data_2XNF
# 
_entry.id   2XNF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XNF         
PDBE  EBI-44928    
WWPDB D_1290044928 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XNF 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-02 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vojnic, E.'       1  
'Mourao, A.'       2  
'Seizl, M.'        3  
'Simon, B.'        4  
'Wenzeck, L.'      5  
'Lariviere, L.'    6  
'Baumli, S.'       7  
'Meisterernst, M.' 8  
'Sattler, M.'      9  
'Cramer, P.'       10 
# 
_citation.id                        primary 
_citation.title                     'Structure and Vp16 Binding of the Mediator Med25 Activator Interaction Domain.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            18 
_citation.page_first                404 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21378965 
_citation.pdbx_database_id_DOI      10.1038/NSMB.1997 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vojnic, E.'       1  
primary 'Mourao, A.'       2  
primary 'Seizl, M.'        3  
primary 'Simon, B.'        4  
primary 'Wenzeck, L.'      5  
primary 'Lariviere, L.'    6  
primary 'Baumli, S.'       7  
primary 'Baumgart, K.'     8  
primary 'Meisterernst, M.' 9  
primary 'Sattler, M.'      10 
primary 'Cramer, P.'       11 
# 
_cell.entry_id           2XNF 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XNF 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'MEDIATOR OF RNA POLYMERASE II TRANSCRIPTION SUBUNIT 25' 
_entity.formula_weight             18284.301 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'MED25 ACID DOMAIN, RESIDUES 394-543' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;MEDIATOR COMPLEX SUBUNIT 25, ACTIVATOR-RECRUITED COFACTOR 92 KDA COMPONENT, ARC92, ACTIVATOR INTERACTION DOMAIN-CONTAINING PROTEIN 1, P78, MED25
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQ
FHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQ
FHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   VAL n 
1 4   SER n 
1 5   ASN n 
1 6   LYS n 
1 7   LEU n 
1 8   LEU n 
1 9   ALA n 
1 10  TRP n 
1 11  SER n 
1 12  GLY n 
1 13  VAL n 
1 14  LEU n 
1 15  GLU n 
1 16  TRP n 
1 17  GLN n 
1 18  GLU n 
1 19  LYS n 
1 20  PRO n 
1 21  LYS n 
1 22  PRO n 
1 23  ALA n 
1 24  SER n 
1 25  VAL n 
1 26  ASP n 
1 27  ALA n 
1 28  ASN n 
1 29  THR n 
1 30  LYS n 
1 31  LEU n 
1 32  THR n 
1 33  ARG n 
1 34  SER n 
1 35  LEU n 
1 36  PRO n 
1 37  CYS n 
1 38  GLN n 
1 39  VAL n 
1 40  TYR n 
1 41  VAL n 
1 42  ASN n 
1 43  HIS n 
1 44  GLY n 
1 45  GLU n 
1 46  ASN n 
1 47  LEU n 
1 48  LYS n 
1 49  THR n 
1 50  GLU n 
1 51  GLN n 
1 52  TRP n 
1 53  PRO n 
1 54  GLN n 
1 55  LYS n 
1 56  LEU n 
1 57  ILE n 
1 58  MET n 
1 59  GLN n 
1 60  LEU n 
1 61  ILE n 
1 62  PRO n 
1 63  GLN n 
1 64  GLN n 
1 65  LEU n 
1 66  LEU n 
1 67  THR n 
1 68  THR n 
1 69  LEU n 
1 70  GLY n 
1 71  PRO n 
1 72  LEU n 
1 73  PHE n 
1 74  ARG n 
1 75  ASN n 
1 76  SER n 
1 77  ARG n 
1 78  MET n 
1 79  VAL n 
1 80  GLN n 
1 81  PHE n 
1 82  HIS n 
1 83  PHE n 
1 84  THR n 
1 85  ASN n 
1 86  LYS n 
1 87  ASP n 
1 88  LEU n 
1 89  GLU n 
1 90  SER n 
1 91  LEU n 
1 92  LYS n 
1 93  GLY n 
1 94  LEU n 
1 95  TYR n 
1 96  ARG n 
1 97  ILE n 
1 98  MET n 
1 99  GLY n 
1 100 ASN n 
1 101 GLY n 
1 102 PHE n 
1 103 ALA n 
1 104 GLY n 
1 105 CYS n 
1 106 VAL n 
1 107 HIS n 
1 108 PHE n 
1 109 PRO n 
1 110 HIS n 
1 111 THR n 
1 112 ALA n 
1 113 PRO n 
1 114 CYS n 
1 115 GLU n 
1 116 VAL n 
1 117 ARG n 
1 118 VAL n 
1 119 LEU n 
1 120 MET n 
1 121 LEU n 
1 122 LEU n 
1 123 TYR n 
1 124 SER n 
1 125 SER n 
1 126 LYS n 
1 127 LYS n 
1 128 LYS n 
1 129 ILE n 
1 130 PHE n 
1 131 MET n 
1 132 GLY n 
1 133 LEU n 
1 134 ILE n 
1 135 PRO n 
1 136 TYR n 
1 137 ASP n 
1 138 GLN n 
1 139 SER n 
1 140 GLY n 
1 141 PHE n 
1 142 VAL n 
1 143 ASN n 
1 144 GLY n 
1 145 ILE n 
1 146 ARG n 
1 147 GLN n 
1 148 VAL n 
1 149 ILE n 
1 150 THR n 
1 151 ASN n 
1 152 LEU n 
1 153 GLU n 
1 154 HIS n 
1 155 HIS n 
1 156 HIS n 
1 157 HIS n 
1 158 HIS n 
1 159 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MED25_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q71SY5 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XNF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 151 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q71SY5 
_struct_ref_seq.db_align_beg                  394 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  543 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       394 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XNF MET A 1   ? UNP Q71SY5 ? ? 'expression tag' 393 1 
1 2XNF LEU A 152 ? UNP Q71SY5 ? ? 'expression tag' 544 2 
1 2XNF GLU A 153 ? UNP Q71SY5 ? ? 'expression tag' 545 3 
1 2XNF HIS A 154 ? UNP Q71SY5 ? ? 'expression tag' 546 4 
1 2XNF HIS A 155 ? UNP Q71SY5 ? ? 'expression tag' 547 5 
1 2XNF HIS A 156 ? UNP Q71SY5 ? ? 'expression tag' 548 6 
1 2XNF HIS A 157 ? UNP Q71SY5 ? ? 'expression tag' 549 7 
1 2XNF HIS A 158 ? UNP Q71SY5 ? ? 'expression tag' 550 8 
1 2XNF HIS A 159 ? UNP Q71SY5 ? ? 'expression tag' 551 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY      1 
2 2 HSQC       1 
3 3 HNCA       1 
4 4 HNCACB     1 
5 5 CBCACONH   1 
6 6 HCCH-TOCSY 1 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units 
_pdbx_nmr_exptl_sample_conditions.pH_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 295.0 atm 1.0 6.5 100 ?  pH K 
2 295.0 atm 1.0 6.5 100 mM pH K 
# 
_pdbx_nmr_sample_details.solution_id   1 
_pdbx_nmr_sample_details.contents      '90%WATER/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
1 Avance Bruker 900 
2 DMX    Bruker 600 
# 
_pdbx_nmr_refine.entry_id           2XNF 
_pdbx_nmr_refine.method             CYANA 
_pdbx_nmr_refine.details            WATER-REFINED 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2XNF 
_pdbx_nmr_details.text       
'THE STRUCTURE WAS DETERMINED USING MULTIDIMENSIONAL NMR SPECTROSCOPY ON 13C, 15N-LABELED MED25 ACID DOMAIN' 
# 
_pdbx_nmr_ensemble.entry_id                             2XNF 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    10 
_pdbx_nmr_ensemble.conformer_selection_criteria         ENERGY 
# 
_pdbx_nmr_representative.entry_id             2XNF 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS     ? 
'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ, RICE, SIMONSON,WARREN' 1 
'structure solution' NMRVIEW ? ? 2 
# 
_exptl.entry_id          2XNF 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2XNF 
_struct.title                     
'The Mediator Med25 activator interaction domain: Structure and cooperative binding of VP16 subdomains' 
_struct.pdbx_descriptor           'MEDIATOR OF RNA POLYMERASE II TRANSCRIPTION SUBUNIT 25' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XNF 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TRANSCRIPTION, ACTIVATED TRANSCRIPTION, MEDIATOR' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 48  ? TRP A 52  ? LYS A 440 TRP A 444 5 ? 5  
HELX_P HELX_P2 2 GLN A 63  ? THR A 67  ? GLN A 455 THR A 459 1 ? 5  
HELX_P HELX_P3 3 THR A 68  ? ARG A 74  ? THR A 460 ARG A 466 5 ? 7  
HELX_P HELX_P4 4 ASP A 87  ? ASN A 100 ? ASP A 479 ASN A 492 1 ? 14 
HELX_P HELX_P5 5 ASP A 137 ? HIS A 156 ? ASP A 529 HIS A 548 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AA 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 7   ? GLN A 17  ? LEU A 399 GLN A 409 
AA 2 THR A 32  ? ASN A 42  ? THR A 424 ASN A 434 
AA 3 SER A 76  ? PHE A 83  ? SER A 468 PHE A 475 
AA 4 ILE A 129 ? PRO A 135 ? ILE A 521 PRO A 527 
AA 5 VAL A 118 ? SER A 124 ? VAL A 510 SER A 516 
AA 6 PHE A 102 ? HIS A 107 ? PHE A 494 HIS A 499 
AA 7 LYS A 55  ? PRO A 62  ? LYS A 447 PRO A 454 
AA 8 LEU A 7   ? GLN A 17  ? LEU A 399 GLN A 409 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N TRP A 16  ? N TRP A 408 O ARG A 33  ? O ARG A 425 
AA 2 3 N ASN A 42  ? N ASN A 434 O MET A 78  ? O MET A 470 
AA 3 4 N PHE A 81  ? N PHE A 473 O PHE A 130 ? O PHE A 522 
AA 4 5 O PRO A 135 ? O PRO A 527 N VAL A 118 ? N VAL A 510 
AA 5 6 N LEU A 121 ? N LEU A 513 O GLY A 104 ? O GLY A 496 
AA 6 7 N HIS A 107 ? N HIS A 499 O ILE A 57  ? O ILE A 449 
AA 7 8 N LEU A 56  ? N LEU A 448 O VAL A 13  ? O VAL A 405 
# 
_database_PDB_matrix.entry_id          2XNF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XNF 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 27.357  3.040   -1.459  1.00 0.00 ? 393 MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 28.105  4.143   -0.840  1.00 0.00 ? 393 MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 27.134  5.142   -0.227  1.00 0.00 ? 393 MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 26.210  5.599   -0.895  1.00 0.00 ? 393 MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 29.040  4.830   -1.868  1.00 0.00 ? 393 MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 28.329  5.452   -3.074  1.00 0.00 ? 393 MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 29.461  6.177   -4.283  1.00 0.00 ? 393 MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 30.259  7.450   -3.301  1.00 0.00 ? 393 MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 26.706  3.396   -2.188  1.00 0.00 ? 393 MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? 27.988  2.347   -1.909  1.00 0.00 ? 393 MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? 26.789  2.530   -0.756  1.00 0.00 ? 393 MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? 28.695  3.724   -0.038  1.00 0.00 ? 393 MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? 29.585  5.613   -1.362  1.00 0.00 ? 393 MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? 29.746  4.098   -2.231  1.00 0.00 ? 393 MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? 27.742  4.693   -3.569  1.00 0.00 ? 393 MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? 27.669  6.227   -2.714  1.00 0.00 ? 393 MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? 29.514  8.133   -2.920  1.00 0.00 ? 393 MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? 30.786  6.993   -2.476  1.00 0.00 ? 393 MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? 30.964  7.991   -3.915  1.00 0.00 ? 393 MET A HE3  1  
ATOM 20    N N    . SER A 1 2   ? 27.321  5.434   1.059   1.00 0.00 ? 394 SER A N    1  
ATOM 21    C CA   . SER A 1 2   ? 26.487  6.351   1.860   1.00 0.00 ? 394 SER A CA   1  
ATOM 22    C C    . SER A 1 2   ? 25.070  5.813   2.123   1.00 0.00 ? 394 SER A C    1  
ATOM 23    O O    . SER A 1 2   ? 24.604  5.809   3.267   1.00 0.00 ? 394 SER A O    1  
ATOM 24    C CB   . SER A 1 2   ? 26.431  7.778   1.281   1.00 0.00 ? 394 SER A CB   1  
ATOM 25    O OG   . SER A 1 2   ? 25.598  8.608   2.088   1.00 0.00 ? 394 SER A OG   1  
ATOM 26    H H    . SER A 1 2   ? 28.068  5.013   1.538   1.00 0.00 ? 394 SER A H    1  
ATOM 27    H HA   . SER A 1 2   ? 26.971  6.399   2.825   1.00 0.00 ? 394 SER A HA   1  
ATOM 28    H HB2  . SER A 1 2   ? 27.425  8.198   1.253   1.00 0.00 ? 394 SER A HB2  1  
ATOM 29    H HB3  . SER A 1 2   ? 26.024  7.741   0.282   1.00 0.00 ? 394 SER A HB3  1  
ATOM 30    H HG   . SER A 1 2   ? 25.598  9.503   1.717   1.00 0.00 ? 394 SER A HG   1  
ATOM 31    N N    . VAL A 1 3   ? 24.396  5.394   1.076   1.00 0.00 ? 395 VAL A N    1  
ATOM 32    C CA   . VAL A 1 3   ? 23.052  4.884   1.153   1.00 0.00 ? 395 VAL A CA   1  
ATOM 33    C C    . VAL A 1 3   ? 23.027  3.562   1.907   1.00 0.00 ? 395 VAL A C    1  
ATOM 34    O O    . VAL A 1 3   ? 23.459  2.523   1.385   1.00 0.00 ? 395 VAL A O    1  
ATOM 35    C CB   . VAL A 1 3   ? 22.446  4.709   -0.262  1.00 0.00 ? 395 VAL A CB   1  
ATOM 36    C CG1  . VAL A 1 3   ? 21.048  4.122   -0.195  1.00 0.00 ? 395 VAL A CG1  1  
ATOM 37    C CG2  . VAL A 1 3   ? 22.426  6.040   -0.996  1.00 0.00 ? 395 VAL A CG2  1  
ATOM 38    H H    . VAL A 1 3   ? 24.840  5.442   0.200   1.00 0.00 ? 395 VAL A H    1  
ATOM 39    H HA   . VAL A 1 3   ? 22.464  5.612   1.689   1.00 0.00 ? 395 VAL A HA   1  
ATOM 40    H HB   . VAL A 1 3   ? 23.076  4.029   -0.817  1.00 0.00 ? 395 VAL A HB   1  
ATOM 41    H HG11 . VAL A 1 3   ? 20.408  4.778   0.375   1.00 0.00 ? 395 VAL A HG11 1  
ATOM 42    H HG12 . VAL A 1 3   ? 20.653  4.013   -1.194  1.00 0.00 ? 395 VAL A HG12 1  
ATOM 43    H HG13 . VAL A 1 3   ? 21.091  3.154   0.283   1.00 0.00 ? 395 VAL A HG13 1  
ATOM 44    H HG21 . VAL A 1 3   ? 21.840  6.752   -0.433  1.00 0.00 ? 395 VAL A HG21 1  
ATOM 45    H HG22 . VAL A 1 3   ? 23.436  6.408   -1.102  1.00 0.00 ? 395 VAL A HG22 1  
ATOM 46    H HG23 . VAL A 1 3   ? 21.987  5.905   -1.973  1.00 0.00 ? 395 VAL A HG23 1  
ATOM 47    N N    . SER A 1 4   ? 22.584  3.613   3.135   1.00 0.00 ? 396 SER A N    1  
ATOM 48    C CA   . SER A 1 4   ? 22.528  2.436   3.955   1.00 0.00 ? 396 SER A CA   1  
ATOM 49    C C    . SER A 1 4   ? 21.252  2.438   4.827   1.00 0.00 ? 396 SER A C    1  
ATOM 50    O O    . SER A 1 4   ? 20.860  1.395   5.354   1.00 0.00 ? 396 SER A O    1  
ATOM 51    C CB   . SER A 1 4   ? 23.813  2.345   4.817   1.00 0.00 ? 396 SER A CB   1  
ATOM 52    O OG   . SER A 1 4   ? 23.964  1.071   5.443   1.00 0.00 ? 396 SER A OG   1  
ATOM 53    H H    . SER A 1 4   ? 22.318  4.481   3.505   1.00 0.00 ? 396 SER A H    1  
ATOM 54    H HA   . SER A 1 4   ? 22.495  1.582   3.295   1.00 0.00 ? 396 SER A HA   1  
ATOM 55    H HB2  . SER A 1 4   ? 24.676  2.518   4.191   1.00 0.00 ? 396 SER A HB2  1  
ATOM 56    H HB3  . SER A 1 4   ? 23.776  3.101   5.588   1.00 0.00 ? 396 SER A HB3  1  
ATOM 57    H HG   . SER A 1 4   ? 24.608  0.580   4.917   1.00 0.00 ? 396 SER A HG   1  
ATOM 58    N N    . ASN A 1 5   ? 20.583  3.595   4.948   1.00 0.00 ? 397 ASN A N    1  
ATOM 59    C CA   . ASN A 1 5   ? 19.359  3.666   5.761   1.00 0.00 ? 397 ASN A CA   1  
ATOM 60    C C    . ASN A 1 5   ? 18.221  3.043   5.004   1.00 0.00 ? 397 ASN A C    1  
ATOM 61    O O    . ASN A 1 5   ? 17.515  2.182   5.512   1.00 0.00 ? 397 ASN A O    1  
ATOM 62    C CB   . ASN A 1 5   ? 18.962  5.108   6.146   1.00 0.00 ? 397 ASN A CB   1  
ATOM 63    C CG   . ASN A 1 5   ? 20.022  5.883   6.901   1.00 0.00 ? 397 ASN A CG   1  
ATOM 64    O OD1  . ASN A 1 5   ? 20.799  6.634   6.305   1.00 0.00 ? 397 ASN A OD1  1  
ATOM 65    N ND2  . ASN A 1 5   ? 20.086  5.705   8.191   1.00 0.00 ? 397 ASN A ND2  1  
ATOM 66    H H    . ASN A 1 5   ? 20.902  4.403   4.496   1.00 0.00 ? 397 ASN A H    1  
ATOM 67    H HA   . ASN A 1 5   ? 19.533  3.090   6.657   1.00 0.00 ? 397 ASN A HA   1  
ATOM 68    H HB2  . ASN A 1 5   ? 18.739  5.656   5.243   1.00 0.00 ? 397 ASN A HB2  1  
ATOM 69    H HB3  . ASN A 1 5   ? 18.070  5.069   6.754   1.00 0.00 ? 397 ASN A HB3  1  
ATOM 70    H HD21 . ASN A 1 5   ? 19.453  5.076   8.604   1.00 0.00 ? 397 ASN A HD21 1  
ATOM 71    H HD22 . ASN A 1 5   ? 20.763  6.204   8.696   1.00 0.00 ? 397 ASN A HD22 1  
ATOM 72    N N    . LYS A 1 6   ? 18.060  3.485   3.783   1.00 0.00 ? 398 LYS A N    1  
ATOM 73    C CA   . LYS A 1 6   ? 17.048  2.986   2.900   1.00 0.00 ? 398 LYS A CA   1  
ATOM 74    C C    . LYS A 1 6   ? 17.562  2.978   1.489   1.00 0.00 ? 398 LYS A C    1  
ATOM 75    O O    . LYS A 1 6   ? 18.221  3.918   1.067   1.00 0.00 ? 398 LYS A O    1  
ATOM 76    C CB   . LYS A 1 6   ? 15.695  3.718   3.081   1.00 0.00 ? 398 LYS A CB   1  
ATOM 77    C CG   . LYS A 1 6   ? 15.758  5.240   3.170   1.00 0.00 ? 398 LYS A CG   1  
ATOM 78    C CD   . LYS A 1 6   ? 16.040  5.923   1.852   1.00 0.00 ? 398 LYS A CD   1  
ATOM 79    C CE   . LYS A 1 6   ? 16.171  7.392   2.086   1.00 0.00 ? 398 LYS A CE   1  
ATOM 80    N NZ   . LYS A 1 6   ? 16.385  8.173   0.842   1.00 0.00 ? 398 LYS A NZ   1  
ATOM 81    H H    . LYS A 1 6   ? 18.667  4.169   3.435   1.00 0.00 ? 398 LYS A H    1  
ATOM 82    H HA   . LYS A 1 6   ? 16.922  1.959   3.189   1.00 0.00 ? 398 LYS A HA   1  
ATOM 83    H HB2  . LYS A 1 6   ? 15.056  3.469   2.247   1.00 0.00 ? 398 LYS A HB2  1  
ATOM 84    H HB3  . LYS A 1 6   ? 15.232  3.346   3.983   1.00 0.00 ? 398 LYS A HB3  1  
ATOM 85    H HG2  . LYS A 1 6   ? 14.811  5.603   3.541   1.00 0.00 ? 398 LYS A HG2  1  
ATOM 86    H HG3  . LYS A 1 6   ? 16.531  5.502   3.877   1.00 0.00 ? 398 LYS A HG3  1  
ATOM 87    H HD2  . LYS A 1 6   ? 16.961  5.537   1.442   1.00 0.00 ? 398 LYS A HD2  1  
ATOM 88    H HD3  . LYS A 1 6   ? 15.225  5.741   1.168   1.00 0.00 ? 398 LYS A HD3  1  
ATOM 89    H HE2  . LYS A 1 6   ? 15.277  7.719   2.594   1.00 0.00 ? 398 LYS A HE2  1  
ATOM 90    H HE3  . LYS A 1 6   ? 17.024  7.489   2.741   1.00 0.00 ? 398 LYS A HE3  1  
ATOM 91    H HZ1  . LYS A 1 6   ? 15.634  8.060   0.135   1.00 0.00 ? 398 LYS A HZ1  1  
ATOM 92    H HZ2  . LYS A 1 6   ? 16.430  9.181   1.100   1.00 0.00 ? 398 LYS A HZ2  1  
ATOM 93    H HZ3  . LYS A 1 6   ? 17.302  7.949   0.405   1.00 0.00 ? 398 LYS A HZ3  1  
ATOM 94    N N    . LEU A 1 7   ? 17.314  1.912   0.791   1.00 0.00 ? 399 LEU A N    1  
ATOM 95    C CA   . LEU A 1 7   ? 17.847  1.724   -0.544  1.00 0.00 ? 399 LEU A CA   1  
ATOM 96    C C    . LEU A 1 7   ? 16.767  2.010   -1.550  1.00 0.00 ? 399 LEU A C    1  
ATOM 97    O O    . LEU A 1 7   ? 15.656  1.546   -1.386  1.00 0.00 ? 399 LEU A O    1  
ATOM 98    C CB   . LEU A 1 7   ? 18.331  0.268   -0.755  1.00 0.00 ? 399 LEU A CB   1  
ATOM 99    C CG   . LEU A 1 7   ? 19.388  -0.313  0.214   1.00 0.00 ? 399 LEU A CG   1  
ATOM 100   C CD1  . LEU A 1 7   ? 18.819  -0.580  1.601   1.00 0.00 ? 399 LEU A CD1  1  
ATOM 101   C CD2  . LEU A 1 7   ? 19.968  -1.579  -0.358  1.00 0.00 ? 399 LEU A CD2  1  
ATOM 102   H H    . LEU A 1 7   ? 16.733  1.213   1.170   1.00 0.00 ? 399 LEU A H    1  
ATOM 103   H HA   . LEU A 1 7   ? 18.680  2.395   -0.689  1.00 0.00 ? 399 LEU A HA   1  
ATOM 104   H HB2  . LEU A 1 7   ? 17.464  -0.373  -0.702  1.00 0.00 ? 399 LEU A HB2  1  
ATOM 105   H HB3  . LEU A 1 7   ? 18.727  0.201   -1.758  1.00 0.00 ? 399 LEU A HB3  1  
ATOM 106   H HG   . LEU A 1 7   ? 20.193  0.397   0.331   1.00 0.00 ? 399 LEU A HG   1  
ATOM 107   H HD11 . LEU A 1 7   ? 18.443  0.342   2.019   1.00 0.00 ? 399 LEU A HD11 1  
ATOM 108   H HD12 . LEU A 1 7   ? 18.015  -1.297  1.528   1.00 0.00 ? 399 LEU A HD12 1  
ATOM 109   H HD13 . LEU A 1 7   ? 19.596  -0.974  2.240   1.00 0.00 ? 399 LEU A HD13 1  
ATOM 110   H HD21 . LEU A 1 7   ? 19.178  -2.301  -0.508  1.00 0.00 ? 399 LEU A HD21 1  
ATOM 111   H HD22 . LEU A 1 7   ? 20.452  -1.365  -1.299  1.00 0.00 ? 399 LEU A HD22 1  
ATOM 112   H HD23 . LEU A 1 7   ? 20.693  -1.973  0.339   1.00 0.00 ? 399 LEU A HD23 1  
ATOM 113   N N    . LEU A 1 8   ? 17.074  2.755   -2.584  1.00 0.00 ? 400 LEU A N    1  
ATOM 114   C CA   . LEU A 1 8   ? 16.084  3.047   -3.592  1.00 0.00 ? 400 LEU A CA   1  
ATOM 115   C C    . LEU A 1 8   ? 15.924  1.798   -4.436  1.00 0.00 ? 400 LEU A C    1  
ATOM 116   O O    . LEU A 1 8   ? 16.907  1.247   -4.957  1.00 0.00 ? 400 LEU A O    1  
ATOM 117   C CB   . LEU A 1 8   ? 16.506  4.274   -4.420  1.00 0.00 ? 400 LEU A CB   1  
ATOM 118   C CG   . LEU A 1 8   ? 15.390  5.043   -5.160  1.00 0.00 ? 400 LEU A CG   1  
ATOM 119   C CD1  . LEU A 1 8   ? 15.949  6.309   -5.750  1.00 0.00 ? 400 LEU A CD1  1  
ATOM 120   C CD2  . LEU A 1 8   ? 14.744  4.213   -6.252  1.00 0.00 ? 400 LEU A CD2  1  
ATOM 121   H H    . LEU A 1 8   ? 17.989  3.098   -2.690  1.00 0.00 ? 400 LEU A H    1  
ATOM 122   H HA   . LEU A 1 8   ? 15.134  3.226   -3.112  1.00 0.00 ? 400 LEU A HA   1  
ATOM 123   H HB2  . LEU A 1 8   ? 17.001  4.968   -3.757  1.00 0.00 ? 400 LEU A HB2  1  
ATOM 124   H HB3  . LEU A 1 8   ? 17.224  3.943   -5.155  1.00 0.00 ? 400 LEU A HB3  1  
ATOM 125   H HG   . LEU A 1 8   ? 14.631  5.328   -4.445  1.00 0.00 ? 400 LEU A HG   1  
ATOM 126   H HD11 . LEU A 1 8   ? 16.348  6.917   -4.951  1.00 0.00 ? 400 LEU A HD11 1  
ATOM 127   H HD12 . LEU A 1 8   ? 16.736  6.069   -6.449  1.00 0.00 ? 400 LEU A HD12 1  
ATOM 128   H HD13 . LEU A 1 8   ? 15.161  6.846   -6.255  1.00 0.00 ? 400 LEU A HD13 1  
ATOM 129   H HD21 . LEU A 1 8   ? 14.326  3.321   -5.810  1.00 0.00 ? 400 LEU A HD21 1  
ATOM 130   H HD22 . LEU A 1 8   ? 13.962  4.786   -6.726  1.00 0.00 ? 400 LEU A HD22 1  
ATOM 131   H HD23 . LEU A 1 8   ? 15.491  3.940   -6.982  1.00 0.00 ? 400 LEU A HD23 1  
ATOM 132   N N    . ALA A 1 9   ? 14.719  1.328   -4.537  1.00 0.00 ? 401 ALA A N    1  
ATOM 133   C CA   . ALA A 1 9   ? 14.481  0.083   -5.191  1.00 0.00 ? 401 ALA A CA   1  
ATOM 134   C C    . ALA A 1 9   ? 13.581  0.205   -6.404  1.00 0.00 ? 401 ALA A C    1  
ATOM 135   O O    . ALA A 1 9   ? 13.848  -0.411  -7.436  1.00 0.00 ? 401 ALA A O    1  
ATOM 136   C CB   . ALA A 1 9   ? 13.900  -0.888  -4.194  1.00 0.00 ? 401 ALA A CB   1  
ATOM 137   H H    . ALA A 1 9   ? 13.962  1.821   -4.147  1.00 0.00 ? 401 ALA A H    1  
ATOM 138   H HA   . ALA A 1 9   ? 15.434  -0.318  -5.500  1.00 0.00 ? 401 ALA A HA   1  
ATOM 139   H HB1  . ALA A 1 9   ? 12.930  -0.521  -3.891  1.00 0.00 ? 401 ALA A HB1  1  
ATOM 140   H HB2  . ALA A 1 9   ? 13.809  -1.871  -4.629  1.00 0.00 ? 401 ALA A HB2  1  
ATOM 141   H HB3  . ALA A 1 9   ? 14.546  -0.920  -3.328  1.00 0.00 ? 401 ALA A HB3  1  
ATOM 142   N N    . TRP A 1 10  ? 12.544  0.998   -6.310  1.00 0.00 ? 402 TRP A N    1  
ATOM 143   C CA   . TRP A 1 10  ? 11.565  1.054   -7.362  1.00 0.00 ? 402 TRP A CA   1  
ATOM 144   C C    . TRP A 1 10  ? 10.979  2.434   -7.426  1.00 0.00 ? 402 TRP A C    1  
ATOM 145   O O    . TRP A 1 10  ? 10.986  3.159   -6.446  1.00 0.00 ? 402 TRP A O    1  
ATOM 146   C CB   . TRP A 1 10  ? 10.464  -0.002  -7.097  1.00 0.00 ? 402 TRP A CB   1  
ATOM 147   C CG   . TRP A 1 10  ? 9.400   -0.104  -8.154  1.00 0.00 ? 402 TRP A CG   1  
ATOM 148   C CD1  . TRP A 1 10  ? 9.530   -0.624  -9.403  1.00 0.00 ? 402 TRP A CD1  1  
ATOM 149   C CD2  . TRP A 1 10  ? 8.034   0.295   -8.029  1.00 0.00 ? 402 TRP A CD2  1  
ATOM 150   N NE1  . TRP A 1 10  ? 8.337   -0.547  -10.071 1.00 0.00 ? 402 TRP A NE1  1  
ATOM 151   C CE2  . TRP A 1 10  ? 7.399   0.009   -9.245  1.00 0.00 ? 402 TRP A CE2  1  
ATOM 152   C CE3  . TRP A 1 10  ? 7.295   0.870   -7.007  1.00 0.00 ? 402 TRP A CE3  1  
ATOM 153   C CZ2  . TRP A 1 10  ? 6.054   0.285   -9.462  1.00 0.00 ? 402 TRP A CZ2  1  
ATOM 154   C CZ3  . TRP A 1 10  ? 5.963   1.140   -7.216  1.00 0.00 ? 402 TRP A CZ3  1  
ATOM 155   C CH2  . TRP A 1 10  ? 5.352   0.847   -8.436  1.00 0.00 ? 402 TRP A CH2  1  
ATOM 156   H H    . TRP A 1 10  ? 12.404  1.602   -5.546  1.00 0.00 ? 402 TRP A H    1  
ATOM 157   H HA   . TRP A 1 10  ? 12.047  0.822   -8.300  1.00 0.00 ? 402 TRP A HA   1  
ATOM 158   H HB2  . TRP A 1 10  ? 10.927  -0.973  -7.020  1.00 0.00 ? 402 TRP A HB2  1  
ATOM 159   H HB3  . TRP A 1 10  ? 9.984   0.226   -6.158  1.00 0.00 ? 402 TRP A HB3  1  
ATOM 160   H HD1  . TRP A 1 10  ? 10.451  -1.020  -9.801  1.00 0.00 ? 402 TRP A HD1  1  
ATOM 161   H HE1  . TRP A 1 10  ? 8.180   -0.852  -10.992 1.00 0.00 ? 402 TRP A HE1  1  
ATOM 162   H HE3  . TRP A 1 10  ? 7.757   1.102   -6.059  1.00 0.00 ? 402 TRP A HE3  1  
ATOM 163   H HZ2  . TRP A 1 10  ? 5.567   0.069   -10.400 1.00 0.00 ? 402 TRP A HZ2  1  
ATOM 164   H HZ3  . TRP A 1 10  ? 5.381   1.583   -6.421  1.00 0.00 ? 402 TRP A HZ3  1  
ATOM 165   H HH2  . TRP A 1 10  ? 4.304   1.073   -8.557  1.00 0.00 ? 402 TRP A HH2  1  
ATOM 166   N N    . SER A 1 11  ? 10.591  2.834   -8.573  1.00 0.00 ? 403 SER A N    1  
ATOM 167   C CA   . SER A 1 11  ? 9.910   4.067   -8.762  1.00 0.00 ? 403 SER A CA   1  
ATOM 168   C C    . SER A 1 11  ? 8.797   3.823   -9.769  1.00 0.00 ? 403 SER A C    1  
ATOM 169   O O    . SER A 1 11  ? 9.060   3.421   -10.906 1.00 0.00 ? 403 SER A O    1  
ATOM 170   C CB   . SER A 1 11  ? 10.903  5.125   -9.227  1.00 0.00 ? 403 SER A CB   1  
ATOM 171   O OG   . SER A 1 11  ? 11.952  5.266   -8.267  1.00 0.00 ? 403 SER A OG   1  
ATOM 172   H H    . SER A 1 11  ? 10.753  2.280   -9.368  1.00 0.00 ? 403 SER A H    1  
ATOM 173   H HA   . SER A 1 11  ? 9.477   4.358   -7.816  1.00 0.00 ? 403 SER A HA   1  
ATOM 174   H HB2  . SER A 1 11  ? 11.341  4.800   -10.158 1.00 0.00 ? 403 SER A HB2  1  
ATOM 175   H HB3  . SER A 1 11  ? 10.405  6.075   -9.344  1.00 0.00 ? 403 SER A HB3  1  
ATOM 176   H HG   . SER A 1 11  ? 11.740  4.638   -7.565  1.00 0.00 ? 403 SER A HG   1  
ATOM 177   N N    . GLY A 1 12  ? 7.579   4.012   -9.344  1.00 0.00 ? 404 GLY A N    1  
ATOM 178   C CA   . GLY A 1 12  ? 6.455   3.698   -10.174 1.00 0.00 ? 404 GLY A CA   1  
ATOM 179   C C    . GLY A 1 12  ? 5.223   4.402   -9.708  1.00 0.00 ? 404 GLY A C    1  
ATOM 180   O O    . GLY A 1 12  ? 5.282   5.222   -8.778  1.00 0.00 ? 404 GLY A O    1  
ATOM 181   H H    . GLY A 1 12  ? 7.405   4.403   -8.459  1.00 0.00 ? 404 GLY A H    1  
ATOM 182   H HA2  . GLY A 1 12  ? 6.667   3.963   -11.199 1.00 0.00 ? 404 GLY A HA2  1  
ATOM 183   H HA3  . GLY A 1 12  ? 6.280   2.633   -10.121 1.00 0.00 ? 404 GLY A HA3  1  
ATOM 184   N N    . VAL A 1 13  ? 4.115   4.072   -10.295 1.00 0.00 ? 405 VAL A N    1  
ATOM 185   C CA   . VAL A 1 13  ? 2.879   4.733   -10.004 1.00 0.00 ? 405 VAL A CA   1  
ATOM 186   C C    . VAL A 1 13  ? 1.972   3.787   -9.226  1.00 0.00 ? 405 VAL A C    1  
ATOM 187   O O    . VAL A 1 13  ? 1.940   2.587   -9.486  1.00 0.00 ? 405 VAL A O    1  
ATOM 188   C CB   . VAL A 1 13  ? 2.175   5.193   -11.328 1.00 0.00 ? 405 VAL A CB   1  
ATOM 189   C CG1  . VAL A 1 13  ? 0.889   5.956   -11.052 1.00 0.00 ? 405 VAL A CG1  1  
ATOM 190   C CG2  . VAL A 1 13  ? 3.115   6.039   -12.181 1.00 0.00 ? 405 VAL A CG2  1  
ATOM 191   H H    . VAL A 1 13  ? 4.082   3.312   -10.920 1.00 0.00 ? 405 VAL A H    1  
ATOM 192   H HA   . VAL A 1 13  ? 3.088   5.605   -9.402  1.00 0.00 ? 405 VAL A HA   1  
ATOM 193   H HB   . VAL A 1 13  ? 1.920   4.307   -11.889 1.00 0.00 ? 405 VAL A HB   1  
ATOM 194   H HG11 . VAL A 1 13  ? 1.111   6.834   -10.465 1.00 0.00 ? 405 VAL A HG11 1  
ATOM 195   H HG12 . VAL A 1 13  ? 0.441   6.252   -11.989 1.00 0.00 ? 405 VAL A HG12 1  
ATOM 196   H HG13 . VAL A 1 13  ? 0.202   5.324   -10.508 1.00 0.00 ? 405 VAL A HG13 1  
ATOM 197   H HG21 . VAL A 1 13  ? 3.988   5.456   -12.435 1.00 0.00 ? 405 VAL A HG21 1  
ATOM 198   H HG22 . VAL A 1 13  ? 2.608   6.341   -13.086 1.00 0.00 ? 405 VAL A HG22 1  
ATOM 199   H HG23 . VAL A 1 13  ? 3.415   6.916   -11.626 1.00 0.00 ? 405 VAL A HG23 1  
ATOM 200   N N    . LEU A 1 14  ? 1.256   4.313   -8.288  1.00 0.00 ? 406 LEU A N    1  
ATOM 201   C CA   . LEU A 1 14  ? 0.339   3.521   -7.521  1.00 0.00 ? 406 LEU A CA   1  
ATOM 202   C C    . LEU A 1 14  ? -1.030  3.975   -7.848  1.00 0.00 ? 406 LEU A C    1  
ATOM 203   O O    . LEU A 1 14  ? -1.258  5.174   -8.078  1.00 0.00 ? 406 LEU A O    1  
ATOM 204   C CB   . LEU A 1 14  ? 0.550   3.718   -6.016  1.00 0.00 ? 406 LEU A CB   1  
ATOM 205   C CG   . LEU A 1 14  ? 1.925   3.399   -5.444  1.00 0.00 ? 406 LEU A CG   1  
ATOM 206   C CD1  . LEU A 1 14  ? 1.938   3.690   -3.957  1.00 0.00 ? 406 LEU A CD1  1  
ATOM 207   C CD2  . LEU A 1 14  ? 2.298   1.950   -5.696  1.00 0.00 ? 406 LEU A CD2  1  
ATOM 208   H H    . LEU A 1 14  ? 1.329   5.271   -8.077  1.00 0.00 ? 406 LEU A H    1  
ATOM 209   H HA   . LEU A 1 14  ? 0.424   2.474   -7.764  1.00 0.00 ? 406 LEU A HA   1  
ATOM 210   H HB2  . LEU A 1 14  ? 0.338   4.753   -5.790  1.00 0.00 ? 406 LEU A HB2  1  
ATOM 211   H HB3  . LEU A 1 14  ? -0.179  3.111   -5.500  1.00 0.00 ? 406 LEU A HB3  1  
ATOM 212   H HG   . LEU A 1 14  ? 2.660   4.033   -5.918  1.00 0.00 ? 406 LEU A HG   1  
ATOM 213   H HD11 . LEU A 1 14  ? 1.688   4.726   -3.787  1.00 0.00 ? 406 LEU A HD11 1  
ATOM 214   H HD12 . LEU A 1 14  ? 1.211   3.062   -3.461  1.00 0.00 ? 406 LEU A HD12 1  
ATOM 215   H HD13 . LEU A 1 14  ? 2.918   3.485   -3.553  1.00 0.00 ? 406 LEU A HD13 1  
ATOM 216   H HD21 . LEU A 1 14  ? 2.297   1.754   -6.758  1.00 0.00 ? 406 LEU A HD21 1  
ATOM 217   H HD22 . LEU A 1 14  ? 3.280   1.757   -5.292  1.00 0.00 ? 406 LEU A HD22 1  
ATOM 218   H HD23 . LEU A 1 14  ? 1.576   1.312   -5.209  1.00 0.00 ? 406 LEU A HD23 1  
ATOM 219   N N    . GLU A 1 15  ? -1.925  3.050   -7.936  1.00 0.00 ? 407 GLU A N    1  
ATOM 220   C CA   . GLU A 1 15  ? -3.278  3.372   -8.137  1.00 0.00 ? 407 GLU A CA   1  
ATOM 221   C C    . GLU A 1 15  ? -4.064  2.925   -6.937  1.00 0.00 ? 407 GLU A C    1  
ATOM 222   O O    . GLU A 1 15  ? -3.999  1.756   -6.521  1.00 0.00 ? 407 GLU A O    1  
ATOM 223   C CB   . GLU A 1 15  ? -3.801  2.822   -9.472  1.00 0.00 ? 407 GLU A CB   1  
ATOM 224   C CG   . GLU A 1 15  ? -3.396  3.700   -10.660 1.00 0.00 ? 407 GLU A CG   1  
ATOM 225   C CD   . GLU A 1 15  ? -3.903  3.233   -12.001 1.00 0.00 ? 407 GLU A CD   1  
ATOM 226   O OE1  . GLU A 1 15  ? -5.119  3.182   -12.194 1.00 0.00 ? 407 GLU A OE1  1  
ATOM 227   O OE2  . GLU A 1 15  ? -3.080  2.989   -12.929 1.00 0.00 ? 407 GLU A OE2  1  
ATOM 228   H H    . GLU A 1 15  ? -1.685  2.101   -7.827  1.00 0.00 ? 407 GLU A H    1  
ATOM 229   H HA   . GLU A 1 15  ? -3.321  4.453   -8.162  1.00 0.00 ? 407 GLU A HA   1  
ATOM 230   H HB2  . GLU A 1 15  ? -3.397  1.831   -9.621  1.00 0.00 ? 407 GLU A HB2  1  
ATOM 231   H HB3  . GLU A 1 15  ? -4.874  2.766   -9.429  1.00 0.00 ? 407 GLU A HB3  1  
ATOM 232   H HG2  . GLU A 1 15  ? -3.849  4.665   -10.488 1.00 0.00 ? 407 GLU A HG2  1  
ATOM 233   H HG3  . GLU A 1 15  ? -2.321  3.794   -10.690 1.00 0.00 ? 407 GLU A HG3  1  
ATOM 234   N N    . TRP A 1 16  ? -4.780  3.849   -6.368  1.00 0.00 ? 408 TRP A N    1  
ATOM 235   C CA   . TRP A 1 16  ? -5.474  3.612   -5.146  1.00 0.00 ? 408 TRP A CA   1  
ATOM 236   C C    . TRP A 1 16  ? -6.957  3.740   -5.297  1.00 0.00 ? 408 TRP A C    1  
ATOM 237   O O    . TRP A 1 16  ? -7.473  4.631   -6.022  1.00 0.00 ? 408 TRP A O    1  
ATOM 238   C CB   . TRP A 1 16  ? -4.942  4.509   -3.997  1.00 0.00 ? 408 TRP A CB   1  
ATOM 239   C CG   . TRP A 1 16  ? -4.989  5.996   -4.236  1.00 0.00 ? 408 TRP A CG   1  
ATOM 240   C CD1  . TRP A 1 16  ? -4.041  6.752   -4.861  1.00 0.00 ? 408 TRP A CD1  1  
ATOM 241   C CD2  . TRP A 1 16  ? -6.012  6.908   -3.808  1.00 0.00 ? 408 TRP A CD2  1  
ATOM 242   N NE1  . TRP A 1 16  ? -4.420  8.070   -4.872  1.00 0.00 ? 408 TRP A NE1  1  
ATOM 243   C CE2  . TRP A 1 16  ? -5.624  8.194   -4.228  1.00 0.00 ? 408 TRP A CE2  1  
ATOM 244   C CE3  . TRP A 1 16  ? -7.220  6.759   -3.119  1.00 0.00 ? 408 TRP A CE3  1  
ATOM 245   C CZ2  . TRP A 1 16  ? -6.401  9.325   -3.981  1.00 0.00 ? 408 TRP A CZ2  1  
ATOM 246   C CZ3  . TRP A 1 16  ? -7.988  7.879   -2.873  1.00 0.00 ? 408 TRP A CZ3  1  
ATOM 247   C CH2  . TRP A 1 16  ? -7.576  9.147   -3.302  1.00 0.00 ? 408 TRP A CH2  1  
ATOM 248   H H    . TRP A 1 16  ? -4.846  4.729   -6.803  1.00 0.00 ? 408 TRP A H    1  
ATOM 249   H HA   . TRP A 1 16  ? -5.268  2.587   -4.873  1.00 0.00 ? 408 TRP A HA   1  
ATOM 250   H HB2  . TRP A 1 16  ? -5.512  4.314   -3.102  1.00 0.00 ? 408 TRP A HB2  1  
ATOM 251   H HB3  . TRP A 1 16  ? -3.911  4.249   -3.807  1.00 0.00 ? 408 TRP A HB3  1  
ATOM 252   H HD1  . TRP A 1 16  ? -3.135  6.353   -5.292  1.00 0.00 ? 408 TRP A HD1  1  
ATOM 253   H HE1  . TRP A 1 16  ? -3.903  8.801   -5.272  1.00 0.00 ? 408 TRP A HE1  1  
ATOM 254   H HE3  . TRP A 1 16  ? -7.554  5.789   -2.780  1.00 0.00 ? 408 TRP A HE3  1  
ATOM 255   H HZ2  . TRP A 1 16  ? -6.099  10.310  -4.305  1.00 0.00 ? 408 TRP A HZ2  1  
ATOM 256   H HZ3  . TRP A 1 16  ? -8.922  7.783   -2.340  1.00 0.00 ? 408 TRP A HZ3  1  
ATOM 257   H HH2  . TRP A 1 16  ? -8.210  9.994   -3.086  1.00 0.00 ? 408 TRP A HH2  1  
ATOM 258   N N    . GLN A 1 17  ? -7.644  2.850   -4.655  1.00 0.00 ? 409 GLN A N    1  
ATOM 259   C CA   . GLN A 1 17  ? -9.056  2.870   -4.619  1.00 0.00 ? 409 GLN A CA   1  
ATOM 260   C C    . GLN A 1 17  ? -9.505  3.227   -3.220  1.00 0.00 ? 409 GLN A C    1  
ATOM 261   O O    . GLN A 1 17  ? -8.915  2.795   -2.224  1.00 0.00 ? 409 GLN A O    1  
ATOM 262   C CB   . GLN A 1 17  ? -9.673  1.537   -5.088  1.00 0.00 ? 409 GLN A CB   1  
ATOM 263   C CG   . GLN A 1 17  ? -9.354  1.188   -6.540  1.00 0.00 ? 409 GLN A CG   1  
ATOM 264   C CD   . GLN A 1 17  ? -10.074 -0.056  -7.032  1.00 0.00 ? 409 GLN A CD   1  
ATOM 265   O OE1  . GLN A 1 17  ? -9.574  -1.175  -6.918  1.00 0.00 ? 409 GLN A OE1  1  
ATOM 266   N NE2  . GLN A 1 17  ? -11.239 0.126   -7.603  1.00 0.00 ? 409 GLN A NE2  1  
ATOM 267   H H    . GLN A 1 17  ? -7.165  2.150   -4.155  1.00 0.00 ? 409 GLN A H    1  
ATOM 268   H HA   . GLN A 1 17  ? -9.374  3.657   -5.286  1.00 0.00 ? 409 GLN A HA   1  
ATOM 269   H HB2  . GLN A 1 17  ? -9.304  0.740   -4.459  1.00 0.00 ? 409 GLN A HB2  1  
ATOM 270   H HB3  . GLN A 1 17  ? -10.746 1.595   -4.981  1.00 0.00 ? 409 GLN A HB3  1  
ATOM 271   H HG2  . GLN A 1 17  ? -9.648  2.017   -7.167  1.00 0.00 ? 409 GLN A HG2  1  
ATOM 272   H HG3  . GLN A 1 17  ? -8.289  1.033   -6.632  1.00 0.00 ? 409 GLN A HG3  1  
ATOM 273   H HE21 . GLN A 1 17  ? -11.579 1.042   -7.681  1.00 0.00 ? 409 GLN A HE21 1  
ATOM 274   H HE22 . GLN A 1 17  ? -11.723 -0.657  -7.936  1.00 0.00 ? 409 GLN A HE22 1  
ATOM 275   N N    . GLU A 1 18  ? -10.473 4.079   -3.164  1.00 0.00 ? 410 GLU A N    1  
ATOM 276   C CA   . GLU A 1 18  ? -11.086 4.517   -1.930  1.00 0.00 ? 410 GLU A CA   1  
ATOM 277   C C    . GLU A 1 18  ? -12.065 3.456   -1.441  1.00 0.00 ? 410 GLU A C    1  
ATOM 278   O O    . GLU A 1 18  ? -12.228 3.223   -0.239  1.00 0.00 ? 410 GLU A O    1  
ATOM 279   C CB   . GLU A 1 18  ? -11.866 5.801   -2.255  1.00 0.00 ? 410 GLU A CB   1  
ATOM 280   C CG   . GLU A 1 18  ? -12.803 6.307   -1.171  1.00 0.00 ? 410 GLU A CG   1  
ATOM 281   C CD   . GLU A 1 18  ? -13.684 7.417   -1.684  1.00 0.00 ? 410 GLU A CD   1  
ATOM 282   O OE1  . GLU A 1 18  ? -14.658 7.133   -2.432  1.00 0.00 ? 410 GLU A OE1  1  
ATOM 283   O OE2  . GLU A 1 18  ? -13.414 8.596   -1.383  1.00 0.00 ? 410 GLU A OE2  1  
ATOM 284   H H    . GLU A 1 18  ? -10.788 4.475   -4.003  1.00 0.00 ? 410 GLU A H    1  
ATOM 285   H HA   . GLU A 1 18  ? -10.336 4.745   -1.189  1.00 0.00 ? 410 GLU A HA   1  
ATOM 286   H HB2  . GLU A 1 18  ? -11.159 6.588   -2.469  1.00 0.00 ? 410 GLU A HB2  1  
ATOM 287   H HB3  . GLU A 1 18  ? -12.449 5.620   -3.146  1.00 0.00 ? 410 GLU A HB3  1  
ATOM 288   H HG2  . GLU A 1 18  ? -13.424 5.491   -0.832  1.00 0.00 ? 410 GLU A HG2  1  
ATOM 289   H HG3  . GLU A 1 18  ? -12.217 6.682   -0.345  1.00 0.00 ? 410 GLU A HG3  1  
ATOM 290   N N    . LYS A 1 19  ? -12.622 2.774   -2.391  1.00 0.00 ? 411 LYS A N    1  
ATOM 291   C CA   . LYS A 1 19  ? -13.771 1.945   -2.219  1.00 0.00 ? 411 LYS A CA   1  
ATOM 292   C C    . LYS A 1 19  ? -13.609 0.829   -3.280  1.00 0.00 ? 411 LYS A C    1  
ATOM 293   O O    . LYS A 1 19  ? -13.650 1.108   -4.475  1.00 0.00 ? 411 LYS A O    1  
ATOM 294   C CB   . LYS A 1 19  ? -14.900 2.948   -2.500  1.00 0.00 ? 411 LYS A CB   1  
ATOM 295   C CG   . LYS A 1 19  ? -16.340 2.611   -2.202  1.00 0.00 ? 411 LYS A CG   1  
ATOM 296   C CD   . LYS A 1 19  ? -17.119 3.943   -2.072  1.00 0.00 ? 411 LYS A CD   1  
ATOM 297   C CE   . LYS A 1 19  ? -17.037 4.798   -3.351  1.00 0.00 ? 411 LYS A CE   1  
ATOM 298   N NZ   . LYS A 1 19  ? -17.157 6.259   -3.092  1.00 0.00 ? 411 LYS A NZ   1  
ATOM 299   H H    . LYS A 1 19  ? -12.223 2.793   -3.285  1.00 0.00 ? 411 LYS A H    1  
ATOM 300   H HA   . LYS A 1 19  ? -13.835 1.568   -1.210  1.00 0.00 ? 411 LYS A HA   1  
ATOM 301   H HB2  . LYS A 1 19  ? -14.676 3.837   -1.930  1.00 0.00 ? 411 LYS A HB2  1  
ATOM 302   H HB3  . LYS A 1 19  ? -14.803 3.210   -3.541  1.00 0.00 ? 411 LYS A HB3  1  
ATOM 303   H HG2  . LYS A 1 19  ? -16.749 2.018   -3.007  1.00 0.00 ? 411 LYS A HG2  1  
ATOM 304   H HG3  . LYS A 1 19  ? -16.411 2.078   -1.267  1.00 0.00 ? 411 LYS A HG3  1  
ATOM 305   H HD2  . LYS A 1 19  ? -18.157 3.720   -1.872  1.00 0.00 ? 411 LYS A HD2  1  
ATOM 306   H HD3  . LYS A 1 19  ? -16.713 4.507   -1.246  1.00 0.00 ? 411 LYS A HD3  1  
ATOM 307   H HE2  . LYS A 1 19  ? -16.091 4.626   -3.840  1.00 0.00 ? 411 LYS A HE2  1  
ATOM 308   H HE3  . LYS A 1 19  ? -17.834 4.496   -4.016  1.00 0.00 ? 411 LYS A HE3  1  
ATOM 309   H HZ1  . LYS A 1 19  ? -17.924 6.542   -2.442  1.00 0.00 ? 411 LYS A HZ1  1  
ATOM 310   H HZ2  . LYS A 1 19  ? -16.259 6.622   -2.698  1.00 0.00 ? 411 LYS A HZ2  1  
ATOM 311   H HZ3  . LYS A 1 19  ? -17.283 6.761   -3.991  1.00 0.00 ? 411 LYS A HZ3  1  
ATOM 312   N N    . PRO A 1 20  ? -13.324 -0.420  -2.850  1.00 0.00 ? 412 PRO A N    1  
ATOM 313   C CA   . PRO A 1 20  ? -12.836 -1.481  -3.746  1.00 0.00 ? 412 PRO A CA   1  
ATOM 314   C C    . PRO A 1 20  ? -13.855 -2.453  -4.366  1.00 0.00 ? 412 PRO A C    1  
ATOM 315   O O    . PRO A 1 20  ? -13.625 -2.925  -5.477  1.00 0.00 ? 412 PRO A O    1  
ATOM 316   C CB   . PRO A 1 20  ? -11.934 -2.269  -2.804  1.00 0.00 ? 412 PRO A CB   1  
ATOM 317   C CG   . PRO A 1 20  ? -12.638 -2.208  -1.476  1.00 0.00 ? 412 PRO A CG   1  
ATOM 318   C CD   . PRO A 1 20  ? -13.412 -0.901  -1.452  1.00 0.00 ? 412 PRO A CD   1  
ATOM 319   H HA   . PRO A 1 20  ? -12.197 -1.089  -4.522  1.00 0.00 ? 412 PRO A HA   1  
ATOM 320   H HB2  . PRO A 1 20  ? -11.840 -3.285  -3.159  1.00 0.00 ? 412 PRO A HB2  1  
ATOM 321   H HB3  . PRO A 1 20  ? -10.962 -1.804  -2.750  1.00 0.00 ? 412 PRO A HB3  1  
ATOM 322   H HG2  . PRO A 1 20  ? -13.316 -3.044  -1.387  1.00 0.00 ? 412 PRO A HG2  1  
ATOM 323   H HG3  . PRO A 1 20  ? -11.918 -2.229  -0.672  1.00 0.00 ? 412 PRO A HG3  1  
ATOM 324   H HD2  . PRO A 1 20  ? -14.439 -1.084  -1.174  1.00 0.00 ? 412 PRO A HD2  1  
ATOM 325   H HD3  . PRO A 1 20  ? -12.943 -0.206  -0.771  1.00 0.00 ? 412 PRO A HD3  1  
ATOM 326   N N    . LYS A 1 21  ? -14.940 -2.742  -3.664  1.00 0.00 ? 413 LYS A N    1  
ATOM 327   C CA   . LYS A 1 21  ? -15.853 -3.843  -4.009  1.00 0.00 ? 413 LYS A CA   1  
ATOM 328   C C    . LYS A 1 21  ? -16.428 -3.796  -5.426  1.00 0.00 ? 413 LYS A C    1  
ATOM 329   O O    . LYS A 1 21  ? -17.199 -2.881  -5.763  1.00 0.00 ? 413 LYS A O    1  
ATOM 330   C CB   . LYS A 1 21  ? -16.997 -3.900  -3.016  1.00 0.00 ? 413 LYS A CB   1  
ATOM 331   C CG   . LYS A 1 21  ? -17.956 -5.082  -3.192  1.00 0.00 ? 413 LYS A CG   1  
ATOM 332   C CD   . LYS A 1 21  ? -19.096 -5.004  -2.190  1.00 0.00 ? 413 LYS A CD   1  
ATOM 333   C CE   . LYS A 1 21  ? -20.030 -3.840  -2.489  1.00 0.00 ? 413 LYS A CE   1  
ATOM 334   N NZ   . LYS A 1 21  ? -20.861 -3.505  -1.328  1.00 0.00 ? 413 LYS A NZ   1  
ATOM 335   H H    . LYS A 1 21  ? -15.147 -2.187  -2.882  1.00 0.00 ? 413 LYS A H    1  
ATOM 336   H HA   . LYS A 1 21  ? -15.295 -4.760  -3.895  1.00 0.00 ? 413 LYS A HA   1  
ATOM 337   H HB2  . LYS A 1 21  ? -16.583 -3.940  -2.020  1.00 0.00 ? 413 LYS A HB2  1  
ATOM 338   H HB3  . LYS A 1 21  ? -17.557 -2.984  -3.120  1.00 0.00 ? 413 LYS A HB3  1  
ATOM 339   H HG2  . LYS A 1 21  ? -18.361 -5.058  -4.194  1.00 0.00 ? 413 LYS A HG2  1  
ATOM 340   H HG3  . LYS A 1 21  ? -17.410 -6.001  -3.039  1.00 0.00 ? 413 LYS A HG3  1  
ATOM 341   H HD2  . LYS A 1 21  ? -19.662 -5.923  -2.221  1.00 0.00 ? 413 LYS A HD2  1  
ATOM 342   H HD3  . LYS A 1 21  ? -18.685 -4.875  -1.199  1.00 0.00 ? 413 LYS A HD3  1  
ATOM 343   H HE2  . LYS A 1 21  ? -19.463 -2.965  -2.768  1.00 0.00 ? 413 LYS A HE2  1  
ATOM 344   H HE3  . LYS A 1 21  ? -20.678 -4.120  -3.307  1.00 0.00 ? 413 LYS A HE3  1  
ATOM 345   H HZ1  . LYS A 1 21  ? -21.417 -4.312  -0.984  1.00 0.00 ? 413 LYS A HZ1  1  
ATOM 346   H HZ2  . LYS A 1 21  ? -20.211 -3.177  -0.578  1.00 0.00 ? 413 LYS A HZ2  1  
ATOM 347   H HZ3  . LYS A 1 21  ? -21.506 -2.722  -1.547  1.00 0.00 ? 413 LYS A HZ3  1  
ATOM 348   N N    . PRO A 1 22  ? -16.059 -4.778  -6.270  1.00 0.00 ? 414 PRO A N    1  
ATOM 349   C CA   . PRO A 1 22  ? -16.679 -4.977  -7.562  1.00 0.00 ? 414 PRO A CA   1  
ATOM 350   C C    . PRO A 1 22  ? -17.973 -5.749  -7.325  1.00 0.00 ? 414 PRO A C    1  
ATOM 351   O O    . PRO A 1 22  ? -17.957 -6.943  -7.028  1.00 0.00 ? 414 PRO A O    1  
ATOM 352   C CB   . PRO A 1 22  ? -15.662 -5.836  -8.343  1.00 0.00 ? 414 PRO A CB   1  
ATOM 353   C CG   . PRO A 1 22  ? -14.493 -6.025  -7.423  1.00 0.00 ? 414 PRO A CG   1  
ATOM 354   C CD   . PRO A 1 22  ? -14.999 -5.766  -6.038  1.00 0.00 ? 414 PRO A CD   1  
ATOM 355   H HA   . PRO A 1 22  ? -16.888 -4.042  -8.063  1.00 0.00 ? 414 PRO A HA   1  
ATOM 356   H HB2  . PRO A 1 22  ? -16.114 -6.783  -8.595  1.00 0.00 ? 414 PRO A HB2  1  
ATOM 357   H HB3  . PRO A 1 22  ? -15.369 -5.323  -9.247  1.00 0.00 ? 414 PRO A HB3  1  
ATOM 358   H HG2  . PRO A 1 22  ? -14.125 -7.037  -7.499  1.00 0.00 ? 414 PRO A HG2  1  
ATOM 359   H HG3  . PRO A 1 22  ? -13.712 -5.323  -7.673  1.00 0.00 ? 414 PRO A HG3  1  
ATOM 360   H HD2  . PRO A 1 22  ? -15.388 -6.672  -5.596  1.00 0.00 ? 414 PRO A HD2  1  
ATOM 361   H HD3  . PRO A 1 22  ? -14.205 -5.351  -5.434  1.00 0.00 ? 414 PRO A HD3  1  
ATOM 362   N N    . ALA A 1 23  ? -19.073 -5.060  -7.390  1.00 0.00 ? 415 ALA A N    1  
ATOM 363   C CA   . ALA A 1 23  ? -20.343 -5.626  -6.974  1.00 0.00 ? 415 ALA A CA   1  
ATOM 364   C C    . ALA A 1 23  ? -21.130 -6.280  -8.100  1.00 0.00 ? 415 ALA A C    1  
ATOM 365   O O    . ALA A 1 23  ? -22.255 -6.726  -7.868  1.00 0.00 ? 415 ALA A O    1  
ATOM 366   C CB   . ALA A 1 23  ? -21.180 -4.560  -6.291  1.00 0.00 ? 415 ALA A CB   1  
ATOM 367   H H    . ALA A 1 23  ? -19.026 -4.139  -7.727  1.00 0.00 ? 415 ALA A H    1  
ATOM 368   H HA   . ALA A 1 23  ? -20.129 -6.380  -6.232  1.00 0.00 ? 415 ALA A HA   1  
ATOM 369   H HB1  . ALA A 1 23  ? -21.493 -3.827  -7.018  1.00 0.00 ? 415 ALA A HB1  1  
ATOM 370   H HB2  . ALA A 1 23  ? -22.057 -5.015  -5.859  1.00 0.00 ? 415 ALA A HB2  1  
ATOM 371   H HB3  . ALA A 1 23  ? -20.600 -4.082  -5.516  1.00 0.00 ? 415 ALA A HB3  1  
ATOM 372   N N    . SER A 1 24  ? -20.568 -6.294  -9.309  1.00 0.00 ? 416 SER A N    1  
ATOM 373   C CA   . SER A 1 24  ? -21.209 -6.853  -10.526 1.00 0.00 ? 416 SER A CA   1  
ATOM 374   C C    . SER A 1 24  ? -22.372 -5.972  -11.011 1.00 0.00 ? 416 SER A C    1  
ATOM 375   O O    . SER A 1 24  ? -22.429 -5.594  -12.177 1.00 0.00 ? 416 SER A O    1  
ATOM 376   C CB   . SER A 1 24  ? -21.613 -8.320  -10.328 1.00 0.00 ? 416 SER A CB   1  
ATOM 377   O OG   . SER A 1 24  ? -20.475 -9.090  -9.945  1.00 0.00 ? 416 SER A OG   1  
ATOM 378   H H    . SER A 1 24  ? -19.661 -5.936  -9.404  1.00 0.00 ? 416 SER A H    1  
ATOM 379   H HA   . SER A 1 24  ? -20.455 -6.797  -11.299 1.00 0.00 ? 416 SER A HA   1  
ATOM 380   H HB2  . SER A 1 24  ? -22.362 -8.382  -9.553  1.00 0.00 ? 416 SER A HB2  1  
ATOM 381   H HB3  . SER A 1 24  ? -22.010 -8.716  -11.251 1.00 0.00 ? 416 SER A HB3  1  
ATOM 382   H HG   . SER A 1 24  ? -20.797 -9.963  -9.695  1.00 0.00 ? 416 SER A HG   1  
ATOM 383   N N    . VAL A 1 25  ? -23.274 -5.611  -10.097 1.00 0.00 ? 417 VAL A N    1  
ATOM 384   C CA   . VAL A 1 25  ? -24.324 -4.630  -10.373 1.00 0.00 ? 417 VAL A CA   1  
ATOM 385   C C    . VAL A 1 25  ? -23.661 -3.251  -10.483 1.00 0.00 ? 417 VAL A C    1  
ATOM 386   O O    . VAL A 1 25  ? -24.228 -2.283  -10.990 1.00 0.00 ? 417 VAL A O    1  
ATOM 387   C CB   . VAL A 1 25  ? -25.421 -4.619  -9.267  1.00 0.00 ? 417 VAL A CB   1  
ATOM 388   C CG1  . VAL A 1 25  ? -26.140 -5.957  -9.222  1.00 0.00 ? 417 VAL A CG1  1  
ATOM 389   C CG2  . VAL A 1 25  ? -24.826 -4.294  -7.896  1.00 0.00 ? 417 VAL A CG2  1  
ATOM 390   H H    . VAL A 1 25  ? -23.223 -6.042  -9.212  1.00 0.00 ? 417 VAL A H    1  
ATOM 391   H HA   . VAL A 1 25  ? -24.761 -4.880  -11.330 1.00 0.00 ? 417 VAL A HA   1  
ATOM 392   H HB   . VAL A 1 25  ? -26.148 -3.859  -9.516  1.00 0.00 ? 417 VAL A HB   1  
ATOM 393   H HG11 . VAL A 1 25  ? -25.426 -6.737  -9.006  1.00 0.00 ? 417 VAL A HG11 1  
ATOM 394   H HG12 . VAL A 1 25  ? -26.894 -5.936  -8.450  1.00 0.00 ? 417 VAL A HG12 1  
ATOM 395   H HG13 . VAL A 1 25  ? -26.607 -6.153  -10.177 1.00 0.00 ? 417 VAL A HG13 1  
ATOM 396   H HG21 . VAL A 1 25  ? -24.351 -3.325  -7.937  1.00 0.00 ? 417 VAL A HG21 1  
ATOM 397   H HG22 . VAL A 1 25  ? -25.608 -4.281  -7.151  1.00 0.00 ? 417 VAL A HG22 1  
ATOM 398   H HG23 . VAL A 1 25  ? -24.091 -5.042  -7.638  1.00 0.00 ? 417 VAL A HG23 1  
ATOM 399   N N    . ASP A 1 26  ? -22.452 -3.208  -9.982  1.00 0.00 ? 418 ASP A N    1  
ATOM 400   C CA   . ASP A 1 26  ? -21.571 -2.092  -10.089 1.00 0.00 ? 418 ASP A CA   1  
ATOM 401   C C    . ASP A 1 26  ? -20.463 -2.512  -11.023 1.00 0.00 ? 418 ASP A C    1  
ATOM 402   O O    . ASP A 1 26  ? -19.498 -3.160  -10.606 1.00 0.00 ? 418 ASP A O    1  
ATOM 403   C CB   . ASP A 1 26  ? -21.008 -1.721  -8.714  1.00 0.00 ? 418 ASP A CB   1  
ATOM 404   C CG   . ASP A 1 26  ? -19.987 -0.609  -8.757  1.00 0.00 ? 418 ASP A CG   1  
ATOM 405   O OD1  . ASP A 1 26  ? -20.358 0.540   -9.062  1.00 0.00 ? 418 ASP A OD1  1  
ATOM 406   O OD2  . ASP A 1 26  ? -18.817 -0.861  -8.414  1.00 0.00 ? 418 ASP A OD2  1  
ATOM 407   H H    . ASP A 1 26  ? -22.128 -4.014  -9.532  1.00 0.00 ? 418 ASP A H    1  
ATOM 408   H HA   . ASP A 1 26  ? -22.115 -1.261  -10.508 1.00 0.00 ? 418 ASP A HA   1  
ATOM 409   H HB2  . ASP A 1 26  ? -21.816 -1.413  -8.069  1.00 0.00 ? 418 ASP A HB2  1  
ATOM 410   H HB3  . ASP A 1 26  ? -20.534 -2.594  -8.292  1.00 0.00 ? 418 ASP A HB3  1  
ATOM 411   N N    . ALA A 1 27  ? -20.677 -2.264  -12.300 1.00 0.00 ? 419 ALA A N    1  
ATOM 412   C CA   . ALA A 1 27  ? -19.736 -2.646  -13.335 1.00 0.00 ? 419 ALA A CA   1  
ATOM 413   C C    . ALA A 1 27  ? -18.595 -1.663  -13.382 1.00 0.00 ? 419 ALA A C    1  
ATOM 414   O O    . ALA A 1 27  ? -17.434 -2.039  -13.576 1.00 0.00 ? 419 ALA A O    1  
ATOM 415   C CB   . ALA A 1 27  ? -20.433 -2.729  -14.685 1.00 0.00 ? 419 ALA A CB   1  
ATOM 416   H H    . ALA A 1 27  ? -21.507 -1.809  -12.562 1.00 0.00 ? 419 ALA A H    1  
ATOM 417   H HA   . ALA A 1 27  ? -19.350 -3.624  -13.086 1.00 0.00 ? 419 ALA A HA   1  
ATOM 418   H HB1  . ALA A 1 27  ? -21.245 -3.440  -14.626 1.00 0.00 ? 419 ALA A HB1  1  
ATOM 419   H HB2  . ALA A 1 27  ? -20.823 -1.757  -14.948 1.00 0.00 ? 419 ALA A HB2  1  
ATOM 420   H HB3  . ALA A 1 27  ? -19.727 -3.051  -15.436 1.00 0.00 ? 419 ALA A HB3  1  
ATOM 421   N N    . ASN A 1 28  ? -18.920 -0.407  -13.190 1.00 0.00 ? 420 ASN A N    1  
ATOM 422   C CA   . ASN A 1 28  ? -17.923 0.631   -13.127 1.00 0.00 ? 420 ASN A CA   1  
ATOM 423   C C    . ASN A 1 28  ? -17.504 0.762   -11.702 1.00 0.00 ? 420 ASN A C    1  
ATOM 424   O O    . ASN A 1 28  ? -18.058 1.567   -10.953 1.00 0.00 ? 420 ASN A O    1  
ATOM 425   C CB   . ASN A 1 28  ? -18.447 1.984   -13.639 1.00 0.00 ? 420 ASN A CB   1  
ATOM 426   C CG   . ASN A 1 28  ? -18.685 2.053   -15.138 1.00 0.00 ? 420 ASN A CG   1  
ATOM 427   O OD1  . ASN A 1 28  ? -19.006 1.057   -15.801 1.00 0.00 ? 420 ASN A OD1  1  
ATOM 428   N ND2  . ASN A 1 28  ? -18.517 3.221   -15.685 1.00 0.00 ? 420 ASN A ND2  1  
ATOM 429   H H    . ASN A 1 28  ? -19.861 -0.164  -13.059 1.00 0.00 ? 420 ASN A H    1  
ATOM 430   H HA   . ASN A 1 28  ? -17.075 0.320   -13.718 1.00 0.00 ? 420 ASN A HA   1  
ATOM 431   H HB2  . ASN A 1 28  ? -19.384 2.199   -13.150 1.00 0.00 ? 420 ASN A HB2  1  
ATOM 432   H HB3  . ASN A 1 28  ? -17.734 2.748   -13.368 1.00 0.00 ? 420 ASN A HB3  1  
ATOM 433   H HD21 . ASN A 1 28  ? -18.247 3.967   -15.107 1.00 0.00 ? 420 ASN A HD21 1  
ATOM 434   H HD22 . ASN A 1 28  ? -18.674 3.313   -16.650 1.00 0.00 ? 420 ASN A HD22 1  
ATOM 435   N N    . THR A 1 29  ? -16.586 -0.069  -11.308 1.00 0.00 ? 421 THR A N    1  
ATOM 436   C CA   . THR A 1 29  ? -16.169 -0.153  -9.944  1.00 0.00 ? 421 THR A CA   1  
ATOM 437   C C    . THR A 1 29  ? -15.309 1.026   -9.473  1.00 0.00 ? 421 THR A C    1  
ATOM 438   O O    . THR A 1 29  ? -14.062 0.987   -9.506  1.00 0.00 ? 421 THR A O    1  
ATOM 439   C CB   . THR A 1 29  ? -15.521 -1.514  -9.653  1.00 0.00 ? 421 THR A CB   1  
ATOM 440   O OG1  . THR A 1 29  ? -16.474 -2.535  -10.002 1.00 0.00 ? 421 THR A OG1  1  
ATOM 441   C CG2  . THR A 1 29  ? -15.157 -1.659  -8.183  1.00 0.00 ? 421 THR A CG2  1  
ATOM 442   H H    . THR A 1 29  ? -16.182 -0.675  -11.964 1.00 0.00 ? 421 THR A H    1  
ATOM 443   H HA   . THR A 1 29  ? -17.083 -0.109  -9.369  1.00 0.00 ? 421 THR A HA   1  
ATOM 444   H HB   . THR A 1 29  ? -14.638 -1.624  -10.266 1.00 0.00 ? 421 THR A HB   1  
ATOM 445   H HG1  . THR A 1 29  ? -17.351 -2.160  -9.832  1.00 0.00 ? 421 THR A HG1  1  
ATOM 446   H HG21 . THR A 1 29  ? -14.461 -0.880  -7.907  1.00 0.00 ? 421 THR A HG21 1  
ATOM 447   H HG22 . THR A 1 29  ? -16.048 -1.572  -7.579  1.00 0.00 ? 421 THR A HG22 1  
ATOM 448   H HG23 . THR A 1 29  ? -14.702 -2.624  -8.018  1.00 0.00 ? 421 THR A HG23 1  
ATOM 449   N N    . LYS A 1 30  ? -16.025 2.089   -9.105  1.00 0.00 ? 422 LYS A N    1  
ATOM 450   C CA   . LYS A 1 30  ? -15.504 3.289   -8.465  1.00 0.00 ? 422 LYS A CA   1  
ATOM 451   C C    . LYS A 1 30  ? -14.407 3.988   -9.268  1.00 0.00 ? 422 LYS A C    1  
ATOM 452   O O    . LYS A 1 30  ? -14.113 3.624   -10.415 1.00 0.00 ? 422 LYS A O    1  
ATOM 453   C CB   . LYS A 1 30  ? -15.058 3.000   -7.003  1.00 0.00 ? 422 LYS A CB   1  
ATOM 454   C CG   . LYS A 1 30  ? -16.200 2.583   -6.051  1.00 0.00 ? 422 LYS A CG   1  
ATOM 455   C CD   . LYS A 1 30  ? -16.721 1.176   -6.320  1.00 0.00 ? 422 LYS A CD   1  
ATOM 456   C CE   . LYS A 1 30  ? -17.948 0.859   -5.494  1.00 0.00 ? 422 LYS A CE   1  
ATOM 457   N NZ   . LYS A 1 30  ? -18.475 -0.478  -5.805  1.00 0.00 ? 422 LYS A NZ   1  
ATOM 458   H H    . LYS A 1 30  ? -16.987 2.054   -9.301  1.00 0.00 ? 422 LYS A H    1  
ATOM 459   H HA   . LYS A 1 30  ? -16.337 3.975   -8.417  1.00 0.00 ? 422 LYS A HA   1  
ATOM 460   H HB2  . LYS A 1 30  ? -14.333 2.201   -7.022  1.00 0.00 ? 422 LYS A HB2  1  
ATOM 461   H HB3  . LYS A 1 30  ? -14.586 3.884   -6.600  1.00 0.00 ? 422 LYS A HB3  1  
ATOM 462   H HG2  . LYS A 1 30  ? -15.838 2.610   -5.036  1.00 0.00 ? 422 LYS A HG2  1  
ATOM 463   H HG3  . LYS A 1 30  ? -17.014 3.286   -6.156  1.00 0.00 ? 422 LYS A HG3  1  
ATOM 464   H HD2  . LYS A 1 30  ? -16.968 1.086   -7.367  1.00 0.00 ? 422 LYS A HD2  1  
ATOM 465   H HD3  . LYS A 1 30  ? -15.941 0.469   -6.079  1.00 0.00 ? 422 LYS A HD3  1  
ATOM 466   H HE2  . LYS A 1 30  ? -17.682 0.902   -4.450  1.00 0.00 ? 422 LYS A HE2  1  
ATOM 467   H HE3  . LYS A 1 30  ? -18.709 1.597   -5.699  1.00 0.00 ? 422 LYS A HE3  1  
ATOM 468   H HZ1  . LYS A 1 30  ? -18.667 -0.553  -6.833  1.00 0.00 ? 422 LYS A HZ1  1  
ATOM 469   H HZ2  . LYS A 1 30  ? -17.811 -1.240  -5.553  1.00 0.00 ? 422 LYS A HZ2  1  
ATOM 470   H HZ3  . LYS A 1 30  ? -19.367 -0.644  -5.302  1.00 0.00 ? 422 LYS A HZ3  1  
ATOM 471   N N    . LEU A 1 31  ? -13.852 5.019   -8.697  1.00 0.00 ? 423 LEU A N    1  
ATOM 472   C CA   . LEU A 1 31  ? -12.796 5.749   -9.340  1.00 0.00 ? 423 LEU A CA   1  
ATOM 473   C C    . LEU A 1 31  ? -11.468 5.384   -8.724  1.00 0.00 ? 423 LEU A C    1  
ATOM 474   O O    . LEU A 1 31  ? -11.333 5.321   -7.497  1.00 0.00 ? 423 LEU A O    1  
ATOM 475   C CB   . LEU A 1 31  ? -13.031 7.253   -9.229  1.00 0.00 ? 423 LEU A CB   1  
ATOM 476   C CG   . LEU A 1 31  ? -14.324 7.783   -9.856  1.00 0.00 ? 423 LEU A CG   1  
ATOM 477   C CD1  . LEU A 1 31  ? -14.439 9.267   -9.629  1.00 0.00 ? 423 LEU A CD1  1  
ATOM 478   C CD2  . LEU A 1 31  ? -14.382 7.474   -11.346 1.00 0.00 ? 423 LEU A CD2  1  
ATOM 479   H H    . LEU A 1 31  ? -14.158 5.311   -7.810  1.00 0.00 ? 423 LEU A H    1  
ATOM 480   H HA   . LEU A 1 31  ? -12.785 5.473   -10.383 1.00 0.00 ? 423 LEU A HA   1  
ATOM 481   H HB2  . LEU A 1 31  ? -13.030 7.518   -8.182  1.00 0.00 ? 423 LEU A HB2  1  
ATOM 482   H HB3  . LEU A 1 31  ? -12.200 7.754   -9.704  1.00 0.00 ? 423 LEU A HB3  1  
ATOM 483   H HG   . LEU A 1 31  ? -15.168 7.310   -9.377  1.00 0.00 ? 423 LEU A HG   1  
ATOM 484   H HD11 . LEU A 1 31  ? -13.580 9.764   -10.058 1.00 0.00 ? 423 LEU A HD11 1  
ATOM 485   H HD12 . LEU A 1 31  ? -15.341 9.623   -10.103 1.00 0.00 ? 423 LEU A HD12 1  
ATOM 486   H HD13 . LEU A 1 31  ? -14.484 9.469   -8.569  1.00 0.00 ? 423 LEU A HD13 1  
ATOM 487   H HD21 . LEU A 1 31  ? -13.525 7.903   -11.842 1.00 0.00 ? 423 LEU A HD21 1  
ATOM 488   H HD22 . LEU A 1 31  ? -14.384 6.403   -11.487 1.00 0.00 ? 423 LEU A HD22 1  
ATOM 489   H HD23 . LEU A 1 31  ? -15.288 7.888   -11.763 1.00 0.00 ? 423 LEU A HD23 1  
ATOM 490   N N    . THR A 1 32  ? -10.515 5.126   -9.552  1.00 0.00 ? 424 THR A N    1  
ATOM 491   C CA   . THR A 1 32  ? -9.194  4.798   -9.121  1.00 0.00 ? 424 THR A CA   1  
ATOM 492   C C    . THR A 1 32  ? -8.315  6.008   -9.403  1.00 0.00 ? 424 THR A C    1  
ATOM 493   O O    . THR A 1 32  ? -8.490  6.671   -10.431 1.00 0.00 ? 424 THR A O    1  
ATOM 494   C CB   . THR A 1 32  ? -8.667  3.584   -9.909  1.00 0.00 ? 424 THR A CB   1  
ATOM 495   O OG1  . THR A 1 32  ? -9.667  2.538   -9.904  1.00 0.00 ? 424 THR A OG1  1  
ATOM 496   C CG2  . THR A 1 32  ? -7.403  3.042   -9.262  1.00 0.00 ? 424 THR A CG2  1  
ATOM 497   H H    . THR A 1 32  ? -10.681 5.192   -10.516 1.00 0.00 ? 424 THR A H    1  
ATOM 498   H HA   . THR A 1 32  ? -9.204  4.575   -8.065  1.00 0.00 ? 424 THR A HA   1  
ATOM 499   H HB   . THR A 1 32  ? -8.439  3.907   -10.914 1.00 0.00 ? 424 THR A HB   1  
ATOM 500   H HG1  . THR A 1 32  ? -10.244 2.625   -10.671 1.00 0.00 ? 424 THR A HG1  1  
ATOM 501   H HG21 . THR A 1 32  ? -6.660  3.825   -9.235  1.00 0.00 ? 424 THR A HG21 1  
ATOM 502   H HG22 . THR A 1 32  ? -7.621  2.723   -8.254  1.00 0.00 ? 424 THR A HG22 1  
ATOM 503   H HG23 . THR A 1 32  ? -7.033  2.206   -9.836  1.00 0.00 ? 424 THR A HG23 1  
ATOM 504   N N    . ARG A 1 33  ? -7.427  6.334   -8.509  1.00 0.00 ? 425 ARG A N    1  
ATOM 505   C CA   . ARG A 1 33  ? -6.560  7.463   -8.726  1.00 0.00 ? 425 ARG A CA   1  
ATOM 506   C C    . ARG A 1 33  ? -5.128  7.020   -8.712  1.00 0.00 ? 425 ARG A C    1  
ATOM 507   O O    . ARG A 1 33  ? -4.773  6.093   -7.996  1.00 0.00 ? 425 ARG A O    1  
ATOM 508   C CB   . ARG A 1 33  ? -6.815  8.570   -7.699  1.00 0.00 ? 425 ARG A CB   1  
ATOM 509   C CG   . ARG A 1 33  ? -8.200  9.203   -7.800  1.00 0.00 ? 425 ARG A CG   1  
ATOM 510   C CD   . ARG A 1 33  ? -8.397  9.888   -9.146  1.00 0.00 ? 425 ARG A CD   1  
ATOM 511   N NE   . ARG A 1 33  ? -9.716  10.524  -9.275  1.00 0.00 ? 425 ARG A NE   1  
ATOM 512   C CZ   . ARG A 1 33  ? -10.293 10.851  -10.447 1.00 0.00 ? 425 ARG A CZ   1  
ATOM 513   N NH1  . ARG A 1 33  ? -9.664  10.611  -11.601 1.00 0.00 ? 425 ARG A NH1  1  
ATOM 514   N NH2  . ARG A 1 33  ? -11.495 11.420  -10.463 1.00 0.00 ? 425 ARG A NH2  1  
ATOM 515   H H    . ARG A 1 33  ? -7.317  5.799   -7.691  1.00 0.00 ? 425 ARG A H    1  
ATOM 516   H HA   . ARG A 1 33  ? -6.774  7.843   -9.712  1.00 0.00 ? 425 ARG A HA   1  
ATOM 517   H HB2  . ARG A 1 33  ? -6.708  8.153   -6.708  1.00 0.00 ? 425 ARG A HB2  1  
ATOM 518   H HB3  . ARG A 1 33  ? -6.077  9.347   -7.833  1.00 0.00 ? 425 ARG A HB3  1  
ATOM 519   H HG2  . ARG A 1 33  ? -8.933  8.414   -7.708  1.00 0.00 ? 425 ARG A HG2  1  
ATOM 520   H HG3  . ARG A 1 33  ? -8.323  9.924   -7.007  1.00 0.00 ? 425 ARG A HG3  1  
ATOM 521   H HD2  . ARG A 1 33  ? -7.634  10.640  -9.279  1.00 0.00 ? 425 ARG A HD2  1  
ATOM 522   H HD3  . ARG A 1 33  ? -8.303  9.141   -9.920  1.00 0.00 ? 425 ARG A HD3  1  
ATOM 523   H HE   . ARG A 1 33  ? -10.179 10.717  -8.427  1.00 0.00 ? 425 ARG A HE   1  
ATOM 524   H HH11 . ARG A 1 33  ? -8.755  10.187  -11.657 1.00 0.00 ? 425 ARG A HH11 1  
ATOM 525   H HH12 . ARG A 1 33  ? -10.079 10.856  -12.482 1.00 0.00 ? 425 ARG A HH12 1  
ATOM 526   H HH21 . ARG A 1 33  ? -12.013 11.630  -9.628  1.00 0.00 ? 425 ARG A HH21 1  
ATOM 527   H HH22 . ARG A 1 33  ? -11.943 11.667  -11.327 1.00 0.00 ? 425 ARG A HH22 1  
ATOM 528   N N    . SER A 1 34  ? -4.325  7.666   -9.505  1.00 0.00 ? 426 SER A N    1  
ATOM 529   C CA   . SER A 1 34  ? -2.938  7.329   -9.629  1.00 0.00 ? 426 SER A CA   1  
ATOM 530   C C    . SER A 1 34  ? -2.064  8.387   -8.991  1.00 0.00 ? 426 SER A C    1  
ATOM 531   O O    . SER A 1 34  ? -2.403  9.581   -9.013  1.00 0.00 ? 426 SER A O    1  
ATOM 532   C CB   . SER A 1 34  ? -2.581  7.134   -11.107 1.00 0.00 ? 426 SER A CB   1  
ATOM 533   O OG   . SER A 1 34  ? -2.994  8.247   -11.908 1.00 0.00 ? 426 SER A OG   1  
ATOM 534   H H    . SER A 1 34  ? -4.680  8.416   -10.027 1.00 0.00 ? 426 SER A H    1  
ATOM 535   H HA   . SER A 1 34  ? -2.779  6.395   -9.114  1.00 0.00 ? 426 SER A HA   1  
ATOM 536   H HB2  . SER A 1 34  ? -1.511  7.025   -11.198 1.00 0.00 ? 426 SER A HB2  1  
ATOM 537   H HB3  . SER A 1 34  ? -3.059  6.243   -11.484 1.00 0.00 ? 426 SER A HB3  1  
ATOM 538   H HG   . SER A 1 34  ? -3.362  8.936   -11.337 1.00 0.00 ? 426 SER A HG   1  
ATOM 539   N N    . LEU A 1 35  ? -0.979  7.961   -8.405  1.00 0.00 ? 427 LEU A N    1  
ATOM 540   C CA   . LEU A 1 35  ? -0.046  8.854   -7.786  1.00 0.00 ? 427 LEU A CA   1  
ATOM 541   C C    . LEU A 1 35  ? 1.366   8.264   -7.949  1.00 0.00 ? 427 LEU A C    1  
ATOM 542   O O    . LEU A 1 35  ? 1.573   7.080   -7.663  1.00 0.00 ? 427 LEU A O    1  
ATOM 543   C CB   . LEU A 1 35  ? -0.421  9.010   -6.300  1.00 0.00 ? 427 LEU A CB   1  
ATOM 544   C CG   . LEU A 1 35  ? 0.229   10.161  -5.531  1.00 0.00 ? 427 LEU A CG   1  
ATOM 545   C CD1  . LEU A 1 35  ? -0.170  11.501  -6.140  1.00 0.00 ? 427 LEU A CD1  1  
ATOM 546   C CD2  . LEU A 1 35  ? -0.190  10.107  -4.071  1.00 0.00 ? 427 LEU A CD2  1  
ATOM 547   H H    . LEU A 1 35  ? -0.800  6.993   -8.360  1.00 0.00 ? 427 LEU A H    1  
ATOM 548   H HA   . LEU A 1 35  ? -0.112  9.811   -8.280  1.00 0.00 ? 427 LEU A HA   1  
ATOM 549   H HB2  . LEU A 1 35  ? -1.492  9.138   -6.242  1.00 0.00 ? 427 LEU A HB2  1  
ATOM 550   H HB3  . LEU A 1 35  ? -0.168  8.088   -5.797  1.00 0.00 ? 427 LEU A HB3  1  
ATOM 551   H HG   . LEU A 1 35  ? 1.304   10.071  -5.581  1.00 0.00 ? 427 LEU A HG   1  
ATOM 552   H HD11 . LEU A 1 35  ? 0.118   11.543  -7.179  1.00 0.00 ? 427 LEU A HD11 1  
ATOM 553   H HD12 . LEU A 1 35  ? -1.240  11.618  -6.065  1.00 0.00 ? 427 LEU A HD12 1  
ATOM 554   H HD13 . LEU A 1 35  ? 0.315   12.300  -5.599  1.00 0.00 ? 427 LEU A HD13 1  
ATOM 555   H HD21 . LEU A 1 35  ? 0.124   9.169   -3.637  1.00 0.00 ? 427 LEU A HD21 1  
ATOM 556   H HD22 . LEU A 1 35  ? 0.274   10.921  -3.533  1.00 0.00 ? 427 LEU A HD22 1  
ATOM 557   H HD23 . LEU A 1 35  ? -1.265  10.195  -3.999  1.00 0.00 ? 427 LEU A HD23 1  
ATOM 558   N N    . PRO A 1 36  ? 2.323   9.038   -8.487  1.00 0.00 ? 428 PRO A N    1  
ATOM 559   C CA   . PRO A 1 36  ? 3.702   8.569   -8.673  1.00 0.00 ? 428 PRO A CA   1  
ATOM 560   C C    . PRO A 1 36  ? 4.490   8.546   -7.353  1.00 0.00 ? 428 PRO A C    1  
ATOM 561   O O    . PRO A 1 36  ? 4.347   9.443   -6.504  1.00 0.00 ? 428 PRO A O    1  
ATOM 562   C CB   . PRO A 1 36  ? 4.298   9.593   -9.640  1.00 0.00 ? 428 PRO A CB   1  
ATOM 563   C CG   . PRO A 1 36  ? 3.517   10.845  -9.408  1.00 0.00 ? 428 PRO A CG   1  
ATOM 564   C CD   . PRO A 1 36  ? 2.140   10.422  -8.973  1.00 0.00 ? 428 PRO A CD   1  
ATOM 565   H HA   . PRO A 1 36  ? 3.724   7.585   -9.118  1.00 0.00 ? 428 PRO A HA   1  
ATOM 566   H HB2  . PRO A 1 36  ? 5.347   9.731   -9.419  1.00 0.00 ? 428 PRO A HB2  1  
ATOM 567   H HB3  . PRO A 1 36  ? 4.183   9.244   -10.655 1.00 0.00 ? 428 PRO A HB3  1  
ATOM 568   H HG2  . PRO A 1 36  ? 3.981   11.432  -8.628  1.00 0.00 ? 428 PRO A HG2  1  
ATOM 569   H HG3  . PRO A 1 36  ? 3.460   11.420  -10.320 1.00 0.00 ? 428 PRO A HG3  1  
ATOM 570   H HD2  . PRO A 1 36  ? 1.797   11.062  -8.175  1.00 0.00 ? 428 PRO A HD2  1  
ATOM 571   H HD3  . PRO A 1 36  ? 1.452   10.453  -9.804  1.00 0.00 ? 428 PRO A HD3  1  
ATOM 572   N N    . CYS A 1 37  ? 5.318   7.550   -7.181  1.00 0.00 ? 429 CYS A N    1  
ATOM 573   C CA   . CYS A 1 37  ? 6.068   7.413   -5.962  1.00 0.00 ? 429 CYS A CA   1  
ATOM 574   C C    . CYS A 1 37  ? 7.457   6.857   -6.215  1.00 0.00 ? 429 CYS A C    1  
ATOM 575   O O    . CYS A 1 37  ? 7.748   6.304   -7.293  1.00 0.00 ? 429 CYS A O    1  
ATOM 576   C CB   . CYS A 1 37  ? 5.324   6.485   -5.011  1.00 0.00 ? 429 CYS A CB   1  
ATOM 577   S SG   . CYS A 1 37  ? 5.022   4.843   -5.698  1.00 0.00 ? 429 CYS A SG   1  
ATOM 578   H H    . CYS A 1 37  ? 5.436   6.878   -7.890  1.00 0.00 ? 429 CYS A H    1  
ATOM 579   H HA   . CYS A 1 37  ? 6.143   8.384   -5.498  1.00 0.00 ? 429 CYS A HA   1  
ATOM 580   H HB2  . CYS A 1 37  ? 5.906   6.362   -4.109  1.00 0.00 ? 429 CYS A HB2  1  
ATOM 581   H HB3  . CYS A 1 37  ? 4.368   6.922   -4.762  1.00 0.00 ? 429 CYS A HB3  1  
ATOM 582   H HG   . CYS A 1 37  ? 4.886   4.982   -7.012  1.00 0.00 ? 429 CYS A HG   1  
ATOM 583   N N    . GLN A 1 38  ? 8.298   7.017   -5.237  1.00 0.00 ? 430 GLN A N    1  
ATOM 584   C CA   . GLN A 1 38  ? 9.610   6.466   -5.216  1.00 0.00 ? 430 GLN A CA   1  
ATOM 585   C C    . GLN A 1 38  ? 9.602   5.518   -4.033  1.00 0.00 ? 430 GLN A C    1  
ATOM 586   O O    . GLN A 1 38  ? 9.186   5.900   -2.928  1.00 0.00 ? 430 GLN A O    1  
ATOM 587   C CB   . GLN A 1 38  ? 10.651  7.573   -4.976  1.00 0.00 ? 430 GLN A CB   1  
ATOM 588   C CG   . GLN A 1 38  ? 10.461  8.810   -5.847  1.00 0.00 ? 430 GLN A CG   1  
ATOM 589   C CD   . GLN A 1 38  ? 11.524  9.862   -5.616  1.00 0.00 ? 430 GLN A CD   1  
ATOM 590   O OE1  . GLN A 1 38  ? 11.399  10.716  -4.732  1.00 0.00 ? 430 GLN A OE1  1  
ATOM 591   N NE2  . GLN A 1 38  ? 12.547  9.847   -6.423  1.00 0.00 ? 430 GLN A NE2  1  
ATOM 592   H H    . GLN A 1 38  ? 8.027   7.537   -4.448  1.00 0.00 ? 430 GLN A H    1  
ATOM 593   H HA   . GLN A 1 38  ? 9.808   5.941   -6.138  1.00 0.00 ? 430 GLN A HA   1  
ATOM 594   H HB2  . GLN A 1 38  ? 10.599  7.879   -3.941  1.00 0.00 ? 430 GLN A HB2  1  
ATOM 595   H HB3  . GLN A 1 38  ? 11.634  7.170   -5.171  1.00 0.00 ? 430 GLN A HB3  1  
ATOM 596   H HG2  . GLN A 1 38  ? 10.493  8.514   -6.886  1.00 0.00 ? 430 GLN A HG2  1  
ATOM 597   H HG3  . GLN A 1 38  ? 9.494   9.239   -5.631  1.00 0.00 ? 430 GLN A HG3  1  
ATOM 598   H HE21 . GLN A 1 38  ? 12.580  9.166   -7.130  1.00 0.00 ? 430 GLN A HE21 1  
ATOM 599   H HE22 . GLN A 1 38  ? 13.243  10.532  -6.323  1.00 0.00 ? 430 GLN A HE22 1  
ATOM 600   N N    . VAL A 1 39  ? 10.022  4.316   -4.244  1.00 0.00 ? 431 VAL A N    1  
ATOM 601   C CA   . VAL A 1 39  ? 9.962   3.315   -3.222  1.00 0.00 ? 431 VAL A CA   1  
ATOM 602   C C    . VAL A 1 39  ? 11.347  2.852   -2.860  1.00 0.00 ? 431 VAL A C    1  
ATOM 603   O O    . VAL A 1 39  ? 12.159  2.446   -3.731  1.00 0.00 ? 431 VAL A O    1  
ATOM 604   C CB   . VAL A 1 39  ? 9.080   2.107   -3.649  1.00 0.00 ? 431 VAL A CB   1  
ATOM 605   C CG1  . VAL A 1 39  ? 8.960   1.074   -2.532  1.00 0.00 ? 431 VAL A CG1  1  
ATOM 606   C CG2  . VAL A 1 39  ? 7.710   2.591   -4.068  1.00 0.00 ? 431 VAL A CG2  1  
ATOM 607   H H    . VAL A 1 39  ? 10.401  4.055   -5.113  1.00 0.00 ? 431 VAL A H    1  
ATOM 608   H HA   . VAL A 1 39  ? 9.517   3.767   -2.347  1.00 0.00 ? 431 VAL A HA   1  
ATOM 609   H HB   . VAL A 1 39  ? 9.538   1.625   -4.499  1.00 0.00 ? 431 VAL A HB   1  
ATOM 610   H HG11 . VAL A 1 39  ? 9.943   0.707   -2.277  1.00 0.00 ? 431 VAL A HG11 1  
ATOM 611   H HG12 . VAL A 1 39  ? 8.511   1.530   -1.662  1.00 0.00 ? 431 VAL A HG12 1  
ATOM 612   H HG13 . VAL A 1 39  ? 8.345   0.251   -2.864  1.00 0.00 ? 431 VAL A HG13 1  
ATOM 613   H HG21 . VAL A 1 39  ? 7.271   3.157   -3.259  1.00 0.00 ? 431 VAL A HG21 1  
ATOM 614   H HG22 . VAL A 1 39  ? 7.792   3.218   -4.943  1.00 0.00 ? 431 VAL A HG22 1  
ATOM 615   H HG23 . VAL A 1 39  ? 7.074   1.745   -4.280  1.00 0.00 ? 431 VAL A HG23 1  
ATOM 616   N N    . TYR A 1 40  ? 11.622  2.943   -1.611  1.00 0.00 ? 432 TYR A N    1  
ATOM 617   C CA   . TYR A 1 40  ? 12.857  2.527   -1.052  1.00 0.00 ? 432 TYR A CA   1  
ATOM 618   C C    . TYR A 1 40  ? 12.593  1.273   -0.270  1.00 0.00 ? 432 TYR A C    1  
ATOM 619   O O    . TYR A 1 40  ? 11.448  1.003   0.078   1.00 0.00 ? 432 TYR A O    1  
ATOM 620   C CB   . TYR A 1 40  ? 13.395  3.582   -0.091  1.00 0.00 ? 432 TYR A CB   1  
ATOM 621   C CG   . TYR A 1 40  ? 13.501  4.972   -0.657  1.00 0.00 ? 432 TYR A CG   1  
ATOM 622   C CD1  . TYR A 1 40  ? 14.538  5.326   -1.498  1.00 0.00 ? 432 TYR A CD1  1  
ATOM 623   C CD2  . TYR A 1 40  ? 12.573  5.941   -0.315  1.00 0.00 ? 432 TYR A CD2  1  
ATOM 624   C CE1  . TYR A 1 40  ? 14.651  6.610   -1.985  1.00 0.00 ? 432 TYR A CE1  1  
ATOM 625   C CE2  . TYR A 1 40  ? 12.674  7.221   -0.804  1.00 0.00 ? 432 TYR A CE2  1  
ATOM 626   C CZ   . TYR A 1 40  ? 13.714  7.552   -1.634  1.00 0.00 ? 432 TYR A CZ   1  
ATOM 627   O OH   . TYR A 1 40  ? 13.826  8.831   -2.099  1.00 0.00 ? 432 TYR A OH   1  
ATOM 628   H H    . TYR A 1 40  ? 10.927  3.288   -1.004  1.00 0.00 ? 432 TYR A H    1  
ATOM 629   H HA   . TYR A 1 40  ? 13.577  2.348   -1.835  1.00 0.00 ? 432 TYR A HA   1  
ATOM 630   H HB2  . TYR A 1 40  ? 12.750  3.630   0.773   1.00 0.00 ? 432 TYR A HB2  1  
ATOM 631   H HB3  . TYR A 1 40  ? 14.382  3.276   0.226   1.00 0.00 ? 432 TYR A HB3  1  
ATOM 632   H HD1  . TYR A 1 40  ? 15.266  4.578   -1.776  1.00 0.00 ? 432 TYR A HD1  1  
ATOM 633   H HD2  . TYR A 1 40  ? 11.757  5.675   0.339   1.00 0.00 ? 432 TYR A HD2  1  
ATOM 634   H HE1  . TYR A 1 40  ? 15.468  6.870   -2.642  1.00 0.00 ? 432 TYR A HE1  1  
ATOM 635   H HE2  . TYR A 1 40  ? 11.942  7.964   -0.529  1.00 0.00 ? 432 TYR A HE2  1  
ATOM 636   H HH   . TYR A 1 40  ? 14.126  8.829   -3.015  1.00 0.00 ? 432 TYR A HH   1  
ATOM 637   N N    . VAL A 1 41  ? 13.607  0.521   0.006   1.00 0.00 ? 433 VAL A N    1  
ATOM 638   C CA   . VAL A 1 41  ? 13.455  -0.631  0.831   1.00 0.00 ? 433 VAL A CA   1  
ATOM 639   C C    . VAL A 1 41  ? 14.342  -0.510  2.021   1.00 0.00 ? 433 VAL A C    1  
ATOM 640   O O    . VAL A 1 41  ? 15.457  0.041   1.936   1.00 0.00 ? 433 VAL A O    1  
ATOM 641   C CB   . VAL A 1 41  ? 13.716  -2.007  0.112   1.00 0.00 ? 433 VAL A CB   1  
ATOM 642   C CG1  . VAL A 1 41  ? 12.787  -2.209  -1.060  1.00 0.00 ? 433 VAL A CG1  1  
ATOM 643   C CG2  . VAL A 1 41  ? 15.173  -2.198  -0.300  1.00 0.00 ? 433 VAL A CG2  1  
ATOM 644   H H    . VAL A 1 41  ? 14.491  0.754   -0.359  1.00 0.00 ? 433 VAL A H    1  
ATOM 645   H HA   . VAL A 1 41  ? 12.442  -0.622  1.188   1.00 0.00 ? 433 VAL A HA   1  
ATOM 646   H HB   . VAL A 1 41  ? 13.464  -2.779  0.827   1.00 0.00 ? 433 VAL A HB   1  
ATOM 647   H HG11 . VAL A 1 41  ? 12.907  -1.398  -1.763  1.00 0.00 ? 433 VAL A HG11 1  
ATOM 648   H HG12 . VAL A 1 41  ? 13.037  -3.140  -1.544  1.00 0.00 ? 433 VAL A HG12 1  
ATOM 649   H HG13 . VAL A 1 41  ? 11.766  -2.245  -0.713  1.00 0.00 ? 433 VAL A HG13 1  
ATOM 650   H HG21 . VAL A 1 41  ? 15.485  -1.395  -0.951  1.00 0.00 ? 433 VAL A HG21 1  
ATOM 651   H HG22 . VAL A 1 41  ? 15.782  -2.217  0.593   1.00 0.00 ? 433 VAL A HG22 1  
ATOM 652   H HG23 . VAL A 1 41  ? 15.274  -3.147  -0.805  1.00 0.00 ? 433 VAL A HG23 1  
ATOM 653   N N    . ASN A 1 42  ? 13.842  -0.940  3.139   1.00 0.00 ? 434 ASN A N    1  
ATOM 654   C CA   . ASN A 1 42  ? 14.639  -0.988  4.289   1.00 0.00 ? 434 ASN A CA   1  
ATOM 655   C C    . ASN A 1 42  ? 15.224  -2.376  4.388   1.00 0.00 ? 434 ASN A C    1  
ATOM 656   O O    . ASN A 1 42  ? 14.430  -3.478  4.336   1.00 0.00 ? 434 ASN A O    1  
ATOM 657   C CB   . ASN A 1 42  ? 13.955  -0.481  5.576   1.00 0.00 ? 434 ASN A CB   1  
ATOM 658   C CG   . ASN A 1 42  ? 14.892  -0.474  6.774   1.00 0.00 ? 434 ASN A CG   1  
ATOM 659   O OD1  . ASN A 1 42  ? 16.093  -0.261  6.642   1.00 0.00 ? 434 ASN A OD1  1  
ATOM 660   N ND2  . ASN A 1 42  ? 14.364  -0.733  7.935   1.00 0.00 ? 434 ASN A ND2  1  
ATOM 661   H H    . ASN A 1 42  ? 12.929  -1.299  3.134   1.00 0.00 ? 434 ASN A H    1  
ATOM 662   H HA   . ASN A 1 42  ? 15.477  -0.345  4.051   1.00 0.00 ? 434 ASN A HA   1  
ATOM 663   H HB2  . ASN A 1 42  ? 13.651  0.541   5.405   1.00 0.00 ? 434 ASN A HB2  1  
ATOM 664   H HB3  . ASN A 1 42  ? 13.078  -1.049  5.829   1.00 0.00 ? 434 ASN A HB3  1  
ATOM 665   H HD21 . ASN A 1 42  ? 13.404  -0.928  8.011   1.00 0.00 ? 434 ASN A HD21 1  
ATOM 666   H HD22 . ASN A 1 42  ? 14.969  -0.721  8.706   1.00 0.00 ? 434 ASN A HD22 1  
ATOM 667   N N    . HIS A 1 43  ? 16.562  -2.251  4.614   1.00 0.00 ? 435 HIS A N    1  
ATOM 668   C CA   . HIS A 1 43  ? 17.709  -3.167  4.471   1.00 0.00 ? 435 HIS A CA   1  
ATOM 669   C C    . HIS A 1 43  ? 17.536  -4.612  4.838   1.00 0.00 ? 435 HIS A C    1  
ATOM 670   O O    . HIS A 1 43  ? 16.814  -4.971  5.764   1.00 0.00 ? 435 HIS A O    1  
ATOM 671   C CB   . HIS A 1 43  ? 18.912  -2.594  5.252   1.00 0.00 ? 435 HIS A CB   1  
ATOM 672   C CG   . HIS A 1 43  ? 20.163  -2.410  4.429   1.00 0.00 ? 435 HIS A CG   1  
ATOM 673   N ND1  . HIS A 1 43  ? 20.871  -1.227  4.354   1.00 0.00 ? 435 HIS A ND1  1  
ATOM 674   C CD2  . HIS A 1 43  ? 20.833  -3.291  3.640   1.00 0.00 ? 435 HIS A CD2  1  
ATOM 675   C CE1  . HIS A 1 43  ? 21.914  -1.418  3.541   1.00 0.00 ? 435 HIS A CE1  1  
ATOM 676   N NE2  . HIS A 1 43  ? 21.939  -2.657  3.079   1.00 0.00 ? 435 HIS A NE2  1  
ATOM 677   H H    . HIS A 1 43  ? 16.803  -1.366  4.966   1.00 0.00 ? 435 HIS A H    1  
ATOM 678   H HA   . HIS A 1 43  ? 18.013  -3.116  3.436   1.00 0.00 ? 435 HIS A HA   1  
ATOM 679   H HB2  . HIS A 1 43  ? 18.644  -1.628  5.655   1.00 0.00 ? 435 HIS A HB2  1  
ATOM 680   H HB3  . HIS A 1 43  ? 19.146  -3.260  6.070   1.00 0.00 ? 435 HIS A HB3  1  
ATOM 681   H HD1  . HIS A 1 43  ? 20.669  -0.386  4.831   1.00 0.00 ? 435 HIS A HD1  1  
ATOM 682   H HD2  . HIS A 1 43  ? 20.561  -4.322  3.470   1.00 0.00 ? 435 HIS A HD2  1  
ATOM 683   H HE1  . HIS A 1 43  ? 22.633  -0.652  3.288   1.00 0.00 ? 435 HIS A HE1  1  
ATOM 684   N N    . GLY A 1 44  ? 18.295  -5.426  4.091   1.00 0.00 ? 436 GLY A N    1  
ATOM 685   C CA   . GLY A 1 44  ? 18.404  -6.851  4.301   1.00 0.00 ? 436 GLY A CA   1  
ATOM 686   C C    . GLY A 1 44  ? 17.684  -7.603  3.230   1.00 0.00 ? 436 GLY A C    1  
ATOM 687   O O    . GLY A 1 44  ? 17.955  -8.782  2.958   1.00 0.00 ? 436 GLY A O    1  
ATOM 688   H H    . GLY A 1 44  ? 18.796  -5.046  3.337   1.00 0.00 ? 436 GLY A H    1  
ATOM 689   H HA2  . GLY A 1 44  ? 19.447  -7.130  4.291   1.00 0.00 ? 436 GLY A HA2  1  
ATOM 690   H HA3  . GLY A 1 44  ? 17.974  -7.104  5.259   1.00 0.00 ? 436 GLY A HA3  1  
ATOM 691   N N    . GLU A 1 45  ? 16.825  -6.903  2.577   1.00 0.00 ? 437 GLU A N    1  
ATOM 692   C CA   . GLU A 1 45  ? 15.901  -7.478  1.663   1.00 0.00 ? 437 GLU A CA   1  
ATOM 693   C C    . GLU A 1 45  ? 16.401  -7.350  0.242   1.00 0.00 ? 437 GLU A C    1  
ATOM 694   O O    . GLU A 1 45  ? 16.601  -6.238  -0.251  1.00 0.00 ? 437 GLU A O    1  
ATOM 695   C CB   . GLU A 1 45  ? 14.584  -6.741  1.810   1.00 0.00 ? 437 GLU A CB   1  
ATOM 696   C CG   . GLU A 1 45  ? 14.209  -6.440  3.266   1.00 0.00 ? 437 GLU A CG   1  
ATOM 697   C CD   . GLU A 1 45  ? 14.193  -7.676  4.172   1.00 0.00 ? 437 GLU A CD   1  
ATOM 698   O OE1  . GLU A 1 45  ? 15.146  -7.913  4.907   1.00 0.00 ? 437 GLU A OE1  1  
ATOM 699   O OE2  . GLU A 1 45  ? 13.240  -8.433  4.128   1.00 0.00 ? 437 GLU A OE2  1  
ATOM 700   H H    . GLU A 1 45  ? 16.813  -5.937  2.732   1.00 0.00 ? 437 GLU A H    1  
ATOM 701   H HA   . GLU A 1 45  ? 15.737  -8.513  1.918   1.00 0.00 ? 437 GLU A HA   1  
ATOM 702   H HB2  . GLU A 1 45  ? 14.654  -5.805  1.275   1.00 0.00 ? 437 GLU A HB2  1  
ATOM 703   H HB3  . GLU A 1 45  ? 13.802  -7.338  1.368   1.00 0.00 ? 437 GLU A HB3  1  
ATOM 704   H HG2  . GLU A 1 45  ? 14.931  -5.725  3.633   1.00 0.00 ? 437 GLU A HG2  1  
ATOM 705   H HG3  . GLU A 1 45  ? 13.237  -5.970  3.267   1.00 0.00 ? 437 GLU A HG3  1  
ATOM 706   N N    . ASN A 1 46  ? 16.624  -8.465  -0.403  1.00 0.00 ? 438 ASN A N    1  
ATOM 707   C CA   . ASN A 1 46  ? 17.051  -8.455  -1.791  1.00 0.00 ? 438 ASN A CA   1  
ATOM 708   C C    . ASN A 1 46  ? 15.921  -8.937  -2.672  1.00 0.00 ? 438 ASN A C    1  
ATOM 709   O O    . ASN A 1 46  ? 15.550  -10.106 -2.628  1.00 0.00 ? 438 ASN A O    1  
ATOM 710   C CB   . ASN A 1 46  ? 18.289  -9.344  -2.016  1.00 0.00 ? 438 ASN A CB   1  
ATOM 711   C CG   . ASN A 1 46  ? 18.784  -9.296  -3.462  1.00 0.00 ? 438 ASN A CG   1  
ATOM 712   O OD1  . ASN A 1 46  ? 19.618  -8.460  -3.812  1.00 0.00 ? 438 ASN A OD1  1  
ATOM 713   N ND2  . ASN A 1 46  ? 18.295  -10.187 -4.302  1.00 0.00 ? 438 ASN A ND2  1  
ATOM 714   H H    . ASN A 1 46  ? 16.504  -9.325  0.055   1.00 0.00 ? 438 ASN A H    1  
ATOM 715   H HA   . ASN A 1 46  ? 17.293  -7.437  -2.059  1.00 0.00 ? 438 ASN A HA   1  
ATOM 716   H HB2  . ASN A 1 46  ? 19.088  -9.009  -1.371  1.00 0.00 ? 438 ASN A HB2  1  
ATOM 717   H HB3  . ASN A 1 46  ? 18.041  -10.367 -1.775  1.00 0.00 ? 438 ASN A HB3  1  
ATOM 718   H HD21 . ASN A 1 46  ? 17.645  -10.844 -3.965  1.00 0.00 ? 438 ASN A HD21 1  
ATOM 719   H HD22 . ASN A 1 46  ? 18.566  -10.162 -5.245  1.00 0.00 ? 438 ASN A HD22 1  
ATOM 720   N N    . LEU A 1 47  ? 15.337  -8.041  -3.412  1.00 0.00 ? 439 LEU A N    1  
ATOM 721   C CA   . LEU A 1 47  ? 14.287  -8.380  -4.347  1.00 0.00 ? 439 LEU A CA   1  
ATOM 722   C C    . LEU A 1 47  ? 14.507  -7.604  -5.631  1.00 0.00 ? 439 LEU A C    1  
ATOM 723   O O    . LEU A 1 47  ? 15.183  -6.566  -5.615  1.00 0.00 ? 439 LEU A O    1  
ATOM 724   C CB   . LEU A 1 47  ? 12.863  -8.116  -3.772  1.00 0.00 ? 439 LEU A CB   1  
ATOM 725   C CG   . LEU A 1 47  ? 12.428  -6.652  -3.496  1.00 0.00 ? 439 LEU A CG   1  
ATOM 726   C CD1  . LEU A 1 47  ? 10.967  -6.620  -3.120  1.00 0.00 ? 439 LEU A CD1  1  
ATOM 727   C CD2  . LEU A 1 47  ? 13.233  -6.010  -2.376  1.00 0.00 ? 439 LEU A CD2  1  
ATOM 728   H H    . LEU A 1 47  ? 15.626  -7.105  -3.371  1.00 0.00 ? 439 LEU A H    1  
ATOM 729   H HA   . LEU A 1 47  ? 14.394  -9.431  -4.574  1.00 0.00 ? 439 LEU A HA   1  
ATOM 730   H HB2  . LEU A 1 47  ? 12.152  -8.534  -4.470  1.00 0.00 ? 439 LEU A HB2  1  
ATOM 731   H HB3  . LEU A 1 47  ? 12.779  -8.667  -2.847  1.00 0.00 ? 439 LEU A HB3  1  
ATOM 732   H HG   . LEU A 1 47  ? 12.553  -6.067  -4.396  1.00 0.00 ? 439 LEU A HG   1  
ATOM 733   H HD11 . LEU A 1 47  ? 10.376  -7.025  -3.928  1.00 0.00 ? 439 LEU A HD11 1  
ATOM 734   H HD12 . LEU A 1 47  ? 10.817  -7.211  -2.229  1.00 0.00 ? 439 LEU A HD12 1  
ATOM 735   H HD13 . LEU A 1 47  ? 10.673  -5.599  -2.927  1.00 0.00 ? 439 LEU A HD13 1  
ATOM 736   H HD21 . LEU A 1 47  ? 13.140  -6.600  -1.476  1.00 0.00 ? 439 LEU A HD21 1  
ATOM 737   H HD22 . LEU A 1 47  ? 14.270  -5.932  -2.666  1.00 0.00 ? 439 LEU A HD22 1  
ATOM 738   H HD23 . LEU A 1 47  ? 12.829  -5.025  -2.193  1.00 0.00 ? 439 LEU A HD23 1  
ATOM 739   N N    . LYS A 1 48  ? 13.992  -8.098  -6.724  1.00 0.00 ? 440 LYS A N    1  
ATOM 740   C CA   . LYS A 1 48  ? 14.122  -7.418  -7.986  1.00 0.00 ? 440 LYS A CA   1  
ATOM 741   C C    . LYS A 1 48  ? 12.836  -6.700  -8.353  1.00 0.00 ? 440 LYS A C    1  
ATOM 742   O O    . LYS A 1 48  ? 11.772  -7.314  -8.481  1.00 0.00 ? 440 LYS A O    1  
ATOM 743   C CB   . LYS A 1 48  ? 14.610  -8.358  -9.093  1.00 0.00 ? 440 LYS A CB   1  
ATOM 744   C CG   . LYS A 1 48  ? 14.697  -7.688  -10.453 1.00 0.00 ? 440 LYS A CG   1  
ATOM 745   C CD   . LYS A 1 48  ? 15.515  -8.483  -11.454 1.00 0.00 ? 440 LYS A CD   1  
ATOM 746   C CE   . LYS A 1 48  ? 17.004  -8.490  -11.090 1.00 0.00 ? 440 LYS A CE   1  
ATOM 747   N NZ   . LYS A 1 48  ? 17.551  -7.116  -10.942 1.00 0.00 ? 440 LYS A NZ   1  
ATOM 748   H H    . LYS A 1 48  ? 13.489  -8.941  -6.684  1.00 0.00 ? 440 LYS A H    1  
ATOM 749   H HA   . LYS A 1 48  ? 14.865  -6.650  -7.832  1.00 0.00 ? 440 LYS A HA   1  
ATOM 750   H HB2  . LYS A 1 48  ? 15.586  -8.732  -8.826  1.00 0.00 ? 440 LYS A HB2  1  
ATOM 751   H HB3  . LYS A 1 48  ? 13.927  -9.191  -9.168  1.00 0.00 ? 440 LYS A HB3  1  
ATOM 752   H HG2  . LYS A 1 48  ? 13.699  -7.562  -10.843 1.00 0.00 ? 440 LYS A HG2  1  
ATOM 753   H HG3  . LYS A 1 48  ? 15.148  -6.715  -10.324 1.00 0.00 ? 440 LYS A HG3  1  
ATOM 754   H HD2  . LYS A 1 48  ? 15.156  -9.501  -11.475 1.00 0.00 ? 440 LYS A HD2  1  
ATOM 755   H HD3  . LYS A 1 48  ? 15.397  -8.039  -12.431 1.00 0.00 ? 440 LYS A HD3  1  
ATOM 756   H HE2  . LYS A 1 48  ? 17.140  -9.016  -10.158 1.00 0.00 ? 440 LYS A HE2  1  
ATOM 757   H HE3  . LYS A 1 48  ? 17.549  -9.000  -11.870 1.00 0.00 ? 440 LYS A HE3  1  
ATOM 758   H HZ1  . LYS A 1 48  ? 17.247  -6.502  -11.732 1.00 0.00 ? 440 LYS A HZ1  1  
ATOM 759   H HZ2  . LYS A 1 48  ? 17.281  -6.663  -10.048 1.00 0.00 ? 440 LYS A HZ2  1  
ATOM 760   H HZ3  . LYS A 1 48  ? 18.591  -7.147  -10.975 1.00 0.00 ? 440 LYS A HZ3  1  
ATOM 761   N N    . THR A 1 49  ? 12.945  -5.414  -8.530  1.00 0.00 ? 441 THR A N    1  
ATOM 762   C CA   . THR A 1 49  ? 11.821  -4.562  -8.773  1.00 0.00 ? 441 THR A CA   1  
ATOM 763   C C    . THR A 1 49  ? 11.461  -4.421  -10.257 1.00 0.00 ? 441 THR A C    1  
ATOM 764   O O    . THR A 1 49  ? 10.378  -3.945  -10.591 1.00 0.00 ? 441 THR A O    1  
ATOM 765   C CB   . THR A 1 49  ? 12.095  -3.223  -8.134  1.00 0.00 ? 441 THR A CB   1  
ATOM 766   O OG1  . THR A 1 49  ? 13.474  -2.889  -8.384  1.00 0.00 ? 441 THR A OG1  1  
ATOM 767   C CG2  . THR A 1 49  ? 11.844  -3.302  -6.630  1.00 0.00 ? 441 THR A CG2  1  
ATOM 768   H H    . THR A 1 49  ? 13.813  -4.953  -8.484  1.00 0.00 ? 441 THR A H    1  
ATOM 769   H HA   . THR A 1 49  ? 10.974  -4.995  -8.261  1.00 0.00 ? 441 THR A HA   1  
ATOM 770   H HB   . THR A 1 49  ? 11.447  -2.479  -8.572  1.00 0.00 ? 441 THR A HB   1  
ATOM 771   H HG1  . THR A 1 49  ? 13.643  -2.021  -7.992  1.00 0.00 ? 441 THR A HG1  1  
ATOM 772   H HG21 . THR A 1 49  ? 12.435  -4.106  -6.217  1.00 0.00 ? 441 THR A HG21 1  
ATOM 773   H HG22 . THR A 1 49  ? 12.122  -2.373  -6.155  1.00 0.00 ? 441 THR A HG22 1  
ATOM 774   H HG23 . THR A 1 49  ? 10.799  -3.509  -6.454  1.00 0.00 ? 441 THR A HG23 1  
ATOM 775   N N    . GLU A 1 50  ? 12.354  -4.847  -11.160 1.00 0.00 ? 442 GLU A N    1  
ATOM 776   C CA   . GLU A 1 50  ? 12.020  -4.860  -12.596 1.00 0.00 ? 442 GLU A CA   1  
ATOM 777   C C    . GLU A 1 50  ? 10.908  -5.875  -12.855 1.00 0.00 ? 442 GLU A C    1  
ATOM 778   O O    . GLU A 1 50  ? 10.209  -5.821  -13.867 1.00 0.00 ? 442 GLU A O    1  
ATOM 779   C CB   . GLU A 1 50  ? 13.224  -5.193  -13.507 1.00 0.00 ? 442 GLU A CB   1  
ATOM 780   C CG   . GLU A 1 50  ? 14.438  -4.287  -13.361 1.00 0.00 ? 442 GLU A CG   1  
ATOM 781   C CD   . GLU A 1 50  ? 15.367  -4.720  -12.258 1.00 0.00 ? 442 GLU A CD   1  
ATOM 782   O OE1  . GLU A 1 50  ? 16.406  -5.346  -12.561 1.00 0.00 ? 442 GLU A OE1  1  
ATOM 783   O OE2  . GLU A 1 50  ? 15.082  -4.461  -11.074 1.00 0.00 ? 442 GLU A OE2  1  
ATOM 784   H H    . GLU A 1 50  ? 13.267  -5.069  -10.867 1.00 0.00 ? 442 GLU A H    1  
ATOM 785   H HA   . GLU A 1 50  ? 11.642  -3.877  -12.839 1.00 0.00 ? 442 GLU A HA   1  
ATOM 786   H HB2  . GLU A 1 50  ? 13.544  -6.202  -13.292 1.00 0.00 ? 442 GLU A HB2  1  
ATOM 787   H HB3  . GLU A 1 50  ? 12.892  -5.151  -14.534 1.00 0.00 ? 442 GLU A HB3  1  
ATOM 788   H HG2  . GLU A 1 50  ? 14.988  -4.293  -14.290 1.00 0.00 ? 442 GLU A HG2  1  
ATOM 789   H HG3  . GLU A 1 50  ? 14.096  -3.284  -13.153 1.00 0.00 ? 442 GLU A HG3  1  
ATOM 790   N N    . GLN A 1 51  ? 10.743  -6.783  -11.911 1.00 0.00 ? 443 GLN A N    1  
ATOM 791   C CA   . GLN A 1 51  ? 9.732   -7.818  -11.985 1.00 0.00 ? 443 GLN A CA   1  
ATOM 792   C C    . GLN A 1 51  ? 8.376   -7.275  -11.526 1.00 0.00 ? 443 GLN A C    1  
ATOM 793   O O    . GLN A 1 51  ? 7.343   -7.910  -11.725 1.00 0.00 ? 443 GLN A O    1  
ATOM 794   C CB   . GLN A 1 51  ? 10.158  -9.026  -11.143 1.00 0.00 ? 443 GLN A CB   1  
ATOM 795   C CG   . GLN A 1 51  ? 11.467  -9.643  -11.616 1.00 0.00 ? 443 GLN A CG   1  
ATOM 796   C CD   . GLN A 1 51  ? 11.964  -10.779 -10.747 1.00 0.00 ? 443 GLN A CD   1  
ATOM 797   O OE1  . GLN A 1 51  ? 11.714  -10.825 -9.542  1.00 0.00 ? 443 GLN A OE1  1  
ATOM 798   N NE2  . GLN A 1 51  ? 12.664  -11.705 -11.340 1.00 0.00 ? 443 GLN A NE2  1  
ATOM 799   H H    . GLN A 1 51  ? 11.325  -6.740  -11.125 1.00 0.00 ? 443 GLN A H    1  
ATOM 800   H HA   . GLN A 1 51  ? 9.647   -8.122  -13.017 1.00 0.00 ? 443 GLN A HA   1  
ATOM 801   H HB2  . GLN A 1 51  ? 10.275  -8.714  -10.116 1.00 0.00 ? 443 GLN A HB2  1  
ATOM 802   H HB3  . GLN A 1 51  ? 9.387   -9.780  -11.199 1.00 0.00 ? 443 GLN A HB3  1  
ATOM 803   H HG2  . GLN A 1 51  ? 11.314  -10.030 -12.611 1.00 0.00 ? 443 GLN A HG2  1  
ATOM 804   H HG3  . GLN A 1 51  ? 12.221  -8.871  -11.651 1.00 0.00 ? 443 GLN A HG3  1  
ATOM 805   H HE21 . GLN A 1 51  ? 12.816  -11.626 -12.309 1.00 0.00 ? 443 GLN A HE21 1  
ATOM 806   H HE22 . GLN A 1 51  ? 13.054  -12.426 -10.800 1.00 0.00 ? 443 GLN A HE22 1  
ATOM 807   N N    . TRP A 1 52  ? 8.389   -6.090  -10.949 1.00 0.00 ? 444 TRP A N    1  
ATOM 808   C CA   . TRP A 1 52  ? 7.177   -5.439  -10.497 1.00 0.00 ? 444 TRP A CA   1  
ATOM 809   C C    . TRP A 1 52  ? 6.530   -4.707  -11.655 1.00 0.00 ? 444 TRP A C    1  
ATOM 810   O O    . TRP A 1 52  ? 7.241   -4.173  -12.527 1.00 0.00 ? 444 TRP A O    1  
ATOM 811   C CB   . TRP A 1 52  ? 7.471   -4.411  -9.391  1.00 0.00 ? 444 TRP A CB   1  
ATOM 812   C CG   . TRP A 1 52  ? 7.861   -4.971  -8.057  1.00 0.00 ? 444 TRP A CG   1  
ATOM 813   C CD1  . TRP A 1 52  ? 8.295   -6.231  -7.770  1.00 0.00 ? 444 TRP A CD1  1  
ATOM 814   C CD2  . TRP A 1 52  ? 7.856   -4.258  -6.818  1.00 0.00 ? 444 TRP A CD2  1  
ATOM 815   N NE1  . TRP A 1 52  ? 8.544   -6.347  -6.428  1.00 0.00 ? 444 TRP A NE1  1  
ATOM 816   C CE2  . TRP A 1 52  ? 8.285   -5.145  -5.821  1.00 0.00 ? 444 TRP A CE2  1  
ATOM 817   C CE3  . TRP A 1 52  ? 7.524   -2.948  -6.458  1.00 0.00 ? 444 TRP A CE3  1  
ATOM 818   C CZ2  . TRP A 1 52  ? 8.390   -4.767  -4.485  1.00 0.00 ? 444 TRP A CZ2  1  
ATOM 819   C CZ3  . TRP A 1 52  ? 7.632   -2.571  -5.135  1.00 0.00 ? 444 TRP A CZ3  1  
ATOM 820   C CH2  . TRP A 1 52  ? 8.062   -3.480  -4.160  1.00 0.00 ? 444 TRP A CH2  1  
ATOM 821   H H    . TRP A 1 52  ? 9.234   -5.604  -10.843 1.00 0.00 ? 444 TRP A H    1  
ATOM 822   H HA   . TRP A 1 52  ? 6.517   -6.197  -10.103 1.00 0.00 ? 444 TRP A HA   1  
ATOM 823   H HB2  . TRP A 1 52  ? 8.281   -3.775  -9.715  1.00 0.00 ? 444 TRP A HB2  1  
ATOM 824   H HB3  . TRP A 1 52  ? 6.591   -3.801  -9.250  1.00 0.00 ? 444 TRP A HB3  1  
ATOM 825   H HD1  . TRP A 1 52  ? 8.412   -7.017  -8.501  1.00 0.00 ? 444 TRP A HD1  1  
ATOM 826   H HE1  . TRP A 1 52  ? 8.862   -7.167  -5.989  1.00 0.00 ? 444 TRP A HE1  1  
ATOM 827   H HE3  . TRP A 1 52  ? 7.193   -2.235  -7.199  1.00 0.00 ? 444 TRP A HE3  1  
ATOM 828   H HZ2  . TRP A 1 52  ? 8.719   -5.457  -3.722  1.00 0.00 ? 444 TRP A HZ2  1  
ATOM 829   H HZ3  . TRP A 1 52  ? 7.378   -1.560  -4.850  1.00 0.00 ? 444 TRP A HZ3  1  
ATOM 830   H HH2  . TRP A 1 52  ? 8.140   -3.153  -3.134  1.00 0.00 ? 444 TRP A HH2  1  
ATOM 831   N N    . PRO A 1 53  ? 5.195   -4.721  -11.739 1.00 0.00 ? 445 PRO A N    1  
ATOM 832   C CA   . PRO A 1 53  ? 4.456   -3.902  -12.706 1.00 0.00 ? 445 PRO A CA   1  
ATOM 833   C C    . PRO A 1 53  ? 4.608   -2.418  -12.353 1.00 0.00 ? 445 PRO A C    1  
ATOM 834   O O    . PRO A 1 53  ? 5.005   -2.087  -11.236 1.00 0.00 ? 445 PRO A O    1  
ATOM 835   C CB   . PRO A 1 53  ? 3.000   -4.355  -12.520 1.00 0.00 ? 445 PRO A CB   1  
ATOM 836   C CG   . PRO A 1 53  ? 3.097   -5.664  -11.824 1.00 0.00 ? 445 PRO A CG   1  
ATOM 837   C CD   . PRO A 1 53  ? 4.285   -5.547  -10.930 1.00 0.00 ? 445 PRO A CD   1  
ATOM 838   H HA   . PRO A 1 53  ? 4.788   -4.073  -13.719 1.00 0.00 ? 445 PRO A HA   1  
ATOM 839   H HB2  . PRO A 1 53  ? 2.466   -3.626  -11.929 1.00 0.00 ? 445 PRO A HB2  1  
ATOM 840   H HB3  . PRO A 1 53  ? 2.534   -4.458  -13.488 1.00 0.00 ? 445 PRO A HB3  1  
ATOM 841   H HG2  . PRO A 1 53  ? 2.201   -5.854  -11.252 1.00 0.00 ? 445 PRO A HG2  1  
ATOM 842   H HG3  . PRO A 1 53  ? 3.251   -6.452  -12.547 1.00 0.00 ? 445 PRO A HG3  1  
ATOM 843   H HD2  . PRO A 1 53  ? 4.018   -5.057  -10.004 1.00 0.00 ? 445 PRO A HD2  1  
ATOM 844   H HD3  . PRO A 1 53  ? 4.704   -6.524  -10.745 1.00 0.00 ? 445 PRO A HD3  1  
ATOM 845   N N    . GLN A 1 54  ? 4.306   -1.536  -13.282 1.00 0.00 ? 446 GLN A N    1  
ATOM 846   C CA   . GLN A 1 54  ? 4.481   -0.111  -13.040 1.00 0.00 ? 446 GLN A CA   1  
ATOM 847   C C    . GLN A 1 54  ? 3.319   0.500   -12.264 1.00 0.00 ? 446 GLN A C    1  
ATOM 848   O O    . GLN A 1 54  ? 3.385   1.667   -11.852 1.00 0.00 ? 446 GLN A O    1  
ATOM 849   C CB   . GLN A 1 54  ? 4.777   0.652   -14.326 1.00 0.00 ? 446 GLN A CB   1  
ATOM 850   C CG   . GLN A 1 54  ? 6.116   0.271   -14.944 1.00 0.00 ? 446 GLN A CG   1  
ATOM 851   C CD   . GLN A 1 54  ? 6.457   1.075   -16.178 1.00 0.00 ? 446 GLN A CD   1  
ATOM 852   O OE1  . GLN A 1 54  ? 5.574   1.506   -16.928 1.00 0.00 ? 446 GLN A OE1  1  
ATOM 853   N NE2  . GLN A 1 54  ? 7.727   1.287   -16.401 1.00 0.00 ? 446 GLN A NE2  1  
ATOM 854   H H    . GLN A 1 54  ? 3.943   -1.842  -14.141 1.00 0.00 ? 446 GLN A H    1  
ATOM 855   H HA   . GLN A 1 54  ? 5.349   -0.041  -12.401 1.00 0.00 ? 446 GLN A HA   1  
ATOM 856   H HB2  . GLN A 1 54  ? 3.995   0.450   -15.042 1.00 0.00 ? 446 GLN A HB2  1  
ATOM 857   H HB3  . GLN A 1 54  ? 4.794   1.710   -14.111 1.00 0.00 ? 446 GLN A HB3  1  
ATOM 858   H HG2  . GLN A 1 54  ? 6.893   0.432   -14.211 1.00 0.00 ? 446 GLN A HG2  1  
ATOM 859   H HG3  . GLN A 1 54  ? 6.088   -0.776  -15.209 1.00 0.00 ? 446 GLN A HG3  1  
ATOM 860   H HE21 . GLN A 1 54  ? 8.375   0.915   -15.762 1.00 0.00 ? 446 GLN A HE21 1  
ATOM 861   H HE22 . GLN A 1 54  ? 7.988   1.801   -17.192 1.00 0.00 ? 446 GLN A HE22 1  
ATOM 862   N N    . LYS A 1 55  ? 2.257   -0.268  -12.106 1.00 0.00 ? 447 LYS A N    1  
ATOM 863   C CA   . LYS A 1 55  ? 1.139   0.103   -11.267 1.00 0.00 ? 447 LYS A CA   1  
ATOM 864   C C    . LYS A 1 55  ? 0.888   -0.966  -10.250 1.00 0.00 ? 447 LYS A C    1  
ATOM 865   O O    . LYS A 1 55  ? 0.922   -2.161  -10.564 1.00 0.00 ? 447 LYS A O    1  
ATOM 866   C CB   . LYS A 1 55  ? -0.171  0.347   -12.033 1.00 0.00 ? 447 LYS A CB   1  
ATOM 867   C CG   . LYS A 1 55  ? -0.320  1.693   -12.711 1.00 0.00 ? 447 LYS A CG   1  
ATOM 868   C CD   . LYS A 1 55  ? 0.522   1.856   -13.948 1.00 0.00 ? 447 LYS A CD   1  
ATOM 869   C CE   . LYS A 1 55  ? 0.229   3.195   -14.591 1.00 0.00 ? 447 LYS A CE   1  
ATOM 870   N NZ   . LYS A 1 55  ? -1.205  3.325   -14.978 1.00 0.00 ? 447 LYS A NZ   1  
ATOM 871   H H    . LYS A 1 55  ? 2.204   -1.136  -12.563 1.00 0.00 ? 447 LYS A H    1  
ATOM 872   H HA   . LYS A 1 55  ? 1.412   1.010   -10.747 1.00 0.00 ? 447 LYS A HA   1  
ATOM 873   H HB2  . LYS A 1 55  ? -0.268  -0.410  -12.795 1.00 0.00 ? 447 LYS A HB2  1  
ATOM 874   H HB3  . LYS A 1 55  ? -0.988  0.229   -11.337 1.00 0.00 ? 447 LYS A HB3  1  
ATOM 875   H HG2  . LYS A 1 55  ? -1.355  1.821   -12.991 1.00 0.00 ? 447 LYS A HG2  1  
ATOM 876   H HG3  . LYS A 1 55  ? -0.053  2.461   -11.999 1.00 0.00 ? 447 LYS A HG3  1  
ATOM 877   H HD2  . LYS A 1 55  ? 1.567   1.803   -13.681 1.00 0.00 ? 447 LYS A HD2  1  
ATOM 878   H HD3  . LYS A 1 55  ? 0.283   1.069   -14.648 1.00 0.00 ? 447 LYS A HD3  1  
ATOM 879   H HE2  . LYS A 1 55  ? 0.476   3.979   -13.890 1.00 0.00 ? 447 LYS A HE2  1  
ATOM 880   H HE3  . LYS A 1 55  ? 0.843   3.297   -15.473 1.00 0.00 ? 447 LYS A HE3  1  
ATOM 881   H HZ1  . LYS A 1 55  ? -1.841  3.163   -14.164 1.00 0.00 ? 447 LYS A HZ1  1  
ATOM 882   H HZ2  . LYS A 1 55  ? -1.405  4.270   -15.362 1.00 0.00 ? 447 LYS A HZ2  1  
ATOM 883   H HZ3  . LYS A 1 55  ? -1.446  2.624   -15.709 1.00 0.00 ? 447 LYS A HZ3  1  
ATOM 884   N N    . LEU A 1 56  ? 0.662   -0.550  -9.042  1.00 0.00 ? 448 LEU A N    1  
ATOM 885   C CA   . LEU A 1 56  ? 0.320   -1.450  -7.976  1.00 0.00 ? 448 LEU A CA   1  
ATOM 886   C C    . LEU A 1 56  ? -1.059  -1.067  -7.477  1.00 0.00 ? 448 LEU A C    1  
ATOM 887   O O    . LEU A 1 56  ? -1.414  0.129   -7.496  1.00 0.00 ? 448 LEU A O    1  
ATOM 888   C CB   . LEU A 1 56  ? 1.348   -1.379  -6.846  1.00 0.00 ? 448 LEU A CB   1  
ATOM 889   C CG   . LEU A 1 56  ? 2.815   -1.619  -7.236  1.00 0.00 ? 448 LEU A CG   1  
ATOM 890   C CD1  . LEU A 1 56  ? 3.713   -1.617  -6.013  1.00 0.00 ? 448 LEU A CD1  1  
ATOM 891   C CD2  . LEU A 1 56  ? 2.971   -2.906  -8.025  1.00 0.00 ? 448 LEU A CD2  1  
ATOM 892   H H    . LEU A 1 56  ? 0.722   0.411   -8.854  1.00 0.00 ? 448 LEU A H    1  
ATOM 893   H HA   . LEU A 1 56  ? 0.282   -2.451  -8.378  1.00 0.00 ? 448 LEU A HA   1  
ATOM 894   H HB2  . LEU A 1 56  ? 1.278   -0.402  -6.391  1.00 0.00 ? 448 LEU A HB2  1  
ATOM 895   H HB3  . LEU A 1 56  ? 1.075   -2.117  -6.106  1.00 0.00 ? 448 LEU A HB3  1  
ATOM 896   H HG   . LEU A 1 56  ? 3.138   -0.801  -7.860  1.00 0.00 ? 448 LEU A HG   1  
ATOM 897   H HD11 . LEU A 1 56  ? 3.637   -0.664  -5.511  1.00 0.00 ? 448 LEU A HD11 1  
ATOM 898   H HD12 . LEU A 1 56  ? 3.408   -2.405  -5.341  1.00 0.00 ? 448 LEU A HD12 1  
ATOM 899   H HD13 . LEU A 1 56  ? 4.736   -1.781  -6.317  1.00 0.00 ? 448 LEU A HD13 1  
ATOM 900   H HD21 . LEU A 1 56  ? 2.480   -3.696  -7.477  1.00 0.00 ? 448 LEU A HD21 1  
ATOM 901   H HD22 . LEU A 1 56  ? 2.482   -2.802  -8.983  1.00 0.00 ? 448 LEU A HD22 1  
ATOM 902   H HD23 . LEU A 1 56  ? 4.017   -3.137  -8.163  1.00 0.00 ? 448 LEU A HD23 1  
ATOM 903   N N    . ILE A 1 57  ? -1.836  -2.044  -7.043  1.00 0.00 ? 449 ILE A N    1  
ATOM 904   C CA   . ILE A 1 57  ? -3.211  -1.792  -6.644  1.00 0.00 ? 449 ILE A CA   1  
ATOM 905   C C    . ILE A 1 57  ? -3.277  -1.672  -5.139  1.00 0.00 ? 449 ILE A C    1  
ATOM 906   O O    . ILE A 1 57  ? -2.970  -2.624  -4.427  1.00 0.00 ? 449 ILE A O    1  
ATOM 907   C CB   . ILE A 1 57  ? -4.151  -2.953  -7.081  1.00 0.00 ? 449 ILE A CB   1  
ATOM 908   C CG1  . ILE A 1 57  ? -4.028  -3.221  -8.589  1.00 0.00 ? 449 ILE A CG1  1  
ATOM 909   C CG2  . ILE A 1 57  ? -5.607  -2.633  -6.714  1.00 0.00 ? 449 ILE A CG2  1  
ATOM 910   C CD1  . ILE A 1 57  ? -4.846  -4.407  -9.069  1.00 0.00 ? 449 ILE A CD1  1  
ATOM 911   H H    . ILE A 1 57  ? -1.486  -2.960  -6.942  1.00 0.00 ? 449 ILE A H    1  
ATOM 912   H HA   . ILE A 1 57  ? -3.547  -0.875  -7.105  1.00 0.00 ? 449 ILE A HA   1  
ATOM 913   H HB   . ILE A 1 57  ? -3.858  -3.841  -6.540  1.00 0.00 ? 449 ILE A HB   1  
ATOM 914   H HG12 . ILE A 1 57  ? -4.358  -2.348  -9.133  1.00 0.00 ? 449 ILE A HG12 1  
ATOM 915   H HG13 . ILE A 1 57  ? -2.991  -3.413  -8.825  1.00 0.00 ? 449 ILE A HG13 1  
ATOM 916   H HG21 . ILE A 1 57  ? -5.686  -2.495  -5.645  1.00 0.00 ? 449 ILE A HG21 1  
ATOM 917   H HG22 . ILE A 1 57  ? -5.914  -1.729  -7.218  1.00 0.00 ? 449 ILE A HG22 1  
ATOM 918   H HG23 . ILE A 1 57  ? -6.245  -3.450  -7.019  1.00 0.00 ? 449 ILE A HG23 1  
ATOM 919   H HD11 . ILE A 1 57  ? -4.528  -5.297  -8.546  1.00 0.00 ? 449 ILE A HD11 1  
ATOM 920   H HD12 . ILE A 1 57  ? -5.892  -4.229  -8.867  1.00 0.00 ? 449 ILE A HD12 1  
ATOM 921   H HD13 . ILE A 1 57  ? -4.704  -4.544  -10.130 1.00 0.00 ? 449 ILE A HD13 1  
ATOM 922   N N    . MET A 1 58  ? -3.655  -0.527  -4.654  1.00 0.00 ? 450 MET A N    1  
ATOM 923   C CA   . MET A 1 58  ? -3.741  -0.326  -3.228  1.00 0.00 ? 450 MET A CA   1  
ATOM 924   C C    . MET A 1 58  ? -5.129  0.108   -2.793  1.00 0.00 ? 450 MET A C    1  
ATOM 925   O O    . MET A 1 58  ? -5.757  0.974   -3.412  1.00 0.00 ? 450 MET A O    1  
ATOM 926   C CB   . MET A 1 58  ? -2.671  0.650   -2.718  1.00 0.00 ? 450 MET A CB   1  
ATOM 927   C CG   . MET A 1 58  ? -2.661  1.987   -3.426  1.00 0.00 ? 450 MET A CG   1  
ATOM 928   S SD   . MET A 1 58  ? -1.547  3.195   -2.681  1.00 0.00 ? 450 MET A SD   1  
ATOM 929   C CE   . MET A 1 58  ? -2.381  3.528   -1.127  1.00 0.00 ? 450 MET A CE   1  
ATOM 930   H H    . MET A 1 58  ? -3.894  0.208   -5.264  1.00 0.00 ? 450 MET A H    1  
ATOM 931   H HA   . MET A 1 58  ? -3.556  -1.290  -2.778  1.00 0.00 ? 450 MET A HA   1  
ATOM 932   H HB2  . MET A 1 58  ? -2.826  0.823   -1.664  1.00 0.00 ? 450 MET A HB2  1  
ATOM 933   H HB3  . MET A 1 58  ? -1.707  0.188   -2.863  1.00 0.00 ? 450 MET A HB3  1  
ATOM 934   H HG2  . MET A 1 58  ? -2.374  1.836   -4.456  1.00 0.00 ? 450 MET A HG2  1  
ATOM 935   H HG3  . MET A 1 58  ? -3.670  2.368   -3.388  1.00 0.00 ? 450 MET A HG3  1  
ATOM 936   H HE1  . MET A 1 58  ? -3.369  3.916   -1.325  1.00 0.00 ? 450 MET A HE1  1  
ATOM 937   H HE2  . MET A 1 58  ? -2.459  2.618   -0.551  1.00 0.00 ? 450 MET A HE2  1  
ATOM 938   H HE3  . MET A 1 58  ? -1.816  4.260   -0.568  1.00 0.00 ? 450 MET A HE3  1  
ATOM 939   N N    . GLN A 1 59  ? -5.601  -0.514  -1.751  1.00 0.00 ? 451 GLN A N    1  
ATOM 940   C CA   . GLN A 1 59  ? -6.882  -0.197  -1.165  1.00 0.00 ? 451 GLN A CA   1  
ATOM 941   C C    . GLN A 1 59  ? -6.681  0.311   0.243   1.00 0.00 ? 451 GLN A C    1  
ATOM 942   O O    . GLN A 1 59  ? -5.903  -0.267  1.012   1.00 0.00 ? 451 GLN A O    1  
ATOM 943   C CB   . GLN A 1 59  ? -7.822  -1.420  -1.151  1.00 0.00 ? 451 GLN A CB   1  
ATOM 944   C CG   . GLN A 1 59  ? -9.103  -1.200  -0.333  1.00 0.00 ? 451 GLN A CG   1  
ATOM 945   C CD   . GLN A 1 59  ? -9.972  -0.061  -0.853  1.00 0.00 ? 451 GLN A CD   1  
ATOM 946   O OE1  . GLN A 1 59  ? -10.029 0.194   -2.040  1.00 0.00 ? 451 GLN A OE1  1  
ATOM 947   N NE2  . GLN A 1 59  ? -10.601 0.658   0.047   1.00 0.00 ? 451 GLN A NE2  1  
ATOM 948   H H    . GLN A 1 59  ? -5.051  -1.221  -1.344  1.00 0.00 ? 451 GLN A H    1  
ATOM 949   H HA   . GLN A 1 59  ? -7.332  0.586   -1.757  1.00 0.00 ? 451 GLN A HA   1  
ATOM 950   H HB2  . GLN A 1 59  ? -8.103  -1.657  -2.167  1.00 0.00 ? 451 GLN A HB2  1  
ATOM 951   H HB3  . GLN A 1 59  ? -7.291  -2.261  -0.729  1.00 0.00 ? 451 GLN A HB3  1  
ATOM 952   H HG2  . GLN A 1 59  ? -9.689  -2.106  -0.342  1.00 0.00 ? 451 GLN A HG2  1  
ATOM 953   H HG3  . GLN A 1 59  ? -8.815  -0.972  0.682   1.00 0.00 ? 451 GLN A HG3  1  
ATOM 954   H HE21 . GLN A 1 59  ? -10.480 0.443   0.999   1.00 0.00 ? 451 GLN A HE21 1  
ATOM 955   H HE22 . GLN A 1 59  ? -11.176 1.393   -0.259  1.00 0.00 ? 451 GLN A HE22 1  
ATOM 956   N N    . LEU A 1 60  ? -7.347  1.388   0.564   1.00 0.00 ? 452 LEU A N    1  
ATOM 957   C CA   . LEU A 1 60  ? -7.293  1.945   1.885   1.00 0.00 ? 452 LEU A CA   1  
ATOM 958   C C    . LEU A 1 60  ? -8.251  1.195   2.808   1.00 0.00 ? 452 LEU A C    1  
ATOM 959   O O    . LEU A 1 60  ? -9.477  1.260   2.652   1.00 0.00 ? 452 LEU A O    1  
ATOM 960   C CB   . LEU A 1 60  ? -7.606  3.461   1.883   1.00 0.00 ? 452 LEU A CB   1  
ATOM 961   C CG   . LEU A 1 60  ? -6.586  4.406   1.194   1.00 0.00 ? 452 LEU A CG   1  
ATOM 962   C CD1  . LEU A 1 60  ? -5.189  4.208   1.743   1.00 0.00 ? 452 LEU A CD1  1  
ATOM 963   C CD2  . LEU A 1 60  ? -6.601  4.280   -0.327  1.00 0.00 ? 452 LEU A CD2  1  
ATOM 964   H H    . LEU A 1 60  ? -7.907  1.825   -0.114  1.00 0.00 ? 452 LEU A H    1  
ATOM 965   H HA   . LEU A 1 60  ? -6.290  1.797   2.255   1.00 0.00 ? 452 LEU A HA   1  
ATOM 966   H HB2  . LEU A 1 60  ? -8.559  3.601   1.396   1.00 0.00 ? 452 LEU A HB2  1  
ATOM 967   H HB3  . LEU A 1 60  ? -7.710  3.777   2.911   1.00 0.00 ? 452 LEU A HB3  1  
ATOM 968   H HG   . LEU A 1 60  ? -6.864  5.418   1.451   1.00 0.00 ? 452 LEU A HG   1  
ATOM 969   H HD11 . LEU A 1 60  ? -5.196  4.377   2.810   1.00 0.00 ? 452 LEU A HD11 1  
ATOM 970   H HD12 . LEU A 1 60  ? -4.857  3.200   1.543   1.00 0.00 ? 452 LEU A HD12 1  
ATOM 971   H HD13 . LEU A 1 60  ? -4.515  4.908   1.271   1.00 0.00 ? 452 LEU A HD13 1  
ATOM 972   H HD21 . LEU A 1 60  ? -7.584  4.523   -0.702  1.00 0.00 ? 452 LEU A HD21 1  
ATOM 973   H HD22 . LEU A 1 60  ? -5.876  4.959   -0.751  1.00 0.00 ? 452 LEU A HD22 1  
ATOM 974   H HD23 . LEU A 1 60  ? -6.348  3.267   -0.603  1.00 0.00 ? 452 LEU A HD23 1  
ATOM 975   N N    . ILE A 1 61  ? -7.683  0.460   3.719   1.00 0.00 ? 453 ILE A N    1  
ATOM 976   C CA   . ILE A 1 61  ? -8.415  -0.297  4.704   1.00 0.00 ? 453 ILE A CA   1  
ATOM 977   C C    . ILE A 1 61  ? -8.061  0.198   6.099   1.00 0.00 ? 453 ILE A C    1  
ATOM 978   O O    . ILE A 1 61  ? -6.993  0.758   6.276   1.00 0.00 ? 453 ILE A O    1  
ATOM 979   C CB   . ILE A 1 61  ? -8.202  -1.830  4.543   1.00 0.00 ? 453 ILE A CB   1  
ATOM 980   C CG1  . ILE A 1 61  ? -6.753  -2.209  4.296   1.00 0.00 ? 453 ILE A CG1  1  
ATOM 981   C CG2  . ILE A 1 61  ? -9.084  -2.392  3.445   1.00 0.00 ? 453 ILE A CG2  1  
ATOM 982   C CD1  . ILE A 1 61  ? -5.857  -2.227  5.517   1.00 0.00 ? 453 ILE A CD1  1  
ATOM 983   H H    . ILE A 1 61  ? -6.698  0.442   3.755   1.00 0.00 ? 453 ILE A H    1  
ATOM 984   H HA   . ILE A 1 61  ? -9.452  -0.083  4.511   1.00 0.00 ? 453 ILE A HA   1  
ATOM 985   H HB   . ILE A 1 61  ? -8.528  -2.284  5.468   1.00 0.00 ? 453 ILE A HB   1  
ATOM 986   H HG12 . ILE A 1 61  ? -6.820  -3.195  3.878   1.00 0.00 ? 453 ILE A HG12 1  
ATOM 987   H HG13 . ILE A 1 61  ? -6.334  -1.547  3.551   1.00 0.00 ? 453 ILE A HG13 1  
ATOM 988   H HG21 . ILE A 1 61  ? -8.838  -1.908  2.512   1.00 0.00 ? 453 ILE A HG21 1  
ATOM 989   H HG22 . ILE A 1 61  ? -8.906  -3.453  3.356   1.00 0.00 ? 453 ILE A HG22 1  
ATOM 990   H HG23 . ILE A 1 61  ? -10.122 -2.217  3.684   1.00 0.00 ? 453 ILE A HG23 1  
ATOM 991   H HD11 . ILE A 1 61  ? -5.873  -1.252  5.980   1.00 0.00 ? 453 ILE A HD11 1  
ATOM 992   H HD12 . ILE A 1 61  ? -6.217  -2.966  6.218   1.00 0.00 ? 453 ILE A HD12 1  
ATOM 993   H HD13 . ILE A 1 61  ? -4.851  -2.473  5.211   1.00 0.00 ? 453 ILE A HD13 1  
ATOM 994   N N    . PRO A 1 62  ? -8.943  0.069   7.100   1.00 0.00 ? 454 PRO A N    1  
ATOM 995   C CA   . PRO A 1 62  ? -8.646  0.582   8.438   1.00 0.00 ? 454 PRO A CA   1  
ATOM 996   C C    . PRO A 1 62  ? -7.480  -0.157  9.126   1.00 0.00 ? 454 PRO A C    1  
ATOM 997   O O    . PRO A 1 62  ? -7.483  -1.390  9.266   1.00 0.00 ? 454 PRO A O    1  
ATOM 998   C CB   . PRO A 1 62  ? -9.957  0.365   9.209   1.00 0.00 ? 454 PRO A CB   1  
ATOM 999   C CG   . PRO A 1 62  ? -10.674 -0.705  8.454   1.00 0.00 ? 454 PRO A CG   1  
ATOM 1000  C CD   . PRO A 1 62  ? -10.281 -0.534  7.016   1.00 0.00 ? 454 PRO A CD   1  
ATOM 1001  H HA   . PRO A 1 62  ? -8.418  1.638   8.405   1.00 0.00 ? 454 PRO A HA   1  
ATOM 1002  H HB2  . PRO A 1 62  ? -9.733  0.058   10.220  1.00 0.00 ? 454 PRO A HB2  1  
ATOM 1003  H HB3  . PRO A 1 62  ? -10.525 1.284   9.225   1.00 0.00 ? 454 PRO A HB3  1  
ATOM 1004  H HG2  . PRO A 1 62  ? -10.360 -1.676  8.808   1.00 0.00 ? 454 PRO A HG2  1  
ATOM 1005  H HG3  . PRO A 1 62  ? -11.741 -0.589  8.570   1.00 0.00 ? 454 PRO A HG3  1  
ATOM 1006  H HD2  . PRO A 1 62  ? -10.243 -1.490  6.518   1.00 0.00 ? 454 PRO A HD2  1  
ATOM 1007  H HD3  . PRO A 1 62  ? -10.967 0.130   6.512   1.00 0.00 ? 454 PRO A HD3  1  
ATOM 1008  N N    . GLN A 1 63  ? -6.532  0.632   9.607   1.00 0.00 ? 455 GLN A N    1  
ATOM 1009  C CA   . GLN A 1 63  ? -5.328  0.175   10.301  1.00 0.00 ? 455 GLN A CA   1  
ATOM 1010  C C    . GLN A 1 63  ? -5.696  -0.541  11.603  1.00 0.00 ? 455 GLN A C    1  
ATOM 1011  O O    . GLN A 1 63  ? -4.972  -1.408  12.086  1.00 0.00 ? 455 GLN A O    1  
ATOM 1012  C CB   . GLN A 1 63  ? -4.398  1.378   10.536  1.00 0.00 ? 455 GLN A CB   1  
ATOM 1013  C CG   . GLN A 1 63  ? -3.053  1.075   11.164  1.00 0.00 ? 455 GLN A CG   1  
ATOM 1014  C CD   . GLN A 1 63  ? -2.156  2.306   11.215  1.00 0.00 ? 455 GLN A CD   1  
ATOM 1015  O OE1  . GLN A 1 63  ? -2.228  3.193   10.352  1.00 0.00 ? 455 GLN A OE1  1  
ATOM 1016  N NE2  . GLN A 1 63  ? -1.329  2.384   12.209  1.00 0.00 ? 455 GLN A NE2  1  
ATOM 1017  H H    . GLN A 1 63  ? -6.635  1.606   9.486   1.00 0.00 ? 455 GLN A H    1  
ATOM 1018  H HA   . GLN A 1 63  ? -4.831  -0.532  9.651   1.00 0.00 ? 455 GLN A HA   1  
ATOM 1019  H HB2  . GLN A 1 63  ? -4.215  1.855   9.586   1.00 0.00 ? 455 GLN A HB2  1  
ATOM 1020  H HB3  . GLN A 1 63  ? -4.915  2.082   11.171  1.00 0.00 ? 455 GLN A HB3  1  
ATOM 1021  H HG2  . GLN A 1 63  ? -3.209  0.715   12.171  1.00 0.00 ? 455 GLN A HG2  1  
ATOM 1022  H HG3  . GLN A 1 63  ? -2.559  0.313   10.580  1.00 0.00 ? 455 GLN A HG3  1  
ATOM 1023  H HE21 . GLN A 1 63  ? -1.327  1.658   12.869  1.00 0.00 ? 455 GLN A HE21 1  
ATOM 1024  H HE22 . GLN A 1 63  ? -0.735  3.161   12.262  1.00 0.00 ? 455 GLN A HE22 1  
ATOM 1025  N N    . GLN A 1 64  ? -6.852  -0.180  12.138  1.00 0.00 ? 456 GLN A N    1  
ATOM 1026  C CA   . GLN A 1 64  ? -7.381  -0.753  13.370  1.00 0.00 ? 456 GLN A CA   1  
ATOM 1027  C C    . GLN A 1 64  ? -7.522  -2.275  13.265  1.00 0.00 ? 456 GLN A C    1  
ATOM 1028  O O    . GLN A 1 64  ? -7.165  -3.012  14.190  1.00 0.00 ? 456 GLN A O    1  
ATOM 1029  C CB   . GLN A 1 64  ? -8.747  -0.158  13.672  1.00 0.00 ? 456 GLN A CB   1  
ATOM 1030  C CG   . GLN A 1 64  ? -8.757  1.344   13.856  1.00 0.00 ? 456 GLN A CG   1  
ATOM 1031  C CD   . GLN A 1 64  ? -10.154 1.874   14.092  1.00 0.00 ? 456 GLN A CD   1  
ATOM 1032  O OE1  . GLN A 1 64  ? -11.135 1.309   13.608  1.00 0.00 ? 456 GLN A OE1  1  
ATOM 1033  N NE2  . GLN A 1 64  ? -10.263 2.941   14.835  1.00 0.00 ? 456 GLN A NE2  1  
ATOM 1034  H H    . GLN A 1 64  ? -7.354  0.523   11.678  1.00 0.00 ? 456 GLN A H    1  
ATOM 1035  H HA   . GLN A 1 64  ? -6.709  -0.502  14.177  1.00 0.00 ? 456 GLN A HA   1  
ATOM 1036  H HB2  . GLN A 1 64  ? -9.413  -0.395  12.855  1.00 0.00 ? 456 GLN A HB2  1  
ATOM 1037  H HB3  . GLN A 1 64  ? -9.133  -0.610  14.573  1.00 0.00 ? 456 GLN A HB3  1  
ATOM 1038  H HG2  . GLN A 1 64  ? -8.144  1.586   14.712  1.00 0.00 ? 456 GLN A HG2  1  
ATOM 1039  H HG3  . GLN A 1 64  ? -8.349  1.812   12.972  1.00 0.00 ? 456 GLN A HG3  1  
ATOM 1040  H HE21 . GLN A 1 64  ? -9.439  3.337   15.196  1.00 0.00 ? 456 GLN A HE21 1  
ATOM 1041  H HE22 . GLN A 1 64  ? -11.154 3.314   15.001  1.00 0.00 ? 456 GLN A HE22 1  
ATOM 1042  N N    . LEU A 1 65  ? -7.986  -2.747  12.121  1.00 0.00 ? 457 LEU A N    1  
ATOM 1043  C CA   . LEU A 1 65  ? -8.209  -4.175  11.928  1.00 0.00 ? 457 LEU A CA   1  
ATOM 1044  C C    . LEU A 1 65  ? -6.943  -4.871  11.474  1.00 0.00 ? 457 LEU A C    1  
ATOM 1045  O O    . LEU A 1 65  ? -6.864  -6.103  11.463  1.00 0.00 ? 457 LEU A O    1  
ATOM 1046  C CB   . LEU A 1 65  ? -9.366  -4.469  10.949  1.00 0.00 ? 457 LEU A CB   1  
ATOM 1047  C CG   . LEU A 1 65  ? -10.810 -4.236  11.453  1.00 0.00 ? 457 LEU A CG   1  
ATOM 1048  C CD1  . LEU A 1 65  ? -11.096 -2.772  11.751  1.00 0.00 ? 457 LEU A CD1  1  
ATOM 1049  C CD2  . LEU A 1 65  ? -11.810 -4.784  10.452  1.00 0.00 ? 457 LEU A CD2  1  
ATOM 1050  H H    . LEU A 1 65  ? -8.165  -2.131  11.378  1.00 0.00 ? 457 LEU A H    1  
ATOM 1051  H HA   . LEU A 1 65  ? -8.473  -4.571  12.898  1.00 0.00 ? 457 LEU A HA   1  
ATOM 1052  H HB2  . LEU A 1 65  ? -9.221  -3.856  10.072  1.00 0.00 ? 457 LEU A HB2  1  
ATOM 1053  H HB3  . LEU A 1 65  ? -9.281  -5.503  10.648  1.00 0.00 ? 457 LEU A HB3  1  
ATOM 1054  H HG   . LEU A 1 65  ? -10.938 -4.782  12.376  1.00 0.00 ? 457 LEU A HG   1  
ATOM 1055  H HD11 . LEU A 1 65  ? -10.406 -2.433  12.509  1.00 0.00 ? 457 LEU A HD11 1  
ATOM 1056  H HD12 . LEU A 1 65  ? -10.964 -2.186  10.853  1.00 0.00 ? 457 LEU A HD12 1  
ATOM 1057  H HD13 . LEU A 1 65  ? -12.110 -2.668  12.109  1.00 0.00 ? 457 LEU A HD13 1  
ATOM 1058  H HD21 . LEU A 1 65  ? -11.648 -5.844  10.320  1.00 0.00 ? 457 LEU A HD21 1  
ATOM 1059  H HD22 . LEU A 1 65  ? -12.811 -4.617  10.821  1.00 0.00 ? 457 LEU A HD22 1  
ATOM 1060  H HD23 . LEU A 1 65  ? -11.688 -4.277  9.506   1.00 0.00 ? 457 LEU A HD23 1  
ATOM 1061  N N    . LEU A 1 66  ? -5.939  -4.084  11.158  1.00 0.00 ? 458 LEU A N    1  
ATOM 1062  C CA   . LEU A 1 66  ? -4.675  -4.603  10.679  1.00 0.00 ? 458 LEU A CA   1  
ATOM 1063  C C    . LEU A 1 66  ? -3.855  -5.152  11.844  1.00 0.00 ? 458 LEU A C    1  
ATOM 1064  O O    . LEU A 1 66  ? -2.979  -5.996  11.659  1.00 0.00 ? 458 LEU A O    1  
ATOM 1065  C CB   . LEU A 1 66  ? -3.902  -3.505  9.944   1.00 0.00 ? 458 LEU A CB   1  
ATOM 1066  C CG   . LEU A 1 66  ? -2.586  -3.923  9.309   1.00 0.00 ? 458 LEU A CG   1  
ATOM 1067  C CD1  . LEU A 1 66  ? -2.829  -4.976  8.234   1.00 0.00 ? 458 LEU A CD1  1  
ATOM 1068  C CD2  . LEU A 1 66  ? -1.863  -2.708  8.745   1.00 0.00 ? 458 LEU A CD2  1  
ATOM 1069  H H    . LEU A 1 66  ? -6.043  -3.113  11.254  1.00 0.00 ? 458 LEU A H    1  
ATOM 1070  H HA   . LEU A 1 66  ? -4.888  -5.406  9.990   1.00 0.00 ? 458 LEU A HA   1  
ATOM 1071  H HB2  . LEU A 1 66  ? -4.539  -3.111  9.166   1.00 0.00 ? 458 LEU A HB2  1  
ATOM 1072  H HB3  . LEU A 1 66  ? -3.698  -2.711  10.647  1.00 0.00 ? 458 LEU A HB3  1  
ATOM 1073  H HG   . LEU A 1 66  ? -1.959  -4.371  10.067  1.00 0.00 ? 458 LEU A HG   1  
ATOM 1074  H HD11 . LEU A 1 66  ? -3.301  -5.840  8.676   1.00 0.00 ? 458 LEU A HD11 1  
ATOM 1075  H HD12 . LEU A 1 66  ? -3.473  -4.567  7.469   1.00 0.00 ? 458 LEU A HD12 1  
ATOM 1076  H HD13 . LEU A 1 66  ? -1.893  -5.282  7.792   1.00 0.00 ? 458 LEU A HD13 1  
ATOM 1077  H HD21 . LEU A 1 66  ? -1.671  -1.999  9.537   1.00 0.00 ? 458 LEU A HD21 1  
ATOM 1078  H HD22 . LEU A 1 66  ? -0.924  -3.013  8.309   1.00 0.00 ? 458 LEU A HD22 1  
ATOM 1079  H HD23 . LEU A 1 66  ? -2.473  -2.240  7.986   1.00 0.00 ? 458 LEU A HD23 1  
ATOM 1080  N N    . THR A 1 67  ? -4.201  -4.708  13.049  1.00 0.00 ? 459 THR A N    1  
ATOM 1081  C CA   . THR A 1 67  ? -3.545  -5.112  14.286  1.00 0.00 ? 459 THR A CA   1  
ATOM 1082  C C    . THR A 1 67  ? -3.609  -6.647  14.456  1.00 0.00 ? 459 THR A C    1  
ATOM 1083  O O    . THR A 1 67  ? -2.704  -7.274  15.025  1.00 0.00 ? 459 THR A O    1  
ATOM 1084  C CB   . THR A 1 67  ? -4.287  -4.447  15.463  1.00 0.00 ? 459 THR A CB   1  
ATOM 1085  O OG1  . THR A 1 67  ? -4.491  -3.048  15.164  1.00 0.00 ? 459 THR A OG1  1  
ATOM 1086  C CG2  . THR A 1 67  ? -3.503  -4.571  16.761  1.00 0.00 ? 459 THR A CG2  1  
ATOM 1087  H H    . THR A 1 67  ? -4.915  -4.041  13.118  1.00 0.00 ? 459 THR A H    1  
ATOM 1088  H HA   . THR A 1 67  ? -2.521  -4.771  14.283  1.00 0.00 ? 459 THR A HA   1  
ATOM 1089  H HB   . THR A 1 67  ? -5.244  -4.935  15.569  1.00 0.00 ? 459 THR A HB   1  
ATOM 1090  H HG1  . THR A 1 67  ? -5.447  -2.900  15.168  1.00 0.00 ? 459 THR A HG1  1  
ATOM 1091  H HG21 . THR A 1 67  ? -3.360  -5.616  16.990  1.00 0.00 ? 459 THR A HG21 1  
ATOM 1092  H HG22 . THR A 1 67  ? -2.542  -4.092  16.652  1.00 0.00 ? 459 THR A HG22 1  
ATOM 1093  H HG23 . THR A 1 67  ? -4.053  -4.098  17.562  1.00 0.00 ? 459 THR A HG23 1  
ATOM 1094  N N    . THR A 1 68  ? -4.645  -7.236  13.896  1.00 0.00 ? 460 THR A N    1  
ATOM 1095  C CA   . THR A 1 68  ? -4.892  -8.646  13.987  1.00 0.00 ? 460 THR A CA   1  
ATOM 1096  C C    . THR A 1 68  ? -3.813  -9.455  13.210  1.00 0.00 ? 460 THR A C    1  
ATOM 1097  O O    . THR A 1 68  ? -3.553  -10.624 13.516  1.00 0.00 ? 460 THR A O    1  
ATOM 1098  C CB   . THR A 1 68  ? -6.276  -8.934  13.396  1.00 0.00 ? 460 THR A CB   1  
ATOM 1099  O OG1  . THR A 1 68  ? -7.119  -7.774  13.602  1.00 0.00 ? 460 THR A OG1  1  
ATOM 1100  C CG2  . THR A 1 68  ? -6.903  -10.110 14.109  1.00 0.00 ? 460 THR A CG2  1  
ATOM 1101  H H    . THR A 1 68  ? -5.299  -6.698  13.403  1.00 0.00 ? 460 THR A H    1  
ATOM 1102  H HA   . THR A 1 68  ? -4.896  -8.937  15.026  1.00 0.00 ? 460 THR A HA   1  
ATOM 1103  H HB   . THR A 1 68  ? -6.188  -9.152  12.343  1.00 0.00 ? 460 THR A HB   1  
ATOM 1104  H HG1  . THR A 1 68  ? -7.278  -7.380  12.730  1.00 0.00 ? 460 THR A HG1  1  
ATOM 1105  H HG21 . THR A 1 68  ? -7.000  -9.889  15.162  1.00 0.00 ? 460 THR A HG21 1  
ATOM 1106  H HG22 . THR A 1 68  ? -7.880  -10.304 13.692  1.00 0.00 ? 460 THR A HG22 1  
ATOM 1107  H HG23 . THR A 1 68  ? -6.276  -10.981 13.979  1.00 0.00 ? 460 THR A HG23 1  
ATOM 1108  N N    . LEU A 1 69  ? -3.158  -8.798  12.248  1.00 0.00 ? 461 LEU A N    1  
ATOM 1109  C CA   . LEU A 1 69  ? -2.144  -9.435  11.405  1.00 0.00 ? 461 LEU A CA   1  
ATOM 1110  C C    . LEU A 1 69  ? -0.745  -9.123  11.919  1.00 0.00 ? 461 LEU A C    1  
ATOM 1111  O O    . LEU A 1 69  ? 0.244   -9.449  11.272  1.00 0.00 ? 461 LEU A O    1  
ATOM 1112  C CB   . LEU A 1 69  ? -2.254  -8.980  9.924   1.00 0.00 ? 461 LEU A CB   1  
ATOM 1113  C CG   . LEU A 1 69  ? -3.473  -9.465  9.098   1.00 0.00 ? 461 LEU A CG   1  
ATOM 1114  C CD1  . LEU A 1 69  ? -4.786  -8.880  9.597   1.00 0.00 ? 461 LEU A CD1  1  
ATOM 1115  C CD2  . LEU A 1 69  ? -3.277  -9.148  7.626   1.00 0.00 ? 461 LEU A CD2  1  
ATOM 1116  H H    . LEU A 1 69  ? -3.330  -7.840  12.101  1.00 0.00 ? 461 LEU A H    1  
ATOM 1117  H HA   . LEU A 1 69  ? -2.313  -10.500 11.454  1.00 0.00 ? 461 LEU A HA   1  
ATOM 1118  H HB2  . LEU A 1 69  ? -2.258  -7.900  9.919   1.00 0.00 ? 461 LEU A HB2  1  
ATOM 1119  H HB3  . LEU A 1 69  ? -1.354  -9.303  9.421   1.00 0.00 ? 461 LEU A HB3  1  
ATOM 1120  H HG   . LEU A 1 69  ? -3.538  -10.538 9.196   1.00 0.00 ? 461 LEU A HG   1  
ATOM 1121  H HD11 . LEU A 1 69  ? -4.922  -9.172  10.627  1.00 0.00 ? 461 LEU A HD11 1  
ATOM 1122  H HD12 . LEU A 1 69  ? -4.751  -7.803  9.529   1.00 0.00 ? 461 LEU A HD12 1  
ATOM 1123  H HD13 . LEU A 1 69  ? -5.603  -9.258  9.001   1.00 0.00 ? 461 LEU A HD13 1  
ATOM 1124  H HD21 . LEU A 1 69  ? -3.167  -8.081  7.500   1.00 0.00 ? 461 LEU A HD21 1  
ATOM 1125  H HD22 . LEU A 1 69  ? -2.387  -9.645  7.269   1.00 0.00 ? 461 LEU A HD22 1  
ATOM 1126  H HD23 . LEU A 1 69  ? -4.132  -9.491  7.063   1.00 0.00 ? 461 LEU A HD23 1  
ATOM 1127  N N    . GLY A 1 70  ? -0.691  -8.529  13.105  1.00 0.00 ? 462 GLY A N    1  
ATOM 1128  C CA   . GLY A 1 70  ? 0.559   -8.096  13.746  1.00 0.00 ? 462 GLY A CA   1  
ATOM 1129  C C    . GLY A 1 70  ? 1.746   -9.079  13.664  1.00 0.00 ? 462 GLY A C    1  
ATOM 1130  O O    . GLY A 1 70  ? 2.810   -8.698  13.159  1.00 0.00 ? 462 GLY A O    1  
ATOM 1131  H H    . GLY A 1 70  ? -1.540  -8.361  13.566  1.00 0.00 ? 462 GLY A H    1  
ATOM 1132  H HA2  . GLY A 1 70  ? 0.868   -7.177  13.272  1.00 0.00 ? 462 GLY A HA2  1  
ATOM 1133  H HA3  . GLY A 1 70  ? 0.352   -7.888  14.785  1.00 0.00 ? 462 GLY A HA3  1  
ATOM 1134  N N    . PRO A 1 71  ? 1.611   -10.354 14.125  1.00 0.00 ? 463 PRO A N    1  
ATOM 1135  C CA   . PRO A 1 71  ? 2.729   -11.318 14.107  1.00 0.00 ? 463 PRO A CA   1  
ATOM 1136  C C    . PRO A 1 71  ? 3.178   -11.698 12.685  1.00 0.00 ? 463 PRO A C    1  
ATOM 1137  O O    . PRO A 1 71  ? 4.309   -12.134 12.476  1.00 0.00 ? 463 PRO A O    1  
ATOM 1138  C CB   . PRO A 1 71  ? 2.160   -12.547 14.833  1.00 0.00 ? 463 PRO A CB   1  
ATOM 1139  C CG   . PRO A 1 71  ? 0.683   -12.423 14.687  1.00 0.00 ? 463 PRO A CG   1  
ATOM 1140  C CD   . PRO A 1 71  ? 0.393   -10.953 14.717  1.00 0.00 ? 463 PRO A CD   1  
ATOM 1141  H HA   . PRO A 1 71  ? 3.580   -10.938 14.652  1.00 0.00 ? 463 PRO A HA   1  
ATOM 1142  H HB2  . PRO A 1 71  ? 2.533   -13.447 14.368  1.00 0.00 ? 463 PRO A HB2  1  
ATOM 1143  H HB3  . PRO A 1 71  ? 2.456   -12.526 15.872  1.00 0.00 ? 463 PRO A HB3  1  
ATOM 1144  H HG2  . PRO A 1 71  ? 0.372   -12.847 13.744  1.00 0.00 ? 463 PRO A HG2  1  
ATOM 1145  H HG3  . PRO A 1 71  ? 0.188   -12.920 15.508  1.00 0.00 ? 463 PRO A HG3  1  
ATOM 1146  H HD2  . PRO A 1 71  ? -0.479  -10.722 14.122  1.00 0.00 ? 463 PRO A HD2  1  
ATOM 1147  H HD3  . PRO A 1 71  ? 0.260   -10.618 15.734  1.00 0.00 ? 463 PRO A HD3  1  
ATOM 1148  N N    . LEU A 1 72  ? 2.313   -11.475 11.713  1.00 0.00 ? 464 LEU A N    1  
ATOM 1149  C CA   . LEU A 1 72  ? 2.589   -11.844 10.331  1.00 0.00 ? 464 LEU A CA   1  
ATOM 1150  C C    . LEU A 1 72  ? 3.568   -10.842 9.706   1.00 0.00 ? 464 LEU A C    1  
ATOM 1151  O O    . LEU A 1 72  ? 4.293   -11.158 8.769   1.00 0.00 ? 464 LEU A O    1  
ATOM 1152  C CB   . LEU A 1 72  ? 1.269   -11.932 9.538   1.00 0.00 ? 464 LEU A CB   1  
ATOM 1153  C CG   . LEU A 1 72  ? 1.349   -12.412 8.083   1.00 0.00 ? 464 LEU A CG   1  
ATOM 1154  C CD1  . LEU A 1 72  ? 1.969   -13.802 8.005   1.00 0.00 ? 464 LEU A CD1  1  
ATOM 1155  C CD2  . LEU A 1 72  ? -0.039  -12.429 7.471   1.00 0.00 ? 464 LEU A CD2  1  
ATOM 1156  H H    . LEU A 1 72  ? 1.471   -11.016 11.924  1.00 0.00 ? 464 LEU A H    1  
ATOM 1157  H HA   . LEU A 1 72  ? 3.059   -12.817 10.347  1.00 0.00 ? 464 LEU A HA   1  
ATOM 1158  H HB2  . LEU A 1 72  ? 0.607   -12.600 10.068  1.00 0.00 ? 464 LEU A HB2  1  
ATOM 1159  H HB3  . LEU A 1 72  ? 0.820   -10.950 9.542   1.00 0.00 ? 464 LEU A HB3  1  
ATOM 1160  H HG   . LEU A 1 72  ? 1.963   -11.729 7.513   1.00 0.00 ? 464 LEU A HG   1  
ATOM 1161  H HD11 . LEU A 1 72  ? 1.365   -14.499 8.568   1.00 0.00 ? 464 LEU A HD11 1  
ATOM 1162  H HD12 . LEU A 1 72  ? 2.015   -14.118 6.974   1.00 0.00 ? 464 LEU A HD12 1  
ATOM 1163  H HD13 . LEU A 1 72  ? 2.967   -13.779 8.416   1.00 0.00 ? 464 LEU A HD13 1  
ATOM 1164  H HD21 . LEU A 1 72  ? -0.477  -11.444 7.530   1.00 0.00 ? 464 LEU A HD21 1  
ATOM 1165  H HD22 . LEU A 1 72  ? 0.032   -12.729 6.436   1.00 0.00 ? 464 LEU A HD22 1  
ATOM 1166  H HD23 . LEU A 1 72  ? -0.658  -13.136 8.005   1.00 0.00 ? 464 LEU A HD23 1  
ATOM 1167  N N    . PHE A 1 73  ? 3.622   -9.655  10.279  1.00 0.00 ? 465 PHE A N    1  
ATOM 1168  C CA   . PHE A 1 73  ? 4.546   -8.616  9.835   1.00 0.00 ? 465 PHE A CA   1  
ATOM 1169  C C    . PHE A 1 73  ? 5.988   -8.936  10.213  1.00 0.00 ? 465 PHE A C    1  
ATOM 1170  O O    . PHE A 1 73  ? 6.917   -8.315  9.719   1.00 0.00 ? 465 PHE A O    1  
ATOM 1171  C CB   . PHE A 1 73  ? 4.142   -7.232  10.349  1.00 0.00 ? 465 PHE A CB   1  
ATOM 1172  C CG   . PHE A 1 73  ? 2.972   -6.622  9.624   1.00 0.00 ? 465 PHE A CG   1  
ATOM 1173  C CD1  . PHE A 1 73  ? 1.673   -6.781  10.079  1.00 0.00 ? 465 PHE A CD1  1  
ATOM 1174  C CD2  . PHE A 1 73  ? 3.184   -5.874  8.482   1.00 0.00 ? 465 PHE A CD2  1  
ATOM 1175  C CE1  . PHE A 1 73  ? 0.620   -6.202  9.405   1.00 0.00 ? 465 PHE A CE1  1  
ATOM 1176  C CE2  . PHE A 1 73  ? 2.139   -5.299  7.808   1.00 0.00 ? 465 PHE A CE2  1  
ATOM 1177  C CZ   . PHE A 1 73  ? 0.858   -5.460  8.268   1.00 0.00 ? 465 PHE A CZ   1  
ATOM 1178  H H    . PHE A 1 73  ? 3.014   -9.463  11.025  1.00 0.00 ? 465 PHE A H    1  
ATOM 1179  H HA   . PHE A 1 73  ? 4.494   -8.608  8.756   1.00 0.00 ? 465 PHE A HA   1  
ATOM 1180  H HB2  . PHE A 1 73  ? 3.877   -7.313  11.392  1.00 0.00 ? 465 PHE A HB2  1  
ATOM 1181  H HB3  . PHE A 1 73  ? 4.983   -6.562  10.251  1.00 0.00 ? 465 PHE A HB3  1  
ATOM 1182  H HD1  . PHE A 1 73  ? 1.472   -7.362  10.966  1.00 0.00 ? 465 PHE A HD1  1  
ATOM 1183  H HD2  . PHE A 1 73  ? 4.187   -5.741  8.109   1.00 0.00 ? 465 PHE A HD2  1  
ATOM 1184  H HE1  . PHE A 1 73  ? -0.389  -6.331  9.767   1.00 0.00 ? 465 PHE A HE1  1  
ATOM 1185  H HE2  . PHE A 1 73  ? 2.326   -4.717  6.918   1.00 0.00 ? 465 PHE A HE2  1  
ATOM 1186  H HZ   . PHE A 1 73  ? 0.043   -5.000  7.731   1.00 0.00 ? 465 PHE A HZ   1  
ATOM 1187  N N    . ARG A 1 74  ? 6.176   -9.914  11.099  1.00 0.00 ? 466 ARG A N    1  
ATOM 1188  C CA   . ARG A 1 74  ? 7.516   -10.294 11.525  1.00 0.00 ? 466 ARG A CA   1  
ATOM 1189  C C    . ARG A 1 74  ? 8.280   -11.048 10.437  1.00 0.00 ? 466 ARG A C    1  
ATOM 1190  O O    . ARG A 1 74  ? 9.476   -11.309 10.572  1.00 0.00 ? 466 ARG A O    1  
ATOM 1191  C CB   . ARG A 1 74  ? 7.513   -11.075 12.841  1.00 0.00 ? 466 ARG A CB   1  
ATOM 1192  C CG   . ARG A 1 74  ? 7.062   -10.269 14.064  1.00 0.00 ? 466 ARG A CG   1  
ATOM 1193  C CD   . ARG A 1 74  ? 7.851   -8.959  14.213  1.00 0.00 ? 466 ARG A CD   1  
ATOM 1194  N NE   . ARG A 1 74  ? 9.313   -9.159  14.153  1.00 0.00 ? 466 ARG A NE   1  
ATOM 1195  C CZ   . ARG A 1 74  ? 10.228  -8.165  14.173  1.00 0.00 ? 466 ARG A CZ   1  
ATOM 1196  N NH1  . ARG A 1 74  ? 9.858   -6.904  14.401  1.00 0.00 ? 466 ARG A NH1  1  
ATOM 1197  N NH2  . ARG A 1 74  ? 11.510  -8.439  13.977  1.00 0.00 ? 466 ARG A NH2  1  
ATOM 1198  H H    . ARG A 1 74  ? 5.393   -10.388 11.452  1.00 0.00 ? 466 ARG A H    1  
ATOM 1199  H HA   . ARG A 1 74  ? 8.049   -9.367  11.682  1.00 0.00 ? 466 ARG A HA   1  
ATOM 1200  H HB2  . ARG A 1 74  ? 6.851   -11.923 12.736  1.00 0.00 ? 466 ARG A HB2  1  
ATOM 1201  H HB3  . ARG A 1 74  ? 8.513   -11.438 13.020  1.00 0.00 ? 466 ARG A HB3  1  
ATOM 1202  H HG2  . ARG A 1 74  ? 6.013   -10.034 13.960  1.00 0.00 ? 466 ARG A HG2  1  
ATOM 1203  H HG3  . ARG A 1 74  ? 7.207   -10.869 14.951  1.00 0.00 ? 466 ARG A HG3  1  
ATOM 1204  H HD2  . ARG A 1 74  ? 7.559   -8.281  13.425  1.00 0.00 ? 466 ARG A HD2  1  
ATOM 1205  H HD3  . ARG A 1 74  ? 7.602   -8.517  15.167  1.00 0.00 ? 466 ARG A HD3  1  
ATOM 1206  H HE   . ARG A 1 74  ? 9.605   -10.093 14.044  1.00 0.00 ? 466 ARG A HE   1  
ATOM 1207  H HH11 . ARG A 1 74  ? 8.906   -6.632  14.560  1.00 0.00 ? 466 ARG A HH11 1  
ATOM 1208  H HH12 . ARG A 1 74  ? 10.530  -6.155  14.434  1.00 0.00 ? 466 ARG A HH12 1  
ATOM 1209  H HH21 . ARG A 1 74  ? 11.854  -9.368  13.804  1.00 0.00 ? 466 ARG A HH21 1  
ATOM 1210  H HH22 . ARG A 1 74  ? 12.203  -7.712  13.959  1.00 0.00 ? 466 ARG A HH22 1  
ATOM 1211  N N    . ASN A 1 75  ? 7.591   -11.421 9.385   1.00 0.00 ? 467 ASN A N    1  
ATOM 1212  C CA   . ASN A 1 75  ? 8.232   -12.014 8.234   1.00 0.00 ? 467 ASN A CA   1  
ATOM 1213  C C    . ASN A 1 75  ? 7.910   -11.219 6.992   1.00 0.00 ? 467 ASN A C    1  
ATOM 1214  O O    . ASN A 1 75  ? 6.965   -11.513 6.248   1.00 0.00 ? 467 ASN A O    1  
ATOM 1215  C CB   . ASN A 1 75  ? 8.013   -13.563 8.095   1.00 0.00 ? 467 ASN A CB   1  
ATOM 1216  C CG   . ASN A 1 75  ? 6.563   -14.088 8.167   1.00 0.00 ? 467 ASN A CG   1  
ATOM 1217  O OD1  . ASN A 1 75  ? 6.326   -15.164 8.702   1.00 0.00 ? 467 ASN A OD1  1  
ATOM 1218  N ND2  . ASN A 1 75  ? 5.620   -13.408 7.595   1.00 0.00 ? 467 ASN A ND2  1  
ATOM 1219  H H    . ASN A 1 75  ? 6.622   -11.262 9.373   1.00 0.00 ? 467 ASN A H    1  
ATOM 1220  H HA   . ASN A 1 75  ? 9.282   -11.827 8.412   1.00 0.00 ? 467 ASN A HA   1  
ATOM 1221  H HB2  . ASN A 1 75  ? 8.410   -13.879 7.142   1.00 0.00 ? 467 ASN A HB2  1  
ATOM 1222  H HB3  . ASN A 1 75  ? 8.587   -14.049 8.869   1.00 0.00 ? 467 ASN A HB3  1  
ATOM 1223  H HD21 . ASN A 1 75  ? 5.854   -12.575 7.126   1.00 0.00 ? 467 ASN A HD21 1  
ATOM 1224  H HD22 . ASN A 1 75  ? 4.703   -13.746 7.656   1.00 0.00 ? 467 ASN A HD22 1  
ATOM 1225  N N    . SER A 1 76  ? 8.641   -10.144 6.818   1.00 0.00 ? 468 SER A N    1  
ATOM 1226  C CA   . SER A 1 76  ? 8.411   -9.211  5.742   1.00 0.00 ? 468 SER A CA   1  
ATOM 1227  C C    . SER A 1 76  ? 9.695   -8.431  5.395   1.00 0.00 ? 468 SER A C    1  
ATOM 1228  O O    . SER A 1 76  ? 10.668  -8.444  6.152   1.00 0.00 ? 468 SER A O    1  
ATOM 1229  C CB   . SER A 1 76  ? 7.294   -8.232  6.133   1.00 0.00 ? 468 SER A CB   1  
ATOM 1230  O OG   . SER A 1 76  ? 6.075   -8.906  6.405   1.00 0.00 ? 468 SER A OG   1  
ATOM 1231  H H    . SER A 1 76  ? 9.397   -9.963  7.422   1.00 0.00 ? 468 SER A H    1  
ATOM 1232  H HA   . SER A 1 76  ? 8.088   -9.769  4.876   1.00 0.00 ? 468 SER A HA   1  
ATOM 1233  H HB2  . SER A 1 76  ? 7.591   -7.692  7.019   1.00 0.00 ? 468 SER A HB2  1  
ATOM 1234  H HB3  . SER A 1 76  ? 7.140   -7.545  5.315   1.00 0.00 ? 468 SER A HB3  1  
ATOM 1235  H HG   . SER A 1 76  ? 6.277   -9.847  6.433   1.00 0.00 ? 468 SER A HG   1  
ATOM 1236  N N    . ARG A 1 77  ? 9.640   -7.720  4.292   1.00 0.00 ? 469 ARG A N    1  
ATOM 1237  C CA   . ARG A 1 77  ? 10.761  -6.950  3.732   1.00 0.00 ? 469 ARG A CA   1  
ATOM 1238  C C    . ARG A 1 77  ? 10.400  -5.497  3.926   1.00 0.00 ? 469 ARG A C    1  
ATOM 1239  O O    . ARG A 1 77  ? 9.200   -5.187  3.793   1.00 0.00 ? 469 ARG A O    1  
ATOM 1240  C CB   . ARG A 1 77  ? 10.889  -7.226  2.214   1.00 0.00 ? 469 ARG A CB   1  
ATOM 1241  C CG   . ARG A 1 77  ? 10.508  -8.649  1.769   1.00 0.00 ? 469 ARG A CG   1  
ATOM 1242  C CD   . ARG A 1 77  ? 11.626  -9.349  1.015   1.00 0.00 ? 469 ARG A CD   1  
ATOM 1243  N NE   . ARG A 1 77  ? 12.724  -9.648  1.903   1.00 0.00 ? 469 ARG A NE   1  
ATOM 1244  C CZ   . ARG A 1 77  ? 13.640  -10.591 1.762   1.00 0.00 ? 469 ARG A CZ   1  
ATOM 1245  N NH1  . ARG A 1 77  ? 13.705  -11.331 0.659   1.00 0.00 ? 469 ARG A NH1  1  
ATOM 1246  N NH2  . ARG A 1 77  ? 14.512  -10.765 2.735   1.00 0.00 ? 469 ARG A NH2  1  
ATOM 1247  H H    . ARG A 1 77  ? 8.789   -7.696  3.806   1.00 0.00 ? 469 ARG A H    1  
