HOH 77  2077 2077 HOH HOH A . 
F 3 HOH 78  2078 2078 HOH HOH A . 
F 3 HOH 79  2079 2079 HOH HOH A . 
F 3 HOH 80  2080 2080 HOH HOH A . 
F 3 HOH 81  2081 2081 HOH HOH A . 
F 3 HOH 82  2082 2082 HOH HOH A . 
F 3 HOH 83  2083 2083 HOH HOH A . 
F 3 HOH 84  2084 2084 HOH HOH A . 
F 3 HOH 85  2085 2085 HOH HOH A . 
F 3 HOH 86  2086 2086 HOH HOH A . 
F 3 HOH 87  2087 2087 HOH HOH A . 
F 3 HOH 88  2088 2088 HOH HOH A . 
F 3 HOH 89  2089 2089 HOH HOH A . 
F 3 HOH 90  2090 2090 HOH HOH A . 
F 3 HOH 91  2091 2091 HOH HOH A . 
F 3 HOH 92  2092 2092 HOH HOH A . 
F 3 HOH 93  2093 2093 HOH HOH A . 
F 3 HOH 94  2094 2094 HOH HOH A . 
F 3 HOH 95  2095 2095 HOH HOH A . 
F 3 HOH 96  2096 2096 HOH HOH A . 
F 3 HOH 97  2097 2097 HOH HOH A . 
F 3 HOH 98  2098 2098 HOH HOH A . 
F 3 HOH 99  2099 2099 HOH HOH A . 
F 3 HOH 100 2100 2100 HOH HOH A . 
F 3 HOH 101 2101 2101 HOH HOH A . 
F 3 HOH 102 2102 2102 HOH HOH A . 
F 3 HOH 103 2103 2103 HOH HOH A . 
F 3 HOH 104 2104 2104 HOH HOH A . 
F 3 HOH 105 2105 2105 HOH HOH A . 
F 3 HOH 106 2106 2106 HOH HOH A . 
F 3 HOH 107 2107 2107 HOH HOH A . 
F 3 HOH 108 2108 2108 HOH HOH A . 
F 3 HOH 109 2109 2109 HOH HOH A . 
F 3 HOH 110 2110 2110 HOH HOH A . 
F 3 HOH 111 2111 2111 HOH HOH A . 
F 3 HOH 112 2112 2112 HOH HOH A . 
F 3 HOH 113 2113 2113 HOH HOH A . 
F 3 HOH 114 2114 2114 HOH HOH A . 
F 3 HOH 115 2115 2115 HOH HOH A . 
F 3 HOH 116 2116 2116 HOH HOH A . 
F 3 HOH 117 2117 2117 HOH HOH A . 
F 3 HOH 118 2118 2118 HOH HOH A . 
F 3 HOH 119 2119 2119 HOH HOH A . 
F 3 HOH 120 2120 2120 HOH HOH A . 
F 3 HOH 121 2121 2121 HOH HOH A . 
F 3 HOH 122 2122 2122 HOH HOH A . 
F 3 HOH 123 2123 2123 HOH HOH A . 
F 3 HOH 124 2124 2124 HOH HOH A . 
F 3 HOH 125 2125 2125 HOH HOH A . 
F 3 HOH 126 2126 2126 HOH HOH A . 
F 3 HOH 127 2127 2127 HOH HOH A . 
F 3 HOH 128 2128 2128 HOH HOH A . 
F 3 HOH 129 2129 2129 HOH HOH A . 
F 3 HOH 130 2130 2130 HOH HOH A . 
F 3 HOH 131 2131 2131 HOH HOH A . 
F 3 HOH 132 2132 2132 HOH HOH A . 
F 3 HOH 133 2133 2133 HOH HOH A . 
F 3 HOH 134 2134 2134 HOH HOH A . 
F 3 HOH 135 2135 2135 HOH HOH A . 
F 3 HOH 136 2136 2136 HOH HOH A . 
F 3 HOH 137 2137 2137 HOH HOH A . 
F 3 HOH 138 2138 2138 HOH HOH A . 
F 3 HOH 139 2139 2139 HOH HOH A . 
F 3 HOH 140 2140 2140 HOH HOH A . 
F 3 HOH 141 2141 2141 HOH HOH A . 