ATOM 1248  H HA   . ARG A 1 77  ? 11.674  -7.191  4.253   1.00 0.00 ? 469 ARG A HA   1  
ATOM 1249  H HB2  . ARG A 1 77  ? 10.274  -6.519  1.679   1.00 0.00 ? 469 ARG A HB2  1  
ATOM 1250  H HB3  . ARG A 1 77  ? 11.914  -7.050  1.928   1.00 0.00 ? 469 ARG A HB3  1  
ATOM 1251  H HG2  . ARG A 1 77  ? 10.273  -9.232  2.647   1.00 0.00 ? 469 ARG A HG2  1  
ATOM 1252  H HG3  . ARG A 1 77  ? 9.634   -8.597  1.137   1.00 0.00 ? 469 ARG A HG3  1  
ATOM 1253  H HD2  . ARG A 1 77  ? 11.247  -10.268 0.591   1.00 0.00 ? 469 ARG A HD2  1  
ATOM 1254  H HD3  . ARG A 1 77  ? 11.975  -8.703  0.223   1.00 0.00 ? 469 ARG A HD3  1  
ATOM 1255  H HE   . ARG A 1 77  ? 12.759  -9.099  2.733   1.00 0.00 ? 469 ARG A HE   1  
ATOM 1256  H HH11 . ARG A 1 77  ? 13.086  -11.218 -0.121  1.00 0.00 ? 469 ARG A HH11 1  
ATOM 1257  H HH12 . ARG A 1 77  ? 14.377  -12.069 0.556   1.00 0.00 ? 469 ARG A HH12 1  
ATOM 1258  H HH21 . ARG A 1 77  ? 14.461  -10.178 3.552   1.00 0.00 ? 469 ARG A HH21 1  
ATOM 1259  H HH22 . ARG A 1 77  ? 15.223  -11.472 2.736   1.00 0.00 ? 469 ARG A HH22 1  
ATOM 1260  N N    . MET A 1 78  ? 11.332  -4.556  4.267   1.00 0.00 ? 470 MET A N    1  
ATOM 1261  C CA   . MET A 1 78  ? 10.774  -3.282  4.557   1.00 0.00 ? 470 MET A CA   1  
ATOM 1262  C C    . MET A 1 78  ? 10.856  -2.373  3.379   1.00 0.00 ? 470 MET A C    1  
ATOM 1263  O O    . MET A 1 78  ? 11.733  -2.505  2.559   1.00 0.00 ? 470 MET A O    1  
ATOM 1264  C CB   . MET A 1 78  ? 11.452  -2.645  5.713   1.00 0.00 ? 470 MET A CB   1  
ATOM 1265  C CG   . MET A 1 78  ? 11.280  -3.328  7.032   1.00 0.00 ? 470 MET A CG   1  
ATOM 1266  S SD   . MET A 1 78  ? 11.633  -2.198  8.397   1.00 0.00 ? 470 MET A SD   1  
ATOM 1267  C CE   . MET A 1 78  ? 10.428  -0.885  8.080   1.00 0.00 ? 470 MET A CE   1  
ATOM 1268  H H    . MET A 1 78  ? 12.323  -4.616  4.303   1.00 0.00 ? 470 MET A H    1  
ATOM 1269  H HA   . MET A 1 78  ? 9.735   -3.425  4.812   1.00 0.00 ? 470 MET A HA   1  
ATOM 1270  H HB2  . MET A 1 78  ? 12.503  -2.720  5.476   1.00 0.00 ? 470 MET A HB2  1  
ATOM 1271  H HB3  . MET A 1 78  ? 11.144  -1.614  5.780   1.00 0.00 ? 470 MET A HB3  1  
ATOM 1272  H HG2  . MET A 1 78  ? 10.288  -3.740  7.096   1.00 0.00 ? 470 MET A HG2  1  
ATOM 1273  H HG3  . MET A 1 78  ? 11.986  -4.145  7.077   1.00 0.00 ? 470 MET A HG3  1  
ATOM 1274  H HE1  . MET A 1 78  ? 9.437   -1.305  7.996   1.00 0.00 ? 470 MET A HE1  1  
ATOM 1275  H HE2  . MET A 1 78  ? 10.439  -0.181  8.897   1.00 0.00 ? 470 MET A HE2  1  
ATOM 1276  H HE3  . MET A 1 78  ? 10.660  -0.361  7.164   1.00 0.00 ? 470 MET A HE3  1  
ATOM 1277  N N    . VAL A 1 79  ? 9.894   -1.487  3.276   1.00 0.00 ? 471 VAL A N    1  
ATOM 1278  C CA   . VAL A 1 79  ? 9.835   -0.511  2.221   1.00 0.00 ? 471 VAL A CA   1  
ATOM 1279  C C    . VAL A 1 79  ? 9.486   0.842   2.807   1.00 0.00 ? 471 VAL A C    1  
ATOM 1280  O O    . VAL A 1 79  ? 8.987   0.933   3.946   1.00 0.00 ? 471 VAL A O    1  
ATOM 1281  C CB   . VAL A 1 79  ? 8.785   -0.860  1.114   1.00 0.00 ? 471 VAL A CB   1  
ATOM 1282  C CG1  . VAL A 1 79  ? 8.969   -2.267  0.562   1.00 0.00 ? 471 VAL A CG1  1  
ATOM 1283  C CG2  . VAL A 1 79  ? 7.373   -0.647  1.610   1.00 0.00 ? 471 VAL A CG2  1  
ATOM 1284  H H    . VAL A 1 79  ? 9.158   -1.470  3.928   1.00 0.00 ? 471 VAL A H    1  
ATOM 1285  H HA   . VAL A 1 79  ? 10.804  -0.431  1.767   1.00 0.00 ? 471 VAL A HA   1  
ATOM 1286  H HB   . VAL A 1 79  ? 8.956   -0.178  0.292   1.00 0.00 ? 471 VAL A HB   1  
ATOM 1287  H HG11 . VAL A 1 79  ? 8.875   -2.977  1.371   1.00 0.00 ? 471 VAL A HG11 1  
ATOM 1288  H HG12 . VAL A 1 79  ? 8.216   -2.470  -0.184  1.00 0.00 ? 471 VAL A HG12 1  
ATOM 1289  H HG13 . VAL A 1 79  ? 9.950   -2.356  0.120   1.00 0.00 ? 471 VAL A HG13 1  
ATOM 1290  H HG21 . VAL A 1 79  ? 7.226   -1.237  2.504   1.00 0.00 ? 471 VAL A HG21 1  
ATOM 1291  H HG22 . VAL A 1 79  ? 7.239   0.395   1.861   1.00 0.00 ? 471 VAL A HG22 1  
ATOM 1292  H HG23 . VAL A 1 79  ? 6.676   -0.931  0.837   1.00 0.00 ? 471 VAL A HG23 1  
ATOM 1293  N N    . GLN A 1 80  ? 9.777   1.869   2.064   1.00 0.00 ? 472 GLN A N    1  
ATOM 1294  C CA   . GLN A 1 80  ? 9.420   3.215   2.410   1.00 0.00 ? 472 GLN A CA   1  
ATOM 1295  C C    . GLN A 1 80  ? 8.968   3.928   1.157   1.00 0.00 ? 472 GLN A C    1  
ATOM 1296  O O    . GLN A 1 80  ? 9.612   3.828   0.108   1.00 0.00 ? 472 GLN A O    1  
ATOM 1297  C CB   . GLN A 1 80  ? 10.571  3.980   3.075   1.00 0.00 ? 472 GLN A CB   1  
ATOM 1298  C CG   . GLN A 1 80  ? 11.031  3.397   4.406   1.00 0.00 ? 472 GLN A CG   1  
ATOM 1299  C CD   . GLN A 1 80  ? 12.122  4.212   5.043   1.00 0.00 ? 472 GLN A CD   1  
ATOM 1300  O OE1  . GLN A 1 80  ? 12.900  4.856   4.363   1.00 0.00 ? 472 GLN A OE1  1  
ATOM 1301  N NE2  . GLN A 1 80  ? 12.193  4.192   6.344   1.00 0.00 ? 472 GLN A NE2  1  
ATOM 1302  H H    . GLN A 1 80  ? 10.251  1.714   1.214   1.00 0.00 ? 472 GLN A H    1  
ATOM 1303  H HA   . GLN A 1 80  ? 8.580   3.163   3.086   1.00 0.00 ? 472 GLN A HA   1  
ATOM 1304  H HB2  . GLN A 1 80  ? 11.415  3.991   2.403   1.00 0.00 ? 472 GLN A HB2  1  
ATOM 1305  H HB3  . GLN A 1 80  ? 10.253  4.999   3.244   1.00 0.00 ? 472 GLN A HB3  1  
ATOM 1306  H HG2  . GLN A 1 80  ? 10.189  3.362   5.081   1.00 0.00 ? 472 GLN A HG2  1  
ATOM 1307  H HG3  . GLN A 1 80  ? 11.399  2.396   4.238   1.00 0.00 ? 472 GLN A HG3  1  
ATOM 1308  H HE21 . GLN A 1 80  ? 11.542  3.665   6.852   1.00 0.00 ? 472 GLN A HE21 1  
ATOM 1309  H HE22 . GLN A 1 80  ? 12.905  4.704   6.782   1.00 0.00 ? 472 GLN A HE22 1  
ATOM 1310  N N    . PHE A 1 81  ? 7.877   4.613   1.264   1.00 0.00 ? 473 PHE A N    1  
ATOM 1311  C CA   . PHE A 1 81  ? 7.300   5.325   0.168   1.00 0.00 ? 473 PHE A CA   1  
ATOM 1312  C C    . PHE A 1 81  ? 7.476   6.817   0.346   1.00 0.00 ? 473 PHE A C    1  
ATOM 1313  O O    . PHE A 1 81  ? 7.115   7.405   1.404   1.00 0.00 ? 473 PHE A O    1  
ATOM 1314  C CB   . PHE A 1 81  ? 5.801   5.005   -0.002  1.00 0.00 ? 473 PHE A CB   1  
ATOM 1315  C CG   . PHE A 1 81  ? 5.467   3.651   -0.535  1.00 0.00 ? 473 PHE A CG   1  
ATOM 1316  C CD1  . PHE A 1 81  ? 5.154   3.492   -1.867  1.00 0.00 ? 473 PHE A CD1  1  
ATOM 1317  C CD2  . PHE A 1 81  ? 5.441   2.542   0.291   1.00 0.00 ? 473 PHE A CD2  1  
ATOM 1318  C CE1  . PHE A 1 81  ? 4.820   2.257   -2.372  1.00 0.00 ? 473 PHE A CE1  1  
ATOM 1319  C CE2  . PHE A 1 81  ? 5.111   1.304   -0.212  1.00 0.00 ? 473 PHE A CE2  1  
ATOM 1320  C CZ   . PHE A 1 81  ? 4.798   1.165   -1.547  1.00 0.00 ? 473 PHE A CZ   1  
ATOM 1321  H H    . PHE A 1 81  ? 7.458   4.683   2.151   1.00 0.00 ? 473 PHE A H    1  
ATOM 1322  H HA   . PHE A 1 81  ? 7.816   5.015   -0.728  1.00 0.00 ? 473 PHE A HA   1  
ATOM 1323  H HB2  . PHE A 1 81  ? 5.327   5.037   0.965   1.00 0.00 ? 473 PHE A HB2  1  
ATOM 1324  H HB3  . PHE A 1 81  ? 5.350   5.742   -0.650  1.00 0.00 ? 473 PHE A HB3  1  
ATOM 1325  H HD1  . PHE A 1 81  ? 5.168   4.354   -2.518  1.00 0.00 ? 473 PHE A HD1  1  
ATOM 1326  H HD2  . PHE A 1 81  ? 5.688   2.646   1.338   1.00 0.00 ? 473 PHE A HD2  1  
ATOM 1327  H HE1  . PHE A 1 81  ? 4.586   2.148   -3.420  1.00 0.00 ? 473 PHE A HE1  1  
ATOM 1328  H HE2  . PHE A 1 81  ? 5.092   0.444   0.440   1.00 0.00 ? 473 PHE A HE2  1  
ATOM 1329  H HZ   . PHE A 1 81  ? 4.534   0.199   -1.949  1.00 0.00 ? 473 PHE A HZ   1  
ATOM 1330  N N    . HIS A 1 82  ? 8.053   7.408   -0.651  1.00 0.00 ? 474 HIS A N    1  
ATOM 1331  C CA   . HIS A 1 82  ? 8.195   8.826   -0.762  1.00 0.00 ? 474 HIS A CA   1  
ATOM 1332  C C    . HIS A 1 82  ? 7.498   9.181   -2.048  1.00 0.00 ? 474 HIS A C    1  
ATOM 1333  O O    . HIS A 1 82  ? 7.822   8.636   -3.083  1.00 0.00 ? 474 HIS A O    1  
ATOM 1334  C CB   . HIS A 1 82  ? 9.688   9.199   -0.825  1.00 0.00 ? 474 HIS A CB   1  
ATOM 1335  C CG   . HIS A 1 82  ? 9.979   10.670  -0.950  1.00 0.00 ? 474 HIS A CG   1  
ATOM 1336  N ND1  . HIS A 1 82  ? 10.497  11.261  -2.084  1.00 0.00 ? 474 HIS A ND1  1  
ATOM 1337  C CD2  . HIS A 1 82  ? 9.849   11.666  -0.040  1.00 0.00 ? 474 HIS A CD2  1  
ATOM 1338  C CE1  . HIS A 1 82  ? 10.664  12.556  -1.838  1.00 0.00 ? 474 HIS A CE1  1  
ATOM 1339  N NE2  . HIS A 1 82  ? 10.285  12.860  -0.607  1.00 0.00 ? 474 HIS A NE2  1  
ATOM 1340  H H    . HIS A 1 82  ? 8.406   6.863   -1.394  1.00 0.00 ? 474 HIS A H    1  
ATOM 1341  H HA   . HIS A 1 82  ? 7.712   9.307   0.077   1.00 0.00 ? 474 HIS A HA   1  
ATOM 1342  H HB2  . HIS A 1 82  ? 10.162  8.857   0.083   1.00 0.00 ? 474 HIS A HB2  1  
ATOM 1343  H HB3  . HIS A 1 82  ? 10.132  8.694   -1.670  1.00 0.00 ? 474 HIS A HB3  1  
ATOM 1344  H HD1  . HIS A 1 82  ? 10.723  10.823  -2.937  1.00 0.00 ? 474 HIS A HD1  1  
ATOM 1345  H HD2  . HIS A 1 82  ? 9.471   11.559  0.966   1.00 0.00 ? 474 HIS A HD2  1  
ATOM 1346  H HE1  . HIS A 1 82  ? 11.059  13.266  -2.549  1.00 0.00 ? 474 HIS A HE1  1  
ATOM 1347  N N    . PHE A 1 83  ? 6.543   10.042  -1.998  1.00 0.00 ? 475 PHE A N    1  
ATOM 1348  C CA   . PHE A 1 83  ? 5.776   10.320  -3.183  1.00 0.00 ? 475 PHE A CA   1  
ATOM 1349  C C    . PHE A 1 83  ? 6.346   11.432  -4.002  1.00 0.00 ? 475 PHE A C    1  
ATOM 1350  O O    . PHE A 1 83  ? 6.891   12.413  -3.472  1.00 0.00 ? 475 PHE A O    1  
ATOM 1351  C CB   . PHE A 1 83  ? 4.308   10.573  -2.868  1.00 0.00 ? 475 PHE A CB   1  
ATOM 1352  C CG   . PHE A 1 83  ? 3.551   9.337   -2.481  1.00 0.00 ? 475 PHE A CG   1  
ATOM 1353  C CD1  . PHE A 1 83  ? 2.960   8.553   -3.452  1.00 0.00 ? 475 PHE A CD1  1  
ATOM 1354  C CD2  . PHE A 1 83  ? 3.427   8.959   -1.161  1.00 0.00 ? 475 PHE A CD2  1  
ATOM 1355  C CE1  . PHE A 1 83  ? 2.257   7.418   -3.117  1.00 0.00 ? 475 PHE A CE1  1  
ATOM 1356  C CE2  . PHE A 1 83  ? 2.724   7.822   -0.817  1.00 0.00 ? 475 PHE A CE2  1  
ATOM 1357  C CZ   . PHE A 1 83  ? 2.139   7.050   -1.796  1.00 0.00 ? 475 PHE A CZ   1  
ATOM 1358  H H    . PHE A 1 83  ? 6.357   10.522  -1.166  1.00 0.00 ? 475 PHE A H    1  
ATOM 1359  H HA   . PHE A 1 83  ? 5.826   9.423   -3.781  1.00 0.00 ? 475 PHE A HA   1  
ATOM 1360  H HB2  . PHE A 1 83  ? 4.246   11.272  -2.047  1.00 0.00 ? 475 PHE A HB2  1  
ATOM 1361  H HB3  . PHE A 1 83  ? 3.832   11.002  -3.737  1.00 0.00 ? 475 PHE A HB3  1  
ATOM 1362  H HD1  . PHE A 1 83  ? 3.052   8.841   -4.488  1.00 0.00 ? 475 PHE A HD1  1  
ATOM 1363  H HD2  . PHE A 1 83  ? 3.885   9.561   -0.390  1.00 0.00 ? 475 PHE A HD2  1  
ATOM 1364  H HE1  . PHE A 1 83  ? 1.803   6.820   -3.892  1.00 0.00 ? 475 PHE A HE1  1  
ATOM 1365  H HE2  . PHE A 1 83  ? 2.636   7.543   0.222   1.00 0.00 ? 475 PHE A HE2  1  
ATOM 1366  H HZ   . PHE A 1 83  ? 1.587   6.161   -1.529  1.00 0.00 ? 475 PHE A HZ   1  
ATOM 1367  N N    . THR A 1 84  ? 6.233   11.276  -5.284  1.00 0.00 ? 476 THR A N    1  
ATOM 1368  C CA   . THR A 1 84  ? 6.629   12.267  -6.204  1.00 0.00 ? 476 THR A CA   1  
ATOM 1369  C C    . THR A 1 84  ? 5.486   13.272  -6.253  1.00 0.00 ? 476 THR A C    1  
ATOM 1370  O O    . THR A 1 84  ? 4.431   13.011  -6.850  1.00 0.00 ? 476 THR A O    1  
ATOM 1371  C CB   . THR A 1 84  ? 6.862   11.628  -7.588  1.00 0.00 ? 476 THR A CB   1  
ATOM 1372  O OG1  . THR A 1 84  ? 7.722   10.482  -7.435  1.00 0.00 ? 476 THR A OG1  1  
ATOM 1373  C CG2  . THR A 1 84  ? 7.511   12.617  -8.543  1.00 0.00 ? 476 THR A CG2  1  
ATOM 1374  H H    . THR A 1 84  ? 5.837   10.456  -5.652  1.00 0.00 ? 476 THR A H    1  
ATOM 1375  H HA   . THR A 1 84  ? 7.534   12.742  -5.855  1.00 0.00 ? 476 THR A HA   1  
ATOM 1376  H HB   . THR A 1 84  ? 5.912   11.309  -7.987  1.00 0.00 ? 476 THR A HB   1  
ATOM 1377  H HG1  . THR A 1 84  ? 8.051   10.228  -8.304  1.00 0.00 ? 476 THR A HG1  1  
ATOM 1378  H HG21 . THR A 1 84  ? 8.459   12.934  -8.136  1.00 0.00 ? 476 THR A HG21 1  
ATOM 1379  H HG22 . THR A 1 84  ? 7.666   12.140  -9.499  1.00 0.00 ? 476 THR A HG22 1  
ATOM 1380  H HG23 . THR A 1 84  ? 6.864   13.473  -8.666  1.00 0.00 ? 476 THR A HG23 1  
ATOM 1381  N N    . ASN A 1 85  ? 5.656   14.359  -5.531  1.00 0.00 ? 477 ASN A N    1  
ATOM 1382  C CA   . ASN A 1 85  ? 4.623   15.367  -5.375  1.00 0.00 ? 477 ASN A CA   1  
ATOM 1383  C C    . ASN A 1 85  ? 4.279   16.129  -6.647  1.00 0.00 ? 477 ASN A C    1  
ATOM 1384  O O    . ASN A 1 85  ? 4.765   17.219  -6.912  1.00 0.00 ? 477 ASN A O    1  
ATOM 1385  C CB   . ASN A 1 85  ? 4.861   16.293  -4.159  1.00 0.00 ? 477 ASN A CB   1  
ATOM 1386  C CG   . ASN A 1 85  ? 6.237   16.945  -4.110  1.00 0.00 ? 477 ASN A CG   1  
ATOM 1387  O OD1  . ASN A 1 85  ? 7.177   16.394  -3.532  1.00 0.00 ? 477 ASN A OD1  1  
ATOM 1388  N ND2  . ASN A 1 85  ? 6.367   18.098  -4.683  1.00 0.00 ? 477 ASN A ND2  1  
ATOM 1389  H H    . ASN A 1 85  ? 6.514   14.480  -5.071  1.00 0.00 ? 477 ASN A H    1  
ATOM 1390  H HA   . ASN A 1 85  ? 3.726   14.800  -5.166  1.00 0.00 ? 477 ASN A HA   1  
ATOM 1391  H HB2  . ASN A 1 85  ? 4.127   17.084  -4.181  1.00 0.00 ? 477 ASN A HB2  1  
ATOM 1392  H HB3  . ASN A 1 85  ? 4.721   15.718  -3.256  1.00 0.00 ? 477 ASN A HB3  1  
ATOM 1393  H HD21 . ASN A 1 85  ? 5.587   18.500  -5.125  1.00 0.00 ? 477 ASN A HD21 1  
ATOM 1394  H HD22 . ASN A 1 85  ? 7.238   18.547  -4.676  1.00 0.00 ? 477 ASN A HD22 1  
ATOM 1395  N N    . LYS A 1 86  ? 3.508   15.473  -7.460  1.00 0.00 ? 478 LYS A N    1  
ATOM 1396  C CA   . LYS A 1 86  ? 2.922   16.039  -8.645  1.00 0.00 ? 478 LYS A CA   1  
ATOM 1397  C C    . LYS A 1 86  ? 1.695   16.823  -8.221  1.00 0.00 ? 478 LYS A C    1  
ATOM 1398  O O    . LYS A 1 86  ? 1.528   17.987  -8.557  1.00 0.00 ? 478 LYS A O    1  
ATOM 1399  C CB   . LYS A 1 86  ? 2.544   14.872  -9.594  1.00 0.00 ? 478 LYS A CB   1  
ATOM 1400  C CG   . LYS A 1 86  ? 1.684   15.181  -10.845 1.00 0.00 ? 478 LYS A CG   1  
ATOM 1401  C CD   . LYS A 1 86  ? 2.338   16.129  -11.855 1.00 0.00 ? 478 LYS A CD   1  
ATOM 1402  C CE   . LYS A 1 86  ? 2.059   17.605  -11.563 1.00 0.00 ? 478 LYS A CE   1  
ATOM 1403  N NZ   . LYS A 1 86  ? 0.601   17.925  -11.597 1.00 0.00 ? 478 LYS A NZ   1  
ATOM 1404  H H    . LYS A 1 86  ? 3.371   14.521  -7.256  1.00 0.00 ? 478 LYS A H    1  
ATOM 1405  H HA   . LYS A 1 86  ? 3.639   16.683  -9.130  1.00 0.00 ? 478 LYS A HA   1  
ATOM 1406  H HB2  . LYS A 1 86  ? 3.460   14.424  -9.949  1.00 0.00 ? 478 LYS A HB2  1  
ATOM 1407  H HB3  . LYS A 1 86  ? 2.024   14.130  -9.007  1.00 0.00 ? 478 LYS A HB3  1  
ATOM 1408  H HG2  . LYS A 1 86  ? 1.469   14.252  -11.351 1.00 0.00 ? 478 LYS A HG2  1  
ATOM 1409  H HG3  . LYS A 1 86  ? 0.752   15.613  -10.510 1.00 0.00 ? 478 LYS A HG3  1  
ATOM 1410  H HD2  . LYS A 1 86  ? 3.403   15.967  -11.819 1.00 0.00 ? 478 LYS A HD2  1  
ATOM 1411  H HD3  . LYS A 1 86  ? 1.989   15.884  -12.846 1.00 0.00 ? 478 LYS A HD3  1  
ATOM 1412  H HE2  . LYS A 1 86  ? 2.444   17.845  -10.584 1.00 0.00 ? 478 LYS A HE2  1  
ATOM 1413  H HE3  . LYS A 1 86  ? 2.567   18.206  -12.303 1.00 0.00 ? 478 LYS A HE3  1  
ATOM 1414  H HZ1  . LYS A 1 86  ? 0.199   17.713  -12.533 1.00 0.00 ? 478 LYS A HZ1  1  
ATOM 1415  H HZ2  . LYS A 1 86  ? 0.064   17.394  -10.875 1.00 0.00 ? 478 LYS A HZ2  1  
ATOM 1416  H HZ3  . LYS A 1 86  ? 0.462   18.941  -11.418 1.00 0.00 ? 478 LYS A HZ3  1  
ATOM 1417  N N    . ASP A 1 87  ? 0.879   16.188  -7.438  1.00 0.00 ? 479 ASP A N    1  
ATOM 1418  C CA   . ASP A 1 87  ? -0.344  16.775  -6.985  1.00 0.00 ? 479 ASP A CA   1  
ATOM 1419  C C    . ASP A 1 87  ? -0.428  16.761  -5.492  1.00 0.00 ? 479 ASP A C    1  
ATOM 1420  O O    . ASP A 1 87  ? -0.806  15.752  -4.889  1.00 0.00 ? 479 ASP A O    1  
ATOM 1421  C CB   . ASP A 1 87  ? -1.547  16.072  -7.595  1.00 0.00 ? 479 ASP A CB   1  
ATOM 1422  C CG   . ASP A 1 87  ? -1.900  16.573  -8.972  1.00 0.00 ? 479 ASP A CG   1  
ATOM 1423  O OD1  . ASP A 1 87  ? -2.947  17.234  -9.106  1.00 0.00 ? 479 ASP A OD1  1  
ATOM 1424  O OD2  . ASP A 1 87  ? -1.154  16.320  -9.949  1.00 0.00 ? 479 ASP A OD2  1  
ATOM 1425  H H    . ASP A 1 87  ? 1.103   15.283  -7.140  1.00 0.00 ? 479 ASP A H    1  
ATOM 1426  H HA   . ASP A 1 87  ? -0.349  17.801  -7.321  1.00 0.00 ? 479 ASP A HA   1  
ATOM 1427  H HB2  . ASP A 1 87  ? -1.329  15.017  -7.667  1.00 0.00 ? 479 ASP A HB2  1  
ATOM 1428  H HB3  . ASP A 1 87  ? -2.395  16.210  -6.941  1.00 0.00 ? 479 ASP A HB3  1  
ATOM 1429  N N    . LEU A 1 88  ? -0.044  17.864  -4.888  1.00 0.00 ? 480 LEU A N    1  
ATOM 1430  C CA   . LEU A 1 88  ? -0.088  18.017  -3.442  1.00 0.00 ? 480 LEU A CA   1  
ATOM 1431  C C    . LEU A 1 88  ? -1.502  17.919  -2.901  1.00 0.00 ? 480 LEU A C    1  
ATOM 1432  O O    . LEU A 1 88  ? -1.693  17.506  -1.779  1.00 0.00 ? 480 LEU A O    1  
ATOM 1433  C CB   . LEU A 1 88  ? 0.596   19.307  -2.983  1.00 0.00 ? 480 LEU A CB   1  
ATOM 1434  C CG   . LEU A 1 88  ? 2.123   19.340  -3.117  1.00 0.00 ? 480 LEU A CG   1  
ATOM 1435  C CD1  . LEU A 1 88  ? 2.658   20.717  -2.783  1.00 0.00 ? 480 LEU A CD1  1  
ATOM 1436  C CD2  . LEU A 1 88  ? 2.753   18.306  -2.195  1.00 0.00 ? 480 LEU A CD2  1  
ATOM 1437  H H    . LEU A 1 88  ? 0.294   18.605  -5.437  1.00 0.00 ? 480 LEU A H    1  
ATOM 1438  H HA   . LEU A 1 88  ? 0.460   17.180  -3.038  1.00 0.00 ? 480 LEU A HA   1  
ATOM 1439  H HB2  . LEU A 1 88  ? 0.185   20.126  -3.553  1.00 0.00 ? 480 LEU A HB2  1  
ATOM 1440  H HB3  . LEU A 1 88  ? 0.347   19.461  -1.943  1.00 0.00 ? 480 LEU A HB3  1  
ATOM 1441  H HG   . LEU A 1 88  ? 2.404   19.101  -4.132  1.00 0.00 ? 480 LEU A HG   1  
ATOM 1442  H HD11 . LEU A 1 88  ? 2.389   20.972  -1.769  1.00 0.00 ? 480 LEU A HD11 1  
ATOM 1443  H HD12 . LEU A 1 88  ? 3.734   20.714  -2.878  1.00 0.00 ? 480 LEU A HD12 1  
ATOM 1444  H HD13 . LEU A 1 88  ? 2.239   21.443  -3.464  1.00 0.00 ? 480 LEU A HD13 1  
ATOM 1445  H HD21 . LEU A 1 88  ? 2.451   18.491  -1.175  1.00 0.00 ? 480 LEU A HD21 1  
ATOM 1446  H HD22 . LEU A 1 88  ? 2.443   17.314  -2.489  1.00 0.00 ? 480 LEU A HD22 1  
ATOM 1447  H HD23 . LEU A 1 88  ? 3.829   18.373  -2.266  1.00 0.00 ? 480 LEU A HD23 1  
ATOM 1448  N N    . GLU A 1 89  ? -2.490  18.262  -3.716  1.00 0.00 ? 481 GLU A N    1  
ATOM 1449  C CA   . GLU A 1 89  ? -3.884  18.124  -3.309  1.00 0.00 ? 481 GLU A CA   1  
ATOM 1450  C C    . GLU A 1 89  ? -4.245  16.655  -3.119  1.00 0.00 ? 481 GLU A C    1  
ATOM 1451  O O    . GLU A 1 89  ? -4.931  16.296  -2.156  1.00 0.00 ? 481 GLU A O    1  
ATOM 1452  C CB   . GLU A 1 89  ? -4.822  18.786  -4.310  1.00 0.00 ? 481 GLU A CB   1  
ATOM 1453  C CG   . GLU A 1 89  ? -4.727  20.294  -4.329  1.00 0.00 ? 481 GLU A CG   1  
ATOM 1454  C CD   . GLU A 1 89  ? -5.178  20.913  -3.031  1.00 0.00 ? 481 GLU A CD   1  
ATOM 1455  O OE1  . GLU A 1 89  ? -4.343  21.165  -2.146  1.00 0.00 ? 481 GLU A OE1  1  
ATOM 1456  O OE2  . GLU A 1 89  ? -6.397  21.162  -2.866  1.00 0.00 ? 481 GLU A OE2  1  
ATOM 1457  H H    . GLU A 1 89  ? -2.277  18.620  -4.606  1.00 0.00 ? 481 GLU A H    1  
ATOM 1458  H HA   . GLU A 1 89  ? -3.981  18.620  -2.354  1.00 0.00 ? 481 GLU A HA   1  
ATOM 1459  H HB2  . GLU A 1 89  ? -4.576  18.427  -5.298  1.00 0.00 ? 481 GLU A HB2  1  
ATOM 1460  H HB3  . GLU A 1 89  ? -5.839  18.510  -4.075  1.00 0.00 ? 481 GLU A HB3  1  
ATOM 1461  H HG2  . GLU A 1 89  ? -3.700  20.577  -4.505  1.00 0.00 ? 481 GLU A HG2  1  
ATOM 1462  H HG3  . GLU A 1 89  ? -5.347  20.672  -5.128  1.00 0.00 ? 481 GLU A HG3  1  
ATOM 1463  N N    . SER A 1 90  ? -3.755  15.810  -4.017  1.00 0.00 ? 482 SER A N    1  
ATOM 1464  C CA   . SER A 1 90  ? -3.969  14.387  -3.915  1.00 0.00 ? 482 SER A CA   1  
ATOM 1465  C C    . SER A 1 90  ? -3.240  13.841  -2.684  1.00 0.00 ? 482 SER A C    1  
ATOM 1466  O O    . SER A 1 90  ? -3.792  13.030  -1.942  1.00 0.00 ? 482 SER A O    1  
ATOM 1467  C CB   . SER A 1 90  ? -3.511  13.683  -5.195  1.00 0.00 ? 482 SER A CB   1  
ATOM 1468  O OG   . SER A 1 90  ? -4.208  14.191  -6.335  1.00 0.00 ? 482 SER A OG   1  
ATOM 1469  H H    . SER A 1 90  ? -3.238  16.147  -4.779  1.00 0.00 ? 482 SER A H    1  
ATOM 1470  H HA   . SER A 1 90  ? -5.029  14.230  -3.782  1.00 0.00 ? 482 SER A HA   1  
ATOM 1471  H HB2  . SER A 1 90  ? -2.452  13.846  -5.332  1.00 0.00 ? 482 SER A HB2  1  
ATOM 1472  H HB3  . SER A 1 90  ? -3.704  12.623  -5.112  1.00 0.00 ? 482 SER A HB3  1  
ATOM 1473  H HG   . SER A 1 90  ? -4.220  13.480  -6.990  1.00 0.00 ? 482 SER A HG   1  
ATOM 1474  N N    . LEU A 1 91  ? -2.010  14.328  -2.452  1.00 0.00 ? 483 LEU A N    1  
ATOM 1475  C CA   . LEU A 1 91  ? -1.256  13.938  -1.258  1.00 0.00 ? 483 LEU A CA   1  
ATOM 1476  C C    . LEU A 1 91  ? -1.976  14.373  -0.004  1.00 0.00 ? 483 LEU A C    1  
ATOM 1477  O O    . LEU A 1 91  ? -2.158  13.588  0.886   1.00 0.00 ? 483 LEU A O    1  
ATOM 1478  C CB   . LEU A 1 91  ? 0.199   14.473  -1.237  1.00 0.00 ? 483 LEU A CB   1  
ATOM 1479  C CG   . LEU A 1 91  ? 1.282   13.666  -1.986  1.00 0.00 ? 483 LEU A CG   1  
ATOM 1480  C CD1  . LEU A 1 91  ? 1.364   12.236  -1.466  1.00 0.00 ? 483 LEU A CD1  1  
ATOM 1481  C CD2  . LEU A 1 91  ? 1.083   13.692  -3.485  1.00 0.00 ? 483 LEU A CD2  1  
ATOM 1482  H H    . LEU A 1 91  ? -1.618  14.954  -3.100  1.00 0.00 ? 483 LEU A H    1  
ATOM 1483  H HA   . LEU A 1 91  ? -1.231  12.859  -1.252  1.00 0.00 ? 483 LEU A HA   1  
ATOM 1484  H HB2  . LEU A 1 91  ? 0.187   15.468  -1.654  1.00 0.00 ? 483 LEU A HB2  1  
ATOM 1485  H HB3  . LEU A 1 91  ? 0.498   14.552  -0.201  1.00 0.00 ? 483 LEU A HB3  1  
ATOM 1486  H HG   . LEU A 1 91  ? 2.238   14.118  -1.760  1.00 0.00 ? 483 LEU A HG   1  
ATOM 1487  H HD11 . LEU A 1 91  ? 0.410   11.745  -1.580  1.00 0.00 ? 483 LEU A HD11 1  
ATOM 1488  H HD12 . LEU A 1 91  ? 2.105   11.685  -2.025  1.00 0.00 ? 483 LEU A HD12 1  
ATOM 1489  H HD13 . LEU A 1 91  ? 1.638   12.239  -0.423  1.00 0.00 ? 483 LEU A HD13 1  
ATOM 1490  H HD21 . LEU A 1 91  ? 0.105   13.296  -3.715  1.00 0.00 ? 483 LEU A HD21 1  
ATOM 1491  H HD22 . LEU A 1 91  ? 1.146   14.711  -3.839  1.00 0.00 ? 483 LEU A HD22 1  
ATOM 1492  H HD23 . LEU A 1 91  ? 1.842   13.092  -3.966  1.00 0.00 ? 483 LEU A HD23 1  
ATOM 1493  N N    . LYS A 1 92  ? -2.402  15.617  0.026   1.00 0.00 ? 484 LYS A N    1  
ATOM 1494  C CA   . LYS A 1 92  ? -3.104  16.201  1.164   1.00 0.00 ? 484 LYS A CA   1  
ATOM 1495  C C    . LYS A 1 92  ? -4.338  15.371  1.528   1.00 0.00 ? 484 LYS A C    1  
ATOM 1496  O O    . LYS A 1 92  ? -4.551  15.046  2.697   1.00 0.00 ? 484 LYS A O    1  
ATOM 1497  C CB   . LYS A 1 92  ? -3.526  17.620  0.814   1.00 0.00 ? 484 LYS A CB   1  
ATOM 1498  C CG   . LYS A 1 92  ? -4.137  18.413  1.955   1.00 0.00 ? 484 LYS A CG   1  
ATOM 1499  C CD   . LYS A 1 92  ? -4.620  19.769  1.471   1.00 0.00 ? 484 LYS A CD   1  
ATOM 1500  C CE   . LYS A 1 92  ? -5.826  19.636  0.549   1.00 0.00 ? 484 LYS A CE   1  
ATOM 1501  N NZ   . LYS A 1 92  ? -6.228  20.927  -0.027  1.00 0.00 ? 484 LYS A NZ   1  
ATOM 1502  H H    . LYS A 1 92  ? -2.223  16.197  -0.749  1.00 0.00 ? 484 LYS A H    1  
ATOM 1503  H HA   . LYS A 1 92  ? -2.430  16.235  2.007   1.00 0.00 ? 484 LYS A HA   1  
ATOM 1504  H HB2  . LYS A 1 92  ? -2.660  18.157  0.454   1.00 0.00 ? 484 LYS A HB2  1  
ATOM 1505  H HB3  . LYS A 1 92  ? -4.247  17.557  0.013   1.00 0.00 ? 484 LYS A HB3  1  
ATOM 1506  H HG2  . LYS A 1 92  ? -4.974  17.863  2.357   1.00 0.00 ? 484 LYS A HG2  1  
ATOM 1507  H HG3  . LYS A 1 92  ? -3.393  18.557  2.724   1.00 0.00 ? 484 LYS A HG3  1  
ATOM 1508  H HD2  . LYS A 1 92  ? -4.889  20.374  2.324   1.00 0.00 ? 484 LYS A HD2  1  
ATOM 1509  H HD3  . LYS A 1 92  ? -3.817  20.248  0.932   1.00 0.00 ? 484 LYS A HD3  1  
ATOM 1510  H HE2  . LYS A 1 92  ? -5.590  18.967  -0.265  1.00 0.00 ? 484 LYS A HE2  1  
ATOM 1511  H HE3  . LYS A 1 92  ? -6.652  19.232  1.116   1.00 0.00 ? 484 LYS A HE3  1  
ATOM 1512  H HZ1  . LYS A 1 92  ? -6.245  21.686  0.681   1.00 0.00 ? 484 LYS A HZ1  1  
ATOM 1513  H HZ2  . LYS A 1 92  ? -5.547  21.179  -0.780  1.00 0.00 ? 484 LYS A HZ2  1  
ATOM 1514  H HZ3  . LYS A 1 92  ? -7.154  20.845  -0.491  1.00 0.00 ? 484 LYS A HZ3  1  
ATOM 1515  N N    . GLY A 1 93  ? -5.126  15.017  0.516   1.00 0.00 ? 485 GLY A N    1  
ATOM 1516  C CA   . GLY A 1 93  ? -6.308  14.209  0.735   1.00 0.00 ? 485 GLY A CA   1  
ATOM 1517  C C    . GLY A 1 93  ? -5.955  12.836  1.275   1.00 0.00 ? 485 GLY A C    1  
ATOM 1518  O O    . GLY A 1 93  ? -6.590  12.339  2.219   1.00 0.00 ? 485 GLY A O    1  
ATOM 1519  H H    . GLY A 1 93  ? -4.901  15.313  -0.394  1.00 0.00 ? 485 GLY A H    1  
ATOM 1520  H HA2  . GLY A 1 93  ? -6.954  14.712  1.439   1.00 0.00 ? 485 GLY A HA2  1  
ATOM 1521  H HA3  . GLY A 1 93  ? -6.830  14.090  -0.203  1.00 0.00 ? 485 GLY A HA3  1  
ATOM 1522  N N    . LEU A 1 94  ? -4.927  12.242  0.699   1.00 0.00 ? 486 LEU A N    1  
ATOM 1523  C CA   . LEU A 1 94  ? -4.443  10.950  1.095   1.00 0.00 ? 486 LEU A CA   1  
ATOM 1524  C C    . LEU A 1 94  ? -3.851  10.996  2.527   1.00 0.00 ? 486 LEU A C    1  
ATOM 1525  O O    . LEU A 1 94  ? -4.054  10.066  3.312   1.00 0.00 ? 486 LEU A O    1  
ATOM 1526  C CB   . LEU A 1 94  ? -3.445  10.440  0.025   1.00 0.00 ? 486 LEU A CB   1  
ATOM 1527  C CG   . LEU A 1 94  ? -2.894  9.026   0.187   1.00 0.00 ? 486 LEU A CG   1  
ATOM 1528  C CD1  . LEU A 1 94  ? -2.438  8.480   -1.156  1.00 0.00 ? 486 LEU A CD1  1  
ATOM 1529  C CD2  . LEU A 1 94  ? -1.723  9.013   1.138   1.00 0.00 ? 486 LEU A CD2  1  
ATOM 1530  H H    . LEU A 1 94  ? -4.462  12.670  -0.051  1.00 0.00 ? 486 LEU A H    1  
ATOM 1531  H HA   . LEU A 1 94  ? -5.297  10.289  1.112   1.00 0.00 ? 486 LEU A HA   1  
ATOM 1532  H HB2  . LEU A 1 94  ? -3.933  10.495  -0.937  1.00 0.00 ? 486 LEU A HB2  1  
ATOM 1533  H HB3  . LEU A 1 94  ? -2.609  11.125  0.012   1.00 0.00 ? 486 LEU A HB3  1  
ATOM 1534  H HG   . LEU A 1 94  ? -3.682  8.416   0.597   1.00 0.00 ? 486 LEU A HG   1  
ATOM 1535  H HD11 . LEU A 1 94  ? -1.671  9.118   -1.569  1.00 0.00 ? 486 LEU A HD11 1  
ATOM 1536  H HD12 . LEU A 1 94  ? -2.043  7.485   -1.012  1.00 0.00 ? 486 LEU A HD12 1  
ATOM 1537  H HD13 . LEU A 1 94  ? -3.279  8.436   -1.832  1.00 0.00 ? 486 LEU A HD13 1  
ATOM 1538  H HD21 . LEU A 1 94  ? -2.044  9.380   2.102   1.00 0.00 ? 486 LEU A HD21 1  
ATOM 1539  H HD22 . LEU A 1 94  ? -1.363  8.001   1.244   1.00 0.00 ? 486 LEU A HD22 1  
ATOM 1540  H HD23 . LEU A 1 94  ? -0.933  9.642   0.753   1.00 0.00 ? 486 LEU A HD23 1  
ATOM 1541  N N    . TYR A 1 95  ? -3.150  12.090  2.859   1.00 0.00 ? 487 TYR A N    1  
ATOM 1542  C CA   . TYR A 1 95  ? -2.592  12.314  4.209   1.00 0.00 ? 487 TYR A CA   1  
ATOM 1543  C C    . TYR A 1 95  ? -3.679  12.254  5.252   1.00 0.00 ? 487 TYR A C    1  
ATOM 1544  O O    . TYR A 1 95  ? -3.489  11.674  6.315   1.00 0.00 ? 487 TYR A O    1  
ATOM 1545  C CB   . TYR A 1 95  ? -1.890  13.681  4.332   1.00 0.00 ? 487 TYR A CB   1  
ATOM 1546  C CG   . TYR A 1 95  ? -0.459  13.782  3.817   1.00 0.00 ? 487 TYR A CG   1  
ATOM 1547  C CD1  . TYR A 1 95  ? 0.404   14.718  4.370   1.00 0.00 ? 487 TYR A CD1  1  
ATOM 1548  C CD2  . TYR A 1 95  ? 0.027   12.971  2.801   1.00 0.00 ? 487 TYR A CD2  1  
ATOM 1549  C CE1  . TYR A 1 95  ? 1.701   14.852  3.928   1.00 0.00 ? 487 TYR A CE1  1  
ATOM 1550  C CE2  . TYR A 1 95  ? 1.328   13.096  2.352   1.00 0.00 ? 487 TYR A CE2  1  
ATOM 1551  C CZ   . TYR A 1 95  ? 2.160   14.043  2.920   1.00 0.00 ? 487 TYR A CZ   1  
ATOM 1552  O OH   . TYR A 1 95  ? 3.458   14.183  2.475   1.00 0.00 ? 487 TYR A OH   1  
ATOM 1553  H H    . TYR A 1 95  ? -2.986  12.761  2.158   1.00 0.00 ? 487 TYR A H    1  
ATOM 1554  H HA   . TYR A 1 95  ? -1.871  11.535  4.407   1.00 0.00 ? 487 TYR A HA   1  
ATOM 1555  H HB2  . TYR A 1 95  ? -2.468  14.410  3.785   1.00 0.00 ? 487 TYR A HB2  1  
ATOM 1556  H HB3  . TYR A 1 95  ? -1.888  13.964  5.375   1.00 0.00 ? 487 TYR A HB3  1  
ATOM 1557  H HD1  . TYR A 1 95  ? 0.041   15.355  5.164   1.00 0.00 ? 487 TYR A HD1  1  
ATOM 1558  H HD2  . TYR A 1 95  ? -0.626  12.233  2.359   1.00 0.00 ? 487 TYR A HD2  1  
ATOM 1559  H HE1  . TYR A 1 95  ? 2.354   15.587  4.374   1.00 0.00 ? 487 TYR A HE1  1  
ATOM 1560  H HE2  . TYR A 1 95  ? 1.680   12.454  1.557   1.00 0.00 ? 487 TYR A HE2  1  
ATOM 1561  H HH   . TYR A 1 95  ? 3.447   14.179  1.512   1.00 0.00 ? 487 TYR A HH   1  
ATOM 1562  N N    . ARG A 1 96  ? -4.825  12.849  4.935   1.00 0.00 ? 488 ARG A N    1  
ATOM 1563  C CA   . ARG A 1 96  ? -5.967  12.856  5.844   1.00 0.00 ? 488 ARG A CA   1  
ATOM 1564  C C    . ARG A 1 96  ? -6.402  11.425  6.108   1.00 0.00 ? 488 ARG A C    1  
ATOM 1565  O O    . ARG A 1 96  ? -6.591  11.021  7.247   1.00 0.00 ? 488 ARG A O    1  
ATOM 1566  C CB   . ARG A 1 96  ? -7.170  13.614  5.250   1.00 0.00 ? 488 ARG A CB   1  
ATOM 1567  C CG   . ARG A 1 96  ? -6.907  15.035  4.768   1.00 0.00 ? 488 ARG A CG   1  
ATOM 1568  C CD   . ARG A 1 96  ? -6.345  15.930  5.853   1.00 0.00 ? 488 ARG A CD   1  
ATOM 1569  N NE   . ARG A 1 96  ? -6.202  17.315  5.382   1.00 0.00 ? 488 ARG A NE   1  
ATOM 1570  C CZ   . ARG A 1 96  ? -5.206  18.149  5.712   1.00 0.00 ? 488 ARG A CZ   1  
ATOM 1571  N NH1  . ARG A 1 96  ? -4.202  17.727  6.484   1.00 0.00 ? 488 ARG A NH1  1  
ATOM 1572  N NH2  . ARG A 1 96  ? -5.208  19.402  5.247   1.00 0.00 ? 488 ARG A NH2  1  
ATOM 1573  H H    . ARG A 1 96  ? -4.881  13.296  4.062   1.00 0.00 ? 488 ARG A H    1  
ATOM 1574  H HA   . ARG A 1 96  ? -5.671  13.323  6.772   1.00 0.00 ? 488 ARG A HA   1  
ATOM 1575  H HB2  . ARG A 1 96  ? -7.533  13.048  4.405   1.00 0.00 ? 488 ARG A HB2  1  
ATOM 1576  H HB3  . ARG A 1 96  ? -7.952  13.648  5.993   1.00 0.00 ? 488 ARG A HB3  1  
ATOM 1577  H HG2  . ARG A 1 96  ? -6.200  15.001  3.952   1.00 0.00 ? 488 ARG A HG2  1  
ATOM 1578  H HG3  . ARG A 1 96  ? -7.836  15.456  4.412   1.00 0.00 ? 488 ARG A HG3  1  
ATOM 1579  H HD2  . ARG A 1 96  ? -6.999  15.908  6.711   1.00 0.00 ? 488 ARG A HD2  1  
ATOM 1580  H HD3  . ARG A 1 96  ? -5.372  15.553  6.129   1.00 0.00 ? 488 ARG A HD3  1  
ATOM 1581  H HE   . ARG A 1 96  ? -6.929  17.614  4.787   1.00 0.00 ? 488 ARG A HE   1  
ATOM 1582  H HH11 . ARG A 1 96  ? -4.159  16.788  6.838   1.00 0.00 ? 488 ARG A HH11 1  
ATOM 1583  H HH12 . ARG A 1 96  ? -3.442  18.332  6.736   1.00 0.00 ? 488 ARG A HH12 1  
ATOM 1584  H HH21 . ARG A 1 96  ? -5.932  19.761  4.650   1.00 0.00 ? 488 ARG A HH21 1  
ATOM 1585  H HH22 . ARG A 1 96  ? -4.473  20.052  5.477   1.00 0.00 ? 488 ARG A HH22 1  
ATOM 1586  N N    . ILE A 1 97  ? -6.518  10.664  5.032   1.00 0.00 ? 489 ILE A N    1  
ATOM 1587  C CA   . ILE A 1 97  ? -6.991  9.299   5.088   1.00 0.00 ? 489 ILE A CA   1  
ATOM 1588  C C    . ILE A 1 97  ? -5.988  8.370   5.797   1.00 0.00 ? 489 ILE A C    1  
ATOM 1589  O O    . ILE A 1 97  ? -6.325  7.725   6.790   1.00 0.00 ? 489 ILE A O    1  
ATOM 1590  C CB   . ILE A 1 97  ? -7.272  8.784   3.638   1.00 0.00 ? 489 ILE A CB   1  
ATOM 1591  C CG1  . ILE A 1 97  ? -8.396  9.606   2.986   1.00 0.00 ? 489 ILE A CG1  1  
ATOM 1592  C CG2  . ILE A 1 97  ? -7.595  7.293   3.606   1.00 0.00 ? 489 ILE A CG2  1  
ATOM 1593  C CD1  . ILE A 1 97  ? -8.703  9.213   1.554   1.00 0.00 ? 489 ILE A CD1  1  
ATOM 1594  H H    . ILE A 1 97  ? -6.262  11.045  4.165   1.00 0.00 ? 489 ILE A H    1  
ATOM 1595  H HA   . ILE A 1 97  ? -7.925  9.288   5.630   1.00 0.00 ? 489 ILE A HA   1  
ATOM 1596  H HB   . ILE A 1 97  ? -6.370  8.932   3.063   1.00 0.00 ? 489 ILE A HB   1  
ATOM 1597  H HG12 . ILE A 1 97  ? -9.304  9.481   3.557   1.00 0.00 ? 489 ILE A HG12 1  
ATOM 1598  H HG13 . ILE A 1 97  ? -8.114  10.649  2.991   1.00 0.00 ? 489 ILE A HG13 1  
ATOM 1599  H HG21 . ILE A 1 97  ? -8.440  7.082   4.244   1.00 0.00 ? 489 ILE A HG21 1  
ATOM 1600  H HG22 . ILE A 1 97  ? -7.819  7.003   2.590   1.00 0.00 ? 489 ILE A HG22 1  
ATOM 1601  H HG23 . ILE A 1 97  ? -6.731  6.743   3.949   1.00 0.00 ? 489 ILE A HG23 1  
ATOM 1602  H HD11 . ILE A 1 97  ? -8.999  8.175   1.532   1.00 0.00 ? 489 ILE A HD11 1  
ATOM 1603  H HD12 . ILE A 1 97  ? -9.505  9.831   1.177   1.00 0.00 ? 489 ILE A HD12 1  
ATOM 1604  H HD13 . ILE A 1 97  ? -7.821  9.350   0.948   1.00 0.00 ? 489 ILE A HD13 1  
ATOM 1605  N N    . MET A 1 98  ? -4.746  8.375   5.363   1.00 0.00 ? 490 MET A N    1  
ATOM 1606  C CA   . MET A 1 98  ? -3.769  7.451   5.932   1.00 0.00 ? 490 MET A CA   1  
ATOM 1607  C C    . MET A 1 98  ? -3.296  7.891   7.302   1.00 0.00 ? 490 MET A C    1  
ATOM 1608  O O    . MET A 1 98  ? -2.882  7.075   8.115   1.00 0.00 ? 490 MET A O    1  
ATOM 1609  C CB   . MET A 1 98  ? -2.615  7.133   4.962   1.00 0.00 ? 490 MET A CB   1  
ATOM 1610  C CG   . MET A 1 98  ? -3.108  6.469   3.677   1.00 0.00 ? 490 MET A CG   1  
ATOM 1611  S SD   . MET A 1 98  ? -1.805  5.918   2.542   1.00 0.00 ? 490 MET A SD   1  
ATOM 1612  C CE   . MET A 1 98  ? -1.078  4.547   3.424   1.00 0.00 ? 490 MET A CE   1  
ATOM 1613  H H    . MET A 1 98  ? -4.488  9.006   4.651   1.00 0.00 ? 490 MET A H    1  
ATOM 1614  H HA   . MET A 1 98  ? -4.328  6.542   6.102   1.00 0.00 ? 490 MET A HA   1  
ATOM 1615  H HB2  . MET A 1 98  ? -2.108  8.051   4.705   1.00 0.00 ? 490 MET A HB2  1  
ATOM 1616  H HB3  . MET A 1 98  ? -1.919  6.464   5.446   1.00 0.00 ? 490 MET A HB3  1  
ATOM 1617  H HG2  . MET A 1 98  ? -3.696  5.605   3.950   1.00 0.00 ? 490 MET A HG2  1  
ATOM 1618  H HG3  . MET A 1 98  ? -3.744  7.172   3.159   1.00 0.00 ? 490 MET A HG3  1  
ATOM 1619  H HE1  . MET A 1 98  ? -1.849  3.853   3.721   1.00 0.00 ? 490 MET A HE1  1  
ATOM 1620  H HE2  . MET A 1 98  ? -0.380  4.048   2.762   1.00 0.00 ? 490 MET A HE2  1  
ATOM 1621  H HE3  . MET A 1 98  ? -0.549  4.908   4.293   1.00 0.00 ? 490 MET A HE3  1  
ATOM 1622  N N    . GLY A 1 99  ? -3.417  9.173   7.578   1.00 0.00 ? 491 GLY A N    1  
ATOM 1623  C CA   . GLY A 1 99  ? -3.055  9.694   8.876   1.00 0.00 ? 491 GLY A CA   1  
ATOM 1624  C C    . GLY A 1 99  ? -4.162  9.483   9.896   1.00 0.00 ? 491 GLY A C    1  
ATOM 1625  O O    . GLY A 1 99  ? -3.946  9.637   11.098  1.00 0.00 ? 491 GLY A O    1  
ATOM 1626  H H    . GLY A 1 99  ? -3.737  9.802   6.893   1.00 0.00 ? 491 GLY A H    1  
ATOM 1627  H HA2  . GLY A 1 99  ? -2.157  9.199   9.213   1.00 0.00 ? 491 GLY A HA2  1  
ATOM 1628  H HA3  . GLY A 1 99  ? -2.861  10.753  8.789   1.00 0.00 ? 491 GLY A HA3  1  
ATOM 1629  N N    . ASN A 1 100 ? -5.343  9.106   9.421   1.00 0.00 ? 492 ASN A N    1  
ATOM 1630  C CA   . ASN A 1 100 ? -6.499  8.878   10.294  1.00 0.00 ? 492 ASN A CA   1  
ATOM 1631  C C    . ASN A 1 100 ? -6.569  7.399   10.697  1.00 0.00 ? 492 ASN A C    1  
ATOM 1632  O O    . ASN A 1 100 ? -7.472  6.966   11.418  1.00 0.00 ? 492 ASN A O    1  
ATOM 1633  C CB   . ASN A 1 100 ? -7.809  9.294   9.582   1.00 0.00 ? 492 ASN A CB   1  
ATOM 1634  C CG   . ASN A 1 100 ? -9.052  9.261   10.481  1.00 0.00 ? 492 ASN A CG   1  
ATOM 1635  O OD1  . ASN A 1 100 ? -10.147 8.932   10.030  1.00 0.00 ? 492 ASN A OD1  1  
ATOM 1636  N ND2  . ASN A 1 100 ? -8.905  9.629   11.737  1.00 0.00 ? 492 ASN A ND2  1  
ATOM 1637  H H    . ASN A 1 100 ? -5.453  8.988   8.452   1.00 0.00 ? 492 ASN A H    1  
ATOM 1638  H HA   . ASN A 1 100 ? -6.368  9.479   11.181  1.00 0.00 ? 492 ASN A HA   1  
ATOM 1639  H HB2  . ASN A 1 100 ? -7.693  10.300  9.207   1.00 0.00 ? 492 ASN A HB2  1  
ATOM 1640  H HB3  . ASN A 1 100 ? -7.975  8.631   8.746   1.00 0.00 ? 492 ASN A HB3  1  
ATOM 1641  H HD21 . ASN A 1 100 ? -8.026  9.912   12.062  1.00 0.00 ? 492 ASN A HD21 1  
ATOM 1642  H HD22 . ASN A 1 100 ? -9.697  9.588   12.317  1.00 0.00 ? 492 ASN A HD22 1  
ATOM 1643  N N    . GLY A 1 101 ? -5.589  6.642   10.281  1.00 0.00 ? 493 GLY A N    1  
ATOM 1644  C CA   . GLY A 1 101 ? -5.591  5.242   10.596  1.00 0.00 ? 493 GLY A CA   1  
ATOM 1645  C C    . GLY A 1 101 ? -6.073  4.379   9.458   1.00 0.00 ? 493 GLY A C    1  
ATOM 1646  O O    . GLY A 1 101 ? -6.691  3.340   9.670   1.00 0.00 ? 493 GLY A O    1  
ATOM 1647  H H    . GLY A 1 101 ? -4.857  7.043   9.769   1.00 0.00 ? 493 GLY A H    1  
ATOM 1648  H HA2  . GLY A 1 101 ? -4.588  4.941   10.862  1.00 0.00 ? 493 GLY A HA2  1  
ATOM 1649  H HA3  . GLY A 1 101 ? -6.238  5.087   11.446  1.00 0.00 ? 493 GLY A HA3  1  
ATOM 1650  N N    . PHE A 1 102 ? -5.847  4.822   8.258   1.00 0.00 ? 494 PHE A N    1  
ATOM 1651  C CA   . PHE A 1 102 ? -6.082  3.992   7.113   1.00 0.00 ? 494 PHE A CA   1  
ATOM 1652  C C    . PHE A 1 102 ? -4.761  3.512   6.578   1.00 0.00 ? 494 PHE A C    1  
ATOM 1653  O O    . PHE A 1 102 ? -3.767  4.254   6.577   1.00 0.00 ? 494 PHE A O    1  
ATOM 1654  C CB   . PHE A 1 102 ? -6.889  4.688   6.023   1.00 0.00 ? 494 PHE A CB   1  
ATOM 1655  C CG   . PHE A 1 102 ? -8.351  4.789   6.337   1.00 0.00 ? 494 PHE A CG   1  
ATOM 1656  C CD1  . PHE A 1 102 ? -8.922  5.984   6.739   1.00 0.00 ? 494 PHE A CD1  1  
ATOM 1657  C CD2  . PHE A 1 102 ? -9.152  3.672   6.231   1.00 0.00 ? 494 PHE A CD2  1  
ATOM 1658  C CE1  . PHE A 1 102 ? -10.267 6.059   7.025   1.00 0.00 ? 494 PHE A CE1  1  
ATOM 1659  C CE2  . PHE A 1 102 ? -10.493 3.734   6.514   1.00 0.00 ? 494 PHE A CE2  1  
ATOM 1660  C CZ   . PHE A 1 102 ? -11.057 4.930   6.912   1.00 0.00 ? 494 PHE A CZ   1  
ATOM 1661  H H    . PHE A 1 102 ? -5.504  5.729   8.126   1.00 0.00 ? 494 PHE A H    1  
ATOM 1662  H HA   . PHE A 1 102 ? -6.638  3.135   7.469   1.00 0.00 ? 494 PHE A HA   1  
ATOM 1663  H HB2  . PHE A 1 102 ? -6.511  5.691   5.890   1.00 0.00 ? 494 PHE A HB2  1  
ATOM 1664  H HB3  . PHE A 1 102 ? -6.781  4.143   5.097   1.00 0.00 ? 494 PHE A HB3  1  
ATOM 1665  H HD1  . PHE A 1 102 ? -8.303  6.866   6.821   1.00 0.00 ? 494 PHE A HD1  1  
ATOM 1666  H HD2  . PHE A 1 102 ? -8.711  2.736   5.922   1.00 0.00 ? 494 PHE A HD2  1  
ATOM 1667  H HE1  . PHE A 1 102 ? -10.701 6.995   7.340   1.00 0.00 ? 494 PHE A HE1  1  
ATOM 1668  H HE2  . PHE A 1 102 ? -11.092 2.842   6.423   1.00 0.00 ? 494 PHE A HE2  1  
ATOM 1669  H HZ   . PHE A 1 102 ? -12.112 4.983   7.135   1.00 0.00 ? 494 PHE A HZ   1  
ATOM 1670  N N    . ALA A 1 103 ? -4.741  2.296   6.163   1.00 0.00 ? 495 ALA A N    1  
ATOM 1671  C CA   . ALA A 1 103 ? -3.574  1.663   5.651   1.00 0.00 ? 495 ALA A CA   1  
ATOM 1672  C C    . ALA A 1 103 ? -3.833  1.267   4.223   1.00 0.00 ? 495 ALA A C    1  
ATOM 1673  O O    . ALA A 1 103 ? -4.969  0.958   3.857   1.00 0.00 ? 495 ALA A O    1  
ATOM 1674  C CB   . ALA A 1 103 ? -3.259  0.438   6.482   1.00 0.00 ? 495 ALA A CB   1  
ATOM 1675  H H    . ALA A 1 103 ? -5.567  1.765   6.179   1.00 0.00 ? 495 ALA A H    1  
ATOM 1676  H HA   . ALA A 1 103 ? -2.741  2.348   5.708   1.00 0.00 ? 495 ALA A HA   1  
ATOM 1677  H HB1  . ALA A 1 103 ? -4.083  -0.256  6.419   1.00 0.00 ? 495 ALA A HB1  1  
ATOM 1678  H HB2  . ALA A 1 103 ? -3.111  0.733   7.511   1.00 0.00 ? 495 ALA A HB2  1  
ATOM 1679  H HB3  . ALA A 1 103 ? -2.360  -0.031  6.111   1.00 0.00 ? 495 ALA A HB3  1  
ATOM 1680  N N    . GLY A 1 104 ? -2.821  1.286   3.428   1.00 0.00 ? 496 GLY A N    1  
ATOM 1681  C CA   . GLY A 1 104 ? -2.979  0.961   2.054   1.00 0.00 ? 496 GLY A CA   1  
ATOM 1682  C C    . GLY A 1 104 ? -2.462  -0.407  1.772   1.00 0.00 ? 496 GLY A C    1  
ATOM 1683  O O    . GLY A 1 104 ? -1.265  -0.622  1.754   1.00 0.00 ? 496 GLY A O    1  
ATOM 1684  H H    . GLY A 1 104 ? -1.925  1.483   3.789   1.00 0.00 ? 496 GLY A H    1  
ATOM 1685  H HA2  . GLY A 1 104 ? -4.026  1.008   1.795   1.00 0.00 ? 496 GLY A HA2  1  
ATOM 1686  H HA3  . GLY A 1 104 ? -2.430  1.673   1.456   1.00 0.00 ? 496 GLY A HA3  1  
ATOM 1687  N N    . CYS A 1 105 ? -3.335  -1.342  1.592   1.00 0.00 ? 497 CYS A N    1  
ATOM 1688  C CA   . CYS A 1 105 ? -2.900  -2.666  1.283   1.00 0.00 ? 497 CYS A CA   1  
ATOM 1689  C C    . CYS A 1 105 ? -2.632  -2.741  -0.199  1.00 0.00 ? 497 CYS A C    1  
ATOM 1690  O O    . CYS A 1 105 ? -3.532  -2.504  -1.022  1.00 0.00 ? 497 CYS A O    1  
ATOM 1691  C CB   . CYS A 1 105 ? -3.914  -3.719  1.723   1.00 0.00 ? 497 CYS A CB   1  
ATOM 1692  S SG   . CYS A 1 105 ? -3.356  -5.417  1.451   1.00 0.00 ? 497 CYS A SG   1  
ATOM 1693  H H    . CYS A 1 105 ? -4.292  -1.120  1.643   1.00 0.00 ? 497 CYS A H    1  
ATOM 1694  H HA   . CYS A 1 105 ? -1.964  -2.824  1.800   1.00 0.00 ? 497 CYS A HA   1  
ATOM 1695  H HB2  . CYS A 1 105 ? -4.099  -3.603  2.781   1.00 0.00 ? 497 CYS A HB2  1  
ATOM 1696  H HB3  . CYS A 1 105 ? -4.841  -3.580  1.186   1.00 0.00 ? 497 CYS A HB3  1  
ATOM 1697  H HG   . CYS A 1 105 ? -2.073  -5.387  1.115   1.00 0.00 ? 497 CYS A HG   1  
ATOM 1698  N N    . VAL A 1 106 ? -1.412  -3.050  -0.528  1.00 0.00 ? 498 VAL A N    1  
ATOM 1699  C CA   . VAL A 1 106 ? -0.947  -3.075  -1.878  1.00 0.00 ? 498 VAL A CA   1  
ATOM 1700  C C    . VAL A 1 106 ? -0.897  -4.503  -2.372  1.00 0.00 ? 498 VAL A C    1  
ATOM 1701  O O    . VAL A 1 106 ? -0.217  -5.357  -1.794  1.00 0.00 ? 498 VAL A O    1  
ATOM 1702  C CB   . VAL A 1 106 ? 0.485   -2.475  -1.981  1.00 0.00 ? 498 VAL A CB   1  
ATOM 1703  C CG1  . VAL A 1 106 ? 0.989   -2.461  -3.421  1.00 0.00 ? 498 VAL A CG1  1  
ATOM 1704  C CG2  . VAL A 1 106 ? 0.554   -1.083  -1.371  1.00 0.00 ? 498 VAL A CG2  1  
ATOM 1705  H H    . VAL A 1 106 ? -0.766  -3.302  0.170   1.00 0.00 ? 498 VAL A H    1  
ATOM 1706  H HA   . VAL A 1 106 ? -1.609  -2.487  -2.497  1.00 0.00 ? 498 VAL A HA   1  
ATOM 1707  H HB   . VAL A 1 106 ? 1.134   -3.124  -1.412  1.00 0.00 ? 498 VAL A HB   1  
ATOM 1708  H HG11 . VAL A 1 106 ? 0.314   -1.875  -4.028  1.00 0.00 ? 498 VAL A HG11 1  
ATOM 1709  H HG12 . VAL A 1 106 ? 1.976   -2.025  -3.460  1.00 0.00 ? 498 VAL A HG12 1  
ATOM 1710  H HG13 . VAL A 1 106 ? 1.030   -3.470  -3.808  1.00 0.00 ? 498 VAL A HG13 1  
ATOM 1711  H HG21 . VAL A 1 106 ? 0.255   -1.139  -0.335  1.00 0.00 ? 498 VAL A HG21 1  
ATOM 1712  H HG22 . VAL A 1 106 ? 1.566   -0.713  -1.434  1.00 0.00 ? 498 VAL A HG22 1  
ATOM 1713  H HG23 . VAL A 1 106 ? -0.108  -0.418  -1.902  1.00 0.00 ? 498 VAL A HG23 1  
ATOM 1714  N N    . HIS A 1 107 ? -1.617  -4.745  -3.410  1.00 0.00 ? 499 HIS A N    1  
ATOM 1715  C CA   . HIS A 1 107 ? -1.629  -6.008  -4.072  1.00 0.00 ? 499 HIS A CA   1  
ATOM 1716  C C    . HIS A 1 107 ? -0.921  -5.826  -5.398  1.00 0.00 ? 499 HIS A C    1  
ATOM 1717  O O    . HIS A 1 107 ? -1.096  -4.776  -6.077  1.00 0.00 ? 499 HIS A O    1  
ATOM 1718  C CB   . HIS A 1 107 ? -3.074  -6.514  -4.298  1.00 0.00 ? 499 HIS A CB   1  
ATOM 1719  C CG   . HIS A 1 107 ? -3.818  -6.957  -3.052  1.00 0.00 ? 499 HIS A CG   1  
ATOM 1720  N ND1  . HIS A 1 107 ? -4.402  -6.099  -2.138  1.00 0.00 ? 499 HIS A ND1  1  
ATOM 1721  C CD2  . HIS A 1 107 ? -4.094  -8.212  -2.602  1.00 0.00 ? 499 HIS A CD2  1  
ATOM 1722  C CE1  . HIS A 1 107 ? -4.998  -6.847  -1.192  1.00 0.00 ? 499 HIS A CE1  1  
ATOM 1723  N NE2  . HIS A 1 107 ? -4.843  -8.131  -1.432  1.00 0.00 ? 499 HIS A NE2  1  
ATOM 1724  H H    . HIS A 1 107 ? -2.156  -4.013  -3.790  1.00 0.00 ? 499 HIS A H    1  
ATOM 1725  H HA   . HIS A 1 107 ? -1.087  -6.708  -3.451  1.00 0.00 ? 499 HIS A HA   1  
ATOM 1726  H HB2  . HIS A 1 107 ? -3.649  -5.720  -4.750  1.00 0.00 ? 499 HIS A HB2  1  
ATOM 1727  H HB3  . HIS A 1 107 ? -3.044  -7.349  -4.983  1.00 0.00 ? 499 HIS A HB3  1  
ATOM 1728  H HD1  . HIS A 1 107 ? -4.378  -5.119  -2.158  1.00 0.00 ? 499 HIS A HD1  1  
ATOM 1729  H HD2  . HIS A 1 107 ? -3.786  -9.143  -3.054  1.00 0.00 ? 499 HIS A HD2  1  
ATOM 1730  H HE1  . HIS A 1 107 ? -5.523  -6.462  -0.330  1.00 0.00 ? 499 HIS A HE1  1  
ATOM 1731  N N    . PHE A 1 108 ? -0.106  -6.772  -5.752  1.00 0.00 ? 500 PHE A N    1  
ATOM 1732  C CA   . PHE A 1 108 ? 0.615   -6.708  -6.989  1.00 0.00 ? 500 PHE A CA   1  
ATOM 1733  C C    . PHE A 1 108 ? -0.177  -7.414  -8.060  1.00 0.00 ? 500 PHE A C    1  
ATOM 1734  O O    . PHE A 1 108 ? -0.740  -8.485  -7.807  1.00 0.00 ? 500 PHE A O    1  
ATOM 1735  C CB   . PHE A 1 108 ? 2.006   -7.362  -6.868  1.00 0.00 ? 500 PHE A CB   1  
ATOM 1736  C CG   . PHE A 1 108 ? 2.915   -6.724  -5.856  1.00 0.00 ? 500 PHE A CG   1  
ATOM 1737  C CD1  . PHE A 1 108 ? 3.677   -5.626  -6.183  1.00 0.00 ? 500 PHE A CD1  1  
ATOM 1738  C CD2  . PHE A 1 108 ? 3.001   -7.223  -4.583  1.00 0.00 ? 500 PHE A CD2  1  
ATOM 1739  C CE1  . PHE A 1 108 ? 4.506   -5.035  -5.255  1.00 0.00 ? 500 PHE A CE1  1  
ATOM 1740  C CE2  . PHE A 1 108 ? 3.826   -6.643  -3.648  1.00 0.00 ? 500 PHE A CE2  1  
ATOM 1741  C CZ   . PHE A 1 108 ? 4.578   -5.542  -3.985  1.00 0.00 ? 500 PHE A CZ   1  
ATOM 1742  H H    . PHE A 1 108 ? 0.005   -7.565  -5.187  1.00 0.00 ? 500 PHE A H    1  
ATOM 1743  H HA   . PHE A 1 108 ? 0.738   -5.667  -7.248  1.00 0.00 ? 500 PHE A HA   1  
ATOM 1744  H HB2  . PHE A 1 108 ? 1.879   -8.397  -6.586  1.00 0.00 ? 500 PHE A HB2  1  
ATOM 1745  H HB3  . PHE A 1 108 ? 2.495   -7.322  -7.830  1.00 0.00 ? 500 PHE A HB3  1  
ATOM 1746  H HD1  . PHE A 1 108 ? 3.624   -5.216  -7.180  1.00 0.00 ? 500 PHE A HD1  1  
ATOM 1747  H HD2  . PHE A 1 108 ? 2.415   -8.095  -4.327  1.00 0.00 ? 500 PHE A HD2  1  
ATOM 1748  H HE1  . PHE A 1 108 ? 5.098   -4.174  -5.529  1.00 0.00 ? 500 PHE A HE1  1  
ATOM 1749  H HE2  . PHE A 1 108 ? 3.877   -7.049  -2.648  1.00 0.00 ? 500 PHE A HE2  1  
ATOM 1750  H HZ   . PHE A 1 108 ? 5.227   -5.079  -3.257  1.00 0.00 ? 500 PHE A HZ   1  
ATOM 1751  N N    . PRO A 1 109 ? -0.312  -6.797  -9.245  1.00 0.00 ? 501 PRO A N    1  
ATOM 1752  C CA   . PRO A 1 109 ? -0.915  -7.454  -10.397 1.00 0.00 ? 501 PRO A CA   1  
ATOM 1753  C C    . PRO A 1 109 ? -0.169  -8.760  -10.728 1.00 0.00 ? 501 PRO A C    1  
ATOM 1754  O O    . PRO A 1 109 ? 1.014   -8.939  -10.367 1.00 0.00 ? 501 PRO A O    1  
ATOM 1755  C CB   . PRO A 1 109 ? -0.741  -6.434  -11.526 1.00 0.00 ? 501 PRO A CB   1  
ATOM 1756  C CG   . PRO A 1 109 ? -0.651  -5.124  -10.833 1.00 0.00 ? 501 PRO A CG   1  
ATOM 1757  C CD   . PRO A 1 109 ? 0.052   -5.397  -9.535  1.00 0.00 ? 501 PRO A CD   1  
ATOM 1758  H HA   . PRO A 1 109 ? -1.962  -7.665  -10.232 1.00 0.00 ? 501 PRO A HA   1  
ATOM 1759  H HB2  . PRO A 1 109 ? 0.165   -6.658  -12.070 1.00 0.00 ? 501 PRO A HB2  1  
ATOM 1760  H HB3  . PRO A 1 109 ? -1.590  -6.471  -12.193 1.00 0.00 ? 501 PRO A HB3  1  
ATOM 1761  H HG2  . PRO A 1 109 ? -0.083  -4.430  -11.434 1.00 0.00 ? 501 PRO A HG2  1  
ATOM 1762  H HG3  . PRO A 1 109 ? -1.643  -4.737  -10.648 1.00 0.00 ? 501 PRO A HG3  1  
ATOM 1763  H HD2  . PRO A 1 109 ? 1.120   -5.282  -9.637  1.00 0.00 ? 501 PRO A HD2  1  
ATOM 1764  H HD3  . PRO A 1 109 ? -0.326  -4.739  -8.767  1.00 0.00 ? 501 PRO A HD3  1  
ATOM 1765  N N    . HIS A 1 110 ? -0.815  -9.624  -11.447 1.00 0.00 ? 502 HIS A N    1  
ATOM 1766  C CA   . HIS A 1 110 ? -0.285  -10.930 -11.713 1.00 0.00 ? 502 HIS A CA   1  
ATOM 1767  C C    . HIS A 1 110 ? 0.809   -10.849 -12.767 1.00 0.00 ? 502 HIS A C    1  
ATOM 1768  O O    . HIS A 1 110 ? 0.631   -10.255 -13.839 1.00 0.00 ? 502 HIS A O    1  
ATOM 1769  C CB   . HIS A 1 110 ? -1.418  -11.872 -12.165 1.00 0.00 ? 502 HIS A CB   1  
ATOM 1770  C CG   . HIS A 1 110 ? -1.000  -13.292 -12.440 1.00 0.00 ? 502 HIS A CG   1  
ATOM 1771  N ND1  . HIS A 1 110 ? -0.856  -13.823 -13.705 1.00 0.00 ? 502 HIS A ND1  1  
ATOM 1772  C CD2  . HIS A 1 110 ? -0.720  -14.299 -11.583 1.00 0.00 ? 502 HIS A CD2  1  
ATOM 1773  C CE1  . HIS A 1 110 ? -0.502  -15.102 -13.581 1.00 0.00 ? 502 HIS A CE1  1  
ATOM 1774  N NE2  . HIS A 1 110 ? -0.406  -15.444 -12.310 1.00 0.00 ? 502 HIS A NE2  1  
ATOM 1775  H H    . HIS A 1 110 ? -1.678  -9.367  -11.836 1.00 0.00 ? 502 HIS A H    1  
ATOM 1776  H HA   . HIS A 1 110 ? 0.135   -11.313 -10.794 1.00 0.00 ? 502 HIS A HA   1  
ATOM 1777  H HB2  . HIS A 1 110 ? -2.179  -11.899 -11.400 1.00 0.00 ? 502 HIS A HB2  1  
ATOM 1778  H HB3  . HIS A 1 110 ? -1.851  -11.471 -13.068 1.00 0.00 ? 502 HIS A HB3  1  
ATOM 1779  H HD1  . HIS A 1 110 ? -1.003  -13.365 -14.562 1.00 0.00 ? 502 HIS A HD1  1  
ATOM 1780  H HD2  . HIS A 1 110 ? -0.733  -14.237 -10.505 1.00 0.00 ? 502 HIS A HD2  1  
ATOM 1781  H HE1  . HIS A 1 110 ? -0.319  -15.771 -14.409 1.00 0.00 ? 502 HIS A HE1  1  
ATOM 1782  N N    . THR A 1 111 ? 1.928   -11.416 -12.428 1.00 0.00 ? 503 THR A N    1  
ATOM 1783  C CA   . THR A 1 111 ? 3.090   -11.464 -13.271 1.00 0.00 ? 503 THR A CA   1  
ATOM 1784  C C    . THR A 1 111 ? 3.963   -12.625 -12.788 1.00 0.00 ? 503 THR A C    1  
ATOM 1785  O O    . THR A 1 111 ? 4.537   -13.375 -13.583 1.00 0.00 ? 503 THR A O    1  
ATOM 1786  C CB   . THR A 1 111 ? 3.864   -10.084 -13.300 1.00 0.00 ? 503 THR A CB   1  
ATOM 1787  O OG1  . THR A 1 111 ? 5.046   -10.157 -14.118 1.00 0.00 ? 503 THR A OG1  1  
ATOM 1788  C CG2  . THR A 1 111 ? 4.236   -9.593  -11.899 1.00 0.00 ? 503 THR A CG2  1  
ATOM 1789  H H    . THR A 1 111 ? 1.964   -11.855 -11.554 1.00 0.00 ? 503 THR A H    1  
ATOM 1790  H HA   . THR A 1 111 ? 2.740   -11.706 -14.265 1.00 0.00 ? 503 THR A HA   1  
ATOM 1791  H HB   . THR A 1 111 ? 3.203   -9.361  -13.757 1.00 0.00 ? 503 THR A HB   1  
ATOM 1792  H HG1  . THR A 1 111 ? 5.683   -10.700 -13.630 1.00 0.00 ? 503 THR A HG1  1  
ATOM 1793  H HG21 . THR A 1 111 ? 4.863   -10.325 -11.413 1.00 0.00 ? 503 THR A HG21 1  
ATOM 1794  H HG22 . THR A 1 111 ? 4.766   -8.656  -11.977 1.00 0.00 ? 503 THR A HG22 1  
ATOM 1795  H HG23 . THR A 1 111 ? 3.338   -9.449  -11.317 1.00 0.00 ? 503 THR A HG23 1  
ATOM 1796  N N    . ALA A 1 112 ? 4.022   -12.790 -11.476 1.00 0.00 ? 504 ALA A N    1  
ATOM 1797  C CA   . ALA A 1 112 ? 4.673   -13.927 -10.877 1.00 0.00 ? 504 ALA A CA   1  
ATOM 1798  C C    . ALA A 1 112 ? 3.661   -15.073 -10.870 1.00 0.00 ? 504 ALA A C    1  
ATOM 1799  O O    . ALA A 1 112 ? 2.462   -14.798 -10.858 1.00 0.00 ? 504 ALA A O    1  
ATOM 1800  C CB   . ALA A 1 112 ? 5.132   -13.576 -9.471  1.00 0.00 ? 504 ALA A CB   1  
ATOM 1801  H H    . ALA A 1 112 ? 3.629   -12.123 -10.878 1.00 0.00 ? 504 ALA A H    1  
ATOM 1802  H HA   . ALA A 1 112 ? 5.520   -14.200 -11.489 1.00 0.00 ? 504 ALA A HA   1  
ATOM 1803  H HB1  . ALA A 1 112 ? 5.837   -12.758 -9.518  1.00 0.00 ? 504 ALA A HB1  1  
ATOM 1804  H HB2  . ALA A 1 112 ? 5.604   -14.431 -9.013  1.00 0.00 ? 504 ALA A HB2  1  
ATOM 1805  H HB3  . ALA A 1 112 ? 4.278   -13.280 -8.881  1.00 0.00 ? 504 ALA A HB3  1  
ATOM 1806  N N    . PRO A 1 113 ? 4.122   -16.354 -10.880 1.00 0.00 ? 505 PRO A N    1  
ATOM 1807  C CA   . PRO A 1 113 ? 3.255   -17.559 -11.011 1.00 0.00 ? 505 PRO A CA   1  
ATOM 1808  C C    . PRO A 1 113 ? 2.014   -17.611 -10.102 1.00 0.00 ? 505 PRO A C    1  
ATOM 1809  O O    . PRO A 1 113 ? 0.984   -18.164 -10.497 1.00 0.00 ? 505 PRO A O    1  
ATOM 1810  C CB   . PRO A 1 113 ? 4.199   -18.730 -10.665 1.00 0.00 ? 505 PRO A CB   1  
ATOM 1811  C CG   . PRO A 1 113 ? 5.449   -18.097 -10.142 1.00 0.00 ? 505 PRO A CG   1  
ATOM 1812  C CD   . PRO A 1 113 ? 5.535   -16.755 -10.794 1.00 0.00 ? 505 PRO A CD   1  
ATOM 1813  H HA   . PRO A 1 113 ? 2.930   -17.681 -12.034 1.00 0.00 ? 505 PRO A HA   1  
ATOM 1814  H HB2  . PRO A 1 113 ? 3.731   -19.354 -9.917  1.00 0.00 ? 505 PRO A HB2  1  
ATOM 1815  H HB3  . PRO A 1 113 ? 4.391   -19.317 -11.550 1.00 0.00 ? 505 PRO A HB3  1  
ATOM 1816  H HG2  . PRO A 1 113 ? 5.384   -17.989 -9.069  1.00 0.00 ? 505 PRO A HG2  1  
ATOM 1817  H HG3  . PRO A 1 113 ? 6.307   -18.699 -10.405 1.00 0.00 ? 505 PRO A HG3  1  
ATOM 1818  H HD2  . PRO A 1 113 ? 6.107   -16.071 -10.184 1.00 0.00 ? 505 PRO A HD2  1  
ATOM 1819  H HD3  . PRO A 1 113 ? 5.970   -16.839 -11.779 1.00 0.00 ? 505 PRO A HD3  1  
ATOM 1820  N N    . CYS A 1 114 ? 2.097   -17.059 -8.913  1.00 0.00 ? 506 CYS A N    1  
ATOM 1821  C CA   . CYS A 1 114 ? 0.968   -17.109 -8.012  1.00 0.00 ? 506 CYS A CA   1  
ATOM 1822  C C    . CYS A 1 114 ? 0.256   -15.751 -7.952  1.00 0.00 ? 506 CYS A C    1  
ATOM 1823  O O    . CYS A 1 114 ? -0.808  -15.573 -8.549  1.00 0.00 ? 506 CYS A O    1  
ATOM 1824  C CB   . CYS A 1 114 ? 1.411   -17.563 -6.616  1.00 0.00 ? 506 CYS A CB   1  
ATOM 1825  S SG   . CYS A 1 114 ? 2.437   -19.060 -6.615  1.00 0.00 ? 506 CYS A SG   1  
ATOM 1826  H H    . CYS A 1 114 ? 2.927   -16.613 -8.643  1.00 0.00 ? 506 CYS A H    1  
ATOM 1827  H HA   . CYS A 1 114 ? 0.280   -17.838 -8.414  1.00 0.00 ? 506 CYS A HA   1  
ATOM 1828  H HB2  . CYS A 1 114 ? 1.968   -16.775 -6.133  1.00 0.00 ? 506 CYS A HB2  1  
ATOM 1829  H HB3  . CYS A 1 114 ? 0.530   -17.772 -6.027  1.00 0.00 ? 506 CYS A HB3  1  
ATOM 1830  H HG   . CYS A 1 114 ? 1.627   -20.068 -6.908  1.00 0.00 ? 506 CYS A HG   1  
ATOM 1831  N N    . GLU A 1 115 ? 0.865   -14.798 -7.255  1.00 0.00 ? 507 GLU A N    1  
ATOM 1832  C CA   . GLU A 1 115 ? 0.307   -13.450 -7.079  1.00 0.00 ? 507 GLU A CA   1  
ATOM 1833  C C    . GLU A 1 115 ? 1.403   -12.562 -6.472  1.00 0.00 ? 507 GLU A C    1  
ATOM 1834  O O    . GLU A 1 115 ? 1.149   -11.549 -5.835  1.00 0.00 ? 507 GLU A O    1  
ATOM 1835  C CB   . GLU A 1 115 ? -0.949  -13.527 -6.166  1.00 0.00 ? 507 GLU A CB   1  
ATOM 1836  C CG   . GLU A 1 115 ? -1.730  -12.224 -6.011  1.00 0.00 ? 507 GLU A CG   1  
ATOM 1837  C CD   . GLU A 1 115 ? -3.021  -12.423 -5.272  1.00 0.00 ? 507 GLU A CD   1  
ATOM 1838  O OE1  . GLU A 1 115 ? -3.023  -12.480 -4.037  1.00 0.00 ? 507 GLU A OE1  1  
ATOM 1839  O OE2  . GLU A 1 115 ? -4.076  -12.561 -5.942  1.00 0.00 ? 507 GLU A OE2  1  
ATOM 1840  H H    . GLU A 1 115 ? 1.720   -15.005 -6.823  1.00 0.00 ? 507 GLU A H    1  
ATOM 1841  H HA   . GLU A 1 115 ? 0.037   -13.066 -8.052  1.00 0.00 ? 507 GLU A HA   1  
ATOM 1842  H HB2  . GLU A 1 115 ? -1.623  -14.265 -6.575  1.00 0.00 ? 507 GLU A HB2  1  
ATOM 1843  H HB3  . GLU A 1 115 ? -0.639  -13.856 -5.186  1.00 0.00 ? 507 GLU A HB3  1  
ATOM 1844  H HG2  . GLU A 1 115 ? -1.125  -11.517 -5.465  1.00 0.00 ? 507 GLU A HG2  1  
ATOM 1845  H HG3  . GLU A 1 115 ? -1.947  -11.831 -6.993  1.00 0.00 ? 507 GLU A HG3  1  
ATOM 1846  N N    . VAL A 1 116 ? 2.639   -12.950 -6.745  1.00 0.00 ? 508 VAL A N    1  
ATOM 1847  C CA   . VAL A 1 116 ? 3.831   -12.293 -6.228  1.00 0.00 ? 508 VAL A CA   1  
ATOM 1848  C C    . VAL A 1 116 ? 3.933   -12.489 -4.706  1.00 0.00 ? 508 VAL A C    1  
ATOM 1849  O O    . VAL A 1 116 ? 4.295   -13.574 -4.240  1.00 0.00 ? 508 VAL A O    1  
ATOM 1850  C CB   . VAL A 1 116 ? 3.948   -10.762 -6.624  1.00 0.00 ? 508 VAL A CB   1  
ATOM 1851  C CG1  . VAL A 1 116 ? 5.286   -10.161 -6.183  1.00 0.00 ? 508 VAL A CG1  1  
ATOM 1852  C CG2  . VAL A 1 116 ? 3.754   -10.559 -8.124  1.00 0.00 ? 508 VAL A CG2  1  
ATOM 1853  H H    . VAL A 1 116 ? 2.773   -13.729 -7.323  1.00 0.00 ? 508 VAL A H    1  
ATOM 1854  H HA   . VAL A 1 116 ? 4.675   -12.820 -6.647  1.00 0.00 ? 508 VAL A HA   1  
ATOM 1855  H HB   . VAL A 1 116 ? 3.160   -10.235 -6.105  1.00 0.00 ? 508 VAL A HB   1  
ATOM 1856  H HG11 . VAL A 1 116 ? 6.098   -10.700 -6.649  1.00 0.00 ? 508 VAL A HG11 1  
ATOM 1857  H HG12 . VAL A 1 116 ? 5.330   -9.122  -6.473  1.00 0.00 ? 508 VAL A HG12 1  
ATOM 1858  H HG13 . VAL A 1 116 ? 5.375   -10.239 -5.109  1.00 0.00 ? 508 VAL A HG13 1  
ATOM 1859  H HG21 . VAL A 1 116 ? 2.792   -10.951 -8.420  1.00 0.00 ? 508 VAL A HG21 1  
ATOM 1860  H HG22 . VAL A 1 116 ? 3.804   -9.504  -8.353  1.00 0.00 ? 508 VAL A HG22 1  
ATOM 1861  H HG23 . VAL A 1 116 ? 4.535   -11.079 -8.658  1.00 0.00 ? 508 VAL A HG23 1  
ATOM 1862  N N    . ARG A 1 117 ? 3.492   -11.500 -3.976  1.00 0.00 ? 509 ARG A N    1  
ATOM 1863  C CA   . ARG A 1 117 ? 3.560   -11.366 -2.527  1.00 0.00 ? 509 ARG A CA   1  
ATOM 1864  C C    . ARG A 1 117 ? 2.678   -10.180 -2.277  1.00 0.00 ? 509 ARG A C    1  
ATOM 1865  O O    . ARG A 1 117 ? 2.118   -9.678  -3.245  1.00 0.00 ? 509 ARG A O    1  
ATOM 1866  C CB   . ARG A 1 117 ? 5.022   -11.065 -2.052  1.00 0.00 ? 509 ARG A CB   1  
ATOM 1867  C CG   . ARG A 1 117 ? 5.994   -12.232 -2.225  1.00 0.00 ? 509 ARG A CG   1  
ATOM 1868  C CD   . ARG A 1 117 ? 7.428   -11.880 -1.903  1.00 0.00 ? 509 ARG A CD   1  
ATOM 1869  N NE   . ARG A 1 117 ? 8.305   -13.054 -2.070  1.00 0.00 ? 509 ARG A NE   1  
ATOM 1870  C CZ   . ARG A 1 117 ? 9.637   -13.016 -2.277  1.00 0.00 ? 509 ARG A CZ   1  
ATOM 1871  N NH1  . ARG A 1 117 ? 10.280  -11.855 -2.305  1.00 0.00 ? 509 ARG A NH1  1  
ATOM 1872  N NH2  . ARG A 1 117 ? 10.311  -14.142 -2.460  1.00 0.00 ? 509 ARG A NH2  1  
ATOM 1873  H H    . ARG A 1 117 ? 3.006   -10.760 -4.407  1.00 0.00 ? 509 ARG A H    1  
ATOM 1874  H HA   . ARG A 1 117 ? 3.154   -12.251 -2.058  1.00 0.00 ? 509 ARG A HA   1  
ATOM 1875  H HB2  . ARG A 1 117 ? 5.401   -10.228 -2.619  1.00 0.00 ? 509 ARG A HB2  1  
ATOM 1876  H HB3  . ARG A 1 117 ? 4.995   -10.792 -1.007  1.00 0.00 ? 509 ARG A HB3  1  
ATOM 1877  H HG2  . ARG A 1 117 ? 5.689   -13.036 -1.572  1.00 0.00 ? 509 ARG A HG2  1  
ATOM 1878  H HG3  . ARG A 1 117 ? 5.936   -12.571 -3.249  1.00 0.00 ? 509 ARG A HG3  1  
ATOM 1879  H HD2  . ARG A 1 117 ? 7.750   -11.105 -2.583  1.00 0.00 ? 509 ARG A HD2  1  
ATOM 1880  H HD3  . ARG A 1 117 ? 7.497   -11.524 -0.886  1.00 0.00 ? 509 ARG A HD3  1  
ATOM 1881  H HE   . ARG A 1 117 ? 7.829   -13.916 -2.042  1.00 0.00 ? 509 ARG A HE   1  
ATOM 1882  H HH11 . ARG A 1 117 ? 9.807   -10.983 -2.167  1.00 0.00 ? 509 ARG A HH11 1  
ATOM 1883  H HH12 . ARG A 1 117 ? 11.268  -11.796 -2.471  1.00 0.00 ? 509 ARG A HH12 1  
ATOM 1884  H HH21 . ARG A 1 117 ? 9.865   -15.039 -2.444  1.00 0.00 ? 509 ARG A HH21 1  
ATOM 1885  H HH22 . ARG A 1 117 ? 11.301  -14.160 -2.619  1.00 0.00 ? 509 ARG A HH22 1  
ATOM 1886  N N    . VAL A 1 118 ? 2.527   -9.700  -1.071  1.00 0.00 ? 510 VAL A N    1  
ATOM 1887  C CA   . VAL A 1 118 ? 1.686   -8.505  -0.907  1.00 0.00 ? 510 VAL A CA   1  
ATOM 1888  C C    . VAL A 1 118 ? 2.333   -7.510  -0.012  1.00 0.00 ? 510 VAL A C    1  
ATOM 1889  O O    . VAL A 1 118 ? 3.146   -7.869  0.788   1.00 0.00 ? 510 VAL A O    1  
ATOM 1890  C CB   . VAL A 1 118 ? 0.216   -8.779  -0.485  1.00 0.00 ? 510 VAL A CB   1  
ATOM 1891  C CG1  . VAL A 1 118 ? -0.597  -9.343  -1.641  1.00 0.00 ? 510 VAL A CG1  1  
ATOM 1892  C CG2  . VAL A 1 118 ? 0.153   -9.722  0.677   1.00 0.00 ? 510 VAL A CG2  1  
ATOM 1893  H H    . VAL A 1 118 ? 2.984   -10.069 -0.277  1.00 0.00 ? 510 VAL A H    1  
ATOM 1894  H HA   . VAL A 1 118 ? 1.680   -8.046  -1.886  1.00 0.00 ? 510 VAL A HA   1  
ATOM 1895  H HB   . VAL A 1 118 ? -0.214  -7.837  -0.184  1.00 0.00 ? 510 VAL A HB   1  
ATOM 1896  H HG11 . VAL A 1 118 ? -0.597  -8.641  -2.462  1.00 0.00 ? 510 VAL A HG11 1  
ATOM 1897  H HG12 . VAL A 1 118 ? -0.160  -10.276 -1.965  1.00 0.00 ? 510 VAL A HG12 1  
ATOM 1898  H HG13 . VAL A 1 118 ? -1.612  -9.515  -1.316  1.00 0.00 ? 510 VAL A HG13 1  
ATOM 1899  H HG21 . VAL A 1 118 ? 0.652   -10.642 0.416   1.00 0.00 ? 510 VAL A HG21 1  
ATOM 1900  H HG22 . VAL A 1 118 ? 0.622   -9.271  1.539   1.00 0.00 ? 510 VAL A HG22 1  
ATOM 1901  H HG23 . VAL A 1 118 ? -0.891  -9.909  0.882   1.00 0.00 ? 510 VAL A HG23 1  
ATOM 1902  N N    . LEU A 1 119 ? 1.973   -6.270  -0.149  1.00 0.00 ? 511 LEU A N    1  
ATOM 1903  C CA   . LEU A 1 119 ? 2.643   -5.202  0.555   1.00 0.00 ? 511 LEU A CA   1  
ATOM 1904  C C    . LEU A 1 119 ? 1.659   -4.354  1.359   1.00 0.00 ? 511 LEU A C    1  
ATOM 1905  O O    . LEU A 1 119 ? 0.491   -4.241  1.006   1.00 0.00 ? 511 LEU A O    1  
ATOM 1906  C CB   . LEU A 1 119 ? 3.422   -4.361  -0.484  1.00 0.00 ? 511 LEU A CB   1  
ATOM 1907  C CG   . LEU A 1 119 ? 4.027   -3.026  -0.038  1.00 0.00 ? 511 LEU A CG   1  
ATOM 1908  C CD1  . LEU A 1 119 ? 5.053   -3.216  1.053   1.00 0.00 ? 511 LEU A CD1  1  
ATOM 1909  C CD2  . LEU A 1 119 ? 4.652   -2.331  -1.227  1.00 0.00 ? 511 LEU A CD2  1  
ATOM 1910  H H    . LEU A 1 119 ? 1.209   -6.038  -0.726  1.00 0.00 ? 511 LEU A H    1  
ATOM 1911  H HA   . LEU A 1 119 ? 3.357   -5.646  1.231   1.00 0.00 ? 511 LEU A HA   1  
ATOM 1912  H HB2  . LEU A 1 119 ? 4.240   -4.977  -0.827  1.00 0.00 ? 511 LEU A HB2  1  
ATOM 1913  H HB3  . LEU A 1 119 ? 2.786   -4.185  -1.337  1.00 0.00 ? 511 LEU A HB3  1  
ATOM 1914  H HG   . LEU A 1 119 ? 3.245   -2.386  0.343   1.00 0.00 ? 511 LEU A HG   1  
ATOM 1915  H HD11 . LEU A 1 119 ? 4.672   -3.880  1.814   1.00 0.00 ? 511 LEU A HD11 1  
ATOM 1916  H HD12 . LEU A 1 119 ? 5.958   -3.620  0.623   1.00 0.00 ? 511 LEU A HD12 1  
ATOM 1917  H HD13 . LEU A 1 119 ? 5.289   -2.258  1.489   1.00 0.00 ? 511 LEU A HD13 1  
ATOM 1918  H HD21 . LEU A 1 119 ? 5.391   -2.981  -1.672  1.00 0.00 ? 511 LEU A HD21 1  
ATOM 1919  H HD22 . LEU A 1 119 ? 3.889   -2.100  -1.955  1.00 0.00 ? 511 LEU A HD22 1  
ATOM 1920  H HD23 . LEU A 1 119 ? 5.130   -1.422  -0.897  1.00 0.00 ? 511 LEU A HD23 1  
ATOM 1921  N N    . MET A 1 120 ? 2.117   -3.816  2.463   1.00 0.00 ? 512 MET A N    1  
ATOM 1922  C CA   . MET A 1 120 ? 1.322   -2.914  3.263   1.00 0.00 ? 512 MET A CA   1  
ATOM 1923  C C    . MET A 1 120 ? 1.935   -1.521  3.237   1.00 0.00 ? 512 MET A C    1  
ATOM 1924  O O    . MET A 1 120 ? 3.142   -1.387  3.295   1.00 0.00 ? 512 MET A O    1  
ATOM 1925  C CB   . MET A 1 120 ? 1.226   -3.425  4.701   1.00 0.00 ? 512 MET A CB   1  
ATOM 1926  C CG   . MET A 1 120 ? 0.501   -2.481  5.650   1.00 0.00 ? 512 MET A CG   1  
ATOM 1927  S SD   . MET A 1 120 ? -1.154  -2.039  5.082   1.00 0.00 ? 512 MET A SD   1  
ATOM 1928  C CE   . MET A 1 120 ? -1.932  -3.639  5.025   1.00 0.00 ? 512 MET A CE   1  
ATOM 1929  H H    . MET A 1 120 ? 3.025   -4.030  2.782   1.00 0.00 ? 512 MET A H    1  
ATOM 1930  H HA   . MET A 1 120 ? 0.330   -2.869  2.837   1.00 0.00 ? 512 MET A HA   1  
ATOM 1931  H HB2  . MET A 1 120 ? 0.716   -4.377  4.707   1.00 0.00 ? 512 MET A HB2  1  
ATOM 1932  H HB3  . MET A 1 120 ? 2.231   -3.572  5.072   1.00 0.00 ? 512 MET A HB3  1  
ATOM 1933  H HG2  . MET A 1 120 ? 0.422   -2.951  6.619   1.00 0.00 ? 512 MET A HG2  1  
ATOM 1934  H HG3  . MET A 1 120 ? 1.090   -1.581  5.738   1.00 0.00 ? 512 MET A HG3  1  
ATOM 1935  H HE1  . MET A 1 120 ? -1.846  -4.102  5.997   1.00 0.00 ? 512 MET A HE1  1  
ATOM 1936  H HE2  . MET A 1 120 ? -2.970  -3.534  4.750   1.00 0.00 ? 512 MET A HE2  1  
ATOM 1937  H HE3  . MET A 1 120 ? -1.424  -4.254  4.298   1.00 0.00 ? 512 MET A HE3  1  
ATOM 1938  N N    . LEU A 1 121 ? 1.104   -0.510  3.131   1.00 0.00 ? 513 LEU A N    1  
ATOM 1939  C CA   . LEU A 1 121 ? 1.547   0.866   3.114   1.00 0.00 ? 513 LEU A CA   1  
ATOM 1940  C C    . LEU A 1 121 ? 0.947   1.557   4.334   1.00 0.00 ? 513 LEU A C    1  
ATOM 1941  O O    . LEU A 1 121 ? -0.268  1.545   4.534   1.00 0.00 ? 513 LEU A O    1  
ATOM 1942  C CB   . LEU A 1 121 ? 1.046   1.556   1.826   1.00 0.00 ? 513 LEU A CB   1  
ATOM 1943  C CG   . LEU A 1 121 ? 1.867   2.725   1.248   1.00 0.00 ? 513 LEU A CG   1  
ATOM 1944  C CD1  . LEU A 1 121 ? 1.158   3.408   0.104   1.00 0.00 ? 513 LEU A CD1  1  
ATOM 1945  C CD2  . LEU A 1 121 ? 2.325   3.720   2.277   1.00 0.00 ? 513 LEU A CD2  1  
ATOM 1946  H H    . LEU A 1 121 ? 0.138   -0.680  3.050   1.00 0.00 ? 513 LEU A H    1  
ATOM 1947  H HA   . LEU A 1 121 ? 2.621   0.928   3.181   1.00 0.00 ? 513 LEU A HA   1  
ATOM 1948  H HB2  . LEU A 1 121 ? 0.978   0.800   1.059   1.00 0.00 ? 513 LEU A HB2  1  
ATOM 1949  H HB3  . LEU A 1 121 ? 0.046   1.915   2.022   1.00 0.00 ? 513 LEU A HB3  1  
ATOM 1950  H HG   . LEU A 1 121 ? 2.742   2.284   0.807   1.00 0.00 ? 513 LEU A HG   1  
ATOM 1951  H HD11 . LEU A 1 121 ? 0.981   2.692   -0.685  1.00 0.00 ? 513 LEU A HD11 1  
ATOM 1952  H HD12 . LEU A 1 121 ? 0.218   3.813   0.447   1.00 0.00 ? 513 LEU A HD12 1  
ATOM 1953  H HD13 . LEU A 1 121 ? 1.779   4.208   -0.270  1.00 0.00 ? 513 LEU A HD13 1  
ATOM 1954  H HD21 . LEU A 1 121 ? 1.512   4.045   2.905   1.00 0.00 ? 513 LEU A HD21 1  
ATOM 1955  H HD22 . LEU A 1 121 ? 3.113   3.286   2.875   1.00 0.00 ? 513 LEU A HD22 1  
ATOM 1956  H HD23 . LEU A 1 121 ? 2.703   4.574   1.735   1.00 0.00 ? 513 LEU A HD23 1  
ATOM 1957  N N    . LEU A 1 122 ? 1.789   2.140   5.123   1.00 0.00 ? 514 LEU A N    1  
ATOM 1958  C CA   . LEU A 1 122 ? 1.406   2.837   6.320   1.00 0.00 ? 514 LEU A CA   1  
ATOM 1959  C C    . LEU A 1 122 ? 2.056   4.210   6.340   1.00 0.00 ? 514 LEU A C    1  
ATOM 1960  O O    . LEU A 1 122 ? 3.213   4.360   5.954   1.00 0.00 ? 514 LEU A O    1  
ATOM 1961  C CB   . LEU A 1 122 ? 1.861   2.032   7.534   1.00 0.00 ? 514 LEU A CB   1  
ATOM 1962  C CG   . LEU A 1 122 ? 1.135   0.716   7.789   1.00 0.00 ? 514 LEU A CG   1  
ATOM 1963  C CD1  . LEU A 1 122 ? 1.839   -0.064  8.866   1.00 0.00 ? 514 LEU A CD1  1  
ATOM 1964  C CD2  . LEU A 1 122 ? -0.293  0.981   8.214   1.00 0.00 ? 514 LEU A CD2  1  
ATOM 1965  H H    . LEU A 1 122 ? 2.747   2.115   4.904   1.00 0.00 ? 514 LEU A H    1  
ATOM 1966  H HA   . LEU A 1 122 ? 0.331   2.934   6.344   1.00 0.00 ? 514 LEU A HA   1  
ATOM 1967  H HB2  . LEU A 1 122 ? 2.909   1.813   7.402   1.00 0.00 ? 514 LEU A HB2  1  
ATOM 1968  H HB3  . LEU A 1 122 ? 1.762   2.652   8.408   1.00 0.00 ? 514 LEU A HB3  1  
ATOM 1969  H HG   . LEU A 1 122 ? 1.114   0.130   6.882   1.00 0.00 ? 514 LEU A HG   1  
ATOM 1970  H HD11 . LEU A 1 122 ? 2.855   -0.258  8.553   1.00 0.00 ? 514 LEU A HD11 1  
ATOM 1971  H HD12 . LEU A 1 122 ? 1.846   0.509   9.781   1.00 0.00 ? 514 LEU A HD12 1  
ATOM 1972  H HD13 . LEU A 1 122 ? 1.325   -1.000  9.026   1.00 0.00 ? 514 LEU A HD13 1  
ATOM 1973  H HD21 . LEU A 1 122 ? -0.300  1.579   9.113   1.00 0.00 ? 514 LEU A HD21 1  
ATOM 1974  H HD22 . LEU A 1 122 ? -0.815  1.505   7.428   1.00 0.00 ? 514 LEU A HD22 1  
ATOM 1975  H HD23 . LEU A 1 122 ? -0.788  0.041   8.407   1.00 0.00 ? 514 LEU A HD23 1  
ATOM 1976  N N    . TYR A 1 123 ? 1.338   5.201   6.768   1.00 0.00 ? 515 TYR A N    1  
ATOM 1977  C CA   . TYR A 1 123 ? 1.893   6.530   6.839   1.00 0.00 ? 515 TYR A CA   1  
ATOM 1978  C C    . TYR A 1 123 ? 2.435   6.786   8.218   1.00 0.00 ? 515 TYR A C    1  
ATOM 1979  O O    . TYR A 1 123 ? 1.710   6.637   9.215   1.00 0.00 ? 515 TYR A O    1  
ATOM 1980  C CB   . TYR A 1 123 ? 0.849   7.604   6.456   1.00 0.00 ? 515 TYR A CB   1  
ATOM 1981  C CG   . TYR A 1 123 ? 1.341   9.053   6.591   1.00 0.00 ? 515 TYR A CG   1  
ATOM 1982  C CD1  . TYR A 1 123 ? 2.542   9.467   6.015   1.00 0.00 ? 515 TYR A CD1  1  
ATOM 1983  C CD2  . TYR A 1 123 ? 0.595   10.000  7.287   1.00 0.00 ? 515 TYR A CD2  1  
ATOM 1984  C CE1  . TYR A 1 123 ? 2.983   10.773  6.132   1.00 0.00 ? 515 TYR A CE1  1  
ATOM 1985  C CE2  . TYR A 1 123 ? 1.032   11.312  7.405   1.00 0.00 ? 515 TYR A CE2  1  
ATOM 1986  C CZ   . TYR A 1 123 ? 2.226   11.690  6.827   1.00 0.00 ? 515 TYR A CZ   1  
ATOM 1987  O OH   . TYR A 1 123 ? 2.668   12.997  6.942   1.00 0.00 ? 515 TYR A OH   1  
ATOM 1988  H H    . TYR A 1 123 ? 0.417   5.039   7.069   1.00 0.00 ? 515 TYR A H    1  
ATOM 1989  H HA   . TYR A 1 123 ? 2.713   6.578   6.138   1.00 0.00 ? 515 TYR A HA   1  
ATOM 1990  H HB2  . TYR A 1 123 ? 0.556   7.457   5.427   1.00 0.00 ? 515 TYR A HB2  1  
ATOM 1991  H HB3  . TYR A 1 123 ? -0.019  7.489   7.087   1.00 0.00 ? 515 TYR A HB3  1  
ATOM 1992  H HD1  . TYR A 1 123 ? 3.135   8.748   5.469   1.00 0.00 ? 515 TYR A HD1  1  
ATOM 1993  H HD2  . TYR A 1 123 ? -0.339  9.704   7.740   1.00 0.00 ? 515 TYR A HD2  1  
ATOM 1994  H HE1  . TYR A 1 123 ? 3.917   11.074  5.681   1.00 0.00 ? 515 TYR A HE1  1  
ATOM 1995  H HE2  . TYR A 1 123 ? 0.443   12.035  7.949   1.00 0.00 ? 515 TYR A HE2  1  
ATOM 1996  H HH   . TYR A 1 123 ? 3.018   13.242  6.078   1.00 0.00 ? 515 TYR A HH   1  
ATOM 1997  N N    . SER A 1 124 ? 3.703   7.121   8.293   1.00 0.00 ? 516 SER A N    1  
ATOM 1998  C CA   . SER A 1 124 ? 4.270   7.496   9.538   1.00 0.00 ? 516 SER A CA   1  
ATOM 1999  C C    . SER A 1 124 ? 4.474   8.998   9.538   1.00 0.00 ? 516 SER A C    1  
ATOM 2000  O O    . SER A 1 124 ? 5.326   9.542   8.795   1.00 0.00 ? 516 SER A O    1  
ATOM 2001  C CB   . SER A 1 124 ? 5.583   6.730   9.809   1.00 0.00 ? 516 SER A CB   1  
ATOM 2002  O OG   . SER A 1 124 ? 6.523   6.867   8.741   1.00 0.00 ? 516 SER A OG   1  
ATOM 2003  H H    . SER A 1 124 ? 4.263   7.145   7.486   1.00 0.00 ? 516 SER A H    1  
ATOM 2004  H HA   . SER A 1 124 ? 3.548   7.252   10.304  1.00 0.00 ? 516 SER A HA   1  
ATOM 2005  H HB2  . SER A 1 124 ? 6.035   7.115   10.711  1.00 0.00 ? 516 SER A HB2  1  
ATOM 2006  H HB3  . SER A 1 124 ? 5.361   5.682   9.945   1.00 0.00 ? 516 SER A HB3  1  
ATOM 2007  H HG   . SER A 1 124 ? 6.127   7.369   8.014   1.00 0.00 ? 516 SER A HG   1  
ATOM 2008  N N    . SER A 1 125 ? 3.689   9.651   10.344  1.00 0.00 ? 517 SER A N    1  
ATOM 2009  C CA   . SER A 1 125 ? 3.694   11.075  10.496  1.00 0.00 ? 517 SER A CA   1  
ATOM 2010  C C    . SER A 1 125 ? 4.990   11.535  11.167  1.00 0.00 ? 517 SER A C    1  
ATOM 2011  O O    . SER A 1 125 ? 5.526   12.604  10.861  1.00 0.00 ? 517 SER A O    1  
ATOM 2012  C CB   . SER A 1 125 ? 2.478   11.458  11.321  1.00 0.00 ? 517 SER A CB   1  
ATOM 2013  O OG   . SER A 1 125 ? 1.310   10.835  10.792  1.00 0.00 ? 517 SER A OG   1  
ATOM 2014  H H    . SER A 1 125 ? 3.048   9.152   10.895  1.00 0.00 ? 517 SER A H    1  
ATOM 2015  H HA   . SER A 1 125 ? 3.608   11.529  9.519   1.00 0.00 ? 517 SER A HA   1  
ATOM 2016  H HB2  . SER A 1 125 ? 2.620   11.131  12.340  1.00 0.00 ? 517 SER A HB2  1  
ATOM 2017  H HB3  . SER A 1 125 ? 2.340   12.528  11.293  1.00 0.00 ? 517 SER A HB3  1  
ATOM 2018  H HG   . SER A 1 125 ? 0.685   10.708  11.514  1.00 0.00 ? 517 SER A HG   1  
ATOM 2019  N N    . LYS A 1 126 ? 5.513   10.682  12.039  1.00 0.00 ? 518 LYS A N    1  
ATOM 2020  C CA   . LYS A 1 126 ? 6.727   10.959  12.787  1.00 0.00 ? 518 LYS A CA   1  
ATOM 2021  C C    . LYS A 1 126 ? 7.924   11.109  11.846  1.00 0.00 ? 518 LYS A C    1  
ATOM 2022  O O    . LYS A 1 126 ? 8.756   12.005  12.008  1.00 0.00 ? 518 LYS A O    1  
ATOM 2023  C CB   . LYS A 1 126 ? 6.986   9.838   13.805  1.00 0.00 ? 518 LYS A CB   1  
ATOM 2024  C CG   . LYS A 1 126 ? 8.211   10.055  14.682  1.00 0.00 ? 518 LYS A CG   1  
ATOM 2025  C CD   . LYS A 1 126 ? 8.063   11.299  15.532  1.00 0.00 ? 518 LYS A CD   1  
ATOM 2026  C CE   . LYS A 1 126 ? 9.311   11.577  16.343  1.00 0.00 ? 518 LYS A CE   1  
ATOM 2027  N NZ   . LYS A 1 126 ? 9.148   12.774  17.180  1.00 0.00 ? 518 LYS A NZ   1  
ATOM 2028  H H    . LYS A 1 126 ? 5.032   9.840   12.199  1.00 0.00 ? 518 LYS A H    1  
ATOM 2029  H HA   . LYS A 1 126 ? 6.579   11.885  13.321  1.00 0.00 ? 518 LYS A HA   1  
ATOM 2030  H HB2  . LYS A 1 126 ? 6.122   9.752   14.446  1.00 0.00 ? 518 LYS A HB2  1  
ATOM 2031  H HB3  . LYS A 1 126 ? 7.115   8.911   13.266  1.00 0.00 ? 518 LYS A HB3  1  
ATOM 2032  H HG2  . LYS A 1 126 ? 8.338   9.200   15.330  1.00 0.00 ? 518 LYS A HG2  1  
ATOM 2033  H HG3  . LYS A 1 126 ? 9.079   10.162  14.048  1.00 0.00 ? 518 LYS A HG3  1  
ATOM 2034  H HD2  . LYS A 1 126 ? 7.879   12.147  14.889  1.00 0.00 ? 518 LYS A HD2  1  
ATOM 2035  H HD3  . LYS A 1 126 ? 7.229   11.166  16.204  1.00 0.00 ? 518 LYS A HD3  1  
ATOM 2036  H HE2  . LYS A 1 126 ? 9.510   10.726  16.975  1.00 0.00 ? 518 LYS A HE2  1  
ATOM 2037  H HE3  . LYS A 1 126 ? 10.142  11.727  15.669  1.00 0.00 ? 518 LYS A HE3  1  
ATOM 2038  H HZ1  . LYS A 1 126 ? 8.924   13.605  16.596  1.00 0.00 ? 518 LYS A HZ1  1  
ATOM 2039  H HZ2  . LYS A 1 126 ? 8.359   12.627  17.842  1.00 0.00 ? 518 LYS A HZ2  1  
ATOM 2040  H HZ3  . LYS A 1 126 ? 10.001  12.950  17.745  1.00 0.00 ? 518 LYS A HZ3  1  
ATOM 2041  N N    . LYS A 1 127 ? 7.995   10.260  10.858  1.00 0.00 ? 519 LYS A N    1  
ATOM 2042  C CA   . LYS A 1 127 ? 9.084   10.318  9.903   1.00 0.00 ? 519 LYS A CA   1  
ATOM 2043  C C    . LYS A 1 127 ? 8.654   11.153  8.694   1.00 0.00 ? 519 LYS A C    1  
ATOM 2044  O O    . LYS A 1 127 ? 9.450   11.428  7.795   1.00 0.00 ? 519 LYS A O    1  
ATOM 2045  C CB   . LYS A 1 127 ? 9.485   8.906   9.465   1.00 0.00 ? 519 LYS A CB   1  
ATOM 2046  C CG   . LYS A 1 127 ? 9.880   7.954   10.599  1.00 0.00 ? 519 LYS A CG   1  
ATOM 2047  C CD   . LYS A 1 127 ? 11.101  8.430   11.380  1.00 0.00 ? 519 LYS A CD   1  
ATOM 2048  C CE   . LYS A 1 127 ? 11.508  7.395   12.427  1.00 0.00 ? 519 LYS A CE   1  
ATOM 2049  N NZ   . LYS A 1 127 ? 12.677  7.823   13.225  1.00 0.00 ? 519 LYS A NZ   1  
ATOM 2050  H H    . LYS A 1 127 ? 7.299   9.576   10.759  1.00 0.00 ? 519 LYS A H    1  
ATOM 2051  H HA   . LYS A 1 127 ? 9.925   10.800  10.379  1.00 0.00 ? 519 LYS A HA   1  
ATOM 2052  H HB2  . LYS A 1 127 ? 8.652   8.466   8.938   1.00 0.00 ? 519 LYS A HB2  1  
ATOM 2053  H HB3  . LYS A 1 127 ? 10.320  8.985   8.784   1.00 0.00 ? 519 LYS A HB3  1  
ATOM 2054  H HG2  . LYS A 1 127 ? 9.052   7.865   11.287  1.00 0.00 ? 519 LYS A HG2  1  
ATOM 2055  H HG3  . LYS A 1 127 ? 10.093  6.984   10.175  1.00 0.00 ? 519 LYS A HG3  1  
ATOM 2056  H HD2  . LYS A 1 127 ? 11.921  8.586   10.694  1.00 0.00 ? 519 LYS A HD2  1  
ATOM 2057  H HD3  . LYS A 1 127 ? 10.862  9.359   11.878  1.00 0.00 ? 519 LYS A HD3  1  
ATOM 2058  H HE2  . LYS A 1 127 ? 10.676  7.226   13.094  1.00 0.00 ? 519 LYS A HE2  1  
ATOM 2059  H HE3  . LYS A 1 127 ? 11.747  6.471   11.920  1.00 0.00 ? 519 LYS A HE3  1  
ATOM 2060  H HZ1  . LYS A 1 127 ? 13.495  8.034   12.621  1.00 0.00 ? 519 LYS A HZ1  1  
ATOM 2061  H HZ2  . LYS A 1 127 ? 12.459  8.667   13.794  1.00 0.00 ? 519 LYS A HZ2  1  
ATOM 2062  H HZ3  . LYS A 1 127 ? 12.950  7.077   13.897  1.00 0.00 ? 519 LYS A HZ3  1  
ATOM 2063  N N    . LYS A 1 128 ? 7.363   11.539  8.703   1.00 0.00 ? 520 LYS A N    1  
ATOM 2064  C CA   . LYS A 1 128 ? 6.707   12.341  7.661   1.00 0.00 ? 520 LYS A CA   1  
ATOM 2065  C C    . LYS A 1 128 ? 6.712   11.588  6.317   1.00 0.00 ? 520 LYS A C    1  
ATOM 2066  O O    . LYS A 1 128 ? 6.494   12.163  5.255   1.00 0.00 ? 520 LYS A O    1  
ATOM 2067  C CB   . LYS A 1 128 ? 7.400   13.708  7.536   1.00 0.00 ? 520 LYS A CB   1  
ATOM 2068  C CG   . LYS A 1 128 ? 6.612   14.763  6.781   1.00 0.00 ? 520 LYS A CG   1  
ATOM 2069  C CD   . LYS A 1 128 ? 5.362   15.153  7.539   1.00 0.00 ? 520 LYS A CD   1  
ATOM 2070  C CE   . LYS A 1 128 ? 4.587   16.225  6.799   1.00 0.00 ? 520 LYS A CE   1  
ATOM 2071  N NZ   . LYS A 1 128 ? 3.430   16.702  7.576   1.00 0.00 ? 520 LYS A NZ   1  
ATOM 2072  H H    . LYS A 1 128 ? 6.804   11.287  9.466   1.00 0.00 ? 520 LYS A H    1  
ATOM 2073  H HA   . LYS A 1 128 ? 5.683   12.487  7.969   1.00 0.00 ? 520 LYS A HA   1  
ATOM 2074  H HB2  . LYS A 1 128 ? 7.593   14.085  8.528   1.00 0.00 ? 520 LYS A HB2  1  
ATOM 2075  H HB3  . LYS A 1 128 ? 8.344   13.559  7.033   1.00 0.00 ? 520 LYS A HB3  1  
ATOM 2076  H HG2  . LYS A 1 128 ? 7.230   15.638  6.652   1.00 0.00 ? 520 LYS A HG2  1  
ATOM 2077  H HG3  . LYS A 1 128 ? 6.330   14.368  5.816   1.00 0.00 ? 520 LYS A HG3  1  
ATOM 2078  H HD2  . LYS A 1 128 ? 4.742   14.277  7.658   1.00 0.00 ? 520 LYS A HD2  1  
ATOM 2079  H HD3  . LYS A 1 128 ? 5.645   15.520  8.514   1.00 0.00 ? 520 LYS A HD3  1  
ATOM 2080  H HE2  . LYS A 1 128 ? 5.244   17.058  6.601   1.00 0.00 ? 520 LYS A HE2  1  
ATOM 2081  H HE3  . LYS A 1 128 ? 4.239   15.816  5.861   1.00 0.00 ? 520 LYS A HE3  1  
ATOM 2082  H HZ1  . LYS A 1 128 ? 3.748   17.081  8.490   1.00 0.00 ? 520 LYS A HZ1  1  
ATOM 2083  H HZ2  . LYS A 1 128 ? 2.940   17.479  7.090   1.00 0.00 ? 520 LYS A HZ2  1  
ATOM 2084  H HZ3  . LYS A 1 128 ? 2.737   15.951  7.770   1.00 0.00 ? 520 LYS A HZ3  1  
ATOM 2085  N N    . ILE A 1 129 ? 6.861   10.291  6.390   1.00 0.00 ? 521 ILE A N    1  
ATOM 2086  C CA   . ILE A 1 129 ? 7.013   9.479   5.201   1.00 0.00 ? 521 ILE A CA   1  
ATOM 2087  C C    . ILE A 1 129 ? 6.218   8.225   5.310   1.00 0.00 ? 521 ILE A C    1  
ATOM 2088  O O    . ILE A 1 129 ? 5.705   7.883   6.392   1.00 0.00 ? 521 ILE A O    1  
ATOM 2089  C CB   . ILE A 1 129 ? 8.516   9.187   4.769   1.00 0.00 ? 521 ILE A CB   1  
ATOM 2090  C CG1  . ILE A 1 129 ? 9.400   8.582   5.893   1.00 0.00 ? 521 ILE A CG1  1  
ATOM 2091  C CG2  . ILE A 1 129 ? 9.179   10.420  4.172   1.00 0.00 ? 521 ILE A CG2  1  
ATOM 2092  C CD1  . ILE A 1 129 ? 9.127   7.125   6.237   1.00 0.00 ? 521 ILE A CD1  1  
ATOM 2093  H H    . ILE A 1 129 ? 6.772   9.862   7.272   1.00 0.00 ? 521 ILE A H    1  
ATOM 2094  H HA   . ILE A 1 129 ? 6.546   10.054  4.415   1.00 0.00 ? 521 ILE A HA   1  
ATOM 2095  H HB   . ILE A 1 129 ? 8.448   8.474   3.958   1.00 0.00 ? 521 ILE A HB   1  
ATOM 2096  H HG12 . ILE A 1 129 ? 10.435  8.649   5.593   1.00 0.00 ? 521 ILE A HG12 1  
ATOM 2097  H HG13 . ILE A 1 129 ? 9.264   9.171   6.787   1.00 0.00 ? 521 ILE A HG13 1  
ATOM 2098  H HG21 . ILE A 1 129 ? 9.177   11.215  4.903   1.00 0.00 ? 521 ILE A HG21 1  
ATOM 2099  H HG22 . ILE A 1 129 ? 10.196  10.185  3.894   1.00 0.00 ? 521 ILE A HG22 1  
ATOM 2100  H HG23 . ILE A 1 129 ? 8.629   10.737  3.299   1.00 0.00 ? 521 ILE A HG23 1  
ATOM 2101  H HD11 . ILE A 1 129 ? 9.278   6.509   5.363   1.00 0.00 ? 521 ILE A HD11 1  
ATOM 2102  H HD12 . ILE A 1 129 ? 9.802   6.811   7.019   1.00 0.00 ? 521 ILE A HD12 1  
ATOM 2103  H HD13 . ILE A 1 129 ? 8.109   7.022   6.581   1.00 0.00 ? 521 ILE A HD13 1  
ATOM 2104  N N    . PHE A 1 130 ? 6.084   7.554   4.232   1.00 0.00 ? 522 PHE A N    1  
ATOM 2105  C CA   . PHE A 1 130 ? 5.314   6.379   4.202   1.00 0.00 ? 522 PHE A CA   1  
ATOM 2106  C C    . PHE A 1 130 ? 6.224   5.176   4.367   1.00 0.00 ? 522 PHE A C    1  
ATOM 2107  O O    . PHE A 1 130 ? 7.327   5.158   3.855   1.00 0.00 ? 522 PHE A O    1  
ATOM 2108  C CB   . PHE A 1 130 ? 4.530   6.337   2.918   1.00 0.00 ? 522 PHE A CB   1  
ATOM 2109  C CG   . PHE A 1 130 ? 3.487   7.420   2.785   1.00 0.00 ? 522 PHE A CG   1  
ATOM 2110  C CD1  . PHE A 1 130 ? 3.847   8.720   2.446   1.00 0.00 ? 522 PHE A CD1  1  
ATOM 2111  C CD2  . PHE A 1 130 ? 2.153   7.137   2.988   1.00 0.00 ? 522 PHE A CD2  1  
ATOM 2112  C CE1  . PHE A 1 130 ? 2.897   9.707   2.321   1.00 0.00 ? 522 PHE A CE1  1  
ATOM 2113  C CE2  . PHE A 1 130 ? 1.198   8.120   2.863   1.00 0.00 ? 522 PHE A CE2  1  
ATOM 2114  C CZ   . PHE A 1 130 ? 1.569   9.407   2.530   1.00 0.00 ? 522 PHE A CZ   1  
ATOM 2115  H H    . PHE A 1 130 ? 6.541   7.803   3.393   1.00 0.00 ? 522 PHE A H    1  
ATOM 2116  H HA   . PHE A 1 130 ? 4.625   6.413   5.032   1.00 0.00 ? 522 PHE A HA   1  
ATOM 2117  H HB2  . PHE A 1 130 ? 5.237   6.511   2.121   1.00 0.00 ? 522 PHE A HB2  1  
ATOM 2118  H HB3  . PHE A 1 130 ? 4.060   5.372   2.826   1.00 0.00 ? 522 PHE A HB3  1  
ATOM 2119  H HD1  . PHE A 1 130 ? 4.890   8.954   2.284   1.00 0.00 ? 522 PHE A HD1  1  
ATOM 2120  H HD2  . PHE A 1 130 ? 1.862   6.130   3.245   1.00 0.00 ? 522 PHE A HD2  1  
ATOM 2121  H HE1  . PHE A 1 130 ? 3.191   10.713  2.058   1.00 0.00 ? 522 PHE A HE1  1  
ATOM 2122  H HE2  . PHE A 1 130 ? 0.157   7.883   3.026   1.00 0.00 ? 522 PHE A HE2  1  
ATOM 2123  H HZ   . PHE A 1 130 ? 0.818   10.177  2.433   1.00 0.00 ? 522 PHE A HZ   1  
ATOM 2124  N N    . MET A 1 131 ? 5.788   4.226   5.121   1.00 0.00 ? 523 MET A N    1  
ATOM 2125  C CA   . MET A 1 131 ? 6.559   3.033   5.413   1.00 0.00 ? 523 MET A CA   1  
ATOM 2126  C C    . MET A 1 131 ? 5.704   1.831   5.117   1.00 0.00 ? 523 MET A C    1  
ATOM 2127  O O    . MET A 1 131 ? 4.507   1.974   4.928   1.00 0.00 ? 523 MET A O    1  
ATOM 2128  C CB   . MET A 1 131 ? 6.973   3.013   6.897   1.00 0.00 ? 523 MET A CB   1  
ATOM 2129  C CG   . MET A 1 131 ? 5.800   2.982   7.878   1.00 0.00 ? 523 MET A CG   1  
ATOM 2130  S SD   . MET A 1 131 ? 6.326   2.946   9.605   1.00 0.00 ? 523 MET A SD   1  
ATOM 2131  C CE   . MET A 1 131 ? 4.731   2.917   10.438  1.00 0.00 ? 523 MET A CE   1  
ATOM 2132  H H    . MET A 1 131 ? 4.872   4.278   5.481   1.00 0.00 ? 523 MET A H    1  
ATOM 2133  H HA   . MET A 1 131 ? 7.443   3.020   4.793   1.00 0.00 ? 523 MET A HA   1  
ATOM 2134  H HB2  . MET A 1 131 ? 7.577   2.136   7.078   1.00 0.00 ? 523 MET A HB2  1  
ATOM 2135  H HB3  . MET A 1 131 ? 7.560   3.894   7.102   1.00 0.00 ? 523 MET A HB3  1  
ATOM 2136  H HG2  . MET A 1 131 ? 5.195   3.862   7.721   1.00 0.00 ? 523 MET A HG2  1  
ATOM 2137  H HG3  . MET A 1 131 ? 5.207   2.103   7.676   1.00 0.00 ? 523 MET A HG3  1  
ATOM 2138  H HE1  . MET A 1 131 ? 4.165   3.796   10.168  1.00 0.00 ? 523 MET A HE1  1  
ATOM 2139  H HE2  . MET A 1 131 ? 4.186   2.033   10.141  1.00 0.00 ? 523 MET A HE2  1  
ATOM 2140  H HE3  . MET A 1 131 ? 4.883   2.905   11.507  1.00 0.00 ? 523 MET A HE3  1  
ATOM 2141  N N    . GLY A 1 132 ? 6.288   0.676   5.044   1.00 0.00 ? 524 GLY A N    1  
ATOM 2142  C CA   . GLY A 1 132 ? 5.498   -0.496  4.856   1.00 0.00 ? 524 GLY A CA   1  
ATOM 2143  C C    . GLY A 1 132 ? 6.320   -1.743  4.832   1.00 0.00 ? 524 GLY A C    1  
ATOM 2144  O O    . GLY A 1 132 ? 7.518   -1.694  4.596   1.00 0.00 ? 524 GLY A O    1  
ATOM 2145  H H    . GLY A 1 132 ? 7.268   0.593   5.061   1.00 0.00 ? 524 GLY A H    1  
ATOM 2146  H HA2  . GLY A 1 132 ? 4.783   -0.563  5.663   1.00 0.00 ? 524 GLY A HA2  1  
ATOM 2147  H HA3  . GLY A 1 132 ? 4.962   -0.413  3.922   1.00 0.00 ? 524 GLY A HA3  1  
ATOM 2148  N N    . LEU A 1 133 ? 5.719   -2.828  5.190   1.00 0.00 ? 525 LEU A N    1  
ATOM 2149  C CA   . LEU A 1 133 ? 6.351   -4.120  5.114   1.00 0.00 ? 525 LEU A CA   1  
ATOM 2150  C C    . LEU A 1 133 ? 5.638   -4.998  4.111   1.00 0.00 ? 525 LEU A C    1  
ATOM 2151  O O    . LEU A 1 133 ? 4.400   -4.922  3.979   1.00 0.00 ? 525 LEU A O    1  
ATOM 2152  C CB   . LEU A 1 133 ? 6.499   -4.813  6.483   1.00 0.00 ? 525 LEU A CB   1  
ATOM 2153  C CG   . LEU A 1 133 ? 7.610   -4.284  7.417   1.00 0.00 ? 525 LEU A CG   1  
ATOM 2154  C CD1  . LEU A 1 133 ? 7.284   -2.908  7.975   1.00 0.00 ? 525 LEU A CD1  1  
ATOM 2155  C CD2  . LEU A 1 133 ? 7.885   -5.260  8.548   1.00 0.00 ? 525 LEU A CD2  1  
ATOM 2156  H H    . LEU A 1 133 ? 4.787   -2.782  5.488   1.00 0.00 ? 525 LEU A H    1  
ATOM 2157  H HA   . LEU A 1 133 ? 7.336   -3.935  4.711   1.00 0.00 ? 525 LEU A HA   1  
ATOM 2158  H HB2  . LEU A 1 133 ? 5.558   -4.701  7.000   1.00 0.00 ? 525 LEU A HB2  1  
ATOM 2159  H HB3  . LEU A 1 133 ? 6.671   -5.864  6.314   1.00 0.00 ? 525 LEU A HB3  1  
ATOM 2160  H HG   . LEU A 1 133 ? 8.509   -4.212  6.815   1.00 0.00 ? 525 LEU A HG   1  
ATOM 2161  H HD11 . LEU A 1 133 ? 6.340   -2.953  8.498   1.00 0.00 ? 525 LEU A HD11 1  
ATOM 2162  H HD12 . LEU A 1 133 ? 8.058   -2.613  8.669   1.00 0.00 ? 525 LEU A HD12 1  
ATOM 2163  H HD13 . LEU A 1 133 ? 7.218   -2.192  7.169   1.00 0.00 ? 525 LEU A HD13 1  
ATOM 2164  H HD21 . LEU A 1 133 ? 6.975   -5.459  9.094   1.00 0.00 ? 525 LEU A HD21 1  
ATOM 2165  H HD22 . LEU A 1 133 ? 8.276   -6.180  8.141   1.00 0.00 ? 525 LEU A HD22 1  
ATOM 2166  H HD23 . LEU A 1 133 ? 8.621   -4.834  9.212   1.00 0.00 ? 525 LEU A HD23 1  
ATOM 2167  N N    . ILE A 1 134 ? 6.394   -5.752  3.347   1.00 0.00 ? 526 ILE A N    1  
ATOM 2168  C CA   . ILE A 1 134 ? 5.806   -6.681  2.391   1.00 0.00 ? 526 ILE A CA   1  
ATOM 2169  C C    . ILE A 1 134 ? 5.995   -8.145  2.823   1.00 0.00 ? 526 ILE A C    1  
ATOM 2170  O O    . ILE A 1 134 ? 7.128   -8.672  2.826   1.00 0.00 ? 526 ILE A O    1  
ATOM 2171  C CB   . ILE A 1 134 ? 6.354   -6.438  0.931   1.00 0.00 ? 526 ILE A CB   1  
ATOM 2172  C CG1  . ILE A 1 134 ? 6.037   -7.608  -0.021  1.00 0.00 ? 526 ILE A CG1  1  
ATOM 2173  C CG2  . ILE A 1 134 ? 7.832   -6.112  0.925   1.00 0.00 ? 526 ILE A CG2  1  
ATOM 2174  C CD1  . ILE A 1 134 ? 6.464   -7.368  -1.450  1.00 0.00 ? 526 ILE A CD1  1  
ATOM 2175  H H    . ILE A 1 134 ? 7.371   -5.670  3.424   1.00 0.00 ? 526 ILE A H    1  
ATOM 2176  H HA   . ILE A 1 134 ? 4.746   -6.480  2.389   1.00 0.00 ? 526 ILE A HA   1  
ATOM 2177  H HB   . ILE A 1 134 ? 5.847   -5.558  0.563   1.00 0.00 ? 526 ILE A HB   1  
ATOM 2178  H HG12 . ILE A 1 134 ? 6.543   -8.496  0.329   1.00 0.00 ? 526 ILE A HG12 1  
ATOM 2179  H HG13 . ILE A 1 134 ? 4.971   -7.785  -0.014  1.00 0.00 ? 526 ILE A HG13 1  
ATOM 2180  H HG21 . ILE A 1 134 ? 8.357   -6.936  1.382   1.00 0.00 ? 526 ILE A HG21 1  
ATOM 2181  H HG22 . ILE A 1 134 ? 8.175   -5.974  -0.090  1.00 0.00 ? 526 ILE A HG22 1  
ATOM 2182  H HG23 . ILE A 1 134 ? 8.011   -5.213  1.496   1.00 0.00 ? 526 ILE A HG23 1  
ATOM 2183  H HD11 . ILE A 1 134 ? 7.527   -7.180  -1.481  1.00 0.00 ? 526 ILE A HD11 1  
ATOM 2184  H HD12 . ILE A 1 134 ? 6.227   -8.234  -2.050  1.00 0.00 ? 526 ILE A HD12 1  
ATOM 2185  H HD13 . ILE A 1 134 ? 5.938   -6.506  -1.834  1.00 0.00 ? 526 ILE A HD13 1  
ATOM 2186  N N    . PRO A 1 135 ? 4.895   -8.795  3.257   1.00 0.00 ? 527 PRO A N    1  
ATOM 2187  C CA   . PRO A 1 135 ? 4.860   -10.222 3.536   1.00 0.00 ? 527 PRO A CA   1  
ATOM 2188  C C    . PRO A 1 135 ? 4.959   -11.078 2.266   1.00 0.00 ? 527 PRO A C    1  
ATOM 2189  O O    . PRO A 1 135 ? 4.342   -10.769 1.184   1.00 0.00 ? 527 PRO A O    1  
ATOM 2190  C CB   . PRO A 1 135 ? 3.500   -10.442 4.215   1.00 0.00 ? 527 PRO A CB   1  
ATOM 2191  C CG   . PRO A 1 135 ? 3.095   -9.095  4.675   1.00 0.00 ? 527 PRO A CG   1  
ATOM 2192  C CD   . PRO A 1 135 ? 3.628   -8.155  3.650   1.00 0.00 ? 527 PRO A CD   1  
ATOM 2193  H HA   . PRO A 1 135 ? 5.651   -10.505 4.215   1.00 0.00 ? 527 PRO A HA   1  
ATOM 2194  H HB2  . PRO A 1 135 ? 2.801   -10.845 3.496   1.00 0.00 ? 527 PRO A HB2  1  
ATOM 2195  H HB3  . PRO A 1 135 ? 3.609   -11.129 5.041   1.00 0.00 ? 527 PRO A HB3  1  
ATOM 2196  H HG2  . PRO A 1 135 ? 2.017   -9.029  4.724   1.00 0.00 ? 527 PRO A HG2  1  
ATOM 2197  H HG3  . PRO A 1 135 ? 3.531   -8.885  5.641   1.00 0.00 ? 527 PRO A HG3  1  
ATOM 2198  H HD2  . PRO A 1 135 ? 2.952   -8.078  2.811   1.00 0.00 ? 527 PRO A HD2  1  
ATOM 2199  H HD3  . PRO A 1 135 ? 3.808   -7.186  4.093   1.00 0.00 ? 527 PRO A HD3  1  
ATOM 2200  N N    . TYR A 1 136 ? 5.718   -12.159 2.412   1.00 0.00 ? 528 TYR A N    1  
ATOM 2201  C CA   . TYR A 1 136 ? 5.993   -13.103 1.350   1.00 0.00 ? 528 TYR A CA   1  
ATOM 2202  C C    . TYR A 1 136 ? 4.744   -13.905 1.020   1.00 0.00 ? 528 TYR A C    1  
ATOM 2203  O O    . TYR A 1 136 ? 4.409   -14.118 -0.150  1.00 0.00 ? 528 TYR A O    1  
ATOM 2204  C CB   . TYR A 1 136 ? 7.069   -14.102 1.793   1.00 0.00 ? 528 TYR A CB   1  
ATOM 2205  C CG   . TYR A 1 136 ? 8.306   -13.512 2.427   1.00 0.00 ? 528 TYR A CG   1  
ATOM 2206  C CD1  . TYR A 1 136 ? 8.415   -13.438 3.809   1.00 0.00 ? 528 TYR A CD1  1  
ATOM 2207  C CD2  . TYR A 1 136 ? 9.373   -13.065 1.661   1.00 0.00 ? 528 TYR A CD2  1  
ATOM 2208  C CE1  . TYR A 1 136 ? 9.544   -12.939 4.409   1.00 0.00 ? 528 TYR A CE1  1  
ATOM 2209  C CE2  . TYR A 1 136 ? 10.509  -12.555 2.263   1.00 0.00 ? 528 TYR A CE2  1  
ATOM 2210  C CZ   . TYR A 1 136 ? 10.585  -12.500 3.640   1.00 0.00 ? 528 TYR A CZ   1  
ATOM 2211  O OH   . TYR A 1 136 ? 11.711  -12.015 4.248   1.00 0.00 ? 528 TYR A OH   1  
ATOM 2212  H H    . TYR A 1 136 ? 6.120   -12.313 3.292   1.00 0.00 ? 528 TYR A H    1  
ATOM 2213  H HA   . TYR A 1 136 ? 6.350   -12.575 0.481   1.00 0.00 ? 528 TYR A HA   1  
ATOM 2214  H HB2  . TYR A 1 136 ? 6.636   -14.778 2.515   1.00 0.00 ? 528 TYR A HB2  1  
ATOM 2215  H HB3  . TYR A 1 136 ? 7.380   -14.675 0.933   1.00 0.00 ? 528 TYR A HB3  1  
ATOM 2216  H HD1  . TYR A 1 136 ? 7.592   -13.781 4.418   1.00 0.00 ? 528 TYR A HD1  1  
ATOM 2217  H HD2  . TYR A 1 136 ? 9.308   -13.111 0.584   1.00 0.00 ? 528 TYR A HD2  1  
ATOM 2218  H HE1  . TYR A 1 136 ? 9.610   -12.887 5.486   1.00 0.00 ? 528 TYR A HE1  1  
ATOM 2219  H HE2  . TYR A 1 136 ? 11.335  -12.203 1.663   1.00 0.00 ? 528 TYR A HE2  1  
ATOM 2220  H HH   . TYR A 1 136 ? 11.945  -12.651 4.938   1.00 0.00 ? 528 TYR A HH   1  
ATOM 2221  N N    . ASP A 1 137 ? 4.068   -14.358 2.047   1.00 0.00 ? 529 ASP A N    1  
ATOM 2222  C CA   . ASP A 1 137 ? 2.918   -15.205 1.864   1.00 0.00 ? 529 ASP A CA   1  
ATOM 2223  C C    . ASP A 1 137 ? 1.687   -14.380 1.635   1.00 0.00 ? 529 ASP A C    1  
ATOM 2224  O O    . ASP A 1 137 ? 1.135   -13.774 2.564   1.00 0.00 ? 529 ASP A O    1  
ATOM 2225  C CB   . ASP A 1 137 ? 2.710   -16.140 3.046   1.00 0.00 ? 529 ASP A CB   1  
ATOM 2226  C CG   . ASP A 1 137 ? 1.624   -17.156 2.773   1.00 0.00 ? 529 ASP A CG   1  
ATOM 2227  O OD1  . ASP A 1 137 ? 0.444   -16.867 2.991   1.00 0.00 ? 529 ASP A OD1  1  
ATOM 2228  O OD2  . ASP A 1 137 ? 1.955   -18.280 2.323   1.00 0.00 ? 529 ASP A OD2  1  
ATOM 2229  H H    . ASP A 1 137 ? 4.338   -14.109 2.953   1.00 0.00 ? 529 ASP A H    1  
ATOM 2230  H HA   . ASP A 1 137 ? 3.098   -15.800 0.981   1.00 0.00 ? 529 ASP A HA   1  
ATOM 2231  H HB2  . ASP A 1 137 ? 3.631   -16.668 3.246   1.00 0.00 ? 529 ASP A HB2  1  
ATOM 2232  H HB3  . ASP A 1 137 ? 2.432   -15.561 3.914   1.00 0.00 ? 529 ASP A HB3  1  
ATOM 2233  N N    . GLN A 1 138 ? 1.300   -14.301 0.399   1.00 0.00 ? 530 GLN A N    1  
ATOM 2234  C CA   . GLN A 1 138 ? 0.128   -13.569 0.019   1.00 0.00 ? 530 GLN A CA   1  
ATOM 2235  C C    . GLN A 1 138 ? -1.149  -14.221 0.547   1.00 0.00 ? 530 GLN A C    1  
ATOM 2236  O O    . GLN A 1 138 ? -2.064  -13.532 0.923   1.00 0.00 ? 530 GLN A O    1  
ATOM 2237  C CB   . GLN A 1 138 ? 0.103   -13.283 -1.514  1.00 0.00 ? 530 GLN A CB   1  
ATOM 2238  C CG   . GLN A 1 138 ? 0.243   -14.510 -2.419  1.00 0.00 ? 530 GLN A CG   1  
ATOM 2239  C CD   . GLN A 1 138 ? -1.020  -15.354 -2.529  1.00 0.00 ? 530 GLN A CD   1  
ATOM 2240  O OE1  . GLN A 1 138 ? -0.947  -16.560 -2.648  1.00 0.00 ? 530 GLN A OE1  1  
ATOM 2241  N NE2  . GLN A 1 138 ? -2.162  -14.727 -2.602  1.00 0.00 ? 530 GLN A NE2  1  
ATOM 2242  H H    . GLN A 1 138 ? 1.837   -14.762 -0.279  1.00 0.00 ? 530 GLN A H    1  
ATOM 2243  H HA   . GLN A 1 138 ? 0.213   -12.623 0.530   1.00 0.00 ? 530 GLN A HA   1  
ATOM 2244  H HB2  . GLN A 1 138 ? -0.834  -12.803 -1.753  1.00 0.00 ? 530 GLN A HB2  1  
ATOM 2245  H HB3  . GLN A 1 138 ? 0.905   -12.597 -1.744  1.00 0.00 ? 530 GLN A HB3  1  
ATOM 2246  H HG2  . GLN A 1 138 ? 0.512   -14.165 -3.405  1.00 0.00 ? 530 GLN A HG2  1  
ATOM 2247  H HG3  . GLN A 1 138 ? 1.042   -15.125 -2.033  1.00 0.00 ? 530 GLN A HG3  1  
ATOM 2248  H HE21 . GLN A 1 138 ? -2.189  -13.741 -2.605  1.00 0.00 ? 530 GLN A HE21 1  
ATOM 2249  H HE22 . GLN A 1 138 ? -2.986  -15.254 -2.654  1.00 0.00 ? 530 GLN A HE22 1  
ATOM 2250  N N    . SER A 1 139 ? -1.150  -15.541 0.658   1.00 0.00 ? 531 SER A N    1  
ATOM 2251  C CA   . SER A 1 139 ? -2.337  -16.297 1.036   1.00 0.00 ? 531 SER A CA   1  
ATOM 2252  C C    . SER A 1 139 ? -2.878  -15.886 2.409   1.00 0.00 ? 531 SER A C    1  
ATOM 2253  O O    . SER A 1 139 ? -4.063  -15.586 2.548   1.00 0.00 ? 531 SER A O    1  
ATOM 2254  C CB   . SER A 1 139 ? -1.989  -17.779 1.042   1.00 0.00 ? 531 SER A CB   1  
ATOM 2255  O OG   . SER A 1 139 ? -1.410  -18.163 -0.199  1.00 0.00 ? 531 SER A OG   1  
ATOM 2256  H H    . SER A 1 139 ? -0.328  -16.049 0.493   1.00 0.00 ? 531 SER A H    1  
ATOM 2257  H HA   . SER A 1 139 ? -3.100  -16.133 0.290   1.00 0.00 ? 531 SER A HA   1  
ATOM 2258  H HB2  . SER A 1 139 ? -1.275  -17.965 1.831   1.00 0.00 ? 531 SER A HB2  1  
ATOM 2259  H HB3  . SER A 1 139 ? -2.879  -18.364 1.216   1.00 0.00 ? 531 SER A HB3  1  
ATOM 2260  H HG   . SER A 1 139 ? -2.150  -18.408 -0.767  1.00 0.00 ? 531 SER A HG   1  
ATOM 2261  N N    . GLY A 1 140 ? -2.003  -15.809 3.387   1.00 0.00 ? 532 GLY A N    1  
ATOM 2262  C CA   . GLY A 1 140 ? -2.419  -15.468 4.720   1.00 0.00 ? 532 GLY A CA   1  
ATOM 2263  C C    . GLY A 1 140 ? -2.737  -14.009 4.858   1.00 0.00 ? 532 GLY A C    1  
ATOM 2264  O O    . GLY A 1 140 ? -3.732  -13.633 5.492   1.00 0.00 ? 532 GLY A O    1  
ATOM 2265  H H    . GLY A 1 140 ? -1.056  -16.019 3.198   1.00 0.00 ? 532 GLY A H    1  
ATOM 2266  H HA2  . GLY A 1 140 ? -3.302  -16.040 4.962   1.00 0.00 ? 532 GLY A HA2  1  
ATOM 2267  H HA3  . GLY A 1 140 ? -1.632  -15.724 5.414   1.00 0.00 ? 532 GLY A HA3  1  
ATOM 2268  N N    . PHE A 1 141 ? -1.928  -13.179 4.234   1.00 0.00 ? 533 PHE A N    1  
ATOM 2269  C CA   . PHE A 1 141 ? -2.096  -11.752 4.356   1.00 0.00 ? 533 PHE A CA   1  
ATOM 2270  C C    . PHE A 1 141 ? -3.353  -11.292 3.617   1.00 0.00 ? 533 PHE A C    1  
ATOM 2271  O O    . PHE A 1 141 ? -4.163  -10.557 4.178   1.00 0.00 ? 533 PHE A O    1  
ATOM 2272  C CB   . PHE A 1 141 ? -0.858  -11.011 3.868   1.00 0.00 ? 533 PHE A CB   1  
ATOM 2273  C CG   . PHE A 1 141 ? -0.813  -9.570  4.293   1.00 0.00 ? 533 PHE A CG   1  
ATOM 2274  C CD1  . PHE A 1 141 ? -1.318  -8.563  3.489   1.00 0.00 ? 533 PHE A CD1  1  
ATOM 2275  C CD2  . PHE A 1 141 ? -0.254  -9.229  5.508   1.00 0.00 ? 533 PHE A CD2  1  
ATOM 2276  C CE1  . PHE A 1 141 ? -1.263  -7.250  3.892   1.00 0.00 ? 533 PHE A CE1  1  
ATOM 2277  C CE2  . PHE A 1 141 ? -0.199  -7.921  5.917   1.00 0.00 ? 533 PHE A CE2  1  
ATOM 2278  C CZ   . PHE A 1 141 ? -0.703  -6.929  5.111   1.00 0.00 ? 533 PHE A CZ   1  
ATOM 2279  H H    . PHE A 1 141 ? -1.210  -13.550 3.678   1.00 0.00 ? 533 PHE A H    1  
ATOM 2280  H HA   . PHE A 1 141 ? -2.236  -11.543 5.407   1.00 0.00 ? 533 PHE A HA   1  
ATOM 2281  H HB2  . PHE A 1 141 ? 0.022   -11.502 4.257   1.00 0.00 ? 533 PHE A HB2  1  
ATOM 2282  H HB3  . PHE A 1 141 ? -0.829  -11.042 2.788   1.00 0.00 ? 533 PHE A HB3  1  
ATOM 2283  H HD1  . PHE A 1 141 ? -1.763  -8.817  2.537   1.00 0.00 ? 533 PHE A HD1  1  
ATOM 2284  H HD2  . PHE A 1 141 ? 0.144   -10.006 6.143   1.00 0.00 ? 533 PHE A HD2  1  
ATOM 2285  H HE1  . PHE A 1 141 ? -1.662  -6.475  3.253   1.00 0.00 ? 533 PHE A HE1  1  
ATOM 2286  H HE2  . PHE A 1 141 ? 0.238   -7.674  6.873   1.00 0.00 ? 533 PHE A HE2  1  
ATOM 2287  H HZ   . PHE A 1 141 ? -0.657  -5.901  5.436   1.00 0.00 ? 533 PHE A HZ   1  
ATOM 2288  N N    . VAL A 1 142 ? -3.533  -11.764 2.378   1.00 0.00 ? 534 VAL A N    1  
ATOM 2289  C CA   . VAL A 1 142 ? -4.711  -11.422 1.585   1.00 0.00 ? 534 VAL A CA   1  
ATOM 2290  C C    . VAL A 1 142 ? -5.965  -11.930 2.288   1.00 0.00 ? 534 VAL A C    1  
ATOM 2291  O O    . VAL A 1 142 ? -6.966  -11.248 2.324   1.00 0.00 ? 534 VAL A O    1  
ATOM 2292  C CB   . VAL A 1 142 ? -4.641  -11.984 0.122   1.00 0.00 ? 534 VAL A CB   1  
ATOM 2293  C CG1  . VAL A 1 142 ? -5.942  -11.727 -0.636  1.00 0.00 ? 534 VAL A CG1  1  
ATOM 2294  C CG2  . VAL A 1 142 ? -3.493  -11.335 -0.628  1.00 0.00 ? 534 VAL A CG2  1  
ATOM 2295  H H    . VAL A 1 142 ? -2.869  -12.373 1.982   1.00 0.00 ? 534 VAL A H    1  
ATOM 2296  H HA   . VAL A 1 142 ? -4.747  -10.340 1.543   1.00 0.00 ? 534 VAL A HA   1  
ATOM 2297  H HB   . VAL A 1 142 ? -4.461  -13.049 0.163   1.00 0.00 ? 534 VAL A HB   1  
ATOM 2298  H HG11 . VAL A 1 142 ? -6.124  -10.664 -0.680  1.00 0.00 ? 534 VAL A HG11 1  
ATOM 2299  H HG12 . VAL A 1 142 ? -5.858  -12.117 -1.639  1.00 0.00 ? 534 VAL A HG12 1  
ATOM 2300  H HG13 . VAL A 1 142 ? -6.760  -12.213 -0.125  1.00 0.00 ? 534 VAL A HG13 1  
ATOM 2301  H HG21 . VAL A 1 142 ? -2.567  -11.546 -0.113  1.00 0.00 ? 534 VAL A HG21 1  
ATOM 2302  H HG22 . VAL A 1 142 ? -3.448  -11.726 -1.634  1.00 0.00 ? 534 VAL A HG22 1  
ATOM 2303  H HG23 . VAL A 1 142 ? -3.647  -10.266 -0.662  1.00 0.00 ? 534 VAL A HG23 1  
ATOM 2304  N N    . ASN A 1 143 ? -5.874  -13.121 2.884   1.00 0.00 ? 535 ASN A N    1  
ATOM 2305  C CA   . ASN A 1 143 ? -6.986  -13.708 3.652   1.00 0.00 ? 535 ASN A CA   1  
ATOM 2306  C C    . ASN A 1 143 ? -7.406  -12.770 4.778   1.00 0.00 ? 535 ASN A C    1  
ATOM 2307  O O    . ASN A 1 143 ? -8.598  -12.504 4.965   1.00 0.00 ? 535 ASN A O    1  
ATOM 2308  C CB   . ASN A 1 143 ? -6.582  -15.072 4.236   1.00 0.00 ? 535 ASN A CB   1  
ATOM 2309  C CG   . ASN A 1 143 ? -7.654  -15.701 5.110   1.00 0.00 ? 535 ASN A CG   1  
ATOM 2310  O OD1  . ASN A 1 143 ? -7.698  -15.485 6.325   1.00 0.00 ? 535 ASN A OD1  1  
ATOM 2311  N ND2  . ASN A 1 143 ? -8.503  -16.497 4.518   1.00 0.00 ? 535 ASN A ND2  1  
ATOM 2312  H H    . ASN A 1 143 ? -5.040  -13.632 2.793   1.00 0.00 ? 535 ASN A H    1  
ATOM 2313  H HA   . ASN A 1 143 ? -7.820  -13.843 2.980   1.00 0.00 ? 535 ASN A HA   1  
ATOM 2314  H HB2  . ASN A 1 143 ? -6.370  -15.752 3.424   1.00 0.00 ? 535 ASN A HB2  1  
ATOM 2315  H HB3  . ASN A 1 143 ? -5.687  -14.945 4.828   1.00 0.00 ? 535 ASN A HB3  1  
ATOM 2316  H HD21 . ASN A 1 143 ? -8.394  -16.642 3.550   1.00 0.00 ? 535 ASN A HD21 1  
ATOM 2317  H HD22 . ASN A 1 143 ? -9.215  -16.923 5.039   1.00 0.00 ? 535 ASN A HD22 1  
ATOM 2318  N N    . GLY A 1 144 ? -6.422  -12.251 5.500   1.00 0.00 ? 536 GLY A N    1  
ATOM 2319  C CA   . GLY A 1 144 ? -6.694  -11.312 6.567   1.00 0.00 ? 536 GLY A CA   1  
ATOM 2320  C C    . GLY A 1 144 ? -7.296  -10.022 6.038   1.00 0.00 ? 536 GLY A C    1  
ATOM 2321  O O    . GLY A 1 144 ? -8.250  -9.492  6.606   1.00 0.00 ? 536 GLY A O    1  
ATOM 2322  H H    . GLY A 1 144 ? -5.497  -12.519 5.303   1.00 0.00 ? 536 GLY A H    1  
ATOM 2323  H HA2  . GLY A 1 144 ? -7.386  -11.765 7.262   1.00 0.00 ? 536 GLY A HA2  1  
ATOM 2324  H HA3  . GLY A 1 144 ? -5.774  -11.084 7.083   1.00 0.00 ? 536 GLY A HA3  1  
ATOM 2325  N N    . ILE A 1 145 ? -6.759  -9.540  4.932   1.00 0.00 ? 537 ILE A N    1  
ATOM 2326  C CA   . ILE A 1 145 ? -7.246  -8.324  4.303   1.00 0.00 ? 537 ILE A CA   1  
ATOM 2327  C C    . ILE A 1 145 ? -8.666  -8.523  3.748   1.00 0.00 ? 537 ILE A C    1  
ATOM 2328  O O    . ILE A 1 145 ? -9.485  -7.626  3.832   1.00 0.00 ? 537 ILE A O    1  
ATOM 2329  C CB   . ILE A 1 145 ? -6.266  -7.806  3.207   1.00 0.00 ? 537 ILE A CB   1  
ATOM 2330  C CG1  . ILE A 1 145 ? -4.892  -7.495  3.826   1.00 0.00 ? 537 ILE A CG1  1  
ATOM 2331  C CG2  . ILE A 1 145 ? -6.818  -6.573  2.489   1.00 0.00 ? 537 ILE A CG2  1  
ATOM 2332  C CD1  . ILE A 1 145 ? -4.909  -6.432  4.919   1.00 0.00 ? 537 ILE A CD1  1  
ATOM 2333  H H    . ILE A 1 145 ? -5.994  -10.015 4.534   1.00 0.00 ? 537 ILE A H    1  
ATOM 2334  H HA   . ILE A 1 145 ? -7.316  -7.581  5.084   1.00 0.00 ? 537 ILE A HA   1  
ATOM 2335  H HB   . ILE A 1 145 ? -6.139  -8.590  2.475   1.00 0.00 ? 537 ILE A HB   1  
ATOM 2336  H HG12 . ILE A 1 145 ? -4.494  -8.399  4.263   1.00 0.00 ? 537 ILE A HG12 1  
ATOM 2337  H HG13 . ILE A 1 145 ? -4.225  -7.160  3.046   1.00 0.00 ? 537 ILE A HG13 1  
ATOM 2338  H HG21 . ILE A 1 145 ? -6.990  -5.788  3.211   1.00 0.00 ? 537 ILE A HG21 1  
ATOM 2339  H HG22 . ILE A 1 145 ? -6.102  -6.234  1.756   1.00 0.00 ? 537 ILE A HG22 1  
ATOM 2340  H HG23 . ILE A 1 145 ? -7.745  -6.826  1.998   1.00 0.00 ? 537 ILE A HG23 1  
ATOM 2341  H HD11 . ILE A 1 145 ? -5.309  -5.512  4.520   1.00 0.00 ? 537 ILE A HD11 1  
ATOM 2342  H HD12 . ILE A 1 145 ? -5.518  -6.766  5.746   1.00 0.00 ? 537 ILE A HD12 1  
ATOM 2343  H HD13 . ILE A 1 145 ? -3.900  -6.262  5.264   1.00 0.00 ? 537 ILE A HD13 1  
ATOM 2344  N N    . ARG A 1 146 ? -8.954  -9.720  3.235   1.00 0.00 ? 538 ARG A N    1  
ATOM 2345  C CA   . ARG A 1 146 ? -10.300 -10.086 2.761   1.00 0.00 ? 538 ARG A CA   1  
ATOM 2346  C C    . ARG A 1 146 ? -11.312 -9.892  3.867   1.00 0.00 ? 538 ARG A C    1  
ATOM 2347  O O    . ARG A 1 146 ? -12.401 -9.368  3.635   1.00 0.00 ? 538 ARG A O    1  
ATOM 2348  C CB   . ARG A 1 146 ? -10.338 -11.542 2.311   1.00 0.00 ? 538 ARG A CB   1  
ATOM 2349  C CG   . ARG A 1 146 ? -9.757  -11.827 0.933   1.00 0.00 ? 538 ARG A CG   1  
ATOM 2350  C CD   . ARG A 1 146 ? -10.739 -11.505 -0.204  1.00 0.00 ? 538 ARG A CD   1  
ATOM 2351  N NE   . ARG A 1 146 ? -10.977 -10.067 -0.444  1.00 0.00 ? 538 ARG A NE   1  
ATOM 2352  C CZ   . ARG A 1 146 ? -12.201 -9.528  -0.644  1.00 0.00 ? 538 ARG A CZ   1  
ATOM 2353  N NH1  . ARG A 1 146 ? -13.294 -10.179 -0.235  1.00 0.00 ? 538 ARG A NH1  1  
ATOM 2354  N NH2  . ARG A 1 146 ? -12.331 -8.327  -1.207  1.00 0.00 ? 538 ARG A NH2  1  
ATOM 2355  H H    . ARG A 1 146 ? -8.219  -10.371 3.153   1.00 0.00 ? 538 ARG A H    1  
ATOM 2356  H HA   . ARG A 1 146 ? -10.543 -9.456  1.919   1.00 0.00 ? 538 ARG A HA   1  
ATOM 2357  H HB2  . ARG A 1 146 ? -9.787  -12.129 3.031   1.00 0.00 ? 538 ARG A HB2  1  
ATOM 2358  H HB3  . ARG A 1 146 ? -11.366 -11.875 2.320   1.00 0.00 ? 538 ARG A HB3  1  
ATOM 2359  H HG2  . ARG A 1 146 ? -8.867  -11.230 0.806   1.00 0.00 ? 538 ARG A HG2  1  
ATOM 2360  H HG3  . ARG A 1 146 ? -9.495  -12.871 0.890   1.00 0.00 ? 538 ARG A HG3  1  
ATOM 2361  H HD2  . ARG A 1 146 ? -10.350 -11.930 -1.117  1.00 0.00 ? 538 ARG A HD2  1  
ATOM 2362  H HD3  . ARG A 1 146 ? -11.681 -11.981 0.022   1.00 0.00 ? 538 ARG A HD3  1  
ATOM 2363  H HE   . ARG A 1 146 ? -10.149 -9.552  -0.591  1.00 0.00 ? 538 ARG A HE   1  
ATOM 2364  H HH11 . ARG A 1 146 ? -13.271 -11.067 0.234   1.00 0.00 ? 538 ARG A HH11 1  
ATOM 2365  H HH12 . ARG A 1 146 ? -14.213 -9.809  -0.399  1.00 0.00 ? 538 ARG A HH12 1  
ATOM 2366  H HH21 . ARG A 1 146 ? -11.542 -7.783  -1.512  1.00 0.00 ? 538 ARG A HH21 1  
ATOM 2367  H HH22 . ARG A 1 146 ? -13.238 -7.923  -1.357  1.00 0.00 ? 538 ARG A HH22 1  
ATOM 2368  N N    . GLN A 1 147 ? -10.923 -10.284 5.079   1.00 0.00 ? 539 GLN A N    1  
ATOM 2369  C CA   . GLN A 1 147 ? -11.762 -10.126 6.255   1.00 0.00 ? 539 GLN A CA   1  
ATOM 2370  C C    . GLN A 1 147 ? -12.010 -8.653  6.510   1.00 0.00 ? 539 GLN A C    1  
ATOM 2371  O O    . GLN A 1 147 ? -13.145 -8.225  6.720   1.00 0.00 ? 539 GLN A O    1  
ATOM 2372  C CB   . GLN A 1 147 ? -11.100 -10.741 7.488   1.00 0.00 ? 539 GLN A CB   1  
ATOM 2373  C CG   . GLN A 1 147 ? -10.827 -12.225 7.391   1.00 0.00 ? 539 GLN A CG   1  
ATOM 2374  C CD   . GLN A 1 147 ? -10.228 -12.767 8.662   1.00 0.00 ? 539 GLN A CD   1  
ATOM 2375  O OE1  . GLN A 1 147 ? -9.006  -12.809 8.835   1.00 0.00 ? 539 GLN A OE1  1  
ATOM 2376  N NE2  . GLN A 1 147 ? -11.072 -13.167 9.568   1.00 0.00 ? 539 GLN A NE2  1  
ATOM 2377  H H    . GLN A 1 147 ? -10.036 -10.694 5.175   1.00 0.00 ? 539 GLN A H    1  
ATOM 2378  H HA   . GLN A 1 147 ? -12.702 -10.625 6.071   1.00 0.00 ? 539 GLN A HA   1  
ATOM 2379  H HB2  . GLN A 1 147 ? -10.155 -10.243 7.649   1.00 0.00 ? 539 GLN A HB2  1  
ATOM 2380  H HB3  . GLN A 1 147 ? -11.733 -10.566 8.345   1.00 0.00 ? 539 GLN A HB3  1  
ATOM 2381  H HG2  . GLN A 1 147 ? -11.757 -12.741 7.207   1.00 0.00 ? 539 GLN A HG2  1  
ATOM 2382  H HG3  . GLN A 1 147 ? -10.140 -12.407 6.577   1.00 0.00 ? 539 GLN A HG3  1  
ATOM 2383  H HE21 . GLN A 1 147 ? -12.031 -13.095 9.374   1.00 0.00 ? 539 GLN A HE21 1  
ATOM 2384  H HE22 . GLN A 1 147 ? -10.737 -13.521 10.419  1.00 0.00 ? 539 GLN A HE22 1  
ATOM 2385  N N    . VAL A 1 148 ? -10.943 -7.880  6.434   1.00 0.00 ? 540 VAL A N    1  
ATOM 2386  C CA   . VAL A 1 148 ? -11.009 -6.452  6.647   1.00 0.00 ? 540 VAL A CA   1  
ATOM 2387  C C    . VAL A 1 148 ? -11.905 -5.796  5.589   1.00 0.00 ? 540 VAL A C    1  
ATOM 2388  O O    . VAL A 1 148 ? -12.771 -5.005  5.922   1.00 0.00 ? 540 VAL A O    1  
ATOM 2389  C CB   . VAL A 1 148 ? -9.594  -5.796  6.632   1.00 0.00 ? 540 VAL A CB   1  
ATOM 2390  C CG1  . VAL A 1 148 ? -9.678  -4.302  6.906   1.00 0.00 ? 540 VAL A CG1  1  
ATOM 2391  C CG2  . VAL A 1 148 ? -8.676  -6.461  7.647   1.00 0.00 ? 540 VAL A CG2  1  
ATOM 2392  H H    . VAL A 1 148 ? -10.080 -8.302  6.232   1.00 0.00 ? 540 VAL A H    1  
ATOM 2393  H HA   . VAL A 1 148 ? -11.457 -6.293  7.617   1.00 0.00 ? 540 VAL A HA   1  
ATOM 2394  H HB   . VAL A 1 148 ? -9.173  -5.935  5.648   1.00 0.00 ? 540 VAL A HB   1  
ATOM 2395  H HG11 . VAL A 1 148 ? -10.134 -4.138  7.871   1.00 0.00 ? 540 VAL A HG11 1  
ATOM 2396  H HG12 . VAL A 1 148 ? -8.683  -3.882  6.903   1.00 0.00 ? 540 VAL A HG12 1  
ATOM 2397  H HG13 . VAL A 1 148 ? -10.274 -3.829  6.139   1.00 0.00 ? 540 VAL A HG13 1  
ATOM 2398  H HG21 . VAL A 1 148 ? -9.100  -6.367  8.635   1.00 0.00 ? 540 VAL A HG21 1  
ATOM 2399  H HG22 . VAL A 1 148 ? -8.563  -7.507  7.402   1.00 0.00 ? 540 VAL A HG22 1  
ATOM 2400  H HG23 . VAL A 1 148 ? -7.709  -5.981  7.626   1.00 0.00 ? 540 VAL A HG23 1  
ATOM 2401  N N    . ILE A 1 149 ? -11.715 -6.174  4.328   1.00 0.00 ? 541 ILE A N    1  
ATOM 2402  C CA   . ILE A 1 149 ? -12.488 -5.616  3.219   1.00 0.00 ? 541 ILE A CA   1  
ATOM 2403  C C    . ILE A 1 149 ? -13.966 -5.995  3.322   1.00 0.00 ? 541 ILE A C    1  
ATOM 2404  O O    . ILE A 1 149 ? -14.827 -5.137  3.193   1.00 0.00 ? 541 ILE A O    1  
ATOM 2405  C CB   . ILE A 1 149 ? -11.950 -6.081  1.830   1.00 0.00 ? 541 ILE A CB   1  
ATOM 2406  C CG1  . ILE A 1 149 ? -10.470 -5.688  1.639   1.00 0.00 ? 541 ILE A CG1  1  
ATOM 2407  C CG2  . ILE A 1 149 ? -12.809 -5.502  0.692   1.00 0.00 ? 541 ILE A CG2  1  
ATOM 2408  C CD1  . ILE A 1 149 ? -9.866  -6.157  0.327   1.00 0.00 ? 541 ILE A CD1  1  
ATOM 2409  H H    . ILE A 1 149 ? -11.012 -6.840  4.145   1.00 0.00 ? 541 ILE A H    1  
ATOM 2410  H HA   . ILE A 1 149 ? -12.408 -4.541  3.274   1.00 0.00 ? 541 ILE A HA   1  
ATOM 2411  H HB   . ILE A 1 149 ? -12.038 -7.157  1.817   1.00 0.00 ? 541 ILE A HB   1  
ATOM 2412  H HG12 . ILE A 1 149 ? -10.350 -4.616  1.672   1.00 0.00 ? 541 ILE A HG12 1  
ATOM 2413  H HG13 . ILE A 1 149 ? -9.890  -6.128  2.438   1.00 0.00 ? 541 ILE A HG13 1  
ATOM 2414  H HG21 . ILE A 1 149 ? -13.829 -5.836  0.806   1.00 0.00 ? 541 ILE A HG21 1  
ATOM 2415  H HG22 . ILE A 1 149 ? -12.777 -4.424  0.731   1.00 0.00 ? 541 ILE A HG22 1  
ATOM 2416  H HG23 . ILE A 1 149 ? -12.422 -5.840  -0.258  1.00 0.00 ? 541 ILE A HG23 1  
ATOM 2417  H HD11 . ILE A 1 149 ? -10.424 -5.732  -0.494  1.00 0.00 ? 541 ILE A HD11 1  
ATOM 2418  H HD12 . ILE A 1 149 ? -8.837  -5.836  0.267   1.00 0.00 ? 541 ILE A HD12 1  
ATOM 2419  H HD13 . ILE A 1 149 ? -9.915  -7.234  0.272   1.00 0.00 ? 541 ILE A HD13 1  
ATOM 2420  N N    . THR A 1 150 ? -14.257 -7.259  3.608   1.00 0.00 ? 542 THR A N    1  
ATOM 2421  C CA   . THR A 1 150 ? -15.642 -7.694  3.679   1.00 0.00 ? 542 THR A CA   1  
ATOM 2422  C C    . THR A 1 150 ? -16.340 -7.031  4.881   1.00 0.00 ? 542 THR A C    1  
ATOM 2423  O O    . THR A 1 150 ? -17.505 -6.635  4.796   1.00 0.00 ? 542 THR A O    1  
ATOM 2424  C CB   . THR A 1 150 ? -15.800 -9.270  3.673   1.00 0.00 ? 542 THR A CB   1  
ATOM 2425  O OG1  . THR A 1 150 ? -17.177 -9.647  3.502   1.00 0.00 ? 542 THR A OG1  1  
ATOM 2426  C CG2  . THR A 1 150 ? -15.283 -9.903  4.953   1.00 0.00 ? 542 THR A CG2  1  
ATOM 2427  H H    . THR A 1 150 ? -13.529 -7.906  3.755   1.00 0.00 ? 542 THR A H    1  
ATOM 2428  H HA   . THR A 1 150 ? -16.115 -7.289  2.794   1.00 0.00 ? 542 THR A HA   1  
ATOM 2429  H HB   . THR A 1 150 ? -15.235 -9.656  2.836   1.00 0.00 ? 542 THR A HB   1  
ATOM 2430  H HG1  . THR A 1 150 ? -17.593 -9.613  4.376   1.00 0.00 ? 542 THR A HG1  1  
ATOM 2431  H HG21 . THR A 1 150 ? -14.238 -9.656  5.069   1.00 0.00 ? 542 THR A HG21 1  
ATOM 2432  H HG22 . THR A 1 150 ? -15.839 -9.517  5.794   1.00 0.00 ? 542 THR A HG22 1  
ATOM 2433  H HG23 . THR A 1 150 ? -15.400 -10.976 4.903   1.00 0.00 ? 542 THR A HG23 1  
ATOM 2434  N N    . ASN A 1 151 ? -15.597 -6.852  5.970   1.00 0.00 ? 543 ASN A N    1  
ATOM 2435  C CA   . ASN A 1 151 ? -16.118 -6.151  7.143   1.00 0.00 ? 543 ASN A CA   1  
ATOM 2436  C C    . ASN A 1 151 ? -16.333 -4.684  6.812   1.00 0.00 ? 543 ASN A C    1  
ATOM 2437  O O    . ASN A 1 151 ? -17.352 -4.095  7.164   1.00 0.00 ? 543 ASN A O    1  
ATOM 2438  C CB   . ASN A 1 151 ? -15.164 -6.288  8.347   1.00 0.00 ? 543 ASN A CB   1  
ATOM 2439  C CG   . ASN A 1 151 ? -15.598 -5.457  9.557   1.00 0.00 ? 543 ASN A CG   1  
ATOM 2440  O OD1  . ASN A 1 151 ? -16.368 -5.911  10.402  1.00 0.00 ? 543 ASN A OD1  1  
ATOM 2441  N ND2  . ASN A 1 151 ? -15.090 -4.251  9.658   1.00 0.00 ? 543 ASN A ND2  1  
ATOM 2442  H H    . ASN A 1 151 ? -14.679 -7.209  5.982   1.00 0.00 ? 543 ASN A H    1  
ATOM 2443  H HA   . ASN A 1 151 ? -17.072 -6.592  7.393   1.00 0.00 ? 543 ASN A HA   1  
ATOM 2444  H HB2  . ASN A 1 151 ? -15.120 -7.324  8.647   1.00 0.00 ? 543 ASN A HB2  1  
ATOM 2445  H HB3  . ASN A 1 151 ? -14.178 -5.967  8.048   1.00 0.00 ? 543 ASN A HB3  1  
ATOM 2446  H HD21 . ASN A 1 151 ? -14.467 -3.942  8.969   1.00 0.00 ? 543 ASN A HD21 1  
ATOM 2447  H HD22 . ASN A 1 151 ? -15.345 -3.693  10.427  1.00 0.00 ? 543 ASN A HD22 1  
ATOM 2448  N N    . LEU A 1 152 ? -15.375 -4.117  6.100   1.00 0.00 ? 544 LEU A N    1  
ATOM 2449  C CA   . LEU A 1 152 ? -15.391 -2.718  5.708   1.00 0.00 ? 544 LEU A CA   1  
ATOM 2450  C C    . LEU A 1 152 ? -16.556 -2.436  4.773   1.00 0.00 ? 544 LEU A C    1  
ATOM 2451  O O    . LEU A 1 152 ? -17.182 -1.404  4.874   1.00 0.00 ? 544 LEU A O    1  
ATOM 2452  C CB   . LEU A 1 152 ? -14.061 -2.339  5.048   1.00 0.00 ? 544 LEU A CB   1  
ATOM 2453  C CG   . LEU A 1 152 ? -13.861 -0.871  4.688   1.00 0.00 ? 544 LEU A CG   1  
ATOM 2454  C CD1  . LEU A 1 152 ? -13.897 0.007   5.935   1.00 0.00 ? 544 LEU A CD1  1  
ATOM 2455  C CD2  . LEU A 1 152 ? -12.552 -0.688  3.938   1.00 0.00 ? 544 LEU A CD2  1  
ATOM 2456  H H    . LEU A 1 152 ? -14.606 -4.665  5.823   1.00 0.00 ? 544 LEU A H    1  
ATOM 2457  H HA   . LEU A 1 152 ? -15.516 -2.129  6.605   1.00 0.00 ? 544 LEU A HA   1  
ATOM 2458  H HB2  . LEU A 1 152 ? -13.261 -2.626  5.714   1.00 0.00 ? 544 LEU A HB2  1  
ATOM 2459  H HB3  . LEU A 1 152 ? -13.971 -2.922  4.143   1.00 0.00 ? 544 LEU A HB3  1  
ATOM 2460  H HG   . LEU A 1 152 ? -14.667 -0.556  4.042   1.00 0.00 ? 544 LEU A HG   1  
ATOM 2461  H HD11 . LEU A 1 152 ? -13.132 -0.313  6.626   1.00 0.00 ? 544 LEU A HD11 1  
ATOM 2462  H HD12 . LEU A 1 152 ? -13.727 1.036   5.652   1.00 0.00 ? 544 LEU A HD12 1  
ATOM 2463  H HD13 . LEU A 1 152 ? -14.864 -0.078  6.409   1.00 0.00 ? 544 LEU A HD13 1  
ATOM 2464  H HD21 . LEU A 1 152 ? -11.733 -1.017  4.560   1.00 0.00 ? 544 LEU A HD21 1  
ATOM 2465  H HD22 . LEU A 1 152 ? -12.572 -1.269  3.028   1.00 0.00 ? 544 LEU A HD22 1  
ATOM 2466  H HD23 . LEU A 1 152 ? -12.418 0.356   3.695   1.00 0.00 ? 544 LEU A HD23 1  
ATOM 2467  N N    . GLU A 1 153 ? -16.834 -3.364  3.879   1.00 0.00 ? 545 GLU A N    1  
ATOM 2468  C CA   . GLU A 1 153 ? -17.969 -3.257  2.967   1.00 0.00 ? 545 GLU A CA   1  
ATOM 2469  C C    . GLU A 1 153 ? -19.287 -3.426  3.680   1.00 0.00 ? 545 GLU A C    1  
ATOM 2470  O O    . GLU A 1 153 ? -20.270 -2.752  3.359   1.00 0.00 ? 545 GLU A O    1  
ATOM 2471  C CB   . GLU A 1 153 ? -17.855 -4.262  1.838   1.00 0.00 ? 545 GLU A CB   1  
ATOM 2472  C CG   . GLU A 1 153 ? -16.945 -3.808  0.730   1.00 0.00 ? 545 GLU A CG   1  
ATOM 2473  C CD   . GLU A 1 153 ? -17.483 -2.564  0.052   1.00 0.00 ? 545 GLU A CD   1  
ATOM 2474  O OE1  . GLU A 1 153 ? -18.734 -2.412  -0.040  1.00 0.00 ? 545 GLU A OE1  1  
ATOM 2475  O OE2  . GLU A 1 153 ? -16.691 -1.760  -0.455  1.00 0.00 ? 545 GLU A OE2  1  
ATOM 2476  H H    . GLU A 1 153 ? -16.233 -4.139  3.804   1.00 0.00 ? 545 GLU A H    1  
ATOM 2477  H HA   . GLU A 1 153 ? -17.945 -2.266  2.539   1.00 0.00 ? 545 GLU A HA   1  
ATOM 2478  H HB2  . GLU A 1 153 ? -17.471 -5.191  2.235   1.00 0.00 ? 545 GLU A HB2  1  
ATOM 2479  H HB3  . GLU A 1 153 ? -18.837 -4.436  1.425   1.00 0.00 ? 545 GLU A HB3  1  
ATOM 2480  H HG2  . GLU A 1 153 ? -15.974 -3.586  1.148   1.00 0.00 ? 545 GLU A HG2  1  
ATOM 2481  H HG3  . GLU A 1 153 ? -16.854 -4.596  -0.002  1.00 0.00 ? 545 GLU A HG3  1  
ATOM 2482  N N    . HIS A 1 154 ? -19.315 -4.322  4.636   1.00 0.00 ? 546 HIS A N    1  
ATOM 2483  C CA   . HIS A 1 154 ? -20.505 -4.554  5.422   1.00 0.00 ? 546 HIS A CA   1  
ATOM 2484  C C    . HIS A 1 154 ? -20.812 -3.303  6.254   1.00 0.00 ? 546 HIS A C    1  
ATOM 2485  O O    . HIS A 1 154 ? -21.968 -2.893  6.397   1.00 0.00 ? 546 HIS A O    1  
ATOM 2486  C CB   . HIS A 1 154 ? -20.293 -5.779  6.316   1.00 0.00 ? 546 HIS A CB   1  
ATOM 2487  C CG   . HIS A 1 154 ? -21.497 -6.210  7.086   1.00 0.00 ? 546 HIS A CG   1  
ATOM 2488  N ND1  . HIS A 1 154 ? -22.461 -7.060  6.596   1.00 0.00 ? 546 HIS A ND1  1  
ATOM 2489  C CD2  . HIS A 1 154 ? -21.866 -5.914  8.342   1.00 0.00 ? 546 HIS A CD2  1  
ATOM 2490  C CE1  . HIS A 1 154 ? -23.367 -7.252  7.549   1.00 0.00 ? 546 HIS A CE1  1  
ATOM 2491  N NE2  . HIS A 1 154 ? -23.048 -6.574  8.643   1.00 0.00 ? 546 HIS A NE2  1  
ATOM 2492  H H    . HIS A 1 154 ? -18.515 -4.867  4.806   1.00 0.00 ? 546 HIS A H    1  
ATOM 2493  H HA   . HIS A 1 154 ? -21.327 -4.740  4.747   1.00 0.00 ? 546 HIS A HA   1  
ATOM 2494  H HB2  . HIS A 1 154 ? -19.977 -6.613  5.707   1.00 0.00 ? 546 HIS A HB2  1  
ATOM 2495  H HB3  . HIS A 1 154 ? -19.508 -5.554  7.023   1.00 0.00 ? 546 HIS A HB3  1  
ATOM 2496  H HD1  . HIS A 1 154 ? -22.484 -7.453  5.696   1.00 0.00 ? 546 HIS A HD1  1  
ATOM 2497  H HD2  . HIS A 1 154 ? -21.332 -5.263  9.018   1.00 0.00 ? 546 HIS A HD2  1  
ATOM 2498  H HE1  . HIS A 1 154 ? -24.243 -7.877  7.446   1.00 0.00 ? 546 HIS A HE1  1  
ATOM 2499  N N    . HIS A 1 155 ? -19.769 -2.699  6.767   1.00 0.00 ? 547 HIS A N    1  
ATOM 2500  C CA   . HIS A 1 155 ? -19.869 -1.484  7.543   1.00 0.00 ? 547 HIS A CA   1  
ATOM 2501  C C    . HIS A 1 155 ? -20.219 -0.314  6.594   1.00 0.00 ? 547 HIS A C    1  
ATOM 2502  O O    . HIS A 1 155 ? -21.259 0.315   6.734   1.00 0.00 ? 547 HIS A O    1  
ATOM 2503  C CB   . HIS A 1 155 ? -18.514 -1.240  8.247   1.00 0.00 ? 547 HIS A CB   1  
ATOM 2504  C CG   . HIS A 1 155 ? -18.512 -0.190  9.321   1.00 0.00 ? 547 HIS A CG   1  
ATOM 2505  N ND1  . HIS A 1 155 ? -18.144 -0.441  10.625  1.00 0.00 ? 547 HIS A ND1  1  
ATOM 2506  C CD2  . HIS A 1 155 ? -18.788 1.131   9.262   1.00 0.00 ? 547 HIS A CD2  1  
ATOM 2507  C CE1  . HIS A 1 155 ? -18.205 0.698   11.304  1.00 0.00 ? 547 HIS A CE1  1  
ATOM 2508  N NE2  . HIS A 1 155 ? -18.594 1.695   10.520  1.00 0.00 ? 547 HIS A NE2  1  
ATOM 2509  H H    . HIS A 1 155 ? -18.887 -3.111  6.626   1.00 0.00 ? 547 HIS A H    1  
ATOM 2510  H HA   . HIS A 1 155 ? -20.646 -1.602  8.284   1.00 0.00 ? 547 HIS A HA   1  
ATOM 2511  H HB2  . HIS A 1 155 ? -18.190 -2.163  8.703   1.00 0.00 ? 547 HIS A HB2  1  
ATOM 2512  H HB3  . HIS A 1 155 ? -17.788 -0.955  7.500   1.00 0.00 ? 547 HIS A HB3  1  
ATOM 2513  H HD1  . HIS A 1 155 ? -17.860 -1.304  11.000  1.00 0.00 ? 547 HIS A HD1  1  
ATOM 2514  H HD2  . HIS A 1 155 ? -19.120 1.666   8.384   1.00 0.00 ? 547 HIS A HD2  1  
ATOM 2515  H HE1  . HIS A 1 155 ? -17.968 0.798   12.352  1.00 0.00 ? 547 HIS A HE1  1  
ATOM 2516  N N    . HIS A 1 156 ? -19.347 -0.103  5.615   1.00 0.00 ? 548 HIS A N    1  
ATOM 2517  C CA   . HIS A 1 156 ? -19.421 0.941   4.584   1.00 0.00 ? 548 HIS A CA   1  
ATOM 2518  C C    . HIS A 1 156 ? -19.627 2.338   5.171   1.00 0.00 ? 548 HIS A C    1  
ATOM 2519  O O    . HIS A 1 156 ? -20.749 2.814   5.320   1.00 0.00 ? 548 HIS A O    1  
ATOM 2520  C CB   . HIS A 1 156 ? -20.460 0.624   3.485   1.00 0.00 ? 548 HIS A CB   1  
ATOM 2521  C CG   . HIS A 1 156 ? -20.356 1.510   2.258   1.00 0.00 ? 548 HIS A CG   1  
ATOM 2522  N ND1  . HIS A 1 156 ? -21.019 2.707   2.110   1.00 0.00 ? 548 HIS A ND1  1  
ATOM 2523  C CD2  . HIS A 1 156 ? -19.642 1.339   1.112   1.00 0.00 ? 548 HIS A CD2  1  
ATOM 2524  C CE1  . HIS A 1 156 ? -20.703 3.217   0.917   1.00 0.00 ? 548 HIS A CE1  1  
ATOM 2525  N NE2  . HIS A 1 156 ? -19.868 2.426   0.263   1.00 0.00 ? 548 HIS A NE2  1  
ATOM 2526  H H    . HIS A 1 156 ? -18.573 -0.709  5.547   1.00 0.00 ? 548 HIS A H    1  
ATOM 2527  H HA   . HIS A 1 156 ? -18.440 0.945   4.132   1.00 0.00 ? 548 HIS A HA   1  
ATOM 2528  H HB2  . HIS A 1 156 ? -20.333 -0.400  3.166   1.00 0.00 ? 548 HIS A HB2  1  
ATOM 2529  H HB3  . HIS A 1 156 ? -21.449 0.744   3.900   1.00 0.00 ? 548 HIS A HB3  1  
ATOM 2530  H HD1  . HIS A 1 156 ? -21.632 3.122   2.757   1.00 0.00 ? 548 HIS A HD1  1  
ATOM 2531  H HD2  . HIS A 1 156 ? -19.001 0.501   0.884   1.00 0.00 ? 548 HIS A HD2  1  
ATOM 2532  H HE1  . HIS A 1 156 ? -21.075 4.158   0.540   1.00 0.00 ? 548 HIS A HE1  1  
ATOM 2533  N N    . HIS A 1 157 ? -18.541 2.980   5.514   1.00 0.00 ? 549 HIS A N    1  
ATOM 2534  C CA   . HIS A 1 157 ? -18.593 4.326   6.071   1.00 0.00 ? 549 HIS A CA   1  
ATOM 2535  C C    . HIS A 1 157 ? -17.885 5.245   5.075   1.00 0.00 ? 549 HIS A C    1  
ATOM 2536  O O    . HIS A 1 157 ? -17.273 6.252   5.420   1.00 0.00 ? 549 HIS A O    1  
ATOM 2537  C CB   . HIS A 1 157 ? -17.911 4.336   7.464   1.00 0.00 ? 549 HIS A CB   1  
ATOM 2538  C CG   . HIS A 1 157 ? -18.173 5.571   8.305   1.00 0.00 ? 549 HIS A CG   1  
ATOM 2539  N ND1  . HIS A 1 157 ? -19.303 5.749   9.083   1.00 0.00 ? 549 HIS A ND1  1  
ATOM 2540  C CD2  . HIS A 1 157 ? -17.415 6.680   8.500   1.00 0.00 ? 549 HIS A CD2  1  
ATOM 2541  C CE1  . HIS A 1 157 ? -19.196 6.926   9.707   1.00 0.00 ? 549 HIS A CE1  1  
ATOM 2542  N NE2  . HIS A 1 157 ? -18.065 7.535   9.388   1.00 0.00 ? 549 HIS A NE2  1  
ATOM 2543  H H    . HIS A 1 157 ? -17.666 2.555   5.391   1.00 0.00 ? 549 HIS A H    1  
ATOM 2544  H HA   . HIS A 1 157 ? -19.630 4.618   6.155   1.00 0.00 ? 549 HIS A HA   1  
ATOM 2545  H HB2  . HIS A 1 157 ? -18.259 3.486   8.031   1.00 0.00 ? 549 HIS A HB2  1  
ATOM 2546  H HB3  . HIS A 1 157 ? -16.844 4.245   7.329   1.00 0.00 ? 549 HIS A HB3  1  
ATOM 2547  H HD1  . HIS A 1 157 ? -20.071 5.140   9.164   1.00 0.00 ? 549 HIS A HD1  1  
ATOM 2548  H HD2  . HIS A 1 157 ? -16.458 6.882   8.043   1.00 0.00 ? 549 HIS A HD2  1  
ATOM 2549  H HE1  . HIS A 1 157 ? -19.934 7.327   10.386  1.00 0.00 ? 549 HIS A HE1  1  
ATOM 2550  N N    . HIS A 1 158 ? -18.004 4.880   3.823   1.00 0.00 ? 550 HIS A N    1  
ATOM 2551  C CA   . HIS A 1 158 ? -17.372 5.602   2.741   1.00 0.00 ? 550 HIS A CA   1  
ATOM 2552  C C    . HIS A 1 158 ? -18.414 6.453   2.080   1.00 0.00 ? 550 HIS A C    1  
ATOM 2553  O O    . HIS A 1 158 ? -19.613 6.157   2.179   1.00 0.00 ? 550 HIS A O    1  
ATOM 2554  C CB   . HIS A 1 158 ? -16.793 4.637   1.692   1.00 0.00 ? 550 HIS A CB   1  
ATOM 2555  C CG   . HIS A 1 158 ? -15.883 3.590   2.246   1.00 0.00 ? 550 HIS A CG   1  
ATOM 2556  N ND1  . HIS A 1 158 ? -14.513 3.673   2.260   1.00 0.00 ? 550 HIS A ND1  1  
ATOM 2557  C CD2  . HIS A 1 158 ? -16.188 2.403   2.810   1.00 0.00 ? 550 HIS A CD2  1  
ATOM 2558  C CE1  . HIS A 1 158 ? -14.043 2.561   2.814   1.00 0.00 ? 550 HIS A CE1  1  
ATOM 2559  N NE2  . HIS A 1 158 ? -15.027 1.755   3.169   1.00 0.00 ? 550 HIS A NE2  1  
ATOM 2560  H H    . HIS A 1 158 ? -18.576 4.116   3.606   1.00 0.00 ? 550 HIS A H    1  
ATOM 2561  H HA   . HIS A 1 158 ? -16.581 6.221   3.138   1.00 0.00 ? 550 HIS A HA   1  
ATOM 2562  H HB2  . HIS A 1 158 ? -17.608 4.126   1.201   1.00 0.00 ? 550 HIS A HB2  1  
ATOM 2563  H HB3  . HIS A 1 158 ? -16.243 5.207   0.957   1.00 0.00 ? 550 HIS A HB3  1  
ATOM 2564  H HD1  . HIS A 1 158 ? -13.952 4.415   1.947   1.00 0.00 ? 550 HIS A HD1  1  
ATOM 2565  H HD2  . HIS A 1 158 ? -17.184 2.014   2.958   1.00 0.00 ? 550 HIS A HD2  1  
ATOM 2566  H HE1  . HIS A 1 158 ? -12.994 2.345   2.956   1.00 0.00 ? 550 HIS A HE1  1  
ATOM 2567  N N    . HIS A 1 159 ? -17.992 7.490   1.439   1.00 0.00 ? 551 HIS A N    1  
ATOM 2568  C CA   . HIS A 1 159 ? -18.894 8.370   0.744   1.00 0.00 ? 551 HIS A CA   1  
ATOM 2569  C C    . HIS A 1 159 ? -18.432 8.454   -0.689  1.00 0.00 ? 551 HIS A C    1  
ATOM 2570  O O    . HIS A 1 159 ? -18.811 7.591   -1.495  1.00 0.00 ? 551 HIS A O    1  
ATOM 2571  C CB   . HIS A 1 159 ? -18.911 9.772   1.409   1.00 0.00 ? 551 HIS A CB   1  
ATOM 2572  C CG   . HIS A 1 159 ? -19.317 9.749   2.861   1.00 0.00 ? 551 HIS A CG   1  
ATOM 2573  N ND1  . HIS A 1 159 ? -18.435 9.552   3.908   1.00 0.00 ? 551 HIS A ND1  1  
ATOM 2574  C CD2  . HIS A 1 159 ? -20.538 9.849   3.425   1.00 0.00 ? 551 HIS A CD2  1  
ATOM 2575  C CE1  . HIS A 1 159 ? -19.128 9.528   5.042   1.00 0.00 ? 551 HIS A CE1  1  
ATOM 2576  N NE2  . HIS A 1 159 ? -20.420 9.703   4.810   1.00 0.00 ? 551 HIS A NE2  1  
ATOM 2577  H H    . HIS A 1 159 ? -17.036 7.701   1.402   1.00 0.00 ? 551 HIS A H    1  
ATOM 2578  H HA   . HIS A 1 159 ? -19.884 7.938   0.779   1.00 0.00 ? 551 HIS A HA   1  
ATOM 2579  H HB2  . HIS A 1 159 ? -17.926 10.209  1.346   1.00 0.00 ? 551 HIS A HB2  1  
ATOM 2580  H HB3  . HIS A 1 159 ? -19.607 10.404  0.877   1.00 0.00 ? 551 HIS A HB3  1  
ATOM 2581  H HD1  . HIS A 1 159 ? -17.458 9.452   3.837   1.00 0.00 ? 551 HIS A HD1  1  
ATOM 2582  H HD2  . HIS A 1 159 ? -21.464 10.015  2.897   1.00 0.00 ? 551 HIS A HD2  1  
ATOM 2583  H HE1  . HIS A 1 159 ? -18.699 9.385   6.023   1.00 0.00 ? 551 HIS A HE1  1  
ATOM 2584  N N    . MET A 1 1   ? 27.850  -0.602  -1.833  1.00 0.00 ? 393 MET A N    2  
ATOM 2585  C CA   . MET A 1 1   ? 26.960  0.355   -2.479  1.00 0.00 ? 393 MET A CA   2  
ATOM 2586  C C    . MET A 1 1   ? 26.722  1.485   -1.517  1.00 0.00 ? 393 MET A C    2  
ATOM 2587  O O    . MET A 1 1   ? 26.972  1.333   -0.338  1.00 0.00 ? 393 MET A O    2  
ATOM 2588  C CB   . MET A 1 1   ? 25.618  -0.293  -2.862  1.00 0.00 ? 393 MET A CB   2  
ATOM 2589  C CG   . MET A 1 1   ? 25.728  -1.442  -3.850  1.00 0.00 ? 393 MET A CG   2  
ATOM 2590  S SD   . MET A 1 1   ? 26.554  -0.963  -5.375  1.00 0.00 ? 393 MET A SD   2  
ATOM 2591  C CE   . MET A 1 1   ? 26.525  -2.509  -6.277  1.00 0.00 ? 393 MET A CE   2  
ATOM 2592  H H1   . MET A 1 1   ? 27.435  -0.893  -0.925  1.00 0.00 ? 393 MET A H1   2  
ATOM 2593  H H2   . MET A 1 1   ? 28.043  -1.444  -2.405  1.00 0.00 ? 393 MET A H2   2  
ATOM 2594  H H3   . MET A 1 1   ? 28.748  -0.129  -1.607  1.00 0.00 ? 393 MET A H3   2  
ATOM 2595  H HA   . MET A 1 1   ? 27.448  0.743   -3.361  1.00 0.00 ? 393 MET A HA   2  
ATOM 2596  H HB2  . MET A 1 1   ? 25.153  -0.671  -1.964  1.00 0.00 ? 393 MET A HB2  2  
ATOM 2597  H HB3  . MET A 1 1   ? 24.980  0.466   -3.291  1.00 0.00 ? 393 MET A HB3  2  
ATOM 2598  H HG2  . MET A 1 1   ? 26.280  -2.248  -3.393  1.00 0.00 ? 393 MET A HG2  2  
ATOM 2599  H HG3  . MET A 1 1   ? 24.732  -1.783  -4.092  1.00 0.00 ? 393 MET A HG3  2  
ATOM 2600  H HE1  . MET A 1 1   ? 25.501  -2.823  -6.420  1.00 0.00 ? 393 MET A HE1  2  
ATOM 2601  H HE2  . MET A 1 1   ? 26.997  -2.374  -7.239  1.00 0.00 ? 393 MET A HE2  2  
ATOM 2602  H HE3  . MET A 1 1   ? 27.057  -3.263  -5.716  1.00 0.00 ? 393 MET A HE3  2  
ATOM 2603  N N    . SER A 1 2   ? 26.216  2.598   -1.996  1.00 0.00 ? 394 SER A N    2  
ATOM 2604  C CA   . SER A 1 2   ? 25.992  3.758   -1.149  1.00 0.00 ? 394 SER A CA   2  
ATOM 2605  C C    . SER A 1 2   ? 24.586  3.744   -0.524  1.00 0.00 ? 394 SER A C    2  
ATOM 2606  O O    . SER A 1 2   ? 24.117  4.747   0.016   1.00 0.00 ? 394 SER A O    2  
ATOM 2607  C CB   . SER A 1 2   ? 26.219  5.023   -1.961  1.00 0.00 ? 394 SER A CB   2  
ATOM 2608  O OG   . SER A 1 2   ? 27.531  5.022   -2.528  1.00 0.00 ? 394 SER A OG   2  
ATOM 2609  H H    . SER A 1 2   ? 25.976  2.667   -2.946  1.00 0.00 ? 394 SER A H    2  
ATOM 2610  H HA   . SER A 1 2   ? 26.719  3.724   -0.352  1.00 0.00 ? 394 SER A HA   2  
ATOM 2611  H HB2  . SER A 1 2   ? 25.491  5.074   -2.756  1.00 0.00 ? 394 SER A HB2  2  
ATOM 2612  H HB3  . SER A 1 2   ? 26.119  5.885   -1.319  1.00 0.00 ? 394 SER A HB3  2  
ATOM 2613  H HG   . SER A 1 2   ? 27.799  4.105   -2.654  1.00 0.00 ? 394 SER A HG   2  
ATOM 2614  N N    . VAL A 1 3   ? 23.932  2.607   -0.587  1.00 0.00 ? 395 VAL A N    2  
ATOM 2615  C CA   . VAL A 1 3   ? 22.633  2.447   0.016   1.00 0.00 ? 395 VAL A CA   2  
ATOM 2616  C C    . VAL A 1 3   ? 22.790  1.921   1.448   1.00 0.00 ? 395 VAL A C    2  
ATOM 2617  O O    . VAL A 1 3   ? 22.748  0.724   1.712   1.00 0.00 ? 395 VAL A O    2  
ATOM 2618  C CB   . VAL A 1 3   ? 21.665  1.569   -0.848  1.00 0.00 ? 395 VAL A CB   2  
ATOM 2619  C CG1  . VAL A 1 3   ? 21.315  2.302   -2.132  1.00 0.00 ? 395 VAL A CG1  2  
ATOM 2620  C CG2  . VAL A 1 3   ? 22.284  0.216   -1.200  1.00 0.00 ? 395 VAL A CG2  2  
ATOM 2621  H H    . VAL A 1 3   ? 24.356  1.843   -1.025  1.00 0.00 ? 395 VAL A H    2  
ATOM 2622  H HA   . VAL A 1 3   ? 22.227  3.446   0.097   1.00 0.00 ? 395 VAL A HA   2  
ATOM 2623  H HB   . VAL A 1 3   ? 20.763  1.406   -0.278  1.00 0.00 ? 395 VAL A HB   2  
ATOM 2624  H HG11 . VAL A 1 3   ? 20.852  3.247   -1.892  1.00 0.00 ? 395 VAL A HG11 2  
ATOM 2625  H HG12 . VAL A 1 3   ? 22.217  2.474   -2.701  1.00 0.00 ? 395 VAL A HG12 2  
ATOM 2626  H HG13 . VAL A 1 3   ? 20.635  1.701   -2.717  1.00 0.00 ? 395 VAL A HG13 2  
ATOM 2627  H HG21 . VAL A 1 3   ? 22.519  -0.317  -0.291  1.00 0.00 ? 395 VAL A HG21 2  
ATOM 2628  H HG22 . VAL A 1 3   ? 21.583  -0.361  -1.785  1.00 0.00 ? 395 VAL A HG22 2  
ATOM 2629  H HG23 . VAL A 1 3   ? 23.187  0.371   -1.771  1.00 0.00 ? 395 VAL A HG23 2  
ATOM 2630  N N    . SER A 1 4   ? 23.063  2.831   2.342   1.00 0.00 ? 396 SER A N    2  
ATOM 2631  C CA   . SER A 1 4   ? 23.350  2.484   3.711   1.00 0.00 ? 396 SER A CA   2  
ATOM 2632  C C    . SER A 1 4   ? 22.153  2.746   4.633   1.00 0.00 ? 396 SER A C    2  
ATOM 2633  O O    . SER A 1 4   ? 22.179  2.389   5.817   1.00 0.00 ? 396 SER A O    2  
ATOM 2634  C CB   . SER A 1 4   ? 24.569  3.285   4.174   1.00 0.00 ? 396 SER A CB   2  
ATOM 2635  O OG   . SER A 1 4   ? 25.657  3.125   3.256   1.00 0.00 ? 396 SER A OG   2  
ATOM 2636  H H    . SER A 1 4   ? 23.103  3.773   2.073   1.00 0.00 ? 396 SER A H    2  
ATOM 2637  H HA   . SER A 1 4   ? 23.605  1.437   3.746   1.00 0.00 ? 396 SER A HA   2  
ATOM 2638  H HB2  . SER A 1 4   ? 24.309  4.332   4.225   1.00 0.00 ? 396 SER A HB2  2  
ATOM 2639  H HB3  . SER A 1 4   ? 24.880  2.939   5.149   1.00 0.00 ? 396 SER A HB3  2  
ATOM 2640  H HG   . SER A 1 4   ? 26.383  3.683   3.561   1.00 0.00 ? 396 SER A HG   2  
ATOM 2641  N N    . ASN A 1 5   ? 21.124  3.376   4.107   1.00 0.00 ? 397 ASN A N    2  
ATOM 2642  C CA   . ASN A 1 5   ? 19.939  3.679   4.910   1.00 0.00 ? 397 ASN A CA   2  
ATOM 2643  C C    . ASN A 1 5   ? 18.711  3.242   4.176   1.00 0.00 ? 397 ASN A C    2  
ATOM 2644  O O    . ASN A 1 5   ? 17.886  2.491   4.701   1.00 0.00 ? 397 ASN A O    2  
ATOM 2645  C CB   . ASN A 1 5   ? 19.824  5.184   5.233   1.00 0.00 ? 397 ASN A CB   2  
ATOM 2646  C CG   . ASN A 1 5   ? 21.036  5.752   5.936   1.00 0.00 ? 397 ASN A CG   2  
ATOM 2647  O OD1  . ASN A 1 5   ? 21.957  6.257   5.292   1.00 0.00 ? 397 ASN A OD1  2  
ATOM 2648  N ND2  . ASN A 1 5   ? 21.064  5.672   7.242   1.00 0.00 ? 397 ASN A ND2  2  
ATOM 2649  H H    . ASN A 1 5   ? 21.163  3.629   3.162   1.00 0.00 ? 397 ASN A H    2  
ATOM 2650  H HA   . ASN A 1 5   ? 20.016  3.125   5.834   1.00 0.00 ? 397 ASN A HA   2  
ATOM 2651  H HB2  . ASN A 1 5   ? 19.688  5.731   4.311   1.00 0.00 ? 397 ASN A HB2  2  
ATOM 2652  H HB3  . ASN A 1 5   ? 18.958  5.341   5.860   1.00 0.00 ? 397 ASN A HB3  2  
ATOM 2653  H HD21 . ASN A 1 5   ? 20.312  5.251   7.712   1.00 0.00 ? 397 ASN A HD21 2  
ATOM 2654  H HD22 . ASN A 1 5   ? 21.850  6.027   7.710   1.00 0.00 ? 397 ASN A HD22 2  
ATOM 2655  N N    . LYS A 1 6   ? 18.591  3.716   2.959   1.00 0.00 ? 398 LYS A N    2  
ATOM 2656  C CA   . LYS A 1 6   ? 17.496  3.366   2.105   1.00 0.00 ? 398 LYS A CA   2  
ATOM 2657  C C    . LYS A 1 6   ? 18.015  2.889   0.766   1.00 0.00 ? 398 LYS A C    2  
ATOM 2658  O O    . LYS A 1 6   ? 18.934  3.492   0.187   1.00 0.00 ? 398 LYS A O    2  
ATOM 2659  C CB   . LYS A 1 6   ? 16.421  4.499   2.031   1.00 0.00 ? 398 LYS A CB   2  
ATOM 2660  C CG   . LYS A 1 6   ? 16.960  5.925   1.906   1.00 0.00 ? 398 LYS A CG   2  
ATOM 2661  C CD   . LYS A 1 6   ? 17.535  6.223   0.542   1.00 0.00 ? 398 LYS A CD   2  
ATOM 2662  C CE   . LYS A 1 6   ? 18.343  7.496   0.559   1.00 0.00 ? 398 LYS A CE   2  
ATOM 2663  N NZ   . LYS A 1 6   ? 17.550  8.698   0.933   1.00 0.00 ? 398 LYS A NZ   2  
ATOM 2664  H H    . LYS A 1 6   ? 19.278  4.313   2.597   1.00 0.00 ? 398 LYS A H    2  
ATOM 2665  H HA   . LYS A 1 6   ? 17.056  2.506   2.581   1.00 0.00 ? 398 LYS A HA   2  
ATOM 2666  H HB2  . LYS A 1 6   ? 15.791  4.316   1.173   1.00 0.00 ? 398 LYS A HB2  2  
ATOM 2667  H HB3  . LYS A 1 6   ? 15.809  4.445   2.919   1.00 0.00 ? 398 LYS A HB3  2  
ATOM 2668  H HG2  . LYS A 1 6   ? 16.158  6.622   2.096   1.00 0.00 ? 398 LYS A HG2  2  
ATOM 2669  H HG3  . LYS A 1 6   ? 17.730  6.060   2.651   1.00 0.00 ? 398 LYS A HG3  2  
ATOM 2670  H HD2  . LYS A 1 6   ? 18.179  5.405   0.253   1.00 0.00 ? 398 LYS A HD2  2  
ATOM 2671  H HD3  . LYS A 1 6   ? 16.728  6.320   -0.170  1.00 0.00 ? 398 LYS A HD3  2  
ATOM 2672  H HE2  . LYS A 1 6   ? 19.113  7.335   1.298   1.00 0.00 ? 398 LYS A HE2  2  
ATOM 2673  H HE3  . LYS A 1 6   ? 18.789  7.625   -0.415  1.00 0.00 ? 398 LYS A HE3  2  
ATOM 2674  H HZ1  . LYS A 1 6   ? 17.146  8.615   1.887   1.00 0.00 ? 398 LYS A HZ1  2  
ATOM 2675  H HZ2  . LYS A 1 6   ? 18.169  9.533   0.935   1.00 0.00 ? 398 LYS A HZ2  2  
ATOM 2676  H HZ3  . LYS A 1 6   ? 16.776  8.881   0.264   1.00 0.00 ? 398 LYS A HZ3  2  
ATOM 2677  N N    . LEU A 1 7   ? 17.488  1.787   0.315   1.00 0.00 ? 399 LEU A N    2  
ATOM 2678  C CA   . LEU A 1 7   ? 17.952  1.148   -0.897  1.00 0.00 ? 399 LEU A CA   2  
ATOM 2679  C C    . LEU A 1 7   ? 16.974  1.439   -2.024  1.00 0.00 ? 399 LEU A C    2  
ATOM 2680  O O    . LEU A 1 7   ? 15.816  1.091   -1.916  1.00 0.00 ? 399 LEU A O    2  
ATOM 2681  C CB   . LEU A 1 7   ? 18.058  -0.408  -0.689  1.00 0.00 ? 399 LEU A CB   2  
ATOM 2682  C CG   . LEU A 1 7   ? 19.034  -0.978  0.396   1.00 0.00 ? 399 LEU A CG   2  
ATOM 2683  C CD1  . LEU A 1 7   ? 18.657  -0.553  1.792   1.00 0.00 ? 399 LEU A CD1  2  
ATOM 2684  C CD2  . LEU A 1 7   ? 19.065  -2.490  0.336   1.00 0.00 ? 399 LEU A CD2  2  
ATOM 2685  H H    . LEU A 1 7   ? 16.761  1.355   0.817   1.00 0.00 ? 399 LEU A H    2  
ATOM 2686  H HA   . LEU A 1 7   ? 18.926  1.534   -1.152  1.00 0.00 ? 399 LEU A HA   2  
ATOM 2687  H HB2  . LEU A 1 7   ? 17.078  -0.766  -0.410  1.00 0.00 ? 399 LEU A HB2  2  
ATOM 2688  H HB3  . LEU A 1 7   ? 18.320  -0.851  -1.638  1.00 0.00 ? 399 LEU A HB3  2  
ATOM 2689  H HG   . LEU A 1 7   ? 20.040  -0.628  0.236   1.00 0.00 ? 399 LEU A HG   2  
ATOM 2690  H HD11 . LEU A 1 7   ? 18.672  0.526   1.852   1.00 0.00 ? 399 LEU A HD11 2  
ATOM 2691  H HD12 . LEU A 1 7   ? 17.664  -0.911  2.023   1.00 0.00 ? 399 LEU A HD12 2  
ATOM 2692  H HD13 . LEU A 1 7   ? 19.361  -0.963  2.501   1.00 0.00 ? 399 LEU A HD13 2  
ATOM 2693  H HD21 . LEU A 1 7   ? 19.410  -2.817  -0.633  1.00 0.00 ? 399 LEU A HD21 2  
ATOM 2694  H HD22 . LEU A 1 7   ? 19.729  -2.846  1.110   1.00 0.00 ? 399 LEU A HD22 2  
ATOM 2695  H HD23 . LEU A 1 7   ? 18.071  -2.864  0.528   1.00 0.00 ? 399 LEU A HD23 2  
ATOM 2696  N N    . LEU A 1 8   ? 17.427  2.107   -3.077  1.00 0.00 ? 400 LEU A N    2  
ATOM 2697  C CA   . LEU A 1 8   ? 16.580  2.370   -4.244  1.00 0.00 ? 400 LEU A CA   2  
ATOM 2698  C C    . LEU A 1 8   ? 16.239  1.041   -4.876  1.00 0.00 ? 400 LEU A C    2  
ATOM 2699  O O    . LEU A 1 8   ? 17.132  0.228   -5.153  1.00 0.00 ? 400 LEU A O    2  
ATOM 2700  C CB   . LEU A 1 8   ? 17.302  3.335   -5.247  1.00 0.00 ? 400 LEU A CB   2  
ATOM 2701  C CG   . LEU A 1 8   ? 16.514  3.875   -6.496  1.00 0.00 ? 400 LEU A CG   2  
ATOM 2702  C CD1  . LEU A 1 8   ? 16.259  2.807   -7.550  1.00 0.00 ? 400 LEU A CD1  2  
ATOM 2703  C CD2  . LEU A 1 8   ? 15.199  4.525   -6.083  1.00 0.00 ? 400 LEU A CD2  2  
ATOM 2704  H H    . LEU A 1 8   ? 18.341  2.458   -3.073  1.00 0.00 ? 400 LEU A H    2  
ATOM 2705  H HA   . LEU A 1 8   ? 15.664  2.822   -3.894  1.00 0.00 ? 400 LEU A HA   2  
ATOM 2706  H HB2  . LEU A 1 8   ? 17.629  4.199   -4.687  1.00 0.00 ? 400 LEU A HB2  2  
ATOM 2707  H HB3  . LEU A 1 8   ? 18.183  2.823   -5.608  1.00 0.00 ? 400 LEU A HB3  2  
ATOM 2708  H HG   . LEU A 1 8   ? 17.121  4.636   -6.968  1.00 0.00 ? 400 LEU A HG   2  
ATOM 2709  H HD11 . LEU A 1 8   ? 17.205  2.398   -7.870  1.00 0.00 ? 400 LEU A HD11 2  
ATOM 2710  H HD12 . LEU A 1 8   ? 15.656  2.018   -7.125  1.00 0.00 ? 400 LEU A HD12 2  
ATOM 2711  H HD13 . LEU A 1 8   ? 15.747  3.242   -8.395  1.00 0.00 ? 400 LEU A HD13 2  
ATOM 2712  H HD21 . LEU A 1 8   ? 15.395  5.342   -5.405  1.00 0.00 ? 400 LEU A HD21 2  
ATOM 2713  H HD22 . LEU A 1 8   ? 14.692  4.902   -6.958  1.00 0.00 ? 400 LEU A HD22 2  
ATOM 2714  H HD23 . LEU A 1 8   ? 14.574  3.792   -5.594  1.00 0.00 ? 400 LEU A HD23 2  
ATOM 2715  N N    . ALA A 1 9   ? 14.968  0.797   -5.062  1.00 0.00 ? 401 ALA A N    2  
ATOM 2716  C CA   . ALA A 1 9   ? 14.548  -0.465  -5.581  1.00 0.00 ? 401 ALA A CA   2  
ATOM 2717  C C    . ALA A 1 9   ? 13.544  -0.329  -6.707  1.00 0.00 ? 401 ALA A C    2  
ATOM 2718  O O    . ALA A 1 9   ? 13.675  -0.998  -7.746  1.00 0.00 ? 401 ALA A O    2  
ATOM 2719  C CB   . ALA A 1 9   ? 13.980  -1.297  -4.469  1.00 0.00 ? 401 ALA A CB   2  
ATOM 2720  H H    . ALA A 1 9   ? 14.304  1.477   -4.823  1.00 0.00 ? 401 ALA A H    2  
ATOM 2721  H HA   . ALA A 1 9   ? 15.422  -0.981  -5.951  1.00 0.00 ? 401 ALA A HA   2  
ATOM 2722  H HB1  . ALA A 1 9   ? 13.090  -0.805  -4.102  1.00 0.00 ? 401 ALA A HB1  2  
ATOM 2723  H HB2  . ALA A 1 9   ? 13.741  -2.287  -4.826  1.00 0.00 ? 401 ALA A HB2  2  
ATOM 2724  H HB3  . ALA A 1 9   ? 14.708  -1.347  -3.672  1.00 0.00 ? 401 ALA A HB3  2  
ATOM 2725  N N    . TRP A 1 10  ? 12.543  0.517   -6.532  1.00 0.00 ? 402 TRP A N    2  
ATOM 2726  C CA   . TRP A 1 10  ? 11.519  0.614   -7.543  1.00 0.00 ? 402 TRP A CA   2  
ATOM 2727  C C    . TRP A 1 10  ? 10.957  2.024   -7.629  1.00 0.00 ? 402 TRP A C    2  
ATOM 2728  O O    . TRP A 1 10  ? 10.844  2.725   -6.635  1.00 0.00 ? 402 TRP A O    2  
ATOM 2729  C CB   . TRP A 1 10  ? 10.416  -0.434  -7.261  1.00 0.00 ? 402 TRP A CB   2  
ATOM 2730  C CG   . TRP A 1 10  ? 9.277   -0.462  -8.242  1.00 0.00 ? 402 TRP A CG   2  
ATOM 2731  C CD1  . TRP A 1 10  ? 9.294   -0.934  -9.519  1.00 0.00 ? 402 TRP A CD1  2  
ATOM 2732  C CD2  . TRP A 1 10  ? 7.942   -0.031  -7.993  1.00 0.00 ? 402 TRP A CD2  2  
ATOM 2733  N NE1  . TRP A 1 10  ? 8.047   -0.796  -10.083 1.00 0.00 ? 402 TRP A NE1  2  
ATOM 2734  C CE2  . TRP A 1 10  ? 7.202   -0.246  -9.159  1.00 0.00 ? 402 TRP A CE2  2  
ATOM 2735  C CE3  . TRP A 1 10  ? 7.310   0.521   -6.893  1.00 0.00 ? 402 TRP A CE3  2  
ATOM 2736  C CZ2  . TRP A 1 10  ? 5.851   0.076   -9.250  1.00 0.00 ? 402 TRP A CZ2  2  
ATOM 2737  C CZ3  . TRP A 1 10  ? 5.978   0.837   -6.978  1.00 0.00 ? 402 TRP A CZ3  2  
ATOM 2738  C CH2  . TRP A 1 10  ? 5.258   0.614   -8.152  1.00 0.00 ? 402 TRP A CH2  2  
ATOM 2739  H H    . TRP A 1 10  ? 12.464  1.087   -5.733  1.00 0.00 ? 402 TRP A H    2  
ATOM 2740  H HA   . TRP A 1 10  ? 11.980  0.369   -8.488  1.00 0.00 ? 402 TRP A HA   2  
ATOM 2741  H HB2  . TRP A 1 10  ? 10.861  -1.418  -7.260  1.00 0.00 ? 402 TRP A HB2  2  
ATOM 2742  H HB3  . TRP A 1 10  ? 10.007  -0.245  -6.279  1.00 0.00 ? 402 TRP A HB3  2  
ATOM 2743  H HD1  . TRP A 1 10  ? 10.170  -1.338  -10.004 1.00 0.00 ? 402 TRP A HD1  2  
ATOM 2744  H HE1  . TRP A 1 10  ? 7.790   -1.055  -10.993 1.00 0.00 ? 402 TRP A HE1  2  
ATOM 2745  H HE3  . TRP A 1 10  ? 7.857   0.697   -5.979  1.00 0.00 ? 402 TRP A HE3  2  
ATOM 2746  H HZ2  . TRP A 1 10  ? 5.282   -0.091  -10.153 1.00 0.00 ? 402 TRP A HZ2  2  
ATOM 2747  H HZ3  . TRP A 1 10  ? 5.480   1.263   -6.120  1.00 0.00 ? 402 TRP A HZ3  2  
ATOM 2748  H HH2  . TRP A 1 10  ? 4.211   0.878   -8.175  1.00 0.00 ? 402 TRP A HH2  2  
ATOM 2749  N N    . SER A 1 11  ? 10.655  2.433   -8.813  1.00 0.00 ? 403 SER A N    2  
ATOM 2750  C CA   . SER A 1 11  ? 10.061  3.702   -9.072  1.00 0.00 ? 403 SER A CA   2  
ATOM 2751  C C    . SER A 1 11  ? 8.821   3.430   -9.914  1.00 0.00 ? 403 SER A C    2  
ATOM 2752  O O    . SER A 1 11  ? 8.926   2.864   -11.012 1.00 0.00 ? 403 SER A O    2  
ATOM 2753  C CB   . SER A 1 11  ? 11.079  4.589   -9.817  1.00 0.00 ? 403 SER A CB   2  
ATOM 2754  O OG   . SER A 1 11  ? 10.576  5.894   -10.102 1.00 0.00 ? 403 SER A OG   2  
ATOM 2755  H H    . SER A 1 11  ? 10.825  1.843   -9.580  1.00 0.00 ? 403 SER A H    2  
ATOM 2756  H HA   . SER A 1 11  ? 9.779   4.162   -8.137  1.00 0.00 ? 403 SER A HA   2  
ATOM 2757  H HB2  . SER A 1 11  ? 11.964  4.697   -9.207  1.00 0.00 ? 403 SER A HB2  2  
ATOM 2758  H HB3  . SER A 1 11  ? 11.346  4.105   -10.745 1.00 0.00 ? 403 SER A HB3  2  
ATOM 2759  H HG   . SER A 1 11  ? 11.336  6.402   -10.415 1.00 0.00 ? 403 SER A HG   2  
ATOM 2760  N N    . GLY A 1 12  ? 7.661   3.775   -9.397  1.00 0.00 ? 404 GLY A N    2  
ATOM 2761  C CA   . GLY A 1 12  ? 6.450   3.461   -10.089 1.00 0.00 ? 404 GLY A CA   2  
ATOM 2762  C C    . GLY A 1 12  ? 5.273   4.252   -9.598  1.00 0.00 ? 404 GLY A C    2  
ATOM 2763  O O    . GLY A 1 12  ? 5.415   5.164   -8.767  1.00 0.00 ? 404 GLY A O    2  
ATOM 2764  H H    . GLY A 1 12  ? 7.608   4.271   -8.550  1.00 0.00 ? 404 GLY A H    2  
ATOM 2765  H HA2  . GLY A 1 12  ? 6.589   3.664   -11.141 1.00 0.00 ? 404 GLY A HA2  2  
ATOM 2766  H HA3  . GLY A 1 12  ? 6.240   2.408   -9.963  1.00 0.00 ? 404 GLY A HA3  2  
ATOM 2767  N N    . VAL A 1 13  ? 4.125   3.895   -10.089 1.00 0.00 ? 405 VAL A N    2  
ATOM 2768  C CA   . VAL A 1 13  ? 2.901   4.581   -9.805  1.00 0.00 ? 405 VAL A CA   2  
ATOM 2769  C C    . VAL A 1 13  ? 1.986   3.668   -8.994  1.00 0.00 ? 405 VAL A C    2  
ATOM 2770  O O    . VAL A 1 13  ? 1.935   2.457   -9.221  1.00 0.00 ? 405 VAL A O    2  
ATOM 2771  C CB   . VAL A 1 13  ? 2.188   4.969   -11.142 1.00 0.00 ? 405 VAL A CB   2  
ATOM 2772  C CG1  . VAL A 1 13  ? 0.905   5.749   -10.903 1.00 0.00 ? 405 VAL A CG1  2  
ATOM 2773  C CG2  . VAL A 1 13  ? 3.121   5.755   -12.052 1.00 0.00 ? 405 VAL A CG2  2  
ATOM 2774  H H    . VAL A 1 13  ? 4.058   3.094   -10.658 1.00 0.00 ? 405 VAL A H    2  
ATOM 2775  H HA   . VAL A 1 13  ? 3.119   5.484   -9.255  1.00 0.00 ? 405 VAL A HA   2  
ATOM 2776  H HB   . VAL A 1 13  ? 1.925   4.053   -11.648 1.00 0.00 ? 405 VAL A HB   2  
ATOM 2777  H HG11 . VAL A 1 13  ? 0.220   5.150   -10.321 1.00 0.00 ? 405 VAL A HG11 2  
ATOM 2778  H HG12 . VAL A 1 13  ? 1.130   6.662   -10.371 1.00 0.00 ? 405 VAL A HG12 2  
ATOM 2779  H HG13 . VAL A 1 13  ? 0.451   5.991   -11.853 1.00 0.00 ? 405 VAL A HG13 2  
ATOM 2780  H HG21 . VAL A 1 13  ? 3.996   5.160   -12.267 1.00 0.00 ? 405 VAL A HG21 2  
ATOM 2781  H HG22 . VAL A 1 13  ? 2.609   5.983   -12.975 1.00 0.00 ? 405 VAL A HG22 2  
ATOM 2782  H HG23 . VAL A 1 13  ? 3.415   6.673   -11.565 1.00 0.00 ? 405 VAL A HG23 2  
ATOM 2783  N N    . LEU A 1 14  ? 1.296   4.232   -8.053  1.00 0.00 ? 406 LEU A N    2  
ATOM 2784  C CA   . LEU A 1 14  ? 0.320   3.502   -7.286  1.00 0.00 ? 406 LEU A CA   2  
ATOM 2785  C C    . LEU A 1 14  ? -1.030  4.048   -7.583  1.00 0.00 ? 406 LEU A C    2  
ATOM 2786  O O    . LEU A 1 14  ? -1.196  5.264   -7.771  1.00 0.00 ? 406 LEU A O    2  
ATOM 2787  C CB   . LEU A 1 14  ? 0.580   3.557   -5.770  1.00 0.00 ? 406 LEU A CB   2  
ATOM 2788  C CG   . LEU A 1 14  ? 1.513   2.491   -5.169  1.00 0.00 ? 406 LEU A CG   2  
ATOM 2789  C CD1  . LEU A 1 14  ? 2.906   2.546   -5.759  1.00 0.00 ? 406 LEU A CD1  2  
ATOM 2790  C CD2  . LEU A 1 14  ? 1.565   2.638   -3.660  1.00 0.00 ? 406 LEU A CD2  2  
ATOM 2791  H H    . LEU A 1 14  ? 1.429   5.186   -7.855  1.00 0.00 ? 406 LEU A H    2  
ATOM 2792  H HA   . LEU A 1 14  ? 0.337   2.473   -7.612  1.00 0.00 ? 406 LEU A HA   2  
ATOM 2793  H HB2  . LEU A 1 14  ? 0.998   4.527   -5.544  1.00 0.00 ? 406 LEU A HB2  2  
ATOM 2794  H HB3  . LEU A 1 14  ? -0.375  3.483   -5.272  1.00 0.00 ? 406 LEU A HB3  2  
ATOM 2795  H HG   . LEU A 1 14  ? 1.104   1.516   -5.386  1.00 0.00 ? 406 LEU A HG   2  
ATOM 2796  H HD11 . LEU A 1 14  ? 2.846   2.396   -6.828  1.00 0.00 ? 406 LEU A HD11 2  
ATOM 2797  H HD12 . LEU A 1 14  ? 3.347   3.509   -5.554  1.00 0.00 ? 406 LEU A HD12 2  
ATOM 2798  H HD13 . LEU A 1 14  ? 3.511   1.767   -5.319  1.00 0.00 ? 406 LEU A HD13 2  
ATOM 2799  H HD21 . LEU A 1 14  ? 1.932   3.623   -3.407  1.00 0.00 ? 406 LEU A HD21 2  
ATOM 2800  H HD22 . LEU A 1 14  ? 0.574   2.509   -3.251  1.00 0.00 ? 406 LEU A HD22 2  
ATOM 2801  H HD23 . LEU A 1 14  ? 2.225   1.890   -3.246  1.00 0.00 ? 406 LEU A HD23 2  
ATOM 2802  N N    . GLU A 1 15  ? -1.973  3.169   -7.681  1.00 0.00 ? 407 GLU A N    2  
ATOM 2803  C CA   . GLU A 1 15  ? -3.316  3.539   -7.929  1.00 0.00 ? 407 GLU A CA   2  
ATOM 2804  C C    . GLU A 1 15  ? -4.165  3.167   -6.753  1.00 0.00 ? 407 GLU A C    2  
ATOM 2805  O O    . GLU A 1 15  ? -4.171  2.013   -6.305  1.00 0.00 ? 407 GLU A O    2  
ATOM 2806  C CB   . GLU A 1 15  ? -3.832  2.900   -9.213  1.00 0.00 ? 407 GLU A CB   2  
ATOM 2807  C CG   . GLU A 1 15  ? -3.192  3.486   -10.450 1.00 0.00 ? 407 GLU A CG   2  
ATOM 2808  C CD   . GLU A 1 15  ? -3.704  2.917   -11.738 1.00 0.00 ? 407 GLU A CD   2  
ATOM 2809  O OE1  . GLU A 1 15  ? -3.850  1.706   -11.847 1.00 0.00 ? 407 GLU A OE1  2  
ATOM 2810  O OE2  . GLU A 1 15  ? -3.916  3.696   -12.709 1.00 0.00 ? 407 GLU A OE2  2  
ATOM 2811  H H    . GLU A 1 15  ? -1.765  2.214   -7.564  1.00 0.00 ? 407 GLU A H    2  
ATOM 2812  H HA   . GLU A 1 15  ? -3.326  4.613   -8.051  1.00 0.00 ? 407 GLU A HA   2  
ATOM 2813  H HB2  . GLU A 1 15  ? -3.619  1.841   -9.187  1.00 0.00 ? 407 GLU A HB2  2  
ATOM 2814  H HB3  . GLU A 1 15  ? -4.899  3.045   -9.274  1.00 0.00 ? 407 GLU A HB3  2  
ATOM 2815  H HG2  . GLU A 1 15  ? -3.487  4.522   -10.435 1.00 0.00 ? 407 GLU A HG2  2  
ATOM 2816  H HG3  . GLU A 1 15  ? -2.117  3.395   -10.399 1.00 0.00 ? 407 GLU A HG3  2  
ATOM 2817  N N    . TRP A 1 16  ? -4.867  4.124   -6.256  1.00 0.00 ? 408 TRP A N    2  
ATOM 2818  C CA   . TRP A 1 16  ? -5.701  3.942   -5.118  1.00 0.00 ? 408 TRP A CA   2  
ATOM 2819  C C    . TRP A 1 16  ? -7.107  4.316   -5.465  1.00 0.00 ? 408 TRP A C    2  
ATOM 2820  O O    . TRP A 1 16  ? -7.346  5.113   -6.381  1.00 0.00 ? 408 TRP A O    2  
ATOM 2821  C CB   . TRP A 1 16  ? -5.179  4.728   -3.896  1.00 0.00 ? 408 TRP A CB   2  
ATOM 2822  C CG   . TRP A 1 16  ? -5.032  6.210   -4.097  1.00 0.00 ? 408 TRP A CG   2  
ATOM 2823  C CD1  . TRP A 1 16  ? -4.042  6.848   -4.783  1.00 0.00 ? 408 TRP A CD1  2  
ATOM 2824  C CD2  . TRP A 1 16  ? -5.876  7.238   -3.564  1.00 0.00 ? 408 TRP A CD2  2  
ATOM 2825  N NE1  . TRP A 1 16  ? -4.233  8.200   -4.739  1.00 0.00 ? 408 TRP A NE1  2  
ATOM 2826  C CE2  . TRP A 1 16  ? -5.351  8.470   -3.993  1.00 0.00 ? 408 TRP A CE2  2  
ATOM 2827  C CE3  . TRP A 1 16  ? -7.035  7.236   -2.780  1.00 0.00 ? 408 TRP A CE3  2  
ATOM 2828  C CZ2  . TRP A 1 16  ? -5.933  9.688   -3.657  1.00 0.00 ? 408 TRP A CZ2  2  
ATOM 2829  C CZ3  . TRP A 1 16  ? -7.610  8.444   -2.446  1.00 0.00 ? 408 TRP A CZ3  2  
ATOM 2830  C CH2  . TRP A 1 16  ? -7.061  9.655   -2.886  1.00 0.00 ? 408 TRP A CH2  2  
ATOM 2831  H H    . TRP A 1 16  ? -4.839  5.003   -6.696  1.00 0.00 ? 408 TRP A H    2  
ATOM 2832  H HA   . TRP A 1 16  ? -5.689  2.888   -4.883  1.00 0.00 ? 408 TRP A HA   2  
ATOM 2833  H HB2  . TRP A 1 16  ? -5.859  4.584   -3.070  1.00 0.00 ? 408 TRP A HB2  2  
ATOM 2834  H HB3  . TRP A 1 16  ? -4.213  4.333   -3.619  1.00 0.00 ? 408 TRP A HB3  2  
ATOM 2835  H HD1  . TRP A 1 16  ? -3.239  6.339   -5.297  1.00 0.00 ? 408 TRP A HD1  2  
ATOM 2836  H HE1  . TRP A 1 16  ? -3.654  8.863   -5.168  1.00 0.00 ? 408 TRP A HE1  2  
ATOM 2837  H HE3  . TRP A 1 16  ? -7.473  6.313   -2.431  1.00 0.00 ? 408 TRP A HE3  2  
ATOM 2838  H HZ2  . TRP A 1 16  ? -5.522  10.630  -3.989  1.00 0.00 ? 408 TRP A HZ2  2  
ATOM 2839  H HZ3  . TRP A 1 16  ? -8.501  8.463   -1.836  1.00 0.00 ? 408 TRP A HZ3  2  
ATOM 2840  H HH2  . TRP A 1 16  ? -7.544  10.578  -2.599  1.00 0.00 ? 408 TRP A HH2  2  
ATOM 2841  N N    . GLN A 1 17  ? -8.025  3.738   -4.773  1.00 0.00 ? 409 GLN A N    2  
ATOM 2842  C CA   . GLN A 1 17  ? -9.404  3.962   -5.041  1.00 0.00 ? 409 GLN A CA   2  
ATOM 2843  C C    . GLN A 1 17  ? -9.974  4.946   -4.045  1.00 0.00 ? 409 GLN A C    2  
ATOM 2844  O O    . GLN A 1 17  ? -9.690  4.862   -2.856  1.00 0.00 ? 409 GLN A O    2  
ATOM 2845  C CB   . GLN A 1 17  ? -10.169 2.640   -4.974  1.00 0.00 ? 409 GLN A CB   2  
ATOM 2846  C CG   . GLN A 1 17  ? -9.646  1.581   -5.935  1.00 0.00 ? 409 GLN A CG   2  
ATOM 2847  C CD   . GLN A 1 17  ? -10.406 0.281   -5.834  1.00 0.00 ? 409 GLN A CD   2  
ATOM 2848  O OE1  . GLN A 1 17  ? -11.393 0.075   -6.527  1.00 0.00 ? 409 GLN A OE1  2  
ATOM 2849  N NE2  . GLN A 1 17  ? -9.959  -0.599  -4.983  1.00 0.00 ? 409 GLN A NE2  2  
ATOM 2850  H H    . GLN A 1 17  ? -7.764  3.160   -4.028  1.00 0.00 ? 409 GLN A H    2  
ATOM 2851  H HA   . GLN A 1 17  ? -9.501  4.363   -6.039  1.00 0.00 ? 409 GLN A HA   2  
ATOM 2852  H HB2  . GLN A 1 17  ? -10.101 2.250   -3.969  1.00 0.00 ? 409 GLN A HB2  2  
ATOM 2853  H HB3  . GLN A 1 17  ? -11.207 2.825   -5.206  1.00 0.00 ? 409 GLN A HB3  2  
ATOM 2854  H HG2  . GLN A 1 17  ? -9.736  1.952   -6.944  1.00 0.00 ? 409 GLN A HG2  2  
ATOM 2855  H HG3  . GLN A 1 17  ? -8.606  1.393   -5.715  1.00 0.00 ? 409 GLN A HG3  2  
ATOM 2856  H HE21 . GLN A 1 17  ? -9.165  -0.391  -4.450  1.00 0.00 ? 409 GLN A HE21 2  
ATOM 2857  H HE22 . GLN A 1 17  ? -10.440 -1.452  -4.910  1.00 0.00 ? 409 GLN A HE22 2  
ATOM 2858  N N    . GLU A 1 18  ? -10.802 5.849   -4.545  1.00 0.00 ? 410 GLU A N    2  
ATOM 2859  C CA   . GLU A 1 18  ? -11.523 6.856   -3.738  1.00 0.00 ? 410 GLU A CA   2  
ATOM 2860  C C    . GLU A 1 18  ? -12.591 6.189   -2.856  1.00 0.00 ? 410 GLU A C    2  
ATOM 2861  O O    . GLU A 1 18  ? -13.188 6.837   -1.984  1.00 0.00 ? 410 GLU A O    2  
ATOM 2862  C CB   . GLU A 1 18  ? -12.249 7.802   -4.700  1.00 0.00 ? 410 GLU A CB   2  
ATOM 2863  C CG   . GLU A 1 18  ? -11.363 8.731   -5.511  1.00 0.00 ? 410 GLU A CG   2  
ATOM 2864  C CD   . GLU A 1 18  ? -11.025 10.000  -4.770  1.00 0.00 ? 410 GLU A CD   2  
ATOM 2865  O OE1  . GLU A 1 18  ? -11.854 10.964  -4.806  1.00 0.00 ? 410 GLU A OE1  2  
ATOM 2866  O OE2  . GLU A 1 18  ? -9.970  10.086  -4.180  1.00 0.00 ? 410 GLU A OE2  2  
ATOM 2867  H H    . GLU A 1 18  ? -10.936 5.877   -5.517  1.00 0.00 ? 410 GLU A H    2  
ATOM 2868  H HA   . GLU A 1 18  ? -10.826 7.430   -3.146  1.00 0.00 ? 410 GLU A HA   2  
ATOM 2869  H HB2  . GLU A 1 18  ? -12.821 7.205   -5.394  1.00 0.00 ? 410 GLU A HB2  2  
ATOM 2870  H HB3  . GLU A 1 18  ? -12.937 8.407   -4.126  1.00 0.00 ? 410 GLU A HB3  2  
ATOM 2871  H HG2  . GLU A 1 18  ? -10.443 8.213   -5.742  1.00 0.00 ? 410 GLU A HG2  2  
ATOM 2872  H HG3  . GLU A 1 18  ? -11.868 8.987   -6.431  1.00 0.00 ? 410 GLU A HG3  2  
ATOM 2873  N N    . LYS A 1 19  ? -12.783 4.888   -3.085  1.00 0.00 ? 411 LYS A N    2  
ATOM 2874  C CA   . LYS A 1 19  ? -13.875 4.102   -2.536  1.00 0.00 ? 411 LYS A CA   2  
ATOM 2875  C C    . LYS A 1 19  ? -15.165 4.661   -3.116  1.00 0.00 ? 411 LYS A C    2  
ATOM 2876  O O    . LYS A 1 19  ? -15.774 5.561   -2.551  1.00 0.00 ? 411 LYS A O    2  
ATOM 2877  C CB   . LYS A 1 19  ? -13.883 4.031   -0.987  1.00 0.00 ? 411 LYS A CB   2  
ATOM 2878  C CG   . LYS A 1 19  ? -14.981 3.136   -0.400  1.00 0.00 ? 411 LYS A CG   2  
ATOM 2879  C CD   . LYS A 1 19  ? -14.876 1.699   -0.910  1.00 0.00 ? 411 LYS A CD   2  
ATOM 2880  C CE   . LYS A 1 19  ? -15.948 0.806   -0.302  1.00 0.00 ? 411 LYS A CE   2  
ATOM 2881  N NZ   . LYS A 1 19  ? -15.884 -0.571  -0.838  1.00 0.00 ? 411 LYS A NZ   2  
ATOM 2882  H H    . LYS A 1 19  ? -12.123 4.462   -3.664  1.00 0.00 ? 411 LYS A H    2  
ATOM 2883  H HA   . LYS A 1 19  ? -13.746 3.115   -2.958  1.00 0.00 ? 411 LYS A HA   2  
ATOM 2884  H HB2  . LYS A 1 19  ? -12.927 3.650   -0.656  1.00 0.00 ? 411 LYS A HB2  2  
ATOM 2885  H HB3  . LYS A 1 19  ? -14.012 5.029   -0.597  1.00 0.00 ? 411 LYS A HB3  2  
ATOM 2886  H HG2  . LYS A 1 19  ? -14.890 3.131   0.676   1.00 0.00 ? 411 LYS A HG2  2  
ATOM 2887  H HG3  . LYS A 1 19  ? -15.944 3.539   -0.678  1.00 0.00 ? 411 LYS A HG3  2  
ATOM 2888  H HD2  . LYS A 1 19  ? -14.996 1.698   -1.983  1.00 0.00 ? 411 LYS A HD2  2  
ATOM 2889  H HD3  . LYS A 1 19  ? -13.904 1.307   -0.653  1.00 0.00 ? 411 LYS A HD3  2  
ATOM 2890  H HE2  . LYS A 1 19  ? -15.810 0.770   0.769   1.00 0.00 ? 411 LYS A HE2  2  
ATOM 2891  H HE3  . LYS A 1 19  ? -16.918 1.225   -0.525  1.00 0.00 ? 411 LYS A HE3  2  
ATOM 2892  H HZ1  . LYS A 1 19  ? -14.949 -1.007  -0.707  1.00 0.00 ? 411 LYS A HZ1  2  
ATOM 2893  H HZ2  . LYS A 1 19  ? -16.564 -1.196  -0.346  1.00 0.00 ? 411 LYS A HZ2  2  
ATOM 2894  H HZ3  . LYS A 1 19  ? -16.122 -0.601  -1.850  1.00 0.00 ? 411 LYS A HZ3  2  
ATOM 2895  N N    . PRO A 1 20  ? -15.529 4.146   -4.309  1.00 0.00 ? 412 PRO A N    2  
ATOM 2896  C CA   . PRO A 1 20  ? -16.611 4.671   -5.148  1.00 0.00 ? 412 PRO A CA   2  
ATOM 2897  C C    . PRO A 1 20  ? -17.891 5.039   -4.423  1.00 0.00 ? 412 PRO A C    2  
ATOM 2898  O O    . PRO A 1 20  ? -18.631 4.173   -3.921  1.00 0.00 ? 412 PRO A O    2  
ATOM 2899  C CB   . PRO A 1 20  ? -16.872 3.558   -6.143  1.00 0.00 ? 412 PRO A CB   2  
ATOM 2900  C CG   . PRO A 1 20  ? -15.580 2.850   -6.263  1.00 0.00 ? 412 PRO A CG   2  
ATOM 2901  C CD   . PRO A 1 20  ? -14.905 2.961   -4.933  1.00 0.00 ? 412 PRO A CD   2  
ATOM 2902  H HA   . PRO A 1 20  ? -16.272 5.538   -5.695  1.00 0.00 ? 412 PRO A HA   2  
ATOM 2903  H HB2  . PRO A 1 20  ? -17.644 2.911   -5.755  1.00 0.00 ? 412 PRO A HB2  2  
ATOM 2904  H HB3  . PRO A 1 20  ? -17.187 3.974   -7.089  1.00 0.00 ? 412 PRO A HB3  2  
ATOM 2905  H HG2  . PRO A 1 20  ? -15.756 1.812   -6.499  1.00 0.00 ? 412 PRO A HG2  2  
ATOM 2906  H HG3  . PRO A 1 20  ? -14.973 3.315   -7.025  1.00 0.00 ? 412 PRO A HG3  2  
ATOM 2907  H HD2  . PRO A 1 20  ? -15.084 2.077   -4.341  1.00 0.00 ? 412 PRO A HD2  2  
ATOM 2908  H HD3  . PRO A 1 20  ? -13.845 3.115   -5.069  1.00 0.00 ? 412 PRO A HD3  2  
ATOM 2909  N N    . LYS A 1 21  ? -18.112 6.315   -4.332  1.00 0.00 ? 413 LYS A N    2  
ATOM 2910  C CA   . LYS A 1 21  ? -19.333 6.868   -3.840  1.00 0.00 ? 413 LYS A CA   2  
ATOM 2911  C C    . LYS A 1 21  ? -19.996 7.544   -5.039  1.00 0.00 ? 413 LYS A C    2  
ATOM 2912  O O    . LYS A 1 21  ? -19.626 8.669   -5.385  1.00 0.00 ? 413 LYS A O    2  
ATOM 2913  C CB   . LYS A 1 21  ? -19.061 7.940   -2.764  1.00 0.00 ? 413 LYS A CB   2  
ATOM 2914  C CG   . LYS A 1 21  ? -18.246 7.502   -1.547  1.00 0.00 ? 413 LYS A CG   2  
ATOM 2915  C CD   . LYS A 1 21  ? -19.002 6.555   -0.623  1.00 0.00 ? 413 LYS A CD   2  
ATOM 2916  C CE   . LYS A 1 21  ? -18.141 6.208   0.589   1.00 0.00 ? 413 LYS A CE   2  
ATOM 2917  N NZ   . LYS A 1 21  ? -18.857 5.389   1.588   1.00 0.00 ? 413 LYS A NZ   2  
ATOM 2918  H H    . LYS A 1 21  ? -17.401 6.937   -4.603  1.00 0.00 ? 413 LYS A H    2  
ATOM 2919  H HA   . LYS A 1 21  ? -19.960 6.082   -3.443  1.00 0.00 ? 413 LYS A HA   2  
ATOM 2920  H HB2  . LYS A 1 21  ? -18.529 8.752   -3.237  1.00 0.00 ? 413 LYS A HB2  2  
ATOM 2921  H HB3  . LYS A 1 21  ? -20.010 8.321   -2.418  1.00 0.00 ? 413 LYS A HB3  2  
ATOM 2922  H HG2  . LYS A 1 21  ? -17.358 6.998   -1.896  1.00 0.00 ? 413 LYS A HG2  2  
ATOM 2923  H HG3  . LYS A 1 21  ? -17.959 8.382   -0.991  1.00 0.00 ? 413 LYS A HG3  2  
ATOM 2924  H HD2  . LYS A 1 21  ? -19.909 7.036   -0.289  1.00 0.00 ? 413 LYS A HD2  2  
ATOM 2925  H HD3  . LYS A 1 21  ? -19.243 5.649   -1.158  1.00 0.00 ? 413 LYS A HD3  2  
ATOM 2926  H HE2  . LYS A 1 21  ? -17.281 5.650   0.251   1.00 0.00 ? 413 LYS A HE2  2  
ATOM 2927  H HE3  . LYS A 1 21  ? -17.813 7.126   1.055   1.00 0.00 ? 413 LYS A HE3  2  
ATOM 2928  H HZ1  . LYS A 1 21  ? -19.225 4.504   1.190   1.00 0.00 ? 413 LYS A HZ1  2  
ATOM 2929  H HZ2  . LYS A 1 21  ? -18.216 5.164   2.375   1.00 0.00 ? 413 LYS A HZ2  2  
ATOM 2930  H HZ3  . LYS A 1 21  ? -19.655 5.921   1.989   1.00 0.00 ? 413 LYS A HZ3  2  
ATOM 2931  N N    . PRO A 1 22  ? -20.894 6.850   -5.764  1.00 0.00 ? 414 PRO A N    2  
ATOM 2932  C CA   . PRO A 1 22  ? -21.564 7.429   -6.919  1.00 0.00 ? 414 PRO A CA   2  
ATOM 2933  C C    . PRO A 1 22  ? -22.418 8.625   -6.518  1.00 0.00 ? 414 PRO A C    2  
ATOM 2934  O O    . PRO A 1 22  ? -23.427 8.479   -5.823  1.00 0.00 ? 414 PRO A O    2  
ATOM 2935  C CB   . PRO A 1 22  ? -22.442 6.285   -7.460  1.00 0.00 ? 414 PRO A CB   2  
ATOM 2936  C CG   . PRO A 1 22  ? -21.851 5.051   -6.872  1.00 0.00 ? 414 PRO A CG   2  
ATOM 2937  C CD   . PRO A 1 22  ? -21.321 5.461   -5.531  1.00 0.00 ? 414 PRO A CD   2  
ATOM 2938  H HA   . PRO A 1 22  ? -20.852 7.737   -7.669  1.00 0.00 ? 414 PRO A HA   2  
ATOM 2939  H HB2  . PRO A 1 22  ? -23.461 6.431   -7.136  1.00 0.00 ? 414 PRO A HB2  2  
ATOM 2940  H HB3  . PRO A 1 22  ? -22.399 6.267   -8.538  1.00 0.00 ? 414 PRO A HB3  2  
ATOM 2941  H HG2  . PRO A 1 22  ? -22.613 4.294   -6.764  1.00 0.00 ? 414 PRO A HG2  2  
ATOM 2942  H HG3  . PRO A 1 22  ? -21.049 4.690   -7.499  1.00 0.00 ? 414 PRO A HG3  2  
ATOM 2943  H HD2  . PRO A 1 22  ? -22.111 5.416   -4.799  1.00 0.00 ? 414 PRO A HD2  2  
ATOM 2944  H HD3  . PRO A 1 22  ? -20.487 4.840   -5.241  1.00 0.00 ? 414 PRO A HD3  2  
ATOM 2945  N N    . ALA A 1 23  ? -22.009 9.802   -6.958  1.00 0.00 ? 415 ALA A N    2  
ATOM 2946  C CA   . ALA A 1 23  ? -22.695 11.047  -6.638  1.00 0.00 ? 415 ALA A CA   2  
ATOM 2947  C C    . ALA A 1 23  ? -23.975 11.189  -7.456  1.00 0.00 ? 415 ALA A C    2  
ATOM 2948  O O    . ALA A 1 23  ? -24.709 12.165  -7.318  1.00 0.00 ? 415 ALA A O    2  
ATOM 2949  C CB   . ALA A 1 23  ? -21.770 12.233  -6.873  1.00 0.00 ? 415 ALA A CB   2  
ATOM 2950  H H    . ALA A 1 23  ? -21.207 9.846   -7.521  1.00 0.00 ? 415 ALA A H    2  
ATOM 2951  H HA   . ALA A 1 23  ? -22.952 11.018  -5.590  1.00 0.00 ? 415 ALA A HA   2  
ATOM 2952  H HB1  . ALA A 1 23  ? -22.269 13.144  -6.576  1.00 0.00 ? 415 ALA A HB1  2  
ATOM 2953  H HB2  . ALA A 1 23  ? -20.870 12.108  -6.290  1.00 0.00 ? 415 ALA A HB2  2  
ATOM 2954  H HB3  . ALA A 1 23  ? -21.515 12.290  -7.921  1.00 0.00 ? 415 ALA A HB3  2  
ATOM 2955  N N    . SER A 1 24  ? -24.196 10.208  -8.339  1.00 0.00 ? 416 SER A N    2  
ATOM 2956  C CA   . SER A 1 24  ? -25.385 10.090  -9.175  1.00 0.00 ? 416 SER A CA   2  
ATOM 2957  C C    . SER A 1 24  ? -25.378 11.104  -10.319 1.00 0.00 ? 416 SER A C    2  
ATOM 2958  O O    . SER A 1 24  ? -26.398 11.357  -10.956 1.00 0.00 ? 416 SER A O    2  
ATOM 2959  C CB   . SER A 1 24  ? -26.664 10.158  -8.328  1.00 0.00 ? 416 SER A CB   2  
ATOM 2960  O OG   . SER A 1 24  ? -26.623 9.158   -7.309  1.00 0.00 ? 416 SER A OG   2  
ATOM 2961  H H    . SER A 1 24  ? -23.484 9.543   -8.443  1.00 0.00 ? 416 SER A H    2  
ATOM 2962  H HA   . SER A 1 24  ? -25.328 9.111   -9.630  1.00 0.00 ? 416 SER A HA   2  
ATOM 2963  H HB2  . SER A 1 24  ? -26.729 11.131  -7.867  1.00 0.00 ? 416 SER A HB2  2  
ATOM 2964  H HB3  . SER A 1 24  ? -27.527 9.991   -8.954  1.00 0.00 ? 416 SER A HB3  2  
ATOM 2965  H HG   . SER A 1 24  ? -25.696 8.928   -7.175  1.00 0.00 ? 416 SER A HG   2  
ATOM 2966  N N    . VAL A 1 25  ? -24.209 11.663  -10.579 1.00 0.00 ? 417 VAL A N    2  
ATOM 2967  C CA   . VAL A 1 25  ? -24.004 12.532  -11.727 1.00 0.00 ? 417 VAL A CA   2  
ATOM 2968  C C    . VAL A 1 25  ? -23.737 11.611  -12.903 1.00 0.00 ? 417 VAL A C    2  
ATOM 2969  O O    . VAL A 1 25  ? -24.168 11.840  -14.040 1.00 0.00 ? 417 VAL A O    2  
ATOM 2970  C CB   . VAL A 1 25  ? -22.787 13.466  -11.512 1.00 0.00 ? 417 VAL A CB   2  
ATOM 2971  C CG1  . VAL A 1 25  ? -22.606 14.415  -12.692 1.00 0.00 ? 417 VAL A CG1  2  
ATOM 2972  C CG2  . VAL A 1 25  ? -22.937 14.242  -10.213 1.00 0.00 ? 417 VAL A CG2  2  
ATOM 2973  H H    . VAL A 1 25  ? -23.465 11.473  -9.968  1.00 0.00 ? 417 VAL A H    2  
ATOM 2974  H HA   . VAL A 1 25  ? -24.901 13.107  -11.903 1.00 0.00 ? 417 VAL A HA   2  
ATOM 2975  H HB   . VAL A 1 25  ? -21.901 12.850  -11.440 1.00 0.00 ? 417 VAL A HB   2  
ATOM 2976  H HG11 . VAL A 1 25  ? -22.470 13.836  -13.594 1.00 0.00 ? 417 VAL A HG11 2  
ATOM 2977  H HG12 . VAL A 1 25  ? -23.481 15.038  -12.796 1.00 0.00 ? 417 VAL A HG12 2  
ATOM 2978  H HG13 . VAL A 1 25  ? -21.736 15.033  -12.534 1.00 0.00 ? 417 VAL A HG13 2  
ATOM 2979  H HG21 . VAL A 1 25  ? -23.012 13.549  -9.389  1.00 0.00 ? 417 VAL A HG21 2  
ATOM 2980  H HG22 . VAL A 1 25  ? -22.078 14.880  -10.071 1.00 0.00 ? 417 VAL A HG22 2  
ATOM 2981  H HG23 . VAL A 1 25  ? -23.830 14.846  -10.256 1.00 0.00 ? 417 VAL A HG23 2  
ATOM 2982  N N    . ASP A 1 26  ? -23.053 10.545  -12.575 1.00 0.00 ? 418 ASP A N    2  
ATOM 2983  C CA   . ASP A 1 26  ? -22.761 9.455   -13.462 1.00 0.00 ? 418 ASP A CA   2  
ATOM 2984  C C    . ASP A 1 26  ? -23.386 8.243   -12.804 1.00 0.00 ? 418 ASP A C    2  
ATOM 2985  O O    . ASP A 1 26  ? -23.507 8.226   -11.566 1.00 0.00 ? 418 ASP A O    2  
ATOM 2986  C CB   . ASP A 1 26  ? -21.240 9.254   -13.581 1.00 0.00 ? 418 ASP A CB   2  
ATOM 2987  C CG   . ASP A 1 26  ? -20.850 8.230   -14.632 1.00 0.00 ? 418 ASP A CG   2  
ATOM 2988  O OD1  . ASP A 1 26  ? -20.284 8.618   -15.680 1.00 0.00 ? 418 ASP A OD1  2  
ATOM 2989  O OD2  . ASP A 1 26  ? -21.095 7.033   -14.448 1.00 0.00 ? 418 ASP A OD2  2  
ATOM 2990  H H    . ASP A 1 26  ? -22.750 10.463  -11.647 1.00 0.00 ? 418 ASP A H    2  
ATOM 2991  H HA   . ASP A 1 26  ? -23.203 9.649   -14.427 1.00 0.00 ? 418 ASP A HA   2  
ATOM 2992  H HB2  . ASP A 1 26  ? -20.779 10.194  -13.844 1.00 0.00 ? 418 ASP A HB2  2  
ATOM 2993  H HB3  . ASP A 1 26  ? -20.857 8.928   -12.624 1.00 0.00 ? 418 ASP A HB3  2  
ATOM 2994  N N    . ALA A 1 27  ? -23.783 7.256   -13.570 1.00 0.00 ? 419 ALA A N    2  
ATOM 2995  C CA   . ALA A 1 27  ? -24.452 6.093   -13.009 1.00 0.00 ? 419 ALA A CA   2  
ATOM 2996  C C    . ALA A 1 27  ? -23.498 5.211   -12.213 1.00 0.00 ? 419 ALA A C    2  
ATOM 2997  O O    . ALA A 1 27  ? -23.867 4.673   -11.168 1.00 0.00 ? 419 ALA A O    2  
ATOM 2998  C CB   . ALA A 1 27  ? -25.127 5.293   -14.091 1.00 0.00 ? 419 ALA A CB   2  
ATOM 2999  H H    . ALA A 1 27  ? -23.602 7.294   -14.535 1.00 0.00 ? 419 ALA A H    2  
ATOM 3000  H HA   . ALA A 1 27  ? -25.215 6.457   -12.336 1.00 0.00 ? 419 ALA A HA   2  
ATOM 3001  H HB1  . ALA A 1 27  ? -24.372 4.898   -14.752 1.00 0.00 ? 419 ALA A HB1  2  
ATOM 3002  H HB2  . ALA A 1 27  ? -25.680 4.478   -13.646 1.00 0.00 ? 419 ALA A HB2  2  
ATOM 3003  H HB3  . ALA A 1 27  ? -25.798 5.929   -14.649 1.00 0.00 ? 419 ALA A HB3  2  
ATOM 3004  N N    . ASN A 1 28  ? -22.279 5.076   -12.684 1.00 0.00 ? 420 ASN A N    2  
ATOM 3005  C CA   . ASN A 1 28  ? -21.295 4.253   -12.001 1.00 0.00 ? 420 ASN A CA   2  
ATOM 3006  C C    . ASN A 1 28  ? -19.900 4.773   -12.246 1.00 0.00 ? 420 ASN A C    2  
ATOM 3007  O O    . ASN A 1 28  ? -19.475 4.960   -13.378 1.00 0.00 ? 420 ASN A O    2  
ATOM 3008  C CB   . ASN A 1 28  ? -21.458 2.713   -12.275 1.00 0.00 ? 420 ASN A CB   2  
ATOM 3009  C CG   . ASN A 1 28  ? -21.381 2.243   -13.741 1.00 0.00 ? 420 ASN A CG   2  
ATOM 3010  O OD1  . ASN A 1 28  ? -20.670 2.786   -14.575 1.00 0.00 ? 420 ASN A OD1  2  
ATOM 3011  N ND2  . ASN A 1 28  ? -22.136 1.226   -14.053 1.00 0.00 ? 420 ASN A ND2  2  
ATOM 3012  H H    . ASN A 1 28  ? -21.999 5.578   -13.485 1.00 0.00 ? 420 ASN A H    2  
ATOM 3013  H HA   . ASN A 1 28  ? -21.484 4.437   -10.952 1.00 0.00 ? 420 ASN A HA   2  
ATOM 3014  H HB2  . ASN A 1 28  ? -20.690 2.183   -11.734 1.00 0.00 ? 420 ASN A HB2  2  
ATOM 3015  H HB3  . ASN A 1 28  ? -22.414 2.410   -11.872 1.00 0.00 ? 420 ASN A HB3  2  
ATOM 3016  H HD21 . ASN A 1 28  ? -22.692 0.838   -13.343 1.00 0.00 ? 420 ASN A HD21 2  
ATOM 3017  H HD22 . ASN A 1 28  ? -22.130 0.873   -14.969 1.00 0.00 ? 420 ASN A HD22 2  
ATOM 3018  N N    . THR A 1 29  ? -19.206 5.053   -11.187 1.00 0.00 ? 421 THR A N    2  
ATOM 3019  C CA   . THR A 1 29  ? -17.928 5.678   -11.282 1.00 0.00 ? 421 THR A CA   2  
ATOM 3020  C C    . THR A 1 29  ? -16.936 5.052   -10.300 1.00 0.00 ? 421 THR A C    2  
ATOM 3021  O O    . THR A 1 29  ? -17.052 5.209   -9.077  1.00 0.00 ? 421 THR A O    2  
ATOM 3022  C CB   . THR A 1 29  ? -18.062 7.245   -11.081 1.00 0.00 ? 421 THR A CB   2  
ATOM 3023  O OG1  . THR A 1 29  ? -16.785 7.903   -11.066 1.00 0.00 ? 421 THR A OG1  2  
ATOM 3024  C CG2  . THR A 1 29  ? -18.844 7.602   -9.812  1.00 0.00 ? 421 THR A CG2  2  
ATOM 3025  H H    . THR A 1 29  ? -19.537 4.816   -10.295 1.00 0.00 ? 421 THR A H    2  
ATOM 3026  H HA   . THR A 1 29  ? -17.573 5.501   -12.285 1.00 0.00 ? 421 THR A HA   2  
ATOM 3027  H HB   . THR A 1 29  ? -18.606 7.623   -11.934 1.00 0.00 ? 421 THR A HB   2  
ATOM 3028  H HG1  . THR A 1 29  ? -16.333 7.659   -11.886 1.00 0.00 ? 421 THR A HG1  2  
ATOM 3029  H HG21 . THR A 1 29  ? -19.837 7.179   -9.870  1.00 0.00 ? 421 THR A HG21 2  
ATOM 3030  H HG22 . THR A 1 29  ? -18.333 7.195   -8.952  1.00 0.00 ? 421 THR A HG22 2  
ATOM 3031  H HG23 . THR A 1 29  ? -18.914 8.676   -9.716  1.00 0.00 ? 421 THR A HG23 2  
ATOM 3032  N N    . LYS A 1 30  ? -16.003 4.293   -10.826 1.00 0.00 ? 422 LYS A N    2  
ATOM 3033  C CA   . LYS A 1 30  ? -14.976 3.729   -10.004 1.00 0.00 ? 422 LYS A CA   2  
ATOM 3034  C C    . LYS A 1 30  ? -13.724 4.539   -10.261 1.00 0.00 ? 422 LYS A C    2  
ATOM 3035  O O    . LYS A 1 30  ? -12.902 4.193   -11.117 1.00 0.00 ? 422 LYS A O    2  
ATOM 3036  C CB   . LYS A 1 30  ? -14.759 2.214   -10.295 1.00 0.00 ? 422 LYS A CB   2  
ATOM 3037  C CG   . LYS A 1 30  ? -14.127 1.416   -9.129  1.00 0.00 ? 422 LYS A CG   2  
ATOM 3038  C CD   . LYS A 1 30  ? -12.685 1.811   -8.808  1.00 0.00 ? 422 LYS A CD   2  
ATOM 3039  C CE   . LYS A 1 30  ? -11.679 1.176   -9.763  1.00 0.00 ? 422 LYS A CE   2  
ATOM 3040  N NZ   . LYS A 1 30  ? -11.607 -0.293  -9.587  1.00 0.00 ? 422 LYS A NZ   2  
ATOM 3041  H H    . LYS A 1 30  ? -15.994 4.128   -11.792 1.00 0.00 ? 422 LYS A H    2  
ATOM 3042  H HA   . LYS A 1 30  ? -15.278 3.871   -8.977  1.00 0.00 ? 422 LYS A HA   2  
ATOM 3043  H HB2  . LYS A 1 30  ? -15.715 1.768   -10.525 1.00 0.00 ? 422 LYS A HB2  2  
ATOM 3044  H HB3  . LYS A 1 30  ? -14.114 2.120   -11.156 1.00 0.00 ? 422 LYS A HB3  2  
ATOM 3045  H HG2  . LYS A 1 30  ? -14.725 1.564   -8.244  1.00 0.00 ? 422 LYS A HG2  2  
ATOM 3046  H HG3  . LYS A 1 30  ? -14.154 0.367   -9.383  1.00 0.00 ? 422 LYS A HG3  2  
ATOM 3047  H HD2  . LYS A 1 30  ? -12.598 2.885   -8.882  1.00 0.00 ? 422 LYS A HD2  2  
ATOM 3048  H HD3  . LYS A 1 30  ? -12.457 1.500   -7.799  1.00 0.00 ? 422 LYS A HD3  2  
ATOM 3049  H HE2  . LYS A 1 30  ? -11.983 1.393   -10.777 1.00 0.00 ? 422 LYS A HE2  2  
ATOM 3050  H HE3  . LYS A 1 30  ? -10.705 1.605   -9.581  1.00 0.00 ? 422 LYS A HE3  2  
ATOM 3051  H HZ1  . LYS A 1 30  ? -11.399 -0.537  -8.595  1.00 0.00 ? 422 LYS A HZ1  2  
ATOM 3052  H HZ2  . LYS A 1 30  ? -12.490 -0.768  -9.861  1.00 0.00 ? 422 LYS A HZ2  2  
ATOM 3053  H HZ3  . LYS A 1 30  ? -10.835 -0.691  -10.159 1.00 0.00 ? 422 LYS A HZ3  2  
ATOM 3054  N N    . LEU A 1 31  ? -13.628 5.657   -9.583  1.00 0.00 ? 423 LEU A N    2  
ATOM 3055  C CA   . LEU A 1 31  ? -12.534 6.565   -9.778  1.00 0.00 ? 423 LEU A CA   2  
ATOM 3056  C C    . LEU A 1 31  ? -11.287 6.087   -9.058  1.00 0.00 ? 423 LEU A C    2  
ATOM 3057  O O    . LEU A 1 31  ? -11.272 5.918   -7.823  1.00 0.00 ? 423 LEU A O    2  
ATOM 3058  C CB   . LEU A 1 31  ? -12.908 7.985   -9.340  1.00 0.00 ? 423 LEU A CB   2  
ATOM 3059  C CG   . LEU A 1 31  ? -11.843 9.064   -9.577  1.00 0.00 ? 423 LEU A CG   2  
ATOM 3060  C CD1  . LEU A 1 31  ? -11.523 9.206   -11.062 1.00 0.00 ? 423 LEU A CD1  2  
ATOM 3061  C CD2  . LEU A 1 31  ? -12.293 10.389  -9.007  1.00 0.00 ? 423 LEU A CD2  2  
ATOM 3062  H H    . LEU A 1 31  ? -14.324 5.883   -8.930  1.00 0.00 ? 423 LEU A H    2  
ATOM 3063  H HA   . LEU A 1 31  ? -12.328 6.580   -10.838 1.00 0.00 ? 423 LEU A HA   2  
ATOM 3064  H HB2  . LEU A 1 31  ? -13.804 8.274   -9.870  1.00 0.00 ? 423 LEU A HB2  2  
ATOM 3065  H HB3  . LEU A 1 31  ? -13.131 7.958   -8.284  1.00 0.00 ? 423 LEU A HB3  2  
ATOM 3066  H HG   . LEU A 1 31  ? -10.932 8.771   -9.075  1.00 0.00 ? 423 LEU A HG   2  
ATOM 3067  H HD11 . LEU A 1 31  ? -12.422 9.467   -11.601 1.00 0.00 ? 423 LEU A HD11 2  
ATOM 3068  H HD12 . LEU A 1 31  ? -10.785 9.981   -11.199 1.00 0.00 ? 423 LEU A HD12 2  
ATOM 3069  H HD13 . LEU A 1 31  ? -11.136 8.272   -11.439 1.00 0.00 ? 423 LEU A HD13 2  
ATOM 3070  H HD21 . LEU A 1 31  ? -13.218 10.684  -9.477  1.00 0.00 ? 423 LEU A HD21 2  
ATOM 3071  H HD22 . LEU A 1 31  ? -12.447 10.300  -7.942  1.00 0.00 ? 423 LEU A HD22 2  
ATOM 3072  H HD23 . LEU A 1 31  ? -11.533 11.130  -9.204  1.00 0.00 ? 423 LEU A HD23 2  
ATOM 3073  N N    . THR A 1 32  ? -10.280 5.843   -9.832  1.00 0.00 ? 424 THR A N    2  
ATOM 3074  C CA   . THR A 1 32  ? -9.013  5.420   -9.352  1.00 0.00 ? 424 THR A CA   2  
ATOM 3075  C C    . THR A 1 32  ? -8.067  6.605   -9.485  1.00 0.00 ? 424 THR A C    2  
ATOM 3076  O O    . THR A 1 32  ? -8.142  7.365   -10.477 1.00 0.00 ? 424 THR A O    2  
ATOM 3077  C CB   . THR A 1 32  ? -8.485  4.290   -10.240 1.00 0.00 ? 424 THR A CB   2  
ATOM 3078  O OG1  . THR A 1 32  ? -9.573  3.402   -10.570 1.00 0.00 ? 424 THR A OG1  2  
ATOM 3079  C CG2  . THR A 1 32  ? -7.400  3.502   -9.524  1.00 0.00 ? 424 THR A CG2  2  
ATOM 3080  H H    . THR A 1 32  ? -10.382 5.965   -10.801 1.00 0.00 ? 424 THR A H    2  
ATOM 3081  H HA   . THR A 1 32  ? -9.082  5.083   -8.330  1.00 0.00 ? 424 THR A HA   2  
ATOM 3082  H HB   . THR A 1 32  ? -8.068  4.760   -11.117 1.00 0.00 ? 424 THR A HB   2  
ATOM 3083  H HG1  . THR A 1 32  ? -10.113 3.875   -11.215 1.00 0.00 ? 424 THR A HG1  2  
ATOM 3084  H HG21 . THR A 1 32  ? -7.800  3.072   -8.616  1.00 0.00 ? 424 THR A HG21 2  
ATOM 3085  H HG22 . THR A 1 32  ? -7.043  2.713   -10.169 1.00 0.00 ? 424 THR A HG22 2  
ATOM 3086  H HG23 . THR A 1 32  ? -6.586  4.168   -9.280  1.00 0.00 ? 424 THR A HG23 2  
ATOM 3087  N N    . ARG A 1 33  ? -7.228  6.811   -8.524  1.00 0.00 ? 425 ARG A N    2  
ATOM 3088  C CA   . ARG A 1 33  ? -6.283  7.875   -8.622  1.00 0.00 ? 425 ARG A CA   2  
ATOM 3089  C C    . ARG A 1 33  ? -4.905  7.292   -8.698  1.00 0.00 ? 425 ARG A C    2  
ATOM 3090  O O    . ARG A 1 33  ? -4.642  6.271   -8.087  1.00 0.00 ? 425 ARG A O    2  
ATOM 3091  C CB   . ARG A 1 33  ? -6.412  8.840   -7.445  1.00 0.00 ? 425 ARG A CB   2  
ATOM 3092  C CG   . ARG A 1 33  ? -7.805  9.446   -7.290  1.00 0.00 ? 425 ARG A CG   2  
ATOM 3093  C CD   . ARG A 1 33  ? -8.284  10.100  -8.584  1.00 0.00 ? 425 ARG A CD   2  
ATOM 3094  N NE   . ARG A 1 33  ? -7.303  11.042  -9.150  1.00 0.00 ? 425 ARG A NE   2  
ATOM 3095  C CZ   . ARG A 1 33  ? -6.911  11.055  -10.439 1.00 0.00 ? 425 ARG A CZ   2  
ATOM 3096  N NH1  . ARG A 1 33  ? -7.334  10.108  -11.276 1.00 0.00 ? 425 ARG A NH1  2  
ATOM 3097  N NH2  . ARG A 1 33  ? -6.062  11.982  -10.863 1.00 0.00 ? 425 ARG A NH2  2  
ATOM 3098  H H    . ARG A 1 33  ? -7.220  6.225   -7.730  1.00 0.00 ? 425 ARG A H    2  
ATOM 3099  H HA   . ARG A 1 33  ? -6.483  8.408   -9.541  1.00 0.00 ? 425 ARG A HA   2  
ATOM 3100  H HB2  . ARG A 1 33  ? -6.170  8.311   -6.535  1.00 0.00 ? 425 ARG A HB2  2  
ATOM 3101  H HB3  . ARG A 1 33  ? -5.706  9.646   -7.577  1.00 0.00 ? 425 ARG A HB3  2  
ATOM 3102  H HG2  . ARG A 1 33  ? -8.475  8.624   -7.080  1.00 0.00 ? 425 ARG A HG2  2  
ATOM 3103  H HG3  . ARG A 1 33  ? -7.811  10.167  -6.487  1.00 0.00 ? 425 ARG A HG3  2  
ATOM 3104  H HD2  . ARG A 1 33  ? -8.488  9.323   -9.306  1.00 0.00 ? 425 ARG A HD2  2  
ATOM 3105  H HD3  . ARG A 1 33  ? -9.202  10.633  -8.377  1.00 0.00 ? 425 ARG A HD3  2  
ATOM 3106  H HE   . ARG A 1 33  ? -6.961  11.704  -8.505  1.00 0.00 ? 425 ARG A HE   2  
ATOM 3107  H HH11 . ARG A 1 33  ? -7.939  9.359   -10.987 1.00 0.00 ? 425 ARG A HH11 2  
ATOM 3108  H HH12 . ARG A 1 33  ? -7.094  10.095  -12.253 1.00 0.00 ? 425 ARG A HH12 2  
ATOM 3109  H HH21 . ARG A 1 33  ? -5.700  12.678  -10.239 1.00 0.00 ? 425 ARG A HH21 2  
ATOM 3110  H HH22 . ARG A 1 33  ? -5.744  12.039  -11.816 1.00 0.00 ? 425 ARG A HH22 2  
ATOM 3111  N N    . SER A 1 34  ? -4.039  7.927   -9.433  1.00 0.00 ? 426 SER A N    2  
ATOM 3112  C CA   . SER A 1 34  ? -2.716  7.430   -9.631  1.00 0.00 ? 426 SER A CA   2  
ATOM 3113  C C    . SER A 1 34  ? -1.687  8.446   -9.184  1.00 0.00 ? 426 SER A C    2  
ATOM 3114  O O    . SER A 1 34  ? -1.811  9.638   -9.477  1.00 0.00 ? 426 SER A O    2  
ATOM 3115  C CB   . SER A 1 34  ? -2.536  7.036   -11.095 1.00 0.00 ? 426 SER A CB   2  
ATOM 3116  O OG   . SER A 1 34  ? -3.099  8.019   -11.972 1.00 0.00 ? 426 SER A OG   2  
ATOM 3117  H H    . SER A 1 34  ? -4.261  8.777   -9.865  1.00 0.00 ? 426 SER A H    2  
ATOM 3118  H HA   . SER A 1 34  ? -2.607  6.543   -9.026  1.00 0.00 ? 426 SER A HA   2  
ATOM 3119  H HB2  . SER A 1 34  ? -1.485  6.923   -11.306 1.00 0.00 ? 426 SER A HB2  2  
ATOM 3120  H HB3  . SER A 1 34  ? -3.028  6.097   -11.291 1.00 0.00 ? 426 SER A HB3  2  
ATOM 3121  H HG   . SER A 1 34  ? -4.056  7.881   -11.954 1.00 0.00 ? 426 SER A HG   2  
ATOM 3122  N N    . LEU A 1 35  ? -0.714  7.991   -8.441  1.00 0.00 ? 427 LEU A N    2  
ATOM 3123  C CA   . LEU A 1 35  ? 0.332   8.851   -7.929  1.00 0.00 ? 427 LEU A CA   2  
ATOM 3124  C C    . LEU A 1 35  ? 1.694   8.210   -8.150  1.00 0.00 ? 427 LEU A C    2  
ATOM 3125  O O    . LEU A 1 35  ? 1.890   7.042   -7.796  1.00 0.00 ? 427 LEU A O    2  
ATOM 3126  C CB   . LEU A 1 35  ? 0.121   9.092   -6.431  1.00 0.00 ? 427 LEU A CB   2  
ATOM 3127  C CG   . LEU A 1 35  ? -1.169  9.812   -6.024  1.00 0.00 ? 427 LEU A CG   2  
ATOM 3128  C CD1  . LEU A 1 35  ? -1.293  9.834   -4.523  1.00 0.00 ? 427 LEU A CD1  2  
ATOM 3129  C CD2  . LEU A 1 35  ? -1.192  11.233  -6.569  1.00 0.00 ? 427 LEU A CD2  2  
ATOM 3130  H H    . LEU A 1 35  ? -0.689  7.032   -8.213  1.00 0.00 ? 427 LEU A H    2  
ATOM 3131  H HA   . LEU A 1 35  ? 0.278   9.798   -8.444  1.00 0.00 ? 427 LEU A HA   2  
ATOM 3132  H HB2  . LEU A 1 35  ? 0.131   8.131   -5.940  1.00 0.00 ? 427 LEU A HB2  2  
ATOM 3133  H HB3  . LEU A 1 35  ? 0.956   9.671   -6.065  1.00 0.00 ? 427 LEU A HB3  2  
ATOM 3134  H HG   . LEU A 1 35  ? -2.018  9.277   -6.425  1.00 0.00 ? 427 LEU A HG   2  
ATOM 3135  H HD11 . LEU A 1 35  ? -0.435  10.328  -4.091  1.00 0.00 ? 427 LEU A HD11 2  
ATOM 3136  H HD12 . LEU A 1 35  ? -2.190  10.365  -4.239  1.00 0.00 ? 427 LEU A HD12 2  
ATOM 3137  H HD13 . LEU A 1 35  ? -1.345  8.821   -4.150  1.00 0.00 ? 427 LEU A HD13 2  
ATOM 3138  H HD21 . LEU A 1 35  ? -0.346  11.782  -6.184  1.00 0.00 ? 427 LEU A HD21 2  
ATOM 3139  H HD22 . LEU A 1 35  ? -1.149  11.211  -7.648  1.00 0.00 ? 427 LEU A HD22 2  
ATOM 3140  H HD23 . LEU A 1 35  ? -2.106  11.720  -6.261  1.00 0.00 ? 427 LEU A HD23 2  
ATOM 3141  N N    . PRO A 1 36  ? 2.632   8.922   -8.791  1.00 0.00 ? 428 PRO A N    2  
ATOM 3142  C CA   . PRO A 1 36  ? 3.993   8.438   -8.961  1.00 0.00 ? 428 PRO A CA   2  
ATOM 3143  C C    . PRO A 1 36  ? 4.799   8.603   -7.667  1.00 0.00 ? 428 PRO A C    2  
ATOM 3144  O O    . PRO A 1 36  ? 4.746   9.659   -7.002  1.00 0.00 ? 428 PRO A O    2  
ATOM 3145  C CB   . PRO A 1 36  ? 4.580   9.332   -10.070 1.00 0.00 ? 428 PRO A CB   2  
ATOM 3146  C CG   . PRO A 1 36  ? 3.453   10.206  -10.532 1.00 0.00 ? 428 PRO A CG   2  
ATOM 3147  C CD   . PRO A 1 36  ? 2.446   10.232  -9.423  1.00 0.00 ? 428 PRO A CD   2  
ATOM 3148  H HA   . PRO A 1 36  ? 4.013   7.402   -9.266  1.00 0.00 ? 428 PRO A HA   2  
ATOM 3149  H HB2  . PRO A 1 36  ? 5.392   9.912   -9.657  1.00 0.00 ? 428 PRO A HB2  2  
ATOM 3150  H HB3  . PRO A 1 36  ? 4.956   8.714   -10.872 1.00 0.00 ? 428 PRO A HB3  2  
ATOM 3151  H HG2  . PRO A 1 36  ? 3.811   11.206  -10.723 1.00 0.00 ? 428 PRO A HG2  2  
ATOM 3152  H HG3  . PRO A 1 36  ? 3.011   9.793   -11.427 1.00 0.00 ? 428 PRO A HG3  2  
ATOM 3153  H HD2  . PRO A 1 36  ? 2.657   11.035  -8.734  1.00 0.00 ? 428 PRO A HD2  2  
ATOM 3154  H HD3  . PRO A 1 36  ? 1.458   10.328  -9.846  1.00 0.00 ? 428 PRO A HD3  2  
ATOM 3155  N N    . CYS A 1 37  ? 5.529   7.585   -7.310  1.00 0.00 ? 429 CYS A N    2  
ATOM 3156  C CA   . CYS A 1 37  ? 6.310   7.607   -6.108  1.00 0.00 ? 429 CYS A CA   2  
ATOM 3157  C C    . CYS A 1 37  ? 7.612   6.887   -6.318  1.00 0.00 ? 429 CYS A C    2  
ATOM 3158  O O    . CYS A 1 37  ? 7.794   6.189   -7.329  1.00 0.00 ? 429 CYS A O    2  
ATOM 3159  C CB   . CYS A 1 37  ? 5.533   6.955   -4.970  1.00 0.00 ? 429 CYS A CB   2  
ATOM 3160  S SG   . CYS A 1 37  ? 4.973   5.281   -5.332  1.00 0.00 ? 429 CYS A SG   2  
ATOM 3161  H H    . CYS A 1 37  ? 5.568   6.776   -7.869  1.00 0.00 ? 429 CYS A H    2  
ATOM 3162  H HA   . CYS A 1 37  ? 6.501   8.636   -5.852  1.00 0.00 ? 429 CYS A HA   2  
ATOM 3163  H HB2  . CYS A 1 37  ? 6.164   6.905   -4.095  1.00 0.00 ? 429 CYS A HB2  2  
ATOM 3164  H HB3  . CYS A 1 37  ? 4.663   7.554   -4.744  1.00 0.00 ? 429 CYS A HB3  2  
ATOM 3165  H HG   . CYS A 1 37  ? 4.886   5.157   -6.651  1.00 0.00 ? 429 CYS A HG   2  
ATOM 3166  N N    . GLN A 1 38  ? 8.518   7.055   -5.401  1.00 0.00 ? 430 GLN A N    2  
ATOM 3167  C CA   . GLN A 1 38  ? 9.746   6.357   -5.445  1.00 0.00 ? 430 GLN A CA   2  
ATOM 3168  C C    . GLN A 1 38  ? 9.810   5.481   -4.223  1.00 0.00 ? 430 GLN A C    2  
ATOM 3169  O O    . GLN A 1 38  ? 9.529   5.935   -3.072  1.00 0.00 ? 430 GLN A O    2  
ATOM 3170  C CB   . GLN A 1 38  ? 10.939  7.318   -5.528  1.00 0.00 ? 430 GLN A CB   2  
ATOM 3171  C CG   . GLN A 1 38  ? 10.862  8.257   -6.729  1.00 0.00 ? 430 GLN A CG   2  
ATOM 3172  C CD   . GLN A 1 38  ? 12.094  9.107   -6.912  1.00 0.00 ? 430 GLN A CD   2  
ATOM 3173  O OE1  . GLN A 1 38  ? 13.030  8.729   -7.619  1.00 0.00 ? 430 GLN A OE1  2  
ATOM 3174  N NE2  . GLN A 1 38  ? 12.124  10.248  -6.287  1.00 0.00 ? 430 GLN A NE2  2  
ATOM 3175  H H    . GLN A 1 38  ? 8.368   7.651   -4.630  1.00 0.00 ? 430 GLN A H    2  
ATOM 3176  H HA   . GLN A 1 38  ? 9.728   5.722   -6.319  1.00 0.00 ? 430 GLN A HA   2  
ATOM 3177  H HB2  . GLN A 1 38  ? 10.971  7.913   -4.627  1.00 0.00 ? 430 GLN A HB2  2  
ATOM 3178  H HB3  . GLN A 1 38  ? 11.850  6.744   -5.606  1.00 0.00 ? 430 GLN A HB3  2  
ATOM 3179  H HG2  . GLN A 1 38  ? 10.728  7.667   -7.623  1.00 0.00 ? 430 GLN A HG2  2  
ATOM 3180  H HG3  . GLN A 1 38  ? 10.008  8.907   -6.605  1.00 0.00 ? 430 GLN A HG3  2  
ATOM 3181  H HE21 . GLN A 1 38  ? 11.364  10.515  -5.723  1.00 0.00 ? 430 GLN A HE21 2  
ATOM 3182  H HE22 . GLN A 1 38  ? 12.910  10.823  -6.391  1.00 0.00 ? 430 GLN A HE22 2  
ATOM 3183  N N    . VAL A 1 39  ? 10.109  4.239   -4.456  1.00 0.00 ? 431 VAL A N    2  
ATOM 3184  C CA   . VAL A 1 39  ? 10.123  3.272   -3.430  1.00 0.00 ? 431 VAL A CA   2  
ATOM 3185  C C    . VAL A 1 39  ? 11.522  2.811   -3.183  1.00 0.00 ? 431 VAL A C    2  
ATOM 3186  O O    . VAL A 1 39  ? 12.244  2.302   -4.098  1.00 0.00 ? 431 VAL A O    2  
ATOM 3187  C CB   . VAL A 1 39  ? 9.234   2.058   -3.795  1.00 0.00 ? 431 VAL A CB   2  
ATOM 3188  C CG1  . VAL A 1 39  ? 9.182   1.036   -2.661  1.00 0.00 ? 431 VAL A CG1  2  
ATOM 3189  C CG2  . VAL A 1 39  ? 7.844   2.527   -4.161  1.00 0.00 ? 431 VAL A CG2  2  
ATOM 3190  H H    . VAL A 1 39  ? 10.350  3.928   -5.358  1.00 0.00 ? 431 VAL A H    2  
ATOM 3191  H HA   . VAL A 1 39  ? 9.728   3.708   -2.523  1.00 0.00 ? 431 VAL A HA   2  
ATOM 3192  H HB   . VAL A 1 39  ? 9.662   1.572   -4.660  1.00 0.00 ? 431 VAL A HB   2  
ATOM 3193  H HG11 . VAL A 1 39  ? 10.180  0.683   -2.451  1.00 0.00 ? 431 VAL A HG11 2  
ATOM 3194  H HG12 . VAL A 1 39  ? 8.772   1.499   -1.776  1.00 0.00 ? 431 VAL A HG12 2  
ATOM 3195  H HG13 . VAL A 1 39  ? 8.559   0.204   -2.952  1.00 0.00 ? 431 VAL A HG13 2  
ATOM 3196  H HG21 . VAL A 1 39  ? 7.433   3.096   -3.341  1.00 0.00 ? 431 VAL A HG21 2  
ATOM 3197  H HG22 . VAL A 1 39  ? 7.887   3.146   -5.046  1.00 0.00 ? 431 VAL A HG22 2  
ATOM 3198  H HG23 . VAL A 1 39  ? 7.211   1.670   -4.340  1.00 0.00 ? 431 VAL A HG23 2  
ATOM 3199  N N    . TYR A 1 40  ? 11.900  2.979   -1.983  1.00 0.00 ? 432 TYR A N    2  
ATOM 3200  C CA   . TYR A 1 40  ? 13.132  2.532   -1.498  1.00 0.00 ? 432 TYR A CA   2  
ATOM 3201  C C    . TYR A 1 40  ? 12.797  1.397   -0.609  1.00 0.00 ? 432 TYR A C    2  
ATOM 3202  O O    . TYR A 1 40  ? 11.653  1.291   -0.161  1.00 0.00 ? 432 TYR A O    2  
ATOM 3203  C CB   . TYR A 1 40  ? 13.826  3.626   -0.690  1.00 0.00 ? 432 TYR A CB   2  
ATOM 3204  C CG   . TYR A 1 40  ? 14.093  4.893   -1.459  1.00 0.00 ? 432 TYR A CG   2  
ATOM 3205  C CD1  . TYR A 1 40  ? 13.229  5.978   -1.376  1.00 0.00 ? 432 TYR A CD1  2  
ATOM 3206  C CD2  . TYR A 1 40  ? 15.209  5.005   -2.263  1.00 0.00 ? 432 TYR A CD2  2  
ATOM 3207  C CE1  . TYR A 1 40  ? 13.478  7.142   -2.074  1.00 0.00 ? 432 TYR A CE1  2  
ATOM 3208  C CE2  . TYR A 1 40  ? 15.468  6.165   -2.968  1.00 0.00 ? 432 TYR A CE2  2  
ATOM 3209  C CZ   . TYR A 1 40  ? 14.599  7.230   -2.869  1.00 0.00 ? 432 TYR A CZ   2  
ATOM 3210  O OH   . TYR A 1 40  ? 14.858  8.398   -3.563  1.00 0.00 ? 432 TYR A OH   2  
ATOM 3211  H H    . TYR A 1 40  ? 11.283  3.405   -1.343  1.00 0.00 ? 432 TYR A H    2  
ATOM 3212  H HA   . TYR A 1 40  ? 13.763  2.213   -2.314  1.00 0.00 ? 432 TYR A HA   2  
ATOM 3213  H HB2  . TYR A 1 40  ? 13.209  3.882   0.158   1.00 0.00 ? 432 TYR A HB2  2  
ATOM 3214  H HB3  . TYR A 1 40  ? 14.771  3.240   -0.337  1.00 0.00 ? 432 TYR A HB3  2  
ATOM 3215  H HD1  . TYR A 1 40  ? 12.352  5.898   -0.751  1.00 0.00 ? 432 TYR A HD1  2  
ATOM 3216  H HD2  . TYR A 1 40  ? 15.874  4.156   -2.332  1.00 0.00 ? 432 TYR A HD2  2  
ATOM 3217  H HE1  . TYR A 1 40  ? 12.796  7.978   -1.999  1.00 0.00 ? 432 TYR A HE1  2  
ATOM 3218  H HE2  . TYR A 1 40  ? 16.348  6.235   -3.591  1.00 0.00 ? 432 TYR A HE2  2  
ATOM 3219  H HH   . TYR A 1 40  ? 15.094  8.163   -4.471  1.00 0.00 ? 432 TYR A HH   2  
ATOM 3220  N N    . VAL A 1 41  ? 13.714  0.568   -0.334  1.00 0.00 ? 433 VAL A N    2  
ATOM 3221  C CA   . VAL A 1 41  ? 13.416  -0.509  0.514   1.00 0.00 ? 433 VAL A CA   2  
ATOM 3222  C C    . VAL A 1 41  ? 14.305  -0.456  1.706   1.00 0.00 ? 433 VAL A C    2  
ATOM 3223  O O    . VAL A 1 41  ? 15.470  -0.036  1.617   1.00 0.00 ? 433 VAL A O    2  
ATOM 3224  C CB   . VAL A 1 41  ? 13.505  -1.887  -0.198  1.00 0.00 ? 433 VAL A CB   2  
ATOM 3225  C CG1  . VAL A 1 41  ? 12.563  -1.921  -1.381  1.00 0.00 ? 433 VAL A CG1  2  
ATOM 3226  C CG2  . VAL A 1 41  ? 14.923  -2.211  -0.640  1.00 0.00 ? 433 VAL A CG2  2  
ATOM 3227  H H    . VAL A 1 41  ? 14.611  0.668   -0.725  1.00 0.00 ? 433 VAL A H    2  
ATOM 3228  H HA   . VAL A 1 41  ? 12.397  -0.347  0.815   1.00 0.00 ? 433 VAL A HA   2  
ATOM 3229  H HB   . VAL A 1 41  ? 13.173  -2.648  0.493   1.00 0.00 ? 433 VAL A HB   2  
ATOM 3230  H HG11 . VAL A 1 41  ? 11.552  -1.730  -1.052  1.00 0.00 ? 433 VAL A HG11 2  
ATOM 3231  H HG12 . VAL A 1 41  ? 12.852  -1.154  -2.082  1.00 0.00 ? 433 VAL A HG12 2  
ATOM 3232  H HG13 . VAL A 1 41  ? 12.612  -2.886  -1.864  1.00 0.00 ? 433 VAL A HG13 2  
ATOM 3233  H HG21 . VAL A 1 41  ? 15.575  -2.207  0.221   1.00 0.00 ? 433 VAL A HG21 2  
ATOM 3234  H HG22 . VAL A 1 41  ? 14.937  -3.187  -1.100  1.00 0.00 ? 433 VAL A HG22 2  
ATOM 3235  H HG23 . VAL A 1 41  ? 15.252  -1.471  -1.354  1.00 0.00 ? 433 VAL A HG23 2  
ATOM 3236  N N    . ASN A 1 42  ? 13.744  -0.766  2.819   1.00 0.00 ? 434 ASN A N    2  
ATOM 3237  C CA   . ASN A 1 42  ? 14.464  -0.780  4.023   1.00 0.00 ? 434 ASN A CA   2  
ATOM 3238  C C    . ASN A 1 42  ? 14.939  -2.188  4.318   1.00 0.00 ? 434 ASN A C    2  
ATOM 3239  O O    . ASN A 1 42  ? 14.089  -3.205  4.348   1.00 0.00 ? 434 ASN A O    2  
ATOM 3240  C CB   . ASN A 1 42  ? 13.671  -0.159  5.172   1.00 0.00 ? 434 ASN A CB   2  
ATOM 3241  C CG   . ASN A 1 42  ? 14.482  -0.067  6.446   1.00 0.00 ? 434 ASN A CG   2  
ATOM 3242  O OD1  . ASN A 1 42  ? 14.481  -0.982  7.279   1.00 0.00 ? 434 ASN A OD1  2  
ATOM 3243  N ND2  . ASN A 1 42  ? 15.192  1.023   6.605   1.00 0.00 ? 434 ASN A ND2  2  
ATOM 3244  H H    . ASN A 1 42  ? 12.816  -1.089  2.807   1.00 0.00 ? 434 ASN A H    2  
ATOM 3245  H HA   . ASN A 1 42  ? 15.346  -0.182  3.847   1.00 0.00 ? 434 ASN A HA   2  
ATOM 3246  H HB2  . ASN A 1 42  ? 13.393  0.845   4.884   1.00 0.00 ? 434 ASN A HB2  2  
ATOM 3247  H HB3  . ASN A 1 42  ? 12.776  -0.728  5.356   1.00 0.00 ? 434 ASN A HB3  2  
ATOM 3248  H HD21 . ASN A 1 42  ? 15.162  1.716   5.905   1.00 0.00 ? 434 ASN A HD21 2  
ATOM 3249  H HD22 . ASN A 1 42  ? 15.735  1.105   7.417   1.00 0.00 ? 434 ASN A HD22 2  
ATOM 3250  N N    . HIS A 1 43  ? 16.255  -2.210  4.632   1.00 0.00 ? 435 HIS A N    2  
ATOM 3251  C CA   . HIS A 1 43  ? 17.124  -3.376  4.800   1.00 0.00 ? 435 HIS A CA   2  
ATOM 3252  C C    . HIS A 1 43  ? 16.389  -4.618  5.240   1.00 0.00 ? 435 HIS A C    2  
ATOM 3253  O O    . HIS A 1 43  ? 15.658  -4.623  6.247   1.00 0.00 ? 435 HIS A O    2  
ATOM 3254  C CB   . HIS A 1 43  ? 18.269  -3.075  5.791   1.00 0.00 ? 435 HIS A CB   2  
ATOM 3255  C CG   . HIS A 1 43  ? 19.260  -2.029  5.336   1.00 0.00 ? 435 HIS A CG   2  
ATOM 3256  N ND1  . HIS A 1 43  ? 20.592  -2.280  5.090   1.00 0.00 ? 435 HIS A ND1  2  
ATOM 3257  C CD2  . HIS A 1 43  ? 19.096  -0.704  5.126   1.00 0.00 ? 435 HIS A CD2  2  
ATOM 3258  C CE1  . HIS A 1 43  ? 21.179  -1.129  4.753   1.00 0.00 ? 435 HIS A CE1  2  
ATOM 3259  N NE2  . HIS A 1 43  ? 20.311  -0.139  4.761   1.00 0.00 ? 435 HIS A NE2  2  
ATOM 3260  H H    . HIS A 1 43  ? 16.673  -1.333  4.758   1.00 0.00 ? 435 HIS A H    2  
ATOM 3261  H HA   . HIS A 1 43  ? 17.572  -3.521  3.825   1.00 0.00 ? 435 HIS A HA   2  
ATOM 3262  H HB2  . HIS A 1 43  ? 17.840  -2.731  6.721   1.00 0.00 ? 435 HIS A HB2  2  
ATOM 3263  H HB3  . HIS A 1 43  ? 18.811  -3.991  5.976   1.00 0.00 ? 435 HIS A HB3  2  
ATOM 3264  H HD1  . HIS A 1 43  ? 21.036  -3.154  5.139   1.00 0.00 ? 435 HIS A HD1  2  
ATOM 3265  H HD2  . HIS A 1 43  ? 18.160  -0.169  5.178   1.00 0.00 ? 435 HIS A HD2  2  
ATOM 3266  H HE1  . HIS A 1 43  ? 22.224  -1.026  4.505   1.00 0.00 ? 435 HIS A HE1  2  
ATOM 3267  N N    . GLY A 1 44  ? 16.657  -5.682  4.561   1.00 0.00 ? 436 GLY A N    2  
ATOM 3268  C CA   . GLY A 1 44  ? 15.939  -6.890  4.775   1.00 0.00 ? 436 GLY A CA   2  
ATOM 3269  C C    . GLY A 1 44  ? 15.071  -7.209  3.590   1.00 0.00 ? 436 GLY A C    2  
ATOM 3270  O O    . GLY A 1 44  ? 14.379  -8.229  3.582   1.00 0.00 ? 436 GLY A O    2  
ATOM 3271  H H    . GLY A 1 44  ? 17.364  -5.660  3.882   1.00 0.00 ? 436 GLY A H    2  
ATOM 3272  H HA2  . GLY A 1 44  ? 16.641  -7.695  4.938   1.00 0.00 ? 436 GLY A HA2  2  
ATOM 3273  H HA3  . GLY A 1 44  ? 15.312  -6.779  5.646   1.00 0.00 ? 436 GLY A HA3  2  
ATOM 3274  N N    . GLU A 1 45  ? 15.071  -6.310  2.611   1.00 0.00 ? 437 GLU A N    2  
ATOM 3275  C CA   . GLU A 1 45  ? 14.416  -6.521  1.388   1.00 0.00 ? 437 GLU A CA   2  
ATOM 3276  C C    . GLU A 1 45  ? 15.446  -6.560  0.269   1.00 0.00 ? 437 GLU A C    2  
ATOM 3277  O O    . GLU A 1 45  ? 16.113  -5.552  -0.022  1.00 0.00 ? 437 GLU A O    2  
ATOM 3278  C CB   . GLU A 1 45  ? 13.374  -5.441  1.108   1.00 0.00 ? 437 GLU A CB   2  
ATOM 3279  C CG   . GLU A 1 45  ? 12.741  -5.669  -0.224  1.00 0.00 ? 437 GLU A CG   2  
ATOM 3280  C CD   . GLU A 1 45  ? 11.336  -5.127  -0.376  1.00 0.00 ? 437 GLU A CD   2  
ATOM 3281  O OE1  . GLU A 1 45  ? 10.503  -5.393  0.511   1.00 0.00 ? 437 GLU A OE1  2  
ATOM 3282  O OE2  . GLU A 1 45  ? 11.004  -4.617  -1.441  1.00 0.00 ? 437 GLU A OE2  2  
ATOM 3283  H H    . GLU A 1 45  ? 15.532  -5.451  2.669   1.00 0.00 ? 437 GLU A H    2  
ATOM 3284  H HA   . GLU A 1 45  ? 13.922  -7.480  1.438   1.00 0.00 ? 437 GLU A HA   2  
ATOM 3285  H HB2  . GLU A 1 45  ? 12.620  -5.408  1.879   1.00 0.00 ? 437 GLU A HB2  2  
ATOM 3286  H HB3  . GLU A 1 45  ? 13.881  -4.489  1.076   1.00 0.00 ? 437 GLU A HB3  2  
ATOM 3287  H HG2  . GLU A 1 45  ? 13.403  -5.190  -0.927  1.00 0.00 ? 437 GLU A HG2  2  
ATOM 3288  H HG3  . GLU A 1 45  ? 12.758  -6.734  -0.380  1.00 0.00 ? 437 GLU A HG3  2  
ATOM 3289  N N    . ASN A 1 46  ? 15.621  -7.708  -0.315  1.00 0.00 ? 438 ASN A N    2  
ATOM 3290  C CA   . ASN A 1 46  ? 16.531  -7.856  -1.427  1.00 0.00 ? 438 ASN A CA   2  
ATOM 3291  C C    . ASN A 1 46  ? 15.882  -8.700  -2.485  1.00 0.00 ? 438 ASN A C    2  
ATOM 3292  O O    . ASN A 1 46  ? 15.820  -9.926  -2.365  1.00 0.00 ? 438 ASN A O    2  
ATOM 3293  C CB   . ASN A 1 46  ? 17.846  -8.511  -0.981  1.00 0.00 ? 438 ASN A CB   2  
ATOM 3294  C CG   . ASN A 1 46  ? 18.845  -8.678  -2.116  1.00 0.00 ? 438 ASN A CG   2  
ATOM 3295  O OD1  . ASN A 1 46  ? 18.892  -7.875  -3.058  1.00 0.00 ? 438 ASN A OD1  2  
ATOM 3296  N ND2  . ASN A 1 46  ? 19.638  -9.709  -2.046  1.00 0.00 ? 438 ASN A ND2  2  
ATOM 3297  H H    . ASN A 1 46  ? 15.129  -8.497  0.000   1.00 0.00 ? 438 ASN A H    2  
ATOM 3298  H HA   . ASN A 1 46  ? 16.744  -6.878  -1.828  1.00 0.00 ? 438 ASN A HA   2  
ATOM 3299  H HB2  . ASN A 1 46  ? 18.302  -7.898  -0.218  1.00 0.00 ? 438 ASN A HB2  2  
ATOM 3300  H HB3  . ASN A 1 46  ? 17.629  -9.485  -0.570  1.00 0.00 ? 438 ASN A HB3  2  
ATOM 3301  H HD21 . ASN A 1 46  ? 19.547  -10.314 -1.276  1.00 0.00 ? 438 ASN A HD21 2  
ATOM 3302  H HD22 . ASN A 1 46  ? 20.305  -9.844  -2.753  1.00 0.00 ? 438 ASN A HD22 2  
ATOM 3303  N N    . LEU A 1 47  ? 15.320  -8.058  -3.466  1.00 0.00 ? 439 LEU A N    2  
ATOM 3304  C CA   . LEU A 1 47  ? 14.728  -8.762  -4.571  1.00 0.00 ? 439 LEU A CA   2  
ATOM 3305  C C    . LEU A 1 47  ? 15.056  -8.050  -5.853  1.00 0.00 ? 439 LEU A C    2  
ATOM 3306  O O    . LEU A 1 47  ? 15.381  -6.847  -5.839  1.00 0.00 ? 439 LEU A O    2  
ATOM 3307  C CB   . LEU A 1 47  ? 13.196  -8.931  -4.441  1.00 0.00 ? 439 LEU A CB   2  
ATOM 3308  C CG   . LEU A 1 47  ? 12.304  -7.715  -4.746  1.00 0.00 ? 439 LEU A CG   2  
ATOM 3309  C CD1  . LEU A 1 47  ? 10.863  -8.146  -4.764  1.00 0.00 ? 439 LEU A CD1  2  
ATOM 3310  C CD2  . LEU A 1 47  ? 12.497  -6.596  -3.734  1.00 0.00 ? 439 LEU A CD2  2  
ATOM 3311  H H    . LEU A 1 47  ? 15.319  -7.076  -3.473  1.00 0.00 ? 439 LEU A H    2  
ATOM 3312  H HA   . LEU A 1 47  ? 15.188  -9.738  -4.599  1.00 0.00 ? 439 LEU A HA   2  
ATOM 3313  H HB2  . LEU A 1 47  ? 12.893  -9.728  -5.103  1.00 0.00 ? 439 LEU A HB2  2  
ATOM 3314  H HB3  . LEU A 1 47  ? 12.988  -9.249  -3.429  1.00 0.00 ? 439 LEU A HB3  2  
ATOM 3315  H HG   . LEU A 1 47  ? 12.548  -7.342  -5.731  1.00 0.00 ? 439 LEU A HG   2  
ATOM 3316  H HD11 . LEU A 1 47  ? 10.723  -8.917  -5.507  1.00 0.00 ? 439 LEU A HD11 2  
ATOM 3317  H HD12 . LEU A 1 47  ? 10.589  -8.523  -3.790  1.00 0.00 ? 439 LEU A HD12 2  
ATOM 3318  H HD13 . LEU A 1 47  ? 10.244  -7.296  -5.008  1.00 0.00 ? 439 LEU A HD13 2  
ATOM 3319  H HD21 . LEU A 1 47  ? 12.262  -6.955  -2.742  1.00 0.00 ? 439 LEU A HD21 2  
ATOM 3320  H HD22 . LEU A 1 47  ? 13.524  -6.265  -3.761  1.00 0.00 ? 439 LEU A HD22 2  
ATOM 3321  H HD23 . LEU A 1 47  ? 11.847  -5.767  -3.978  1.00 0.00 ? 439 LEU A HD23 2  
ATOM 3322  N N    . LYS A 1 48  ? 14.992  -8.754  -6.936  1.00 0.00 ? 440 LYS A N    2  
ATOM 3323  C CA   . LYS A 1 48  ? 15.183  -8.151  -8.213  1.00 0.00 ? 440 LYS A CA   2  
ATOM 3324  C C    . LYS A 1 48  ? 13.800  -7.710  -8.694  1.00 0.00 ? 440 LYS A C    2  
ATOM 3325  O O    . LYS A 1 48  ? 12.966  -8.547  -9.038  1.00 0.00 ? 440 LYS A O    2  
ATOM 3326  C CB   . LYS A 1 48  ? 15.802  -9.169  -9.181  1.00 0.00 ? 440 LYS A CB   2  
ATOM 3327  C CG   . LYS A 1 48  ? 16.439  -8.566  -10.426 1.00 0.00 ? 440 LYS A CG   2  
ATOM 3328  C CD   . LYS A 1 48  ? 17.010  -9.661  -11.318 1.00 0.00 ? 440 LYS A CD   2  
ATOM 3329  C CE   . LYS A 1 48  ? 17.947  -9.107  -12.385 1.00 0.00 ? 440 LYS A CE   2  
ATOM 3330  N NZ   . LYS A 1 48  ? 17.292  -8.155  -13.306 1.00 0.00 ? 440 LYS A NZ   2  
ATOM 3331  H H    . LYS A 1 48  ? 14.801  -9.716  -6.870  1.00 0.00 ? 440 LYS A H    2  
ATOM 3332  H HA   . LYS A 1 48  ? 15.830  -7.294  -8.104  1.00 0.00 ? 440 LYS A HA   2  
ATOM 3333  H HB2  . LYS A 1 48  ? 16.565  -9.721  -8.655  1.00 0.00 ? 440 LYS A HB2  2  
ATOM 3334  H HB3  . LYS A 1 48  ? 15.030  -9.857  -9.493  1.00 0.00 ? 440 LYS A HB3  2  
ATOM 3335  H HG2  . LYS A 1 48  ? 15.690  -8.012  -10.973 1.00 0.00 ? 440 LYS A HG2  2  
ATOM 3336  H HG3  . LYS A 1 48  ? 17.235  -7.900  -10.130 1.00 0.00 ? 440 LYS A HG3  2  
ATOM 3337  H HD2  . LYS A 1 48  ? 17.559  -10.360 -10.705 1.00 0.00 ? 440 LYS A HD2  2  
ATOM 3338  H HD3  . LYS A 1 48  ? 16.192  -10.174 -11.802 1.00 0.00 ? 440 LYS A HD3  2  
ATOM 3339  H HE2  . LYS A 1 48  ? 18.768  -8.608  -11.894 1.00 0.00 ? 440 LYS A HE2  2  
ATOM 3340  H HE3  . LYS A 1 48  ? 18.332  -9.938  -12.956 1.00 0.00 ? 440 LYS A HE3  2  
ATOM 3341  H HZ1  . LYS A 1 48  ? 16.849  -7.368  -12.792 1.00 0.00 ? 440 LYS A HZ1  2  
ATOM 3342  H HZ2  . LYS A 1 48  ? 18.002  -7.754  -13.953 1.00 0.00 ? 440 LYS A HZ2  2  
ATOM 3343  H HZ3  . LYS A 1 48  ? 16.563  -8.640  -13.879 1.00 0.00 ? 440 LYS A HZ3  2  
ATOM 3344  N N    . THR A 1 49  ? 13.552  -6.415  -8.697  1.00 0.00 ? 441 THR A N    2  
ATOM 3345  C CA   . THR A 1 49  ? 12.248  -5.816  -9.049  1.00 0.00 ? 441 THR A CA   2  
ATOM 3346  C C    . THR A 1 49  ? 11.958  -5.849  -10.573 1.00 0.00 ? 441 THR A C    2  
ATOM 3347  O O    . THR A 1 49  ? 11.200  -5.040  -11.099 1.00 0.00 ? 441 THR A O    2  
ATOM 3348  C CB   . THR A 1 49  ? 12.220  -4.364  -8.526  1.00 0.00 ? 441 THR A CB   2  
ATOM 3349  O OG1  . THR A 1 49  ? 13.502  -3.750  -8.770  1.00 0.00 ? 441 THR A OG1  2  
ATOM 3350  C CG2  . THR A 1 49  ? 11.914  -4.323  -7.037  1.00 0.00 ? 441 THR A CG2  2  
ATOM 3351  H H    . THR A 1 49  ? 14.265  -5.785  -8.455  1.00 0.00 ? 441 THR A H    2  
ATOM 3352  H HA   . THR A 1 49  ? 11.477  -6.371  -8.536  1.00 0.00 ? 441 THR A HA   2  
ATOM 3353  H HB   . THR A 1 49  ? 11.460  -3.815  -9.065  1.00 0.00 ? 441 THR A HB   2  
ATOM 3354  H HG1  . THR A 1 49  ? 13.442  -2.824  -8.492  1.00 0.00 ? 441 THR A HG1  2  
ATOM 3355  H HG21 . THR A 1 49  ? 12.650  -4.902  -6.498  1.00 0.00 ? 441 THR A HG21 2  
ATOM 3356  H HG22 . THR A 1 49  ? 11.938  -3.299  -6.694  1.00 0.00 ? 441 THR A HG22 2  
ATOM 3357  H HG23 . THR A 1 49  ? 10.929  -4.732  -6.866  1.00 0.00 ? 441 THR A HG23 2  
ATOM 3358  N N    . GLU A 1 50  ? 12.472  -6.866  -11.216 1.00 0.00 ? 442 GLU A N    2  
ATOM 3359  C CA   . GLU A 1 50  ? 12.421  -7.042  -12.650 1.00 0.00 ? 442 GLU A CA   2  
ATOM 3360  C C    . GLU A 1 50  ? 11.003  -7.281  -13.165 1.00 0.00 ? 442 GLU A C    2  
ATOM 3361  O O    . GLU A 1 50  ? 10.567  -6.639  -14.117 1.00 0.00 ? 442 GLU A O    2  
ATOM 3362  C CB   . GLU A 1 50  ? 13.315  -8.213  -12.997 1.00 0.00 ? 442 GLU A CB   2  
ATOM 3363  C CG   . GLU A 1 50  ? 13.345  -8.606  -14.444 1.00 0.00 ? 442 GLU A CG   2  
ATOM 3364  C CD   . GLU A 1 50  ? 14.317  -9.712  -14.664 1.00 0.00 ? 442 GLU A CD   2  
ATOM 3365  O OE1  . GLU A 1 50  ? 13.919  -10.890 -14.622 1.00 0.00 ? 442 GLU A OE1  2  
ATOM 3366  O OE2  . GLU A 1 50  ? 15.512  -9.421  -14.834 1.00 0.00 ? 442 GLU A OE2  2  
ATOM 3367  H H    . GLU A 1 50  ? 12.894  -7.559  -10.665 1.00 0.00 ? 442 GLU A H    2  
ATOM 3368  H HA   . GLU A 1 50  ? 12.833  -6.163  -13.123 1.00 0.00 ? 442 GLU A HA   2  
ATOM 3369  H HB2  . GLU A 1 50  ? 14.327  -7.984  -12.699 1.00 0.00 ? 442 GLU A HB2  2  
ATOM 3370  H HB3  . GLU A 1 50  ? 12.980  -9.065  -12.427 1.00 0.00 ? 442 GLU A HB3  2  
ATOM 3371  H HG2  . GLU A 1 50  ? 12.360  -8.938  -14.738 1.00 0.00 ? 442 GLU A HG2  2  
ATOM 3372  H HG3  . GLU A 1 50  ? 13.639  -7.754  -15.040 1.00 0.00 ? 442 GLU A HG3  2  
ATOM 3373  N N    . GLN A 1 51  ? 10.275  -8.164  -12.516 1.00 0.00 ? 443 GLN A N    2  
ATOM 3374  C CA   . GLN A 1 51  ? 8.935   -8.507  -12.972 1.00 0.00 ? 443 GLN A CA   2  
ATOM 3375  C C    . GLN A 1 51  ? 7.878   -7.650  -12.289 1.00 0.00 ? 443 GLN A C    2  
ATOM 3376  O O    . GLN A 1 51  ? 6.689   -7.961  -12.332 1.00 0.00 ? 443 GLN A O    2  
ATOM 3377  C CB   . GLN A 1 51  ? 8.643   -9.995  -12.759 1.00 0.00 ? 443 GLN A CB   2  
ATOM 3378  C CG   . GLN A 1 51  ? 9.634   -10.924 -13.455 1.00 0.00 ? 443 GLN A CG   2  
ATOM 3379  C CD   . GLN A 1 51  ? 9.261   -12.394 -13.353 1.00 0.00 ? 443 GLN A CD   2  
ATOM 3380  O OE1  . GLN A 1 51  ? 10.124  -13.263 -13.305 1.00 0.00 ? 443 GLN A OE1  2  
ATOM 3381  N NE2  . GLN A 1 51  ? 7.988   -12.692 -13.367 1.00 0.00 ? 443 GLN A NE2  2  
ATOM 3382  H H    . GLN A 1 51  ? 10.638  -8.613  -11.723 1.00 0.00 ? 443 GLN A H    2  
ATOM 3383  H HA   . GLN A 1 51  ? 8.898   -8.298  -14.031 1.00 0.00 ? 443 GLN A HA   2  
ATOM 3384  H HB2  . GLN A 1 51  ? 8.666   -10.208 -11.700 1.00 0.00 ? 443 GLN A HB2  2  
ATOM 3385  H HB3  . GLN A 1 51  ? 7.655   -10.207 -13.137 1.00 0.00 ? 443 GLN A HB3  2  
ATOM 3386  H HG2  . GLN A 1 51  ? 9.678   -10.658 -14.500 1.00 0.00 ? 443 GLN A HG2  2  
ATOM 3387  H HG3  . GLN A 1 51  ? 10.610  -10.782 -13.016 1.00 0.00 ? 443 GLN A HG3  2  
ATOM 3388  H HE21 . GLN A 1 51  ? 7.329   -11.972 -13.438 1.00 0.00 ? 443 GLN A HE21 2  
ATOM 3389  H HE22 . GLN A 1 51  ? 7.761   -13.645 -13.328 1.00 0.00 ? 443 GLN A HE22 2  
ATOM 3390  N N    . TRP A 1 52  ? 8.314   -6.577  -11.674 1.00 0.00 ? 444 TRP A N    2  
ATOM 3391  C CA   . TRP A 1 52  ? 7.413   -5.651  -11.032 1.00 0.00 ? 444 TRP A CA   2  
ATOM 3392  C C    . TRP A 1 52  ? 6.725   -4.776  -12.056 1.00 0.00 ? 444 TRP A C    2  
ATOM 3393  O O    . TRP A 1 52  ? 7.387   -4.205  -12.943 1.00 0.00 ? 444 TRP A O    2  
ATOM 3394  C CB   . TRP A 1 52  ? 8.140   -4.772  -10.013 1.00 0.00 ? 444 TRP A CB   2  
ATOM 3395  C CG   . TRP A 1 52  ? 8.354   -5.413  -8.680  1.00 0.00 ? 444 TRP A CG   2  
ATOM 3396  C CD1  . TRP A 1 52  ? 8.775   -6.683  -8.426  1.00 0.00 ? 444 TRP A CD1  2  
ATOM 3397  C CD2  . TRP A 1 52  ? 8.171   -4.785  -7.409  1.00 0.00 ? 444 TRP A CD2  2  
ATOM 3398  N NE1  . TRP A 1 52  ? 8.845   -6.889  -7.075  1.00 0.00 ? 444 TRP A NE1  2  
ATOM 3399  C CE2  . TRP A 1 52  ? 8.480   -5.732  -6.426  1.00 0.00 ? 444 TRP A CE2  2  
ATOM 3400  C CE3  . TRP A 1 52  ? 7.765   -3.508  -7.015  1.00 0.00 ? 444 TRP A CE3  2  
ATOM 3401  C CZ2  . TRP A 1 52  ? 8.399   -5.443  -5.062  1.00 0.00 ? 444 TRP A CZ2  2  
ATOM 3402  C CZ3  . TRP A 1 52  ? 7.686   -3.217  -5.669  1.00 0.00 ? 444 TRP A CZ3  2  
ATOM 3403  C CH2  . TRP A 1 52  ? 8.000   -4.180  -4.705  1.00 0.00 ? 444 TRP A CH2  2  
ATOM 3404  H H    . TRP A 1 52  ? 9.275   -6.389  -11.680 1.00 0.00 ? 444 TRP A H    2  
ATOM 3405  H HA   . TRP A 1 52  ? 6.670   -6.238  -10.513 1.00 0.00 ? 444 TRP A HA   2  
ATOM 3406  H HB2  . TRP A 1 52  ? 9.112   -4.514  -10.408 1.00 0.00 ? 444 TRP A HB2  2  
ATOM 3407  H HB3  . TRP A 1 52  ? 7.567   -3.868  -9.864  1.00 0.00 ? 444 TRP A HB3  2  
ATOM 3408  H HD1  . TRP A 1 52  ? 9.006   -7.413  -9.188  1.00 0.00 ? 444 TRP A HD1  2  
ATOM 3409  H HE1  . TRP A 1 52  ? 9.118   -7.730  -6.654  1.00 0.00 ? 444 TRP A HE1  2  
ATOM 3410  H HE3  . TRP A 1 52  ? 7.523   -2.753  -7.747  1.00 0.00 ? 444 TRP A HE3  2  
ATOM 3411  H HZ2  . TRP A 1 52  ? 8.635   -6.173  -4.303  1.00 0.00 ? 444 TRP A HZ2  2  
ATOM 3412  H HZ3  . TRP A 1 52  ? 7.374   -2.230  -5.354  1.00 0.00 ? 444 TRP A HZ3  2  
ATOM 3413  H HH2  . TRP A 1 52  ? 7.924   -3.913  -3.662  1.00 0.00 ? 444 TRP A HH2  2  
ATOM 3414  N N    . PRO A 1 53  ? 5.396   -4.685  -11.980 1.00 0.00 ? 445 PRO A N    2  
ATOM 3415  C CA   . PRO A 1 53  ? 4.627   -3.798  -12.831 1.00 0.00 ? 445 PRO A CA   2  
ATOM 3416  C C    . PRO A 1 53  ? 4.869   -2.348  -12.418 1.00 0.00 ? 445 PRO A C    2  
ATOM 3417  O O    . PRO A 1 53  ? 5.379   -2.087  -11.331 1.00 0.00 ? 445 PRO A O    2  
ATOM 3418  C CB   . PRO A 1 53  ? 3.169   -4.202  -12.570 1.00 0.00 ? 445 PRO A CB   2  
ATOM 3419  C CG   . PRO A 1 53  ? 3.178   -4.825  -11.221 1.00 0.00 ? 445 PRO A CG   2  
ATOM 3420  C CD   . PRO A 1 53  ? 4.533   -5.448  -11.050 1.00 0.00 ? 445 PRO A CD   2  
ATOM 3421  H HA   . PRO A 1 53  ? 4.884   -3.941  -13.869 1.00 0.00 ? 445 PRO A HA   2  
ATOM 3422  H HB2  . PRO A 1 53  ? 2.537   -3.327  -12.595 1.00 0.00 ? 445 PRO A HB2  2  
ATOM 3423  H HB3  . PRO A 1 53  ? 2.846   -4.904  -13.323 1.00 0.00 ? 445 PRO A HB3  2  
ATOM 3424  H HG2  . PRO A 1 53  ? 3.019   -4.065  -10.470 1.00 0.00 ? 445 PRO A HG2  2  
ATOM 3425  H HG3  . PRO A 1 53  ? 2.408   -5.580  -11.159 1.00 0.00 ? 445 PRO A HG3  2  
ATOM 3426  H HD2  . PRO A 1 53  ? 4.870   -5.334  -10.030 1.00 0.00 ? 445 PRO A HD2  2  
ATOM 3427  H HD3  . PRO A 1 53  ? 4.505   -6.492  -11.326 1.00 0.00 ? 445 PRO A HD3  2  
ATOM 3428  N N    . GLN A 1 54  ? 4.527   -1.416  -13.266 1.00 0.00 ? 446 GLN A N    2  
ATOM 3429  C CA   . GLN A 1 54  ? 4.732   -0.015  -12.955 1.00 0.00 ? 446 GLN A CA   2  
ATOM 3430  C C    . GLN A 1 54  ? 3.587   0.568   -12.165 1.00 0.00 ? 446 GLN A C    2  
ATOM 3431  O O    . GLN A 1 54  ? 3.654   1.713   -11.723 1.00 0.00 ? 446 GLN A O    2  
ATOM 3432  C CB   . GLN A 1 54  ? 5.022   0.806   -14.211 1.00 0.00 ? 446 GLN A CB   2  
ATOM 3433  C CG   . GLN A 1 54  ? 6.366   0.462   -14.819 1.00 0.00 ? 446 GLN A CG   2  
ATOM 3434  C CD   . GLN A 1 54  ? 7.519   0.729   -13.860 1.00 0.00 ? 446 GLN A CD   2  
ATOM 3435  O OE1  . GLN A 1 54  ? 8.523   0.030   -13.874 1.00 0.00 ? 446 GLN A OE1  2  
ATOM 3436  N NE2  . GLN A 1 54  ? 7.422   1.776   -13.083 1.00 0.00 ? 446 GLN A NE2  2  
ATOM 3437  H H    . GLN A 1 54  ? 4.110   -1.672  -14.118 1.00 0.00 ? 446 GLN A H    2  
ATOM 3438  H HA   . GLN A 1 54  ? 5.607   0.023   -12.323 1.00 0.00 ? 446 GLN A HA   2  
ATOM 3439  H HB2  . GLN A 1 54  ? 4.252   0.612   -14.943 1.00 0.00 ? 446 GLN A HB2  2  
ATOM 3440  H HB3  . GLN A 1 54  ? 5.020   1.856   -13.958 1.00 0.00 ? 446 GLN A HB3  2  
ATOM 3441  H HG2  . GLN A 1 54  ? 6.371   -0.583  -15.088 1.00 0.00 ? 446 GLN A HG2  2  
ATOM 3442  H HG3  . GLN A 1 54  ? 6.508   1.064   -15.705 1.00 0.00 ? 446 GLN A HG3  2  
ATOM 3443  H HE21 . GLN A 1 54  ? 6.625   2.343   -13.157 1.00 0.00 ? 446 GLN A HE21 2  
ATOM 3444  H HE22 . GLN A 1 54  ? 8.142   1.979   -12.441 1.00 0.00 ? 446 GLN A HE22 2  
ATOM 3445  N N    . LYS A 1 55  ? 2.549   -0.214  -11.989 1.00 0.00 ? 447 LYS A N    2  
ATOM 3446  C CA   . LYS A 1 55  ? 1.408   0.189   -11.209 1.00 0.00 ? 447 LYS A CA   2  
ATOM 3447  C C    . LYS A 1 55  ? 1.076   -0.840  -10.160 1.00 0.00 ? 447 LYS A C    2  
ATOM 3448  O O    . LYS A 1 55  ? 1.042   -2.038  -10.443 1.00 0.00 ? 447 LYS A O    2  
ATOM 3449  C CB   . LYS A 1 55  ? 0.177   0.412   -12.073 1.00 0.00 ? 447 LYS A CB   2  
ATOM 3450  C CG   . LYS A 1 55  ? 0.258   1.574   -13.028 1.00 0.00 ? 447 LYS A CG   2  
ATOM 3451  C CD   . LYS A 1 55  ? -1.077  1.763   -13.696 1.00 0.00 ? 447 LYS A CD   2  
ATOM 3452  C CE   . LYS A 1 55  ? -1.120  2.998   -14.557 1.00 0.00 ? 447 LYS A CE   2  
ATOM 3453  N NZ   . LYS A 1 55  ? -2.492  3.264   -15.035 1.00 0.00 ? 447 LYS A NZ   2  
ATOM 3454  H H    . LYS A 1 55  ? 2.548   -1.104  -12.401 1.00 0.00 ? 447 LYS A H    2  
ATOM 3455  H HA   . LYS A 1 55  ? 1.653   1.120   -10.721 1.00 0.00 ? 447 LYS A HA   2  
ATOM 3456  H HB2  . LYS A 1 55  ? 0.006   -0.481  -12.657 1.00 0.00 ? 447 LYS A HB2  2  
ATOM 3457  H HB3  . LYS A 1 55  ? -0.674  0.565   -11.424 1.00 0.00 ? 447 LYS A HB3  2  
ATOM 3458  H HG2  . LYS A 1 55  ? 0.514   2.466   -12.478 1.00 0.00 ? 447 LYS A HG2  2  
ATOM 3459  H HG3  . LYS A 1 55  ? 1.007   1.372   -13.780 1.00 0.00 ? 447 LYS A HG3  2  
ATOM 3460  H HD2  . LYS A 1 55  ? -1.281  0.902   -14.316 1.00 0.00 ? 447 LYS A HD2  2  
ATOM 3461  H HD3  . LYS A 1 55  ? -1.839  1.840   -12.934 1.00 0.00 ? 447 LYS A HD3  2  
ATOM 3462  H HE2  . LYS A 1 55  ? -0.776  3.844   -13.982 1.00 0.00 ? 447 LYS A HE2  2  
ATOM 3463  H HE3  . LYS A 1 55  ? -0.475  2.852   -15.411 1.00 0.00 ? 447 LYS A HE3  2  
ATOM 3464  H HZ1  . LYS A 1 55  ? -2.861  2.456   -15.574 1.00 0.00 ? 447 LYS A HZ1  2  
ATOM 3465  H HZ2  . LYS A 1 55  ? -3.123  3.408   -14.213 1.00 0.00 ? 447 LYS A HZ2  2  
ATOM 3466  H HZ3  . LYS A 1 55  ? -2.519  4.121   -15.623 1.00 0.00 ? 447 LYS A HZ3  2  
ATOM 3467  N N    . LEU A 1 56  ? 0.863   -0.376  -8.958  1.00 0.00 ? 448 LEU A N    2  
ATOM 3468  C CA   . LEU A 1 56  ? 0.424   -1.215  -7.869  1.00 0.00 ? 448 LEU A CA   2  
ATOM 3469  C C    . LEU A 1 56  ? -0.929  -0.723  -7.371  1.00 0.00 ? 448 LEU A C    2  
ATOM 3470  O O    . LEU A 1 56  ? -1.195  0.486   -7.395  1.00 0.00 ? 448 LEU A O    2  
ATOM 3471  C CB   . LEU A 1 56  ? 1.461   -1.259  -6.744  1.00 0.00 ? 448 LEU A CB   2  
ATOM 3472  C CG   . LEU A 1 56  ? 2.814   -1.895  -7.092  1.00 0.00 ? 448 LEU A CG   2  
ATOM 3473  C CD1  . LEU A 1 56  ? 3.717   -1.944  -5.875  1.00 0.00 ? 448 LEU A CD1  2  
ATOM 3474  C CD2  . LEU A 1 56  ? 2.613   -3.279  -7.664  1.00 0.00 ? 448 LEU A CD2  2  
ATOM 3475  H H    . LEU A 1 56  ? 0.998   0.583   -8.796  1.00 0.00 ? 448 LEU A H    2  
ATOM 3476  H HA   . LEU A 1 56  ? 0.282   -2.209  -8.270  1.00 0.00 ? 448 LEU A HA   2  
ATOM 3477  H HB2  . LEU A 1 56  ? 1.643   -0.245  -6.419  1.00 0.00 ? 448 LEU A HB2  2  
ATOM 3478  H HB3  . LEU A 1 56  ? 1.032   -1.813  -5.922  1.00 0.00 ? 448 LEU A HB3  2  
ATOM 3479  H HG   . LEU A 1 56  ? 3.333   -1.305  -7.830  1.00 0.00 ? 448 LEU A HG   2  
ATOM 3480  H HD11 . LEU A 1 56  ? 3.882   -0.943  -5.508  1.00 0.00 ? 448 LEU A HD11 2  
ATOM 3481  H HD12 . LEU A 1 56  ? 3.248   -2.538  -5.105  1.00 0.00 ? 448 LEU A HD12 2  
ATOM 3482  H HD13 . LEU A 1 56  ? 4.664   -2.390  -6.145  1.00 0.00 ? 448 LEU A HD13 2  
ATOM 3483  H HD21 . LEU A 1 56  ? 2.099   -3.894  -6.941  1.00 0.00 ? 448 LEU A HD21 2  
ATOM 3484  H HD22 . LEU A 1 56  ? 2.036   -3.217  -8.574  1.00 0.00 ? 448 LEU A HD22 2  
ATOM 3485  H HD23 . LEU A 1 56  ? 3.576   -3.716  -7.887  1.00 0.00 ? 448 LEU A HD23 2  
ATOM 3486  N N    . ILE A 1 57  ? -1.776  -1.635  -6.931  1.00 0.00 ? 449 ILE A N    2  
ATOM 3487  C CA   . ILE A 1 57  ? -3.134  -1.281  -6.554  1.00 0.00 ? 449 ILE A CA   2  
ATOM 3488  C C    . ILE A 1 57  ? -3.280  -1.201  -5.035  1.00 0.00 ? 449 ILE A C    2  
ATOM 3489  O O    . ILE A 1 57  ? -2.907  -2.129  -4.312  1.00 0.00 ? 449 ILE A O    2  
ATOM 3490  C CB   . ILE A 1 57  ? -4.161  -2.293  -7.139  1.00 0.00 ? 449 ILE A CB   2  
ATOM 3491  C CG1  . ILE A 1 57  ? -4.006  -2.367  -8.670  1.00 0.00 ? 449 ILE A CG1  2  
ATOM 3492  C CG2  . ILE A 1 57  ? -5.593  -1.892  -6.765  1.00 0.00 ? 449 ILE A CG2  2  
ATOM 3493  C CD1  . ILE A 1 57  ? -4.917  -3.369  -9.347  1.00 0.00 ? 449 ILE A CD1  2  
ATOM 3494  H H    . ILE A 1 57  ? -1.485  -2.568  -6.814  1.00 0.00 ? 449 ILE A H    2  
ATOM 3495  H HA   . ILE A 1 57  ? -3.341  -0.306  -6.970  1.00 0.00 ? 449 ILE A HA   2  
ATOM 3496  H HB   . ILE A 1 57  ? -3.957  -3.267  -6.719  1.00 0.00 ? 449 ILE A HB   2  
ATOM 3497  H HG12 . ILE A 1 57  ? -4.221  -1.396  -9.090  1.00 0.00 ? 449 ILE A HG12 2  
ATOM 3498  H HG13 . ILE A 1 57  ? -2.985  -2.634  -8.904  1.00 0.00 ? 449 ILE A HG13 2  
ATOM 3499  H HG21 . ILE A 1 57  ? -5.694  -1.873  -5.690  1.00 0.00 ? 449 ILE A HG21 2  
ATOM 3500  H HG22 . ILE A 1 57  ? -5.805  -0.911  -7.165  1.00 0.00 ? 449 ILE A HG22 2  
ATOM 3501  H HG23 . ILE A 1 57  ? -6.287  -2.606  -7.184  1.00 0.00 ? 449 ILE A HG23 2  
ATOM 3502  H HD11 . ILE A 1 57  ? -4.714  -4.358  -8.965  1.00 0.00 ? 449 ILE A HD11 2  
ATOM 3503  H HD12 . ILE A 1 57  ? -5.947  -3.110  -9.150  1.00 0.00 ? 449 ILE A HD12 2  
ATOM 3504  H HD13 . ILE A 1 57  ? -4.741  -3.351  -10.413 1.00 0.00 ? 449 ILE A HD13 2  
ATOM 3505  N N    . MET A 1 58  ? -3.812  -0.098  -4.566  1.00 0.00 ? 450 MET A N    2  
ATOM 3506  C CA   . MET A 1 58  ? -4.009  0.141   -3.154  1.00 0.00 ? 450 MET A CA   2  
ATOM 3507  C C    . MET A 1 58  ? -5.460  -0.109  -2.747  1.00 0.00 ? 450 MET A C    2  
ATOM 3508  O O    . MET A 1 58  ? -6.397  0.448   -3.337  1.00 0.00 ? 450 MET A O    2  
ATOM 3509  C CB   . MET A 1 58  ? -3.646  1.584   -2.797  1.00 0.00 ? 450 MET A CB   2  
ATOM 3510  C CG   . MET A 1 58  ? -2.187  1.952   -2.984  1.00 0.00 ? 450 MET A CG   2  
ATOM 3511  S SD   . MET A 1 58  ? -1.865  3.712   -2.704  1.00 0.00 ? 450 MET A SD   2  
ATOM 3512  C CE   . MET A 1 58  ? -2.487  3.938   -1.036  1.00 0.00 ? 450 MET A CE   2  
ATOM 3513  H H    . MET A 1 58  ? -4.085  0.601   -5.207  1.00 0.00 ? 450 MET A H    2  
ATOM 3514  H HA   . MET A 1 58  ? -3.359  -0.520  -2.602  1.00 0.00 ? 450 MET A HA   2  
ATOM 3515  H HB2  . MET A 1 58  ? -4.236  2.245   -3.414  1.00 0.00 ? 450 MET A HB2  2  
ATOM 3516  H HB3  . MET A 1 58  ? -3.910  1.752   -1.762  1.00 0.00 ? 450 MET A HB3  2  
ATOM 3517  H HG2  . MET A 1 58  ? -1.597  1.383   -2.281  1.00 0.00 ? 450 MET A HG2  2  
ATOM 3518  H HG3  . MET A 1 58  ? -1.892  1.701   -3.992  1.00 0.00 ? 450 MET A HG3  2  
ATOM 3519  H HE1  . MET A 1 58  ? -1.982  3.263   -0.363  1.00 0.00 ? 450 MET A HE1  2  
ATOM 3520  H HE2  . MET A 1 58  ? -2.308  4.958   -0.728  1.00 0.00 ? 450 MET A HE2  2  
ATOM 3521  H HE3  . MET A 1 58  ? -3.549  3.746   -1.017  1.00 0.00 ? 450 MET A HE3  2  
ATOM 3522  N N    . GLN A 1 59  ? -5.632  -0.957  -1.766  1.00 0.00 ? 451 GLN A N    2  
ATOM 3523  C CA   . GLN A 1 59  ? -6.919  -1.218  -1.159  1.00 0.00 ? 451 GLN A CA   2  
ATOM 3524  C C    . GLN A 1 59  ? -6.893  -0.579  0.221   1.00 0.00 ? 451 GLN A C    2  
ATOM 3525  O O    . GLN A 1 59  ? -6.105  -0.992  1.075   1.00 0.00 ? 451 GLN A O    2  
ATOM 3526  C CB   . GLN A 1 59  ? -7.148  -2.735  -1.003  1.00 0.00 ? 451 GLN A CB   2  
ATOM 3527  C CG   . GLN A 1 59  ? -7.135  -3.534  -2.303  1.00 0.00 ? 451 GLN A CG   2  
ATOM 3528  C CD   . GLN A 1 59  ? -8.254  -3.158  -3.258  1.00 0.00 ? 451 GLN A CD   2  
ATOM 3529  O OE1  . GLN A 1 59  ? -9.339  -2.736  -2.846  1.00 0.00 ? 451 GLN A OE1  2  
ATOM 3530  N NE2  . GLN A 1 59  ? -8.011  -3.323  -4.530  1.00 0.00 ? 451 GLN A NE2  2  
ATOM 3531  H H    . GLN A 1 59  ? -4.850  -1.441  -1.417  1.00 0.00 ? 451 GLN A H    2  
ATOM 3532  H HA   . GLN A 1 59  ? -7.700  -0.782  -1.764  1.00 0.00 ? 451 GLN A HA   2  
ATOM 3533  H HB2  . GLN A 1 59  ? -6.373  -3.131  -0.364  1.00 0.00 ? 451 GLN A HB2  2  
ATOM 3534  H HB3  . GLN A 1 59  ? -8.104  -2.884  -0.520  1.00 0.00 ? 451 GLN A HB3  2  
ATOM 3535  H HG2  . GLN A 1 59  ? -6.192  -3.363  -2.802  1.00 0.00 ? 451 GLN A HG2  2  
ATOM 3536  H HG3  . GLN A 1 59  ? -7.219  -4.583  -2.064  1.00 0.00 ? 451 GLN A HG3  2  
ATOM 3537  H HE21 . GLN A 1 59  ? -7.138  -3.672  -4.804  1.00 0.00 ? 451 GLN A HE21 2  
ATOM 3538  H HE22 . GLN A 1 59  ? -8.724  -3.110  -5.169  1.00 0.00 ? 451 GLN A HE22 2  
ATOM 3539  N N    . LEU A 1 60  ? -7.693  0.431   0.429   1.00 0.00 ? 452 LEU A N    2  
ATOM 3540  C CA   . LEU A 1 60  ? -7.697  1.123   1.707   1.00 0.00 ? 452 LEU A CA   2  
ATOM 3541  C C    . LEU A 1 60  ? -8.604  0.439   2.708   1.00 0.00 ? 452 LEU A C    2  
ATOM 3542  O O    . LEU A 1 60  ? -9.785  0.203   2.444   1.00 0.00 ? 452 LEU A O    2  
ATOM 3543  C CB   . LEU A 1 60  ? -8.024  2.627   1.578   1.00 0.00 ? 452 LEU A CB   2  
ATOM 3544  C CG   . LEU A 1 60  ? -6.925  3.541   0.976   1.00 0.00 ? 452 LEU A CG   2  
ATOM 3545  C CD1  . LEU A 1 60  ? -6.652  3.242   -0.492  1.00 0.00 ? 452 LEU A CD1  2  
ATOM 3546  C CD2  . LEU A 1 60  ? -7.282  5.005   1.165   1.00 0.00 ? 452 LEU A CD2  2  
ATOM 3547  H H    . LEU A 1 60  ? -8.311  0.727   -0.269  1.00 0.00 ? 452 LEU A H    2  
ATOM 3548  H HA   . LEU A 1 60  ? -6.690  1.024   2.089   1.00 0.00 ? 452 LEU A HA   2  
ATOM 3549  H HB2  . LEU A 1 60  ? -8.905  2.721   0.962   1.00 0.00 ? 452 LEU A HB2  2  
ATOM 3550  H HB3  . LEU A 1 60  ? -8.264  2.999   2.564   1.00 0.00 ? 452 LEU A HB3  2  
ATOM 3551  H HG   . LEU A 1 60  ? -6.004  3.357   1.511   1.00 0.00 ? 452 LEU A HG   2  
ATOM 3552  H HD11 . LEU A 1 60  ? -7.554  3.385   -1.067  1.00 0.00 ? 452 LEU A HD11 2  
ATOM 3553  H HD12 . LEU A 1 60  ? -5.881  3.908   -0.851  1.00 0.00 ? 452 LEU A HD12 2  
ATOM 3554  H HD13 . LEU A 1 60  ? -6.316  2.219   -0.589  1.00 0.00 ? 452 LEU A HD13 2  
ATOM 3555  H HD21 . LEU A 1 60  ? -8.223  5.210   0.677   1.00 0.00 ? 452 LEU A HD21 2  
ATOM 3556  H HD22 . LEU A 1 60  ? -7.363  5.219   2.220   1.00 0.00 ? 452 LEU A HD22 2  
ATOM 3557  H HD23 . LEU A 1 60  ? -6.506  5.620   0.733   1.00 0.00 ? 452 LEU A HD23 2  
ATOM 3558  N N    . ILE A 1 61  ? -8.028  0.109   3.831   1.00 0.00 ? 453 ILE A N    2  
ATOM 3559  C CA   . ILE A 1 61  ? -8.689  -0.594  4.913   1.00 0.00 ? 453 ILE A CA   2  
ATOM 3560  C C    . ILE A 1 61  ? -8.336  0.101   6.229   1.00 0.00 ? 453 ILE A C    2  
ATOM 3561  O O    . ILE A 1 61  ? -7.383  0.856   6.267   1.00 0.00 ? 453 ILE A O    2  
ATOM 3562  C CB   . ILE A 1 61  ? -8.224  -2.076  4.971   1.00 0.00 ? 453 ILE A CB   2  
ATOM 3563  C CG1  . ILE A 1 61  ? -6.682  -2.155  5.012   1.00 0.00 ? 453 ILE A CG1  2  
ATOM 3564  C CG2  . ILE A 1 61  ? -8.804  -2.877  3.806   1.00 0.00 ? 453 ILE A CG2  2  
ATOM 3565  C CD1  . ILE A 1 61  ? -6.132  -3.555  5.123   1.00 0.00 ? 453 ILE A CD1  2  
ATOM 3566  H H    . ILE A 1 61  ? -7.087  0.369   3.965   1.00 0.00 ? 453 ILE A H    2  
ATOM 3567  H HA   . ILE A 1 61  ? -9.757  -0.556  4.753   1.00 0.00 ? 453 ILE A HA   2  
ATOM 3568  H HB   . ILE A 1 61  ? -8.614  -2.501  5.883   1.00 0.00 ? 453 ILE A HB   2  
ATOM 3569  H HG12 . ILE A 1 61  ? -6.283  -1.721  4.107   1.00 0.00 ? 453 ILE A HG12 2  
ATOM 3570  H HG13 . ILE A 1 61  ? -6.328  -1.587  5.859   1.00 0.00 ? 453 ILE A HG13 2  
ATOM 3571  H HG21 . ILE A 1 61  ? -8.475  -2.443  2.873   1.00 0.00 ? 453 ILE A HG21 2  
ATOM 3572  H HG22 . ILE A 1 61  ? -8.469  -3.902  3.868   1.00 0.00 ? 453 ILE A HG22 2  
ATOM 3573  H HG23 . ILE A 1 61  ? -9.882  -2.845  3.857   1.00 0.00 ? 453 ILE A HG23 2  
ATOM 3574  H HD11 . ILE A 1 61  ? -6.500  -4.023  6.022   1.00 0.00 ? 453 ILE A HD11 2  
ATOM 3575  H HD12 . ILE A 1 61  ? -6.442  -4.130  4.264   1.00 0.00 ? 453 ILE A HD12 2  
ATOM 3576  H HD13 . ILE A 1 61  ? -5.056  -3.509  5.160   1.00 0.00 ? 453 ILE A HD13 2  
ATOM 3577  N N    . PRO A 1 62  ? -9.094  -0.097  7.318   1.00 0.00 ? 454 PRO A N    2  
ATOM 3578  C CA   . PRO A 1 62  ? -8.769  0.552   8.585   1.00 0.00 ? 454 PRO A CA   2  
ATOM 3579  C C    . PRO A 1 62  ? -7.517  -0.053  9.255   1.00 0.00 ? 454 PRO A C    2  
ATOM 3580  O O    . PRO A 1 62  ? -7.431  -1.268  9.483   1.00 0.00 ? 454 PRO A O    2  
ATOM 3581  C CB   . PRO A 1 62  ? -10.018 0.316   9.447   1.00 0.00 ? 454 PRO A CB   2  
ATOM 3582  C CG   . PRO A 1 62  ? -10.684 -0.884  8.854   1.00 0.00 ? 454 PRO A CG   2  
ATOM 3583  C CD   . PRO A 1 62  ? -10.321 -0.908  7.393   1.00 0.00 ? 454 PRO A CD   2  
ATOM 3584  H HA   . PRO A 1 62  ? -8.612  1.612   8.451   1.00 0.00 ? 454 PRO A HA   2  
ATOM 3585  H HB2  . PRO A 1 62  ? -9.721  0.141   10.471  1.00 0.00 ? 454 PRO A HB2  2  
ATOM 3586  H HB3  . PRO A 1 62  ? -10.658 1.185   9.398   1.00 0.00 ? 454 PRO A HB3  2  
ATOM 3587  H HG2  . PRO A 1 62  ? -10.321 -1.779  9.337   1.00 0.00 ? 454 PRO A HG2  2  
ATOM 3588  H HG3  . PRO A 1 62  ? -11.755 -0.806  8.972   1.00 0.00 ? 454 PRO A HG3  2  
ATOM 3589  H HD2  . PRO A 1 62  ? -10.150 -1.918  7.055   1.00 0.00 ? 454 PRO A HD2  2  
ATOM 3590  H HD3  . PRO A 1 62  ? -11.103 -0.465  6.797   1.00 0.00 ? 454 PRO A HD3  2  
ATOM 3591  N N    . GLN A 1 63  ? -6.589  0.825   9.616   1.00 0.00 ? 455 GLN A N    2  
ATOM 3592  C CA   . GLN A 1 63  ? -5.309  0.475   10.247  1.00 0.00 ? 455 GLN A CA   2  
ATOM 3593  C C    . GLN A 1 63  ? -5.543  -0.169  11.616  1.00 0.00 ? 455 GLN A C    2  
ATOM 3594  O O    . GLN A 1 63  ? -4.786  -1.022  12.063  1.00 0.00 ? 455 GLN A O    2  
ATOM 3595  C CB   . GLN A 1 63  ? -4.447  1.743   10.391  1.00 0.00 ? 455 GLN A CB   2  
ATOM 3596  C CG   . GLN A 1 63  ? -3.016  1.513   10.882  1.00 0.00 ? 455 GLN A CG   2  
ATOM 3597  C CD   . GLN A 1 63  ? -2.219  2.811   11.041  1.00 0.00 ? 455 GLN A CD   2  
ATOM 3598  O OE1  . GLN A 1 63  ? -0.998  2.836   10.855  1.00 0.00 ? 455 GLN A OE1  2  
ATOM 3599  N NE2  . GLN A 1 63  ? -2.871  3.868   11.453  1.00 0.00 ? 455 GLN A NE2  2  
ATOM 3600  H H    . GLN A 1 63  ? -6.786  1.778   9.457   1.00 0.00 ? 455 GLN A H    2  
ATOM 3601  H HA   . GLN A 1 63  ? -4.797  -0.227  9.606   1.00 0.00 ? 455 GLN A HA   2  
ATOM 3602  H HB2  . GLN A 1 63  ? -4.397  2.232   9.429   1.00 0.00 ? 455 GLN A HB2  2  
ATOM 3603  H HB3  . GLN A 1 63  ? -4.944  2.404   11.085  1.00 0.00 ? 455 GLN A HB3  2  
ATOM 3604  H HG2  . GLN A 1 63  ? -3.055  1.015   11.839  1.00 0.00 ? 455 GLN A HG2  2  
ATOM 3605  H HG3  . GLN A 1 63  ? -2.504  0.878   10.174  1.00 0.00 ? 455 GLN A HG3  2  
ATOM 3606  H HE21 . GLN A 1 63  ? -3.830  3.784   11.650  1.00 0.00 ? 455 GLN A HE21 2  
ATOM 3607  H HE22 . GLN A 1 63  ? -2.375  4.708   11.552  1.00 0.00 ? 455 GLN A HE22 2  
ATOM 3608  N N    . GLN A 1 64  ? -6.623  0.238   12.249  1.00 0.00 ? 456 GLN A N    2  
ATOM 3609  C CA   . GLN A 1 64  ? -6.994  -0.227  13.580  1.00 0.00 ? 456 GLN A CA   2  
ATOM 3610  C C    . GLN A 1 64  ? -7.275  -1.728  13.601  1.00 0.00 ? 456 GLN A C    2  
ATOM 3611  O O    . GLN A 1 64  ? -6.958  -2.410  14.560  1.00 0.00 ? 456 GLN A O    2  
ATOM 3612  C CB   . GLN A 1 64  ? -8.230  0.522   14.054  1.00 0.00 ? 456 GLN A CB   2  
ATOM 3613  C CG   . GLN A 1 64  ? -8.044  2.022   14.158  1.00 0.00 ? 456 GLN A CG   2  
ATOM 3614  C CD   . GLN A 1 64  ? -9.320  2.719   14.546  1.00 0.00 ? 456 GLN A CD   2  
ATOM 3615  O OE1  . GLN A 1 64  ? -10.103 3.124   13.690  1.00 0.00 ? 456 GLN A OE1  2  
ATOM 3616  N NE2  . GLN A 1 64  ? -9.549  2.853   15.820  1.00 0.00 ? 456 GLN A NE2  2  
ATOM 3617  H H    . GLN A 1 64  ? -7.191  0.893   11.792  1.00 0.00 ? 456 GLN A H    2  
ATOM 3618  H HA   . GLN A 1 64  ? -6.183  -0.005  14.257  1.00 0.00 ? 456 GLN A HA   2  
ATOM 3619  H HB2  . GLN A 1 64  ? -9.034  0.333   13.359  1.00 0.00 ? 456 GLN A HB2  2  
ATOM 3620  H HB3  . GLN A 1 64  ? -8.515  0.148   15.025  1.00 0.00 ? 456 GLN A HB3  2  
ATOM 3621  H HG2  . GLN A 1 64  ? -7.294  2.234   14.904  1.00 0.00 ? 456 GLN A HG2  2  
ATOM 3622  H HG3  . GLN A 1 64  ? -7.719  2.400   13.200  1.00 0.00 ? 456 GLN A HG3  2  
ATOM 3623  H HE21 . GLN A 1 64  ? -8.888  2.503   16.457  1.00 0.00 ? 456 GLN A HE21 2  
ATOM 3624  H HE22 . GLN A 1 64  ? -10.383 3.285   16.101  1.00 0.00 ? 456 GLN A HE22 2  
ATOM 3625  N N    . LEU A 1 65  ? -7.860  -2.229  12.536  1.00 0.00 ? 457 LEU A N    2  
ATOM 3626  C CA   . LEU A 1 65  ? -8.246  -3.626  12.459  1.00 0.00 ? 457 LEU A CA   2  
ATOM 3627  C C    . LEU A 1 65  ? -7.083  -4.493  11.939  1.00 0.00 ? 457 LEU A C    2  
ATOM 3628  O O    . LEU A 1 65  ? -7.150  -5.729  11.926  1.00 0.00 ? 457 LEU A O    2  
ATOM 3629  C CB   . LEU A 1 65  ? -9.478  -3.747  11.563  1.00 0.00 ? 457 LEU A CB   2  
ATOM 3630  C CG   . LEU A 1 65  ? -10.154 -5.111  11.503  1.00 0.00 ? 457 LEU A CG   2  
ATOM 3631  C CD1  . LEU A 1 65  ? -10.641 -5.528  12.884  1.00 0.00 ? 457 LEU A CD1  2  
ATOM 3632  C CD2  . LEU A 1 65  ? -11.305 -5.067  10.533  1.00 0.00 ? 457 LEU A CD2  2  
ATOM 3633  H H    . LEU A 1 65  ? -8.033  -1.657  11.759  1.00 0.00 ? 457 LEU A H    2  
ATOM 3634  H HA   . LEU A 1 65  ? -8.508  -3.949  13.455  1.00 0.00 ? 457 LEU A HA   2  
ATOM 3635  H HB2  . LEU A 1 65  ? -10.206 -3.027  11.902  1.00 0.00 ? 457 LEU A HB2  2  
ATOM 3636  H HB3  . LEU A 1 65  ? -9.179  -3.477  10.561  1.00 0.00 ? 457 LEU A HB3  2  
ATOM 3637  H HG   . LEU A 1 65  ? -9.442  -5.846  11.156  1.00 0.00 ? 457 LEU A HG   2  
ATOM 3638  H HD11 . LEU A 1 65  ? -11.329 -4.786  13.261  1.00 0.00 ? 457 LEU A HD11 2  
ATOM 3639  H HD12 . LEU A 1 65  ? -11.140 -6.483  12.816  1.00 0.00 ? 457 LEU A HD12 2  
ATOM 3640  H HD13 . LEU A 1 65  ? -9.797  -5.611  13.553  1.00 0.00 ? 457 LEU A HD13 2  
ATOM 3641  H HD21 . LEU A 1 65  ? -10.955 -4.773  9.555   1.00 0.00 ? 457 LEU A HD21 2  
ATOM 3642  H HD22 . LEU A 1 65  ? -11.767 -6.041  10.478  1.00 0.00 ? 457 LEU A HD22 2  
ATOM 3643  H HD23 . LEU A 1 65  ? -12.032 -4.349  10.879  1.00 0.00 ? 457 LEU A HD23 2  
ATOM 3644  N N    . LEU A 1 66  ? -6.015  -3.834  11.555  1.00 0.00 ? 458 LEU A N    2  
ATOM 3645  C CA   . LEU A 1 66  ? -4.845  -4.480  10.977  1.00 0.00 ? 458 LEU A CA   2  
ATOM 3646  C C    . LEU A 1 66  ? -3.989  -5.134  12.069  1.00 0.00 ? 458 LEU A C    2  
ATOM 3647  O O    . LEU A 1 66  ? -3.171  -6.018  11.791  1.00 0.00 ? 458 LEU A O    2  
ATOM 3648  C CB   . LEU A 1 66  ? -4.024  -3.445  10.193  1.00 0.00 ? 458 LEU A CB   2  
ATOM 3649  C CG   . LEU A 1 66  ? -2.777  -3.949  9.473   1.00 0.00 ? 458 LEU A CG   2  
ATOM 3650  C CD1  . LEU A 1 66  ? -3.147  -4.958  8.393   1.00 0.00 ? 458 LEU A CD1  2  
ATOM 3651  C CD2  . LEU A 1 66  ? -1.995  -2.781  8.889   1.00 0.00 ? 458 LEU A CD2  2  
ATOM 3652  H H    . LEU A 1 66  ? -5.998  -2.860  11.672  1.00 0.00 ? 458 LEU A H    2  
ATOM 3653  H HA   . LEU A 1 66  ? -5.190  -5.241  10.295  1.00 0.00 ? 458 LEU A HA   2  
ATOM 3654  H HB2  . LEU A 1 66  ? -4.674  -2.996  9.455   1.00 0.00 ? 458 LEU A HB2  2  
ATOM 3655  H HB3  . LEU A 1 66  ? -3.723  -2.674  10.887  1.00 0.00 ? 458 LEU A HB3  2  
ATOM 3656  H HG   . LEU A 1 66  ? -2.145  -4.456  10.189  1.00 0.00 ? 458 LEU A HG   2  
ATOM 3657  H HD11 . LEU A 1 66  ? -3.657  -5.796  8.843   1.00 0.00 ? 458 LEU A HD11 2  
ATOM 3658  H HD12 . LEU A 1 66  ? -3.795  -4.488  7.669   1.00 0.00 ? 458 LEU A HD12 2  
ATOM 3659  H HD13 . LEU A 1 66  ? -2.252  -5.306  7.901   1.00 0.00 ? 458 LEU A HD13 2  
ATOM 3660  H HD21 . LEU A 1 66  ? -1.703  -2.105  9.679   1.00 0.00 ? 458 LEU A HD21 2  
ATOM 3661  H HD22 . LEU A 1 66  ? -1.109  -3.148  8.392   1.00 0.00 ? 458 LEU A HD22 2  
ATOM 3662  H HD23 . LEU A 1 66  ? -2.609  -2.249  8.177   1.00 0.00 ? 458 LEU A HD23 2  
ATOM 3663  N N    . THR A 1 67  ? -4.238  -4.740  13.308  1.00 0.00 ? 459 THR A N    2  
ATOM 3664  C CA   . THR A 1 67  ? -3.466  -5.158  14.467  1.00 0.00 ? 459 THR A CA   2  
ATOM 3665  C C    . THR A 1 67  ? -3.431  -6.684  14.650  1.00 0.00 ? 459 THR A C    2  
ATOM 3666  O O    . THR A 1 67  ? -2.435  -7.236  15.149  1.00 0.00 ? 459 THR A O    2  
ATOM 3667  C CB   . THR A 1 67  ? -4.044  -4.494  15.718  1.00 0.00 ? 459 THR A CB   2  
ATOM 3668  O OG1  . THR A 1 67  ? -5.464  -4.694  15.731  1.00 0.00 ? 459 THR A OG1  2  
ATOM 3669  C CG2  . THR A 1 67  ? -3.746  -3.000  15.721  1.00 0.00 ? 459 THR A CG2  2  
ATOM 3670  H H    . THR A 1 67  ? -5.000  -4.147  13.482  1.00 0.00 ? 459 THR A H    2  
ATOM 3671  H HA   . THR A 1 67  ? -2.456  -4.798  14.341  1.00 0.00 ? 459 THR A HA   2  
ATOM 3672  H HB   . THR A 1 67  ? -3.604  -4.951  16.592  1.00 0.00 ? 459 THR A HB   2  
ATOM 3673  H HG1  . THR A 1 67  ? -5.678  -5.197  16.525  1.00 0.00 ? 459 THR A HG1  2  
ATOM 3674  H HG21 . THR A 1 67  ? -4.184  -2.544  14.846  1.00 0.00 ? 459 THR A HG21 2  
ATOM 3675  H HG22 . THR A 1 67  ? -4.166  -2.551  16.609  1.00 0.00 ? 459 THR A HG22 2  
ATOM 3676  H HG23 . THR A 1 67  ? -2.676  -2.845  15.710  1.00 0.00 ? 459 THR A HG23 2  
ATOM 3677  N N    . THR A 1 68  ? -4.484  -7.357  14.202  1.00 0.00 ? 460 THR A N    2  
ATOM 3678  C CA   . THR A 1 68  ? -4.582  -8.805  14.288  1.00 0.00 ? 460 THR A CA   2  
ATOM 3679  C C    . THR A 1 68  ? -3.471  -9.481  13.448  1.00 0.00 ? 460 THR A C    2  
ATOM 3680  O O    . THR A 1 68  ? -2.964  -10.539 13.803  1.00 0.00 ? 460 THR A O    2  
ATOM 3681  C CB   . THR A 1 68  ? -5.960  -9.271  13.775  1.00 0.00 ? 460 THR A CB   2  
ATOM 3682  O OG1  . THR A 1 68  ? -7.000  -8.506  14.414  1.00 0.00 ? 460 THR A OG1  2  
ATOM 3683  C CG2  . THR A 1 68  ? -6.183  -10.751 14.063  1.00 0.00 ? 460 THR A CG2  2  
ATOM 3684  H H    . THR A 1 68  ? -5.234  -6.857  13.814  1.00 0.00 ? 460 THR A H    2  
ATOM 3685  H HA   . THR A 1 68  ? -4.482  -9.098  15.321  1.00 0.00 ? 460 THR A HA   2  
ATOM 3686  H HB   . THR A 1 68  ? -5.991  -9.106  12.710  1.00 0.00 ? 460 THR A HB   2  
ATOM 3687  H HG1  . THR A 1 68  ? -7.487  -9.105  14.999  1.00 0.00 ? 460 THR A HG1  2  
ATOM 3688  H HG21 . THR A 1 68  ? -5.404  -11.326 13.583  1.00 0.00 ? 460 THR A HG21 2  
ATOM 3689  H HG22 . THR A 1 68  ? -6.149  -10.921 15.130  1.00 0.00 ? 460 THR A HG22 2  
ATOM 3690  H HG23 . THR A 1 68  ? -7.146  -11.055 13.678  1.00 0.00 ? 460 THR A HG23 2  
ATOM 3691  N N    . LEU A 1 69  ? -3.047  -8.817  12.380  1.00 0.00 ? 461 LEU A N    2  
ATOM 3692  C CA   . LEU A 1 69  ? -2.058  -9.376  11.461  1.00 0.00 ? 461 LEU A CA   2  
ATOM 3693  C C    . LEU A 1 69  ? -0.633  -9.053  11.906  1.00 0.00 ? 461 LEU A C    2  
ATOM 3694  O O    . LEU A 1 69  ? 0.318   -9.352  11.200  1.00 0.00 ? 461 LEU A O    2  
ATOM 3695  C CB   . LEU A 1 69  ? -2.280  -8.894  10.000  1.00 0.00 ? 461 LEU A CB   2  
ATOM 3696  C CG   . LEU A 1 69  ? -3.531  -9.421  9.248   1.00 0.00 ? 461 LEU A CG   2  
ATOM 3697  C CD1  . LEU A 1 69  ? -4.830  -8.888  9.837   1.00 0.00 ? 461 LEU A CD1  2  
ATOM 3698  C CD2  . LEU A 1 69  ? -3.442  -9.095  7.766   1.00 0.00 ? 461 LEU A CD2  2  
ATOM 3699  H H    . LEU A 1 69  ? -3.378  -7.908  12.202  1.00 0.00 ? 461 LEU A H    2  
ATOM 3700  H HA   . LEU A 1 69  ? -2.187  -10.448 11.488  1.00 0.00 ? 461 LEU A HA   2  
ATOM 3701  H HB2  . LEU A 1 69  ? -2.335  -7.816  10.018  1.00 0.00 ? 461 LEU A HB2  2  
ATOM 3702  H HB3  . LEU A 1 69  ? -1.404  -9.169  9.432   1.00 0.00 ? 461 LEU A HB3  2  
ATOM 3703  H HG   . LEU A 1 69  ? -3.555  -10.497 9.347   1.00 0.00 ? 461 LEU A HG   2  
ATOM 3704  H HD11 . LEU A 1 69  ? -4.889  -9.196  10.871  1.00 0.00 ? 461 LEU A HD11 2  
ATOM 3705  H HD12 . LEU A 1 69  ? -4.839  -7.810  9.775   1.00 0.00 ? 461 LEU A HD12 2  
ATOM 3706  H HD13 . LEU A 1 69  ? -5.670  -9.290  9.290   1.00 0.00 ? 461 LEU A HD13 2  
ATOM 3707  H HD21 . LEU A 1 69  ? -2.564  -9.558  7.342   1.00 0.00 ? 461 LEU A HD21 2  
ATOM 3708  H HD22 . LEU A 1 69  ? -4.322  -9.471  7.265   1.00 0.00 ? 461 LEU A HD22 2  
ATOM 3709  H HD23 . LEU A 1 69  ? -3.384  -8.024  7.636   1.00 0.00 ? 461 LEU A HD23 2  
ATOM 3710  N N    . GLY A 1 70  ? -0.512  -8.483  13.101  1.00 0.00 ? 462 GLY A N    2  
ATOM 3711  C CA   . GLY A 1 70  ? 0.780   -8.084  13.677  1.00 0.00 ? 462 GLY A CA   2  
ATOM 3712  C C    . GLY A 1 70  ? 1.904   -9.135  13.568  1.00 0.00 ? 462 GLY A C    2  
ATOM 3713  O O    . GLY A 1 70  ? 2.954   -8.840  12.984  1.00 0.00 ? 462 GLY A O    2  
ATOM 3714  H H    . GLY A 1 70  ? -1.336  -8.327  13.610  1.00 0.00 ? 462 GLY A H    2  
ATOM 3715  H HA2  . GLY A 1 70  ? 1.112   -7.183  13.184  1.00 0.00 ? 462 GLY A HA2  2  
ATOM 3716  H HA3  . GLY A 1 70  ? 0.628   -7.856  14.720  1.00 0.00 ? 462 GLY A HA3  2  
ATOM 3717  N N    . PRO A 1 71  ? 1.725   -10.370 14.113  1.00 0.00 ? 463 PRO A N    2  
ATOM 3718  C CA   . PRO A 1 71  ? 2.757   -11.427 14.051  1.00 0.00 ? 463 PRO A CA   2  
ATOM 3719  C C    . PRO A 1 71  ? 3.122   -11.839 12.614  1.00 0.00 ? 463 PRO A C    2  
ATOM 3720  O O    . PRO A 1 71  ? 4.224   -12.333 12.357  1.00 0.00 ? 463 PRO A O    2  
ATOM 3721  C CB   . PRO A 1 71  ? 2.123   -12.608 14.805  1.00 0.00 ? 463 PRO A CB   2  
ATOM 3722  C CG   . PRO A 1 71  ? 0.665   -12.319 14.822  1.00 0.00 ? 463 PRO A CG   2  
ATOM 3723  C CD   . PRO A 1 71  ? 0.544   -10.826 14.877  1.00 0.00 ? 463 PRO A CD   2  
ATOM 3724  H HA   . PRO A 1 71  ? 3.658   -11.116 14.556  1.00 0.00 ? 463 PRO A HA   2  
ATOM 3725  H HB2  . PRO A 1 71  ? 2.337   -13.525 14.279  1.00 0.00 ? 463 PRO A HB2  2  
ATOM 3726  H HB3  . PRO A 1 71  ? 2.525   -12.661 15.807  1.00 0.00 ? 463 PRO A HB3  2  
ATOM 3727  H HG2  . PRO A 1 71  ? 0.216   -12.701 13.918  1.00 0.00 ? 463 PRO A HG2  2  
ATOM 3728  H HG3  . PRO A 1 71  ? 0.207   -12.771 15.690  1.00 0.00 ? 463 PRO A HG3  2  
ATOM 3729  H HD2  . PRO A 1 71  ? -0.372  -10.497 14.410  1.00 0.00 ? 463 PRO A HD2  2  
ATOM 3730  H HD3  . PRO A 1 71  ? 0.597   -10.480 15.898  1.00 0.00 ? 463 PRO A HD3  2  
ATOM 3731  N N    . LEU A 1 72  ? 2.220   -11.597 11.680  1.00 0.00 ? 464 LEU A N    2  
ATOM 3732  C CA   . LEU A 1 72  ? 2.435   -11.949 10.286  1.00 0.00 ? 464 LEU A CA   2  
ATOM 3733  C C    . LEU A 1 72  ? 3.469   -11.001 9.661   1.00 0.00 ? 464 LEU A C    2  
ATOM 3734  O O    . LEU A 1 72  ? 4.260   -11.400 8.802   1.00 0.00 ? 464 LEU A O    2  
ATOM 3735  C CB   . LEU A 1 72  ? 1.092   -11.931 9.534   1.00 0.00 ? 464 LEU A CB   2  
ATOM 3736  C CG   . LEU A 1 72  ? 1.096   -12.325 8.052   1.00 0.00 ? 464 LEU A CG   2  
ATOM 3737  C CD1  . LEU A 1 72  ? 1.690   -13.710 7.858   1.00 0.00 ? 464 LEU A CD1  2  
ATOM 3738  C CD2  . LEU A 1 72  ? -0.324  -12.303 7.519   1.00 0.00 ? 464 LEU A CD2  2  
ATOM 3739  H H    . LEU A 1 72  ? 1.386   -11.143 11.931  1.00 0.00 ? 464 LEU A H    2  
ATOM 3740  H HA   . LEU A 1 72  ? 2.838   -12.950 10.268  1.00 0.00 ? 464 LEU A HA   2  
ATOM 3741  H HB2  . LEU A 1 72  ? 0.416   -12.597 10.048  1.00 0.00 ? 464 LEU A HB2  2  
ATOM 3742  H HB3  . LEU A 1 72  ? 0.692   -10.931 9.612   1.00 0.00 ? 464 LEU A HB3  2  
ATOM 3743  H HG   . LEU A 1 72  ? 1.678   -11.613 7.486   1.00 0.00 ? 464 LEU A HG   2  
ATOM 3744  H HD11 . LEU A 1 72  ? 1.106   -14.427 8.415   1.00 0.00 ? 464 LEU A HD11 2  
ATOM 3745  H HD12 . LEU A 1 72  ? 1.670   -13.966 6.810   1.00 0.00 ? 464 LEU A HD12 2  
ATOM 3746  H HD13 . LEU A 1 72  ? 2.709   -13.721 8.215   1.00 0.00 ? 464 LEU A HD13 2  
ATOM 3747  H HD21 . LEU A 1 72  ? -0.759  -11.328 7.673   1.00 0.00 ? 464 LEU A HD21 2  
ATOM 3748  H HD22 . LEU A 1 72  ? -0.317  -12.543 6.467   1.00 0.00 ? 464 LEU A HD22 2  
ATOM 3749  H HD23 . LEU A 1 72  ? -0.911  -13.040 8.046   1.00 0.00 ? 464 LEU A HD23 2  
ATOM 3750  N N    . PHE A 1 73  ? 3.502   -9.777  10.177  1.00 0.00 ? 465 PHE A N    2  
ATOM 3751  C CA   . PHE A 1 73  ? 4.429   -8.731  9.736   1.00 0.00 ? 465 PHE A CA   2  
ATOM 3752  C C    . PHE A 1 73  ? 5.850   -8.943  10.238  1.00 0.00 ? 465 PHE A C    2  
ATOM 3753  O O    . PHE A 1 73  ? 6.760   -8.245  9.809   1.00 0.00 ? 465 PHE A O    2  
ATOM 3754  C CB   . PHE A 1 73  ? 3.966   -7.334  10.168  1.00 0.00 ? 465 PHE A CB   2  
ATOM 3755  C CG   . PHE A 1 73  ? 2.790   -6.792  9.421   1.00 0.00 ? 465 PHE A CG   2  
ATOM 3756  C CD1  . PHE A 1 73  ? 2.954   -6.280  8.148   1.00 0.00 ? 465 PHE A CD1  2  
ATOM 3757  C CD2  . PHE A 1 73  ? 1.532   -6.760  9.993   1.00 0.00 ? 465 PHE A CD2  2  
ATOM 3758  C CE1  . PHE A 1 73  ? 1.892   -5.752  7.463   1.00 0.00 ? 465 PHE A CE1  2  
ATOM 3759  C CE2  . PHE A 1 73  ? 0.461   -6.236  9.307   1.00 0.00 ? 465 PHE A CE2  2  
ATOM 3760  C CZ   . PHE A 1 73  ? 0.642   -5.728  8.042   1.00 0.00 ? 465 PHE A CZ   2  
ATOM 3761  H H    . PHE A 1 73  ? 2.862   -9.566  10.891  1.00 0.00 ? 465 PHE A H    2  
ATOM 3762  H HA   . PHE A 1 73  ? 4.446   -8.754  8.657   1.00 0.00 ? 465 PHE A HA   2  
ATOM 3763  H HB2  . PHE A 1 73  ? 3.694   -7.367  11.212  1.00 0.00 ? 465 PHE A HB2  2  
ATOM 3764  H HB3  . PHE A 1 73  ? 4.788   -6.645  10.045  1.00 0.00 ? 465 PHE A HB3  2  
ATOM 3765  H HD1  . PHE A 1 73  ? 3.931   -6.300  7.691   1.00 0.00 ? 465 PHE A HD1  2  
ATOM 3766  H HD2  . PHE A 1 73  ? 1.379   -7.159  10.985  1.00 0.00 ? 465 PHE A HD2  2  
ATOM 3767  H HE1  . PHE A 1 73  ? 2.035   -5.358  6.468   1.00 0.00 ? 465 PHE A HE1  2  
ATOM 3768  H HE2  . PHE A 1 73  ? -0.518  -6.219  9.762   1.00 0.00 ? 465 PHE A HE2  2  
ATOM 3769  H HZ   . PHE A 1 73  ? -0.193  -5.311  7.500   1.00 0.00 ? 465 PHE A HZ   2  
ATOM 3770  N N    . ARG A 1 74  ? 6.040   -9.844  11.199  1.00 0.00 ? 466 ARG A N    2  
ATOM 3771  C CA   . ARG A 1 74  ? 7.374   -10.048 11.759  1.00 0.00 ? 466 ARG A CA   2  
ATOM 3772  C C    . ARG A 1 74  ? 8.362   -10.527 10.711  1.00 0.00 ? 466 ARG A C    2  
ATOM 3773  O O    . ARG A 1 74  ? 9.472   -9.988  10.599  1.00 0.00 ? 466 ARG A O    2  
ATOM 3774  C CB   . ARG A 1 74  ? 7.368   -10.949 12.994  1.00 0.00 ? 466 ARG A CB   2  
ATOM 3775  C CG   . ARG A 1 74  ? 6.636   -10.373 14.219  1.00 0.00 ? 466 ARG A CG   2  
ATOM 3776  C CD   . ARG A 1 74  ? 7.208   -9.018  14.677  1.00 0.00 ? 466 ARG A CD   2  
ATOM 3777  N NE   . ARG A 1 74  ? 6.831   -7.897  13.783  1.00 0.00 ? 466 ARG A NE   2  
ATOM 3778  C CZ   . ARG A 1 74  ? 7.618   -6.848  13.453  1.00 0.00 ? 466 ARG A CZ   2  
ATOM 3779  N NH1  . ARG A 1 74  ? 8.876   -6.776  13.883  1.00 0.00 ? 466 ARG A NH1  2  
ATOM 3780  N NH2  . ARG A 1 74  ? 7.138   -5.892  12.667  1.00 0.00 ? 466 ARG A NH2  2  
ATOM 3781  H H    . ARG A 1 74  ? 5.281   -10.384 11.505  1.00 0.00 ? 466 ARG A H    2  
ATOM 3782  H HA   . ARG A 1 74  ? 7.707   -9.064  12.057  1.00 0.00 ? 466 ARG A HA   2  
ATOM 3783  H HB2  . ARG A 1 74  ? 6.892   -11.882 12.731  1.00 0.00 ? 466 ARG A HB2  2  
ATOM 3784  H HB3  . ARG A 1 74  ? 8.392   -11.148 13.275  1.00 0.00 ? 466 ARG A HB3  2  
ATOM 3785  H HG2  . ARG A 1 74  ? 5.597   -10.234 13.966  1.00 0.00 ? 466 ARG A HG2  2  
ATOM 3786  H HG3  . ARG A 1 74  ? 6.719   -11.079 15.030  1.00 0.00 ? 466 ARG A HG3  2  
ATOM 3787  H HD2  . ARG A 1 74  ? 6.842   -8.806  15.670  1.00 0.00 ? 466 ARG A HD2  2  
ATOM 3788  H HD3  . ARG A 1 74  ? 8.285   -9.097  14.704  1.00 0.00 ? 466 ARG A HD3  2  
ATOM 3789  H HE   . ARG A 1 74  ? 5.914   -7.958  13.438  1.00 0.00 ? 466 ARG A HE   2  
ATOM 3790  H HH11 . ARG A 1 74  ? 9.288   -7.487  14.461  1.00 0.00 ? 466 ARG A HH11 2  
ATOM 3791  H HH12 . ARG A 1 74  ? 9.470   -6.004  13.644  1.00 0.00 ? 466 ARG A HH12 2  
ATOM 3792  H HH21 . ARG A 1 74  ? 6.207   -5.907  12.301  1.00 0.00 ? 466 ARG A HH21 2  
ATOM 3793  H HH22 . ARG A 1 74  ? 7.703   -5.102  12.411  1.00 0.00 ? 466 ARG A HH22 2  
ATOM 3794  N N    . ASN A 1 75  ? 7.966   -11.498 9.919   1.00 0.00 ? 467 ASN A N    2  
ATOM 3795  C CA   . ASN A 1 75  ? 8.817   -11.920 8.831   1.00 0.00 ? 467 ASN A CA   2  
ATOM 3796  C C    . ASN A 1 75  ? 8.390   -11.195 7.579   1.00 0.00 ? 467 ASN A C    2  
ATOM 3797  O O    . ASN A 1 75  ? 7.522   -11.667 6.822   1.00 0.00 ? 467 ASN A O    2  
ATOM 3798  C CB   . ASN A 1 75  ? 8.797   -13.436 8.594   1.00 0.00 ? 467 ASN A CB   2  
ATOM 3799  C CG   . ASN A 1 75  ? 9.828   -13.861 7.555   1.00 0.00 ? 467 ASN A CG   2  
ATOM 3800  O OD1  . ASN A 1 75  ? 10.890  -13.249 7.430   1.00 0.00 ? 467 ASN A OD1  2  
ATOM 3801  N ND2  . ASN A 1 75  ? 9.538   -14.890 6.809   1.00 0.00 ? 467 ASN A ND2  2  
ATOM 3802  H H    . ASN A 1 75  ? 7.098   -11.925 10.068  1.00 0.00 ? 467 ASN A H    2  
ATOM 3803  H HA   . ASN A 1 75  ? 9.821   -11.603 9.074   1.00 0.00 ? 467 ASN A HA   2  
ATOM 3804  H HB2  . ASN A 1 75  ? 9.020   -13.946 9.519   1.00 0.00 ? 467 ASN A HB2  2  
ATOM 3805  H HB3  . ASN A 1 75  ? 7.818   -13.730 8.246   1.00 0.00 ? 467 ASN A HB3  2  
ATOM 3806  H HD21 . ASN A 1 75  ? 8.675   -15.337 6.952   1.00 0.00 ? 467 ASN A HD21 2  
ATOM 3807  H HD22 . ASN A 1 75  ? 10.185  -15.195 6.139   1.00 0.00 ? 467 ASN A HD22 2  
ATOM 3808  N N    . SER A 1 76  ? 8.894   -10.005 7.423   1.00 0.00 ? 468 SER A N    2  
ATOM 3809  C CA   . SER A 1 76  ? 8.608   -9.179  6.283   1.00 0.00 ? 468 SER A CA   2  
ATOM 3810  C C    . SER A 1 76  ? 9.816   -8.303  5.959   1.00 0.00 ? 468 SER A C    2  
ATOM 3811  O O    . SER A 1 76  ? 10.778  -8.239  6.732   1.00 0.00 ? 468 SER A O    2  
ATOM 3812  C CB   . SER A 1 76  ? 7.354   -8.334  6.531   1.00 0.00 ? 468 SER A CB   2  
ATOM 3813  O OG   . SER A 1 76  ? 6.222   -9.163  6.738   1.00 0.00 ? 468 SER A OG   2  
ATOM 3814  H H    . SER A 1 76  ? 9.493   -9.644  8.112   1.00 0.00 ? 468 SER A H    2  
ATOM 3815  H HA   . SER A 1 76  ? 8.430   -9.837  5.446   1.00 0.00 ? 468 SER A HA   2  
ATOM 3816  H HB2  . SER A 1 76  ? 7.502   -7.734  7.415   1.00 0.00 ? 468 SER A HB2  2  
ATOM 3817  H HB3  . SER A 1 76  ? 7.171   -7.698  5.677   1.00 0.00 ? 468 SER A HB3  2  
ATOM 3818  H HG   . SER A 1 76  ? 6.542   -10.061 6.886   1.00 0.00 ? 468 SER A HG   2  
ATOM 3819  N N    . ARG A 1 77  ? 9.760   -7.662  4.837   1.00 0.00 ? 469 ARG A N    2  
ATOM 3820  C CA   . ARG A 1 77  ? 10.841  -6.845  4.299   1.00 0.00 ? 469 ARG A CA   2  
ATOM 3821  C C    . ARG A 1 77  ? 10.365  -5.409  4.367   1.00 0.00 ? 469 ARG A C    2  
ATOM 3822  O O    . ARG A 1 77  ? 9.165   -5.188  4.183   1.00 0.00 ? 469 ARG A O    2  
ATOM 3823  C CB   . ARG A 1 77  ? 11.094  -7.230  2.853   1.00 0.00 ? 469 ARG A CB   2  
ATOM 3824  C CG   . ARG A 1 77  ? 10.780  -8.675  2.498   1.00 0.00 ? 469 ARG A CG   2  
ATOM 3825  C CD   . ARG A 1 77  ? 11.065  -8.975  1.031   1.00 0.00 ? 469 ARG A CD   2  
ATOM 3826  N NE   . ARG A 1 77  ? 10.408  -8.013  0.146   1.00 0.00 ? 469 ARG A NE   2  
ATOM 3827  C CZ   . ARG A 1 77  ? 9.973   -8.220  -1.087  1.00 0.00 ? 469 ARG A CZ   2  
ATOM 3828  N NH1  . ARG A 1 77  ? 10.039  -9.426  -1.635  1.00 0.00 ? 469 ARG A NH1  2  
ATOM 3829  N NH2  . ARG A 1 77  ? 9.515   -7.189  -1.784  1.00 0.00 ? 469 ARG A NH2  2  
ATOM 3830  H H    . ARG A 1 77  ? 8.935   -7.701  4.306   1.00 0.00 ? 469 ARG A H    2  
ATOM 3831  H HA   . ARG A 1 77  ? 11.733  -6.954  4.898   1.00 0.00 ? 469 ARG A HA   2  
ATOM 3832  H HB2  . ARG A 1 77  ? 10.520  -6.586  2.206   1.00 0.00 ? 469 ARG A HB2  2  
ATOM 3833  H HB3  . ARG A 1 77  ? 12.145  -7.076  2.661   1.00 0.00 ? 469 ARG A HB3  2  
ATOM 3834  H HG2  . ARG A 1 77  ? 11.374  -9.334  3.113   1.00 0.00 ? 469 ARG A HG2  2  
ATOM 3835  H HG3  . ARG A 1 77  ? 9.730   -8.848  2.688   1.00 0.00 ? 469 ARG A HG3  2  
ATOM 3836  H HD2  . ARG A 1 77  ? 12.131  -8.928  0.866   1.00 0.00 ? 469 ARG A HD2  2  
ATOM 3837  H HD3  . ARG A 1 77  ? 10.707  -9.968  0.803   1.00 0.00 ? 469 ARG A HD3  2  
ATOM 3838  H HE   . ARG A 1 77  ? 10.344  -7.086  0.507   1.00 0.00 ? 469 ARG A HE   2  
ATOM 3839  H HH11 . ARG A 1 77  ? 10.425  -10.206 -1.136  1.00 0.00 ? 469 ARG A HH11 2  
ATOM 3840  H HH12 . ARG A 1 77  ? 9.724   -9.619  -2.564  1.00 0.00 ? 469 ARG A HH12 2  
ATOM 3841  H HH21 . ARG A 1 77  ? 9.535   -6.273  -1.353  1.00 0.00 ? 469 ARG A HH21 2  
ATOM 3842  H HH22 . ARG A 1 77  ? 9.151   -7.217  -2.712  1.00 0.00 ? 469 ARG A HH22 2  
ATOM 3843  N N    . MET A 1 78  ? 11.218  -4.424  4.688   1.00 0.00 ? 470 MET A N    2  
ATOM 3844  C CA   . MET A 1 78  ? 10.661  -3.126  4.874   1.00 0.00 ? 470 MET A CA   2  
ATOM 3845  C C    . MET A 1 78  ? 10.856  -2.292  3.663   1.00 0.00 ? 470 MET A C    2  
ATOM 3846  O O    . MET A 1 78  ? 11.751  -2.532  2.886   1.00 0.00 ? 470 MET A O    2  
ATOM 3847  C CB   . MET A 1 78  ? 11.247  -2.432  6.078   1.00 0.00 ? 470 MET A CB   2  
ATOM 3848  C CG   . MET A 1 78  ? 10.933  -3.084  7.387   1.00 0.00 ? 470 MET A CG   2  
ATOM 3849  S SD   . MET A 1 78  ? 11.216  -1.976  8.778   1.00 0.00 ? 470 MET A SD   2  
ATOM 3850  C CE   . MET A 1 78  ? 10.110  -0.615  8.359   1.00 0.00 ? 470 MET A CE   2  
ATOM 3851  H H    . MET A 1 78  ? 12.204  -4.455  4.710   1.00 0.00 ? 470 MET A H    2  
ATOM 3852  H HA   . MET A 1 78  ? 9.601   -3.245  5.036   1.00 0.00 ? 470 MET A HA   2  
ATOM 3853  H HB2  . MET A 1 78  ? 12.321  -2.456  5.976   1.00 0.00 ? 470 MET A HB2  2  
ATOM 3854  H HB3  . MET A 1 78  ? 10.895  -1.412  6.097   1.00 0.00 ? 470 MET A HB3  2  
ATOM 3855  H HG2  . MET A 1 78  ? 9.912   -3.420  7.364   1.00 0.00 ? 470 MET A HG2  2  
ATOM 3856  H HG3  . MET A 1 78  ? 11.575  -3.946  7.495   1.00 0.00 ? 470 MET A HG3  2  
ATOM 3857  H HE1  . MET A 1 78  ? 9.118   -0.987  8.150   1.00 0.00 ? 470 MET A HE1  2  
ATOM 3858  H HE2  . MET A 1 78  ? 10.078  0.085   9.181   1.00 0.00 ? 470 MET A HE2  2  
ATOM 3859  H HE3  . MET A 1 78  ? 10.473  -0.103  7.480   1.00 0.00 ? 470 MET A HE3  2  
ATOM 3860  N N    . VAL A 1 79  ? 9.979   -1.355  3.468   1.00 0.00 ? 471 VAL A N    2  
ATOM 3861  C CA   . VAL A 1 79  ? 10.062  -0.450  2.369   1.00 0.00 ? 471 VAL A CA   2  
ATOM 3862  C C    . VAL A 1 79  ? 9.823   0.963   2.854   1.00 0.00 ? 471 VAL A C    2  
ATOM 3863  O O    . VAL A 1 79  ? 9.241   1.181   3.936   1.00 0.00 ? 471 VAL A O    2  
ATOM 3864  C CB   . VAL A 1 79  ? 9.068   -0.784  1.219   1.00 0.00 ? 471 VAL A CB   2  
ATOM 3865  C CG1  . VAL A 1 79  ? 9.274   -2.185  0.695   1.00 0.00 ? 471 VAL A CG1  2  
ATOM 3866  C CG2  . VAL A 1 79  ? 7.642   -0.591  1.664   1.00 0.00 ? 471 VAL A CG2  2  
ATOM 3867  H H    . VAL A 1 79  ? 9.219   -1.256  4.080   1.00 0.00 ? 471 VAL A H    2  
ATOM 3868  H HA   . VAL A 1 79  ? 11.067  -0.525  1.998   1.00 0.00 ? 471 VAL A HA   2  
ATOM 3869  H HB   . VAL A 1 79  ? 9.263   -0.098  0.408   1.00 0.00 ? 471 VAL A HB   2  
ATOM 3870  H HG11 . VAL A 1 79  ? 10.295  -2.311  0.369   1.00 0.00 ? 471 VAL A HG11 2  
ATOM 3871  H HG12 . VAL A 1 79  ? 9.072   -2.881  1.495   1.00 0.00 ? 471 VAL A HG12 2  
ATOM 3872  H HG13 . VAL A 1 79  ? 8.599   -2.374  -0.125  1.00 0.00 ? 471 VAL A HG13 2  
ATOM 3873  H HG21 . VAL A 1 79  ? 7.475   -1.153  2.572   1.00 0.00 ? 471 VAL A HG21 2  
ATOM 3874  H HG22 . VAL A 1 79  ? 7.484   0.459   1.859   1.00 0.00 ? 471 VAL A HG22 2  
ATOM 3875  H HG23 . VAL A 1 79  ? 6.969   -0.923  0.889   1.00 0.00 ? 471 VAL A HG23 2  
ATOM 3876  N N    . GLN A 1 80  ? 10.267  1.895   2.078   1.00 0.00 ? 472 GLN A N    2  
ATOM 3877  C CA   . GLN A 1 80  ? 10.127  3.289   2.353   1.00 0.00 ? 472 GLN A CA   2  
ATOM 3878  C C    . GLN A 1 80  ? 9.549   3.971   1.130   1.00 0.00 ? 472 GLN A C    2  
ATOM 3879  O O    . GLN A 1 80  ? 10.130  3.928   0.042   1.00 0.00 ? 472 GLN A O    2  
ATOM 3880  C CB   . GLN A 1 80  ? 11.486  3.884   2.749   1.00 0.00 ? 472 GLN A CB   2  
ATOM 3881  C CG   . GLN A 1 80  ? 11.949  3.463   4.141   1.00 0.00 ? 472 GLN A CG   2  
ATOM 3882  C CD   . GLN A 1 80  ? 13.389  3.826   4.432   1.00 0.00 ? 472 GLN A CD   2  
ATOM 3883  O OE1  . GLN A 1 80  ? 14.300  3.029   4.210   1.00 0.00 ? 472 GLN A OE1  2  
ATOM 3884  N NE2  . GLN A 1 80  ? 13.616  5.029   4.889   1.00 0.00 ? 472 GLN A NE2  2  
ATOM 3885  H H    . GLN A 1 80  ? 10.713  1.642   1.234   1.00 0.00 ? 472 GLN A H    2  
ATOM 3886  H HA   . GLN A 1 80  ? 9.437   3.399   3.176   1.00 0.00 ? 472 GLN A HA   2  
ATOM 3887  H HB2  . GLN A 1 80  ? 12.227  3.554   2.036   1.00 0.00 ? 472 GLN A HB2  2  
ATOM 3888  H HB3  . GLN A 1 80  ? 11.422  4.962   2.722   1.00 0.00 ? 472 GLN A HB3  2  
ATOM 3889  H HG2  . GLN A 1 80  ? 11.323  3.946   4.876   1.00 0.00 ? 472 GLN A HG2  2  
ATOM 3890  H HG3  . GLN A 1 80  ? 11.836  2.393   4.230   1.00 0.00 ? 472 GLN A HG3  2  
ATOM 3891  H HE21 . GLN A 1 80  ? 12.853  5.636   5.017   1.00 0.00 ? 472 GLN A HE21 2  
ATOM 3892  H HE22 . GLN A 1 80  ? 14.540  5.290   5.080   1.00 0.00 ? 472 GLN A HE22 2  
ATOM 3893  N N    . PHE A 1 81  ? 8.409   4.573   1.310   1.00 0.00 ? 473 PHE A N    2  
ATOM 3894  C CA   . PHE A 1 81  ? 7.700   5.227   0.244   1.00 0.00 ? 473 PHE A CA   2  
ATOM 3895  C C    . PHE A 1 81  ? 7.771   6.714   0.377   1.00 0.00 ? 473 PHE A C    2  
ATOM 3896  O O    . PHE A 1 81  ? 7.322   7.317   1.425   1.00 0.00 ? 473 PHE A O    2  
ATOM 3897  C CB   . PHE A 1 81  ? 6.234   4.810   0.205   1.00 0.00 ? 473 PHE A CB   2  
ATOM 3898  C CG   . PHE A 1 81  ? 5.921   3.584   -0.584  1.00 0.00 ? 473 PHE A CG   2  
ATOM 3899  C CD1  . PHE A 1 81  ? 6.294   2.329   -0.149  1.00 0.00 ? 473 PHE A CD1  2  
ATOM 3900  C CD2  . PHE A 1 81  ? 5.213   3.696   -1.764  1.00 0.00 ? 473 PHE A CD2  2  
ATOM 3901  C CE1  . PHE A 1 81  ? 5.968   1.213   -0.888  1.00 0.00 ? 473 PHE A CE1  2  
ATOM 3902  C CE2  . PHE A 1 81  ? 4.890   2.587   -2.500  1.00 0.00 ? 473 PHE A CE2  2  
ATOM 3903  C CZ   . PHE A 1 81  ? 5.265   1.344   -2.065  1.00 0.00 ? 473 PHE A CZ   2  
ATOM 3904  H H    . PHE A 1 81  ? 8.022   4.614   2.213   1.00 0.00 ? 473 PHE A H    2  
ATOM 3905  H HA   . PHE A 1 81  ? 8.158   4.928   -0.688  1.00 0.00 ? 473 PHE A HA   2  
ATOM 3906  H HB2  . PHE A 1 81  ? 5.912   4.616   1.217   1.00 0.00 ? 473 PHE A HB2  2  
ATOM 3907  H HB3  . PHE A 1 81  ? 5.654   5.628   -0.197  1.00 0.00 ? 473 PHE A HB3  2  
ATOM 3908  H HD1  . PHE A 1 81  ? 6.843   2.222   0.776   1.00 0.00 ? 473 PHE A HD1  2  
ATOM 3909  H HD2  . PHE A 1 81  ? 4.913   4.673   -2.111  1.00 0.00 ? 473 PHE A HD2  2  
ATOM 3910  H HE1  . PHE A 1 81  ? 6.264   0.232   -0.553  1.00 0.00 ? 473 PHE A HE1  2  
ATOM 3911  H HE2  . PHE A 1 81  ? 4.342   2.696   -3.424  1.00 0.00 ? 473 PHE A HE2  2  
ATOM 3912  H HZ   . PHE A 1 81  ? 5.010   0.469   -2.644  1.00 0.00 ? 473 PHE A HZ   2  
ATOM 3913  N N    . HIS A 1 82  ? 8.335   7.320   -0.637  1.00 0.00 ? 474 HIS A N    2  
ATOM 3914  C CA   . HIS A 1 82  ? 8.387   8.736   -0.727  1.00 0.00 ? 474 HIS A CA   2  
ATOM 3915  C C    . HIS A 1 82  ? 7.912   9.103   -2.118  1.00 0.00 ? 474 HIS A C    2  
ATOM 3916  O O    . HIS A 1 82  ? 8.449   8.624   -3.112  1.00 0.00 ? 474 HIS A O    2  
ATOM 3917  C CB   . HIS A 1 82  ? 9.811   9.248   -0.479  1.00 0.00 ? 474 HIS A CB   2  
ATOM 3918  C CG   . HIS A 1 82  ? 9.895   10.736  -0.372  1.00 0.00 ? 474 HIS A CG   2  
ATOM 3919  N ND1  . HIS A 1 82  ? 10.298  11.561  -1.390  1.00 0.00 ? 474 HIS A ND1  2  
ATOM 3920  C CD2  . HIS A 1 82  ? 9.600   11.548  0.670   1.00 0.00 ? 474 HIS A CD2  2  
ATOM 3921  C CE1  . HIS A 1 82  ? 10.240  12.810  -0.955  1.00 0.00 ? 474 HIS A CE1  2  
ATOM 3922  N NE2  . HIS A 1 82  ? 9.818   12.864  0.297   1.00 0.00 ? 474 HIS A NE2  2  
ATOM 3923  H H    . HIS A 1 82  ? 8.736   6.798   -1.375  1.00 0.00 ? 474 HIS A H    2  
ATOM 3924  H HA   . HIS A 1 82  ? 7.711   9.151   0.007   1.00 0.00 ? 474 HIS A HA   2  
ATOM 3925  H HB2  . HIS A 1 82  ? 10.186  8.825   0.442   1.00 0.00 ? 474 HIS A HB2  2  
ATOM 3926  H HB3  . HIS A 1 82  ? 10.444  8.934   -1.296  1.00 0.00 ? 474 HIS A HB3  2  
ATOM 3927  H HD1  . HIS A 1 82  ? 10.586  11.303  -2.295  1.00 0.00 ? 474 HIS A HD1  2  
ATOM 3928  H HD2  . HIS A 1 82  ? 9.254   11.233  1.643   1.00 0.00 ? 474 HIS A HD2  2  
ATOM 3929  H HE1  . HIS A 1 82  ? 10.508  13.668  -1.552  1.00 0.00 ? 474 HIS A HE1  2  
ATOM 3930  N N    . PHE A 1 83  ? 6.906   9.910   -2.194  1.00 0.00 ? 475 PHE A N    2  
ATOM 3931  C CA   . PHE A 1 83  ? 6.335   10.258  -3.465  1.00 0.00 ? 475 PHE A CA   2  
ATOM 3932  C C    . PHE A 1 83  ? 7.185   11.309  -4.178  1.00 0.00 ? 475 PHE A C    2  