F 3 HOH 142 2142 2142 HOH HOH A . 
F 3 HOH 143 2143 2143 HOH HOH A . 
F 3 HOH 144 2144 2144 HOH HOH A . 
F 3 HOH 145 2145 2145 HOH HOH A . 
F 3 HOH 146 2146 2146 HOH HOH A . 
F 3 HOH 147 2147 2147 HOH HOH A . 
F 3 HOH 148 2148 2148 HOH HOH A . 
F 3 HOH 149 2149 2149 HOH HOH A . 
F 3 HOH 150 2150 2150 HOH HOH A . 
F 3 HOH 151 2151 2151 HOH HOH A . 
F 3 HOH 152 2152 2152 HOH HOH A . 
F 3 HOH 153 2153 2153 HOH HOH A . 
F 3 HOH 154 2154 2154 HOH HOH A . 
F 3 HOH 155 2155 2155 HOH HOH A . 
F 3 HOH 156 2156 2156 HOH HOH A . 
F 3 HOH 157 2157 2157 HOH HOH A . 
F 3 HOH 158 2158 2158 HOH HOH A . 
F 3 HOH 159 2159 2159 HOH HOH A . 
F 3 HOH 160 2160 2160 HOH HOH A . 
F 3 HOH 161 2161 2161 HOH HOH A . 
F 3 HOH 162 2162 2162 HOH HOH A . 
F 3 HOH 163 2163 2163 HOH HOH A . 
F 3 HOH 164 2164 2164 HOH HOH A . 
F 3 HOH 165 2165 2165 HOH HOH A . 
F 3 HOH 166 2166 2166 HOH HOH A . 
F 3 HOH 167 2167 2167 HOH HOH A . 
F 3 HOH 168 2168 2168 HOH HOH A . 
F 3 HOH 169 2169 2169 HOH HOH A . 
F 3 HOH 170 2170 2170 HOH HOH A . 
F 3 HOH 171 2171 2171 HOH HOH A . 
F 3 HOH 172 2172 2172 HOH HOH A . 
F 3 HOH 173 2173 2173 HOH HOH A . 
F 3 HOH 174 2174 2174 HOH HOH A . 
F 3 HOH 175 2175 2175 HOH HOH A . 
F 3 HOH 176 2176 2176 HOH HOH A . 
F 3 HOH 177 2177 2177 HOH HOH A . 
F 3 HOH 178 2178 2178 HOH HOH A . 
F 3 HOH 179 2179 2179 HOH HOH A . 
F 3 HOH 180 2180 2180 HOH HOH A . 
F 3 HOH 181 2181 2181 HOH HOH A . 
F 3 HOH 182 2182 2182 HOH HOH A . 
F 3 HOH 183 2183 2183 HOH HOH A . 
F 3 HOH 184 2184 2184 HOH HOH A . 
F 3 HOH 185 2185 2185 HOH HOH A . 
F 3 HOH 186 2186 2186 HOH HOH A . 
F 3 HOH 187 2187 2187 HOH HOH A . 
F 3 HOH 188 2188 2188 HOH HOH A . 
F 3 HOH 189 2189 2189 HOH HOH A . 
F 3 HOH 190 2190 2190 HOH HOH A . 
F 3 HOH 191 2191 2191 HOH HOH A . 
F 3 HOH 192 2192 2192 HOH HOH A . 
F 3 HOH 193 2193 2193 HOH HOH A . 
F 3 HOH 194 2194 2194 HOH HOH A . 
F 3 HOH 195 2195 2195 HOH HOH A . 
F 3 HOH 196 2196 2196 HOH HOH A . 
F 3 HOH 197 2197 2197 HOH HOH A . 
F 3 HOH 198 2198 2198 HOH HOH A . 
F 3 HOH 199 2199 2199 HOH HOH A . 
F 3 HOH 200 2200 2200 HOH HOH A . 
F 3 HOH 201 2201 2201 HOH HOH A . 
F 3 HOH 202 2202 2202 HOH HOH A . 
F 3 HOH 203 2203 2203 HOH HOH A . 
F 3 HOH 204 2204 2204 HOH HOH A . 
F 3 HOH 205 2205 2205 HOH HOH A . 
F 3 HOH 206 2206 2206 HOH HOH A . 
F 3 HOH 207 2207 2207 HOH HOH A . 