ATOM 3933  O O    . PHE A 1 83  ? 7.780   12.188  -3.523  1.00 0.00 ? 475 PHE A O    2  
ATOM 3934  C CB   . PHE A 1 83  ? 4.863   10.684  -3.311  1.00 0.00 ? 475 PHE A CB   2  
ATOM 3935  C CG   . PHE A 1 83  ? 3.924   9.550   -2.919  1.00 0.00 ? 475 PHE A CG   2  
ATOM 3936  C CD1  . PHE A 1 83  ? 3.920   9.035   -1.630  1.00 0.00 ? 475 PHE A CD1  2  
ATOM 3937  C CD2  . PHE A 1 83  ? 3.047   9.004   -3.848  1.00 0.00 ? 475 PHE A CD2  2  
ATOM 3938  C CE1  . PHE A 1 83  ? 3.070   8.004   -1.278  1.00 0.00 ? 475 PHE A CE1  2  
ATOM 3939  C CE2  . PHE A 1 83  ? 2.193   7.971   -3.497  1.00 0.00 ? 475 PHE A CE2  2  
ATOM 3940  C CZ   . PHE A 1 83  ? 2.207   7.472   -2.212  1.00 0.00 ? 475 PHE A CZ   2  
ATOM 3941  H H    . PHE A 1 83  ? 6.540   10.313  -1.380  1.00 0.00 ? 475 PHE A H    2  
ATOM 3942  H HA   . PHE A 1 83  ? 6.371   9.353   -4.051  1.00 0.00 ? 475 PHE A HA   2  
ATOM 3943  H HB2  . PHE A 1 83  ? 4.796   11.443  -2.546  1.00 0.00 ? 475 PHE A HB2  2  
ATOM 3944  H HB3  . PHE A 1 83  ? 4.515   11.097  -4.246  1.00 0.00 ? 475 PHE A HB3  2  
ATOM 3945  H HD1  . PHE A 1 83  ? 4.593   9.448   -0.892  1.00 0.00 ? 475 PHE A HD1  2  
ATOM 3946  H HD2  . PHE A 1 83  ? 3.027   9.388   -4.856  1.00 0.00 ? 475 PHE A HD2  2  
ATOM 3947  H HE1  . PHE A 1 83  ? 3.082   7.615   -0.272  1.00 0.00 ? 475 PHE A HE1  2  
ATOM 3948  H HE2  . PHE A 1 83  ? 1.516   7.553   -4.227  1.00 0.00 ? 475 PHE A HE2  2  
ATOM 3949  H HZ   . PHE A 1 83  ? 1.543   6.664   -1.937  1.00 0.00 ? 475 PHE A HZ   2  
ATOM 3950  N N    . THR A 1 84  ? 7.258   11.190  -5.515  1.00 0.00 ? 476 THR A N    2  
ATOM 3951  C CA   . THR A 1 84  ? 8.050   12.058  -6.390  1.00 0.00 ? 476 THR A CA   2  
ATOM 3952  C C    . THR A 1 84  ? 7.702   13.533  -6.106  1.00 0.00 ? 476 THR A C    2  
ATOM 3953  O O    . THR A 1 84  ? 8.574   14.409  -6.019  1.00 0.00 ? 476 THR A O    2  
ATOM 3954  C CB   . THR A 1 84  ? 7.723   11.680  -7.844  1.00 0.00 ? 476 THR A CB   2  
ATOM 3955  O OG1  . THR A 1 84  ? 7.735   10.237  -7.937  1.00 0.00 ? 476 THR A OG1  2  
ATOM 3956  C CG2  . THR A 1 84  ? 8.756   12.247  -8.801  1.00 0.00 ? 476 THR A CG2  2  
ATOM 3957  H H    . THR A 1 84  ? 6.764   10.481  -5.982  1.00 0.00 ? 476 THR A H    2  
ATOM 3958  H HA   . THR A 1 84  ? 9.098   11.882  -6.201  1.00 0.00 ? 476 THR A HA   2  
ATOM 3959  H HB   . THR A 1 84  ? 6.739   12.049  -8.093  1.00 0.00 ? 476 THR A HB   2  
ATOM 3960  H HG1  . THR A 1 84  ? 8.111   9.949   -8.776  1.00 0.00 ? 476 THR A HG1  2  
ATOM 3961  H HG21 . THR A 1 84  ? 9.730   11.856  -8.549  1.00 0.00 ? 476 THR A HG21 2  
ATOM 3962  H HG22 . THR A 1 84  ? 8.504   11.969  -9.814  1.00 0.00 ? 476 THR A HG22 2  
ATOM 3963  H HG23 . THR A 1 84  ? 8.761   13.323  -8.713  1.00 0.00 ? 476 THR A HG23 2  
ATOM 3964  N N    . ASN A 1 85  ? 6.436   13.762  -5.929  1.00 0.00 ? 477 ASN A N    2  
ATOM 3965  C CA   . ASN A 1 85  ? 5.897   14.992  -5.428  1.00 0.00 ? 477 ASN A CA   2  
ATOM 3966  C C    . ASN A 1 85  ? 5.069   14.538  -4.354  1.00 0.00 ? 477 ASN A C    2  
ATOM 3967  O O    . ASN A 1 85  ? 4.446   13.485  -4.473  1.00 0.00 ? 477 ASN A O    2  
ATOM 3968  C CB   . ASN A 1 85  ? 4.995   15.759  -6.429  1.00 0.00 ? 477 ASN A CB   2  
ATOM 3969  C CG   . ASN A 1 85  ? 5.598   15.902  -7.812  1.00 0.00 ? 477 ASN A CG   2  
ATOM 3970  O OD1  . ASN A 1 85  ? 6.371   16.822  -8.082  1.00 0.00 ? 477 ASN A OD1  2  
ATOM 3971  N ND2  . ASN A 1 85  ? 5.228   15.016  -8.705  1.00 0.00 ? 477 ASN A ND2  2  
ATOM 3972  H H    . ASN A 1 85  ? 5.792   13.041  -6.095  1.00 0.00 ? 477 ASN A H    2  
ATOM 3973  H HA   . ASN A 1 85  ? 6.554   15.688  -4.934  1.00 0.00 ? 477 ASN A HA   2  
ATOM 3974  H HB2  . ASN A 1 85  ? 4.033   15.273  -6.492  1.00 0.00 ? 477 ASN A HB2  2  
ATOM 3975  H HB3  . ASN A 1 85  ? 4.829   16.747  -6.009  1.00 0.00 ? 477 ASN A HB3  2  
ATOM 3976  H HD21 . ASN A 1 85  ? 4.587   14.321  -8.436  1.00 0.00 ? 477 ASN A HD21 2  
ATOM 3977  H HD22 . ASN A 1 85  ? 5.586   15.081  -9.615  1.00 0.00 ? 477 ASN A HD22 2  
ATOM 3978  N N    . LYS A 1 86  ? 5.037   15.282  -3.299  1.00 0.00 ? 478 LYS A N    2  
ATOM 3979  C CA   . LYS A 1 86  ? 4.153   15.033  -2.184  1.00 0.00 ? 478 LYS A CA   2  
ATOM 3980  C C    . LYS A 1 86  ? 2.711   15.205  -2.614  1.00 0.00 ? 478 LYS A C    2  
ATOM 3981  O O    . LYS A 1 86  ? 1.822   15.119  -1.806  1.00 0.00 ? 478 LYS A O    2  
ATOM 3982  C CB   . LYS A 1 86  ? 4.502   15.916  -1.011  1.00 0.00 ? 478 LYS A CB   2  
ATOM 3983  C CG   . LYS A 1 86  ? 5.835   15.552  -0.378  1.00 0.00 ? 478 LYS A CG   2  
ATOM 3984  C CD   . LYS A 1 86  ? 6.193   16.490  0.749   1.00 0.00 ? 478 LYS A CD   2  
ATOM 3985  C CE   . LYS A 1 86  ? 5.127   16.502  1.824   1.00 0.00 ? 478 LYS A CE   2  
ATOM 3986  N NZ   . LYS A 1 86  ? 5.506   17.376  2.940   1.00 0.00 ? 478 LYS A NZ   2  
ATOM 3987  H H    . LYS A 1 86  ? 5.655   16.044  -3.238  1.00 0.00 ? 478 LYS A H    2  
ATOM 3988  H HA   . LYS A 1 86  ? 4.284   14.002  -1.893  1.00 0.00 ? 478 LYS A HA   2  
ATOM 3989  H HB2  . LYS A 1 86  ? 4.544   16.943  -1.341  1.00 0.00 ? 478 LYS A HB2  2  
ATOM 3990  H HB3  . LYS A 1 86  ? 3.730   15.808  -0.265  1.00 0.00 ? 478 LYS A HB3  2  
ATOM 3991  H HG2  . LYS A 1 86  ? 5.774   14.547  0.016   1.00 0.00 ? 478 LYS A HG2  2  
ATOM 3992  H HG3  . LYS A 1 86  ? 6.607   15.590  -1.133  1.00 0.00 ? 478 LYS A HG3  2  
ATOM 3993  H HD2  . LYS A 1 86  ? 7.129   16.177  1.187   1.00 0.00 ? 478 LYS A HD2  2  
ATOM 3994  H HD3  . LYS A 1 86  ? 6.296   17.487  0.346   1.00 0.00 ? 478 LYS A HD3  2  
ATOM 3995  H HE2  . LYS A 1 86  ? 4.206   16.860  1.386   1.00 0.00 ? 478 LYS A HE2  2  
ATOM 3996  H HE3  . LYS A 1 86  ? 4.984   15.493  2.181   1.00 0.00 ? 478 LYS A HE3  2  
ATOM 3997  H HZ1  . LYS A 1 86  ? 5.722   18.335  2.602   1.00 0.00 ? 478 LYS A HZ1  2  
ATOM 3998  H HZ2  . LYS A 1 86  ? 4.748   17.450  3.648   1.00 0.00 ? 478 LYS A HZ2  2  
ATOM 3999  H HZ3  . LYS A 1 86  ? 6.349   17.005  3.425   1.00 0.00 ? 478 LYS A HZ3  2  
ATOM 4000  N N    . ASP A 1 87  ? 2.563   15.595  -3.901  1.00 0.00 ? 479 ASP A N    2  
ATOM 4001  C CA   . ASP A 1 87  ? 1.340   15.779  -4.634  1.00 0.00 ? 479 ASP A CA   2  
ATOM 4002  C C    . ASP A 1 87  ? 0.436   16.515  -3.805  1.00 0.00 ? 479 ASP A C    2  
ATOM 4003  O O    . ASP A 1 87  ? -0.575  16.013  -3.316  1.00 0.00 ? 479 ASP A O    2  
ATOM 4004  C CB   . ASP A 1 87  ? 0.724   14.505  -5.175  1.00 0.00 ? 479 ASP A CB   2  
ATOM 4005  C CG   . ASP A 1 87  ? -0.047  14.809  -6.433  1.00 0.00 ? 479 ASP A CG   2  
ATOM 4006  O OD1  . ASP A 1 87  ? -1.223  15.221  -6.360  1.00 0.00 ? 479 ASP A OD1  2  
ATOM 4007  O OD2  . ASP A 1 87  ? 0.544   14.699  -7.532  1.00 0.00 ? 479 ASP A OD2  2  
ATOM 4008  H H    . ASP A 1 87  ? 3.400   15.762  -4.377  1.00 0.00 ? 479 ASP A H    2  
ATOM 4009  H HA   . ASP A 1 87  ? 1.597   16.425  -5.461  1.00 0.00 ? 479 ASP A HA   2  
ATOM 4010  H HB2  . ASP A 1 87  ? 1.502   13.787  -5.388  1.00 0.00 ? 479 ASP A HB2  2  
ATOM 4011  H HB3  . ASP A 1 87  ? 0.041   14.097  -4.445  1.00 0.00 ? 479 ASP A HB3  2  
ATOM 4012  N N    . LEU A 1 88  ? 0.864   17.699  -3.603  1.00 0.00 ? 480 LEU A N    2  
ATOM 4013  C CA   . LEU A 1 88  ? 0.316   18.617  -2.632  1.00 0.00 ? 480 LEU A CA   2  
ATOM 4014  C C    . LEU A 1 88  ? -1.222  18.692  -2.677  1.00 0.00 ? 480 LEU A C    2  
ATOM 4015  O O    . LEU A 1 88  ? -1.867  18.718  -1.632  1.00 0.00 ? 480 LEU A O    2  
ATOM 4016  C CB   . LEU A 1 88  ? 0.972   19.981  -2.856  1.00 0.00 ? 480 LEU A CB   2  
ATOM 4017  C CG   . LEU A 1 88  ? 2.509   19.920  -3.065  1.00 0.00 ? 480 LEU A CG   2  
ATOM 4018  C CD1  . LEU A 1 88  ? 3.108   21.279  -3.290  1.00 0.00 ? 480 LEU A CD1  2  
ATOM 4019  C CD2  . LEU A 1 88  ? 3.220   19.187  -1.932  1.00 0.00 ? 480 LEU A CD2  2  
ATOM 4020  H H    . LEU A 1 88  ? 1.687   17.903  -4.115  1.00 0.00 ? 480 LEU A H    2  
ATOM 4021  H HA   . LEU A 1 88  ? 0.612   18.270  -1.654  1.00 0.00 ? 480 LEU A HA   2  
ATOM 4022  H HB2  . LEU A 1 88  ? 0.518   20.436  -3.723  1.00 0.00 ? 480 LEU A HB2  2  
ATOM 4023  H HB3  . LEU A 1 88  ? 0.776   20.604  -1.997  1.00 0.00 ? 480 LEU A HB3  2  
ATOM 4024  H HG   . LEU A 1 88  ? 2.701   19.374  -3.976  1.00 0.00 ? 480 LEU A HG   2  
ATOM 4025  H HD11 . LEU A 1 88  ? 2.659   21.716  -4.168  1.00 0.00 ? 480 LEU A HD11 2  
ATOM 4026  H HD12 . LEU A 1 88  ? 2.940   21.904  -2.427  1.00 0.00 ? 480 LEU A HD12 2  
ATOM 4027  H HD13 . LEU A 1 88  ? 4.166   21.139  -3.462  1.00 0.00 ? 480 LEU A HD13 2  
ATOM 4028  H HD21 . LEU A 1 88  ? 2.839   18.176  -1.885  1.00 0.00 ? 480 LEU A HD21 2  
ATOM 4029  H HD22 . LEU A 1 88  ? 4.275   19.135  -2.162  1.00 0.00 ? 480 LEU A HD22 2  
ATOM 4030  H HD23 . LEU A 1 88  ? 3.060   19.687  -0.989  1.00 0.00 ? 480 LEU A HD23 2  
ATOM 4031  N N    . GLU A 1 89  ? -1.815  18.706  -3.855  1.00 0.00 ? 481 GLU A N    2  
ATOM 4032  C CA   . GLU A 1 89  ? -3.258  18.663  -3.915  1.00 0.00 ? 481 GLU A CA   2  
ATOM 4033  C C    . GLU A 1 89  ? -3.845  17.262  -3.539  1.00 0.00 ? 481 GLU A C    2  
ATOM 4034  O O    . GLU A 1 89  ? -4.655  17.162  -2.611  1.00 0.00 ? 481 GLU A O    2  
ATOM 4035  C CB   . GLU A 1 89  ? -3.775  19.115  -5.282  1.00 0.00 ? 481 GLU A CB   2  
ATOM 4036  C CG   . GLU A 1 89  ? -5.296  19.105  -5.401  1.00 0.00 ? 481 GLU A CG   2  
ATOM 4037  C CD   . GLU A 1 89  ? -5.984  20.114  -4.501  1.00 0.00 ? 481 GLU A CD   2  
ATOM 4038  O OE1  . GLU A 1 89  ? -5.953  19.977  -3.265  1.00 0.00 ? 481 GLU A OE1  2  
ATOM 4039  O OE2  . GLU A 1 89  ? -6.611  21.037  -5.022  1.00 0.00 ? 481 GLU A OE2  2  
ATOM 4040  H H    . GLU A 1 89  ? -1.277  18.753  -4.674  1.00 0.00 ? 481 GLU A H    2  
ATOM 4041  H HA   . GLU A 1 89  ? -3.611  19.363  -3.170  1.00 0.00 ? 481 GLU A HA   2  
ATOM 4042  H HB2  . GLU A 1 89  ? -3.427  20.120  -5.472  1.00 0.00 ? 481 GLU A HB2  2  
ATOM 4043  H HB3  . GLU A 1 89  ? -3.371  18.454  -6.034  1.00 0.00 ? 481 GLU A HB3  2  
ATOM 4044  H HG2  . GLU A 1 89  ? -5.562  19.335  -6.423  1.00 0.00 ? 481 GLU A HG2  2  
ATOM 4045  H HG3  . GLU A 1 89  ? -5.656  18.117  -5.156  1.00 0.00 ? 481 GLU A HG3  2  
ATOM 4046  N N    . SER A 1 90  ? -3.391  16.188  -4.198  1.00 0.00 ? 482 SER A N    2  
ATOM 4047  C CA   . SER A 1 90  ? -4.007  14.860  -4.005  1.00 0.00 ? 482 SER A CA   2  
ATOM 4048  C C    . SER A 1 90  ? -3.649  14.220  -2.667  1.00 0.00 ? 482 SER A C    2  
ATOM 4049  O O    . SER A 1 90  ? -4.529  13.763  -1.922  1.00 0.00 ? 482 SER A O    2  
ATOM 4050  C CB   . SER A 1 90  ? -3.614  13.923  -5.130  1.00 0.00 ? 482 SER A CB   2  
ATOM 4051  O OG   . SER A 1 90  ? -3.769  14.553  -6.393  1.00 0.00 ? 482 SER A OG   2  
ATOM 4052  H H    . SER A 1 90  ? -2.625  16.264  -4.807  1.00 0.00 ? 482 SER A H    2  
ATOM 4053  H HA   . SER A 1 90  ? -5.078  14.995  -4.041  1.00 0.00 ? 482 SER A HA   2  
ATOM 4054  H HB2  . SER A 1 90  ? -2.579  13.640  -5.008  1.00 0.00 ? 482 SER A HB2  2  
ATOM 4055  H HB3  . SER A 1 90  ? -4.234  13.039  -5.102  1.00 0.00 ? 482 SER A HB3  2  
ATOM 4056  H HG   . SER A 1 90  ? -2.851  14.797  -6.613  1.00 0.00 ? 482 SER A HG   2  
ATOM 4057  N N    . LEU A 1 91  ? -2.374  14.228  -2.337  1.00 0.00 ? 483 LEU A N    2  
ATOM 4058  C CA   . LEU A 1 91  ? -1.897  13.560  -1.150  1.00 0.00 ? 483 LEU A CA   2  
ATOM 4059  C C    . LEU A 1 91  ? -2.302  14.244  0.105   1.00 0.00 ? 483 LEU A C    2  
ATOM 4060  O O    . LEU A 1 91  ? -2.374  13.618  1.115   1.00 0.00 ? 483 LEU A O    2  
ATOM 4061  C CB   . LEU A 1 91  ? -0.404  13.280  -1.185  1.00 0.00 ? 483 LEU A CB   2  
ATOM 4062  C CG   . LEU A 1 91  ? 0.038   12.055  -1.988  1.00 0.00 ? 483 LEU A CG   2  
ATOM 4063  C CD1  . LEU A 1 91  ? 1.539   12.014  -2.119  1.00 0.00 ? 483 LEU A CD1  2  
ATOM 4064  C CD2  . LEU A 1 91  ? -0.427  10.793  -1.300  1.00 0.00 ? 483 LEU A CD2  2  
ATOM 4065  H H    . LEU A 1 91  ? -1.721  14.721  -2.886  1.00 0.00 ? 483 LEU A H    2  
ATOM 4066  H HA   . LEU A 1 91  ? -2.405  12.608  -1.137  1.00 0.00 ? 483 LEU A HA   2  
ATOM 4067  H HB2  . LEU A 1 91  ? 0.087   14.148  -1.601  1.00 0.00 ? 483 LEU A HB2  2  
ATOM 4068  H HB3  . LEU A 1 91  ? -0.064  13.155  -0.167  1.00 0.00 ? 483 LEU A HB3  2  
ATOM 4069  H HG   . LEU A 1 91  ? -0.404  12.083  -2.972  1.00 0.00 ? 483 LEU A HG   2  
ATOM 4070  H HD11 . LEU A 1 91  ? 1.989   11.976  -1.138  1.00 0.00 ? 483 LEU A HD11 2  
ATOM 4071  H HD12 . LEU A 1 91  ? 1.827   11.138  -2.682  1.00 0.00 ? 483 LEU A HD12 2  
ATOM 4072  H HD13 . LEU A 1 91  ? 1.881   12.898  -2.638  1.00 0.00 ? 483 LEU A HD13 2  
ATOM 4073  H HD21 . LEU A 1 91  ? -0.039  10.762  -0.293  1.00 0.00 ? 483 LEU A HD21 2  
ATOM 4074  H HD22 . LEU A 1 91  ? -1.505  10.769  -1.266  1.00 0.00 ? 483 LEU A HD22 2  
ATOM 4075  H HD23 . LEU A 1 91  ? -0.068  9.933   -1.846  1.00 0.00 ? 483 LEU A HD23 2  
ATOM 4076  N N    . LYS A 1 92  ? -2.608  15.518  0.030   1.00 0.00 ? 484 LYS A N    2  
ATOM 4077  C CA   . LYS A 1 92  ? -3.118  16.244  1.192   1.00 0.00 ? 484 LYS A CA   2  
ATOM 4078  C C    . LYS A 1 92  ? -4.374  15.517  1.726   1.00 0.00 ? 484 LYS A C    2  
ATOM 4079  O O    . LYS A 1 92  ? -4.522  15.296  2.939   1.00 0.00 ? 484 LYS A O    2  
ATOM 4080  C CB   . LYS A 1 92  ? -3.439  17.679  0.781   1.00 0.00 ? 484 LYS A CB   2  
ATOM 4081  C CG   . LYS A 1 92  ? -3.961  18.592  1.886   1.00 0.00 ? 484 LYS A CG   2  
ATOM 4082  C CD   . LYS A 1 92  ? -4.065  20.078  1.454   1.00 0.00 ? 484 LYS A CD   2  
ATOM 4083  C CE   . LYS A 1 92  ? -5.057  20.356  0.296   1.00 0.00 ? 484 LYS A CE   2  
ATOM 4084  N NZ   . LYS A 1 92  ? -4.611  19.819  -1.019  1.00 0.00 ? 484 LYS A NZ   2  
ATOM 4085  H H    . LYS A 1 92  ? -2.464  15.983  -0.820  1.00 0.00 ? 484 LYS A H    2  
ATOM 4086  H HA   . LYS A 1 92  ? -2.359  16.238  1.962   1.00 0.00 ? 484 LYS A HA   2  
ATOM 4087  H HB2  . LYS A 1 92  ? -2.572  18.142  0.331   1.00 0.00 ? 484 LYS A HB2  2  
ATOM 4088  H HB3  . LYS A 1 92  ? -4.204  17.603  0.025   1.00 0.00 ? 484 LYS A HB3  2  
ATOM 4089  H HG2  . LYS A 1 92  ? -4.943  18.254  2.177   1.00 0.00 ? 484 LYS A HG2  2  
ATOM 4090  H HG3  . LYS A 1 92  ? -3.299  18.520  2.736   1.00 0.00 ? 484 LYS A HG3  2  
ATOM 4091  H HD2  . LYS A 1 92  ? -4.379  20.661  2.308   1.00 0.00 ? 484 LYS A HD2  2  
ATOM 4092  H HD3  . LYS A 1 92  ? -3.081  20.409  1.155   1.00 0.00 ? 484 LYS A HD3  2  
ATOM 4093  H HE2  . LYS A 1 92  ? -6.007  19.906  0.540   1.00 0.00 ? 484 LYS A HE2  2  
ATOM 4094  H HE3  . LYS A 1 92  ? -5.189  21.426  0.212   1.00 0.00 ? 484 LYS A HE3  2  
ATOM 4095  H HZ1  . LYS A 1 92  ? -3.633  20.102  -1.235  1.00 0.00 ? 484 LYS A HZ1  2  
ATOM 4096  H HZ2  . LYS A 1 92  ? -4.670  18.784  -1.037  1.00 0.00 ? 484 LYS A HZ2  2  
ATOM 4097  H HZ3  . LYS A 1 92  ? -5.222  20.121  -1.813  1.00 0.00 ? 484 LYS A HZ3  2  
ATOM 4098  N N    . GLY A 1 93  ? -5.224  15.096  0.795   1.00 0.00 ? 485 GLY A N    2  
ATOM 4099  C CA   . GLY A 1 93  ? -6.396  14.324  1.128   1.00 0.00 ? 485 GLY A CA   2  
ATOM 4100  C C    . GLY A 1 93  ? -6.044  12.921  1.594   1.00 0.00 ? 485 GLY A C    2  
ATOM 4101  O O    . GLY A 1 93  ? -6.573  12.439  2.597   1.00 0.00 ? 485 GLY A O    2  
ATOM 4102  H H    . GLY A 1 93  ? -5.043  15.305  -0.144  1.00 0.00 ? 485 GLY A H    2  
ATOM 4103  H HA2  . GLY A 1 93  ? -6.921  14.828  1.926   1.00 0.00 ? 485 GLY A HA2  2  
ATOM 4104  H HA3  . GLY A 1 93  ? -7.038  14.254  0.262   1.00 0.00 ? 485 GLY A HA3  2  
ATOM 4105  N N    . LEU A 1 94  ? -5.121  12.269  0.879   1.00 0.00 ? 486 LEU A N    2  
ATOM 4106  C CA   . LEU A 1 94  ? -4.726  10.892  1.204   1.00 0.00 ? 486 LEU A CA   2  
ATOM 4107  C C    . LEU A 1 94  ? -4.060  10.848  2.595   1.00 0.00 ? 486 LEU A C    2  
ATOM 4108  O O    . LEU A 1 94  ? -4.336  9.955   3.388   1.00 0.00 ? 486 LEU A O    2  
ATOM 4109  C CB   . LEU A 1 94  ? -3.770  10.317  0.138   1.00 0.00 ? 486 LEU A CB   2  
ATOM 4110  C CG   . LEU A 1 94  ? -4.046  8.867   -0.356  1.00 0.00 ? 486 LEU A CG   2  
ATOM 4111  C CD1  . LEU A 1 94  ? -2.914  8.356   -1.230  1.00 0.00 ? 486 LEU A CD1  2  
ATOM 4112  C CD2  . LEU A 1 94  ? -4.288  7.904   0.783   1.00 0.00 ? 486 LEU A CD2  2  
ATOM 4113  H H    . LEU A 1 94  ? -4.719  12.727  0.109   1.00 0.00 ? 486 LEU A H    2  
ATOM 4114  H HA   . LEU A 1 94  ? -5.631  10.303  1.235   1.00 0.00 ? 486 LEU A HA   2  
ATOM 4115  H HB2  . LEU A 1 94  ? -3.804  10.971  -0.721  1.00 0.00 ? 486 LEU A HB2  2  
ATOM 4116  H HB3  . LEU A 1 94  ? -2.769  10.344  0.547   1.00 0.00 ? 486 LEU A HB3  2  
ATOM 4117  H HG   . LEU A 1 94  ? -4.931  8.891   -0.975  1.00 0.00 ? 486 LEU A HG   2  
ATOM 4118  H HD11 . LEU A 1 94  ? -2.788  9.002   -2.087  1.00 0.00 ? 486 LEU A HD11 2  
ATOM 4119  H HD12 . LEU A 1 94  ? -2.000  8.341   -0.653  1.00 0.00 ? 486 LEU A HD12 2  
ATOM 4120  H HD13 . LEU A 1 94  ? -3.135  7.353   -1.562  1.00 0.00 ? 486 LEU A HD13 2  
ATOM 4121  H HD21 . LEU A 1 94  ? -5.139  8.223   1.366   1.00 0.00 ? 486 LEU A HD21 2  
ATOM 4122  H HD22 . LEU A 1 94  ? -4.466  6.916   0.385   1.00 0.00 ? 486 LEU A HD22 2  
ATOM 4123  H HD23 . LEU A 1 94  ? -3.407  7.885   1.408   1.00 0.00 ? 486 LEU A HD23 2  
ATOM 4124  N N    . TYR A 1 95  ? -3.206  11.839  2.881   1.00 0.00 ? 487 TYR A N    2  
ATOM 4125  C CA   . TYR A 1 95  ? -2.533  11.979  4.185   1.00 0.00 ? 487 TYR A CA   2  
ATOM 4126  C C    . TYR A 1 95  ? -3.564  12.037  5.289   1.00 0.00 ? 487 TYR A C    2  
ATOM 4127  O O    . TYR A 1 95  ? -3.408  11.400  6.335   1.00 0.00 ? 487 TYR A O    2  
ATOM 4128  C CB   . TYR A 1 95  ? -1.670  13.269  4.250   1.00 0.00 ? 487 TYR A CB   2  
ATOM 4129  C CG   . TYR A 1 95  ? -0.360  13.281  3.454   1.00 0.00 ? 487 TYR A CG   2  
ATOM 4130  C CD1  . TYR A 1 95  ? 0.585   14.274  3.687   1.00 0.00 ? 487 TYR A CD1  2  
ATOM 4131  C CD2  . TYR A 1 95  ? -0.065  12.322  2.488   1.00 0.00 ? 487 TYR A CD2  2  
ATOM 4132  C CE1  . TYR A 1 95  ? 1.776   14.313  2.990   1.00 0.00 ? 487 TYR A CE1  2  
ATOM 4133  C CE2  . TYR A 1 95  ? 1.123   12.360  1.785   1.00 0.00 ? 487 TYR A CE2  2  
ATOM 4134  C CZ   . TYR A 1 95  ? 2.039   13.355  2.041   1.00 0.00 ? 487 TYR A CZ   2  
ATOM 4135  O OH   . TYR A 1 95  ? 3.231   13.386  1.353   1.00 0.00 ? 487 TYR A OH   2  
ATOM 4136  H H    . TYR A 1 95  ? -3.005  12.508  2.185   1.00 0.00 ? 487 TYR A H    2  
ATOM 4137  H HA   . TYR A 1 95  ? -1.897  11.120  4.337   1.00 0.00 ? 487 TYR A HA   2  
ATOM 4138  H HB2  . TYR A 1 95  ? -2.263  14.084  3.864   1.00 0.00 ? 487 TYR A HB2  2  
ATOM 4139  H HB3  . TYR A 1 95  ? -1.437  13.487  5.281   1.00 0.00 ? 487 TYR A HB3  2  
ATOM 4140  H HD1  . TYR A 1 95  ? 0.375   15.029  4.432   1.00 0.00 ? 487 TYR A HD1  2  
ATOM 4141  H HD2  . TYR A 1 95  ? -0.786  11.544  2.283   1.00 0.00 ? 487 TYR A HD2  2  
ATOM 4142  H HE1  . TYR A 1 95  ? 2.497   15.095  3.180   1.00 0.00 ? 487 TYR A HE1  2  
ATOM 4143  H HE2  . TYR A 1 95  ? 1.324   11.613  1.030   1.00 0.00 ? 487 TYR A HE2  2  
ATOM 4144  H HH   . TYR A 1 95  ? 3.935   13.454  2.003   1.00 0.00 ? 487 TYR A HH   2  
ATOM 4145  N N    . ARG A 1 96  ? -4.626  12.783  5.035   1.00 0.00 ? 488 ARG A N    2  
ATOM 4146  C CA   . ARG A 1 96  ? -5.708  12.933  5.975   1.00 0.00 ? 488 ARG A CA   2  
ATOM 4147  C C    . ARG A 1 96  ? -6.387  11.586  6.217   1.00 0.00 ? 488 ARG A C    2  
ATOM 4148  O O    . ARG A 1 96  ? -6.588  11.189  7.363   1.00 0.00 ? 488 ARG A O    2  
ATOM 4149  C CB   . ARG A 1 96  ? -6.732  13.966  5.464   1.00 0.00 ? 488 ARG A CB   2  
ATOM 4150  C CG   . ARG A 1 96  ? -7.911  14.190  6.401   1.00 0.00 ? 488 ARG A CG   2  
ATOM 4151  C CD   . ARG A 1 96  ? -7.466  14.778  7.727   1.00 0.00 ? 488 ARG A CD   2  
ATOM 4152  N NE   . ARG A 1 96  ? -8.552  14.803  8.699   1.00 0.00 ? 488 ARG A NE   2  
ATOM 4153  C CZ   . ARG A 1 96  ? -8.473  15.293  9.938   1.00 0.00 ? 488 ARG A CZ   2  
ATOM 4154  N NH1  . ARG A 1 96  ? -7.356  15.884  10.363  1.00 0.00 ? 488 ARG A NH1  2  
ATOM 4155  N NH2  . ARG A 1 96  ? -9.524  15.201  10.741  1.00 0.00 ? 488 ARG A NH2  2  
ATOM 4156  H H    . ARG A 1 96  ? -4.681  13.250  4.174   1.00 0.00 ? 488 ARG A H    2  
ATOM 4157  H HA   . ARG A 1 96  ? -5.285  13.290  6.902   1.00 0.00 ? 488 ARG A HA   2  
ATOM 4158  H HB2  . ARG A 1 96  ? -6.233  14.912  5.319   1.00 0.00 ? 488 ARG A HB2  2  
ATOM 4159  H HB3  . ARG A 1 96  ? -7.114  13.628  4.512   1.00 0.00 ? 488 ARG A HB3  2  
ATOM 4160  H HG2  . ARG A 1 96  ? -8.609  14.871  5.936   1.00 0.00 ? 488 ARG A HG2  2  
ATOM 4161  H HG3  . ARG A 1 96  ? -8.395  13.241  6.580   1.00 0.00 ? 488 ARG A HG3  2  
ATOM 4162  H HD2  . ARG A 1 96  ? -6.658  14.184  8.124   1.00 0.00 ? 488 ARG A HD2  2  
ATOM 4163  H HD3  . ARG A 1 96  ? -7.118  15.787  7.564   1.00 0.00 ? 488 ARG A HD3  2  
ATOM 4164  H HE   . ARG A 1 96  ? -9.391  14.396  8.384   1.00 0.00 ? 488 ARG A HE   2  
ATOM 4165  H HH11 . ARG A 1 96  ? -6.553  15.975  9.770   1.00 0.00 ? 488 ARG A HH11 2  
ATOM 4166  H HH12 . ARG A 1 96  ? -7.280  16.269  11.287  1.00 0.00 ? 488 ARG A HH12 2  
ATOM 4167  H HH21 . ARG A 1 96  ? -10.375 14.766  10.436  1.00 0.00 ? 488 ARG A HH21 2  
ATOM 4168  H HH22 . ARG A 1 96  ? -9.525  15.579  11.671  1.00 0.00 ? 488 ARG A HH22 2  
ATOM 4169  N N    . ILE A 1 97  ? -6.698  10.886  5.132   1.00 0.00 ? 489 ILE A N    2  
ATOM 4170  C CA   . ILE A 1 97  ? -7.369  9.593   5.196   1.00 0.00 ? 489 ILE A CA   2  
ATOM 4171  C C    . ILE A 1 97  ? -6.515  8.557   5.938   1.00 0.00 ? 489 ILE A C    2  
ATOM 4172  O O    . ILE A 1 97  ? -6.977  7.941   6.893   1.00 0.00 ? 489 ILE A O    2  
ATOM 4173  C CB   . ILE A 1 97  ? -7.728  9.066   3.770   1.00 0.00 ? 489 ILE A CB   2  
ATOM 4174  C CG1  . ILE A 1 97  ? -8.686  10.039  3.064   1.00 0.00 ? 489 ILE A CG1  2  
ATOM 4175  C CG2  . ILE A 1 97  ? -8.340  7.665   3.836   1.00 0.00 ? 489 ILE A CG2  2  
ATOM 4176  C CD1  . ILE A 1 97  ? -9.069  9.618   1.657   1.00 0.00 ? 489 ILE A CD1  2  
ATOM 4177  H H    . ILE A 1 97  ? -6.472  11.263  4.253   1.00 0.00 ? 489 ILE A H    2  
ATOM 4178  H HA   . ILE A 1 97  ? -8.285  9.736   5.747   1.00 0.00 ? 489 ILE A HA   2  
ATOM 4179  H HB   . ILE A 1 97  ? -6.814  9.005   3.200   1.00 0.00 ? 489 ILE A HB   2  
ATOM 4180  H HG12 . ILE A 1 97  ? -9.594  10.120  3.642   1.00 0.00 ? 489 ILE A HG12 2  
ATOM 4181  H HG13 . ILE A 1 97  ? -8.217  11.011  3.007   1.00 0.00 ? 489 ILE A HG13 2  
ATOM 4182  H HG21 . ILE A 1 97  ? -9.240  7.693   4.431   1.00 0.00 ? 489 ILE A HG21 2  
ATOM 4183  H HG22 . ILE A 1 97  ? -8.574  7.326   2.838   1.00 0.00 ? 489 ILE A HG22 2  
ATOM 4184  H HG23 . ILE A 1 97  ? -7.632  6.986   4.287   1.00 0.00 ? 489 ILE A HG23 2  
ATOM 4185  H HD11 . ILE A 1 97  ? -9.537  8.646   1.705   1.00 0.00 ? 489 ILE A HD11 2  
ATOM 4186  H HD12 . ILE A 1 97  ? -9.762  10.333  1.238   1.00 0.00 ? 489 ILE A HD12 2  
ATOM 4187  H HD13 . ILE A 1 97  ? -8.184  9.560   1.043   1.00 0.00 ? 489 ILE A HD13 2  
ATOM 4188  N N    . MET A 1 98  ? -5.260  8.430   5.545   1.00 0.00 ? 490 MET A N    2  
ATOM 4189  C CA   . MET A 1 98  ? -4.353  7.435   6.142   1.00 0.00 ? 490 MET A CA   2  
ATOM 4190  C C    . MET A 1 98  ? -4.130  7.737   7.617   1.00 0.00 ? 490 MET A C    2  
ATOM 4191  O O    . MET A 1 98  ? -4.207  6.852   8.472   1.00 0.00 ? 490 MET A O    2  
ATOM 4192  C CB   . MET A 1 98  ? -3.004  7.420   5.416   1.00 0.00 ? 490 MET A CB   2  
ATOM 4193  C CG   . MET A 1 98  ? -3.086  7.126   3.928   1.00 0.00 ? 490 MET A CG   2  
ATOM 4194  S SD   . MET A 1 98  ? -3.585  5.439   3.524   1.00 0.00 ? 490 MET A SD   2  
ATOM 4195  C CE   . MET A 1 98  ? -2.117  4.526   3.984   1.00 0.00 ? 490 MET A CE   2  
ATOM 4196  H H    . MET A 1 98  ? -4.938  9.018   4.824   1.00 0.00 ? 490 MET A H    2  
ATOM 4197  H HA   . MET A 1 98  ? -4.815  6.462   6.050   1.00 0.00 ? 490 MET A HA   2  
ATOM 4198  H HB2  . MET A 1 98  ? -2.526  8.380   5.544   1.00 0.00 ? 490 MET A HB2  2  
ATOM 4199  H HB3  . MET A 1 98  ? -2.387  6.662   5.875   1.00 0.00 ? 490 MET A HB3  2  
ATOM 4200  H HG2  . MET A 1 98  ? -3.811  7.801   3.499   1.00 0.00 ? 490 MET A HG2  2  
ATOM 4201  H HG3  . MET A 1 98  ? -2.119  7.321   3.486   1.00 0.00 ? 490 MET A HG3  2  
ATOM 4202  H HE1  . MET A 1 98  ? -1.898  4.670   5.031   1.00 0.00 ? 490 MET A HE1  2  
ATOM 4203  H HE2  . MET A 1 98  ? -2.283  3.476   3.788   1.00 0.00 ? 490 MET A HE2  2  
ATOM 4204  H HE3  . MET A 1 98  ? -1.290  4.871   3.381   1.00 0.00 ? 490 MET A HE3  2  
ATOM 4205  N N    . GLY A 1 99  ? -3.933  9.012   7.919   1.00 0.00 ? 491 GLY A N    2  
ATOM 4206  C CA   . GLY A 1 99  ? -3.692  9.439   9.286   1.00 0.00 ? 491 GLY A CA   2  
ATOM 4207  C C    . GLY A 1 99  ? -4.929  9.322   10.164  1.00 0.00 ? 491 GLY A C    2  
ATOM 4208  O O    . GLY A 1 99  ? -4.841  9.386   11.389  1.00 0.00 ? 491 GLY A O    2  
ATOM 4209  H H    . GLY A 1 99  ? -3.947  9.684   7.202   1.00 0.00 ? 491 GLY A H    2  
ATOM 4210  H HA2  . GLY A 1 99  ? -2.908  8.822   9.703   1.00 0.00 ? 491 GLY A HA2  2  
ATOM 4211  H HA3  . GLY A 1 99  ? -3.359  10.465  9.282   1.00 0.00 ? 491 GLY A HA3  2  
ATOM 4212  N N    . ASN A 1 100 ? -6.071  9.117   9.537   1.00 0.00 ? 492 ASN A N    2  
ATOM 4213  C CA   . ASN A 1 100 ? -7.341  8.971   10.239  1.00 0.00 ? 492 ASN A CA   2  
ATOM 4214  C C    . ASN A 1 100 ? -7.553  7.486   10.601  1.00 0.00 ? 492 ASN A C    2  
ATOM 4215  O O    . ASN A 1 100 ? -8.622  7.063   11.050  1.00 0.00 ? 492 ASN A O    2  
ATOM 4216  C CB   . ASN A 1 100 ? -8.491  9.532   9.355   1.00 0.00 ? 492 ASN A CB   2  
ATOM 4217  C CG   . ASN A 1 100 ? -9.857  9.597   10.034  1.00 0.00 ? 492 ASN A CG   2  
ATOM 4218  O OD1  . ASN A 1 100 ? -10.174 10.564  10.729  1.00 0.00 ? 492 ASN A OD1  2  
ATOM 4219  N ND2  . ASN A 1 100 ? -10.695 8.630   9.786   1.00 0.00 ? 492 ASN A ND2  2  
ATOM 4220  H H    . ASN A 1 100 ? -6.069  9.056   8.557   1.00 0.00 ? 492 ASN A H    2  
ATOM 4221  H HA   . ASN A 1 100 ? -7.279  9.540   11.155  1.00 0.00 ? 492 ASN A HA   2  
ATOM 4222  H HB2  . ASN A 1 100 ? -8.231  10.533  9.046   1.00 0.00 ? 492 ASN A HB2  2  
ATOM 4223  H HB3  . ASN A 1 100 ? -8.576  8.913   8.474   1.00 0.00 ? 492 ASN A HB3  2  
ATOM 4224  H HD21 . ASN A 1 100 ? -10.427 7.905   9.183   1.00 0.00 ? 492 ASN A HD21 2  
ATOM 4225  H HD22 . ASN A 1 100 ? -11.579 8.659   10.209  1.00 0.00 ? 492 ASN A HD22 2  
ATOM 4226  N N    . GLY A 1 101 ? -6.507  6.706   10.434  1.00 0.00 ? 493 GLY A N    2  
ATOM 4227  C CA   . GLY A 1 101 ? -6.565  5.319   10.793  1.00 0.00 ? 493 GLY A CA   2  
ATOM 4228  C C    . GLY A 1 101 ? -6.816  4.417   9.620   1.00 0.00 ? 493 GLY A C    2  
ATOM 4229  O O    . GLY A 1 101 ? -7.437  3.369   9.766   1.00 0.00 ? 493 GLY A O    2  
ATOM 4230  H H    . GLY A 1 101 ? -5.688  7.087   10.052  1.00 0.00 ? 493 GLY A H    2  
ATOM 4231  H HA2  . GLY A 1 101 ? -5.627  5.041   11.249  1.00 0.00 ? 493 GLY A HA2  2  
ATOM 4232  H HA3  . GLY A 1 101 ? -7.359  5.180   11.513  1.00 0.00 ? 493 GLY A HA3  2  
ATOM 4233  N N    . PHE A 1 102 ? -6.368  4.814   8.456   1.00 0.00 ? 494 PHE A N    2  
ATOM 4234  C CA   . PHE A 1 102 ? -6.489  3.979   7.284   1.00 0.00 ? 494 PHE A CA   2  
ATOM 4235  C C    . PHE A 1 102 ? -5.129  3.520   6.789   1.00 0.00 ? 494 PHE A C    2  
ATOM 4236  O O    . PHE A 1 102 ? -4.138  4.237   6.909   1.00 0.00 ? 494 PHE A O    2  
ATOM 4237  C CB   . PHE A 1 102 ? -7.319  4.632   6.173   1.00 0.00 ? 494 PHE A CB   2  
ATOM 4238  C CG   . PHE A 1 102 ? -8.780  4.725   6.521   1.00 0.00 ? 494 PHE A CG   2  
ATOM 4239  C CD1  . PHE A 1 102 ? -9.548  3.578   6.590   1.00 0.00 ? 494 PHE A CD1  2  
ATOM 4240  C CD2  . PHE A 1 102 ? -9.383  5.945   6.784   1.00 0.00 ? 494 PHE A CD2  2  
ATOM 4241  C CE1  . PHE A 1 102 ? -10.885 3.638   6.915   1.00 0.00 ? 494 PHE A CE1  2  
ATOM 4242  C CE2  . PHE A 1 102 ? -10.723 6.016   7.107   1.00 0.00 ? 494 PHE A CE2  2  
ATOM 4243  C CZ   . PHE A 1 102 ? -11.475 4.859   7.176   1.00 0.00 ? 494 PHE A CZ   2  
ATOM 4244  H H    . PHE A 1 102 ? -5.901  5.672   8.367   1.00 0.00 ? 494 PHE A H    2  
ATOM 4245  H HA   . PHE A 1 102 ? -7.009  3.094   7.621   1.00 0.00 ? 494 PHE A HA   2  
ATOM 4246  H HB2  . PHE A 1 102 ? -6.954  5.634   5.998   1.00 0.00 ? 494 PHE A HB2  2  
ATOM 4247  H HB3  . PHE A 1 102 ? -7.224  4.051   5.268   1.00 0.00 ? 494 PHE A HB3  2  
ATOM 4248  H HD1  . PHE A 1 102 ? -9.083  2.624   6.388   1.00 0.00 ? 494 PHE A HD1  2  
ATOM 4249  H HD2  . PHE A 1 102 ? -8.795  6.851   6.727   1.00 0.00 ? 494 PHE A HD2  2  
ATOM 4250  H HE1  . PHE A 1 102 ? -11.461 2.727   6.964   1.00 0.00 ? 494 PHE A HE1  2  
ATOM 4251  H HE2  . PHE A 1 102 ? -11.179 6.973   7.310   1.00 0.00 ? 494 PHE A HE2  2  
ATOM 4252  H HZ   . PHE A 1 102 ? -12.524 4.912   7.431   1.00 0.00 ? 494 PHE A HZ   2  
ATOM 4253  N N    . ALA A 1 103 ? -5.095  2.327   6.283   1.00 0.00 ? 495 ALA A N    2  
ATOM 4254  C CA   . ALA A 1 103 ? -3.908  1.713   5.765   1.00 0.00 ? 495 ALA A CA   2  
ATOM 4255  C C    . ALA A 1 103 ? -4.173  1.290   4.341   1.00 0.00 ? 495 ALA A C    2  
ATOM 4256  O O    . ALA A 1 103 ? -5.328  1.032   3.970   1.00 0.00 ? 495 ALA A O    2  
ATOM 4257  C CB   . ALA A 1 103 ? -3.532  0.506   6.610   1.00 0.00 ? 495 ALA A CB   2  
ATOM 4258  H H    . ALA A 1 103 ? -5.927  1.809   6.212   1.00 0.00 ? 495 ALA A H    2  
ATOM 4259  H HA   . ALA A 1 103 ? -3.098  2.428   5.792   1.00 0.00 ? 495 ALA A HA   2  
ATOM 4260  H HB1  . ALA A 1 103 ? -3.397  0.821   7.633   1.00 0.00 ? 495 ALA A HB1  2  
ATOM 4261  H HB2  . ALA A 1 103 ? -4.320  -0.230  6.560   1.00 0.00 ? 495 ALA A HB2  2  
ATOM 4262  H HB3  . ALA A 1 103 ? -2.604  0.082   6.249   1.00 0.00 ? 495 ALA A HB3  2  
ATOM 4263  N N    . GLY A 1 104 ? -3.146  1.216   3.554   1.00 0.00 ? 496 GLY A N    2  
ATOM 4264  C CA   . GLY A 1 104 ? -3.313  0.864   2.186   1.00 0.00 ? 496 GLY A CA   2  
ATOM 4265  C C    . GLY A 1 104 ? -2.674  -0.451  1.885   1.00 0.00 ? 496 GLY A C    2  
ATOM 4266  O O    . GLY A 1 104 ? -1.456  -0.554  1.846   1.00 0.00 ? 496 GLY A O    2  
ATOM 4267  H H    . GLY A 1 104 ? -2.240  1.372   3.906   1.00 0.00 ? 496 GLY A H    2  
ATOM 4268  H HA2  . GLY A 1 104 ? -4.367  0.811   1.957   1.00 0.00 ? 496 GLY A HA2  2  
ATOM 4269  H HA3  . GLY A 1 104 ? -2.855  1.621   1.568   1.00 0.00 ? 496 GLY A HA3  2  
ATOM 4270  N N    . CYS A 1 105 ? -3.466  -1.457  1.685   1.00 0.00 ? 497 CYS A N    2  
ATOM 4271  C CA   . CYS A 1 105 ? -2.932  -2.736  1.357   1.00 0.00 ? 497 CYS A CA   2  
ATOM 4272  C C    . CYS A 1 105 ? -2.651  -2.750  -0.122  1.00 0.00 ? 497 CYS A C    2  
ATOM 4273  O O    . CYS A 1 105 ? -3.556  -2.552  -0.942  1.00 0.00 ? 497 CYS A O    2  
ATOM 4274  C CB   . CYS A 1 105 ? -3.895  -3.859  1.734   1.00 0.00 ? 497 CYS A CB   2  
ATOM 4275  S SG   . CYS A 1 105 ? -3.202  -5.515  1.508   1.00 0.00 ? 497 CYS A SG   2  
ATOM 4276  H H    . CYS A 1 105 ? -4.440  -1.326  1.733   1.00 0.00 ? 497 CYS A H    2  
ATOM 4277  H HA   . CYS A 1 105 ? -2.003  -2.857  1.893   1.00 0.00 ? 497 CYS A HA   2  
ATOM 4278  H HB2  . CYS A 1 105 ? -4.178  -3.755  2.771   1.00 0.00 ? 497 CYS A HB2  2  
ATOM 4279  H HB3  . CYS A 1 105 ? -4.779  -3.786  1.119   1.00 0.00 ? 497 CYS A HB3  2  
ATOM 4280  H HG   . CYS A 1 105 ? -1.938  -5.393  1.122   1.00 0.00 ? 497 CYS A HG   2  
ATOM 4281  N N    . VAL A 1 106 ? -1.432  -2.977  -0.461  1.00 0.00 ? 498 VAL A N    2  
ATOM 4282  C CA   . VAL A 1 106 ? -1.011  -2.910  -1.812  1.00 0.00 ? 498 VAL A CA   2  
ATOM 4283  C C    . VAL A 1 106 ? -0.910  -4.297  -2.377  1.00 0.00 ? 498 VAL A C    2  
ATOM 4284  O O    . VAL A 1 106 ? -0.157  -5.157  -1.874  1.00 0.00 ? 498 VAL A O    2  
ATOM 4285  C CB   . VAL A 1 106 ? 0.360   -2.196  -1.939  1.00 0.00 ? 498 VAL A CB   2  
ATOM 4286  C CG1  . VAL A 1 106 ? 0.794   -2.098  -3.392  1.00 0.00 ? 498 VAL A CG1  2  
ATOM 4287  C CG2  . VAL A 1 106 ? 0.307   -0.817  -1.310  1.00 0.00 ? 498 VAL A CG2  2  
ATOM 4288  H H    . VAL A 1 106 ? -0.768  -3.234  0.218   1.00 0.00 ? 498 VAL A H    2  
ATOM 4289  H HA   . VAL A 1 106 ? -1.741  -2.345  -2.371  1.00 0.00 ? 498 VAL A HA   2  
ATOM 4290  H HB   . VAL A 1 106 ? 1.091   -2.784  -1.406  1.00 0.00 ? 498 VAL A HB   2  
ATOM 4291  H HG11 . VAL A 1 106 ? 0.045   -1.557  -3.952  1.00 0.00 ? 498 VAL A HG11 2  
ATOM 4292  H HG12 . VAL A 1 106 ? 1.739   -1.579  -3.457  1.00 0.00 ? 498 VAL A HG12 2  
ATOM 4293  H HG13 . VAL A 1 106 ? 0.898   -3.091  -3.805  1.00 0.00 ? 498 VAL A HG13 2  
ATOM 4294  H HG21 . VAL A 1 106 ? 0.050   -0.912  -0.266  1.00 0.00 ? 498 VAL A HG21 2  
ATOM 4295  H HG22 . VAL A 1 106 ? 1.270   -0.340  -1.408  1.00 0.00 ? 498 VAL A HG22 2  
ATOM 4296  H HG23 . VAL A 1 106 ? -0.442  -0.230  -1.818  1.00 0.00 ? 498 VAL A HG23 2  
ATOM 4297  N N    . HIS A 1 107 ? -1.666  -4.499  -3.403  1.00 0.00 ? 499 HIS A N    2  
ATOM 4298  C CA   . HIS A 1 107 ? -1.701  -5.726  -4.116  1.00 0.00 ? 499 HIS A CA   2  
ATOM 4299  C C    . HIS A 1 107 ? -1.015  -5.511  -5.437  1.00 0.00 ? 499 HIS A C    2  
ATOM 4300  O O    . HIS A 1 107 ? -1.107  -4.410  -6.041  1.00 0.00 ? 499 HIS A O    2  
ATOM 4301  C CB   . HIS A 1 107 ? -3.144  -6.214  -4.327  1.00 0.00 ? 499 HIS A CB   2  
ATOM 4302  C CG   . HIS A 1 107 ? -3.828  -6.735  -3.086  1.00 0.00 ? 499 HIS A CG   2  
ATOM 4303  N ND1  . HIS A 1 107 ? -4.406  -5.938  -2.116  1.00 0.00 ? 499 HIS A ND1  2  
ATOM 4304  C CD2  . HIS A 1 107 ? -4.044  -8.014  -2.684  1.00 0.00 ? 499 HIS A CD2  2  
ATOM 4305  C CE1  . HIS A 1 107 ? -4.940  -6.742  -1.185  1.00 0.00 ? 499 HIS A CE1  2  
ATOM 4306  N NE2  . HIS A 1 107 ? -4.750  -8.009  -1.487  1.00 0.00 ? 499 HIS A NE2  2  
ATOM 4307  H H    . HIS A 1 107 ? -2.210  -3.750  -3.732  1.00 0.00 ? 499 HIS A H    2  
ATOM 4308  H HA   . HIS A 1 107 ? -1.157  -6.453  -3.528  1.00 0.00 ? 499 HIS A HA   2  
ATOM 4309  H HB2  . HIS A 1 107 ? -3.736  -5.393  -4.701  1.00 0.00 ? 499 HIS A HB2  2  
ATOM 4310  H HB3  . HIS A 1 107 ? -3.137  -7.005  -5.062  1.00 0.00 ? 499 HIS A HB3  2  
ATOM 4311  H HD1  . HIS A 1 107 ? -4.408  -4.958  -2.095  1.00 0.00 ? 499 HIS A HD1  2  
ATOM 4312  H HD2  . HIS A 1 107 ? -3.719  -8.912  -3.188  1.00 0.00 ? 499 HIS A HD2  2  
ATOM 4313  H HE1  . HIS A 1 107 ? -5.443  -6.404  -0.291  1.00 0.00 ? 499 HIS A HE1  2  
ATOM 4314  N N    . PHE A 1 108 ? -0.317  -6.499  -5.867  1.00 0.00 ? 500 PHE A N    2  
ATOM 4315  C CA   . PHE A 1 108 ? 0.443   -6.425  -7.072  1.00 0.00 ? 500 PHE A CA   2  
ATOM 4316  C C    . PHE A 1 108 ? -0.318  -7.104  -8.197  1.00 0.00 ? 500 PHE A C    2  
ATOM 4317  O O    . PHE A 1 108 ? -0.845  -8.212  -8.005  1.00 0.00 ? 500 PHE A O    2  
ATOM 4318  C CB   . PHE A 1 108 ? 1.799   -7.142  -6.890  1.00 0.00 ? 500 PHE A CB   2  
ATOM 4319  C CG   . PHE A 1 108 ? 2.739   -6.555  -5.852  1.00 0.00 ? 500 PHE A CG   2  
ATOM 4320  C CD1  . PHE A 1 108 ? 3.900   -5.911  -6.238  1.00 0.00 ? 500 PHE A CD1  2  
ATOM 4321  C CD2  . PHE A 1 108 ? 2.470   -6.664  -4.500  1.00 0.00 ? 500 PHE A CD2  2  
ATOM 4322  C CE1  . PHE A 1 108 ? 4.764   -5.388  -5.303  1.00 0.00 ? 500 PHE A CE1  2  
ATOM 4323  C CE2  . PHE A 1 108 ? 3.333   -6.137  -3.559  1.00 0.00 ? 500 PHE A CE2  2  
ATOM 4324  C CZ   . PHE A 1 108 ? 4.479   -5.499  -3.961  1.00 0.00 ? 500 PHE A CZ   2  
ATOM 4325  H H    . PHE A 1 108 ? -0.320  -7.346  -5.367  1.00 0.00 ? 500 PHE A H    2  
ATOM 4326  H HA   . PHE A 1 108 ? 0.629   -5.390  -7.311  1.00 0.00 ? 500 PHE A HA   2  
ATOM 4327  H HB2  . PHE A 1 108 ? 1.609   -8.163  -6.595  1.00 0.00 ? 500 PHE A HB2  2  
ATOM 4328  H HB3  . PHE A 1 108 ? 2.313   -7.150  -7.840  1.00 0.00 ? 500 PHE A HB3  2  
ATOM 4329  H HD1  . PHE A 1 108 ? 4.131   -5.801  -7.288  1.00 0.00 ? 500 PHE A HD1  2  
ATOM 4330  H HD2  . PHE A 1 108 ? 1.569   -7.170  -4.186  1.00 0.00 ? 500 PHE A HD2  2  
ATOM 4331  H HE1  . PHE A 1 108 ? 5.666   -4.888  -5.623  1.00 0.00 ? 500 PHE A HE1  2  
ATOM 4332  H HE2  . PHE A 1 108 ? 3.108   -6.223  -2.506  1.00 0.00 ? 500 PHE A HE2  2  
ATOM 4333  H HZ   . PHE A 1 108 ? 5.156   -5.087  -3.227  1.00 0.00 ? 500 PHE A HZ   2  
ATOM 4334  N N    . PRO A 1 109 ? -0.484  -6.435  -9.345  1.00 0.00 ? 501 PRO A N    2  
ATOM 4335  C CA   . PRO A 1 109 ? -0.992  -7.092  -10.543 1.00 0.00 ? 501 PRO A CA   2  
ATOM 4336  C C    . PRO A 1 109 ? -0.010  -8.198  -10.900 1.00 0.00 ? 501 PRO A C    2  
ATOM 4337  O O    . PRO A 1 109 ? 1.215   -7.981  -10.848 1.00 0.00 ? 501 PRO A O    2  
ATOM 4338  C CB   . PRO A 1 109 ? -0.962  -5.982  -11.605 1.00 0.00 ? 501 PRO A CB   2  
ATOM 4339  C CG   . PRO A 1 109 ? -1.001  -4.717  -10.824 1.00 0.00 ? 501 PRO A CG   2  
ATOM 4340  C CD   . PRO A 1 109 ? -0.243  -4.999  -9.558  1.00 0.00 ? 501 PRO A CD   2  
ATOM 4341  H HA   . PRO A 1 109 ? -1.983  -7.494  -10.404 1.00 0.00 ? 501 PRO A HA   2  
ATOM 4342  H HB2  . PRO A 1 109 ? -0.056  -6.065  -12.186 1.00 0.00 ? 501 PRO A HB2  2  
ATOM 4343  H HB3  . PRO A 1 109 ? -1.821  -6.073  -12.254 1.00 0.00 ? 501 PRO A HB3  2  
ATOM 4344  H HG2  . PRO A 1 109 ? -0.527  -3.923  -11.381 1.00 0.00 ? 501 PRO A HG2  2  
ATOM 4345  H HG3  . PRO A 1 109 ? -2.026  -4.462  -10.596 1.00 0.00 ? 501 PRO A HG3  2  
ATOM 4346  H HD2  . PRO A 1 109 ? 0.809   -4.794  -9.688  1.00 0.00 ? 501 PRO A HD2  2  
ATOM 4347  H HD3  . PRO A 1 109 ? -0.647  -4.418  -8.743  1.00 0.00 ? 501 PRO A HD3  2  
ATOM 4348  N N    . HIS A 1 110 ? -0.494  -9.367  -11.219 1.00 0.00 ? 502 HIS A N    2  
ATOM 4349  C CA   . HIS A 1 110 ? 0.418   -10.454 -11.415 1.00 0.00 ? 502 HIS A CA   2  
ATOM 4350  C C    . HIS A 1 110 ? 1.110   -10.419 -12.750 1.00 0.00 ? 502 HIS A C    2  
ATOM 4351  O O    . HIS A 1 110 ? 0.501   -10.579 -13.815 1.00 0.00 ? 502 HIS A O    2  
ATOM 4352  C CB   . HIS A 1 110 ? -0.235  -11.824 -11.169 1.00 0.00 ? 502 HIS A CB   2  
ATOM 4353  C CG   . HIS A 1 110 ? -0.445  -12.158 -9.717  1.00 0.00 ? 502 HIS A CG   2  
ATOM 4354  N ND1  . HIS A 1 110 ? 0.334   -13.062 -9.023  1.00 0.00 ? 502 HIS A ND1  2  
ATOM 4355  C CD2  . HIS A 1 110 ? -1.373  -11.710 -8.827  1.00 0.00 ? 502 HIS A CD2  2  
ATOM 4356  C CE1  . HIS A 1 110 ? -0.125  -13.139 -7.776  1.00 0.00 ? 502 HIS A CE1  2  
ATOM 4357  N NE2  . HIS A 1 110 ? -1.165  -12.336 -7.595  1.00 0.00 ? 502 HIS A NE2  2  
ATOM 4358  H H    . HIS A 1 110 ? -1.458  -9.482  -11.356 1.00 0.00 ? 502 HIS A H    2  
ATOM 4359  H HA   . HIS A 1 110 ? 1.184   -10.329 -10.665 1.00 0.00 ? 502 HIS A HA   2  
ATOM 4360  H HB2  . HIS A 1 110 ? -1.200  -11.843 -11.653 1.00 0.00 ? 502 HIS A HB2  2  
ATOM 4361  H HB3  . HIS A 1 110 ? 0.391   -12.591 -11.600 1.00 0.00 ? 502 HIS A HB3  2  
ATOM 4362  H HD1  . HIS A 1 110 ? 1.100   -13.563 -9.381  1.00 0.00 ? 502 HIS A HD1  2  
ATOM 4363  H HD2  . HIS A 1 110 ? -2.150  -10.988 -9.031  1.00 0.00 ? 502 HIS A HD2  2  
ATOM 4364  H HE1  . HIS A 1 110 ? 0.293   -13.773 -7.008  1.00 0.00 ? 502 HIS A HE1  2  
ATOM 4365  N N    . THR A 1 111 ? 2.384   -10.221 -12.663 1.00 0.00 ? 503 THR A N    2  
ATOM 4366  C CA   . THR A 1 111 ? 3.290   -10.339 -13.762 1.00 0.00 ? 503 THR A CA   2  
ATOM 4367  C C    . THR A 1 111 ? 4.149   -11.564 -13.453 1.00 0.00 ? 503 THR A C    2  
ATOM 4368  O O    . THR A 1 111 ? 4.556   -12.325 -14.341 1.00 0.00 ? 503 THR A O    2  
ATOM 4369  C CB   . THR A 1 111 ? 4.160   -9.074  -13.867 1.00 0.00 ? 503 THR A CB   2  
ATOM 4370  O OG1  . THR A 1 111 ? 3.297   -7.921  -13.830 1.00 0.00 ? 503 THR A OG1  2  
ATOM 4371  C CG2  . THR A 1 111 ? 4.945   -9.063  -15.170 1.00 0.00 ? 503 THR A CG2  2  
ATOM 4372  H H    . THR A 1 111 ? 2.721   -9.916  -11.797 1.00 0.00 ? 503 THR A H    2  
ATOM 4373  H HA   . THR A 1 111 ? 2.729   -10.496 -14.672 1.00 0.00 ? 503 THR A HA   2  
ATOM 4374  H HB   . THR A 1 111 ? 4.843   -9.041  -13.032 1.00 0.00 ? 503 THR A HB   2  
ATOM 4375  H HG1  . THR A 1 111 ? 3.794   -7.154  -14.136 1.00 0.00 ? 503 THR A HG1  2  
ATOM 4376  H HG21 . THR A 1 111 ? 4.261   -9.087  -16.005 1.00 0.00 ? 503 THR A HG21 2  
ATOM 4377  H HG22 . THR A 1 111 ? 5.545   -8.165  -15.223 1.00 0.00 ? 503 THR A HG22 2  
ATOM 4378  H HG23 . THR A 1 111 ? 5.588   -9.929  -15.206 1.00 0.00 ? 503 THR A HG23 2  
ATOM 4379  N N    . ALA A 1 112 ? 4.444   -11.722 -12.165 1.00 0.00 ? 504 ALA A N    2  
ATOM 4380  C CA   . ALA A 1 112 ? 5.043   -12.918 -11.663 1.00 0.00 ? 504 ALA A CA   2  
ATOM 4381  C C    . ALA A 1 112 ? 3.901   -13.900 -11.393 1.00 0.00 ? 504 ALA A C    2  
ATOM 4382  O O    . ALA A 1 112 ? 3.019   -13.618 -10.564 1.00 0.00 ? 504 ALA A O    2  
ATOM 4383  C CB   . ALA A 1 112 ? 5.810   -12.613 -10.379 1.00 0.00 ? 504 ALA A CB   2  
ATOM 4384  H H    . ALA A 1 112 ? 4.235   -11.009 -11.531 1.00 0.00 ? 504 ALA A H    2  
ATOM 4385  H HA   . ALA A 1 112 ? 5.715   -13.315 -12.409 1.00 0.00 ? 504 ALA A HA   2  
ATOM 4386  H HB1  . ALA A 1 112 ? 6.619   -11.929 -10.593 1.00 0.00 ? 504 ALA A HB1  2  
ATOM 4387  H HB2  . ALA A 1 112 ? 6.210   -13.527 -9.967  1.00 0.00 ? 504 ALA A HB2  2  
ATOM 4388  H HB3  . ALA A 1 112 ? 5.141   -12.160 -9.662  1.00 0.00 ? 504 ALA A HB3  2  
ATOM 4389  N N    . PRO A 1 113 ? 3.873   -15.034 -12.083 1.00 0.00 ? 505 PRO A N    2  
ATOM 4390  C CA   . PRO A 1 113 ? 2.797   -16.013 -11.938 1.00 0.00 ? 505 PRO A CA   2  
ATOM 4391  C C    . PRO A 1 113 ? 2.971   -16.965 -10.753 1.00 0.00 ? 505 PRO A C    2  
ATOM 4392  O O    . PRO A 1 113 ? 2.126   -17.822 -10.525 1.00 0.00 ? 505 PRO A O    2  
ATOM 4393  C CB   . PRO A 1 113 ? 2.871   -16.785 -13.246 1.00 0.00 ? 505 PRO A CB   2  
ATOM 4394  C CG   . PRO A 1 113 ? 4.320   -16.771 -13.584 1.00 0.00 ? 505 PRO A CG   2  
ATOM 4395  C CD   . PRO A 1 113 ? 4.833   -15.431 -13.134 1.00 0.00 ? 505 PRO A CD   2  
ATOM 4396  H HA   . PRO A 1 113 ? 1.832   -15.533 -11.869 1.00 0.00 ? 505 PRO A HA   2  
ATOM 4397  H HB2  . PRO A 1 113 ? 2.506   -17.789 -13.091 1.00 0.00 ? 505 PRO A HB2  2  
ATOM 4398  H HB3  . PRO A 1 113 ? 2.284   -16.286 -14.003 1.00 0.00 ? 505 PRO A HB3  2  
ATOM 4399  H HG2  . PRO A 1 113 ? 4.824   -17.564 -13.051 1.00 0.00 ? 505 PRO A HG2  2  
ATOM 4400  H HG3  . PRO A 1 113 ? 4.462   -16.891 -14.647 1.00 0.00 ? 505 PRO A HG3  2  
ATOM 4401  H HD2  . PRO A 1 113 ? 5.833   -15.509 -12.738 1.00 0.00 ? 505 PRO A HD2  2  
ATOM 4402  H HD3  . PRO A 1 113 ? 4.807   -14.725 -13.951 1.00 0.00 ? 505 PRO A HD3  2  
ATOM 4403  N N    . CYS A 1 114 ? 4.055   -16.848 -10.023 1.00 0.00 ? 506 CYS A N    2  
ATOM 4404  C CA   . CYS A 1 114 ? 4.253   -17.720 -8.892  1.00 0.00 ? 506 CYS A CA   2  
ATOM 4405  C C    . CYS A 1 114 ? 4.171   -16.944 -7.578  1.00 0.00 ? 506 CYS A C    2  
ATOM 4406  O O    . CYS A 1 114 ? 3.113   -16.927 -6.916  1.00 0.00 ? 506 CYS A O    2  
ATOM 4407  C CB   . CYS A 1 114 ? 5.568   -18.500 -9.018  1.00 0.00 ? 506 CYS A CB   2  
ATOM 4408  S SG   . CYS A 1 114 ? 5.711   -19.445 -10.553 1.00 0.00 ? 506 CYS A SG   2  
ATOM 4409  H H    . CYS A 1 114 ? 4.735   -16.180 -10.255 1.00 0.00 ? 506 CYS A H    2  
ATOM 4410  H HA   . CYS A 1 114 ? 3.433   -18.423 -8.904  1.00 0.00 ? 506 CYS A HA   2  
ATOM 4411  H HB2  . CYS A 1 114 ? 6.405   -17.820 -8.967  1.00 0.00 ? 506 CYS A HB2  2  
ATOM 4412  H HB3  . CYS A 1 114 ? 5.641   -19.201 -8.202  1.00 0.00 ? 506 CYS A HB3  2  
ATOM 4413  H HG   . CYS A 1 114 ? 6.779   -18.986 -11.190 1.00 0.00 ? 506 CYS A HG   2  
ATOM 4414  N N    . GLU A 1 115 ? 5.228   -16.250 -7.237  1.00 0.00 ? 507 GLU A N    2  
ATOM 4415  C CA   . GLU A 1 115 ? 5.283   -15.516 -6.002  1.00 0.00 ? 507 GLU A CA   2  
ATOM 4416  C C    . GLU A 1 115 ? 5.525   -14.052 -6.284  1.00 0.00 ? 507 GLU A C    2  
ATOM 4417  O O    . GLU A 1 115 ? 6.543   -13.679 -6.871  1.00 0.00 ? 507 GLU A O    2  
ATOM 4418  C CB   . GLU A 1 115 ? 6.380   -16.086 -5.089  1.00 0.00 ? 507 GLU A CB   2  
ATOM 4419  C CG   . GLU A 1 115 ? 6.558   -15.344 -3.775  1.00 0.00 ? 507 GLU A CG   2  
ATOM 4420  C CD   . GLU A 1 115 ? 7.628   -15.948 -2.900  1.00 0.00 ? 507 GLU A CD   2  
ATOM 4421  O OE1  . GLU A 1 115 ? 7.299   -16.506 -1.828  1.00 0.00 ? 507 GLU A OE1  2  
ATOM 4422  O OE2  . GLU A 1 115 ? 8.820   -15.879 -3.265  1.00 0.00 ? 507 GLU A OE2  2  
ATOM 4423  H H    . GLU A 1 115 ? 6.007   -16.197 -7.831  1.00 0.00 ? 507 GLU A H    2  
ATOM 4424  H HA   . GLU A 1 115 ? 4.329   -15.625 -5.507  1.00 0.00 ? 507 GLU A HA   2  
ATOM 4425  H HB2  . GLU A 1 115 ? 6.140   -17.112 -4.856  1.00 0.00 ? 507 GLU A HB2  2  
ATOM 4426  H HB3  . GLU A 1 115 ? 7.319   -16.061 -5.623  1.00 0.00 ? 507 GLU A HB3  2  
ATOM 4427  H HG2  . GLU A 1 115 ? 6.838   -14.325 -3.997  1.00 0.00 ? 507 GLU A HG2  2  
ATOM 4428  H HG3  . GLU A 1 115 ? 5.621   -15.348 -3.237  1.00 0.00 ? 507 GLU A HG3  2  
ATOM 4429  N N    . VAL A 1 116 ? 4.582   -13.231 -5.911  1.00 0.00 ? 508 VAL A N    2  
ATOM 4430  C CA   . VAL A 1 116 ? 4.730   -11.816 -6.092  1.00 0.00 ? 508 VAL A CA   2  
ATOM 4431  C C    . VAL A 1 116 ? 4.891   -11.143 -4.734  1.00 0.00 ? 508 VAL A C    2  
ATOM 4432  O O    . VAL A 1 116 ? 5.667   -10.173 -4.609  1.00 0.00 ? 508 VAL A O    2  
ATOM 4433  C CB   . VAL A 1 116 ? 3.560   -11.193 -6.917  1.00 0.00 ? 508 VAL A CB   2  
ATOM 4434  C CG1  . VAL A 1 116 ? 2.241   -11.160 -6.152  1.00 0.00 ? 508 VAL A CG1  2  
ATOM 4435  C CG2  . VAL A 1 116 ? 3.939   -9.824  -7.451  1.00 0.00 ? 508 VAL A CG2  2  
ATOM 4436  H H    . VAL A 1 116 ? 3.765   -13.588 -5.497  1.00 0.00 ? 508 VAL A H    2  
ATOM 4437  H HA   . VAL A 1 116 ? 5.658   -11.634 -6.615  1.00 0.00 ? 508 VAL A HA   2  
ATOM 4438  H HB   . VAL A 1 116 ? 3.404   -11.845 -7.765  1.00 0.00 ? 508 VAL A HB   2  
ATOM 4439  H HG11 . VAL A 1 116 ? 1.953   -12.165 -5.880  1.00 0.00 ? 508 VAL A HG11 2  
ATOM 4440  H HG12 . VAL A 1 116 ? 2.362   -10.571 -5.254  1.00 0.00 ? 508 VAL A HG12 2  
ATOM 4441  H HG13 . VAL A 1 116 ? 1.474   -10.718 -6.770  1.00 0.00 ? 508 VAL A HG13 2  
ATOM 4442  H HG21 . VAL A 1 116 ? 4.807   -9.910  -8.087  1.00 0.00 ? 508 VAL A HG21 2  
ATOM 4443  H HG22 . VAL A 1 116 ? 3.115   -9.421  -8.022  1.00 0.00 ? 508 VAL A HG22 2  
ATOM 4444  H HG23 . VAL A 1 116 ? 4.161   -9.165  -6.624  1.00 0.00 ? 508 VAL A HG23 2  
ATOM 4445  N N    . ARG A 1 117 ? 4.238   -11.747 -3.688  1.00 0.00 ? 509 ARG A N    2  
ATOM 4446  C CA   . ARG A 1 117 ? 4.229   -11.245 -2.288  1.00 0.00 ? 509 ARG A CA   2  
ATOM 4447  C C    . ARG A 1 117 ? 3.352   -10.010 -2.210  1.00 0.00 ? 509 ARG A C    2  
ATOM 4448  O O    . ARG A 1 117 ? 2.994   -9.463  -3.242  1.00 0.00 ? 509 ARG A O    2  
ATOM 4449  C CB   . ARG A 1 117 ? 5.651   -10.978 -1.794  1.00 0.00 ? 509 ARG A CB   2  
ATOM 4450  C CG   . ARG A 1 117 ? 6.514   -12.223 -1.819  1.00 0.00 ? 509 ARG A CG   2  
ATOM 4451  C CD   . ARG A 1 117 ? 7.928   -11.907 -2.230  1.00 0.00 ? 509 ARG A CD   2  
ATOM 4452  N NE   . ARG A 1 117 ? 7.969   -11.416 -3.623  1.00 0.00 ? 509 ARG A NE   2  
ATOM 4453  C CZ   . ARG A 1 117 ? 8.916   -11.729 -4.526  1.00 0.00 ? 509 ARG A CZ   2  
ATOM 4454  N NH1  . ARG A 1 117 ? 9.982   -12.433 -4.166  1.00 0.00 ? 509 ARG A NH1  2  
ATOM 4455  N NH2  . ARG A 1 117 ? 8.792   -11.330 -5.788  1.00 0.00 ? 509 ARG A NH2  2  
ATOM 4456  H H    . ARG A 1 117 ? 3.696   -12.543 -3.874  1.00 0.00 ? 509 ARG A H    2  
ATOM 4457  H HA   . ARG A 1 117 ? 3.768   -12.014 -1.686  1.00 0.00 ? 509 ARG A HA   2  
ATOM 4458  H HB2  . ARG A 1 117 ? 6.105   -10.227 -2.426  1.00 0.00 ? 509 ARG A HB2  2  
ATOM 4459  H HB3  . ARG A 1 117 ? 5.609   -10.610 -0.779  1.00 0.00 ? 509 ARG A HB3  2  
ATOM 4460  H HG2  . ARG A 1 117 ? 6.515   -12.704 -0.854  1.00 0.00 ? 509 ARG A HG2  2  
ATOM 4461  H HG3  . ARG A 1 117 ? 6.092   -12.903 -2.543  1.00 0.00 ? 509 ARG A HG3  2  
ATOM 4462  H HD2  . ARG A 1 117 ? 8.331   -11.151 -1.571  1.00 0.00 ? 509 ARG A HD2  2  
ATOM 4463  H HD3  . ARG A 1 117 ? 8.519   -12.808 -2.161  1.00 0.00 ? 509 ARG A HD3  2  
ATOM 4464  H HE   . ARG A 1 117 ? 7.193   -10.863 -3.888  1.00 0.00 ? 509 ARG A HE   2  
ATOM 4465  H HH11 . ARG A 1 117 ? 10.145  -12.760 -3.231  1.00 0.00 ? 509 ARG A HH11 2  
ATOM 4466  H HH12 . ARG A 1 117 ? 10.674  -12.689 -4.849  1.00 0.00 ? 509 ARG A HH12 2  
ATOM 4467  H HH21 . ARG A 1 117 ? 8.020   -10.795 -6.135  1.00 0.00 ? 509 ARG A HH21 2  
ATOM 4468  H HH22 . ARG A 1 117 ? 9.476   -11.580 -6.484  1.00 0.00 ? 509 ARG A HH22 2  
ATOM 4469  N N    . VAL A 1 118 ? 2.969   -9.571  -1.032  1.00 0.00 ? 510 VAL A N    2  
ATOM 4470  C CA   . VAL A 1 118 ? 2.085   -8.400  -0.993  1.00 0.00 ? 510 VAL A CA   2  
ATOM 4471  C C    . VAL A 1 118 ? 2.613   -7.349  -0.073  1.00 0.00 ? 510 VAL A C    2  
ATOM 4472  O O    . VAL A 1 118 ? 3.465   -7.627  0.713   1.00 0.00 ? 510 VAL A O    2  
ATOM 4473  C CB   . VAL A 1 118 ? 0.587   -8.713  -0.718  1.00 0.00 ? 510 VAL A CB   2  
ATOM 4474  C CG1  . VAL A 1 118 ? -0.056  -9.423  -1.902  1.00 0.00 ? 510 VAL A CG1  2  
ATOM 4475  C CG2  . VAL A 1 118 ? 0.411   -9.535  0.527   1.00 0.00 ? 510 VAL A CG2  2  
ATOM 4476  H H    . VAL A 1 118 ? 3.298   -9.949  -0.181  1.00 0.00 ? 510 VAL A H    2  
ATOM 4477  H HA   . VAL A 1 118 ? 2.167   -7.979  -1.986  1.00 0.00 ? 510 VAL A HA   2  
ATOM 4478  H HB   . VAL A 1 118 ? 0.084   -7.769  -0.578  1.00 0.00 ? 510 VAL A HB   2  
ATOM 4479  H HG11 . VAL A 1 118 ? 0.470   -10.346 -2.096  1.00 0.00 ? 510 VAL A HG11 2  
ATOM 4480  H HG12 . VAL A 1 118 ? -1.091  -9.635  -1.678  1.00 0.00 ? 510 VAL A HG12 2  
ATOM 4481  H HG13 . VAL A 1 118 ? -0.001  -8.789  -2.775  1.00 0.00 ? 510 VAL A HG13 2  
ATOM 4482  H HG21 . VAL A 1 118 ? 0.940   -10.470 0.416   1.00 0.00 ? 510 VAL A HG21 2  
ATOM 4483  H HG22 . VAL A 1 118 ? 0.785   -8.989  1.380   1.00 0.00 ? 510 VAL A HG22 2  
ATOM 4484  H HG23 . VAL A 1 118 ? -0.648  -9.715  0.647   1.00 0.00 ? 510 VAL A HG23 2  
ATOM 4485  N N    . LEU A 1 119 ? 2.118   -6.148  -0.179  1.00 0.00 ? 511 LEU A N    2  
ATOM 4486  C CA   . LEU A 1 119 ? 2.670   -5.039  0.568   1.00 0.00 ? 511 LEU A CA   2  
ATOM 4487  C C    . LEU A 1 119 ? 1.612   -4.309  1.389   1.00 0.00 ? 511 LEU A C    2  
ATOM 4488  O O    . LEU A 1 119 ? 0.451   -4.243  1.013   1.00 0.00 ? 511 LEU A O    2  
ATOM 4489  C CB   . LEU A 1 119 ? 3.388   -4.103  -0.432  1.00 0.00 ? 511 LEU A CB   2  
ATOM 4490  C CG   . LEU A 1 119 ? 3.641   -2.628  -0.036  1.00 0.00 ? 511 LEU A CG   2  
ATOM 4491  C CD1  . LEU A 1 119 ? 4.603   -2.474  1.131   1.00 0.00 ? 511 LEU A CD1  2  
ATOM 4492  C CD2  . LEU A 1 119 ? 4.138   -1.860  -1.238  1.00 0.00 ? 511 LEU A CD2  2  
ATOM 4493  H H    . LEU A 1 119 ? 1.344   -5.973  -0.764  1.00 0.00 ? 511 LEU A H    2  
ATOM 4494  H HA   . LEU A 1 119 ? 3.414   -5.432  1.242   1.00 0.00 ? 511 LEU A HA   2  
ATOM 4495  H HB2  . LEU A 1 119 ? 4.347   -4.566  -0.623  1.00 0.00 ? 511 LEU A HB2  2  
ATOM 4496  H HB3  . LEU A 1 119 ? 2.837   -4.125  -1.360  1.00 0.00 ? 511 LEU A HB3  2  
ATOM 4497  H HG   . LEU A 1 119 ? 2.701   -2.187  0.262   1.00 0.00 ? 511 LEU A HG   2  
ATOM 4498  H HD11 . LEU A 1 119 ? 4.252   -3.054  1.973   1.00 0.00 ? 511 LEU A HD11 2  
ATOM 4499  H HD12 . LEU A 1 119 ? 5.593   -2.797  0.846   1.00 0.00 ? 511 LEU A HD12 2  
ATOM 4500  H HD13 . LEU A 1 119 ? 4.641   -1.434  1.415   1.00 0.00 ? 511 LEU A HD13 2  
ATOM 4501  H HD21 . LEU A 1 119 ? 3.399   -1.904  -2.024  1.00 0.00 ? 511 LEU A HD21 2  
ATOM 4502  H HD22 . LEU A 1 119 ? 4.305   -0.831  -0.960  1.00 0.00 ? 511 LEU A HD22 2  
ATOM 4503  H HD23 . LEU A 1 119 ? 5.064   -2.294  -1.587  1.00 0.00 ? 511 LEU A HD23 2  
ATOM 4504  N N    . MET A 1 120 ? 2.015   -3.823  2.534   1.00 0.00 ? 512 MET A N    2  
ATOM 4505  C CA   . MET A 1 120 ? 1.169   -3.002  3.367   1.00 0.00 ? 512 MET A CA   2  
ATOM 4506  C C    . MET A 1 120 ? 1.759   -1.613  3.462   1.00 0.00 ? 512 MET A C    2  
ATOM 4507  O O    . MET A 1 120 ? 2.868   -1.446  3.959   1.00 0.00 ? 512 MET A O    2  
ATOM 4508  C CB   . MET A 1 120 ? 1.030   -3.603  4.760   1.00 0.00 ? 512 MET A CB   2  
ATOM 4509  C CG   . MET A 1 120 ? 0.281   -2.710  5.744   1.00 0.00 ? 512 MET A CG   2  
ATOM 4510  S SD   . MET A 1 120 ? -1.355  -2.222  5.159   1.00 0.00 ? 512 MET A SD   2  
ATOM 4511  C CE   . MET A 1 120 ? -2.147  -3.810  5.016   1.00 0.00 ? 512 MET A CE   2  
ATOM 4512  H H    . MET A 1 120 ? 2.927   -4.018  2.850   1.00 0.00 ? 512 MET A H    2  
ATOM 4513  H HA   . MET A 1 120 ? 0.193   -2.943  2.905   1.00 0.00 ? 512 MET A HA   2  
ATOM 4514  H HB2  . MET A 1 120 ? 0.517   -4.551  4.688   1.00 0.00 ? 512 MET A HB2  2  
ATOM 4515  H HB3  . MET A 1 120 ? 2.024   -3.768  5.149   1.00 0.00 ? 512 MET A HB3  2  
ATOM 4516  H HG2  . MET A 1 120 ? 0.172   -3.238  6.678   1.00 0.00 ? 512 MET A HG2  2  
ATOM 4517  H HG3  . MET A 1 120 ? 0.874   -1.821  5.904   1.00 0.00 ? 512 MET A HG3  2  
ATOM 4518  H HE1  . MET A 1 120 ? -2.155  -4.292  5.981   1.00 0.00 ? 512 MET A HE1  2  
ATOM 4519  H HE2  . MET A 1 120 ? -3.156  -3.672  4.663   1.00 0.00 ? 512 MET A HE2  2  
ATOM 4520  H HE3  . MET A 1 120 ? -1.601  -4.420  4.312   1.00 0.00 ? 512 MET A HE3  2  
ATOM 4521  N N    . LEU A 1 121 ? 1.033   -0.638  2.988   1.00 0.00 ? 513 LEU A N    2  
ATOM 4522  C CA   . LEU A 1 121 ? 1.487   0.724   2.986   1.00 0.00 ? 513 LEU A CA   2  
ATOM 4523  C C    . LEU A 1 121 ? 0.867   1.480   4.149   1.00 0.00 ? 513 LEU A C    2  
ATOM 4524  O O    . LEU A 1 121 ? -0.363  1.582   4.267   1.00 0.00 ? 513 LEU A O    2  
ATOM 4525  C CB   . LEU A 1 121 ? 1.137   1.396   1.659   1.00 0.00 ? 513 LEU A CB   2  
ATOM 4526  C CG   . LEU A 1 121 ? 1.659   2.811   1.470   1.00 0.00 ? 513 LEU A CG   2  
ATOM 4527  C CD1  . LEU A 1 121 ? 3.169   2.819   1.501   1.00 0.00 ? 513 LEU A CD1  2  
ATOM 4528  C CD2  . LEU A 1 121 ? 1.145   3.415   0.177   1.00 0.00 ? 513 LEU A CD2  2  
ATOM 4529  H H    . LEU A 1 121 ? 0.131   -0.814  2.638   1.00 0.00 ? 513 LEU A H    2  
ATOM 4530  H HA   . LEU A 1 121 ? 2.560   0.729   3.111   1.00 0.00 ? 513 LEU A HA   2  
ATOM 4531  H HB2  . LEU A 1 121 ? 1.530   0.785   0.860   1.00 0.00 ? 513 LEU A HB2  2  
ATOM 4532  H HB3  . LEU A 1 121 ? 0.061   1.420   1.569   1.00 0.00 ? 513 LEU A HB3  2  
ATOM 4533  H HG   . LEU A 1 121 ? 1.304   3.413   2.293   1.00 0.00 ? 513 LEU A HG   2  
ATOM 4534  H HD11 . LEU A 1 121 ? 3.551   2.090   0.802   1.00 0.00 ? 513 LEU A HD11 2  
ATOM 4535  H HD12 . LEU A 1 121 ? 3.523   3.801   1.229   1.00 0.00 ? 513 LEU A HD12 2  
ATOM 4536  H HD13 . LEU A 1 121 ? 3.512   2.580   2.496   1.00 0.00 ? 513 LEU A HD13 2  
ATOM 4537  H HD21 . LEU A 1 121 ? 1.437   2.799   -0.661  1.00 0.00 ? 513 LEU A HD21 2  
ATOM 4538  H HD22 . LEU A 1 121 ? 0.069   3.488   0.221   1.00 0.00 ? 513 LEU A HD22 2  
ATOM 4539  H HD23 . LEU A 1 121 ? 1.567   4.402   0.059   1.00 0.00 ? 513 LEU A HD23 2  
ATOM 4540  N N    . LEU A 1 122 ? 1.711   2.001   4.985   1.00 0.00 ? 514 LEU A N    2  
ATOM 4541  C CA   . LEU A 1 122 ? 1.310   2.707   6.163   1.00 0.00 ? 514 LEU A CA   2  
ATOM 4542  C C    . LEU A 1 122 ? 1.912   4.105   6.176   1.00 0.00 ? 514 LEU A C    2  
ATOM 4543  O O    . LEU A 1 122 ? 3.107   4.286   5.952   1.00 0.00 ? 514 LEU A O    2  
ATOM 4544  C CB   . LEU A 1 122 ? 1.751   1.912   7.392   1.00 0.00 ? 514 LEU A CB   2  
ATOM 4545  C CG   . LEU A 1 122 ? 1.010   0.598   7.640   1.00 0.00 ? 514 LEU A CG   2  
ATOM 4546  C CD1  . LEU A 1 122 ? 1.739   -0.240  8.674   1.00 0.00 ? 514 LEU A CD1  2  
ATOM 4547  C CD2  . LEU A 1 122 ? -0.393  0.881   8.127   1.00 0.00 ? 514 LEU A CD2  2  
ATOM 4548  H H    . LEU A 1 122 ? 2.677   1.921   4.810   1.00 0.00 ? 514 LEU A H    2  
ATOM 4549  H HA   . LEU A 1 122 ? 0.233   2.780   6.168   1.00 0.00 ? 514 LEU A HA   2  
ATOM 4550  H HB2  . LEU A 1 122 ? 2.800   1.687   7.276   1.00 0.00 ? 514 LEU A HB2  2  
ATOM 4551  H HB3  . LEU A 1 122 ? 1.636   2.535   8.263   1.00 0.00 ? 514 LEU A HB3  2  
ATOM 4552  H HG   . LEU A 1 122 ? 0.931   0.053   6.710   1.00 0.00 ? 514 LEU A HG   2  
ATOM 4553  H HD11 . LEU A 1 122 ? 2.737   -0.460  8.324   1.00 0.00 ? 514 LEU A HD11 2  
ATOM 4554  H HD12 . LEU A 1 122 ? 1.796   0.307   9.603   1.00 0.00 ? 514 LEU A HD12 2  
ATOM 4555  H HD13 . LEU A 1 122 ? 1.202   -1.164  8.829   1.00 0.00 ? 514 LEU A HD13 2  
ATOM 4556  H HD21 . LEU A 1 122 ? -0.929  1.456   7.386   1.00 0.00 ? 514 LEU A HD21 2  
ATOM 4557  H HD22 . LEU A 1 122 ? -0.906  -0.056  8.291   1.00 0.00 ? 514 LEU A HD22 2  
ATOM 4558  H HD23 . LEU A 1 122 ? -0.350  1.436   9.053   1.00 0.00 ? 514 LEU A HD23 2  
ATOM 4559  N N    . TYR A 1 123 ? 1.091   5.078   6.405   1.00 0.00 ? 515 TYR A N    2  
ATOM 4560  C CA   . TYR A 1 123 ? 1.541   6.445   6.476   1.00 0.00 ? 515 TYR A CA   2  
ATOM 4561  C C    . TYR A 1 123 ? 1.911   6.775   7.891   1.00 0.00 ? 515 TYR A C    2  
ATOM 4562  O O    . TYR A 1 123 ? 1.127   6.529   8.827   1.00 0.00 ? 515 TYR A O    2  
ATOM 4563  C CB   . TYR A 1 123 ? 0.448   7.398   5.967   1.00 0.00 ? 515 TYR A CB   2  
ATOM 4564  C CG   . TYR A 1 123 ? 0.733   8.883   6.163   1.00 0.00 ? 515 TYR A CG   2  
ATOM 4565  C CD1  . TYR A 1 123 ? -0.166  9.691   6.847   1.00 0.00 ? 515 TYR A CD1  2  
ATOM 4566  C CD2  . TYR A 1 123 ? 1.899   9.468   5.681   1.00 0.00 ? 515 TYR A CD2  2  
ATOM 4567  C CE1  . TYR A 1 123 ? 0.084   11.035  7.039   1.00 0.00 ? 515 TYR A CE1  2  
ATOM 4568  C CE2  . TYR A 1 123 ? 2.156   10.813  5.873   1.00 0.00 ? 515 TYR A CE2  2  
ATOM 4569  C CZ   . TYR A 1 123 ? 1.242   11.593  6.553   1.00 0.00 ? 515 TYR A CZ   2  
ATOM 4570  O OH   . TYR A 1 123 ? 1.487   12.932  6.752   1.00 0.00 ? 515 TYR A OH   2  
ATOM 4571  H H    . TYR A 1 123 ? 0.146   4.877   6.561   1.00 0.00 ? 515 TYR A H    2  
ATOM 4572  H HA   . TYR A 1 123 ? 2.420   6.566   5.859   1.00 0.00 ? 515 TYR A HA   2  
ATOM 4573  H HB2  . TYR A 1 123 ? 0.298   7.232   4.911   1.00 0.00 ? 515 TYR A HB2  2  
ATOM 4574  H HB3  . TYR A 1 123 ? -0.468  7.167   6.491   1.00 0.00 ? 515 TYR A HB3  2  
ATOM 4575  H HD1  . TYR A 1 123 ? -1.078  9.257   7.231   1.00 0.00 ? 515 TYR A HD1  2  
ATOM 4576  H HD2  . TYR A 1 123 ? 2.613   8.856   5.148   1.00 0.00 ? 515 TYR A HD2  2  
ATOM 4577  H HE1  . TYR A 1 123 ? -0.626  11.648  7.575   1.00 0.00 ? 515 TYR A HE1  2  
ATOM 4578  H HE2  . TYR A 1 123 ? 3.073   11.239  5.491   1.00 0.00 ? 515 TYR A HE2  2  
ATOM 4579  H HH   . TYR A 1 123 ? 1.137   13.184  7.615   1.00 0.00 ? 515 TYR A HH   2  
ATOM 4580  N N    . SER A 1 124 ? 3.089   7.280   8.070   1.00 0.00 ? 516 SER A N    2  
ATOM 4581  C CA   . SER A 1 124 ? 3.477   7.728   9.340   1.00 0.00 ? 516 SER A CA   2  
ATOM 4582  C C    . SER A 1 124 ? 3.348   9.234   9.334   1.00 0.00 ? 516 SER A C    2  
ATOM 4583  O O    . SER A 1 124 ? 4.083   9.951   8.598   1.00 0.00 ? 516 SER A O    2  
ATOM 4584  C CB   . SER A 1 124 ? 4.896   7.246   9.682   1.00 0.00 ? 516 SER A CB   2  
ATOM 4585  O OG   . SER A 1 124 ? 5.834   7.609   8.688   1.00 0.00 ? 516 SER A OG   2  
ATOM 4586  H H    . SER A 1 124 ? 3.710   7.398   7.317   1.00 0.00 ? 516 SER A H    2  
ATOM 4587  H HA   . SER A 1 124 ? 2.772   7.326   10.055  1.00 0.00 ? 516 SER A HA   2  
ATOM 4588  H HB2  . SER A 1 124 ? 5.206   7.686   10.618  1.00 0.00 ? 516 SER A HB2  2  
ATOM 4589  H HB3  . SER A 1 124 ? 4.890   6.170   9.777   1.00 0.00 ? 516 SER A HB3  2  
ATOM 4590  H HG   . SER A 1 124 ? 5.586   7.232   7.837   1.00 0.00 ? 516 SER A HG   2  
ATOM 4591  N N    . SER A 1 125 ? 2.378   9.692   10.089  1.00 0.00 ? 517 SER A N    2  
ATOM 4592  C CA   . SER A 1 125 ? 2.021   11.076  10.203  1.00 0.00 ? 517 SER A CA   2  
ATOM 4593  C C    . SER A 1 125 ? 3.104   11.865  10.914  1.00 0.00 ? 517 SER A C    2  
ATOM 4594  O O    . SER A 1 125 ? 3.366   13.002  10.583  1.00 0.00 ? 517 SER A O    2  
ATOM 4595  C CB   . SER A 1 125 ? 0.699   11.161  10.948  1.00 0.00 ? 517 SER A CB   2  
ATOM 4596  O OG   . SER A 1 125 ? -0.229  10.231  10.390  1.00 0.00 ? 517 SER A OG   2  
ATOM 4597  H H    . SER A 1 125 ? 1.831   9.068   10.610  1.00 0.00 ? 517 SER A H    2  
ATOM 4598  H HA   . SER A 1 125 ? 1.878   11.475  9.210   1.00 0.00 ? 517 SER A HA   2  
ATOM 4599  H HB2  . SER A 1 125 ? 0.853   10.928  11.990  1.00 0.00 ? 517 SER A HB2  2  
ATOM 4600  H HB3  . SER A 1 125 ? 0.293   12.157  10.850  1.00 0.00 ? 517 SER A HB3  2  
ATOM 4601  H HG   . SER A 1 125 ? -0.970  10.148  11.000  1.00 0.00 ? 517 SER A HG   2  
ATOM 4602  N N    . LYS A 1 126 ? 3.758   11.225  11.871  1.00 0.00 ? 518 LYS A N    2  
ATOM 4603  C CA   . LYS A 1 126 ? 4.804   11.875  12.636  1.00 0.00 ? 518 LYS A CA   2  
ATOM 4604  C C    . LYS A 1 126 ? 6.071   12.018  11.804  1.00 0.00 ? 518 LYS A C    2  
ATOM 4605  O O    . LYS A 1 126 ? 6.849   12.935  11.995  1.00 0.00 ? 518 LYS A O    2  
ATOM 4606  C CB   . LYS A 1 126 ? 5.089   11.113  13.941  1.00 0.00 ? 518 LYS A CB   2  
ATOM 4607  C CG   . LYS A 1 126 ? 6.160   11.763  14.827  1.00 0.00 ? 518 LYS A CG   2  
ATOM 4608  C CD   . LYS A 1 126 ? 6.392   10.998  16.127  1.00 0.00 ? 518 LYS A CD   2  
ATOM 4609  C CE   . LYS A 1 126 ? 5.167   11.017  17.039  1.00 0.00 ? 518 LYS A CE   2  
ATOM 4610  N NZ   . LYS A 1 126 ? 4.806   12.388  17.475  1.00 0.00 ? 518 LYS A NZ   2  
ATOM 4611  H H    . LYS A 1 126 ? 3.506   10.299  12.071  1.00 0.00 ? 518 LYS A H    2  
ATOM 4612  H HA   . LYS A 1 126 ? 4.444   12.862  12.881  1.00 0.00 ? 518 LYS A HA   2  
ATOM 4613  H HB2  . LYS A 1 126 ? 4.172   11.047  14.508  1.00 0.00 ? 518 LYS A HB2  2  
ATOM 4614  H HB3  . LYS A 1 126 ? 5.418   10.115  13.693  1.00 0.00 ? 518 LYS A HB3  2  
ATOM 4615  H HG2  . LYS A 1 126 ? 7.089   11.798  14.279  1.00 0.00 ? 518 LYS A HG2  2  
ATOM 4616  H HG3  . LYS A 1 126 ? 5.849   12.771  15.059  1.00 0.00 ? 518 LYS A HG3  2  
ATOM 4617  H HD2  . LYS A 1 126 ? 6.629   9.971   15.890  1.00 0.00 ? 518 LYS A HD2  2  
ATOM 4618  H HD3  . LYS A 1 126 ? 7.227   11.445  16.648  1.00 0.00 ? 518 LYS A HD3  2  
ATOM 4619  H HE2  . LYS A 1 126 ? 4.330   10.573  16.522  1.00 0.00 ? 518 LYS A HE2  2  
ATOM 4620  H HE3  . LYS A 1 126 ? 5.394   10.423  17.911  1.00 0.00 ? 518 LYS A HE3  2  
ATOM 4621  H HZ1  . LYS A 1 126 ? 4.635   13.021  16.668  1.00 0.00 ? 518 LYS A HZ1  2  
ATOM 4622  H HZ2  . LYS A 1 126 ? 3.930   12.351  18.036  1.00 0.00 ? 518 LYS A HZ2  2  
ATOM 4623  H HZ3  . LYS A 1 126 ? 5.546   12.802  18.073  1.00 0.00 ? 518 LYS A HZ3  2  
ATOM 4624  N N    . LYS A 1 127 ? 6.264   11.130  10.865  1.00 0.00 ? 519 LYS A N    2  
ATOM 4625  C CA   . LYS A 1 127 ? 7.459   11.177  10.042  1.00 0.00 ? 519 LYS A CA   2  
ATOM 4626  C C    . LYS A 1 127 ? 7.143   11.849  8.705   1.00 0.00 ? 519 LYS A C    2  
ATOM 4627  O O    . LYS A 1 127 ? 8.044   12.178  7.937   1.00 0.00 ? 519 LYS A O    2  
ATOM 4628  C CB   . LYS A 1 127 ? 8.017   9.758   9.829   1.00 0.00 ? 519 LYS A CB   2  
ATOM 4629  C CG   . LYS A 1 127 ? 8.256   8.969   11.132  1.00 0.00 ? 519 LYS A CG   2  
ATOM 4630  C CD   . LYS A 1 127 ? 9.332   9.589   12.037  1.00 0.00 ? 519 LYS A CD   2  
ATOM 4631  C CE   . LYS A 1 127 ? 10.771  9.181   11.661  1.00 0.00 ? 519 LYS A CE   2  
ATOM 4632  N NZ   . LYS A 1 127 ? 11.173  9.551   10.286  1.00 0.00 ? 519 LYS A NZ   2  
ATOM 4633  H H    . LYS A 1 127 ? 5.595   10.431  10.709  1.00 0.00 ? 519 LYS A H    2  
ATOM 4634  H HA   . LYS A 1 127 ? 8.194   11.775  10.558  1.00 0.00 ? 519 LYS A HA   2  
ATOM 4635  H HB2  . LYS A 1 127 ? 7.319   9.202   9.222   1.00 0.00 ? 519 LYS A HB2  2  
ATOM 4636  H HB3  . LYS A 1 127 ? 8.957   9.833   9.303   1.00 0.00 ? 519 LYS A HB3  2  
ATOM 4637  H HG2  . LYS A 1 127 ? 7.329   8.931   11.684  1.00 0.00 ? 519 LYS A HG2  2  
ATOM 4638  H HG3  . LYS A 1 127 ? 8.552   7.963   10.872  1.00 0.00 ? 519 LYS A HG3  2  
ATOM 4639  H HD2  . LYS A 1 127 ? 9.259   10.665  11.985  1.00 0.00 ? 519 LYS A HD2  2  
ATOM 4640  H HD3  . LYS A 1 127 ? 9.137   9.278   13.053  1.00 0.00 ? 519 LYS A HD3  2  
ATOM 4641  H HE2  . LYS A 1 127 ? 11.452  9.664   12.347  1.00 0.00 ? 519 LYS A HE2  2  
ATOM 4642  H HE3  . LYS A 1 127 ? 10.861  8.111   11.781  1.00 0.00 ? 519 LYS A HE3  2  
ATOM 4643  H HZ1  . LYS A 1 127 ? 11.063  10.569  10.097  1.00 0.00 ? 519 LYS A HZ1  2  
ATOM 4644  H HZ2  . LYS A 1 127 ? 12.173  9.316   10.129  1.00 0.00 ? 519 LYS A HZ2  2  
ATOM 4645  H HZ3  . LYS A 1 127 ? 10.624  9.029   9.575   1.00 0.00 ? 519 LYS A HZ3  2  
ATOM 4646  N N    . LYS A 1 128 ? 5.842   12.066  8.461   1.00 0.00 ? 520 LYS A N    2  
ATOM 4647  C CA   . LYS A 1 128 ? 5.315   12.678  7.227   1.00 0.00 ? 520 LYS A CA   2  
ATOM 4648  C C    . LYS A 1 128 ? 5.688   11.869  5.990   1.00 0.00 ? 520 LYS A C    2  
ATOM 4649  O O    . LYS A 1 128 ? 5.796   12.424  4.885   1.00 0.00 ? 520 LYS A O    2  
ATOM 4650  C CB   . LYS A 1 128 ? 5.754   14.161  7.059   1.00 0.00 ? 520 LYS A CB   2  
ATOM 4651  C CG   . LYS A 1 128 ? 5.011   15.180  7.933   1.00 0.00 ? 520 LYS A CG   2  
ATOM 4652  C CD   . LYS A 1 128 ? 5.311   15.064  9.419   1.00 0.00 ? 520 LYS A CD   2  
ATOM 4653  C CE   . LYS A 1 128 ? 6.730   15.513  9.768   1.00 0.00 ? 520 LYS A CE   2  
ATOM 4654  N NZ   . LYS A 1 128 ? 6.951   15.537  11.237  1.00 0.00 ? 520 LYS A NZ   2  
ATOM 4655  H H    . LYS A 1 128 ? 5.187   11.792  9.136   1.00 0.00 ? 520 LYS A H    2  
ATOM 4656  H HA   . LYS A 1 128 ? 4.239   12.648  7.313   1.00 0.00 ? 520 LYS A HA   2  
ATOM 4657  H HB2  . LYS A 1 128 ? 6.808   14.240  7.278   1.00 0.00 ? 520 LYS A HB2  2  
ATOM 4658  H HB3  . LYS A 1 128 ? 5.596   14.431  6.026   1.00 0.00 ? 520 LYS A HB3  2  
ATOM 4659  H HG2  . LYS A 1 128 ? 5.293   16.170  7.612   1.00 0.00 ? 520 LYS A HG2  2  
ATOM 4660  H HG3  . LYS A 1 128 ? 3.949   15.054  7.778   1.00 0.00 ? 520 LYS A HG3  2  
ATOM 4661  H HD2  . LYS A 1 128 ? 4.594   15.653  9.970   1.00 0.00 ? 520 LYS A HD2  2  
ATOM 4662  H HD3  . LYS A 1 128 ? 5.189   14.022  9.682   1.00 0.00 ? 520 LYS A HD3  2  
ATOM 4663  H HE2  . LYS A 1 128 ? 7.434   14.828  9.324   1.00 0.00 ? 520 LYS A HE2  2  
ATOM 4664  H HE3  . LYS A 1 128 ? 6.887   16.505  9.369   1.00 0.00 ? 520 LYS A HE3  2  
ATOM 4665  H HZ1  . LYS A 1 128 ? 6.233   16.126  11.707  1.00 0.00 ? 520 LYS A HZ1  2  
ATOM 4666  H HZ2  . LYS A 1 128 ? 6.889   14.587  11.659  1.00 0.00 ? 520 LYS A HZ2  2  
ATOM 4667  H HZ3  . LYS A 1 128 ? 7.885   15.914  11.494  1.00 0.00 ? 520 LYS A HZ3  2  
ATOM 4668  N N    . ILE A 1 129 ? 5.810   10.554  6.155   1.00 0.00 ? 521 ILE A N    2  
ATOM 4669  C CA   . ILE A 1 129 ? 6.253   9.682   5.045   1.00 0.00 ? 521 ILE A CA   2  
ATOM 4670  C C    . ILE A 1 129 ? 5.577   8.339   5.071   1.00 0.00 ? 521 ILE A C    2  
ATOM 4671  O O    . ILE A 1 129 ? 4.927   7.976   6.068   1.00 0.00 ? 521 ILE A O    2  
ATOM 4672  C CB   . ILE A 1 129 ? 7.819   9.519   4.908   1.00 0.00 ? 521 ILE A CB   2  
ATOM 4673  C CG1  . ILE A 1 129 ? 8.537   9.141   6.229   1.00 0.00 ? 521 ILE A CG1  2  
ATOM 4674  C CG2  . ILE A 1 129 ? 8.462   10.729  4.263   1.00 0.00 ? 521 ILE A CG2  2  
ATOM 4675  C CD1  . ILE A 1 129 ? 8.362   7.701   6.679   1.00 0.00 ? 521 ILE A CD1  2  
ATOM 4676  H H    . ILE A 1 129 ? 5.526   10.161  7.016   1.00 0.00 ? 521 ILE A H    2  
ATOM 4677  H HA   . ILE A 1 129 ? 5.891   10.173  4.152   1.00 0.00 ? 521 ILE A HA   2  
ATOM 4678  H HB   . ILE A 1 129 ? 7.956   8.713   4.202   1.00 0.00 ? 521 ILE A HB   2  
ATOM 4679  H HG12 . ILE A 1 129 ? 9.597   9.309   6.106   1.00 0.00 ? 521 ILE A HG12 2  
ATOM 4680  H HG13 . ILE A 1 129 ? 8.172   9.785   7.016   1.00 0.00 ? 521 ILE A HG13 2  
ATOM 4681  H HG21 . ILE A 1 129 ? 8.045   10.869  3.278   1.00 0.00 ? 521 ILE A HG21 2  
ATOM 4682  H HG22 . ILE A 1 129 ? 8.263   11.602  4.865   1.00 0.00 ? 521 ILE A HG22 2  
ATOM 4683  H HG23 . ILE A 1 129 ? 9.528   10.573  4.188   1.00 0.00 ? 521 ILE A HG23 2  
ATOM 4684  H HD11 . ILE A 1 129 ? 7.310   7.499   6.817   1.00 0.00 ? 521 ILE A HD11 2  
ATOM 4685  H HD12 . ILE A 1 129 ? 8.763   7.033   5.932   1.00 0.00 ? 521 ILE A HD12 2  
ATOM 4686  H HD13 . ILE A 1 129 ? 8.883   7.550   7.613   1.00 0.00 ? 521 ILE A HD13 2  
ATOM 4687  N N    . PHE A 1 130 ? 5.701   7.584   4.000   1.00 0.00 ? 522 PHE A N    2  
ATOM 4688  C CA   . PHE A 1 130 ? 5.066   6.314   3.967   1.00 0.00 ? 522 PHE A CA   2  
ATOM 4689  C C    . PHE A 1 130 ? 6.073   5.220   4.211   1.00 0.00 ? 522 PHE A C    2  
ATOM 4690  O O    . PHE A 1 130 ? 7.206   5.272   3.722   1.00 0.00 ? 522 PHE A O    2  
ATOM 4691  C CB   . PHE A 1 130 ? 4.308   6.100   2.666   1.00 0.00 ? 522 PHE A CB   2  
ATOM 4692  C CG   . PHE A 1 130 ? 3.082   6.958   2.494   1.00 0.00 ? 522 PHE A CG   2  
ATOM 4693  C CD1  . PHE A 1 130 ? 3.189   8.315   2.262   1.00 0.00 ? 522 PHE A CD1  2  
ATOM 4694  C CD2  . PHE A 1 130 ? 1.819   6.393   2.544   1.00 0.00 ? 522 PHE A CD2  2  
ATOM 4695  C CE1  . PHE A 1 130 ? 2.068   9.088   2.087   1.00 0.00 ? 522 PHE A CE1  2  
ATOM 4696  C CE2  . PHE A 1 130 ? 0.689   7.164   2.371   1.00 0.00 ? 522 PHE A CE2  2  
ATOM 4697  C CZ   . PHE A 1 130 ? 0.813   8.515   2.140   1.00 0.00 ? 522 PHE A CZ   2  
ATOM 4698  H H    . PHE A 1 130 ? 6.252   7.831   3.218   1.00 0.00 ? 522 PHE A H    2  
ATOM 4699  H HA   . PHE A 1 130 ? 4.360   6.298   4.784   1.00 0.00 ? 522 PHE A HA   2  
ATOM 4700  H HB2  . PHE A 1 130 ? 4.966   6.318   1.839   1.00 0.00 ? 522 PHE A HB2  2  
ATOM 4701  H HB3  . PHE A 1 130 ? 4.001   5.067   2.625   1.00 0.00 ? 522 PHE A HB3  2  
ATOM 4702  H HD1  . PHE A 1 130 ? 4.167   8.772   2.224   1.00 0.00 ? 522 PHE A HD1  2  
ATOM 4703  H HD2  . PHE A 1 130 ? 1.723   5.334   2.727   1.00 0.00 ? 522 PHE A HD2  2  
ATOM 4704  H HE1  . PHE A 1 130 ? 2.181   10.146  1.908   1.00 0.00 ? 522 PHE A HE1  2  
ATOM 4705  H HE2  . PHE A 1 130 ? -0.289  6.708   2.412   1.00 0.00 ? 522 PHE A HE2  2  
ATOM 4706  H HZ   . PHE A 1 130 ? -0.068  9.124   2.002   1.00 0.00 ? 522 PHE A HZ   2  
ATOM 4707  N N    . MET A 1 131 ? 5.679   4.278   4.983   1.00 0.00 ? 523 MET A N    2  
ATOM 4708  C CA   . MET A 1 131 ? 6.493   3.153   5.338   1.00 0.00 ? 523 MET A CA   2  
ATOM 4709  C C    . MET A 1 131 ? 5.695   1.919   5.022   1.00 0.00 ? 523 MET A C    2  
ATOM 4710  O O    . MET A 1 131 ? 4.475   2.001   4.876   1.00 0.00 ? 523 MET A O    2  
ATOM 4711  C CB   . MET A 1 131 ? 6.848   3.201   6.843   1.00 0.00 ? 523 MET A CB   2  
ATOM 4712  C CG   . MET A 1 131 ? 5.637   3.190   7.783   1.00 0.00 ? 523 MET A CG   2  
ATOM 4713  S SD   . MET A 1 131 ? 6.077   3.320   9.537   1.00 0.00 ? 523 MET A SD   2  
ATOM 4714  C CE   . MET A 1 131 ? 7.035   1.821   9.770   1.00 0.00 ? 523 MET A CE   2  
ATOM 4715  H H    . MET A 1 131 ? 4.758   4.291   5.332   1.00 0.00 ? 523 MET A H    2  
ATOM 4716  H HA   . MET A 1 131 ? 7.396   3.172   4.747   1.00 0.00 ? 523 MET A HA   2  
ATOM 4717  H HB2  . MET A 1 131 ? 7.455   2.339   7.078   1.00 0.00 ? 523 MET A HB2  2  
ATOM 4718  H HB3  . MET A 1 131 ? 7.419   4.097   7.036   1.00 0.00 ? 523 MET A HB3  2  
ATOM 4719  H HG2  . MET A 1 131 ? 4.999   4.024   7.531   1.00 0.00 ? 523 MET A HG2  2  
ATOM 4720  H HG3  . MET A 1 131 ? 5.094   2.270   7.627   1.00 0.00 ? 523 MET A HG3  2  
ATOM 4721  H HE1  . MET A 1 131 ? 6.431   0.963   9.514   1.00 0.00 ? 523 MET A HE1  2  
ATOM 4722  H HE2  . MET A 1 131 ? 7.911   1.850   9.138   1.00 0.00 ? 523 MET A HE2  2  
ATOM 4723  H HE3  . MET A 1 131 ? 7.345   1.751   10.802  1.00 0.00 ? 523 MET A HE3  2  
ATOM 4724  N N    . GLY A 1 132 ? 6.333   0.811   4.873   1.00 0.00 ? 524 GLY A N    2  
ATOM 4725  C CA   . GLY A 1 132 ? 5.588   -0.367  4.600   1.00 0.00 ? 524 GLY A CA   2  
ATOM 4726  C C    . GLY A 1 132 ? 6.388   -1.605  4.781   1.00 0.00 ? 524 GLY A C    2  
ATOM 4727  O O    . GLY A 1 132 ? 7.605   -1.561  4.758   1.00 0.00 ? 524 GLY A O    2  
ATOM 4728  H H    . GLY A 1 132 ? 7.314   0.765   4.914   1.00 0.00 ? 524 GLY A H    2  
ATOM 4729  H HA2  . GLY A 1 132 ? 4.724   -0.391  5.244   1.00 0.00 ? 524 GLY A HA2  2  
ATOM 4730  H HA3  . GLY A 1 132 ? 5.249   -0.319  3.575   1.00 0.00 ? 524 GLY A HA3  2  
ATOM 4731  N N    . LEU A 1 133 ? 5.726   -2.670  5.085   1.00 0.00 ? 525 LEU A N    2  
ATOM 4732  C CA   . LEU A 1 133 ? 6.347   -3.968  5.118   1.00 0.00 ? 525 LEU A CA   2  
ATOM 4733  C C    . LEU A 1 133 ? 5.739   -4.836  4.062   1.00 0.00 ? 525 LEU A C    2  
ATOM 4734  O O    . LEU A 1 133 ? 4.516   -4.755  3.822   1.00 0.00 ? 525 LEU A O    2  
ATOM 4735  C CB   . LEU A 1 133 ? 6.304   -4.651  6.502   1.00 0.00 ? 525 LEU A CB   2  
ATOM 4736  C CG   . LEU A 1 133 ? 7.317   -4.149  7.548   1.00 0.00 ? 525 LEU A CG   2  
ATOM 4737  C CD1  . LEU A 1 133 ? 7.008   -2.732  8.012   1.00 0.00 ? 525 LEU A CD1  2  
ATOM 4738  C CD2  . LEU A 1 133 ? 7.392   -5.089  8.738   1.00 0.00 ? 525 LEU A CD2  2  
ATOM 4739  H H    . LEU A 1 133 ? 4.762   -2.605  5.245   1.00 0.00 ? 525 LEU A H    2  
ATOM 4740  H HA   . LEU A 1 133 ? 7.378   -3.809  4.835   1.00 0.00 ? 525 LEU A HA   2  
ATOM 4741  H HB2  . LEU A 1 133 ? 5.311   -4.516  6.906   1.00 0.00 ? 525 LEU A HB2  2  
ATOM 4742  H HB3  . LEU A 1 133 ? 6.466   -5.709  6.358   1.00 0.00 ? 525 LEU A HB3  2  
ATOM 4743  H HG   . LEU A 1 133 ? 8.280   -4.161  7.054   1.00 0.00 ? 525 LEU A HG   2  
ATOM 4744  H HD11 . LEU A 1 133 ? 6.010   -2.701  8.425   1.00 0.00 ? 525 LEU A HD11 2  
ATOM 4745  H HD12 . LEU A 1 133 ? 7.718   -2.434  8.769   1.00 0.00 ? 525 LEU A HD12 2  
ATOM 4746  H HD13 . LEU A 1 133 ? 7.067   -2.061  7.168   1.00 0.00 ? 525 LEU A HD13 2  
ATOM 4747  H HD21 . LEU A 1 133 ? 6.412   -5.203  9.176   1.00 0.00 ? 525 LEU A HD21 2  
ATOM 4748  H HD22 . LEU A 1 133 ? 7.759   -6.051  8.414   1.00 0.00 ? 525 LEU A HD22 2  
ATOM 4749  H HD23 . LEU A 1 133 ? 8.072   -4.687  9.473   1.00 0.00 ? 525 LEU A HD23 2  
ATOM 4750  N N    . ILE A 1 134 ? 6.550   -5.603  3.388   1.00 0.00 ? 526 ILE A N    2  
ATOM 4751  C CA   . ILE A 1 134 ? 6.046   -6.531  2.427   1.00 0.00 ? 526 ILE A CA   2  
ATOM 4752  C C    . ILE A 1 134 ? 6.136   -7.947  3.001   1.00 0.00 ? 526 ILE A C    2  
ATOM 4753  O O    . ILE A 1 134 ? 7.250   -8.486  3.193   1.00 0.00 ? 526 ILE A O    2  
ATOM 4754  C CB   . ILE A 1 134 ? 6.853   -6.440  1.094   1.00 0.00 ? 526 ILE A CB   2  
ATOM 4755  C CG1  . ILE A 1 134 ? 6.742   -5.037  0.515   1.00 0.00 ? 526 ILE A CG1  2  
ATOM 4756  C CG2  . ILE A 1 134 ? 6.440   -7.505  0.088   1.00 0.00 ? 526 ILE A CG2  2  
ATOM 4757  C CD1  . ILE A 1 134 ? 7.336   -4.856  -0.868  1.00 0.00 ? 526 ILE A CD1  2  
ATOM 4758  H H    . ILE A 1 134 ? 7.523   -5.537  3.519   1.00 0.00 ? 526 ILE A H    2  
ATOM 4759  H HA   . ILE A 1 134 ? 5.013   -6.290  2.228   1.00 0.00 ? 526 ILE A HA   2  
ATOM 4760  H HB   . ILE A 1 134 ? 7.887   -6.619  1.319   1.00 0.00 ? 526 ILE A HB   2  
ATOM 4761  H HG12 . ILE A 1 134 ? 5.707   -4.750  0.515   1.00 0.00 ? 526 ILE A HG12 2  
ATOM 4762  H HG13 . ILE A 1 134 ? 7.263   -4.369  1.187   1.00 0.00 ? 526 ILE A HG13 2  
ATOM 4763  H HG21 . ILE A 1 134 ? 6.603   -8.475  0.533   1.00 0.00 ? 526 ILE A HG21 2  
ATOM 4764  H HG22 . ILE A 1 134 ? 5.395   -7.385  -0.152  1.00 0.00 ? 526 ILE A HG22 2  
ATOM 4765  H HG23 . ILE A 1 134 ? 7.038   -7.408  -0.806  1.00 0.00 ? 526 ILE A HG23 2  
ATOM 4766  H HD11 . ILE A 1 134 ? 6.871   -5.554  -1.549  1.00 0.00 ? 526 ILE A HD11 2  
ATOM 4767  H HD12 . ILE A 1 134 ? 7.160   -3.846  -1.209  1.00 0.00 ? 526 ILE A HD12 2  
ATOM 4768  H HD13 . ILE A 1 134 ? 8.397   -5.052  -0.821  1.00 0.00 ? 526 ILE A HD13 2  
ATOM 4769  N N    . PRO A 1 135 ? 4.982   -8.533  3.369   1.00 0.00 ? 527 PRO A N    2  
ATOM 4770  C CA   . PRO A 1 135 ? 4.893   -9.920  3.757   1.00 0.00 ? 527 PRO A CA   2  
ATOM 4771  C C    . PRO A 1 135 ? 5.079   -10.868 2.571   1.00 0.00 ? 527 PRO A C    2  
ATOM 4772  O O    . PRO A 1 135 ? 4.527   -10.649 1.420   1.00 0.00 ? 527 PRO A O    2  
ATOM 4773  C CB   . PRO A 1 135 ? 3.481   -10.066 4.342   1.00 0.00 ? 527 PRO A CB   2  
ATOM 4774  C CG   . PRO A 1 135 ? 3.058   -8.677  4.633   1.00 0.00 ? 527 PRO A CG   2  
ATOM 4775  C CD   . PRO A 1 135 ? 3.700   -7.847  3.579   1.00 0.00 ? 527 PRO A CD   2  
ATOM 4776  H HA   . PRO A 1 135 ? 5.625   -10.157 4.515   1.00 0.00 ? 527 PRO A HA   2  
ATOM 4777  H HB2  . PRO A 1 135 ? 2.836   -10.533 3.612   1.00 0.00 ? 527 PRO A HB2  2  
ATOM 4778  H HB3  . PRO A 1 135 ? 3.514   -10.666 5.240   1.00 0.00 ? 527 PRO A HB3  2  
ATOM 4779  H HG2  . PRO A 1 135 ? 1.982   -8.596  4.582   1.00 0.00 ? 527 PRO A HG2  2  
ATOM 4780  H HG3  . PRO A 1 135 ? 3.413   -8.381  5.610   1.00 0.00 ? 527 PRO A HG3  2  
ATOM 4781  H HD2  . PRO A 1 135 ? 3.105   -7.850  2.677   1.00 0.00 ? 527 PRO A HD2  2  
ATOM 4782  H HD3  . PRO A 1 135 ? 3.856   -6.839  3.934   1.00 0.00 ? 527 PRO A HD3  2  
ATOM 4783  N N    . TYR A 1 136 ? 5.843   -11.920 2.853   1.00 0.00 ? 528 TYR A N    2  
ATOM 4784  C CA   . TYR A 1 136 ? 6.168   -12.944 1.901   1.00 0.00 ? 528 TYR A CA   2  
ATOM 4785  C C    . TYR A 1 136 ? 4.955   -13.798 1.616   1.00 0.00 ? 528 TYR A C    2  
ATOM 4786  O O    . TYR A 1 136 ? 4.697   -14.171 0.466   1.00 0.00 ? 528 TYR A O    2  
ATOM 4787  C CB   . TYR A 1 136 ? 7.285   -13.854 2.428   1.00 0.00 ? 528 TYR A CB   2  
ATOM 4788  C CG   . TYR A 1 136 ? 8.643   -13.209 2.619   1.00 0.00 ? 528 TYR A CG   2  
ATOM 4789  C CD1  . TYR A 1 136 ? 9.012   -12.635 3.832   1.00 0.00 ? 528 TYR A CD1  2  
ATOM 4790  C CD2  . TYR A 1 136 ? 9.566   -13.203 1.589   1.00 0.00 ? 528 TYR A CD2  2  
ATOM 4791  C CE1  . TYR A 1 136 ? 10.266  -12.070 4.001   1.00 0.00 ? 528 TYR A CE1  2  
ATOM 4792  C CE2  . TYR A 1 136 ? 10.813  -12.643 1.749   1.00 0.00 ? 528 TYR A CE2  2  
ATOM 4793  C CZ   . TYR A 1 136 ? 11.163  -12.082 2.950   1.00 0.00 ? 528 TYR A CZ   2  
ATOM 4794  O OH   . TYR A 1 136 ? 12.408  -11.509 3.093   1.00 0.00 ? 528 TYR A OH   2  
ATOM 4795  H H    . TYR A 1 136 ? 6.190   -11.997 3.766   1.00 0.00 ? 528 TYR A H    2  
ATOM 4796  H HA   . TYR A 1 136 ? 6.517   -12.456 1.007   1.00 0.00 ? 528 TYR A HA   2  
ATOM 4797  H HB2  . TYR A 1 136 ? 6.982   -14.250 3.384   1.00 0.00 ? 528 TYR A HB2  2  
ATOM 4798  H HB3  . TYR A 1 136 ? 7.401   -14.677 1.738   1.00 0.00 ? 528 TYR A HB3  2  
ATOM 4799  H HD1  . TYR A 1 136 ? 8.306   -12.629 4.648   1.00 0.00 ? 528 TYR A HD1  2  
ATOM 4800  H HD2  . TYR A 1 136 ? 9.296   -13.643 0.641   1.00 0.00 ? 528 TYR A HD2  2  
ATOM 4801  H HE1  . TYR A 1 136 ? 10.537  -11.629 4.948   1.00 0.00 ? 528 TYR A HE1  2  
ATOM 4802  H HE2  . TYR A 1 136 ? 11.520  -12.650 0.932   1.00 0.00 ? 528 TYR A HE2  2  
ATOM 4803  H HH   . TYR A 1 136 ? 12.833  -11.828 3.900   1.00 0.00 ? 528 TYR A HH   2  
ATOM 4804  N N    . ASP A 1 137 ? 4.220   -14.110 2.667   1.00 0.00 ? 529 ASP A N    2  
ATOM 4805  C CA   . ASP A 1 137 ? 3.060   -14.981 2.570   1.00 0.00 ? 529 ASP A CA   2  
ATOM 4806  C C    . ASP A 1 137 ? 1.877   -14.223 1.993   1.00 0.00 ? 529 ASP A C    2  
ATOM 4807  O O    . ASP A 1 137 ? 1.122   -13.564 2.711   1.00 0.00 ? 529 ASP A O    2  
ATOM 4808  C CB   . ASP A 1 137 ? 2.715   -15.571 3.936   1.00 0.00 ? 529 ASP A CB   2  
ATOM 4809  C CG   . ASP A 1 137 ? 1.649   -16.638 3.867   1.00 0.00 ? 529 ASP A CG   2  
ATOM 4810  O OD1  . ASP A 1 137 ? 1.996   -17.820 3.695   1.00 0.00 ? 529 ASP A OD1  2  
ATOM 4811  O OD2  . ASP A 1 137 ? 0.467   -16.342 4.042   1.00 0.00 ? 529 ASP A OD2  2  
ATOM 4812  H H    . ASP A 1 137 ? 4.459   -13.736 3.541   1.00 0.00 ? 529 ASP A H    2  
ATOM 4813  H HA   . ASP A 1 137 ? 3.318   -15.783 1.895   1.00 0.00 ? 529 ASP A HA   2  
ATOM 4814  H HB2  . ASP A 1 137 ? 3.605   -16.010 4.361   1.00 0.00 ? 529 ASP A HB2  2  
ATOM 4815  H HB3  . ASP A 1 137 ? 2.367   -14.777 4.580   1.00 0.00 ? 529 ASP A HB3  2  
ATOM 4816  N N    . GLN A 1 138 ? 1.779   -14.260 0.681   1.00 0.00 ? 530 GLN A N    2  
ATOM 4817  C CA   . GLN A 1 138 ? 0.751   -13.553 -0.042  1.00 0.00 ? 530 GLN A CA   2  
ATOM 4818  C C    . GLN A 1 138 ? -0.638  -14.137 0.232   1.00 0.00 ? 530 GLN A C    2  
ATOM 4819  O O    . GLN A 1 138 ? -1.579  -13.405 0.528   1.00 0.00 ? 530 GLN A O    2  
ATOM 4820  C CB   . GLN A 1 138 ? 1.075   -13.492 -1.564  1.00 0.00 ? 530 GLN A CB   2  
ATOM 4821  C CG   . GLN A 1 138 ? 1.129   -14.844 -2.284  1.00 0.00 ? 530 GLN A CG   2  
ATOM 4822  C CD   . GLN A 1 138 ? 1.600   -14.753 -3.734  1.00 0.00 ? 530 GLN A CD   2  
ATOM 4823  O OE1  . GLN A 1 138 ? 2.425   -13.901 -4.098  1.00 0.00 ? 530 GLN A OE1  2  
ATOM 4824  N NE2  . GLN A 1 138 ? 1.057   -15.595 -4.579  1.00 0.00 ? 530 GLN A NE2  2  
ATOM 4825  H H    . GLN A 1 138 ? 2.432   -14.804 0.193   1.00 0.00 ? 530 GLN A H    2  
ATOM 4826  H HA   . GLN A 1 138 ? 0.753   -12.543 0.344   1.00 0.00 ? 530 GLN A HA   2  
ATOM 4827  H HB2  . GLN A 1 138 ? 0.319   -12.893 -2.050  1.00 0.00 ? 530 GLN A HB2  2  
ATOM 4828  H HB3  . GLN A 1 138 ? 2.028   -13.003 -1.692  1.00 0.00 ? 530 GLN A HB3  2  
ATOM 4829  H HG2  . GLN A 1 138 ? 1.810   -15.488 -1.747  1.00 0.00 ? 530 GLN A HG2  2  
ATOM 4830  H HG3  . GLN A 1 138 ? 0.142   -15.282 -2.268  1.00 0.00 ? 530 GLN A HG3  2  
ATOM 4831  H HE21 . GLN A 1 138 ? 0.383   -16.225 -4.242  1.00 0.00 ? 530 GLN A HE21 2  
ATOM 4832  H HE22 . GLN A 1 138 ? 1.327   -15.575 -5.520  1.00 0.00 ? 530 GLN A HE22 2  
ATOM 4833  N N    . SER A 1 139 ? -0.731  -15.454 0.202   1.00 0.00 ? 531 SER A N    2  
ATOM 4834  C CA   . SER A 1 139 ? -1.990  -16.155 0.319   1.00 0.00 ? 531 SER A CA   2  
ATOM 4835  C C    . SER A 1 139 ? -2.708  -15.870 1.642   1.00 0.00 ? 531 SER A C    2  
ATOM 4836  O O    . SER A 1 139 ? -3.909  -15.544 1.643   1.00 0.00 ? 531 SER A O    2  
ATOM 4837  C CB   . SER A 1 139 ? -1.753  -17.641 0.139   1.00 0.00 ? 531 SER A CB   2  
ATOM 4838  O OG   . SER A 1 139 ? -1.026  -17.875 -1.068  1.00 0.00 ? 531 SER A OG   2  
ATOM 4839  H H    . SER A 1 139 ? 0.088   -15.989 0.106   1.00 0.00 ? 531 SER A H    2  
ATOM 4840  H HA   . SER A 1 139 ? -2.625  -15.819 -0.487  1.00 0.00 ? 531 SER A HA   2  
ATOM 4841  H HB2  . SER A 1 139 ? -1.189  -18.012 0.980   1.00 0.00 ? 531 SER A HB2  2  
ATOM 4842  H HB3  . SER A 1 139 ? -2.698  -18.158 0.082   1.00 0.00 ? 531 SER A HB3  2  
ATOM 4843  H HG   . SER A 1 139 ? -1.346  -17.240 -1.721  1.00 0.00 ? 531 SER A HG   2  
ATOM 4844  N N    . GLY A 1 140 ? -1.981  -15.938 2.742   1.00 0.00 ? 532 GLY A N    2  
ATOM 4845  C CA   . GLY A 1 140 ? -2.578  -15.734 4.033   1.00 0.00 ? 532 GLY A CA   2  
ATOM 4846  C C    . GLY A 1 140 ? -2.860  -14.286 4.312   1.00 0.00 ? 532 GLY A C    2  
ATOM 4847  O O    . GLY A 1 140 ? -3.902  -13.956 4.881   1.00 0.00 ? 532 GLY A O    2  
ATOM 4848  H H    . GLY A 1 140 ? -1.013  -16.121 2.718   1.00 0.00 ? 532 GLY A H    2  
ATOM 4849  H HA2  . GLY A 1 140 ? -3.508  -16.283 4.073   1.00 0.00 ? 532 GLY A HA2  2  
ATOM 4850  H HA3  . GLY A 1 140 ? -1.911  -16.116 4.791   1.00 0.00 ? 532 GLY A HA3  2  
ATOM 4851  N N    . PHE A 1 141 ? -1.954  -13.412 3.889   1.00 0.00 ? 533 PHE A N    2  
ATOM 4852  C CA   . PHE A 1 141 ? -2.116  -11.989 4.122   1.00 0.00 ? 533 PHE A CA   2  
ATOM 4853  C C    . PHE A 1 141 ? -3.348  -11.475 3.383   1.00 0.00 ? 533 PHE A C    2  
ATOM 4854  O O    . PHE A 1 141 ? -4.196  -10.816 3.976   1.00 0.00 ? 533 PHE A O    2  
ATOM 4855  C CB   . PHE A 1 141 ? -0.862  -11.217 3.697   1.00 0.00 ? 533 PHE A CB   2  
ATOM 4856  C CG   . PHE A 1 141 ? -0.841  -9.782  4.156   1.00 0.00 ? 533 PHE A CG   2  
ATOM 4857  C CD1  . PHE A 1 141 ? -0.370  -9.465  5.410   1.00 0.00 ? 533 PHE A CD1  2  
ATOM 4858  C CD2  . PHE A 1 141 ? -1.282  -8.758  3.338   1.00 0.00 ? 533 PHE A CD2  2  
ATOM 4859  C CE1  . PHE A 1 141 ? -0.337  -8.165  5.845   1.00 0.00 ? 533 PHE A CE1  2  
ATOM 4860  C CE2  . PHE A 1 141 ? -1.250  -7.451  3.767   1.00 0.00 ? 533 PHE A CE2  2  
ATOM 4861  C CZ   . PHE A 1 141 ? -0.776  -7.156  5.024   1.00 0.00 ? 533 PHE A CZ   2  
ATOM 4862  H H    . PHE A 1 141 ? -1.153  -13.741 3.425   1.00 0.00 ? 533 PHE A H    2  
ATOM 4863  H HA   . PHE A 1 141 ? -2.273  -11.852 5.183   1.00 0.00 ? 533 PHE A HA   2  
ATOM 4864  H HB2  . PHE A 1 141 ? 0.010   -11.705 4.107   1.00 0.00 ? 533 PHE A HB2  2  
ATOM 4865  H HB3  . PHE A 1 141 ? -0.796  -11.226 2.619   1.00 0.00 ? 533 PHE A HB3  2  
ATOM 4866  H HD1  . PHE A 1 141 ? -0.021  -10.255 6.057   1.00 0.00 ? 533 PHE A HD1  2  
ATOM 4867  H HD2  . PHE A 1 141 ? -1.657  -8.991  2.352   1.00 0.00 ? 533 PHE A HD2  2  
ATOM 4868  H HE1  . PHE A 1 141 ? 0.035   -7.933  6.832   1.00 0.00 ? 533 PHE A HE1  2  
ATOM 4869  H HE2  . PHE A 1 141 ? -1.594  -6.658  3.119   1.00 0.00 ? 533 PHE A HE2  2  
ATOM 4870  H HZ   . PHE A 1 141 ? -0.750  -6.134  5.371   1.00 0.00 ? 533 PHE A HZ   2  
ATOM 4871  N N    . VAL A 1 142 ? -3.476  -11.843 2.106   1.00 0.00 ? 534 VAL A N    2  
ATOM 4872  C CA   . VAL A 1 142 ? -4.632  -11.443 1.297   1.00 0.00 ? 534 VAL A CA   2  
ATOM 4873  C C    . VAL A 1 142 ? -5.923  -12.005 1.910   1.00 0.00 ? 534 VAL A C    2  
ATOM 4874  O O    . VAL A 1 142 ? -6.953  -11.324 1.964   1.00 0.00 ? 534 VAL A O    2  
ATOM 4875  C CB   . VAL A 1 142 ? -4.496  -11.894 -0.195  1.00 0.00 ? 534 VAL A CB   2  
ATOM 4876  C CG1  . VAL A 1 142 ? -5.752  -11.563 -0.995  1.00 0.00 ? 534 VAL A CG1  2  
ATOM 4877  C CG2  . VAL A 1 142 ? -3.295  -11.219 -0.843  1.00 0.00 ? 534 VAL A CG2  2  
ATOM 4878  H H    . VAL A 1 142 ? -2.769  -12.395 1.701   1.00 0.00 ? 534 VAL A H    2  
ATOM 4879  H HA   . VAL A 1 142 ? -4.682  -10.363 1.333   1.00 0.00 ? 534 VAL A HA   2  
ATOM 4880  H HB   . VAL A 1 142 ? -4.337  -12.962 -0.219  1.00 0.00 ? 534 VAL A HB   2  
ATOM 4881  H HG11 . VAL A 1 142 ? -6.605  -12.061 -0.557  1.00 0.00 ? 534 VAL A HG11 2  
ATOM 4882  H HG12 . VAL A 1 142 ? -5.914  -10.495 -0.983  1.00 0.00 ? 534 VAL A HG12 2  
ATOM 4883  H HG13 . VAL A 1 142 ? -5.625  -11.895 -2.015  1.00 0.00 ? 534 VAL A HG13 2  
ATOM 4884  H HG21 . VAL A 1 142 ? -3.420  -10.147 -0.808  1.00 0.00 ? 534 VAL A HG21 2  
ATOM 4885  H HG22 . VAL A 1 142 ? -2.396  -11.492 -0.309  1.00 0.00 ? 534 VAL A HG22 2  
ATOM 4886  H HG23 . VAL A 1 142 ? -3.213  -11.538 -1.872  1.00 0.00 ? 534 VAL A HG23 2  
ATOM 4887  N N    . ASN A 1 143 ? -5.843  -13.235 2.412   1.00 0.00 ? 535 ASN A N    2  
ATOM 4888  C CA   . ASN A 1 143 ? -6.986  -13.887 3.054   1.00 0.00 ? 535 ASN A CA   2  
ATOM 4889  C C    . ASN A 1 143 ? -7.416  -13.105 4.295   1.00 0.00 ? 535 ASN A C    2  
ATOM 4890  O O    . ASN A 1 143 ? -8.612  -12.900 4.530   1.00 0.00 ? 535 ASN A O    2  
ATOM 4891  C CB   . ASN A 1 143 ? -6.662  -15.350 3.411   1.00 0.00 ? 535 ASN A CB   2  
ATOM 4892  C CG   . ASN A 1 143 ? -7.846  -16.088 4.013   1.00 0.00 ? 535 ASN A CG   2  
ATOM 4893  O OD1  . ASN A 1 143 ? -8.677  -16.645 3.283   1.00 0.00 ? 535 ASN A OD1  2  
ATOM 4894  N ND2  . ASN A 1 143 ? -7.908  -16.159 5.319   1.00 0.00 ? 535 ASN A ND2  2  
ATOM 4895  H H    . ASN A 1 143 ? -4.990  -13.716 2.353   1.00 0.00 ? 535 ASN A H    2  
ATOM 4896  H HA   . ASN A 1 143 ? -7.801  -13.868 2.347   1.00 0.00 ? 535 ASN A HA   2  
ATOM 4897  H HB2  . ASN A 1 143 ? -6.355  -15.874 2.518   1.00 0.00 ? 535 ASN A HB2  2  
ATOM 4898  H HB3  . ASN A 1 143 ? -5.851  -15.364 4.125   1.00 0.00 ? 535 ASN A HB3  2  
ATOM 4899  H HD21 . ASN A 1 143 ? -7.199  -15.752 5.864   1.00 0.00 ? 535 ASN A HD21 2  
ATOM 4900  H HD22 . ASN A 1 143 ? -8.667  -16.624 5.729   1.00 0.00 ? 535 ASN A HD22 2  
ATOM 4901  N N    . GLY A 1 144 ? -6.435  -12.639 5.056   1.00 0.00 ? 536 GLY A N    2  
ATOM 4902  C CA   . GLY A 1 144 ? -6.706  -11.833 6.226   1.00 0.00 ? 536 GLY A CA   2  
ATOM 4903  C C    . GLY A 1 144 ? -7.297  -10.489 5.848   1.00 0.00 ? 536 GLY A C    2  
ATOM 4904  O O    . GLY A 1 144 ? -8.253  -10.019 6.477   1.00 0.00 ? 536 GLY A O    2  
ATOM 4905  H H    . GLY A 1 144 ? -5.502  -12.852 4.826   1.00 0.00 ? 536 GLY A H    2  
ATOM 4906  H HA2  . GLY A 1 144 ? -7.399  -12.361 6.865   1.00 0.00 ? 536 GLY A HA2  2  
ATOM 4907  H HA3  . GLY A 1 144 ? -5.785  -11.667 6.765   1.00 0.00 ? 536 GLY A HA3  2  
ATOM 4908  N N    . ILE A 1 145 ? -6.756  -9.895  4.790   1.00 0.00 ? 537 ILE A N    2  
ATOM 4909  C CA   . ILE A 1 145 ? -7.217  -8.604  4.287   1.00 0.00 ? 537 ILE A CA   2  
ATOM 4910  C C    . ILE A 1 145 ? -8.669  -8.683  3.816   1.00 0.00 ? 537 ILE A C    2  
ATOM 4911  O O    . ILE A 1 145 ? -9.433  -7.757  4.035   1.00 0.00 ? 537 ILE A O    2  
ATOM 4912  C CB   . ILE A 1 145 ? -6.293  -8.049  3.151   1.00 0.00 ? 537 ILE A CB   2  
ATOM 4913  C CG1  . ILE A 1 145 ? -4.862  -7.843  3.672   1.00 0.00 ? 537 ILE A CG1  2  
ATOM 4914  C CG2  . ILE A 1 145 ? -6.834  -6.750  2.555   1.00 0.00 ? 537 ILE A CG2  2  
ATOM 4915  C CD1  . ILE A 1 145 ? -4.751  -6.919  4.872   1.00 0.00 ? 537 ILE A CD1  2  
ATOM 4916  H H    . ILE A 1 145 ? -6.000  -10.337 4.342   1.00 0.00 ? 537 ILE A H    2  
ATOM 4917  H HA   . ILE A 1 145 ? -7.188  -7.917  5.120   1.00 0.00 ? 537 ILE A HA   2  
ATOM 4918  H HB   . ILE A 1 145 ? -6.265  -8.787  2.363   1.00 0.00 ? 537 ILE A HB   2  
ATOM 4919  H HG12 . ILE A 1 145 ? -4.454  -8.799  3.963   1.00 0.00 ? 537 ILE A HG12 2  
ATOM 4920  H HG13 . ILE A 1 145 ? -4.256  -7.432  2.878   1.00 0.00 ? 537 ILE A HG13 2  
ATOM 4921  H HG21 . ILE A 1 145 ? -6.927  -6.011  3.336   1.00 0.00 ? 537 ILE A HG21 2  
ATOM 4922  H HG22 . ILE A 1 145 ? -6.153  -6.387  1.797   1.00 0.00 ? 537 ILE A HG22 2  
ATOM 4923  H HG23 . ILE A 1 145 ? -7.801  -6.932  2.110   1.00 0.00 ? 537 ILE A HG23 2  
ATOM 4924  H HD11 . ILE A 1 145 ? -5.176  -5.956  4.628   1.00 0.00 ? 537 ILE A HD11 2  
ATOM 4925  H HD12 . ILE A 1 145 ? -5.279  -7.347  5.710   1.00 0.00 ? 537 ILE A HD12 2  
ATOM 4926  H HD13 . ILE A 1 145 ? -3.710  -6.796  5.134   1.00 0.00 ? 537 ILE A HD13 2  
ATOM 4927  N N    . ARG A 1 146 ? -9.057  -9.820  3.238   1.00 0.00 ? 538 ARG A N    2  
ATOM 4928  C CA   . ARG A 1 146 ? -10.444 -10.044 2.783   1.00 0.00 ? 538 ARG A CA   2  
ATOM 4929  C C    . ARG A 1 146 ? -11.439 -9.843  3.920   1.00 0.00 ? 538 ARG A C    2  
ATOM 4930  O O    . ARG A 1 146 ? -12.507 -9.256  3.734   1.00 0.00 ? 538 ARG A O    2  
ATOM 4931  C CB   . ARG A 1 146 ? -10.605 -11.442 2.196   1.00 0.00 ? 538 ARG A CB   2  
ATOM 4932  C CG   . ARG A 1 146 ? -9.991  -11.602 0.824   1.00 0.00 ? 538 ARG A CG   2  
ATOM 4933  C CD   . ARG A 1 146 ? -9.973  -13.054 0.380   1.00 0.00 ? 538 ARG A CD   2  
ATOM 4934  N NE   . ARG A 1 146 ? -11.298 -13.707 0.405   1.00 0.00 ? 538 ARG A NE   2  
ATOM 4935  C CZ   . ARG A 1 146 ? -11.494 -15.039 0.249   1.00 0.00 ? 538 ARG A CZ   2  
ATOM 4936  N NH1  . ARG A 1 146 ? -10.465 -15.839 -0.036  1.00 0.00 ? 538 ARG A NH1  2  
ATOM 4937  N NH2  . ARG A 1 146 ? -12.718 -15.558 0.333   1.00 0.00 ? 538 ARG A NH2  2  
ATOM 4938  H H    . ARG A 1 146 ? -8.373  -10.512 3.098   1.00 0.00 ? 538 ARG A H    2  
ATOM 4939  H HA   . ARG A 1 146 ? -10.643 -9.321  2.006   1.00 0.00 ? 538 ARG A HA   2  
ATOM 4940  H HB2  . ARG A 1 146 ? -10.142 -12.155 2.861   1.00 0.00 ? 538 ARG A HB2  2  
ATOM 4941  H HB3  . ARG A 1 146 ? -11.660 -11.662 2.122   1.00 0.00 ? 538 ARG A HB3  2  
ATOM 4942  H HG2  . ARG A 1 146 ? -10.567 -11.027 0.115   1.00 0.00 ? 538 ARG A HG2  2  
ATOM 4943  H HG3  . ARG A 1 146 ? -8.979  -11.229 0.853   1.00 0.00 ? 538 ARG A HG3  2  
ATOM 4944  H HD2  . ARG A 1 146 ? -9.595  -13.083 -0.631  1.00 0.00 ? 538 ARG A HD2  2  
ATOM 4945  H HD3  . ARG A 1 146 ? -9.301  -13.587 1.034   1.00 0.00 ? 538 ARG A HD3  2  
ATOM 4946  H HE   . ARG A 1 146 ? -12.062 -13.111 0.566   1.00 0.00 ? 538 ARG A HE   2  
ATOM 4947  H HH11 . ARG A 1 146 ? -9.532  -15.492 -0.155  1.00 0.00 ? 538 ARG A HH11 2  
ATOM 4948  H HH12 . ARG A 1 146 ? -10.586 -16.831 -0.136  1.00 0.00 ? 538 ARG A HH12 2  
ATOM 4949  H HH21 . ARG A 1 146 ? -13.543 -15.010 0.508   1.00 0.00 ? 538 ARG A HH21 2  
ATOM 4950  H HH22 . ARG A 1 146 ? -12.863 -16.546 0.230   1.00 0.00 ? 538 ARG A HH22 2  
ATOM 4951  N N    . GLN A 1 147 ? -11.055 -10.285 5.097   1.00 0.00 ? 539 GLN A N    2  
ATOM 4952  C CA   . GLN A 1 147 ? -11.868 -10.147 6.298   1.00 0.00 ? 539 GLN A CA   2  
ATOM 4953  C C    . GLN A 1 147 ? -11.936 -8.674  6.695   1.00 0.00 ? 539 GLN A C    2  
ATOM 4954  O O    . GLN A 1 147 ? -13.009 -8.145  6.984   1.00 0.00 ? 539 GLN A O    2  
ATOM 4955  C CB   . GLN A 1 147 ? -11.237 -10.964 7.416   1.00 0.00 ? 539 GLN A CB   2  
ATOM 4956  C CG   . GLN A 1 147 ? -11.088 -12.451 7.091   1.00 0.00 ? 539 GLN A CG   2  
ATOM 4957  C CD   . GLN A 1 147 ? -10.216 -13.199 8.087   1.00 0.00 ? 539 GLN A CD   2  
ATOM 4958  O OE1  . GLN A 1 147 ? -10.418 -14.393 8.342   1.00 0.00 ? 539 GLN A OE1  2  
ATOM 4959  N NE2  . GLN A 1 147 ? -9.228  -12.529 8.636   1.00 0.00 ? 539 GLN A NE2  2  
ATOM 4960  H H    . GLN A 1 147 ? -10.178 -10.720 5.164   1.00 0.00 ? 539 GLN A H    2  
ATOM 4961  H HA   . GLN A 1 147 ? -12.875 -10.498 6.113   1.00 0.00 ? 539 GLN A HA   2  
ATOM 4962  H HB2  . GLN A 1 147 ? -10.258 -10.553 7.614   1.00 0.00 ? 539 GLN A HB2  2  
ATOM 4963  H HB3  . GLN A 1 147 ? -11.848 -10.863 8.300   1.00 0.00 ? 539 GLN A HB3  2  
ATOM 4964  H HG2  . GLN A 1 147 ? -12.066 -12.908 7.083   1.00 0.00 ? 539 GLN A HG2  2  
ATOM 4965  H HG3  . GLN A 1 147 ? -10.647 -12.541 6.108   1.00 0.00 ? 539 GLN A HG3  2  
ATOM 4966  H HE21 . GLN A 1 147 ? -9.104  -11.589 8.385   1.00 0.00 ? 539 GLN A HE21 2  
ATOM 4967  H HE22 . GLN A 1 147 ? -8.633  -12.989 9.267   1.00 0.00 ? 539 GLN A HE22 2  
ATOM 4968  N N    . VAL A 1 148 ? -10.788 -8.012  6.647   1.00 0.00 ? 540 VAL A N    2  
ATOM 4969  C CA   . VAL A 1 148 ? -10.679 -6.596  6.989   1.00 0.00 ? 540 VAL A CA   2  
ATOM 4970  C C    . VAL A 1 148 ? -11.529 -5.748  6.021   1.00 0.00 ? 540 VAL A C    2  
ATOM 4971  O O    . VAL A 1 148 ? -12.241 -4.833  6.441   1.00 0.00 ? 540 VAL A O    2  
ATOM 4972  C CB   . VAL A 1 148 ? -9.197  -6.116  6.962   1.00 0.00 ? 540 VAL A CB   2  
ATOM 4973  C CG1  . VAL A 1 148 ? -9.083  -4.659  7.382   1.00 0.00 ? 540 VAL A CG1  2  
ATOM 4974  C CG2  . VAL A 1 148 ? -8.328  -6.988  7.861   1.00 0.00 ? 540 VAL A CG2  2  
ATOM 4975  H H    . VAL A 1 148 ? -9.980  -8.498  6.370   1.00 0.00 ? 540 VAL A H    2  
ATOM 4976  H HA   . VAL A 1 148 ? -11.074 -6.473  7.987   1.00 0.00 ? 540 VAL A HA   2  
ATOM 4977  H HB   . VAL A 1 148 ? -8.832  -6.206  5.949   1.00 0.00 ? 540 VAL A HB   2  
ATOM 4978  H HG11 . VAL A 1 148 ? -9.722  -4.058  6.751   1.00 0.00 ? 540 VAL A HG11 2  
ATOM 4979  H HG12 . VAL A 1 148 ? -9.379  -4.549  8.413   1.00 0.00 ? 540 VAL A HG12 2  
ATOM 4980  H HG13 . VAL A 1 148 ? -8.060  -4.333  7.272   1.00 0.00 ? 540 VAL A HG13 2  
ATOM 4981  H HG21 . VAL A 1 148 ? -8.700  -6.942  8.874   1.00 0.00 ? 540 VAL A HG21 2  
ATOM 4982  H HG22 . VAL A 1 148 ? -8.362  -8.009  7.512   1.00 0.00 ? 540 VAL A HG22 2  
ATOM 4983  H HG23 . VAL A 1 148 ? -7.308  -6.631  7.835   1.00 0.00 ? 540 VAL A HG23 2  
ATOM 4984  N N    . ILE A 1 149 ? -11.467 -6.094  4.736   1.00 0.00 ? 541 ILE A N    2  
ATOM 4985  C CA   . ILE A 1 149 ? -12.259 -5.443  3.687   1.00 0.00 ? 541 ILE A CA   2  
ATOM 4986  C C    . ILE A 1 149 ? -13.744 -5.618  3.981   1.00 0.00 ? 541 ILE A C    2  
ATOM 4987  O O    . ILE A 1 149 ? -14.514 -4.666  3.926   1.00 0.00 ? 541 ILE A O    2  
ATOM 4988  C CB   . ILE A 1 149 ? -11.960 -6.074  2.292   1.00 0.00 ? 541 ILE A CB   2  
ATOM 4989  C CG1  . ILE A 1 149 ? -10.502 -5.819  1.855   1.00 0.00 ? 541 ILE A CG1  2  
ATOM 4990  C CG2  . ILE A 1 149 ? -12.954 -5.588  1.233   1.00 0.00 ? 541 ILE A CG2  2  
ATOM 4991  C CD1  . ILE A 1 149 ? -10.127 -6.455  0.529   1.00 0.00 ? 541 ILE A CD1  2  
ATOM 4992  H H    . ILE A 1 149 ? -10.840 -6.810  4.484   1.00 0.00 ? 541 ILE A H    2  
ATOM 4993  H HA   . ILE A 1 149 ? -12.011 -4.392  3.658   1.00 0.00 ? 541 ILE A HA   2  
ATOM 4994  H HB   . ILE A 1 149 ? -12.106 -7.136  2.425   1.00 0.00 ? 541 ILE A HB   2  
ATOM 4995  H HG12 . ILE A 1 149 ? -10.313 -4.760  1.764   1.00 0.00 ? 541 ILE A HG12 2  
ATOM 4996  H HG13 . ILE A 1 149 ? -9.843  -6.224  2.610   1.00 0.00 ? 541 ILE A HG13 2  
ATOM 4997  H HG21 . ILE A 1 149 ? -12.907 -4.512  1.158   1.00 0.00 ? 541 ILE A HG21 2  
ATOM 4998  H HG22 . ILE A 1 149 ? -12.720 -6.038  0.278   1.00 0.00 ? 541 ILE A HG22 2  
ATOM 4999  H HG23 . ILE A 1 149 ? -13.944 -5.886  1.545   1.00 0.00 ? 541 ILE A HG23 2  
ATOM 5000  H HD11 . ILE A 1 149 ? -10.765 -6.062  -0.249  1.00 0.00 ? 541 ILE A HD11 2  
ATOM 5001  H HD12 . ILE A 1 149 ? -9.098  -6.225  0.297   1.00 0.00 ? 541 ILE A HD12 2  
ATOM 5002  H HD13 . ILE A 1 149 ? -10.254 -7.526  0.594   1.00 0.00 ? 541 ILE A HD13 2  
ATOM 5003  N N    . THR A 1 150 ? -14.107 -6.830  4.342   1.00 0.00 ? 542 THR A N    2  
ATOM 5004  C CA   . THR A 1 150 ? -15.467 -7.183  4.660   1.00 0.00 ? 542 THR A CA   2  
ATOM 5005  C C    . THR A 1 150 ? -16.007 -6.324  5.825   1.00 0.00 ? 542 THR A C    2  
ATOM 5006  O O    . THR A 1 150 ? -17.163 -5.848  5.800   1.00 0.00 ? 542 THR A O    2  
ATOM 5007  C CB   . THR A 1 150 ? -15.510 -8.666  4.994   1.00 0.00 ? 542 THR A CB   2  
ATOM 5008  O OG1  . THR A 1 150 ? -15.142 -9.455  3.829   1.00 0.00 ? 542 THR A OG1  2  
ATOM 5009  C CG2  . THR A 1 150 ? -16.833 -9.131  5.561   1.00 0.00 ? 542 THR A CG2  2  
ATOM 5010  H H    . THR A 1 150 ? -13.413 -7.521  4.391   1.00 0.00 ? 542 THR A H    2  
ATOM 5011  H HA   . THR A 1 150 ? -16.058 -7.025  3.779   1.00 0.00 ? 542 THR A HA   2  
ATOM 5012  H HB   . THR A 1 150 ? -14.735 -8.736  5.727   1.00 0.00 ? 542 THR A HB   2  
ATOM 5013  H HG1  . THR A 1 150 ? -14.208 -9.278  3.629   1.00 0.00 ? 542 THR A HG1  2  
ATOM 5014  H HG21 . THR A 1 150 ? -17.039 -8.595  6.476   1.00 0.00 ? 542 THR A HG21 2  
ATOM 5015  H HG22 . THR A 1 150 ? -17.622 -8.963  4.843   1.00 0.00 ? 542 THR A HG22 2  
ATOM 5016  H HG23 . THR A 1 150 ? -16.744 -10.186 5.777   1.00 0.00 ? 542 THR A HG23 2  
ATOM 5017  N N    . ASN A 1 151 ? -15.171 -6.116  6.820   1.00 0.00 ? 543 ASN A N    2  
ATOM 5018  C CA   . ASN A 1 151 ? -15.517 -5.245  7.940   1.00 0.00 ? 543 ASN A CA   2  
ATOM 5019  C C    . ASN A 1 151 ? -15.605 -3.793  7.479   1.00 0.00 ? 543 ASN A C    2  
ATOM 5020  O O    . ASN A 1 151 ? -16.535 -3.078  7.832   1.00 0.00 ? 543 ASN A O    2  
ATOM 5021  C CB   . ASN A 1 151 ? -14.516 -5.371  9.103   1.00 0.00 ? 543 ASN A CB   2  
ATOM 5022  C CG   . ASN A 1 151 ? -14.562 -6.713  9.838   1.00 0.00 ? 543 ASN A CG   2  
ATOM 5023  O OD1  . ASN A 1 151 ? -14.916 -7.745  9.273   1.00 0.00 ? 543 ASN A OD1  2  
ATOM 5024  N ND2  . ASN A 1 151 ? -14.186 -6.706  11.102  1.00 0.00 ? 543 ASN A ND2  2  
ATOM 5025  H H    . ASN A 1 151 ? -14.300 -6.574  6.801   1.00 0.00 ? 543 ASN A H    2  
ATOM 5026  H HA   . ASN A 1 151 ? -16.496 -5.548  8.282   1.00 0.00 ? 543 ASN A HA   2  
ATOM 5027  H HB2  . ASN A 1 151 ? -13.517 -5.244  8.714   1.00 0.00 ? 543 ASN A HB2  2  
ATOM 5028  H HB3  . ASN A 1 151 ? -14.711 -4.584  9.817   1.00 0.00 ? 543 ASN A HB3  2  
ATOM 5029  H HD21 . ASN A 1 151 ? -13.907 -5.859  11.507  1.00 0.00 ? 543 ASN A HD21 2  
ATOM 5030  H HD22 . ASN A 1 151 ? -14.163 -7.552  11.602  1.00 0.00 ? 543 ASN A HD22 2  
ATOM 5031  N N    . LEU A 1 152 ? -14.642 -3.386  6.652   1.00 0.00 ? 544 LEU A N    2  
ATOM 5032  C CA   . LEU A 1 152 ? -14.552 -2.021  6.116   1.00 0.00 ? 544 LEU A CA   2  
ATOM 5033  C C    . LEU A 1 152 ? -15.793 -1.650  5.298   1.00 0.00 ? 544 LEU A C    2  
ATOM 5034  O O    . LEU A 1 152 ? -16.269 -0.528  5.387   1.00 0.00 ? 544 LEU A O    2  
ATOM 5035  C CB   . LEU A 1 152 ? -13.214 -1.849  5.316   1.00 0.00 ? 544 LEU A CB   2  
ATOM 5036  C CG   . LEU A 1 152 ? -12.895 -0.489  4.605   1.00 0.00 ? 544 LEU A CG   2  
ATOM 5037  C CD1  . LEU A 1 152 ? -13.621 -0.354  3.275   1.00 0.00 ? 544 LEU A CD1  2  
ATOM 5038  C CD2  . LEU A 1 152 ? -13.212 0.708   5.504   1.00 0.00 ? 544 LEU A CD2  2  
ATOM 5039  H H    . LEU A 1 152 ? -13.947 -4.031  6.394   1.00 0.00 ? 544 LEU A H    2  
ATOM 5040  H HA   . LEU A 1 152 ? -14.526 -1.360  6.970   1.00 0.00 ? 544 LEU A HA   2  
ATOM 5041  H HB2  . LEU A 1 152 ? -12.401 -2.052  5.996   1.00 0.00 ? 544 LEU A HB2  2  
ATOM 5042  H HB3  . LEU A 1 152 ? -13.196 -2.624  4.563   1.00 0.00 ? 544 LEU A HB3  2  
ATOM 5043  H HG   . LEU A 1 152 ? -11.839 -0.469  4.382   1.00 0.00 ? 544 LEU A HG   2  
ATOM 5044  H HD11 . LEU A 1 152 ? -14.686 -0.411  3.441   1.00 0.00 ? 544 LEU A HD11 2  
ATOM 5045  H HD12 . LEU A 1 152 ? -13.372 0.595   2.823   1.00 0.00 ? 544 LEU A HD12 2  
ATOM 5046  H HD13 . LEU A 1 152 ? -13.309 -1.157  2.623   1.00 0.00 ? 544 LEU A HD13 2  
ATOM 5047  H HD21 . LEU A 1 152 ? -12.641 0.662   6.418   1.00 0.00 ? 544 LEU A HD21 2  
ATOM 5048  H HD22 . LEU A 1 152 ? -12.979 1.622   4.978   1.00 0.00 ? 544 LEU A HD22 2  
ATOM 5049  H HD23 . LEU A 1 152 ? -14.265 0.695   5.745   1.00 0.00 ? 544 LEU A HD23 2  
ATOM 5050  N N    . GLU A 1 153 ? -16.330 -2.604  4.544   1.00 0.00 ? 545 GLU A N    2  
ATOM 5051  C CA   . GLU A 1 153 ? -17.533 -2.370  3.730   1.00 0.00 ? 545 GLU A CA   2  
ATOM 5052  C C    . GLU A 1 153 ? -18.710 -1.911  4.594   1.00 0.00 ? 545 GLU A C    2  
ATOM 5053  O O    . GLU A 1 153 ? -19.539 -1.105  4.165   1.00 0.00 ? 545 GLU A O    2  
ATOM 5054  C CB   . GLU A 1 153 ? -17.944 -3.640  2.973   1.00 0.00 ? 545 GLU A CB   2  
ATOM 5055  C CG   . GLU A 1 153 ? -16.942 -4.127  1.940   1.00 0.00 ? 545 GLU A CG   2  
ATOM 5056  C CD   . GLU A 1 153 ? -16.664 -3.115  0.852   1.00 0.00 ? 545 GLU A CD   2  
ATOM 5057  O OE1  . GLU A 1 153 ? -15.598 -3.182  0.218   1.00 0.00 ? 545 GLU A OE1  2  
ATOM 5058  O OE2  . GLU A 1 153 ? -17.513 -2.236  0.584   1.00 0.00 ? 545 GLU A OE2  2  
ATOM 5059  H H    . GLU A 1 153 ? -15.882 -3.480  4.509   1.00 0.00 ? 545 GLU A H    2  
ATOM 5060  H HA   . GLU A 1 153 ? -17.305 -1.598  3.012   1.00 0.00 ? 545 GLU A HA   2  
ATOM 5061  H HB2  . GLU A 1 153 ? -18.090 -4.433  3.691   1.00 0.00 ? 545 GLU A HB2  2  
ATOM 5062  H HB3  . GLU A 1 153 ? -18.883 -3.450  2.475   1.00 0.00 ? 545 GLU A HB3  2  
ATOM 5063  H HG2  . GLU A 1 153 ? -16.011 -4.349  2.442   1.00 0.00 ? 545 GLU A HG2  2  
ATOM 5064  H HG3  . GLU A 1 153 ? -17.323 -5.029  1.485   1.00 0.00 ? 545 GLU A HG3  2  
ATOM 5065  N N    . HIS A 1 154 ? -18.756 -2.399  5.804   1.00 0.00 ? 546 HIS A N    2  
ATOM 5066  C CA   . HIS A 1 154 ? -19.838 -2.083  6.715   1.00 0.00 ? 546 HIS A CA   2  
ATOM 5067  C C    . HIS A 1 154 ? -19.448 -0.940  7.645   1.00 0.00 ? 546 HIS A C    2  
ATOM 5068  O O    . HIS A 1 154 ? -20.312 -0.268  8.210   1.00 0.00 ? 546 HIS A O    2  
ATOM 5069  C CB   . HIS A 1 154 ? -20.212 -3.320  7.543   1.00 0.00 ? 546 HIS A CB   2  
ATOM 5070  C CG   . HIS A 1 154 ? -20.762 -4.465  6.738   1.00 0.00 ? 546 HIS A CG   2  
ATOM 5071  N ND1  . HIS A 1 154 ? -19.990 -5.479  6.201   1.00 0.00 ? 546 HIS A ND1  2  
ATOM 5072  C CD2  . HIS A 1 154 ? -22.042 -4.752  6.394   1.00 0.00 ? 546 HIS A CD2  2  
ATOM 5073  C CE1  . HIS A 1 154 ? -20.802 -6.325  5.568   1.00 0.00 ? 546 HIS A CE1  2  
ATOM 5074  N NE2  . HIS A 1 154 ? -22.064 -5.933  5.652   1.00 0.00 ? 546 HIS A NE2  2  
ATOM 5075  H H    . HIS A 1 154 ? -18.031 -2.986  6.105   1.00 0.00 ? 546 HIS A H    2  
ATOM 5076  H HA   . HIS A 1 154 ? -20.697 -1.788  6.132   1.00 0.00 ? 546 HIS A HA   2  
ATOM 5077  H HB2  . HIS A 1 154 ? -19.333 -3.679  8.058   1.00 0.00 ? 546 HIS A HB2  2  
ATOM 5078  H HB3  . HIS A 1 154 ? -20.957 -3.035  8.270   1.00 0.00 ? 546 HIS A HB3  2  
ATOM 5079  H HD1  . HIS A 1 154 ? -19.010 -5.571  6.254   1.00 0.00 ? 546 HIS A HD1  2  
ATOM 5080  H HD2  . HIS A 1 154 ? -22.914 -4.167  6.646   1.00 0.00 ? 546 HIS A HD2  2  
ATOM 5081  H HE1  . HIS A 1 154 ? -20.473 -7.216  5.053   1.00 0.00 ? 546 HIS A HE1  2  
ATOM 5082  N N    . HIS A 1 155 ? -18.139 -0.732  7.785   1.00 0.00 ? 547 HIS A N    2  
ATOM 5083  C CA   . HIS A 1 155 ? -17.537 0.255   8.702   1.00 0.00 ? 547 HIS A CA   2  
ATOM 5084  C C    . HIS A 1 155 ? -17.816 -0.127  10.158  1.00 0.00 ? 547 HIS A C    2  
ATOM 5085  O O    . HIS A 1 155 ? -18.547 -1.097  10.451  1.00 0.00 ? 547 HIS A O    2  
ATOM 5086  C CB   . HIS A 1 155 ? -18.035 1.708   8.460   1.00 0.00 ? 547 HIS A CB   2  
ATOM 5087  C CG   . HIS A 1 155 ? -17.740 2.302   7.112   1.00 0.00 ? 547 HIS A CG   2  
ATOM 5088  N ND1  . HIS A 1 155 ? -18.710 2.803   6.279   1.00 0.00 ? 547 HIS A ND1  2  
ATOM 5089  C CD2  . HIS A 1 155 ? -16.557 2.553   6.501   1.00 0.00 ? 547 HIS A CD2  2  
ATOM 5090  C CE1  . HIS A 1 155 ? -18.114 3.336   5.219   1.00 0.00 ? 547 HIS A CE1  2  
ATOM 5091  N NE2  . HIS A 1 155 ? -16.798 3.213   5.295   1.00 0.00 ? 547 HIS A NE2  2  
ATOM 5092  H H    . HIS A 1 155 ? -17.536 -1.283  7.245   1.00 0.00 ? 547 HIS A H    2  
ATOM 5093  H HA   . HIS A 1 155 ? -16.469 0.217   8.547   1.00 0.00 ? 547 HIS A HA   2  
ATOM 5094  H HB2  . HIS A 1 155 ? -19.108 1.724   8.581   1.00 0.00 ? 547 HIS A HB2  2  
ATOM 5095  H HB3  . HIS A 1 155 ? -17.598 2.349   9.212   1.00 0.00 ? 547 HIS A HB3  2  
ATOM 5096  H HD1  . HIS A 1 155 ? -19.680 2.767   6.429   1.00 0.00 ? 547 HIS A HD1  2  
ATOM 5097  H HD2  . HIS A 1 155 ? -15.580 2.290   6.878   1.00 0.00 ? 547 HIS A HD2  2  
ATOM 5098  H HE1  . HIS A 1 155 ? -18.634 3.816   4.403   1.00 0.00 ? 547 HIS A HE1  2  
ATOM 5099  N N    . HIS A 1 156 ? -17.242 0.614   11.078  1.00 0.00 ? 548 HIS A N    2  
ATOM 5100  C CA   . HIS A 1 156 ? -17.531 0.414   12.483  1.00 0.00 ? 548 HIS A CA   2  
ATOM 5101  C C    . HIS A 1 156 ? -18.829 1.145   12.785  1.00 0.00 ? 548 HIS A C    2  
ATOM 5102  O O    . HIS A 1 156 ? -18.831 2.258   13.273  1.00 0.00 ? 548 HIS A O    2  
ATOM 5103  C CB   . HIS A 1 156 ? -16.393 0.924   13.395  1.00 0.00 ? 548 HIS A CB   2  
ATOM 5104  C CG   . HIS A 1 156 ? -15.059 0.259   13.175  1.00 0.00 ? 548 HIS A CG   2  
ATOM 5105  N ND1  . HIS A 1 156 ? -13.952 0.906   12.662  1.00 0.00 ? 548 HIS A ND1  2  
ATOM 5106  C CD2  . HIS A 1 156 ? -14.658 -1.009  13.439  1.00 0.00 ? 548 HIS A CD2  2  
ATOM 5107  C CE1  . HIS A 1 156 ? -12.940 0.039   12.628  1.00 0.00 ? 548 HIS A CE1  2  
ATOM 5108  N NE2  . HIS A 1 156 ? -13.310 -1.144  13.091  1.00 0.00 ? 548 HIS A NE2  2  
ATOM 5109  H H    . HIS A 1 156 ? -16.616 1.320   10.817  1.00 0.00 ? 548 HIS A H    2  
ATOM 5110  H HA   . HIS A 1 156 ? -17.688 -0.645  12.637  1.00 0.00 ? 548 HIS A HA   2  
ATOM 5111  H HB2  . HIS A 1 156 ? -16.263 1.983   13.229  1.00 0.00 ? 548 HIS A HB2  2  
ATOM 5112  H HB3  . HIS A 1 156 ? -16.678 0.765   14.426  1.00 0.00 ? 548 HIS A HB3  2  
ATOM 5113  H HD1  . HIS A 1 156 ? -13.904 1.847   12.385  1.00 0.00 ? 548 HIS A HD1  2  
ATOM 5114  H HD2  . HIS A 1 156 ? -15.272 -1.795  13.853  1.00 0.00 ? 548 HIS A HD2  2  
ATOM 5115  H HE1  . HIS A 1 156 ? -11.948 0.274   12.271  1.00 0.00 ? 548 HIS A HE1  2  
ATOM 5116  N N    . HIS A 1 157 ? -19.917 0.536   12.403  1.00 0.00 ? 549 HIS A N    2  
ATOM 5117  C CA   . HIS A 1 157 ? -21.242 1.148   12.504  1.00 0.00 ? 549 HIS A CA   2  
ATOM 5118  C C    . HIS A 1 157 ? -21.960 0.716   13.780  1.00 0.00 ? 549 HIS A C    2  
ATOM 5119  O O    . HIS A 1 157 ? -23.160 0.907   13.928  1.00 0.00 ? 549 HIS A O    2  
ATOM 5120  C CB   . HIS A 1 157 ? -22.086 0.782   11.251  1.00 0.00 ? 549 HIS A CB   2  
ATOM 5121  C CG   . HIS A 1 157 ? -22.392 -0.691  11.097  1.00 0.00 ? 549 HIS A CG   2  
ATOM 5122  N ND1  . HIS A 1 157 ? -21.540 -1.604  10.516  1.00 0.00 ? 549 HIS A ND1  2  
ATOM 5123  C CD2  . HIS A 1 157 ? -23.479 -1.394  11.490  1.00 0.00 ? 549 HIS A CD2  2  
ATOM 5124  C CE1  . HIS A 1 157 ? -22.117 -2.806  10.578  1.00 0.00 ? 549 HIS A CE1  2  
ATOM 5125  N NE2  . HIS A 1 157 ? -23.302 -2.734  11.163  1.00 0.00 ? 549 HIS A NE2  2  
ATOM 5126  H H    . HIS A 1 157 ? -19.830 -0.356  12.007  1.00 0.00 ? 549 HIS A H    2  
ATOM 5127  H HA   . HIS A 1 157 ? -21.108 2.219   12.523  1.00 0.00 ? 549 HIS A HA   2  
ATOM 5128  H HB2  . HIS A 1 157 ? -23.032 1.299   11.298  1.00 0.00 ? 549 HIS A HB2  2  
ATOM 5129  H HB3  . HIS A 1 157 ? -21.558 1.104   10.366  1.00 0.00 ? 549 HIS A HB3  2  
ATOM 5130  H HD1  . HIS A 1 157 ? -20.676 -1.401  10.087  1.00 0.00 ? 549 HIS A HD1  2  
ATOM 5131  H HD2  . HIS A 1 157 ? -24.350 -0.987  11.980  1.00 0.00 ? 549 HIS A HD2  2  
ATOM 5132  H HE1  . HIS A 1 157 ? -21.677 -3.719  10.204  1.00 0.00 ? 549 HIS A HE1  2  
ATOM 5133  N N    . HIS A 1 158 ? -21.221 0.152   14.689  1.00 0.00 ? 550 HIS A N    2  
ATOM 5134  C CA   . HIS A 1 158 ? -21.790 -0.353  15.919  1.00 0.00 ? 550 HIS A CA   2  
ATOM 5135  C C    . HIS A 1 158 ? -20.783 -0.179  17.038  1.00 0.00 ? 550 HIS A C    2  
ATOM 5136  O O    . HIS A 1 158 ? -21.056 0.464   18.048  1.00 0.00 ? 550 HIS A O    2  
ATOM 5137  C CB   . HIS A 1 158 ? -22.193 -1.846  15.747  1.00 0.00 ? 550 HIS A CB   2  
ATOM 5138  C CG   . HIS A 1 158 ? -22.806 -2.484  16.970  1.00 0.00 ? 550 HIS A CG   2  
ATOM 5139  N ND1  . HIS A 1 158 ? -22.465 -3.738  17.437  1.00 0.00 ? 550 HIS A ND1  2  
ATOM 5140  C CD2  . HIS A 1 158 ? -23.762 -2.020  17.814  1.00 0.00 ? 550 HIS A CD2  2  
ATOM 5141  C CE1  . HIS A 1 158 ? -23.195 -3.989  18.522  1.00 0.00 ? 550 HIS A CE1  2  
ATOM 5142  N NE2  . HIS A 1 158 ? -24.004 -2.977  18.797  1.00 0.00 ? 550 HIS A NE2  2  
ATOM 5143  H H    . HIS A 1 158 ? -20.254 0.124   14.541  1.00 0.00 ? 550 HIS A H    2  
ATOM 5144  H HA   . HIS A 1 158 ? -22.673 0.226   16.146  1.00 0.00 ? 550 HIS A HA   2  
ATOM 5145  H HB2  . HIS A 1 158 ? -22.912 -1.925  14.945  1.00 0.00 ? 550 HIS A HB2  2  
ATOM 5146  H HB3  . HIS A 1 158 ? -21.312 -2.413  15.482  1.00 0.00 ? 550 HIS A HB3  2  
ATOM 5147  H HD1  . HIS A 1 158 ? -21.843 -4.380  17.026  1.00 0.00 ? 550 HIS A HD1  2  
ATOM 5148  H HD2  . HIS A 1 158 ? -24.262 -1.065  17.743  1.00 0.00 ? 550 HIS A HD2  2  
ATOM 5149  H HE1  . HIS A 1 158 ? -23.133 -4.893  19.110  1.00 0.00 ? 550 HIS A HE1  2  
ATOM 5150  N N    . HIS A 1 159 ? -19.628 -0.731  16.838  1.00 0.00 ? 551 HIS A N    2  
ATOM 5151  C CA   . HIS A 1 159 ? -18.562 -0.658  17.794  1.00 0.00 ? 551 HIS A CA   2  
ATOM 5152  C C    . HIS A 1 159 ? -17.390 0.081   17.191  1.00 0.00 ? 551 HIS A C    2  
ATOM 5153  O O    . HIS A 1 159 ? -16.643 -0.509  16.412  1.00 0.00 ? 551 HIS A O    2  
ATOM 5154  C CB   . HIS A 1 159 ? -18.177 -2.069  18.341  1.00 0.00 ? 551 HIS A CB   2  
ATOM 5155  C CG   . HIS A 1 159 ? -17.987 -3.149  17.295  1.00 0.00 ? 551 HIS A CG   2  
ATOM 5156  N ND1  . HIS A 1 159 ? -16.783 -3.473  16.717  1.00 0.00 ? 551 HIS A ND1  2  
ATOM 5157  C CD2  . HIS A 1 159 ? -18.898 -3.984  16.742  1.00 0.00 ? 551 HIS A CD2  2  
ATOM 5158  C CE1  . HIS A 1 159 ? -16.988 -4.466  15.852  1.00 0.00 ? 551 HIS A CE1  2  
ATOM 5159  N NE2  . HIS A 1 159 ? -18.263 -4.818  15.828  1.00 0.00 ? 551 HIS A NE2  2  
ATOM 5160  H H    . HIS A 1 159 ? -19.429 -1.209  16.008  1.00 0.00 ? 551 HIS A H    2  
ATOM 5161  H HA   . HIS A 1 159 ? -18.934 -0.058  18.611  1.00 0.00 ? 551 HIS A HA   2  
ATOM 5162  H HB2  . HIS A 1 159 ? -17.247 -1.987  18.885  1.00 0.00 ? 551 HIS A HB2  2  
ATOM 5163  H HB3  . HIS A 1 159 ? -18.947 -2.395  19.025  1.00 0.00 ? 551 HIS A HB3  2  
ATOM 5164  H HD1  . HIS A 1 159 ? -15.919 -3.035  16.893  1.00 0.00 ? 551 HIS A HD1  2  
ATOM 5165  H HD2  . HIS A 1 159 ? -19.954 -4.006  16.966  1.00 0.00 ? 551 HIS A HD2  2  
ATOM 5166  H HE1  . HIS A 1 159 ? -16.217 -4.921  15.247  1.00 0.00 ? 551 HIS A HE1  2  
ATOM 5167  N N    . MET A 1 1   ? 26.658  1.444   12.416  1.00 0.00 ? 393 MET A N    3  
ATOM 5168  C CA   . MET A 1 1   ? 25.752  0.851   13.387  1.00 0.00 ? 393 MET A CA   3  
ATOM 5169  C C    . MET A 1 1   ? 24.320  1.305   13.142  1.00 0.00 ? 393 MET A C    3  
ATOM 5170  O O    . MET A 1 1   ? 23.434  0.483   12.909  1.00 0.00 ? 393 MET A O    3  
ATOM 5171  C CB   . MET A 1 1   ? 26.193  1.170   14.820  1.00 0.00 ? 393 MET A CB   3  
ATOM 5172  C CG   . MET A 1 1   ? 25.272  0.600   15.888  1.00 0.00 ? 393 MET A CG   3  
ATOM 5173  S SD   . MET A 1 1   ? 25.023  -1.196  15.748  1.00 0.00 ? 393 MET A SD   3  
ATOM 5174  C CE   . MET A 1 1   ? 26.696  -1.811  15.950  1.00 0.00 ? 393 MET A CE   3  
ATOM 5175  H H1   . MET A 1 1   ? 26.356  1.186   11.455  1.00 0.00 ? 393 MET A H1   3  
ATOM 5176  H H2   . MET A 1 1   ? 26.706  2.479   12.473  1.00 0.00 ? 393 MET A H2   3  
ATOM 5177  H H3   . MET A 1 1   ? 27.618  1.063   12.535  1.00 0.00 ? 393 MET A H3   3  
ATOM 5178  H HA   . MET A 1 1   ? 25.784  -0.220  13.241  1.00 0.00 ? 393 MET A HA   3  
ATOM 5179  H HB2  . MET A 1 1   ? 27.185  0.781   14.984  1.00 0.00 ? 393 MET A HB2  3  
ATOM 5180  H HB3  . MET A 1 1   ? 26.220  2.243   14.939  1.00 0.00 ? 393 MET A HB3  3  
ATOM 5181  H HG2  . MET A 1 1   ? 25.696  0.814   16.857  1.00 0.00 ? 393 MET A HG2  3  
ATOM 5182  H HG3  . MET A 1 1   ? 24.313  1.089   15.803  1.00 0.00 ? 393 MET A HG3  3  
ATOM 5183  H HE1  . MET A 1 1   ? 27.087  -1.478  16.900  1.00 0.00 ? 393 MET A HE1  3  
ATOM 5184  H HE2  . MET A 1 1   ? 26.685  -2.891  15.925  1.00 0.00 ? 393 MET A HE2  3  
ATOM 5185  H HE3  . MET A 1 1   ? 27.321  -1.435  15.154  1.00 0.00 ? 393 MET A HE3  3  
ATOM 5186  N N    . SER A 1 2   ? 24.080  2.592   13.195  1.00 0.00 ? 394 SER A N    3  
ATOM 5187  C CA   . SER A 1 2   ? 22.769  3.101   12.964  1.00 0.00 ? 394 SER A CA   3  
ATOM 5188  C C    . SER A 1 2   ? 22.825  4.153   11.878  1.00 0.00 ? 394 SER A C    3  
ATOM 5189  O O    . SER A 1 2   ? 23.508  5.175   12.008  1.00 0.00 ? 394 SER A O    3  
ATOM 5190  C CB   . SER A 1 2   ? 22.171  3.665   14.259  1.00 0.00 ? 394 SER A CB   3  
ATOM 5191  O OG   . SER A 1 2   ? 20.817  4.078   14.081  1.00 0.00 ? 394 SER A OG   3  
ATOM 5192  H H    . SER A 1 2   ? 24.785  3.248   13.385  1.00 0.00 ? 394 SER A H    3  
ATOM 5193  H HA   . SER A 1 2   ? 22.157  2.278   12.623  1.00 0.00 ? 394 SER A HA   3  
ATOM 5194  H HB2  . SER A 1 2   ? 22.199  2.898   15.019  1.00 0.00 ? 394 SER A HB2  3  
ATOM 5195  H HB3  . SER A 1 2   ? 22.760  4.512   14.576  1.00 0.00 ? 394 SER A HB3  3  
ATOM 5196  H HG   . SER A 1 2   ? 20.753  4.997   14.374  1.00 0.00 ? 394 SER A HG   3  
ATOM 5197  N N    . VAL A 1 3   ? 22.166  3.872   10.798  1.00 0.00 ? 395 VAL A N    3  
ATOM 5198  C CA   . VAL A 1 3   ? 22.087  4.782   9.685   1.00 0.00 ? 395 VAL A CA   3  
ATOM 5199  C C    . VAL A 1 3   ? 20.690  4.736   9.063   1.00 0.00 ? 395 VAL A C    3  
ATOM 5200  O O    . VAL A 1 3   ? 20.179  5.760   8.596   1.00 0.00 ? 395 VAL A O    3  
ATOM 5201  C CB   . VAL A 1 3   ? 23.194  4.489   8.615   1.00 0.00 ? 395 VAL A CB   3  
ATOM 5202  C CG1  . VAL A 1 3   ? 23.130  3.059   8.117   1.00 0.00 ? 395 VAL A CG1  3  
ATOM 5203  C CG2  . VAL A 1 3   ? 23.118  5.466   7.448   1.00 0.00 ? 395 VAL A CG2  3  
ATOM 5204  H H    . VAL A 1 3   ? 21.721  2.999   10.753  1.00 0.00 ? 395 VAL A H    3  
ATOM 5205  H HA   . VAL A 1 3   ? 22.243  5.775   10.081  1.00 0.00 ? 395 VAL A HA   3  
ATOM 5206  H HB   . VAL A 1 3   ? 24.153  4.614   9.097   1.00 0.00 ? 395 VAL A HB   3  
ATOM 5207  H HG11 . VAL A 1 3   ? 22.150  2.863   7.712   1.00 0.00 ? 395 VAL A HG11 3  
ATOM 5208  H HG12 . VAL A 1 3   ? 23.874  2.919   7.348   1.00 0.00 ? 395 VAL A HG12 3  
ATOM 5209  H HG13 . VAL A 1 3   ? 23.328  2.382   8.936   1.00 0.00 ? 395 VAL A HG13 3  
ATOM 5210  H HG21 . VAL A 1 3   ? 22.151  5.382   6.974   1.00 0.00 ? 395 VAL A HG21 3  
ATOM 5211  H HG22 . VAL A 1 3   ? 23.253  6.474   7.811   1.00 0.00 ? 395 VAL A HG22 3  
ATOM 5212  H HG23 . VAL A 1 3   ? 23.891  5.234   6.731   1.00 0.00 ? 395 VAL A HG23 3  
ATOM 5213  N N    . SER A 1 4   ? 20.064  3.541   9.101   1.00 0.00 ? 396 SER A N    3  
ATOM 5214  C CA   . SER A 1 4   ? 18.746  3.312   8.542   1.00 0.00 ? 396 SER A CA   3  
ATOM 5215  C C    . SER A 1 4   ? 18.816  3.558   7.017   1.00 0.00 ? 396 SER A C    3  
ATOM 5216  O O    . SER A 1 4   ? 17.880  4.083   6.392   1.00 0.00 ? 396 SER A O    3  
ATOM 5217  C CB   . SER A 1 4   ? 17.702  4.235   9.252   1.00 0.00 ? 396 SER A CB   3  
ATOM 5218  O OG   . SER A 1 4   ? 16.357  3.930   8.886   1.00 0.00 ? 396 SER A OG   3  
ATOM 5219  H H    . SER A 1 4   ? 20.508  2.771   9.515   1.00 0.00 ? 396 SER A H    3  
ATOM 5220  H HA   . SER A 1 4   ? 18.495  2.276   8.713   1.00 0.00 ? 396 SER A HA   3  
ATOM 5221  H HB2  . SER A 1 4   ? 17.797  4.122   10.322  1.00 0.00 ? 396 SER A HB2  3  
ATOM 5222  H HB3  . SER A 1 4   ? 17.910  5.260   8.985   1.00 0.00 ? 396 SER A HB3  3  
ATOM 5223  H HG   . SER A 1 4   ? 16.318  2.976   8.739   1.00 0.00 ? 396 SER A HG   3  
ATOM 5224  N N    . ASN A 1 5   ? 19.928  3.128   6.417   1.00 0.00 ? 397 ASN A N    3  
ATOM 5225  C CA   . ASN A 1 5   ? 20.148  3.337   5.002   1.00 0.00 ? 397 ASN A CA   3  
ATOM 5226  C C    . ASN A 1 5   ? 19.180  2.483   4.215   1.00 0.00 ? 397 ASN A C    3  
ATOM 5227  O O    . ASN A 1 5   ? 18.799  1.387   4.650   1.00 0.00 ? 397 ASN A O    3  
ATOM 5228  C CB   . ASN A 1 5   ? 21.626  3.076   4.581   1.00 0.00 ? 397 ASN A CB   3  
ATOM 5229  C CG   . ASN A 1 5   ? 22.041  1.617   4.541   1.00 0.00 ? 397 ASN A CG   3  
ATOM 5230  O OD1  . ASN A 1 5   ? 22.433  1.046   5.545   1.00 0.00 ? 397 ASN A OD1  3  
ATOM 5231  N ND2  . ASN A 1 5   ? 22.038  1.027   3.364   1.00 0.00 ? 397 ASN A ND2  3  
ATOM 5232  H H    . ASN A 1 5   ? 20.586  2.628   6.944   1.00 0.00 ? 397 ASN A H    3  
ATOM 5233  H HA   . ASN A 1 5   ? 19.901  4.370   4.811   1.00 0.00 ? 397 ASN A HA   3  
ATOM 5234  H HB2  . ASN A 1 5   ? 21.792  3.472   3.591   1.00 0.00 ? 397 ASN A HB2  3  
ATOM 5235  H HB3  . ASN A 1 5   ? 22.277  3.594   5.272   1.00 0.00 ? 397 ASN A HB3  3  
ATOM 5236  H HD21 . ASN A 1 5   ? 21.776  1.542   2.571   1.00 0.00 ? 397 ASN A HD21 3  
ATOM 5237  H HD22 . ASN A 1 5   ? 22.307  0.086   3.321   1.00 0.00 ? 397 ASN A HD22 3  
ATOM 5238  N N    . LYS A 1 6   ? 18.778  2.972   3.087   1.00 0.00 ? 398 LYS A N    3  
ATOM 5239  C CA   . LYS A 1 6   ? 17.769  2.310   2.309   1.00 0.00 ? 398 LYS A CA   3  
ATOM 5240  C C    . LYS A 1 6   ? 18.255  2.125   0.910   1.00 0.00 ? 398 LYS A C    3  
ATOM 5241  O O    . LYS A 1 6   ? 19.095  2.892   0.419   1.00 0.00 ? 398 LYS A O    3  
ATOM 5242  C CB   . LYS A 1 6   ? 16.388  3.030   2.327   1.00 0.00 ? 398 LYS A CB   3  
ATOM 5243  C CG   . LYS A 1 6   ? 16.290  4.337   1.539   1.00 0.00 ? 398 LYS A CG   3  
ATOM 5244  C CD   . LYS A 1 6   ? 17.154  5.451   2.081   1.00 0.00 ? 398 LYS A CD   3  
ATOM 5245  C CE   . LYS A 1 6   ? 16.558  6.177   3.298   1.00 0.00 ? 398 LYS A CE   3  
ATOM 5246  N NZ   . LYS A 1 6   ? 16.321  5.326   4.494   1.00 0.00 ? 398 LYS A NZ   3  
ATOM 5247  H H    . LYS A 1 6   ? 19.248  3.757   2.732   1.00 0.00 ? 398 LYS A H    3  
ATOM 5248  H HA   . LYS A 1 6   ? 17.650  1.338   2.759   1.00 0.00 ? 398 LYS A HA   3  
ATOM 5249  H HB2  . LYS A 1 6   ? 15.656  2.355   1.910   1.00 0.00 ? 398 LYS A HB2  3  
ATOM 5250  H HB3  . LYS A 1 6   ? 16.120  3.228   3.354   1.00 0.00 ? 398 LYS A HB3  3  
ATOM 5251  H HG2  . LYS A 1 6   ? 16.606  4.131   0.526   1.00 0.00 ? 398 LYS A HG2  3  
ATOM 5252  H HG3  . LYS A 1 6   ? 15.258  4.654   1.528   1.00 0.00 ? 398 LYS A HG3  3  
ATOM 5253  H HD2  . LYS A 1 6   ? 18.072  4.969   2.367   1.00 0.00 ? 398 LYS A HD2  3  
ATOM 5254  H HD3  . LYS A 1 6   ? 17.350  6.149   1.282   1.00 0.00 ? 398 LYS A HD3  3  
ATOM 5255  H HE2  . LYS A 1 6   ? 17.241  6.959   3.587   1.00 0.00 ? 398 LYS A HE2  3  
ATOM 5256  H HE3  . LYS A 1 6   ? 15.622  6.609   2.983   1.00 0.00 ? 398 LYS A HE3  3  
ATOM 5257  H HZ1  . LYS A 1 6   ? 17.176  4.873   4.881   1.00 0.00 ? 398 LYS A HZ1  3  
ATOM 5258  H HZ2  . LYS A 1 6   ? 15.956  5.924   5.262   1.00 0.00 ? 398 LYS A HZ2  3  
ATOM 5259  H HZ3  . LYS A 1 6   ? 15.596  4.598   4.322   1.00 0.00 ? 398 LYS A HZ3  3  
ATOM 5260  N N    . LEU A 1 7   ? 17.742  1.151   0.287   1.00 0.00 ? 399 LEU A N    3  
ATOM 5261  C CA   . LEU A 1 7   ? 18.149  0.752   -1.028  1.00 0.00 ? 399 LEU A CA   3  
ATOM 5262  C C    . LEU A 1 7   ? 17.061  1.176   -2.015  1.00 0.00 ? 399 LEU A C    3  
ATOM 5263  O O    . LEU A 1 7   ? 15.885  0.983   -1.743  1.00 0.00 ? 399 LEU A O    3  
ATOM 5264  C CB   . LEU A 1 7   ? 18.352  -0.804  -1.084  1.00 0.00 ? 399 LEU A CB   3  
ATOM 5265  C CG   . LEU A 1 7   ? 19.308  -1.472  -0.037  1.00 0.00 ? 399 LEU A CG   3  
ATOM 5266  C CD1  . LEU A 1 7   ? 18.674  -1.595  1.333   1.00 0.00 ? 399 LEU A CD1  3  
ATOM 5267  C CD2  . LEU A 1 7   ? 19.785  -2.825  -0.510  1.00 0.00 ? 399 LEU A CD2  3  
ATOM 5268  H H    . LEU A 1 7   ? 17.010  0.667   0.731   1.00 0.00 ? 399 LEU A H    3  
ATOM 5269  H HA   . LEU A 1 7   ? 19.081  1.242   -1.271  1.00 0.00 ? 399 LEU A HA   3  
ATOM 5270  H HB2  . LEU A 1 7   ? 17.383  -1.250  -0.913  1.00 0.00 ? 399 LEU A HB2  3  
ATOM 5271  H HB3  . LEU A 1 7   ? 18.690  -1.069  -2.076  1.00 0.00 ? 399 LEU A HB3  3  
ATOM 5272  H HG   . LEU A 1 7   ? 20.175  -0.857  0.129   1.00 0.00 ? 399 LEU A HG   3  
ATOM 5273  H HD11 . LEU A 1 7   ? 18.416  -0.612  1.695   1.00 0.00 ? 399 LEU A HD11 3  
ATOM 5274  H HD12 . LEU A 1 7   ? 17.785  -2.206  1.272   1.00 0.00 ? 399 LEU A HD12 3  