F 3 HOH 208 2208 2208 HOH HOH A . 
F 3 HOH 209 2209 2209 HOH HOH A . 
F 3 HOH 210 2210 2210 HOH HOH A . 
F 3 HOH 211 2211 2211 HOH HOH A . 
F 3 HOH 212 2212 2212 HOH HOH A . 
F 3 HOH 213 2213 2213 HOH HOH A . 
F 3 HOH 214 2214 2214 HOH HOH A . 
F 3 HOH 215 2215 2215 HOH HOH A . 
F 3 HOH 216 2216 2216 HOH HOH A . 
F 3 HOH 217 2217 2217 HOH HOH A . 
F 3 HOH 218 2218 2218 HOH HOH A . 
F 3 HOH 219 2219 2219 HOH HOH A . 
F 3 HOH 220 2220 2220 HOH HOH A . 
F 3 HOH 221 2221 2221 HOH HOH A . 
F 3 HOH 222 2222 2222 HOH HOH A . 
F 3 HOH 223 2223 2223 HOH HOH A . 
F 3 HOH 224 2224 2224 HOH HOH A . 
F 3 HOH 225 2225 2225 HOH HOH A . 
F 3 HOH 226 2226 2226 HOH HOH A . 
F 3 HOH 227 2227 2227 HOH HOH A . 
F 3 HOH 228 2228 2228 HOH HOH A . 
F 3 HOH 229 2229 2229 HOH HOH A . 
F 3 HOH 230 2230 2230 HOH HOH A . 
F 3 HOH 231 2231 2231 HOH HOH A . 
F 3 HOH 232 2232 2232 HOH HOH A . 
F 3 HOH 233 2233 2233 HOH HOH A . 
F 3 HOH 234 2234 2234 HOH HOH A . 
F 3 HOH 235 2235 2235 HOH HOH A . 
F 3 HOH 236 2236 2236 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 17650 ? 
1 MORE         -71.3 ? 
1 'SSA (A^2)'  76820 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
3 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
4 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-03-16 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined -9.0970  -41.4280 -25.7330 0.6882 0.4216  0.5441  -0.0159 -0.1324 0.1698  10.1168 13.0392 8.2792  
8.7602  -7.2145 -2.1126 -0.7667 -0.0444 -1.3144 -1.3429 0.2677  -0.0423 1.4809  -0.0746 0.4990  
'X-RAY DIFFRACTION' 2  ? refined 6.0790   -21.8540 -21.7420 0.1288 -0.2401 -0.0904 0.0071  0.0036  -0.0287 1.9258  1.0704  0.5925  
0.5408  0.1908  -0.2248 0.0174  -0.0681 -0.0004 -0.0128 -0.0002 -0.1043 0.1290  0.0208  -0.0172 
'X-RAY DIFFRACTION' 3  ? refined 26.9190  -23.7400 -9.9780  0.4682 0.6461  0.4956  0.0118  -0.0061 0.0776  1.8071  27.0941 41.6029 
-6.7429 0.7239  6.2386  -0.0813 -0.8685 -0.0213 2.2629  -0.7315 -2.4410 4.1006  2.2755  0.8128  
'X-RAY DIFFRACTION' 4  ? refined 12.5070  -13.8380 -23.3020 0.1138 -0.2203 -0.0123 0.0312  0.0273  -0.0296 2.8942  2.2322  0.8852  
0.8807  0.2590  -0.2146 -0.0452 0.0266  0.2101  0.0963  0.0060  -0.2067 -0.0830 0.0813  0.0392  
'X-RAY DIFFRACTION' 5  ? refined -17.7340 -19.4650 -26.7490 0.0589 -0.2097 -0.0520 -0.0242 -0.0446 -0.0063 1.6182  2.7684  1.8775  
0.3409  0.3914  0.6136  -0.0198 -0.0676 0.0857  0.0576  0.0095  0.1032  0.0147  -0.0921 0.0103  
'X-RAY DIFFRACTION' 6  ? refined -23.1560 -9.9910  -20.9510 0.1217 -0.0683 0.1669  -0.0193 0.0135  -0.0801 1.6206  9.8631  4.2270  
-0.1131 -0.0635 -5.0651 -0.3526 -0.1675 0.0866  0.3121  0.4385  0.8175  -0.0492 -0.6049 -0.0859 