ATOM 5275  H HD13 . LEU A 1 7   ? 19.379  -2.051  2.013   1.00 0.00 ? 399 LEU A HD13 3  
ATOM 5276  H HD21 . LEU A 1 7   ? 20.330  -2.719  -1.436  1.00 0.00 ? 399 LEU A HD21 3  
ATOM 5277  H HD22 . LEU A 1 7   ? 20.433  -3.227  0.256   1.00 0.00 ? 399 LEU A HD22 3  
ATOM 5278  H HD23 . LEU A 1 7   ? 18.940  -3.482  -0.648  1.00 0.00 ? 399 LEU A HD23 3  
ATOM 5279  N N    . LEU A 1 8   ? 17.438  1.805   -3.120  1.00 0.00 ? 400 LEU A N    3  
ATOM 5280  C CA   . LEU A 1 8   ? 16.456  2.201   -4.131  1.00 0.00 ? 400 LEU A CA   3  
ATOM 5281  C C    . LEU A 1 8   ? 15.952  0.940   -4.814  1.00 0.00 ? 400 LEU A C    3  
ATOM 5282  O O    . LEU A 1 8   ? 16.752  0.099   -5.246  1.00 0.00 ? 400 LEU A O    3  
ATOM 5283  C CB   . LEU A 1 8   ? 17.088  3.217   -5.138  1.00 0.00 ? 400 LEU A CB   3  
ATOM 5284  C CG   . LEU A 1 8   ? 16.182  3.868   -6.239  1.00 0.00 ? 400 LEU A CG   3  
ATOM 5285  C CD1  . LEU A 1 8   ? 15.827  2.905   -7.371  1.00 0.00 ? 400 LEU A CD1  3  
ATOM 5286  C CD2  . LEU A 1 8   ? 14.915  4.460   -5.628  1.00 0.00 ? 400 LEU A CD2  3  
ATOM 5287  H H    . LEU A 1 8   ? 18.385  2.005   -3.271  1.00 0.00 ? 400 LEU A H    3  
ATOM 5288  H HA   . LEU A 1 8   ? 15.628  2.663   -3.615  1.00 0.00 ? 400 LEU A HA   3  
ATOM 5289  H HB2  . LEU A 1 8   ? 17.511  4.024   -4.560  1.00 0.00 ? 400 LEU A HB2  3  
ATOM 5290  H HB3  . LEU A 1 8   ? 17.900  2.710   -5.639  1.00 0.00 ? 400 LEU A HB3  3  
ATOM 5291  H HG   . LEU A 1 8   ? 16.738  4.680   -6.687  1.00 0.00 ? 400 LEU A HG   3  
ATOM 5292  H HD11 . LEU A 1 8   ? 15.299  2.055   -6.965  1.00 0.00 ? 400 LEU A HD11 3  
ATOM 5293  H HD12 . LEU A 1 8   ? 15.198  3.410   -8.090  1.00 0.00 ? 400 LEU A HD12 3  
ATOM 5294  H HD13 . LEU A 1 8   ? 16.729  2.570   -7.860  1.00 0.00 ? 400 LEU A HD13 3  
ATOM 5295  H HD21 . LEU A 1 8   ? 15.188  5.205   -4.896  1.00 0.00 ? 400 LEU A HD21 3  
ATOM 5296  H HD22 . LEU A 1 8   ? 14.320  4.917   -6.405  1.00 0.00 ? 400 LEU A HD22 3  
ATOM 5297  H HD23 . LEU A 1 8   ? 14.344  3.678   -5.149  1.00 0.00 ? 400 LEU A HD23 3  
ATOM 5298  N N    . ALA A 1 9   ? 14.656  0.790   -4.885  1.00 0.00 ? 401 ALA A N    3  
ATOM 5299  C CA   . ALA A 1 9   ? 14.093  -0.407  -5.432  1.00 0.00 ? 401 ALA A CA   3  
ATOM 5300  C C    . ALA A 1 9   ? 13.253  -0.147  -6.660  1.00 0.00 ? 401 ALA A C    3  
ATOM 5301  O O    . ALA A 1 9   ? 13.586  -0.595  -7.746  1.00 0.00 ? 401 ALA A O    3  
ATOM 5302  C CB   . ALA A 1 9   ? 13.275  -1.117  -4.383  1.00 0.00 ? 401 ALA A CB   3  
ATOM 5303  H H    . ALA A 1 9   ? 14.052  1.493   -4.560  1.00 0.00 ? 401 ALA A H    3  
ATOM 5304  H HA   . ALA A 1 9   ? 14.908  -1.062  -5.701  1.00 0.00 ? 401 ALA A HA   3  
ATOM 5305  H HB1  . ALA A 1 9   ? 12.447  -0.483  -4.099  1.00 0.00 ? 401 ALA A HB1  3  
ATOM 5306  H HB2  . ALA A 1 9   ? 12.909  -2.054  -4.773  1.00 0.00 ? 401 ALA A HB2  3  
ATOM 5307  H HB3  . ALA A 1 9   ? 13.898  -1.298  -3.520  1.00 0.00 ? 401 ALA A HB3  3  
ATOM 5308  N N    . TRP A 1 10  ? 12.186  0.596   -6.506  1.00 0.00 ? 402 TRP A N    3  
ATOM 5309  C CA   . TRP A 1 10  ? 11.238  0.750   -7.585  1.00 0.00 ? 402 TRP A CA   3  
ATOM 5310  C C    . TRP A 1 10  ? 10.728  2.176   -7.673  1.00 0.00 ? 402 TRP A C    3  
ATOM 5311  O O    . TRP A 1 10  ? 10.619  2.871   -6.672  1.00 0.00 ? 402 TRP A O    3  
ATOM 5312  C CB   . TRP A 1 10  ? 10.080  -0.250  -7.363  1.00 0.00 ? 402 TRP A CB   3  
ATOM 5313  C CG   . TRP A 1 10  ? 8.984   -0.246  -8.394  1.00 0.00 ? 402 TRP A CG   3  
ATOM 5314  C CD1  . TRP A 1 10  ? 9.057   -0.679  -9.682  1.00 0.00 ? 402 TRP A CD1  3  
ATOM 5315  C CD2  . TRP A 1 10  ? 7.634   0.169   -8.187  1.00 0.00 ? 402 TRP A CD2  3  
ATOM 5316  N NE1  . TRP A 1 10  ? 7.834   -0.537  -10.294 1.00 0.00 ? 402 TRP A NE1  3  
ATOM 5317  C CE2  . TRP A 1 10  ? 6.943   -0.020  -9.393  1.00 0.00 ? 402 TRP A CE2  3  
ATOM 5318  C CE3  . TRP A 1 10  ? 6.949   0.687   -7.099  1.00 0.00 ? 402 TRP A CE3  3  
ATOM 5319  C CZ2  . TRP A 1 10  ? 5.591   0.294   -9.531  1.00 0.00 ? 402 TRP A CZ2  3  
ATOM 5320  C CZ3  . TRP A 1 10  ? 5.617   0.997   -7.231  1.00 0.00 ? 402 TRP A CZ3  3  
ATOM 5321  C CH2  . TRP A 1 10  ? 4.947   0.800   -8.439  1.00 0.00 ? 402 TRP A CH2  3  
ATOM 5322  H H    . TRP A 1 10  ? 12.022  1.081   -5.666  1.00 0.00 ? 402 TRP A H    3  
ATOM 5323  H HA   . TRP A 1 10  ? 11.732  0.488   -8.508  1.00 0.00 ? 402 TRP A HA   3  
ATOM 5324  H HB2  . TRP A 1 10  ? 10.484  -1.248  -7.341  1.00 0.00 ? 402 TRP A HB2  3  
ATOM 5325  H HB3  . TRP A 1 10  ? 9.632   -0.048  -6.402  1.00 0.00 ? 402 TRP A HB3  3  
ATOM 5326  H HD1  . TRP A 1 10  ? 9.956   -1.060  -10.143 1.00 0.00 ? 402 TRP A HD1  3  
ATOM 5327  H HE1  . TRP A 1 10  ? 7.632   -0.775  -11.226 1.00 0.00 ? 402 TRP A HE1  3  
ATOM 5328  H HE3  . TRP A 1 10  ? 7.455   0.846   -6.159  1.00 0.00 ? 402 TRP A HE3  3  
ATOM 5329  H HZ2  . TRP A 1 10  ? 5.048   0.151   -10.452 1.00 0.00 ? 402 TRP A HZ2  3  
ATOM 5330  H HZ3  . TRP A 1 10  ? 5.084   1.391   -6.379  1.00 0.00 ? 402 TRP A HZ3  3  
ATOM 5331  H HH2  . TRP A 1 10  ? 3.901   1.060   -8.498  1.00 0.00 ? 402 TRP A HH2  3  
ATOM 5332  N N    . SER A 1 11  ? 10.476  2.601   -8.866  1.00 0.00 ? 403 SER A N    3  
ATOM 5333  C CA   . SER A 1 11  ? 9.895   3.874   -9.141  1.00 0.00 ? 403 SER A CA   3  
ATOM 5334  C C    . SER A 1 11  ? 8.680   3.580   -10.014 1.00 0.00 ? 403 SER A C    3  
ATOM 5335  O O    . SER A 1 11  ? 8.815   2.934   -11.068 1.00 0.00 ? 403 SER A O    3  
ATOM 5336  C CB   . SER A 1 11  ? 10.926  4.754   -9.879  1.00 0.00 ? 403 SER A CB   3  
ATOM 5337  O OG   . SER A 1 11  ? 10.493  6.100   -10.018 1.00 0.00 ? 403 SER A OG   3  
ATOM 5338  H H    . SER A 1 11  ? 10.683  2.029   -9.637  1.00 0.00 ? 403 SER A H    3  
ATOM 5339  H HA   . SER A 1 11  ? 9.590   4.337   -8.214  1.00 0.00 ? 403 SER A HA   3  
ATOM 5340  H HB2  . SER A 1 11  ? 11.857  4.746   -9.333  1.00 0.00 ? 403 SER A HB2  3  
ATOM 5341  H HB3  . SER A 1 11  ? 11.095  4.340   -10.863 1.00 0.00 ? 403 SER A HB3  3  
ATOM 5342  H HG   . SER A 1 11  ? 11.291  6.635   -10.085 1.00 0.00 ? 403 SER A HG   3  
ATOM 5343  N N    . GLY A 1 12  ? 7.509   3.978   -9.572  1.00 0.00 ? 404 GLY A N    3  
ATOM 5344  C CA   . GLY A 1 12  ? 6.313   3.638   -10.299 1.00 0.00 ? 404 GLY A CA   3  
ATOM 5345  C C    . GLY A 1 12  ? 5.107   4.377   -9.796  1.00 0.00 ? 404 GLY A C    3  
ATOM 5346  O O    . GLY A 1 12  ? 5.224   5.264   -8.943  1.00 0.00 ? 404 GLY A O    3  
ATOM 5347  H H    . GLY A 1 12  ? 7.438   4.524   -8.756  1.00 0.00 ? 404 GLY A H    3  
ATOM 5348  H HA2  . GLY A 1 12  ? 6.460   3.878   -11.341 1.00 0.00 ? 404 GLY A HA2  3  
ATOM 5349  H HA3  . GLY A 1 12  ? 6.138   2.576   -10.202 1.00 0.00 ? 404 GLY A HA3  3  
ATOM 5350  N N    . VAL A 1 13  ? 3.951   4.012   -10.291 1.00 0.00 ? 405 VAL A N    3  
ATOM 5351  C CA   . VAL A 1 13  ? 2.739   4.691   -9.955  1.00 0.00 ? 405 VAL A CA   3  
ATOM 5352  C C    . VAL A 1 13  ? 1.894   3.789   -9.081  1.00 0.00 ? 405 VAL A C    3  
ATOM 5353  O O    . VAL A 1 13  ? 1.807   2.576   -9.308  1.00 0.00 ? 405 VAL A O    3  
ATOM 5354  C CB   . VAL A 1 13  ? 1.945   5.100   -11.235 1.00 0.00 ? 405 VAL A CB   3  
ATOM 5355  C CG1  . VAL A 1 13  ? 0.675   5.881   -10.890 1.00 0.00 ? 405 VAL A CG1  3  
ATOM 5356  C CG2  . VAL A 1 13  ? 2.825   5.911   -12.183 1.00 0.00 ? 405 VAL A CG2  3  
ATOM 5357  H H    . VAL A 1 13  ? 3.867   3.211   -10.856 1.00 0.00 ? 405 VAL A H    3  
ATOM 5358  H HA   . VAL A 1 13  ? 2.988   5.582   -9.399  1.00 0.00 ? 405 VAL A HA   3  
ATOM 5359  H HB   . VAL A 1 13  ? 1.656   4.190   -11.737 1.00 0.00 ? 405 VAL A HB   3  
ATOM 5360  H HG11 . VAL A 1 13  ? 0.941   6.778   -10.348 1.00 0.00 ? 405 VAL A HG11 3  
ATOM 5361  H HG12 . VAL A 1 13  ? 0.156   6.150   -11.798 1.00 0.00 ? 405 VAL A HG12 3  
ATOM 5362  H HG13 . VAL A 1 13  ? 0.033   5.268   -10.277 1.00 0.00 ? 405 VAL A HG13 3  
ATOM 5363  H HG21 . VAL A 1 13  ? 3.684   5.322   -12.470 1.00 0.00 ? 405 VAL A HG21 3  
ATOM 5364  H HG22 . VAL A 1 13  ? 2.260   6.176   -13.064 1.00 0.00 ? 405 VAL A HG22 3  
ATOM 5365  H HG23 . VAL A 1 13  ? 3.158   6.809   -11.685 1.00 0.00 ? 405 VAL A HG23 3  
ATOM 5366  N N    . LEU A 1 14  ? 1.297   4.361   -8.101  1.00 0.00 ? 406 LEU A N    3  
ATOM 5367  C CA   . LEU A 1 14  ? 0.478   3.640   -7.210  1.00 0.00 ? 406 LEU A CA   3  
ATOM 5368  C C    . LEU A 1 14  ? -0.921  4.155   -7.425  1.00 0.00 ? 406 LEU A C    3  
ATOM 5369  O O    . LEU A 1 14  ? -1.127  5.370   -7.502  1.00 0.00 ? 406 LEU A O    3  
ATOM 5370  C CB   . LEU A 1 14  ? 0.919   3.922   -5.776  1.00 0.00 ? 406 LEU A CB   3  
ATOM 5371  C CG   . LEU A 1 14  ? 0.667   2.811   -4.776  1.00 0.00 ? 406 LEU A CG   3  
ATOM 5372  C CD1  . LEU A 1 14  ? 1.576   1.637   -5.098  1.00 0.00 ? 406 LEU A CD1  3  
ATOM 5373  C CD2  . LEU A 1 14  ? 0.911   3.301   -3.364  1.00 0.00 ? 406 LEU A CD2  3  
ATOM 5374  H H    . LEU A 1 14  ? 1.394   5.327   -7.952  1.00 0.00 ? 406 LEU A H    3  
ATOM 5375  H HA   . LEU A 1 14  ? 0.535   2.584   -7.417  1.00 0.00 ? 406 LEU A HA   3  
ATOM 5376  H HB2  . LEU A 1 14  ? 1.977   4.139   -5.785  1.00 0.00 ? 406 LEU A HB2  3  
ATOM 5377  H HB3  . LEU A 1 14  ? 0.397   4.805   -5.436  1.00 0.00 ? 406 LEU A HB3  3  
ATOM 5378  H HG   . LEU A 1 14  ? -0.357  2.479   -4.859  1.00 0.00 ? 406 LEU A HG   3  
ATOM 5379  H HD11 . LEU A 1 14  ? 1.493   1.384   -6.144  1.00 0.00 ? 406 LEU A HD11 3  
ATOM 5380  H HD12 . LEU A 1 14  ? 2.598   1.933   -4.911  1.00 0.00 ? 406 LEU A HD12 3  
ATOM 5381  H HD13 . LEU A 1 14  ? 1.334   0.783   -4.483  1.00 0.00 ? 406 LEU A HD13 3  
ATOM 5382  H HD21 . LEU A 1 14  ? 1.935   3.636   -3.272  1.00 0.00 ? 406 LEU A HD21 3  
ATOM 5383  H HD22 . LEU A 1 14  ? 0.240   4.118   -3.147  1.00 0.00 ? 406 LEU A HD22 3  
ATOM 5384  H HD23 . LEU A 1 14  ? 0.731   2.496   -2.666  1.00 0.00 ? 406 LEU A HD23 3  
ATOM 5385  N N    . GLU A 1 15  ? -1.859  3.281   -7.567  1.00 0.00 ? 407 GLU A N    3  
ATOM 5386  C CA   . GLU A 1 15  ? -3.195  3.692   -7.810  1.00 0.00 ? 407 GLU A CA   3  
ATOM 5387  C C    . GLU A 1 15  ? -4.011  3.248   -6.610  1.00 0.00 ? 407 GLU A C    3  
ATOM 5388  O O    . GLU A 1 15  ? -3.982  2.081   -6.227  1.00 0.00 ? 407 GLU A O    3  
ATOM 5389  C CB   . GLU A 1 15  ? -3.696  3.084   -9.134  1.00 0.00 ? 407 GLU A CB   3  
ATOM 5390  C CG   . GLU A 1 15  ? -4.798  3.889   -9.801  1.00 0.00 ? 407 GLU A CG   3  
ATOM 5391  C CD   . GLU A 1 15  ? -5.245  3.332   -11.132 1.00 0.00 ? 407 GLU A CD   3  
ATOM 5392  O OE1  . GLU A 1 15  ? -4.602  3.634   -12.174 1.00 0.00 ? 407 GLU A OE1  3  
ATOM 5393  O OE2  . GLU A 1 15  ? -6.280  2.628   -11.187 1.00 0.00 ? 407 GLU A OE2  3  
ATOM 5394  H H    . GLU A 1 15  ? -1.676  2.317   -7.477  1.00 0.00 ? 407 GLU A H    3  
ATOM 5395  H HA   . GLU A 1 15  ? -3.212  4.771   -7.865  1.00 0.00 ? 407 GLU A HA   3  
ATOM 5396  H HB2  . GLU A 1 15  ? -2.866  3.012   -9.823  1.00 0.00 ? 407 GLU A HB2  3  
ATOM 5397  H HB3  . GLU A 1 15  ? -4.074  2.092   -8.935  1.00 0.00 ? 407 GLU A HB3  3  
ATOM 5398  H HG2  . GLU A 1 15  ? -5.644  3.960   -9.140  1.00 0.00 ? 407 GLU A HG2  3  
ATOM 5399  H HG3  . GLU A 1 15  ? -4.419  4.886   -9.958  1.00 0.00 ? 407 GLU A HG3  3  
ATOM 5400  N N    . TRP A 1 16  ? -4.703  4.168   -6.015  1.00 0.00 ? 408 TRP A N    3  
ATOM 5401  C CA   . TRP A 1 16  ? -5.376  3.925   -4.772  1.00 0.00 ? 408 TRP A CA   3  
ATOM 5402  C C    . TRP A 1 16  ? -6.799  4.418   -4.819  1.00 0.00 ? 408 TRP A C    3  
ATOM 5403  O O    . TRP A 1 16  ? -7.110  5.424   -5.490  1.00 0.00 ? 408 TRP A O    3  
ATOM 5404  C CB   . TRP A 1 16  ? -4.611  4.601   -3.621  1.00 0.00 ? 408 TRP A CB   3  
ATOM 5405  C CG   . TRP A 1 16  ? -4.514  6.106   -3.721  1.00 0.00 ? 408 TRP A CG   3  
ATOM 5406  C CD1  . TRP A 1 16  ? -3.659  6.830   -4.506  1.00 0.00 ? 408 TRP A CD1  3  
ATOM 5407  C CD2  . TRP A 1 16  ? -5.290  7.063   -2.991  1.00 0.00 ? 408 TRP A CD2  3  
ATOM 5408  N NE1  . TRP A 1 16  ? -3.882  8.170   -4.323  1.00 0.00 ? 408 TRP A NE1  3  
ATOM 5409  C CE2  . TRP A 1 16  ? -4.867  8.337   -3.393  1.00 0.00 ? 408 TRP A CE2  3  
ATOM 5410  C CE3  . TRP A 1 16  ? -6.305  6.962   -2.043  1.00 0.00 ? 408 TRP A CE3  3  
ATOM 5411  C CZ2  . TRP A 1 16  ? -5.422  9.500   -2.879  1.00 0.00 ? 408 TRP A CZ2  3  
ATOM 5412  C CZ3  . TRP A 1 16  ? -6.852  8.119   -1.534  1.00 0.00 ? 408 TRP A CZ3  3  
ATOM 5413  C CH2  . TRP A 1 16  ? -6.411  9.372   -1.953  1.00 0.00 ? 408 TRP A CH2  3  
ATOM 5414  H H    . TRP A 1 16  ? -4.791  5.052   -6.437  1.00 0.00 ? 408 TRP A H    3  
ATOM 5415  H HA   . TRP A 1 16  ? -5.376  2.861   -4.592  1.00 0.00 ? 408 TRP A HA   3  
ATOM 5416  H HB2  . TRP A 1 16  ? -5.093  4.365   -2.684  1.00 0.00 ? 408 TRP A HB2  3  
ATOM 5417  H HB3  . TRP A 1 16  ? -3.606  4.208   -3.606  1.00 0.00 ? 408 TRP A HB3  3  
ATOM 5418  H HD1  . TRP A 1 16  ? -2.936  6.398   -5.180  1.00 0.00 ? 408 TRP A HD1  3  
ATOM 5419  H HE1  . TRP A 1 16  ? -3.407  8.899   -4.777  1.00 0.00 ? 408 TRP A HE1  3  
ATOM 5420  H HE3  . TRP A 1 16  ? -6.660  6.000   -1.707  1.00 0.00 ? 408 TRP A HE3  3  
ATOM 5421  H HZ2  . TRP A 1 16  ? -5.091  10.479  -3.194  1.00 0.00 ? 408 TRP A HZ2  3  
ATOM 5422  H HZ3  . TRP A 1 16  ? -7.640  8.062   -0.798  1.00 0.00 ? 408 TRP A HZ3  3  
ATOM 5423  H HH2  . TRP A 1 16  ? -6.870  10.251  -1.527  1.00 0.00 ? 408 TRP A HH2  3  
ATOM 5424  N N    . GLN A 1 17  ? -7.662  3.725   -4.150  1.00 0.00 ? 409 GLN A N    3  
ATOM 5425  C CA   . GLN A 1 17  ? -9.027  4.114   -4.110  1.00 0.00 ? 409 GLN A CA   3  
ATOM 5426  C C    . GLN A 1 17  ? -9.313  4.815   -2.793  1.00 0.00 ? 409 GLN A C    3  
ATOM 5427  O O    . GLN A 1 17  ? -8.928  4.344   -1.724  1.00 0.00 ? 409 GLN A O    3  
ATOM 5428  C CB   . GLN A 1 17  ? -9.957  2.917   -4.353  1.00 0.00 ? 409 GLN A CB   3  
ATOM 5429  C CG   . GLN A 1 17  ? -11.431 3.286   -4.464  1.00 0.00 ? 409 GLN A CG   3  
ATOM 5430  C CD   . GLN A 1 17  ? -11.688 4.375   -5.495  1.00 0.00 ? 409 GLN A CD   3  
ATOM 5431  O OE1  . GLN A 1 17  ? -11.669 5.567   -5.174  1.00 0.00 ? 409 GLN A OE1  3  
ATOM 5432  N NE2  . GLN A 1 17  ? -11.921 3.990   -6.721  1.00 0.00 ? 409 GLN A NE2  3  
ATOM 5433  H H    . GLN A 1 17  ? -7.369  2.934   -3.647  1.00 0.00 ? 409 GLN A H    3  
ATOM 5434  H HA   . GLN A 1 17  ? -9.167  4.834   -4.904  1.00 0.00 ? 409 GLN A HA   3  
ATOM 5435  H HB2  . GLN A 1 17  ? -9.659  2.423   -5.265  1.00 0.00 ? 409 GLN A HB2  3  
ATOM 5436  H HB3  . GLN A 1 17  ? -9.843  2.225   -3.532  1.00 0.00 ? 409 GLN A HB3  3  
ATOM 5437  H HG2  . GLN A 1 17  ? -11.992 2.407   -4.745  1.00 0.00 ? 409 GLN A HG2  3  
ATOM 5438  H HG3  . GLN A 1 17  ? -11.773 3.635   -3.500  1.00 0.00 ? 409 GLN A HG3  3  
ATOM 5439  H HE21 . GLN A 1 17  ? -11.920 3.030   -6.919  1.00 0.00 ? 409 GLN A HE21 3  
ATOM 5440  H HE22 . GLN A 1 17  ? -12.090 4.681   -7.394  1.00 0.00 ? 409 GLN A HE22 3  
ATOM 5441  N N    . GLU A 1 18  ? -9.957  5.950   -2.903  1.00 0.00 ? 410 GLU A N    3  
ATOM 5442  C CA   . GLU A 1 18  ? -10.283 6.801   -1.780  1.00 0.00 ? 410 GLU A CA   3  
ATOM 5443  C C    . GLU A 1 18  ? -11.499 6.245   -1.055  1.00 0.00 ? 410 GLU A C    3  
ATOM 5444  O O    . GLU A 1 18  ? -11.612 6.332   0.170   1.00 0.00 ? 410 GLU A O    3  
ATOM 5445  C CB   . GLU A 1 18  ? -10.499 8.243   -2.331  1.00 0.00 ? 410 GLU A CB   3  
ATOM 5446  C CG   . GLU A 1 18  ? -10.879 9.351   -1.336  1.00 0.00 ? 410 GLU A CG   3  
ATOM 5447  C CD   . GLU A 1 18  ? -12.363 9.435   -1.039  1.00 0.00 ? 410 GLU A CD   3  
ATOM 5448  O OE1  . GLU A 1 18  ? -12.775 9.238   0.109   1.00 0.00 ? 410 GLU A OE1  3  
ATOM 5449  O OE2  . GLU A 1 18  ? -13.141 9.740   -1.954  1.00 0.00 ? 410 GLU A OE2  3  
ATOM 5450  H H    . GLU A 1 18  ? -10.244 6.220   -3.801  1.00 0.00 ? 410 GLU A H    3  
ATOM 5451  H HA   . GLU A 1 18  ? -9.441  6.809   -1.104  1.00 0.00 ? 410 GLU A HA   3  
ATOM 5452  H HB2  . GLU A 1 18  ? -9.587  8.556   -2.816  1.00 0.00 ? 410 GLU A HB2  3  
ATOM 5453  H HB3  . GLU A 1 18  ? -11.271 8.191   -3.085  1.00 0.00 ? 410 GLU A HB3  3  
ATOM 5454  H HG2  . GLU A 1 18  ? -10.368 9.162   -0.404  1.00 0.00 ? 410 GLU A HG2  3  
ATOM 5455  H HG3  . GLU A 1 18  ? -10.549 10.299  -1.734  1.00 0.00 ? 410 GLU A HG3  3  
ATOM 5456  N N    . LYS A 1 19  ? -12.363 5.623   -1.810  1.00 0.00 ? 411 LYS A N    3  
ATOM 5457  C CA   . LYS A 1 19  ? -13.590 5.087   -1.285  1.00 0.00 ? 411 LYS A CA   3  
ATOM 5458  C C    . LYS A 1 19  ? -13.372 3.612   -0.936  1.00 0.00 ? 411 LYS A C    3  
ATOM 5459  O O    . LYS A 1 19  ? -13.098 2.811   -1.821  1.00 0.00 ? 411 LYS A O    3  
ATOM 5460  C CB   . LYS A 1 19  ? -14.692 5.234   -2.335  1.00 0.00 ? 411 LYS A CB   3  
ATOM 5461  C CG   . LYS A 1 19  ? -14.729 6.623   -2.970  1.00 0.00 ? 411 LYS A CG   3  
ATOM 5462  C CD   . LYS A 1 19  ? -15.883 6.782   -3.942  1.00 0.00 ? 411 LYS A CD   3  
ATOM 5463  C CE   . LYS A 1 19  ? -17.212 6.919   -3.217  1.00 0.00 ? 411 LYS A CE   3  
ATOM 5464  N NZ   . LYS A 1 19  ? -17.284 8.166   -2.427  1.00 0.00 ? 411 LYS A NZ   3  
ATOM 5465  H H    . LYS A 1 19  ? -12.147 5.489   -2.755  1.00 0.00 ? 411 LYS A H    3  
ATOM 5466  H HA   . LYS A 1 19  ? -13.859 5.647   -0.403  1.00 0.00 ? 411 LYS A HA   3  
ATOM 5467  H HB2  . LYS A 1 19  ? -14.530 4.504   -3.115  1.00 0.00 ? 411 LYS A HB2  3  
ATOM 5468  H HB3  . LYS A 1 19  ? -15.647 5.046   -1.868  1.00 0.00 ? 411 LYS A HB3  3  
ATOM 5469  H HG2  . LYS A 1 19  ? -14.830 7.363   -2.190  1.00 0.00 ? 411 LYS A HG2  3  
ATOM 5470  H HG3  . LYS A 1 19  ? -13.800 6.784   -3.496  1.00 0.00 ? 411 LYS A HG3  3  
ATOM 5471  H HD2  . LYS A 1 19  ? -15.713 7.662   -4.542  1.00 0.00 ? 411 LYS A HD2  3  
ATOM 5472  H HD3  . LYS A 1 19  ? -15.919 5.915   -4.584  1.00 0.00 ? 411 LYS A HD3  3  
ATOM 5473  H HE2  . LYS A 1 19  ? -18.005 6.930   -3.948  1.00 0.00 ? 411 LYS A HE2  3  
ATOM 5474  H HE3  . LYS A 1 19  ? -17.347 6.075   -2.558  1.00 0.00 ? 411 LYS A HE3  3  
ATOM 5475  H HZ1  . LYS A 1 19  ? -16.545 8.206   -1.697  1.00 0.00 ? 411 LYS A HZ1  3  
ATOM 5476  H HZ2  . LYS A 1 19  ? -17.194 9.006   -3.035  1.00 0.00 ? 411 LYS A HZ2  3  
ATOM 5477  H HZ3  . LYS A 1 19  ? -18.205 8.217   -1.948  1.00 0.00 ? 411 LYS A HZ3  3  
ATOM 5478  N N    . PRO A 1 20  ? -13.485 3.239   0.363   1.00 0.00 ? 412 PRO A N    3  
ATOM 5479  C CA   . PRO A 1 20  ? -13.218 1.858   0.839   1.00 0.00 ? 412 PRO A CA   3  
ATOM 5480  C C    . PRO A 1 20  ? -14.112 0.794   0.185   1.00 0.00 ? 412 PRO A C    3  
ATOM 5481  O O    . PRO A 1 20  ? -13.743 -0.376  0.100   1.00 0.00 ? 412 PRO A O    3  
ATOM 5482  C CB   . PRO A 1 20  ? -13.504 1.937   2.345   1.00 0.00 ? 412 PRO A CB   3  
ATOM 5483  C CG   . PRO A 1 20  ? -13.364 3.379   2.681   1.00 0.00 ? 412 PRO A CG   3  
ATOM 5484  C CD   . PRO A 1 20  ? -13.847 4.128   1.479   1.00 0.00 ? 412 PRO A CD   3  
ATOM 5485  H HA   . PRO A 1 20  ? -12.185 1.588   0.685   1.00 0.00 ? 412 PRO A HA   3  
ATOM 5486  H HB2  . PRO A 1 20  ? -14.499 1.574   2.550   1.00 0.00 ? 412 PRO A HB2  3  
ATOM 5487  H HB3  . PRO A 1 20  ? -12.778 1.344   2.879   1.00 0.00 ? 412 PRO A HB3  3  
ATOM 5488  H HG2  . PRO A 1 20  ? -13.964 3.619   3.546   1.00 0.00 ? 412 PRO A HG2  3  
ATOM 5489  H HG3  . PRO A 1 20  ? -12.326 3.610   2.875   1.00 0.00 ? 412 PRO A HG3  3  
ATOM 5490  H HD2  . PRO A 1 20  ? -14.915 4.282   1.527   1.00 0.00 ? 412 PRO A HD2  3  
ATOM 5491  H HD3  . PRO A 1 20  ? -13.321 5.066   1.406   1.00 0.00 ? 412 PRO A HD3  3  
ATOM 5492  N N    . LYS A 1 21  ? -15.274 1.203   -0.270  1.00 0.00 ? 413 LYS A N    3  
ATOM 5493  C CA   . LYS A 1 21  ? -16.194 0.313   -0.931  1.00 0.00 ? 413 LYS A CA   3  
ATOM 5494  C C    . LYS A 1 21  ? -16.945 1.081   -1.998  1.00 0.00 ? 413 LYS A C    3  
ATOM 5495  O O    . LYS A 1 21  ? -17.128 2.305   -1.863  1.00 0.00 ? 413 LYS A O    3  
ATOM 5496  C CB   . LYS A 1 21  ? -17.204 -0.306  0.063   1.00 0.00 ? 413 LYS A CB   3  
ATOM 5497  C CG   . LYS A 1 21  ? -18.056 0.709   0.822   1.00 0.00 ? 413 LYS A CG   3  
ATOM 5498  C CD   . LYS A 1 21  ? -19.186 0.025   1.570   1.00 0.00 ? 413 LYS A CD   3  
ATOM 5499  C CE   . LYS A 1 21  ? -19.972 1.001   2.420   1.00 0.00 ? 413 LYS A CE   3  
ATOM 5500  N NZ   . LYS A 1 21  ? -19.149 1.564   3.499   1.00 0.00 ? 413 LYS A NZ   3  
ATOM 5501  H H    . LYS A 1 21  ? -15.505 2.151   -0.192  1.00 0.00 ? 413 LYS A H    3  
ATOM 5502  H HA   . LYS A 1 21  ? -15.623 -0.476  -1.395  1.00 0.00 ? 413 LYS A HA   3  
ATOM 5503  H HB2  . LYS A 1 21  ? -17.872 -0.953  -0.484  1.00 0.00 ? 413 LYS A HB2  3  
ATOM 5504  H HB3  . LYS A 1 21  ? -16.658 -0.899  0.783   1.00 0.00 ? 413 LYS A HB3  3  
ATOM 5505  H HG2  . LYS A 1 21  ? -17.430 1.232   1.530   1.00 0.00 ? 413 LYS A HG2  3  
ATOM 5506  H HG3  . LYS A 1 21  ? -18.474 1.411   0.116   1.00 0.00 ? 413 LYS A HG3  3  
ATOM 5507  H HD2  . LYS A 1 21  ? -19.858 -0.441  0.864   1.00 0.00 ? 413 LYS A HD2  3  
ATOM 5508  H HD3  . LYS A 1 21  ? -18.763 -0.729  2.218   1.00 0.00 ? 413 LYS A HD3  3  
ATOM 5509  H HE2  . LYS A 1 21  ? -20.327 1.808   1.796   1.00 0.00 ? 413 LYS A HE2  3  
ATOM 5510  H HE3  . LYS A 1 21  ? -20.814 0.483   2.854   1.00 0.00 ? 413 LYS A HE3  3  
ATOM 5511  H HZ1  . LYS A 1 21  ? -18.270 2.001   3.164   1.00 0.00 ? 413 LYS A HZ1  3  
ATOM 5512  H HZ2  . LYS A 1 21  ? -19.677 2.279   4.045   1.00 0.00 ? 413 LYS A HZ2  3  
ATOM 5513  H HZ3  . LYS A 1 21  ? -18.895 0.816   4.182   1.00 0.00 ? 413 LYS A HZ3  3  
ATOM 5514  N N    . PRO A 1 22  ? -17.363 0.418   -3.084  1.00 0.00 ? 414 PRO A N    3  
ATOM 5515  C CA   . PRO A 1 22  ? -18.184 1.046   -4.095  1.00 0.00 ? 414 PRO A CA   3  
ATOM 5516  C C    . PRO A 1 22  ? -19.624 1.241   -3.595  1.00 0.00 ? 414 PRO A C    3  
ATOM 5517  O O    . PRO A 1 22  ? -20.512 0.422   -3.828  1.00 0.00 ? 414 PRO A O    3  
ATOM 5518  C CB   . PRO A 1 22  ? -18.125 0.087   -5.291  1.00 0.00 ? 414 PRO A CB   3  
ATOM 5519  C CG   . PRO A 1 22  ? -17.801 -1.244  -4.701  1.00 0.00 ? 414 PRO A CG   3  
ATOM 5520  C CD   . PRO A 1 22  ? -17.027 -0.983  -3.429  1.00 0.00 ? 414 PRO A CD   3  
ATOM 5521  H HA   . PRO A 1 22  ? -17.780 2.010   -4.367  1.00 0.00 ? 414 PRO A HA   3  
ATOM 5522  H HB2  . PRO A 1 22  ? -19.082 0.077   -5.789  1.00 0.00 ? 414 PRO A HB2  3  
ATOM 5523  H HB3  . PRO A 1 22  ? -17.359 0.408   -5.982  1.00 0.00 ? 414 PRO A HB3  3  
ATOM 5524  H HG2  . PRO A 1 22  ? -18.718 -1.770  -4.481  1.00 0.00 ? 414 PRO A HG2  3  
ATOM 5525  H HG3  . PRO A 1 22  ? -17.206 -1.818  -5.395  1.00 0.00 ? 414 PRO A HG3  3  
ATOM 5526  H HD2  . PRO A 1 22  ? -17.347 -1.654  -2.646  1.00 0.00 ? 414 PRO A HD2  3  
ATOM 5527  H HD3  . PRO A 1 22  ? -15.967 -1.088  -3.604  1.00 0.00 ? 414 PRO A HD3  3  
ATOM 5528  N N    . ALA A 1 23  ? -19.796 2.279   -2.812  1.00 0.00 ? 415 ALA A N    3  
ATOM 5529  C CA   . ALA A 1 23  ? -21.088 2.676   -2.257  1.00 0.00 ? 415 ALA A CA   3  
ATOM 5530  C C    . ALA A 1 23  ? -21.652 3.796   -3.101  1.00 0.00 ? 415 ALA A C    3  
ATOM 5531  O O    . ALA A 1 23  ? -22.687 4.383   -2.790  1.00 0.00 ? 415 ALA A O    3  
ATOM 5532  C CB   . ALA A 1 23  ? -20.916 3.132   -0.814  1.00 0.00 ? 415 ALA A CB   3  
ATOM 5533  H H    . ALA A 1 23  ? -18.993 2.796   -2.573  1.00 0.00 ? 415 ALA A H    3  
ATOM 5534  H HA   . ALA A 1 23  ? -21.755 1.827   -2.289  1.00 0.00 ? 415 ALA A HA   3  
ATOM 5535  H HB1  . ALA A 1 23  ? -20.232 3.968   -0.781  1.00 0.00 ? 415 ALA A HB1  3  
ATOM 5536  H HB2  . ALA A 1 23  ? -21.872 3.430   -0.412  1.00 0.00 ? 415 ALA A HB2  3  
ATOM 5537  H HB3  . ALA A 1 23  ? -20.516 2.316   -0.233  1.00 0.00 ? 415 ALA A HB3  3  
ATOM 5538  N N    . SER A 1 24  ? -20.909 4.099   -4.135  1.00 0.00 ? 416 SER A N    3  
ATOM 5539  C CA   . SER A 1 24  ? -21.167 5.163   -5.036  1.00 0.00 ? 416 SER A CA   3  
ATOM 5540  C C    . SER A 1 24  ? -22.538 5.186   -5.663  1.00 0.00 ? 416 SER A C    3  
ATOM 5541  O O    . SER A 1 24  ? -22.947 4.282   -6.386  1.00 0.00 ? 416 SER A O    3  
ATOM 5542  C CB   . SER A 1 24  ? -20.104 5.205   -6.106  1.00 0.00 ? 416 SER A CB   3  
ATOM 5543  O OG   . SER A 1 24  ? -18.877 5.607   -5.545  1.00 0.00 ? 416 SER A OG   3  
ATOM 5544  H H    . SER A 1 24  ? -20.122 3.546   -4.311  1.00 0.00 ? 416 SER A H    3  
ATOM 5545  H HA   . SER A 1 24  ? -21.052 6.078   -4.474  1.00 0.00 ? 416 SER A HA   3  
ATOM 5546  H HB2  . SER A 1 24  ? -19.994 4.223   -6.541  1.00 0.00 ? 416 SER A HB2  3  
ATOM 5547  H HB3  . SER A 1 24  ? -20.393 5.913   -6.867  1.00 0.00 ? 416 SER A HB3  3  
ATOM 5548  H HG   . SER A 1 24  ? -19.060 6.520   -5.270  1.00 0.00 ? 416 SER A HG   3  
ATOM 5549  N N    . VAL A 1 25  ? -23.227 6.233   -5.340  1.00 0.00 ? 417 VAL A N    3  
ATOM 5550  C CA   . VAL A 1 25  ? -24.443 6.641   -6.002  1.00 0.00 ? 417 VAL A CA   3  
ATOM 5551  C C    . VAL A 1 25  ? -24.076 8.037   -6.561  1.00 0.00 ? 417 VAL A C    3  
ATOM 5552  O O    . VAL A 1 25  ? -24.912 8.880   -6.923  1.00 0.00 ? 417 VAL A O    3  
ATOM 5553  C CB   . VAL A 1 25  ? -25.636 6.742   -4.988  1.00 0.00 ? 417 VAL A CB   3  
ATOM 5554  C CG1  . VAL A 1 25  ? -26.956 6.975   -5.709  1.00 0.00 ? 417 VAL A CG1  3  
ATOM 5555  C CG2  . VAL A 1 25  ? -25.728 5.491   -4.115  1.00 0.00 ? 417 VAL A CG2  3  
ATOM 5556  H H    . VAL A 1 25  ? -22.911 6.777   -4.587  1.00 0.00 ? 417 VAL A H    3  
ATOM 5557  H HA   . VAL A 1 25  ? -24.652 5.957   -6.813  1.00 0.00 ? 417 VAL A HA   3  
ATOM 5558  H HB   . VAL A 1 25  ? -25.455 7.590   -4.344  1.00 0.00 ? 417 VAL A HB   3  
ATOM 5559  H HG11 . VAL A 1 25  ? -26.898 7.888   -6.281  1.00 0.00 ? 417 VAL A HG11 3  
ATOM 5560  H HG12 . VAL A 1 25  ? -27.154 6.146   -6.373  1.00 0.00 ? 417 VAL A HG12 3  
ATOM 5561  H HG13 . VAL A 1 25  ? -27.752 7.054   -4.984  1.00 0.00 ? 417 VAL A HG13 3  
ATOM 5562  H HG21 . VAL A 1 25  ? -25.877 4.626   -4.745  1.00 0.00 ? 417 VAL A HG21 3  
ATOM 5563  H HG22 . VAL A 1 25  ? -24.814 5.376   -3.552  1.00 0.00 ? 417 VAL A HG22 3  
ATOM 5564  H HG23 . VAL A 1 25  ? -26.561 5.587   -3.436  1.00 0.00 ? 417 VAL A HG23 3  
ATOM 5565  N N    . ASP A 1 26  ? -22.766 8.234   -6.608  1.00 0.00 ? 418 ASP A N    3  
ATOM 5566  C CA   . ASP A 1 26  ? -22.115 9.455   -7.001  1.00 0.00 ? 418 ASP A CA   3  
ATOM 5567  C C    . ASP A 1 26  ? -21.463 9.327   -8.363  1.00 0.00 ? 418 ASP A C    3  
ATOM 5568  O O    . ASP A 1 26  ? -20.847 8.300   -8.693  1.00 0.00 ? 418 ASP A O    3  
ATOM 5569  C CB   . ASP A 1 26  ? -21.045 9.862   -5.956  1.00 0.00 ? 418 ASP A CB   3  
ATOM 5570  C CG   . ASP A 1 26  ? -20.022 8.766   -5.659  1.00 0.00 ? 418 ASP A CG   3  
ATOM 5571  O OD1  . ASP A 1 26  ? -19.025 8.619   -6.390  1.00 0.00 ? 418 ASP A OD1  3  
ATOM 5572  O OD2  . ASP A 1 26  ? -20.201 8.032   -4.678  1.00 0.00 ? 418 ASP A OD2  3  
ATOM 5573  H H    . ASP A 1 26  ? -22.192 7.477   -6.376  1.00 0.00 ? 418 ASP A H    3  
ATOM 5574  H HA   . ASP A 1 26  ? -22.861 10.234  -7.029  1.00 0.00 ? 418 ASP A HA   3  
ATOM 5575  H HB2  . ASP A 1 26  ? -20.504 10.723  -6.323  1.00 0.00 ? 418 ASP A HB2  3  
ATOM 5576  H HB3  . ASP A 1 26  ? -21.538 10.128  -5.033  1.00 0.00 ? 418 ASP A HB3  3  
ATOM 5577  N N    . ALA A 1 27  ? -21.624 10.351  -9.159  1.00 0.00 ? 419 ALA A N    3  
ATOM 5578  C CA   . ALA A 1 27  ? -20.985 10.430  -10.453 1.00 0.00 ? 419 ALA A CA   3  
ATOM 5579  C C    . ALA A 1 27  ? -19.607 11.073  -10.305 1.00 0.00 ? 419 ALA A C    3  
ATOM 5580  O O    . ALA A 1 27  ? -18.680 10.780  -11.066 1.00 0.00 ? 419 ALA A O    3  
ATOM 5581  C CB   . ALA A 1 27  ? -21.847 11.227  -11.417 1.00 0.00 ? 419 ALA A CB   3  
ATOM 5582  H H    . ALA A 1 27  ? -22.208 11.082  -8.859  1.00 0.00 ? 419 ALA A H    3  
ATOM 5583  H HA   . ALA A 1 27  ? -20.870 9.425   -10.833 1.00 0.00 ? 419 ALA A HA   3  
ATOM 5584  H HB1  . ALA A 1 27  ? -22.814 10.756  -11.514 1.00 0.00 ? 419 ALA A HB1  3  
ATOM 5585  H HB2  . ALA A 1 27  ? -21.971 12.231  -11.041 1.00 0.00 ? 419 ALA A HB2  3  
ATOM 5586  H HB3  . ALA A 1 27  ? -21.365 11.263  -12.383 1.00 0.00 ? 419 ALA A HB3  3  
ATOM 5587  N N    . ASN A 1 28  ? -19.485 11.932  -9.299  1.00 0.00 ? 420 ASN A N    3  
ATOM 5588  C CA   . ASN A 1 28  ? -18.244 12.660  -9.009  1.00 0.00 ? 420 ASN A CA   3  
ATOM 5589  C C    . ASN A 1 28  ? -17.127 11.721  -8.592  1.00 0.00 ? 420 ASN A C    3  
ATOM 5590  O O    . ASN A 1 28  ? -17.228 11.049  -7.569  1.00 0.00 ? 420 ASN A O    3  
ATOM 5591  C CB   . ASN A 1 28  ? -18.474 13.702  -7.905  1.00 0.00 ? 420 ASN A CB   3  
ATOM 5592  C CG   . ASN A 1 28  ? -17.184 14.360  -7.401  1.00 0.00 ? 420 ASN A CG   3  
ATOM 5593  O OD1  . ASN A 1 28  ? -16.203 14.542  -8.139  1.00 0.00 ? 420 ASN A OD1  3  
ATOM 5594  N ND2  . ASN A 1 28  ? -17.171 14.697  -6.148  1.00 0.00 ? 420 ASN A ND2  3  
ATOM 5595  H H    . ASN A 1 28  ? -20.261 12.072  -8.713  1.00 0.00 ? 420 ASN A H    3  
ATOM 5596  H HA   . ASN A 1 28  ? -17.948 13.179  -9.908  1.00 0.00 ? 420 ASN A HA   3  
ATOM 5597  H HB2  . ASN A 1 28  ? -19.124 14.477  -8.282  1.00 0.00 ? 420 ASN A HB2  3  
ATOM 5598  H HB3  . ASN A 1 28  ? -18.957 13.215  -7.070  1.00 0.00 ? 420 ASN A HB3  3  
ATOM 5599  H HD21 . ASN A 1 28  ? -17.979 14.512  -5.621  1.00 0.00 ? 420 ASN A HD21 3  
ATOM 5600  H HD22 . ASN A 1 28  ? -16.371 15.095  -5.745  1.00 0.00 ? 420 ASN A HD22 3  
ATOM 5601  N N    . THR A 1 29  ? -16.071 11.706  -9.397  1.00 0.00 ? 421 THR A N    3  
ATOM 5602  C CA   . THR A 1 29  ? -14.888 10.903  -9.176  1.00 0.00 ? 421 THR A CA   3  
ATOM 5603  C C    . THR A 1 29  ? -15.235 9.410   -9.156  1.00 0.00 ? 421 THR A C    3  
ATOM 5604  O O    . THR A 1 29  ? -15.608 8.832   -8.133  1.00 0.00 ? 421 THR A O    3  
ATOM 5605  C CB   . THR A 1 29  ? -14.137 11.326  -7.895  1.00 0.00 ? 421 THR A CB   3  
ATOM 5606  O OG1  . THR A 1 29  ? -13.954 12.760  -7.919  1.00 0.00 ? 421 THR A OG1  3  
ATOM 5607  C CG2  . THR A 1 29  ? -12.767 10.656  -7.838  1.00 0.00 ? 421 THR A CG2  3  
ATOM 5608  H H    . THR A 1 29  ? -16.094 12.266  -10.202 1.00 0.00 ? 421 THR A H    3  
ATOM 5609  H HA   . THR A 1 29  ? -14.242 11.074  -10.027 1.00 0.00 ? 421 THR A HA   3  
ATOM 5610  H HB   . THR A 1 29  ? -14.718 11.042  -7.030  1.00 0.00 ? 421 THR A HB   3  
ATOM 5611  H HG1  . THR A 1 29  ? -14.821 13.146  -8.103  1.00 0.00 ? 421 THR A HG1  3  
ATOM 5612  H HG21 . THR A 1 29  ? -12.197 10.937  -8.710  1.00 0.00 ? 421 THR A HG21 3  
ATOM 5613  H HG22 . THR A 1 29  ? -12.244 10.985  -6.951  1.00 0.00 ? 421 THR A HG22 3  
ATOM 5614  H HG23 . THR A 1 29  ? -12.883 9.583   -7.811  1.00 0.00 ? 421 THR A HG23 3  
ATOM 5615  N N    . LYS A 1 30  ? -15.182 8.804   -10.295 1.00 0.00 ? 422 LYS A N    3  
ATOM 5616  C CA   . LYS A 1 30  ? -15.516 7.418   -10.394 1.00 0.00 ? 422 LYS A CA   3  
ATOM 5617  C C    . LYS A 1 30  ? -14.258 6.615   -10.717 1.00 0.00 ? 422 LYS A C    3  
ATOM 5618  O O    . LYS A 1 30  ? -14.307 5.415   -10.932 1.00 0.00 ? 422 LYS A O    3  
ATOM 5619  C CB   . LYS A 1 30  ? -16.595 7.235   -11.476 1.00 0.00 ? 422 LYS A CB   3  
ATOM 5620  C CG   . LYS A 1 30  ? -17.315 5.884   -11.469 1.00 0.00 ? 422 LYS A CG   3  
ATOM 5621  C CD   . LYS A 1 30  ? -18.536 5.781   -10.500 1.00 0.00 ? 422 LYS A CD   3  
ATOM 5622  C CE   . LYS A 1 30  ? -18.241 6.041   -9.008  1.00 0.00 ? 422 LYS A CE   3  
ATOM 5623  N NZ   . LYS A 1 30  ? -18.233 7.491   -8.650  1.00 0.00 ? 422 LYS A NZ   3  
ATOM 5624  H H    . LYS A 1 30  ? -14.916 9.305   -11.099 1.00 0.00 ? 422 LYS A H    3  
ATOM 5625  H HA   . LYS A 1 30  ? -15.913 7.096   -9.443  1.00 0.00 ? 422 LYS A HA   3  
ATOM 5626  H HB2  . LYS A 1 30  ? -17.339 8.007   -11.350 1.00 0.00 ? 422 LYS A HB2  3  
ATOM 5627  H HB3  . LYS A 1 30  ? -16.124 7.362   -12.440 1.00 0.00 ? 422 LYS A HB3  3  
ATOM 5628  H HG2  . LYS A 1 30  ? -17.666 5.694   -12.473 1.00 0.00 ? 422 LYS A HG2  3  
ATOM 5629  H HG3  . LYS A 1 30  ? -16.593 5.126   -11.208 1.00 0.00 ? 422 LYS A HG3  3  
ATOM 5630  H HD2  . LYS A 1 30  ? -19.272 6.507   -10.813 1.00 0.00 ? 422 LYS A HD2  3  
ATOM 5631  H HD3  . LYS A 1 30  ? -18.962 4.794   -10.609 1.00 0.00 ? 422 LYS A HD3  3  
ATOM 5632  H HE2  . LYS A 1 30  ? -19.005 5.552   -8.424  1.00 0.00 ? 422 LYS A HE2  3  
ATOM 5633  H HE3  . LYS A 1 30  ? -17.283 5.608   -8.760  1.00 0.00 ? 422 LYS A HE3  3  
ATOM 5634  H HZ1  . LYS A 1 30  ? -19.169 7.907   -8.846  1.00 0.00 ? 422 LYS A HZ1  3  
ATOM 5635  H HZ2  . LYS A 1 30  ? -18.128 7.647   -7.621  1.00 0.00 ? 422 LYS A HZ2  3  
ATOM 5636  H HZ3  . LYS A 1 30  ? -17.499 8.043   -9.133  1.00 0.00 ? 422 LYS A HZ3  3  
ATOM 5637  N N    . LEU A 1 31  ? -13.131 7.282   -10.719 1.00 0.00 ? 423 LEU A N    3  
ATOM 5638  C CA   . LEU A 1 31  ? -11.879 6.645   -11.058 1.00 0.00 ? 423 LEU A CA   3  
ATOM 5639  C C    . LEU A 1 31  ? -10.989 6.530   -9.843  1.00 0.00 ? 423 LEU A C    3  
ATOM 5640  O O    . LEU A 1 31  ? -11.049 7.373   -8.937  1.00 0.00 ? 423 LEU A O    3  
ATOM 5641  C CB   . LEU A 1 31  ? -11.150 7.436   -12.148 1.00 0.00 ? 423 LEU A CB   3  
ATOM 5642  C CG   . LEU A 1 31  ? -11.878 7.596   -13.484 1.00 0.00 ? 423 LEU A CG   3  
ATOM 5643  C CD1  . LEU A 1 31  ? -11.040 8.424   -14.440 1.00 0.00 ? 423 LEU A CD1  3  
ATOM 5644  C CD2  . LEU A 1 31  ? -12.198 6.239   -14.095 1.00 0.00 ? 423 LEU A CD2  3  
ATOM 5645  H H    . LEU A 1 31  ? -13.122 8.224   -10.451 1.00 0.00 ? 423 LEU A H    3  
ATOM 5646  H HA   . LEU A 1 31  ? -12.090 5.657   -11.436 1.00 0.00 ? 423 LEU A HA   3  
ATOM 5647  H HB2  . LEU A 1 31  ? -10.944 8.423   -11.761 1.00 0.00 ? 423 LEU A HB2  3  
ATOM 5648  H HB3  . LEU A 1 31  ? -10.206 6.948   -12.339 1.00 0.00 ? 423 LEU A HB3  3  
ATOM 5649  H HG   . LEU A 1 31  ? -12.806 8.123   -13.315 1.00 0.00 ? 423 LEU A HG   3  
ATOM 5650  H HD11 . LEU A 1 31  ? -10.087 7.941   -14.596 1.00 0.00 ? 423 LEU A HD11 3  
ATOM 5651  H HD12 . LEU A 1 31  ? -11.557 8.504   -15.384 1.00 0.00 ? 423 LEU A HD12 3  
ATOM 5652  H HD13 . LEU A 1 31  ? -10.888 9.411   -14.028 1.00 0.00 ? 423 LEU A HD13 3  
ATOM 5653  H HD21 . LEU A 1 31  ? -11.286 5.679   -14.237 1.00 0.00 ? 423 LEU A HD21 3  
ATOM 5654  H HD22 . LEU A 1 31  ? -12.858 5.697   -13.435 1.00 0.00 ? 423 LEU A HD22 3  
ATOM 5655  H HD23 . LEU A 1 31  ? -12.687 6.381   -15.046 1.00 0.00 ? 423 LEU A HD23 3  
ATOM 5656  N N    . THR A 1 32  ? -10.211 5.474   -9.811  1.00 0.00 ? 424 THR A N    3  
ATOM 5657  C CA   . THR A 1 32  ? -9.203  5.261   -8.802  1.00 0.00 ? 424 THR A CA   3  
ATOM 5658  C C    . THR A 1 32  ? -8.123  6.350   -8.993  1.00 0.00 ? 424 THR A C    3  
ATOM 5659  O O    . THR A 1 32  ? -7.844  6.745   -10.134 1.00 0.00 ? 424 THR A O    3  
ATOM 5660  C CB   . THR A 1 32  ? -8.576  3.899   -9.060  1.00 0.00 ? 424 THR A CB   3  
ATOM 5661  O OG1  . THR A 1 32  ? -9.614  2.961   -9.416  1.00 0.00 ? 424 THR A OG1  3  
ATOM 5662  C CG2  . THR A 1 32  ? -7.842  3.389   -7.845  1.00 0.00 ? 424 THR A CG2  3  
ATOM 5663  H H    . THR A 1 32  ? -10.316 4.767   -10.485 1.00 0.00 ? 424 THR A H    3  
ATOM 5664  H HA   . THR A 1 32  ? -9.636  5.292   -7.814  1.00 0.00 ? 424 THR A HA   3  
ATOM 5665  H HB   . THR A 1 32  ? -7.876  4.039   -9.867  1.00 0.00 ? 424 THR A HB   3  
ATOM 5666  H HG1  . THR A 1 32  ? -9.195  2.090   -9.468  1.00 0.00 ? 424 THR A HG1  3  
ATOM 5667  H HG21 . THR A 1 32  ? -8.521  3.314   -7.009  1.00 0.00 ? 424 THR A HG21 3  
ATOM 5668  H HG22 . THR A 1 32  ? -7.407  2.424   -8.059  1.00 0.00 ? 424 THR A HG22 3  
ATOM 5669  H HG23 . THR A 1 32  ? -7.050  4.088   -7.613  1.00 0.00 ? 424 THR A HG23 3  
ATOM 5670  N N    . ARG A 1 33  ? -7.520  6.813   -7.922  1.00 0.00 ? 425 ARG A N    3  
ATOM 5671  C CA   . ARG A 1 33  ? -6.577  7.916   -8.009  1.00 0.00 ? 425 ARG A CA   3  
ATOM 5672  C C    . ARG A 1 33  ? -5.191  7.365   -8.206  1.00 0.00 ? 425 ARG A C    3  
ATOM 5673  O O    . ARG A 1 33  ? -4.877  6.318   -7.684  1.00 0.00 ? 425 ARG A O    3  
ATOM 5674  C CB   . ARG A 1 33  ? -6.634  8.749   -6.737  1.00 0.00 ? 425 ARG A CB   3  
ATOM 5675  C CG   . ARG A 1 33  ? -8.045  9.127   -6.319  1.00 0.00 ? 425 ARG A CG   3  
ATOM 5676  C CD   . ARG A 1 33  ? -8.790  9.915   -7.395  1.00 0.00 ? 425 ARG A CD   3  
ATOM 5677  N NE   . ARG A 1 33  ? -8.094  11.146  -7.811  1.00 0.00 ? 425 ARG A NE   3  
ATOM 5678  C CZ   . ARG A 1 33  ? -8.682  12.345  -7.943  1.00 0.00 ? 425 ARG A CZ   3  
ATOM 5679  N NH1  . ARG A 1 33  ? -9.850  12.587  -7.362  1.00 0.00 ? 425 ARG A NH1  3  
ATOM 5680  N NH2  . ARG A 1 33  ? -8.056  13.316  -8.580  1.00 0.00 ? 425 ARG A NH2  3  
ATOM 5681  H H    . ARG A 1 33  ? -7.649  6.374   -7.050  1.00 0.00 ? 425 ARG A H    3  
ATOM 5682  H HA   . ARG A 1 33  ? -6.843  8.532   -8.854  1.00 0.00 ? 425 ARG A HA   3  
ATOM 5683  H HB2  . ARG A 1 33  ? -6.182  8.185   -5.933  1.00 0.00 ? 425 ARG A HB2  3  
ATOM 5684  H HB3  . ARG A 1 33  ? -6.072  9.658   -6.891  1.00 0.00 ? 425 ARG A HB3  3  
ATOM 5685  H HG2  . ARG A 1 33  ? -8.574  8.193   -6.183  1.00 0.00 ? 425 ARG A HG2  3  
ATOM 5686  H HG3  . ARG A 1 33  ? -8.022  9.686   -5.396  1.00 0.00 ? 425 ARG A HG3  3  
ATOM 5687  H HD2  . ARG A 1 33  ? -8.909  9.281   -8.261  1.00 0.00 ? 425 ARG A HD2  3  
ATOM 5688  H HD3  . ARG A 1 33  ? -9.768  10.175  -7.016  1.00 0.00 ? 425 ARG A HD3  3  
ATOM 5689  H HE   . ARG A 1 33  ? -7.160  11.021  -8.095  1.00 0.00 ? 425 ARG A HE   3  
ATOM 5690  H HH11 . ARG A 1 33  ? -10.313 11.894  -6.805  1.00 0.00 ? 425 ARG A HH11 3  
ATOM 5691  H HH12 . ARG A 1 33  ? -10.331 13.464  -7.461  1.00 0.00 ? 425 ARG A HH12 3  
ATOM 5692  H HH21 . ARG A 1 33  ? -7.144  13.192  -8.979  1.00 0.00 ? 425 ARG A HH21 3  
ATOM 5693  H HH22 . ARG A 1 33  ? -8.434  14.236  -8.718  1.00 0.00 ? 425 ARG A HH22 3  
ATOM 5694  N N    . SER A 1 34  ? -4.372  8.058   -8.926  1.00 0.00 ? 426 SER A N    3  
ATOM 5695  C CA   . SER A 1 34  ? -3.075  7.558   -9.247  1.00 0.00 ? 426 SER A CA   3  
ATOM 5696  C C    . SER A 1 34  ? -1.967  8.553   -8.835  1.00 0.00 ? 426 SER A C    3  
ATOM 5697  O O    . SER A 1 34  ? -2.063  9.760   -9.102  1.00 0.00 ? 426 SER A O    3  
ATOM 5698  C CB   . SER A 1 34  ? -3.071  7.240   -10.737 1.00 0.00 ? 426 SER A CB   3  
ATOM 5699  O OG   . SER A 1 34  ? -3.479  8.386   -11.500 1.00 0.00 ? 426 SER A OG   3  
ATOM 5700  H H    . SER A 1 34  ? -4.613  8.937   -9.285  1.00 0.00 ? 426 SER A H    3  
ATOM 5701  H HA   . SER A 1 34  ? -2.931  6.637   -8.704  1.00 0.00 ? 426 SER A HA   3  
ATOM 5702  H HB2  . SER A 1 34  ? -2.109  6.866   -11.048 1.00 0.00 ? 426 SER A HB2  3  
ATOM 5703  H HB3  . SER A 1 34  ? -3.810  6.464   -10.887 1.00 0.00 ? 426 SER A HB3  3  
ATOM 5704  H HG   . SER A 1 34  ? -3.577  8.137   -12.426 1.00 0.00 ? 426 SER A HG   3  
ATOM 5705  N N    . LEU A 1 35  ? -0.954  8.052   -8.155  1.00 0.00 ? 427 LEU A N    3  
ATOM 5706  C CA   . LEU A 1 35  ? 0.153   8.868   -7.674  1.00 0.00 ? 427 LEU A CA   3  
ATOM 5707  C C    . LEU A 1 35  ? 1.501   8.199   -7.914  1.00 0.00 ? 427 LEU A C    3  
ATOM 5708  O O    . LEU A 1 35  ? 1.691   7.041   -7.554  1.00 0.00 ? 427 LEU A O    3  
ATOM 5709  C CB   . LEU A 1 35  ? -0.006  9.150   -6.179  1.00 0.00 ? 427 LEU A CB   3  
ATOM 5710  C CG   . LEU A 1 35  ? -1.064  10.174  -5.797  1.00 0.00 ? 427 LEU A CG   3  
ATOM 5711  C CD1  . LEU A 1 35  ? -1.249  10.196  -4.300  1.00 0.00 ? 427 LEU A CD1  3  
ATOM 5712  C CD2  . LEU A 1 35  ? -0.639  11.547  -6.287  1.00 0.00 ? 427 LEU A CD2  3  
ATOM 5713  H H    . LEU A 1 35  ? -0.938  7.087   -7.952  1.00 0.00 ? 427 LEU A H    3  
ATOM 5714  H HA   . LEU A 1 35  ? 0.114   9.808   -8.200  1.00 0.00 ? 427 LEU A HA   3  
ATOM 5715  H HB2  . LEU A 1 35  ? -0.245  8.220   -5.686  1.00 0.00 ? 427 LEU A HB2  3  
ATOM 5716  H HB3  . LEU A 1 35  ? 0.946   9.496   -5.807  1.00 0.00 ? 427 LEU A HB3  3  
ATOM 5717  H HG   . LEU A 1 35  ? -2.005  9.924   -6.263  1.00 0.00 ? 427 LEU A HG   3  
ATOM 5718  H HD11 . LEU A 1 35  ? -0.308  10.445  -3.832  1.00 0.00 ? 427 LEU A HD11 3  
ATOM 5719  H HD12 . LEU A 1 35  ? -1.989  10.937  -4.035  1.00 0.00 ? 427 LEU A HD12 3  
ATOM 5720  H HD13 . LEU A 1 35  ? -1.574  9.223   -3.961  1.00 0.00 ? 427 LEU A HD13 3  
ATOM 5721  H HD21 . LEU A 1 35  ? 0.357   11.755  -5.923  1.00 0.00 ? 427 LEU A HD21 3  
ATOM 5722  H HD22 . LEU A 1 35  ? -0.626  11.567  -7.366  1.00 0.00 ? 427 LEU A HD22 3  
ATOM 5723  H HD23 . LEU A 1 35  ? -1.312  12.301  -5.913  1.00 0.00 ? 427 LEU A HD23 3  
ATOM 5724  N N    . PRO A 1 36  ? 2.451   8.900   -8.553  1.00 0.00 ? 428 PRO A N    3  
ATOM 5725  C CA   . PRO A 1 36  ? 3.807   8.389   -8.742  1.00 0.00 ? 428 PRO A CA   3  
ATOM 5726  C C    . PRO A 1 36  ? 4.594   8.425   -7.419  1.00 0.00 ? 428 PRO A C    3  
ATOM 5727  O O    . PRO A 1 36  ? 4.578   9.439   -6.681  1.00 0.00 ? 428 PRO A O    3  
ATOM 5728  C CB   . PRO A 1 36  ? 4.433   9.354   -9.765  1.00 0.00 ? 428 PRO A CB   3  
ATOM 5729  C CG   . PRO A 1 36  ? 3.306   10.201  -10.257 1.00 0.00 ? 428 PRO A CG   3  
ATOM 5730  C CD   . PRO A 1 36  ? 2.286   10.222  -9.167  1.00 0.00 ? 428 PRO A CD   3  
ATOM 5731  H HA   . PRO A 1 36  ? 3.799   7.382   -9.128  1.00 0.00 ? 428 PRO A HA   3  
ATOM 5732  H HB2  . PRO A 1 36  ? 5.188   9.949   -9.273  1.00 0.00 ? 428 PRO A HB2  3  
ATOM 5733  H HB3  . PRO A 1 36  ? 4.884   8.789   -10.568 1.00 0.00 ? 428 PRO A HB3  3  
ATOM 5734  H HG2  . PRO A 1 36  ? 3.656   11.203  -10.458 1.00 0.00 ? 428 PRO A HG2  3  
ATOM 5735  H HG3  . PRO A 1 36  ? 2.888   9.767   -11.153 1.00 0.00 ? 428 PRO A HG3  3  
ATOM 5736  H HD2  . PRO A 1 36  ? 2.496   11.014  -8.463  1.00 0.00 ? 428 PRO A HD2  3  
ATOM 5737  H HD3  . PRO A 1 36  ? 1.304   10.337  -9.601  1.00 0.00 ? 428 PRO A HD3  3  
ATOM 5738  N N    . CYS A 1 37  ? 5.276   7.360   -7.123  1.00 0.00 ? 429 CYS A N    3  
ATOM 5739  C CA   . CYS A 1 37  ? 6.006   7.245   -5.895  1.00 0.00 ? 429 CYS A CA   3  
ATOM 5740  C C    . CYS A 1 37  ? 7.322   6.523   -6.119  1.00 0.00 ? 429 CYS A C    3  
ATOM 5741  O O    . CYS A 1 37  ? 7.509   5.846   -7.142  1.00 0.00 ? 429 CYS A O    3  
ATOM 5742  C CB   . CYS A 1 37  ? 5.152   6.509   -4.854  1.00 0.00 ? 429 CYS A CB   3  
ATOM 5743  S SG   . CYS A 1 37  ? 4.516   4.909   -5.411  1.00 0.00 ? 429 CYS A SG   3  
ATOM 5744  H H    . CYS A 1 37  ? 5.320   6.604   -7.755  1.00 0.00 ? 429 CYS A H    3  
ATOM 5745  H HA   . CYS A 1 37  ? 6.205   8.242   -5.531  1.00 0.00 ? 429 CYS A HA   3  
ATOM 5746  H HB2  . CYS A 1 37  ? 5.749   6.332   -3.971  1.00 0.00 ? 429 CYS A HB2  3  
ATOM 5747  H HB3  . CYS A 1 37  ? 4.306   7.127   -4.591  1.00 0.00 ? 429 CYS A HB3  3  
ATOM 5748  H HG   . CYS A 1 37  ? 4.692   4.835   -6.724  1.00 0.00 ? 429 CYS A HG   3  
ATOM 5749  N N    . GLN A 1 38  ? 8.222   6.683   -5.189  1.00 0.00 ? 430 GLN A N    3  
ATOM 5750  C CA   . GLN A 1 38  ? 9.489   6.023   -5.227  1.00 0.00 ? 430 GLN A CA   3  
ATOM 5751  C C    . GLN A 1 38  ? 9.561   5.114   -4.030  1.00 0.00 ? 430 GLN A C    3  
ATOM 5752  O O    . GLN A 1 38  ? 9.280   5.535   -2.891  1.00 0.00 ? 430 GLN A O    3  
ATOM 5753  C CB   . GLN A 1 38  ? 10.638  7.034   -5.193  1.00 0.00 ? 430 GLN A CB   3  
ATOM 5754  C CG   . GLN A 1 38  ? 10.650  8.001   -6.368  1.00 0.00 ? 430 GLN A CG   3  
ATOM 5755  C CD   . GLN A 1 38  ? 11.831  8.938   -6.330  1.00 0.00 ? 430 GLN A CD   3  
ATOM 5756  O OE1  . GLN A 1 38  ? 12.895  8.637   -6.872  1.00 0.00 ? 430 GLN A OE1  3  
ATOM 5757  N NE2  . GLN A 1 38  ? 11.672  10.076  -5.699  1.00 0.00 ? 430 GLN A NE2  3  
ATOM 5758  H H    . GLN A 1 38  ? 8.033   7.259   -4.414  1.00 0.00 ? 430 GLN A H    3  
ATOM 5759  H HA   . GLN A 1 38  ? 9.544   5.438   -6.133  1.00 0.00 ? 430 GLN A HA   3  
ATOM 5760  H HB2  . GLN A 1 38  ? 10.570  7.611   -4.282  1.00 0.00 ? 430 GLN A HB2  3  
ATOM 5761  H HB3  . GLN A 1 38  ? 11.574  6.494   -5.191  1.00 0.00 ? 430 GLN A HB3  3  
ATOM 5762  H HG2  . GLN A 1 38  ? 10.689  7.430   -7.284  1.00 0.00 ? 430 GLN A HG2  3  
ATOM 5763  H HG3  . GLN A 1 38  ? 9.742   8.586   -6.349  1.00 0.00 ? 430 GLN A HG3  3  
ATOM 5764  H HE21 . GLN A 1 38  ? 10.809  10.290  -5.276  1.00 0.00 ? 430 GLN A HE21 3  
ATOM 5765  H HE22 . GLN A 1 38  ? 12.426  10.697  -5.646  1.00 0.00 ? 430 GLN A HE22 3  
ATOM 5766  N N    . VAL A 1 39  ? 9.911   3.889   -4.277  1.00 0.00 ? 431 VAL A N    3  
ATOM 5767  C CA   . VAL A 1 39  ? 9.944   2.888   -3.266  1.00 0.00 ? 431 VAL A CA   3  
ATOM 5768  C C    . VAL A 1 39  ? 11.359  2.460   -2.995  1.00 0.00 ? 431 VAL A C    3  
ATOM 5769  O O    . VAL A 1 39  ? 12.111  2.054   -3.910  1.00 0.00 ? 431 VAL A O    3  
ATOM 5770  C CB   . VAL A 1 39  ? 9.101   1.649   -3.671  1.00 0.00 ? 431 VAL A CB   3  
ATOM 5771  C CG1  . VAL A 1 39  ? 9.089   0.591   -2.571  1.00 0.00 ? 431 VAL A CG1  3  
ATOM 5772  C CG2  . VAL A 1 39  ? 7.694   2.071   -4.024  1.00 0.00 ? 431 VAL A CG2  3  
ATOM 5773  H H    . VAL A 1 39  ? 10.171  3.627   -5.191  1.00 0.00 ? 431 VAL A H    3  
ATOM 5774  H HA   . VAL A 1 39  ? 9.519   3.302   -2.364  1.00 0.00 ? 431 VAL A HA   3  
ATOM 5775  H HB   . VAL A 1 39  ? 9.547   1.205   -4.548  1.00 0.00 ? 431 VAL A HB   3  
ATOM 5776  H HG11 . VAL A 1 39  ? 10.101  0.268   -2.375  1.00 0.00 ? 431 VAL A HG11 3  
ATOM 5777  H HG12 . VAL A 1 39  ? 8.660   1.007   -1.672  1.00 0.00 ? 431 VAL A HG12 3  
ATOM 5778  H HG13 . VAL A 1 39  ? 8.501   -0.256  -2.892  1.00 0.00 ? 431 VAL A HG13 3  
ATOM 5779  H HG21 . VAL A 1 39  ? 7.274   2.612   -3.188  1.00 0.00 ? 431 VAL A HG21 3  
ATOM 5780  H HG22 . VAL A 1 39  ? 7.708   2.716   -4.890  1.00 0.00 ? 431 VAL A HG22 3  
ATOM 5781  H HG23 . VAL A 1 39  ? 7.086   1.201   -4.220  1.00 0.00 ? 431 VAL A HG23 3  
ATOM 5782  N N    . TYR A 1 40  ? 11.723  2.574   -1.773  1.00 0.00 ? 432 TYR A N    3  
ATOM 5783  C CA   . TYR A 1 40  ? 12.985  2.141   -1.302  1.00 0.00 ? 432 TYR A CA   3  
ATOM 5784  C C    . TYR A 1 40  ? 12.743  0.915   -0.484  1.00 0.00 ? 432 TYR A C    3  
ATOM 5785  O O    . TYR A 1 40  ? 11.649  0.744   0.041   1.00 0.00 ? 432 TYR A O    3  
ATOM 5786  C CB   . TYR A 1 40  ? 13.607  3.192   -0.404  1.00 0.00 ? 432 TYR A CB   3  
ATOM 5787  C CG   . TYR A 1 40  ? 13.815  4.538   -1.040  1.00 0.00 ? 432 TYR A CG   3  
ATOM 5788  C CD1  . TYR A 1 40  ? 12.867  5.544   -0.901  1.00 0.00 ? 432 TYR A CD1  3  
ATOM 5789  C CD2  . TYR A 1 40  ? 14.964  4.807   -1.756  1.00 0.00 ? 432 TYR A CD2  3  
ATOM 5790  C CE1  . TYR A 1 40  ? 13.062  6.787   -1.456  1.00 0.00 ? 432 TYR A CE1  3  
ATOM 5791  C CE2  . TYR A 1 40  ? 15.169  6.052   -2.322  1.00 0.00 ? 432 TYR A CE2  3  
ATOM 5792  C CZ   . TYR A 1 40  ? 14.212  7.039   -2.167  1.00 0.00 ? 432 TYR A CZ   3  
ATOM 5793  O OH   . TYR A 1 40  ? 14.417  8.289   -2.712  1.00 0.00 ? 432 TYR A OH   3  
ATOM 5794  H H    . TYR A 1 40  ? 11.089  2.963   -1.126  1.00 0.00 ? 432 TYR A H    3  
ATOM 5795  H HA   . TYR A 1 40  ? 13.645  1.932   -2.129  1.00 0.00 ? 432 TYR A HA   3  
ATOM 5796  H HB2  . TYR A 1 40  ? 12.972  3.336   0.456   1.00 0.00 ? 432 TYR A HB2  3  
ATOM 5797  H HB3  . TYR A 1 40  ? 14.567  2.832   -0.067  1.00 0.00 ? 432 TYR A HB3  3  
ATOM 5798  H HD1  . TYR A 1 40  ? 11.967  5.338   -0.342  1.00 0.00 ? 432 TYR A HD1  3  
ATOM 5799  H HD2  . TYR A 1 40  ? 15.692  4.014   -1.862  1.00 0.00 ? 432 TYR A HD2  3  
ATOM 5800  H HE1  . TYR A 1 40  ? 12.314  7.556   -1.337  1.00 0.00 ? 432 TYR A HE1  3  
ATOM 5801  H HE2  . TYR A 1 40  ? 16.073  6.251   -2.879  1.00 0.00 ? 432 TYR A HE2  3  
ATOM 5802  H HH   . TYR A 1 40  ? 14.773  8.167   -3.602  1.00 0.00 ? 432 TYR A HH   3  
ATOM 5803  N N    . VAL A 1 41  ? 13.717  0.085   -0.359  1.00 0.00 ? 433 VAL A N    3  
ATOM 5804  C CA   . VAL A 1 41  ? 13.588  -1.083  0.454   1.00 0.00 ? 433 VAL A CA   3  
ATOM 5805  C C    . VAL A 1 41  ? 14.658  -1.079  1.519   1.00 0.00 ? 433 VAL A C    3  
ATOM 5806  O O    . VAL A 1 41  ? 15.757  -0.562  1.303   1.00 0.00 ? 433 VAL A O    3  
ATOM 5807  C CB   . VAL A 1 41  ? 13.692  -2.396  -0.393  1.00 0.00 ? 433 VAL A CB   3  
ATOM 5808  C CG1  . VAL A 1 41  ? 12.492  -2.559  -1.312  1.00 0.00 ? 433 VAL A CG1  3  
ATOM 5809  C CG2  . VAL A 1 41  ? 14.974  -2.409  -1.216  1.00 0.00 ? 433 VAL A CG2  3  
ATOM 5810  H H    . VAL A 1 41  ? 14.573  0.253   -0.816  1.00 0.00 ? 433 VAL A H    3  
ATOM 5811  H HA   . VAL A 1 41  ? 12.618  -1.057  0.921   1.00 0.00 ? 433 VAL A HA   3  
ATOM 5812  H HB   . VAL A 1 41  ? 13.718  -3.236  0.286   1.00 0.00 ? 433 VAL A HB   3  
ATOM 5813  H HG11 . VAL A 1 41  ? 12.431  -1.705  -1.969  1.00 0.00 ? 433 VAL A HG11 3  
ATOM 5814  H HG12 . VAL A 1 41  ? 12.615  -3.452  -1.907  1.00 0.00 ? 433 VAL A HG12 3  
ATOM 5815  H HG13 . VAL A 1 41  ? 11.581  -2.633  -0.740  1.00 0.00 ? 433 VAL A HG13 3  
ATOM 5816  H HG21 . VAL A 1 41  ? 15.068  -1.477  -1.754  1.00 0.00 ? 433 VAL A HG21 3  
ATOM 5817  H HG22 . VAL A 1 41  ? 15.828  -2.554  -0.571  1.00 0.00 ? 433 VAL A HG22 3  
ATOM 5818  H HG23 . VAL A 1 41  ? 14.917  -3.207  -1.941  1.00 0.00 ? 433 VAL A HG23 3  
ATOM 5819  N N    . ASN A 1 42  ? 14.277  -1.470  2.695   1.00 0.00 ? 434 ASN A N    3  
ATOM 5820  C CA   . ASN A 1 42  ? 15.192  -1.750  3.745   1.00 0.00 ? 434 ASN A CA   3  
ATOM 5821  C C    . ASN A 1 42  ? 15.437  -3.262  3.821   1.00 0.00 ? 434 ASN A C    3  
ATOM 5822  O O    . ASN A 1 42  ? 14.433  -4.082  4.004   1.00 0.00 ? 434 ASN A O    3  
ATOM 5823  C CB   . ASN A 1 42  ? 14.766  -1.132  5.084   1.00 0.00 ? 434 ASN A CB   3  
ATOM 5824  C CG   . ASN A 1 42  ? 15.711  -1.459  6.241   1.00 0.00 ? 434 ASN A CG   3  
ATOM 5825  O OD1  . ASN A 1 42  ? 16.926  -1.651  6.058   1.00 0.00 ? 434 ASN A OD1  3  
ATOM 5826  N ND2  . ASN A 1 42  ? 15.173  -1.518  7.435   1.00 0.00 ? 434 ASN A ND2  3  
ATOM 5827  H H    . ASN A 1 42  ? 13.324  -1.649  2.843   1.00 0.00 ? 434 ASN A H    3  
ATOM 5828  H HA   . ASN A 1 42  ? 16.127  -1.307  3.430   1.00 0.00 ? 434 ASN A HA   3  
ATOM 5829  H HB2  . ASN A 1 42  ? 14.762  -0.058  4.965   1.00 0.00 ? 434 ASN A HB2  3  
ATOM 5830  H HB3  . ASN A 1 42  ? 13.768  -1.445  5.335   1.00 0.00 ? 434 ASN A HB3  3  
ATOM 5831  H HD21 . ASN A 1 42  ? 14.212  -1.356  7.521   1.00 0.00 ? 434 ASN A HD21 3  
ATOM 5832  H HD22 . ASN A 1 42  ? 15.748  -1.702  8.208   1.00 0.00 ? 434 ASN A HD22 3  
ATOM 5833  N N    . HIS A 1 43  ? 16.749  -3.547  3.867   1.00 0.00 ? 435 HIS A N    3  
ATOM 5834  C CA   . HIS A 1 43  ? 17.475  -4.842  3.756   1.00 0.00 ? 435 HIS A CA   3  
ATOM 5835  C C    . HIS A 1 43  ? 16.685  -6.147  4.011   1.00 0.00 ? 435 HIS A C    3  
ATOM 5836  O O    . HIS A 1 43  ? 15.769  -6.221  4.845   1.00 0.00 ? 435 HIS A O    3  
ATOM 5837  C CB   . HIS A 1 43  ? 18.708  -4.833  4.659   1.00 0.00 ? 435 HIS A CB   3  
ATOM 5838  C CG   . HIS A 1 43  ? 19.733  -3.815  4.287   1.00 0.00 ? 435 HIS A CG   3  
ATOM 5839  N ND1  . HIS A 1 43  ? 19.731  -2.514  4.748   1.00 0.00 ? 435 HIS A ND1  3  
ATOM 5840  C CD2  . HIS A 1 43  ? 20.810  -3.925  3.473   1.00 0.00 ? 435 HIS A CD2  3  
ATOM 5841  C CE1  . HIS A 1 43  ? 20.771  -1.890  4.210   1.00 0.00 ? 435 HIS A CE1  3  
ATOM 5842  N NE2  . HIS A 1 43  ? 21.471  -2.700  3.426   1.00 0.00 ? 435 HIS A NE2  3  
ATOM 5843  H H    . HIS A 1 43  ? 17.323  -2.762  3.975   1.00 0.00 ? 435 HIS A H    3  
ATOM 5844  H HA   . HIS A 1 43  ? 17.856  -4.794  2.741   1.00 0.00 ? 435 HIS A HA   3  
ATOM 5845  H HB2  . HIS A 1 43  ? 18.394  -4.624  5.671   1.00 0.00 ? 435 HIS A HB2  3  
ATOM 5846  H HB3  . HIS A 1 43  ? 19.172  -5.807  4.629   1.00 0.00 ? 435 HIS A HB3  3  
ATOM 5847  H HD1  . HIS A 1 43  ? 19.091  -2.111  5.375   1.00 0.00 ? 435 HIS A HD1  3  
ATOM 5848  H HD2  . HIS A 1 43  ? 21.116  -4.814  2.940   1.00 0.00 ? 435 HIS A HD2  3  
ATOM 5849  H HE1  . HIS A 1 43  ? 21.012  -0.849  4.357   1.00 0.00 ? 435 HIS A HE1  3  
ATOM 5850  N N    . GLY A 1 44  ? 17.162  -7.222  3.381   1.00 0.00 ? 436 GLY A N    3  
ATOM 5851  C CA   . GLY A 1 44  ? 16.508  -8.513  3.500   1.00 0.00 ? 436 GLY A CA   3  
ATOM 5852  C C    . GLY A 1 44  ? 15.855  -8.926  2.198   1.00 0.00 ? 436 GLY A C    3  
ATOM 5853  O O    . GLY A 1 44  ? 15.230  -9.996  2.085   1.00 0.00 ? 436 GLY A O    3  
ATOM 5854  H H    . GLY A 1 44  ? 17.954  -7.115  2.813   1.00 0.00 ? 436 GLY A H    3  
ATOM 5855  H HA2  . GLY A 1 44  ? 17.247  -9.249  3.776   1.00 0.00 ? 436 GLY A HA2  3  
ATOM 5856  H HA3  . GLY A 1 44  ? 15.754  -8.459  4.272   1.00 0.00 ? 436 GLY A HA3  3  
ATOM 5857  N N    . GLU A 1 45  ? 15.969  -8.073  1.243   1.00 0.00 ? 437 GLU A N    3  
ATOM 5858  C CA   . GLU A 1 45  ? 15.321  -8.219  -0.021  1.00 0.00 ? 437 GLU A CA   3  
ATOM 5859  C C    . GLU A 1 45  ? 16.212  -8.826  -1.123  1.00 0.00 ? 437 GLU A C    3  
ATOM 5860  O O    . GLU A 1 45  ? 17.433  -8.660  -1.141  1.00 0.00 ? 437 GLU A O    3  
ATOM 5861  C CB   . GLU A 1 45  ? 14.837  -6.833  -0.502  1.00 0.00 ? 437 GLU A CB   3  
ATOM 5862  C CG   . GLU A 1 45  ? 15.955  -5.851  -0.922  1.00 0.00 ? 437 GLU A CG   3  
ATOM 5863  C CD   . GLU A 1 45  ? 16.934  -5.497  0.186   1.00 0.00 ? 437 GLU A CD   3  
ATOM 5864  O OE1  . GLU A 1 45  ? 16.650  -4.618  0.946   1.00 0.00 ? 437 GLU A OE1  3  
ATOM 5865  O OE2  . GLU A 1 45  ? 18.011  -6.164  0.305   1.00 0.00 ? 437 GLU A OE2  3  
ATOM 5866  H H    . GLU A 1 45  ? 16.536  -7.280  1.377   1.00 0.00 ? 437 GLU A H    3  
ATOM 5867  H HA   . GLU A 1 45  ? 14.439  -8.825  0.108   1.00 0.00 ? 437 GLU A HA   3  
ATOM 5868  H HB2  . GLU A 1 45  ? 14.178  -6.965  -1.348  1.00 0.00 ? 437 GLU A HB2  3  
ATOM 5869  H HB3  . GLU A 1 45  ? 14.279  -6.371  0.300   1.00 0.00 ? 437 GLU A HB3  3  
ATOM 5870  H HG2  . GLU A 1 45  ? 16.510  -6.298  -1.733  1.00 0.00 ? 437 GLU A HG2  3  
ATOM 5871  H HG3  . GLU A 1 45  ? 15.488  -4.946  -1.279  1.00 0.00 ? 437 GLU A HG3  3  
ATOM 5872  N N    . ASN A 1 46  ? 15.578  -9.579  -1.980  1.00 0.00 ? 438 ASN A N    3  
ATOM 5873  C CA   . ASN A 1 46  ? 16.109  -9.895  -3.285  1.00 0.00 ? 438 ASN A CA   3  
ATOM 5874  C C    . ASN A 1 46  ? 14.939  -10.229 -4.152  1.00 0.00 ? 438 ASN A C    3  
ATOM 5875  O O    . ASN A 1 46  ? 14.405  -11.337 -4.122  1.00 0.00 ? 438 ASN A O    3  
ATOM 5876  C CB   . ASN A 1 46  ? 17.115  -11.063 -3.297  1.00 0.00 ? 438 ASN A CB   3  
ATOM 5877  C CG   . ASN A 1 46  ? 17.584  -11.409 -4.722  1.00 0.00 ? 438 ASN A CG   3  
ATOM 5878  O OD1  . ASN A 1 46  ? 17.645  -10.549 -5.609  1.00 0.00 ? 438 ASN A OD1  3  
ATOM 5879  N ND2  . ASN A 1 46  ? 17.898  -12.658 -4.957  1.00 0.00 ? 438 ASN A ND2  3  
ATOM 5880  H H    . ASN A 1 46  ? 14.711  -9.970  -1.748  1.00 0.00 ? 438 ASN A H    3  
ATOM 5881  H HA   . ASN A 1 46  ? 16.573  -8.998  -3.669  1.00 0.00 ? 438 ASN A HA   3  
ATOM 5882  H HB2  . ASN A 1 46  ? 17.978  -10.796 -2.704  1.00 0.00 ? 438 ASN A HB2  3  
ATOM 5883  H HB3  . ASN A 1 46  ? 16.645  -11.937 -2.874  1.00 0.00 ? 438 ASN A HB3  3  
ATOM 5884  H HD21 . ASN A 1 46  ? 17.815  -13.300 -4.221  1.00 0.00 ? 438 ASN A HD21 3  
ATOM 5885  H HD22 . ASN A 1 46  ? 18.218  -12.905 -5.852  1.00 0.00 ? 438 ASN A HD22 3  
ATOM 5886  N N    . LEU A 1 47  ? 14.481  -9.235  -4.818  1.00 0.00 ? 439 LEU A N    3  
ATOM 5887  C CA   . LEU A 1 47  ? 13.443  -9.341  -5.781  1.00 0.00 ? 439 LEU A CA   3  
ATOM 5888  C C    . LEU A 1 47  ? 13.773  -8.411  -6.903  1.00 0.00 ? 439 LEU A C    3  
ATOM 5889  O O    . LEU A 1 47  ? 14.379  -7.358  -6.661  1.00 0.00 ? 439 LEU A O    3  
ATOM 5890  C CB   . LEU A 1 47  ? 12.027  -9.071  -5.179  1.00 0.00 ? 439 LEU A CB   3  
ATOM 5891  C CG   . LEU A 1 47  ? 11.668  -7.655  -4.648  1.00 0.00 ? 439 LEU A CG   3  
ATOM 5892  C CD1  . LEU A 1 47  ? 10.237  -7.654  -4.163  1.00 0.00 ? 439 LEU A CD1  3  
ATOM 5893  C CD2  . LEU A 1 47  ? 12.571  -7.198  -3.511  1.00 0.00 ? 439 LEU A CD2  3  
ATOM 5894  H H    . LEU A 1 47  ? 14.880  -8.345  -4.692  1.00 0.00 ? 439 LEU A H    3  
ATOM 5895  H HA   . LEU A 1 47  ? 13.481  -10.349 -6.169  1.00 0.00 ? 439 LEU A HA   3  
ATOM 5896  H HB2  . LEU A 1 47  ? 11.307  -9.296  -5.950  1.00 0.00 ? 439 LEU A HB2  3  
ATOM 5897  H HB3  . LEU A 1 47  ? 11.884  -9.775  -4.373  1.00 0.00 ? 439 LEU A HB3  3  
ATOM 5898  H HG   . LEU A 1 47  ? 11.738  -6.948  -5.462  1.00 0.00 ? 439 LEU A HG   3  
ATOM 5899  H HD11 . LEU A 1 47  ? 10.116  -8.419  -3.409  1.00 0.00 ? 439 LEU A HD11 3  
ATOM 5900  H HD12 . LEU A 1 47  ? 10.022  -6.692  -3.721  1.00 0.00 ? 439 LEU A HD12 3  
ATOM 5901  H HD13 . LEU A 1 47  ? 9.567   -7.846  -4.987  1.00 0.00 ? 439 LEU A HD13 3  
ATOM 5902  H HD21 . LEU A 1 47  ? 12.494  -7.890  -2.686  1.00 0.00 ? 439 LEU A HD21 3  
ATOM 5903  H HD22 . LEU A 1 47  ? 13.592  -7.152  -3.859  1.00 0.00 ? 439 LEU A HD22 3  
ATOM 5904  H HD23 . LEU A 1 47  ? 12.254  -6.217  -3.190  1.00 0.00 ? 439 LEU A HD23 3  
ATOM 5905  N N    . LYS A 1 48  ? 13.434  -8.749  -8.092  1.00 0.00 ? 440 LYS A N    3  
ATOM 5906  C CA   . LYS A 1 48  ? 13.662  -7.832  -9.152  1.00 0.00 ? 440 LYS A CA   3  
ATOM 5907  C C    . LYS A 1 48  ? 12.370  -7.144  -9.534  1.00 0.00 ? 440 LYS A C    3  
ATOM 5908  O O    . LYS A 1 48  ? 11.345  -7.783  -9.753  1.00 0.00 ? 440 LYS A O    3  
ATOM 5909  C CB   . LYS A 1 48  ? 14.400  -8.470  -10.336 1.00 0.00 ? 440 LYS A CB   3  
ATOM 5910  C CG   . LYS A 1 48  ? 13.712  -9.638  -11.016 1.00 0.00 ? 440 LYS A CG   3  
ATOM 5911  C CD   . LYS A 1 48  ? 14.637  -10.282 -12.045 1.00 0.00 ? 440 LYS A CD   3  
ATOM 5912  C CE   . LYS A 1 48  ? 15.093  -9.286  -13.106 1.00 0.00 ? 440 LYS A CE   3  
ATOM 5913  N NZ   . LYS A 1 48  ? 16.092  -9.847  -14.036 1.00 0.00 ? 440 LYS A NZ   3  
ATOM 5914  H H    . LYS A 1 48  ? 13.020  -9.620  -8.270  1.00 0.00 ? 440 LYS A H    3  
ATOM 5915  H HA   . LYS A 1 48  ? 14.292  -7.065  -8.725  1.00 0.00 ? 440 LYS A HA   3  
ATOM 5916  H HB2  . LYS A 1 48  ? 14.532  -7.699  -11.079 1.00 0.00 ? 440 LYS A HB2  3  
ATOM 5917  H HB3  . LYS A 1 48  ? 15.376  -8.793  -10.004 1.00 0.00 ? 440 LYS A HB3  3  
ATOM 5918  H HG2  . LYS A 1 48  ? 13.450  -10.373 -10.268 1.00 0.00 ? 440 LYS A HG2  3  
ATOM 5919  H HG3  . LYS A 1 48  ? 12.819  -9.286  -11.511 1.00 0.00 ? 440 LYS A HG3  3  
ATOM 5920  H HD2  . LYS A 1 48  ? 15.499  -10.681 -11.534 1.00 0.00 ? 440 LYS A HD2  3  
ATOM 5921  H HD3  . LYS A 1 48  ? 14.104  -11.087 -12.527 1.00 0.00 ? 440 LYS A HD3  3  
ATOM 5922  H HE2  . LYS A 1 48  ? 14.237  -8.977  -13.686 1.00 0.00 ? 440 LYS A HE2  3  
ATOM 5923  H HE3  . LYS A 1 48  ? 15.520  -8.423  -12.618 1.00 0.00 ? 440 LYS A HE3  3  
ATOM 5924  H HZ1  . LYS A 1 48  ? 15.747  -10.723 -14.474 1.00 0.00 ? 440 LYS A HZ1  3  
ATOM 5925  H HZ2  . LYS A 1 48  ? 16.272  -9.161  -14.799 1.00 0.00 ? 440 LYS A HZ2  3  
ATOM 5926  H HZ3  . LYS A 1 48  ? 16.991  -10.036 -13.551 1.00 0.00 ? 440 LYS A HZ3  3  
ATOM 5927  N N    . THR A 1 49  ? 12.425  -5.847  -9.595  1.00 0.00 ? 441 THR A N    3  
ATOM 5928  C CA   . THR A 1 49  ? 11.286  -5.004  -9.854  1.00 0.00 ? 441 THR A CA   3  
ATOM 5929  C C    . THR A 1 49  ? 11.009  -4.882  -11.359 1.00 0.00 ? 441 THR A C    3  
ATOM 5930  O O    . THR A 1 49  ? 10.084  -4.191  -11.803 1.00 0.00 ? 441 THR A O    3  
ATOM 5931  C CB   . THR A 1 49  ? 11.573  -3.653  -9.222  1.00 0.00 ? 441 THR A CB   3  
ATOM 5932  O OG1  . THR A 1 49  ? 12.931  -3.316  -9.532  1.00 0.00 ? 441 THR A OG1  3  
ATOM 5933  C CG2  . THR A 1 49  ? 11.413  -3.740  -7.709  1.00 0.00 ? 441 THR A CG2  3  
ATOM 5934  H H    . THR A 1 49  ? 13.271  -5.362  -9.468  1.00 0.00 ? 441 THR A H    3  
ATOM 5935  H HA   . THR A 1 49  ? 10.427  -5.434  -9.363  1.00 0.00 ? 441 THR A HA   3  
ATOM 5936  H HB   . THR A 1 49  ? 10.897  -2.911  -9.621  1.00 0.00 ? 441 THR A HB   3  
ATOM 5937  H HG1  . THR A 1 49  ? 12.993  -2.372  -9.716  1.00 0.00 ? 441 THR A HG1  3  
ATOM 5938  H HG21 . THR A 1 49  ? 12.022  -4.547  -7.328  1.00 0.00 ? 441 THR A HG21 3  
ATOM 5939  H HG22 . THR A 1 49  ? 11.715  -2.809  -7.253  1.00 0.00 ? 441 THR A HG22 3  
ATOM 5940  H HG23 . THR A 1 49  ? 10.379  -3.938  -7.468  1.00 0.00 ? 441 THR A HG23 3  
ATOM 5941  N N    . GLU A 1 50  ? 11.828  -5.573  -12.124 1.00 0.00 ? 442 GLU A N    3  
ATOM 5942  C CA   . GLU A 1 50  ? 11.692  -5.693  -13.564 1.00 0.00 ? 442 GLU A CA   3  
ATOM 5943  C C    . GLU A 1 50  ? 10.385  -6.426  -13.901 1.00 0.00 ? 442 GLU A C    3  
ATOM 5944  O O    . GLU A 1 50  ? 9.758   -6.178  -14.936 1.00 0.00 ? 442 GLU A O    3  
ATOM 5945  C CB   . GLU A 1 50  ? 12.866  -6.517  -14.073 1.00 0.00 ? 442 GLU A CB   3  
ATOM 5946  C CG   . GLU A 1 50  ? 12.964  -6.685  -15.577 1.00 0.00 ? 442 GLU A CG   3  
ATOM 5947  C CD   . GLU A 1 50  ? 14.052  -7.658  -15.944 1.00 0.00 ? 442 GLU A CD   3  
ATOM 5948  O OE1  . GLU A 1 50  ? 15.246  -7.314  -15.828 1.00 0.00 ? 442 GLU A OE1  3  
ATOM 5949  O OE2  . GLU A 1 50  ? 13.738  -8.803  -16.311 1.00 0.00 ? 442 GLU A OE2  3  
ATOM 5950  H H    . GLU A 1 50  ? 12.598  -5.984  -11.675 1.00 0.00 ? 442 GLU A H    3  
ATOM 5951  H HA   . GLU A 1 50  ? 11.720  -4.717  -14.021 1.00 0.00 ? 442 GLU A HA   3  
ATOM 5952  H HB2  . GLU A 1 50  ? 13.775  -6.047  -13.736 1.00 0.00 ? 442 GLU A HB2  3  
ATOM 5953  H HB3  . GLU A 1 50  ? 12.799  -7.496  -13.624 1.00 0.00 ? 442 GLU A HB3  3  
ATOM 5954  H HG2  . GLU A 1 50  ? 12.022  -7.056  -15.953 1.00 0.00 ? 442 GLU A HG2  3  
ATOM 5955  H HG3  . GLU A 1 50  ? 13.185  -5.727  -16.026 1.00 0.00 ? 442 GLU A HG3  3  
ATOM 5956  N N    . GLN A 1 51  ? 9.981   -7.306  -13.002 1.00 0.00 ? 443 GLN A N    3  
ATOM 5957  C CA   . GLN A 1 51  ? 8.805   -8.135  -13.185 1.00 0.00 ? 443 GLN A CA   3  
ATOM 5958  C C    . GLN A 1 51  ? 7.620   -7.574  -12.391 1.00 0.00 ? 443 GLN A C    3  
ATOM 5959  O O    . GLN A 1 51  ? 6.627   -8.256  -12.153 1.00 0.00 ? 443 GLN A O    3  
ATOM 5960  C CB   . GLN A 1 51  ? 9.133   -9.571  -12.761 1.00 0.00 ? 443 GLN A CB   3  
ATOM 5961  C CG   . GLN A 1 51  ? 9.533   -9.710  -11.302 1.00 0.00 ? 443 GLN A CG   3  
ATOM 5962  C CD   . GLN A 1 51  ? 10.089  -11.075 -10.952 1.00 0.00 ? 443 GLN A CD   3  
ATOM 5963  O OE1  . GLN A 1 51  ? 10.906  -11.207 -10.043 1.00 0.00 ? 443 GLN A OE1  3  
ATOM 5964  N NE2  . GLN A 1 51  ? 9.682   -12.089 -11.668 1.00 0.00 ? 443 GLN A NE2  3  
ATOM 5965  H H    . GLN A 1 51  ? 10.493  -7.395  -12.169 1.00 0.00 ? 443 GLN A H    3  
ATOM 5966  H HA   . GLN A 1 51  ? 8.556   -8.130  -14.235 1.00 0.00 ? 443 GLN A HA   3  
ATOM 5967  H HB2  . GLN A 1 51  ? 8.262   -10.187 -12.930 1.00 0.00 ? 443 GLN A HB2  3  
ATOM 5968  H HB3  . GLN A 1 51  ? 9.943   -9.936  -13.374 1.00 0.00 ? 443 GLN A HB3  3  
ATOM 5969  H HG2  . GLN A 1 51  ? 10.288  -8.972  -11.078 1.00 0.00 ? 443 GLN A HG2  3  
ATOM 5970  H HG3  . GLN A 1 51  ? 8.663   -9.524  -10.688 1.00 0.00 ? 443 GLN A HG3  3  
ATOM 5971  H HE21 . GLN A 1 51  ? 9.042   -11.935 -12.396 1.00 0.00 ? 443 GLN A HE21 3  
ATOM 5972  H HE22 . GLN A 1 51  ? 10.020  -12.987 -11.465 1.00 0.00 ? 443 GLN A HE22 3  
ATOM 5973  N N    . TRP A 1 52  ? 7.742   -6.327  -12.003 1.00 0.00 ? 444 TRP A N    3  
ATOM 5974  C CA   . TRP A 1 52  ? 6.699   -5.627  -11.287 1.00 0.00 ? 444 TRP A CA   3  
ATOM 5975  C C    . TRP A 1 52  ? 5.857   -4.819  -12.247 1.00 0.00 ? 444 TRP A C    3  
ATOM 5976  O O    . TRP A 1 52  ? 6.391   -4.270  -13.224 1.00 0.00 ? 444 TRP A O    3  
ATOM 5977  C CB   . TRP A 1 52  ? 7.291   -4.670  -10.247 1.00 0.00 ? 444 TRP A CB   3  
ATOM 5978  C CG   . TRP A 1 52  ? 7.645   -5.295  -8.938  1.00 0.00 ? 444 TRP A CG   3  
ATOM 5979  C CD1  . TRP A 1 52  ? 8.071   -6.570  -8.709  1.00 0.00 ? 444 TRP A CD1  3  
ATOM 5980  C CD2  . TRP A 1 52  ? 7.617   -4.643  -7.667  1.00 0.00 ? 444 TRP A CD2  3  
ATOM 5981  N NE1  . TRP A 1 52  ? 8.284   -6.759  -7.368  1.00 0.00 ? 444 TRP A NE1  3  
ATOM 5982  C CE2  . TRP A 1 52  ? 8.016   -5.583  -6.706  1.00 0.00 ? 444 TRP A CE2  3  
ATOM 5983  C CE3  . TRP A 1 52  ? 7.284   -3.345  -7.251  1.00 0.00 ? 444 TRP A CE3  3  
ATOM 5984  C CZ2  . TRP A 1 52  ? 8.092   -5.270  -5.350  1.00 0.00 ? 444 TRP A CZ2  3  
ATOM 5985  C CZ3  . TRP A 1 52  ? 7.364   -3.035  -5.908  1.00 0.00 ? 444 TRP A CZ3  3  
ATOM 5986  C CH2  . TRP A 1 52  ? 7.765   -3.997  -4.969  1.00 0.00 ? 444 TRP A CH2  3  
ATOM 5987  H H    . TRP A 1 52  ? 8.556   -5.833  -12.236 1.00 0.00 ? 444 TRP A H    3  
ATOM 5988  H HA   . TRP A 1 52  ? 6.094   -6.359  -10.775 1.00 0.00 ? 444 TRP A HA   3  
ATOM 5989  H HB2  . TRP A 1 52  ? 8.191   -4.234  -10.652 1.00 0.00 ? 444 TRP A HB2  3  
ATOM 5990  H HB3  . TRP A 1 52  ? 6.579   -3.879  -10.062 1.00 0.00 ? 444 TRP A HB3  3  
ATOM 5991  H HD1  . TRP A 1 52  ? 8.198   -7.318  -9.477  1.00 0.00 ? 444 TRP A HD1  3  
ATOM 5992  H HE1  . TRP A 1 52  ? 8.582   -7.603  -6.964  1.00 0.00 ? 444 TRP A HE1  3  
ATOM 5993  H HE3  . TRP A 1 52  ? 6.976   -2.592  -7.962  1.00 0.00 ? 444 TRP A HE3  3  
ATOM 5994  H HZ2  . TRP A 1 52  ? 8.393   -5.997  -4.612  1.00 0.00 ? 444 TRP A HZ2  3  
ATOM 5995  H HZ3  . TRP A 1 52  ? 7.111   -2.037  -5.578  1.00 0.00 ? 444 TRP A HZ3  3  
ATOM 5996  H HH2  . TRP A 1 52  ? 7.823   -3.732  -3.924  1.00 0.00 ? 444 TRP A HH2  3  
ATOM 5997  N N    . PRO A 1 53  ? 4.537   -4.761  -12.024 1.00 0.00 ? 445 PRO A N    3  
ATOM 5998  C CA   . PRO A 1 53  ? 3.657   -3.886  -12.791 1.00 0.00 ? 445 PRO A CA   3  
ATOM 5999  C C    . PRO A 1 53  ? 3.982   -2.420  -12.477 1.00 0.00 ? 445 PRO A C    3  
ATOM 6000  O O    . PRO A 1 53  ? 4.626   -2.125  -11.467 1.00 0.00 ? 445 PRO A O    3  
ATOM 6001  C CB   . PRO A 1 53  ? 2.247   -4.241  -12.279 1.00 0.00 ? 445 PRO A CB   3  
ATOM 6002  C CG   . PRO A 1 53  ? 2.404   -5.550  -11.584 1.00 0.00 ? 445 PRO A CG   3  
ATOM 6003  C CD   . PRO A 1 53  ? 3.795   -5.560  -11.039 1.00 0.00 ? 445 PRO A CD   3  
ATOM 6004  H HA   . PRO A 1 53  ? 3.737   -4.062  -13.853 1.00 0.00 ? 445 PRO A HA   3  
ATOM 6005  H HB2  . PRO A 1 53  ? 1.904   -3.470  -11.605 1.00 0.00 ? 445 PRO A HB2  3  
ATOM 6006  H HB3  . PRO A 1 53  ? 1.568   -4.321  -13.114 1.00 0.00 ? 445 PRO A HB3  3  
ATOM 6007  H HG2  . PRO A 1 53  ? 1.686   -5.634  -10.782 1.00 0.00 ? 445 PRO A HG2  3  
ATOM 6008  H HG3  . PRO A 1 53  ? 2.271   -6.357  -12.289 1.00 0.00 ? 445 PRO A HG3  3  
ATOM 6009  H HD2  . PRO A 1 53  ? 3.824   -5.107  -10.059 1.00 0.00 ? 445 PRO A HD2  3  
ATOM 6010  H HD3  . PRO A 1 53  ? 4.161   -6.575  -11.004 1.00 0.00 ? 445 PRO A HD3  3  
ATOM 6011  N N    . GLN A 1 54  ? 3.538   -1.516  -13.309 1.00 0.00 ? 446 GLN A N    3  
ATOM 6012  C CA   . GLN A 1 54  ? 3.853   -0.120  -13.116 1.00 0.00 ? 446 GLN A CA   3  
ATOM 6013  C C    . GLN A 1 54  ? 2.747   0.678   -12.408 1.00 0.00 ? 446 GLN A C    3  
ATOM 6014  O O    . GLN A 1 54  ? 2.944   1.846   -12.034 1.00 0.00 ? 446 GLN A O    3  
ATOM 6015  C CB   . GLN A 1 54  ? 4.459   0.525   -14.380 1.00 0.00 ? 446 GLN A CB   3  
ATOM 6016  C CG   . GLN A 1 54  ? 3.800   0.112   -15.674 1.00 0.00 ? 446 GLN A CG   3  
ATOM 6017  C CD   . GLN A 1 54  ? 2.546   0.876   -15.996 1.00 0.00 ? 446 GLN A CD   3  
ATOM 6018  O OE1  . GLN A 1 54  ? 2.420   2.050   -15.656 1.00 0.00 ? 446 GLN A OE1  3  
ATOM 6019  N NE2  . GLN A 1 54  ? 1.608   0.225   -16.636 1.00 0.00 ? 446 GLN A NE2  3  
ATOM 6020  H H    . GLN A 1 54  ? 2.964   -1.798  -14.053 1.00 0.00 ? 446 GLN A H    3  
ATOM 6021  H HA   . GLN A 1 54  ? 4.647   -0.199  -12.391 1.00 0.00 ? 446 GLN A HA   3  
ATOM 6022  H HB2  . GLN A 1 54  ? 4.377   1.599   -14.294 1.00 0.00 ? 446 GLN A HB2  3  
ATOM 6023  H HB3  . GLN A 1 54  ? 5.505   0.262   -14.431 1.00 0.00 ? 446 GLN A HB3  3  
ATOM 6024  H HG2  . GLN A 1 54  ? 4.508   0.217   -16.480 1.00 0.00 ? 446 GLN A HG2  3  
ATOM 6025  H HG3  . GLN A 1 54  ? 3.554   -0.930  -15.532 1.00 0.00 ? 446 GLN A HG3  3  
ATOM 6026  H HE21 . GLN A 1 54  ? 1.769   -0.716  -16.867 1.00 0.00 ? 446 GLN A HE21 3  
ATOM 6027  H HE22 . GLN A 1 54  ? 0.773   0.689   -16.861 1.00 0.00 ? 446 GLN A HE22 3  
ATOM 6028  N N    . LYS A 1 55  ? 1.597   0.024   -12.217 1.00 0.00 ? 447 LYS A N    3  
ATOM 6029  C CA   . LYS A 1 55  ? 0.499   0.528   -11.378 1.00 0.00 ? 447 LYS A CA   3  
ATOM 6030  C C    . LYS A 1 55  ? 0.092   -0.538  -10.373 1.00 0.00 ? 447 LYS A C    3  
ATOM 6031  O O    . LYS A 1 55  ? -0.405  -1.596  -10.753 1.00 0.00 ? 447 LYS A O    3  
ATOM 6032  C CB   . LYS A 1 55  ? -0.770  0.960   -12.163 1.00 0.00 ? 447 LYS A CB   3  
ATOM 6033  C CG   . LYS A 1 55  ? -0.809  2.407   -12.654 1.00 0.00 ? 447 LYS A CG   3  
ATOM 6034  C CD   . LYS A 1 55  ? 0.080   2.649   -13.841 1.00 0.00 ? 447 LYS A CD   3  
ATOM 6035  C CE   . LYS A 1 55  ? 0.056   4.112   -14.253 1.00 0.00 ? 447 LYS A CE   3  
ATOM 6036  N NZ   . LYS A 1 55  ? 0.873   4.362   -15.451 1.00 0.00 ? 447 LYS A NZ   3  
ATOM 6037  H H    . LYS A 1 55  ? 1.478   -0.847  -12.653 1.00 0.00 ? 447 LYS A H    3  
ATOM 6038  H HA   . LYS A 1 55  ? 0.886   1.373   -10.829 1.00 0.00 ? 447 LYS A HA   3  
ATOM 6039  H HB2  . LYS A 1 55  ? -0.860  0.323   -13.031 1.00 0.00 ? 447 LYS A HB2  3  
ATOM 6040  H HB3  . LYS A 1 55  ? -1.629  0.792   -11.530 1.00 0.00 ? 447 LYS A HB3  3  
ATOM 6041  H HG2  . LYS A 1 55  ? -1.822  2.658   -12.929 1.00 0.00 ? 447 LYS A HG2  3  
ATOM 6042  H HG3  . LYS A 1 55  ? -0.499  3.050   -11.845 1.00 0.00 ? 447 LYS A HG3  3  
ATOM 6043  H HD2  . LYS A 1 55  ? 1.091   2.367   -13.589 1.00 0.00 ? 447 LYS A HD2  3  
ATOM 6044  H HD3  . LYS A 1 55  ? -0.266  2.044   -14.667 1.00 0.00 ? 447 LYS A HD3  3  
ATOM 6045  H HE2  . LYS A 1 55  ? -0.962  4.393   -14.473 1.00 0.00 ? 447 LYS A HE2  3  
ATOM 6046  H HE3  . LYS A 1 55  ? 0.428   4.714   -13.439 1.00 0.00 ? 447 LYS A HE3  3  
ATOM 6047  H HZ1  . LYS A 1 55  ? 1.771   3.834   -15.445 1.00 0.00 ? 447 LYS A HZ1  3  
ATOM 6048  H HZ2  . LYS A 1 55  ? 0.352   4.031   -16.285 1.00 0.00 ? 447 LYS A HZ2  3  
ATOM 6049  H HZ3  . LYS A 1 55  ? 1.060   5.371   -15.609 1.00 0.00 ? 447 LYS A HZ3  3  
ATOM 6050  N N    . LEU A 1 56  ? 0.317   -0.275  -9.113  1.00 0.00 ? 448 LEU A N    3  
ATOM 6051  C CA   . LEU A 1 56  ? -0.080  -1.201  -8.061  1.00 0.00 ? 448 LEU A CA   3  
ATOM 6052  C C    . LEU A 1 56  ? -1.329  -0.658  -7.402  1.00 0.00 ? 448 LEU A C    3  
ATOM 6053  O O    . LEU A 1 56  ? -1.487  0.557   -7.308  1.00 0.00 ? 448 LEU A O    3  
ATOM 6054  C CB   . LEU A 1 56  ? 1.022   -1.367  -7.023  1.00 0.00 ? 448 LEU A CB   3  
ATOM 6055  C CG   . LEU A 1 56  ? 2.409   -1.712  -7.549  1.00 0.00 ? 448 LEU A CG   3  
ATOM 6056  C CD1  . LEU A 1 56  ? 3.390   -1.840  -6.413  1.00 0.00 ? 448 LEU A CD1  3  
ATOM 6057  C CD2  . LEU A 1 56  ? 2.385   -2.964  -8.408  1.00 0.00 ? 448 LEU A CD2  3  
ATOM 6058  H H    . LEU A 1 56  ? 0.752   0.574   -8.875  1.00 0.00 ? 448 LEU A H    3  
ATOM 6059  H HA   . LEU A 1 56  ? -0.307  -2.154  -8.515  1.00 0.00 ? 448 LEU A HA   3  
ATOM 6060  H HB2  . LEU A 1 56  ? 1.089   -0.460  -6.445  1.00 0.00 ? 448 LEU A HB2  3  
ATOM 6061  H HB3  . LEU A 1 56  ? 0.719   -2.157  -6.351  1.00 0.00 ? 448 LEU A HB3  3  
ATOM 6062  H HG   . LEU A 1 56  ? 2.770   -0.899  -8.154  1.00 0.00 ? 448 LEU A HG   3  
ATOM 6063  H HD11 . LEU A 1 56  ? 3.442   -0.907  -5.870  1.00 0.00 ? 448 LEU A HD11 3  
ATOM 6064  H HD12 . LEU A 1 56  ? 3.066   -2.625  -5.746  1.00 0.00 ? 448 LEU A HD12 3  
ATOM 6065  H HD13 . LEU A 1 56  ? 4.366   -2.085  -6.806  1.00 0.00 ? 448 LEU A HD13 3  
ATOM 6066  H HD21 . LEU A 1 56  ? 2.023   -3.795  -7.822  1.00 0.00 ? 448 LEU A HD21 3  
ATOM 6067  H HD22 . LEU A 1 56  ? 1.739   -2.808  -9.259  1.00 0.00 ? 448 LEU A HD22 3  
ATOM 6068  H HD23 . LEU A 1 56  ? 3.387   -3.177  -8.751  1.00 0.00 ? 448 LEU A HD23 3  
ATOM 6069  N N    . ILE A 1 57  ? -2.203  -1.524  -6.948  1.00 0.00 ? 449 ILE A N    3  
ATOM 6070  C CA   . ILE A 1 57  ? -3.477  -1.087  -6.410  1.00 0.00 ? 449 ILE A CA   3  
ATOM 6071  C C    . ILE A 1 57  ? -3.431  -1.053  -4.886  1.00 0.00 ? 449 ILE A C    3  
ATOM 6072  O O    . ILE A 1 57  ? -3.125  -2.058  -4.239  1.00 0.00 ? 449 ILE A O    3  
ATOM 6073  C CB   . ILE A 1 57  ? -4.638  -2.008  -6.888  1.00 0.00 ? 449 ILE A CB   3  
ATOM 6074  C CG1  . ILE A 1 57  ? -4.664  -2.102  -8.431  1.00 0.00 ? 449 ILE A CG1  3  
ATOM 6075  C CG2  . ILE A 1 57  ? -5.992  -1.525  -6.355  1.00 0.00 ? 449 ILE A CG2  3  
ATOM 6076  C CD1  . ILE A 1 57  ? -4.790  -0.765  -9.146  1.00 0.00 ? 449 ILE A CD1  3  
ATOM 6077  H H    . ILE A 1 57  ? -1.987  -2.483  -6.915  1.00 0.00 ? 449 ILE A H    3  
ATOM 6078  H HA   . ILE A 1 57  ? -3.661  -0.085  -6.768  1.00 0.00 ? 449 ILE A HA   3  
ATOM 6079  H HB   . ILE A 1 57  ? -4.459  -2.995  -6.486  1.00 0.00 ? 449 ILE A HB   3  
ATOM 6080  H HG12 . ILE A 1 57  ? -3.751  -2.565  -8.770  1.00 0.00 ? 449 ILE A HG12 3  
ATOM 6081  H HG13 . ILE A 1 57  ? -5.501  -2.718  -8.729  1.00 0.00 ? 449 ILE A HG13 3  
ATOM 6082  H HG21 . ILE A 1 57  ? -5.974  -1.525  -5.275  1.00 0.00 ? 449 ILE A HG21 3  
ATOM 6083  H HG22 . ILE A 1 57  ? -6.182  -0.523  -6.712  1.00 0.00 ? 449 ILE A HG22 3  
ATOM 6084  H HG23 . ILE A 1 57  ? -6.773  -2.184  -6.705  1.00 0.00 ? 449 ILE A HG23 3  
ATOM 6085  H HD11 . ILE A 1 57  ? -5.695  -0.271  -8.825  1.00 0.00 ? 449 ILE A HD11 3  
ATOM 6086  H HD12 . ILE A 1 57  ? -3.939  -0.146  -8.901  1.00 0.00 ? 449 ILE A HD12 3  
ATOM 6087  H HD13 . ILE A 1 57  ? -4.822  -0.927  -10.213 1.00 0.00 ? 449 ILE A HD13 3  
ATOM 6088  N N    . MET A 1 58  ? -3.703  0.097   -4.326  1.00 0.00 ? 450 MET A N    3  
ATOM 6089  C CA   . MET A 1 58  ? -3.718  0.263   -2.893  1.00 0.00 ? 450 MET A CA   3  
ATOM 6090  C C    . MET A 1 58  ? -5.128  0.526   -2.398  1.00 0.00 ? 450 MET A C    3  
ATOM 6091  O O    . MET A 1 58  ? -5.779  1.483   -2.820  1.00 0.00 ? 450 MET A O    3  
ATOM 6092  C CB   . MET A 1 58  ? -2.777  1.393   -2.441  1.00 0.00 ? 450 MET A CB   3  
ATOM 6093  C CG   . MET A 1 58  ? -2.768  1.594   -0.926  1.00 0.00 ? 450 MET A CG   3  
ATOM 6094  S SD   . MET A 1 58  ? -1.561  2.807   -0.336  1.00 0.00 ? 450 MET A SD   3  
ATOM 6095  C CE   . MET A 1 58  ? -2.109  4.308   -1.137  1.00 0.00 ? 450 MET A CE   3  
ATOM 6096  H H    . MET A 1 58  ? -3.914  0.865   -4.907  1.00 0.00 ? 450 MET A H    3  
ATOM 6097  H HA   . MET A 1 58  ? -3.375  -0.665  -2.460  1.00 0.00 ? 450 MET A HA   3  
ATOM 6098  H HB2  . MET A 1 58  ? -1.774  1.182   -2.780  1.00 0.00 ? 450 MET A HB2  3  
ATOM 6099  H HB3  . MET A 1 58  ? -3.113  2.312   -2.899  1.00 0.00 ? 450 MET A HB3  3  
ATOM 6100  H HG2  . MET A 1 58  ? -3.750  1.923   -0.622  1.00 0.00 ? 450 MET A HG2  3  
ATOM 6101  H HG3  . MET A 1 58  ? -2.560  0.645   -0.455  1.00 0.00 ? 450 MET A HG3  3  
ATOM 6102  H HE1  . MET A 1 58  ? -3.132  4.515   -0.859  1.00 0.00 ? 450 MET A HE1  3  
ATOM 6103  H HE2  . MET A 1 58  ? -1.480  5.128   -0.823  1.00 0.00 ? 450 MET A HE2  3  
ATOM 6104  H HE3  . MET A 1 58  ? -2.034  4.195   -2.207  1.00 0.00 ? 450 MET A HE3  3  
ATOM 6105  N N    . GLN A 1 59  ? -5.592  -0.322  -1.517  1.00 0.00 ? 451 GLN A N    3  
ATOM 6106  C CA   . GLN A 1 59  ? -6.907  -0.174  -0.929  1.00 0.00 ? 451 GLN A CA   3  
ATOM 6107  C C    . GLN A 1 59  ? -6.752  0.286   0.503   1.00 0.00 ? 451 GLN A C    3  
ATOM 6108  O O    . GLN A 1 59  ? -5.912  -0.249  1.244   1.00 0.00 ? 451 GLN A O    3  
ATOM 6109  C CB   . GLN A 1 59  ? -7.691  -1.490  -0.990  1.00 0.00 ? 451 GLN A CB   3  
ATOM 6110  C CG   . GLN A 1 59  ? -7.918  -2.035  -2.401  1.00 0.00 ? 451 GLN A CG   3  
ATOM 6111  C CD   . GLN A 1 59  ? -8.763  -1.125  -3.293  1.00 0.00 ? 451 GLN A CD   3  
ATOM 6112  O OE1  . GLN A 1 59  ? -8.767  0.092   -3.161  1.00 0.00 ? 451 GLN A OE1  3  
ATOM 6113  N NE2  . GLN A 1 59  ? -9.482  -1.715  -4.207  1.00 0.00 ? 451 GLN A NE2  3  
ATOM 6114  H H    . GLN A 1 59  ? -5.018  -1.072  -1.240  1.00 0.00 ? 451 GLN A H    3  
ATOM 6115  H HA   . GLN A 1 59  ? -7.434  0.586   -1.489  1.00 0.00 ? 451 GLN A HA   3  
ATOM 6116  H HB2  . GLN A 1 59  ? -7.154  -2.238  -0.426  1.00 0.00 ? 451 GLN A HB2  3  
ATOM 6117  H HB3  . GLN A 1 59  ? -8.656  -1.333  -0.528  1.00 0.00 ? 451 GLN A HB3  3  
ATOM 6118  H HG2  . GLN A 1 59  ? -6.955  -2.164  -2.875  1.00 0.00 ? 451 GLN A HG2  3  
ATOM 6119  H HG3  . GLN A 1 59  ? -8.406  -2.995  -2.323  1.00 0.00 ? 451 GLN A HG3  3  
ATOM 6120  H HE21 . GLN A 1 59  ? -9.453  -2.692  -4.289  1.00 0.00 ? 451 GLN A HE21 3  
ATOM 6121  H HE22 . GLN A 1 59  ? -10.031 -1.148  -4.783  1.00 0.00 ? 451 GLN A HE22 3  
ATOM 6122  N N    . LEU A 1 60  ? -7.512  1.268   0.888   1.00 0.00 ? 452 LEU A N    3  
ATOM 6123  C CA   . LEU A 1 60  ? -7.403  1.827   2.214   1.00 0.00 ? 452 LEU A CA   3  
ATOM 6124  C C    . LEU A 1 60  ? -8.349  1.132   3.191   1.00 0.00 ? 452 LEU A C    3  
ATOM 6125  O O    . LEU A 1 60  ? -9.571  1.186   3.051   1.00 0.00 ? 452 LEU A O    3  
ATOM 6126  C CB   . LEU A 1 60  ? -7.629  3.337   2.170   1.00 0.00 ? 452 LEU A CB   3  
ATOM 6127  C CG   . LEU A 1 60  ? -6.657  4.118   1.258   1.00 0.00 ? 452 LEU A CG   3  
ATOM 6128  C CD1  . LEU A 1 60  ? -6.999  5.582   1.232   1.00 0.00 ? 452 LEU A CD1  3  
ATOM 6129  C CD2  . LEU A 1 60  ? -5.213  3.931   1.708   1.00 0.00 ? 452 LEU A CD2  3  
ATOM 6130  H H    . LEU A 1 60  ? -8.184  1.633   0.272   1.00 0.00 ? 452 LEU A H    3  
ATOM 6131  H HA   . LEU A 1 60  ? -6.395  1.641   2.552   1.00 0.00 ? 452 LEU A HA   3  
ATOM 6132  H HB2  . LEU A 1 60  ? -8.639  3.517   1.828   1.00 0.00 ? 452 LEU A HB2  3  
ATOM 6133  H HB3  . LEU A 1 60  ? -7.529  3.724   3.172   1.00 0.00 ? 452 LEU A HB3  3  
ATOM 6134  H HG   . LEU A 1 60  ? -6.745  3.743   0.249   1.00 0.00 ? 452 LEU A HG   3  
ATOM 6135  H HD11 . LEU A 1 60  ? -8.022  5.720   0.915   1.00 0.00 ? 452 LEU A HD11 3  
ATOM 6136  H HD12 . LEU A 1 60  ? -6.863  5.995   2.220   1.00 0.00 ? 452 LEU A HD12 3  
ATOM 6137  H HD13 . LEU A 1 60  ? -6.339  6.088   0.543   1.00 0.00 ? 452 LEU A HD13 3  
ATOM 6138  H HD21 . LEU A 1 60  ? -5.114  4.247   2.736   1.00 0.00 ? 452 LEU A HD21 3  
ATOM 6139  H HD22 . LEU A 1 60  ? -4.936  2.891   1.624   1.00 0.00 ? 452 LEU A HD22 3  
ATOM 6140  H HD23 . LEU A 1 60  ? -4.562  4.528   1.087   1.00 0.00 ? 452 LEU A HD23 3  
ATOM 6141  N N    . ILE A 1 61  ? -7.759  0.479   4.163   1.00 0.00 ? 453 ILE A N    3  
ATOM 6142  C CA   . ILE A 1 61  ? -8.473  -0.293  5.168   1.00 0.00 ? 453 ILE A CA   3  
ATOM 6143  C C    . ILE A 1 61  ? -8.226  0.329   6.546   1.00 0.00 ? 453 ILE A C    3  
ATOM 6144  O O    . ILE A 1 61  ? -7.293  1.097   6.692   1.00 0.00 ? 453 ILE A O    3  
ATOM 6145  C CB   . ILE A 1 61  ? -8.002  -1.778  5.177   1.00 0.00 ? 453 ILE A CB   3  
ATOM 6146  C CG1  . ILE A 1 61  ? -6.488  -1.867  5.466   1.00 0.00 ? 453 ILE A CG1  3  
ATOM 6147  C CG2  . ILE A 1 61  ? -8.351  -2.463  3.855   1.00 0.00 ? 453 ILE A CG2  3  
ATOM 6148  C CD1  . ILE A 1 61  ? -5.962  -3.278  5.598   1.00 0.00 ? 453 ILE A CD1  3  
ATOM 6149  H H    . ILE A 1 61  ? -6.780  0.550   4.233   1.00 0.00 ? 453 ILE A H    3  
ATOM 6150  H HA   . ILE A 1 61  ? -9.526  -0.251  4.934   1.00 0.00 ? 453 ILE A HA   3  
ATOM 6151  H HB   . ILE A 1 61  ? -8.538  -2.286  5.964   1.00 0.00 ? 453 ILE A HB   3  
ATOM 6152  H HG12 . ILE A 1 61  ? -5.946  -1.390  4.665   1.00 0.00 ? 453 ILE A HG12 3  
ATOM 6153  H HG13 . ILE A 1 61  ? -6.281  -1.345  6.389   1.00 0.00 ? 453 ILE A HG13 3  
ATOM 6154  H HG21 . ILE A 1 61  ? -7.866  -1.944  3.041   1.00 0.00 ? 453 ILE A HG21 3  
ATOM 6155  H HG22 . ILE A 1 61  ? -8.010  -3.487  3.881   1.00 0.00 ? 453 ILE A HG22 3  
ATOM 6156  H HG23 . ILE A 1 61  ? -9.420  -2.445  3.707   1.00 0.00 ? 453 ILE A HG23 3  
ATOM 6157  H HD11 . ILE A 1 61  ? -6.475  -3.781  6.403   1.00 0.00 ? 453 ILE A HD11 3  
ATOM 6158  H HD12 . ILE A 1 61  ? -6.130  -3.811  4.675   1.00 0.00 ? 453 ILE A HD12 3  
ATOM 6159  H HD13 . ILE A 1 61  ? -4.904  -3.245  5.813   1.00 0.00 ? 453 ILE A HD13 3  
ATOM 6160  N N    . PRO A 1 62  ? -9.045  0.040   7.573   1.00 0.00 ? 454 PRO A N    3  
ATOM 6161  C CA   . PRO A 1 62  ? -8.834  0.609   8.897   1.00 0.00 ? 454 PRO A CA   3  
ATOM 6162  C C    . PRO A 1 62  ? -7.605  -0.012  9.570   1.00 0.00 ? 454 PRO A C    3  
ATOM 6163  O O    . PRO A 1 62  ? -7.486  -1.247  9.662   1.00 0.00 ? 454 PRO A O    3  
ATOM 6164  C CB   . PRO A 1 62  ? -10.115 0.236   9.672   1.00 0.00 ? 454 PRO A CB   3  
ATOM 6165  C CG   . PRO A 1 62  ? -11.056 -0.315  8.651   1.00 0.00 ? 454 PRO A CG   3  
ATOM 6166  C CD   . PRO A 1 62  ? -10.203 -0.846  7.545   1.00 0.00 ? 454 PRO A CD   3  
ATOM 6167  H HA   . PRO A 1 62  ? -8.720  1.684   8.857   1.00 0.00 ? 454 PRO A HA   3  
ATOM 6168  H HB2  . PRO A 1 62  ? -9.873  -0.503  10.422  1.00 0.00 ? 454 PRO A HB2  3  
ATOM 6169  H HB3  . PRO A 1 62  ? -10.522 1.116   10.149  1.00 0.00 ? 454 PRO A HB3  3  
ATOM 6170  H HG2  . PRO A 1 62  ? -11.633 -1.116  9.089   1.00 0.00 ? 454 PRO A HG2  3  
ATOM 6171  H HG3  . PRO A 1 62  ? -11.724 0.449   8.282   1.00 0.00 ? 454 PRO A HG3  3  
ATOM 6172  H HD2  . PRO A 1 62  ? -9.915  -1.869  7.741   1.00 0.00 ? 454 PRO A HD2  3  
ATOM 6173  H HD3  . PRO A 1 62  ? -10.720 -0.775  6.601   1.00 0.00 ? 454 PRO A HD3  3  
ATOM 6174  N N    . GLN A 1 63  ? -6.722  0.843   10.074  1.00 0.00 ? 455 GLN A N    3  
ATOM 6175  C CA   . GLN A 1 63  ? -5.467  0.428   10.719  1.00 0.00 ? 455 GLN A CA   3  
ATOM 6176  C C    . GLN A 1 63  ? -5.740  -0.403  11.974  1.00 0.00 ? 455 GLN A C    3  
ATOM 6177  O O    . GLN A 1 63  ? -4.962  -1.278  12.343  1.00 0.00 ? 455 GLN A O    3  
ATOM 6178  C CB   . GLN A 1 63  ? -4.641  1.668   11.071  1.00 0.00 ? 455 GLN A CB   3  
ATOM 6179  C CG   . GLN A 1 63  ? -3.325  1.392   11.775  1.00 0.00 ? 455 GLN A CG   3  
ATOM 6180  C CD   . GLN A 1 63  ? -2.603  2.665   12.144  1.00 0.00 ? 455 GLN A CD   3  
ATOM 6181  O OE1  . GLN A 1 63  ? -1.796  3.187   11.384  1.00 0.00 ? 455 GLN A OE1  3  
ATOM 6182  N NE2  . GLN A 1 63  ? -2.874  3.177   13.309  1.00 0.00 ? 455 GLN A NE2  3  
ATOM 6183  H H    . GLN A 1 63  ? -6.920  1.807   10.017  1.00 0.00 ? 455 GLN A H    3  
ATOM 6184  H HA   . GLN A 1 63  ? -4.912  -0.172  10.014  1.00 0.00 ? 455 GLN A HA   3  
ATOM 6185  H HB2  . GLN A 1 63  ? -4.422  2.207   10.162  1.00 0.00 ? 455 GLN A HB2  3  
ATOM 6186  H HB3  . GLN A 1 63  ? -5.239  2.302   11.710  1.00 0.00 ? 455 GLN A HB3  3  
ATOM 6187  H HG2  . GLN A 1 63  ? -3.521  0.832   12.676  1.00 0.00 ? 455 GLN A HG2  3  
ATOM 6188  H HG3  . GLN A 1 63  ? -2.693  0.811   11.120  1.00 0.00 ? 455 GLN A HG3  3  
ATOM 6189  H HE21 . GLN A 1 63  ? -3.519  2.730   13.900  1.00 0.00 ? 455 GLN A HE21 3  
ATOM 6190  H HE22 . GLN A 1 63  ? -2.412  3.998   13.574  1.00 0.00 ? 455 GLN A HE22 3  
ATOM 6191  N N    . GLN A 1 64  ? -6.872  -0.146  12.584  1.00 0.00 ? 456 GLN A N    3  
ATOM 6192  C CA   . GLN A 1 64  ? -7.272  -0.787  13.825  1.00 0.00 ? 456 GLN A CA   3  
ATOM 6193  C C    . GLN A 1 64  ? -7.453  -2.287  13.607  1.00 0.00 ? 456 GLN A C    3  
ATOM 6194  O O    . GLN A 1 64  ? -7.000  -3.104  14.407  1.00 0.00 ? 456 GLN A O    3  
ATOM 6195  C CB   . GLN A 1 64  ? -8.587  -0.178  14.371  1.00 0.00 ? 456 GLN A CB   3  
ATOM 6196  C CG   . GLN A 1 64  ? -8.580  1.346   14.616  1.00 0.00 ? 456 GLN A CG   3  
ATOM 6197  C CD   . GLN A 1 64  ? -8.499  2.166   13.333  1.00 0.00 ? 456 GLN A CD   3  
ATOM 6198  O OE1  . GLN A 1 64  ? -8.959  1.737   12.282  1.00 0.00 ? 456 GLN A OE1  3  
ATOM 6199  N NE2  . GLN A 1 64  ? -7.899  3.314   13.393  1.00 0.00 ? 456 GLN A NE2  3  
ATOM 6200  H H    . GLN A 1 64  ? -7.480  0.510   12.173  1.00 0.00 ? 456 GLN A H    3  
ATOM 6201  H HA   . GLN A 1 64  ? -6.487  -0.629  14.550  1.00 0.00 ? 456 GLN A HA   3  
ATOM 6202  H HB2  . GLN A 1 64  ? -9.377  -0.390  13.665  1.00 0.00 ? 456 GLN A HB2  3  
ATOM 6203  H HB3  . GLN A 1 64  ? -8.824  -0.670  15.303  1.00 0.00 ? 456 GLN A HB3  3  
ATOM 6204  H HG2  . GLN A 1 64  ? -9.483  1.623   15.141  1.00 0.00 ? 456 GLN A HG2  3  
ATOM 6205  H HG3  . GLN A 1 64  ? -7.727  1.588   15.232  1.00 0.00 ? 456 GLN A HG3  3  
ATOM 6206  H HE21 . GLN A 1 64  ? -7.514  3.633   14.238  1.00 0.00 ? 456 GLN A HE21 3  
ATOM 6207  H HE22 . GLN A 1 64  ? -7.863  3.825   12.557  1.00 0.00 ? 456 GLN A HE22 3  
ATOM 6208  N N    . LEU A 1 65  ? -8.043  -2.637  12.474  1.00 0.00 ? 457 LEU A N    3  
ATOM 6209  C CA   . LEU A 1 65  ? -8.330  -4.029  12.140  1.00 0.00 ? 457 LEU A CA   3  
ATOM 6210  C C    . LEU A 1 65  ? -7.072  -4.753  11.660  1.00 0.00 ? 457 LEU A C    3  
ATOM 6211  O O    . LEU A 1 65  ? -7.052  -5.978  11.539  1.00 0.00 ? 457 LEU A O    3  
ATOM 6212  C CB   . LEU A 1 65  ? -9.423  -4.113  11.062  1.00 0.00 ? 457 LEU A CB   3  
ATOM 6213  C CG   . LEU A 1 65  ? -10.795 -3.520  11.421  1.00 0.00 ? 457 LEU A CG   3  
ATOM 6214  C CD1  . LEU A 1 65  ? -11.765 -3.691  10.258  1.00 0.00 ? 457 LEU A CD1  3  
ATOM 6215  C CD2  . LEU A 1 65  ? -11.357 -4.166  12.683  1.00 0.00 ? 457 LEU A CD2  3  
ATOM 6216  H H    . LEU A 1 65  ? -8.286  -1.937  11.831  1.00 0.00 ? 457 LEU A H    3  
ATOM 6217  H HA   . LEU A 1 65  ? -8.689  -4.519  13.033  1.00 0.00 ? 457 LEU A HA   3  
ATOM 6218  H HB2  . LEU A 1 65  ? -9.058  -3.592  10.189  1.00 0.00 ? 457 LEU A HB2  3  
ATOM 6219  H HB3  . LEU A 1 65  ? -9.564  -5.150  10.800  1.00 0.00 ? 457 LEU A HB3  3  
ATOM 6220  H HG   . LEU A 1 65  ? -10.682 -2.459  11.597  1.00 0.00 ? 457 LEU A HG   3  
ATOM 6221  H HD11 . LEU A 1 65  ? -11.372 -3.199  9.382   1.00 0.00 ? 457 LEU A HD11 3  
ATOM 6222  H HD12 . LEU A 1 65  ? -11.900 -4.741  10.047  1.00 0.00 ? 457 LEU A HD12 3  
ATOM 6223  H HD13 . LEU A 1 65  ? -12.719 -3.253  10.516  1.00 0.00 ? 457 LEU A HD13 3  
ATOM 6224  H HD21 . LEU A 1 65  ? -11.448 -5.231  12.532  1.00 0.00 ? 457 LEU A HD21 3  
ATOM 6225  H HD22 . LEU A 1 65  ? -10.698 -3.973  13.517  1.00 0.00 ? 457 LEU A HD22 3  
ATOM 6226  H HD23 . LEU A 1 65  ? -12.330 -3.749  12.898  1.00 0.00 ? 457 LEU A HD23 3  
ATOM 6227  N N    . LEU A 1 66  ? -6.029  -3.992  11.400  1.00 0.00 ? 458 LEU A N    3  
ATOM 6228  C CA   . LEU A 1 66  ? -4.779  -4.536  10.910  1.00 0.00 ? 458 LEU A CA   3  
ATOM 6229  C C    . LEU A 1 66  ? -3.923  -5.074  12.063  1.00 0.00 ? 458 LEU A C    3  
ATOM 6230  O O    . LEU A 1 66  ? -3.037  -5.908  11.853  1.00 0.00 ? 458 LEU A O    3  
ATOM 6231  C CB   . LEU A 1 66  ? -4.007  -3.464  10.134  1.00 0.00 ? 458 LEU A CB   3  
ATOM 6232  C CG   . LEU A 1 66  ? -2.691  -3.909  9.507   1.00 0.00 ? 458 LEU A CG   3  
ATOM 6233  C CD1  . LEU A 1 66  ? -2.935  -4.976  8.449   1.00 0.00 ? 458 LEU A CD1  3  
ATOM 6234  C CD2  . LEU A 1 66  ? -1.946  -2.719  8.931   1.00 0.00 ? 458 LEU A CD2  3  
ATOM 6235  H H    . LEU A 1 66  ? -6.100  -3.023  11.543  1.00 0.00 ? 458 LEU A H    3  
ATOM 6236  H HA   . LEU A 1 66  ? -5.016  -5.346  10.238  1.00 0.00 ? 458 LEU A HA   3  
ATOM 6237  H HB2  . LEU A 1 66  ? -4.647  -3.095  9.347   1.00 0.00 ? 458 LEU A HB2  3  
ATOM 6238  H HB3  . LEU A 1 66  ? -3.799  -2.648  10.811  1.00 0.00 ? 458 LEU A HB3  3  
ATOM 6239  H HG   . LEU A 1 66  ? -2.078  -4.354  10.277  1.00 0.00 ? 458 LEU A HG   3  
ATOM 6240  H HD11 . LEU A 1 66  ? -3.422  -5.827  8.902   1.00 0.00 ? 458 LEU A HD11 3  
ATOM 6241  H HD12 . LEU A 1 66  ? -3.565  -4.572  7.669   1.00 0.00 ? 458 LEU A HD12 3  
ATOM 6242  H HD13 . LEU A 1 66  ? -1.992  -5.291  8.029   1.00 0.00 ? 458 LEU A HD13 3  
ATOM 6243  H HD21 . LEU A 1 66  ? -1.737  -2.009  9.717   1.00 0.00 ? 458 LEU A HD21 3  
ATOM 6244  H HD22 . LEU A 1 66  ? -1.018  -3.054  8.493   1.00 0.00 ? 458 LEU A HD22 3  
ATOM 6245  H HD23 . LEU A 1 66  ? -2.551  -2.247  8.171   1.00 0.00 ? 458 LEU A HD23 3  
ATOM 6246  N N    . THR A 1 67  ? -4.224  -4.625  13.279  1.00 0.00 ? 459 THR A N    3  
ATOM 6247  C CA   . THR A 1 67  ? -3.469  -5.000  14.476  1.00 0.00 ? 459 THR A CA   3  
ATOM 6248  C C    . THR A 1 67  ? -3.469  -6.536  14.678  1.00 0.00 ? 459 THR A C    3  
ATOM 6249  O O    . THR A 1 67  ? -2.509  -7.110  15.197  1.00 0.00 ? 459 THR A O    3  
ATOM 6250  C CB   . THR A 1 67  ? -4.073  -4.303  15.714  1.00 0.00 ? 459 THR A CB   3  
ATOM 6251  O OG1  . THR A 1 67  ? -4.332  -2.920  15.393  1.00 0.00 ? 459 THR A OG1  3  
ATOM 6252  C CG2  . THR A 1 67  ? -3.115  -4.365  16.902  1.00 0.00 ? 459 THR A CG2  3  
ATOM 6253  H H    . THR A 1 67  ? -4.972  -4.002  13.387  1.00 0.00 ? 459 THR A H    3  
ATOM 6254  H HA   . THR A 1 67  ? -2.451  -4.663  14.348  1.00 0.00 ? 459 THR A HA   3  
ATOM 6255  H HB   . THR A 1 67  ? -4.999  -4.793  15.975  1.00 0.00 ? 459 THR A HB   3  
ATOM 6256  H HG1  . THR A 1 67  ? -5.295  -2.854  15.321  1.00 0.00 ? 459 THR A HG1  3  
ATOM 6257  H HG21 . THR A 1 67  ? -2.906  -5.396  17.140  1.00 0.00 ? 459 THR A HG21 3  
ATOM 6258  H HG22 . THR A 1 67  ? -2.194  -3.859  16.652  1.00 0.00 ? 459 THR A HG22 3  
ATOM 6259  H HG23 . THR A 1 67  ? -3.564  -3.882  17.757  1.00 0.00 ? 459 THR A HG23 3  
ATOM 6260  N N    . THR A 1 68  ? -4.526  -7.184  14.199  1.00 0.00 ? 460 THR A N    3  
ATOM 6261  C CA   . THR A 1 68  ? -4.683  -8.623  14.273  1.00 0.00 ? 460 THR A CA   3  
ATOM 6262  C C    . THR A 1 68  ? -3.544  -9.355  13.499  1.00 0.00 ? 460 THR A C    3  
ATOM 6263  O O    . THR A 1 68  ? -3.139  -10.467 13.863  1.00 0.00 ? 460 THR A O    3  
ATOM 6264  C CB   . THR A 1 68  ? -6.045  -8.995  13.660  1.00 0.00 ? 460 THR A CB   3  
ATOM 6265  O OG1  . THR A 1 68  ? -7.061  -8.137  14.219  1.00 0.00 ? 460 THR A OG1  3  
ATOM 6266  C CG2  . THR A 1 68  ? -6.407  -10.450 13.940  1.00 0.00 ? 460 THR A CG2  3  
ATOM 6267  H H    . THR A 1 68  ? -5.253  -6.675  13.780  1.00 0.00 ? 460 THR A H    3  
ATOM 6268  H HA   . THR A 1 68  ? -4.679  -8.927  15.308  1.00 0.00 ? 460 THR A HA   3  
ATOM 6269  H HB   . THR A 1 68  ? -5.989  -8.834  12.595  1.00 0.00 ? 460 THR A HB   3  
ATOM 6270  H HG1  . THR A 1 68  ? -6.778  -7.791  15.077  1.00 0.00 ? 460 THR A HG1  3  
ATOM 6271  H HG21 . THR A 1 68  ? -6.452  -10.617 15.006  1.00 0.00 ? 460 THR A HG21 3  
ATOM 6272  H HG22 . THR A 1 68  ? -7.370  -10.669 13.503  1.00 0.00 ? 460 THR A HG22 3  
ATOM 6273  H HG23 . THR A 1 68  ? -5.662  -11.098 13.506  1.00 0.00 ? 460 THR A HG23 3  
ATOM 6274  N N    . LEU A 1 69  ? -2.994  -8.691  12.482  1.00 0.00 ? 461 LEU A N    3  
ATOM 6275  C CA   . LEU A 1 69  ? -1.965  -9.278  11.626  1.00 0.00 ? 461 LEU A CA   3  
ATOM 6276  C C    . LEU A 1 69  ? -0.562  -8.964  12.137  1.00 0.00 ? 461 LEU A C    3  
ATOM 6277  O O    . LEU A 1 69  ? 0.423   -9.280  11.476  1.00 0.00 ? 461 LEU A O    3  
ATOM 6278  C CB   . LEU A 1 69  ? -2.107  -8.824  10.151  1.00 0.00 ? 461 LEU A CB   3  
ATOM 6279  C CG   . LEU A 1 69  ? -3.317  -9.361  9.345   1.00 0.00 ? 461 LEU A CG   3  
ATOM 6280  C CD1  . LEU A 1 69  ? -4.643  -8.811  9.852   1.00 0.00 ? 461 LEU A CD1  3  
ATOM 6281  C CD2  . LEU A 1 69  ? -3.147  -9.066  7.867   1.00 0.00 ? 461 LEU A CD2  3  
ATOM 6282  H H    . LEU A 1 69  ? -3.263  -7.762  12.303  1.00 0.00 ? 461 LEU A H    3  
ATOM 6283  H HA   . LEU A 1 69  ? -2.093  -10.350 11.662  1.00 0.00 ? 461 LEU A HA   3  
ATOM 6284  H HB2  . LEU A 1 69  ? -2.161  -7.745  10.144  1.00 0.00 ? 461 LEU A HB2  3  
ATOM 6285  H HB3  . LEU A 1 69  ? -1.204  -9.111  9.632   1.00 0.00 ? 461 LEU A HB3  3  
ATOM 6286  H HG   . LEU A 1 69  ? -3.352  -10.434 9.466   1.00 0.00 ? 461 LEU A HG   3  
ATOM 6287  H HD11 . LEU A 1 69  ? -4.749  -9.087  10.892  1.00 0.00 ? 461 LEU A HD11 3  
ATOM 6288  H HD12 . LEU A 1 69  ? -4.648  -7.735  9.763   1.00 0.00 ? 461 LEU A HD12 3  
ATOM 6289  H HD13 . LEU A 1 69  ? -5.455  -9.234  9.279   1.00 0.00 ? 461 LEU A HD13 3  
ATOM 6290  H HD21 . LEU A 1 69  ? -3.070  -7.999  7.721   1.00 0.00 ? 461 LEU A HD21 3  
ATOM 6291  H HD22 . LEU A 1 69  ? -2.247  -9.543  7.505   1.00 0.00 ? 461 LEU A HD22 3  
ATOM 6292  H HD23 . LEU A 1 69  ? -4.000  -9.444  7.324   1.00 0.00 ? 461 LEU A HD23 3  
ATOM 6293  N N    . GLY A 1 70  ? -0.492  -8.382  13.332  1.00 0.00 ? 462 GLY A N    3  
ATOM 6294  C CA   . GLY A 1 70  ? 0.780   -8.021  13.976  1.00 0.00 ? 462 GLY A CA   3  
ATOM 6295  C C    . GLY A 1 70  ? 1.865   -9.120  13.934  1.00 0.00 ? 462 GLY A C    3  
ATOM 6296  O O    . GLY A 1 70  ? 2.990   -8.846  13.506  1.00 0.00 ? 462 GLY A O    3  
ATOM 6297  H H    . GLY A 1 70  ? -1.330  -8.184  13.803  1.00 0.00 ? 462 GLY A H    3  
ATOM 6298  H HA2  . GLY A 1 70  ? 1.174   -7.142  13.489  1.00 0.00 ? 462 GLY A HA2  3  
ATOM 6299  H HA3  . GLY A 1 70  ? 0.575   -7.779  15.007  1.00 0.00 ? 462 GLY A HA3  3  
ATOM 6300  N N    . PRO A 1 71  ? 1.564   -10.384 14.373  1.00 0.00 ? 463 PRO A N    3  
ATOM 6301  C CA   . PRO A 1 71  ? 2.529   -11.498 14.328  1.00 0.00 ? 463 PRO A CA   3  
ATOM 6302  C C    . PRO A 1 71  ? 3.091   -11.764 12.919  1.00 0.00 ? 463 PRO A C    3  
ATOM 6303  O O    . PRO A 1 71  ? 4.231   -12.188 12.771  1.00 0.00 ? 463 PRO A O    3  
ATOM 6304  C CB   . PRO A 1 71  ? 1.715   -12.712 14.812  1.00 0.00 ? 463 PRO A CB   3  
ATOM 6305  C CG   . PRO A 1 71  ? 0.290   -12.283 14.737  1.00 0.00 ? 463 PRO A CG   3  
ATOM 6306  C CD   . PRO A 1 71  ? 0.298   -10.815 15.000  1.00 0.00 ? 463 PRO A CD   3  
ATOM 6307  H HA   . PRO A 1 71  ? 3.351   -11.322 15.007  1.00 0.00 ? 463 PRO A HA   3  
ATOM 6308  H HB2  . PRO A 1 71  ? 1.909   -13.558 14.169  1.00 0.00 ? 463 PRO A HB2  3  
ATOM 6309  H HB3  . PRO A 1 71  ? 1.998   -12.953 15.826  1.00 0.00 ? 463 PRO A HB3  3  
ATOM 6310  H HG2  . PRO A 1 71  ? -0.106  -12.488 13.753  1.00 0.00 ? 463 PRO A HG2  3  
ATOM 6311  H HG3  . PRO A 1 71  ? -0.293  -12.796 15.489  1.00 0.00 ? 463 PRO A HG3  3  
ATOM 6312  H HD2  . PRO A 1 71  ? -0.549  -10.337 14.532  1.00 0.00 ? 463 PRO A HD2  3  
ATOM 6313  H HD3  . PRO A 1 71  ? 0.311   -10.615 16.062  1.00 0.00 ? 463 PRO A HD3  3  
ATOM 6314  N N    . LEU A 1 72  ? 2.317   -11.456 11.902  1.00 0.00 ? 464 LEU A N    3  
ATOM 6315  C CA   . LEU A 1 72  ? 2.706   -11.717 10.521  1.00 0.00 ? 464 LEU A CA   3  
ATOM 6316  C C    . LEU A 1 72  ? 3.750   -10.689 10.044  1.00 0.00 ? 464 LEU A C    3  
ATOM 6317  O O    . LEU A 1 72  ? 4.638   -11.003 9.260   1.00 0.00 ? 464 LEU A O    3  
ATOM 6318  C CB   . LEU A 1 72  ? 1.447   -11.720 9.645   1.00 0.00 ? 464 LEU A CB   3  
ATOM 6319  C CG   . LEU A 1 72  ? 1.598   -12.034 8.155   1.00 0.00 ? 464 LEU A CG   3  
ATOM 6320  C CD1  . LEU A 1 72  ? 2.282   -13.378 7.950   1.00 0.00 ? 464 LEU A CD1  3  
ATOM 6321  C CD2  . LEU A 1 72  ? 0.223   -12.058 7.513   1.00 0.00 ? 464 LEU A CD2  3  
ATOM 6322  H H    . LEU A 1 72  ? 1.459   -11.013 12.073  1.00 0.00 ? 464 LEU A H    3  
ATOM 6323  H HA   . LEU A 1 72  ? 3.155   -12.698 10.493  1.00 0.00 ? 464 LEU A HA   3  
ATOM 6324  H HB2  . LEU A 1 72  ? 0.765   -12.444 10.063  1.00 0.00 ? 464 LEU A HB2  3  
ATOM 6325  H HB3  . LEU A 1 72  ? 0.989   -10.746 9.738   1.00 0.00 ? 464 LEU A HB3  3  
ATOM 6326  H HG   . LEU A 1 72  ? 2.181   -11.266 7.668   1.00 0.00 ? 464 LEU A HG   3  
ATOM 6327  H HD11 . LEU A 1 72  ? 1.696   -14.151 8.425   1.00 0.00 ? 464 LEU A HD11 3  
ATOM 6328  H HD12 . LEU A 1 72  ? 2.360   -13.583 6.892   1.00 0.00 ? 464 LEU A HD12 3  
ATOM 6329  H HD13 . LEU A 1 72  ? 3.269   -13.353 8.387   1.00 0.00 ? 464 LEU A HD13 3  
ATOM 6330  H HD21 . LEU A 1 72  ? -0.284  -11.122 7.705   1.00 0.00 ? 464 LEU A HD21 3  
ATOM 6331  H HD22 . LEU A 1 72  ? 0.317   -12.225 6.451   1.00 0.00 ? 464 LEU A HD22 3  
ATOM 6332  H HD23 . LEU A 1 72  ? -0.357  -12.857 7.953   1.00 0.00 ? 464 LEU A HD23 3  
ATOM 6333  N N    . PHE A 1 73  ? 3.678   -9.492  10.597  1.00 0.00 ? 465 PHE A N    3  
ATOM 6334  C CA   . PHE A 1 73  ? 4.613   -8.407  10.269  1.00 0.00 ? 465 PHE A CA   3  
ATOM 6335  C C    . PHE A 1 73  ? 5.996   -8.639  10.866  1.00 0.00 ? 465 PHE A C    3  
ATOM 6336  O O    . PHE A 1 73  ? 6.956   -7.930  10.549  1.00 0.00 ? 465 PHE A O    3  
ATOM 6337  C CB   . PHE A 1 73  ? 4.070   -7.038  10.680  1.00 0.00 ? 465 PHE A CB   3  
ATOM 6338  C CG   . PHE A 1 73  ? 2.920   -6.572  9.840   1.00 0.00 ? 465 PHE A CG   3  
ATOM 6339  C CD1  . PHE A 1 73  ? 1.625   -6.599  10.321  1.00 0.00 ? 465 PHE A CD1  3  
ATOM 6340  C CD2  . PHE A 1 73  ? 3.142   -6.106  8.558   1.00 0.00 ? 465 PHE A CD2  3  
ATOM 6341  C CE1  . PHE A 1 73  ? 0.578   -6.171  9.538   1.00 0.00 ? 465 PHE A CE1  3  
ATOM 6342  C CE2  . PHE A 1 73  ? 2.102   -5.680  7.776   1.00 0.00 ? 465 PHE A CE2  3  
ATOM 6343  C CZ   . PHE A 1 73  ? 0.818   -5.712  8.264   1.00 0.00 ? 465 PHE A CZ   3  
ATOM 6344  H H    . PHE A 1 73  ? 2.967   -9.326  11.253  1.00 0.00 ? 465 PHE A H    3  
ATOM 6345  H HA   . PHE A 1 73  ? 4.726   -8.424  9.194   1.00 0.00 ? 465 PHE A HA   3  
ATOM 6346  H HB2  . PHE A 1 73  ? 3.735   -7.089  11.705  1.00 0.00 ? 465 PHE A HB2  3  
ATOM 6347  H HB3  . PHE A 1 73  ? 4.863   -6.307  10.603  1.00 0.00 ? 465 PHE A HB3  3  
ATOM 6348  H HD1  . PHE A 1 73  ? 1.426   -6.961  11.317  1.00 0.00 ? 465 PHE A HD1  3  
ATOM 6349  H HD2  . PHE A 1 73  ? 4.147   -6.077  8.164   1.00 0.00 ? 465 PHE A HD2  3  
ATOM 6350  H HE1  . PHE A 1 73  ? -0.430  -6.199  9.926   1.00 0.00 ? 465 PHE A HE1  3  
ATOM 6351  H HE2  . PHE A 1 73  ? 2.294   -5.321  6.777   1.00 0.00 ? 465 PHE A HE2  3  
ATOM 6352  H HZ   . PHE A 1 73  ? 0.003   -5.375  7.643   1.00 0.00 ? 465 PHE A HZ   3  
ATOM 6353  N N    . ARG A 1 74  ? 6.080   -9.593  11.768  1.00 0.00 ? 466 ARG A N    3  
ATOM 6354  C CA   . ARG A 1 74  ? 7.330   -9.922  12.443  1.00 0.00 ? 466 ARG A CA   3  
ATOM 6355  C C    . ARG A 1 74  ? 8.343   -10.560 11.485  1.00 0.00 ? 466 ARG A C    3  
ATOM 6356  O O    . ARG A 1 74  ? 9.555   -10.562 11.761  1.00 0.00 ? 466 ARG A O    3  
ATOM 6357  C CB   . ARG A 1 74  ? 7.067   -10.847 13.617  1.00 0.00 ? 466 ARG A CB   3  
ATOM 6358  C CG   . ARG A 1 74  ? 6.164   -10.249 14.672  1.00 0.00 ? 466 ARG A CG   3  
ATOM 6359  C CD   . ARG A 1 74  ? 5.880   -11.241 15.767  1.00 0.00 ? 466 ARG A CD   3  
ATOM 6360  N NE   . ARG A 1 74  ? 5.058   -10.664 16.830  1.00 0.00 ? 466 ARG A NE   3  
ATOM 6361  C CZ   . ARG A 1 74  ? 4.717   -11.304 17.954  1.00 0.00 ? 466 ARG A CZ   3  
ATOM 6362  N NH1  . ARG A 1 74  ? 5.036   -12.588 18.123  1.00 0.00 ? 466 ARG A NH1  3  
ATOM 6363  N NH2  . ARG A 1 74  ? 4.049   -10.663 18.898  1.00 0.00 ? 466 ARG A NH2  3  
ATOM 6364  H H    . ARG A 1 74  ? 5.264   -10.097 11.974  1.00 0.00 ? 466 ARG A H    3  
ATOM 6365  H HA   . ARG A 1 74  ? 7.748   -8.999  12.817  1.00 0.00 ? 466 ARG A HA   3  
ATOM 6366  H HB2  . ARG A 1 74  ? 6.609   -11.751 13.244  1.00 0.00 ? 466 ARG A HB2  3  
ATOM 6367  H HB3  . ARG A 1 74  ? 8.011   -11.099 14.079  1.00 0.00 ? 466 ARG A HB3  3  
ATOM 6368  H HG2  . ARG A 1 74  ? 6.643   -9.382  15.099  1.00 0.00 ? 466 ARG A HG2  3  
ATOM 6369  H HG3  . ARG A 1 74  ? 5.232   -9.959  14.207  1.00 0.00 ? 466 ARG A HG3  3  
ATOM 6370  H HD2  . ARG A 1 74  ? 5.369   -12.094 15.346  1.00 0.00 ? 466 ARG A HD2  3  
ATOM 6371  H HD3  . ARG A 1 74  ? 6.818   -11.563 16.190  1.00 0.00 ? 466 ARG A HD3  3  
ATOM 6372  H HE   . ARG A 1 74  ? 4.792   -9.727  16.677  1.00 0.00 ? 466 ARG A HE   3  
ATOM 6373  H HH11 . ARG A 1 74  ? 5.535   -13.131 17.440  1.00 0.00 ? 466 ARG A HH11 3  
ATOM 6374  H HH12 . ARG A 1 74  ? 4.789   -13.097 18.952  1.00 0.00 ? 466 ARG A HH12 3  
ATOM 6375  H HH21 . ARG A 1 74  ? 3.775   -9.700  18.808  1.00 0.00 ? 466 ARG A HH21 3  
ATOM 6376  H HH22 . ARG A 1 74  ? 3.805   -11.112 19.762  1.00 0.00 ? 466 ARG A HH22 3  
ATOM 6377  N N    . ASN A 1 75  ? 7.858   -11.095 10.382  1.00 0.00 ? 467 ASN A N    3  
ATOM 6378  C CA   . ASN A 1 75  ? 8.719   -11.716 9.385   1.00 0.00 ? 467 ASN A CA   3  
ATOM 6379  C C    . ASN A 1 75  ? 8.431   -11.114 8.022   1.00 0.00 ? 467 ASN A C    3  
ATOM 6380  O O    . ASN A 1 75  ? 7.588   -11.607 7.268   1.00 0.00 ? 467 ASN A O    3  
ATOM 6381  C CB   . ASN A 1 75  ? 8.542   -13.250 9.364   1.00 0.00 ? 467 ASN A CB   3  
ATOM 6382  C CG   . ASN A 1 75  ? 9.431   -13.953 8.340   1.00 0.00 ? 467 ASN A CG   3  
ATOM 6383  O OD1  . ASN A 1 75  ? 10.529  -13.479 8.004   1.00 0.00 ? 467 ASN A OD1  3  
ATOM 6384  N ND2  . ASN A 1 75  ? 8.982   -15.094 7.858   1.00 0.00 ? 467 ASN A ND2  3  
ATOM 6385  H H    . ASN A 1 75  ? 6.893   -11.060 10.203  1.00 0.00 ? 467 ASN A H    3  
ATOM 6386  H HA   . ASN A 1 75  ? 9.737   -11.479 9.653   1.00 0.00 ? 467 ASN A HA   3  
ATOM 6387  H HB2  . ASN A 1 75  ? 8.770   -13.650 10.341  1.00 0.00 ? 467 ASN A HB2  3  
ATOM 6388  H HB3  . ASN A 1 75  ? 7.512   -13.467 9.123   1.00 0.00 ? 467 ASN A HB3  3  
ATOM 6389  H HD21 . ASN A 1 75  ? 8.114   -15.439 8.166   1.00 0.00 ? 467 ASN A HD21 3  
ATOM 6390  H HD22 . ASN A 1 75  ? 9.531   -15.575 7.204   1.00 0.00 ? 467 ASN A HD22 3  
ATOM 6391  N N    . SER A 1 76  ? 9.064   -9.998  7.748   1.00 0.00 ? 468 SER A N    3  
ATOM 6392  C CA   . SER A 1 76  ? 8.888   -9.268  6.510   1.00 0.00 ? 468 SER A CA   3  
ATOM 6393  C C    . SER A 1 76  ? 10.105  -8.362  6.252   1.00 0.00 ? 468 SER A C    3  
ATOM 6394  O O    . SER A 1 76  ? 10.960  -8.184  7.127   1.00 0.00 ? 468 SER A O    3  
ATOM 6395  C CB   . SER A 1 76  ? 7.593   -8.427  6.547   1.00 0.00 ? 468 SER A CB   3  
ATOM 6396  O OG   . SER A 1 76  ? 6.435   -9.240  6.693   1.00 0.00 ? 468 SER A OG   3  
ATOM 6397  H H    . SER A 1 76  ? 9.699   -9.632  8.399   1.00 0.00 ? 468 SER A H    3  
ATOM 6398  H HA   . SER A 1 76  ? 8.815   -9.988  5.709   1.00 0.00 ? 468 SER A HA   3  
ATOM 6399  H HB2  . SER A 1 76  ? 7.634   -7.747  7.385   1.00 0.00 ? 468 SER A HB2  3  
ATOM 6400  H HB3  . SER A 1 76  ? 7.512   -7.867  5.627   1.00 0.00 ? 468 SER A HB3  3  
ATOM 6401  H HG   . SER A 1 76  ? 6.713   -10.141 6.909   1.00 0.00 ? 468 SER A HG   3  
ATOM 6402  N N    . ARG A 1 77  ? 10.155  -7.805  5.078   1.00 0.00 ? 469 ARG A N    3  
ATOM 6403  C CA   . ARG A 1 77  ? 11.211  -6.909  4.641   1.00 0.00 ? 469 ARG A CA   3  
ATOM 6404  C C    . ARG A 1 77  ? 10.670  -5.520  4.513   1.00 0.00 ? 469 ARG A C    3  
ATOM 6405  O O    . ARG A 1 77  ? 9.511   -5.350  4.113   1.00 0.00 ? 469 ARG A O    3  
ATOM 6406  C CB   . ARG A 1 77  ? 11.923  -7.384  3.385   1.00 0.00 ? 469 ARG A CB   3  
ATOM 6407  C CG   . ARG A 1 77  ? 11.042  -7.716  2.200   1.00 0.00 ? 469 ARG A CG   3  
ATOM 6408  C CD   . ARG A 1 77  ? 11.927  -8.218  1.096   1.00 0.00 ? 469 ARG A CD   3  
ATOM 6409  N NE   . ARG A 1 77  ? 11.219  -8.803  -0.037  1.00 0.00 ? 469 ARG A NE   3  
ATOM 6410  C CZ   . ARG A 1 77  ? 11.630  -9.931  -0.649  1.00 0.00 ? 469 ARG A CZ   3  
ATOM 6411  N NH1  . ARG A 1 77  ? 12.684  -10.616 -0.165  1.00 0.00 ? 469 ARG A NH1  3  
ATOM 6412  N NH2  . ARG A 1 77  ? 10.980  -10.395 -1.714  1.00 0.00 ? 469 ARG A NH2  3  
ATOM 6413  H H    . ARG A 1 77  ? 9.425   -7.983  4.449   1.00 0.00 ? 469 ARG A H    3  
ATOM 6414  H HA   . ARG A 1 77  ? 11.914  -6.885  5.463   1.00 0.00 ? 469 ARG A HA   3  
ATOM 6415  H HB2  . ARG A 1 77  ? 12.611  -6.613  3.072   1.00 0.00 ? 469 ARG A HB2  3  
ATOM 6416  H HB3  . ARG A 1 77  ? 12.493  -8.267  3.639   1.00 0.00 ? 469 ARG A HB3  3  
ATOM 6417  H HG2  . ARG A 1 77  ? 10.334  -8.482  2.481   1.00 0.00 ? 469 ARG A HG2  3  
ATOM 6418  H HG3  . ARG A 1 77  ? 10.524  -6.828  1.872   1.00 0.00 ? 469 ARG A HG3  3  
ATOM 6419  H HD2  . ARG A 1 77  ? 12.506  -7.385  0.727   1.00 0.00 ? 469 ARG A HD2  3  
ATOM 6420  H HD3  . ARG A 1 77  ? 12.585  -8.962  1.516   1.00 0.00 ? 469 ARG A HD3  3  
ATOM 6421  H HE   . ARG A 1 77  ? 10.430  -8.299  -0.334  1.00 0.00 ? 469 ARG A HE   3  
ATOM 6422  H HH11 . ARG A 1 77  ? 13.198  -10.330 0.649   1.00 0.00 ? 469 ARG A HH11 3  
ATOM 6423  H HH12 . ARG A 1 77  ? 13.005  -11.474 -0.582  1.00 0.00 ? 469 ARG A HH12 3  
ATOM 6424  H HH21 . ARG A 1 77  ? 10.181  -9.945  -2.112  1.00 0.00 ? 469 ARG A HH21 3  
ATOM 6425  H HH22 . ARG A 1 77  ? 11.275  -11.254 -2.152  1.00 0.00 ? 469 ARG A HH22 3  
ATOM 6426  N N    . MET A 1 78  ? 11.464  -4.527  4.847   1.00 0.00 ? 470 MET A N    3  
ATOM 6427  C CA   . MET A 1 78  ? 10.947  -3.198  5.053   1.00 0.00 ? 470 MET A CA   3  
ATOM 6428  C C    . MET A 1 78  ? 11.116  -2.401  3.816   1.00 0.00 ? 470 MET A C    3  
ATOM 6429  O O    . MET A 1 78  ? 11.943  -2.710  3.000   1.00 0.00 ? 470 MET A O    3  
ATOM 6430  C CB   . MET A 1 78  ? 11.776  -2.546  6.142   1.00 0.00 ? 470 MET A CB   3  
ATOM 6431  C CG   . MET A 1 78  ? 11.471  -2.955  7.556   1.00 0.00 ? 470 MET A CG   3  
ATOM 6432  S SD   . MET A 1 78  ? 10.089  -2.055  8.270   1.00 0.00 ? 470 MET A SD   3  
ATOM 6433  C CE   . MET A 1 78  ? 10.608  -0.351  8.016   1.00 0.00 ? 470 MET A CE   3  
ATOM 6434  H H    . MET A 1 78  ? 12.445  -4.627  4.893   1.00 0.00 ? 470 MET A H    3  
ATOM 6435  H HA   . MET A 1 78  ? 9.919   -3.227  5.376   1.00 0.00 ? 470 MET A HA   3  
ATOM 6436  H HB2  . MET A 1 78  ? 12.790  -2.873  5.968   1.00 0.00 ? 470 MET A HB2  3  
ATOM 6437  H HB3  . MET A 1 78  ? 11.717  -1.473  6.052   1.00 0.00 ? 470 MET A HB3  3  
ATOM 6438  H HG2  . MET A 1 78  ? 11.200  -4.000  7.513   1.00 0.00 ? 470 MET A HG2  3  
ATOM 6439  H HG3  . MET A 1 78  ? 12.349  -2.818  8.168   1.00 0.00 ? 470 MET A HG3  3  
ATOM 6440  H HE1  . MET A 1 78  ? 11.586  -0.192  8.446   1.00 0.00 ? 470 MET A HE1  3  
ATOM 6441  H HE2  . MET A 1 78  ? 10.621  -0.117  6.962   1.00 0.00 ? 470 MET A HE2  3  
ATOM 6442  H HE3  . MET A 1 78  ? 9.896   0.300   8.501   1.00 0.00 ? 470 MET A HE3  3  
ATOM 6443  N N    . VAL A 1 79  ? 10.255  -1.444  3.626   1.00 0.00 ? 471 VAL A N    3  
ATOM 6444  C CA   . VAL A 1 79  ? 10.297  -0.566  2.493   1.00 0.00 ? 471 VAL A CA   3  
ATOM 6445  C C    . VAL A 1 79  ? 9.908   0.833   2.940   1.00 0.00 ? 471 VAL A C    3  
ATOM 6446  O O    . VAL A 1 79  ? 9.320   1.014   4.021   1.00 0.00 ? 471 VAL A O    3  
ATOM 6447  C CB   . VAL A 1 79  ? 9.356   -1.019  1.324   1.00 0.00 ? 471 VAL A CB   3  
ATOM 6448  C CG1  . VAL A 1 79  ? 9.535   -2.483  0.989   1.00 0.00 ? 471 VAL A CG1  3  
ATOM 6449  C CG2  . VAL A 1 79  ? 7.910   -0.719  1.620   1.00 0.00 ? 471 VAL A CG2  3  
ATOM 6450  H H    . VAL A 1 79  ? 9.518   -1.307  4.266   1.00 0.00 ? 471 VAL A H    3  
ATOM 6451  H HA   . VAL A 1 79  ? 11.314  -0.529  2.139   1.00 0.00 ? 471 VAL A HA   3  
ATOM 6452  H HB   . VAL A 1 79  ? 9.646   -0.457  0.449   1.00 0.00 ? 471 VAL A HB   3  
ATOM 6453  H HG11 . VAL A 1 79  ? 10.588  -2.688  0.871   1.00 0.00 ? 471 VAL A HG11 3  
ATOM 6454  H HG12 . VAL A 1 79  ? 9.191   -3.067  1.831   1.00 0.00 ? 471 VAL A HG12 3  
ATOM 6455  H HG13 . VAL A 1 79  ? 8.985   -2.753  0.099   1.00 0.00 ? 471 VAL A HG13 3  
ATOM 6456  H HG21 . VAL A 1 79  ? 7.642   -1.173  2.562   1.00 0.00 ? 471 VAL A HG21 3  
ATOM 6457  H HG22 . VAL A 1 79  ? 7.779   0.351   1.693   1.00 0.00 ? 471 VAL A HG22 3  
ATOM 6458  H HG23 . VAL A 1 79  ? 7.292   -1.118  0.831   1.00 0.00 ? 471 VAL A HG23 3  
ATOM 6459  N N    . GLN A 1 80  ? 10.237  1.797   2.141   1.00 0.00 ? 472 GLN A N    3  
ATOM 6460  C CA   . GLN A 1 80  ? 9.913   3.171   2.410   1.00 0.00 ? 472 GLN A CA   3  
ATOM 6461  C C    . GLN A 1 80  ? 9.351   3.796   1.153   1.00 0.00 ? 472 GLN A C    3  
ATOM 6462  O O    . GLN A 1 80  ? 9.925   3.652   0.070   1.00 0.00 ? 472 GLN A O    3  
ATOM 6463  C CB   . GLN A 1 80  ? 11.143  3.941   2.904   1.00 0.00 ? 472 GLN A CB   3  
ATOM 6464  C CG   . GLN A 1 80  ? 11.722  3.395   4.204   1.00 0.00 ? 472 GLN A CG   3  
ATOM 6465  C CD   . GLN A 1 80  ? 12.934  4.151   4.666   1.00 0.00 ? 472 GLN A CD   3  
ATOM 6466  O OE1  . GLN A 1 80  ? 14.062  3.821   4.312   1.00 0.00 ? 472 GLN A OE1  3  
ATOM 6467  N NE2  . GLN A 1 80  ? 12.728  5.150   5.472   1.00 0.00 ? 472 GLN A NE2  3  
ATOM 6468  H H    . GLN A 1 80  ? 10.702  1.573   1.301   1.00 0.00 ? 472 GLN A H    3  
ATOM 6469  H HA   . GLN A 1 80  ? 9.152   3.183   3.176   1.00 0.00 ? 472 GLN A HA   3  
ATOM 6470  H HB2  . GLN A 1 80  ? 11.911  3.900   2.148   1.00 0.00 ? 472 GLN A HB2  3  
ATOM 6471  H HB3  . GLN A 1 80  ? 10.864  4.972   3.065   1.00 0.00 ? 472 GLN A HB3  3  
ATOM 6472  H HG2  . GLN A 1 80  ? 10.968  3.454   4.975   1.00 0.00 ? 472 GLN A HG2  3  
ATOM 6473  H HG3  . GLN A 1 80  ? 11.993  2.362   4.053   1.00 0.00 ? 472 GLN A HG3  3  
ATOM 6474  H HE21 . GLN A 1 80  ? 11.806  5.359   5.736   1.00 0.00 ? 472 GLN A HE21 3  
ATOM 6475  H HE22 . GLN A 1 80  ? 13.488  5.679   5.796   1.00 0.00 ? 472 GLN A HE22 3  
ATOM 6476  N N    . PHE A 1 81  ? 8.233   4.440   1.292   1.00 0.00 ? 473 PHE A N    3  
ATOM 6477  C CA   . PHE A 1 81  ? 7.546   5.071   0.198   1.00 0.00 ? 473 PHE A CA   3  
ATOM 6478  C C    . PHE A 1 81  ? 7.594   6.568   0.323   1.00 0.00 ? 473 PHE A C    3  
ATOM 6479  O O    . PHE A 1 81  ? 7.071   7.175   1.314   1.00 0.00 ? 473 PHE A O    3  
ATOM 6480  C CB   . PHE A 1 81  ? 6.083   4.642   0.131   1.00 0.00 ? 473 PHE A CB   3  
ATOM 6481  C CG   . PHE A 1 81  ? 5.781   3.361   -0.592  1.00 0.00 ? 473 PHE A CG   3  
ATOM 6482  C CD1  . PHE A 1 81  ? 6.216   2.137   -0.118  1.00 0.00 ? 473 PHE A CD1  3  
ATOM 6483  C CD2  . PHE A 1 81  ? 5.010   3.389   -1.745  1.00 0.00 ? 473 PHE A CD2  3  
ATOM 6484  C CE1  . PHE A 1 81  ? 5.892   0.973   -0.784  1.00 0.00 ? 473 PHE A CE1  3  
ATOM 6485  C CE2  . PHE A 1 81  ? 4.688   2.230   -2.412  1.00 0.00 ? 473 PHE A CE2  3  
ATOM 6486  C CZ   . PHE A 1 81  ? 5.128   1.019   -1.931  1.00 0.00 ? 473 PHE A CZ   3  
ATOM 6487  H H    . PHE A 1 81  ? 7.851   4.548   2.192   1.00 0.00 ? 473 PHE A H    3  
ATOM 6488  H HA   . PHE A 1 81  ? 8.026   4.772   -0.722  1.00 0.00 ? 473 PHE A HA   3  
ATOM 6489  H HB2  . PHE A 1 81  ? 5.743   4.506   1.145   1.00 0.00 ? 473 PHE A HB2  3  
ATOM 6490  H HB3  . PHE A 1 81  ? 5.509   5.436   -0.326  1.00 0.00 ? 473 PHE A HB3  3  
ATOM 6491  H HD1  . PHE A 1 81  ? 6.812   2.092   0.783   1.00 0.00 ? 473 PHE A HD1  3  
ATOM 6492  H HD2  . PHE A 1 81  ? 4.662   4.338   -2.125  1.00 0.00 ? 473 PHE A HD2  3  
ATOM 6493  H HE1  . PHE A 1 81  ? 6.234   0.020   -0.415  1.00 0.00 ? 473 PHE A HE1  3  
ATOM 6494  H HE2  . PHE A 1 81  ? 4.091   2.269   -3.311  1.00 0.00 ? 473 PHE A HE2  3  
ATOM 6495  H HZ   . PHE A 1 81  ? 4.876   0.106   -2.451  1.00 0.00 ? 473 PHE A HZ   3  
ATOM 6496  N N    . HIS A 1 82  ? 8.214   7.171   -0.644  1.00 0.00 ? 474 HIS A N    3  
ATOM 6497  C CA   . HIS A 1 82  ? 8.234   8.588   -0.756  1.00 0.00 ? 474 HIS A CA   3  
ATOM 6498  C C    . HIS A 1 82  ? 7.480   8.933   -2.012  1.00 0.00 ? 474 HIS A C    3  
ATOM 6499  O O    . HIS A 1 82  ? 7.811   8.447   -3.093  1.00 0.00 ? 474 HIS A O    3  
ATOM 6500  C CB   . HIS A 1 82  ? 9.671   9.146   -0.809  1.00 0.00 ? 474 HIS A CB   3  
ATOM 6501  C CG   . HIS A 1 82  ? 10.430  9.031   0.489   1.00 0.00 ? 474 HIS A CG   3  
ATOM 6502  N ND1  . HIS A 1 82  ? 11.100  10.075  1.090   1.00 0.00 ? 474 HIS A ND1  3  
ATOM 6503  C CD2  . HIS A 1 82  ? 10.641  7.956   1.278   1.00 0.00 ? 474 HIS A CD2  3  
ATOM 6504  C CE1  . HIS A 1 82  ? 11.686  9.612   2.193   1.00 0.00 ? 474 HIS A CE1  3  
ATOM 6505  N NE2  . HIS A 1 82  ? 11.441  8.323   2.358   1.00 0.00 ? 474 HIS A NE2  3  
ATOM 6506  H H    . HIS A 1 82  ? 8.663   6.635   -1.338  1.00 0.00 ? 474 HIS A H    3  
ATOM 6507  H HA   . HIS A 1 82  ? 7.729   8.963   0.122   1.00 0.00 ? 474 HIS A HA   3  
ATOM 6508  H HB2  . HIS A 1 82  ? 10.226  8.613   -1.567  1.00 0.00 ? 474 HIS A HB2  3  
ATOM 6509  H HB3  . HIS A 1 82  ? 9.628   10.191  -1.080  1.00 0.00 ? 474 HIS A HB3  3  
ATOM 6510  H HD1  . HIS A 1 82  ? 11.135  11.006  0.782   1.00 0.00 ? 474 HIS A HD1  3  
ATOM 6511  H HD2  . HIS A 1 82  ? 10.211  6.982   1.098   1.00 0.00 ? 474 HIS A HD2  3  
ATOM 6512  H HE1  . HIS A 1 82  ? 12.283  10.208  2.868   1.00 0.00 ? 474 HIS A HE1  3  
ATOM 6513  N N    . PHE A 1 83  ? 6.470   9.722   -1.881  1.00 0.00 ? 475 PHE A N    3  
ATOM 6514  C CA   . PHE A 1 83  ? 5.648   10.072  -3.011  1.00 0.00 ? 475 PHE A CA   3  
ATOM 6515  C C    . PHE A 1 83  ? 6.161   11.310  -3.673  1.00 0.00 ? 475 PHE A C    3  
ATOM 6516  O O    . PHE A 1 83  ? 6.785   12.161  -3.023  1.00 0.00 ? 475 PHE A O    3  
ATOM 6517  C CB   . PHE A 1 83  ? 4.186   10.254  -2.598  1.00 0.00 ? 475 PHE A CB   3  
ATOM 6518  C CG   . PHE A 1 83  ? 3.448   8.968   -2.327  1.00 0.00 ? 475 PHE A CG   3  
ATOM 6519  C CD1  . PHE A 1 83  ? 2.414   8.574   -3.156  1.00 0.00 ? 475 PHE A CD1  3  
ATOM 6520  C CD2  . PHE A 1 83  ? 3.787   8.155   -1.260  1.00 0.00 ? 475 PHE A CD2  3  
ATOM 6521  C CE1  . PHE A 1 83  ? 1.730   7.402   -2.928  1.00 0.00 ? 475 PHE A CE1  3  
ATOM 6522  C CE2  . PHE A 1 83  ? 3.107   6.977   -1.025  1.00 0.00 ? 475 PHE A CE2  3  
ATOM 6523  C CZ   . PHE A 1 83  ? 2.077   6.599   -1.858  1.00 0.00 ? 475 PHE A CZ   3  
ATOM 6524  H H    . PHE A 1 83  ? 6.270   10.111  -1.006  1.00 0.00 ? 475 PHE A H    3  
ATOM 6525  H HA   . PHE A 1 83  ? 5.703   9.256   -3.715  1.00 0.00 ? 475 PHE A HA   3  
ATOM 6526  H HB2  . PHE A 1 83  ? 4.150   10.847  -1.696  1.00 0.00 ? 475 PHE A HB2  3  
ATOM 6527  H HB3  . PHE A 1 83  ? 3.668   10.781  -3.385  1.00 0.00 ? 475 PHE A HB3  3  
ATOM 6528  H HD1  . PHE A 1 83  ? 2.141   9.201   -3.990  1.00 0.00 ? 475 PHE A HD1  3  
ATOM 6529  H HD2  . PHE A 1 83  ? 4.594   8.453   -0.607  1.00 0.00 ? 475 PHE A HD2  3  
ATOM 6530  H HE1  . PHE A 1 83  ? 0.924   7.121   -3.587  1.00 0.00 ? 475 PHE A HE1  3  
ATOM 6531  H HE2  . PHE A 1 83  ? 3.381   6.353   -0.186  1.00 0.00 ? 475 PHE A HE2  3  
ATOM 6532  H HZ   . PHE A 1 83  ? 1.548   5.676   -1.671  1.00 0.00 ? 475 PHE A HZ   3  
ATOM 6533  N N    . THR A 1 84  ? 5.939   11.408  -4.950  1.00 0.00 ? 476 THR A N    3  
ATOM 6534  C CA   . THR A 1 84  ? 6.343   12.569  -5.656  1.00 0.00 ? 476 THR A CA   3  
ATOM 6535  C C    . THR A 1 84  ? 5.281   13.634  -5.472  1.00 0.00 ? 476 THR A C    3  
ATOM 6536  O O    . THR A 1 84  ? 4.075   13.332  -5.502  1.00 0.00 ? 476 THR A O    3  
ATOM 6537  C CB   . THR A 1 84  ? 6.575   12.290  -7.167  1.00 0.00 ? 476 THR A CB   3  
ATOM 6538  O OG1  . THR A 1 84  ? 5.380   11.777  -7.780  1.00 0.00 ? 476 THR A OG1  3  
ATOM 6539  C CG2  . THR A 1 84  ? 7.714   11.297  -7.367  1.00 0.00 ? 476 THR A CG2  3  
ATOM 6540  H H    . THR A 1 84  ? 5.466   10.692  -5.426  1.00 0.00 ? 476 THR A H    3  
ATOM 6541  H HA   . THR A 1 84  ? 7.267   12.909  -5.214  1.00 0.00 ? 476 THR A HA   3  
ATOM 6542  H HB   . THR A 1 84  ? 6.835   13.220  -7.650  1.00 0.00 ? 476 THR A HB   3  
ATOM 6543  H HG1  . THR A 1 84  ? 5.076   10.985  -7.317  1.00 0.00 ? 476 THR A HG1  3  
ATOM 6544  H HG21 . THR A 1 84  ? 7.470   10.369  -6.870  1.00 0.00 ? 476 THR A HG21 3  
ATOM 6545  H HG22 . THR A 1 84  ? 7.854   11.117  -8.423  1.00 0.00 ? 476 THR A HG22 3  
ATOM 6546  H HG23 . THR A 1 84  ? 8.624   11.702  -6.948  1.00 0.00 ? 476 THR A HG23 3  
ATOM 6547  N N    . ASN A 1 85  ? 5.697   14.857  -5.266  1.00 0.00 ? 477 ASN A N    3  
ATOM 6548  C CA   . ASN A 1 85  ? 4.785   15.994  -5.116  1.00 0.00 ? 477 ASN A CA   3  
ATOM 6549  C C    . ASN A 1 85  ? 4.236   16.414  -6.495  1.00 0.00 ? 477 ASN A C    3  
ATOM 6550  O O    . ASN A 1 85  ? 4.183   17.595  -6.852  1.00 0.00 ? 477 ASN A O    3  
ATOM 6551  C CB   . ASN A 1 85  ? 5.483   17.178  -4.377  1.00 0.00 ? 477 ASN A CB   3  
ATOM 6552  C CG   . ASN A 1 85  ? 6.715   17.760  -5.084  1.00 0.00 ? 477 ASN A CG   3  
ATOM 6553  O OD1  . ASN A 1 85  ? 7.416   17.077  -5.829  1.00 0.00 ? 477 ASN A OD1  3  
ATOM 6554  N ND2  . ASN A 1 85  ? 7.017   19.001  -4.804  1.00 0.00 ? 477 ASN A ND2  3  
ATOM 6555  H H    . ASN A 1 85  ? 6.665   15.017  -5.201  1.00 0.00 ? 477 ASN A H    3  
ATOM 6556  H HA   . ASN A 1 85  ? 3.951   15.645  -4.524  1.00 0.00 ? 477 ASN A HA   3  
ATOM 6557  H HB2  . ASN A 1 85  ? 4.771   17.982  -4.257  1.00 0.00 ? 477 ASN A HB2  3  
ATOM 6558  H HB3  . ASN A 1 85  ? 5.784   16.839  -3.397  1.00 0.00 ? 477 ASN A HB3  3  
ATOM 6559  H HD21 . ASN A 1 85  ? 6.458   19.493  -4.163  1.00 0.00 ? 477 ASN A HD21 3  
ATOM 6560  H HD22 . ASN A 1 85  ? 7.802   19.397  -5.240  1.00 0.00 ? 477 ASN A HD22 3  
ATOM 6561  N N    . LYS A 1 86  ? 3.786   15.414  -7.232  1.00 0.00 ? 478 LYS A N    3  
ATOM 6562  C CA   . LYS A 1 86  ? 3.277   15.552  -8.568  1.00 0.00 ? 478 LYS A CA   3  
ATOM 6563  C C    . LYS A 1 86  ? 1.824   16.007  -8.504  1.00 0.00 ? 478 LYS A C    3  
ATOM 6564  O O    . LYS A 1 86  ? 1.396   16.863  -9.285  1.00 0.00 ? 478 LYS A O    3  
ATOM 6565  C CB   . LYS A 1 86  ? 3.381   14.196  -9.291  1.00 0.00 ? 478 LYS A CB   3  
ATOM 6566  C CG   . LYS A 1 86  ? 3.200   14.256  -10.801 1.00 0.00 ? 478 LYS A CG   3  
ATOM 6567  C CD   . LYS A 1 86  ? 4.355   15.005  -11.460 1.00 0.00 ? 478 LYS A CD   3  
ATOM 6568  C CE   . LYS A 1 86  ? 4.205   15.065  -12.968 1.00 0.00 ? 478 LYS A CE   3  
ATOM 6569  N NZ   . LYS A 1 86  ? 4.236   13.723  -13.593 1.00 0.00 ? 478 LYS A NZ   3  
ATOM 6570  H H    . LYS A 1 86  ? 3.811   14.522  -6.816  1.00 0.00 ? 478 LYS A H    3  
ATOM 6571  H HA   . LYS A 1 86  ? 3.869   16.280  -9.098  1.00 0.00 ? 478 LYS A HA   3  
ATOM 6572  H HB2  . LYS A 1 86  ? 4.353   13.772  -9.090  1.00 0.00 ? 478 LYS A HB2  3  
ATOM 6573  H HB3  . LYS A 1 86  ? 2.628   13.537  -8.883  1.00 0.00 ? 478 LYS A HB3  3  
ATOM 6574  H HG2  . LYS A 1 86  ? 3.164   13.250  -11.192 1.00 0.00 ? 478 LYS A HG2  3  
ATOM 6575  H HG3  . LYS A 1 86  ? 2.275   14.768  -11.025 1.00 0.00 ? 478 LYS A HG3  3  
ATOM 6576  H HD2  . LYS A 1 86  ? 4.396   16.016  -11.081 1.00 0.00 ? 478 LYS A HD2  3  
ATOM 6577  H HD3  . LYS A 1 86  ? 5.278   14.496  -11.223 1.00 0.00 ? 478 LYS A HD3  3  
ATOM 6578  H HE2  . LYS A 1 86  ? 3.258   15.534  -13.196 1.00 0.00 ? 478 LYS A HE2  3  
ATOM 6579  H HE3  . LYS A 1 86  ? 5.004   15.669  -13.372 1.00 0.00 ? 478 LYS A HE3  3  
ATOM 6580  H HZ1  . LYS A 1 86  ? 5.132   13.230  -13.406 1.00 0.00 ? 478 LYS A HZ1  3  
ATOM 6581  H HZ2  . LYS A 1 86  ? 3.467   13.113  -13.251 1.00 0.00 ? 478 LYS A HZ2  3  
ATOM 6582  H HZ3  . LYS A 1 86  ? 4.123   13.791  -14.624 1.00 0.00 ? 478 LYS A HZ3  3  
ATOM 6583  N N    . ASP A 1 87  ? 1.084   15.445  -7.562  1.00 0.00 ? 479 ASP A N    3  
ATOM 6584  C CA   . ASP A 1 87  ? -0.319  15.798  -7.352  1.00 0.00 ? 479 ASP A CA   3  
ATOM 6585  C C    . ASP A 1 87  ? -0.549  15.967  -5.862  1.00 0.00 ? 479 ASP A C    3  
ATOM 6586  O O    . ASP A 1 87  ? -0.780  14.996  -5.136  1.00 0.00 ? 479 ASP A O    3  
ATOM 6587  C CB   . ASP A 1 87  ? -1.266  14.717  -7.898  1.00 0.00 ? 479 ASP A CB   3  
ATOM 6588  C CG   . ASP A 1 87  ? -2.737  15.140  -7.924  1.00 0.00 ? 479 ASP A CG   3  
ATOM 6589  O OD1  . ASP A 1 87  ? -3.348  15.103  -9.018  1.00 0.00 ? 479 ASP A OD1  3  
ATOM 6590  O OD2  . ASP A 1 87  ? -3.307  15.500  -6.879  1.00 0.00 ? 479 ASP A OD2  3  
ATOM 6591  H H    . ASP A 1 87  ? 1.480   14.777  -6.966  1.00 0.00 ? 479 ASP A H    3  
ATOM 6592  H HA   . ASP A 1 87  ? -0.503  16.737  -7.853  1.00 0.00 ? 479 ASP A HA   3  
ATOM 6593  H HB2  . ASP A 1 87  ? -0.975  14.450  -8.902  1.00 0.00 ? 479 ASP A HB2  3  
ATOM 6594  H HB3  . ASP A 1 87  ? -1.184  13.846  -7.264  1.00 0.00 ? 479 ASP A HB3  3  
ATOM 6595  N N    . LEU A 1 88  ? -0.376  17.175  -5.395  1.00 0.00 ? 480 LEU A N    3  
ATOM 6596  C CA   . LEU A 1 88  ? -0.559  17.495  -3.995  1.00 0.00 ? 480 LEU A CA   3  
ATOM 6597  C C    . LEU A 1 88  ? -1.999  17.380  -3.540  1.00 0.00 ? 480 LEU A C    3  
ATOM 6598  O O    . LEU A 1 88  ? -2.247  17.157  -2.373  1.00 0.00 ? 480 LEU A O    3  
ATOM 6599  C CB   . LEU A 1 88  ? 0.031   18.856  -3.635  1.00 0.00 ? 480 LEU A CB   3  
ATOM 6600  C CG   . LEU A 1 88  ? 1.563   18.938  -3.631  1.00 0.00 ? 480 LEU A CG   3  
ATOM 6601  C CD1  . LEU A 1 88  ? 2.007   20.366  -3.365  1.00 0.00 ? 480 LEU A CD1  3  
ATOM 6602  C CD2  . LEU A 1 88  ? 2.147   17.996  -2.568  1.00 0.00 ? 480 LEU A CD2  3  
ATOM 6603  H H    . LEU A 1 88  ? -0.143  17.891  -6.023  1.00 0.00 ? 480 LEU A H    3  
ATOM 6604  H HA   . LEU A 1 88  ? -0.007  16.743  -3.451  1.00 0.00 ? 480 LEU A HA   3  
ATOM 6605  H HB2  . LEU A 1 88  ? -0.349  19.580  -4.341  1.00 0.00 ? 480 LEU A HB2  3  
ATOM 6606  H HB3  . LEU A 1 88  ? -0.323  19.124  -2.649  1.00 0.00 ? 480 LEU A HB3  3  
ATOM 6607  H HG   . LEU A 1 88  ? 1.942   18.640  -4.597  1.00 0.00 ? 480 LEU A HG   3  
ATOM 6608  H HD11 . LEU A 1 88  ? 1.615   21.014  -4.135  1.00 0.00 ? 480 LEU A HD11 3  
ATOM 6609  H HD12 . LEU A 1 88  ? 1.641   20.684  -2.400  1.00 0.00 ? 480 LEU A HD12 3  
ATOM 6610  H HD13 . LEU A 1 88  ? 3.086   20.415  -3.371  1.00 0.00 ? 480 LEU A HD13 3  
ATOM 6611  H HD21 . LEU A 1 88  ? 1.755   18.255  -1.595  1.00 0.00 ? 480 LEU A HD21 3  
ATOM 6612  H HD22 . LEU A 1 88  ? 1.886   16.970  -2.776  1.00 0.00 ? 480 LEU A HD22 3  
ATOM 6613  H HD23 . LEU A 1 88  ? 3.222   18.094  -2.548  1.00 0.00 ? 480 LEU A HD23 3  
ATOM 6614  N N    . GLU A 1 89  ? -2.941  17.504  -4.459  1.00 0.00 ? 481 GLU A N    3  
ATOM 6615  C CA   . GLU A 1 89  ? -4.353  17.433  -4.101  1.00 0.00 ? 481 GLU A CA   3  
ATOM 6616  C C    . GLU A 1 89  ? -4.738  16.015  -3.685  1.00 0.00 ? 481 GLU A C    3  
ATOM 6617  O O    . GLU A 1 89  ? -5.477  15.807  -2.704  1.00 0.00 ? 481 GLU A O    3  
ATOM 6618  C CB   . GLU A 1 89  ? -5.246  17.896  -5.252  1.00 0.00 ? 481 GLU A CB   3  
ATOM 6619  C CG   . GLU A 1 89  ? -5.009  19.324  -5.701  1.00 0.00 ? 481 GLU A CG   3  
ATOM 6620  C CD   . GLU A 1 89  ? -5.126  20.316  -4.579  1.00 0.00 ? 481 GLU A CD   3  
ATOM 6621  O OE1  . GLU A 1 89  ? -6.238  20.509  -4.052  1.00 0.00 ? 481 GLU A OE1  3  
ATOM 6622  O OE2  . GLU A 1 89  ? -4.118  20.963  -4.226  1.00 0.00 ? 481 GLU A OE2  3  
ATOM 6623  H H    . GLU A 1 89  ? -2.684  17.626  -5.399  1.00 0.00 ? 481 GLU A H    3  
ATOM 6624  H HA   . GLU A 1 89  ? -4.504  18.090  -3.255  1.00 0.00 ? 481 GLU A HA   3  
ATOM 6625  H HB2  . GLU A 1 89  ? -5.070  17.251  -6.099  1.00 0.00 ? 481 GLU A HB2  3  
ATOM 6626  H HB3  . GLU A 1 89  ? -6.277  17.802  -4.945  1.00 0.00 ? 481 GLU A HB3  3  
ATOM 6627  H HG2  . GLU A 1 89  ? -4.016  19.393  -6.115  1.00 0.00 ? 481 GLU A HG2  3  
ATOM 6628  H HG3  . GLU A 1 89  ? -5.733  19.574  -6.461  1.00 0.00 ? 481 GLU A HG3  3  
ATOM 6629  N N    . SER A 1 90  ? -4.247  15.046  -4.419  1.00 0.00 ? 482 SER A N    3  
ATOM 6630  C CA   . SER A 1 90  ? -4.513  13.677  -4.119  1.00 0.00 ? 482 SER A CA   3  
ATOM 6631  C C    . SER A 1 90  ? -3.729  13.283  -2.862  1.00 0.00 ? 482 SER A C    3  
ATOM 6632  O O    . SER A 1 90  ? -4.250  12.578  -1.987  1.00 0.00 ? 482 SER A O    3  
ATOM 6633  C CB   . SER A 1 90  ? -4.164  12.786  -5.321  1.00 0.00 ? 482 SER A CB   3  
ATOM 6634  O OG   . SER A 1 90  ? -4.707  11.485  -5.187  1.00 0.00 ? 482 SER A OG   3  
ATOM 6635  H H    . SER A 1 90  ? -3.710  15.260  -5.222  1.00 0.00 ? 482 SER A H    3  
ATOM 6636  H HA   . SER A 1 90  ? -5.567  13.598  -3.910  1.00 0.00 ? 482 SER A HA   3  
ATOM 6637  H HB2  . SER A 1 90  ? -4.546  13.228  -6.228  1.00 0.00 ? 482 SER A HB2  3  
ATOM 6638  H HB3  . SER A 1 90  ? -3.091  12.709  -5.390  1.00 0.00 ? 482 SER A HB3  3  
ATOM 6639  H HG   . SER A 1 90  ? -5.642  11.599  -4.980  1.00 0.00 ? 482 SER A HG   3  
ATOM 6640  N N    . LEU A 1 91  ? -2.497  13.799  -2.746  1.00 0.00 ? 483 LEU A N    3  
ATOM 6641  C CA   . LEU A 1 91  ? -1.669  13.556  -1.570  1.00 0.00 ? 483 LEU A CA   3  
ATOM 6642  C C    . LEU A 1 91  ? -2.309  14.128  -0.318  1.00 0.00 ? 483 LEU A C    3  
ATOM 6643  O O    . LEU A 1 91  ? -2.358  13.466  0.695   1.00 0.00 ? 483 LEU A O    3  
ATOM 6644  C CB   . LEU A 1 91  ? -0.246  14.106  -1.749  1.00 0.00 ? 483 LEU A CB   3  
ATOM 6645  C CG   . LEU A 1 91  ? 0.658   13.339  -2.720  1.00 0.00 ? 483 LEU A CG   3  
ATOM 6646  C CD1  . LEU A 1 91  ? 1.956   14.090  -2.934  1.00 0.00 ? 483 LEU A CD1  3  
ATOM 6647  C CD2  . LEU A 1 91  ? 0.952   11.948  -2.178  1.00 0.00 ? 483 LEU A CD2  3  
ATOM 6648  H H    . LEU A 1 91  ? -2.142  14.345  -3.481  1.00 0.00 ? 483 LEU A H    3  
ATOM 6649  H HA   . LEU A 1 91  ? -1.613  12.484  -1.451  1.00 0.00 ? 483 LEU A HA   3  
ATOM 6650  H HB2  . LEU A 1 91  ? -0.330  15.126  -2.095  1.00 0.00 ? 483 LEU A HB2  3  
ATOM 6651  H HB3  . LEU A 1 91  ? 0.230   14.116  -0.780  1.00 0.00 ? 483 LEU A HB3  3  
ATOM 6652  H HG   . LEU A 1 91  ? 0.161   13.236  -3.673  1.00 0.00 ? 483 LEU A HG   3  
ATOM 6653  H HD11 . LEU A 1 91  ? 2.448   14.240  -1.985  1.00 0.00 ? 483 LEU A HD11 3  
ATOM 6654  H HD12 . LEU A 1 91  ? 2.598   13.513  -3.584  1.00 0.00 ? 483 LEU A HD12 3  
ATOM 6655  H HD13 . LEU A 1 91  ? 1.746   15.044  -3.395  1.00 0.00 ? 483 LEU A HD13 3  
ATOM 6656  H HD21 . LEU A 1 91  ? 0.031   11.410  -2.013  1.00 0.00 ? 483 LEU A HD21 3  
ATOM 6657  H HD22 . LEU A 1 91  ? 1.556   11.401  -2.887  1.00 0.00 ? 483 LEU A HD22 3  
ATOM 6658  H HD23 . LEU A 1 91  ? 1.489   12.030  -1.246  1.00 0.00 ? 483 LEU A HD23 3  
ATOM 6659  N N    . LYS A 1 92  ? -2.832  15.339  -0.419  1.00 0.00 ? 484 LYS A N    3  
ATOM 6660  C CA   . LYS A 1 92  ? -3.510  16.021  0.693   1.00 0.00 ? 484 LYS A CA   3  
ATOM 6661  C C    . LYS A 1 92  ? -4.644  15.150  1.249   1.00 0.00 ? 484 LYS A C    3  
ATOM 6662  O O    . LYS A 1 92  ? -4.816  15.028  2.479   1.00 0.00 ? 484 LYS A O    3  
ATOM 6663  C CB   . LYS A 1 92  ? -4.079  17.352  0.195   1.00 0.00 ? 484 LYS A CB   3  
ATOM 6664  C CG   . LYS A 1 92  ? -4.835  18.161  1.230   1.00 0.00 ? 484 LYS A CG   3  
ATOM 6665  C CD   . LYS A 1 92  ? -5.470  19.375  0.591   1.00 0.00 ? 484 LYS A CD   3  
ATOM 6666  C CE   . LYS A 1 92  ? -6.260  20.183  1.595   1.00 0.00 ? 484 LYS A CE   3  
ATOM 6667  N NZ   . LYS A 1 92  ? -6.936  21.328  0.959   1.00 0.00 ? 484 LYS A NZ   3  
ATOM 6668  H H    . LYS A 1 92  ? -2.740  15.828  -1.268  1.00 0.00 ? 484 LYS A H    3  
ATOM 6669  H HA   . LYS A 1 92  ? -2.780  16.215  1.465   1.00 0.00 ? 484 LYS A HA   3  
ATOM 6670  H HB2  . LYS A 1 92  ? -3.263  17.959  -0.168  1.00 0.00 ? 484 LYS A HB2  3  
ATOM 6671  H HB3  . LYS A 1 92  ? -4.747  17.147  -0.629  1.00 0.00 ? 484 LYS A HB3  3  
ATOM 6672  H HG2  . LYS A 1 92  ? -5.610  17.541  1.659   1.00 0.00 ? 484 LYS A HG2  3  
ATOM 6673  H HG3  . LYS A 1 92  ? -4.153  18.482  2.003   1.00 0.00 ? 484 LYS A HG3  3  
ATOM 6674  H HD2  . LYS A 1 92  ? -4.690  20.000  0.183   1.00 0.00 ? 484 LYS A HD2  3  
ATOM 6675  H HD3  . LYS A 1 92  ? -6.130  19.054  -0.202  1.00 0.00 ? 484 LYS A HD3  3  
ATOM 6676  H HE2  . LYS A 1 92  ? -7.000  19.541  2.049   1.00 0.00 ? 484 LYS A HE2  3  
ATOM 6677  H HE3  . LYS A 1 92  ? -5.586  20.543  2.357   1.00 0.00 ? 484 LYS A HE3  3  
ATOM 6678  H HZ1  . LYS A 1 92  ? -6.263  21.950  0.467   1.00 0.00 ? 484 LYS A HZ1  3  
ATOM 6679  H HZ2  . LYS A 1 92  ? -7.611  20.984  0.248   1.00 0.00 ? 484 LYS A HZ2  3  
ATOM 6680  H HZ3  . LYS A 1 92  ? -7.461  21.891  1.656   1.00 0.00 ? 484 LYS A HZ3  3  
ATOM 6681  N N    . GLY A 1 93  ? -5.399  14.548  0.340   1.00 0.00 ? 485 GLY A N    3  
ATOM 6682  C CA   . GLY A 1 93  ? -6.472  13.665  0.722   1.00 0.00 ? 485 GLY A CA   3  
ATOM 6683  C C    . GLY A 1 93  ? -5.936  12.394  1.337   1.00 0.00 ? 485 GLY A C    3  
ATOM 6684  O O    . GLY A 1 93  ? -6.390  11.974  2.394   1.00 0.00 ? 485 GLY A O    3  
ATOM 6685  H H    . GLY A 1 93  ? -5.208  14.718  -0.608  1.00 0.00 ? 485 GLY A H    3  
ATOM 6686  H HA2  . GLY A 1 93  ? -7.104  14.168  1.438   1.00 0.00 ? 485 GLY A HA2  3  
ATOM 6687  H HA3  . GLY A 1 93  ? -7.053  13.413  -0.153  1.00 0.00 ? 485 GLY A HA3  3  
ATOM 6688  N N    . LEU A 1 94  ? -4.940  11.814  0.687   1.00 0.00 ? 486 LEU A N    3  
ATOM 6689  C CA   . LEU A 1 94  ? -4.297  10.591  1.131   1.00 0.00 ? 486 LEU A CA   3  
ATOM 6690  C C    . LEU A 1 94  ? -3.706  10.752  2.538   1.00 0.00 ? 486 LEU A C    3  
ATOM 6691  O O    . LEU A 1 94  ? -3.885  9.882   3.394   1.00 0.00 ? 486 LEU A O    3  
ATOM 6692  C CB   . LEU A 1 94  ? -3.228  10.189  0.108   1.00 0.00 ? 486 LEU A CB   3  
ATOM 6693  C CG   . LEU A 1 94  ? -2.327  9.010   0.457   1.00 0.00 ? 486 LEU A CG   3  
ATOM 6694  C CD1  . LEU A 1 94  ? -3.133  7.761   0.745   1.00 0.00 ? 486 LEU A CD1  3  
ATOM 6695  C CD2  . LEU A 1 94  ? -1.356  8.750   -0.669  1.00 0.00 ? 486 LEU A CD2  3  
ATOM 6696  H H    . LEU A 1 94  ? -4.603  12.217  -0.144  1.00 0.00 ? 486 LEU A H    3  
ATOM 6697  H HA   . LEU A 1 94  ? -5.052  9.820   1.162   1.00 0.00 ? 486 LEU A HA   3  
ATOM 6698  H HB2  . LEU A 1 94  ? -3.730  9.954   -0.819  1.00 0.00 ? 486 LEU A HB2  3  
ATOM 6699  H HB3  . LEU A 1 94  ? -2.601  11.052  -0.063  1.00 0.00 ? 486 LEU A HB3  3  
ATOM 6700  H HG   . LEU A 1 94  ? -1.759  9.277   1.334   1.00 0.00 ? 486 LEU A HG   3  
ATOM 6701  H HD11 . LEU A 1 94  ? -3.722  7.503   -0.121  1.00 0.00 ? 486 LEU A HD11 3  
ATOM 6702  H HD12 . LEU A 1 94  ? -2.442  6.963   0.973   1.00 0.00 ? 486 LEU A HD12 3  
ATOM 6703  H HD13 . LEU A 1 94  ? -3.769  7.947   1.597   1.00 0.00 ? 486 LEU A HD13 3  
ATOM 6704  H HD21 . LEU A 1 94  ? -1.922  8.532   -1.563  1.00 0.00 ? 486 LEU A HD21 3  
ATOM 6705  H HD22 . LEU A 1 94  ? -0.742  9.623   -0.831  1.00 0.00 ? 486 LEU A HD22 3  
ATOM 6706  H HD23 . LEU A 1 94  ? -0.736  7.902   -0.417  1.00 0.00 ? 486 LEU A HD23 3  
ATOM 6707  N N    . TYR A 1 95  ? -3.040  11.873  2.772   1.00 0.00 ? 487 TYR A N    3  
ATOM 6708  C CA   . TYR A 1 95  ? -2.474  12.195  4.079   1.00 0.00 ? 487 TYR A CA   3  
ATOM 6709  C C    . TYR A 1 95  ? -3.549  12.268  5.135   1.00 0.00 ? 487 TYR A C    3  
ATOM 6710  O O    . TYR A 1 95  ? -3.368  11.773  6.239   1.00 0.00 ? 487 TYR A O    3  
ATOM 6711  C CB   . TYR A 1 95  ? -1.688  13.510  4.039   1.00 0.00 ? 487 TYR A CB   3  
ATOM 6712  C CG   . TYR A 1 95  ? -0.263  13.382  3.544   1.00 0.00 ? 487 TYR A CG   3  
ATOM 6713  C CD1  . TYR A 1 95  ? 0.034   12.831  2.308   1.00 0.00 ? 487 TYR A CD1  3  
ATOM 6714  C CD2  . TYR A 1 95  ? 0.785   13.823  4.326   1.00 0.00 ? 487 TYR A CD2  3  
ATOM 6715  C CE1  . TYR A 1 95  ? 1.330   12.718  1.868   1.00 0.00 ? 487 TYR A CE1  3  
ATOM 6716  C CE2  . TYR A 1 95  ? 2.088   13.717  3.900   1.00 0.00 ? 487 TYR A CE2  3  
ATOM 6717  C CZ   . TYR A 1 95  ? 2.362   13.164  2.677   1.00 0.00 ? 487 TYR A CZ   3  
ATOM 6718  O OH   . TYR A 1 95  ? 3.673   13.058  2.263   1.00 0.00 ? 487 TYR A OH   3  
ATOM 6719  H H    . TYR A 1 95  ? -2.917  12.506  2.026   1.00 0.00 ? 487 TYR A H    3  
ATOM 6720  H HA   . TYR A 1 95  ? -1.795  11.397  4.339   1.00 0.00 ? 487 TYR A HA   3  
ATOM 6721  H HB2  . TYR A 1 95  ? -2.196  14.198  3.380   1.00 0.00 ? 487 TYR A HB2  3  
ATOM 6722  H HB3  . TYR A 1 95  ? -1.662  13.928  5.034   1.00 0.00 ? 487 TYR A HB3  3  
ATOM 6723  H HD1  . TYR A 1 95  ? -0.777  12.481  1.685   1.00 0.00 ? 487 TYR A HD1  3  
ATOM 6724  H HD2  . TYR A 1 95  ? 0.569   14.258  5.290   1.00 0.00 ? 487 TYR A HD2  3  
ATOM 6725  H HE1  . TYR A 1 95  ? 1.506   12.283  0.896   1.00 0.00 ? 487 TYR A HE1  3  
ATOM 6726  H HE2  . TYR A 1 95  ? 2.894   14.065  4.528   1.00 0.00 ? 487 TYR A HE2  3  
ATOM 6727  H HH   . TYR A 1 95  ? 4.191   12.721  3.009   1.00 0.00 ? 487 TYR A HH   3  
ATOM 6728  N N    . ARG A 1 96  ? -4.680  12.847  4.776   1.00 0.00 ? 488 ARG A N    3  
ATOM 6729  C CA   . ARG A 1 96  ? -5.797  12.984  5.688   1.00 0.00 ? 488 ARG A CA   3  
ATOM 6730  C C    . ARG A 1 96  ? -6.384  11.625  6.040   1.00 0.00 ? 488 ARG A C    3  
ATOM 6731  O O    . ARG A 1 96  ? -6.658  11.347  7.197   1.00 0.00 ? 488 ARG A O    3  
ATOM 6732  C CB   . ARG A 1 96  ? -6.872  13.898  5.100   1.00 0.00 ? 488 ARG A CB   3  
ATOM 6733  C CG   . ARG A 1 96  ? -8.062  14.103  6.016   1.00 0.00 ? 488 ARG A CG   3  
ATOM 6734  C CD   . ARG A 1 96  ? -9.031  15.131  5.475   1.00 0.00 ? 488 ARG A CD   3  
ATOM 6735  N NE   . ARG A 1 96  ? -8.456  16.487  5.433   1.00 0.00 ? 488 ARG A NE   3  
ATOM 6736  C CZ   . ARG A 1 96  ? -9.159  17.613  5.657   1.00 0.00 ? 488 ARG A CZ   3  
ATOM 6737  N NH1  . ARG A 1 96  ? -10.465 17.542  5.946   1.00 0.00 ? 488 ARG A NH1  3  
ATOM 6738  N NH2  . ARG A 1 96  ? -8.555  18.800  5.597   1.00 0.00 ? 488 ARG A NH2  3  
ATOM 6739  H H    . ARG A 1 96  ? -4.758  13.201  3.864   1.00 0.00 ? 488 ARG A H    3  
ATOM 6740  H HA   . ARG A 1 96  ? -5.424  13.430  6.596   1.00 0.00 ? 488 ARG A HA   3  
ATOM 6741  H HB2  . ARG A 1 96  ? -6.436  14.860  4.879   1.00 0.00 ? 488 ARG A HB2  3  
ATOM 6742  H HB3  . ARG A 1 96  ? -7.227  13.460  4.179   1.00 0.00 ? 488 ARG A HB3  3  
ATOM 6743  H HG2  . ARG A 1 96  ? -8.578  13.163  6.134   1.00 0.00 ? 488 ARG A HG2  3  
ATOM 6744  H HG3  . ARG A 1 96  ? -7.701  14.432  6.979   1.00 0.00 ? 488 ARG A HG3  3  
ATOM 6745  H HD2  . ARG A 1 96  ? -9.332  14.846  4.478   1.00 0.00 ? 488 ARG A HD2  3  
ATOM 6746  H HD3  . ARG A 1 96  ? -9.895  15.142  6.123   1.00 0.00 ? 488 ARG A HD3  3  
ATOM 6747  H HE   . ARG A 1 96  ? -7.494  16.536  5.229   1.00 0.00 ? 488 ARG A HE   3  
ATOM 6748  H HH11 . ARG A 1 96  ? -10.944 16.661  6.007   1.00 0.00 ? 488 ARG A HH11 3  
ATOM 6749  H HH12 . ARG A 1 96  ? -11.030 18.356  6.110   1.00 0.00 ? 488 ARG A HH12 3  
ATOM 6750  H HH21 . ARG A 1 96  ? -7.581  18.897  5.384   1.00 0.00 ? 488 ARG A HH21 3  
ATOM 6751  H HH22 . ARG A 1 96  ? -9.050  19.654  5.780   1.00 0.00 ? 488 ARG A HH22 3  
ATOM 6752  N N    . ILE A 1 97  ? -6.547  10.783  5.037   1.00 0.00 ? 489 ILE A N    3  
ATOM 6753  C CA   . ILE A 1 97  ? -7.107  9.451   5.230   1.00 0.00 ? 489 ILE A CA   3  
ATOM 6754  C C    . ILE A 1 97  ? -6.157  8.607   6.081   1.00 0.00 ? 489 ILE A C    3  
ATOM 6755  O O    . ILE A 1 97  ? -6.571  7.944   7.026   1.00 0.00 ? 489 ILE A O    3  
ATOM 6756  C CB   . ILE A 1 97  ? -7.374  8.753   3.874   1.00 0.00 ? 489 ILE A CB   3  
ATOM 6757  C CG1  . ILE A 1 97  ? -8.269  9.623   2.998   1.00 0.00 ? 489 ILE A CG1  3  
ATOM 6758  C CG2  . ILE A 1 97  ? -8.037  7.404   4.100   1.00 0.00 ? 489 ILE A CG2  3  
ATOM 6759  C CD1  . ILE A 1 97  ? -8.443  9.091   1.600   1.00 0.00 ? 489 ILE A CD1  3  
ATOM 6760  H H    . ILE A 1 97  ? -6.287  11.075  4.135   1.00 0.00 ? 489 ILE A H    3  
ATOM 6761  H HA   . ILE A 1 97  ? -8.041  9.563   5.762   1.00 0.00 ? 489 ILE A HA   3  
ATOM 6762  H HB   . ILE A 1 97  ? -6.432  8.599   3.369   1.00 0.00 ? 489 ILE A HB   3  
ATOM 6763  H HG12 . ILE A 1 97  ? -9.246  9.690   3.451   1.00 0.00 ? 489 ILE A HG12 3  
ATOM 6764  H HG13 . ILE A 1 97  ? -7.840  10.611  2.926   1.00 0.00 ? 489 ILE A HG13 3  
ATOM 6765  H HG21 . ILE A 1 97  ? -8.920  7.533   4.709   1.00 0.00 ? 489 ILE A HG21 3  
ATOM 6766  H HG22 . ILE A 1 97  ? -8.313  6.976   3.148   1.00 0.00 ? 489 ILE A HG22 3  
ATOM 6767  H HG23 . ILE A 1 97  ? -7.346  6.745   4.602   1.00 0.00 ? 489 ILE A HG23 3  
ATOM 6768  H HD11 . ILE A 1 97  ? -7.472  9.002   1.133   1.00 0.00 ? 489 ILE A HD11 3  
ATOM 6769  H HD12 . ILE A 1 97  ? -8.907  8.119   1.658   1.00 0.00 ? 489 ILE A HD12 3  
ATOM 6770  H HD13 . ILE A 1 97  ? -9.062  9.770   1.033   1.00 0.00 ? 489 ILE A HD13 3  
ATOM 6771  N N    . MET A 1 98  ? -4.884  8.682   5.766   1.00 0.00 ? 490 MET A N    3  
ATOM 6772  C CA   . MET A 1 98  ? -3.860  7.978   6.526   1.00 0.00 ? 490 MET A CA   3  
ATOM 6773  C C    . MET A 1 98  ? -3.787  8.496   7.954   1.00 0.00 ? 490 MET A C    3  
ATOM 6774  O O    . MET A 1 98  ? -3.733  7.716   8.905   1.00 0.00 ? 490 MET A O    3  
ATOM 6775  C CB   . MET A 1 98  ? -2.511  8.112   5.849   1.00 0.00 ? 490 MET A CB   3  
ATOM 6776  C CG   . MET A 1 98  ? -2.257  7.127   4.724   1.00 0.00 ? 490 MET A CG   3  
ATOM 6777  S SD   . MET A 1 98  ? -2.095  5.436   5.335   1.00 0.00 ? 490 MET A SD   3  
ATOM 6778  C CE   . MET A 1 98  ? -1.570  4.557   3.865   1.00 0.00 ? 490 MET A CE   3  
ATOM 6779  H H    . MET A 1 98  ? -4.619  9.227   4.992   1.00 0.00 ? 490 MET A H    3  
ATOM 6780  H HA   . MET A 1 98  ? -4.135  6.935   6.552   1.00 0.00 ? 490 MET A HA   3  
ATOM 6781  H HB2  . MET A 1 98  ? -2.433  9.110   5.443   1.00 0.00 ? 490 MET A HB2  3  
ATOM 6782  H HB3  . MET A 1 98  ? -1.741  7.980   6.595   1.00 0.00 ? 490 MET A HB3  3  
ATOM 6783  H HG2  . MET A 1 98  ? -3.083  7.171   4.029   1.00 0.00 ? 490 MET A HG2  3  
ATOM 6784  H HG3  . MET A 1 98  ? -1.342  7.410   4.228   1.00 0.00 ? 490 MET A HG3  3  
ATOM 6785  H HE1  . MET A 1 98  ? -0.642  4.977   3.507   1.00 0.00 ? 490 MET A HE1  3  
ATOM 6786  H HE2  . MET A 1 98  ? -1.407  3.519   4.120   1.00 0.00 ? 490 MET A HE2  3  
ATOM 6787  H HE3  . MET A 1 98  ? -2.325  4.635   3.096   1.00 0.00 ? 490 MET A HE3  3  
ATOM 6788  N N    . GLY A 1 99  ? -3.849  9.808   8.100   1.00 0.00 ? 491 GLY A N    3  
ATOM 6789  C CA   . GLY A 1 99  ? -3.815  10.432  9.405   1.00 0.00 ? 491 GLY A CA   3  
ATOM 6790  C C    . GLY A 1 99  ? -5.076  10.160  10.204  1.00 0.00 ? 491 GLY A C    3  
ATOM 6791  O O    . GLY A 1 99  ? -5.105  10.348  11.425  1.00 0.00 ? 491 GLY A O    3  
ATOM 6792  H H    . GLY A 1 99  ? -3.901  10.389  7.305   1.00 0.00 ? 491 GLY A H    3  
ATOM 6793  H HA2  . GLY A 1 99  ? -2.964  10.052  9.949   1.00 0.00 ? 491 GLY A HA2  3  
ATOM 6794  H HA3  . GLY A 1 99  ? -3.705  11.499  9.281   1.00 0.00 ? 491 GLY A HA3  3  
ATOM 6795  N N    . ASN A 1 100 ? -6.103  9.700   9.524   1.00 0.00 ? 492 ASN A N    3  
ATOM 6796  C CA   . ASN A 1 100 ? -7.381  9.377   10.140  1.00 0.00 ? 492 ASN A CA   3  
ATOM 6797  C C    . ASN A 1 100 ? -7.341  7.947   10.711  1.00 0.00 ? 492 ASN A C    3  
ATOM 6798  O O    . ASN A 1 100 ? -8.252  7.511   11.405  1.00 0.00 ? 492 ASN A O    3  
ATOM 6799  C CB   . ASN A 1 100 ? -8.519  9.559   9.106   1.00 0.00 ? 492 ASN A CB   3  
ATOM 6800  C CG   . ASN A 1 100 ? -9.930  9.403   9.664   1.00 0.00 ? 492 ASN A CG   3  
ATOM 6801  O OD1  . ASN A 1 100 ? -10.515 8.329   9.639   1.00 0.00 ? 492 ASN A OD1  3  
ATOM 6802  N ND2  . ASN A 1 100 ? -10.496 10.481  10.145  1.00 0.00 ? 492 ASN A ND2  3  
ATOM 6803  H H    . ASN A 1 100 ? -6.010  9.579   8.554   1.00 0.00 ? 492 ASN A H    3  
ATOM 6804  H HA   . ASN A 1 100 ? -7.528  10.065  10.958  1.00 0.00 ? 492 ASN A HA   3  
ATOM 6805  H HB2  . ASN A 1 100 ? -8.444  10.550  8.681   1.00 0.00 ? 492 ASN A HB2  3  
ATOM 6806  H HB3  . ASN A 1 100 ? -8.378  8.836   8.316   1.00 0.00 ? 492 ASN A HB3  3  
ATOM 6807  H HD21 . ASN A 1 100 ? -10.001 11.330  10.132  1.00 0.00 ? 492 ASN A HD21 3  
ATOM 6808  H HD22 . ASN A 1 100 ? -11.408 10.390  10.497  1.00 0.00 ? 492 ASN A HD22 3  
ATOM 6809  N N    . GLY A 1 101 ? -6.238  7.247   10.480  1.00 0.00 ? 493 GLY A N    3  
ATOM 6810  C CA   . GLY A 1 101 ? -6.095  5.920   11.028  1.00 0.00 ? 493 GLY A CA   3  
ATOM 6811  C C    . GLY A 1 101 ? -6.395  4.820   10.041  1.00 0.00 ? 493 GLY A C    3  
ATOM 6812  O O    . GLY A 1 101 ? -6.893  3.750   10.422  1.00 0.00 ? 493 GLY A O    3  
ATOM 6813  H H    . GLY A 1 101 ? -5.521  7.635   9.932   1.00 0.00 ? 493 GLY A H    3  
ATOM 6814  H HA2  . GLY A 1 101 ? -5.080  5.797   11.374  1.00 0.00 ? 493 GLY A HA2  3  
ATOM 6815  H HA3  . GLY A 1 101 ? -6.765  5.822   11.870  1.00 0.00 ? 493 GLY A HA3  3  
ATOM 6816  N N    . PHE A 1 102 ? -6.141  5.075   8.787   1.00 0.00 ? 494 PHE A N    3  
ATOM 6817  C CA   . PHE A 1 102 ? -6.280  4.061   7.770   1.00 0.00 ? 494 PHE A CA   3  
ATOM 6818  C C    . PHE A 1 102 ? -4.913  3.533   7.359   1.00 0.00 ? 494 PHE A C    3  
ATOM 6819  O O    . PHE A 1 102 ? -3.891  4.153   7.643   1.00 0.00 ? 494 PHE A O    3  
ATOM 6820  C CB   . PHE A 1 102 ? -7.058  4.579   6.558   1.00 0.00 ? 494 PHE A CB   3  
ATOM 6821  C CG   . PHE A 1 102 ? -8.522  4.759   6.833   1.00 0.00 ? 494 PHE A CG   3  
ATOM 6822  C CD1  . PHE A 1 102 ? -9.072  6.013   7.012   1.00 0.00 ? 494 PHE A CD1  3  
ATOM 6823  C CD2  . PHE A 1 102 ? -9.344  3.658   6.924   1.00 0.00 ? 494 PHE A CD2  3  
ATOM 6824  C CE1  . PHE A 1 102 ? -10.415 6.163   7.273   1.00 0.00 ? 494 PHE A CE1  3  
ATOM 6825  C CE2  . PHE A 1 102 ? -10.683 3.794   7.185   1.00 0.00 ? 494 PHE A CE2  3  
ATOM 6826  C CZ   . PHE A 1 102 ? -11.226 5.050   7.361   1.00 0.00 ? 494 PHE A CZ   3  
ATOM 6827  H H    . PHE A 1 102 ? -5.831  5.966   8.519   1.00 0.00 ? 494 PHE A H    3  
ATOM 6828  H HA   . PHE A 1 102 ? -6.843  3.255   8.222   1.00 0.00 ? 494 PHE A HA   3  
ATOM 6829  H HB2  . PHE A 1 102 ? -6.651  5.536   6.269   1.00 0.00 ? 494 PHE A HB2  3  
ATOM 6830  H HB3  . PHE A 1 102 ? -6.948  3.883   5.740   1.00 0.00 ? 494 PHE A HB3  3  
ATOM 6831  H HD1  . PHE A 1 102 ? -8.436  6.884   6.937   1.00 0.00 ? 494 PHE A HD1  3  
ATOM 6832  H HD2  . PHE A 1 102 ? -8.923  2.673   6.785   1.00 0.00 ? 494 PHE A HD2  3  
ATOM 6833  H HE1  . PHE A 1 102 ? -10.827 7.152   7.408   1.00 0.00 ? 494 PHE A HE1  3  
ATOM 6834  H HE2  . PHE A 1 102 ? -11.298 2.912   7.252   1.00 0.00 ? 494 PHE A HE2  3  
ATOM 6835  H HZ   . PHE A 1 102 ? -12.280 5.159   7.565   1.00 0.00 ? 494 PHE A HZ   3  
ATOM 6836  N N    . ALA A 1 103 ? -4.904  2.387   6.740   1.00 0.00 ? 495 ALA A N    3  
ATOM 6837  C CA   . ALA A 1 103 ? -3.707  1.747   6.255   1.00 0.00 ? 495 ALA A CA   3  
ATOM 6838  C C    . ALA A 1 103 ? -3.917  1.401   4.800   1.00 0.00 ? 495 ALA A C    3  
ATOM 6839  O O    . ALA A 1 103 ? -5.060  1.194   4.371   1.00 0.00 ? 495 ALA A O    3  
ATOM 6840  C CB   . ALA A 1 103 ? -3.424  0.482   7.056   1.00 0.00 ? 495 ALA A CB   3  
ATOM 6841  H H    . ALA A 1 103 ? -5.755  1.926   6.574   1.00 0.00 ? 495 ALA A H    3  
ATOM 6842  H HA   . ALA A 1 103 ? -2.875  2.428   6.355   1.00 0.00 ? 495 ALA A HA   3  
ATOM 6843  H HB1  . ALA A 1 103 ? -4.235  -0.220  6.938   1.00 0.00 ? 495 ALA A HB1  3  
ATOM 6844  H HB2  . ALA A 1 103 ? -3.322  0.737   8.100   1.00 0.00 ? 495 ALA A HB2  3  
ATOM 6845  H HB3  . ALA A 1 103 ? -2.502  0.037   6.708   1.00 0.00 ? 495 ALA A HB3  3  
ATOM 6846  N N    . GLY A 1 104 ? -2.859  1.326   4.048   1.00 0.00 ? 496 GLY A N    3  
ATOM 6847  C CA   . GLY A 1 104 ? -2.988  1.067   2.654   1.00 0.00 ? 496 GLY A CA   3  
ATOM 6848  C C    . GLY A 1 104 ? -2.446  -0.272  2.271   1.00 0.00 ? 496 GLY A C    3  
ATOM 6849  O O    . GLY A 1 104 ? -1.246  -0.483  2.260   1.00 0.00 ? 496 GLY A O    3  
ATOM 6850  H H    . GLY A 1 104 ? -1.955  1.412   4.431   1.00 0.00 ? 496 GLY A H    3  
ATOM 6851  H HA2  . GLY A 1 104 ? -4.034  1.105   2.389   1.00 0.00 ? 496 GLY A HA2  3  
ATOM 6852  H HA3  . GLY A 1 104 ? -2.456  1.830   2.104   1.00 0.00 ? 496 GLY A HA3  3  
ATOM 6853  N N    . CYS A 1 105 ? -3.312  -1.182  1.966   1.00 0.00 ? 497 CYS A N    3  
ATOM 6854  C CA   . CYS A 1 105 ? -2.882  -2.476  1.536   1.00 0.00 ? 497 CYS A CA   3  
ATOM 6855  C C    . CYS A 1 105 ? -2.596  -2.435  0.041   1.00 0.00 ? 497 CYS A C    3  
ATOM 6856  O O    . CYS A 1 105 ? -3.497  -2.160  -0.770  1.00 0.00 ? 497 CYS A O    3  
ATOM 6857  C CB   . CYS A 1 105 ? -3.926  -3.546  1.895   1.00 0.00 ? 497 CYS A CB   3  
ATOM 6858  S SG   . CYS A 1 105 ? -5.605  -3.217  1.299   1.00 0.00 ? 497 CYS A SG   3  
ATOM 6859  H H    . CYS A 1 105 ? -4.267  -0.961  2.006   1.00 0.00 ? 497 CYS A H    3  
ATOM 6860  H HA   . CYS A 1 105 ? -1.958  -2.694  2.052   1.00 0.00 ? 497 CYS A HA   3  
ATOM 6861  H HB2  . CYS A 1 105 ? -3.617  -4.491  1.474   1.00 0.00 ? 497 CYS A HB2  3  
ATOM 6862  H HB3  . CYS A 1 105 ? -3.970  -3.643  2.970   1.00 0.00 ? 497 CYS A HB3  3  
ATOM 6863  H HG   . CYS A 1 105 ? -5.816  -1.906  1.357   1.00 0.00 ? 497 CYS A HG   3  
ATOM 6864  N N    . VAL A 1 106 ? -1.363  -2.676  -0.327  1.00 0.00 ? 498 VAL A N    3  
ATOM 6865  C CA   . VAL A 1 106 ? -0.973  -2.615  -1.702  1.00 0.00 ? 498 VAL A CA   3  
ATOM 6866  C C    . VAL A 1 106 ? -0.889  -4.007  -2.256  1.00 0.00 ? 498 VAL A C    3  
ATOM 6867  O O    . VAL A 1 106 ? -0.108  -4.875  -1.770  1.00 0.00 ? 498 VAL A O    3  
ATOM 6868  C CB   . VAL A 1 106 ? 0.387   -1.890  -1.903  1.00 0.00 ? 498 VAL A CB   3  
ATOM 6869  C CG1  . VAL A 1 106 ? 0.775   -1.832  -3.386  1.00 0.00 ? 498 VAL A CG1  3  
ATOM 6870  C CG2  . VAL A 1 106 ? 0.335   -0.491  -1.318  1.00 0.00 ? 498 VAL A CG2  3  
ATOM 6871  H H    . VAL A 1 106 ? -0.671  -2.929  0.326   1.00 0.00 ? 498 VAL A H    3  
ATOM 6872  H HA   . VAL A 1 106 ? -1.737  -2.073  -2.240  1.00 0.00 ? 498 VAL A HA   3  
ATOM 6873  H HB   . VAL A 1 106 ? 1.146   -2.452  -1.379  1.00 0.00 ? 498 VAL A HB   3  
ATOM 6874  H HG11 . VAL A 1 106 ? 0.859   -2.833  -3.782  1.00 0.00 ? 498 VAL A HG11 3  
ATOM 6875  H HG12 . VAL A 1 106 ? 0.022   -1.296  -3.945  1.00 0.00 ? 498 VAL A HG12 3  
ATOM 6876  H HG13 . VAL A 1 106 ? 1.726   -1.331  -3.504  1.00 0.00 ? 498 VAL A HG13 3  
ATOM 6877  H HG21 . VAL A 1 106 ? 0.118   -0.549  -0.263  1.00 0.00 ? 498 VAL A HG21 3  
ATOM 6878  H HG22 . VAL A 1 106 ? 1.284   0.002   -1.471  1.00 0.00 ? 498 VAL A HG22 3  
ATOM 6879  H HG23 . VAL A 1 106 ? -0.443  0.068   -1.813  1.00 0.00 ? 498 VAL A HG23 3  
ATOM 6880  N N    . HIS A 1 107 ? -1.681  -4.204  -3.252  1.00 0.00 ? 499 HIS A N    3  
ATOM 6881  C CA   . HIS A 1 107 ? -1.788  -5.429  -3.944  1.00 0.00 ? 499 HIS A CA   3  
ATOM 6882  C C    . HIS A 1 107 ? -1.259  -5.219  -5.329  1.00 0.00 ? 499 HIS A C    3  
ATOM 6883  O O    . HIS A 1 107 ? -1.436  -4.143  -5.933  1.00 0.00 ? 499 HIS A O    3  
ATOM 6884  C CB   . HIS A 1 107 ? -3.246  -5.898  -4.008  1.00 0.00 ? 499 HIS A CB   3  
ATOM 6885  C CG   . HIS A 1 107 ? -3.806  -6.366  -2.699  1.00 0.00 ? 499 HIS A CG   3  
ATOM 6886  N ND1  . HIS A 1 107 ? -4.193  -5.533  -1.670  1.00 0.00 ? 499 HIS A ND1  3  
ATOM 6887  C CD2  . HIS A 1 107 ? -4.031  -7.623  -2.261  1.00 0.00 ? 499 HIS A CD2  3  
ATOM 6888  C CE1  . HIS A 1 107 ? -4.623  -6.299  -0.665  1.00 0.00 ? 499 HIS A CE1  3  
ATOM 6889  N NE2  . HIS A 1 107 ? -4.550  -7.575  -0.974  1.00 0.00 ? 499 HIS A NE2  3  
ATOM 6890  H H    . HIS A 1 107 ? -2.224  -3.451  -3.583  1.00 0.00 ? 499 HIS A H    3  
ATOM 6891  H HA   . HIS A 1 107 ? -1.201  -6.164  -3.408  1.00 0.00 ? 499 HIS A HA   3  
ATOM 6892  H HB2  . HIS A 1 107 ? -3.865  -5.084  -4.356  1.00 0.00 ? 499 HIS A HB2  3  
ATOM 6893  H HB3  . HIS A 1 107 ? -3.311  -6.717  -4.709  1.00 0.00 ? 499 HIS A HB3  3  
ATOM 6894  H HD1  . HIS A 1 107 ? -4.162  -4.552  -1.671  1.00 0.00 ? 499 HIS A HD1  3  
ATOM 6895  H HD2  . HIS A 1 107 ? -3.843  -8.530  -2.816  1.00 0.00 ? 499 HIS A HD2  3  
ATOM 6896  H HE1  . HIS A 1 107 ? -4.967  -5.929  0.288   1.00 0.00 ? 499 HIS A HE1  3  
ATOM 6897  N N    . PHE A 1 108 ? -0.616  -6.194  -5.822  1.00 0.00 ? 500 PHE A N    3  
ATOM 6898  C CA   . PHE A 1 108 ? -0.024  -6.134  -7.104  1.00 0.00 ? 500 PHE A CA   3  
ATOM 6899  C C    . PHE A 1 108 ? -0.978  -6.824  -8.058  1.00 0.00 ? 500 PHE A C    3  
ATOM 6900  O O    . PHE A 1 108 ? -1.437  -7.927  -7.767  1.00 0.00 ? 500 PHE A O    3  
ATOM 6901  C CB   . PHE A 1 108 ? 1.354   -6.817  -7.066  1.00 0.00 ? 500 PHE A CB   3  
ATOM 6902  C CG   . PHE A 1 108 ? 2.342   -6.172  -6.091  1.00 0.00 ? 500 PHE A CG   3  
ATOM 6903  C CD1  . PHE A 1 108 ? 2.161   -6.269  -4.717  1.00 0.00 ? 500 PHE A CD1  3  
ATOM 6904  C CD2  . PHE A 1 108 ? 3.450   -5.483  -6.551  1.00 0.00 ? 500 PHE A CD2  3  
ATOM 6905  C CE1  . PHE A 1 108 ? 3.057   -5.696  -3.836  1.00 0.00 ? 500 PHE A CE1  3  
ATOM 6906  C CE2  . PHE A 1 108 ? 4.344   -4.915  -5.669  1.00 0.00 ? 500 PHE A CE2  3  
ATOM 6907  C CZ   . PHE A 1 108 ? 4.147   -5.021  -4.314  1.00 0.00 ? 500 PHE A CZ   3  
ATOM 6908  H H    . PHE A 1 108 ? -0.558  -7.033  -5.315  1.00 0.00 ? 500 PHE A H    3  
ATOM 6909  H HA   . PHE A 1 108 ? 0.088   -5.095  -7.372  1.00 0.00 ? 500 PHE A HA   3  
ATOM 6910  H HB2  . PHE A 1 108 ? 1.224   -7.846  -6.768  1.00 0.00 ? 500 PHE A HB2  3  
ATOM 6911  H HB3  . PHE A 1 108 ? 1.790   -6.785  -8.054  1.00 0.00 ? 500 PHE A HB3  3  
ATOM 6912  H HD1  . PHE A 1 108 ? 1.304   -6.806  -4.341  1.00 0.00 ? 500 PHE A HD1  3  
ATOM 6913  H HD2  . PHE A 1 108 ? 3.620   -5.376  -7.612  1.00 0.00 ? 500 PHE A HD2  3  
ATOM 6914  H HE1  . PHE A 1 108 ? 2.902   -5.779  -2.771  1.00 0.00 ? 500 PHE A HE1  3  
ATOM 6915  H HE2  . PHE A 1 108 ? 5.205   -4.382  -6.045  1.00 0.00 ? 500 PHE A HE2  3  
ATOM 6916  H HZ   . PHE A 1 108 ? 4.849   -4.572  -3.625  1.00 0.00 ? 500 PHE A HZ   3  
ATOM 6917  N N    . PRO A 1 109 ? -1.371  -6.157  -9.149  1.00 0.00 ? 501 PRO A N    3  
ATOM 6918  C CA   . PRO A 1 109 ? -2.333  -6.705  -10.100 1.00 0.00 ? 501 PRO A CA   3  
ATOM 6919  C C    . PRO A 1 109 ? -1.886  -8.031  -10.701 1.00 0.00 ? 501 PRO A C    3  
ATOM 6920  O O    . PRO A 1 109 ? -0.882  -8.109  -11.432 1.00 0.00 ? 501 PRO A O    3  
ATOM 6921  C CB   . PRO A 1 109 ? -2.459  -5.628  -11.185 1.00 0.00 ? 501 PRO A CB   3  
ATOM 6922  C CG   . PRO A 1 109 ? -1.278  -4.745  -10.997 1.00 0.00 ? 501 PRO A CG   3  
ATOM 6923  C CD   . PRO A 1 109 ? -0.932  -4.808  -9.539  1.00 0.00 ? 501 PRO A CD   3  
ATOM 6924  H HA   . PRO A 1 109 ? -3.292  -6.852  -9.626  1.00 0.00 ? 501 PRO A HA   3  
ATOM 6925  H HB2  . PRO A 1 109 ? -2.455  -6.096  -12.158 1.00 0.00 ? 501 PRO A HB2  3  
ATOM 6926  H HB3  . PRO A 1 109 ? -3.383  -5.086  -11.045 1.00 0.00 ? 501 PRO A HB3  3  
ATOM 6927  H HG2  . PRO A 1 109 ? -0.452  -5.108  -11.590 1.00 0.00 ? 501 PRO A HG2  3  
ATOM 6928  H HG3  . PRO A 1 109 ? -1.523  -3.732  -11.278 1.00 0.00 ? 501 PRO A HG3  3  
ATOM 6929  H HD2  . PRO A 1 109 ? 0.132   -4.691  -9.400  1.00 0.00 ? 501 PRO A HD2  3  
ATOM 6930  H HD3  . PRO A 1 109 ? -1.476  -4.054  -8.989  1.00 0.00 ? 501 PRO A HD3  3  
ATOM 6931  N N    . HIS A 1 110 ? -2.614  -9.073  -10.367 1.00 0.00 ? 502 HIS A N    3  
ATOM 6932  C CA   . HIS A 1 110 ? -2.348  -10.370 -10.898 1.00 0.00 ? 502 HIS A CA   3  
ATOM 6933  C C    . HIS A 1 110 ? -2.880  -10.423 -12.293 1.00 0.00 ? 502 HIS A C    3  
ATOM 6934  O O    . HIS A 1 110 ? -4.066  -10.119 -12.544 1.00 0.00 ? 502 HIS A O    3  
ATOM 6935  C CB   . HIS A 1 110 ? -2.922  -11.500 -10.034 1.00 0.00 ? 502 HIS A CB   3  
ATOM 6936  C CG   . HIS A 1 110 ? -2.233  -11.679 -8.711  1.00 0.00 ? 502 HIS A CG   3  
ATOM 6937  N ND1  . HIS A 1 110 ? -1.338  -12.697 -8.428  1.00 0.00 ? 502 HIS A ND1  3  
ATOM 6938  C CD2  . HIS A 1 110 ? -2.335  -10.955 -7.578  1.00 0.00 ? 502 HIS A CD2  3  
ATOM 6939  C CE1  . HIS A 1 110 ? -0.937  -12.554 -7.161  1.00 0.00 ? 502 HIS A CE1  3  
ATOM 6940  N NE2  . HIS A 1 110 ? -1.518  -11.506 -6.599  1.00 0.00 ? 502 HIS A NE2  3  
ATOM 6941  H H    . HIS A 1 110 ? -3.373  -8.948  -9.758  1.00 0.00 ? 502 HIS A H    3  
ATOM 6942  H HA   . HIS A 1 110 ? -1.273  -10.469 -10.948 1.00 0.00 ? 502 HIS A HA   3  
ATOM 6943  H HB2  . HIS A 1 110 ? -3.961  -11.286 -9.833  1.00 0.00 ? 502 HIS A HB2  3  
ATOM 6944  H HB3  . HIS A 1 110 ? -2.846  -12.429 -10.579 1.00 0.00 ? 502 HIS A HB3  3  
ATOM 6945  H HD1  . HIS A 1 110 ? -1.035  -13.410 -9.034  1.00 0.00 ? 502 HIS A HD1  3  
ATOM 6946  H HD2  . HIS A 1 110 ? -2.948  -10.076 -7.448  1.00 0.00 ? 502 HIS A HD2  3  
ATOM 6947  H HE1  . HIS A 1 110 ? -0.235  -13.206 -6.662  1.00 0.00 ? 502 HIS A HE1  3  
ATOM 6948  N N    . THR A 1 111 ? -1.996  -10.757 -13.177 1.00 0.00 ? 503 THR A N    3  
ATOM 6949  C CA   . THR A 1 111 ? -2.203  -10.764 -14.601 1.00 0.00 ? 503 THR A CA   3  
ATOM 6950  C C    . THR A 1 111 ? -0.835  -11.035 -15.216 1.00 0.00 ? 503 THR A C    3  
ATOM 6951  O O    . THR A 1 111 ? -0.708  -11.528 -16.341 1.00 0.00 ? 503 THR A O    3  
ATOM 6952  C CB   . THR A 1 111 ? -2.799  -9.396  -15.127 1.00 0.00 ? 503 THR A CB   3  
ATOM 6953  O OG1  . THR A 1 111 ? -3.039  -9.450  -16.544 1.00 0.00 ? 503 THR A OG1  3  
ATOM 6954  C CG2  . THR A 1 111 ? -1.888  -8.204  -14.801 1.00 0.00 ? 503 THR A CG2  3  
ATOM 6955  H H    . THR A 1 111 ? -1.129  -11.079 -12.854 1.00 0.00 ? 503 THR A H    3  
ATOM 6956  H HA   . THR A 1 111 ? -2.867  -11.581 -14.840 1.00 0.00 ? 503 THR A HA   3  
ATOM 6957  H HB   . THR A 1 111 ? -3.751  -9.254  -14.636 1.00 0.00 ? 503 THR A HB   3  
ATOM 6958  H HG1  . THR A 1 111 ? -3.602  -10.213 -16.713 1.00 0.00 ? 503 THR A HG1  3  
ATOM 6959  H HG21 . THR A 1 111 ? -1.761  -8.140  -13.731 1.00 0.00 ? 503 THR A HG21 3  
ATOM 6960  H HG22 . THR A 1 111 ? -0.925  -8.347  -15.267 1.00 0.00 ? 503 THR A HG22 3  
ATOM 6961  H HG23 . THR A 1 111 ? -2.336  -7.292  -15.168 1.00 0.00 ? 503 THR A HG23 3  
ATOM 6962  N N    . ALA A 1 112 ? 0.191   -10.675 -14.457 1.00 0.00 ? 504 ALA A N    3  
ATOM 6963  C CA   . ALA A 1 112 ? 1.543   -11.003 -14.778 1.00 0.00 ? 504 ALA A CA   3  
ATOM 6964  C C    . ALA A 1 112 ? 1.799   -12.416 -14.258 1.00 0.00 ? 504 ALA A C    3  
ATOM 6965  O O    . ALA A 1 112 ? 1.183   -12.819 -13.268 1.00 0.00 ? 504 ALA A O    3  
ATOM 6966  C CB   . ALA A 1 112 ? 2.489   -10.001 -14.118 1.00 0.00 ? 504 ALA A CB   3  
ATOM 6967  H H    . ALA A 1 112 ? 0.032   -10.149 -13.647 1.00 0.00 ? 504 ALA A H    3  
ATOM 6968  H HA   . ALA A 1 112 ? 1.666   -10.969 -15.852 1.00 0.00 ? 504 ALA A HA   3  
ATOM 6969  H HB1  . ALA A 1 112 ? 3.512   -10.271 -14.334 1.00 0.00 ? 504 ALA A HB1  3  
ATOM 6970  H HB2  . ALA A 1 112 ? 2.287   -9.012  -14.502 1.00 0.00 ? 504 ALA A HB2  3  
ATOM 6971  H HB3  . ALA A 1 112 ? 2.332   -10.010 -13.049 1.00 0.00 ? 504 ALA A HB3  3  
ATOM 6972  N N    . PRO A 1 113 ? 2.692   -13.184 -14.899 1.00 0.00 ? 505 PRO A N    3  
ATOM 6973  C CA   . PRO A 1 113 ? 2.980   -14.580 -14.508 1.00 0.00 ? 505 PRO A CA   3  
ATOM 6974  C C    . PRO A 1 113 ? 3.873   -14.687 -13.265 1.00 0.00 ? 505 PRO A C    3  
ATOM 6975  O O    . PRO A 1 113 ? 4.239   -15.782 -12.834 1.00 0.00 ? 505 PRO A O    3  
ATOM 6976  C CB   . PRO A 1 113 ? 3.717   -15.124 -15.728 1.00 0.00 ? 505 PRO A CB   3  
ATOM 6977  C CG   . PRO A 1 113 ? 4.406   -13.936 -16.299 1.00 0.00 ? 505 PRO A CG   3  
ATOM 6978  C CD   . PRO A 1 113 ? 3.480   -12.777 -16.082 1.00 0.00 ? 505 PRO A CD   3  
ATOM 6979  H HA   . PRO A 1 113 ? 2.072   -15.144 -14.353 1.00 0.00 ? 505 PRO A HA   3  
ATOM 6980  H HB2  . PRO A 1 113 ? 4.417   -15.882 -15.410 1.00 0.00 ? 505 PRO A HB2  3  
ATOM 6981  H HB3  . PRO A 1 113 ? 3.012   -15.548 -16.426 1.00 0.00 ? 505 PRO A HB3  3  
ATOM 6982  H HG2  . PRO A 1 113 ? 5.340   -13.770 -15.784 1.00 0.00 ? 505 PRO A HG2  3  
ATOM 6983  H HG3  . PRO A 1 113 ? 4.580   -14.083 -17.353 1.00 0.00 ? 505 PRO A HG3  3  
ATOM 6984  H HD2  . PRO A 1 113 ? 4.041   -11.877 -15.881 1.00 0.00 ? 505 PRO A HD2  3  
ATOM 6985  H HD3  . PRO A 1 113 ? 2.839   -12.635 -16.940 1.00 0.00 ? 505 PRO A HD3  3  
ATOM 6986  N N    . CYS A 1 114 ? 4.219   -13.559 -12.707 1.00 0.00 ? 506 CYS A N    3  
ATOM 6987  C CA   . CYS A 1 114 ? 5.071   -13.504 -11.555 1.00 0.00 ? 506 CYS A CA   3  
ATOM 6988  C C    . CYS A 1 114 ? 4.256   -13.675 -10.284 1.00 0.00 ? 506 CYS A C    3  
ATOM 6989  O O    . CYS A 1 114 ? 3.103   -13.214 -10.198 1.00 0.00 ? 506 CYS A O    3  
ATOM 6990  C CB   . CYS A 1 114 ? 5.815   -12.160 -11.524 1.00 0.00 ? 506 CYS A CB   3  
ATOM 6991  S SG   . CYS A 1 114 ? 6.920   -11.942 -10.109 1.00 0.00 ? 506 CYS A SG   3  
ATOM 6992  H H    . CYS A 1 114 ? 3.854   -12.735 -13.086 1.00 0.00 ? 506 CYS A H    3  
ATOM 6993  H HA   . CYS A 1 114 ? 5.798   -14.297 -11.630 1.00 0.00 ? 506 CYS A HA   3  
ATOM 6994  H HB2  . CYS A 1 114 ? 6.414   -12.064 -12.417 1.00 0.00 ? 506 CYS A HB2  3  
ATOM 6995  H HB3  . CYS A 1 114 ? 5.090   -11.358 -11.502 1.00 0.00 ? 506 CYS A HB3  3  
ATOM 6996  H HG   . CYS A 1 114 ? 8.047   -12.574 -10.415 1.00 0.00 ? 506 CYS A HG   3  
ATOM 6997  N N    . GLU A 1 115 ? 4.817   -14.361 -9.325  1.00 0.00 ? 507 GLU A N    3  
ATOM 6998  C CA   . GLU A 1 115 ? 4.200   -14.476 -8.048  1.00 0.00 ? 507 GLU A CA   3  
ATOM 6999  C C    . GLU A 1 115 ? 4.709   -13.324 -7.225  1.00 0.00 ? 507 GLU A C    3  
ATOM 7000  O O    . GLU A 1 115 ? 5.803   -13.387 -6.653  1.00 0.00 ? 507 GLU A O    3  
ATOM 7001  C CB   . GLU A 1 115 ? 4.547   -15.792 -7.361  1.00 0.00 ? 507 GLU A CB   3  
ATOM 7002  C CG   . GLU A 1 115 ? 3.623   -16.110 -6.201  1.00 0.00 ? 507 GLU A CG   3  
ATOM 7003  C CD   . GLU A 1 115 ? 2.222   -16.357 -6.691  1.00 0.00 ? 507 GLU A CD   3  
ATOM 7004  O OE1  . GLU A 1 115 ? 1.430   -15.400 -6.803  1.00 0.00 ? 507 GLU A OE1  3  
ATOM 7005  O OE2  . GLU A 1 115 ? 1.912   -17.513 -7.051  1.00 0.00 ? 507 GLU A OE2  3  
ATOM 7006  H H    . GLU A 1 115 ? 5.684   -14.795 -9.474  1.00 0.00 ? 507 GLU A H    3  
ATOM 7007  H HA   . GLU A 1 115 ? 3.131   -14.385 -8.167  1.00 0.00 ? 507 GLU A HA   3  
ATOM 7008  H HB2  . GLU A 1 115 ? 4.482   -16.594 -8.082  1.00 0.00 ? 507 GLU A HB2  3  
ATOM 7009  H HB3  . GLU A 1 115 ? 5.558   -15.733 -6.985  1.00 0.00 ? 507 GLU A HB3  3  
ATOM 7010  H HG2  . GLU A 1 115 ? 3.978   -16.988 -5.684  1.00 0.00 ? 507 GLU A HG2  3  
ATOM 7011  H HG3  . GLU A 1 115 ? 3.607   -15.268 -5.522  1.00 0.00 ? 507 GLU A HG3  3  
ATOM 7012  N N    . VAL A 1 116 ? 3.991   -12.256 -7.234  1.00 0.00 ? 508 VAL A N    3  
ATOM 7013  C CA   . VAL A 1 116 ? 4.429   -11.091 -6.545  1.00 0.00 ? 508 VAL A CA   3  
ATOM 7014  C C    . VAL A 1 116 ? 3.942   -11.146 -5.113  1.00 0.00 ? 508 VAL A C    3  
ATOM 7015  O O    . VAL A 1 116 ? 2.814   -11.568 -4.848  1.00 0.00 ? 508 VAL A O    3  
ATOM 7016  C CB   . VAL A 1 116 ? 3.950   -9.787  -7.229  1.00 0.00 ? 508 VAL A CB   3  
ATOM 7017  C CG1  . VAL A 1 116 ? 4.733   -8.607  -6.691  1.00 0.00 ? 508 VAL A CG1  3  
ATOM 7018  C CG2  . VAL A 1 116 ? 4.090   -9.868  -8.747  1.00 0.00 ? 508 VAL A CG2  3  
ATOM 7019  H H    . VAL A 1 116 ? 3.132   -12.252 -7.705  1.00 0.00 ? 508 VAL A H    3  
ATOM 7020  H HA   . VAL A 1 116 ? 5.508   -11.094 -6.528  1.00 0.00 ? 508 VAL A HA   3  
ATOM 7021  H HB   . VAL A 1 116 ? 2.909   -9.637  -6.983  1.00 0.00 ? 508 VAL A HB   3  
ATOM 7022  H HG11 . VAL A 1 116 ? 4.587   -8.534  -5.624  1.00 0.00 ? 508 VAL A HG11 3  
ATOM 7023  H HG12 . VAL A 1 116 ? 5.782   -8.744  -6.903  1.00 0.00 ? 508 VAL A HG12 3  
ATOM 7024  H HG13 . VAL A 1 116 ? 4.389   -7.701  -7.166  1.00 0.00 ? 508 VAL A HG13 3  
ATOM 7025  H HG21 . VAL A 1 116 ? 3.506   -10.696 -9.120  1.00 0.00 ? 508 VAL A HG21 3  
ATOM 7026  H HG22 . VAL A 1 116 ? 3.739   -8.950  -9.195  1.00 0.00 ? 508 VAL A HG22 3  
ATOM 7027  H HG23 . VAL A 1 116 ? 5.128   -10.016 -9.006  1.00 0.00 ? 508 VAL A HG23 3  
ATOM 7028  N N    . ARG A 1 117 ? 4.806   -10.773 -4.202  1.00 0.00 ? 509 ARG A N    3  
ATOM 7029  C CA   . ARG A 1 117 ? 4.482   -10.751 -2.791  1.00 0.00 ? 509 ARG A CA   3  
ATOM 7030  C C    . ARG A 1 117 ? 3.726   -9.466  -2.524  1.00 0.00 ? 509 ARG A C    3  
ATOM 7031  O O    . ARG A 1 117 ? 3.684   -8.618  -3.396  1.00 0.00 ? 509 ARG A O    3  
ATOM 7032  C CB   . ARG A 1 117 ? 5.772   -10.849 -1.968  1.00 0.00 ? 509 ARG A CB   3  
ATOM 7033  C CG   . ARG A 1 117 ? 6.672   -12.009 -2.411  1.00 0.00 ? 509 ARG A CG   3  
ATOM 7034  C CD   . ARG A 1 117 ? 5.921   -13.334 -2.386  1.00 0.00 ? 509 ARG A CD   3  
ATOM 7035  N NE   . ARG A 1 117 ? 6.674   -14.425 -2.995  1.00 0.00 ? 509 ARG A NE   3  
ATOM 7036  C CZ   . ARG A 1 117 ? 6.407   -15.728 -2.844  1.00 0.00 ? 509 ARG A CZ   3  
ATOM 7037  N NH1  . ARG A 1 117 ? 5.562   -16.138 -1.884  1.00 0.00 ? 509 ARG A NH1  3  
ATOM 7038  N NH2  . ARG A 1 117 ? 7.028   -16.616 -3.615  1.00 0.00 ? 509 ARG A NH2  3  
ATOM 7039  H H    . ARG A 1 117 ? 5.685   -10.462 -4.498  1.00 0.00 ? 509 ARG A H    3  
ATOM 7040  H HA   . ARG A 1 117 ? 3.833   -11.586 -2.572  1.00 0.00 ? 509 ARG A HA   3  
ATOM 7041  H HB2  . ARG A 1 117 ? 6.322   -9.925  -2.075  1.00 0.00 ? 509 ARG A HB2  3  
ATOM 7042  H HB3  . ARG A 1 117 ? 5.515   -10.990 -0.928  1.00 0.00 ? 509 ARG A HB3  3  
ATOM 7043  H HG2  . ARG A 1 117 ? 7.015   -11.821 -3.416  1.00 0.00 ? 509 ARG A HG2  3  
ATOM 7044  H HG3  . ARG A 1 117 ? 7.522   -12.069 -1.748  1.00 0.00 ? 509 ARG A HG3  3  
ATOM 7045  H HD2  . ARG A 1 117 ? 5.700   -13.596 -1.363  1.00 0.00 ? 509 ARG A HD2  3  
ATOM 7046  H HD3  . ARG A 1 117 ? 4.996   -13.212 -2.929  1.00 0.00 ? 509 ARG A HD3  3  
ATOM 7047  H HE   . ARG A 1 117 ? 7.380   -14.137 -3.618  1.00 0.00 ? 509 ARG A HE   3  
ATOM 7048  H HH11 . ARG A 1 117 ? 5.119   -15.488 -1.258  1.00 0.00 ? 509 ARG A HH11 3  
ATOM 7049  H HH12 . ARG A 1 117 ? 5.335   -17.103 -1.741  1.00 0.00 ? 509 ARG A HH12 3  
ATOM 7050  H HH21 . ARG A 1 117 ? 7.689   -16.313 -4.306  1.00 0.00 ? 509 ARG A HH21 3  
ATOM 7051  H HH22 . ARG A 1 117 ? 6.875   -17.607 -3.563  1.00 0.00 ? 509 ARG A HH22 3  
ATOM 7052  N N    . VAL A 1 118 ? 3.165   -9.283  -1.356  1.00 0.00 ? 510 VAL A N    3  
ATOM 7053  C CA   . VAL A 1 118 ? 2.287   -8.108  -1.186  1.00 0.00 ? 510 VAL A CA   3  
ATOM 7054  C C    . VAL A 1 118 ? 2.900   -7.073  -0.304  1.00 0.00 ? 510 VAL A C    3  
ATOM 7055  O O    . VAL A 1 118 ? 3.900   -7.342  0.307   1.00 0.00 ? 510 VAL A O    3  
ATOM 7056  C CB   . VAL A 1 118 ? 0.834   -8.433  -0.771  1.00 0.00 ? 510 VAL A CB   3  
ATOM 7057  C CG1  . VAL A 1 118 ? 0.115   -9.169  -1.883  1.00 0.00 ? 510 VAL A CG1  3  
ATOM 7058  C CG2  . VAL A 1 118 ? 0.790   -9.241  0.497   1.00 0.00 ? 510 VAL A CG2  3  
ATOM 7059  H H    . VAL A 1 118 ? 3.394   -9.838  -0.573  1.00 0.00 ? 510 VAL A H    3  
ATOM 7060  H HA   . VAL A 1 118 ? 2.264   -7.661  -2.169  1.00 0.00 ? 510 VAL A HA   3  
ATOM 7061  H HB   . VAL A 1 118 ? 0.319   -7.499  -0.605  1.00 0.00 ? 510 VAL A HB   3  
ATOM 7062  H HG11 . VAL A 1 118 ? 0.640   -10.086 -2.106  1.00 0.00 ? 510 VAL A HG11 3  
ATOM 7063  H HG12 . VAL A 1 118 ? -0.895  -9.397  -1.575  1.00 0.00 ? 510 VAL A HG12 3  
ATOM 7064  H HG13 . VAL A 1 118 ? 0.092   -8.544  -2.764  1.00 0.00 ? 510 VAL A HG13 3  
ATOM 7065  H HG21 . VAL A 1 118 ? 1.310   -10.176 0.350   1.00 0.00 ? 510 VAL A HG21 3  
ATOM 7066  H HG22 . VAL A 1 118 ? 1.242   -8.677  1.298   1.00 0.00 ? 510 VAL A HG22 3  
ATOM 7067  H HG23 . VAL A 1 118 ? -0.249  -9.424  0.727   1.00 0.00 ? 510 VAL A HG23 3  
ATOM 7068  N N    . LEU A 1 119 ? 2.365   -5.868  -0.292  1.00 0.00 ? 511 LEU A N    3  
ATOM 7069  C CA   . LEU A 1 119 ? 2.968   -4.829  0.510   1.00 0.00 ? 511 LEU A CA   3  
ATOM 7070  C C    . LEU A 1 119 ? 1.932   -4.066  1.338   1.00 0.00 ? 511 LEU A C    3  
ATOM 7071  O O    . LEU A 1 119 ? 0.861   -3.726  0.860   1.00 0.00 ? 511 LEU A O    3  
ATOM 7072  C CB   . LEU A 1 119 ? 3.891   -3.938  -0.407  1.00 0.00 ? 511 LEU A CB   3  
ATOM 7073  C CG   . LEU A 1 119 ? 4.448   -2.557  0.092   1.00 0.00 ? 511 LEU A CG   3  
ATOM 7074  C CD1  . LEU A 1 119 ? 3.395   -1.474  0.100   1.00 0.00 ? 511 LEU A CD1  3  
ATOM 7075  C CD2  . LEU A 1 119 ? 5.080   -2.657  1.458   1.00 0.00 ? 511 LEU A CD2  3  
ATOM 7076  H H    . LEU A 1 119 ? 1.552   -5.652  -0.809  1.00 0.00 ? 511 LEU A H    3  
ATOM 7077  H HA   . LEU A 1 119 ? 3.601   -5.338  1.220   1.00 0.00 ? 511 LEU A HA   3  
ATOM 7078  H HB2  . LEU A 1 119 ? 4.747   -4.569  -0.605  1.00 0.00 ? 511 LEU A HB2  3  
ATOM 7079  H HB3  . LEU A 1 119 ? 3.413   -3.796  -1.363  1.00 0.00 ? 511 LEU A HB3  3  
ATOM 7080  H HG   . LEU A 1 119 ? 5.210   -2.238  -0.603  1.00 0.00 ? 511 LEU A HG   3  
ATOM 7081  H HD11 . LEU A 1 119 ? 2.577   -1.769  0.741   1.00 0.00 ? 511 LEU A HD11 3  
ATOM 7082  H HD12 . LEU A 1 119 ? 3.829   -0.556  0.469   1.00 0.00 ? 511 LEU A HD12 3  
ATOM 7083  H HD13 . LEU A 1 119 ? 3.028   -1.324  -0.904  1.00 0.00 ? 511 LEU A HD13 3  
ATOM 7084  H HD21 . LEU A 1 119 ? 4.357   -3.050  2.156   1.00 0.00 ? 511 LEU A HD21 3  
ATOM 7085  H HD22 . LEU A 1 119 ? 5.940   -3.307  1.440   1.00 0.00 ? 511 LEU A HD22 3  
ATOM 7086  H HD23 . LEU A 1 119 ? 5.382   -1.671  1.780   1.00 0.00 ? 511 LEU A HD23 3  
ATOM 7087  N N    . MET A 1 120 ? 2.246   -3.854  2.594   1.00 0.00 ? 512 MET A N    3  
ATOM 7088  C CA   . MET A 1 120 ? 1.404   -3.065  3.473   1.00 0.00 ? 512 MET A CA   3  
ATOM 7089  C C    . MET A 1 120 ? 2.007   -1.702  3.633   1.00 0.00 ? 512 MET A C    3  
ATOM 7090  O O    . MET A 1 120 ? 3.132   -1.588  4.082   1.00 0.00 ? 512 MET A O    3  
ATOM 7091  C CB   . MET A 1 120 ? 1.262   -3.724  4.842   1.00 0.00 ? 512 MET A CB   3  
ATOM 7092  C CG   . MET A 1 120 ? 0.592   -2.832  5.897   1.00 0.00 ? 512 MET A CG   3  
ATOM 7093  S SD   . MET A 1 120 ? -1.032  -2.213  5.399   1.00 0.00 ? 512 MET A SD   3  
ATOM 7094  C CE   . MET A 1 120 ? -1.933  -3.732  5.209   1.00 0.00 ? 512 MET A CE   3  
ATOM 7095  H H    . MET A 1 120 ? 3.090   -4.215  2.951   1.00 0.00 ? 512 MET A H    3  
ATOM 7096  H HA   . MET A 1 120 ? 0.428   -2.971  3.018   1.00 0.00 ? 512 MET A HA   3  
ATOM 7097  H HB2  . MET A 1 120 ? 0.689   -4.632  4.735   1.00 0.00 ? 512 MET A HB2  3  
ATOM 7098  H HB3  . MET A 1 120 ? 2.252   -3.978  5.192   1.00 0.00 ? 512 MET A HB3  3  
ATOM 7099  H HG2  . MET A 1 120 ? 0.480   -3.396  6.810   1.00 0.00 ? 512 MET A HG2  3  
ATOM 7100  H HG3  . MET A 1 120 ? 1.243   -1.989  6.084   1.00 0.00 ? 512 MET A HG3  3  
ATOM 7101  H HE1  . MET A 1 120 ? -1.869  -4.281  6.138   1.00 0.00 ? 512 MET A HE1  3  
ATOM 7102  H HE2  . MET A 1 120 ? -2.966  -3.516  4.983   1.00 0.00 ? 512 MET A HE2  3  
ATOM 7103  H HE3  . MET A 1 120 ? -1.489  -4.315  4.417   1.00 0.00 ? 512 MET A HE3  3  
ATOM 7104  N N    . LEU A 1 121 ? 1.276   -0.696  3.280   1.00 0.00 ? 513 LEU A N    3  
ATOM 7105  C CA   . LEU A 1 121 ? 1.762   0.639   3.352   1.00 0.00 ? 513 LEU A CA   3  
ATOM 7106  C C    . LEU A 1 121 ? 1.112   1.379   4.501   1.00 0.00 ? 513 LEU A C    3  
ATOM 7107  O O    . LEU A 1 121 ? -0.115  1.443   4.618   1.00 0.00 ? 513 LEU A O    3  
ATOM 7108  C CB   . LEU A 1 121 ? 1.520   1.364   2.032   1.00 0.00 ? 513 LEU A CB   3  
ATOM 7109  C CG   . LEU A 1 121 ? 2.159   2.733   1.912   1.00 0.00 ? 513 LEU A CG   3  
ATOM 7110  C CD1  . LEU A 1 121 ? 3.649   2.610   2.108   1.00 0.00 ? 513 LEU A CD1  3  
ATOM 7111  C CD2  . LEU A 1 121 ? 1.849   3.355   0.564   1.00 0.00 ? 513 LEU A CD2  3  
ATOM 7112  H H    . LEU A 1 121 ? 0.350   -0.824  2.974   1.00 0.00 ? 513 LEU A H    3  
ATOM 7113  H HA   . LEU A 1 121 ? 2.825   0.599   3.535   1.00 0.00 ? 513 LEU A HA   3  
ATOM 7114  H HB2  . LEU A 1 121 ? 1.898   0.742   1.233   1.00 0.00 ? 513 LEU A HB2  3  
ATOM 7115  H HB3  . LEU A 1 121 ? 0.455   1.476   1.897   1.00 0.00 ? 513 LEU A HB3  3  
ATOM 7116  H HG   . LEU A 1 121 ? 1.767   3.377   2.687   1.00 0.00 ? 513 LEU A HG   3  
ATOM 7117  H HD11 . LEU A 1 121 ? 4.017   1.806   1.489   1.00 0.00 ? 513 LEU A HD11 3  
ATOM 7118  H HD12 . LEU A 1 121 ? 4.113   3.524   1.776   1.00 0.00 ? 513 LEU A HD12 3  
ATOM 7119  H HD13 . LEU A 1 121 ? 3.891   2.432   3.145   1.00 0.00 ? 513 LEU A HD13 3  
ATOM 7120  H HD21 . LEU A 1 121 ? 0.779   3.450   0.450   1.00 0.00 ? 513 LEU A HD21 3  
ATOM 7121  H HD22 . LEU A 1 121 ? 2.304   4.334   0.506   1.00 0.00 ? 513 LEU A HD22 3  
ATOM 7122  H HD23 . LEU A 1 121 ? 2.242   2.726   -0.222  1.00 0.00 ? 513 LEU A HD23 3  
ATOM 7123  N N    . LEU A 1 122 ? 1.931   1.914   5.343   1.00 0.00 ? 514 LEU A N    3  
ATOM 7124  C CA   . LEU A 1 122 ? 1.506   2.651   6.483   1.00 0.00 ? 514 LEU A CA   3  
ATOM 7125  C C    . LEU A 1 122 ? 2.132   4.025   6.449   1.00 0.00 ? 514 LEU A C    3  
ATOM 7126  O O    . LEU A 1 122 ? 3.219   4.217   5.911   1.00 0.00 ? 514 LEU A O    3  
ATOM 7127  C CB   . LEU A 1 122 ? 1.891   1.896   7.753   1.00 0.00 ? 514 LEU A CB   3  
ATOM 7128  C CG   . LEU A 1 122 ? 1.114   0.602   8.005   1.00 0.00 ? 514 LEU A CG   3  
ATOM 7129  C CD1  . LEU A 1 122 ? 1.815   -0.249  9.045   1.00 0.00 ? 514 LEU A CD1  3  
ATOM 7130  C CD2  . LEU A 1 122 ? -0.284  0.930   8.493   1.00 0.00 ? 514 LEU A CD2  3  
ATOM 7131  H H    . LEU A 1 122 ? 2.903   1.831   5.209   1.00 0.00 ? 514 LEU A H    3  
ATOM 7132  H HA   . LEU A 1 122 ? 0.432   2.746   6.442   1.00 0.00 ? 514 LEU A HA   3  
ATOM 7133  H HB2  . LEU A 1 122 ? 2.942   1.656   7.692   1.00 0.00 ? 514 LEU A HB2  3  
ATOM 7134  H HB3  . LEU A 1 122 ? 1.738   2.551   8.594   1.00 0.00 ? 514 LEU A HB3  3  
ATOM 7135  H HG   . LEU A 1 122 ? 1.018   0.060   7.074   1.00 0.00 ? 514 LEU A HG   3  
ATOM 7136  H HD11 . LEU A 1 122 ? 2.807   -0.500  8.698   1.00 0.00 ? 514 LEU A HD11 3  
ATOM 7137  H HD12 . LEU A 1 122 ? 1.884   0.297   9.974   1.00 0.00 ? 514 LEU A HD12 3  
ATOM 7138  H HD13 . LEU A 1 122 ? 1.249   -1.156  9.202   1.00 0.00 ? 514 LEU A HD13 3  
ATOM 7139  H HD21 . LEU A 1 122 ? -0.802  1.515   7.748   1.00 0.00 ? 514 LEU A HD21 3  
ATOM 7140  H HD22 . LEU A 1 122 ? -0.824  0.009   8.661   1.00 0.00 ? 514 LEU A HD22 3  
ATOM 7141  H HD23 . LEU A 1 122 ? -0.227  1.487   9.416   1.00 0.00 ? 514 LEU A HD23 3  
ATOM 7142  N N    . TYR A 1 123 ? 1.452   4.965   6.968   1.00 0.00 ? 515 TYR A N    3  
ATOM 7143  C CA   . TYR A 1 123 ? 1.914   6.307   6.971   1.00 0.00 ? 515 TYR A CA   3  
ATOM 7144  C C    . TYR A 1 123 ? 2.508   6.653   8.309   1.00 0.00 ? 515 TYR A C    3  
ATOM 7145  O O    . TYR A 1 123 ? 1.858   6.495   9.344   1.00 0.00 ? 515 TYR A O    3  
ATOM 7146  C CB   . TYR A 1 123 ? 0.749   7.227   6.651   1.00 0.00 ? 515 TYR A CB   3  
ATOM 7147  C CG   . TYR A 1 123 ? 1.045   8.692   6.766   1.00 0.00 ? 515 TYR A CG   3  
ATOM 7148  C CD1  . TYR A 1 123 ? 1.932   9.312   5.907   1.00 0.00 ? 515 TYR A CD1  3  
ATOM 7149  C CD2  . TYR A 1 123 ? 0.426   9.457   7.740   1.00 0.00 ? 515 TYR A CD2  3  
ATOM 7150  C CE1  . TYR A 1 123 ? 2.199   10.648  6.019   1.00 0.00 ? 515 TYR A CE1  3  
ATOM 7151  C CE2  . TYR A 1 123 ? 0.684   10.793  7.857   1.00 0.00 ? 515 TYR A CE2  3  
ATOM 7152  C CZ   . TYR A 1 123 ? 1.571   11.387  7.000   1.00 0.00 ? 515 TYR A CZ   3  
ATOM 7153  O OH   . TYR A 1 123 ? 1.834   12.731  7.124   1.00 0.00 ? 515 TYR A OH   3  
ATOM 7154  H H    . TYR A 1 123 ? 0.591   4.768   7.397   1.00 0.00 ? 515 TYR A H    3  
ATOM 7155  H HA   . TYR A 1 123 ? 2.666   6.441   6.206   1.00 0.00 ? 515 TYR A HA   3  
ATOM 7156  H HB2  . TYR A 1 123 ? 0.417   7.038   5.641   1.00 0.00 ? 515 TYR A HB2  3  
ATOM 7157  H HB3  . TYR A 1 123 ? -0.055  6.994   7.332   1.00 0.00 ? 515 TYR A HB3  3  
ATOM 7158  H HD1  . TYR A 1 123 ? 2.421   8.727   5.143   1.00 0.00 ? 515 TYR A HD1  3  
ATOM 7159  H HD2  . TYR A 1 123 ? -0.272  8.984   8.416   1.00 0.00 ? 515 TYR A HD2  3  
ATOM 7160  H HE1  . TYR A 1 123 ? 2.898   11.103  5.335   1.00 0.00 ? 515 TYR A HE1  3  
ATOM 7161  H HE2  . TYR A 1 123 ? 0.193   11.371  8.626   1.00 0.00 ? 515 TYR A HE2  3  
ATOM 7162  H HH   . TYR A 1 123 ? 1.851   13.124  6.245   1.00 0.00 ? 515 TYR A HH   3  
ATOM 7163  N N    . SER A 1 124 ? 3.737   7.092   8.307   1.00 0.00 ? 516 SER A N    3  
ATOM 7164  C CA   . SER A 1 124 ? 4.313   7.572   9.509   1.00 0.00 ? 516 SER A CA   3  
ATOM 7165  C C    . SER A 1 124 ? 4.103   9.079   9.539   1.00 0.00 ? 516 SER A C    3  
ATOM 7166  O O    . SER A 1 124 ? 4.683   9.837   8.717   1.00 0.00 ? 516 SER A O    3  
ATOM 7167  C CB   . SER A 1 124 ? 5.796   7.165   9.616   1.00 0.00 ? 516 SER A CB   3  
ATOM 7168  O OG   . SER A 1 124 ? 6.538   7.541   8.469   1.00 0.00 ? 516 SER A OG   3  
ATOM 7169  H H    . SER A 1 124 ? 4.249   7.119   7.468   1.00 0.00 ? 516 SER A H    3  
ATOM 7170  H HA   . SER A 1 124 ? 3.753   7.136   10.323  1.00 0.00 ? 516 SER A HA   3  
ATOM 7171  H HB2  . SER A 1 124 ? 6.239   7.648   10.473  1.00 0.00 ? 516 SER A HB2  3  
ATOM 7172  H HB3  . SER A 1 124 ? 5.862   6.094   9.738   1.00 0.00 ? 516 SER A HB3  3  
ATOM 7173  H HG   . SER A 1 124 ? 5.951   7.723   7.724   1.00 0.00 ? 516 SER A HG   3  
ATOM 7174  N N    . SER A 1 125 ? 3.244   9.489   10.447  1.00 0.00 ? 517 SER A N    3  
ATOM 7175  C CA   . SER A 1 125 ? 2.816   10.853  10.605  1.00 0.00 ? 517 SER A CA   3  
ATOM 7176  C C    . SER A 1 125 ? 3.917   11.767  11.121  1.00 0.00 ? 517 SER A C    3  
ATOM 7177  O O    . SER A 1 125 ? 4.037   12.909  10.687  1.00 0.00 ? 517 SER A O    3  
ATOM 7178  C CB   . SER A 1 125 ? 1.596   10.858  11.514  1.00 0.00 ? 517 SER A CB   3  
ATOM 7179  O OG   . SER A 1 125 ? 1.791   9.939   12.584  1.00 0.00 ? 517 SER A OG   3  
ATOM 7180  H H    . SER A 1 125 ? 2.863   8.845   11.083  1.00 0.00 ? 517 SER A H    3  
ATOM 7181  H HA   . SER A 1 125 ? 2.502   11.210  9.638   1.00 0.00 ? 517 SER A HA   3  
ATOM 7182  H HB2  . SER A 1 125 ? 1.447   11.848  11.919  1.00 0.00 ? 517 SER A HB2  3  
ATOM 7183  H HB3  . SER A 1 125 ? 0.723   10.559  10.953  1.00 0.00 ? 517 SER A HB3  3  
ATOM 7184  H HG   . SER A 1 125 ? 0.958   9.485   12.757  1.00 0.00 ? 517 SER A HG   3  
ATOM 7185  N N    . LYS A 1 126 ? 4.755   11.240  11.986  1.00 0.00 ? 518 LYS A N    3  
ATOM 7186  C CA   . LYS A 1 126 ? 5.811   12.021  12.614  1.00 0.00 ? 518 LYS A CA   3  
ATOM 7187  C C    . LYS A 1 126 ? 6.920   12.319  11.608  1.00 0.00 ? 518 LYS A C    3  
ATOM 7188  O O    . LYS A 1 126 ? 7.652   13.301  11.726  1.00 0.00 ? 518 LYS A O    3  
ATOM 7189  C CB   . LYS A 1 126 ? 6.366   11.256  13.820  1.00 0.00 ? 518 LYS A CB   3  
ATOM 7190  C CG   . LYS A 1 126 ? 7.319   12.054  14.709  1.00 0.00 ? 518 LYS A CG   3  
ATOM 7191  C CD   . LYS A 1 126 ? 7.904   11.193  15.827  1.00 0.00 ? 518 LYS A CD   3  
ATOM 7192  C CE   . LYS A 1 126 ? 6.824   10.588  16.723  1.00 0.00 ? 518 LYS A CE   3  
ATOM 7193  N NZ   . LYS A 1 126 ? 7.392   9.721   17.773  1.00 0.00 ? 518 LYS A NZ   3  
ATOM 7194  H H    . LYS A 1 126 ? 4.638   10.293  12.228  1.00 0.00 ? 518 LYS A H    3  
ATOM 7195  H HA   . LYS A 1 126 ? 5.383   12.951  12.954  1.00 0.00 ? 518 LYS A HA   3  
ATOM 7196  H HB2  . LYS A 1 126 ? 5.529   10.941  14.425  1.00 0.00 ? 518 LYS A HB2  3  
ATOM 7197  H HB3  . LYS A 1 126 ? 6.886   10.380  13.462  1.00 0.00 ? 518 LYS A HB3  3  
ATOM 7198  H HG2  . LYS A 1 126 ? 8.128   12.433  14.100  1.00 0.00 ? 518 LYS A HG2  3  
ATOM 7199  H HG3  . LYS A 1 126 ? 6.780   12.882  15.146  1.00 0.00 ? 518 LYS A HG3  3  
ATOM 7200  H HD2  . LYS A 1 126 ? 8.472   10.393  15.376  1.00 0.00 ? 518 LYS A HD2  3  
ATOM 7201  H HD3  . LYS A 1 126 ? 8.565   11.802  16.426  1.00 0.00 ? 518 LYS A HD3  3  
ATOM 7202  H HE2  . LYS A 1 126 ? 6.268   11.383  17.193  1.00 0.00 ? 518 LYS A HE2  3  
ATOM 7203  H HE3  . LYS A 1 126 ? 6.160   9.998   16.110  1.00 0.00 ? 518 LYS A HE3  3  
ATOM 7204  H HZ1  . LYS A 1 126 ? 7.971   8.949   17.382  1.00 0.00 ? 518 LYS A HZ1  3  
ATOM 7205  H HZ2  . LYS A 1 126 ? 7.989   10.244  18.444  1.00 0.00 ? 518 LYS A HZ2  3  
ATOM 7206  H HZ3  . LYS A 1 126 ? 6.634   9.281   18.334  1.00 0.00 ? 518 LYS A HZ3  3  
ATOM 7207  N N    . LYS A 1 127 ? 7.011   11.482  10.606  1.00 0.00 ? 519 LYS A N    3  
ATOM 7208  C CA   . LYS A 1 127 ? 8.025   11.624  9.581   1.00 0.00 ? 519 LYS A CA   3  
ATOM 7209  C C    . LYS A 1 127 ? 7.404   12.161  8.294   1.00 0.00 ? 519 LYS A C    3  
ATOM 7210  O O    . LYS A 1 127 ? 8.108   12.526  7.359   1.00 0.00 ? 519 LYS A O    3  
ATOM 7211  C CB   . LYS A 1 127 ? 8.694   10.269  9.346   1.00 0.00 ? 519 LYS A CB   3  
ATOM 7212  C CG   . LYS A 1 127 ? 9.368   9.714   10.592  1.00 0.00 ? 519 LYS A CG   3  
ATOM 7213  C CD   . LYS A 1 127 ? 9.927   8.323   10.369  1.00 0.00 ? 519 LYS A CD   3  
ATOM 7214  C CE   . LYS A 1 127 ? 10.593  7.808   11.633  1.00 0.00 ? 519 LYS A CE   3  
ATOM 7215  N NZ   . LYS A 1 127 ? 11.099  6.431   11.482  1.00 0.00 ? 519 LYS A NZ   3  
ATOM 7216  H H    . LYS A 1 127 ? 6.370   10.742  10.557  1.00 0.00 ? 519 LYS A H    3  
ATOM 7217  H HA   . LYS A 1 127 ? 8.766   12.325  9.937   1.00 0.00 ? 519 LYS A HA   3  
ATOM 7218  H HB2  . LYS A 1 127 ? 7.942   9.565   9.022   1.00 0.00 ? 519 LYS A HB2  3  
ATOM 7219  H HB3  . LYS A 1 127 ? 9.440   10.371  8.572   1.00 0.00 ? 519 LYS A HB3  3  
ATOM 7220  H HG2  . LYS A 1 127 ? 10.175  10.373  10.878  1.00 0.00 ? 519 LYS A HG2  3  
ATOM 7221  H HG3  . LYS A 1 127 ? 8.641   9.677   11.390  1.00 0.00 ? 519 LYS A HG3  3  
ATOM 7222  H HD2  . LYS A 1 127 ? 9.123   7.657   10.094  1.00 0.00 ? 519 LYS A HD2  3  
ATOM 7223  H HD3  . LYS A 1 127 ? 10.656  8.356   9.573   1.00 0.00 ? 519 LYS A HD3  3  
ATOM 7224  H HE2  . LYS A 1 127 ? 11.424  8.455   11.875  1.00 0.00 ? 519 LYS A HE2  3  
ATOM 7225  H HE3  . LYS A 1 127 ? 9.874   7.834   12.437  1.00 0.00 ? 519 LYS A HE3  3  
ATOM 7226  H HZ1  . LYS A 1 127 ? 11.783  6.357   10.705  1.00 0.00 ? 519 LYS A HZ1  3  
ATOM 7227  H HZ2  . LYS A 1 127 ? 11.569  6.146   12.364  1.00 0.00 ? 519 LYS A HZ2  3  
ATOM 7228  H HZ3  . LYS A 1 127 ? 10.316  5.764   11.326  1.00 0.00 ? 519 LYS A HZ3  3  
ATOM 7229  N N    . LYS A 1 128 ? 6.061   12.198  8.281   1.00 0.00 ? 520 LYS A N    3  
ATOM 7230  C CA   . LYS A 1 128 ? 5.245   12.677  7.151   1.00 0.00 ? 520 LYS A CA   3  
ATOM 7231  C C    . LYS A 1 128 ? 5.480   11.833  5.884   1.00 0.00 ? 520 LYS A C    3  
ATOM 7232  O O    . LYS A 1 128 ? 5.157   12.261  4.761   1.00 0.00 ? 520 LYS A O    3  
ATOM 7233  C CB   . LYS A 1 128 ? 5.500   14.180  6.880   1.00 0.00 ? 520 LYS A CB   3  
ATOM 7234  C CG   . LYS A 1 128 ? 5.131   15.115  8.040   1.00 0.00 ? 520 LYS A CG   3  
ATOM 7235  C CD   . LYS A 1 128 ? 3.635   15.119  8.323   1.00 0.00 ? 520 LYS A CD   3  
ATOM 7236  C CE   . LYS A 1 128 ? 3.270   16.055  9.479   1.00 0.00 ? 520 LYS A CE   3  
ATOM 7237  N NZ   . LYS A 1 128 ? 3.872   15.628  10.765  1.00 0.00 ? 520 LYS A NZ   3  
ATOM 7238  H H    . LYS A 1 128 ? 5.589   11.881  9.077   1.00 0.00 ? 520 LYS A H    3  
ATOM 7239  H HA   . LYS A 1 128 ? 4.212   12.547  7.438   1.00 0.00 ? 520 LYS A HA   3  
ATOM 7240  H HB2  . LYS A 1 128 ? 6.550   14.315  6.662   1.00 0.00 ? 520 LYS A HB2  3  
ATOM 7241  H HB3  . LYS A 1 128 ? 4.927   14.472  6.012   1.00 0.00 ? 520 LYS A HB3  3  
ATOM 7242  H HG2  . LYS A 1 128 ? 5.644   14.785  8.930   1.00 0.00 ? 520 LYS A HG2  3  
ATOM 7243  H HG3  . LYS A 1 128 ? 5.443   16.119  7.795   1.00 0.00 ? 520 LYS A HG3  3  
ATOM 7244  H HD2  . LYS A 1 128 ? 3.109   15.438  7.436   1.00 0.00 ? 520 LYS A HD2  3  
ATOM 7245  H HD3  . LYS A 1 128 ? 3.328   14.115  8.578   1.00 0.00 ? 520 LYS A HD3  3  
ATOM 7246  H HE2  . LYS A 1 128 ? 3.624   17.047  9.247   1.00 0.00 ? 520 LYS A HE2  3  
ATOM 7247  H HE3  . LYS A 1 128 ? 2.195   16.079  9.582   1.00 0.00 ? 520 LYS A HE3  3  
ATOM 7248  H HZ1  . LYS A 1 128 ? 3.625   14.632  10.955  1.00 0.00 ? 520 LYS A HZ1  3  
ATOM 7249  H HZ2  . LYS A 1 128 ? 4.909   15.692  10.743  1.00 0.00 ? 520 LYS A HZ2  3  
ATOM 7250  H HZ3  . LYS A 1 128 ? 3.513   16.195  11.560  1.00 0.00 ? 520 LYS A HZ3  3  
ATOM 7251  N N    . ILE A 1 129 ? 5.923   10.594  6.074   1.00 0.00 ? 521 ILE A N    3  
ATOM 7252  C CA   . ILE A 1 129 ? 6.298   9.729   4.941   1.00 0.00 ? 521 ILE A CA   3  
ATOM 7253  C C    . ILE A 1 129 ? 5.704   8.352   5.072   1.00 0.00 ? 521 ILE A C    3  
ATOM 7254  O O    . ILE A 1 129 ? 5.188   7.996   6.146   1.00 0.00 ? 521 ILE A O    3  
ATOM 7255  C CB   . ILE A 1 129 ? 7.853   9.679   4.635   1.00 0.00 ? 521 ILE A CB   3  
ATOM 7256  C CG1  . ILE A 1 129 ? 8.726   9.260   5.842   1.00 0.00 ? 521 ILE A CG1  3  
ATOM 7257  C CG2  . ILE A 1 129 ? 8.342   10.994  4.065   1.00 0.00 ? 521 ILE A CG2  3  
ATOM 7258  C CD1  . ILE A 1 129 ? 8.735   7.772   6.152   1.00 0.00 ? 521 ILE A CD1  3  
ATOM 7259  H H    . ILE A 1 129 ? 5.914   10.244  6.997   1.00 0.00 ? 521 ILE A H    3  
ATOM 7260  H HA   . ILE A 1 129 ? 5.800   10.176  4.092   1.00 0.00 ? 521 ILE A HA   3  
ATOM 7261  H HB   . ILE A 1 129 ? 7.975   8.951   3.846   1.00 0.00 ? 521 ILE A HB   3  
ATOM 7262  H HG12 . ILE A 1 129 ? 9.747   9.555   5.653   1.00 0.00 ? 521 ILE A HG12 3  
ATOM 7263  H HG13 . ILE A 1 129 ? 8.369   9.782   6.717   1.00 0.00 ? 521 ILE A HG13 3  
ATOM 7264  H HG21 . ILE A 1 129 ? 7.818   11.208  3.145   1.00 0.00 ? 521 ILE A HG21 3  
ATOM 7265  H HG22 . ILE A 1 129 ? 8.157   11.785  4.776   1.00 0.00 ? 521 ILE A HG22 3  
ATOM 7266  H HG23 . ILE A 1 129 ? 9.401   10.925  3.867   1.00 0.00 ? 521 ILE A HG23 3  
ATOM 7267  H HD11 . ILE A 1 129 ? 7.728   7.445   6.364   1.00 0.00 ? 521 ILE A HD11 3  
ATOM 7268  H HD12 . ILE A 1 129 ? 9.122   7.225   5.305   1.00 0.00 ? 521 ILE A HD12 3  
ATOM 7269  H HD13 . ILE A 1 129 ? 9.360   7.591   7.014   1.00 0.00 ? 521 ILE A HD13 3  
ATOM 7270  N N    . PHE A 1 130 ? 5.754   7.572   4.020   1.00 0.00 ? 522 PHE A N    3  
ATOM 7271  C CA   . PHE A 1 130 ? 5.117   6.295   4.045   1.00 0.00 ? 522 PHE A CA   3  
ATOM 7272  C C    . PHE A 1 130 ? 6.148   5.194   4.252   1.00 0.00 ? 522 PHE A C    3  
ATOM 7273  O O    . PHE A 1 130 ? 7.245   5.245   3.710   1.00 0.00 ? 522 PHE A O    3  
ATOM 7274  C CB   . PHE A 1 130 ? 4.294   6.085   2.774   1.00 0.00 ? 522 PHE A CB   3  
ATOM 7275  C CG   . PHE A 1 130 ? 3.150   7.057   2.588   1.00 0.00 ? 522 PHE A CG   3  
ATOM 7276  C CD1  . PHE A 1 130 ? 1.843   6.634   2.730   1.00 0.00 ? 522 PHE A CD1  3  
ATOM 7277  C CD2  . PHE A 1 130 ? 3.383   8.388   2.260   1.00 0.00 ? 522 PHE A CD2  3  
ATOM 7278  C CE1  . PHE A 1 130 ? 0.796   7.511   2.549   1.00 0.00 ? 522 PHE A CE1  3  
ATOM 7279  C CE2  . PHE A 1 130 ? 2.340   9.267   2.084   1.00 0.00 ? 522 PHE A CE2  3  
ATOM 7280  C CZ   . PHE A 1 130 ? 1.044   8.829   2.228   1.00 0.00 ? 522 PHE A CZ   3  
ATOM 7281  H H    . PHE A 1 130 ? 6.259   7.787   3.197   1.00 0.00 ? 522 PHE A H    3  
ATOM 7282  H HA   . PHE A 1 130 ? 4.450   6.294   4.894   1.00 0.00 ? 522 PHE A HA   3  
ATOM 7283  H HB2  . PHE A 1 130 ? 4.937   6.182   1.914   1.00 0.00 ? 522 PHE A HB2  3  
ATOM 7284  H HB3  . PHE A 1 130 ? 3.875   5.093   2.815   1.00 0.00 ? 522 PHE A HB3  3  
ATOM 7285  H HD1  . PHE A 1 130 ? 1.643   5.604   2.986   1.00 0.00 ? 522 PHE A HD1  3  
ATOM 7286  H HD2  . PHE A 1 130 ? 4.401   8.732   2.148   1.00 0.00 ? 522 PHE A HD2  3  
ATOM 7287  H HE1  . PHE A 1 130 ? -0.220  7.163   2.656   1.00 0.00 ? 522 PHE A HE1  3  
ATOM 7288  H HE2  . PHE A 1 130 ? 2.539   10.299  1.834   1.00 0.00 ? 522 PHE A HE2  3  
ATOM 7289  H HZ   . PHE A 1 130 ? 0.224   9.516   2.088   1.00 0.00 ? 522 PHE A HZ   3  
ATOM 7290  N N    . MET A 1 131 ? 5.809   4.243   5.057   1.00 0.00 ? 523 MET A N    3  
ATOM 7291  C CA   . MET A 1 131 ? 6.688   3.152   5.414   1.00 0.00 ? 523 MET A CA   3  
ATOM 7292  C C    . MET A 1 131 ? 5.889   1.868   5.304   1.00 0.00 ? 523 MET A C    3  
ATOM 7293  O O    . MET A 1 131 ? 4.704   1.858   5.625   1.00 0.00 ? 523 MET A O    3  
ATOM 7294  C CB   . MET A 1 131 ? 7.217   3.393   6.857   1.00 0.00 ? 523 MET A CB   3  
ATOM 7295  C CG   . MET A 1 131 ? 8.158   2.328   7.439   1.00 0.00 ? 523 MET A CG   3  
ATOM 7296  S SD   . MET A 1 131 ? 7.338   0.786   7.939   1.00 0.00 ? 523 MET A SD   3  
ATOM 7297  C CE   . MET A 1 131 ? 6.228   1.366   9.223   1.00 0.00 ? 523 MET A CE   3  
ATOM 7298  H H    . MET A 1 131 ? 4.897   4.225   5.432   1.00 0.00 ? 523 MET A H    3  
ATOM 7299  H HA   . MET A 1 131 ? 7.514   3.126   4.720   1.00 0.00 ? 523 MET A HA   3  
ATOM 7300  H HB2  . MET A 1 131 ? 7.752   4.331   6.862   1.00 0.00 ? 523 MET A HB2  3  
ATOM 7301  H HB3  . MET A 1 131 ? 6.367   3.493   7.514   1.00 0.00 ? 523 MET A HB3  3  
ATOM 7302  H HG2  . MET A 1 131 ? 8.896   2.083   6.689   1.00 0.00 ? 523 MET A HG2  3  
ATOM 7303  H HG3  . MET A 1 131 ? 8.659   2.749   8.298   1.00 0.00 ? 523 MET A HG3  3  
ATOM 7304  H HE1  . MET A 1 131 ? 6.796   1.848   10.005  1.00 0.00 ? 523 MET A HE1  3  
ATOM 7305  H HE2  . MET A 1 131 ? 5.522   2.067   8.803   1.00 0.00 ? 523 MET A HE2  3  
ATOM 7306  H HE3  . MET A 1 131 ? 5.687   0.526   9.633   1.00 0.00 ? 523 MET A HE3  3  
ATOM 7307  N N    . GLY A 1 132 ? 6.489   0.811   4.830   1.00 0.00 ? 524 GLY A N    3  
ATOM 7308  C CA   . GLY A 1 132 ? 5.740   -0.399  4.679   1.00 0.00 ? 524 GLY A CA   3  
ATOM 7309  C C    . GLY A 1 132 ? 6.583   -1.639  4.766   1.00 0.00 ? 524 GLY A C    3  
ATOM 7310  O O    . GLY A 1 132 ? 7.785   -1.569  4.655   1.00 0.00 ? 524 GLY A O    3  
ATOM 7311  H H    . GLY A 1 132 ? 7.447   0.817   4.607   1.00 0.00 ? 524 GLY A H    3  
ATOM 7312  H HA2  . GLY A 1 132 ? 4.972   -0.425  5.435   1.00 0.00 ? 524 GLY A HA2  3  
ATOM 7313  H HA3  . GLY A 1 132 ? 5.255   -0.373  3.713   1.00 0.00 ? 524 GLY A HA3  3  
ATOM 7314  N N    . LEU A 1 133 ? 5.966   -2.752  5.058   1.00 0.00 ? 525 LEU A N    3  
ATOM 7315  C CA   . LEU A 1 133 ? 6.641   -4.044  5.026   1.00 0.00 ? 525 LEU A CA   3  
ATOM 7316  C C    . LEU A 1 133 ? 6.035   -4.913  3.962   1.00 0.00 ? 525 LEU A C    3  
ATOM 7317  O O    . LEU A 1 133 ? 4.802   -4.882  3.769   1.00 0.00 ? 525 LEU A O    3  
ATOM 7318  C CB   . LEU A 1 133 ? 6.664   -4.787  6.375   1.00 0.00 ? 525 LEU A CB   3  
ATOM 7319  C CG   . LEU A 1 133 ? 7.516   -4.177  7.491   1.00 0.00 ? 525 LEU A CG   3  
ATOM 7320  C CD1  . LEU A 1 133 ? 6.851   -2.938  8.081   1.00 0.00 ? 525 LEU A CD1  3  
ATOM 7321  C CD2  . LEU A 1 133 ? 7.784   -5.205  8.575   1.00 0.00 ? 525 LEU A CD2  3  
ATOM 7322  H H    . LEU A 1 133 ? 5.008   -2.718  5.264   1.00 0.00 ? 525 LEU A H    3  
ATOM 7323  H HA   . LEU A 1 133 ? 7.657   -3.841  4.717   1.00 0.00 ? 525 LEU A HA   3  
ATOM 7324  H HB2  . LEU A 1 133 ? 5.648   -4.854  6.733   1.00 0.00 ? 525 LEU A HB2  3  
ATOM 7325  H HB3  . LEU A 1 133 ? 7.021   -5.789  6.191   1.00 0.00 ? 525 LEU A HB3  3  
ATOM 7326  H HG   . LEU A 1 133 ? 8.472   -3.899  7.055   1.00 0.00 ? 525 LEU A HG   3  
ATOM 7327  H HD11 . LEU A 1 133 ? 6.682   -2.214  7.299   1.00 0.00 ? 525 LEU A HD11 3  
ATOM 7328  H HD12 . LEU A 1 133 ? 5.904   -3.212  8.524   1.00 0.00 ? 525 LEU A HD12 3  
ATOM 7329  H HD13 . LEU A 1 133 ? 7.492   -2.511  8.838   1.00 0.00 ? 525 LEU A HD13 3  
ATOM 7330  H HD21 . LEU A 1 133 ? 6.849   -5.570  8.971   1.00 0.00 ? 525 LEU A HD21 3  
ATOM 7331  H HD22 . LEU A 1 133 ? 8.352   -6.027  8.166   1.00 0.00 ? 525 LEU A HD22 3  
ATOM 7332  H HD23 . LEU A 1 133 ? 8.355   -4.742  9.366   1.00 0.00 ? 525 LEU A HD23 3  
ATOM 7333  N N    . ILE A 1 134 ? 6.858   -5.647  3.245   1.00 0.00 ? 526 ILE A N    3  
ATOM 7334  C CA   . ILE A 1 134 ? 6.359   -6.555  2.236   1.00 0.00 ? 526 ILE A CA   3  
ATOM 7335  C C    . ILE A 1 134 ? 6.286   -7.988  2.804   1.00 0.00 ? 526 ILE A C    3  
ATOM 7336  O O    . ILE A 1 134 ? 7.334   -8.614  3.070   1.00 0.00 ? 526 ILE A O    3  
ATOM 7337  C CB   . ILE A 1 134 ? 7.277   -6.533  0.959   1.00 0.00 ? 526 ILE A CB   3  
ATOM 7338  C CG1  . ILE A 1 134 ? 7.249   -5.160  0.293   1.00 0.00 ? 526 ILE A CG1  3  
ATOM 7339  C CG2  . ILE A 1 134 ? 6.992   -7.659  -0.025  1.00 0.00 ? 526 ILE A CG2  3  
ATOM 7340  C CD1  . ILE A 1 134 ? 7.859   -5.086  -1.096  1.00 0.00 ? 526 ILE A CD1  3  
ATOM 7341  H H    . ILE A 1 134 ? 7.825   -5.587  3.408   1.00 0.00 ? 526 ILE A H    3  
ATOM 7342  H HA   . ILE A 1 134 ? 5.367   -6.234  1.955   1.00 0.00 ? 526 ILE A HA   3  
ATOM 7343  H HB   . ILE A 1 134 ? 8.277   -6.694  1.313   1.00 0.00 ? 526 ILE A HB   3  
ATOM 7344  H HG12 . ILE A 1 134 ? 6.233   -4.821  0.257   1.00 0.00 ? 526 ILE A HG12 3  
ATOM 7345  H HG13 . ILE A 1 134 ? 7.799   -4.482  0.931   1.00 0.00 ? 526 ILE A HG13 3  
ATOM 7346  H HG21 . ILE A 1 134 ? 5.972   -7.594  -0.371  1.00 0.00 ? 526 ILE A HG21 3  
ATOM 7347  H HG22 . ILE A 1 134 ? 7.678   -7.575  -0.855  1.00 0.00 ? 526 ILE A HG22 3  
ATOM 7348  H HG23 . ILE A 1 134 ? 7.155   -8.602  0.476   1.00 0.00 ? 526 ILE A HG23 3  
ATOM 7349  H HD11 . ILE A 1 134 ? 8.896   -5.386  -1.064  1.00 0.00 ? 526 ILE A HD11 3  
ATOM 7350  H HD12 . ILE A 1 134 ? 7.303   -5.740  -1.753  1.00 0.00 ? 526 ILE A HD12 3  
ATOM 7351  H HD13 . ILE A 1 134 ? 7.778   -4.071  -1.459  1.00 0.00 ? 526 ILE A HD13 3  
ATOM 7352  N N    . PRO A 1 135 ? 5.056   -8.497  3.063   1.00 0.00 ? 527 PRO A N    3  
ATOM 7353  C CA   . PRO A 1 135 ? 4.830   -9.882  3.430   1.00 0.00 ? 527 PRO A CA   3  
ATOM 7354  C C    . PRO A 1 135 ? 5.028   -10.839 2.244   1.00 0.00 ? 527 PRO A C    3  
ATOM 7355  O O    . PRO A 1 135 ? 4.504   -10.611 1.083   1.00 0.00 ? 527 PRO A O    3  
ATOM 7356  C CB   . PRO A 1 135 ? 3.370   -9.919  3.906   1.00 0.00 ? 527 PRO A CB   3  
ATOM 7357  C CG   . PRO A 1 135 ? 3.030   -8.501  4.159   1.00 0.00 ? 527 PRO A CG   3  
ATOM 7358  C CD   . PRO A 1 135 ? 3.812   -7.729  3.158   1.00 0.00 ? 527 PRO A CD   3  
ATOM 7359  H HA   . PRO A 1 135 ? 5.483   -10.179 4.237   1.00 0.00 ? 527 PRO A HA   3  
ATOM 7360  H HB2  . PRO A 1 135 ? 2.746   -10.347 3.134   1.00 0.00 ? 527 PRO A HB2  3  
ATOM 7361  H HB3  . PRO A 1 135 ? 3.294   -10.512 4.805   1.00 0.00 ? 527 PRO A HB3  3  
ATOM 7362  H HG2  . PRO A 1 135 ? 1.970   -8.341  4.021   1.00 0.00 ? 527 PRO A HG2  3  
ATOM 7363  H HG3  . PRO A 1 135 ? 3.323   -8.224  5.162   1.00 0.00 ? 527 PRO A HG3  3  
ATOM 7364  H HD2  . PRO A 1 135 ? 3.300   -7.706  2.207   1.00 0.00 ? 527 PRO A HD2  3  
ATOM 7365  H HD3  . PRO A 1 135 ? 4.003   -6.730  3.519   1.00 0.00 ? 527 PRO A HD3  3  
ATOM 7366  N N    . TYR A 1 136 ? 5.773   -11.899 2.544   1.00 0.00 ? 528 TYR A N    3  
ATOM 7367  C CA   . TYR A 1 136 ? 6.140   -12.939 1.605   1.00 0.00 ? 528 TYR A CA   3  
ATOM 7368  C C    . TYR A 1 136 ? 4.957   -13.847 1.326   1.00 0.00 ? 528 TYR A C    3  
ATOM 7369  O O    . TYR A 1 136 ? 4.728   -14.261 0.186   1.00 0.00 ? 528 TYR A O    3  
ATOM 7370  C CB   . TYR A 1 136 ? 7.291   -13.775 2.175   1.00 0.00 ? 528 TYR A CB   3  
ATOM 7371  C CG   . TYR A 1 136 ? 8.502   -12.974 2.589   1.00 0.00 ? 528 TYR A CG   3  
ATOM 7372  C CD1  . TYR A 1 136 ? 9.416   -12.533 1.650   1.00 0.00 ? 528 TYR A CD1  3  
ATOM 7373  C CD2  . TYR A 1 136 ? 8.731   -12.660 3.925   1.00 0.00 ? 528 TYR A CD2  3  
ATOM 7374  C CE1  . TYR A 1 136 ? 10.518  -11.803 2.025   1.00 0.00 ? 528 TYR A CE1  3  
ATOM 7375  C CE2  . TYR A 1 136 ? 9.836   -11.929 4.307   1.00 0.00 ? 528 TYR A CE2  3  
ATOM 7376  C CZ   . TYR A 1 136 ? 10.729  -11.504 3.348   1.00 0.00 ? 528 TYR A CZ   3  
ATOM 7377  O OH   . TYR A 1 136 ? 11.833  -10.765 3.705   1.00 0.00 ? 528 TYR A OH   3  
ATOM 7378  H H    . TYR A 1 136 ? 6.098   -11.961 3.467   1.00 0.00 ? 528 TYR A H    3  
ATOM 7379  H HA   . TYR A 1 136 ? 6.473   -12.474 0.690   1.00 0.00 ? 528 TYR A HA   3  
ATOM 7380  H HB2  . TYR A 1 136 ? 6.936   -14.298 3.051   1.00 0.00 ? 528 TYR A HB2  3  
ATOM 7381  H HB3  . TYR A 1 136 ? 7.602   -14.498 1.435   1.00 0.00 ? 528 TYR A HB3  3  
ATOM 7382  H HD1  . TYR A 1 136 ? 9.255   -12.769 0.609   1.00 0.00 ? 528 TYR A HD1  3  
ATOM 7383  H HD2  . TYR A 1 136 ? 8.025   -12.997 4.671   1.00 0.00 ? 528 TYR A HD2  3  
ATOM 7384  H HE1  . TYR A 1 136 ? 11.220  -11.468 1.274   1.00 0.00 ? 528 TYR A HE1  3  
ATOM 7385  H HE2  . TYR A 1 136 ? 9.993   -11.701 5.352   1.00 0.00 ? 528 TYR A HE2  3  
ATOM 7386  H HH   . TYR A 1 136 ? 12.227  -11.131 4.508   1.00 0.00 ? 528 TYR A HH   3  
ATOM 7387  N N    . ASP A 1 137 ? 4.214   -14.178 2.352   1.00 0.00 ? 529 ASP A N    3  
ATOM 7388  C CA   . ASP A 1 137 ? 3.055   -15.013 2.154   1.00 0.00 ? 529 ASP A CA   3  
ATOM 7389  C C    . ASP A 1 137 ? 1.882   -14.179 1.738   1.00 0.00 ? 529 ASP A C    3  
ATOM 7390  O O    . ASP A 1 137 ? 1.184   -13.581 2.558   1.00 0.00 ? 529 ASP A O    3  
ATOM 7391  C CB   . ASP A 1 137 ? 2.709   -15.888 3.351   1.00 0.00 ? 529 ASP A CB   3  
ATOM 7392  C CG   . ASP A 1 137 ? 1.485   -16.737 3.071   1.00 0.00 ? 529 ASP A CG   3  
ATOM 7393  O OD1  . ASP A 1 137 ? 0.438   -16.483 3.657   1.00 0.00 ? 529 ASP A OD1  3  
ATOM 7394  O OD2  . ASP A 1 137 ? 1.566   -17.643 2.224   1.00 0.00 ? 529 ASP A OD2  3  
ATOM 7395  H H    . ASP A 1 137 ? 4.437   -13.860 3.250   1.00 0.00 ? 529 ASP A H    3  
ATOM 7396  H HA   . ASP A 1 137 ? 3.297   -15.647 1.314   1.00 0.00 ? 529 ASP A HA   3  
ATOM 7397  H HB2  . ASP A 1 137 ? 3.540   -16.545 3.559   1.00 0.00 ? 529 ASP A HB2  3  
ATOM 7398  H HB3  . ASP A 1 137 ? 2.508   -15.269 4.212   1.00 0.00 ? 529 ASP A HB3  3  
ATOM 7399  N N    . GLN A 1 138 ? 1.742   -14.062 0.457   1.00 0.00 ? 530 GLN A N    3  
ATOM 7400  C CA   . GLN A 1 138 ? 0.673   -13.322 -0.134  1.00 0.00 ? 530 GLN A CA   3  
ATOM 7401  C C    . GLN A 1 138 ? -0.693  -13.959 0.092   1.00 0.00 ? 530 GLN A C    3  
ATOM 7402  O O    . GLN A 1 138 ? -1.652  -13.261 0.374   1.00 0.00 ? 530 GLN A O    3  
ATOM 7403  C CB   . GLN A 1 138 ? 0.959   -12.958 -1.621  1.00 0.00 ? 530 GLN A CB   3  
ATOM 7404  C CG   . GLN A 1 138 ? 1.830   -13.953 -2.419  1.00 0.00 ? 530 GLN A CG   3  
ATOM 7405  C CD   . GLN A 1 138 ? 1.257   -15.351 -2.543  1.00 0.00 ? 530 GLN A CD   3  
ATOM 7406  O OE1  . GLN A 1 138 ? 1.511   -16.212 -1.698  1.00 0.00 ? 530 GLN A OE1  3  
ATOM 7407  N NE2  . GLN A 1 138 ? 0.529   -15.601 -3.589  1.00 0.00 ? 530 GLN A NE2  3  
ATOM 7408  H H    . GLN A 1 138 ? 2.401   -14.514 -0.110  1.00 0.00 ? 530 GLN A H    3  
ATOM 7409  H HA   . GLN A 1 138 ? 0.651   -12.396 0.424   1.00 0.00 ? 530 GLN A HA   3  
ATOM 7410  H HB2  . GLN A 1 138 ? 0.015   -12.870 -2.136  1.00 0.00 ? 530 GLN A HB2  3  
ATOM 7411  H HB3  . GLN A 1 138 ? 1.450   -11.996 -1.641  1.00 0.00 ? 530 GLN A HB3  3  
ATOM 7412  H HG2  . GLN A 1 138 ? 1.961   -13.560 -3.416  1.00 0.00 ? 530 GLN A HG2  3  
ATOM 7413  H HG3  . GLN A 1 138 ? 2.796   -14.013 -1.941  1.00 0.00 ? 530 GLN A HG3  3  
ATOM 7414  H HE21 . GLN A 1 138 ? 0.382   -14.887 -4.246  1.00 0.00 ? 530 GLN A HE21 3  
ATOM 7415  H HE22 . GLN A 1 138 ? 0.148   -16.499 -3.697  1.00 0.00 ? 530 GLN A HE22 3  
ATOM 7416  N N    . SER A 1 139 ? -0.747  -15.277 0.057   1.00 0.00 ? 531 SER A N    3  
ATOM 7417  C CA   . SER A 1 139 ? -2.004  -16.003 0.164   1.00 0.00 ? 531 SER A CA   3  
ATOM 7418  C C    . SER A 1 139 ? -2.717  -15.728 1.505   1.00 0.00 ? 531 SER A C    3  
ATOM 7419  O O    . SER A 1 139 ? -3.913  -15.388 1.521   1.00 0.00 ? 531 SER A O    3  
ATOM 7420  C CB   . SER A 1 139 ? -1.749  -17.513 -0.029  1.00 0.00 ? 531 SER A CB   3  
ATOM 7421  O OG   . SER A 1 139 ? -2.962  -18.256 -0.083  1.00 0.00 ? 531 SER A OG   3  
ATOM 7422  H H    . SER A 1 139 ? 0.085   -15.786 -0.047  1.00 0.00 ? 531 SER A H    3  
ATOM 7423  H HA   . SER A 1 139 ? -2.646  -15.661 -0.634  1.00 0.00 ? 531 SER A HA   3  
ATOM 7424  H HB2  . SER A 1 139 ? -1.206  -17.671 -0.949  1.00 0.00 ? 531 SER A HB2  3  
ATOM 7425  H HB3  . SER A 1 139 ? -1.158  -17.878 0.798   1.00 0.00 ? 531 SER A HB3  3  
ATOM 7426  H HG   . SER A 1 139 ? -3.071  -18.535 -1.000  1.00 0.00 ? 531 SER A HG   3  
ATOM 7427  N N    . GLY A 1 140 ? -1.987  -15.810 2.605   1.00 0.00 ? 532 GLY A N    3  
ATOM 7428  C CA   . GLY A 1 140 ? -2.580  -15.604 3.898   1.00 0.00 ? 532 GLY A CA   3  
ATOM 7429  C C    . GLY A 1 140 ? -2.829  -14.155 4.200   1.00 0.00 ? 532 GLY A C    3  
ATOM 7430  O O    . GLY A 1 140 ? -3.854  -13.806 4.817   1.00 0.00 ? 532 GLY A O    3  
ATOM 7431  H H    . GLY A 1 140 ? -1.027  -16.036 2.588   1.00 0.00 ? 532 GLY A H    3  
ATOM 7432  H HA2  . GLY A 1 140 ? -3.522  -16.130 3.936   1.00 0.00 ? 532 GLY A HA2  3  
ATOM 7433  H HA3  . GLY A 1 140 ? -1.921  -16.008 4.652   1.00 0.00 ? 532 GLY A HA3  3  
ATOM 7434  N N    . PHE A 1 141 ? -1.925  -13.296 3.757   1.00 0.00 ? 533 PHE A N    3  
ATOM 7435  C CA   . PHE A 1 141 ? -2.052  -11.875 4.012   1.00 0.00 ? 533 PHE A CA   3  
ATOM 7436  C C    . PHE A 1 141 ? -3.268  -11.326 3.276   1.00 0.00 ? 533 PHE A C    3  
ATOM 7437  O O    . PHE A 1 141 ? -4.105  -10.646 3.870   1.00 0.00 ? 533 PHE A O    3  
ATOM 7438  C CB   . PHE A 1 141 ? -0.781  -11.121 3.592   1.00 0.00 ? 533 PHE A CB   3  
ATOM 7439  C CG   . PHE A 1 141 ? -0.744  -9.682  4.052   1.00 0.00 ? 533 PHE A CG   3  
ATOM 7440  C CD1  . PHE A 1 141 ? -1.183  -8.653  3.235   1.00 0.00 ? 533 PHE A CD1  3  
ATOM 7441  C CD2  . PHE A 1 141 ? -0.259  -9.369  5.304   1.00 0.00 ? 533 PHE A CD2  3  
ATOM 7442  C CE1  . PHE A 1 141 ? -1.141  -7.346  3.669   1.00 0.00 ? 533 PHE A CE1  3  
ATOM 7443  C CE2  . PHE A 1 141 ? -0.215  -8.071  5.742   1.00 0.00 ? 533 PHE A CE2  3  
ATOM 7444  C CZ   . PHE A 1 141 ? -0.653  -7.058  4.926   1.00 0.00 ? 533 PHE A CZ   3  
ATOM 7445  H H    . PHE A 1 141 ? -1.153  -13.643 3.259   1.00 0.00 ? 533 PHE A H    3  
ATOM 7446  H HA   . PHE A 1 141 ? -2.207  -11.746 5.073   1.00 0.00 ? 533 PHE A HA   3  
ATOM 7447  H HB2  . PHE A 1 141 ? 0.080   -11.623 4.009   1.00 0.00 ? 533 PHE A HB2  3  
ATOM 7448  H HB3  . PHE A 1 141 ? -0.711  -11.131 2.514   1.00 0.00 ? 533 PHE A HB3  3  
ATOM 7449  H HD1  . PHE A 1 141 ? -1.570  -8.878  2.253   1.00 0.00 ? 533 PHE A HD1  3  
ATOM 7450  H HD2  . PHE A 1 141 ? 0.089   -10.160 5.950   1.00 0.00 ? 533 PHE A HD2  3  
ATOM 7451  H HE1  . PHE A 1 141 ? -1.486  -6.551  3.025   1.00 0.00 ? 533 PHE A HE1  3  
ATOM 7452  H HE2  . PHE A 1 141 ? 0.166   -7.847  6.728   1.00 0.00 ? 533 PHE A HE2  3  
ATOM 7453  H HZ   . PHE A 1 141 ? -0.619  -6.038  5.277   1.00 0.00 ? 533 PHE A HZ   3  
ATOM 7454  N N    . VAL A 1 142 ? -3.393  -11.680 2.005   1.00 0.00 ? 534 VAL A N    3  
ATOM 7455  C CA   . VAL A 1 142 ? -4.512  -11.238 1.187   1.00 0.00 ? 534 VAL A CA   3  
ATOM 7456  C C    . VAL A 1 142 ? -5.819  -11.829 1.722   1.00 0.00 ? 534 VAL A C    3  
ATOM 7457  O O    . VAL A 1 142 ? -6.841  -11.153 1.755   1.00 0.00 ? 534 VAL A O    3  
ATOM 7458  C CB   . VAL A 1 142 ? -4.312  -11.578 -0.324  1.00 0.00 ? 534 VAL A CB   3  
ATOM 7459  C CG1  . VAL A 1 142 ? -5.520  -11.168 -1.141  1.00 0.00 ? 534 VAL A CG1  3  
ATOM 7460  C CG2  . VAL A 1 142 ? -3.081  -10.869 -0.867  1.00 0.00 ? 534 VAL A CG2  3  
ATOM 7461  H H    . VAL A 1 142 ? -2.713  -12.263 1.596   1.00 0.00 ? 534 VAL A H    3  
ATOM 7462  H HA   . VAL A 1 142 ? -4.575  -10.164 1.300   1.00 0.00 ? 534 VAL A HA   3  
ATOM 7463  H HB   . VAL A 1 142 ? -4.160  -12.644 -0.427  1.00 0.00 ? 534 VAL A HB   3  
ATOM 7464  H HG11 . VAL A 1 142 ? -5.680  -10.105 -1.043  1.00 0.00 ? 534 VAL A HG11 3  
ATOM 7465  H HG12 . VAL A 1 142 ? -5.348  -11.411 -2.179  1.00 0.00 ? 534 VAL A HG12 3  
ATOM 7466  H HG13 . VAL A 1 142 ? -6.393  -11.695 -0.784  1.00 0.00 ? 534 VAL A HG13 3  
ATOM 7467  H HG21 . VAL A 1 142 ? -2.210  -11.182 -0.309  1.00 0.00 ? 534 VAL A HG21 3  
ATOM 7468  H HG22 . VAL A 1 142 ? -2.951  -11.121 -1.910  1.00 0.00 ? 534 VAL A HG22 3  
ATOM 7469  H HG23 . VAL A 1 142 ? -3.208  -9.801  -0.768  1.00 0.00 ? 534 VAL A HG23 3  
ATOM 7470  N N    . ASN A 1 143 ? -5.769  -13.084 2.172   1.00 0.00 ? 535 ASN A N    3  
ATOM 7471  C CA   . ASN A 1 143 ? -6.942  -13.740 2.779   1.00 0.00 ? 535 ASN A CA   3  
ATOM 7472  C C    . ASN A 1 143 ? -7.414  -12.951 4.003   1.00 0.00 ? 535 ASN A C    3  
ATOM 7473  O O    . ASN A 1 143 ? -8.621  -12.787 4.240   1.00 0.00 ? 535 ASN A O    3  
ATOM 7474  C CB   . ASN A 1 143 ? -6.614  -15.195 3.173   1.00 0.00 ? 535 ASN A CB   3  
ATOM 7475  C CG   . ASN A 1 143 ? -7.800  -15.945 3.772   1.00 0.00 ? 535 ASN A CG   3  
ATOM 7476  O OD1  . ASN A 1 143 ? -8.611  -16.518 3.046   1.00 0.00 ? 535 ASN A OD1  3  
ATOM 7477  N ND2  . ASN A 1 143 ? -7.890  -15.998 5.078   1.00 0.00 ? 535 ASN A ND2  3  
ATOM 7478  H H    . ASN A 1 143 ? -4.933  -13.593 2.080   1.00 0.00 ? 535 ASN A H    3  
ATOM 7479  H HA   . ASN A 1 143 ? -7.732  -13.739 2.043   1.00 0.00 ? 535 ASN A HA   3  
ATOM 7480  H HB2  . ASN A 1 143 ? -6.282  -15.728 2.295   1.00 0.00 ? 535 ASN A HB2  3  
ATOM 7481  H HB3  . ASN A 1 143 ? -5.812  -15.189 3.896   1.00 0.00 ? 535 ASN A HB3  3  
ATOM 7482  H HD21 . ASN A 1 143 ? -7.201  -15.568 5.632   1.00 0.00 ? 535 ASN A HD21 3  
ATOM 7483  H HD22 . ASN A 1 143 ? -8.659  -16.472 5.460   1.00 0.00 ? 535 ASN A HD22 3  
ATOM 7484  N N    . GLY A 1 144 ? -6.457  -12.440 4.760   1.00 0.00 ? 536 GLY A N    3  
ATOM 7485  C CA   . GLY A 1 144 ? -6.766  -11.635 5.914   1.00 0.00 ? 536 GLY A CA   3  
ATOM 7486  C C    . GLY A 1 144 ? -7.327  -10.288 5.512   1.00 0.00 ? 536 GLY A C    3  
ATOM 7487  O O    . GLY A 1 144 ? -8.357  -9.860  6.020   1.00 0.00 ? 536 GLY A O    3  
ATOM 7488  H H    . GLY A 1 144 ? -5.518  -12.612 4.520   1.00 0.00 ? 536 GLY A H    3  
ATOM 7489  H HA2  . GLY A 1 144 ? -7.485  -12.154 6.531   1.00 0.00 ? 536 GLY A HA2  3  
ATOM 7490  H HA3  . GLY A 1 144 ? -5.860  -11.477 6.482   1.00 0.00 ? 536 GLY A HA3  3  
ATOM 7491  N N    . ILE A 1 145 ? -6.677  -9.655  4.553   1.00 0.00 ? 537 ILE A N    3  
ATOM 7492  C CA   . ILE A 1 145 ? -7.071  -8.330  4.097   1.00 0.00 ? 537 ILE A CA   3  
ATOM 7493  C C    . ILE A 1 145 ? -8.431  -8.341  3.382   1.00 0.00 ? 537 ILE A C    3  
ATOM 7494  O O    . ILE A 1 145 ? -9.217  -7.406  3.544   1.00 0.00 ? 537 ILE A O    3  
ATOM 7495  C CB   . ILE A 1 145 ? -5.981  -7.670  3.200   1.00 0.00 ? 537 ILE A CB   3  
ATOM 7496  C CG1  . ILE A 1 145 ? -4.641  -7.565  3.948   1.00 0.00 ? 537 ILE A CG1  3  
ATOM 7497  C CG2  . ILE A 1 145 ? -6.421  -6.295  2.727   1.00 0.00 ? 537 ILE A CG2  3  
ATOM 7498  C CD1  . ILE A 1 145 ? -4.691  -6.774  5.245   1.00 0.00 ? 537 ILE A CD1  3  
ATOM 7499  H H    . ILE A 1 145 ? -5.892  -10.087 4.146   1.00 0.00 ? 537 ILE A H    3  
ATOM 7500  H HA   . ILE A 1 145 ? -7.188  -7.726  4.985   1.00 0.00 ? 537 ILE A HA   3  
ATOM 7501  H HB   . ILE A 1 145 ? -5.841  -8.294  2.331   1.00 0.00 ? 537 ILE A HB   3  
ATOM 7502  H HG12 . ILE A 1 145 ? -4.297  -8.560  4.189   1.00 0.00 ? 537 ILE A HG12 3  
ATOM 7503  H HG13 . ILE A 1 145 ? -3.915  -7.097  3.298   1.00 0.00 ? 537 ILE A HG13 3  
ATOM 7504  H HG21 . ILE A 1 145 ? -6.661  -5.680  3.581   1.00 0.00 ? 537 ILE A HG21 3  
ATOM 7505  H HG22 . ILE A 1 145 ? -5.623  -5.838  2.163   1.00 0.00 ? 537 ILE A HG22 3  
ATOM 7506  H HG23 . ILE A 1 145 ? -7.294  -6.399  2.099   1.00 0.00 ? 537 ILE A HG23 3  
ATOM 7507  H HD11 . ILE A 1 145 ? -5.042  -5.773  5.045   1.00 0.00 ? 537 ILE A HD11 3  
ATOM 7508  H HD12 . ILE A 1 145 ? -5.359  -7.258  5.943   1.00 0.00 ? 537 ILE A HD12 3  
ATOM 7509  H HD13 . ILE A 1 145 ? -3.702  -6.731  5.677   1.00 0.00 ? 537 ILE A HD13 3  
ATOM 7510  N N    . ARG A 1 146 ? -8.722  -9.410  2.623   1.00 0.00 ? 538 ARG A N    3  
ATOM 7511  C CA   . ARG A 1 146 ? -10.012 -9.535  1.929   1.00 0.00 ? 538 ARG A CA   3  
ATOM 7512  C C    . ARG A 1 146 ? -11.154 -9.429  2.936   1.00 0.00 ? 538 ARG A C    3  
ATOM 7513  O O    . ARG A 1 146 ? -12.109 -8.715  2.715   1.00 0.00 ? 538 ARG A O    3  
ATOM 7514  C CB   . ARG A 1 146 ? -10.133 -10.859 1.159   1.00 0.00 ? 538 ARG A CB   3  
ATOM 7515  C CG   . ARG A 1 146 ? -11.416 -10.926 0.336   1.00 0.00 ? 538 ARG A CG   3  
ATOM 7516  C CD   . ARG A 1 146 ? -11.660 -12.287 -0.280  1.00 0.00 ? 538 ARG A CD   3  
ATOM 7517  N NE   . ARG A 1 146 ? -10.665 -12.682 -1.301  1.00 0.00 ? 538 ARG A NE   3  
ATOM 7518  C CZ   . ARG A 1 146 ? -10.931 -13.511 -2.339  1.00 0.00 ? 538 ARG A CZ   3  
ATOM 7519  N NH1  . ARG A 1 146 ? -12.162 -13.965 -2.545  1.00 0.00 ? 538 ARG A NH1  3  
ATOM 7520  N NH2  . ARG A 1 146 ? -9.970  -13.871 -3.159  1.00 0.00 ? 538 ARG A NH2  3  
ATOM 7521  H H    . ARG A 1 146 ? -8.037  -10.108 2.504   1.00 0.00 ? 538 ARG A H    3  
ATOM 7522  H HA   . ARG A 1 146 ? -10.116 -8.716  1.234   1.00 0.00 ? 538 ARG A HA   3  
ATOM 7523  H HB2  . ARG A 1 146 ? -9.286  -10.960 0.494   1.00 0.00 ? 538 ARG A HB2  3  
ATOM 7524  H HB3  . ARG A 1 146 ? -10.136 -11.679 1.862   1.00 0.00 ? 538 ARG A HB3  3  
ATOM 7525  H HG2  . ARG A 1 146 ? -12.248 -10.693 0.984   1.00 0.00 ? 538 ARG A HG2  3  
ATOM 7526  H HG3  . ARG A 1 146 ? -11.361 -10.187 -0.450  1.00 0.00 ? 538 ARG A HG3  3  
ATOM 7527  H HD2  . ARG A 1 146 ? -11.631 -13.000 0.529   1.00 0.00 ? 538 ARG A HD2  3  
ATOM 7528  H HD3  . ARG A 1 146 ? -12.645 -12.268 -0.719  1.00 0.00 ? 538 ARG A HD3  3  
ATOM 7529  H HE   . ARG A 1 146 ? -9.755  -12.328 -1.183  1.00 0.00 ? 538 ARG A HE   3  
ATOM 7530  H HH11 . ARG A 1 146 ? -12.925 -13.713 -1.944  1.00 0.00 ? 538 ARG A HH11 3  
ATOM 7531  H HH12 . ARG A 1 146 ? -12.378 -14.580 -3.309  1.00 0.00 ? 538 ARG A HH12 3  
ATOM 7532  H HH21 . ARG A 1 146 ? -9.026  -13.549 -3.046  1.00 0.00 ? 538 ARG A HH21 3  
ATOM 7533  H HH22 . ARG A 1 146 ? -10.126 -14.487 -3.936  1.00 0.00 ? 538 ARG A HH22 3  
ATOM 7534  N N    . GLN A 1 147 ? -10.989 -10.097 4.067   1.00 0.00 ? 539 GLN A N    3  
ATOM 7535  C CA   . GLN A 1 147 ? -11.963 -10.077 5.158   1.00 0.00 ? 539 GLN A CA   3  
ATOM 7536  C C    . GLN A 1 147 ? -12.173 -8.645  5.670   1.00 0.00 ? 539 GLN A C    3  
ATOM 7537  O O    . GLN A 1 147 ? -13.307 -8.229  5.932   1.00 0.00 ? 539 GLN A O    3  
ATOM 7538  C CB   . GLN A 1 147 ? -11.459 -10.987 6.278   1.00 0.00 ? 539 GLN A CB   3  
ATOM 7539  C CG   . GLN A 1 147 ? -12.246 -10.934 7.574   1.00 0.00 ? 539 GLN A CG   3  
ATOM 7540  C CD   . GLN A 1 147 ? -11.648 -11.837 8.628   1.00 0.00 ? 539 GLN A CD   3  
ATOM 7541  O OE1  . GLN A 1 147 ? -10.438 -12.096 8.626   1.00 0.00 ? 539 GLN A OE1  3  
ATOM 7542  N NE2  . GLN A 1 147 ? -12.454 -12.291 9.544   1.00 0.00 ? 539 GLN A NE2  3  
ATOM 7543  H H    . GLN A 1 147 ? -10.168 -10.621 4.177   1.00 0.00 ? 539 GLN A H    3  
ATOM 7544  H HA   . GLN A 1 147 ? -12.907 -10.455 4.791   1.00 0.00 ? 539 GLN A HA   3  
ATOM 7545  H HB2  . GLN A 1 147 ? -11.483 -12.006 5.924   1.00 0.00 ? 539 GLN A HB2  3  
ATOM 7546  H HB3  . GLN A 1 147 ? -10.432 -10.725 6.494   1.00 0.00 ? 539 GLN A HB3  3  
ATOM 7547  H HG2  . GLN A 1 147 ? -12.250 -9.919  7.944   1.00 0.00 ? 539 GLN A HG2  3  
ATOM 7548  H HG3  . GLN A 1 147 ? -13.259 -11.253 7.380   1.00 0.00 ? 539 GLN A HG3  3  
ATOM 7549  H HE21 . GLN A 1 147 ? -13.398 -12.023 9.508   1.00 0.00 ? 539 GLN A HE21 3  
ATOM 7550  H HE22 . GLN A 1 147 ? -12.070 -12.883 10.225  1.00 0.00 ? 539 GLN A HE22 3  
ATOM 7551  N N    . VAL A 1 148 ? -11.085 -7.896  5.767   1.00 0.00 ? 540 VAL A N    3  
ATOM 7552  C CA   . VAL A 1 148 ? -11.124 -6.513  6.222   1.00 0.00 ? 540 VAL A CA   3  
ATOM 7553  C C    . VAL A 1 148 ? -11.862 -5.638  5.191   1.00 0.00 ? 540 VAL A C    3  
ATOM 7554  O O    . VAL A 1 148 ? -12.751 -4.855  5.550   1.00 0.00 ? 540 VAL A O    3  
ATOM 7555  C CB   . VAL A 1 148 ? -9.691  -5.952  6.468   1.00 0.00 ? 540 VAL A CB   3  
ATOM 7556  C CG1  . VAL A 1 148 ? -9.742  -4.526  6.987   1.00 0.00 ? 540 VAL A CG1  3  
ATOM 7557  C CG2  . VAL A 1 148 ? -8.923  -6.838  7.437   1.00 0.00 ? 540 VAL A CG2  3  
ATOM 7558  H H    . VAL A 1 148 ? -10.221 -8.293  5.523   1.00 0.00 ? 540 VAL A H    3  
ATOM 7559  H HA   . VAL A 1 148 ? -11.676 -6.489  7.151   1.00 0.00 ? 540 VAL A HA   3  
ATOM 7560  H HB   . VAL A 1 148 ? -9.166  -5.945  5.524   1.00 0.00 ? 540 VAL A HB   3  
ATOM 7561  H HG11 . VAL A 1 148 ? -10.289 -4.504  7.918   1.00 0.00 ? 540 VAL A HG11 3  
ATOM 7562  H HG12 . VAL A 1 148 ? -8.739  -4.165  7.155   1.00 0.00 ? 540 VAL A HG12 3  
ATOM 7563  H HG13 . VAL A 1 148 ? -10.241 -3.897  6.263   1.00 0.00 ? 540 VAL A HG13 3  
ATOM 7564  H HG21 . VAL A 1 148 ? -8.848  -7.836  7.030   1.00 0.00 ? 540 VAL A HG21 3  
ATOM 7565  H HG22 . VAL A 1 148 ? -7.932  -6.434  7.590   1.00 0.00 ? 540 VAL A HG22 3  
ATOM 7566  H HG23 . VAL A 1 148 ? -9.447  -6.874  8.381   1.00 0.00 ? 540 VAL A HG23 3  
ATOM 7567  N N    . ILE A 1 149 ? -11.513 -5.810  3.920   1.00 0.00 ? 541 ILE A N    3  
ATOM 7568  C CA   . ILE A 1 149 ? -12.143 -5.064  2.818   1.00 0.00 ? 541 ILE A CA   3  
ATOM 7569  C C    . ILE A 1 149 ? -13.630 -5.403  2.743   1.00 0.00 ? 541 ILE A C    3  
ATOM 7570  O O    . ILE A 1 149 ? -14.476 -4.528  2.647   1.00 0.00 ? 541 ILE A O    3  
ATOM 7571  C CB   . ILE A 1 149 ? -11.470 -5.409  1.455   1.00 0.00 ? 541 ILE A CB   3  
ATOM 7572  C CG1  . ILE A 1 149 ? -9.985  -5.012  1.471   1.00 0.00 ? 541 ILE A CG1  3  
ATOM 7573  C CG2  . ILE A 1 149 ? -12.200 -4.740  0.290   1.00 0.00 ? 541 ILE A CG2  3  
ATOM 7574  C CD1  . ILE A 1 149 ? -9.228  -5.372  0.204   1.00 0.00 ? 541 ILE A CD1  3  
ATOM 7575  H H    . ILE A 1 149 ? -10.798 -6.454  3.716   1.00 0.00 ? 541 ILE A H    3  
ATOM 7576  H HA   . ILE A 1 149 ? -12.038 -4.006  3.008   1.00 0.00 ? 541 ILE A HA   3  
ATOM 7577  H HB   . ILE A 1 149 ? -11.542 -6.479  1.325   1.00 0.00 ? 541 ILE A HB   3  
ATOM 7578  H HG12 . ILE A 1 149 ? -9.909  -3.942  1.606   1.00 0.00 ? 541 ILE A HG12 3  
ATOM 7579  H HG13 . ILE A 1 149 ? -9.502  -5.503  2.303   1.00 0.00 ? 541 ILE A HG13 3  
ATOM 7580  H HG21 . ILE A 1 149 ? -12.188 -3.668  0.427   1.00 0.00 ? 541 ILE A HG21 3  
ATOM 7581  H HG22 . ILE A 1 149 ? -11.709 -4.996  -0.637  1.00 0.00 ? 541 ILE A HG22 3  
ATOM 7582  H HG23 . ILE A 1 149 ? -13.220 -5.092  0.269   1.00 0.00 ? 541 ILE A HG23 3  
ATOM 7583  H HD11 . ILE A 1 149 ? -9.266  -6.439  0.047   1.00 0.00 ? 541 ILE A HD11 3  
ATOM 7584  H HD12 . ILE A 1 149 ? -9.678  -4.870  -0.639  1.00 0.00 ? 541 ILE A HD12 3  
ATOM 7585  H HD13 . ILE A 1 149 ? -8.200  -5.057  0.302   1.00 0.00 ? 541 ILE A HD13 3  
ATOM 7586  N N    . THR A 1 150 ? -13.920 -6.667  2.837   1.00 0.00 ? 542 THR A N    3  
ATOM 7587  C CA   . THR A 1 150 ? -15.256 -7.165  2.843   1.00 0.00 ? 542 THR A CA   3  
ATOM 7588  C C    . THR A 1 150 ? -16.072 -6.679  4.057   1.00 0.00 ? 542 THR A C    3  
ATOM 7589  O O    . THR A 1 150 ? -17.292 -6.465  3.959   1.00 0.00 ? 542 THR A O    3  
ATOM 7590  C CB   . THR A 1 150 ? -15.243 -8.668  2.630   1.00 0.00 ? 542 THR A CB   3  
ATOM 7591  O OG1  . THR A 1 150 ? -14.832 -8.917  1.274   1.00 0.00 ? 542 THR A OG1  3  
ATOM 7592  C CG2  . THR A 1 150 ? -16.558 -9.360  2.919   1.00 0.00 ? 542 THR A CG2  3  
ATOM 7593  H H    . THR A 1 150 ? -13.191 -7.326  2.876   1.00 0.00 ? 542 THR A H    3  
ATOM 7594  H HA   . THR A 1 150 ? -15.696 -6.726  1.967   1.00 0.00 ? 542 THR A HA   3  
ATOM 7595  H HB   . THR A 1 150 ? -14.474 -8.996  3.298   1.00 0.00 ? 542 THR A HB   3  
ATOM 7596  H HG1  . THR A 1 150 ? -15.152 -8.155  0.757   1.00 0.00 ? 542 THR A HG1  3  
ATOM 7597  H HG21 . THR A 1 150 ? -17.344 -8.947  2.304   1.00 0.00 ? 542 THR A HG21 3  
ATOM 7598  H HG22 . THR A 1 150 ? -16.442 -10.415 2.720   1.00 0.00 ? 542 THR A HG22 3  
ATOM 7599  H HG23 . THR A 1 150 ? -16.789 -9.225  3.964   1.00 0.00 ? 542 THR A HG23 3  
ATOM 7600  N N    . ASN A 1 151 ? -15.413 -6.506  5.197   1.00 0.00 ? 543 ASN A N    3  
ATOM 7601  C CA   . ASN A 1 151 ? -16.079 -5.921  6.361   1.00 0.00 ? 543 ASN A CA   3  
ATOM 7602  C C    . ASN A 1 151 ? -16.457 -4.484  6.023   1.00 0.00 ? 543 ASN A C    3  
ATOM 7603  O O    . ASN A 1 151 ? -17.570 -4.064  6.268   1.00 0.00 ? 543 ASN A O    3  
ATOM 7604  C CB   . ASN A 1 151 ? -15.194 -5.946  7.619   1.00 0.00 ? 543 ASN A CB   3  
ATOM 7605  C CG   . ASN A 1 151 ? -15.910 -5.416  8.877   1.00 0.00 ? 543 ASN A CG   3  
ATOM 7606  O OD1  . ASN A 1 151 ? -15.290 -4.795  9.743   1.00 0.00 ? 543 ASN A OD1  3  
ATOM 7607  N ND2  . ASN A 1 151 ? -17.190 -5.696  9.023   1.00 0.00 ? 543 ASN A ND2  3  
ATOM 7608  H H    . ASN A 1 151 ? -14.471 -6.780  5.253   1.00 0.00 ? 543 ASN A H    3  
ATOM 7609  H HA   . ASN A 1 151 ? -16.990 -6.475  6.539   1.00 0.00 ? 543 ASN A HA   3  
ATOM 7610  H HB2  . ASN A 1 151 ? -14.879 -6.961  7.809   1.00 0.00 ? 543 ASN A HB2  3  
ATOM 7611  H HB3  . ASN A 1 151 ? -14.319 -5.338  7.441   1.00 0.00 ? 543 ASN A HB3  3  
ATOM 7612  H HD21 . ASN A 1 151 ? -17.661 -6.231  8.345   1.00 0.00 ? 543 ASN A HD21 3  
ATOM 7613  H HD22 . ASN A 1 151 ? -17.655 -5.359  9.817   1.00 0.00 ? 543 ASN A HD22 3  
ATOM 7614  N N    . LEU A 1 152 ? -15.524 -3.765  5.399   1.00 0.00 ? 544 LEU A N    3  
ATOM 7615  C CA   . LEU A 1 152 ? -15.739 -2.384  4.932   1.00 0.00 ? 544 LEU A CA   3  
ATOM 7616  C C    . LEU A 1 152 ? -16.920 -2.291  3.961   1.00 0.00 ? 544 LEU A C    3  
ATOM 7617  O O    . LEU A 1 152 ? -17.654 -1.304  3.959   1.00 0.00 ? 544 LEU A O    3  
ATOM 7618  C CB   . LEU A 1 152 ? -14.488 -1.868  4.225   1.00 0.00 ? 544 LEU A CB   3  
ATOM 7619  C CG   . LEU A 1 152 ? -13.275 -1.644  5.085   1.00 0.00 ? 544 LEU A CG   3  
ATOM 7620  C CD1  . LEU A 1 152 ? -12.089 -1.308  4.196   1.00 0.00 ? 544 LEU A CD1  3  
ATOM 7621  C CD2  . LEU A 1 152 ? -13.557 -0.502  6.055   1.00 0.00 ? 544 LEU A CD2  3  
ATOM 7622  H H    . LEU A 1 152 ? -14.640 -4.175  5.252   1.00 0.00 ? 544 LEU A H    3  
ATOM 7623  H HA   . LEU A 1 152 ? -15.922 -1.763  5.798   1.00 0.00 ? 544 LEU A HA   3  
ATOM 7624  H HB2  . LEU A 1 152 ? -14.212 -2.595  3.476   1.00 0.00 ? 544 LEU A HB2  3  
ATOM 7625  H HB3  . LEU A 1 152 ? -14.714 -0.941  3.722   1.00 0.00 ? 544 LEU A HB3  3  
ATOM 7626  H HG   . LEU A 1 152 ? -13.051 -2.534  5.656   1.00 0.00 ? 544 LEU A HG   3  
ATOM 7627  H HD11 . LEU A 1 152 ? -12.030 -2.006  3.375   1.00 0.00 ? 544 LEU A HD11 3  
ATOM 7628  H HD12 . LEU A 1 152 ? -12.213 -0.312  3.804   1.00 0.00 ? 544 LEU A HD12 3  
ATOM 7629  H HD13 . LEU A 1 152 ? -11.175 -1.341  4.765   1.00 0.00 ? 544 LEU A HD13 3  
ATOM 7630  H HD21 . LEU A 1 152 ? -13.792 0.394   5.499   1.00 0.00 ? 544 LEU A HD21 3  
ATOM 7631  H HD22 . LEU A 1 152 ? -14.392 -0.760  6.690   1.00 0.00 ? 544 LEU A HD22 3  
ATOM 7632  H HD23 . LEU A 1 152 ? -12.695 -0.321  6.677   1.00 0.00 ? 544 LEU A HD23 3  
ATOM 7633  N N    . GLU A 1 153 ? -17.083 -3.324  3.137   1.00 0.00 ? 545 GLU A N    3  
ATOM 7634  C CA   . GLU A 1 153 ? -18.168 -3.401  2.157   1.00 0.00 ? 545 GLU A CA   3  
ATOM 7635  C C    . GLU A 1 153 ? -19.539 -3.491  2.841   1.00 0.00 ? 545 GLU A C    3  
ATOM 7636  O O    . GLU A 1 153 ? -20.555 -3.071  2.279   1.00 0.00 ? 545 GLU A O    3  
ATOM 7637  C CB   . GLU A 1 153 ? -17.982 -4.615  1.229   1.00 0.00 ? 545 GLU A CB   3  
ATOM 7638  C CG   . GLU A 1 153 ? -16.694 -4.609  0.416   1.00 0.00 ? 545 GLU A CG   3  
ATOM 7639  C CD   . GLU A 1 153 ? -16.588 -5.801  -0.509  1.00 0.00 ? 545 GLU A CD   3  
ATOM 7640  O OE1  . GLU A 1 153 ? -16.159 -6.892  -0.073  1.00 0.00 ? 545 GLU A OE1  3  
ATOM 7641  O OE2  . GLU A 1 153 ? -16.953 -5.673  -1.698  1.00 0.00 ? 545 GLU A OE2  3  
ATOM 7642  H H    . GLU A 1 153 ? -16.423 -4.051  3.176   1.00 0.00 ? 545 GLU A H    3  
ATOM 7643  H HA   . GLU A 1 153 ? -18.133 -2.505  1.557   1.00 0.00 ? 545 GLU A HA   3  
ATOM 7644  H HB2  . GLU A 1 153 ? -17.991 -5.511  1.831   1.00 0.00 ? 545 GLU A HB2  3  
ATOM 7645  H HB3  . GLU A 1 153 ? -18.816 -4.654  0.543   1.00 0.00 ? 545 GLU A HB3  3  
ATOM 7646  H HG2  . GLU A 1 153 ? -16.658 -3.709  -0.179  1.00 0.00 ? 545 GLU A HG2  3  
ATOM 7647  H HG3  . GLU A 1 153 ? -15.855 -4.623  1.096   1.00 0.00 ? 545 GLU A HG3  3  
ATOM 7648  N N    . HIS A 1 154 ? -19.546 -4.035  4.038   1.00 0.00 ? 546 HIS A N    3  
ATOM 7649  C CA   . HIS A 1 154 ? -20.766 -4.253  4.805   1.00 0.00 ? 546 HIS A CA   3  
ATOM 7650  C C    . HIS A 1 154 ? -20.977 -3.102  5.825   1.00 0.00 ? 546 HIS A C    3  
ATOM 7651  O O    . HIS A 1 154 ? -22.110 -2.673  6.092   1.00 0.00 ? 546 HIS A O    3  
ATOM 7652  C CB   . HIS A 1 154 ? -20.634 -5.613  5.515   1.00 0.00 ? 546 HIS A CB   3  
ATOM 7653  C CG   . HIS A 1 154 ? -21.877 -6.144  6.164   1.00 0.00 ? 546 HIS A CG   3  
ATOM 7654  N ND1  . HIS A 1 154 ? -22.635 -7.164  5.635   1.00 0.00 ? 546 HIS A ND1  3  
ATOM 7655  C CD2  . HIS A 1 154 ? -22.455 -5.824  7.344   1.00 0.00 ? 546 HIS A CD2  3  
ATOM 7656  C CE1  . HIS A 1 154 ? -23.622 -7.431  6.480   1.00 0.00 ? 546 HIS A CE1  3  
ATOM 7657  N NE2  . HIS A 1 154 ? -23.565 -6.643  7.547   1.00 0.00 ? 546 HIS A NE2  3  
ATOM 7658  H H    . HIS A 1 154 ? -18.684 -4.302  4.427   1.00 0.00 ? 546 HIS A H    3  
ATOM 7659  H HA   . HIS A 1 154 ? -21.599 -4.291  4.120   1.00 0.00 ? 546 HIS A HA   3  
ATOM 7660  H HB2  . HIS A 1 154 ? -20.315 -6.352  4.794   1.00 0.00 ? 546 HIS A HB2  3  
ATOM 7661  H HB3  . HIS A 1 154 ? -19.871 -5.527  6.274   1.00 0.00 ? 546 HIS A HB3  3  
ATOM 7662  H HD1  . HIS A 1 154 ? -22.473 -7.629  4.784   1.00 0.00 ? 546 HIS A HD1  3  
ATOM 7663  H HD2  . HIS A 1 154 ? -22.117 -5.057  8.024   1.00 0.00 ? 546 HIS A HD2  3  
ATOM 7664  H HE1  . HIS A 1 154 ? -24.372 -8.191  6.320   1.00 0.00 ? 546 HIS A HE1  3  
ATOM 7665  N N    . HIS A 1 155 ? -19.881 -2.633  6.378   1.00 0.00 ? 547 HIS A N    3  
ATOM 7666  C CA   . HIS A 1 155 ? -19.848 -1.555  7.361   1.00 0.00 ? 547 HIS A CA   3  
ATOM 7667  C C    . HIS A 1 155 ? -20.144 -0.225  6.653   1.00 0.00 ? 547 HIS A C    3  
ATOM 7668  O O    . HIS A 1 155 ? -19.350 0.222   5.824   1.00 0.00 ? 547 HIS A O    3  
ATOM 7669  C CB   . HIS A 1 155 ? -18.435 -1.536  8.003   1.00 0.00 ? 547 HIS A CB   3  
ATOM 7670  C CG   . HIS A 1 155 ? -18.214 -0.577  9.146   1.00 0.00 ? 547 HIS A CG   3  
ATOM 7671  N ND1  . HIS A 1 155 ? -17.564 0.633   9.024   1.00 0.00 ? 547 HIS A ND1  3  
ATOM 7672  C CD2  . HIS A 1 155 ? -18.504 -0.708  10.463  1.00 0.00 ? 547 HIS A CD2  3  
ATOM 7673  C CE1  . HIS A 1 155 ? -17.472 1.181   10.240  1.00 0.00 ? 547 HIS A CE1  3  
ATOM 7674  N NE2  . HIS A 1 155 ? -18.034 0.407   11.155  1.00 0.00 ? 547 HIS A NE2  3  
ATOM 7675  H H    . HIS A 1 155 ? -19.022 -3.035  6.118   1.00 0.00 ? 547 HIS A H    3  
ATOM 7676  H HA   . HIS A 1 155 ? -20.587 -1.745  8.125   1.00 0.00 ? 547 HIS A HA   3  
ATOM 7677  H HB2  . HIS A 1 155 ? -18.221 -2.525  8.381   1.00 0.00 ? 547 HIS A HB2  3  
ATOM 7678  H HB3  . HIS A 1 155 ? -17.716 -1.307  7.230   1.00 0.00 ? 547 HIS A HB3  3  
ATOM 7679  H HD1  . HIS A 1 155 ? -17.221 1.031   8.195   1.00 0.00 ? 547 HIS A HD1  3  
ATOM 7680  H HD2  . HIS A 1 155 ? -19.019 -1.542  10.917  1.00 0.00 ? 547 HIS A HD2  3  
ATOM 7681  H HE1  . HIS A 1 155 ? -17.002 2.131   10.447  1.00 0.00 ? 547 HIS A HE1  3  
ATOM 7682  N N    . HIS A 1 156 ? -21.287 0.377   6.975   1.00 0.00 ? 548 HIS A N    3  
ATOM 7683  C CA   . HIS A 1 156 ? -21.756 1.627   6.346   1.00 0.00 ? 548 HIS A CA   3  
ATOM 7684  C C    . HIS A 1 156 ? -20.736 2.756   6.475   1.00 0.00 ? 548 HIS A C    3  
ATOM 7685  O O    . HIS A 1 156 ? -20.066 3.119   5.507   1.00 0.00 ? 548 HIS A O    3  
ATOM 7686  C CB   . HIS A 1 156 ? -23.100 2.102   6.941   1.00 0.00 ? 548 HIS A CB   3  
ATOM 7687  C CG   . HIS A 1 156 ? -24.280 1.205   6.709   1.00 0.00 ? 548 HIS A CG   3  
ATOM 7688  N ND1  . HIS A 1 156 ? -25.325 1.085   7.598   1.00 0.00 ? 548 HIS A ND1  3  
ATOM 7689  C CD2  . HIS A 1 156 ? -24.607 0.439   5.639   1.00 0.00 ? 548 HIS A CD2  3  
ATOM 7690  C CE1  . HIS A 1 156 ? -26.237 0.277   7.062   1.00 0.00 ? 548 HIS A CE1  3  
ATOM 7691  N NE2  . HIS A 1 156 ? -25.854 -0.150  5.863   1.00 0.00 ? 548 HIS A NE2  3  
ATOM 7692  H H    . HIS A 1 156 ? -21.846 -0.040  7.670   1.00 0.00 ? 548 HIS A H    3  
ATOM 7693  H HA   . HIS A 1 156 ? -21.904 1.415   5.298   1.00 0.00 ? 548 HIS A HA   3  
ATOM 7694  H HB2  . HIS A 1 156 ? -22.987 2.207   8.010   1.00 0.00 ? 548 HIS A HB2  3  
ATOM 7695  H HB3  . HIS A 1 156 ? -23.327 3.072   6.525   1.00 0.00 ? 548 HIS A HB3  3  
ATOM 7696  H HD1  . HIS A 1 156 ? -25.390 1.521   8.477   1.00 0.00 ? 548 HIS A HD1  3  
ATOM 7697  H HD2  . HIS A 1 156 ? -24.007 0.299   4.751   1.00 0.00 ? 548 HIS A HD2  3  
ATOM 7698  H HE1  . HIS A 1 156 ? -27.169 0.009   7.538   1.00 0.00 ? 548 HIS A HE1  3  
ATOM 7699  N N    . HIS A 1 157 ? -20.631 3.296   7.660   1.00 0.00 ? 549 HIS A N    3  
ATOM 7700  C CA   . HIS A 1 157 ? -19.687 4.361   7.936   1.00 0.00 ? 549 HIS A CA   3  
ATOM 7701  C C    . HIS A 1 157 ? -19.178 4.160   9.342   1.00 0.00 ? 549 HIS A C    3  
ATOM 7702  O O    . HIS A 1 157 ? -17.978 4.264   9.607   1.00 0.00 ? 549 HIS A O    3  
ATOM 7703  C CB   . HIS A 1 157 ? -20.347 5.753   7.777   1.00 0.00 ? 549 HIS A CB   3  
ATOM 7704  C CG   . HIS A 1 157 ? -19.381 6.916   7.823   1.00 0.00 ? 549 HIS A CG   3  
ATOM 7705  N ND1  . HIS A 1 157 ? -18.998 7.641   6.713   1.00 0.00 ? 549 HIS A ND1  3  
ATOM 7706  C CD2  . HIS A 1 157 ? -18.729 7.480   8.874   1.00 0.00 ? 549 HIS A CD2  3  
ATOM 7707  C CE1  . HIS A 1 157 ? -18.151 8.594   7.108   1.00 0.00 ? 549 HIS A CE1  3  
ATOM 7708  N NE2  . HIS A 1 157 ? -17.950 8.541   8.418   1.00 0.00 ? 549 HIS A NE2  3  
ATOM 7709  H H    . HIS A 1 157 ? -21.206 2.959   8.377   1.00 0.00 ? 549 HIS A H    3  
ATOM 7710  H HA   . HIS A 1 157 ? -18.862 4.264   7.246   1.00 0.00 ? 549 HIS A HA   3  
ATOM 7711  H HB2  . HIS A 1 157 ? -20.864 5.795   6.830   1.00 0.00 ? 549 HIS A HB2  3  
ATOM 7712  H HB3  . HIS A 1 157 ? -21.063 5.890   8.574   1.00 0.00 ? 549 HIS A HB3  3  
ATOM 7713  H HD1  . HIS A 1 157 ? -19.284 7.484   5.785   1.00 0.00 ? 549 HIS A HD1  3  
ATOM 7714  H HD2  . HIS A 1 157 ? -18.797 7.162   9.904   1.00 0.00 ? 549 HIS A HD2  3  
ATOM 7715  H HE1  . HIS A 1 157 ? -17.693 9.317   6.449   1.00 0.00 ? 549 HIS A HE1  3  
ATOM 7716  N N    . HIS A 1 158 ? -20.093 3.875   10.243  1.00 0.00 ? 550 HIS A N    3  
ATOM 7717  C CA   . HIS A 1 158 ? -19.747 3.540   11.589  1.00 0.00 ? 550 HIS A CA   3  
ATOM 7718  C C    . HIS A 1 158 ? -20.856 2.695   12.174  1.00 0.00 ? 550 HIS A C    3  
ATOM 7719  O O    . HIS A 1 158 ? -22.036 2.958   11.933  1.00 0.00 ? 550 HIS A O    3  
ATOM 7720  C CB   . HIS A 1 158 ? -19.521 4.797   12.449  1.00 0.00 ? 550 HIS A CB   3  
ATOM 7721  C CG   . HIS A 1 158 ? -18.912 4.492   13.790  1.00 0.00 ? 550 HIS A CG   3  
ATOM 7722  N ND1  . HIS A 1 158 ? -19.629 4.363   14.960  1.00 0.00 ? 550 HIS A ND1  3  
ATOM 7723  C CD2  . HIS A 1 158 ? -17.621 4.263   14.121  1.00 0.00 ? 550 HIS A CD2  3  
ATOM 7724  C CE1  . HIS A 1 158 ? -18.774 4.062   15.938  1.00 0.00 ? 550 HIS A CE1  3  
ATOM 7725  N NE2  . HIS A 1 158 ? -17.537 3.989   15.480  1.00 0.00 ? 550 HIS A NE2  3  
ATOM 7726  H H    . HIS A 1 158 ? -21.051 3.909   10.033  1.00 0.00 ? 550 HIS A H    3  
ATOM 7727  H HA   . HIS A 1 158 ? -18.841 2.955   11.564  1.00 0.00 ? 550 HIS A HA   3  
ATOM 7728  H HB2  . HIS A 1 158 ? -18.856 5.468   11.926  1.00 0.00 ? 550 HIS A HB2  3  
ATOM 7729  H HB3  . HIS A 1 158 ? -20.469 5.287   12.614  1.00 0.00 ? 550 HIS A HB3  3  
ATOM 7730  H HD1  . HIS A 1 158 ? -20.601 4.476   15.063  1.00 0.00 ? 550 HIS A HD1  3  
ATOM 7731  H HD2  . HIS A 1 158 ? -16.780 4.287   13.444  1.00 0.00 ? 550 HIS A HD2  3  
ATOM 7732  H HE1  . HIS A 1 158 ? -19.058 3.896   16.966  1.00 0.00 ? 550 HIS A HE1  3  
ATOM 7733  N N    . HIS A 1 159 ? -20.480 1.661   12.856  1.00 0.00 ? 551 HIS A N    3  
ATOM 7734  C CA   . HIS A 1 159 ? -21.395 0.804   13.556  1.00 0.00 ? 551 HIS A CA   3  
ATOM 7735  C C    . HIS A 1 159 ? -20.870 0.661   14.952  1.00 0.00 ? 551 HIS A C    3  
ATOM 7736  O O    . HIS A 1 159 ? -21.346 1.370   15.839  1.00 0.00 ? 551 HIS A O    3  
ATOM 7737  C CB   . HIS A 1 159 ? -21.535 -0.585  12.893  1.00 0.00 ? 551 HIS A CB   3  
ATOM 7738  C CG   . HIS A 1 159 ? -22.197 -0.591  11.540  1.00 0.00 ? 551 HIS A CG   3  
ATOM 7739  N ND1  . HIS A 1 159 ? -23.448 -1.111  11.297  1.00 0.00 ? 551 HIS A ND1  3  
ATOM 7740  C CD2  . HIS A 1 159 ? -21.739 -0.169  10.343  1.00 0.00 ? 551 HIS A CD2  3  
ATOM 7741  C CE1  . HIS A 1 159 ? -23.699 -0.998  9.996   1.00 0.00 ? 551 HIS A CE1  3  
ATOM 7742  N NE2  . HIS A 1 159 ? -22.688 -0.429  9.367   1.00 0.00 ? 551 HIS A NE2  3  
ATOM 7743  H H    . HIS A 1 159 ? -19.526 1.447   12.929  1.00 0.00 ? 551 HIS A H    3  
ATOM 7744  H HA   . HIS A 1 159 ? -22.356 1.297   13.589  1.00 0.00 ? 551 HIS A HA   3  
ATOM 7745  H HB2  . HIS A 1 159 ? -20.548 -1.004  12.766  1.00 0.00 ? 551 HIS A HB2  3  
ATOM 7746  H HB3  . HIS A 1 159 ? -22.105 -1.226  13.549  1.00 0.00 ? 551 HIS A HB3  3  
ATOM 7747  H HD1  . HIS A 1 159 ? -24.059 -1.499  11.962  1.00 0.00 ? 551 HIS A HD1  3  
ATOM 7748  H HD2  . HIS A 1 159 ? -20.782 0.298   10.160  1.00 0.00 ? 551 HIS A HD2  3  
ATOM 7749  H HE1  . HIS A 1 159 ? -24.610 -1.321  9.518   1.00 0.00 ? 551 HIS A HE1  3  
ATOM 7750  N N    . MET A 1 1   ? 27.227  6.725   10.886  1.00 0.00 ? 393 MET A N    4  
ATOM 7751  C CA   . MET A 1 1   ? 27.782  6.217   9.645   1.00 0.00 ? 393 MET A CA   4  
ATOM 7752  C C    . MET A 1 1   ? 26.854  6.587   8.525   1.00 0.00 ? 393 MET A C    4  
ATOM 7753  O O    . MET A 1 1   ? 25.646  6.401   8.642   1.00 0.00 ? 393 MET A O    4  
ATOM 7754  C CB   . MET A 1 1   ? 27.938  4.690   9.686   1.00 0.00 ? 393 MET A CB   4  
ATOM 7755  C CG   . MET A 1 1   ? 28.824  4.178   10.799  1.00 0.00 ? 393 MET A CG   4  
ATOM 7756  S SD   . MET A 1 1   ? 30.481  4.866   10.725  1.00 0.00 ? 393 MET A SD   4  
ATOM 7757  C CE   . MET A 1 1   ? 31.215  4.076   12.151  1.00 0.00 ? 393 MET A CE   4  
ATOM 7758  H H1   . MET A 1 1   ? 26.244  6.402   10.983  1.00 0.00 ? 393 MET A H1   4  
ATOM 7759  H H2   . MET A 1 1   ? 27.776  6.472   11.731  1.00 0.00 ? 393 MET A H2   4  
ATOM 7760  H H3   . MET A 1 1   ? 27.192  7.762   10.838  1.00 0.00 ? 393 MET A H3   4  
ATOM 7761  H HA   . MET A 1 1   ? 28.745  6.677   9.481   1.00 0.00 ? 393 MET A HA   4  
ATOM 7762  H HB2  . MET A 1 1   ? 26.962  4.241   9.799   1.00 0.00 ? 393 MET A HB2  4  
ATOM 7763  H HB3  . MET A 1 1   ? 28.356  4.364   8.745   1.00 0.00 ? 393 MET A HB3  4  
ATOM 7764  H HG2  . MET A 1 1   ? 28.383  4.443   11.748  1.00 0.00 ? 393 MET A HG2  4  
ATOM 7765  H HG3  . MET A 1 1   ? 28.892  3.103   10.723  1.00 0.00 ? 393 MET A HG3  4  
ATOM 7766  H HE1  . MET A 1 1   ? 31.176  3.004   12.030  1.00 0.00 ? 393 MET A HE1  4  
ATOM 7767  H HE2  . MET A 1 1   ? 32.244  4.391   12.238  1.00 0.00 ? 393 MET A HE2  4  
ATOM 7768  H HE3  . MET A 1 1   ? 30.671  4.361   13.039  1.00 0.00 ? 393 MET A HE3  4  
ATOM 7769  N N    . SER A 1 2   ? 27.386  7.117   7.458   1.00 0.00 ? 394 SER A N    4  
ATOM 7770  C CA   . SER A 1 2   ? 26.579  7.454   6.325   1.00 0.00 ? 394 SER A CA   4  
ATOM 7771  C C    . SER A 1 2   ? 26.441  6.232   5.431   1.00 0.00 ? 394 SER A C    4  
ATOM 7772  O O    . SER A 1 2   ? 27.203  6.044   4.477   1.00 0.00 ? 394 SER A O    4  
ATOM 7773  C CB   . SER A 1 2   ? 27.193  8.628   5.557   1.00 0.00 ? 394 SER A CB   4  
ATOM 7774  O OG   . SER A 1 2   ? 27.409  9.737   6.416   1.00 0.00 ? 394 SER A OG   4  
ATOM 7775  H H    . SER A 1 2   ? 28.349  7.308   7.418   1.00 0.00 ? 394 SER A H    4  
ATOM 7776  H HA   . SER A 1 2   ? 25.601  7.738   6.686   1.00 0.00 ? 394 SER A HA   4  
ATOM 7777  H HB2  . SER A 1 2   ? 28.140  8.320   5.141   1.00 0.00 ? 394 SER A HB2  4  
ATOM 7778  H HB3  . SER A 1 2   ? 26.527  8.926   4.759   1.00 0.00 ? 394 SER A HB3  4  
ATOM 7779  H HG   . SER A 1 2   ? 28.236  9.590   6.893   1.00 0.00 ? 394 SER A HG   4  
ATOM 7780  N N    . VAL A 1 3   ? 25.549  5.360   5.796   1.00 0.00 ? 395 VAL A N    4  
ATOM 7781  C CA   . VAL A 1 3   ? 25.316  4.166   5.034   1.00 0.00 ? 395 VAL A CA   4  
ATOM 7782  C C    . VAL A 1 3   ? 24.058  4.346   4.216   1.00 0.00 ? 395 VAL A C    4  
ATOM 7783  O O    . VAL A 1 3   ? 23.415  5.402   4.299   1.00 0.00 ? 395 VAL A O    4  
ATOM 7784  C CB   . VAL A 1 3   ? 25.232  2.893   5.932   1.00 0.00 ? 395 VAL A CB   4  
ATOM 7785  C CG1  . VAL A 1 3   ? 26.539  2.688   6.682   1.00 0.00 ? 395 VAL A CG1  4  
ATOM 7786  C CG2  . VAL A 1 3   ? 24.072  2.967   6.912   1.00 0.00 ? 395 VAL A CG2  4  
ATOM 7787  H H    . VAL A 1 3   ? 25.003  5.539   6.595   1.00 0.00 ? 395 VAL A H    4  
ATOM 7788  H HA   . VAL A 1 3   ? 26.143  4.062   4.349   1.00 0.00 ? 395 VAL A HA   4  
ATOM 7789  H HB   . VAL A 1 3   ? 25.089  2.037   5.287   1.00 0.00 ? 395 VAL A HB   4  
ATOM 7790  H HG11 . VAL A 1 3   ? 26.739  3.559   7.288   1.00 0.00 ? 395 VAL A HG11 4  
ATOM 7791  H HG12 . VAL A 1 3   ? 26.454  1.822   7.321   1.00 0.00 ? 395 VAL A HG12 4  
ATOM 7792  H HG13 . VAL A 1 3   ? 27.345  2.543   5.978   1.00 0.00 ? 395 VAL A HG13 4  
ATOM 7793  H HG21 . VAL A 1 3   ? 23.146  3.082   6.368   1.00 0.00 ? 395 VAL A HG21 4  
ATOM 7794  H HG22 . VAL A 1 3   ? 24.037  2.058   7.493   1.00 0.00 ? 395 VAL A HG22 4  
ATOM 7795  H HG23 . VAL A 1 3   ? 24.217  3.807   7.574   1.00 0.00 ? 395 VAL A HG23 4  
ATOM 7796  N N    . SER A 1 4   ? 23.705  3.351   3.448   1.00 0.00 ? 396 SER A N    4  
ATOM 7797  C CA   . SER A 1 4   ? 22.565  3.448   2.591   1.00 0.00 ? 396 SER A CA   4  
ATOM 7798  C C    . SER A 1 4   ? 21.295  3.472   3.432   1.00 0.00 ? 396 SER A C    4  
ATOM 7799  O O    . SER A 1 4   ? 20.468  4.392   3.296   1.00 0.00 ? 396 SER A O    4  
ATOM 7800  C CB   . SER A 1 4   ? 22.550  2.263   1.632   1.00 0.00 ? 396 SER A CB   4  
ATOM 7801  O OG   . SER A 1 4   ? 23.844  2.066   1.061   1.00 0.00 ? 396 SER A OG   4  
ATOM 7802  H H    . SER A 1 4   ? 24.201  2.504   3.458   1.00 0.00 ? 396 SER A H    4  
ATOM 7803  H HA   . SER A 1 4   ? 22.638  4.363   2.022   1.00 0.00 ? 396 SER A HA   4  
ATOM 7804  H HB2  . SER A 1 4   ? 22.242  1.371   2.154   1.00 0.00 ? 396 SER A HB2  4  
ATOM 7805  H HB3  . SER A 1 4   ? 21.849  2.470   0.837   1.00 0.00 ? 396 SER A HB3  4  
ATOM 7806  H HG   . SER A 1 4   ? 24.174  1.218   1.380   1.00 0.00 ? 396 SER A HG   4  
ATOM 7807  N N    . ASN A 1 5   ? 21.173  2.472   4.339   1.00 0.00 ? 397 ASN A N    4  
ATOM 7808  C CA   . ASN A 1 5   ? 19.990  2.268   5.230   1.00 0.00 ? 397 ASN A CA   4  
ATOM 7809  C C    . ASN A 1 5   ? 18.758  1.851   4.421   1.00 0.00 ? 397 ASN A C    4  
ATOM 7810  O O    . ASN A 1 5   ? 18.113  0.839   4.706   1.00 0.00 ? 397 ASN A O    4  
ATOM 7811  C CB   . ASN A 1 5   ? 19.697  3.506   6.112   1.00 0.00 ? 397 ASN A CB   4  
ATOM 7812  C CG   . ASN A 1 5   ? 18.477  3.330   7.013   1.00 0.00 ? 397 ASN A CG   4  
ATOM 7813  O OD1  . ASN A 1 5   ? 17.347  3.659   6.631   1.00 0.00 ? 397 ASN A OD1  4  
ATOM 7814  N ND2  . ASN A 1 5   ? 18.689  2.832   8.207   1.00 0.00 ? 397 ASN A ND2  4  
ATOM 7815  H H    . ASN A 1 5   ? 21.920  1.839   4.415   1.00 0.00 ? 397 ASN A H    4  
ATOM 7816  H HA   . ASN A 1 5   ? 20.237  1.430   5.863   1.00 0.00 ? 397 ASN A HA   4  
ATOM 7817  H HB2  . ASN A 1 5   ? 20.555  3.703   6.738   1.00 0.00 ? 397 ASN A HB2  4  
ATOM 7818  H HB3  . ASN A 1 5   ? 19.531  4.355   5.468   1.00 0.00 ? 397 ASN A HB3  4  
ATOM 7819  H HD21 . ASN A 1 5   ? 19.605  2.593   8.473   1.00 0.00 ? 397 ASN A HD21 4  
ATOM 7820  H HD22 . ASN A 1 5   ? 17.918  2.722   8.806   1.00 0.00 ? 397 ASN A HD22 4  
ATOM 7821  N N    . LYS A 1 6   ? 18.465  2.618   3.423   1.00 0.00 ? 398 LYS A N    4  
ATOM 7822  C CA   . LYS A 1 6   ? 17.432  2.344   2.495   1.00 0.00 ? 398 LYS A CA   4  
ATOM 7823  C C    . LYS A 1 6   ? 18.078  1.932   1.175   1.00 0.00 ? 398 LYS A C    4  
ATOM 7824  O O    . LYS A 1 6   ? 19.110  2.488   0.775   1.00 0.00 ? 398 LYS A O    4  
ATOM 7825  C CB   . LYS A 1 6   ? 16.458  3.560   2.379   1.00 0.00 ? 398 LYS A CB   4  
ATOM 7826  C CG   . LYS A 1 6   ? 17.124  4.918   2.119   1.00 0.00 ? 398 LYS A CG   4  
ATOM 7827  C CD   . LYS A 1 6   ? 17.533  5.104   0.670   1.00 0.00 ? 398 LYS A CD   4  
ATOM 7828  C CE   . LYS A 1 6   ? 18.550  6.211   0.519   1.00 0.00 ? 398 LYS A CE   4  
ATOM 7829  N NZ   . LYS A 1 6   ? 18.068  7.514   1.030   1.00 0.00 ? 398 LYS A NZ   4  
ATOM 7830  H H    . LYS A 1 6   ? 19.016  3.423   3.291   1.00 0.00 ? 398 LYS A H    4  
ATOM 7831  H HA   . LYS A 1 6   ? 16.894  1.491   2.872   1.00 0.00 ? 398 LYS A HA   4  
ATOM 7832  H HB2  . LYS A 1 6   ? 15.769  3.371   1.570   1.00 0.00 ? 398 LYS A HB2  4  
ATOM 7833  H HB3  . LYS A 1 6   ? 15.894  3.632   3.298   1.00 0.00 ? 398 LYS A HB3  4  
ATOM 7834  H HG2  . LYS A 1 6   ? 16.432  5.704   2.383   1.00 0.00 ? 398 LYS A HG2  4  
ATOM 7835  H HG3  . LYS A 1 6   ? 17.999  4.993   2.746   1.00 0.00 ? 398 LYS A HG3  4  
ATOM 7836  H HD2  . LYS A 1 6   ? 17.965  4.181   0.309   1.00 0.00 ? 398 LYS A HD2  4  
ATOM 7837  H HD3  . LYS A 1 6   ? 16.656  5.342   0.086   1.00 0.00 ? 398 LYS A HD3  4  
ATOM 7838  H HE2  . LYS A 1 6   ? 19.409  5.898   1.092   1.00 0.00 ? 398 LYS A HE2  4  
ATOM 7839  H HE3  . LYS A 1 6   ? 18.815  6.295   -0.524  1.00 0.00 ? 398 LYS A HE3  4  
ATOM 7840  H HZ1  . LYS A 1 6   ? 17.184  7.813   0.570   1.00 0.00 ? 398 LYS A HZ1  4  
ATOM 7841  H HZ2  . LYS A 1 6   ? 17.919  7.492   2.058   1.00 0.00 ? 398 LYS A HZ2  4  
ATOM 7842  H HZ3  . LYS A 1 6   ? 18.785  8.245   0.846   1.00 0.00 ? 398 LYS A HZ3  4  
ATOM 7843  N N    . LEU A 1 7   ? 17.552  0.926   0.569   1.00 0.00 ? 399 LEU A N    4  
ATOM 7844  C CA   . LEU A 1 7   ? 18.075  0.427   -0.669  1.00 0.00 ? 399 LEU A CA   4  
ATOM 7845  C C    . LEU A 1 7   ? 17.052  0.694   -1.765  1.00 0.00 ? 399 LEU A C    4  
ATOM 7846  O O    . LEU A 1 7   ? 15.868  0.529   -1.533  1.00 0.00 ? 399 LEU A O    4  
ATOM 7847  C CB   . LEU A 1 7   ? 18.393  -1.095  -0.565  1.00 0.00 ? 399 LEU A CB   4  
ATOM 7848  C CG   . LEU A 1 7   ? 19.303  -1.570  0.598   1.00 0.00 ? 399 LEU A CG   4  
ATOM 7849  C CD1  . LEU A 1 7   ? 18.528  -1.751  1.888   1.00 0.00 ? 399 LEU A CD1  4  
ATOM 7850  C CD2  . LEU A 1 7   ? 20.045  -2.839  0.235   1.00 0.00 ? 399 LEU A CD2  4  
ATOM 7851  H H    . LEU A 1 7   ? 16.778  0.466   0.971   1.00 0.00 ? 399 LEU A H    4  
ATOM 7852  H HA   . LEU A 1 7   ? 18.981  0.966   -0.893  1.00 0.00 ? 399 LEU A HA   4  
ATOM 7853  H HB2  . LEU A 1 7   ? 17.459  -1.621  -0.430  1.00 0.00 ? 399 LEU A HB2  4  
ATOM 7854  H HB3  . LEU A 1 7   ? 18.843  -1.412  -1.493  1.00 0.00 ? 399 LEU A HB3  4  
ATOM 7855  H HG   . LEU A 1 7   ? 20.034  -0.811  0.827   1.00 0.00 ? 399 LEU A HG   4  
ATOM 7856  H HD11 . LEU A 1 7   ? 18.067  -0.816  2.169   1.00 0.00 ? 399 LEU A HD11 4  
ATOM 7857  H HD12 . LEU A 1 7   ? 17.761  -2.499  1.745   1.00 0.00 ? 399 LEU A HD12 4  
ATOM 7858  H HD13 . LEU A 1 7   ? 19.199  -2.070  2.671   1.00 0.00 ? 399 LEU A HD13 4  
ATOM 7859  H HD21 . LEU A 1 7   ? 19.334  -3.622  0.016   1.00 0.00 ? 399 LEU A HD21 4  
ATOM 7860  H HD22 . LEU A 1 7   ? 20.670  -2.661  -0.628  1.00 0.00 ? 399 LEU A HD22 4  
ATOM 7861  H HD23 . LEU A 1 7   ? 20.660  -3.133  1.073   1.00 0.00 ? 399 LEU A HD23 4  
ATOM 7862  N N    . LEU A 1 8   ? 17.496  1.147   -2.929  1.00 0.00 ? 400 LEU A N    4  
ATOM 7863  C CA   . LEU A 1 8   ? 16.585  1.448   -4.044  1.00 0.00 ? 400 LEU A CA   4  
ATOM 7864  C C    . LEU A 1 8   ? 15.880  0.175   -4.472  1.00 0.00 ? 400 LEU A C    4  
ATOM 7865  O O    . LEU A 1 8   ? 16.531  -0.842  -4.761  1.00 0.00 ? 400 LEU A O    4  
ATOM 7866  C CB   . LEU A 1 8   ? 17.365  2.120   -5.220  1.00 0.00 ? 400 LEU A CB   4  
ATOM 7867  C CG   . LEU A 1 8   ? 16.581  2.631   -6.482  1.00 0.00 ? 400 LEU A CG   4  
ATOM 7868  C CD1  . LEU A 1 8   ? 16.083  1.501   -7.377  1.00 0.00 ? 400 LEU A CD1  4  
ATOM 7869  C CD2  . LEU A 1 8   ? 15.421  3.532   -6.081  1.00 0.00 ? 400 LEU A CD2  4  
ATOM 7870  H H    . LEU A 1 8   ? 18.462  1.264   -3.056  1.00 0.00 ? 400 LEU A H    4  
ATOM 7871  H HA   . LEU A 1 8   ? 15.836  2.132   -3.673  1.00 0.00 ? 400 LEU A HA   4  
ATOM 7872  H HB2  . LEU A 1 8   ? 17.883  2.971   -4.808  1.00 0.00 ? 400 LEU A HB2  4  
ATOM 7873  H HB3  . LEU A 1 8   ? 18.110  1.414   -5.556  1.00 0.00 ? 400 LEU A HB3  4  
ATOM 7874  H HG   . LEU A 1 8   ? 17.264  3.219   -7.077  1.00 0.00 ? 400 LEU A HG   4  
ATOM 7875  H HD11 . LEU A 1 8   ? 16.923  0.907   -7.708  1.00 0.00 ? 400 LEU A HD11 4  
ATOM 7876  H HD12 . LEU A 1 8   ? 15.403  0.876   -6.818  1.00 0.00 ? 400 LEU A HD12 4  
ATOM 7877  H HD13 . LEU A 1 8   ? 15.573  1.917   -8.233  1.00 0.00 ? 400 LEU A HD13 4  
ATOM 7878  H HD21 . LEU A 1 8   ? 15.797  4.379   -5.526  1.00 0.00 ? 400 LEU A HD21 4  
ATOM 7879  H HD22 . LEU A 1 8   ? 14.913  3.882   -6.968  1.00 0.00 ? 400 LEU A HD22 4  
ATOM 7880  H HD23 . LEU A 1 8   ? 14.729  2.976   -5.465  1.00 0.00 ? 400 LEU A HD23 4  
ATOM 7881  N N    . ALA A 1 9   ? 14.574  0.214   -4.486  1.00 0.00 ? 401 ALA A N    4  
ATOM 7882  C CA   . ALA A 1 9   ? 13.809  -0.941  -4.830  1.00 0.00 ? 401 ALA A CA   4  
ATOM 7883  C C    . ALA A 1 9   ? 13.091  -0.774  -6.141  1.00 0.00 ? 401 ALA A C    4  
ATOM 7884  O O    . ALA A 1 9   ? 13.419  -1.446  -7.112  1.00 0.00 ? 401 ALA A O    4  
ATOM 7885  C CB   . ALA A 1 9   ? 12.821  -1.271  -3.734  1.00 0.00 ? 401 ALA A CB   4  
ATOM 7886  H H    . ALA A 1 9   ? 14.099  1.044   -4.258  1.00 0.00 ? 401 ALA A H    4  
ATOM 7887  H HA   . ALA A 1 9   ? 14.491  -1.773  -4.911  1.00 0.00 ? 401 ALA A HA   4  
ATOM 7888  H HB1  . ALA A 1 9   ? 12.098  -0.473  -3.650  1.00 0.00 ? 401 ALA A HB1  4  
ATOM 7889  H HB2  . ALA A 1 9   ? 12.312  -2.194  -3.968  1.00 0.00 ? 401 ALA A HB2  4  
ATOM 7890  H HB3  . ALA A 1 9   ? 13.350  -1.378  -2.800  1.00 0.00 ? 401 ALA A HB3  4  
ATOM 7891  N N    . TRP A 1 10  ? 12.164  0.158   -6.189  1.00 0.00 ? 402 TRP A N    4  
ATOM 7892  C CA   . TRP A 1 10  ? 11.268  0.272   -7.300  1.00 0.00 ? 402 TRP A CA   4  
ATOM 7893  C C    . TRP A 1 10  ? 10.655  1.651   -7.290  1.00 0.00 ? 402 TRP A C    4  
ATOM 7894  O O    . TRP A 1 10  ? 10.579  2.288   -6.259  1.00 0.00 ? 402 TRP A O    4  
ATOM 7895  C CB   . TRP A 1 10  ? 10.188  -0.827  -7.161  1.00 0.00 ? 402 TRP A CB   4  
ATOM 7896  C CG   . TRP A 1 10  ? 9.075   -0.799  -8.165  1.00 0.00 ? 402 TRP A CG   4  
ATOM 7897  C CD1  . TRP A 1 10  ? 9.120   -1.195  -9.467  1.00 0.00 ? 402 TRP A CD1  4  
ATOM 7898  C CD2  . TRP A 1 10  ? 7.731   -0.384  -7.916  1.00 0.00 ? 402 TRP A CD2  4  
ATOM 7899  N NE1  . TRP A 1 10  ? 7.886   -1.031  -10.045 1.00 0.00 ? 402 TRP A NE1  4  
ATOM 7900  C CE2  . TRP A 1 10  ? 7.018   -0.535  -9.108  1.00 0.00 ? 402 TRP A CE2  4  
ATOM 7901  C CE3  . TRP A 1 10  ? 7.068   0.110   -6.793  1.00 0.00 ? 402 TRP A CE3  4  
ATOM 7902  C CZ2  . TRP A 1 10  ? 5.670   -0.216  -9.211  1.00 0.00 ? 402 TRP A CZ2  4  
ATOM 7903  C CZ3  . TRP A 1 10  ? 5.732   0.426   -6.892  1.00 0.00 ? 402 TRP A CZ3  4  
ATOM 7904  C CH2  . TRP A 1 10  ? 5.044   0.263   -8.095  1.00 0.00 ? 402 TRP A CH2  4  
ATOM 7905  H H    . TRP A 1 10  ? 12.054  0.834   -5.481  1.00 0.00 ? 402 TRP A H    4  
ATOM 7906  H HA   . TRP A 1 10  ? 11.814  0.113   -8.217  1.00 0.00 ? 402 TRP A HA   4  
ATOM 7907  H HB2  . TRP A 1 10  ? 10.666  -1.790  -7.253  1.00 0.00 ? 402 TRP A HB2  4  
ATOM 7908  H HB3  . TRP A 1 10  ? 9.753   -0.754  -6.175  1.00 0.00 ? 402 TRP A HB3  4  
ATOM 7909  H HD1  . TRP A 1 10  ? 10.004  -1.569  -9.963  1.00 0.00 ? 402 TRP A HD1  4  
ATOM 7910  H HE1  . TRP A 1 10  ? 7.656   -1.240  -10.975 1.00 0.00 ? 402 TRP A HE1  4  
ATOM 7911  H HE3  . TRP A 1 10  ? 7.593   0.239   -5.858  1.00 0.00 ? 402 TRP A HE3  4  
ATOM 7912  H HZ2  . TRP A 1 10  ? 5.123   -0.337  -10.133 1.00 0.00 ? 402 TRP A HZ2  4  
ATOM 7913  H HZ3  . TRP A 1 10  ? 5.205   0.804   -6.028  1.00 0.00 ? 402 TRP A HZ3  4  
ATOM 7914  H HH2  . TRP A 1 10  ? 3.998   0.526   -8.133  1.00 0.00 ? 402 TRP A HH2  4  
ATOM 7915  N N    . SER A 1 11  ? 10.329  2.149   -8.419  1.00 0.00 ? 403 SER A N    4  
ATOM 7916  C CA   . SER A 1 11  ? 9.664   3.402   -8.512  1.00 0.00 ? 403 SER A CA   4  
ATOM 7917  C C    . SER A 1 11  ? 8.449   3.207   -9.405  1.00 0.00 ? 403 SER A C    4  
ATOM 7918  O O    . SER A 1 11  ? 8.583   2.833   -10.573 1.00 0.00 ? 403 SER A O    4  
ATOM 7919  C CB   . SER A 1 11  ? 10.631  4.431   -9.068  1.00 0.00 ? 403 SER A CB   4  
ATOM 7920  O OG   . SER A 1 11  ? 11.840  4.427   -8.301  1.00 0.00 ? 403 SER A OG   4  
ATOM 7921  H H    . SER A 1 11  ? 10.513  1.667   -9.254  1.00 0.00 ? 403 SER A H    4  
ATOM 7922  H HA   . SER A 1 11  ? 9.344   3.693   -7.523  1.00 0.00 ? 403 SER A HA   4  
ATOM 7923  H HB2  . SER A 1 11  ? 10.868  4.165   -10.087 1.00 0.00 ? 403 SER A HB2  4  
ATOM 7924  H HB3  . SER A 1 11  ? 10.190  5.413   -9.017  1.00 0.00 ? 403 SER A HB3  4  
ATOM 7925  H HG   . SER A 1 11  ? 11.695  3.809   -7.575  1.00 0.00 ? 403 SER A HG   4  
ATOM 7926  N N    . GLY A 1 12  ? 7.280   3.417   -8.857  1.00 0.00 ? 404 GLY A N    4  
ATOM 7927  C CA   . GLY A 1 12  ? 6.094   3.139   -9.594  1.00 0.00 ? 404 GLY A CA   4  
ATOM 7928  C C    . GLY A 1 12  ? 4.920   3.932   -9.135  1.00 0.00 ? 404 GLY A C    4  
ATOM 7929  O O    . GLY A 1 12  ? 5.048   4.823   -8.286  1.00 0.00 ? 404 GLY A O    4  
ATOM 7930  H H    . GLY A 1 12  ? 7.199   3.800   -7.958  1.00 0.00 ? 404 GLY A H    4  
ATOM 7931  H HA2  . GLY A 1 12  ? 6.269   3.355   -10.638 1.00 0.00 ? 404 GLY A HA2  4  
ATOM 7932  H HA3  . GLY A 1 12  ? 5.865   2.089   -9.491  1.00 0.00 ? 404 GLY A HA3  4  
ATOM 7933  N N    . VAL A 1 13  ? 3.782   3.605   -9.670  1.00 0.00 ? 405 VAL A N    4  
ATOM 7934  C CA   . VAL A 1 13  ? 2.573   4.316   -9.402  1.00 0.00 ? 405 VAL A CA   4  
ATOM 7935  C C    . VAL A 1 13  ? 1.653   3.451   -8.551  1.00 0.00 ? 405 VAL A C    4  
ATOM 7936  O O    . VAL A 1 13  ? 1.559   2.233   -8.752  1.00 0.00 ? 405 VAL A O    4  
ATOM 7937  C CB   . VAL A 1 13  ? 1.862   4.696   -10.743 1.00 0.00 ? 405 VAL A CB   4  
ATOM 7938  C CG1  . VAL A 1 13  ? 0.586   5.489   -10.511 1.00 0.00 ? 405 VAL A CG1  4  
ATOM 7939  C CG2  . VAL A 1 13  ? 2.805   5.466   -11.660 1.00 0.00 ? 405 VAL A CG2  4  
ATOM 7940  H H    . VAL A 1 13  ? 3.716   2.815   -10.251 1.00 0.00 ? 405 VAL A H    4  
ATOM 7941  H HA   . VAL A 1 13  ? 2.804   5.220   -8.865  1.00 0.00 ? 405 VAL A HA   4  
ATOM 7942  H HB   . VAL A 1 13  ? 1.597   3.775   -11.239 1.00 0.00 ? 405 VAL A HB   4  
ATOM 7943  H HG11 . VAL A 1 13  ? 0.820   6.401   -9.985  1.00 0.00 ? 405 VAL A HG11 4  
ATOM 7944  H HG12 . VAL A 1 13  ? 0.135   5.724   -11.463 1.00 0.00 ? 405 VAL A HG12 4  
ATOM 7945  H HG13 . VAL A 1 13  ? -0.103  4.899   -9.923  1.00 0.00 ? 405 VAL A HG13 4  
ATOM 7946  H HG21 . VAL A 1 13  ? 3.673   4.860   -11.874 1.00 0.00 ? 405 VAL A HG21 4  
ATOM 7947  H HG22 . VAL A 1 13  ? 2.296   5.706   -12.581 1.00 0.00 ? 405 VAL A HG22 4  
ATOM 7948  H HG23 . VAL A 1 13  ? 3.116   6.379   -11.174 1.00 0.00 ? 405 VAL A HG23 4  
ATOM 7949  N N    . LEU A 1 14  ? 0.992   4.068   -7.618  1.00 0.00 ? 406 LEU A N    4  
ATOM 7950  C CA   . LEU A 1 14  ? 0.034   3.392   -6.796  1.00 0.00 ? 406 LEU A CA   4  
ATOM 7951  C C    . LEU A 1 14  ? -1.298  3.965   -7.140  1.00 0.00 ? 406 LEU A C    4  
ATOM 7952  O O    . LEU A 1 14  ? -1.462  5.196   -7.184  1.00 0.00 ? 406 LEU A O    4  
ATOM 7953  C CB   . LEU A 1 14  ? 0.311   3.619   -5.307  1.00 0.00 ? 406 LEU A CB   4  
ATOM 7954  C CG   . LEU A 1 14  ? 1.663   3.156   -4.769  1.00 0.00 ? 406 LEU A CG   4  
ATOM 7955  C CD1  . LEU A 1 14  ? 1.751   3.448   -3.289  1.00 0.00 ? 406 LEU A CD1  4  
ATOM 7956  C CD2  . LEU A 1 14  ? 1.886   1.677   -5.030  1.00 0.00 ? 406 LEU A CD2  4  
ATOM 7957  H H    . LEU A 1 14  ? 1.135   5.031   -7.467  1.00 0.00 ? 406 LEU A H    4  
ATOM 7958  H HA   . LEU A 1 14  ? 0.054   2.336   -7.021  1.00 0.00 ? 406 LEU A HA   4  
ATOM 7959  H HB2  . LEU A 1 14  ? 0.221   4.676   -5.112  1.00 0.00 ? 406 LEU A HB2  4  