'X-RAY DIFFRACTION' 7  ? refined -1.9230  -31.5160 -16.1610 0.1893 -0.1601 -0.0757 -0.0349 0.0252  0.0101  6.2569  4.0883  1.9638  
-1.2838 0.2568  -1.7066 -0.0442 -0.0741 -0.4099 -0.1905 -0.2159 -0.2993 0.3187  0.1243  0.2601  
'X-RAY DIFFRACTION' 8  ? refined 20.4390  -41.9480 -4.1110  0.5306 0.0221  0.3880  0.3122  0.1370  0.0674  1.3953  3.5172  29.3862 
-1.6326 1.6779  -3.6801 -0.2244 0.2783  0.0450  0.1482  -0.2813 -0.4415 2.0479  2.2538  0.5057  
'X-RAY DIFFRACTION' 9  ? refined -1.8260  -32.0560 -13.9060 0.1976 -0.1968 -0.1401 0.0098  -0.0190 0.0209  5.0806  2.6656  1.2083  
0.6881  0.3807  -0.1121 0.0882  -0.3032 -0.1130 -0.0528 -0.0766 -0.0221 0.2509  -0.0705 -0.0117 
'X-RAY DIFFRACTION' 10 ? refined -6.6010  -38.2510 2.3610   0.5554 0.1083  0.2060  -0.0498 -0.0958 -0.0108 10.6486 0.0000  25.3977 
0.0119  16.4453 0.0184  0.3907  0.0355  -0.3846 -0.2160 0.3991  0.0785  0.9266  -0.0228 -0.7897 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 3   ? ? A 32  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 33  ? ? A 126 ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 127 ? ? A 136 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 137 ? ? A 231 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 232 ? ? A 305 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 306 ? ? A 345 ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 346 ? ? A 389 ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 390 ? ? A 432 ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 433 ? ? A 475 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 476 ? ? A 488 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2XCX 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, ASP 52 TO ASN' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 391 ? ? OE1 A GLU 391 ? ? 1.321 1.252 0.069 0.011 N 
2 1 C  A HIS 405 ? ? O   A HIS 405 ? ? 1.501 1.229 0.272 0.019 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 55  ? ? 54.45   15.40  
2 1 THR A 56  ? ? -123.06 -73.06 
3 1 PRO A 267 ? ? -80.70  45.76  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLN 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    364 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    365 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            148.31 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLN 364 ? CG  ? A GLN 382 CG  
2 1 Y 1 A GLN 364 ? CD  ? A GLN 382 CD  
3 1 Y 1 A GLN 364 ? OE1 ? A GLN 382 OE1 
4 1 Y 1 A GLN 364 ? NE2 ? A GLN 382 NE2 
5 1 Y 1 A ILE 416 ? CG1 ? A ILE 434 CG1 
6 1 Y 1 A ILE 416 ? CG2 ? A ILE 434 CG2 
7 1 Y 1 A ILE 416 ? CD1 ? A ILE 434 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -17 ? A GLY 1   
2  1 Y 1 A SER -16 ? A SER 2   
3  1 Y 1 A SER -15 ? A SER 3   
4  1 Y 1 A HIS -14 ? A HIS 4   