ATOM 7960  H HB3  . LEU A 1 14  ? -0.462  3.111   -4.749  1.00 0.00 ? 406 LEU A HB3  4  
ATOM 7961  H HG   . LEU A 1 14  ? 2.446   3.716   -5.261  1.00 0.00 ? 406 LEU A HG   4  
ATOM 7962  H HD11 . LEU A 1 14  ? 0.955   2.935   -2.772  1.00 0.00 ? 406 LEU A HD11 4  
ATOM 7963  H HD12 . LEU A 1 14  ? 2.703   3.108   -2.909  1.00 0.00 ? 406 LEU A HD12 4  
ATOM 7964  H HD13 . LEU A 1 14  ? 1.659   4.511   -3.129  1.00 0.00 ? 406 LEU A HD13 4  
ATOM 7965  H HD21 . LEU A 1 14  ? 1.094   1.106   -4.568  1.00 0.00 ? 406 LEU A HD21 4  
ATOM 7966  H HD22 . LEU A 1 14  ? 1.889   1.501   -6.095  1.00 0.00 ? 406 LEU A HD22 4  
ATOM 7967  H HD23 . LEU A 1 14  ? 2.836   1.376   -4.614  1.00 0.00 ? 406 LEU A HD23 4  
ATOM 7968  N N    . GLU A 1 15  ? -2.219  3.125   -7.438  1.00 0.00 ? 407 GLU A N    4  
ATOM 7969  C CA   . GLU A 1 15  ? -3.497  3.569   -7.836  1.00 0.00 ? 407 GLU A CA   4  
ATOM 7970  C C    . GLU A 1 15  ? -4.509  3.075   -6.805  1.00 0.00 ? 407 GLU A C    4  
ATOM 7971  O O    . GLU A 1 15  ? -4.549  1.884   -6.475  1.00 0.00 ? 407 GLU A O    4  
ATOM 7972  C CB   . GLU A 1 15  ? -3.759  3.076   -9.276  1.00 0.00 ? 407 GLU A CB   4  
ATOM 7973  C CG   . GLU A 1 15  ? -4.872  3.792   -10.008 1.00 0.00 ? 407 GLU A CG   4  
ATOM 7974  C CD   . GLU A 1 15  ? -4.900  3.488   -11.492 1.00 0.00 ? 407 GLU A CD   4  
ATOM 7975  O OE1  . GLU A 1 15  ? -4.383  4.303   -12.295 1.00 0.00 ? 407 GLU A OE1  4  
ATOM 7976  O OE2  . GLU A 1 15  ? -5.432  2.450   -11.892 1.00 0.00 ? 407 GLU A OE2  4  
ATOM 7977  H H    . GLU A 1 15  ? -2.055  2.155   -7.371  1.00 0.00 ? 407 GLU A H    4  
ATOM 7978  H HA   . GLU A 1 15  ? -3.496  4.648   -7.816  1.00 0.00 ? 407 GLU A HA   4  
ATOM 7979  H HB2  . GLU A 1 15  ? -2.855  3.196   -9.855  1.00 0.00 ? 407 GLU A HB2  4  
ATOM 7980  H HB3  . GLU A 1 15  ? -4.005  2.026   -9.238  1.00 0.00 ? 407 GLU A HB3  4  
ATOM 7981  H HG2  . GLU A 1 15  ? -5.806  3.480   -9.580  1.00 0.00 ? 407 GLU A HG2  4  
ATOM 7982  H HG3  . GLU A 1 15  ? -4.761  4.855   -9.864  1.00 0.00 ? 407 GLU A HG3  4  
ATOM 7983  N N    . TRP A 1 16  ? -5.277  3.994   -6.276  1.00 0.00 ? 408 TRP A N    4  
ATOM 7984  C CA   . TRP A 1 16  ? -6.209  3.730   -5.200  1.00 0.00 ? 408 TRP A CA   4  
ATOM 7985  C C    . TRP A 1 16  ? -7.586  4.215   -5.577  1.00 0.00 ? 408 TRP A C    4  
ATOM 7986  O O    . TRP A 1 16  ? -7.724  5.204   -6.295  1.00 0.00 ? 408 TRP A O    4  
ATOM 7987  C CB   . TRP A 1 16  ? -5.728  4.390   -3.885  1.00 0.00 ? 408 TRP A CB   4  
ATOM 7988  C CG   . TRP A 1 16  ? -5.482  5.877   -3.967  1.00 0.00 ? 408 TRP A CG   4  
ATOM 7989  C CD1  . TRP A 1 16  ? -4.347  6.495   -4.409  1.00 0.00 ? 408 TRP A CD1  4  
ATOM 7990  C CD2  . TRP A 1 16  ? -6.381  6.927   -3.576  1.00 0.00 ? 408 TRP A CD2  4  
ATOM 7991  N NE1  . TRP A 1 16  ? -4.489  7.853   -4.330  1.00 0.00 ? 408 TRP A NE1  4  
ATOM 7992  C CE2  . TRP A 1 16  ? -5.724  8.147   -3.819  1.00 0.00 ? 408 TRP A CE2  4  
ATOM 7993  C CE3  . TRP A 1 16  ? -7.678  6.952   -3.047  1.00 0.00 ? 408 TRP A CE3  4  
ATOM 7994  C CZ2  . TRP A 1 16  ? -6.317  9.381   -3.554  1.00 0.00 ? 408 TRP A CZ2  4  
ATOM 7995  C CZ3  . TRP A 1 16  ? -8.264  8.175   -2.783  1.00 0.00 ? 408 TRP A CZ3  4  
ATOM 7996  C CH2  . TRP A 1 16  ? -7.583  9.374   -3.037  1.00 0.00 ? 408 TRP A CH2  4  
ATOM 7997  H H    . TRP A 1 16  ? -5.242  4.903   -6.651  1.00 0.00 ? 408 TRP A H    4  
ATOM 7998  H HA   . TRP A 1 16  ? -6.246  2.659   -5.058  1.00 0.00 ? 408 TRP A HA   4  
ATOM 7999  H HB2  . TRP A 1 16  ? -6.470  4.227   -3.119  1.00 0.00 ? 408 TRP A HB2  4  
ATOM 8000  H HB3  . TRP A 1 16  ? -4.806  3.917   -3.580  1.00 0.00 ? 408 TRP A HB3  4  
ATOM 8001  H HD1  . TRP A 1 16  ? -3.473  5.977   -4.773  1.00 0.00 ? 408 TRP A HD1  4  
ATOM 8002  H HE1  . TRP A 1 16  ? -3.806  8.503   -4.595  1.00 0.00 ? 408 TRP A HE1  4  
ATOM 8003  H HE3  . TRP A 1 16  ? -8.219  6.040   -2.845  1.00 0.00 ? 408 TRP A HE3  4  
ATOM 8004  H HZ2  . TRP A 1 16  ? -5.806  10.313  -3.744  1.00 0.00 ? 408 TRP A HZ2  4  
ATOM 8005  H HZ3  . TRP A 1 16  ? -9.262  8.216   -2.374  1.00 0.00 ? 408 TRP A HZ3  4  
ATOM 8006  H HH2  . TRP A 1 16  ? -8.081  10.306  -2.814  1.00 0.00 ? 408 TRP A HH2  4  
ATOM 8007  N N    . GLN A 1 17  ? -8.593  3.550   -5.103  1.00 0.00 ? 409 GLN A N    4  
ATOM 8008  C CA   . GLN A 1 17  ? -9.939  3.887   -5.483  1.00 0.00 ? 409 GLN A CA   4  
ATOM 8009  C C    . GLN A 1 17  ? -10.621 4.732   -4.427  1.00 0.00 ? 409 GLN A C    4  
ATOM 8010  O O    . GLN A 1 17  ? -10.455 4.495   -3.220  1.00 0.00 ? 409 GLN A O    4  
ATOM 8011  C CB   . GLN A 1 17  ? -10.759 2.617   -5.720  1.00 0.00 ? 409 GLN A CB   4  
ATOM 8012  C CG   . GLN A 1 17  ? -12.201 2.881   -6.140  1.00 0.00 ? 409 GLN A CG   4  
ATOM 8013  C CD   . GLN A 1 17  ? -13.047 1.635   -6.153  1.00 0.00 ? 409 GLN A CD   4  
ATOM 8014  O OE1  . GLN A 1 17  ? -12.559 0.540   -6.399  1.00 0.00 ? 409 GLN A OE1  4  
ATOM 8015  N NE2  . GLN A 1 17  ? -14.311 1.788   -5.869  1.00 0.00 ? 409 GLN A NE2  4  
ATOM 8016  H H    . GLN A 1 17  ? -8.439  2.821   -4.463  1.00 0.00 ? 409 GLN A H    4  
ATOM 8017  H HA   . GLN A 1 17  ? -9.902  4.438   -6.409  1.00 0.00 ? 409 GLN A HA   4  
ATOM 8018  H HB2  . GLN A 1 17  ? -10.279 2.032   -6.490  1.00 0.00 ? 409 GLN A HB2  4  
ATOM 8019  H HB3  . GLN A 1 17  ? -10.776 2.046   -4.803  1.00 0.00 ? 409 GLN A HB3  4  
ATOM 8020  H HG2  . GLN A 1 17  ? -12.641 3.583   -5.450  1.00 0.00 ? 409 GLN A HG2  4  
ATOM 8021  H HG3  . GLN A 1 17  ? -12.202 3.312   -7.131  1.00 0.00 ? 409 GLN A HG3  4  
ATOM 8022  H HE21 . GLN A 1 17  ? -14.633 2.693   -5.668  1.00 0.00 ? 409 GLN A HE21 4  
ATOM 8023  H HE22 . GLN A 1 17  ? -14.868 0.982   -5.858  1.00 0.00 ? 409 GLN A HE22 4  
ATOM 8024  N N    . GLU A 1 18  ? -11.362 5.729   -4.877  1.00 0.00 ? 410 GLU A N    4  
ATOM 8025  C CA   . GLU A 1 18  ? -12.213 6.484   -4.001  1.00 0.00 ? 410 GLU A CA   4  
ATOM 8026  C C    . GLU A 1 18  ? -13.439 5.625   -3.736  1.00 0.00 ? 410 GLU A C    4  
ATOM 8027  O O    . GLU A 1 18  ? -14.206 5.316   -4.659  1.00 0.00 ? 410 GLU A O    4  
ATOM 8028  C CB   . GLU A 1 18  ? -12.621 7.815   -4.634  1.00 0.00 ? 410 GLU A CB   4  
ATOM 8029  C CG   . GLU A 1 18  ? -11.456 8.734   -4.958  1.00 0.00 ? 410 GLU A CG   4  
ATOM 8030  C CD   . GLU A 1 18  ? -11.906 10.054  -5.525  1.00 0.00 ? 410 GLU A CD   4  
ATOM 8031  O OE1  . GLU A 1 18  ? -12.088 10.163  -6.746  1.00 0.00 ? 410 GLU A OE1  4  
ATOM 8032  O OE2  . GLU A 1 18  ? -12.080 11.026  -4.754  1.00 0.00 ? 410 GLU A OE2  4  
ATOM 8033  H H    . GLU A 1 18  ? -11.346 5.966   -5.830  1.00 0.00 ? 410 GLU A H    4  
ATOM 8034  H HA   . GLU A 1 18  ? -11.682 6.653   -3.075  1.00 0.00 ? 410 GLU A HA   4  
ATOM 8035  H HB2  . GLU A 1 18  ? -13.151 7.613   -5.552  1.00 0.00 ? 410 GLU A HB2  4  
ATOM 8036  H HB3  . GLU A 1 18  ? -13.283 8.334   -3.956  1.00 0.00 ? 410 GLU A HB3  4  
ATOM 8037  H HG2  . GLU A 1 18  ? -10.891 8.922   -4.057  1.00 0.00 ? 410 GLU A HG2  4  
ATOM 8038  H HG3  . GLU A 1 18  ? -10.822 8.244   -5.682  1.00 0.00 ? 410 GLU A HG3  4  
ATOM 8039  N N    . LYS A 1 19  ? -13.582 5.181   -2.520  1.00 0.00 ? 411 LYS A N    4  
ATOM 8040  C CA   . LYS A 1 19  ? -14.655 4.290   -2.156  1.00 0.00 ? 411 LYS A CA   4  
ATOM 8041  C C    . LYS A 1 19  ? -15.653 4.971   -1.237  1.00 0.00 ? 411 LYS A C    4  
ATOM 8042  O O    . LYS A 1 19  ? -15.392 5.120   -0.048  1.00 0.00 ? 411 LYS A O    4  
ATOM 8043  C CB   . LYS A 1 19  ? -14.090 3.037   -1.469  1.00 0.00 ? 411 LYS A CB   4  
ATOM 8044  C CG   . LYS A 1 19  ? -13.218 2.163   -2.365  1.00 0.00 ? 411 LYS A CG   4  
ATOM 8045  C CD   . LYS A 1 19  ? -12.558 1.018   -1.592  1.00 0.00 ? 411 LYS A CD   4  
ATOM 8046  C CE   . LYS A 1 19  ? -13.572 0.075   -0.938  1.00 0.00 ? 411 LYS A CE   4  
ATOM 8047  N NZ   . LYS A 1 19  ? -14.466 -0.578  -1.916  1.00 0.00 ? 411 LYS A NZ   4  
ATOM 8048  H H    . LYS A 1 19  ? -12.943 5.457   -1.828  1.00 0.00 ? 411 LYS A H    4  
ATOM 8049  H HA   . LYS A 1 19  ? -15.159 3.978   -3.058  1.00 0.00 ? 411 LYS A HA   4  
ATOM 8050  H HB2  . LYS A 1 19  ? -13.496 3.349   -0.623  1.00 0.00 ? 411 LYS A HB2  4  
ATOM 8051  H HB3  . LYS A 1 19  ? -14.915 2.440   -1.110  1.00 0.00 ? 411 LYS A HB3  4  
ATOM 8052  H HG2  . LYS A 1 19  ? -13.832 1.745   -3.150  1.00 0.00 ? 411 LYS A HG2  4  
ATOM 8053  H HG3  . LYS A 1 19  ? -12.449 2.781   -2.805  1.00 0.00 ? 411 LYS A HG3  4  
ATOM 8054  H HD2  . LYS A 1 19  ? -11.949 0.443   -2.275  1.00 0.00 ? 411 LYS A HD2  4  
ATOM 8055  H HD3  . LYS A 1 19  ? -11.927 1.442   -0.825  1.00 0.00 ? 411 LYS A HD3  4  
ATOM 8056  H HE2  . LYS A 1 19  ? -13.033 -0.691  -0.402  1.00 0.00 ? 411 LYS A HE2  4  
ATOM 8057  H HE3  . LYS A 1 19  ? -14.169 0.640   -0.236  1.00 0.00 ? 411 LYS A HE3  4  
ATOM 8058  H HZ1  . LYS A 1 19  ? -13.949 -1.094  -2.655  1.00 0.00 ? 411 LYS A HZ1  4  
ATOM 8059  H HZ2  . LYS A 1 19  ? -15.068 -1.276  -1.417  1.00 0.00 ? 411 LYS A HZ2  4  
ATOM 8060  H HZ3  . LYS A 1 19  ? -15.107 0.099   -2.372  1.00 0.00 ? 411 LYS A HZ3  4  
ATOM 8061  N N    . PRO A 1 20  ? -16.755 5.500   -1.778  1.00 0.00 ? 412 PRO A N    4  
ATOM 8062  C CA   . PRO A 1 20  ? -17.845 6.024   -0.972  1.00 0.00 ? 412 PRO A CA   4  
ATOM 8063  C C    . PRO A 1 20  ? -18.830 4.887   -0.645  1.00 0.00 ? 412 PRO A C    4  
ATOM 8064  O O    . PRO A 1 20  ? -18.880 4.382   0.486   1.00 0.00 ? 412 PRO A O    4  
ATOM 8065  C CB   . PRO A 1 20  ? -18.499 7.082   -1.892  1.00 0.00 ? 412 PRO A CB   4  
ATOM 8066  C CG   . PRO A 1 20  ? -17.755 7.005   -3.204  1.00 0.00 ? 412 PRO A CG   4  
ATOM 8067  C CD   . PRO A 1 20  ? -17.015 5.697   -3.202  1.00 0.00 ? 412 PRO A CD   4  
ATOM 8068  H HA   . PRO A 1 20  ? -17.490 6.473   -0.055  1.00 0.00 ? 412 PRO A HA   4  
ATOM 8069  H HB2  . PRO A 1 20  ? -19.544 6.842   -2.022  1.00 0.00 ? 412 PRO A HB2  4  
ATOM 8070  H HB3  . PRO A 1 20  ? -18.404 8.060   -1.445  1.00 0.00 ? 412 PRO A HB3  4  
ATOM 8071  H HG2  . PRO A 1 20  ? -18.454 7.036   -4.027  1.00 0.00 ? 412 PRO A HG2  4  
ATOM 8072  H HG3  . PRO A 1 20  ? -17.058 7.827   -3.279  1.00 0.00 ? 412 PRO A HG3  4  
ATOM 8073  H HD2  . PRO A 1 20  ? -17.636 4.906   -3.597  1.00 0.00 ? 412 PRO A HD2  4  
ATOM 8074  H HD3  . PRO A 1 20  ? -16.093 5.779   -3.758  1.00 0.00 ? 412 PRO A HD3  4  
ATOM 8075  N N    . LYS A 1 21  ? -19.572 4.483   -1.659  1.00 0.00 ? 413 LYS A N    4  
ATOM 8076  C CA   . LYS A 1 21  ? -20.457 3.350   -1.644  1.00 0.00 ? 413 LYS A CA   4  
ATOM 8077  C C    . LYS A 1 21  ? -20.986 3.210   -3.073  1.00 0.00 ? 413 LYS A C    4  
ATOM 8078  O O    . LYS A 1 21  ? -21.274 4.230   -3.724  1.00 0.00 ? 413 LYS A O    4  
ATOM 8079  C CB   . LYS A 1 21  ? -21.643 3.519   -0.646  1.00 0.00 ? 413 LYS A CB   4  
ATOM 8080  C CG   . LYS A 1 21  ? -22.658 4.574   -1.041  1.00 0.00 ? 413 LYS A CG   4  
ATOM 8081  C CD   . LYS A 1 21  ? -23.816 4.641   -0.075  1.00 0.00 ? 413 LYS A CD   4  
ATOM 8082  C CE   . LYS A 1 21  ? -24.918 5.549   -0.607  1.00 0.00 ? 413 LYS A CE   4  
ATOM 8083  N NZ   . LYS A 1 21  ? -24.440 6.924   -0.864  1.00 0.00 ? 413 LYS A NZ   4  
ATOM 8084  H H    . LYS A 1 21  ? -19.549 4.984   -2.502  1.00 0.00 ? 413 LYS A H    4  
ATOM 8085  H HA   . LYS A 1 21  ? -19.862 2.487   -1.384  1.00 0.00 ? 413 LYS A HA   4  
ATOM 8086  H HB2  . LYS A 1 21  ? -22.157 2.574   -0.562  1.00 0.00 ? 413 LYS A HB2  4  
ATOM 8087  H HB3  . LYS A 1 21  ? -21.237 3.776   0.320   1.00 0.00 ? 413 LYS A HB3  4  
ATOM 8088  H HG2  . LYS A 1 21  ? -22.172 5.538   -1.070  1.00 0.00 ? 413 LYS A HG2  4  
ATOM 8089  H HG3  . LYS A 1 21  ? -23.033 4.330   -2.024  1.00 0.00 ? 413 LYS A HG3  4  
ATOM 8090  H HD2  . LYS A 1 21  ? -24.212 3.646   0.063   1.00 0.00 ? 413 LYS A HD2  4  
ATOM 8091  H HD3  . LYS A 1 21  ? -23.465 5.025   0.871   1.00 0.00 ? 413 LYS A HD3  4  
ATOM 8092  H HE2  . LYS A 1 21  ? -25.285 5.134   -1.533  1.00 0.00 ? 413 LYS A HE2  4  
ATOM 8093  H HE3  . LYS A 1 21  ? -25.720 5.580   0.116   1.00 0.00 ? 413 LYS A HE3  4  
ATOM 8094  H HZ1  . LYS A 1 21  ? -24.083 7.375   0.004   1.00 0.00 ? 413 LYS A HZ1  4  
ATOM 8095  H HZ2  . LYS A 1 21  ? -23.692 6.945   -1.588  1.00 0.00 ? 413 LYS A HZ2  4  
ATOM 8096  H HZ3  . LYS A 1 21  ? -25.222 7.505   -1.221  1.00 0.00 ? 413 LYS A HZ3  4  
ATOM 8097  N N    . PRO A 1 22  ? -21.061 2.008   -3.619  1.00 0.00 ? 414 PRO A N    4  
ATOM 8098  C CA   . PRO A 1 22  ? -21.599 1.816   -4.942  1.00 0.00 ? 414 PRO A CA   4  
ATOM 8099  C C    . PRO A 1 22  ? -23.123 1.759   -4.907  1.00 0.00 ? 414 PRO A C    4  
ATOM 8100  O O    . PRO A 1 22  ? -23.713 0.848   -4.299  1.00 0.00 ? 414 PRO A O    4  
ATOM 8101  C CB   . PRO A 1 22  ? -21.011 0.476   -5.405  1.00 0.00 ? 414 PRO A CB   4  
ATOM 8102  C CG   . PRO A 1 22  ? -20.414 -0.171  -4.189  1.00 0.00 ? 414 PRO A CG   4  
ATOM 8103  C CD   . PRO A 1 22  ? -20.634 0.743   -3.010  1.00 0.00 ? 414 PRO A CD   4  
ATOM 8104  H HA   . PRO A 1 22  ? -21.290 2.609   -5.607  1.00 0.00 ? 414 PRO A HA   4  
ATOM 8105  H HB2  . PRO A 1 22  ? -21.796 -0.132  -5.829  1.00 0.00 ? 414 PRO A HB2  4  
ATOM 8106  H HB3  . PRO A 1 22  ? -20.257 0.659   -6.157  1.00 0.00 ? 414 PRO A HB3  4  
ATOM 8107  H HG2  . PRO A 1 22  ? -20.905 -1.115  -4.008  1.00 0.00 ? 414 PRO A HG2  4  
ATOM 8108  H HG3  . PRO A 1 22  ? -19.358 -0.331  -4.346  1.00 0.00 ? 414 PRO A HG3  4  
ATOM 8109  H HD2  . PRO A 1 22  ? -21.402 0.346   -2.365  1.00 0.00 ? 414 PRO A HD2  4  
ATOM 8110  H HD3  . PRO A 1 22  ? -19.707 0.860   -2.470  1.00 0.00 ? 414 PRO A HD3  4  
ATOM 8111  N N    . ALA A 1 23  ? -23.755 2.755   -5.496  1.00 0.00 ? 415 ALA A N    4  
ATOM 8112  C CA   . ALA A 1 23  ? -25.206 2.807   -5.557  1.00 0.00 ? 415 ALA A CA   4  
ATOM 8113  C C    . ALA A 1 23  ? -25.724 1.850   -6.624  1.00 0.00 ? 415 ALA A C    4  
ATOM 8114  O O    . ALA A 1 23  ? -26.858 1.385   -6.574  1.00 0.00 ? 415 ALA A O    4  
ATOM 8115  C CB   . ALA A 1 23  ? -25.676 4.229   -5.833  1.00 0.00 ? 415 ALA A CB   4  
ATOM 8116  H H    . ALA A 1 23  ? -23.230 3.486   -5.889  1.00 0.00 ? 415 ALA A H    4  
ATOM 8117  H HA   . ALA A 1 23  ? -25.586 2.496   -4.594  1.00 0.00 ? 415 ALA A HA   4  
ATOM 8118  H HB1  . ALA A 1 23  ? -26.754 4.259   -5.824  1.00 0.00 ? 415 ALA A HB1  4  
ATOM 8119  H HB2  . ALA A 1 23  ? -25.291 4.889   -5.070  1.00 0.00 ? 415 ALA A HB2  4  
ATOM 8120  H HB3  . ALA A 1 23  ? -25.313 4.545   -6.800  1.00 0.00 ? 415 ALA A HB3  4  
ATOM 8121  N N    . SER A 1 24  ? -24.881 1.559   -7.576  1.00 0.00 ? 416 SER A N    4  
ATOM 8122  C CA   . SER A 1 24  ? -25.204 0.664   -8.647  1.00 0.00 ? 416 SER A CA   4  
ATOM 8123  C C    . SER A 1 24  ? -24.298 -0.564  -8.533  1.00 0.00 ? 416 SER A C    4  
ATOM 8124  O O    . SER A 1 24  ? -23.322 -0.542  -7.761  1.00 0.00 ? 416 SER A O    4  
ATOM 8125  C CB   . SER A 1 24  ? -24.949 1.385   -9.961  1.00 0.00 ? 416 SER A CB   4  
ATOM 8126  O OG   . SER A 1 24  ? -25.581 2.665   -9.970  1.00 0.00 ? 416 SER A OG   4  
ATOM 8127  H H    . SER A 1 24  ? -23.981 1.945   -7.564  1.00 0.00 ? 416 SER A H    4  
ATOM 8128  H HA   . SER A 1 24  ? -26.243 0.380   -8.582  1.00 0.00 ? 416 SER A HA   4  
ATOM 8129  H HB2  . SER A 1 24  ? -23.886 1.523   -10.089 1.00 0.00 ? 416 SER A HB2  4  
ATOM 8130  H HB3  . SER A 1 24  ? -25.336 0.803   -10.784 1.00 0.00 ? 416 SER A HB3  4  
ATOM 8131  H HG   . SER A 1 24  ? -26.384 2.622   -9.433  1.00 0.00 ? 416 SER A HG   4  
ATOM 8132  N N    . VAL A 1 25  ? -24.609 -1.615  -9.268  1.00 0.00 ? 417 VAL A N    4  
ATOM 8133  C CA   . VAL A 1 25  ? -23.781 -2.807  -9.270  1.00 0.00 ? 417 VAL A CA   4  
ATOM 8134  C C    . VAL A 1 25  ? -22.528 -2.512  -10.081 1.00 0.00 ? 417 VAL A C    4  
ATOM 8135  O O    . VAL A 1 25  ? -22.566 -2.481  -11.308 1.00 0.00 ? 417 VAL A O    4  
ATOM 8136  C CB   . VAL A 1 25  ? -24.521 -4.040  -9.868  1.00 0.00 ? 417 VAL A CB   4  
ATOM 8137  C CG1  . VAL A 1 25  ? -23.622 -5.275  -9.862  1.00 0.00 ? 417 VAL A CG1  4  
ATOM 8138  C CG2  . VAL A 1 25  ? -25.800 -4.322  -9.101  1.00 0.00 ? 417 VAL A CG2  4  
ATOM 8139  H H    . VAL A 1 25  ? -25.401 -1.595  -9.846  1.00 0.00 ? 417 VAL A H    4  
ATOM 8140  H HA   . VAL A 1 25  ? -23.497 -3.011  -8.248  1.00 0.00 ? 417 VAL A HA   4  
ATOM 8141  H HB   . VAL A 1 25  ? -24.778 -3.816  -10.892 1.00 0.00 ? 417 VAL A HB   4  
ATOM 8142  H HG11 . VAL A 1 25  ? -23.323 -5.500  -8.849  1.00 0.00 ? 417 VAL A HG11 4  
ATOM 8143  H HG12 . VAL A 1 25  ? -24.161 -6.116  -10.272 1.00 0.00 ? 417 VAL A HG12 4  
ATOM 8144  H HG13 . VAL A 1 25  ? -22.745 -5.078  -10.461 1.00 0.00 ? 417 VAL A HG13 4  
ATOM 8145  H HG21 . VAL A 1 25  ? -26.443 -3.457  -9.153  1.00 0.00 ? 417 VAL A HG21 4  
ATOM 8146  H HG22 . VAL A 1 25  ? -26.305 -5.172  -9.537  1.00 0.00 ? 417 VAL A HG22 4  
ATOM 8147  H HG23 . VAL A 1 25  ? -25.562 -4.531  -8.069  1.00 0.00 ? 417 VAL A HG23 4  
ATOM 8148  N N    . ASP A 1 26  ? -21.454 -2.242  -9.397  1.00 0.00 ? 418 ASP A N    4  
ATOM 8149  C CA   . ASP A 1 26  ? -20.213 -1.883  -10.040 1.00 0.00 ? 418 ASP A CA   4  
ATOM 8150  C C    . ASP A 1 26  ? -19.053 -2.600  -9.398  1.00 0.00 ? 418 ASP A C    4  
ATOM 8151  O O    . ASP A 1 26  ? -19.011 -2.749  -8.172  1.00 0.00 ? 418 ASP A O    4  
ATOM 8152  C CB   . ASP A 1 26  ? -20.000 -0.368  -9.962  1.00 0.00 ? 418 ASP A CB   4  
ATOM 8153  C CG   . ASP A 1 26  ? -18.698 0.065   -10.584 1.00 0.00 ? 418 ASP A CG   4  
ATOM 8154  O OD1  . ASP A 1 26  ? -18.033 0.996   -10.047 1.00 0.00 ? 418 ASP A OD1  4  
ATOM 8155  O OD2  . ASP A 1 26  ? -18.310 -0.505  -11.622 1.00 0.00 ? 418 ASP A OD2  4  
ATOM 8156  H H    . ASP A 1 26  ? -21.488 -2.274  -8.418  1.00 0.00 ? 418 ASP A H    4  
ATOM 8157  H HA   . ASP A 1 26  ? -20.278 -2.166  -11.080 1.00 0.00 ? 418 ASP A HA   4  
ATOM 8158  H HB2  . ASP A 1 26  ? -20.807 0.128   -10.479 1.00 0.00 ? 418 ASP A HB2  4  
ATOM 8159  H HB3  . ASP A 1 26  ? -20.004 -0.067  -8.925  1.00 0.00 ? 418 ASP A HB3  4  
ATOM 8160  N N    . ALA A 1 27  ? -18.145 -3.088  -10.212 1.00 0.00 ? 419 ALA A N    4  
ATOM 8161  C CA   . ALA A 1 27  ? -16.964 -3.761  -9.718  1.00 0.00 ? 419 ALA A CA   4  
ATOM 8162  C C    . ALA A 1 27  ? -15.850 -2.752  -9.470  1.00 0.00 ? 419 ALA A C    4  
ATOM 8163  O O    . ALA A 1 27  ? -15.142 -2.842  -8.464  1.00 0.00 ? 419 ALA A O    4  
ATOM 8164  C CB   . ALA A 1 27  ? -16.512 -4.835  -10.700 1.00 0.00 ? 419 ALA A CB   4  
ATOM 8165  H H    . ALA A 1 27  ? -18.276 -2.976  -11.176 1.00 0.00 ? 419 ALA A H    4  
ATOM 8166  H HA   . ALA A 1 27  ? -17.219 -4.234  -8.781  1.00 0.00 ? 419 ALA A HA   4  
ATOM 8167  H HB1  . ALA A 1 27  ? -15.653 -5.354  -10.303 1.00 0.00 ? 419 ALA A HB1  4  
ATOM 8168  H HB2  . ALA A 1 27  ? -17.317 -5.537  -10.862 1.00 0.00 ? 419 ALA A HB2  4  
ATOM 8169  H HB3  . ALA A 1 27  ? -16.246 -4.372  -11.639 1.00 0.00 ? 419 ALA A HB3  4  
ATOM 8170  N N    . ASN A 1 28  ? -15.751 -1.772  -10.370 1.00 0.00 ? 420 ASN A N    4  
ATOM 8171  C CA   . ASN A 1 28  ? -14.759 -0.688  -10.325 1.00 0.00 ? 420 ASN A CA   4  
ATOM 8172  C C    . ASN A 1 28  ? -14.877 0.184   -11.568 1.00 0.00 ? 420 ASN A C    4  
ATOM 8173  O O    . ASN A 1 28  ? -14.256 -0.077  -12.598 1.00 0.00 ? 420 ASN A O    4  
ATOM 8174  C CB   . ASN A 1 28  ? -13.291 -1.188  -10.157 1.00 0.00 ? 420 ASN A CB   4  
ATOM 8175  C CG   . ASN A 1 28  ? -12.234 -0.069  -10.253 1.00 0.00 ? 420 ASN A CG   4  
ATOM 8176  O OD1  . ASN A 1 28  ? -11.713 0.220   -11.338 1.00 0.00 ? 420 ASN A OD1  4  
ATOM 8177  N ND2  . ASN A 1 28  ? -11.881 0.532   -9.148  1.00 0.00 ? 420 ASN A ND2  4  
ATOM 8178  H H    . ASN A 1 28  ? -16.390 -1.759  -11.115 1.00 0.00 ? 420 ASN A H    4  
ATOM 8179  H HA   . ASN A 1 28  ? -15.023 -0.071  -9.477  1.00 0.00 ? 420 ASN A HA   4  
ATOM 8180  H HB2  . ASN A 1 28  ? -13.188 -1.665  -9.193  1.00 0.00 ? 420 ASN A HB2  4  
ATOM 8181  H HB3  . ASN A 1 28  ? -13.087 -1.914  -10.928 1.00 0.00 ? 420 ASN A HB3  4  
ATOM 8182  H HD21 . ASN A 1 28  ? -12.284 0.252   -8.292  1.00 0.00 ? 420 ASN A HD21 4  
ATOM 8183  H HD22 . ASN A 1 28  ? -11.230 1.265   -9.201  1.00 0.00 ? 420 ASN A HD22 4  
ATOM 8184  N N    . THR A 1 29  ? -15.789 1.100   -11.522 1.00 0.00 ? 421 THR A N    4  
ATOM 8185  C CA   . THR A 1 29  ? -15.909 2.123   -12.540 1.00 0.00 ? 421 THR A CA   4  
ATOM 8186  C C    . THR A 1 29  ? -15.957 3.470   -11.812 1.00 0.00 ? 421 THR A C    4  
ATOM 8187  O O    . THR A 1 29  ? -16.194 4.529   -12.385 1.00 0.00 ? 421 THR A O    4  
ATOM 8188  C CB   . THR A 1 29  ? -17.187 1.904   -13.390 1.00 0.00 ? 421 THR A CB   4  
ATOM 8189  O OG1  . THR A 1 29  ? -17.257 0.517   -13.748 1.00 0.00 ? 421 THR A OG1  4  
ATOM 8190  C CG2  . THR A 1 29  ? -17.149 2.724   -14.679 1.00 0.00 ? 421 THR A CG2  4  
ATOM 8191  H H    . THR A 1 29  ? -16.484 1.061   -10.821 1.00 0.00 ? 421 THR A H    4  
ATOM 8192  H HA   . THR A 1 29  ? -15.028 2.085   -13.165 1.00 0.00 ? 421 THR A HA   4  
ATOM 8193  H HB   . THR A 1 29  ? -18.053 2.178   -12.807 1.00 0.00 ? 421 THR A HB   4  
ATOM 8194  H HG1  . THR A 1 29  ? -17.596 0.074   -12.949 1.00 0.00 ? 421 THR A HG1  4  
ATOM 8195  H HG21 . THR A 1 29  ? -17.069 3.774   -14.436 1.00 0.00 ? 421 THR A HG21 4  
ATOM 8196  H HG22 . THR A 1 29  ? -16.295 2.426   -15.270 1.00 0.00 ? 421 THR A HG22 4  
ATOM 8197  H HG23 . THR A 1 29  ? -18.055 2.553   -15.240 1.00 0.00 ? 421 THR A HG23 4  
ATOM 8198  N N    . LYS A 1 30  ? -15.728 3.394   -10.516 1.00 0.00 ? 422 LYS A N    4  
ATOM 8199  C CA   . LYS A 1 30  ? -15.643 4.557   -9.678  1.00 0.00 ? 422 LYS A CA   4  
ATOM 8200  C C    . LYS A 1 30  ? -14.258 5.138   -9.877  1.00 0.00 ? 422 LYS A C    4  
ATOM 8201  O O    . LYS A 1 30  ? -13.322 4.390   -10.213 1.00 0.00 ? 422 LYS A O    4  
ATOM 8202  C CB   . LYS A 1 30  ? -15.857 4.176   -8.203  1.00 0.00 ? 422 LYS A CB   4  
ATOM 8203  C CG   . LYS A 1 30  ? -17.194 3.467   -7.844  1.00 0.00 ? 422 LYS A CG   4  
ATOM 8204  C CD   . LYS A 1 30  ? -18.449 4.360   -7.991  1.00 0.00 ? 422 LYS A CD   4  
ATOM 8205  C CE   . LYS A 1 30  ? -18.971 4.478   -9.433  1.00 0.00 ? 422 LYS A CE   4  
ATOM 8206  N NZ   . LYS A 1 30  ? -19.495 3.197   -9.955  1.00 0.00 ? 422 LYS A NZ   4  
ATOM 8207  H H    . LYS A 1 30  ? -15.570 2.507   -10.134 1.00 0.00 ? 422 LYS A H    4  
ATOM 8208  H HA   . LYS A 1 30  ? -16.369 5.294   -9.986  1.00 0.00 ? 422 LYS A HA   4  
ATOM 8209  H HB2  . LYS A 1 30  ? -15.055 3.516   -7.909  1.00 0.00 ? 422 LYS A HB2  4  
ATOM 8210  H HB3  . LYS A 1 30  ? -15.784 5.075   -7.609  1.00 0.00 ? 422 LYS A HB3  4  
ATOM 8211  H HG2  . LYS A 1 30  ? -17.313 2.614   -8.495  1.00 0.00 ? 422 LYS A HG2  4  
ATOM 8212  H HG3  . LYS A 1 30  ? -17.130 3.118   -6.824  1.00 0.00 ? 422 LYS A HG3  4  
ATOM 8213  H HD2  . LYS A 1 30  ? -19.240 3.943   -7.384  1.00 0.00 ? 422 LYS A HD2  4  
ATOM 8214  H HD3  . LYS A 1 30  ? -18.210 5.345   -7.618  1.00 0.00 ? 422 LYS A HD3  4  
ATOM 8215  H HE2  . LYS A 1 30  ? -19.789 5.183   -9.431  1.00 0.00 ? 422 LYS A HE2  4  
ATOM 8216  H HE3  . LYS A 1 30  ? -18.196 4.837   -10.090 1.00 0.00 ? 422 LYS A HE3  4  
ATOM 8217  H HZ1  . LYS A 1 30  ? -18.800 2.417   -9.910  1.00 0.00 ? 422 LYS A HZ1  4  
ATOM 8218  H HZ2  . LYS A 1 30  ? -20.337 2.904   -9.422  1.00 0.00 ? 422 LYS A HZ2  4  
ATOM 8219  H HZ3  . LYS A 1 30  ? -19.801 3.299   -10.943 1.00 0.00 ? 422 LYS A HZ3  4  
ATOM 8220  N N    . LEU A 1 31  ? -14.121 6.430   -9.687  1.00 0.00 ? 423 LEU A N    4  
ATOM 8221  C CA   . LEU A 1 31  ? -12.858 7.109   -9.934  1.00 0.00 ? 423 LEU A CA   4  
ATOM 8222  C C    . LEU A 1 31  ? -11.715 6.567   -9.088  1.00 0.00 ? 423 LEU A C    4  
ATOM 8223  O O    . LEU A 1 31  ? -11.714 6.653   -7.846  1.00 0.00 ? 423 LEU A O    4  
ATOM 8224  C CB   . LEU A 1 31  ? -12.999 8.628   -9.782  1.00 0.00 ? 423 LEU A CB   4  
ATOM 8225  C CG   . LEU A 1 31  ? -13.863 9.330   -10.841 1.00 0.00 ? 423 LEU A CG   4  
ATOM 8226  C CD1  . LEU A 1 31  ? -14.030 10.803  -10.514 1.00 0.00 ? 423 LEU A CD1  4  
ATOM 8227  C CD2  . LEU A 1 31  ? -13.243 9.171   -12.222 1.00 0.00 ? 423 LEU A CD2  4  
ATOM 8228  H H    . LEU A 1 31  ? -14.880 6.961   -9.364  1.00 0.00 ? 423 LEU A H    4  
ATOM 8229  H HA   . LEU A 1 31  ? -12.607 6.901   -10.963 1.00 0.00 ? 423 LEU A HA   4  
ATOM 8230  H HB2  . LEU A 1 31  ? -13.426 8.827   -8.811  1.00 0.00 ? 423 LEU A HB2  4  
ATOM 8231  H HB3  . LEU A 1 31  ? -12.011 9.064   -9.814  1.00 0.00 ? 423 LEU A HB3  4  
ATOM 8232  H HG   . LEU A 1 31  ? -14.843 8.876   -10.858 1.00 0.00 ? 423 LEU A HG   4  
ATOM 8233  H HD11 . LEU A 1 31  ? -13.058 11.272  -10.453 1.00 0.00 ? 423 LEU A HD11 4  
ATOM 8234  H HD12 . LEU A 1 31  ? -14.615 11.284  -11.284 1.00 0.00 ? 423 LEU A HD12 4  
ATOM 8235  H HD13 . LEU A 1 31  ? -14.535 10.905  -9.566  1.00 0.00 ? 423 LEU A HD13 4  
ATOM 8236  H HD21 . LEU A 1 31  ? -12.240 9.573   -12.219 1.00 0.00 ? 423 LEU A HD21 4  
ATOM 8237  H HD22 . LEU A 1 31  ? -13.216 8.127   -12.499 1.00 0.00 ? 423 LEU A HD22 4  
ATOM 8238  H HD23 . LEU A 1 31  ? -13.840 9.710   -12.943 1.00 0.00 ? 423 LEU A HD23 4  
ATOM 8239  N N    . THR A 1 32  ? -10.777 5.974   -9.766  1.00 0.00 ? 424 THR A N    4  
ATOM 8240  C CA   . THR A 1 32  ? -9.598  5.465   -9.165  1.00 0.00 ? 424 THR A CA   4  
ATOM 8241  C C    . THR A 1 32  ? -8.494  6.500   -9.429  1.00 0.00 ? 424 THR A C    4  
ATOM 8242  O O    . THR A 1 32  ? -8.392  7.030   -10.538 1.00 0.00 ? 424 THR A O    4  
ATOM 8243  C CB   . THR A 1 32  ? -9.223  4.112   -9.803  1.00 0.00 ? 424 THR A CB   4  
ATOM 8244  O OG1  . THR A 1 32  ? -10.412 3.289   -9.929  1.00 0.00 ? 424 THR A OG1  4  
ATOM 8245  C CG2  . THR A 1 32  ? -8.234  3.366   -8.934  1.00 0.00 ? 424 THR A CG2  4  
ATOM 8246  H H    . THR A 1 32  ? -10.865 5.887   -10.742 1.00 0.00 ? 424 THR A H    4  
ATOM 8247  H HA   . THR A 1 32  ? -9.756  5.350   -8.104  1.00 0.00 ? 424 THR A HA   4  
ATOM 8248  H HB   . THR A 1 32  ? -8.778  4.311   -10.766 1.00 0.00 ? 424 THR A HB   4  
ATOM 8249  H HG1  . THR A 1 32  ? -11.155 3.875   -10.128 1.00 0.00 ? 424 THR A HG1  4  
ATOM 8250  H HG21 . THR A 1 32  ? -7.426  4.038   -8.685  1.00 0.00 ? 424 THR A HG21 4  
ATOM 8251  H HG22 . THR A 1 32  ? -8.718  3.070   -8.016  1.00 0.00 ? 424 THR A HG22 4  
ATOM 8252  H HG23 . THR A 1 32  ? -7.853  2.497   -9.450  1.00 0.00 ? 424 THR A HG23 4  
ATOM 8253  N N    . ARG A 1 33  ? -7.719  6.819   -8.431  1.00 0.00 ? 425 ARG A N    4  
ATOM 8254  C CA   . ARG A 1 33  ? -6.718  7.850   -8.560  1.00 0.00 ? 425 ARG A CA   4  
ATOM 8255  C C    . ARG A 1 33  ? -5.350  7.221   -8.548  1.00 0.00 ? 425 ARG A C    4  
ATOM 8256  O O    . ARG A 1 33  ? -5.126  6.251   -7.843  1.00 0.00 ? 425 ARG A O    4  
ATOM 8257  C CB   . ARG A 1 33  ? -6.851  8.831   -7.402  1.00 0.00 ? 425 ARG A CB   4  
ATOM 8258  C CG   . ARG A 1 33  ? -8.246  9.411   -7.256  1.00 0.00 ? 425 ARG A CG   4  
ATOM 8259  C CD   . ARG A 1 33  ? -8.647  10.238  -8.463  1.00 0.00 ? 425 ARG A CD   4  
ATOM 8260  N NE   . ARG A 1 33  ? -9.984  10.798  -8.304  1.00 0.00 ? 425 ARG A NE   4  
ATOM 8261  C CZ   . ARG A 1 33  ? -10.455 11.878  -8.915  1.00 0.00 ? 425 ARG A CZ   4  
ATOM 8262  N NH1  . ARG A 1 33  ? -9.719  12.539  -9.814  1.00 0.00 ? 425 ARG A NH1  4  
ATOM 8263  N NH2  . ARG A 1 33  ? -11.674 12.290  -8.620  1.00 0.00 ? 425 ARG A NH2  4  
ATOM 8264  H H    . ARG A 1 33  ? -7.783  6.319   -7.582  1.00 0.00 ? 425 ARG A H    4  
ATOM 8265  H HA   . ARG A 1 33  ? -6.868  8.377   -9.489  1.00 0.00 ? 425 ARG A HA   4  
ATOM 8266  H HB2  . ARG A 1 33  ? -6.597  8.322   -6.484  1.00 0.00 ? 425 ARG A HB2  4  
ATOM 8267  H HB3  . ARG A 1 33  ? -6.157  9.645   -7.554  1.00 0.00 ? 425 ARG A HB3  4  
ATOM 8268  H HG2  . ARG A 1 33  ? -8.932  8.578   -7.187  1.00 0.00 ? 425 ARG A HG2  4  
ATOM 8269  H HG3  . ARG A 1 33  ? -8.301  10.014  -6.364  1.00 0.00 ? 425 ARG A HG3  4  
ATOM 8270  H HD2  . ARG A 1 33  ? -7.940  11.046  -8.582  1.00 0.00 ? 425 ARG A HD2  4  
ATOM 8271  H HD3  . ARG A 1 33  ? -8.634  9.610   -9.343  1.00 0.00 ? 425 ARG A HD3  4  
ATOM 8272  H HE   . ARG A 1 33  ? -10.587 10.332  -7.667  1.00 0.00 ? 425 ARG A HE   4  
ATOM 8273  H HH11 . ARG A 1 33  ? -8.789  12.251  -10.067 1.00 0.00 ? 425 ARG A HH11 4  
ATOM 8274  H HH12 . ARG A 1 33  ? -10.064 13.355  -10.288 1.00 0.00 ? 425 ARG A HH12 4  
ATOM 8275  H HH21 . ARG A 1 33  ? -12.210 11.775  -7.941  1.00 0.00 ? 425 ARG A HH21 4  
ATOM 8276  H HH22 . ARG A 1 33  ? -12.108 13.094  -9.035  1.00 0.00 ? 425 ARG A HH22 4  
ATOM 8277  N N    . SER A 1 34  ? -4.439  7.781   -9.284  1.00 0.00 ? 426 SER A N    4  
ATOM 8278  C CA   . SER A 1 34  ? -3.129  7.214   -9.400  1.00 0.00 ? 426 SER A CA   4  
ATOM 8279  C C    . SER A 1 34  ? -2.064  8.220   -8.985  1.00 0.00 ? 426 SER A C    4  
ATOM 8280  O O    . SER A 1 34  ? -2.084  9.368   -9.447  1.00 0.00 ? 426 SER A O    4  
ATOM 8281  C CB   . SER A 1 34  ? -2.934  6.758   -10.842 1.00 0.00 ? 426 SER A CB   4  
ATOM 8282  O OG   . SER A 1 34  ? -3.163  7.840   -11.763 1.00 0.00 ? 426 SER A OG   4  
ATOM 8283  H H    . SER A 1 34  ? -4.640  8.603   -9.779  1.00 0.00 ? 426 SER A H    4  
ATOM 8284  H HA   . SER A 1 34  ? -3.070  6.348   -8.759  1.00 0.00 ? 426 SER A HA   4  
ATOM 8285  H HB2  . SER A 1 34  ? -1.960  6.319   -10.976 1.00 0.00 ? 426 SER A HB2  4  
ATOM 8286  H HB3  . SER A 1 34  ? -3.662  5.989   -11.055 1.00 0.00 ? 426 SER A HB3  4  
ATOM 8287  H HG   . SER A 1 34  ? -2.763  8.634   -11.385 1.00 0.00 ? 426 SER A HG   4  
ATOM 8288  N N    . LEU A 1 35  ? -1.162  7.807   -8.120  1.00 0.00 ? 427 LEU A N    4  
ATOM 8289  C CA   . LEU A 1 35  ? -0.093  8.667   -7.652  1.00 0.00 ? 427 LEU A CA   4  
ATOM 8290  C C    . LEU A 1 35  ? 1.264   7.967   -7.759  1.00 0.00 ? 427 LEU A C    4  
ATOM 8291  O O    . LEU A 1 35  ? 1.419   6.837   -7.286  1.00 0.00 ? 427 LEU A O    4  
ATOM 8292  C CB   . LEU A 1 35  ? -0.348  9.128   -6.209  1.00 0.00 ? 427 LEU A CB   4  
ATOM 8293  C CG   . LEU A 1 35  ? -1.551  10.058  -6.003  1.00 0.00 ? 427 LEU A CG   4  
ATOM 8294  C CD1  . LEU A 1 35  ? -1.729  10.377  -4.535  1.00 0.00 ? 427 LEU A CD1  4  
ATOM 8295  C CD2  . LEU A 1 35  ? -1.370  11.344  -6.796  1.00 0.00 ? 427 LEU A CD2  4  
ATOM 8296  H H    . LEU A 1 35  ? -1.205  6.885   -7.773  1.00 0.00 ? 427 LEU A H    4  
ATOM 8297  H HA   . LEU A 1 35  ? -0.105  9.534   -8.293  1.00 0.00 ? 427 LEU A HA   4  
ATOM 8298  H HB2  . LEU A 1 35  ? -0.493  8.248   -5.599  1.00 0.00 ? 427 LEU A HB2  4  
ATOM 8299  H HB3  . LEU A 1 35  ? 0.536   9.642   -5.861  1.00 0.00 ? 427 LEU A HB3  4  
ATOM 8300  H HG   . LEU A 1 35  ? -2.448  9.567   -6.354  1.00 0.00 ? 427 LEU A HG   4  
ATOM 8301  H HD11 . LEU A 1 35  ? -1.874  9.460   -3.983  1.00 0.00 ? 427 LEU A HD11 4  
ATOM 8302  H HD12 . LEU A 1 35  ? -0.844  10.875  -4.168  1.00 0.00 ? 427 LEU A HD12 4  
ATOM 8303  H HD13 . LEU A 1 35  ? -2.586  11.022  -4.400  1.00 0.00 ? 427 LEU A HD13 4  
ATOM 8304  H HD21 . LEU A 1 35  ? -1.285  11.120  -7.849  1.00 0.00 ? 427 LEU A HD21 4  
ATOM 8305  H HD22 . LEU A 1 35  ? -2.230  11.977  -6.637  1.00 0.00 ? 427 LEU A HD22 4  
ATOM 8306  H HD23 . LEU A 1 35  ? -0.480  11.858  -6.461  1.00 0.00 ? 427 LEU A HD23 4  
ATOM 8307  N N    . PRO A 1 36  ? 2.244   8.594   -8.433  1.00 0.00 ? 428 PRO A N    4  
ATOM 8308  C CA   . PRO A 1 36  ? 3.601   8.051   -8.561  1.00 0.00 ? 428 PRO A CA   4  
ATOM 8309  C C    . PRO A 1 36  ? 4.415   8.217   -7.272  1.00 0.00 ? 428 PRO A C    4  
ATOM 8310  O O    . PRO A 1 36  ? 4.328   9.252   -6.575  1.00 0.00 ? 428 PRO A O    4  
ATOM 8311  C CB   . PRO A 1 36  ? 4.222   8.881   -9.698  1.00 0.00 ? 428 PRO A CB   4  
ATOM 8312  C CG   . PRO A 1 36  ? 3.085   9.657   -10.274 1.00 0.00 ? 428 PRO A CG   4  
ATOM 8313  C CD   . PRO A 1 36  ? 2.120   9.856   -9.163  1.00 0.00 ? 428 PRO A CD   4  
ATOM 8314  H HA   . PRO A 1 36  ? 3.589   7.007   -8.835  1.00 0.00 ? 428 PRO A HA   4  
ATOM 8315  H HB2  . PRO A 1 36  ? 4.978   9.534   -9.286  1.00 0.00 ? 428 PRO A HB2  4  
ATOM 8316  H HB3  . PRO A 1 36  ? 4.666   8.224   -10.430 1.00 0.00 ? 428 PRO A HB3  4  
ATOM 8317  H HG2  . PRO A 1 36  ? 3.420   10.610  -10.654 1.00 0.00 ? 428 PRO A HG2  4  
ATOM 8318  H HG3  . PRO A 1 36  ? 2.620   9.087   -11.064 1.00 0.00 ? 428 PRO A HG3  4  
ATOM 8319  H HD2  . PRO A 1 36  ? 2.409   10.705  -8.560  1.00 0.00 ? 428 PRO A HD2  4  
ATOM 8320  H HD3  . PRO A 1 36  ? 1.135   9.985   -9.583  1.00 0.00 ? 428 PRO A HD3  4  
ATOM 8321  N N    . CYS A 1 37  ? 5.210   7.228   -6.971  1.00 0.00 ? 429 CYS A N    4  
ATOM 8322  C CA   . CYS A 1 37  ? 5.980   7.205   -5.761  1.00 0.00 ? 429 CYS A CA   4  
ATOM 8323  C C    . CYS A 1 37  ? 7.371   6.626   -6.003  1.00 0.00 ? 429 CYS A C    4  
ATOM 8324  O O    . CYS A 1 37  ? 7.657   6.071   -7.078  1.00 0.00 ? 429 CYS A O    4  
ATOM 8325  C CB   . CYS A 1 37  ? 5.238   6.394   -4.694  1.00 0.00 ? 429 CYS A CB   4  
ATOM 8326  S SG   . CYS A 1 37  ? 4.833   4.709   -5.207  1.00 0.00 ? 429 CYS A SG   4  
ATOM 8327  H H    . CYS A 1 37  ? 5.293   6.459   -7.579  1.00 0.00 ? 429 CYS A H    4  
ATOM 8328  H HA   . CYS A 1 37  ? 6.079   8.219   -5.412  1.00 0.00 ? 429 CYS A HA   4  
ATOM 8329  H HB2  . CYS A 1 37  ? 5.840   6.334   -3.801  1.00 0.00 ? 429 CYS A HB2  4  
ATOM 8330  H HB3  . CYS A 1 37  ? 4.311   6.899   -4.456  1.00 0.00 ? 429 CYS A HB3  4  
ATOM 8331  H HG   . CYS A 1 37  ? 4.710   4.699   -6.530  1.00 0.00 ? 429 CYS A HG   4  
ATOM 8332  N N    . GLN A 1 38  ? 8.213   6.780   -5.022  1.00 0.00 ? 430 GLN A N    4  
ATOM 8333  C CA   . GLN A 1 38  ? 9.548   6.253   -5.003  1.00 0.00 ? 430 GLN A CA   4  
ATOM 8334  C C    . GLN A 1 38  ? 9.557   5.255   -3.869  1.00 0.00 ? 430 GLN A C    4  
ATOM 8335  O O    . GLN A 1 38  ? 9.096   5.581   -2.755  1.00 0.00 ? 430 GLN A O    4  
ATOM 8336  C CB   . GLN A 1 38  ? 10.547  7.365   -4.649  1.00 0.00 ? 430 GLN A CB   4  
ATOM 8337  C CG   . GLN A 1 38  ? 10.550  8.573   -5.573  1.00 0.00 ? 430 GLN A CG   4  
ATOM 8338  C CD   . GLN A 1 38  ? 11.424  9.693   -5.030  1.00 0.00 ? 430 GLN A CD   4  
ATOM 8339  O OE1  . GLN A 1 38  ? 10.952  10.565  -4.293  1.00 0.00 ? 430 GLN A OE1  4  
ATOM 8340  N NE2  . GLN A 1 38  ? 12.686  9.681   -5.372  1.00 0.00 ? 430 GLN A NE2  4  
ATOM 8341  H H    . GLN A 1 38  ? 7.933   7.282   -4.224  1.00 0.00 ? 430 GLN A H    4  
ATOM 8342  H HA   . GLN A 1 38  ? 9.799   5.797   -5.948  1.00 0.00 ? 430 GLN A HA   4  
ATOM 8343  H HB2  . GLN A 1 38  ? 10.324  7.720   -3.653  1.00 0.00 ? 430 GLN A HB2  4  
ATOM 8344  H HB3  . GLN A 1 38  ? 11.540  6.939   -4.643  1.00 0.00 ? 430 GLN A HB3  4  
ATOM 8345  H HG2  . GLN A 1 38  ? 10.929  8.273   -6.539  1.00 0.00 ? 430 GLN A HG2  4  
ATOM 8346  H HG3  . GLN A 1 38  ? 9.540   8.940   -5.678  1.00 0.00 ? 430 GLN A HG3  4  
ATOM 8347  H HE21 . GLN A 1 38  ? 13.006  8.962   -5.957  1.00 0.00 ? 430 GLN A HE21 4  
ATOM 8348  H HE22 . GLN A 1 38  ? 13.269  10.386  -5.017  1.00 0.00 ? 430 GLN A HE22 4  
ATOM 8349  N N    . VAL A 1 39  ? 10.028  4.056   -4.134  1.00 0.00 ? 431 VAL A N    4  
ATOM 8350  C CA   . VAL A 1 39  ? 10.020  3.011   -3.146  1.00 0.00 ? 431 VAL A CA   4  
ATOM 8351  C C    . VAL A 1 39  ? 11.426  2.492   -2.919  1.00 0.00 ? 431 VAL A C    4  
ATOM 8352  O O    . VAL A 1 39  ? 12.135  2.062   -3.863  1.00 0.00 ? 431 VAL A O    4  
ATOM 8353  C CB   . VAL A 1 39  ? 9.115   1.822   -3.572  1.00 0.00 ? 431 VAL A CB   4  
ATOM 8354  C CG1  . VAL A 1 39  ? 8.963   0.797   -2.452  1.00 0.00 ? 431 VAL A CG1  4  
ATOM 8355  C CG2  . VAL A 1 39  ? 7.766   2.311   -4.058  1.00 0.00 ? 431 VAL A CG2  4  
ATOM 8356  H H    . VAL A 1 39  ? 10.392  3.822   -5.016  1.00 0.00 ? 431 VAL A H    4  
ATOM 8357  H HA   . VAL A 1 39  ? 9.637   3.416   -2.219  1.00 0.00 ? 431 VAL A HA   4  
ATOM 8358  H HB   . VAL A 1 39  ? 9.607   1.324   -4.393  1.00 0.00 ? 431 VAL A HB   4  
ATOM 8359  H HG11 . VAL A 1 39  ? 9.937   0.412   -2.183  1.00 0.00 ? 431 VAL A HG11 4  
ATOM 8360  H HG12 . VAL A 1 39  ? 8.514   1.268   -1.591  1.00 0.00 ? 431 VAL A HG12 4  
ATOM 8361  H HG13 . VAL A 1 39  ? 8.334   -0.014  -2.786  1.00 0.00 ? 431 VAL A HG13 4  
ATOM 8362  H HG21 . VAL A 1 39  ? 7.302   2.895   -3.277  1.00 0.00 ? 431 VAL A HG21 4  
ATOM 8363  H HG22 . VAL A 1 39  ? 7.896   2.929   -4.932  1.00 0.00 ? 431 VAL A HG22 4  
ATOM 8364  H HG23 . VAL A 1 39  ? 7.131   1.471   -4.293  1.00 0.00 ? 431 VAL A HG23 4  
ATOM 8365  N N    . TYR A 1 40  ? 11.826  2.545   -1.702  1.00 0.00 ? 432 TYR A N    4  
ATOM 8366  C CA   . TYR A 1 40  ? 13.081  2.028   -1.268  1.00 0.00 ? 432 TYR A CA   4  
ATOM 8367  C C    . TYR A 1 40  ? 12.772  0.950   -0.268  1.00 0.00 ? 432 TYR A C    4  
ATOM 8368  O O    . TYR A 1 40  ? 11.658  0.895   0.246   1.00 0.00 ? 432 TYR A O    4  
ATOM 8369  C CB   . TYR A 1 40  ? 13.951  3.124   -0.619  1.00 0.00 ? 432 TYR A CB   4  
ATOM 8370  C CG   . TYR A 1 40  ? 14.267  4.292   -1.522  1.00 0.00 ? 432 TYR A CG   4  
ATOM 8371  C CD1  . TYR A 1 40  ? 15.461  4.347   -2.222  1.00 0.00 ? 432 TYR A CD1  4  
ATOM 8372  C CD2  . TYR A 1 40  ? 13.367  5.338   -1.677  1.00 0.00 ? 432 TYR A CD2  4  
ATOM 8373  C CE1  . TYR A 1 40  ? 15.751  5.409   -3.050  1.00 0.00 ? 432 TYR A CE1  4  
ATOM 8374  C CE2  . TYR A 1 40  ? 13.649  6.400   -2.501  1.00 0.00 ? 432 TYR A CE2  4  
ATOM 8375  C CZ   . TYR A 1 40  ? 14.840  6.432   -3.186  1.00 0.00 ? 432 TYR A CZ   4  
ATOM 8376  O OH   . TYR A 1 40  ? 15.122  7.491   -4.009  1.00 0.00 ? 432 TYR A OH   4  
ATOM 8377  H H    . TYR A 1 40  ? 11.222  2.941   -1.032  1.00 0.00 ? 432 TYR A H    4  
ATOM 8378  H HA   . TYR A 1 40  ? 13.594  1.602   -2.118  1.00 0.00 ? 432 TYR A HA   4  
ATOM 8379  H HB2  . TYR A 1 40  ? 13.458  3.521   0.254   1.00 0.00 ? 432 TYR A HB2  4  
ATOM 8380  H HB3  . TYR A 1 40  ? 14.888  2.680   -0.318  1.00 0.00 ? 432 TYR A HB3  4  
ATOM 8381  H HD1  . TYR A 1 40  ? 16.173  3.541   -2.111  1.00 0.00 ? 432 TYR A HD1  4  
ATOM 8382  H HD2  . TYR A 1 40  ? 12.432  5.312   -1.138  1.00 0.00 ? 432 TYR A HD2  4  
ATOM 8383  H HE1  . TYR A 1 40  ? 16.686  5.435   -3.589  1.00 0.00 ? 432 TYR A HE1  4  
ATOM 8384  H HE2  . TYR A 1 40  ? 12.935  7.204   -2.610  1.00 0.00 ? 432 TYR A HE2  4  
ATOM 8385  H HH   . TYR A 1 40  ? 14.903  8.288   -3.508  1.00 0.00 ? 432 TYR A HH   4  
ATOM 8386  N N    . VAL A 1 41  ? 13.695  0.096   -0.017  1.00 0.00 ? 433 VAL A N    4  
ATOM 8387  C CA   . VAL A 1 41  ? 13.488  -0.953  0.941   1.00 0.00 ? 433 VAL A CA   4  
ATOM 8388  C C    . VAL A 1 41  ? 14.518  -0.881  2.030   1.00 0.00 ? 433 VAL A C    4  
ATOM 8389  O O    . VAL A 1 41  ? 15.654  -0.519  1.788   1.00 0.00 ? 433 VAL A O    4  
ATOM 8390  C CB   . VAL A 1 41  ? 13.520  -2.371  0.288   1.00 0.00 ? 433 VAL A CB   4  
ATOM 8391  C CG1  . VAL A 1 41  ? 12.256  -2.641  -0.501  1.00 0.00 ? 433 VAL A CG1  4  
ATOM 8392  C CG2  . VAL A 1 41  ? 14.738  -2.532  -0.614  1.00 0.00 ? 433 VAL A CG2  4  
ATOM 8393  H H    . VAL A 1 41  ? 14.560  0.159   -0.482  1.00 0.00 ? 433 VAL A H    4  
ATOM 8394  H HA   . VAL A 1 41  ? 12.514  -0.806  1.376   1.00 0.00 ? 433 VAL A HA   4  
ATOM 8395  H HB   . VAL A 1 41  ? 13.584  -3.103  1.077   1.00 0.00 ? 433 VAL A HB   4  
ATOM 8396  H HG11 . VAL A 1 41  ? 12.092  -1.843  -1.209  1.00 0.00 ? 433 VAL A HG11 4  
ATOM 8397  H HG12 . VAL A 1 41  ? 12.342  -3.581  -1.024  1.00 0.00 ? 433 VAL A HG12 4  
ATOM 8398  H HG13 . VAL A 1 41  ? 11.426  -2.682  0.185   1.00 0.00 ? 433 VAL A HG13 4  
ATOM 8399  H HG21 . VAL A 1 41  ? 14.739  -1.757  -1.366  1.00 0.00 ? 433 VAL A HG21 4  
ATOM 8400  H HG22 . VAL A 1 41  ? 15.632  -2.452  -0.016  1.00 0.00 ? 433 VAL A HG22 4  
ATOM 8401  H HG23 . VAL A 1 41  ? 14.707  -3.497  -1.097  1.00 0.00 ? 433 VAL A HG23 4  
ATOM 8402  N N    . ASN A 1 42  ? 14.088  -1.121  3.227   1.00 0.00 ? 434 ASN A N    4  
ATOM 8403  C CA   . ASN A 1 42  ? 14.965  -1.240  4.342   1.00 0.00 ? 434 ASN A CA   4  
ATOM 8404  C C    . ASN A 1 42  ? 15.270  -2.710  4.586   1.00 0.00 ? 434 ASN A C    4  
ATOM 8405  O O    . ASN A 1 42  ? 14.303  -3.572  4.639   1.00 0.00 ? 434 ASN A O    4  
ATOM 8406  C CB   . ASN A 1 42  ? 14.455  -0.499  5.593   1.00 0.00 ? 434 ASN A CB   4  
ATOM 8407  C CG   . ASN A 1 42  ? 15.361  -0.693  6.806   1.00 0.00 ? 434 ASN A CG   4  
ATOM 8408  O OD1  . ASN A 1 42  ? 15.140  -1.583  7.621   1.00 0.00 ? 434 ASN A OD1  4  
ATOM 8409  N ND2  . ASN A 1 42  ? 16.392  0.103   6.919   1.00 0.00 ? 434 ASN A ND2  4  
ATOM 8410  H H    . ASN A 1 42  ? 13.128  -1.292  3.347   1.00 0.00 ? 434 ASN A H    4  
ATOM 8411  H HA   . ASN A 1 42  ? 15.891  -0.790  4.016   1.00 0.00 ? 434 ASN A HA   4  
ATOM 8412  H HB2  . ASN A 1 42  ? 14.411  0.558   5.375   1.00 0.00 ? 434 ASN A HB2  4  
ATOM 8413  H HB3  . ASN A 1 42  ? 13.463  -0.844  5.844   1.00 0.00 ? 434 ASN A HB3  4  
ATOM 8414  H HD21 . ASN A 1 42  ? 16.548  0.791   6.234   1.00 0.00 ? 434 ASN A HD21 4  
ATOM 8415  H HD22 . ASN A 1 42  ? 16.998  -0.026  7.681   1.00 0.00 ? 434 ASN A HD22 4  
ATOM 8416  N N    . HIS A 1 43  ? 16.593  -2.944  4.768   1.00 0.00 ? 435 HIS A N    4  
ATOM 8417  C CA   . HIS A 1 43  ? 17.335  -4.240  4.865   1.00 0.00 ? 435 HIS A CA   4  
ATOM 8418  C C    . HIS A 1 43  ? 16.545  -5.475  5.337   1.00 0.00 ? 435 HIS A C    4  
ATOM 8419  O O    . HIS A 1 43  ? 15.570  -5.389  6.083   1.00 0.00 ? 435 HIS A O    4  
ATOM 8420  C CB   . HIS A 1 43  ? 18.575  -4.077  5.750   1.00 0.00 ? 435 HIS A CB   4  
ATOM 8421  C CG   . HIS A 1 43  ? 19.614  -3.164  5.188   1.00 0.00 ? 435 HIS A CG   4  
ATOM 8422  N ND1  . HIS A 1 43  ? 19.715  -1.831  5.500   1.00 0.00 ? 435 HIS A ND1  4  
ATOM 8423  C CD2  . HIS A 1 43  ? 20.612  -3.416  4.311   1.00 0.00 ? 435 HIS A CD2  4  
ATOM 8424  C CE1  . HIS A 1 43  ? 20.740  -1.330  4.814   1.00 0.00 ? 435 HIS A CE1  4  
ATOM 8425  N NE2  . HIS A 1 43  ? 21.322  -2.250  4.076   1.00 0.00 ? 435 HIS A NE2  4  
ATOM 8426  H H    . HIS A 1 43  ? 17.152  -2.143  4.841   1.00 0.00 ? 435 HIS A H    4  
ATOM 8427  H HA   . HIS A 1 43  ? 17.704  -4.381  3.855   1.00 0.00 ? 435 HIS A HA   4  
ATOM 8428  H HB2  . HIS A 1 43  ? 18.263  -3.673  6.701   1.00 0.00 ? 435 HIS A HB2  4  
ATOM 8429  H HB3  . HIS A 1 43  ? 19.023  -5.048  5.908   1.00 0.00 ? 435 HIS A HB3  4  
ATOM 8430  H HD1  . HIS A 1 43  ? 19.161  -1.327  6.136   1.00 0.00 ? 435 HIS A HD1  4  
ATOM 8431  H HD2  . HIS A 1 43  ? 20.835  -4.369  3.859   1.00 0.00 ? 435 HIS A HD2  4  
ATOM 8432  H HE1  . HIS A 1 43  ? 21.051  -0.297  4.840   1.00 0.00 ? 435 HIS A HE1  4  
ATOM 8433  N N    . GLY A 1 44  ? 17.058  -6.636  4.969   1.00 0.00 ? 436 GLY A N    4  
ATOM 8434  C CA   . GLY A 1 44  ? 16.344  -7.877  5.208   1.00 0.00 ? 436 GLY A CA   4  
ATOM 8435  C C    . GLY A 1 44  ? 15.817  -8.378  3.894   1.00 0.00 ? 436 GLY A C    4  
ATOM 8436  O O    . GLY A 1 44  ? 15.169  -9.430  3.783   1.00 0.00 ? 436 GLY A O    4  
ATOM 8437  H H    . GLY A 1 44  ? 17.943  -6.656  4.544   1.00 0.00 ? 436 GLY A H    4  
ATOM 8438  H HA2  . GLY A 1 44  ? 17.013  -8.607  5.640   1.00 0.00 ? 436 GLY A HA2  4  
ATOM 8439  H HA3  . GLY A 1 44  ? 15.514  -7.700  5.874   1.00 0.00 ? 436 GLY A HA3  4  
ATOM 8440  N N    . GLU A 1 45  ? 16.075  -7.579  2.903   1.00 0.00 ? 437 GLU A N    4  
ATOM 8441  C CA   . GLU A 1 45  ? 15.599  -7.771  1.594   1.00 0.00 ? 437 GLU A CA   4  
ATOM 8442  C C    . GLU A 1 45  ? 16.626  -8.348  0.623   1.00 0.00 ? 437 GLU A C    4  
ATOM 8443  O O    . GLU A 1 45  ? 17.835  -8.379  0.892   1.00 0.00 ? 437 GLU A O    4  
ATOM 8444  C CB   . GLU A 1 45  ? 14.995  -6.453  1.062   1.00 0.00 ? 437 GLU A CB   4  
ATOM 8445  C CG   . GLU A 1 45  ? 15.825  -5.191  1.339   1.00 0.00 ? 437 GLU A CG   4  
ATOM 8446  C CD   . GLU A 1 45  ? 17.219  -5.243  0.779   1.00 0.00 ? 437 GLU A CD   4  
ATOM 8447  O OE1  . GLU A 1 45  ? 17.386  -5.108  -0.452  1.00 0.00 ? 437 GLU A OE1  4  
ATOM 8448  O OE2  . GLU A 1 45  ? 18.160  -5.452  1.565   1.00 0.00 ? 437 GLU A OE2  4  
ATOM 8449  H H    . GLU A 1 45  ? 16.648  -6.803  3.074   1.00 0.00 ? 437 GLU A H    4  
ATOM 8450  H HA   . GLU A 1 45  ? 14.781  -8.473  1.661   1.00 0.00 ? 437 GLU A HA   4  
ATOM 8451  H HB2  . GLU A 1 45  ? 14.875  -6.540  -0.006  1.00 0.00 ? 437 GLU A HB2  4  
ATOM 8452  H HB3  . GLU A 1 45  ? 14.023  -6.317  1.510   1.00 0.00 ? 437 GLU A HB3  4  
ATOM 8453  H HG2  . GLU A 1 45  ? 15.318  -4.345  0.901   1.00 0.00 ? 437 GLU A HG2  4  
ATOM 8454  H HG3  . GLU A 1 45  ? 15.887  -5.049  2.408   1.00 0.00 ? 437 GLU A HG3  4  
ATOM 8455  N N    . ASN A 1 46  ? 16.082  -8.868  -0.443  1.00 0.00 ? 438 ASN A N    4  
ATOM 8456  C CA   . ASN A 1 46  ? 16.759  -9.291  -1.650  1.00 0.00 ? 438 ASN A CA   4  
ATOM 8457  C C    . ASN A 1 46  ? 15.657  -9.835  -2.525  1.00 0.00 ? 438 ASN A C    4  
ATOM 8458  O O    . ASN A 1 46  ? 15.173  -10.944 -2.304  1.00 0.00 ? 438 ASN A O    4  
ATOM 8459  C CB   . ASN A 1 46  ? 17.798  -10.399 -1.367  1.00 0.00 ? 438 ASN A CB   4  
ATOM 8460  C CG   . ASN A 1 46  ? 18.595  -10.843 -2.595  1.00 0.00 ? 438 ASN A CG   4  
ATOM 8461  O OD1  . ASN A 1 46  ? 18.981  -12.014 -2.697  1.00 0.00 ? 438 ASN A OD1  4  
ATOM 8462  N ND2  . ASN A 1 46  ? 18.907  -9.934  -3.493  1.00 0.00 ? 438 ASN A ND2  4  
ATOM 8463  H H    . ASN A 1 46  ? 15.111  -8.993  -0.441  1.00 0.00 ? 438 ASN A H    4  
ATOM 8464  H HA   . ASN A 1 46  ? 17.219  -8.434  -2.120  1.00 0.00 ? 438 ASN A HA   4  
ATOM 8465  H HB2  . ASN A 1 46  ? 18.500  -10.041 -0.628  1.00 0.00 ? 438 ASN A HB2  4  
ATOM 8466  H HB3  . ASN A 1 46  ? 17.282  -11.258 -0.964  1.00 0.00 ? 438 ASN A HB3  4  
ATOM 8467  H HD21 . ASN A 1 46  ? 18.634  -8.999  -3.367  1.00 0.00 ? 438 ASN A HD21 4  
ATOM 8468  H HD22 . ASN A 1 46  ? 19.411  -10.211 -4.287  1.00 0.00 ? 438 ASN A HD22 4  
ATOM 8469  N N    . LEU A 1 47  ? 15.143  -8.989  -3.372  1.00 0.00 ? 439 LEU A N    4  
ATOM 8470  C CA   . LEU A 1 47  ? 14.108  -9.356  -4.314  1.00 0.00 ? 439 LEU A CA   4  
ATOM 8471  C C    . LEU A 1 47  ? 14.330  -8.645  -5.623  1.00 0.00 ? 439 LEU A C    4  
ATOM 8472  O O    . LEU A 1 47  ? 14.994  -7.608  -5.646  1.00 0.00 ? 439 LEU A O    4  
ATOM 8473  C CB   . LEU A 1 47  ? 12.665  -9.103  -3.775  1.00 0.00 ? 439 LEU A CB   4  
ATOM 8474  C CG   . LEU A 1 47  ? 12.198  -7.650  -3.513  1.00 0.00 ? 439 LEU A CG   4  
ATOM 8475  C CD1  . LEU A 1 47  ? 10.727  -7.653  -3.161  1.00 0.00 ? 439 LEU A CD1  4  
ATOM 8476  C CD2  . LEU A 1 47  ? 12.970  -6.992  -2.383  1.00 0.00 ? 439 LEU A CD2  4  
ATOM 8477  H H    . LEU A 1 47  ? 15.481  -8.067  -3.408  1.00 0.00 ? 439 LEU A H    4  
ATOM 8478  H HA   . LEU A 1 47  ? 14.231  -10.414 -4.498  1.00 0.00 ? 439 LEU A HA   4  
ATOM 8479  H HB2  . LEU A 1 47  ? 11.971  -9.533  -4.483  1.00 0.00 ? 439 LEU A HB2  4  
ATOM 8480  H HB3  . LEU A 1 47  ? 12.568  -9.654  -2.851  1.00 0.00 ? 439 LEU A HB3  4  
ATOM 8481  H HG   . LEU A 1 47  ? 12.328  -7.068  -4.415  1.00 0.00 ? 439 LEU A HG   4  
ATOM 8482  H HD11 . LEU A 1 47  ? 10.570  -8.282  -2.298  1.00 0.00 ? 439 LEU A HD11 4  
ATOM 8483  H HD12 . LEU A 1 47  ? 10.419  -6.644  -2.930  1.00 0.00 ? 439 LEU A HD12 4  
ATOM 8484  H HD13 . LEU A 1 47  ? 10.155  -8.036  -3.993  1.00 0.00 ? 439 LEU A HD13 4  
ATOM 8485  H HD21 . LEU A 1 47  ? 14.021  -7.002  -2.626  1.00 0.00 ? 439 LEU A HD21 4  
ATOM 8486  H HD22 . LEU A 1 47  ? 12.635  -5.972  -2.253  1.00 0.00 ? 439 LEU A HD22 4  
ATOM 8487  H HD23 . LEU A 1 47  ? 12.809  -7.545  -1.471  1.00 0.00 ? 439 LEU A HD23 4  
ATOM 8488  N N    . LYS A 1 48  ? 13.796  -9.171  -6.685  1.00 0.00 ? 440 LYS A N    4  
ATOM 8489  C CA   . LYS A 1 48  ? 13.828  -8.488  -7.952  1.00 0.00 ? 440 LYS A CA   4  
ATOM 8490  C C    . LYS A 1 48  ? 12.480  -7.811  -8.172  1.00 0.00 ? 440 LYS A C    4  
ATOM 8491  O O    . LYS A 1 48  ? 11.423  -8.430  -7.958  1.00 0.00 ? 440 LYS A O    4  
ATOM 8492  C CB   . LYS A 1 48  ? 14.152  -9.446  -9.097  1.00 0.00 ? 440 LYS A CB   4  
ATOM 8493  C CG   . LYS A 1 48  ? 15.512  -10.104 -8.981  1.00 0.00 ? 440 LYS A CG   4  
ATOM 8494  C CD   . LYS A 1 48  ? 15.809  -10.976 -10.180 1.00 0.00 ? 440 LYS A CD   4  
ATOM 8495  C CE   . LYS A 1 48  ? 17.173  -11.622 -10.057 1.00 0.00 ? 440 LYS A CE   4  
ATOM 8496  N NZ   . LYS A 1 48  ? 17.500  -12.438 -11.243 1.00 0.00 ? 440 LYS A NZ   4  
ATOM 8497  H H    . LYS A 1 48  ? 13.355  -10.045 -6.621  1.00 0.00 ? 440 LYS A H    4  
ATOM 8498  H HA   . LYS A 1 48  ? 14.591  -7.726  -7.888  1.00 0.00 ? 440 LYS A HA   4  
ATOM 8499  H HB2  . LYS A 1 48  ? 13.404  -10.227 -9.117  1.00 0.00 ? 440 LYS A HB2  4  
ATOM 8500  H HB3  . LYS A 1 48  ? 14.116  -8.902  -10.030 1.00 0.00 ? 440 LYS A HB3  4  
ATOM 8501  H HG2  . LYS A 1 48  ? 16.269  -9.338  -8.909  1.00 0.00 ? 440 LYS A HG2  4  
ATOM 8502  H HG3  . LYS A 1 48  ? 15.529  -10.714 -8.089  1.00 0.00 ? 440 LYS A HG3  4  
ATOM 8503  H HD2  . LYS A 1 48  ? 15.060  -11.750 -10.249 1.00 0.00 ? 440 LYS A HD2  4  
ATOM 8504  H HD3  . LYS A 1 48  ? 15.786  -10.367 -11.072 1.00 0.00 ? 440 LYS A HD3  4  
ATOM 8505  H HE2  . LYS A 1 48  ? 17.918  -10.848 -9.943  1.00 0.00 ? 440 LYS A HE2  4  
ATOM 8506  H HE3  . LYS A 1 48  ? 17.176  -12.251 -9.180  1.00 0.00 ? 440 LYS A HE3  4  
ATOM 8507  H HZ1  . LYS A 1 48  ? 16.792  -13.186 -11.379 1.00 0.00 ? 440 LYS A HZ1  4  
ATOM 8508  H HZ2  . LYS A 1 48  ? 17.527  -11.854 -12.104 1.00 0.00 ? 440 LYS A HZ2  4  
ATOM 8509  H HZ3  . LYS A 1 48  ? 18.423  -12.899 -11.124 1.00 0.00 ? 440 LYS A HZ3  4  
ATOM 8510  N N    . THR A 1 49  ? 12.511  -6.561  -8.551  1.00 0.00 ? 441 THR A N    4  
ATOM 8511  C CA   . THR A 1 49  ? 11.307  -5.769  -8.750  1.00 0.00 ? 441 THR A CA   4  
ATOM 8512  C C    . THR A 1 49  ? 10.948  -5.631  -10.242 1.00 0.00 ? 441 THR A C    4  
ATOM 8513  O O    . THR A 1 49  ? 10.160  -4.772  -10.631 1.00 0.00 ? 441 THR A O    4  
ATOM 8514  C CB   . THR A 1 49  ? 11.519  -4.379  -8.136  1.00 0.00 ? 441 THR A CB   4  
ATOM 8515  O OG1  . THR A 1 49  ? 12.796  -3.874  -8.562  1.00 0.00 ? 441 THR A OG1  4  
ATOM 8516  C CG2  . THR A 1 49  ? 11.474  -4.438  -6.611  1.00 0.00 ? 441 THR A CG2  4  
ATOM 8517  H H    . THR A 1 49  ? 13.367  -6.097  -8.679  1.00 0.00 ? 441 THR A H    4  
ATOM 8518  H HA   . THR A 1 49  ? 10.493  -6.247  -8.227  1.00 0.00 ? 441 THR A HA   4  
ATOM 8519  H HB   . THR A 1 49  ? 10.740  -3.723  -8.495  1.00 0.00 ? 441 THR A HB   4  
ATOM 8520  H HG1  . THR A 1 49  ? 13.440  -4.064  -7.868  1.00 0.00 ? 441 THR A HG1  4  
ATOM 8521  H HG21 . THR A 1 49  ? 12.219  -5.134  -6.255  1.00 0.00 ? 441 THR A HG21 4  
ATOM 8522  H HG22 . THR A 1 49  ? 11.677  -3.458  -6.206  1.00 0.00 ? 441 THR A HG22 4  
ATOM 8523  H HG23 . THR A 1 49  ? 10.493  -4.759  -6.292  1.00 0.00 ? 441 THR A HG23 4  
ATOM 8524  N N    . GLU A 1 50  ? 11.485  -6.510  -11.056 1.00 0.00 ? 442 GLU A N    4  
ATOM 8525  C CA   . GLU A 1 50  ? 11.274  -6.462  -12.500 1.00 0.00 ? 442 GLU A CA   4  
ATOM 8526  C C    . GLU A 1 50  ? 9.884   -6.964  -12.882 1.00 0.00 ? 442 GLU A C    4  
ATOM 8527  O O    . GLU A 1 50  ? 9.320   -6.581  -13.911 1.00 0.00 ? 442 GLU A O    4  
ATOM 8528  C CB   . GLU A 1 50  ? 12.338  -7.283  -13.193 1.00 0.00 ? 442 GLU A CB   4  
ATOM 8529  C CG   . GLU A 1 50  ? 13.741  -6.779  -12.942 1.00 0.00 ? 442 GLU A CG   4  
ATOM 8530  C CD   . GLU A 1 50  ? 14.772  -7.687  -13.521 1.00 0.00 ? 442 GLU A CD   4  
ATOM 8531  O OE1  . GLU A 1 50  ? 15.064  -7.593  -14.720 1.00 0.00 ? 442 GLU A OE1  4  
ATOM 8532  O OE2  . GLU A 1 50  ? 15.303  -8.536  -12.786 1.00 0.00 ? 442 GLU A OE2  4  
ATOM 8533  H H    . GLU A 1 50  ? 12.030  -7.232  -10.677 1.00 0.00 ? 442 GLU A H    4  
ATOM 8534  H HA   . GLU A 1 50  ? 11.372  -5.434  -12.814 1.00 0.00 ? 442 GLU A HA   4  
ATOM 8535  H HB2  . GLU A 1 50  ? 12.275  -8.303  -12.843 1.00 0.00 ? 442 GLU A HB2  4  
ATOM 8536  H HB3  . GLU A 1 50  ? 12.159  -7.268  -14.258 1.00 0.00 ? 442 GLU A HB3  4  
ATOM 8537  H HG2  . GLU A 1 50  ? 13.852  -5.802  -13.386 1.00 0.00 ? 442 GLU A HG2  4  
ATOM 8538  H HG3  . GLU A 1 50  ? 13.898  -6.709  -11.876 1.00 0.00 ? 442 GLU A HG3  4  
ATOM 8539  N N    . GLN A 1 51  ? 9.349   -7.832  -12.058 1.00 0.00 ? 443 GLN A N    4  
ATOM 8540  C CA   . GLN A 1 51  ? 8.036   -8.413  -12.272 1.00 0.00 ? 443 GLN A CA   4  
ATOM 8541  C C    . GLN A 1 51  ? 6.972   -7.602  -11.502 1.00 0.00 ? 443 GLN A C    4  
ATOM 8542  O O    . GLN A 1 51  ? 5.800   -7.969  -11.415 1.00 0.00 ? 443 GLN A O    4  
ATOM 8543  C CB   . GLN A 1 51  ? 8.062   -9.909  -11.860 1.00 0.00 ? 443 GLN A CB   4  
ATOM 8544  C CG   . GLN A 1 51  ? 6.768   -10.677 -12.106 1.00 0.00 ? 443 GLN A CG   4  
ATOM 8545  C CD   . GLN A 1 51  ? 6.280   -10.561 -13.536 1.00 0.00 ? 443 GLN A CD   4  
ATOM 8546  O OE1  . GLN A 1 51  ? 5.537   -9.654  -13.871 1.00 0.00 ? 443 GLN A OE1  4  
ATOM 8547  N NE2  . GLN A 1 51  ? 6.668   -11.473 -14.370 1.00 0.00 ? 443 GLN A NE2  4  
ATOM 8548  H H    . GLN A 1 51  ? 9.874   -8.112  -11.278 1.00 0.00 ? 443 GLN A H    4  
ATOM 8549  H HA   . GLN A 1 51  ? 7.816   -8.338  -13.326 1.00 0.00 ? 443 GLN A HA   4  
ATOM 8550  H HB2  . GLN A 1 51  ? 8.848   -10.406 -12.410 1.00 0.00 ? 443 GLN A HB2  4  
ATOM 8551  H HB3  . GLN A 1 51  ? 8.293   -9.967  -10.806 1.00 0.00 ? 443 GLN A HB3  4  
ATOM 8552  H HG2  . GLN A 1 51  ? 6.937   -11.720 -11.884 1.00 0.00 ? 443 GLN A HG2  4  
ATOM 8553  H HG3  . GLN A 1 51  ? 6.005   -10.289 -11.446 1.00 0.00 ? 443 GLN A HG3  4  
ATOM 8554  H HE21 . GLN A 1 51  ? 7.255   -12.201 -14.073 1.00 0.00 ? 443 GLN A HE21 4  
ATOM 8555  H HE22 . GLN A 1 51  ? 6.338   -11.412 -15.292 1.00 0.00 ? 443 GLN A HE22 4  
ATOM 8556  N N    . TRP A 1 52  ? 7.395   -6.487  -10.967 1.00 0.00 ? 444 TRP A N    4  
ATOM 8557  C CA   . TRP A 1 52  ? 6.499   -5.603  -10.276 1.00 0.00 ? 444 TRP A CA   4  
ATOM 8558  C C    . TRP A 1 52  ? 5.740   -4.769  -11.281 1.00 0.00 ? 444 TRP A C    4  
ATOM 8559  O O    . TRP A 1 52  ? 6.356   -4.090  -12.124 1.00 0.00 ? 444 TRP A O    4  
ATOM 8560  C CB   . TRP A 1 52  ? 7.250   -4.701  -9.299  1.00 0.00 ? 444 TRP A CB   4  
ATOM 8561  C CG   . TRP A 1 52  ? 7.657   -5.376  -8.024  1.00 0.00 ? 444 TRP A CG   4  
ATOM 8562  C CD1  . TRP A 1 52  ? 8.049   -6.673  -7.855  1.00 0.00 ? 444 TRP A CD1  4  
ATOM 8563  C CD2  . TRP A 1 52  ? 7.721   -4.767  -6.738  1.00 0.00 ? 444 TRP A CD2  4  
ATOM 8564  N NE1  . TRP A 1 52  ? 8.335   -6.904  -6.536  1.00 0.00 ? 444 TRP A NE1  4  
ATOM 8565  C CE2  . TRP A 1 52  ? 8.139   -5.745  -5.830  1.00 0.00 ? 444 TRP A CE2  4  
ATOM 8566  C CE3  . TRP A 1 52  ? 7.455   -3.481  -6.266  1.00 0.00 ? 444 TRP A CE3  4  
ATOM 8567  C CZ2  . TRP A 1 52  ? 8.300   -5.479  -4.478  1.00 0.00 ? 444 TRP A CZ2  4  
ATOM 8568  C CZ3  . TRP A 1 52  ? 7.616   -3.216  -4.924  1.00 0.00 ? 444 TRP A CZ3  4  
ATOM 8569  C CH2  . TRP A 1 52  ? 8.034   -4.211  -4.041  1.00 0.00 ? 444 TRP A CH2  4  
ATOM 8570  H H    . TRP A 1 52  ? 8.331   -6.221  -11.071 1.00 0.00 ? 444 TRP A H    4  
ATOM 8571  H HA   . TRP A 1 52  ? 5.803   -6.216  -9.722  1.00 0.00 ? 444 TRP A HA   4  
ATOM 8572  H HB2  . TRP A 1 52  ? 8.146   -4.337  -9.779  1.00 0.00 ? 444 TRP A HB2  4  
ATOM 8573  H HB3  . TRP A 1 52  ? 6.620   -3.862  -9.045  1.00 0.00 ? 444 TRP A HB3  4  
ATOM 8574  H HD1  . TRP A 1 52  ? 8.110   -7.400  -8.651  1.00 0.00 ? 444 TRP A HD1  4  
ATOM 8575  H HE1  . TRP A 1 52  ? 8.632   -7.758  -6.162  1.00 0.00 ? 444 TRP A HE1  4  
ATOM 8576  H HE3  . TRP A 1 52  ? 7.133   -2.699  -6.936  1.00 0.00 ? 444 TRP A HE3  4  
ATOM 8577  H HZ2  . TRP A 1 52  ? 8.619   -6.243  -3.787  1.00 0.00 ? 444 TRP A HZ2  4  
ATOM 8578  H HZ3  . TRP A 1 52  ? 7.414   -2.223  -4.548  1.00 0.00 ? 444 TRP A HZ3  4  
ATOM 8579  H HH2  . TRP A 1 52  ? 8.147   -3.963  -2.996  1.00 0.00 ? 444 TRP A HH2  4  
ATOM 8580  N N    . PRO A 1 53  ? 4.397   -4.860  -11.268 1.00 0.00 ? 445 PRO A N    4  
ATOM 8581  C CA   . PRO A 1 53  ? 3.548   -4.053  -12.135 1.00 0.00 ? 445 PRO A CA   4  
ATOM 8582  C C    . PRO A 1 53  ? 3.806   -2.576  -11.894 1.00 0.00 ? 445 PRO A C    4  
ATOM 8583  O O    . PRO A 1 53  ? 4.108   -2.178  -10.780 1.00 0.00 ? 445 PRO A O    4  
ATOM 8584  C CB   . PRO A 1 53  ? 2.125   -4.425  -11.697 1.00 0.00 ? 445 PRO A CB   4  
ATOM 8585  C CG   . PRO A 1 53  ? 2.261   -5.764  -11.070 1.00 0.00 ? 445 PRO A CG   4  
ATOM 8586  C CD   . PRO A 1 53  ? 3.608   -5.770  -10.418 1.00 0.00 ? 445 PRO A CD   4  
ATOM 8587  H HA   . PRO A 1 53  ? 3.699   -4.287  -13.177 1.00 0.00 ? 445 PRO A HA   4  
ATOM 8588  H HB2  . PRO A 1 53  ? 1.756   -3.692  -10.994 1.00 0.00 ? 445 PRO A HB2  4  
ATOM 8589  H HB3  . PRO A 1 53  ? 1.478   -4.460  -12.560 1.00 0.00 ? 445 PRO A HB3  4  
ATOM 8590  H HG2  . PRO A 1 53  ? 1.483   -5.913  -10.338 1.00 0.00 ? 445 PRO A HG2  4  
ATOM 8591  H HG3  . PRO A 1 53  ? 2.210   -6.532  -11.828 1.00 0.00 ? 445 PRO A HG3  4  
ATOM 8592  H HD2  . PRO A 1 53  ? 3.544   -5.400  -9.405  1.00 0.00 ? 445 PRO A HD2  4  
ATOM 8593  H HD3  . PRO A 1 53  ? 4.015   -6.770  -10.439 1.00 0.00 ? 445 PRO A HD3  4  
ATOM 8594  N N    . GLN A 1 54  ? 3.640   -1.767  -12.919 1.00 0.00 ? 446 GLN A N    4  
ATOM 8595  C CA   . GLN A 1 54  ? 3.948   -0.397  -12.872 1.00 0.00 ? 446 GLN A CA   4  
ATOM 8596  C C    . GLN A 1 54  ? 2.889   0.358   -12.053 1.00 0.00 ? 446 GLN A C    4  
ATOM 8597  O O    . GLN A 1 54  ? 3.150   1.454   -11.524 1.00 0.00 ? 446 GLN A O    4  
ATOM 8598  C CB   . GLN A 1 54  ? 3.999   0.078   -14.310 1.00 0.00 ? 446 GLN A CB   4  
ATOM 8599  C CG   . GLN A 1 54  ? 4.350   1.503   -14.480 1.00 0.00 ? 446 GLN A CG   4  
ATOM 8600  C CD   . GLN A 1 54  ? 5.739   1.841   -13.961 1.00 0.00 ? 446 GLN A CD   4  
ATOM 8601  O OE1  . GLN A 1 54  ? 6.723   1.772   -14.685 1.00 0.00 ? 446 GLN A OE1  4  
ATOM 8602  N NE2  . GLN A 1 54  ? 5.824   2.198   -12.710 1.00 0.00 ? 446 GLN A NE2  4  
ATOM 8603  H H    . GLN A 1 54  ? 3.297   -2.049  -13.792 1.00 0.00 ? 446 GLN A H    4  
ATOM 8604  H HA   . GLN A 1 54  ? 4.924   -0.263  -12.433 1.00 0.00 ? 446 GLN A HA   4  
ATOM 8605  H HB2  . GLN A 1 54  ? 4.734   -0.510  -14.841 1.00 0.00 ? 446 GLN A HB2  4  
ATOM 8606  H HB3  . GLN A 1 54  ? 3.030   -0.092  -14.757 1.00 0.00 ? 446 GLN A HB3  4  
ATOM 8607  H HG2  . GLN A 1 54  ? 4.259   1.710   -15.533 1.00 0.00 ? 446 GLN A HG2  4  
ATOM 8608  H HG3  . GLN A 1 54  ? 3.595   2.014   -13.904 1.00 0.00 ? 446 GLN A HG3  4  
ATOM 8609  H HE21 . GLN A 1 54  ? 4.994   2.224   -12.188 1.00 0.00 ? 446 GLN A HE21 4  
ATOM 8610  H HE22 . GLN A 1 54  ? 6.711   2.423   -12.353 1.00 0.00 ? 446 GLN A HE22 4  
ATOM 8611  N N    . LYS A 1 55  ? 1.718   -0.235  -11.951 1.00 0.00 ? 447 LYS A N    4  
ATOM 8612  C CA   . LYS A 1 55  ? 0.662   0.272   -11.120 1.00 0.00 ? 447 LYS A CA   4  
ATOM 8613  C C    . LYS A 1 55  ? 0.226   -0.791  -10.159 1.00 0.00 ? 447 LYS A C    4  
ATOM 8614  O O    . LYS A 1 55  ? -0.128  -1.909  -10.569 1.00 0.00 ? 447 LYS A O    4  
ATOM 8615  C CB   . LYS A 1 55  ? -0.551  0.741   -11.911 1.00 0.00 ? 447 LYS A CB   4  
ATOM 8616  C CG   . LYS A 1 55  ? -0.357  2.002   -12.706 1.00 0.00 ? 447 LYS A CG   4  
ATOM 8617  C CD   . LYS A 1 55  ? -1.677  2.440   -13.286 1.00 0.00 ? 447 LYS A CD   4  
ATOM 8618  C CE   . LYS A 1 55  ? -1.565  3.759   -14.007 1.00 0.00 ? 447 LYS A CE   4  
ATOM 8619  N NZ   . LYS A 1 55  ? -2.878  4.202   -14.502 1.00 0.00 ? 447 LYS A NZ   4  
ATOM 8620  H H    . LYS A 1 55  ? 1.563   -1.074  -12.433 1.00 0.00 ? 447 LYS A H    4  
ATOM 8621  H HA   . LYS A 1 55  ? 1.059   1.104   -10.559 1.00 0.00 ? 447 LYS A HA   4  
ATOM 8622  H HB2  . LYS A 1 55  ? -0.832  -0.044  -12.598 1.00 0.00 ? 447 LYS A HB2  4  
ATOM 8623  H HB3  . LYS A 1 55  ? -1.366  0.897   -11.219 1.00 0.00 ? 447 LYS A HB3  4  
ATOM 8624  H HG2  . LYS A 1 55  ? 0.020   2.777   -12.056 1.00 0.00 ? 447 LYS A HG2  4  
ATOM 8625  H HG3  . LYS A 1 55  ? 0.343   1.820   -13.509 1.00 0.00 ? 447 LYS A HG3  4  
ATOM 8626  H HD2  . LYS A 1 55  ? -2.022  1.689   -13.979 1.00 0.00 ? 447 LYS A HD2  4  
ATOM 8627  H HD3  . LYS A 1 55  ? -2.392  2.541   -12.483 1.00 0.00 ? 447 LYS A HD3  4  
ATOM 8628  H HE2  . LYS A 1 55  ? -1.177  4.501   -13.325 1.00 0.00 ? 447 LYS A HE2  4  
ATOM 8629  H HE3  . LYS A 1 55  ? -0.893  3.642   -14.843 1.00 0.00 ? 447 LYS A HE3  4  
ATOM 8630  H HZ1  . LYS A 1 55  ? -3.542  4.272   -13.695 1.00 0.00 ? 447 LYS A HZ1  4  
ATOM 8631  H HZ2  . LYS A 1 55  ? -2.796  5.134   -14.956 1.00 0.00 ? 447 LYS A HZ2  4  
ATOM 8632  H HZ3  . LYS A 1 55  ? -3.247  3.515   -15.187 1.00 0.00 ? 447 LYS A HZ3  4  
ATOM 8633  N N    . LEU A 1 56  ? 0.279   -0.468  -8.910  1.00 0.00 ? 448 LEU A N    4  
ATOM 8634  C CA   . LEU A 1 56  ? -0.167  -1.344  -7.869  1.00 0.00 ? 448 LEU A CA   4  
ATOM 8635  C C    . LEU A 1 56  ? -1.478  -0.818  -7.335  1.00 0.00 ? 448 LEU A C    4  
ATOM 8636  O O    . LEU A 1 56  ? -1.691  0.399   -7.300  1.00 0.00 ? 448 LEU A O    4  
ATOM 8637  C CB   . LEU A 1 56  ? 0.873   -1.444  -6.759  1.00 0.00 ? 448 LEU A CB   4  
ATOM 8638  C CG   . LEU A 1 56  ? 2.231   -2.027  -7.150  1.00 0.00 ? 448 LEU A CG   4  
ATOM 8639  C CD1  . LEU A 1 56  ? 3.153   -2.067  -5.957  1.00 0.00 ? 448 LEU A CD1  4  
ATOM 8640  C CD2  . LEU A 1 56  ? 2.062   -3.399  -7.753  1.00 0.00 ? 448 LEU A CD2  4  
ATOM 8641  H H    . LEU A 1 56  ? 0.630   0.418   -8.667  1.00 0.00 ? 448 LEU A H    4  
ATOM 8642  H HA   . LEU A 1 56  ? -0.336  -2.320  -8.299  1.00 0.00 ? 448 LEU A HA   4  
ATOM 8643  H HB2  . LEU A 1 56  ? 1.036   -0.453  -6.366  1.00 0.00 ? 448 LEU A HB2  4  
ATOM 8644  H HB3  . LEU A 1 56  ? 0.462   -2.058  -5.971  1.00 0.00 ? 448 LEU A HB3  4  
ATOM 8645  H HG   . LEU A 1 56  ? 2.742   -1.414  -7.874  1.00 0.00 ? 448 LEU A HG   4  
ATOM 8646  H HD11 . LEU A 1 56  ? 3.294   -1.067  -5.573  1.00 0.00 ? 448 LEU A HD11 4  
ATOM 8647  H HD12 . LEU A 1 56  ? 2.724   -2.690  -5.186  1.00 0.00 ? 448 LEU A HD12 4  
ATOM 8648  H HD13 . LEU A 1 56  ? 4.107   -2.476  -6.256  1.00 0.00 ? 448 LEU A HD13 4  
ATOM 8649  H HD21 . LEU A 1 56  ? 1.439   -3.343  -8.633  1.00 0.00 ? 448 LEU A HD21 4  
ATOM 8650  H HD22 . LEU A 1 56  ? 3.035   -3.781  -8.024  1.00 0.00 ? 448 LEU A HD22 4  
ATOM 8651  H HD23 . LEU A 1 56  ? 1.609   -4.054  -7.025  1.00 0.00 ? 448 LEU A HD23 4  
ATOM 8652  N N    . ILE A 1 57  ? -2.347  -1.703  -6.920  1.00 0.00 ? 449 ILE A N    4  
ATOM 8653  C CA   . ILE A 1 57  ? -3.669  -1.307  -6.498  1.00 0.00 ? 449 ILE A CA   4  
ATOM 8654  C C    . ILE A 1 57  ? -3.706  -1.213  -4.991  1.00 0.00 ? 449 ILE A C    4  
ATOM 8655  O O    . ILE A 1 57  ? -3.460  -2.198  -4.282  1.00 0.00 ? 449 ILE A O    4  
ATOM 8656  C CB   . ILE A 1 57  ? -4.755  -2.313  -6.991  1.00 0.00 ? 449 ILE A CB   4  
ATOM 8657  C CG1  . ILE A 1 57  ? -4.722  -2.451  -8.529  1.00 0.00 ? 449 ILE A CG1  4  
ATOM 8658  C CG2  . ILE A 1 57  ? -6.155  -1.902  -6.517  1.00 0.00 ? 449 ILE A CG2  4  
ATOM 8659  C CD1  . ILE A 1 57  ? -4.970  -1.156  -9.288  1.00 0.00 ? 449 ILE A CD1  4  
ATOM 8660  H H    . ILE A 1 57  ? -2.095  -2.650  -6.842  1.00 0.00 ? 449 ILE A H    4  
ATOM 8661  H HA   . ILE A 1 57  ? -3.881  -0.333  -6.914  1.00 0.00 ? 449 ILE A HA   4  
ATOM 8662  H HB   . ILE A 1 57  ? -4.533  -3.276  -6.555  1.00 0.00 ? 449 ILE A HB   4  
ATOM 8663  H HG12 . ILE A 1 57  ? -3.751  -2.817  -8.826  1.00 0.00 ? 449 ILE A HG12 4  
ATOM 8664  H HG13 . ILE A 1 57  ? -5.475  -3.165  -8.831  1.00 0.00 ? 449 ILE A HG13 4  
ATOM 8665  H HG21 . ILE A 1 57  ? -6.174  -1.869  -5.437  1.00 0.00 ? 449 ILE A HG21 4  
ATOM 8666  H HG22 . ILE A 1 57  ? -6.393  -0.923  -6.907  1.00 0.00 ? 449 ILE A HG22 4  
ATOM 8667  H HG23 . ILE A 1 57  ? -6.883  -2.618  -6.869  1.00 0.00 ? 449 ILE A HG23 4  
ATOM 8668  H HD11 . ILE A 1 57  ? -5.940  -0.764  -9.021  1.00 0.00 ? 449 ILE A HD11 4  
ATOM 8669  H HD12 . ILE A 1 57  ? -4.205  -0.437  -9.038  1.00 0.00 ? 449 ILE A HD12 4  
ATOM 8670  H HD13 . ILE A 1 57  ? -4.940  -1.354  -10.349 1.00 0.00 ? 449 ILE A HD13 4  
ATOM 8671  N N    . MET A 1 58  ? -3.989  -0.050  -4.507  1.00 0.00 ? 450 MET A N    4  
ATOM 8672  C CA   . MET A 1 58  ? -4.034  0.190   -3.097  1.00 0.00 ? 450 MET A CA   4  
ATOM 8673  C C    . MET A 1 58  ? -5.447  0.502   -2.662  1.00 0.00 ? 450 MET A C    4  
ATOM 8674  O O    . MET A 1 58  ? -6.115  1.327   -3.259  1.00 0.00 ? 450 MET A O    4  
ATOM 8675  C CB   . MET A 1 58  ? -3.091  1.337   -2.711  1.00 0.00 ? 450 MET A CB   4  
ATOM 8676  C CG   . MET A 1 58  ? -3.142  1.699   -1.228  1.00 0.00 ? 450 MET A CG   4  
ATOM 8677  S SD   . MET A 1 58  ? -1.996  3.011   -0.765  1.00 0.00 ? 450 MET A SD   4  
ATOM 8678  C CE   . MET A 1 58  ? -2.552  4.367   -1.798  1.00 0.00 ? 450 MET A CE   4  
ATOM 8679  H H    . MET A 1 58  ? -4.205  0.684   -5.130  1.00 0.00 ? 450 MET A H    4  
ATOM 8680  H HA   . MET A 1 58  ? -3.704  -0.708  -2.596  1.00 0.00 ? 450 MET A HA   4  
ATOM 8681  H HB2  . MET A 1 58  ? -2.080  1.054   -2.963  1.00 0.00 ? 450 MET A HB2  4  
ATOM 8682  H HB3  . MET A 1 58  ? -3.362  2.210   -3.284  1.00 0.00 ? 450 MET A HB3  4  
ATOM 8683  H HG2  . MET A 1 58  ? -4.144  2.020   -0.986  1.00 0.00 ? 450 MET A HG2  4  
ATOM 8684  H HG3  . MET A 1 58  ? -2.909  0.814   -0.655  1.00 0.00 ? 450 MET A HG3  4  
ATOM 8685  H HE1  . MET A 1 58  ? -3.588  4.587   -1.584  1.00 0.00 ? 450 MET A HE1  4  
ATOM 8686  H HE2  . MET A 1 58  ? -1.949  5.240   -1.596  1.00 0.00 ? 450 MET A HE2  4  
ATOM 8687  H HE3  . MET A 1 58  ? -2.448  4.096   -2.839  1.00 0.00 ? 450 MET A HE3  4  
ATOM 8688  N N    . GLN A 1 59  ? -5.899  -0.176  -1.650  1.00 0.00 ? 451 GLN A N    4  
ATOM 8689  C CA   . GLN A 1 59  ? -7.194  0.088   -1.088  1.00 0.00 ? 451 GLN A CA   4  
ATOM 8690  C C    . GLN A 1 59  ? -7.027  0.504   0.347   1.00 0.00 ? 451 GLN A C    4  
ATOM 8691  O O    . GLN A 1 59  ? -6.288  -0.137  1.119   1.00 0.00 ? 451 GLN A O    4  
ATOM 8692  C CB   . GLN A 1 59  ? -8.146  -1.108  -1.227  1.00 0.00 ? 451 GLN A CB   4  
ATOM 8693  C CG   . GLN A 1 59  ? -8.556  -1.418  -2.675  1.00 0.00 ? 451 GLN A CG   4  
ATOM 8694  C CD   . GLN A 1 59  ? -9.400  -0.312  -3.339  1.00 0.00 ? 451 GLN A CD   4  
ATOM 8695  O OE1  . GLN A 1 59  ? -9.280  0.878   -3.033  1.00 0.00 ? 451 GLN A OE1  4  
ATOM 8696  N NE2  . GLN A 1 59  ? -10.255 -0.703  -4.249  1.00 0.00 ? 451 GLN A NE2  4  
ATOM 8697  H H    . GLN A 1 59  ? -5.341  -0.874  -1.243  1.00 0.00 ? 451 GLN A H    4  
ATOM 8698  H HA   . GLN A 1 59  ? -7.599  0.931   -1.627  1.00 0.00 ? 451 GLN A HA   4  
ATOM 8699  H HB2  . GLN A 1 59  ? -7.662  -1.981  -0.817  1.00 0.00 ? 451 GLN A HB2  4  
ATOM 8700  H HB3  . GLN A 1 59  ? -9.040  -0.906  -0.657  1.00 0.00 ? 451 GLN A HB3  4  
ATOM 8701  H HG2  . GLN A 1 59  ? -7.662  -1.559  -3.263  1.00 0.00 ? 451 GLN A HG2  4  
ATOM 8702  H HG3  . GLN A 1 59  ? -9.128  -2.335  -2.679  1.00 0.00 ? 451 GLN A HG3  4  
ATOM 8703  H HE21 . GLN A 1 59  ? -10.320 -1.662  -4.456  1.00 0.00 ? 451 GLN A HE21 4  
ATOM 8704  H HE22 . GLN A 1 59  ? -10.804 -0.036  -4.711  1.00 0.00 ? 451 GLN A HE22 4  
ATOM 8705  N N    . LEU A 1 60  ? -7.664  1.580   0.689   1.00 0.00 ? 452 LEU A N    4  
ATOM 8706  C CA   . LEU A 1 60  ? -7.554  2.159   2.005   1.00 0.00 ? 452 LEU A CA   4  
ATOM 8707  C C    . LEU A 1 60  ? -8.523  1.484   2.958   1.00 0.00 ? 452 LEU A C    4  
ATOM 8708  O O    . LEU A 1 60  ? -9.726  1.426   2.705   1.00 0.00 ? 452 LEU A O    4  
ATOM 8709  C CB   . LEU A 1 60  ? -7.792  3.670   1.921   1.00 0.00 ? 452 LEU A CB   4  
ATOM 8710  C CG   . LEU A 1 60  ? -6.850  4.430   0.958   1.00 0.00 ? 452 LEU A CG   4  
ATOM 8711  C CD1  . LEU A 1 60  ? -7.225  5.893   0.871   1.00 0.00 ? 452 LEU A CD1  4  
ATOM 8712  C CD2  . LEU A 1 60  ? -5.396  4.286   1.392   1.00 0.00 ? 452 LEU A CD2  4  
ATOM 8713  H H    . LEU A 1 60  ? -8.252  2.003   0.032   1.00 0.00 ? 452 LEU A H    4  
ATOM 8714  H HA   . LEU A 1 60  ? -6.549  1.984   2.360   1.00 0.00 ? 452 LEU A HA   4  
ATOM 8715  H HB2  . LEU A 1 60  ? -8.811  3.831   1.600   1.00 0.00 ? 452 LEU A HB2  4  
ATOM 8716  H HB3  . LEU A 1 60  ? -7.673  4.090   2.908   1.00 0.00 ? 452 LEU A HB3  4  
ATOM 8717  H HG   . LEU A 1 60  ? -6.950  4.008   -0.032  1.00 0.00 ? 452 LEU A HG   4  
ATOM 8718  H HD11 . LEU A 1 60  ? -8.259  5.989   0.575   1.00 0.00 ? 452 LEU A HD11 4  
ATOM 8719  H HD12 . LEU A 1 60  ? -7.071  6.356   1.834   1.00 0.00 ? 452 LEU A HD12 4  
ATOM 8720  H HD13 . LEU A 1 60  ? -6.596  6.374   0.137   1.00 0.00 ? 452 LEU A HD13 4  
ATOM 8721  H HD21 . LEU A 1 60  ? -5.282  4.668   2.395   1.00 0.00 ? 452 LEU A HD21 4  
ATOM 8722  H HD22 . LEU A 1 60  ? -5.111  3.246   1.365   1.00 0.00 ? 452 LEU A HD22 4  
ATOM 8723  H HD23 . LEU A 1 60  ? -4.762  4.845   0.719   1.00 0.00 ? 452 LEU A HD23 4  
ATOM 8724  N N    . ILE A 1 61  ? -7.983  0.964   4.026   1.00 0.00 ? 453 ILE A N    4  
ATOM 8725  C CA   . ILE A 1 61  ? -8.726  0.209   5.017   1.00 0.00 ? 453 ILE A CA   4  
ATOM 8726  C C    . ILE A 1 61  ? -8.441  0.775   6.410   1.00 0.00 ? 453 ILE A C    4  
ATOM 8727  O O    . ILE A 1 61  ? -7.445  1.460   6.593   1.00 0.00 ? 453 ILE A O    4  
ATOM 8728  C CB   . ILE A 1 61  ? -8.303  -1.295  4.991   1.00 0.00 ? 453 ILE A CB   4  
ATOM 8729  C CG1  . ILE A 1 61  ? -6.771  -1.427  5.178   1.00 0.00 ? 453 ILE A CG1  4  
ATOM 8730  C CG2  . ILE A 1 61  ? -8.768  -1.968  3.697   1.00 0.00 ? 453 ILE A CG2  4  
ATOM 8731  C CD1  . ILE A 1 61  ? -6.260  -2.848  5.261   1.00 0.00 ? 453 ILE A CD1  4  
ATOM 8732  H H    . ILE A 1 61  ? -7.022  1.114   4.180   1.00 0.00 ? 453 ILE A H    4  
ATOM 8733  H HA   . ILE A 1 61  ? -9.779  0.281   4.789   1.00 0.00 ? 453 ILE A HA   4  
ATOM 8734  H HB   . ILE A 1 61  ? -8.798  -1.789  5.814   1.00 0.00 ? 453 ILE A HB   4  
ATOM 8735  H HG12 . ILE A 1 61  ? -6.275  -0.954  4.344   1.00 0.00 ? 453 ILE A HG12 4  
ATOM 8736  H HG13 . ILE A 1 61  ? -6.486  -0.914  6.086   1.00 0.00 ? 453 ILE A HG13 4  
ATOM 8737  H HG21 . ILE A 1 61  ? -8.327  -1.460  2.851   1.00 0.00 ? 453 ILE A HG21 4  
ATOM 8738  H HG22 . ILE A 1 61  ? -8.453  -3.002  3.696   1.00 0.00 ? 453 ILE A HG22 4  
ATOM 8739  H HG23 . ILE A 1 61  ? -9.845  -1.919  3.626   1.00 0.00 ? 453 ILE A HG23 4  
ATOM 8740  H HD11 . ILE A 1 61  ? -6.534  -3.384  4.365   1.00 0.00 ? 453 ILE A HD11 4  
ATOM 8741  H HD12 . ILE A 1 61  ? -5.184  -2.835  5.359   1.00 0.00 ? 453 ILE A HD12 4  
ATOM 8742  H HD13 . ILE A 1 61  ? -6.691  -3.340  6.121   1.00 0.00 ? 453 ILE A HD13 4  
ATOM 8743  N N    . PRO A 1 62  ? -9.321  0.549   7.398   1.00 0.00 ? 454 PRO A N    4  
ATOM 8744  C CA   . PRO A 1 62  ? -9.067  0.984   8.776   1.00 0.00 ? 454 PRO A CA   4  
ATOM 8745  C C    . PRO A 1 62  ? -7.839  0.270   9.371   1.00 0.00 ? 454 PRO A C    4  
ATOM 8746  O O    . PRO A 1 62  ? -7.750  -0.969  9.338   1.00 0.00 ? 454 PRO A O    4  
ATOM 8747  C CB   . PRO A 1 62  ? -10.333 0.570   9.539   1.00 0.00 ? 454 PRO A CB   4  
ATOM 8748  C CG   . PRO A 1 62  ? -11.366 0.289   8.494   1.00 0.00 ? 454 PRO A CG   4  
ATOM 8749  C CD   . PRO A 1 62  ? -10.633 -0.094  7.244   1.00 0.00 ? 454 PRO A CD   4  
ATOM 8750  H HA   . PRO A 1 62  ? -8.924  2.053   8.835   1.00 0.00 ? 454 PRO A HA   4  
ATOM 8751  H HB2  . PRO A 1 62  ? -10.121 -0.309  10.129  1.00 0.00 ? 454 PRO A HB2  4  
ATOM 8752  H HB3  . PRO A 1 62  ? -10.642 1.375   10.191  1.00 0.00 ? 454 PRO A HB3  4  
ATOM 8753  H HG2  . PRO A 1 62  ? -11.986 -0.534  8.818   1.00 0.00 ? 454 PRO A HG2  4  
ATOM 8754  H HG3  . PRO A 1 62  ? -11.983 1.158   8.315   1.00 0.00 ? 454 PRO A HG3  4  
ATOM 8755  H HD2  . PRO A 1 62  ? -10.549 -1.166  7.143   1.00 0.00 ? 454 PRO A HD2  4  
ATOM 8756  H HD3  . PRO A 1 62  ? -11.150 0.313   6.388   1.00 0.00 ? 454 PRO A HD3  4  
ATOM 8757  N N    . GLN A 1 63  ? -6.926  1.050   9.949   1.00 0.00 ? 455 GLN A N    4  
ATOM 8758  C CA   . GLN A 1 63  ? -5.668  0.538   10.511  1.00 0.00 ? 455 GLN A CA   4  
ATOM 8759  C C    . GLN A 1 63  ? -5.920  -0.439  11.666  1.00 0.00 ? 455 GLN A C    4  
ATOM 8760  O O    . GLN A 1 63  ? -5.154  -1.369  11.876  1.00 0.00 ? 455 GLN A O    4  
ATOM 8761  C CB   . GLN A 1 63  ? -4.744  1.731   10.914  1.00 0.00 ? 455 GLN A CB   4  
ATOM 8762  C CG   . GLN A 1 63  ? -3.352  1.383   11.492  1.00 0.00 ? 455 GLN A CG   4  
ATOM 8763  C CD   . GLN A 1 63  ? -3.369  0.963   12.961  1.00 0.00 ? 455 GLN A CD   4  
ATOM 8764  O OE1  . GLN A 1 63  ? -4.211  1.414   13.747  1.00 0.00 ? 455 GLN A OE1  4  
ATOM 8765  N NE2  . GLN A 1 63  ? -2.455  0.109   13.339  1.00 0.00 ? 455 GLN A NE2  4  
ATOM 8766  H H    . GLN A 1 63  ? -7.092  2.018   9.993   1.00 0.00 ? 455 GLN A H    4  
ATOM 8767  H HA   . GLN A 1 63  ? -5.184  -0.018  9.721   1.00 0.00 ? 455 GLN A HA   4  
ATOM 8768  H HB2  . GLN A 1 63  ? -4.587  2.345   10.039  1.00 0.00 ? 455 GLN A HB2  4  
ATOM 8769  H HB3  . GLN A 1 63  ? -5.273  2.325   11.645  1.00 0.00 ? 455 GLN A HB3  4  
ATOM 8770  H HG2  . GLN A 1 63  ? -2.938  0.567   10.919  1.00 0.00 ? 455 GLN A HG2  4  
ATOM 8771  H HG3  . GLN A 1 63  ? -2.714  2.249   11.388  1.00 0.00 ? 455 GLN A HG3  4  
ATOM 8772  H HE21 . GLN A 1 63  ? -1.814  -0.216  12.668  1.00 0.00 ? 455 GLN A HE21 4  
ATOM 8773  H HE22 . GLN A 1 63  ? -2.434  -0.172  14.276  1.00 0.00 ? 455 GLN A HE22 4  
ATOM 8774  N N    . GLN A 1 64  ? -7.009  -0.248  12.379  1.00 0.00 ? 456 GLN A N    4  
ATOM 8775  C CA   . GLN A 1 64  ? -7.359  -1.115  13.498  1.00 0.00 ? 456 GLN A CA   4  
ATOM 8776  C C    . GLN A 1 64  ? -7.548  -2.586  13.061  1.00 0.00 ? 456 GLN A C    4  
ATOM 8777  O O    . GLN A 1 64  ? -7.218  -3.512  13.808  1.00 0.00 ? 456 GLN A O    4  
ATOM 8778  C CB   . GLN A 1 64  ? -8.606  -0.576  14.220  1.00 0.00 ? 456 GLN A CB   4  
ATOM 8779  C CG   . GLN A 1 64  ? -9.074  -1.414  15.408  1.00 0.00 ? 456 GLN A CG   4  
ATOM 8780  C CD   . GLN A 1 64  ? -7.985  -1.646  16.444  1.00 0.00 ? 456 GLN A CD   4  
ATOM 8781  O OE1  . GLN A 1 64  ? -7.083  -0.821  16.632  1.00 0.00 ? 456 GLN A OE1  4  
ATOM 8782  N NE2  . GLN A 1 64  ? -8.061  -2.756  17.118  1.00 0.00 ? 456 GLN A NE2  4  
ATOM 8783  H H    . GLN A 1 64  ? -7.578  0.523   12.166  1.00 0.00 ? 456 GLN A H    4  
ATOM 8784  H HA   . GLN A 1 64  ? -6.527  -1.082  14.186  1.00 0.00 ? 456 GLN A HA   4  
ATOM 8785  H HB2  . GLN A 1 64  ? -8.386  0.416   14.587  1.00 0.00 ? 456 GLN A HB2  4  
ATOM 8786  H HB3  . GLN A 1 64  ? -9.415  -0.514  13.508  1.00 0.00 ? 456 GLN A HB3  4  
ATOM 8787  H HG2  . GLN A 1 64  ? -9.902  -0.912  15.887  1.00 0.00 ? 456 GLN A HG2  4  
ATOM 8788  H HG3  . GLN A 1 64  ? -9.403  -2.372  15.034  1.00 0.00 ? 456 GLN A HG3  4  
ATOM 8789  H HE21 . GLN A 1 64  ? -8.806  -3.366  16.928  1.00 0.00 ? 456 GLN A HE21 4  
ATOM 8790  H HE22 . GLN A 1 64  ? -7.374  -2.961  17.789  1.00 0.00 ? 456 GLN A HE22 4  
ATOM 8791  N N    . LEU A 1 65  ? -8.000  -2.795  11.837  1.00 0.00 ? 457 LEU A N    4  
ATOM 8792  C CA   . LEU A 1 65  ? -8.251  -4.147  11.338  1.00 0.00 ? 457 LEU A CA   4  
ATOM 8793  C C    . LEU A 1 65  ? -6.943  -4.829  10.906  1.00 0.00 ? 457 LEU A C    4  
ATOM 8794  O O    . LEU A 1 65  ? -6.886  -6.045  10.730  1.00 0.00 ? 457 LEU A O    4  
ATOM 8795  C CB   . LEU A 1 65  ? -9.257  -4.111  10.179  1.00 0.00 ? 457 LEU A CB   4  
ATOM 8796  C CG   . LEU A 1 65  ? -10.643 -3.523  10.495  1.00 0.00 ? 457 LEU A CG   4  
ATOM 8797  C CD1  . LEU A 1 65  ? -11.513 -3.505  9.253   1.00 0.00 ? 457 LEU A CD1  4  
ATOM 8798  C CD2  . LEU A 1 65  ? -11.329 -4.311  11.600  1.00 0.00 ? 457 LEU A CD2  4  
ATOM 8799  H H    . LEU A 1 65  ? -8.156  -2.029  11.242  1.00 0.00 ? 457 LEU A H    4  
ATOM 8800  H HA   . LEU A 1 65  ? -8.674  -4.715  12.153  1.00 0.00 ? 457 LEU A HA   4  
ATOM 8801  H HB2  . LEU A 1 65  ? -8.822  -3.537  9.374   1.00 0.00 ? 457 LEU A HB2  4  
ATOM 8802  H HB3  . LEU A 1 65  ? -9.397  -5.125  9.835   1.00 0.00 ? 457 LEU A HB3  4  
ATOM 8803  H HG   . LEU A 1 65  ? -10.523 -2.503  10.831  1.00 0.00 ? 457 LEU A HG   4  
ATOM 8804  H HD11 . LEU A 1 65  ? -11.631 -4.511  8.877   1.00 0.00 ? 457 LEU A HD11 4  
ATOM 8805  H HD12 . LEU A 1 65  ? -12.482 -3.097  9.500   1.00 0.00 ? 457 LEU A HD12 4  
ATOM 8806  H HD13 . LEU A 1 65  ? -11.049 -2.888  8.498   1.00 0.00 ? 457 LEU A HD13 4  
ATOM 8807  H HD21 . LEU A 1 65  ? -11.438 -5.341  11.296  1.00 0.00 ? 457 LEU A HD21 4  
ATOM 8808  H HD22 . LEU A 1 65  ? -10.736 -4.260  12.501  1.00 0.00 ? 457 LEU A HD22 4  
ATOM 8809  H HD23 . LEU A 1 65  ? -12.305 -3.889  11.790  1.00 0.00 ? 457 LEU A HD23 4  
ATOM 8810  N N    . LEU A 1 66  ? -5.894  -4.033  10.802  1.00 0.00 ? 458 LEU A N    4  
ATOM 8811  C CA   . LEU A 1 66  ? -4.567  -4.478  10.372  1.00 0.00 ? 458 LEU A CA   4  
ATOM 8812  C C    . LEU A 1 66  ? -3.876  -5.287  11.476  1.00 0.00 ? 458 LEU A C    4  
ATOM 8813  O O    . LEU A 1 66  ? -3.023  -6.131  11.197  1.00 0.00 ? 458 LEU A O    4  
ATOM 8814  C CB   . LEU A 1 66  ? -3.747  -3.207  9.959   1.00 0.00 ? 458 LEU A CB   4  
ATOM 8815  C CG   . LEU A 1 66  ? -2.251  -3.312  9.562   1.00 0.00 ? 458 LEU A CG   4  
ATOM 8816  C CD1  . LEU A 1 66  ? -1.840  -2.022  8.885   1.00 0.00 ? 458 LEU A CD1  4  
ATOM 8817  C CD2  . LEU A 1 66  ? -1.351  -3.494  10.782  1.00 0.00 ? 458 LEU A CD2  4  
ATOM 8818  H H    . LEU A 1 66  ? -6.004  -3.084  11.032  1.00 0.00 ? 458 LEU A H    4  
ATOM 8819  H HA   . LEU A 1 66  ? -4.687  -5.106  9.502   1.00 0.00 ? 458 LEU A HA   4  
ATOM 8820  H HB2  . LEU A 1 66  ? -4.256  -2.760  9.118   1.00 0.00 ? 458 LEU A HB2  4  
ATOM 8821  H HB3  . LEU A 1 66  ? -3.823  -2.506  10.779  1.00 0.00 ? 458 LEU A HB3  4  
ATOM 8822  H HG   . LEU A 1 66  ? -2.099  -4.137  8.882   1.00 0.00 ? 458 LEU A HG   4  
ATOM 8823  H HD11 . LEU A 1 66  ? -1.999  -1.195  9.561   1.00 0.00 ? 458 LEU A HD11 4  
ATOM 8824  H HD12 . LEU A 1 66  ? -0.794  -2.074  8.623   1.00 0.00 ? 458 LEU A HD12 4  
ATOM 8825  H HD13 . LEU A 1 66  ? -2.429  -1.879  7.991   1.00 0.00 ? 458 LEU A HD13 4  
ATOM 8826  H HD21 . LEU A 1 66  ? -1.478  -2.656  11.450  1.00 0.00 ? 458 LEU A HD21 4  
ATOM 8827  H HD22 . LEU A 1 66  ? -1.624  -4.406  11.292  1.00 0.00 ? 458 LEU A HD22 4  
ATOM 8828  H HD23 . LEU A 1 66  ? -0.321  -3.549  10.466  1.00 0.00 ? 458 LEU A HD23 4  
ATOM 8829  N N    . THR A 1 67  ? -4.310  -5.084  12.714  1.00 0.00 ? 459 THR A N    4  
ATOM 8830  C CA   . THR A 1 67  ? -3.664  -5.668  13.895  1.00 0.00 ? 459 THR A CA   4  
ATOM 8831  C C    . THR A 1 67  ? -3.596  -7.221  13.875  1.00 0.00 ? 459 THR A C    4  
ATOM 8832  O O    . THR A 1 67  ? -2.753  -7.827  14.552  1.00 0.00 ? 459 THR A O    4  
ATOM 8833  C CB   . THR A 1 67  ? -4.334  -5.165  15.197  1.00 0.00 ? 459 THR A CB   4  
ATOM 8834  O OG1  . THR A 1 67  ? -5.752  -5.417  15.156  1.00 0.00 ? 459 THR A OG1  4  
ATOM 8835  C CG2  . THR A 1 67  ? -4.089  -3.671  15.392  1.00 0.00 ? 459 THR A CG2  4  
ATOM 8836  H H    . THR A 1 67  ? -5.102  -4.523  12.843  1.00 0.00 ? 459 THR A H    4  
ATOM 8837  H HA   . THR A 1 67  ? -2.646  -5.307  13.891  1.00 0.00 ? 459 THR A HA   4  
ATOM 8838  H HB   . THR A 1 67  ? -3.903  -5.704  16.029  1.00 0.00 ? 459 THR A HB   4  
ATOM 8839  H HG1  . THR A 1 67  ? -6.232  -4.639  14.841  1.00 0.00 ? 459 THR A HG1  4  
ATOM 8840  H HG21 . THR A 1 67  ? -4.497  -3.124  14.555  1.00 0.00 ? 459 THR A HG21 4  
ATOM 8841  H HG22 . THR A 1 67  ? -4.569  -3.340  16.301  1.00 0.00 ? 459 THR A HG22 4  
ATOM 8842  H HG23 . THR A 1 67  ? -3.027  -3.487  15.459  1.00 0.00 ? 459 THR A HG23 4  
ATOM 8843  N N    . THR A 1 68  ? -4.439  -7.844  13.064  1.00 0.00 ? 460 THR A N    4  
ATOM 8844  C CA   . THR A 1 68  ? -4.478  -9.293  12.937  1.00 0.00 ? 460 THR A CA   4  
ATOM 8845  C C    . THR A 1 68  ? -3.223  -9.816  12.204  1.00 0.00 ? 460 THR A C    4  
ATOM 8846  O O    . THR A 1 68  ? -2.825  -10.974 12.361  1.00 0.00 ? 460 THR A O    4  
ATOM 8847  C CB   . THR A 1 68  ? -5.774  -9.747  12.189  1.00 0.00 ? 460 THR A CB   4  
ATOM 8848  O OG1  . THR A 1 68  ? -5.909  -11.174 12.199  1.00 0.00 ? 460 THR A OG1  4  
ATOM 8849  C CG2  . THR A 1 68  ? -5.809  -9.247  10.743  1.00 0.00 ? 460 THR A CG2  4  
ATOM 8850  H H    . THR A 1 68  ? -5.069  -7.302  12.543  1.00 0.00 ? 460 THR A H    4  
ATOM 8851  H HA   . THR A 1 68  ? -4.493  -9.709  13.933  1.00 0.00 ? 460 THR A HA   4  
ATOM 8852  H HB   . THR A 1 68  ? -6.597  -9.311  12.725  1.00 0.00 ? 460 THR A HB   4  
ATOM 8853  H HG1  . THR A 1 68  ? -5.782  -11.501 11.299  1.00 0.00 ? 460 THR A HG1  4  
ATOM 8854  H HG21 . THR A 1 68  ? -4.955  -9.634  10.207  1.00 0.00 ? 460 THR A HG21 4  
ATOM 8855  H HG22 . THR A 1 68  ? -6.716  -9.588  10.264  1.00 0.00 ? 460 THR A HG22 4  
ATOM 8856  H HG23 . THR A 1 68  ? -5.779  -8.167  10.733  1.00 0.00 ? 460 THR A HG23 4  
ATOM 8857  N N    . LEU A 1 69  ? -2.582  -8.948  11.462  1.00 0.00 ? 461 LEU A N    4  
ATOM 8858  C CA   . LEU A 1 69  ? -1.428  -9.310  10.649  1.00 0.00 ? 461 LEU A CA   4  
ATOM 8859  C C    . LEU A 1 69  ? -0.115  -9.190  11.426  1.00 0.00 ? 461 LEU A C    4  
ATOM 8860  O O    . LEU A 1 69  ? 0.961   -9.262  10.836  1.00 0.00 ? 461 LEU A O    4  
ATOM 8861  C CB   . LEU A 1 69  ? -1.375  -8.444  9.397   1.00 0.00 ? 461 LEU A CB   4  
ATOM 8862  C CG   . LEU A 1 69  ? -2.595  -8.494  8.476   1.00 0.00 ? 461 LEU A CG   4  
ATOM 8863  C CD1  . LEU A 1 69  ? -2.401  -7.555  7.318   1.00 0.00 ? 461 LEU A CD1  4  
ATOM 8864  C CD2  . LEU A 1 69  ? -2.864  -9.910  7.977   1.00 0.00 ? 461 LEU A CD2  4  
ATOM 8865  H H    . LEU A 1 69  ? -2.905  -8.019  11.452  1.00 0.00 ? 461 LEU A H    4  
ATOM 8866  H HA   . LEU A 1 69  ? -1.550  -10.339 10.346  1.00 0.00 ? 461 LEU A HA   4  
ATOM 8867  H HB2  . LEU A 1 69  ? -1.241  -7.420  9.714   1.00 0.00 ? 461 LEU A HB2  4  
ATOM 8868  H HB3  . LEU A 1 69  ? -0.507  -8.734  8.823   1.00 0.00 ? 461 LEU A HB3  4  
ATOM 8869  H HG   . LEU A 1 69  ? -3.461  -8.153  9.022   1.00 0.00 ? 461 LEU A HG   4  
ATOM 8870  H HD11 . LEU A 1 69  ? -1.509  -7.828  6.772   1.00 0.00 ? 461 LEU A HD11 4  
ATOM 8871  H HD12 . LEU A 1 69  ? -3.258  -7.621  6.666   1.00 0.00 ? 461 LEU A HD12 4  
ATOM 8872  H HD13 . LEU A 1 69  ? -2.304  -6.543  7.684   1.00 0.00 ? 461 LEU A HD13 4  
ATOM 8873  H HD21 . LEU A 1 69  ? -1.998  -10.277 7.444   1.00 0.00 ? 461 LEU A HD21 4  
ATOM 8874  H HD22 . LEU A 1 69  ? -3.071  -10.558 8.815   1.00 0.00 ? 461 LEU A HD22 4  
ATOM 8875  H HD23 . LEU A 1 69  ? -3.714  -9.898  7.313   1.00 0.00 ? 461 LEU A HD23 4  
ATOM 8876  N N    . GLY A 1 70  ? -0.220  -9.010  12.739  1.00 0.00 ? 462 GLY A N    4  
ATOM 8877  C CA   . GLY A 1 70  ? 0.952   -8.904  13.624  1.00 0.00 ? 462 GLY A CA   4  
ATOM 8878  C C    . GLY A 1 70  ? 2.051   -9.962  13.362  1.00 0.00 ? 462 GLY A C    4  
ATOM 8879  O O    . GLY A 1 70  ? 3.184   -9.592  13.048  1.00 0.00 ? 462 GLY A O    4  
ATOM 8880  H H    . GLY A 1 70  ? -1.119  -8.936  13.122  1.00 0.00 ? 462 GLY A H    4  
ATOM 8881  H HA2  . GLY A 1 70  ? 1.389   -7.924  13.498  1.00 0.00 ? 462 GLY A HA2  4  
ATOM 8882  H HA3  . GLY A 1 70  ? 0.618   -8.998  14.646  1.00 0.00 ? 462 GLY A HA3  4  
ATOM 8883  N N    . PRO A 1 71  ? 1.740   -11.293 13.452  1.00 0.00 ? 463 PRO A N    4  
ATOM 8884  C CA   . PRO A 1 71  ? 2.732   -12.374 13.200  1.00 0.00 ? 463 PRO A CA   4  
ATOM 8885  C C    . PRO A 1 71  ? 3.290   -12.344 11.771  1.00 0.00 ? 463 PRO A C    4  
ATOM 8886  O O    . PRO A 1 71  ? 4.410   -12.807 11.513  1.00 0.00 ? 463 PRO A O    4  
ATOM 8887  C CB   . PRO A 1 71  ? 1.922   -13.668 13.408  1.00 0.00 ? 463 PRO A CB   4  
ATOM 8888  C CG   . PRO A 1 71  ? 0.494   -13.250 13.303  1.00 0.00 ? 463 PRO A CG   4  
ATOM 8889  C CD   . PRO A 1 71  ? 0.436   -11.859 13.846  1.00 0.00 ? 463 PRO A CD   4  
ATOM 8890  H HA   . PRO A 1 71  ? 3.549   -12.337 13.904  1.00 0.00 ? 463 PRO A HA   4  
ATOM 8891  H HB2  . PRO A 1 71  ? 2.184   -14.380 12.639  1.00 0.00 ? 463 PRO A HB2  4  
ATOM 8892  H HB3  . PRO A 1 71  ? 2.140   -14.090 14.377  1.00 0.00 ? 463 PRO A HB3  4  
ATOM 8893  H HG2  . PRO A 1 71  ? 0.184   -13.263 12.269  1.00 0.00 ? 463 PRO A HG2  4  
ATOM 8894  H HG3  . PRO A 1 71  ? -0.131  -13.907 13.889  1.00 0.00 ? 463 PRO A HG3  4  
ATOM 8895  H HD2  . PRO A 1 71  ? -0.375  -11.306 13.397  1.00 0.00 ? 463 PRO A HD2  4  
ATOM 8896  H HD3  . PRO A 1 71  ? 0.338   -11.878 14.921  1.00 0.00 ? 463 PRO A HD3  4  
ATOM 8897  N N    . LEU A 1 72  ? 2.524   -11.773 10.868  1.00 0.00 ? 464 LEU A N    4  
ATOM 8898  C CA   . LEU A 1 72  ? 2.891   -11.715 9.476   1.00 0.00 ? 464 LEU A CA   4  
ATOM 8899  C C    . LEU A 1 72  ? 3.973   -10.660 9.259   1.00 0.00 ? 464 LEU A C    4  
ATOM 8900  O O    . LEU A 1 72  ? 5.000   -10.937 8.643   1.00 0.00 ? 464 LEU A O    4  
ATOM 8901  C CB   . LEU A 1 72  ? 1.645   -11.441 8.625   1.00 0.00 ? 464 LEU A CB   4  
ATOM 8902  C CG   . LEU A 1 72  ? 1.824   -11.387 7.111   1.00 0.00 ? 464 LEU A CG   4  
ATOM 8903  C CD1  . LEU A 1 72  ? 2.397   -12.692 6.575   1.00 0.00 ? 464 LEU A CD1  4  
ATOM 8904  C CD2  . LEU A 1 72  ? 0.493   -11.100 6.465   1.00 0.00 ? 464 LEU A CD2  4  
ATOM 8905  H H    . LEU A 1 72  ? 1.692   -11.351 11.166  1.00 0.00 ? 464 LEU A H    4  
ATOM 8906  H HA   . LEU A 1 72  ? 3.297   -12.675 9.202   1.00 0.00 ? 464 LEU A HA   4  
ATOM 8907  H HB2  . LEU A 1 72  ? 0.924   -12.214 8.845   1.00 0.00 ? 464 LEU A HB2  4  
ATOM 8908  H HB3  . LEU A 1 72  ? 1.229   -10.498 8.950   1.00 0.00 ? 464 LEU A HB3  4  
ATOM 8909  H HG   . LEU A 1 72  ? 2.494   -10.579 6.854   1.00 0.00 ? 464 LEU A HG   4  
ATOM 8910  H HD11 . LEU A 1 72  ? 1.737   -13.509 6.829   1.00 0.00 ? 464 LEU A HD11 4  
ATOM 8911  H HD12 . LEU A 1 72  ? 2.490   -12.628 5.501   1.00 0.00 ? 464 LEU A HD12 4  
ATOM 8912  H HD13 . LEU A 1 72  ? 3.371   -12.865 7.007   1.00 0.00 ? 464 LEU A HD13 4  
ATOM 8913  H HD21 . LEU A 1 72  ? -0.208  -11.880 6.722   1.00 0.00 ? 464 LEU A HD21 4  
ATOM 8914  H HD22 . LEU A 1 72  ? 0.119   -10.149 6.817   1.00 0.00 ? 464 LEU A HD22 4  
ATOM 8915  H HD23 . LEU A 1 72  ? 0.619   -11.067 5.394   1.00 0.00 ? 464 LEU A HD23 4  
ATOM 8916  N N    . PHE A 1 73  ? 3.775   -9.477  9.843   1.00 0.00 ? 465 PHE A N    4  
ATOM 8917  C CA   . PHE A 1 73  ? 4.743   -8.377  9.715   1.00 0.00 ? 465 PHE A CA   4  
ATOM 8918  C C    . PHE A 1 73  ? 6.022   -8.650  10.486  1.00 0.00 ? 465 PHE A C    4  
ATOM 8919  O O    . PHE A 1 73  ? 7.035   -7.981  10.286  1.00 0.00 ? 465 PHE A O    4  
ATOM 8920  C CB   . PHE A 1 73  ? 4.154   -7.029  10.141  1.00 0.00 ? 465 PHE A CB   4  
ATOM 8921  C CG   . PHE A 1 73  ? 3.053   -6.531  9.259   1.00 0.00 ? 465 PHE A CG   4  
ATOM 8922  C CD1  . PHE A 1 73  ? 1.811   -6.233  9.782   1.00 0.00 ? 465 PHE A CD1  4  
ATOM 8923  C CD2  . PHE A 1 73  ? 3.262   -6.360  7.900   1.00 0.00 ? 465 PHE A CD2  4  
ATOM 8924  C CE1  . PHE A 1 73  ? 0.798   -5.773  8.970   1.00 0.00 ? 465 PHE A CE1  4  
ATOM 8925  C CE2  . PHE A 1 73  ? 2.253   -5.903  7.084   1.00 0.00 ? 465 PHE A CE2  4  
ATOM 8926  C CZ   . PHE A 1 73  ? 1.019   -5.610  7.620   1.00 0.00 ? 465 PHE A CZ   4  
ATOM 8927  H H    . PHE A 1 73  ? 2.953   -9.338  10.362  1.00 0.00 ? 465 PHE A H    4  
ATOM 8928  H HA   . PHE A 1 73  ? 5.004   -8.320  8.669   1.00 0.00 ? 465 PHE A HA   4  
ATOM 8929  H HB2  . PHE A 1 73  ? 3.757   -7.122  11.141  1.00 0.00 ? 465 PHE A HB2  4  
ATOM 8930  H HB3  . PHE A 1 73  ? 4.942   -6.288  10.147  1.00 0.00 ? 465 PHE A HB3  4  
ATOM 8931  H HD1  . PHE A 1 73  ? 1.635   -6.362  10.840  1.00 0.00 ? 465 PHE A HD1  4  
ATOM 8932  H HD2  . PHE A 1 73  ? 4.229   -6.590  7.478   1.00 0.00 ? 465 PHE A HD2  4  
ATOM 8933  H HE1  . PHE A 1 73  ? -0.169  -5.545  9.390   1.00 0.00 ? 465 PHE A HE1  4  
ATOM 8934  H HE2  . PHE A 1 73  ? 2.428   -5.775  6.025   1.00 0.00 ? 465 PHE A HE2  4  
ATOM 8935  H HZ   . PHE A 1 73  ? 0.224   -5.249  6.984   1.00 0.00 ? 465 PHE A HZ   4  
ATOM 8936  N N    . ARG A 1 74  ? 5.983   -9.626  11.370  1.00 0.00 ? 466 ARG A N    4  
ATOM 8937  C CA   . ARG A 1 74  ? 7.167   -10.001 12.122  1.00 0.00 ? 466 ARG A CA   4  
ATOM 8938  C C    . ARG A 1 74  ? 8.176   -10.717 11.233  1.00 0.00 ? 466 ARG A C    4  
ATOM 8939  O O    . ARG A 1 74  ? 9.350   -10.815 11.569  1.00 0.00 ? 466 ARG A O    4  
ATOM 8940  C CB   . ARG A 1 74  ? 6.821   -10.830 13.352  1.00 0.00 ? 466 ARG A CB   4  
ATOM 8941  C CG   . ARG A 1 74  ? 6.090   -10.047 14.422  1.00 0.00 ? 466 ARG A CG   4  
ATOM 8942  C CD   . ARG A 1 74  ? 5.796   -10.906 15.627  1.00 0.00 ? 466 ARG A CD   4  
ATOM 8943  N NE   . ARG A 1 74  ? 5.160   -10.137 16.701  1.00 0.00 ? 466 ARG A NE   4  
ATOM 8944  C CZ   . ARG A 1 74  ? 4.954   -10.584 17.950  1.00 0.00 ? 466 ARG A CZ   4  
ATOM 8945  N NH1  . ARG A 1 74  ? 5.284   -11.840 18.279  1.00 0.00 ? 466 ARG A NH1  4  
ATOM 8946  N NH2  . ARG A 1 74  ? 4.401   -9.781  18.857  1.00 0.00 ? 466 ARG A NH2  4  
ATOM 8947  H H    . ARG A 1 74  ? 5.131   -10.092 11.509  1.00 0.00 ? 466 ARG A H    4  
ATOM 8948  H HA   . ARG A 1 74  ? 7.625   -9.076  12.441  1.00 0.00 ? 466 ARG A HA   4  
ATOM 8949  H HB2  . ARG A 1 74  ? 6.187   -11.650 13.047  1.00 0.00 ? 466 ARG A HB2  4  
ATOM 8950  H HB3  . ARG A 1 74  ? 7.732   -11.224 13.780  1.00 0.00 ? 466 ARG A HB3  4  
ATOM 8951  H HG2  . ARG A 1 74  ? 6.704   -9.213  14.731  1.00 0.00 ? 466 ARG A HG2  4  
ATOM 8952  H HG3  . ARG A 1 74  ? 5.160   -9.679  14.014  1.00 0.00 ? 466 ARG A HG3  4  
ATOM 8953  H HD2  . ARG A 1 74  ? 5.133   -11.701 15.324  1.00 0.00 ? 466 ARG A HD2  4  
ATOM 8954  H HD3  . ARG A 1 74  ? 6.721   -11.325 15.995  1.00 0.00 ? 466 ARG A HD3  4  
ATOM 8955  H HE   . ARG A 1 74  ? 4.889   -9.223  16.455  1.00 0.00 ? 466 ARG A HE   4  
ATOM 8956  H HH11 . ARG A 1 74  ? 5.686   -12.480 17.619  1.00 0.00 ? 466 ARG A HH11 4  
ATOM 8957  H HH12 . ARG A 1 74  ? 5.137   -12.208 19.200  1.00 0.00 ? 466 ARG A HH12 4  
ATOM 8958  H HH21 . ARG A 1 74  ? 4.124   -8.842  18.641  1.00 0.00 ? 466 ARG A HH21 4  
ATOM 8959  H HH22 . ARG A 1 74  ? 4.246   -10.069 19.807  1.00 0.00 ? 466 ARG A HH22 4  
ATOM 8960  N N    . ASN A 1 75  ? 7.721   -11.186 10.098  1.00 0.00 ? 467 ASN A N    4  
ATOM 8961  C CA   . ASN A 1 75  ? 8.586   -11.804 9.116   1.00 0.00 ? 467 ASN A CA   4  
ATOM 8962  C C    . ASN A 1 75  ? 8.379   -11.130 7.790   1.00 0.00 ? 467 ASN A C    4  
ATOM 8963  O O    . ASN A 1 75  ? 7.628   -11.611 6.937   1.00 0.00 ? 467 ASN A O    4  
ATOM 8964  C CB   . ASN A 1 75  ? 8.359   -13.322 9.003   1.00 0.00 ? 467 ASN A CB   4  
ATOM 8965  C CG   . ASN A 1 75  ? 8.841   -14.116 10.213  1.00 0.00 ? 467 ASN A CG   4  
ATOM 8966  O OD1  . ASN A 1 75  ? 8.226   -15.118 10.591  1.00 0.00 ? 467 ASN A OD1  4  
ATOM 8967  N ND2  . ASN A 1 75  ? 9.946   -13.719 10.805  1.00 0.00 ? 467 ASN A ND2  4  
ATOM 8968  H H    . ASN A 1 75  ? 6.765   -11.096 9.886   1.00 0.00 ? 467 ASN A H    4  
ATOM 8969  H HA   . ASN A 1 75  ? 9.602   -11.617 9.431   1.00 0.00 ? 467 ASN A HA   4  
ATOM 8970  H HB2  . ASN A 1 75  ? 7.302   -13.507 8.886   1.00 0.00 ? 467 ASN A HB2  4  
ATOM 8971  H HB3  . ASN A 1 75  ? 8.876   -13.683 8.127   1.00 0.00 ? 467 ASN A HB3  4  
ATOM 8972  H HD21 . ASN A 1 75  ? 10.425  -12.930 10.463  1.00 0.00 ? 467 ASN A HD21 4  
ATOM 8973  H HD22 . ASN A 1 75  ? 10.269  -14.234 11.573  1.00 0.00 ? 467 ASN A HD22 4  
ATOM 8974  N N    . SER A 1 76  ? 8.952   -9.952  7.661   1.00 0.00 ? 468 SER A N    4  
ATOM 8975  C CA   . SER A 1 76  ? 8.832   -9.145  6.475   1.00 0.00 ? 468 SER A CA   4  
ATOM 8976  C C    . SER A 1 76  ? 10.058  -8.224  6.309   1.00 0.00 ? 468 SER A C    4  
ATOM 8977  O O    . SER A 1 76  ? 10.924  -8.147  7.187   1.00 0.00 ? 468 SER A O    4  
ATOM 8978  C CB   . SER A 1 76  ? 7.523   -8.326  6.500   1.00 0.00 ? 468 SER A CB   4  
ATOM 8979  O OG   . SER A 1 76  ? 6.378   -9.172  6.518   1.00 0.00 ? 468 SER A OG   4  
ATOM 8980  H H    . SER A 1 76  ? 9.488   -9.584  8.398   1.00 0.00 ? 468 SER A H    4  
ATOM 8981  H HA   . SER A 1 76  ? 8.802   -9.815  5.629   1.00 0.00 ? 468 SER A HA   4  
ATOM 8982  H HB2  . SER A 1 76  ? 7.500   -7.712  7.388   1.00 0.00 ? 468 SER A HB2  4  
ATOM 8983  H HB3  . SER A 1 76  ? 7.477   -7.697  5.623   1.00 0.00 ? 468 SER A HB3  4  
ATOM 8984  H HG   . SER A 1 76  ? 6.648   -10.057 6.797   1.00 0.00 ? 468 SER A HG   4  
ATOM 8985  N N    . ARG A 1 77  ? 10.119  -7.595  5.170   1.00 0.00 ? 469 ARG A N    4  
ATOM 8986  C CA   . ARG A 1 77  ? 11.155  -6.655  4.769   1.00 0.00 ? 469 ARG A CA   4  
ATOM 8987  C C    . ARG A 1 77  ? 10.555  -5.265  4.682   1.00 0.00 ? 469 ARG A C    4  
ATOM 8988  O O    . ARG A 1 77  ? 9.380   -5.137  4.295   1.00 0.00 ? 469 ARG A O    4  
ATOM 8989  C CB   . ARG A 1 77  ? 11.875  -7.097  3.483   1.00 0.00 ? 469 ARG A CB   4  
ATOM 8990  C CG   . ARG A 1 77  ? 10.966  -7.504  2.335   1.00 0.00 ? 469 ARG A CG   4  
ATOM 8991  C CD   . ARG A 1 77  ? 11.770  -8.067  1.166   1.00 0.00 ? 469 ARG A CD   4  
ATOM 8992  N NE   . ARG A 1 77  ? 12.654  -9.171  1.598   1.00 0.00 ? 469 ARG A NE   4  
ATOM 8993  C CZ   . ARG A 1 77  ? 13.281  -10.063 0.817   1.00 0.00 ? 469 ARG A CZ   4  
ATOM 8994  N NH1  . ARG A 1 77  ? 13.079  -10.086 -0.502  1.00 0.00 ? 469 ARG A NH1  4  
ATOM 8995  N NH2  . ARG A 1 77  ? 14.106  -10.932 1.376   1.00 0.00 ? 469 ARG A NH2  4  
ATOM 8996  H H    . ARG A 1 77  ? 9.386   -7.734  4.532   1.00 0.00 ? 469 ARG A H    4  
ATOM 8997  H HA   . ARG A 1 77  ? 11.858  -6.634  5.589   1.00 0.00 ? 469 ARG A HA   4  
ATOM 8998  H HB2  . ARG A 1 77  ? 12.490  -6.277  3.145   1.00 0.00 ? 469 ARG A HB2  4  
ATOM 8999  H HB3  . ARG A 1 77  ? 12.515  -7.931  3.729   1.00 0.00 ? 469 ARG A HB3  4  
ATOM 9000  H HG2  . ARG A 1 77  ? 10.272  -8.255  2.683   1.00 0.00 ? 469 ARG A HG2  4  
ATOM 9001  H HG3  . ARG A 1 77  ? 10.429  -6.630  2.002   1.00 0.00 ? 469 ARG A HG3  4  
ATOM 9002  H HD2  . ARG A 1 77  ? 11.083  -8.440  0.420   1.00 0.00 ? 469 ARG A HD2  4  
ATOM 9003  H HD3  . ARG A 1 77  ? 12.370  -7.274  0.747   1.00 0.00 ? 469 ARG A HD3  4  
ATOM 9004  H HE   . ARG A 1 77  ? 12.782  -9.226  2.577   1.00 0.00 ? 469 ARG A HE   4  
ATOM 9005  H HH11 . ARG A 1 77  ? 12.460  -9.447  -0.959  1.00 0.00 ? 469 ARG A HH11 4  
ATOM 9006  H HH12 . ARG A 1 77  ? 13.523  -10.769 -1.095  1.00 0.00 ? 469 ARG A HH12 4  
ATOM 9007  H HH21 . ARG A 1 77  ? 14.274  -10.927 2.369   1.00 0.00 ? 469 ARG A HH21 4  
ATOM 9008  H HH22 . ARG A 1 77  ? 14.599  -11.654 0.876   1.00 0.00 ? 469 ARG A HH22 4  
ATOM 9009  N N    . MET A 1 78  ? 11.303  -4.230  5.048   1.00 0.00 ? 470 MET A N    4  
ATOM 9010  C CA   . MET A 1 78  ? 10.700  -2.919  5.238   1.00 0.00 ? 470 MET A CA   4  
ATOM 9011  C C    . MET A 1 78  ? 10.838  -2.100  4.002   1.00 0.00 ? 470 MET A C    4  
ATOM 9012  O O    . MET A 1 78  ? 11.708  -2.338  3.193   1.00 0.00 ? 470 MET A O    4  
ATOM 9013  C CB   . MET A 1 78  ? 11.429  -2.197  6.367   1.00 0.00 ? 470 MET A CB   4  
ATOM 9014  C CG   . MET A 1 78  ? 10.933  -2.490  7.756   1.00 0.00 ? 470 MET A CG   4  
ATOM 9015  S SD   . MET A 1 78  ? 9.498   -1.494  8.208   1.00 0.00 ? 470 MET A SD   4  
ATOM 9016  C CE   . MET A 1 78  ? 10.169  0.166   8.123   1.00 0.00 ? 470 MET A CE   4  
ATOM 9017  H H    . MET A 1 78  ? 12.283  -4.282  5.143   1.00 0.00 ? 470 MET A H    4  
ATOM 9018  H HA   . MET A 1 78  ? 9.663   -3.026  5.515   1.00 0.00 ? 470 MET A HA   4  
ATOM 9019  H HB2  . MET A 1 78  ? 12.465  -2.501  6.331   1.00 0.00 ? 470 MET A HB2  4  
ATOM 9020  H HB3  . MET A 1 78  ? 11.369  -1.134  6.191   1.00 0.00 ? 470 MET A HB3  4  
ATOM 9021  H HG2  . MET A 1 78  ? 10.642  -3.530  7.772   1.00 0.00 ? 470 MET A HG2  4  
ATOM 9022  H HG3  . MET A 1 78  ? 11.728  -2.310  8.464   1.00 0.00 ? 470 MET A HG3  4  
ATOM 9023  H HE1  . MET A 1 78  ? 11.015  0.247   8.790   1.00 0.00 ? 470 MET A HE1  4  
ATOM 9024  H HE2  . MET A 1 78  ? 10.480  0.388   7.114   1.00 0.00 ? 470 MET A HE2  4  
ATOM 9025  H HE3  . MET A 1 78  ? 9.409   0.871   8.423   1.00 0.00 ? 470 MET A HE3  4  
ATOM 9026  N N    . VAL A 1 79  ? 9.924   -1.195  3.822   1.00 0.00 ? 471 VAL A N    4  
ATOM 9027  C CA   . VAL A 1 79  ? 9.907   -0.339  2.674   1.00 0.00 ? 471 VAL A CA   4  
ATOM 9028  C C    . VAL A 1 79  ? 9.830   1.118   3.104   1.00 0.00 ? 471 VAL A C    4  
ATOM 9029  O O    . VAL A 1 79  ? 9.501   1.431   4.265   1.00 0.00 ? 471 VAL A O    4  
ATOM 9030  C CB   . VAL A 1 79  ? 8.738   -0.678  1.697   1.00 0.00 ? 471 VAL A CB   4  
ATOM 9031  C CG1  . VAL A 1 79  ? 8.770   -2.135  1.288   1.00 0.00 ? 471 VAL A CG1  4  
ATOM 9032  C CG2  . VAL A 1 79  ? 7.396   -0.331  2.288   1.00 0.00 ? 471 VAL A CG2  4  
ATOM 9033  H H    . VAL A 1 79  ? 9.202   -1.093  4.483   1.00 0.00 ? 471 VAL A H    4  
ATOM 9034  H HA   . VAL A 1 79  ? 10.839  -0.484  2.153   1.00 0.00 ? 471 VAL A HA   4  
ATOM 9035  H HB   . VAL A 1 79  ? 8.881   -0.086  0.804   1.00 0.00 ? 471 VAL A HB   4  
ATOM 9036  H HG11 . VAL A 1 79  ? 8.760   -2.749  2.177   1.00 0.00 ? 471 VAL A HG11 4  
ATOM 9037  H HG12 . VAL A 1 79  ? 7.914   -2.363  0.672   1.00 0.00 ? 471 VAL A HG12 4  
ATOM 9038  H HG13 . VAL A 1 79  ? 9.672   -2.331  0.732   1.00 0.00 ? 471 VAL A HG13 4  
ATOM 9039  H HG21 . VAL A 1 79  ? 7.330   -0.782  3.268   1.00 0.00 ? 471 VAL A HG21 4  
ATOM 9040  H HG22 . VAL A 1 79  ? 7.310   0.739   2.392   1.00 0.00 ? 471 VAL A HG22 4  
ATOM 9041  H HG23 . VAL A 1 79  ? 6.601   -0.718  1.672   1.00 0.00 ? 471 VAL A HG23 4  
ATOM 9042  N N    . GLN A 1 80  ? 10.168  1.972   2.200   1.00 0.00 ? 472 GLN A N    4  
ATOM 9043  C CA   . GLN A 1 80  ? 10.168  3.388   2.391   1.00 0.00 ? 472 GLN A CA   4  
ATOM 9044  C C    . GLN A 1 80  ? 9.484   4.002   1.175   1.00 0.00 ? 472 GLN A C    4  
ATOM 9045  O O    . GLN A 1 80  ? 9.929   3.796   0.040   1.00 0.00 ? 472 GLN A O    4  
ATOM 9046  C CB   . GLN A 1 80  ? 11.630  3.846   2.487   1.00 0.00 ? 472 GLN A CB   4  
ATOM 9047  C CG   . GLN A 1 80  ? 11.864  5.334   2.717   1.00 0.00 ? 472 GLN A CG   4  
ATOM 9048  C CD   . GLN A 1 80  ? 11.296  5.832   4.027   1.00 0.00 ? 472 GLN A CD   4  
ATOM 9049  O OE1  . GLN A 1 80  ? 11.184  5.090   5.001   1.00 0.00 ? 472 GLN A OE1  4  
ATOM 9050  N NE2  . GLN A 1 80  ? 10.989  7.091   4.080   1.00 0.00 ? 472 GLN A NE2  4  
ATOM 9051  H H    . GLN A 1 80  ? 10.450  1.635   1.319   1.00 0.00 ? 472 GLN A H    4  
ATOM 9052  H HA   . GLN A 1 80  ? 9.642   3.637   3.300   1.00 0.00 ? 472 GLN A HA   4  
ATOM 9053  H HB2  . GLN A 1 80  ? 12.101  3.311   3.300   1.00 0.00 ? 472 GLN A HB2  4  
ATOM 9054  H HB3  . GLN A 1 80  ? 12.111  3.561   1.566   1.00 0.00 ? 472 GLN A HB3  4  
ATOM 9055  H HG2  . GLN A 1 80  ? 12.926  5.526   2.711   1.00 0.00 ? 472 GLN A HG2  4  
ATOM 9056  H HG3  . GLN A 1 80  ? 11.403  5.881   1.907   1.00 0.00 ? 472 GLN A HG3  4  
ATOM 9057  H HE21 . GLN A 1 80  ? 11.140  7.650   3.289   1.00 0.00 ? 472 GLN A HE21 4  
ATOM 9058  H HE22 . GLN A 1 80  ? 10.627  7.432   4.923   1.00 0.00 ? 472 GLN A HE22 4  
ATOM 9059  N N    . PHE A 1 81  ? 8.408   4.706   1.408   1.00 0.00 ? 473 PHE A N    4  
ATOM 9060  C CA   . PHE A 1 81  ? 7.630   5.318   0.355   1.00 0.00 ? 473 PHE A CA   4  
ATOM 9061  C C    . PHE A 1 81  ? 7.657   6.826   0.449   1.00 0.00 ? 473 PHE A C    4  
ATOM 9062  O O    . PHE A 1 81  ? 7.340   7.428   1.512   1.00 0.00 ? 473 PHE A O    4  
ATOM 9063  C CB   . PHE A 1 81  ? 6.168   4.859   0.382   1.00 0.00 ? 473 PHE A CB   4  
ATOM 9064  C CG   . PHE A 1 81  ? 5.855   3.562   -0.289  1.00 0.00 ? 473 PHE A CG   4  
ATOM 9065  C CD1  . PHE A 1 81  ? 6.033   2.352   0.353   1.00 0.00 ? 473 PHE A CD1  4  
ATOM 9066  C CD2  . PHE A 1 81  ? 5.343   3.564   -1.575  1.00 0.00 ? 473 PHE A CD2  4  
ATOM 9067  C CE1  . PHE A 1 81  ? 5.707   1.178   -0.289  1.00 0.00 ? 473 PHE A CE1  4  
ATOM 9068  C CE2  . PHE A 1 81  ? 5.021   2.384   -2.209  1.00 0.00 ? 473 PHE A CE2  4  
ATOM 9069  C CZ   . PHE A 1 81  ? 5.205   1.194   -1.566  1.00 0.00 ? 473 PHE A CZ   4  
ATOM 9070  H H    . PHE A 1 81  ? 8.110   4.863   2.334   1.00 0.00 ? 473 PHE A H    4  
ATOM 9071  H HA   . PHE A 1 81  ? 8.060   5.011   -0.588  1.00 0.00 ? 473 PHE A HA   4  
ATOM 9072  H HB2  . PHE A 1 81  ? 5.874   4.739   1.414   1.00 0.00 ? 473 PHE A HB2  4  
ATOM 9073  H HB3  . PHE A 1 81  ? 5.556   5.629   -0.067  1.00 0.00 ? 473 PHE A HB3  4  
ATOM 9074  H HD1  . PHE A 1 81  ? 6.417   2.311   1.365   1.00 0.00 ? 473 PHE A HD1  4  
ATOM 9075  H HD2  . PHE A 1 81  ? 5.193   4.504   -2.084  1.00 0.00 ? 473 PHE A HD2  4  
ATOM 9076  H HE1  . PHE A 1 81  ? 5.846   0.235   0.212   1.00 0.00 ? 473 PHE A HE1  4  
ATOM 9077  H HE2  . PHE A 1 81  ? 4.631   2.388   -3.217  1.00 0.00 ? 473 PHE A HE2  4  
ATOM 9078  H HZ   . PHE A 1 81  ? 4.952   0.267   -2.062  1.00 0.00 ? 473 PHE A HZ   4  
ATOM 9079  N N    . HIS A 1 82  ? 8.024   7.427   -0.637  1.00 0.00 ? 474 HIS A N    4  
ATOM 9080  C CA   . HIS A 1 82  ? 7.998   8.855   -0.773  1.00 0.00 ? 474 HIS A CA   4  
ATOM 9081  C C    . HIS A 1 82  ? 7.317   9.149   -2.090  1.00 0.00 ? 474 HIS A C    4  
ATOM 9082  O O    . HIS A 1 82  ? 7.745   8.657   -3.119  1.00 0.00 ? 474 HIS A O    4  
ATOM 9083  C CB   . HIS A 1 82  ? 9.432   9.408   -0.763  1.00 0.00 ? 474 HIS A CB   4  
ATOM 9084  C CG   . HIS A 1 82  ? 9.529   10.908  -0.797  1.00 0.00 ? 474 HIS A CG   4  
ATOM 9085  N ND1  . HIS A 1 82  ? 9.883   11.635  -1.913  1.00 0.00 ? 474 HIS A ND1  4  
ATOM 9086  C CD2  . HIS A 1 82  ? 9.337   11.814  0.193   1.00 0.00 ? 474 HIS A CD2  4  
ATOM 9087  C CE1  . HIS A 1 82  ? 9.899   12.930  -1.576  1.00 0.00 ? 474 HIS A CE1  4  
ATOM 9088  N NE2  . HIS A 1 82  ? 9.573   13.092  -0.303  1.00 0.00 ? 474 HIS A NE2  4  
ATOM 9089  H H    . HIS A 1 82  ? 8.330   6.883   -1.401  1.00 0.00 ? 474 HIS A H    4  
ATOM 9090  H HA   . HIS A 1 82  ? 7.429   9.276   0.043   1.00 0.00 ? 474 HIS A HA   4  
ATOM 9091  H HB2  . HIS A 1 82  ? 9.925   9.071   0.135   1.00 0.00 ? 474 HIS A HB2  4  
ATOM 9092  H HB3  . HIS A 1 82  ? 9.959   9.019   -1.623  1.00 0.00 ? 474 HIS A HB3  4  
ATOM 9093  H HD1  . HIS A 1 82  ? 10.079  11.268  -2.809  1.00 0.00 ? 474 HIS A HD1  4  
ATOM 9094  H HD2  . HIS A 1 82  ? 9.047   11.590  1.208   1.00 0.00 ? 474 HIS A HD2  4  
ATOM 9095  H HE1  . HIS A 1 82  ? 10.143  13.736  -2.252  1.00 0.00 ? 474 HIS A HE1  4  
ATOM 9096  N N    . PHE A 1 83  ? 6.269   9.908   -2.069  1.00 0.00 ? 475 PHE A N    4  
ATOM 9097  C CA   . PHE A 1 83  ? 5.536   10.188  -3.285  1.00 0.00 ? 475 PHE A CA   4  
ATOM 9098  C C    . PHE A 1 83  ? 6.160   11.307  -4.068  1.00 0.00 ? 475 PHE A C    4  
ATOM 9099  O O    . PHE A 1 83  ? 6.873   12.143  -3.511  1.00 0.00 ? 475 PHE A O    4  
ATOM 9100  C CB   . PHE A 1 83  ? 4.062   10.470  -3.008  1.00 0.00 ? 475 PHE A CB   4  
ATOM 9101  C CG   . PHE A 1 83  ? 3.260   9.246   -2.661  1.00 0.00 ? 475 PHE A CG   4  
ATOM 9102  C CD1  . PHE A 1 83  ? 2.463   8.642   -3.619  1.00 0.00 ? 475 PHE A CD1  4  
ATOM 9103  C CD2  . PHE A 1 83  ? 3.300   8.701   -1.392  1.00 0.00 ? 475 PHE A CD2  4  
ATOM 9104  C CE1  . PHE A 1 83  ? 1.723   7.521   -3.317  1.00 0.00 ? 475 PHE A CE1  4  
ATOM 9105  C CE2  . PHE A 1 83  ? 2.561   7.577   -1.085  1.00 0.00 ? 475 PHE A CE2  4  
ATOM 9106  C CZ   . PHE A 1 83  ? 1.772   6.987   -2.046  1.00 0.00 ? 475 PHE A CZ   4  
ATOM 9107  H H    . PHE A 1 83  ? 5.986   10.323  -1.226  1.00 0.00 ? 475 PHE A H    4  
ATOM 9108  H HA   . PHE A 1 83  ? 5.599   9.292   -3.882  1.00 0.00 ? 475 PHE A HA   4  
ATOM 9109  H HB2  . PHE A 1 83  ? 3.983   11.160  -2.180  1.00 0.00 ? 475 PHE A HB2  4  
ATOM 9110  H HB3  . PHE A 1 83  ? 3.621   10.918  -3.888  1.00 0.00 ? 475 PHE A HB3  4  
ATOM 9111  H HD1  . PHE A 1 83  ? 2.425   9.060   -4.614  1.00 0.00 ? 475 PHE A HD1  4  
ATOM 9112  H HD2  . PHE A 1 83  ? 3.917   9.161   -0.636  1.00 0.00 ? 475 PHE A HD2  4  
ATOM 9113  H HE1  . PHE A 1 83  ? 1.107   7.063   -4.076  1.00 0.00 ? 475 PHE A HE1  4  
ATOM 9114  H HE2  . PHE A 1 83  ? 2.603   7.162   -0.090  1.00 0.00 ? 475 PHE A HE2  4  
ATOM 9115  H HZ   . PHE A 1 83  ? 1.195   6.107   -1.802  1.00 0.00 ? 475 PHE A HZ   4  
ATOM 9116  N N    . THR A 1 84  ? 5.932   11.307  -5.363  1.00 0.00 ? 476 THR A N    4  
ATOM 9117  C CA   . THR A 1 84  ? 6.456   12.349  -6.196  1.00 0.00 ? 476 THR A CA   4  
ATOM 9118  C C    . THR A 1 84  ? 5.699   13.648  -5.936  1.00 0.00 ? 476 THR A C    4  
ATOM 9119  O O    . THR A 1 84  ? 4.465   13.655  -5.856  1.00 0.00 ? 476 THR A O    4  
ATOM 9120  C CB   . THR A 1 84  ? 6.410   11.964  -7.692  1.00 0.00 ? 476 THR A CB   4  
ATOM 9121  O OG1  . THR A 1 84  ? 5.061   11.640  -8.083  1.00 0.00 ? 476 THR A OG1  4  
ATOM 9122  C CG2  . THR A 1 84  ? 7.318   10.772  -7.966  1.00 0.00 ? 476 THR A CG2  4  
ATOM 9123  H H    . THR A 1 84  ? 5.391   10.587  -5.759  1.00 0.00 ? 476 THR A H    4  
ATOM 9124  H HA   . THR A 1 84  ? 7.486   12.498  -5.904  1.00 0.00 ? 476 THR A HA   4  
ATOM 9125  H HB   . THR A 1 84  ? 6.752   12.808  -8.272  1.00 0.00 ? 476 THR A HB   4  
ATOM 9126  H HG1  . THR A 1 84  ? 4.542   11.463  -7.289  1.00 0.00 ? 476 THR A HG1  4  
ATOM 9127  H HG21 . THR A 1 84  ? 6.994   9.931   -7.369  1.00 0.00 ? 476 THR A HG21 4  
ATOM 9128  H HG22 . THR A 1 84  ? 7.265   10.512  -9.012  1.00 0.00 ? 476 THR A HG22 4  
ATOM 9129  H HG23 . THR A 1 84  ? 8.336   11.026  -7.711  1.00 0.00 ? 476 THR A HG23 4  
ATOM 9130  N N    . ASN A 1 85  ? 6.427   14.734  -5.834  1.00 0.00 ? 477 ASN A N    4  
ATOM 9131  C CA   . ASN A 1 85  ? 5.865   16.045  -5.461  1.00 0.00 ? 477 ASN A CA   4  
ATOM 9132  C C    . ASN A 1 85  ? 5.122   16.748  -6.615  1.00 0.00 ? 477 ASN A C    4  
ATOM 9133  O O    . ASN A 1 85  ? 4.888   17.954  -6.561  1.00 0.00 ? 477 ASN A O    4  
ATOM 9134  C CB   . ASN A 1 85  ? 6.969   16.966  -4.883  1.00 0.00 ? 477 ASN A CB   4  
ATOM 9135  C CG   . ASN A 1 85  ? 8.119   17.224  -5.848  1.00 0.00 ? 477 ASN A CG   4  
ATOM 9136  O OD1  . ASN A 1 85  ? 8.084   18.153  -6.642  1.00 0.00 ? 477 ASN A OD1  4  
ATOM 9137  N ND2  . ASN A 1 85  ? 9.159   16.425  -5.764  1.00 0.00 ? 477 ASN A ND2  4  
ATOM 9138  H H    . ASN A 1 85  ? 7.388   14.665  -6.018  1.00 0.00 ? 477 ASN A H    4  
ATOM 9139  H HA   . ASN A 1 85  ? 5.147   15.859  -4.677  1.00 0.00 ? 477 ASN A HA   4  
ATOM 9140  H HB2  . ASN A 1 85  ? 6.531   17.919  -4.627  1.00 0.00 ? 477 ASN A HB2  4  
ATOM 9141  H HB3  . ASN A 1 85  ? 7.370   16.514  -3.988  1.00 0.00 ? 477 ASN A HB3  4  
ATOM 9142  H HD21 . ASN A 1 85  ? 9.176   15.703  -5.100  1.00 0.00 ? 477 ASN A HD21 4  
ATOM 9143  H HD22 . ASN A 1 85  ? 9.907   16.578  -6.382  1.00 0.00 ? 477 ASN A HD22 4  
ATOM 9144  N N    . LYS A 1 86  ? 4.701   15.985  -7.615  1.00 0.00 ? 478 LYS A N    4  
ATOM 9145  C CA   . LYS A 1 86  ? 3.979   16.541  -8.747  1.00 0.00 ? 478 LYS A CA   4  
ATOM 9146  C C    . LYS A 1 86  ? 2.595   17.044  -8.335  1.00 0.00 ? 478 LYS A C    4  
ATOM 9147  O O    . LYS A 1 86  ? 2.227   18.184  -8.624  1.00 0.00 ? 478 LYS A O    4  
ATOM 9148  C CB   . LYS A 1 86  ? 3.835   15.518  -9.885  1.00 0.00 ? 478 LYS A CB   4  
ATOM 9149  C CG   . LYS A 1 86  ? 2.960   16.036  -11.030 1.00 0.00 ? 478 LYS A CG   4  
ATOM 9150  C CD   . LYS A 1 86  ? 2.803   15.039  -12.160 1.00 0.00 ? 478 LYS A CD   4  
ATOM 9151  C CE   . LYS A 1 86  ? 4.099   14.819  -12.907 1.00 0.00 ? 478 LYS A CE   4  
ATOM 9152  N NZ   . LYS A 1 86  ? 3.908   13.903  -14.048 1.00 0.00 ? 478 LYS A NZ   4  
ATOM 9153  H H    . LYS A 1 86  ? 4.871   15.022  -7.558  1.00 0.00 ? 478 LYS A H    4  
ATOM 9154  H HA   . LYS A 1 86  ? 4.552   17.377  -9.119  1.00 0.00 ? 478 LYS A HA   4  
ATOM 9155  H HB2  . LYS A 1 86  ? 4.816   15.289  -10.273 1.00 0.00 ? 478 LYS A HB2  4  
ATOM 9156  H HB3  . LYS A 1 86  ? 3.385   14.617  -9.493  1.00 0.00 ? 478 LYS A HB3  4  
ATOM 9157  H HG2  . LYS A 1 86  ? 1.982   16.259  -10.632 1.00 0.00 ? 478 LYS A HG2  4  
ATOM 9158  H HG3  . LYS A 1 86  ? 3.394   16.946  -11.416 1.00 0.00 ? 478 LYS A HG3  4  
ATOM 9159  H HD2  . LYS A 1 86  ? 2.475   14.094  -11.753 1.00 0.00 ? 478 LYS A HD2  4  
ATOM 9160  H HD3  . LYS A 1 86  ? 2.058   15.411  -12.848 1.00 0.00 ? 478 LYS A HD3  4  
ATOM 9161  H HE2  . LYS A 1 86  ? 4.448   15.777  -13.263 1.00 0.00 ? 478 LYS A HE2  4  
ATOM 9162  H HE3  . LYS A 1 86  ? 4.829   14.410  -12.224 1.00 0.00 ? 478 LYS A HE3  4  
ATOM 9163  H HZ1  . LYS A 1 86  ? 3.545   12.983  -13.729 1.00 0.00 ? 478 LYS A HZ1  4  
ATOM 9164  H HZ2  . LYS A 1 86  ? 3.223   14.299  -14.724 1.00 0.00 ? 478 LYS A HZ2  4  
ATOM 9165  H HZ3  . LYS A 1 86  ? 4.804   13.740  -14.549 1.00 0.00 ? 478 LYS A HZ3  4  
ATOM 9166  N N    . ASP A 1 87  ? 1.841   16.211  -7.645  1.00 0.00 ? 479 ASP A N    4  
ATOM 9167  C CA   . ASP A 1 87  ? 0.477   16.569  -7.306  1.00 0.00 ? 479 ASP A CA   4  
ATOM 9168  C C    . ASP A 1 87  ? 0.307   16.583  -5.809  1.00 0.00 ? 479 ASP A C    4  
ATOM 9169  O O    . ASP A 1 87  ? -0.089  15.581  -5.189  1.00 0.00 ? 479 ASP A O    4  
ATOM 9170  C CB   . ASP A 1 87  ? -0.516  15.600  -7.928  1.00 0.00 ? 479 ASP A CB   4  
ATOM 9171  C CG   . ASP A 1 87  ? -1.905  16.182  -8.080  1.00 0.00 ? 479 ASP A CG   4  
ATOM 9172  O OD1  . ASP A 1 87  ? -2.401  16.232  -9.230  1.00 0.00 ? 479 ASP A OD1  4  
ATOM 9173  O OD2  . ASP A 1 87  ? -2.545  16.576  -7.086  1.00 0.00 ? 479 ASP A OD2  4  
ATOM 9174  H H    . ASP A 1 87  ? 2.215   15.360  -7.336  1.00 0.00 ? 479 ASP A H    4  
ATOM 9175  H HA   . ASP A 1 87  ? 0.290   17.560  -7.690  1.00 0.00 ? 479 ASP A HA   4  
ATOM 9176  H HB2  . ASP A 1 87  ? -0.158  15.302  -8.901  1.00 0.00 ? 479 ASP A HB2  4  
ATOM 9177  H HB3  . ASP A 1 87  ? -0.582  14.723  -7.301  1.00 0.00 ? 479 ASP A HB3  4  
ATOM 9178  N N    . LEU A 1 88  ? 0.682   17.682  -5.227  1.00 0.00 ? 480 LEU A N    4  
ATOM 9179  C CA   . LEU A 1 88  ? 0.613   17.877  -3.796  1.00 0.00 ? 480 LEU A CA   4  
ATOM 9180  C C    . LEU A 1 88  ? -0.833  17.932  -3.311  1.00 0.00 ? 480 LEU A C    4  
ATOM 9181  O O    . LEU A 1 88  ? -1.122  17.660  -2.142  1.00 0.00 ? 480 LEU A O    4  
ATOM 9182  C CB   . LEU A 1 88  ? 1.392   19.131  -3.397  1.00 0.00 ? 480 LEU A CB   4  
ATOM 9183  C CG   . LEU A 1 88  ? 2.896   19.102  -3.720  1.00 0.00 ? 480 LEU A CG   4  
ATOM 9184  C CD1  . LEU A 1 88  ? 3.545   20.429  -3.390  1.00 0.00 ? 480 LEU A CD1  4  
ATOM 9185  C CD2  . LEU A 1 88  ? 3.588   17.974  -2.962  1.00 0.00 ? 480 LEU A CD2  4  
ATOM 9186  H H    . LEU A 1 88  ? 1.000   18.418  -5.796  1.00 0.00 ? 480 LEU A H    4  
ATOM 9187  H HA   . LEU A 1 88  ? 1.084   17.022  -3.335  1.00 0.00 ? 480 LEU A HA   4  
ATOM 9188  H HB2  . LEU A 1 88  ? 0.951   19.981  -3.897  1.00 0.00 ? 480 LEU A HB2  4  
ATOM 9189  H HB3  . LEU A 1 88  ? 1.285   19.271  -2.332  1.00 0.00 ? 480 LEU A HB3  4  
ATOM 9190  H HG   . LEU A 1 88  ? 3.024   18.923  -4.779  1.00 0.00 ? 480 LEU A HG   4  
ATOM 9191  H HD11 . LEU A 1 88  ? 3.066   21.210  -3.962  1.00 0.00 ? 480 LEU A HD11 4  
ATOM 9192  H HD12 . LEU A 1 88  ? 3.436   20.631  -2.334  1.00 0.00 ? 480 LEU A HD12 4  
ATOM 9193  H HD13 . LEU A 1 88  ? 4.594   20.387  -3.644  1.00 0.00 ? 480 LEU A HD13 4  
ATOM 9194  H HD21 . LEU A 1 88  ? 3.449   18.107  -1.899  1.00 0.00 ? 480 LEU A HD21 4  
ATOM 9195  H HD22 . LEU A 1 88  ? 3.173   17.026  -3.266  1.00 0.00 ? 480 LEU A HD22 4  
ATOM 9196  H HD23 . LEU A 1 88  ? 4.644   17.989  -3.189  1.00 0.00 ? 480 LEU A HD23 4  
ATOM 9197  N N    . GLU A 1 89  ? -1.727  18.303  -4.202  1.00 0.00 ? 481 GLU A N    4  
ATOM 9198  C CA   . GLU A 1 89  ? -3.143  18.383  -3.894  1.00 0.00 ? 481 GLU A CA   4  
ATOM 9199  C C    . GLU A 1 89  ? -3.789  17.012  -3.716  1.00 0.00 ? 481 GLU A C    4  
ATOM 9200  O O    . GLU A 1 89  ? -4.541  16.803  -2.767  1.00 0.00 ? 481 GLU A O    4  
ATOM 9201  C CB   . GLU A 1 89  ? -3.877  19.228  -4.912  1.00 0.00 ? 481 GLU A CB   4  
ATOM 9202  C CG   . GLU A 1 89  ? -3.469  20.686  -4.862  1.00 0.00 ? 481 GLU A CG   4  
ATOM 9203  C CD   . GLU A 1 89  ? -3.694  21.277  -3.493  1.00 0.00 ? 481 GLU A CD   4  
ATOM 9204  O OE1  . GLU A 1 89  ? -2.735  21.400  -2.711  1.00 0.00 ? 481 GLU A OE1  4  
ATOM 9205  O OE2  . GLU A 1 89  ? -4.839  21.613  -3.165  1.00 0.00 ? 481 GLU A OE2  4  
ATOM 9206  H H    . GLU A 1 89  ? -1.411  18.533  -5.102  1.00 0.00 ? 481 GLU A H    4  
ATOM 9207  H HA   . GLU A 1 89  ? -3.207  18.879  -2.937  1.00 0.00 ? 481 GLU A HA   4  
ATOM 9208  H HB2  . GLU A 1 89  ? -3.651  18.848  -5.896  1.00 0.00 ? 481 GLU A HB2  4  
ATOM 9209  H HB3  . GLU A 1 89  ? -4.940  19.163  -4.731  1.00 0.00 ? 481 GLU A HB3  4  
ATOM 9210  H HG2  . GLU A 1 89  ? -2.418  20.760  -5.102  1.00 0.00 ? 481 GLU A HG2  4  
ATOM 9211  H HG3  . GLU A 1 89  ? -4.046  21.243  -5.584  1.00 0.00 ? 481 GLU A HG3  4  
ATOM 9212  N N    . SER A 1 90  ? -3.492  16.077  -4.610  1.00 0.00 ? 482 SER A N    4  
ATOM 9213  C CA   . SER A 1 90  ? -4.007  14.721  -4.471  1.00 0.00 ? 482 SER A CA   4  
ATOM 9214  C C    . SER A 1 90  ? -3.442  14.088  -3.201  1.00 0.00 ? 482 SER A C    4  
ATOM 9215  O O    . SER A 1 90  ? -4.141  13.367  -2.476  1.00 0.00 ? 482 SER A O    4  
ATOM 9216  C CB   . SER A 1 90  ? -3.640  13.873  -5.685  1.00 0.00 ? 482 SER A CB   4  
ATOM 9217  O OG   . SER A 1 90  ? -4.157  14.429  -6.893  1.00 0.00 ? 482 SER A OG   4  
ATOM 9218  H H    . SER A 1 90  ? -2.939  16.310  -5.395  1.00 0.00 ? 482 SER A H    4  
ATOM 9219  H HA   . SER A 1 90  ? -5.081  14.781  -4.384  1.00 0.00 ? 482 SER A HA   4  
ATOM 9220  H HB2  . SER A 1 90  ? -2.564  13.828  -5.766  1.00 0.00 ? 482 SER A HB2  4  
ATOM 9221  H HB3  . SER A 1 90  ? -4.037  12.876  -5.560  1.00 0.00 ? 482 SER A HB3  4  
ATOM 9222  H HG   . SER A 1 90  ? -3.782  15.324  -6.961  1.00 0.00 ? 482 SER A HG   4  
ATOM 9223  N N    . LEU A 1 91  ? -2.182  14.403  -2.920  1.00 0.00 ? 483 LEU A N    4  
ATOM 9224  C CA   . LEU A 1 91  ? -1.516  13.928  -1.726  1.00 0.00 ? 483 LEU A CA   4  
ATOM 9225  C C    . LEU A 1 91  ? -2.172  14.489  -0.478  1.00 0.00 ? 483 LEU A C    4  
ATOM 9226  O O    . LEU A 1 91  ? -2.338  13.782  0.493   1.00 0.00 ? 483 LEU A O    4  
ATOM 9227  C CB   . LEU A 1 91  ? -0.023  14.272  -1.755  1.00 0.00 ? 483 LEU A CB   4  
ATOM 9228  C CG   . LEU A 1 91  ? 0.821   13.506  -2.777  1.00 0.00 ? 483 LEU A CG   4  
ATOM 9229  C CD1  . LEU A 1 91  ? 2.246   14.034  -2.785  1.00 0.00 ? 483 LEU A CD1  4  
ATOM 9230  C CD2  . LEU A 1 91  ? 0.819   12.018  -2.453  1.00 0.00 ? 483 LEU A CD2  4  
ATOM 9231  H H    . LEU A 1 91  ? -1.687  14.975  -3.547  1.00 0.00 ? 483 LEU A H    4  
ATOM 9232  H HA   . LEU A 1 91  ? -1.623  12.853  -1.700  1.00 0.00 ? 483 LEU A HA   4  
ATOM 9233  H HB2  . LEU A 1 91  ? 0.069   15.326  -1.966  1.00 0.00 ? 483 LEU A HB2  4  
ATOM 9234  H HB3  . LEU A 1 91  ? 0.385   14.088  -0.773  1.00 0.00 ? 483 LEU A HB3  4  
ATOM 9235  H HG   . LEU A 1 91  ? 0.402   13.640  -3.764  1.00 0.00 ? 483 LEU A HG   4  
ATOM 9236  H HD11 . LEU A 1 91  ? 2.681   13.918  -1.803  1.00 0.00 ? 483 LEU A HD11 4  
ATOM 9237  H HD12 . LEU A 1 91  ? 2.832   13.482  -3.505  1.00 0.00 ? 483 LEU A HD12 4  
ATOM 9238  H HD13 . LEU A 1 91  ? 2.240   15.079  -3.055  1.00 0.00 ? 483 LEU A HD13 4  
ATOM 9239  H HD21 . LEU A 1 91  ? -0.193  11.646  -2.431  1.00 0.00 ? 483 LEU A HD21 4  
ATOM 9240  H HD22 . LEU A 1 91  ? 1.375   11.483  -3.208  1.00 0.00 ? 483 LEU A HD22 4  
ATOM 9241  H HD23 . LEU A 1 91  ? 1.282   11.852  -1.492  1.00 0.00 ? 483 LEU A HD23 4  
ATOM 9242  N N    . LYS A 1 92  ? -2.611  15.731  -0.561  1.00 0.00 ? 484 LYS A N    4  
ATOM 9243  C CA   . LYS A 1 92  ? -3.248  16.445  0.550   1.00 0.00 ? 484 LYS A CA   4  
ATOM 9244  C C    . LYS A 1 92  ? -4.434  15.644  1.098   1.00 0.00 ? 484 LYS A C    4  
ATOM 9245  O O    . LYS A 1 92  ? -4.579  15.490  2.323   1.00 0.00 ? 484 LYS A O    4  
ATOM 9246  C CB   . LYS A 1 92  ? -3.726  17.807  0.037   1.00 0.00 ? 484 LYS A CB   4  
ATOM 9247  C CG   . LYS A 1 92  ? -4.439  18.700  1.043   1.00 0.00 ? 484 LYS A CG   4  
ATOM 9248  C CD   . LYS A 1 92  ? -5.008  19.943  0.354   1.00 0.00 ? 484 LYS A CD   4  
ATOM 9249  C CE   . LYS A 1 92  ? -6.127  19.581  -0.628  1.00 0.00 ? 484 LYS A CE   4  
ATOM 9250  N NZ   . LYS A 1 92  ? -6.619  20.743  -1.388  1.00 0.00 ? 484 LYS A NZ   4  
ATOM 9251  H H    . LYS A 1 92  ? -2.490  16.203  -1.413  1.00 0.00 ? 484 LYS A H    4  
ATOM 9252  H HA   . LYS A 1 92  ? -2.523  16.597  1.336   1.00 0.00 ? 484 LYS A HA   4  
ATOM 9253  H HB2  . LYS A 1 92  ? -2.867  18.345  -0.335  1.00 0.00 ? 484 LYS A HB2  4  
ATOM 9254  H HB3  . LYS A 1 92  ? -4.388  17.615  -0.791  1.00 0.00 ? 484 LYS A HB3  4  
ATOM 9255  H HG2  . LYS A 1 92  ? -5.247  18.145  1.496   1.00 0.00 ? 484 LYS A HG2  4  
ATOM 9256  H HG3  . LYS A 1 92  ? -3.735  19.008  1.803   1.00 0.00 ? 484 LYS A HG3  4  
ATOM 9257  H HD2  . LYS A 1 92  ? -5.401  20.614  1.102   1.00 0.00 ? 484 LYS A HD2  4  
ATOM 9258  H HD3  . LYS A 1 92  ? -4.214  20.433  -0.190  1.00 0.00 ? 484 LYS A HD3  4  
ATOM 9259  H HE2  . LYS A 1 92  ? -5.769  18.851  -1.338  1.00 0.00 ? 484 LYS A HE2  4  
ATOM 9260  H HE3  . LYS A 1 92  ? -6.946  19.162  -0.063  1.00 0.00 ? 484 LYS A HE3  4  
ATOM 9261  H HZ1  . LYS A 1 92  ? -6.925  21.514  -0.762  1.00 0.00 ? 484 LYS A HZ1  4  
ATOM 9262  H HZ2  . LYS A 1 92  ? -5.878  21.106  -2.033  1.00 0.00 ? 484 LYS A HZ2  4  
ATOM 9263  H HZ3  . LYS A 1 92  ? -7.431  20.461  -1.974  1.00 0.00 ? 484 LYS A HZ3  4  
ATOM 9264  N N    . GLY A 1 93  ? -5.243  15.117  0.194   1.00 0.00 ? 485 GLY A N    4  
ATOM 9265  C CA   . GLY A 1 93  ? -6.376  14.313  0.580   1.00 0.00 ? 485 GLY A CA   4  
ATOM 9266  C C    . GLY A 1 93  ? -5.954  12.975  1.170   1.00 0.00 ? 485 GLY A C    4  
ATOM 9267  O O    . GLY A 1 93  ? -6.482  12.550  2.201   1.00 0.00 ? 485 GLY A O    4  
ATOM 9268  H H    . GLY A 1 93  ? -5.060  15.280  -0.757  1.00 0.00 ? 485 GLY A H    4  
ATOM 9269  H HA2  . GLY A 1 93  ? -6.953  14.854  1.316   1.00 0.00 ? 485 GLY A HA2  4  
ATOM 9270  H HA3  . GLY A 1 93  ? -6.991  14.133  -0.288  1.00 0.00 ? 485 GLY A HA3  4  
ATOM 9271  N N    . LEU A 1 94  ? -4.977  12.336  0.533   1.00 0.00 ? 486 LEU A N    4  
ATOM 9272  C CA   . LEU A 1 94  ? -4.485  11.027  0.947   1.00 0.00 ? 486 LEU A CA   4  
ATOM 9273  C C    . LEU A 1 94  ? -3.846  11.120  2.353   1.00 0.00 ? 486 LEU A C    4  
ATOM 9274  O O    . LEU A 1 94  ? -4.085  10.263  3.210   1.00 0.00 ? 486 LEU A O    4  
ATOM 9275  C CB   . LEU A 1 94  ? -3.490  10.498  -0.122  1.00 0.00 ? 486 LEU A CB   4  
ATOM 9276  C CG   . LEU A 1 94  ? -3.171  8.981   -0.134  1.00 0.00 ? 486 LEU A CG   4  
ATOM 9277  C CD1  . LEU A 1 94  ? -2.414  8.621   -1.395  1.00 0.00 ? 486 LEU A CD1  4  
ATOM 9278  C CD2  . LEU A 1 94  ? -2.351  8.548   1.067   1.00 0.00 ? 486 LEU A CD2  4  
ATOM 9279  H H    . LEU A 1 94  ? -4.574  12.756  -0.257  1.00 0.00 ? 486 LEU A H    4  
ATOM 9280  H HA   . LEU A 1 94  ? -5.334  10.364  1.003   1.00 0.00 ? 486 LEU A HA   4  
ATOM 9281  H HB2  . LEU A 1 94  ? -3.885  10.755  -1.093  1.00 0.00 ? 486 LEU A HB2  4  
ATOM 9282  H HB3  . LEU A 1 94  ? -2.560  11.032  0.006   1.00 0.00 ? 486 LEU A HB3  4  
ATOM 9283  H HG   . LEU A 1 94  ? -4.108  8.446   -0.132  1.00 0.00 ? 486 LEU A HG   4  
ATOM 9284  H HD11 . LEU A 1 94  ? -1.498  9.191   -1.439  1.00 0.00 ? 486 LEU A HD11 4  
ATOM 9285  H HD12 . LEU A 1 94  ? -2.183  7.567   -1.389  1.00 0.00 ? 486 LEU A HD12 4  
ATOM 9286  H HD13 . LEU A 1 94  ? -3.024  8.847   -2.257  1.00 0.00 ? 486 LEU A HD13 4  
ATOM 9287  H HD21 . LEU A 1 94  ? -2.887  8.786   1.973   1.00 0.00 ? 486 LEU A HD21 4  
ATOM 9288  H HD22 . LEU A 1 94  ? -2.175  7.483   1.018   1.00 0.00 ? 486 LEU A HD22 4  
ATOM 9289  H HD23 . LEU A 1 94  ? -1.406  9.070   1.060   1.00 0.00 ? 486 LEU A HD23 4  
ATOM 9290  N N    . TYR A 1 95  ? -3.071  12.177  2.582   1.00 0.00 ? 487 TYR A N    4  
ATOM 9291  C CA   . TYR A 1 95  ? -2.443  12.432  3.883   1.00 0.00 ? 487 TYR A CA   4  
ATOM 9292  C C    . TYR A 1 95  ? -3.487  12.548  4.991   1.00 0.00 ? 487 TYR A C    4  
ATOM 9293  O O    . TYR A 1 95  ? -3.308  12.005  6.080   1.00 0.00 ? 487 TYR A O    4  
ATOM 9294  C CB   . TYR A 1 95  ? -1.569  13.697  3.838   1.00 0.00 ? 487 TYR A CB   4  
ATOM 9295  C CG   . TYR A 1 95  ? -0.162  13.488  3.296   1.00 0.00 ? 487 TYR A CG   4  
ATOM 9296  C CD1  . TYR A 1 95  ? 0.071   13.210  1.962   1.00 0.00 ? 487 TYR A CD1  4  
ATOM 9297  C CD2  . TYR A 1 95  ? 0.933   13.598  4.130   1.00 0.00 ? 487 TYR A CD2  4  
ATOM 9298  C CE1  . TYR A 1 95  ? 1.344   13.053  1.468   1.00 0.00 ? 487 TYR A CE1  4  
ATOM 9299  C CE2  . TYR A 1 95  ? 2.214   13.436  3.649   1.00 0.00 ? 487 TYR A CE2  4  
ATOM 9300  C CZ   . TYR A 1 95  ? 2.415   13.165  2.315   1.00 0.00 ? 487 TYR A CZ   4  
ATOM 9301  O OH   . TYR A 1 95  ? 3.704   13.024  1.819   1.00 0.00 ? 487 TYR A OH   4  