5  1 Y 1 A HIS -13 ? A HIS 5   
6  1 Y 1 A HIS -12 ? A HIS 6   
7  1 Y 1 A HIS -11 ? A HIS 7   
8  1 Y 1 A HIS -10 ? A HIS 8   
9  1 Y 1 A HIS -9  ? A HIS 9   
10 1 Y 1 A SER -8  ? A SER 10  
11 1 Y 1 A SER -7  ? A SER 11  
12 1 Y 1 A GLY -6  ? A GLY 12  
13 1 Y 1 A LEU -5  ? A LEU 13  
14 1 Y 1 A VAL -4  ? A VAL 14  
15 1 Y 1 A PRO -3  ? A PRO 15  
16 1 Y 1 A ARG -2  ? A ARG 16  
17 1 Y 1 A GLY -1  ? A GLY 17  
18 1 Y 1 A SER 0   ? A SER 18  
19 1 Y 1 A MET 1   ? A MET 19  
20 1 Y 1 A SER 2   ? A SER 20  
21 1 Y 1 A GLY 355 ? A GLY 373 
22 1 Y 1 A ASP 356 ? A ASP 374 
23 1 Y 1 A ILE 357 ? A ILE 375 
24 1 Y 1 A LEU 358 ? A LEU 376 
25 1 Y 1 A LYS 359 ? A LYS 377 
26 1 Y 1 A SER 360 ? A SER 378 
27 1 Y 1 A LYS 361 ? A LYS 379 
28 1 Y 1 A LYS 362 ? A LYS 380 
29 1 Y 1 A ARG 363 ? A ARG 381 
30 1 Y 1 A LEU 406 ? A LEU 424 
31 1 Y 1 A ASP 407 ? A ASP 425 
32 1 Y 1 A SER 408 ? A SER 426 
33 1 Y 1 A SER 409 ? A SER 427 
34 1 Y 1 A SER 410 ? A SER 428 
35 1 Y 1 A ASN 411 ? A ASN 429 
36 1 Y 1 A GLU 412 ? A GLU 430 
37 1 Y 1 A ARG 413 ? A ARG 431 
38 1 Y 1 A PRO 414 ? A PRO 432 
39 1 Y 1 A ASP 415 ? A ASP 433 
40 1 Y 1 A THR 489 ? A THR 507 
41 1 Y 1 A VAL 490 ? A VAL 508 
42 1 Y 1 A GLU 491 ? A GLU 509 
43 1 Y 1 A HIS 492 ? A HIS 510 
44 1 Y 1 A THR 493 ? A THR 511 
45 1 Y 1 A HIS 494 ? A HIS 512 
46 1 Y 1 A VAL 495 ? A VAL 513 
47 1 Y 1 A ASP 496 ? A ASP 514 
48 1 Y 1 A ILE 497 ? A ILE 515 
49 1 Y 1 A ASN 498 ? A ASN 516 
50 1 Y 1 A GLU 499 ? A GLU 517 
51 1 Y 1 A MET 500 ? A MET 518 
52 1 Y 1 A GLU 501 ? A GLU 519 
53 1 Y 1 A SER 502 ? A SER 520 
54 1 Y 1 A PRO 503 ? A PRO 521 
55 1 Y 1 A LEU 504 ? A LEU 522 
56 1 Y 1 A ALA 505 ? A ALA 523 
57 1 Y 1 A THR 506 ? A THR 524 
58 1 Y 1 A ARG 507 ? A ARG 525 
59 1 Y 1 A ASN 508 ? A ASN 526 
60 1 Y 1 A ARG 509 ? A ARG 527 
61 1 Y 1 A THR 510 ? A THR 528 
62 1 Y 1 A SER 511 ? A SER 529 
63 1 Y 1 A VAL 512 ? A VAL 530 
64 1 Y 1 A ASP 513 ? A ASP 531 
65 1 Y 1 A PHE 514 ? A PHE 532 
66 1 Y 1 A LYS 515 ? A LYS 533 
67 1 Y 1 A ASP 516 ? A ASP 534 
68 1 Y 1 A THR 517 ? A THR 535 
69 1 Y 1 A ASP 518 ? A ASP 536 
70 1 Y 1 A TYR 519 ? A TYR 537 
71 1 Y 1 A LYS 520 ? A LYS 538 
72 1 Y 1 A ARG 521 ? A ARG 539 
73 1 Y 1 A HIS 522 ? A HIS 540 
74 1 Y 1 A GLN 523 ? A GLN 541 
75 1 Y 1 A LEU 524 ? A LEU 542 
76 1 Y 1 A THR 525 ? A THR 543 
77 1 Y 1 A ARG 526 ? A ARG 544 
78 1 Y 1 A SER 527 ? A SER 545 
79 1 Y 1 A ILE 528 ? A ILE 546 
80 1 Y 1 A SER 529 ? A SER 547 
81 1 Y 1 A GLU 530 ? A GLU 548 
82 1 Y 1 A ILE 531 ? A ILE 549 
83 1 Y 1 A LYS 532 ? A LYS 550 
84 1 Y 1 A PRO 533 ? A PRO 551 
85 1 Y 1 A PRO 534 ? A PRO 552 
86 1 Y 1 A ASN 535 ? A ASN 553 
87 1 Y 1 A LEU 536 ? A LEU 554 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
#