ATOM 9302  H H    . TYR A 1 95  ? -2.914  12.805  1.840   1.00 0.00 ? 487 TYR A H    4  
ATOM 9303  H HA   . TYR A 1 95  ? -1.804  11.584  4.088   1.00 0.00 ? 487 TYR A HA   4  
ATOM 9304  H HB2  . TYR A 1 95  ? -2.054  14.415  3.193   1.00 0.00 ? 487 TYR A HB2  4  
ATOM 9305  H HB3  . TYR A 1 95  ? -1.493  14.122  4.827   1.00 0.00 ? 487 TYR A HB3  4  
ATOM 9306  H HD1  . TYR A 1 95  ? -0.775  13.122  1.296   1.00 0.00 ? 487 TYR A HD1  4  
ATOM 9307  H HD2  . TYR A 1 95  ? 0.775   13.808  5.177   1.00 0.00 ? 487 TYR A HD2  4  
ATOM 9308  H HE1  . TYR A 1 95  ? 1.484   12.833  0.420   1.00 0.00 ? 487 TYR A HE1  4  
ATOM 9309  H HE2  . TYR A 1 95  ? 3.048   13.524  4.327   1.00 0.00 ? 487 TYR A HE2  4  
ATOM 9310  H HH   . TYR A 1 95  ? 3.715   13.473  0.966   1.00 0.00 ? 487 TYR A HH   4  
ATOM 9311  N N    . ARG A 1 96  ? -4.594  13.209  4.686   1.00 0.00 ? 488 ARG A N    4  
ATOM 9312  C CA   . ARG A 1 96  ? -5.677  13.392  5.648   1.00 0.00 ? 488 ARG A CA   4  
ATOM 9313  C C    . ARG A 1 96  ? -6.343  12.039  5.963   1.00 0.00 ? 488 ARG A C    4  
ATOM 9314  O O    . ARG A 1 96  ? -6.711  11.773  7.104   1.00 0.00 ? 488 ARG A O    4  
ATOM 9315  C CB   . ARG A 1 96  ? -6.681  14.477  5.127   1.00 0.00 ? 488 ARG A CB   4  
ATOM 9316  C CG   . ARG A 1 96  ? -7.898  14.808  6.029   1.00 0.00 ? 488 ARG A CG   4  
ATOM 9317  C CD   . ARG A 1 96  ? -9.024  13.796  5.862   1.00 0.00 ? 488 ARG A CD   4  
ATOM 9318  N NE   . ARG A 1 96  ? -10.217 14.097  6.674   1.00 0.00 ? 488 ARG A NE   4  
ATOM 9319  C CZ   . ARG A 1 96  ? -11.444 13.600  6.417   1.00 0.00 ? 488 ARG A CZ   4  
ATOM 9320  N NH1  . ARG A 1 96  ? -11.668 12.945  5.272   1.00 0.00 ? 488 ARG A NH1  4  
ATOM 9321  N NH2  . ARG A 1 96  ? -12.448 13.806  7.275   1.00 0.00 ? 488 ARG A NH2  4  
ATOM 9322  H H    . ARG A 1 96  ? -4.685  13.582  3.782   1.00 0.00 ? 488 ARG A H    4  
ATOM 9323  H HA   . ARG A 1 96  ? -5.219  13.745  6.561   1.00 0.00 ? 488 ARG A HA   4  
ATOM 9324  H HB2  . ARG A 1 96  ? -6.138  15.396  4.968   1.00 0.00 ? 488 ARG A HB2  4  
ATOM 9325  H HB3  . ARG A 1 96  ? -7.055  14.148  4.168   1.00 0.00 ? 488 ARG A HB3  4  
ATOM 9326  H HG2  . ARG A 1 96  ? -7.582  14.805  7.061   1.00 0.00 ? 488 ARG A HG2  4  
ATOM 9327  H HG3  . ARG A 1 96  ? -8.265  15.792  5.772   1.00 0.00 ? 488 ARG A HG3  4  
ATOM 9328  H HD2  . ARG A 1 96  ? -9.314  13.797  4.824   1.00 0.00 ? 488 ARG A HD2  4  
ATOM 9329  H HD3  . ARG A 1 96  ? -8.652  12.817  6.127   1.00 0.00 ? 488 ARG A HD3  4  
ATOM 9330  H HE   . ARG A 1 96  ? -10.063 14.666  7.463   1.00 0.00 ? 488 ARG A HE   4  
ATOM 9331  H HH11 . ARG A 1 96  ? -10.947 12.814  4.583   1.00 0.00 ? 488 ARG A HH11 4  
ATOM 9332  H HH12 . ARG A 1 96  ? -12.566 12.562  5.045   1.00 0.00 ? 488 ARG A HH12 4  
ATOM 9333  H HH21 . ARG A 1 96  ? -12.318 14.330  8.118   1.00 0.00 ? 488 ARG A HH21 4  
ATOM 9334  H HH22 . ARG A 1 96  ? -13.374 13.444  7.122   1.00 0.00 ? 488 ARG A HH22 4  
ATOM 9335  N N    . ILE A 1 97  ? -6.475  11.190  4.952   1.00 0.00 ? 489 ILE A N    4  
ATOM 9336  C CA   . ILE A 1 97  ? -7.051  9.859   5.138   1.00 0.00 ? 489 ILE A CA   4  
ATOM 9337  C C    . ILE A 1 97  ? -6.108  8.986   5.980   1.00 0.00 ? 489 ILE A C    4  
ATOM 9338  O O    . ILE A 1 97  ? -6.525  8.341   6.943   1.00 0.00 ? 489 ILE A O    4  
ATOM 9339  C CB   . ILE A 1 97  ? -7.367  9.163   3.779   1.00 0.00 ? 489 ILE A CB   4  
ATOM 9340  C CG1  . ILE A 1 97  ? -8.330  10.023  2.950   1.00 0.00 ? 489 ILE A CG1  4  
ATOM 9341  C CG2  . ILE A 1 97  ? -7.969  7.780   4.014   1.00 0.00 ? 489 ILE A CG2  4  
ATOM 9342  C CD1  . ILE A 1 97  ? -8.660  9.451   1.584   1.00 0.00 ? 489 ILE A CD1  4  
ATOM 9343  H H    . ILE A 1 97  ? -6.180  11.471  4.059   1.00 0.00 ? 489 ILE A H    4  
ATOM 9344  H HA   . ILE A 1 97  ? -7.971  9.986   5.692   1.00 0.00 ? 489 ILE A HA   4  
ATOM 9345  H HB   . ILE A 1 97  ? -6.442  9.047   3.233   1.00 0.00 ? 489 ILE A HB   4  
ATOM 9346  H HG12 . ILE A 1 97  ? -9.257  10.137  3.490   1.00 0.00 ? 489 ILE A HG12 4  
ATOM 9347  H HG13 . ILE A 1 97  ? -7.884  10.995  2.801   1.00 0.00 ? 489 ILE A HG13 4  
ATOM 9348  H HG21 . ILE A 1 97  ? -8.840  7.866   4.647   1.00 0.00 ? 489 ILE A HG21 4  
ATOM 9349  H HG22 . ILE A 1 97  ? -8.257  7.345   3.070   1.00 0.00 ? 489 ILE A HG22 4  
ATOM 9350  H HG23 . ILE A 1 97  ? -7.238  7.146   4.494   1.00 0.00 ? 489 ILE A HG23 4  
ATOM 9351  H HD11 . ILE A 1 97  ? -9.114  8.480   1.713   1.00 0.00 ? 489 ILE A HD11 4  
ATOM 9352  H HD12 . ILE A 1 97  ? -9.344  10.110  1.069   1.00 0.00 ? 489 ILE A HD12 4  
ATOM 9353  H HD13 . ILE A 1 97  ? -7.752  9.347   1.009   1.00 0.00 ? 489 ILE A HD13 4  
ATOM 9354  N N    . MET A 1 98  ? -4.834  9.022   5.648   1.00 0.00 ? 490 MET A N    4  
ATOM 9355  C CA   . MET A 1 98  ? -3.814  8.258   6.373   1.00 0.00 ? 490 MET A CA   4  
ATOM 9356  C C    . MET A 1 98  ? -3.692  8.720   7.817   1.00 0.00 ? 490 MET A C    4  
ATOM 9357  O O    . MET A 1 98  ? -3.504  7.907   8.737   1.00 0.00 ? 490 MET A O    4  
ATOM 9358  C CB   . MET A 1 98  ? -2.471  8.371   5.679   1.00 0.00 ? 490 MET A CB   4  
ATOM 9359  C CG   . MET A 1 98  ? -2.262  7.402   4.532   1.00 0.00 ? 490 MET A CG   4  
ATOM 9360  S SD   . MET A 1 98  ? -2.131  5.696   5.103   1.00 0.00 ? 490 MET A SD   4  
ATOM 9361  C CE   . MET A 1 98  ? -1.728  4.833   3.584   1.00 0.00 ? 490 MET A CE   4  
ATOM 9362  H H    . MET A 1 98  ? -4.572  9.575   4.878   1.00 0.00 ? 490 MET A H    4  
ATOM 9363  H HA   . MET A 1 98  ? -4.120  7.222   6.368   1.00 0.00 ? 490 MET A HA   4  
ATOM 9364  H HB2  . MET A 1 98  ? -2.369  9.374   5.294   1.00 0.00 ? 490 MET A HB2  4  
ATOM 9365  H HB3  . MET A 1 98  ? -1.697  8.203   6.411   1.00 0.00 ? 490 MET A HB3  4  
ATOM 9366  H HG2  . MET A 1 98  ? -3.095  7.482   3.850   1.00 0.00 ? 490 MET A HG2  4  
ATOM 9367  H HG3  . MET A 1 98  ? -1.348  7.671   4.026   1.00 0.00 ? 490 MET A HG3  4  
ATOM 9368  H HE1  . MET A 1 98  ? -0.806  5.226   3.184   1.00 0.00 ? 490 MET A HE1  4  
ATOM 9369  H HE2  . MET A 1 98  ? -1.600  3.782   3.800   1.00 0.00 ? 490 MET A HE2  4  
ATOM 9370  H HE3  . MET A 1 98  ? -2.524  4.967   2.866   1.00 0.00 ? 490 MET A HE3  4  
ATOM 9371  N N    . GLY A 1 99  ? -3.823  10.013  8.018   1.00 0.00 ? 491 GLY A N    4  
ATOM 9372  C CA   . GLY A 1 99  ? -3.770  10.579  9.345   1.00 0.00 ? 491 GLY A CA   4  
ATOM 9373  C C    . GLY A 1 99  ? -5.045  10.325  10.133  1.00 0.00 ? 491 GLY A C    4  
ATOM 9374  O O    . GLY A 1 99  ? -5.095  10.562  11.337  1.00 0.00 ? 491 GLY A O    4  
ATOM 9375  H H    . GLY A 1 99  ? -3.931  10.617  7.247   1.00 0.00 ? 491 GLY A H    4  
ATOM 9376  H HA2  . GLY A 1 99  ? -2.937  10.145  9.876   1.00 0.00 ? 491 GLY A HA2  4  
ATOM 9377  H HA3  . GLY A 1 99  ? -3.615  11.644  9.267   1.00 0.00 ? 491 GLY A HA3  4  
ATOM 9378  N N    . ASN A 1 100 ? -6.075  9.825   9.461   1.00 0.00 ? 492 ASN A N    4  
ATOM 9379  C CA   . ASN A 1 100 ? -7.369  9.565   10.098  1.00 0.00 ? 492 ASN A CA   4  
ATOM 9380  C C    . ASN A 1 100 ? -7.423  8.110   10.604  1.00 0.00 ? 492 ASN A C    4  
ATOM 9381  O O    . ASN A 1 100 ? -8.460  7.613   11.033  1.00 0.00 ? 492 ASN A O    4  
ATOM 9382  C CB   . ASN A 1 100 ? -8.520  9.846   9.100   1.00 0.00 ? 492 ASN A CB   4  
ATOM 9383  C CG   . ASN A 1 100 ? -9.897  9.993   9.756   1.00 0.00 ? 492 ASN A CG   4  
ATOM 9384  O OD1  . ASN A 1 100 ? -10.286 11.092  10.150  1.00 0.00 ? 492 ASN A OD1  4  
ATOM 9385  N ND2  . ASN A 1 100 ? -10.641 8.917   9.868   1.00 0.00 ? 492 ASN A ND2  4  
ATOM 9386  H H    . ASN A 1 100 ? -5.970  9.627   8.505   1.00 0.00 ? 492 ASN A H    4  
ATOM 9387  H HA   . ASN A 1 100 ? -7.459  10.231  10.944  1.00 0.00 ? 492 ASN A HA   4  
ATOM 9388  H HB2  . ASN A 1 100 ? -8.306  10.760  8.567   1.00 0.00 ? 492 ASN A HB2  4  
ATOM 9389  H HB3  . ASN A 1 100 ? -8.564  9.033   8.390   1.00 0.00 ? 492 ASN A HB3  4  
ATOM 9390  H HD21 . ASN A 1 100 ? -10.288 8.066   9.533   1.00 0.00 ? 492 ASN A HD21 4  
ATOM 9391  H HD22 . ASN A 1 100 ? -11.520 8.998   10.294  1.00 0.00 ? 492 ASN A HD22 4  
ATOM 9392  N N    . GLY A 1 101 ? -6.298  7.431   10.549  1.00 0.00 ? 493 GLY A N    4  
ATOM 9393  C CA   . GLY A 1 101 ? -6.241  6.080   11.071  1.00 0.00 ? 493 GLY A CA   4  
ATOM 9394  C C    . GLY A 1 101 ? -6.541  5.034   10.026  1.00 0.00 ? 493 GLY A C    4  
ATOM 9395  O O    . GLY A 1 101 ? -7.088  3.959   10.334  1.00 0.00 ? 493 GLY A O    4  
ATOM 9396  H H    . GLY A 1 101 ? -5.501  7.850   10.160  1.00 0.00 ? 493 GLY A H    4  
ATOM 9397  H HA2  . GLY A 1 101 ? -5.252  5.903   11.466  1.00 0.00 ? 493 GLY A HA2  4  
ATOM 9398  H HA3  . GLY A 1 101 ? -6.957  5.989   11.873  1.00 0.00 ? 493 GLY A HA3  4  
ATOM 9399  N N    . PHE A 1 102 ? -6.221  5.339   8.798   1.00 0.00 ? 494 PHE A N    4  
ATOM 9400  C CA   . PHE A 1 102 ? -6.393  4.406   7.720   1.00 0.00 ? 494 PHE A CA   4  
ATOM 9401  C C    . PHE A 1 102 ? -5.049  3.916   7.235   1.00 0.00 ? 494 PHE A C    4  
ATOM 9402  O O    . PHE A 1 102 ? -4.029  4.572   7.447   1.00 0.00 ? 494 PHE A O    4  
ATOM 9403  C CB   . PHE A 1 102 ? -7.196  5.009   6.567   1.00 0.00 ? 494 PHE A CB   4  
ATOM 9404  C CG   . PHE A 1 102 ? -8.638  5.231   6.907   1.00 0.00 ? 494 PHE A CG   4  
ATOM 9405  C CD1  . PHE A 1 102 ? -9.485  4.155   7.051   1.00 0.00 ? 494 PHE A CD1  4  
ATOM 9406  C CD2  . PHE A 1 102 ? -9.147  6.503   7.082   1.00 0.00 ? 494 PHE A CD2  4  
ATOM 9407  C CE1  . PHE A 1 102 ? -10.808 4.331   7.364   1.00 0.00 ? 494 PHE A CE1  4  
ATOM 9408  C CE2  . PHE A 1 102 ? -10.477 6.693   7.395   1.00 0.00 ? 494 PHE A CE2  4  
ATOM 9409  C CZ   . PHE A 1 102 ? -11.310 5.604   7.538   1.00 0.00 ? 494 PHE A CZ   4  
ATOM 9410  H H    . PHE A 1 102 ? -5.832  6.215   8.595   1.00 0.00 ? 494 PHE A H    4  
ATOM 9411  H HA   . PHE A 1 102 ? -6.947  3.568   8.122   1.00 0.00 ? 494 PHE A HA   4  
ATOM 9412  H HB2  . PHE A 1 102 ? -6.760  5.962   6.302   1.00 0.00 ? 494 PHE A HB2  4  
ATOM 9413  H HB3  . PHE A 1 102 ? -7.145  4.346   5.716   1.00 0.00 ? 494 PHE A HB3  4  
ATOM 9414  H HD1  . PHE A 1 102 ? -9.093  3.156   6.916   1.00 0.00 ? 494 PHE A HD1  4  
ATOM 9415  H HD2  . PHE A 1 102 ? -8.493  7.355   6.964   1.00 0.00 ? 494 PHE A HD2  4  
ATOM 9416  H HE1  . PHE A 1 102 ? -11.442 3.465   7.472   1.00 0.00 ? 494 PHE A HE1  4  
ATOM 9417  H HE2  . PHE A 1 102 ? -10.860 7.694   7.530   1.00 0.00 ? 494 PHE A HE2  4  
ATOM 9418  H HZ   . PHE A 1 102 ? -12.352 5.747   7.786   1.00 0.00 ? 494 PHE A HZ   4  
ATOM 9419  N N    . ALA A 1 103 ? -5.056  2.776   6.622   1.00 0.00 ? 495 ALA A N    4  
ATOM 9420  C CA   . ALA A 1 103 ? -3.883  2.150   6.090   1.00 0.00 ? 495 ALA A CA   4  
ATOM 9421  C C    . ALA A 1 103 ? -4.158  1.794   4.650   1.00 0.00 ? 495 ALA A C    4  
ATOM 9422  O O    . ALA A 1 103 ? -5.324  1.708   4.246   1.00 0.00 ? 495 ALA A O    4  
ATOM 9423  C CB   . ALA A 1 103 ? -3.566  0.896   6.885   1.00 0.00 ? 495 ALA A CB   4  
ATOM 9424  H H    . ALA A 1 103 ? -5.908  2.304   6.484   1.00 0.00 ? 495 ALA A H    4  
ATOM 9425  H HA   . ALA A 1 103 ? -3.050  2.835   6.156   1.00 0.00 ? 495 ALA A HA   4  
ATOM 9426  H HB1  . ALA A 1 103 ? -4.400  0.212   6.827   1.00 0.00 ? 495 ALA A HB1  4  
ATOM 9427  H HB2  . ALA A 1 103 ? -3.385  1.157   7.917   1.00 0.00 ? 495 ALA A HB2  4  
ATOM 9428  H HB3  . ALA A 1 103 ? -2.681  0.426   6.478   1.00 0.00 ? 495 ALA A HB3  4  
ATOM 9429  N N    . GLY A 1 104 ? -3.134  1.582   3.888   1.00 0.00 ? 496 GLY A N    4  
ATOM 9430  C CA   . GLY A 1 104 ? -3.323  1.263   2.516   1.00 0.00 ? 496 GLY A CA   4  
ATOM 9431  C C    . GLY A 1 104 ? -2.784  -0.088  2.191   1.00 0.00 ? 496 GLY A C    4  
ATOM 9432  O O    . GLY A 1 104 ? -1.581  -0.289  2.177   1.00 0.00 ? 496 GLY A O    4  
ATOM 9433  H H    . GLY A 1 104 ? -2.217  1.617   4.246   1.00 0.00 ? 496 GLY A H    4  
ATOM 9434  H HA2  . GLY A 1 104 ? -4.379  1.283   2.292   1.00 0.00 ? 496 GLY A HA2  4  
ATOM 9435  H HA3  . GLY A 1 104 ? -2.817  1.996   1.905   1.00 0.00 ? 496 GLY A HA3  4  
ATOM 9436  N N    . CYS A 1 105 ? -3.647  -1.020  1.940   1.00 0.00 ? 497 CYS A N    4  
ATOM 9437  C CA   . CYS A 1 105 ? -3.200  -2.329  1.576   1.00 0.00 ? 497 CYS A CA   4  
ATOM 9438  C C    . CYS A 1 105 ? -2.882  -2.322  0.097   1.00 0.00 ? 497 CYS A C    4  
ATOM 9439  O O    . CYS A 1 105 ? -3.741  -1.972  -0.736  1.00 0.00 ? 497 CYS A O    4  
ATOM 9440  C CB   . CYS A 1 105 ? -4.243  -3.404  1.947   1.00 0.00 ? 497 CYS A CB   4  
ATOM 9441  S SG   . CYS A 1 105 ? -5.905  -3.132  1.281   1.00 0.00 ? 497 CYS A SG   4  
ATOM 9442  H H    . CYS A 1 105 ? -4.606  -0.813  1.976   1.00 0.00 ? 497 CYS A H    4  
ATOM 9443  H HA   . CYS A 1 105 ? -2.283  -2.512  2.116   1.00 0.00 ? 497 CYS A HA   4  
ATOM 9444  H HB2  . CYS A 1 105 ? -3.905  -4.361  1.580   1.00 0.00 ? 497 CYS A HB2  4  
ATOM 9445  H HB3  . CYS A 1 105 ? -4.324  -3.453  3.023   1.00 0.00 ? 497 CYS A HB3  4  
ATOM 9446  H HG   . CYS A 1 105 ? -6.173  -1.832  1.340   1.00 0.00 ? 497 CYS A HG   4  
ATOM 9447  N N    . VAL A 1 106 ? -1.658  -2.625  -0.233  1.00 0.00 ? 498 VAL A N    4  
ATOM 9448  C CA   . VAL A 1 106 ? -1.229  -2.592  -1.591  1.00 0.00 ? 498 VAL A CA   4  
ATOM 9449  C C    . VAL A 1 106 ? -1.169  -4.001  -2.133  1.00 0.00 ? 498 VAL A C    4  
ATOM 9450  O O    . VAL A 1 106 ? -0.419  -4.861  -1.630  1.00 0.00 ? 498 VAL A O    4  
ATOM 9451  C CB   . VAL A 1 106 ? 0.167   -1.914  -1.733  1.00 0.00 ? 498 VAL A CB   4  
ATOM 9452  C CG1  . VAL A 1 106 ? 0.601   -1.853  -3.189  1.00 0.00 ? 498 VAL A CG1  4  
ATOM 9453  C CG2  . VAL A 1 106 ? 0.156   -0.518  -1.125  1.00 0.00 ? 498 VAL A CG2  4  
ATOM 9454  H H    . VAL A 1 106 ? -1.000  -2.909  0.441   1.00 0.00 ? 498 VAL A H    4  
ATOM 9455  H HA   . VAL A 1 106 ? -1.947  -2.021  -2.161  1.00 0.00 ? 498 VAL A HA   4  
ATOM 9456  H HB   . VAL A 1 106 ? 0.883   -2.515  -1.192  1.00 0.00 ? 498 VAL A HB   4  
ATOM 9457  H HG11 . VAL A 1 106 ? -0.117  -1.283  -3.759  1.00 0.00 ? 498 VAL A HG11 4  
ATOM 9458  H HG12 . VAL A 1 106 ? 1.569   -1.379  -3.259  1.00 0.00 ? 498 VAL A HG12 4  
ATOM 9459  H HG13 . VAL A 1 106 ? 0.663   -2.855  -3.588  1.00 0.00 ? 498 VAL A HG13 4  
ATOM 9460  H HG21 . VAL A 1 106 ? -0.095  -0.581  -0.076  1.00 0.00 ? 498 VAL A HG21 4  
ATOM 9461  H HG22 . VAL A 1 106 ? 1.132   -0.069  -1.233  1.00 0.00 ? 498 VAL A HG22 4  
ATOM 9462  H HG23 . VAL A 1 106 ? -0.577  0.088   -1.635  1.00 0.00 ? 498 VAL A HG23 4  
ATOM 9463  N N    . HIS A 1 107 ? -1.931  -4.225  -3.152  1.00 0.00 ? 499 HIS A N    4  
ATOM 9464  C CA   . HIS A 1 107 ? -1.977  -5.483  -3.805  1.00 0.00 ? 499 HIS A CA   4  
ATOM 9465  C C    . HIS A 1 107 ? -1.398  -5.364  -5.165  1.00 0.00 ? 499 HIS A C    4  
ATOM 9466  O O    . HIS A 1 107 ? -1.624  -4.368  -5.887  1.00 0.00 ? 499 HIS A O    4  
ATOM 9467  C CB   . HIS A 1 107 ? -3.388  -6.079  -3.845  1.00 0.00 ? 499 HIS A CB   4  
ATOM 9468  C CG   . HIS A 1 107 ? -3.811  -6.692  -2.546  1.00 0.00 ? 499 HIS A CG   4  
ATOM 9469  N ND1  . HIS A 1 107 ? -4.600  -6.070  -1.605  1.00 0.00 ? 499 HIS A ND1  4  
ATOM 9470  C CD2  . HIS A 1 107 ? -3.521  -7.910  -2.037  1.00 0.00 ? 499 HIS A CD2  4  
ATOM 9471  C CE1  . HIS A 1 107 ? -4.746  -6.910  -0.578  1.00 0.00 ? 499 HIS A CE1  4  
ATOM 9472  N NE2  . HIS A 1 107 ? -4.116  -8.040  -0.793  1.00 0.00 ? 499 HIS A NE2  4  
ATOM 9473  H H    . HIS A 1 107 ? -2.485  -3.498  -3.517  1.00 0.00 ? 499 HIS A H    4  
ATOM 9474  H HA   . HIS A 1 107 ? -1.341  -6.146  -3.235  1.00 0.00 ? 499 HIS A HA   4  
ATOM 9475  H HB2  . HIS A 1 107 ? -4.097  -5.305  -4.096  1.00 0.00 ? 499 HIS A HB2  4  
ATOM 9476  H HB3  . HIS A 1 107 ? -3.419  -6.849  -4.603  1.00 0.00 ? 499 HIS A HB3  4  
ATOM 9477  H HD1  . HIS A 1 107 ? -5.007  -5.180  -1.689  1.00 0.00 ? 499 HIS A HD1  4  
ATOM 9478  H HD2  . HIS A 1 107 ? -2.926  -8.674  -2.517  1.00 0.00 ? 499 HIS A HD2  4  
ATOM 9479  H HE1  . HIS A 1 107 ? -5.285  -6.701  0.329   1.00 0.00 ? 499 HIS A HE1  4  
ATOM 9480  N N    . PHE A 1 108 ? -0.630  -6.333  -5.497  1.00 0.00 ? 500 PHE A N    4  
ATOM 9481  C CA   . PHE A 1 108 ? 0.046   -6.385  -6.740  1.00 0.00 ? 500 PHE A CA   4  
ATOM 9482  C C    . PHE A 1 108 ? -0.749  -7.274  -7.650  1.00 0.00 ? 500 PHE A C    4  
ATOM 9483  O O    . PHE A 1 108 ? -0.915  -8.463  -7.341  1.00 0.00 ? 500 PHE A O    4  
ATOM 9484  C CB   . PHE A 1 108 ? 1.452   -6.981  -6.556  1.00 0.00 ? 500 PHE A CB   4  
ATOM 9485  C CG   . PHE A 1 108 ? 2.404   -6.218  -5.649  1.00 0.00 ? 500 PHE A CG   4  
ATOM 9486  C CD1  . PHE A 1 108 ? 2.096   -5.971  -4.323  1.00 0.00 ? 500 PHE A CD1  4  
ATOM 9487  C CD2  . PHE A 1 108 ? 3.631   -5.791  -6.123  1.00 0.00 ? 500 PHE A CD2  4  
ATOM 9488  C CE1  . PHE A 1 108 ? 2.980   -5.320  -3.497  1.00 0.00 ? 500 PHE A CE1  4  
ATOM 9489  C CE2  . PHE A 1 108 ? 4.514   -5.135  -5.301  1.00 0.00 ? 500 PHE A CE2  4  
ATOM 9490  C CZ   . PHE A 1 108 ? 4.191   -4.901  -3.984  1.00 0.00 ? 500 PHE A CZ   4  
ATOM 9491  H H    . PHE A 1 108 ? -0.516  -7.082  -4.876  1.00 0.00 ? 500 PHE A H    4  
ATOM 9492  H HA   . PHE A 1 108 ? 0.129   -5.393  -7.152  1.00 0.00 ? 500 PHE A HA   4  
ATOM 9493  H HB2  . PHE A 1 108 ? 1.353   -7.974  -6.143  1.00 0.00 ? 500 PHE A HB2  4  
ATOM 9494  H HB3  . PHE A 1 108 ? 1.914   -7.062  -7.529  1.00 0.00 ? 500 PHE A HB3  4  
ATOM 9495  H HD1  . PHE A 1 108 ? 1.140   -6.298  -3.942  1.00 0.00 ? 500 PHE A HD1  4  
ATOM 9496  H HD2  . PHE A 1 108 ? 3.891   -5.948  -7.159  1.00 0.00 ? 500 PHE A HD2  4  
ATOM 9497  H HE1  . PHE A 1 108 ? 2.718   -5.139  -2.465  1.00 0.00 ? 500 PHE A HE1  4  
ATOM 9498  H HE2  . PHE A 1 108 ? 5.468   -4.807  -5.689  1.00 0.00 ? 500 PHE A HE2  4  
ATOM 9499  H HZ   . PHE A 1 108 ? 4.888   -4.388  -3.338  1.00 0.00 ? 500 PHE A HZ   4  
ATOM 9500  N N    . PRO A 1 109 ? -1.316  -6.720  -8.742  1.00 0.00 ? 501 PRO A N    4  
ATOM 9501  C CA   . PRO A 1 109 ? -2.034  -7.514  -9.730  1.00 0.00 ? 501 PRO A CA   4  
ATOM 9502  C C    . PRO A 1 109 ? -1.094  -8.565  -10.280 1.00 0.00 ? 501 PRO A C    4  
ATOM 9503  O O    . PRO A 1 109 ? -0.129  -8.244  -10.990 1.00 0.00 ? 501 PRO A O    4  
ATOM 9504  C CB   . PRO A 1 109 ? -2.402  -6.498  -10.824 1.00 0.00 ? 501 PRO A CB   4  
ATOM 9505  C CG   . PRO A 1 109 ? -2.370  -5.178  -10.139 1.00 0.00 ? 501 PRO A CG   4  
ATOM 9506  C CD   . PRO A 1 109 ? -1.304  -5.285  -9.090  1.00 0.00 ? 501 PRO A CD   4  
ATOM 9507  H HA   . PRO A 1 109 ? -2.916  -7.979  -9.316  1.00 0.00 ? 501 PRO A HA   4  
ATOM 9508  H HB2  . PRO A 1 109 ? -1.676  -6.551  -11.623 1.00 0.00 ? 501 PRO A HB2  4  
ATOM 9509  H HB3  . PRO A 1 109 ? -3.385  -6.716  -11.213 1.00 0.00 ? 501 PRO A HB3  4  
ATOM 9510  H HG2  . PRO A 1 109 ? -2.127  -4.399  -10.846 1.00 0.00 ? 501 PRO A HG2  4  
ATOM 9511  H HG3  . PRO A 1 109 ? -3.328  -4.983  -9.680  1.00 0.00 ? 501 PRO A HG3  4  
ATOM 9512  H HD2  . PRO A 1 109 ? -0.345  -4.988  -9.486  1.00 0.00 ? 501 PRO A HD2  4  
ATOM 9513  H HD3  . PRO A 1 109 ? -1.565  -4.680  -8.233  1.00 0.00 ? 501 PRO A HD3  4  
ATOM 9514  N N    . HIS A 1 110 ? -1.309  -9.800  -9.901  1.00 0.00 ? 502 HIS A N    4  
ATOM 9515  C CA   . HIS A 1 110 ? -0.391  -10.820 -10.294 1.00 0.00 ? 502 HIS A CA   4  
ATOM 9516  C C    . HIS A 1 110 ? -0.607  -11.216 -11.729 1.00 0.00 ? 502 HIS A C    4  
ATOM 9517  O O    . HIS A 1 110 ? -1.667  -11.697 -12.117 1.00 0.00 ? 502 HIS A O    4  
ATOM 9518  C CB   . HIS A 1 110 ? -0.405  -12.047 -9.330  1.00 0.00 ? 502 HIS A CB   4  
ATOM 9519  C CG   . HIS A 1 110 ? -1.732  -12.750 -9.158  1.00 0.00 ? 502 HIS A CG   4  
ATOM 9520  N ND1  . HIS A 1 110 ? -2.058  -13.945 -9.765  1.00 0.00 ? 502 HIS A ND1  4  
ATOM 9521  C CD2  . HIS A 1 110 ? -2.807  -12.414 -8.402  1.00 0.00 ? 502 HIS A CD2  4  
ATOM 9522  C CE1  . HIS A 1 110 ? -3.284  -14.292 -9.371  1.00 0.00 ? 502 HIS A CE1  4  
ATOM 9523  N NE2  . HIS A 1 110 ? -3.788  -13.395 -8.540  1.00 0.00 ? 502 HIS A NE2  4  
ATOM 9524  H H    . HIS A 1 110 ? -2.092  -10.009 -9.351  1.00 0.00 ? 502 HIS A H    4  
ATOM 9525  H HA   . HIS A 1 110 ? 0.586   -10.365 -10.242 1.00 0.00 ? 502 HIS A HA   4  
ATOM 9526  H HB2  . HIS A 1 110 ? 0.294   -12.782 -9.700  1.00 0.00 ? 502 HIS A HB2  4  
ATOM 9527  H HB3  . HIS A 1 110 ? -0.072  -11.721 -8.356  1.00 0.00 ? 502 HIS A HB3  4  
ATOM 9528  H HD1  . HIS A 1 110 ? -1.495  -14.461 -10.381 1.00 0.00 ? 502 HIS A HD1  4  
ATOM 9529  H HD2  . HIS A 1 110 ? -2.898  -11.531 -7.788  1.00 0.00 ? 502 HIS A HD2  4  
ATOM 9530  H HE1  . HIS A 1 110 ? -3.800  -15.186 -9.687  1.00 0.00 ? 502 HIS A HE1  4  
ATOM 9531  N N    . THR A 1 111 ? 0.384   -10.943 -12.506 1.00 0.00 ? 503 THR A N    4  
ATOM 9532  C CA   . THR A 1 111 ? 0.415   -11.327 -13.877 1.00 0.00 ? 503 THR A CA   4  
ATOM 9533  C C    . THR A 1 111 ? 1.312   -12.566 -13.992 1.00 0.00 ? 503 THR A C    4  
ATOM 9534  O O    . THR A 1 111 ? 1.170   -13.391 -14.896 1.00 0.00 ? 503 THR A O    4  
ATOM 9535  C CB   . THR A 1 111 ? 0.917   -10.123 -14.758 1.00 0.00 ? 503 THR A CB   4  
ATOM 9536  O OG1  . THR A 1 111 ? 0.968   -10.460 -16.143 1.00 0.00 ? 503 THR A OG1  4  
ATOM 9537  C CG2  . THR A 1 111 ? 2.277   -9.611  -14.301 1.00 0.00 ? 503 THR A CG2  4  
ATOM 9538  H H    . THR A 1 111 ? 1.119   -10.403 -12.148 1.00 0.00 ? 503 THR A H    4  
ATOM 9539  H HA   . THR A 1 111 ? -0.590  -11.593 -14.169 1.00 0.00 ? 503 THR A HA   4  
ATOM 9540  H HB   . THR A 1 111 ? 0.197   -9.326  -14.645 1.00 0.00 ? 503 THR A HB   4  
ATOM 9541  H HG1  . THR A 1 111 ? 1.886   -10.360 -16.425 1.00 0.00 ? 503 THR A HG1  4  
ATOM 9542  H HG21 . THR A 1 111 ? 3.003   -10.407 -14.372 1.00 0.00 ? 503 THR A HG21 4  
ATOM 9543  H HG22 . THR A 1 111 ? 2.576   -8.790  -14.935 1.00 0.00 ? 503 THR A HG22 4  
ATOM 9544  H HG23 . THR A 1 111 ? 2.212   -9.273  -13.277 1.00 0.00 ? 503 THR A HG23 4  
ATOM 9545  N N    . ALA A 1 112 ? 2.187   -12.709 -13.004 1.00 0.00 ? 504 ALA A N    4  
ATOM 9546  C CA   . ALA A 1 112 ? 3.092   -13.823 -12.895 1.00 0.00 ? 504 ALA A CA   4  
ATOM 9547  C C    . ALA A 1 112 ? 2.376   -14.985 -12.214 1.00 0.00 ? 504 ALA A C    4  
ATOM 9548  O O    . ALA A 1 112 ? 1.428   -14.761 -11.446 1.00 0.00 ? 504 ALA A O    4  
ATOM 9549  C CB   . ALA A 1 112 ? 4.305   -13.411 -12.073 1.00 0.00 ? 504 ALA A CB   4  
ATOM 9550  H H    . ALA A 1 112 ? 2.195   -12.038 -12.294 1.00 0.00 ? 504 ALA A H    4  
ATOM 9551  H HA   . ALA A 1 112 ? 3.418   -14.111 -13.882 1.00 0.00 ? 504 ALA A HA   4  
ATOM 9552  H HB1  . ALA A 1 112 ? 4.815   -12.596 -12.566 1.00 0.00 ? 504 ALA A HB1  4  
ATOM 9553  H HB2  . ALA A 1 112 ? 4.980   -14.249 -11.977 1.00 0.00 ? 504 ALA A HB2  4  
ATOM 9554  H HB3  . ALA A 1 112 ? 3.985   -13.091 -11.093 1.00 0.00 ? 504 ALA A HB3  4  
ATOM 9555  N N    . PRO A 1 113 ? 2.777   -16.232 -12.500 1.00 0.00 ? 505 PRO A N    4  
ATOM 9556  C CA   . PRO A 1 113 ? 2.192   -17.412 -11.856 1.00 0.00 ? 505 PRO A CA   4  
ATOM 9557  C C    . PRO A 1 113 ? 2.807   -17.683 -10.474 1.00 0.00 ? 505 PRO A C    4  
ATOM 9558  O O    . PRO A 1 113 ? 2.279   -18.474 -9.678  1.00 0.00 ? 505 PRO A O    4  
ATOM 9559  C CB   . PRO A 1 113 ? 2.537   -18.538 -12.831 1.00 0.00 ? 505 PRO A CB   4  
ATOM 9560  C CG   . PRO A 1 113 ? 3.825   -18.115 -13.454 1.00 0.00 ? 505 PRO A CG   4  
ATOM 9561  C CD   . PRO A 1 113 ? 3.785   -16.609 -13.526 1.00 0.00 ? 505 PRO A CD   4  
ATOM 9562  H HA   . PRO A 1 113 ? 1.122   -17.320 -11.758 1.00 0.00 ? 505 PRO A HA   4  
ATOM 9563  H HB2  . PRO A 1 113 ? 2.645   -19.465 -12.289 1.00 0.00 ? 505 PRO A HB2  4  
ATOM 9564  H HB3  . PRO A 1 113 ? 1.756   -18.634 -13.571 1.00 0.00 ? 505 PRO A HB3  4  
ATOM 9565  H HG2  . PRO A 1 113 ? 4.651   -18.438 -12.837 1.00 0.00 ? 505 PRO A HG2  4  
ATOM 9566  H HG3  . PRO A 1 113 ? 3.914   -18.536 -14.445 1.00 0.00 ? 505 PRO A HG3  4  
ATOM 9567  H HD2  . PRO A 1 113 ? 4.752   -16.195 -13.281 1.00 0.00 ? 505 PRO A HD2  4  
ATOM 9568  H HD3  . PRO A 1 113 ? 3.473   -16.286 -14.508 1.00 0.00 ? 505 PRO A HD3  4  
ATOM 9569  N N    . CYS A 1 114 ? 3.903   -17.026 -10.187 1.00 0.00 ? 506 CYS A N    4  
ATOM 9570  C CA   . CYS A 1 114 ? 4.581   -17.217 -8.937  1.00 0.00 ? 506 CYS A CA   4  
ATOM 9571  C C    . CYS A 1 114 ? 4.135   -16.145 -7.955  1.00 0.00 ? 506 CYS A C    4  
ATOM 9572  O O    . CYS A 1 114 ? 3.488   -15.176 -8.353  1.00 0.00 ? 506 CYS A O    4  
ATOM 9573  C CB   . CYS A 1 114 ? 6.091   -17.174 -9.146  1.00 0.00 ? 506 CYS A CB   4  
ATOM 9574  S SG   . CYS A 1 114 ? 7.075   -17.695 -7.722  1.00 0.00 ? 506 CYS A SG   4  
ATOM 9575  H H    . CYS A 1 114 ? 4.235   -16.373 -10.835 1.00 0.00 ? 506 CYS A H    4  
ATOM 9576  H HA   . CYS A 1 114 ? 4.302   -18.186 -8.549  1.00 0.00 ? 506 CYS A HA   4  
ATOM 9577  H HB2  . CYS A 1 114 ? 6.350   -17.815 -9.974  1.00 0.00 ? 506 CYS A HB2  4  
ATOM 9578  H HB3  . CYS A 1 114 ? 6.371   -16.159 -9.386  1.00 0.00 ? 506 CYS A HB3  4  
ATOM 9579  H HG   . CYS A 1 114 ? 7.002   -19.019 -7.658  1.00 0.00 ? 506 CYS A HG   4  
ATOM 9580  N N    . GLU A 1 115 ? 4.496   -16.328 -6.702  1.00 0.00 ? 507 GLU A N    4  
ATOM 9581  C CA   . GLU A 1 115 ? 4.104   -15.467 -5.604  1.00 0.00 ? 507 GLU A CA   4  
ATOM 9582  C C    . GLU A 1 115 ? 4.581   -14.038 -5.770  1.00 0.00 ? 507 GLU A C    4  
ATOM 9583  O O    . GLU A 1 115 ? 5.757   -13.730 -5.556  1.00 0.00 ? 507 GLU A O    4  
ATOM 9584  C CB   . GLU A 1 115 ? 4.616   -16.024 -4.264  1.00 0.00 ? 507 GLU A CB   4  
ATOM 9585  C CG   . GLU A 1 115 ? 3.867   -17.238 -3.723  1.00 0.00 ? 507 GLU A CG   4  
ATOM 9586  C CD   . GLU A 1 115 ? 3.789   -18.399 -4.679  1.00 0.00 ? 507 GLU A CD   4  
ATOM 9587  O OE1  . GLU A 1 115 ? 2.707   -18.633 -5.246  1.00 0.00 ? 507 GLU A OE1  4  
ATOM 9588  O OE2  . GLU A 1 115 ? 4.797   -19.102 -4.883  1.00 0.00 ? 507 GLU A OE2  4  
ATOM 9589  H H    . GLU A 1 115 ? 5.076   -17.089 -6.490  1.00 0.00 ? 507 GLU A H    4  
ATOM 9590  H HA   . GLU A 1 115 ? 3.025   -15.466 -5.561  1.00 0.00 ? 507 GLU A HA   4  
ATOM 9591  H HB2  . GLU A 1 115 ? 5.652   -16.307 -4.386  1.00 0.00 ? 507 GLU A HB2  4  
ATOM 9592  H HB3  . GLU A 1 115 ? 4.565   -15.236 -3.527  1.00 0.00 ? 507 GLU A HB3  4  
ATOM 9593  H HG2  . GLU A 1 115 ? 4.366   -17.575 -2.827  1.00 0.00 ? 507 GLU A HG2  4  
ATOM 9594  H HG3  . GLU A 1 115 ? 2.863   -16.931 -3.469  1.00 0.00 ? 507 GLU A HG3  4  
ATOM 9595  N N    . VAL A 1 116 ? 3.700   -13.180 -6.179  1.00 0.00 ? 508 VAL A N    4  
ATOM 9596  C CA   . VAL A 1 116 ? 3.999   -11.781 -6.224  1.00 0.00 ? 508 VAL A CA   4  
ATOM 9597  C C    . VAL A 1 116 ? 3.702   -11.248 -4.843  1.00 0.00 ? 508 VAL A C    4  
ATOM 9598  O O    . VAL A 1 116 ? 2.538   -11.216 -4.429  1.00 0.00 ? 508 VAL A O    4  
ATOM 9599  C CB   . VAL A 1 116 ? 3.166   -11.026 -7.292  1.00 0.00 ? 508 VAL A CB   4  
ATOM 9600  C CG1  . VAL A 1 116 ? 3.629   -9.579  -7.393  1.00 0.00 ? 508 VAL A CG1  4  
ATOM 9601  C CG2  . VAL A 1 116 ? 3.281   -11.709 -8.649  1.00 0.00 ? 508 VAL A CG2  4  
ATOM 9602  H H    . VAL A 1 116 ? 2.814   -13.510 -6.455  1.00 0.00 ? 508 VAL A H    4  
ATOM 9603  H HA   . VAL A 1 116 ? 5.055   -11.629 -6.403  1.00 0.00 ? 508 VAL A HA   4  
ATOM 9604  H HB   . VAL A 1 116 ? 2.129   -11.031 -6.988  1.00 0.00 ? 508 VAL A HB   4  
ATOM 9605  H HG11 . VAL A 1 116 ? 3.508   -9.095  -6.435  1.00 0.00 ? 508 VAL A HG11 4  
ATOM 9606  H HG12 . VAL A 1 116 ? 4.671   -9.552  -7.678  1.00 0.00 ? 508 VAL A HG12 4  
ATOM 9607  H HG13 . VAL A 1 116 ? 3.042   -9.061  -8.137  1.00 0.00 ? 508 VAL A HG13 4  
ATOM 9608  H HG21 . VAL A 1 116 ? 2.921   -12.724 -8.570  1.00 0.00 ? 508 VAL A HG21 4  
ATOM 9609  H HG22 . VAL A 1 116 ? 2.691   -11.176 -9.378  1.00 0.00 ? 508 VAL A HG22 4  
ATOM 9610  H HG23 . VAL A 1 116 ? 4.315   -11.720 -8.960  1.00 0.00 ? 508 VAL A HG23 4  
ATOM 9611  N N    . ARG A 1 117 ? 4.771   -10.901 -4.115  1.00 0.00 ? 509 ARG A N    4  
ATOM 9612  C CA   . ARG A 1 117 ? 4.673   -10.451 -2.727  1.00 0.00 ? 509 ARG A CA   4  
ATOM 9613  C C    . ARG A 1 117 ? 3.747   -9.244  -2.624  1.00 0.00 ? 509 ARG A C    4  
ATOM 9614  O O    . ARG A 1 117 ? 3.664   -8.466  -3.563  1.00 0.00 ? 509 ARG A O    4  
ATOM 9615  C CB   . ARG A 1 117 ? 6.059   -10.101 -2.143  1.00 0.00 ? 509 ARG A CB   4  
ATOM 9616  C CG   . ARG A 1 117 ? 7.062   -11.263 -1.974  1.00 0.00 ? 509 ARG A CG   4  
ATOM 9617  C CD   . ARG A 1 117 ? 8.119   -11.362 -3.093  1.00 0.00 ? 509 ARG A CD   4  
ATOM 9618  N NE   . ARG A 1 117 ? 7.635   -11.895 -4.387  1.00 0.00 ? 509 ARG A NE   4  
ATOM 9619  C CZ   . ARG A 1 117 ? 8.313   -11.788 -5.562  1.00 0.00 ? 509 ARG A CZ   4  
ATOM 9620  N NH1  . ARG A 1 117 ? 9.498   -11.172 -5.603  1.00 0.00 ? 509 ARG A NH1  4  
ATOM 9621  N NH2  . ARG A 1 117 ? 7.833   -12.367 -6.658  1.00 0.00 ? 509 ARG A NH2  4  
ATOM 9622  H H    . ARG A 1 117 ? 5.646   -10.908 -4.548  1.00 0.00 ? 509 ARG A H    4  
ATOM 9623  H HA   . ARG A 1 117 ? 4.243   -11.258 -2.151  1.00 0.00 ? 509 ARG A HA   4  
ATOM 9624  H HB2  . ARG A 1 117 ? 6.522   -9.375  -2.795  1.00 0.00 ? 509 ARG A HB2  4  
ATOM 9625  H HB3  . ARG A 1 117 ? 5.908   -9.643  -1.177  1.00 0.00 ? 509 ARG A HB3  4  
ATOM 9626  H HG2  . ARG A 1 117 ? 7.597   -11.112 -1.050  1.00 0.00 ? 509 ARG A HG2  4  
ATOM 9627  H HG3  . ARG A 1 117 ? 6.513   -12.191 -1.923  1.00 0.00 ? 509 ARG A HG3  4  
ATOM 9628  H HD2  . ARG A 1 117 ? 8.518   -10.374 -3.269  1.00 0.00 ? 509 ARG A HD2  4  
ATOM 9629  H HD3  . ARG A 1 117 ? 8.916   -11.994 -2.732  1.00 0.00 ? 509 ARG A HD3  4  
ATOM 9630  H HE   . ARG A 1 117 ? 6.799   -12.417 -4.356  1.00 0.00 ? 509 ARG A HE   4  
ATOM 9631  H HH11 . ARG A 1 117 ? 9.911   -10.788 -4.776  1.00 0.00 ? 509 ARG A HH11 4  
ATOM 9632  H HH12 . ARG A 1 117 ? 10.056  -11.101 -6.435  1.00 0.00 ? 509 ARG A HH12 4  
ATOM 9633  H HH21 . ARG A 1 117 ? 6.974   -12.891 -6.610  1.00 0.00 ? 509 ARG A HH21 4  
ATOM 9634  H HH22 . ARG A 1 117 ? 8.284   -12.334 -7.555  1.00 0.00 ? 509 ARG A HH22 4  
ATOM 9635  N N    . VAL A 1 118 ? 3.089   -9.075  -1.490  1.00 0.00 ? 510 VAL A N    4  
ATOM 9636  C CA   . VAL A 1 118 ? 2.089   -8.000  -1.345  1.00 0.00 ? 510 VAL A CA   4  
ATOM 9637  C C    . VAL A 1 118 ? 2.539   -7.064  -0.258  1.00 0.00 ? 510 VAL A C    4  
ATOM 9638  O O    . VAL A 1 118 ? 3.314   -7.465  0.560   1.00 0.00 ? 510 VAL A O    4  
ATOM 9639  C CB   . VAL A 1 118 ? 0.652   -8.549  -1.093  1.00 0.00 ? 510 VAL A CB   4  
ATOM 9640  C CG1  . VAL A 1 118 ? 0.097   -9.184  -2.356  1.00 0.00 ? 510 VAL A CG1  4  
ATOM 9641  C CG2  . VAL A 1 118 ? 0.678   -9.573  0.006   1.00 0.00 ? 510 VAL A CG2  4  
ATOM 9642  H H    . VAL A 1 118 ? 3.321   -9.603  -0.687  1.00 0.00 ? 510 VAL A H    4  
ATOM 9643  H HA   . VAL A 1 118 ? 2.110   -7.445  -2.271  1.00 0.00 ? 510 VAL A HA   4  
ATOM 9644  H HB   . VAL A 1 118 ? -0.035  -7.763  -0.811  1.00 0.00 ? 510 VAL A HB   4  
ATOM 9645  H HG11 . VAL A 1 118 ? 0.740   -9.997  -2.662  1.00 0.00 ? 510 VAL A HG11 4  
ATOM 9646  H HG12 . VAL A 1 118 ? -0.896  -9.563  -2.160  1.00 0.00 ? 510 VAL A HG12 4  
ATOM 9647  H HG13 . VAL A 1 118 ? 0.048   -8.444  -3.142  1.00 0.00 ? 510 VAL A HG13 4  
ATOM 9648  H HG21 . VAL A 1 118 ? 1.334   -10.383 -0.277  1.00 0.00 ? 510 VAL A HG21 4  
ATOM 9649  H HG22 . VAL A 1 118 ? 1.029   -9.113  0.918   1.00 0.00 ? 510 VAL A HG22 4  
ATOM 9650  H HG23 . VAL A 1 118 ? -0.327  -9.940  0.150   1.00 0.00 ? 510 VAL A HG23 4  
ATOM 9651  N N    . LEU A 1 119 ? 2.057   -5.838  -0.222  1.00 0.00 ? 511 LEU A N    4  
ATOM 9652  C CA   . LEU A 1 119 ? 2.683   -4.855  0.654   1.00 0.00 ? 511 LEU A CA   4  
ATOM 9653  C C    . LEU A 1 119 ? 1.662   -4.026  1.439   1.00 0.00 ? 511 LEU A C    4  
ATOM 9654  O O    . LEU A 1 119 ? 0.559   -3.774  0.969   1.00 0.00 ? 511 LEU A O    4  
ATOM 9655  C CB   . LEU A 1 119 ? 3.645   -3.994  -0.236  1.00 0.00 ? 511 LEU A CB   4  
ATOM 9656  C CG   . LEU A 1 119 ? 4.458   -2.836  0.362   1.00 0.00 ? 511 LEU A CG   4  
ATOM 9657  C CD1  . LEU A 1 119 ? 5.579   -2.495  -0.610  1.00 0.00 ? 511 LEU A CD1  4  
ATOM 9658  C CD2  . LEU A 1 119 ? 3.597   -1.594  0.541   1.00 0.00 ? 511 LEU A CD2  4  
ATOM 9659  H H    . LEU A 1 119 ? 1.268   -5.571  -0.748  1.00 0.00 ? 511 LEU A H    4  
ATOM 9660  H HA   . LEU A 1 119 ? 3.291   -5.397  1.361   1.00 0.00 ? 511 LEU A HA   4  
ATOM 9661  H HB2  . LEU A 1 119 ? 4.383   -4.673  -0.639  1.00 0.00 ? 511 LEU A HB2  4  
ATOM 9662  H HB3  . LEU A 1 119 ? 3.068   -3.607  -1.063  1.00 0.00 ? 511 LEU A HB3  4  
ATOM 9663  H HG   . LEU A 1 119 ? 4.882   -3.120  1.314   1.00 0.00 ? 511 LEU A HG   4  
ATOM 9664  H HD11 . LEU A 1 119 ? 6.204   -3.360  -0.773  1.00 0.00 ? 511 LEU A HD11 4  
ATOM 9665  H HD12 . LEU A 1 119 ? 5.150   -2.184  -1.551  1.00 0.00 ? 511 LEU A HD12 4  
ATOM 9666  H HD13 . LEU A 1 119 ? 6.181   -1.694  -0.210  1.00 0.00 ? 511 LEU A HD13 4  
ATOM 9667  H HD21 . LEU A 1 119 ? 2.754   -1.836  1.171   1.00 0.00 ? 511 LEU A HD21 4  
ATOM 9668  H HD22 . LEU A 1 119 ? 4.175   -0.808  1.004   1.00 0.00 ? 511 LEU A HD22 4  
ATOM 9669  H HD23 . LEU A 1 119 ? 3.236   -1.262  -0.422  1.00 0.00 ? 511 LEU A HD23 4  
ATOM 9670  N N    . MET A 1 120 ? 2.025   -3.640  2.648   1.00 0.00 ? 512 MET A N    4  
ATOM 9671  C CA   . MET A 1 120 ? 1.174   -2.776  3.454   1.00 0.00 ? 512 MET A CA   4  
ATOM 9672  C C    . MET A 1 120 ? 1.762   -1.379  3.497   1.00 0.00 ? 512 MET A C    4  
ATOM 9673  O O    . MET A 1 120 ? 2.917   -1.207  3.872   1.00 0.00 ? 512 MET A O    4  
ATOM 9674  C CB   . MET A 1 120 ? 1.032   -3.308  4.880   1.00 0.00 ? 512 MET A CB   4  
ATOM 9675  C CG   . MET A 1 120 ? 0.267   -2.362  5.807   1.00 0.00 ? 512 MET A CG   4  
ATOM 9676  S SD   . MET A 1 120 ? -1.442  -2.074  5.290   1.00 0.00 ? 512 MET A SD   4  
ATOM 9677  C CE   . MET A 1 120 ? -2.168  -3.671  5.631   1.00 0.00 ? 512 MET A CE   4  
ATOM 9678  H H    . MET A 1 120 ? 2.895   -3.916  3.023   1.00 0.00 ? 512 MET A H    4  
ATOM 9679  H HA   . MET A 1 120 ? 0.200   -2.734  2.990   1.00 0.00 ? 512 MET A HA   4  
ATOM 9680  H HB2  . MET A 1 120 ? 0.515   -4.256  4.848   1.00 0.00 ? 512 MET A HB2  4  
ATOM 9681  H HB3  . MET A 1 120 ? 2.018   -3.461  5.292   1.00 0.00 ? 512 MET A HB3  4  
ATOM 9682  H HG2  . MET A 1 120 ? 0.257   -2.785  6.802   1.00 0.00 ? 512 MET A HG2  4  
ATOM 9683  H HG3  . MET A 1 120 ? 0.787   -1.416  5.829   1.00 0.00 ? 512 MET A HG3  4  
ATOM 9684  H HE1  . MET A 1 120 ? -1.638  -4.440  5.092   1.00 0.00 ? 512 MET A HE1  4  
ATOM 9685  H HE2  . MET A 1 120 ? -2.097  -3.858  6.692   1.00 0.00 ? 512 MET A HE2  4  
ATOM 9686  H HE3  . MET A 1 120 ? -3.205  -3.666  5.332   1.00 0.00 ? 512 MET A HE3  4  
ATOM 9687  N N    . LEU A 1 121 ? 0.987   -0.401  3.114   1.00 0.00 ? 513 LEU A N    4  
ATOM 9688  C CA   . LEU A 1 121 ? 1.441   0.959   3.118   1.00 0.00 ? 513 LEU A CA   4  
ATOM 9689  C C    . LEU A 1 121 ? 0.844   1.712   4.295   1.00 0.00 ? 513 LEU A C    4  
ATOM 9690  O O    . LEU A 1 121 ? -0.377  1.715   4.511   1.00 0.00 ? 513 LEU A O    4  
ATOM 9691  C CB   . LEU A 1 121 ? 1.104   1.663   1.799   1.00 0.00 ? 513 LEU A CB   4  
ATOM 9692  C CG   . LEU A 1 121 ? 1.604   3.103   1.670   1.00 0.00 ? 513 LEU A CG   4  
ATOM 9693  C CD1  . LEU A 1 121 ? 3.093   3.153   1.866   1.00 0.00 ? 513 LEU A CD1  4  
ATOM 9694  C CD2  . LEU A 1 121 ? 1.243   3.688   0.322   1.00 0.00 ? 513 LEU A CD2  4  
ATOM 9695  H H    . LEU A 1 121 ? 0.058   -0.570  2.833   1.00 0.00 ? 513 LEU A H    4  
ATOM 9696  H HA   . LEU A 1 121 ? 2.514   0.936   3.234   1.00 0.00 ? 513 LEU A HA   4  
ATOM 9697  H HB2  . LEU A 1 121 ? 1.525   1.083   0.990   1.00 0.00 ? 513 LEU A HB2  4  
ATOM 9698  H HB3  . LEU A 1 121 ? 0.029   1.668   1.689   1.00 0.00 ? 513 LEU A HB3  4  
ATOM 9699  H HG   . LEU A 1 121 ? 1.146   3.708   2.439   1.00 0.00 ? 513 LEU A HG   4  
ATOM 9700  H HD11 . LEU A 1 121 ? 3.545   2.389   1.250   1.00 0.00 ? 513 LEU A HD11 4  
ATOM 9701  H HD12 . LEU A 1 121 ? 3.468   4.113   1.546   1.00 0.00 ? 513 LEU A HD12 4  
ATOM 9702  H HD13 . LEU A 1 121 ? 3.339   2.959   2.900   1.00 0.00 ? 513 LEU A HD13 4  
ATOM 9703  H HD21 . LEU A 1 121 ? 0.173   3.666   0.185   1.00 0.00 ? 513 LEU A HD21 4  
ATOM 9704  H HD22 . LEU A 1 121 ? 1.598   4.707   0.271   1.00 0.00 ? 513 LEU A HD22 4  
ATOM 9705  H HD23 . LEU A 1 121 ? 1.718   3.109   -0.456  1.00 0.00 ? 513 LEU A HD23 4  
ATOM 9706  N N    . LEU A 1 122 ? 1.704   2.327   5.044   1.00 0.00 ? 514 LEU A N    4  
ATOM 9707  C CA   . LEU A 1 122 ? 1.354   3.083   6.204   1.00 0.00 ? 514 LEU A CA   4  
ATOM 9708  C C    . LEU A 1 122 ? 2.019   4.432   6.149   1.00 0.00 ? 514 LEU A C    4  
ATOM 9709  O O    . LEU A 1 122 ? 3.085   4.588   5.566   1.00 0.00 ? 514 LEU A O    4  
ATOM 9710  C CB   . LEU A 1 122 ? 1.801   2.327   7.453   1.00 0.00 ? 514 LEU A CB   4  
ATOM 9711  C CG   . LEU A 1 122 ? 0.961   1.111   7.833   1.00 0.00 ? 514 LEU A CG   4  
ATOM 9712  C CD1  . LEU A 1 122 ? 1.642   0.318   8.926   1.00 0.00 ? 514 LEU A CD1  4  
ATOM 9713  C CD2  . LEU A 1 122 ? -0.413  1.549   8.307   1.00 0.00 ? 514 LEU A CD2  4  
ATOM 9714  H H    . LEU A 1 122 ? 2.664   2.288   4.826   1.00 0.00 ? 514 LEU A H    4  
ATOM 9715  H HA   . LEU A 1 122 ? 0.283   3.204   6.234   1.00 0.00 ? 514 LEU A HA   4  
ATOM 9716  H HB2  . LEU A 1 122 ? 2.801   1.976   7.239   1.00 0.00 ? 514 LEU A HB2  4  
ATOM 9717  H HB3  . LEU A 1 122 ? 1.879   2.998   8.294   1.00 0.00 ? 514 LEU A HB3  4  
ATOM 9718  H HG   . LEU A 1 122 ? 0.826   0.494   6.956   1.00 0.00 ? 514 LEU A HG   4  
ATOM 9719  H HD11 . LEU A 1 122 ? 2.623   0.017   8.595   1.00 0.00 ? 514 LEU A HD11 4  
ATOM 9720  H HD12 . LEU A 1 122 ? 1.727   0.922   9.817   1.00 0.00 ? 514 LEU A HD12 4  
ATOM 9721  H HD13 . LEU A 1 122 ? 1.054   -0.564  9.139   1.00 0.00 ? 514 LEU A HD13 4  
ATOM 9722  H HD21 . LEU A 1 122 ? -0.312  2.186   9.173   1.00 0.00 ? 514 LEU A HD21 4  
ATOM 9723  H HD22 . LEU A 1 122 ? -0.921  2.079   7.516   1.00 0.00 ? 514 LEU A HD22 4  
ATOM 9724  H HD23 . LEU A 1 122 ? -0.990  0.675   8.571   1.00 0.00 ? 514 LEU A HD23 4  
ATOM 9725  N N    . TYR A 1 123 ? 1.391   5.400   6.697   1.00 0.00 ? 515 TYR A N    4  
ATOM 9726  C CA   . TYR A 1 123 ? 1.961   6.700   6.757   1.00 0.00 ? 515 TYR A CA   4  
ATOM 9727  C C    . TYR A 1 123 ? 2.492   6.937   8.140   1.00 0.00 ? 515 TYR A C    4  
ATOM 9728  O O    . TYR A 1 123 ? 1.789   6.713   9.118   1.00 0.00 ? 515 TYR A O    4  
ATOM 9729  C CB   . TYR A 1 123 ? 0.917   7.754   6.405   1.00 0.00 ? 515 TYR A CB   4  
ATOM 9730  C CG   . TYR A 1 123 ? 1.387   9.171   6.605   1.00 0.00 ? 515 TYR A CG   4  
ATOM 9731  C CD1  . TYR A 1 123 ? 0.837   9.966   7.601   1.00 0.00 ? 515 TYR A CD1  4  
ATOM 9732  C CD2  . TYR A 1 123 ? 2.399   9.703   5.827   1.00 0.00 ? 515 TYR A CD2  4  
ATOM 9733  C CE1  . TYR A 1 123 ? 1.284   11.246  7.811   1.00 0.00 ? 515 TYR A CE1  4  
ATOM 9734  C CE2  . TYR A 1 123 ? 2.849   10.983  6.028   1.00 0.00 ? 515 TYR A CE2  4  
ATOM 9735  C CZ   . TYR A 1 123 ? 2.290   11.752  7.022   1.00 0.00 ? 515 TYR A CZ   4  
ATOM 9736  O OH   . TYR A 1 123 ? 2.741   13.028  7.238   1.00 0.00 ? 515 TYR A OH   4  
ATOM 9737  H H    . TYR A 1 123 ? 0.509   5.247   7.101   1.00 0.00 ? 515 TYR A H    4  
ATOM 9738  H HA   . TYR A 1 123 ? 2.772   6.765   6.048   1.00 0.00 ? 515 TYR A HA   4  
ATOM 9739  H HB2  . TYR A 1 123 ? 0.620   7.641   5.373   1.00 0.00 ? 515 TYR A HB2  4  
ATOM 9740  H HB3  . TYR A 1 123 ? 0.063   7.593   7.045   1.00 0.00 ? 515 TYR A HB3  4  
ATOM 9741  H HD1  . TYR A 1 123 ? 0.046   9.567   8.217   1.00 0.00 ? 515 TYR A HD1  4  
ATOM 9742  H HD2  . TYR A 1 123 ? 2.836   9.099   5.046   1.00 0.00 ? 515 TYR A HD2  4  
ATOM 9743  H HE1  . TYR A 1 123 ? 0.843   11.847  8.592   1.00 0.00 ? 515 TYR A HE1  4  
ATOM 9744  H HE2  . TYR A 1 123 ? 3.640   11.373  5.406   1.00 0.00 ? 515 TYR A HE2  4  
ATOM 9745  H HH   . TYR A 1 123 ? 2.789   13.496  6.396   1.00 0.00 ? 515 TYR A HH   4  
ATOM 9746  N N    . SER A 1 124 ? 3.712   7.359   8.240   1.00 0.00 ? 516 SER A N    4  
ATOM 9747  C CA   . SER A 1 124 ? 4.256   7.696   9.501   1.00 0.00 ? 516 SER A CA   4  
ATOM 9748  C C    . SER A 1 124 ? 4.315   9.200   9.590   1.00 0.00 ? 516 SER A C    4  
ATOM 9749  O O    . SER A 1 124 ? 5.074   9.848   8.848   1.00 0.00 ? 516 SER A O    4  
ATOM 9750  C CB   . SER A 1 124 ? 5.664   7.096   9.656   1.00 0.00 ? 516 SER A CB   4  
ATOM 9751  O OG   . SER A 1 124 ? 6.231   7.404   10.925  1.00 0.00 ? 516 SER A OG   4  
ATOM 9752  H H    . SER A 1 124 ? 4.272   7.480   7.438   1.00 0.00 ? 516 SER A H    4  
ATOM 9753  H HA   . SER A 1 124 ? 3.612   7.305   10.274  1.00 0.00 ? 516 SER A HA   4  
ATOM 9754  H HB2  . SER A 1 124 ? 5.605   6.023   9.560   1.00 0.00 ? 516 SER A HB2  4  
ATOM 9755  H HB3  . SER A 1 124 ? 6.304   7.495   8.883   1.00 0.00 ? 516 SER A HB3  4  
ATOM 9756  H HG   . SER A 1 124 ? 5.925   6.722   11.536  1.00 0.00 ? 516 SER A HG   4  
ATOM 9757  N N    . SER A 1 125 ? 3.478   9.756   10.448  1.00 0.00 ? 517 SER A N    4  
ATOM 9758  C CA   . SER A 1 125 ? 3.468   11.167  10.719  1.00 0.00 ? 517 SER A CA   4  
ATOM 9759  C C    . SER A 1 125 ? 4.741   11.541  11.487  1.00 0.00 ? 517 SER A C    4  
ATOM 9760  O O    . SER A 1 125 ? 5.188   12.674  11.452  1.00 0.00 ? 517 SER A O    4  
ATOM 9761  C CB   . SER A 1 125 ? 2.194   11.558  11.486  1.00 0.00 ? 517 SER A CB   4  
ATOM 9762  O OG   . SER A 1 125 ? 2.020   12.978  11.548  1.00 0.00 ? 517 SER A OG   4  
ATOM 9763  H H    . SER A 1 125 ? 2.833   9.189   10.926  1.00 0.00 ? 517 SER A H    4  
ATOM 9764  H HA   . SER A 1 125 ? 3.485   11.677  9.767   1.00 0.00 ? 517 SER A HA   4  
ATOM 9765  H HB2  . SER A 1 125 ? 1.338   11.131  10.985  1.00 0.00 ? 517 SER A HB2  4  
ATOM 9766  H HB3  . SER A 1 125 ? 2.252   11.170  12.492  1.00 0.00 ? 517 SER A HB3  4  
ATOM 9767  H HG   . SER A 1 125 ? 1.158   13.159  11.140  1.00 0.00 ? 517 SER A HG   4  
ATOM 9768  N N    . LYS A 1 126 ? 5.334   10.545  12.145  1.00 0.00 ? 518 LYS A N    4  
ATOM 9769  C CA   . LYS A 1 126 ? 6.561   10.725  12.911  1.00 0.00 ? 518 LYS A CA   4  
ATOM 9770  C C    . LYS A 1 126 ? 7.693   11.151  11.986  1.00 0.00 ? 518 LYS A C    4  
ATOM 9771  O O    . LYS A 1 126 ? 8.468   12.061  12.302  1.00 0.00 ? 518 LYS A O    4  
ATOM 9772  C CB   . LYS A 1 126 ? 6.952   9.406   13.594  1.00 0.00 ? 518 LYS A CB   4  
ATOM 9773  C CG   . LYS A 1 126 ? 5.961   8.881   14.632  1.00 0.00 ? 518 LYS A CG   4  
ATOM 9774  C CD   . LYS A 1 126 ? 5.915   9.738   15.895  1.00 0.00 ? 518 LYS A CD   4  
ATOM 9775  C CE   . LYS A 1 126 ? 7.242   9.721   16.659  1.00 0.00 ? 518 LYS A CE   4  
ATOM 9776  N NZ   . LYS A 1 126 ? 7.651   8.350   17.069  1.00 0.00 ? 518 LYS A NZ   4  
ATOM 9777  H H    . LYS A 1 126 ? 4.909   9.661   12.125  1.00 0.00 ? 518 LYS A H    4  
ATOM 9778  H HA   . LYS A 1 126 ? 6.398   11.479  13.667  1.00 0.00 ? 518 LYS A HA   4  
ATOM 9779  H HB2  . LYS A 1 126 ? 7.057   8.649   12.830  1.00 0.00 ? 518 LYS A HB2  4  
ATOM 9780  H HB3  . LYS A 1 126 ? 7.909   9.538   14.073  1.00 0.00 ? 518 LYS A HB3  4  
ATOM 9781  H HG2  . LYS A 1 126 ? 4.977   8.881   14.192  1.00 0.00 ? 518 LYS A HG2  4  
ATOM 9782  H HG3  . LYS A 1 126 ? 6.238   7.872   14.900  1.00 0.00 ? 518 LYS A HG3  4  
ATOM 9783  H HD2  . LYS A 1 126 ? 5.690   10.758  15.620  1.00 0.00 ? 518 LYS A HD2  4  
ATOM 9784  H HD3  . LYS A 1 126 ? 5.134   9.361   16.538  1.00 0.00 ? 518 LYS A HD3  4  
ATOM 9785  H HE2  . LYS A 1 126 ? 8.022   10.151  16.048  1.00 0.00 ? 518 LYS A HE2  4  
ATOM 9786  H HE3  . LYS A 1 126 ? 7.121   10.326  17.545  1.00 0.00 ? 518 LYS A HE3  4  
ATOM 9787  H HZ1  . LYS A 1 126 ? 6.922   7.883   17.644  1.00 0.00 ? 518 LYS A HZ1  4  
ATOM 9788  H HZ2  . LYS A 1 126 ? 7.868   7.736   16.258  1.00 0.00 ? 518 LYS A HZ2  4  
ATOM 9789  H HZ3  . LYS A 1 126 ? 8.514   8.406   17.647  1.00 0.00 ? 518 LYS A HZ3  4  
ATOM 9790  N N    . LYS A 1 127 ? 7.768   10.502  10.844  1.00 0.00 ? 519 LYS A N    4  
ATOM 9791  C CA   . LYS A 1 127 ? 8.806   10.785  9.872   1.00 0.00 ? 519 LYS A CA   4  
ATOM 9792  C C    . LYS A 1 127 ? 8.265   11.623  8.707   1.00 0.00 ? 519 LYS A C    4  
ATOM 9793  O O    . LYS A 1 127 ? 9.020   12.014  7.822   1.00 0.00 ? 519 LYS A O    4  
ATOM 9794  C CB   . LYS A 1 127 ? 9.378   9.477   9.326   1.00 0.00 ? 519 LYS A CB   4  
ATOM 9795  C CG   . LYS A 1 127 ? 10.042  8.565   10.337  1.00 0.00 ? 519 LYS A CG   4  
ATOM 9796  C CD   . LYS A 1 127 ? 11.221  9.238   10.993  1.00 0.00 ? 519 LYS A CD   4  
ATOM 9797  C CE   . LYS A 1 127 ? 11.971  8.276   11.880  1.00 0.00 ? 519 LYS A CE   4  
ATOM 9798  N NZ   . LYS A 1 127 ? 13.037  8.944   12.636  1.00 0.00 ? 519 LYS A NZ   4  
ATOM 9799  H H    . LYS A 1 127 ? 7.111   9.796   10.660  1.00 0.00 ? 519 LYS A H    4  
ATOM 9800  H HA   . LYS A 1 127 ? 9.599   11.328  10.364  1.00 0.00 ? 519 LYS A HA   4  
ATOM 9801  H HB2  . LYS A 1 127 ? 8.570   8.920   8.877   1.00 0.00 ? 519 LYS A HB2  4  
ATOM 9802  H HB3  . LYS A 1 127 ? 10.101  9.712   8.558   1.00 0.00 ? 519 LYS A HB3  4  
ATOM 9803  H HG2  . LYS A 1 127 ? 9.321   8.305   11.098  1.00 0.00 ? 519 LYS A HG2  4  
ATOM 9804  H HG3  . LYS A 1 127 ? 10.377  7.670   9.834   1.00 0.00 ? 519 LYS A HG3  4  
ATOM 9805  H HD2  . LYS A 1 127 ? 11.888  9.612   10.230  1.00 0.00 ? 519 LYS A HD2  4  
ATOM 9806  H HD3  . LYS A 1 127 ? 10.858  10.059  11.592  1.00 0.00 ? 519 LYS A HD3  4  
ATOM 9807  H HE2  . LYS A 1 127 ? 11.280  7.818   12.570  1.00 0.00 ? 519 LYS A HE2  4  
ATOM 9808  H HE3  . LYS A 1 127 ? 12.409  7.513   11.255  1.00 0.00 ? 519 LYS A HE3  4  
ATOM 9809  H HZ1  . LYS A 1 127 ? 13.718  9.426   12.014  1.00 0.00 ? 519 LYS A HZ1  4  
ATOM 9810  H HZ2  . LYS A 1 127 ? 12.620  9.641   13.285  1.00 0.00 ? 519 LYS A HZ2  4  
ATOM 9811  H HZ3  . LYS A 1 127 ? 13.561  8.251   13.209  1.00 0.00 ? 519 LYS A HZ3  4  
ATOM 9812  N N    . LYS A 1 128 ? 6.948   11.863  8.722   1.00 0.00 ? 520 LYS A N    4  
ATOM 9813  C CA   . LYS A 1 128 ? 6.213   12.602  7.664   1.00 0.00 ? 520 LYS A CA   4  
ATOM 9814  C C    . LYS A 1 128 ? 6.344   11.911  6.302   1.00 0.00 ? 520 LYS A C    4  
ATOM 9815  O O    . LYS A 1 128 ? 6.207   12.539  5.250   1.00 0.00 ? 520 LYS A O    4  
ATOM 9816  C CB   . LYS A 1 128 ? 6.652   14.080  7.587   1.00 0.00 ? 520 LYS A CB   4  
ATOM 9817  C CG   . LYS A 1 128 ? 6.384   14.880  8.858   1.00 0.00 ? 520 LYS A CG   4  
ATOM 9818  C CD   . LYS A 1 128 ? 4.904   14.878  9.227   1.00 0.00 ? 520 LYS A CD   4  
ATOM 9819  C CE   . LYS A 1 128 ? 4.655   15.635  10.518  1.00 0.00 ? 520 LYS A CE   4  
ATOM 9820  N NZ   . LYS A 1 128 ? 3.251   15.520  10.976  1.00 0.00 ? 520 LYS A NZ   4  
ATOM 9821  H H    . LYS A 1 128 ? 6.434   11.532  9.485   1.00 0.00 ? 520 LYS A H    4  
ATOM 9822  H HA   . LYS A 1 128 ? 5.166   12.558  7.929   1.00 0.00 ? 520 LYS A HA   4  
ATOM 9823  H HB2  . LYS A 1 128 ? 7.713   14.117  7.385   1.00 0.00 ? 520 LYS A HB2  4  
ATOM 9824  H HB3  . LYS A 1 128 ? 6.126   14.553  6.771   1.00 0.00 ? 520 LYS A HB3  4  
ATOM 9825  H HG2  . LYS A 1 128 ? 6.947   14.444  9.672   1.00 0.00 ? 520 LYS A HG2  4  
ATOM 9826  H HG3  . LYS A 1 128 ? 6.708   15.897  8.699   1.00 0.00 ? 520 LYS A HG3  4  
ATOM 9827  H HD2  . LYS A 1 128 ? 4.337   15.344  8.435   1.00 0.00 ? 520 LYS A HD2  4  
ATOM 9828  H HD3  . LYS A 1 128 ? 4.568   13.860  9.355   1.00 0.00 ? 520 LYS A HD3  4  
ATOM 9829  H HE2  . LYS A 1 128 ? 5.300   15.227  11.281  1.00 0.00 ? 520 LYS A HE2  4  
ATOM 9830  H HE3  . LYS A 1 128 ? 4.892   16.677  10.363  1.00 0.00 ? 520 LYS A HE3  4  
ATOM 9831  H HZ1  . LYS A 1 128 ? 2.989   14.522  11.122  1.00 0.00 ? 520 LYS A HZ1  4  
ATOM 9832  H HZ2  . LYS A 1 128 ? 3.119   16.013  11.881  1.00 0.00 ? 520 LYS A HZ2  4  
ATOM 9833  H HZ3  . LYS A 1 128 ? 2.605   15.933  10.272  1.00 0.00 ? 520 LYS A HZ3  4  
ATOM 9834  N N    . ILE A 1 129 ? 6.487   10.600  6.340   1.00 0.00 ? 521 ILE A N    4  
ATOM 9835  C CA   . ILE A 1 129 ? 6.719   9.792   5.138   1.00 0.00 ? 521 ILE A CA   4  
ATOM 9836  C C    . ILE A 1 129 ? 5.962   8.498   5.207   1.00 0.00 ? 521 ILE A C    4  
ATOM 9837  O O    . ILE A 1 129 ? 5.424   8.144   6.265   1.00 0.00 ? 521 ILE A O    4  
ATOM 9838  C CB   . ILE A 1 129 ? 8.236   9.526   4.812   1.00 0.00 ? 521 ILE A CB   4  
ATOM 9839  C CG1  . ILE A 1 129 ? 9.041   8.988   6.019   1.00 0.00 ? 521 ILE A CG1  4  
ATOM 9840  C CG2  . ILE A 1 129 ? 8.906   10.757  4.227   1.00 0.00 ? 521 ILE A CG2  4  
ATOM 9841  C CD1  . ILE A 1 129 ? 8.729   7.560   6.459   1.00 0.00 ? 521 ILE A CD1  4  
ATOM 9842  H H    . ILE A 1 129 ? 6.362   10.153  7.209   1.00 0.00 ? 521 ILE A H    4  
ATOM 9843  H HA   . ILE A 1 129 ? 6.289   10.356  4.321   1.00 0.00 ? 521 ILE A HA   4  
ATOM 9844  H HB   . ILE A 1 129 ? 8.247   8.778   4.032   1.00 0.00 ? 521 ILE A HB   4  
ATOM 9845  H HG12 . ILE A 1 129 ? 10.092  9.024   5.777   1.00 0.00 ? 521 ILE A HG12 4  
ATOM 9846  H HG13 . ILE A 1 129 ? 8.855   9.646   6.855   1.00 0.00 ? 521 ILE A HG13 4  
ATOM 9847  H HG21 . ILE A 1 129 ? 8.399   11.048  3.319   1.00 0.00 ? 521 ILE A HG21 4  
ATOM 9848  H HG22 . ILE A 1 129 ? 8.858   11.565  4.942   1.00 0.00 ? 521 ILE A HG22 4  
ATOM 9849  H HG23 . ILE A 1 129 ? 9.940   10.535  4.008   1.00 0.00 ? 521 ILE A HG23 4  
ATOM 9850  H HD11 . ILE A 1 129 ? 8.916   6.878   5.643   1.00 0.00 ? 521 ILE A HD11 4  
ATOM 9851  H HD12 . ILE A 1 129 ? 9.354   7.303   7.301   1.00 0.00 ? 521 ILE A HD12 4  
ATOM 9852  H HD13 . ILE A 1 129 ? 7.691   7.493   6.748   1.00 0.00 ? 521 ILE A HD13 4  
ATOM 9853  N N    . PHE A 1 130 ? 5.902   7.800   4.118   1.00 0.00 ? 522 PHE A N    4  
ATOM 9854  C CA   . PHE A 1 130 ? 5.195   6.571   4.080   1.00 0.00 ? 522 PHE A CA   4  
ATOM 9855  C C    . PHE A 1 130 ? 6.163   5.419   4.291   1.00 0.00 ? 522 PHE A C    4  
ATOM 9856  O O    . PHE A 1 130 ? 7.292   5.440   3.806   1.00 0.00 ? 522 PHE A O    4  
ATOM 9857  C CB   . PHE A 1 130 ? 4.424   6.429   2.780   1.00 0.00 ? 522 PHE A CB   4  
ATOM 9858  C CG   . PHE A 1 130 ? 3.322   7.433   2.577   1.00 0.00 ? 522 PHE A CG   4  
ATOM 9859  C CD1  . PHE A 1 130 ? 3.605   8.750   2.240   1.00 0.00 ? 522 PHE A CD1  4  
ATOM 9860  C CD2  . PHE A 1 130 ? 2.002   7.053   2.704   1.00 0.00 ? 522 PHE A CD2  4  
ATOM 9861  C CE1  . PHE A 1 130 ? 2.594   9.658   2.039   1.00 0.00 ? 522 PHE A CE1  4  
ATOM 9862  C CE2  . PHE A 1 130 ? 0.986   7.960   2.503   1.00 0.00 ? 522 PHE A CE2  4  
ATOM 9863  C CZ   . PHE A 1 130 ? 1.282   9.265   2.171   1.00 0.00 ? 522 PHE A CZ   4  
ATOM 9864  H H    . PHE A 1 130 ? 6.389   8.047   3.295   1.00 0.00 ? 522 PHE A H    4  
ATOM 9865  H HA   . PHE A 1 130 ? 4.499   6.580   4.905   1.00 0.00 ? 522 PHE A HA   4  
ATOM 9866  H HB2  . PHE A 1 130 ? 5.108   6.536   1.952   1.00 0.00 ? 522 PHE A HB2  4  
ATOM 9867  H HB3  . PHE A 1 130 ? 3.985   5.444   2.770   1.00 0.00 ? 522 PHE A HB3  4  
ATOM 9868  H HD1  . PHE A 1 130 ? 4.634   9.059   2.139   1.00 0.00 ? 522 PHE A HD1  4  
ATOM 9869  H HD2  . PHE A 1 130 ? 1.766   6.032   2.965   1.00 0.00 ? 522 PHE A HD2  4  
ATOM 9870  H HE1  . PHE A 1 130 ? 2.828   10.679  1.776   1.00 0.00 ? 522 PHE A HE1  4  
ATOM 9871  H HE2  . PHE A 1 130 ? -0.041  7.645   2.603   1.00 0.00 ? 522 PHE A HE2  4  
ATOM 9872  H HZ   . PHE A 1 130 ? 0.486   9.978   2.015   1.00 0.00 ? 522 PHE A HZ   4  
ATOM 9873  N N    . MET A 1 131 ? 5.742   4.463   5.049   1.00 0.00 ? 523 MET A N    4  
ATOM 9874  C CA   . MET A 1 131 ? 6.531   3.309   5.391   1.00 0.00 ? 523 MET A CA   4  
ATOM 9875  C C    . MET A 1 131 ? 5.673   2.079   5.327   1.00 0.00 ? 523 MET A C    4  
ATOM 9876  O O    . MET A 1 131 ? 4.461   2.184   5.203   1.00 0.00 ? 523 MET A O    4  
ATOM 9877  C CB   . MET A 1 131 ? 7.218   3.470   6.772   1.00 0.00 ? 523 MET A CB   4  
ATOM 9878  C CG   . MET A 1 131 ? 6.345   3.996   7.919   1.00 0.00 ? 523 MET A CG   4  
ATOM 9879  S SD   . MET A 1 131 ? 5.038   2.879   8.474   1.00 0.00 ? 523 MET A SD   4  
ATOM 9880  C CE   . MET A 1 131 ? 5.985   1.472   9.059   1.00 0.00 ? 523 MET A CE   4  
ATOM 9881  H H    . MET A 1 131 ? 4.813   4.487   5.379   1.00 0.00 ? 523 MET A H    4  
ATOM 9882  H HA   . MET A 1 131 ? 7.294   3.217   4.631   1.00 0.00 ? 523 MET A HA   4  
ATOM 9883  H HB2  . MET A 1 131 ? 7.539   2.488   7.083   1.00 0.00 ? 523 MET A HB2  4  
ATOM 9884  H HB3  . MET A 1 131 ? 8.076   4.117   6.669   1.00 0.00 ? 523 MET A HB3  4  
ATOM 9885  H HG2  . MET A 1 131 ? 6.984   4.199   8.765   1.00 0.00 ? 523 MET A HG2  4  
ATOM 9886  H HG3  . MET A 1 131 ? 5.893   4.921   7.592   1.00 0.00 ? 523 MET A HG3  4  
ATOM 9887  H HE1  . MET A 1 131 ? 6.663   1.792   9.836   1.00 0.00 ? 523 MET A HE1  4  
ATOM 9888  H HE2  . MET A 1 131 ? 5.309   0.731   9.459   1.00 0.00 ? 523 MET A HE2  4  
ATOM 9889  H HE3  . MET A 1 131 ? 6.543   1.038   8.243   1.00 0.00 ? 523 MET A HE3  4  
ATOM 9890  N N    . GLY A 1 132 ? 6.272   0.934   5.342   1.00 0.00 ? 524 GLY A N    4  
ATOM 9891  C CA   . GLY A 1 132 ? 5.494   -0.254  5.309   1.00 0.00 ? 524 GLY A CA   4  
ATOM 9892  C C    . GLY A 1 132 ? 6.350   -1.475  5.305   1.00 0.00 ? 524 GLY A C    4  
ATOM 9893  O O    . GLY A 1 132 ? 7.571   -1.372  5.184   1.00 0.00 ? 524 GLY A O    4  
ATOM 9894  H H    . GLY A 1 132 ? 7.250   0.856   5.361   1.00 0.00 ? 524 GLY A H    4  
ATOM 9895  H HA2  . GLY A 1 132 ? 4.817   -0.244  6.144   1.00 0.00 ? 524 GLY A HA2  4  
ATOM 9896  H HA3  . GLY A 1 132 ? 4.906   -0.241  4.403   1.00 0.00 ? 524 GLY A HA3  4  
ATOM 9897  N N    . LEU A 1 133 ? 5.757   -2.597  5.530   1.00 0.00 ? 525 LEU A N    4  
ATOM 9898  C CA   . LEU A 1 133 ? 6.426   -3.854  5.353   1.00 0.00 ? 525 LEU A CA   4  
ATOM 9899  C C    . LEU A 1 133 ? 5.766   -4.607  4.240   1.00 0.00 ? 525 LEU A C    4  
ATOM 9900  O O    . LEU A 1 133 ? 4.526   -4.518  4.063   1.00 0.00 ? 525 LEU A O    4  
ATOM 9901  C CB   . LEU A 1 133 ? 6.528   -4.722  6.623   1.00 0.00 ? 525 LEU A CB   4  
ATOM 9902  C CG   . LEU A 1 133 ? 7.394   -4.182  7.768   1.00 0.00 ? 525 LEU A CG   4  
ATOM 9903  C CD1  . LEU A 1 133 ? 6.666   -3.099  8.545   1.00 0.00 ? 525 LEU A CD1  4  
ATOM 9904  C CD2  . LEU A 1 133 ? 7.818   -5.298  8.696   1.00 0.00 ? 525 LEU A CD2  4  
ATOM 9905  H H    . LEU A 1 133 ? 4.815   -2.604  5.812   1.00 0.00 ? 525 LEU A H    4  
ATOM 9906  H HA   . LEU A 1 133 ? 7.422   -3.607  5.011   1.00 0.00 ? 525 LEU A HA   4  
ATOM 9907  H HB2  . LEU A 1 133 ? 5.528   -4.864  7.006   1.00 0.00 ? 525 LEU A HB2  4  
ATOM 9908  H HB3  . LEU A 1 133 ? 6.918   -5.687  6.333   1.00 0.00 ? 525 LEU A HB3  4  
ATOM 9909  H HG   . LEU A 1 133 ? 8.292   -3.763  7.322   1.00 0.00 ? 525 LEU A HG   4  
ATOM 9910  H HD11 . LEU A 1 133 ? 6.414   -2.287  7.879   1.00 0.00 ? 525 LEU A HD11 4  
ATOM 9911  H HD12 . LEU A 1 133 ? 5.763   -3.515  8.970   1.00 0.00 ? 525 LEU A HD12 4  
ATOM 9912  H HD13 . LEU A 1 133 ? 7.302   -2.733  9.339   1.00 0.00 ? 525 LEU A HD13 4  
ATOM 9913  H HD21 . LEU A 1 133 ? 6.946   -5.814  9.072   1.00 0.00 ? 525 LEU A HD21 4  
ATOM 9914  H HD22 . LEU A 1 133 ? 8.449   -5.989  8.158   1.00 0.00 ? 525 LEU A HD22 4  
ATOM 9915  H HD23 . LEU A 1 133 ? 8.378   -4.884  9.521   1.00 0.00 ? 525 LEU A HD23 4  
ATOM 9916  N N    . ILE A 1 134 ? 6.548   -5.264  3.437   1.00 0.00 ? 526 ILE A N    4  
ATOM 9917  C CA   . ILE A 1 134 ? 5.986   -6.086  2.409   1.00 0.00 ? 526 ILE A CA   4  
ATOM 9918  C C    . ILE A 1 134 ? 6.067   -7.571  2.800   1.00 0.00 ? 526 ILE A C    4  
ATOM 9919  O O    . ILE A 1 134 ? 7.171   -8.160  2.885   1.00 0.00 ? 526 ILE A O    4  
ATOM 9920  C CB   . ILE A 1 134 ? 6.634   -5.804  1.002   1.00 0.00 ? 526 ILE A CB   4  
ATOM 9921  C CG1  . ILE A 1 134 ? 6.176   -6.816  -0.059  1.00 0.00 ? 526 ILE A CG1  4  
ATOM 9922  C CG2  . ILE A 1 134 ? 8.143   -5.740  1.072   1.00 0.00 ? 526 ILE A CG2  4  
ATOM 9923  C CD1  . ILE A 1 134 ? 6.694   -6.537  -1.452  1.00 0.00 ? 526 ILE A CD1  4  
ATOM 9924  H H    . ILE A 1 134 ? 7.522   -5.208  3.553   1.00 0.00 ? 526 ILE A H    4  
ATOM 9925  H HA   . ILE A 1 134 ? 4.940   -5.823  2.362   1.00 0.00 ? 526 ILE A HA   4  
ATOM 9926  H HB   . ILE A 1 134 ? 6.296   -4.822  0.705   1.00 0.00 ? 526 ILE A HB   4  
ATOM 9927  H HG12 . ILE A 1 134 ? 6.522   -7.800  0.223   1.00 0.00 ? 526 ILE A HG12 4  
ATOM 9928  H HG13 . ILE A 1 134 ? 5.097   -6.825  -0.098  1.00 0.00 ? 526 ILE A HG13 4  
ATOM 9929  H HG21 . ILE A 1 134 ? 8.442   -4.967  1.763   1.00 0.00 ? 526 ILE A HG21 4  
ATOM 9930  H HG22 . ILE A 1 134 ? 8.513   -6.701  1.394   1.00 0.00 ? 526 ILE A HG22 4  
ATOM 9931  H HG23 . ILE A 1 134 ? 8.513   -5.514  0.084   1.00 0.00 ? 526 ILE A HG23 4  
ATOM 9932  H HD11 . ILE A 1 134 ? 6.368   -5.556  -1.765  1.00 0.00 ? 526 ILE A HD11 4  
ATOM 9933  H HD12 . ILE A 1 134 ? 7.773   -6.578  -1.450  1.00 0.00 ? 526 ILE A HD12 4  
ATOM 9934  H HD13 . ILE A 1 134 ? 6.305   -7.279  -2.134  1.00 0.00 ? 526 ILE A HD13 4  
ATOM 9935  N N    . PRO A 1 135 ? 4.908   -8.166  3.135   1.00 0.00 ? 527 PRO A N    4  
ATOM 9936  C CA   . PRO A 1 135 ? 4.786   -9.587  3.381   1.00 0.00 ? 527 PRO A CA   4  
ATOM 9937  C C    . PRO A 1 135 ? 5.025   -10.441 2.131   1.00 0.00 ? 527 PRO A C    4  
ATOM 9938  O O    . PRO A 1 135 ? 4.461   -10.193 1.007   1.00 0.00 ? 527 PRO A O    4  
ATOM 9939  C CB   . PRO A 1 135 ? 3.345   -9.762  3.875   1.00 0.00 ? 527 PRO A CB   4  
ATOM 9940  C CG   . PRO A 1 135 ? 2.965   -8.420  4.360   1.00 0.00 ? 527 PRO A CG   4  
ATOM 9941  C CD   . PRO A 1 135 ? 3.646   -7.469  3.442   1.00 0.00 ? 527 PRO A CD   4  
ATOM 9942  H HA   . PRO A 1 135 ? 5.468   -9.905  4.155   1.00 0.00 ? 527 PRO A HA   4  
ATOM 9943  H HB2  . PRO A 1 135 ? 2.722   -10.081 3.053   1.00 0.00 ? 527 PRO A HB2  4  
ATOM 9944  H HB3  . PRO A 1 135 ? 3.314   -10.493 4.668   1.00 0.00 ? 527 PRO A HB3  4  
ATOM 9945  H HG2  . PRO A 1 135 ? 1.894   -8.294  4.307   1.00 0.00 ? 527 PRO A HG2  4  
ATOM 9946  H HG3  . PRO A 1 135 ? 3.316   -8.280  5.372   1.00 0.00 ? 527 PRO A HG3  4  
ATOM 9947  H HD2  . PRO A 1 135 ? 3.056   -7.321  2.548   1.00 0.00 ? 527 PRO A HD2  4  
ATOM 9948  H HD3  . PRO A 1 135 ? 3.832   -6.531  3.943   1.00 0.00 ? 527 PRO A HD3  4  
ATOM 9949  N N    . TYR A 1 136 ? 5.852   -11.447 2.340   1.00 0.00 ? 528 TYR A N    4  
ATOM 9950  C CA   . TYR A 1 136 ? 6.218   -12.410 1.329   1.00 0.00 ? 528 TYR A CA   4  
ATOM 9951  C C    . TYR A 1 136 ? 5.051   -13.312 1.066   1.00 0.00 ? 528 TYR A C    4  
ATOM 9952  O O    . TYR A 1 136 ? 4.765   -13.688 -0.069  1.00 0.00 ? 528 TYR A O    4  
ATOM 9953  C CB   . TYR A 1 136 ? 7.356   -13.295 1.835   1.00 0.00 ? 528 TYR A CB   4  
ATOM 9954  C CG   . TYR A 1 136 ? 8.522   -12.564 2.417   1.00 0.00 ? 528 TYR A CG   4  
ATOM 9955  C CD1  . TYR A 1 136 ? 9.493   -12.037 1.607   1.00 0.00 ? 528 TYR A CD1  4  
ATOM 9956  C CD2  . TYR A 1 136 ? 8.654   -12.413 3.791   1.00 0.00 ? 528 TYR A CD2  4  
ATOM 9957  C CE1  . TYR A 1 136 ? 10.565  -11.378 2.138   1.00 0.00 ? 528 TYR A CE1  4  
ATOM 9958  C CE2  . TYR A 1 136 ? 9.730   -11.748 4.330   1.00 0.00 ? 528 TYR A CE2  4  
ATOM 9959  C CZ   . TYR A 1 136 ? 10.683  -11.233 3.499   1.00 0.00 ? 528 TYR A CZ   4  
ATOM 9960  O OH   . TYR A 1 136 ? 11.771  -10.558 4.025   1.00 0.00 ? 528 TYR A OH   4  
ATOM 9961  H H    . TYR A 1 136 ? 6.246   -11.525 3.234   1.00 0.00 ? 528 TYR A H    4  
ATOM 9962  H HA   . TYR A 1 136 ? 6.538   -11.907 0.431   1.00 0.00 ? 528 TYR A HA   4  
ATOM 9963  H HB2  . TYR A 1 136 ? 6.974   -13.954 2.601   1.00 0.00 ? 528 TYR A HB2  4  
ATOM 9964  H HB3  . TYR A 1 136 ? 7.716   -13.894 1.011   1.00 0.00 ? 528 TYR A HB3  4  
ATOM 9965  H HD1  . TYR A 1 136 ? 9.400   -12.148 0.537   1.00 0.00 ? 528 TYR A HD1  4  
ATOM 9966  H HD2  . TYR A 1 136 ? 7.896   -12.823 4.439   1.00 0.00 ? 528 TYR A HD2  4  
ATOM 9967  H HE1  . TYR A 1 136 ? 11.321  -10.968 1.485   1.00 0.00 ? 528 TYR A HE1  4  
ATOM 9968  H HE2  . TYR A 1 136 ? 9.819   -11.638 5.401   1.00 0.00 ? 528 TYR A HE2  4  
ATOM 9969  H HH   . TYR A 1 136 ? 12.118  -11.056 4.774   1.00 0.00 ? 528 TYR A HH   4  
ATOM 9970  N N    . ASP A 1 137 ? 4.374   -13.644 2.134   1.00 0.00 ? 529 ASP A N    4  
ATOM 9971  C CA   . ASP A 1 137 ? 3.304   -14.587 2.088   1.00 0.00 ? 529 ASP A CA   4  
ATOM 9972  C C    . ASP A 1 137 ? 2.040   -13.892 1.632   1.00 0.00 ? 529 ASP A C    4  
ATOM 9973  O O    . ASP A 1 137 ? 1.274   -13.357 2.451   1.00 0.00 ? 529 ASP A O    4  
ATOM 9974  C CB   . ASP A 1 137 ? 3.099   -15.214 3.463   1.00 0.00 ? 529 ASP A CB   4  
ATOM 9975  C CG   . ASP A 1 137 ? 2.389   -16.536 3.408   1.00 0.00 ? 529 ASP A CG   4  
ATOM 9976  O OD1  . ASP A 1 137 ? 2.981   -17.538 3.867   1.00 0.00 ? 529 ASP A OD1  4  
ATOM 9977  O OD2  . ASP A 1 137 ? 1.261   -16.617 2.894   1.00 0.00 ? 529 ASP A OD2  4  
ATOM 9978  H H    . ASP A 1 137 ? 4.596   -13.213 2.983   1.00 0.00 ? 529 ASP A H    4  
ATOM 9979  H HA   . ASP A 1 137 ? 3.566   -15.362 1.385   1.00 0.00 ? 529 ASP A HA   4  
ATOM 9980  H HB2  . ASP A 1 137 ? 4.062   -15.368 3.927   1.00 0.00 ? 529 ASP A HB2  4  
ATOM 9981  H HB3  . ASP A 1 137 ? 2.518   -14.538 4.072   1.00 0.00 ? 529 ASP A HB3  4  
ATOM 9982  N N    . GLN A 1 138 ? 1.861   -13.832 0.328   1.00 0.00 ? 530 GLN A N    4  
ATOM 9983  C CA   . GLN A 1 138 ? 0.703   -13.191 -0.247  1.00 0.00 ? 530 GLN A CA   4  
ATOM 9984  C C    . GLN A 1 138 ? -0.554  -13.956 0.090   1.00 0.00 ? 530 GLN A C    4  
ATOM 9985  O O    . GLN A 1 138 ? -1.586  -13.367 0.358   1.00 0.00 ? 530 GLN A O    4  
ATOM 9986  C CB   . GLN A 1 138 ? 0.881   -12.892 -1.766  1.00 0.00 ? 530 GLN A CB   4  
ATOM 9987  C CG   . GLN A 1 138 ? 1.216   -14.079 -2.668  1.00 0.00 ? 530 GLN A CG   4  
ATOM 9988  C CD   . GLN A 1 138 ? 0.038   -14.996 -2.968  1.00 0.00 ? 530 GLN A CD   4  
ATOM 9989  O OE1  . GLN A 1 138 ? -1.121  -14.561 -3.046  1.00 0.00 ? 530 GLN A OE1  4  
ATOM 9990  N NE2  . GLN A 1 138 ? 0.309   -16.259 -3.093  1.00 0.00 ? 530 GLN A NE2  4  
ATOM 9991  H H    . GLN A 1 138 ? 2.545   -14.238 -0.250  1.00 0.00 ? 530 GLN A H    4  
ATOM 9992  H HA   . GLN A 1 138 ? 0.622   -12.249 0.277   1.00 0.00 ? 530 GLN A HA   4  
ATOM 9993  H HB2  . GLN A 1 138 ? -0.041  -12.465 -2.132  1.00 0.00 ? 530 GLN A HB2  4  
ATOM 9994  H HB3  . GLN A 1 138 ? 1.661   -12.153 -1.875  1.00 0.00 ? 530 GLN A HB3  4  
ATOM 9995  H HG2  . GLN A 1 138 ? 1.581   -13.682 -3.602  1.00 0.00 ? 530 GLN A HG2  4  
ATOM 9996  H HG3  . GLN A 1 138 ? 2.003   -14.655 -2.204  1.00 0.00 ? 530 GLN A HG3  4  
ATOM 9997  H HE21 . GLN A 1 138 ? 1.241   -16.544 -2.981  1.00 0.00 ? 530 GLN A HE21 4  
ATOM 9998  H HE22 . GLN A 1 138 ? -0.423  -16.878 -3.298  1.00 0.00 ? 530 GLN A HE22 4  
ATOM 9999  N N    . SER A 1 139 ? -0.424  -15.267 0.158   1.00 0.00 ? 531 SER A N    4  
ATOM 10000 C CA   . SER A 1 139 ? -1.516  -16.129 0.505   1.00 0.00 ? 531 SER A CA   4  
ATOM 10001 C C    . SER A 1 139 ? -2.083  -15.788 1.893   1.00 0.00 ? 531 SER A C    4  
ATOM 10002 O O    . SER A 1 139 ? -3.288  -15.613 2.054   1.00 0.00 ? 531 SER A O    4  
ATOM 10003 C CB   . SER A 1 139 ? -1.070  -17.598 0.370   1.00 0.00 ? 531 SER A CB   4  
ATOM 10004 O OG   . SER A 1 139 ? 0.320   -17.767 0.736   1.00 0.00 ? 531 SER A OG   4  
ATOM 10005 H H    . SER A 1 139 ? 0.448   -15.673 -0.037  1.00 0.00 ? 531 SER A H    4  
ATOM 10006 H HA   . SER A 1 139 ? -2.297  -15.944 -0.217  1.00 0.00 ? 531 SER A HA   4  
ATOM 10007 H HB2  . SER A 1 139 ? -1.673  -18.215 1.017   1.00 0.00 ? 531 SER A HB2  4  
ATOM 10008 H HB3  . SER A 1 139 ? -1.197  -17.919 -0.652  1.00 0.00 ? 531 SER A HB3  4  
ATOM 10009 H HG   . SER A 1 139 ? 0.500   -17.360 1.604   1.00 0.00 ? 531 SER A HG   4  
ATOM 10010 N N    . GLY A 1 140 ? -1.201  -15.612 2.857   1.00 0.00 ? 532 GLY A N    4  
ATOM 10011 C CA   . GLY A 1 140 ? -1.606  -15.284 4.188   1.00 0.00 ? 532 GLY A CA   4  
ATOM 10012 C C    . GLY A 1 140 ? -2.060  -13.846 4.338   1.00 0.00 ? 532 GLY A C    4  
ATOM 10013 O O    . GLY A 1 140 ? -2.961  -13.565 5.128   1.00 0.00 ? 532 GLY A O    4  
ATOM 10014 H H    . GLY A 1 140 ? -0.239  -15.738 2.677   1.00 0.00 ? 532 GLY A H    4  
ATOM 10015 H HA2  . GLY A 1 140 ? -2.419  -15.936 4.474   1.00 0.00 ? 532 GLY A HA2  4  
ATOM 10016 H HA3  . GLY A 1 140 ? -0.772  -15.454 4.853   1.00 0.00 ? 532 GLY A HA3  4  
ATOM 10017 N N    . PHE A 1 141 ? -1.439  -12.933 3.605   1.00 0.00 ? 533 PHE A N    4  
ATOM 10018 C CA   . PHE A 1 141 ? -1.804  -11.516 3.701   1.00 0.00 ? 533 PHE A CA   4  
ATOM 10019 C C    . PHE A 1 141 ? -3.168  -11.275 3.086   1.00 0.00 ? 533 PHE A C    4  
ATOM 10020 O O    . PHE A 1 141 ? -4.033  -10.651 3.701   1.00 0.00 ? 533 PHE A O    4  
ATOM 10021 C CB   . PHE A 1 141 ? -0.756  -10.642 3.005   1.00 0.00 ? 533 PHE A CB   4  
ATOM 10022 C CG   . PHE A 1 141 ? -0.996  -9.144  3.097   1.00 0.00 ? 533 PHE A CG   4  
ATOM 10023 C CD1  . PHE A 1 141 ? -1.672  -8.462  2.088   1.00 0.00 ? 533 PHE A CD1  4  
ATOM 10024 C CD2  . PHE A 1 141 ? -0.525  -8.420  4.175   1.00 0.00 ? 533 PHE A CD2  4  
ATOM 10025 C CE1  . PHE A 1 141 ? -1.865  -7.099  2.157   1.00 0.00 ? 533 PHE A CE1  4  
ATOM 10026 C CE2  . PHE A 1 141 ? -0.722  -7.055  4.252   1.00 0.00 ? 533 PHE A CE2  4  
ATOM 10027 C CZ   . PHE A 1 141 ? -1.392  -6.395  3.239   1.00 0.00 ? 533 PHE A CZ   4  
ATOM 10028 H H    . PHE A 1 141 ? -0.720  -13.212 2.995   1.00 0.00 ? 533 PHE A H    4  
ATOM 10029 H HA   . PHE A 1 141 ? -1.840  -11.254 4.747   1.00 0.00 ? 533 PHE A HA   4  
ATOM 10030 H HB2  . PHE A 1 141 ? 0.220   -10.848 3.419   1.00 0.00 ? 533 PHE A HB2  4  
ATOM 10031 H HB3  . PHE A 1 141 ? -0.742  -10.910 1.959   1.00 0.00 ? 533 PHE A HB3  4  
ATOM 10032 H HD1  . PHE A 1 141 ? -2.050  -9.014  1.239   1.00 0.00 ? 533 PHE A HD1  4  
ATOM 10033 H HD2  . PHE A 1 141 ? 0.000   -8.933  4.970   1.00 0.00 ? 533 PHE A HD2  4  
ATOM 10034 H HE1  . PHE A 1 141 ? -2.390  -6.588  1.365   1.00 0.00 ? 533 PHE A HE1  4  
ATOM 10035 H HE2  . PHE A 1 141 ? -0.353  -6.507  5.107   1.00 0.00 ? 533 PHE A HE2  4  
ATOM 10036 H HZ   . PHE A 1 141 ? -1.544  -5.329  3.286   1.00 0.00 ? 533 PHE A HZ   4  
ATOM 10037 N N    . VAL A 1 142 ? -3.370  -11.810 1.897   1.00 0.00 ? 534 VAL A N    4  
ATOM 10038 C CA   . VAL A 1 142 ? -4.614  -11.649 1.176   1.00 0.00 ? 534 VAL A CA   4  
ATOM 10039 C C    . VAL A 1 142 ? -5.755  -12.331 1.940   1.00 0.00 ? 534 VAL A C    4  
ATOM 10040 O O    . VAL A 1 142 ? -6.873  -11.814 1.993   1.00 0.00 ? 534 VAL A O    4  
ATOM 10041 C CB   . VAL A 1 142 ? -4.505  -12.148 -0.304  1.00 0.00 ? 534 VAL A CB   4  
ATOM 10042 C CG1  . VAL A 1 142 ? -5.835  -12.007 -1.040  1.00 0.00 ? 534 VAL A CG1  4  
ATOM 10043 C CG2  . VAL A 1 142 ? -3.418  -11.361 -1.048  1.00 0.00 ? 534 VAL A CG2  4  
ATOM 10044 H H    . VAL A 1 142 ? -2.655  -12.339 1.474   1.00 0.00 ? 534 VAL A H    4  
ATOM 10045 H HA   . VAL A 1 142 ? -4.824  -10.589 1.174   1.00 0.00 ? 534 VAL A HA   4  
ATOM 10046 H HB   . VAL A 1 142 ? -4.220  -13.190 -0.299  1.00 0.00 ? 534 VAL A HB   4  
ATOM 10047 H HG11 . VAL A 1 142 ? -6.593  -12.585 -0.531  1.00 0.00 ? 534 VAL A HG11 4  
ATOM 10048 H HG12 . VAL A 1 142 ? -6.124  -10.967 -1.061  1.00 0.00 ? 534 VAL A HG12 4  
ATOM 10049 H HG13 . VAL A 1 142 ? -5.724  -12.368 -2.053  1.00 0.00 ? 534 VAL A HG13 4  
ATOM 10050 H HG21 . VAL A 1 142 ? -3.652  -10.306 -1.037  1.00 0.00 ? 534 VAL A HG21 4  
ATOM 10051 H HG22 . VAL A 1 142 ? -2.461  -11.490 -0.561  1.00 0.00 ? 534 VAL A HG22 4  
ATOM 10052 H HG23 . VAL A 1 142 ? -3.348  -11.704 -2.068  1.00 0.00 ? 534 VAL A HG23 4  
ATOM 10053 N N    . ASN A 1 143 ? -5.454  -13.486 2.545   1.00 0.00 ? 535 ASN A N    4  
ATOM 10054 C CA   . ASN A 1 143 ? -6.422  -14.208 3.392   1.00 0.00 ? 535 ASN A CA   4  
ATOM 10055 C C    . ASN A 1 143 ? -6.856  -13.314 4.559   1.00 0.00 ? 535 ASN A C    4  
ATOM 10056 O O    . ASN A 1 143 ? -8.046  -13.127 4.789   1.00 0.00 ? 535 ASN A O    4  
ATOM 10057 C CB   . ASN A 1 143 ? -5.770  -15.509 3.947   1.00 0.00 ? 535 ASN A CB   4  
ATOM 10058 C CG   . ASN A 1 143 ? -6.686  -16.398 4.818   1.00 0.00 ? 535 ASN A CG   4  
ATOM 10059 O OD1  . ASN A 1 143 ? -7.603  -15.935 5.497   1.00 0.00 ? 535 ASN A OD1  4  
ATOM 10060 N ND2  . ASN A 1 143 ? -6.420  -17.679 4.814   1.00 0.00 ? 535 ASN A ND2  4  
ATOM 10061 H H    . ASN A 1 143 ? -4.563  -13.874 2.408   1.00 0.00 ? 535 ASN A H    4  
ATOM 10062 H HA   . ASN A 1 143 ? -7.282  -14.468 2.793   1.00 0.00 ? 535 ASN A HA   4  
ATOM 10063 H HB2  . ASN A 1 143 ? -5.432  -16.105 3.113   1.00 0.00 ? 535 ASN A HB2  4  
ATOM 10064 H HB3  . ASN A 1 143 ? -4.908  -15.231 4.534   1.00 0.00 ? 535 ASN A HB3  4  
ATOM 10065 H HD21 . ASN A 1 143 ? -5.669  -18.007 4.272   1.00 0.00 ? 535 ASN A HD21 4  
ATOM 10066 H HD22 . ASN A 1 143 ? -6.970  -18.273 5.371   1.00 0.00 ? 535 ASN A HD22 4  
ATOM 10067 N N    . GLY A 1 144 ? -5.882  -12.706 5.235   1.00 0.00 ? 536 GLY A N    4  
ATOM 10068 C CA   . GLY A 1 144 ? -6.173  -11.860 6.383   1.00 0.00 ? 536 GLY A CA   4  
ATOM 10069 C C    . GLY A 1 144 ? -6.925  -10.609 5.994   1.00 0.00 ? 536 GLY A C    4  
ATOM 10070 O O    . GLY A 1 144 ? -7.924  -10.242 6.624   1.00 0.00 ? 536 GLY A O    4  
ATOM 10071 H H    . GLY A 1 144 ? -4.950  -12.842 4.958   1.00 0.00 ? 536 GLY A H    4  
ATOM 10072 H HA2  . GLY A 1 144 ? -6.772  -12.422 7.084   1.00 0.00 ? 536 GLY A HA2  4  
ATOM 10073 H HA3  . GLY A 1 144 ? -5.244  -11.579 6.856   1.00 0.00 ? 536 GLY A HA3  4  
ATOM 10074 N N    . ILE A 1 145 ? -6.475  -9.983  4.927   1.00 0.00 ? 537 ILE A N    4  
ATOM 10075 C CA   . ILE A 1 145 ? -7.086  -8.769  4.428   1.00 0.00 ? 537 ILE A CA   4  
ATOM 10076 C C    . ILE A 1 145 ? -8.488  -9.041  3.862   1.00 0.00 ? 537 ILE A C    4  
ATOM 10077 O O    . ILE A 1 145 ? -9.317  -8.152  3.827   1.00 0.00 ? 537 ILE A O    4  
ATOM 10078 C CB   . ILE A 1 145 ? -6.155  -8.033  3.392   1.00 0.00 ? 537 ILE A CB   4  
ATOM 10079 C CG1  . ILE A 1 145 ? -4.865  -7.551  4.072   1.00 0.00 ? 537 ILE A CG1  4  
ATOM 10080 C CG2  . ILE A 1 145 ? -6.847  -6.852  2.713   1.00 0.00 ? 537 ILE A CG2  4  
ATOM 10081 C CD1  . ILE A 1 145 ? -5.084  -6.522  5.172   1.00 0.00 ? 537 ILE A CD1  4  
ATOM 10082 H H    . ILE A 1 145 ? -5.688  -10.349 4.460   1.00 0.00 ? 537 ILE A H    4  
ATOM 10083 H HA   . ILE A 1 145 ? -7.219  -8.124  5.285   1.00 0.00 ? 537 ILE A HA   4  
ATOM 10084 H HB   . ILE A 1 145 ? -5.884  -8.745  2.626   1.00 0.00 ? 537 ILE A HB   4  
ATOM 10085 H HG12 . ILE A 1 145 ? -4.359  -8.398  4.511   1.00 0.00 ? 537 ILE A HG12 4  
ATOM 10086 H HG13 . ILE A 1 145 ? -4.221  -7.108  3.328   1.00 0.00 ? 537 ILE A HG13 4  
ATOM 10087 H HG21 . ILE A 1 145 ? -7.228  -6.186  3.473   1.00 0.00 ? 537 ILE A HG21 4  
ATOM 10088 H HG22 . ILE A 1 145 ? -6.145  -6.314  2.094   1.00 0.00 ? 537 ILE A HG22 4  
ATOM 10089 H HG23 . ILE A 1 145 ? -7.670  -7.215  2.116   1.00 0.00 ? 537 ILE A HG23 4  
ATOM 10090 H HD11 . ILE A 1 145 ? -5.649  -5.693  4.771   1.00 0.00 ? 537 ILE A HD11 4  
ATOM 10091 H HD12 . ILE A 1 145 ? -5.637  -6.964  5.988   1.00 0.00 ? 537 ILE A HD12 4  
ATOM 10092 H HD13 . ILE A 1 145 ? -4.131  -6.161  5.528   1.00 0.00 ? 537 ILE A HD13 4  
ATOM 10093 N N    . ARG A 1 146 ? -8.768  -10.285 3.481   1.00 0.00 ? 538 ARG A N    4  
ATOM 10094 C CA   . ARG A 1 146 ? -10.088 -10.639 2.958   1.00 0.00 ? 538 ARG A CA   4  
ATOM 10095 C C    . ARG A 1 146 ? -11.172 -10.371 4.003   1.00 0.00 ? 538 ARG A C    4  
ATOM 10096 O O    . ARG A 1 146 ? -12.238 -9.835  3.675   1.00 0.00 ? 538 ARG A O    4  
ATOM 10097 C CB   . ARG A 1 146 ? -10.151 -12.094 2.475   1.00 0.00 ? 538 ARG A CB   4  
ATOM 10098 C CG   . ARG A 1 146 ? -11.486 -12.445 1.841   1.00 0.00 ? 538 ARG A CG   4  
ATOM 10099 C CD   . ARG A 1 146 ? -11.501 -13.836 1.245   1.00 0.00 ? 538 ARG A CD   4  
ATOM 10100 N NE   . ARG A 1 146 ? -12.783 -14.103 0.579   1.00 0.00 ? 538 ARG A NE   4  
ATOM 10101 C CZ   . ARG A 1 146 ? -12.937 -14.728 -0.600  1.00 0.00 ? 538 ARG A CZ   4  
ATOM 10102 N NH1  . ARG A 1 146 ? -11.897 -15.271 -1.220  1.00 0.00 ? 538 ARG A NH1  4  
ATOM 10103 N NH2  . ARG A 1 146 ? -14.145 -14.803 -1.149  1.00 0.00 ? 538 ARG A NH2  4  
ATOM 10104 H H    . ARG A 1 146 ? -8.067  -10.970 3.536   1.00 0.00 ? 538 ARG A H    4  
ATOM 10105 H HA   . ARG A 1 146 ? -10.273 -9.980  2.121   1.00 0.00 ? 538 ARG A HA   4  
ATOM 10106 H HB2  . ARG A 1 146 ? -9.366  -12.263 1.752   1.00 0.00 ? 538 ARG A HB2  4  
ATOM 10107 H HB3  . ARG A 1 146 ? -9.995  -12.748 3.322   1.00 0.00 ? 538 ARG A HB3  4  
ATOM 10108 H HG2  . ARG A 1 146 ? -12.256 -12.385 2.594   1.00 0.00 ? 538 ARG A HG2  4  
ATOM 10109 H HG3  . ARG A 1 146 ? -11.699 -11.726 1.063   1.00 0.00 ? 538 ARG A HG3  4  
ATOM 10110 H HD2  . ARG A 1 146 ? -10.701 -13.913 0.524   1.00 0.00 ? 538 ARG A HD2  4  
ATOM 10111 H HD3  . ARG A 1 146 ? -11.354 -14.564 2.028   1.00 0.00 ? 538 ARG A HD3  4  
ATOM 10112 H HE   . ARG A 1 146 ? -13.566 -13.744 1.059   1.00 0.00 ? 538 ARG A HE   4  
ATOM 10113 H HH11 . ARG A 1 146 ? -10.969 -15.240 -0.834  1.00 0.00 ? 538 ARG A HH11 4  
ATOM 10114 H HH12 . ARG A 1 146 ? -11.983 -15.732 -2.106  1.00 0.00 ? 538 ARG A HH12 4  
ATOM 10115 H HH21 . ARG A 1 146 ? -14.944 -14.396 -0.696  1.00 0.00 ? 538 ARG A HH21 4  
ATOM 10116 H HH22 . ARG A 1 146 ? -14.317 -15.246 -2.033  1.00 0.00 ? 538 ARG A HH22 4  
ATOM 10117 N N    . GLN A 1 147 ? -10.872 -10.693 5.264   1.00 0.00 ? 539 GLN A N    4  
ATOM 10118 C CA   . GLN A 1 147 ? -11.798 -10.423 6.361   1.00 0.00 ? 539 GLN A CA   4  
ATOM 10119 C C    . GLN A 1 147 ? -11.999 -8.926  6.505   1.00 0.00 ? 539 GLN A C    4  
ATOM 10120 O O    . GLN A 1 147 ? -13.109 -8.447  6.747   1.00 0.00 ? 539 GLN A O    4  
ATOM 10121 C CB   . GLN A 1 147 ? -11.314 -11.009 7.699   1.00 0.00 ? 539 GLN A CB   4  
ATOM 10122 C CG   . GLN A 1 147 ? -11.438 -12.526 7.845   1.00 0.00 ? 539 GLN A CG   4  
ATOM 10123 C CD   . GLN A 1 147 ? -10.593 -13.312 6.876   1.00 0.00 ? 539 GLN A CD   4  
ATOM 10124 O OE1  . GLN A 1 147 ? -11.037 -13.653 5.775   1.00 0.00 ? 539 GLN A OE1  4  
ATOM 10125 N NE2  . GLN A 1 147 ? -9.384  -13.610 7.264   1.00 0.00 ? 539 GLN A NE2  4  
ATOM 10126 H H    . GLN A 1 147 ? -10.007 -11.118 5.453   1.00 0.00 ? 539 GLN A H    4  
ATOM 10127 H HA   . GLN A 1 147 ? -12.743 -10.875 6.098   1.00 0.00 ? 539 GLN A HA   4  
ATOM 10128 H HB2  . GLN A 1 147 ? -10.272 -10.753 7.824   1.00 0.00 ? 539 GLN A HB2  4  
ATOM 10129 H HB3  . GLN A 1 147 ? -11.879 -10.544 8.494   1.00 0.00 ? 539 GLN A HB3  4  
ATOM 10130 H HG2  . GLN A 1 147 ? -11.146 -12.798 8.846   1.00 0.00 ? 539 GLN A HG2  4  
ATOM 10131 H HG3  . GLN A 1 147 ? -12.473 -12.795 7.699   1.00 0.00 ? 539 GLN A HG3  4  
ATOM 10132 H HE21 . GLN A 1 147 ? -9.097  -13.317 8.156   1.00 0.00 ? 539 GLN A HE21 4  
ATOM 10133 H HE22 . GLN A 1 147 ? -8.797  -14.094 6.643   1.00 0.00 ? 539 GLN A HE22 4  
ATOM 10134 N N    . VAL A 1 148 ? -10.923 -8.195  6.310   1.00 0.00 ? 540 VAL A N    4  
ATOM 10135 C CA   . VAL A 1 148 ? -10.943 -6.752  6.375   1.00 0.00 ? 540 VAL A CA   4  
ATOM 10136 C C    . VAL A 1 148 ? -11.816 -6.192  5.246   1.00 0.00 ? 540 VAL A C    4  
ATOM 10137 O O    . VAL A 1 148 ? -12.720 -5.406  5.496   1.00 0.00 ? 540 VAL A O    4  
ATOM 10138 C CB   . VAL A 1 148 ? -9.507  -6.165  6.271   1.00 0.00 ? 540 VAL A CB   4  
ATOM 10139 C CG1  . VAL A 1 148 ? -9.521  -4.650  6.356   1.00 0.00 ? 540 VAL A CG1  4  
ATOM 10140 C CG2  . VAL A 1 148 ? -8.605  -6.754  7.348   1.00 0.00 ? 540 VAL A CG2  4  
ATOM 10141 H H    . VAL A 1 148 ? -10.082 -8.657  6.111   1.00 0.00 ? 540 VAL A H    4  
ATOM 10142 H HA   . VAL A 1 148 ? -11.371 -6.465  7.325   1.00 0.00 ? 540 VAL A HA   4  
ATOM 10143 H HB   . VAL A 1 148 ? -9.103  -6.441  5.307   1.00 0.00 ? 540 VAL A HB   4  
ATOM 10144 H HG11 . VAL A 1 148 ? -10.126 -4.250  5.555   1.00 0.00 ? 540 VAL A HG11 4  
ATOM 10145 H HG12 . VAL A 1 148 ? -9.935  -4.348  7.306   1.00 0.00 ? 540 VAL A HG12 4  
ATOM 10146 H HG13 . VAL A 1 148 ? -8.512  -4.274  6.267   1.00 0.00 ? 540 VAL A HG13 4  
ATOM 10147 H HG21 . VAL A 1 148 ? -9.023  -6.545  8.322   1.00 0.00 ? 540 VAL A HG21 4  
ATOM 10148 H HG22 . VAL A 1 148 ? -8.536  -7.824  7.211   1.00 0.00 ? 540 VAL A HG22 4  
ATOM 10149 H HG23 . VAL A 1 148 ? -7.620  -6.319  7.275   1.00 0.00 ? 540 VAL A HG23 4  
ATOM 10150 N N    . ILE A 1 149 ? -11.565 -6.658  4.025   1.00 0.00 ? 541 ILE A N    4  
ATOM 10151 C CA   . ILE A 1 149 ? -12.280 -6.203  2.831   1.00 0.00 ? 541 ILE A CA   4  
ATOM 10152 C C    . ILE A 1 149 ? -13.770 -6.484  2.928   1.00 0.00 ? 541 ILE A C    4  
ATOM 10153 O O    . ILE A 1 149 ? -14.572 -5.595  2.691   1.00 0.00 ? 541 ILE A O    4  
ATOM 10154 C CB   . ILE A 1 149 ? -11.736 -6.889  1.539   1.00 0.00 ? 541 ILE A CB   4  
ATOM 10155 C CG1  . ILE A 1 149 ? -10.261 -6.543  1.313   1.00 0.00 ? 541 ILE A CG1  4  
ATOM 10156 C CG2  . ILE A 1 149 ? -12.571 -6.502  0.307   1.00 0.00 ? 541 ILE A CG2  4  
ATOM 10157 C CD1  . ILE A 1 149 ? -9.632  -7.251  0.122   1.00 0.00 ? 541 ILE A CD1  4  
ATOM 10158 H H    . ILE A 1 149 ? -10.849 -7.328  3.932   1.00 0.00 ? 541 ILE A H    4  
ATOM 10159 H HA   . ILE A 1 149 ? -12.130 -5.139  2.736   1.00 0.00 ? 541 ILE A HA   4  
ATOM 10160 H HB   . ILE A 1 149 ? -11.829 -7.951  1.703   1.00 0.00 ? 541 ILE A HB   4  
ATOM 10161 H HG12 . ILE A 1 149 ? -10.169 -5.479  1.148   1.00 0.00 ? 541 ILE A HG12 4  
ATOM 10162 H HG13 . ILE A 1 149 ? -9.707  -6.815  2.198   1.00 0.00 ? 541 ILE A HG13 4  
ATOM 10163 H HG21 . ILE A 1 149 ? -13.598 -6.799  0.461   1.00 0.00 ? 541 ILE A HG21 4  
ATOM 10164 H HG22 . ILE A 1 149 ? -12.528 -5.432  0.166   1.00 0.00 ? 541 ILE A HG22 4  
ATOM 10165 H HG23 . ILE A 1 149 ? -12.176 -6.999  -0.566  1.00 0.00 ? 541 ILE A HG23 4  
ATOM 10166 H HD11 . ILE A 1 149 ? -10.170 -6.985  -0.777  1.00 0.00 ? 541 ILE A HD11 4  
ATOM 10167 H HD12 . ILE A 1 149 ? -8.599  -6.949  0.027   1.00 0.00 ? 541 ILE A HD12 4  
ATOM 10168 H HD13 . ILE A 1 149 ? -9.684  -8.319  0.270   1.00 0.00 ? 541 ILE A HD13 4  
ATOM 10169 N N    . THR A 1 150 ? -14.136 -7.687  3.346   1.00 0.00 ? 542 THR A N    4  
ATOM 10170 C CA   . THR A 1 150 ? -15.539 -8.038  3.406   1.00 0.00 ? 542 THR A CA   4  
ATOM 10171 C C    . THR A 1 150 ? -16.258 -7.183  4.467   1.00 0.00 ? 542 THR A C    4  
ATOM 10172 O O    . THR A 1 150 ? -17.385 -6.708  4.251   1.00 0.00 ? 542 THR A O    4  
ATOM 10173 C CB   . THR A 1 150 ? -15.776 -9.587  3.602   1.00 0.00 ? 542 THR A CB   4  
ATOM 10174 O OG1  . THR A 1 150 ? -17.170 -9.907  3.503   1.00 0.00 ? 542 THR A OG1  4  
ATOM 10175 C CG2  . THR A 1 150 ? -15.248 -10.089 4.938   1.00 0.00 ? 542 THR A CG2  4  
ATOM 10176 H H    . THR A 1 150 ? -13.447 -8.341  3.598   1.00 0.00 ? 542 THR A H    4  
ATOM 10177 H HA   . THR A 1 150 ? -15.948 -7.740  2.451   1.00 0.00 ? 542 THR A HA   4  
ATOM 10178 H HB   . THR A 1 150 ? -15.258 -10.101 2.805   1.00 0.00 ? 542 THR A HB   4  
ATOM 10179 H HG1  . THR A 1 150 ? -17.362 -10.529 4.220   1.00 0.00 ? 542 THR A HG1  4  
ATOM 10180 H HG21 . THR A 1 150 ? -14.189 -9.888  4.997   1.00 0.00 ? 542 THR A HG21 4  
ATOM 10181 H HG22 . THR A 1 150 ? -15.757 -9.572  5.739   1.00 0.00 ? 542 THR A HG22 4  
ATOM 10182 H HG23 . THR A 1 150 ? -15.423 -11.151 5.024   1.00 0.00 ? 542 THR A HG23 4  
ATOM 10183 N N    . ASN A 1 151 ? -15.584 -6.939  5.574   1.00 0.00 ? 543 ASN A N    4  
ATOM 10184 C CA   . ASN A 1 151 ? -16.130 -6.083  6.615   1.00 0.00 ? 543 ASN A CA   4  
ATOM 10185 C C    . ASN A 1 151 ? -16.204 -4.620  6.151   1.00 0.00 ? 543 ASN A C    4  
ATOM 10186 O O    . ASN A 1 151 ? -17.196 -3.935  6.382   1.00 0.00 ? 543 ASN A O    4  
ATOM 10187 C CB   . ASN A 1 151 ? -15.349 -6.233  7.934   1.00 0.00 ? 543 ASN A CB   4  
ATOM 10188 C CG   . ASN A 1 151 ? -15.770 -5.233  8.998   1.00 0.00 ? 543 ASN A CG   4  
ATOM 10189 O OD1  . ASN A 1 151 ? -16.738 -5.438  9.735   1.00 0.00 ? 543 ASN A OD1  4  
ATOM 10190 N ND2  . ASN A 1 151 ? -15.016 -4.179  9.130   1.00 0.00 ? 543 ASN A ND2  4  
ATOM 10191 H H    . ASN A 1 151 ? -14.691 -7.339  5.680   1.00 0.00 ? 543 ASN A H    4  
ATOM 10192 H HA   . ASN A 1 151 ? -17.144 -6.416  6.773   1.00 0.00 ? 543 ASN A HA   4  
ATOM 10193 H HB2  . ASN A 1 151 ? -15.504 -7.227  8.328   1.00 0.00 ? 543 ASN A HB2  4  
ATOM 10194 H HB3  . ASN A 1 151 ? -14.297 -6.096  7.734   1.00 0.00 ? 543 ASN A HB3  4  
ATOM 10195 H HD21 . ASN A 1 151 ? -14.230 -4.085  8.551   1.00 0.00 ? 543 ASN A HD21 4  
ATOM 10196 H HD22 . ASN A 1 151 ? -15.249 -3.502  9.800   1.00 0.00 ? 543 ASN A HD22 4  
ATOM 10197 N N    . LEU A 1 152 ? -15.167 -4.167  5.462   1.00 0.00 ? 544 LEU A N    4  
ATOM 10198 C CA   . LEU A 1 152 ? -15.076 -2.792  4.976   1.00 0.00 ? 544 LEU A CA   4  
ATOM 10199 C C    . LEU A 1 152 ? -16.111 -2.548  3.860   1.00 0.00 ? 544 LEU A C    4  
ATOM 10200 O O    . LEU A 1 152 ? -16.670 -1.467  3.761   1.00 0.00 ? 544 LEU A O    4  
ATOM 10201 C CB   . LEU A 1 152 ? -13.609 -2.486  4.529   1.00 0.00 ? 544 LEU A CB   4  
ATOM 10202 C CG   . LEU A 1 152 ? -13.207 -1.018  4.195   1.00 0.00 ? 544 LEU A CG   4  
ATOM 10203 C CD1  . LEU A 1 152 ? -13.705 -0.573  2.833   1.00 0.00 ? 544 LEU A CD1  4  
ATOM 10204 C CD2  . LEU A 1 152 ? -13.702 -0.061  5.274   1.00 0.00 ? 544 LEU A CD2  4  
ATOM 10205 H H    . LEU A 1 152 ? -14.415 -4.777  5.278   1.00 0.00 ? 544 LEU A H    4  
ATOM 10206 H HA   . LEU A 1 152 ? -15.328 -2.152  5.810   1.00 0.00 ? 544 LEU A HA   4  
ATOM 10207 H HB2  . LEU A 1 152 ? -12.954 -2.824  5.318   1.00 0.00 ? 544 LEU A HB2  4  
ATOM 10208 H HB3  . LEU A 1 152 ? -13.410 -3.093  3.659   1.00 0.00 ? 544 LEU A HB3  4  
ATOM 10209 H HG   . LEU A 1 152 ? -12.128 -0.958  4.175   1.00 0.00 ? 544 LEU A HG   4  
ATOM 10210 H HD11 . LEU A 1 152 ? -14.782 -0.637  2.808   1.00 0.00 ? 544 LEU A HD11 4  
ATOM 10211 H HD12 . LEU A 1 152 ? -13.396 0.448   2.664   1.00 0.00 ? 544 LEU A HD12 4  
ATOM 10212 H HD13 . LEU A 1 152 ? -13.281 -1.212  2.073   1.00 0.00 ? 544 LEU A HD13 4  
ATOM 10213 H HD21 . LEU A 1 152 ? -13.291 -0.351  6.229   1.00 0.00 ? 544 LEU A HD21 4  
ATOM 10214 H HD22 . LEU A 1 152 ? -13.388 0.944   5.037   1.00 0.00 ? 544 LEU A HD22 4  
ATOM 10215 H HD23 . LEU A 1 152 ? -14.780 -0.099  5.321   1.00 0.00 ? 544 LEU A HD23 4  
ATOM 10216 N N    . GLU A 1 153 ? -16.386 -3.572  3.059   1.00 0.00 ? 545 GLU A N    4  
ATOM 10217 C CA   . GLU A 1 153 ? -17.418 -3.490  2.019   1.00 0.00 ? 545 GLU A CA   4  
ATOM 10218 C C    . GLU A 1 153 ? -18.812 -3.334  2.614   1.00 0.00 ? 545 GLU A C    4  
ATOM 10219 O O    . GLU A 1 153 ? -19.722 -2.798  1.973   1.00 0.00 ? 545 GLU A O    4  
ATOM 10220 C CB   . GLU A 1 153 ? -17.363 -4.683  1.062   1.00 0.00 ? 545 GLU A CB   4  
ATOM 10221 C CG   . GLU A 1 153 ? -16.227 -4.599  0.055   1.00 0.00 ? 545 GLU A CG   4  
ATOM 10222 C CD   . GLU A 1 153 ? -16.391 -3.416  -0.871  1.00 0.00 ? 545 GLU A CD   4  
ATOM 10223 O OE1  . GLU A 1 153 ? -15.881 -2.326  -0.572  1.00 0.00 ? 545 GLU A OE1  4  
ATOM 10224 O OE2  . GLU A 1 153 ? -17.071 -3.545  -1.905  1.00 0.00 ? 545 GLU A OE2  4  
ATOM 10225 H H    . GLU A 1 153 ? -15.857 -4.399  3.139   1.00 0.00 ? 545 GLU A H    4  
ATOM 10226 H HA   . GLU A 1 153 ? -17.207 -2.590  1.459   1.00 0.00 ? 545 GLU A HA   4  
ATOM 10227 H HB2  . GLU A 1 153 ? -17.241 -5.585  1.641   1.00 0.00 ? 545 GLU A HB2  4  
ATOM 10228 H HB3  . GLU A 1 153 ? -18.295 -4.734  0.518   1.00 0.00 ? 545 GLU A HB3  4  
ATOM 10229 H HG2  . GLU A 1 153 ? -15.293 -4.498  0.587   1.00 0.00 ? 545 GLU A HG2  4  
ATOM 10230 H HG3  . GLU A 1 153 ? -16.213 -5.503  -0.535  1.00 0.00 ? 545 GLU A HG3  4  
ATOM 10231 N N    . HIS A 1 154 ? -18.988 -3.817  3.819   1.00 0.00 ? 546 HIS A N    4  
ATOM 10232 C CA   . HIS A 1 154 ? -20.239 -3.631  4.526   1.00 0.00 ? 546 HIS A CA   4  
ATOM 10233 C C    . HIS A 1 154 ? -20.196 -2.251  5.204   1.00 0.00 ? 546 HIS A C    4  
ATOM 10234 O O    . HIS A 1 154 ? -21.226 -1.585  5.375   1.00 0.00 ? 546 HIS A O    4  
ATOM 10235 C CB   . HIS A 1 154 ? -20.435 -4.763  5.562   1.00 0.00 ? 546 HIS A CB   4  
ATOM 10236 C CG   . HIS A 1 154 ? -21.774 -4.769  6.261   1.00 0.00 ? 546 HIS A CG   4  
ATOM 10237 N ND1  . HIS A 1 154 ? -22.837 -5.565  5.887   1.00 0.00 ? 546 HIS A ND1  4  
ATOM 10238 C CD2  . HIS A 1 154 ? -22.198 -4.072  7.343   1.00 0.00 ? 546 HIS A CD2  4  
ATOM 10239 C CE1  . HIS A 1 154 ? -23.847 -5.333  6.726   1.00 0.00 ? 546 HIS A CE1  4  
ATOM 10240 N NE2  . HIS A 1 154 ? -23.512 -4.431  7.635   1.00 0.00 ? 546 HIS A NE2  4  
ATOM 10241 H H    . HIS A 1 154 ? -18.254 -4.312  4.243   1.00 0.00 ? 546 HIS A H    4  
ATOM 10242 H HA   . HIS A 1 154 ? -21.042 -3.645  3.804   1.00 0.00 ? 546 HIS A HA   4  
ATOM 10243 H HB2  . HIS A 1 154 ? -20.328 -5.715  5.062   1.00 0.00 ? 546 HIS A HB2  4  
ATOM 10244 H HB3  . HIS A 1 154 ? -19.665 -4.678  6.315   1.00 0.00 ? 546 HIS A HB3  4  
ATOM 10245 H HD1  . HIS A 1 154 ? -22.859 -6.197  5.134   1.00 0.00 ? 546 HIS A HD1  4  
ATOM 10246 H HD2  . HIS A 1 154 ? -21.617 -3.347  7.893   1.00 0.00 ? 546 HIS A HD2  4  
ATOM 10247 H HE1  . HIS A 1 154 ? -24.812 -5.815  6.673   1.00 0.00 ? 546 HIS A HE1  4  
ATOM 10248 N N    . HIS A 1 155 ? -18.969 -1.838  5.529   1.00 0.00 ? 547 HIS A N    4  
ATOM 10249 C CA   . HIS A 1 155 ? -18.613 -0.572  6.191   1.00 0.00 ? 547 HIS A CA   4  
ATOM 10250 C C    . HIS A 1 155 ? -19.009 -0.632  7.663   1.00 0.00 ? 547 HIS A C    4  
ATOM 10251 O O    . HIS A 1 155 ? -19.885 -1.418  8.044   1.00 0.00 ? 547 HIS A O    4  
ATOM 10252 C CB   . HIS A 1 155 ? -19.202 0.668   5.472   1.00 0.00 ? 547 HIS A CB   4  
ATOM 10253 C CG   . HIS A 1 155 ? -18.568 1.967   5.884   1.00 0.00 ? 547 HIS A CG   4  
ATOM 10254 N ND1  . HIS A 1 155 ? -19.071 2.811   6.852   1.00 0.00 ? 547 HIS A ND1  4  
ATOM 10255 C CD2  . HIS A 1 155 ? -17.426 2.550   5.442   1.00 0.00 ? 547 HIS A CD2  4  
ATOM 10256 C CE1  . HIS A 1 155 ? -18.237 3.847   6.962   1.00 0.00 ? 547 HIS A CE1  4  
ATOM 10257 N NE2  . HIS A 1 155 ? -17.222 3.738   6.131   1.00 0.00 ? 547 HIS A NE2  4  
ATOM 10258 H H    . HIS A 1 155 ? -18.230 -2.451  5.324   1.00 0.00 ? 547 HIS A H    4  
ATOM 10259 H HA   . HIS A 1 155 ? -17.532 -0.524  6.165   1.00 0.00 ? 547 HIS A HA   4  
ATOM 10260 H HB2  . HIS A 1 155 ? -19.068 0.558   4.406   1.00 0.00 ? 547 HIS A HB2  4  
ATOM 10261 H HB3  . HIS A 1 155 ? -20.258 0.728   5.694   1.00 0.00 ? 547 HIS A HB3  4  
ATOM 10262 H HD1  . HIS A 1 155 ? -19.895 2.692   7.375   1.00 0.00 ? 547 HIS A HD1  4  
ATOM 10263 H HD2  . HIS A 1 155 ? -16.772 2.160   4.677   1.00 0.00 ? 547 HIS A HD2  4  
ATOM 10264 H HE1  . HIS A 1 155 ? -18.378 4.671   7.647   1.00 0.00 ? 547 HIS A HE1  4  
ATOM 10265 N N    . HIS A 1 156 ? -18.380 0.165   8.495   1.00 0.00 ? 548 HIS A N    4  
ATOM 10266 C CA   . HIS A 1 156 ? -18.638 0.078   9.906   1.00 0.00 ? 548 HIS A CA   4  
ATOM 10267 C C    . HIS A 1 156 ? -18.482 1.392   10.656  1.00 0.00 ? 548 HIS A C    4  
ATOM 10268 O O    . HIS A 1 156 ? -17.376 1.874   10.900  1.00 0.00 ? 548 HIS A O    4  
ATOM 10269 C CB   . HIS A 1 156 ? -17.828 -1.074  10.570  1.00 0.00 ? 548 HIS A CB   4  
ATOM 10270 C CG   . HIS A 1 156 ? -16.329 -1.033  10.374  1.00 0.00 ? 548 HIS A CG   4  
ATOM 10271 N ND1  . HIS A 1 156 ? -15.414 -1.009  11.405  1.00 0.00 ? 548 HIS A ND1  4  
ATOM 10272 C CD2  . HIS A 1 156 ? -15.598 -1.092  9.234   1.00 0.00 ? 548 HIS A CD2  4  
ATOM 10273 C CE1  . HIS A 1 156 ? -14.196 -1.062  10.874  1.00 0.00 ? 548 HIS A CE1  4  
ATOM 10274 N NE2  . HIS A 1 156 ? -14.250 -1.113  9.557   1.00 0.00 ? 548 HIS A NE2  4  
ATOM 10275 H H    . HIS A 1 156 ? -17.747 0.839   8.169   1.00 0.00 ? 548 HIS A H    4  
ATOM 10276 H HA   . HIS A 1 156 ? -19.681 -0.187  9.987   1.00 0.00 ? 548 HIS A HA   4  
ATOM 10277 H HB2  . HIS A 1 156 ? -18.006 -1.059  11.636  1.00 0.00 ? 548 HIS A HB2  4  
ATOM 10278 H HB3  . HIS A 1 156 ? -18.188 -2.014  10.177  1.00 0.00 ? 548 HIS A HB3  4  
ATOM 10279 H HD1  . HIS A 1 156 ? -15.602 -0.933  12.368  1.00 0.00 ? 548 HIS A HD1  4  
ATOM 10280 H HD2  . HIS A 1 156 ? -15.994 -1.118  8.230   1.00 0.00 ? 548 HIS A HD2  4  
ATOM 10281 H HE1  . HIS A 1 156 ? -13.278 -1.076  11.444  1.00 0.00 ? 548 HIS A HE1  4  
ATOM 10282 N N    . HIS A 1 157 ? -19.600 1.992   10.958  1.00 0.00 ? 549 HIS A N    4  
ATOM 10283 C CA   . HIS A 1 157 ? -19.635 3.119   11.863  1.00 0.00 ? 549 HIS A CA   4  
ATOM 10284 C C    . HIS A 1 157 ? -19.993 2.591   13.233  1.00 0.00 ? 549 HIS A C    4  
ATOM 10285 O O    . HIS A 1 157 ? -19.423 3.009   14.252  1.00 0.00 ? 549 HIS A O    4  
ATOM 10286 C CB   . HIS A 1 157 ? -20.666 4.199   11.454  1.00 0.00 ? 549 HIS A CB   4  
ATOM 10287 C CG   . HIS A 1 157 ? -20.343 4.994   10.218  1.00 0.00 ? 549 HIS A CG   4  
ATOM 10288 N ND1  . HIS A 1 157 ? -21.251 5.252   9.212   1.00 0.00 ? 549 HIS A ND1  4  
ATOM 10289 C CD2  . HIS A 1 157 ? -19.214 5.659   9.878   1.00 0.00 ? 549 HIS A CD2  4  
ATOM 10290 C CE1  . HIS A 1 157 ? -20.664 6.047   8.313   1.00 0.00 ? 549 HIS A CE1  4  
ATOM 10291 N NE2  . HIS A 1 157 ? -19.420 6.327   8.670   1.00 0.00 ? 549 HIS A NE2  4  
ATOM 10292 H H    . HIS A 1 157 ? -20.424 1.661   10.534  1.00 0.00 ? 549 HIS A H    4  
ATOM 10293 H HA   . HIS A 1 157 ? -18.646 3.549   11.900  1.00 0.00 ? 549 HIS A HA   4  
ATOM 10294 H HB2  . HIS A 1 157 ? -21.614 3.717   11.269  1.00 0.00 ? 549 HIS A HB2  4  
ATOM 10295 H HB3  . HIS A 1 157 ? -20.783 4.890   12.275  1.00 0.00 ? 549 HIS A HB3  4  
ATOM 10296 H HD1  . HIS A 1 157 ? -22.183 4.938   9.175   1.00 0.00 ? 549 HIS A HD1  4  
ATOM 10297 H HD2  . HIS A 1 157 ? -18.294 5.678   10.442  1.00 0.00 ? 549 HIS A HD2  4  
ATOM 10298 H HE1  . HIS A 1 157 ? -21.139 6.414   7.414   1.00 0.00 ? 549 HIS A HE1  4  
ATOM 10299 N N    . HIS A 1 158 ? -20.949 1.638   13.236  1.00 0.00 ? 550 HIS A N    4  
ATOM 10300 C CA   . HIS A 1 158 ? -21.492 0.979   14.445  1.00 0.00 ? 550 HIS A CA   4  
ATOM 10301 C C    . HIS A 1 158 ? -22.372 1.910   15.265  1.00 0.00 ? 550 HIS A C    4  
ATOM 10302 O O    . HIS A 1 158 ? -22.862 1.549   16.331  1.00 0.00 ? 550 HIS A O    4  
ATOM 10303 C CB   . HIS A 1 158 ? -20.410 0.300   15.300  1.00 0.00 ? 550 HIS A CB   4  
ATOM 10304 C CG   . HIS A 1 158 ? -19.822 -0.931  14.671  1.00 0.00 ? 550 HIS A CG   4  
ATOM 10305 N ND1  . HIS A 1 158 ? -18.521 -1.038  14.229  1.00 0.00 ? 550 HIS A ND1  4  
ATOM 10306 C CD2  . HIS A 1 158 ? -20.388 -2.142  14.451  1.00 0.00 ? 550 HIS A CD2  4  
ATOM 10307 C CE1  . HIS A 1 158 ? -18.347 -2.278  13.767  1.00 0.00 ? 550 HIS A CE1  4  
ATOM 10308 N NE2  . HIS A 1 158 ? -19.446 -2.990  13.879  1.00 0.00 ? 550 HIS A NE2  4  
ATOM 10309 H H    . HIS A 1 158 ? -21.333 1.345   12.381  1.00 0.00 ? 550 HIS A H    4  
ATOM 10310 H HA   . HIS A 1 158 ? -22.156 0.214   14.064  1.00 0.00 ? 550 HIS A HA   4  
ATOM 10311 H HB2  . HIS A 1 158 ? -19.605 0.999   15.469  1.00 0.00 ? 550 HIS A HB2  4  
ATOM 10312 H HB3  . HIS A 1 158 ? -20.839 0.017   16.249  1.00 0.00 ? 550 HIS A HB3  4  
ATOM 10313 H HD1  . HIS A 1 158 ? -17.816 -0.353  14.259  1.00 0.00 ? 550 HIS A HD1  4  
ATOM 10314 H HD2  . HIS A 1 158 ? -21.407 -2.417  14.677  1.00 0.00 ? 550 HIS A HD2  4  
ATOM 10315 H HE1  . HIS A 1 158 ? -17.421 -2.649  13.355  1.00 0.00 ? 550 HIS A HE1  4  
ATOM 10316 N N    . HIS A 1 159 ? -22.578 3.089   14.736  1.00 0.00 ? 551 HIS A N    4  
ATOM 10317 C CA   . HIS A 1 159 ? -23.435 4.106   15.290  1.00 0.00 ? 551 HIS A CA   4  
ATOM 10318 C C    . HIS A 1 159 ? -23.932 4.942   14.138  1.00 0.00 ? 551 HIS A C    4  
ATOM 10319 O O    . HIS A 1 159 ? -23.359 6.011   13.866  1.00 0.00 ? 551 HIS A O    4  
ATOM 10320 C CB   . HIS A 1 159 ? -22.725 5.002   16.341  1.00 0.00 ? 551 HIS A CB   4  
ATOM 10321 C CG   . HIS A 1 159 ? -22.470 4.352   17.678  1.00 0.00 ? 551 HIS A CG   4  
ATOM 10322 N ND1  . HIS A 1 159 ? -21.221 4.098   18.199  1.00 0.00 ? 551 HIS A ND1  4  
ATOM 10323 C CD2  . HIS A 1 159 ? -23.345 3.960   18.622  1.00 0.00 ? 551 HIS A CD2  4  
ATOM 10324 C CE1  . HIS A 1 159 ? -21.379 3.575   19.418  1.00 0.00 ? 551 HIS A CE1  4  
ATOM 10325 N NE2  . HIS A 1 159 ? -22.657 3.471   19.726  1.00 0.00 ? 551 HIS A NE2  4  
ATOM 10326 H H    . HIS A 1 159 ? -22.148 3.293   13.880  1.00 0.00 ? 551 HIS A H    4  
ATOM 10327 H HA   . HIS A 1 159 ? -24.276 3.601   15.742  1.00 0.00 ? 551 HIS A HA   4  
ATOM 10328 H HB2  . HIS A 1 159 ? -21.775 5.321   15.943  1.00 0.00 ? 551 HIS A HB2  4  
ATOM 10329 H HB3  . HIS A 1 159 ? -23.334 5.877   16.510  1.00 0.00 ? 551 HIS A HB3  4  
ATOM 10330 H HD1  . HIS A 1 159 ? -20.359 4.262   17.764  1.00 0.00 ? 551 HIS A HD1  4  
ATOM 10331 H HD2  . HIS A 1 159 ? -24.419 4.003   18.540  1.00 0.00 ? 551 HIS A HD2  4  
ATOM 10332 H HE1  . HIS A 1 159 ? -20.567 3.278   20.065  1.00 0.00 ? 551 HIS A HE1  4  
ATOM 10333 N N    . MET A 1 1   ? 27.550  -0.505  8.116   1.00 0.00 ? 393 MET A N    5  
ATOM 10334 C CA   . MET A 1 1   ? 28.433  0.631   7.878   1.00 0.00 ? 393 MET A CA   5  
ATOM 10335 C C    . MET A 1 1   ? 28.766  0.775   6.381   1.00 0.00 ? 393 MET A C    5  
ATOM 10336 O O    . MET A 1 1   ? 28.452  1.800   5.771   1.00 0.00 ? 393 MET A O    5  
ATOM 10337 C CB   . MET A 1 1   ? 29.705  0.512   8.728   1.00 0.00 ? 393 MET A CB   5  
ATOM 10338 C CG   . MET A 1 1   ? 30.705  1.618   8.494   1.00 0.00 ? 393 MET A CG   5  
ATOM 10339 S SD   . MET A 1 1   ? 30.039  3.249   8.839   1.00 0.00 ? 393 MET A SD   5  
ATOM 10340 C CE   . MET A 1 1   ? 31.443  4.248   8.368   1.00 0.00 ? 393 MET A CE   5  
ATOM 10341 H H1   . MET A 1 1   ? 27.982  -1.387  7.773   1.00 0.00 ? 393 MET A H1   5  
ATOM 10342 H H2   . MET A 1 1   ? 27.335  -0.624  9.126   1.00 0.00 ? 393 MET A H2   5  
ATOM 10343 H H3   . MET A 1 1   ? 26.647  -0.367  7.610   1.00 0.00 ? 393 MET A H3   5  
ATOM 10344 H HA   . MET A 1 1   ? 27.892  1.518   8.176   1.00 0.00 ? 393 MET A HA   5  
ATOM 10345 H HB2  . MET A 1 1   ? 29.430  0.529   9.772   1.00 0.00 ? 393 MET A HB2  5  
ATOM 10346 H HB3  . MET A 1 1   ? 30.191  -0.428  8.515   1.00 0.00 ? 393 MET A HB3  5  
ATOM 10347 H HG2  . MET A 1 1   ? 31.560  1.455   9.133   1.00 0.00 ? 393 MET A HG2  5  
ATOM 10348 H HG3  . MET A 1 1   ? 31.014  1.582   7.460   1.00 0.00 ? 393 MET A HG3  5  
ATOM 10349 H HE1  . MET A 1 1   ? 31.695  4.051   7.336   1.00 0.00 ? 393 MET A HE1  5  
ATOM 10350 H HE2  . MET A 1 1   ? 31.194  5.291   8.479   1.00 0.00 ? 393 MET A HE2  5  
ATOM 10351 H HE3  . MET A 1 1   ? 32.285  4.002   8.997   1.00 0.00 ? 393 MET A HE3  5  
ATOM 10352 N N    . SER A 1 2   ? 29.397  -0.236  5.798   1.00 0.00 ? 394 SER A N    5  
ATOM 10353 C CA   . SER A 1 2   ? 29.766  -0.226  4.388   1.00 0.00 ? 394 SER A CA   5  
ATOM 10354 C C    . SER A 1 2   ? 28.514  -0.274  3.491   1.00 0.00 ? 394 SER A C    5  
ATOM 10355 O O    . SER A 1 2   ? 28.416  0.439   2.485   1.00 0.00 ? 394 SER A O    5  
ATOM 10356 C CB   . SER A 1 2   ? 30.667  -1.422  4.119   1.00 0.00 ? 394 SER A CB   5  
ATOM 10357 O OG   . SER A 1 2   ? 31.722  -1.454  5.068   1.00 0.00 ? 394 SER A OG   5  
ATOM 10358 H H    . SER A 1 2   ? 29.684  -1.022  6.311   1.00 0.00 ? 394 SER A H    5  
ATOM 10359 H HA   . SER A 1 2   ? 30.318  0.679   4.188   1.00 0.00 ? 394 SER A HA   5  
ATOM 10360 H HB2  . SER A 1 2   ? 30.092  -2.332  4.202   1.00 0.00 ? 394 SER A HB2  5  
ATOM 10361 H HB3  . SER A 1 2   ? 31.090  -1.345  3.129   1.00 0.00 ? 394 SER A HB3  5  
ATOM 10362 H HG   . SER A 1 2   ? 32.057  -2.357  5.128   1.00 0.00 ? 394 SER A HG   5  
ATOM 10363 N N    . VAL A 1 3   ? 27.567  -1.101  3.870   1.00 0.00 ? 395 VAL A N    5  
ATOM 10364 C CA   . VAL A 1 3   ? 26.315  -1.221  3.159   1.00 0.00 ? 395 VAL A CA   5  
ATOM 10365 C C    . VAL A 1 3   ? 25.161  -1.191  4.163   1.00 0.00 ? 395 VAL A C    5  
ATOM 10366 O O    . VAL A 1 3   ? 24.926  -2.135  4.926   1.00 0.00 ? 395 VAL A O    5  
ATOM 10367 C CB   . VAL A 1 3   ? 26.270  -2.480  2.216   1.00 0.00 ? 395 VAL A CB   5  
ATOM 10368 C CG1  . VAL A 1 3   ? 26.541  -3.789  2.959   1.00 0.00 ? 395 VAL A CG1  5  
ATOM 10369 C CG2  . VAL A 1 3   ? 24.949  -2.547  1.446   1.00 0.00 ? 395 VAL A CG2  5  
ATOM 10370 H H    . VAL A 1 3   ? 27.701  -1.652  4.672   1.00 0.00 ? 395 VAL A H    5  
ATOM 10371 H HA   . VAL A 1 3   ? 26.233  -0.325  2.559   1.00 0.00 ? 395 VAL A HA   5  
ATOM 10372 H HB   . VAL A 1 3   ? 27.066  -2.360  1.497   1.00 0.00 ? 395 VAL A HB   5  
ATOM 10373 H HG11 . VAL A 1 3   ? 27.520  -3.748  3.414   1.00 0.00 ? 395 VAL A HG11 5  
ATOM 10374 H HG12 . VAL A 1 3   ? 25.794  -3.922  3.728   1.00 0.00 ? 395 VAL A HG12 5  
ATOM 10375 H HG13 . VAL A 1 3   ? 26.497  -4.617  2.267   1.00 0.00 ? 395 VAL A HG13 5  
ATOM 10376 H HG21 . VAL A 1 3   ? 24.837  -1.657  0.845   1.00 0.00 ? 395 VAL A HG21 5  
ATOM 10377 H HG22 . VAL A 1 3   ? 24.949  -3.417  0.806   1.00 0.00 ? 395 VAL A HG22 5  
ATOM 10378 H HG23 . VAL A 1 3   ? 24.128  -2.616  2.144   1.00 0.00 ? 395 VAL A HG23 5  
ATOM 10379 N N    . SER A 1 4   ? 24.518  -0.072  4.236   1.00 0.00 ? 396 SER A N    5  
ATOM 10380 C CA   . SER A 1 4   ? 23.458  0.156   5.180   1.00 0.00 ? 396 SER A CA   5  
ATOM 10381 C C    . SER A 1 4   ? 22.454  1.102   4.533   1.00 0.00 ? 396 SER A C    5  
ATOM 10382 O O    . SER A 1 4   ? 22.429  1.191   3.302   1.00 0.00 ? 396 SER A O    5  
ATOM 10383 C CB   . SER A 1 4   ? 24.070  0.748   6.461   1.00 0.00 ? 396 SER A CB   5  
ATOM 10384 O OG   . SER A 1 4   ? 25.078  -0.134  6.974   1.00 0.00 ? 396 SER A OG   5  
ATOM 10385 H H    . SER A 1 4   ? 24.722  0.663   3.618   1.00 0.00 ? 396 SER A H    5  
ATOM 10386 H HA   . SER A 1 4   ? 22.979  -0.784  5.404   1.00 0.00 ? 396 SER A HA   5  
ATOM 10387 H HB2  . SER A 1 4   ? 24.520  1.702   6.232   1.00 0.00 ? 396 SER A HB2  5  
ATOM 10388 H HB3  . SER A 1 4   ? 23.303  0.879   7.209   1.00 0.00 ? 396 SER A HB3  5  
ATOM 10389 H HG   . SER A 1 4   ? 24.911  -0.967  6.510   1.00 0.00 ? 396 SER A HG   5  
ATOM 10390 N N    . ASN A 1 5   ? 21.631  1.776   5.345   1.00 0.00 ? 397 ASN A N    5  
ATOM 10391 C CA   . ASN A 1 5   ? 20.618  2.727   4.860   1.00 0.00 ? 397 ASN A CA   5  
ATOM 10392 C C    . ASN A 1 5   ? 19.521  1.975   4.110   1.00 0.00 ? 397 ASN A C    5  
ATOM 10393 O O    . ASN A 1 5   ? 19.306  0.762   4.344   1.00 0.00 ? 397 ASN A O    5  
ATOM 10394 C CB   . ASN A 1 5   ? 21.248  3.839   3.959   1.00 0.00 ? 397 ASN A CB   5  
ATOM 10395 C CG   . ASN A 1 5   ? 22.292  4.676   4.672   1.00 0.00 ? 397 ASN A CG   5  
ATOM 10396 O OD1  . ASN A 1 5   ? 23.492  4.377   4.622   1.00 0.00 ? 397 ASN A OD1  5  
ATOM 10397 N ND2  . ASN A 1 5   ? 21.860  5.711   5.344   1.00 0.00 ? 397 ASN A ND2  5  
ATOM 10398 H H    . ASN A 1 5   ? 21.684  1.636   6.311   1.00 0.00 ? 397 ASN A H    5  
ATOM 10399 H HA   . ASN A 1 5   ? 20.172  3.185   5.731   1.00 0.00 ? 397 ASN A HA   5  
ATOM 10400 H HB2  . ASN A 1 5   ? 21.728  3.369   3.114   1.00 0.00 ? 397 ASN A HB2  5  
ATOM 10401 H HB3  . ASN A 1 5   ? 20.474  4.494   3.594   1.00 0.00 ? 397 ASN A HB3  5  
ATOM 10402 H HD21 . ASN A 1 5   ? 20.895  5.888   5.346   1.00 0.00 ? 397 ASN A HD21 5  
ATOM 10403 H HD22 . ASN A 1 5   ? 22.502  6.271   5.831   1.00 0.00 ? 397 ASN A HD22 5  
ATOM 10404 N N    . LYS A 1 6   ? 18.831  2.663   3.237   1.00 0.00 ? 398 LYS A N    5  
ATOM 10405 C CA   . LYS A 1 6   ? 17.788  2.062   2.457   1.00 0.00 ? 398 LYS A CA   5  
ATOM 10406 C C    . LYS A 1 6   ? 18.222  1.861   1.014   1.00 0.00 ? 398 LYS A C    5  
ATOM 10407 O O    . LYS A 1 6   ? 19.045  2.622   0.480   1.00 0.00 ? 398 LYS A O    5  
ATOM 10408 C CB   . LYS A 1 6   ? 16.439  2.820   2.605   1.00 0.00 ? 398 LYS A CB   5  
ATOM 10409 C CG   . LYS A 1 6   ? 16.535  4.347   2.635   1.00 0.00 ? 398 LYS A CG   5  
ATOM 10410 C CD   . LYS A 1 6   ? 16.997  4.960   1.328   1.00 0.00 ? 398 LYS A CD   5  
ATOM 10411 C CE   . LYS A 1 6   ? 17.271  6.428   1.527   1.00 0.00 ? 398 LYS A CE   5  
ATOM 10412 N NZ   . LYS A 1 6   ? 17.688  7.105   0.287   1.00 0.00 ? 398 LYS A NZ   5  
ATOM 10413 H H    . LYS A 1 6   ? 19.037  3.609   3.097   1.00 0.00 ? 398 LYS A H    5  
ATOM 10414 H HA   . LYS A 1 6   ? 17.669  1.081   2.885   1.00 0.00 ? 398 LYS A HA   5  
ATOM 10415 H HB2  . LYS A 1 6   ? 15.801  2.547   1.777   1.00 0.00 ? 398 LYS A HB2  5  
ATOM 10416 H HB3  . LYS A 1 6   ? 15.968  2.494   3.520   1.00 0.00 ? 398 LYS A HB3  5  
ATOM 10417 H HG2  . LYS A 1 6   ? 15.562  4.752   2.868   1.00 0.00 ? 398 LYS A HG2  5  
ATOM 10418 H HG3  . LYS A 1 6   ? 17.225  4.624   3.417   1.00 0.00 ? 398 LYS A HG3  5  
ATOM 10419 H HD2  . LYS A 1 6   ? 17.898  4.463   1.001   1.00 0.00 ? 398 LYS A HD2  5  
ATOM 10420 H HD3  . LYS A 1 6   ? 16.222  4.842   0.585   1.00 0.00 ? 398 LYS A HD3  5  
ATOM 10421 H HE2  . LYS A 1 6   ? 16.382  6.892   1.926   1.00 0.00 ? 398 LYS A HE2  5  
ATOM 10422 H HE3  . LYS A 1 6   ? 18.068  6.477   2.253   1.00 0.00 ? 398 LYS A HE3  5  
ATOM 10423 H HZ1  . LYS A 1 6   ? 18.530  6.667   -0.139  1.00 0.00 ? 398 LYS A HZ1  5  
ATOM 10424 H HZ2  . LYS A 1 6   ? 16.922  7.120   -0.414  1.00 0.00 ? 398 LYS A HZ2  5  
ATOM 10425 H HZ3  . LYS A 1 6   ? 17.914  8.101   0.482   1.00 0.00 ? 398 LYS A HZ3  5  
ATOM 10426 N N    . LEU A 1 7   ? 17.710  0.823   0.420   1.00 0.00 ? 399 LEU A N    5  
ATOM 10427 C CA   . LEU A 1 7   ? 18.082  0.416   -0.909  1.00 0.00 ? 399 LEU A CA   5  
ATOM 10428 C C    . LEU A 1 7   ? 17.016  0.843   -1.902  1.00 0.00 ? 399 LEU A C    5  
ATOM 10429 O O    . LEU A 1 7   ? 15.831  0.744   -1.606  1.00 0.00 ? 399 LEU A O    5  
ATOM 10430 C CB   . LEU A 1 7   ? 18.254  -1.125  -0.988  1.00 0.00 ? 399 LEU A CB   5  
ATOM 10431 C CG   . LEU A 1 7   ? 19.208  -1.793  -0.003  1.00 0.00 ? 399 LEU A CG   5  
ATOM 10432 C CD1  . LEU A 1 7   ? 18.491  -2.147  1.286   1.00 0.00 ? 399 LEU A CD1  5  
ATOM 10433 C CD2  . LEU A 1 7   ? 19.841  -3.015  -0.624  1.00 0.00 ? 399 LEU A CD2  5  
ATOM 10434 H H    . LEU A 1 7   ? 17.031  0.292   0.899   1.00 0.00 ? 399 LEU A H    5  
ATOM 10435 H HA   . LEU A 1 7   ? 19.024  0.880   -1.162  1.00 0.00 ? 399 LEU A HA   5  
ATOM 10436 H HB2  . LEU A 1 7   ? 17.298  -1.569  -0.744  1.00 0.00 ? 399 LEU A HB2  5  
ATOM 10437 H HB3  . LEU A 1 7   ? 18.541  -1.405  -1.990  1.00 0.00 ? 399 LEU A HB3  5  
ATOM 10438 H HG   . LEU A 1 7   ? 19.993  -1.109  0.281   1.00 0.00 ? 399 LEU A HG   5  
ATOM 10439 H HD11 . LEU A 1 7   ? 18.073  -1.252  1.722   1.00 0.00 ? 399 LEU A HD11 5  
ATOM 10440 H HD12 . LEU A 1 7   ? 17.700  -2.853  1.082   1.00 0.00 ? 399 LEU A HD12 5  
ATOM 10441 H HD13 . LEU A 1 7   ? 19.193  -2.589  1.979   1.00 0.00 ? 399 LEU A HD13 5  
ATOM 10442 H HD21 . LEU A 1 7   ? 20.361  -2.744  -1.531  1.00 0.00 ? 399 LEU A HD21 5  
ATOM 10443 H HD22 . LEU A 1 7   ? 20.541  -3.442  0.079   1.00 0.00 ? 399 LEU A HD22 5  
ATOM 10444 H HD23 . LEU A 1 7   ? 19.073  -3.742  -0.845  1.00 0.00 ? 399 LEU A HD23 5  
ATOM 10445 N N    . LEU A 1 8   ? 17.428  1.349   -3.045  1.00 0.00 ? 400 LEU A N    5  
ATOM 10446 C CA   . LEU A 1 8   ? 16.498  1.697   -4.111  1.00 0.00 ? 400 LEU A CA   5  
ATOM 10447 C C    . LEU A 1 8   ? 15.899  0.416   -4.664  1.00 0.00 ? 400 LEU A C    5  
ATOM 10448 O O    . LEU A 1 8   ? 16.613  -0.424  -5.215  1.00 0.00 ? 400 LEU A O    5  
ATOM 10449 C CB   . LEU A 1 8   ? 17.210  2.478   -5.229  1.00 0.00 ? 400 LEU A CB   5  
ATOM 10450 C CG   . LEU A 1 8   ? 16.364  2.811   -6.473  1.00 0.00 ? 400 LEU A CG   5  
ATOM 10451 C CD1  . LEU A 1 8   ? 15.176  3.702   -6.128  1.00 0.00 ? 400 LEU A CD1  5  
ATOM 10452 C CD2  . LEU A 1 8   ? 17.224  3.452   -7.548  1.00 0.00 ? 400 LEU A CD2  5  
ATOM 10453 H H    . LEU A 1 8   ? 18.389  1.478   -3.188  1.00 0.00 ? 400 LEU A H    5  
ATOM 10454 H HA   . LEU A 1 8   ? 15.710  2.300   -3.686  1.00 0.00 ? 400 LEU A HA   5  
ATOM 10455 H HB2  . LEU A 1 8   ? 17.571  3.407   -4.813  1.00 0.00 ? 400 LEU A HB2  5  
ATOM 10456 H HB3  . LEU A 1 8   ? 18.062  1.899   -5.550  1.00 0.00 ? 400 LEU A HB3  5  
ATOM 10457 H HG   . LEU A 1 8   ? 15.968  1.888   -6.870  1.00 0.00 ? 400 LEU A HG   5  
ATOM 10458 H HD11 . LEU A 1 8   ? 15.530  4.623   -5.687  1.00 0.00 ? 400 LEU A HD11 5  
ATOM 10459 H HD12 . LEU A 1 8   ? 14.622  3.924   -7.027  1.00 0.00 ? 400 LEU A HD12 5  
ATOM 10460 H HD13 . LEU A 1 8   ? 14.534  3.191   -5.424  1.00 0.00 ? 400 LEU A HD13 5  
ATOM 10461 H HD21 . LEU A 1 8   ? 17.668  4.357   -7.162  1.00 0.00 ? 400 LEU A HD21 5  
ATOM 10462 H HD22 . LEU A 1 8   ? 18.005  2.768   -7.845  1.00 0.00 ? 400 LEU A HD22 5  
ATOM 10463 H HD23 . LEU A 1 8   ? 16.612  3.687   -8.405  1.00 0.00 ? 400 LEU A HD23 5  
ATOM 10464 N N    . ALA A 1 9   ? 14.619  0.254   -4.500  1.00 0.00 ? 401 ALA A N    5  
ATOM 10465 C CA   . ALA A 1 9   ? 13.986  -0.966  -4.900  1.00 0.00 ? 401 ALA A CA   5  
ATOM 10466 C C    . ALA A 1 9   ? 13.142  -0.800  -6.132  1.00 0.00 ? 401 ALA A C    5  
ATOM 10467 O O    . ALA A 1 9   ? 13.348  -1.511  -7.131  1.00 0.00 ? 401 ALA A O    5  
ATOM 10468 C CB   . ALA A 1 9   ? 13.152  -1.513  -3.776  1.00 0.00 ? 401 ALA A CB   5  
ATOM 10469 H H    . ALA A 1 9   ? 14.081  0.968   -4.094  1.00 0.00 ? 401 ALA A H    5  
ATOM 10470 H HA   . ALA A 1 9   ? 14.762  -1.690  -5.105  1.00 0.00 ? 401 ALA A HA   5  
ATOM 10471 H HB1  . ALA A 1 9   ? 12.350  -0.824  -3.557  1.00 0.00 ? 401 ALA A HB1  5  
ATOM 10472 H HB2  . ALA A 1 9   ? 12.742  -2.472  -4.055  1.00 0.00 ? 401 ALA A HB2  5  
ATOM 10473 H HB3  . ALA A 1 9   ? 13.779  -1.628  -2.904  1.00 0.00 ? 401 ALA A HB3  5  
ATOM 10474 N N    . TRP A 1 10  ? 12.218  0.137   -6.102  1.00 0.00 ? 402 TRP A N    5  
ATOM 10475 C CA   . TRP A 1 10  ? 11.264  0.245   -7.164  1.00 0.00 ? 402 TRP A CA   5  
ATOM 10476 C C    . TRP A 1 10  ? 10.662  1.624   -7.183  1.00 0.00 ? 402 TRP A C    5  
ATOM 10477 O O    . TRP A 1 10  ? 10.503  2.248   -6.153  1.00 0.00 ? 402 TRP A O    5  
ATOM 10478 C CB   . TRP A 1 10  ? 10.176  -0.830  -6.951  1.00 0.00 ? 402 TRP A CB   5  
ATOM 10479 C CG   . TRP A 1 10  ? 9.052   -0.839  -7.935  1.00 0.00 ? 402 TRP A CG   5  
ATOM 10480 C CD1  . TRP A 1 10  ? 9.074   -1.314  -9.208  1.00 0.00 ? 402 TRP A CD1  5  
ATOM 10481 C CD2  . TRP A 1 10  ? 7.724   -0.379  -7.703  1.00 0.00 ? 402 TRP A CD2  5  
ATOM 10482 N NE1  . TRP A 1 10  ? 7.841   -1.159  -9.780  1.00 0.00 ? 402 TRP A NE1  5  
ATOM 10483 C CE2  . TRP A 1 10  ? 6.995   -0.590  -8.877  1.00 0.00 ? 402 TRP A CE2  5  
ATOM 10484 C CE3  . TRP A 1 10  ? 7.088   0.194   -6.610  1.00 0.00 ? 402 TRP A CE3  5  
ATOM 10485 C CZ2  . TRP A 1 10  ? 5.655   -0.247  -8.992  1.00 0.00 ? 402 TRP A CZ2  5  
ATOM 10486 C CZ3  . TRP A 1 10  ? 5.762   0.535   -6.718  1.00 0.00 ? 402 TRP A CZ3  5  
ATOM 10487 C CH2  . TRP A 1 10  ? 5.056   0.312   -7.905  1.00 0.00 ? 402 TRP A CH2  5  
ATOM 10488 H H    . TRP A 1 10  ? 12.149  0.808   -5.382  1.00 0.00 ? 402 TRP A H    5  
ATOM 10489 H HA   . TRP A 1 10  ? 11.762  0.041   -8.099  1.00 0.00 ? 402 TRP A HA   5  
ATOM 10490 H HB2  . TRP A 1 10  ? 10.642  -1.800  -7.013  1.00 0.00 ? 402 TRP A HB2  5  
ATOM 10491 H HB3  . TRP A 1 10  ? 9.758   -0.708  -5.962  1.00 0.00 ? 402 TRP A HB3  5  
ATOM 10492 H HD1  . TRP A 1 10  ? 9.944   -1.738  -9.686  1.00 0.00 ? 402 TRP A HD1  5  
ATOM 10493 H HE1  . TRP A 1 10  ? 7.589   -1.420  -10.692 1.00 0.00 ? 402 TRP A HE1  5  
ATOM 10494 H HE3  . TRP A 1 10  ? 7.624   0.371   -5.689  1.00 0.00 ? 402 TRP A HE3  5  
ATOM 10495 H HZ2  . TRP A 1 10  ? 5.098   -0.413  -9.903  1.00 0.00 ? 402 TRP A HZ2  5  
ATOM 10496 H HZ3  . TRP A 1 10  ? 5.264   0.975   -5.867  1.00 0.00 ? 402 TRP A HZ3  5  
ATOM 10497 H HH2  . TRP A 1 10  ? 4.015   0.597   -7.955  1.00 0.00 ? 402 TRP A HH2  5  
ATOM 10498 N N    . SER A 1 11  ? 10.386  2.098   -8.338  1.00 0.00 ? 403 SER A N    5  
ATOM 10499 C CA   . SER A 1 11  ? 9.720   3.337   -8.518  1.00 0.00 ? 403 SER A CA   5  
ATOM 10500 C C    . SER A 1 11  ? 8.563   3.086   -9.489  1.00 0.00 ? 403 SER A C    5  
ATOM 10501 O O    . SER A 1 11  ? 8.773   2.590   -10.613 1.00 0.00 ? 403 SER A O    5  
ATOM 10502 C CB   . SER A 1 11  ? 10.711  4.383   -9.034  1.00 0.00 ? 403 SER A CB   5  
ATOM 10503 O OG   . SER A 1 11  ? 11.815  4.531   -8.129  1.00 0.00 ? 403 SER A OG   5  
ATOM 10504 H H    . SER A 1 11  ? 10.627  1.590   -9.142  1.00 0.00 ? 403 SER A H    5  
ATOM 10505 H HA   . SER A 1 11  ? 9.319   3.644   -7.562  1.00 0.00 ? 403 SER A HA   5  
ATOM 10506 H HB2  . SER A 1 11  ? 11.104  4.038   -9.978  1.00 0.00 ? 403 SER A HB2  5  
ATOM 10507 H HB3  . SER A 1 11  ? 10.218  5.335   -9.149  1.00 0.00 ? 403 SER A HB3  5  
ATOM 10508 H HG   . SER A 1 11  ? 12.335  3.721   -8.212  1.00 0.00 ? 403 SER A HG   5  
ATOM 10509 N N    . GLY A 1 12  ? 7.362   3.360   -9.041  1.00 0.00 ? 404 GLY A N    5  
ATOM 10510 C CA   . GLY A 1 12  ? 6.186   3.049   -9.808  1.00 0.00 ? 404 GLY A CA   5  
ATOM 10511 C C    . GLY A 1 12  ? 5.038   3.918   -9.404  1.00 0.00 ? 404 GLY A C    5  
ATOM 10512 O O    . GLY A 1 12  ? 5.226   4.867   -8.644  1.00 0.00 ? 404 GLY A O    5  
ATOM 10513 H H    . GLY A 1 12  ? 7.242   3.811   -8.177  1.00 0.00 ? 404 GLY A H    5  
ATOM 10514 H HA2  . GLY A 1 12  ? 6.395   3.194   -10.857 1.00 0.00 ? 404 GLY A HA2  5  
ATOM 10515 H HA3  . GLY A 1 12  ? 5.919   2.017   -9.639  1.00 0.00 ? 404 GLY A HA3  5  
ATOM 10516 N N    . VAL A 1 13  ? 3.869   3.624   -9.906  1.00 0.00 ? 405 VAL A N    5  
ATOM 10517 C CA   . VAL A 1 13  ? 2.698   4.431   -9.641  1.00 0.00 ? 405 VAL A CA   5  
ATOM 10518 C C    . VAL A 1 13  ? 1.608   3.579   -8.980  1.00 0.00 ? 405 VAL A C    5  
ATOM 10519 O O    . VAL A 1 13  ? 1.441   2.408   -9.314  1.00 0.00 ? 405 VAL A O    5  
ATOM 10520 C CB   . VAL A 1 13  ? 2.153   5.062   -10.967 1.00 0.00 ? 405 VAL A CB   5  
ATOM 10521 C CG1  . VAL A 1 13  ? 0.937   5.936   -10.718 1.00 0.00 ? 405 VAL A CG1  5  
ATOM 10522 C CG2  . VAL A 1 13  ? 3.235   5.869   -11.660 1.00 0.00 ? 405 VAL A CG2  5  
ATOM 10523 H H    . VAL A 1 13  ? 3.751   2.816   -10.456 1.00 0.00 ? 405 VAL A H    5  
ATOM 10524 H HA   . VAL A 1 13  ? 2.984   5.230   -8.972  1.00 0.00 ? 405 VAL A HA   5  
ATOM 10525 H HB   . VAL A 1 13  ? 1.859   4.259   -11.626 1.00 0.00 ? 405 VAL A HB   5  
ATOM 10526 H HG11 . VAL A 1 13  ? 0.160   5.340   -10.263 1.00 0.00 ? 405 VAL A HG11 5  
ATOM 10527 H HG12 . VAL A 1 13  ? 1.206   6.741   -10.049 1.00 0.00 ? 405 VAL A HG12 5  
ATOM 10528 H HG13 . VAL A 1 13  ? 0.586   6.345   -11.653 1.00 0.00 ? 405 VAL A HG13 5  
ATOM 10529 H HG21 . VAL A 1 13  ? 4.070   5.225   -11.895 1.00 0.00 ? 405 VAL A HG21 5  
ATOM 10530 H HG22 . VAL A 1 13  ? 2.839   6.293   -12.569 1.00 0.00 ? 405 VAL A HG22 5  
ATOM 10531 H HG23 . VAL A 1 13  ? 3.566   6.663   -11.007 1.00 0.00 ? 405 VAL A HG23 5  
ATOM 10532 N N    . LEU A 1 14  ? 0.890   4.163   -8.049  1.00 0.00 ? 406 LEU A N    5  
ATOM 10533 C CA   . LEU A 1 14  ? -0.213  3.483   -7.376  1.00 0.00 ? 406 LEU A CA   5  
ATOM 10534 C C    . LEU A 1 14  ? -1.507  4.147   -7.766  1.00 0.00 ? 406 LEU A C    5  
ATOM 10535 O O    . LEU A 1 14  ? -1.571  5.372   -7.861  1.00 0.00 ? 406 LEU A O    5  
ATOM 10536 C CB   . LEU A 1 14  ? -0.047  3.506   -5.839  1.00 0.00 ? 406 LEU A CB   5  
ATOM 10537 C CG   . LEU A 1 14  ? 0.783   2.379   -5.171  1.00 0.00 ? 406 LEU A CG   5  
ATOM 10538 C CD1  . LEU A 1 14  ? 2.183   2.251   -5.750  1.00 0.00 ? 406 LEU A CD1  5  
ATOM 10539 C CD2  . LEU A 1 14  ? 0.861   2.622   -3.674  1.00 0.00 ? 406 LEU A CD2  5  
ATOM 10540 H H    . LEU A 1 14  ? 1.096   5.088   -7.788  1.00 0.00 ? 406 LEU A H    5  
ATOM 10541 H HA   . LEU A 1 14  ? -0.256  2.460   -7.720  1.00 0.00 ? 406 LEU A HA   5  
ATOM 10542 H HB2  . LEU A 1 14  ? 0.412   4.448   -5.575  1.00 0.00 ? 406 LEU A HB2  5  
ATOM 10543 H HB3  . LEU A 1 14  ? -1.039  3.490   -5.410  1.00 0.00 ? 406 LEU A HB3  5  
ATOM 10544 H HG   . LEU A 1 14  ? 0.275   1.438   -5.319  1.00 0.00 ? 406 LEU A HG   5  
ATOM 10545 H HD11 . LEU A 1 14  ? 2.118   2.045   -6.808  1.00 0.00 ? 406 LEU A HD11 5  
ATOM 10546 H HD12 . LEU A 1 14  ? 2.725   3.171   -5.595  1.00 0.00 ? 406 LEU A HD12 5  
ATOM 10547 H HD13 . LEU A 1 14  ? 2.701   1.443   -5.258  1.00 0.00 ? 406 LEU A HD13 5  
ATOM 10548 H HD21 . LEU A 1 14  ? 1.332   3.577   -3.488  1.00 0.00 ? 406 LEU A HD21 5  
ATOM 10549 H HD22 . LEU A 1 14  ? -0.134  2.628   -3.253  1.00 0.00 ? 406 LEU A HD22 5  
ATOM 10550 H HD23 . LEU A 1 14  ? 1.441   1.837   -3.212  1.00 0.00 ? 406 LEU A HD23 5  
ATOM 10551 N N    . GLU A 1 15  ? -2.518  3.344   -8.001  1.00 0.00 ? 407 GLU A N    5  
ATOM 10552 C CA   . GLU A 1 15  ? -3.799  3.805   -8.483  1.00 0.00 ? 407 GLU A CA   5  
ATOM 10553 C C    . GLU A 1 15  ? -4.926  3.590   -7.489  1.00 0.00 ? 407 GLU A C    5  
ATOM 10554 O O    . GLU A 1 15  ? -4.869  2.689   -6.618  1.00 0.00 ? 407 GLU A O    5  
ATOM 10555 C CB   . GLU A 1 15  ? -4.153  3.190   -9.832  1.00 0.00 ? 407 GLU A CB   5  
ATOM 10556 C CG   . GLU A 1 15  ? -3.244  3.618   -10.967 1.00 0.00 ? 407 GLU A CG   5  
ATOM 10557 C CD   . GLU A 1 15  ? -3.682  3.077   -12.298 1.00 0.00 ? 407 GLU A CD   5  
ATOM 10558 O OE1  . GLU A 1 15  ? -3.978  1.863   -12.403 1.00 0.00 ? 407 GLU A OE1  5  
ATOM 10559 O OE2  . GLU A 1 15  ? -3.716  3.854   -13.287 1.00 0.00 ? 407 GLU A OE2  5  
ATOM 10560 H H    . GLU A 1 15  ? -2.394  2.379   -7.848  1.00 0.00 ? 407 GLU A H    5  
ATOM 10561 H HA   . GLU A 1 15  ? -3.704  4.872   -8.625  1.00 0.00 ? 407 GLU A HA   5  
ATOM 10562 H HB2  . GLU A 1 15  ? -4.104  2.114   -9.749  1.00 0.00 ? 407 GLU A HB2  5  
ATOM 10563 H HB3  . GLU A 1 15  ? -5.164  3.475   -10.079 1.00 0.00 ? 407 GLU A HB3  5  
ATOM 10564 H HG2  . GLU A 1 15  ? -3.308  4.693   -11.038 1.00 0.00 ? 407 GLU A HG2  5  
ATOM 10565 H HG3  . GLU A 1 15  ? -2.228  3.314   -10.767 1.00 0.00 ? 407 GLU A HG3  5  
ATOM 10566 N N    . TRP A 1 16  ? -5.912  4.459   -7.615  1.00 0.00 ? 408 TRP A N    5  
ATOM 10567 C CA   . TRP A 1 16  ? -7.084  4.524   -6.798  1.00 0.00 ? 408 TRP A CA   5  
ATOM 10568 C C    . TRP A 1 16  ? -8.272  4.932   -7.665  1.00 0.00 ? 408 TRP A C    5  
ATOM 10569 O O    . TRP A 1 16  ? -8.076  5.425   -8.764  1.00 0.00 ? 408 TRP A O    5  
ATOM 10570 C CB   . TRP A 1 16  ? -6.839  5.539   -5.696  1.00 0.00 ? 408 TRP A CB   5  
ATOM 10571 C CG   . TRP A 1 16  ? -6.991  4.942   -4.420  1.00 0.00 ? 408 TRP A CG   5  
ATOM 10572 C CD1  . TRP A 1 16  ? -6.026  4.376   -3.762  1.00 0.00 ? 408 TRP A CD1  5  
ATOM 10573 C CD2  . TRP A 1 16  ? -8.189  4.807   -3.651  1.00 0.00 ? 408 TRP A CD2  5  
ATOM 10574 N NE1  . TRP A 1 16  ? -6.497  3.883   -2.562  1.00 0.00 ? 408 TRP A NE1  5  
ATOM 10575 C CE2  . TRP A 1 16  ? -7.843  4.133   -2.487  1.00 0.00 ? 408 TRP A CE2  5  
ATOM 10576 C CE3  . TRP A 1 16  ? -9.517  5.198   -3.839  1.00 0.00 ? 408 TRP A CE3  5  
ATOM 10577 C CZ2  . TRP A 1 16  ? -8.773  3.829   -1.499  1.00 0.00 ? 408 TRP A CZ2  5  
ATOM 10578 C CZ3  . TRP A 1 16  ? -10.443 4.897   -2.864  1.00 0.00 ? 408 TRP A CZ3  5  
ATOM 10579 C CH2  . TRP A 1 16  ? -10.066 4.218   -1.704  1.00 0.00 ? 408 TRP A CH2  5  
ATOM 10580 H H    . TRP A 1 16  ? -5.848  5.123   -8.338  1.00 0.00 ? 408 TRP A H    5  
ATOM 10581 H HA   . TRP A 1 16  ? -7.262  3.555   -6.357  1.00 0.00 ? 408 TRP A HA   5  
ATOM 10582 H HB2  . TRP A 1 16  ? -5.802  5.834   -5.759  1.00 0.00 ? 408 TRP A HB2  5  
ATOM 10583 H HB3  . TRP A 1 16  ? -7.412  6.447   -5.698  1.00 0.00 ? 408 TRP A HB3  5  
ATOM 10584 H HD1  . TRP A 1 16  ? -5.039  4.391   -4.216  1.00 0.00 ? 408 TRP A HD1  5  
ATOM 10585 H HE1  . TRP A 1 16  ? -5.963  3.415   -1.890  1.00 0.00 ? 408 TRP A HE1  5  
ATOM 10586 H HE3  . TRP A 1 16  ? -9.823  5.725   -4.732  1.00 0.00 ? 408 TRP A HE3  5  
ATOM 10587 H HZ2  . TRP A 1 16  ? -8.498  3.305   -0.597  1.00 0.00 ? 408 TRP A HZ2  5  
ATOM 10588 H HZ3  . TRP A 1 16  ? -11.476 5.188   -2.990  1.00 0.00 ? 408 TRP A HZ3  5  
ATOM 10589 H HH2  . TRP A 1 16  ? -10.821 4.000   -0.964  1.00 0.00 ? 408 TRP A HH2  5  
ATOM 10590 N N    . GLN A 1 17  ? -9.479  4.746   -7.197  1.00 0.00 ? 409 GLN A N    5  
ATOM 10591 C CA   . GLN A 1 17  ? -10.643 5.068   -8.014  1.00 0.00 ? 409 GLN A CA   5  
ATOM 10592 C C    . GLN A 1 17  ? -11.443 6.206   -7.399  1.00 0.00 ? 409 GLN A C    5  
ATOM 10593 O O    . GLN A 1 17  ? -11.332 6.476   -6.197  1.00 0.00 ? 409 GLN A O    5  
ATOM 10594 C CB   . GLN A 1 17  ? -11.583 3.861   -8.168  1.00 0.00 ? 409 GLN A CB   5  
ATOM 10595 C CG   . GLN A 1 17  ? -12.325 3.492   -6.886  1.00 0.00 ? 409 GLN A CG   5  
ATOM 10596 C CD   . GLN A 1 17  ? -13.472 2.551   -7.134  1.00 0.00 ? 409 GLN A CD   5  
ATOM 10597 O OE1  . GLN A 1 17  ? -13.330 1.331   -7.068  1.00 0.00 ? 409 GLN A OE1  5  
ATOM 10598 N NE2  . GLN A 1 17  ? -14.608 3.108   -7.452  1.00 0.00 ? 409 GLN A NE2  5  
ATOM 10599 H H    . GLN A 1 17  ? -9.610  4.420   -6.283  1.00 0.00 ? 409 GLN A H    5  
ATOM 10600 H HA   . GLN A 1 17  ? -10.297 5.365   -8.992  1.00 0.00 ? 409 GLN A HA   5  
ATOM 10601 H HB2  . GLN A 1 17  ? -12.315 4.090   -8.928  1.00 0.00 ? 409 GLN A HB2  5  
ATOM 10602 H HB3  . GLN A 1 17  ? -11.006 3.006   -8.484  1.00 0.00 ? 409 GLN A HB3  5  
ATOM 10603 H HG2  . GLN A 1 17  ? -11.637 3.018   -6.203  1.00 0.00 ? 409 GLN A HG2  5  
ATOM 10604 H HG3  . GLN A 1 17  ? -12.709 4.395   -6.434  1.00 0.00 ? 409 GLN A HG3  5  
ATOM 10605 H HE21 . GLN A 1 17  ? -14.660 4.091   -7.511  1.00 0.00 ? 409 GLN A HE21 5  
ATOM 10606 H HE22 . GLN A 1 17  ? -15.390 2.556   -7.663  1.00 0.00 ? 409 GLN A HE22 5  
ATOM 10607 N N    . GLU A 1 18  ? -12.208 6.874   -8.218  1.00 0.00 ? 410 GLU A N    5  
ATOM 10608 C CA   . GLU A 1 18  ? -13.164 7.847   -7.754  1.00 0.00 ? 410 GLU A CA   5  
ATOM 10609 C C    . GLU A 1 18  ? -14.460 7.164   -7.379  1.00 0.00 ? 410 GLU A C    5  
ATOM 10610 O O    . GLU A 1 18  ? -14.822 6.138   -7.976  1.00 0.00 ? 410 GLU A O    5  
ATOM 10611 C CB   . GLU A 1 18  ? -13.469 8.894   -8.821  1.00 0.00 ? 410 GLU A CB   5  
ATOM 10612 C CG   . GLU A 1 18  ? -12.380 9.896   -9.059  1.00 0.00 ? 410 GLU A CG   5  
ATOM 10613 C CD   . GLU A 1 18  ? -12.122 10.742  -7.849  1.00 0.00 ? 410 GLU A CD   5  
ATOM 10614 O OE1  . GLU A 1 18  ? -12.702 11.845  -7.730  1.00 0.00 ? 410 GLU A OE1  5  
ATOM 10615 O OE2  . GLU A 1 18  ? -11.290 10.368  -7.022  1.00 0.00 ? 410 GLU A OE2  5  
ATOM 10616 H H    . GLU A 1 18  ? -12.119 6.728   -9.184  1.00 0.00 ? 410 GLU A H    5  
ATOM 10617 H HA   . GLU A 1 18  ? -12.750 8.344   -6.889  1.00 0.00 ? 410 GLU A HA   5  
ATOM 10618 H HB2  . GLU A 1 18  ? -13.650 8.382   -9.755  1.00 0.00 ? 410 GLU A HB2  5  
ATOM 10619 H HB3  . GLU A 1 18  ? -14.365 9.424   -8.535  1.00 0.00 ? 410 GLU A HB3  5  
ATOM 10620 H HG2  . GLU A 1 18  ? -11.470 9.375   -9.316  1.00 0.00 ? 410 GLU A HG2  5  
ATOM 10621 H HG3  . GLU A 1 18  ? -12.672 10.540  -9.874  1.00 0.00 ? 410 GLU A HG3  5  
ATOM 10622 N N    . LYS A 1 19  ? -15.095 7.720   -6.363  1.00 0.00 ? 411 LYS A N    5  
ATOM 10623 C CA   . LYS A 1 19  ? -16.436 7.371   -5.884  1.00 0.00 ? 411 LYS A CA   5  
ATOM 10624 C C    . LYS A 1 19  ? -16.694 5.862   -5.785  1.00 0.00 ? 411 LYS A C    5  
ATOM 10625 O O    . LYS A 1 19  ? -17.249 5.257   -6.718  1.00 0.00 ? 411 LYS A O    5  
ATOM 10626 C CB   . LYS A 1 19  ? -17.521 8.048   -6.748  1.00 0.00 ? 411 LYS A CB   5  
ATOM 10627 C CG   . LYS A 1 19  ? -17.288 9.542   -7.000  1.00 0.00 ? 411 LYS A CG   5  
ATOM 10628 C CD   . LYS A 1 19  ? -17.180 10.341  -5.708  1.00 0.00 ? 411 LYS A CD   5  
ATOM 10629 C CE   . LYS A 1 19  ? -16.847 11.805  -5.989  1.00 0.00 ? 411 LYS A CE   5  
ATOM 10630 N NZ   . LYS A 1 19  ? -17.905 12.483  -6.770  1.00 0.00 ? 411 LYS A NZ   5  
ATOM 10631 H H    . LYS A 1 19  ? -14.611 8.420   -5.874  1.00 0.00 ? 411 LYS A H    5  
ATOM 10632 H HA   . LYS A 1 19  ? -16.521 7.773   -4.885  1.00 0.00 ? 411 LYS A HA   5  
ATOM 10633 H HB2  . LYS A 1 19  ? -17.555 7.549   -7.704  1.00 0.00 ? 411 LYS A HB2  5  
ATOM 10634 H HB3  . LYS A 1 19  ? -18.475 7.930   -6.258  1.00 0.00 ? 411 LYS A HB3  5  
ATOM 10635 H HG2  . LYS A 1 19  ? -16.371 9.662   -7.557  1.00 0.00 ? 411 LYS A HG2  5  
ATOM 10636 H HG3  . LYS A 1 19  ? -18.111 9.925   -7.582  1.00 0.00 ? 411 LYS A HG3  5  
ATOM 10637 H HD2  . LYS A 1 19  ? -18.123 10.288  -5.183  1.00 0.00 ? 411 LYS A HD2  5  
ATOM 10638 H HD3  . LYS A 1 19  ? -16.400 9.915   -5.096  1.00 0.00 ? 411 LYS A HD3  5  
ATOM 10639 H HE2  . LYS A 1 19  ? -16.711 12.324  -5.053  1.00 0.00 ? 411 LYS A HE2  5  
ATOM 10640 H HE3  . LYS A 1 19  ? -15.924 11.841  -6.547  1.00 0.00 ? 411 LYS A HE3  5  
ATOM 10641 H HZ1  . LYS A 1 19  ? -18.827 12.446  -6.291  1.00 0.00 ? 411 LYS A HZ1  5  
ATOM 10642 H HZ2  . LYS A 1 19  ? -17.671 13.483  -6.928  1.00 0.00 ? 411 LYS A HZ2  5  
ATOM 10643 H HZ3  . LYS A 1 19  ? -18.016 12.050  -7.709  1.00 0.00 ? 411 LYS A HZ3  5  
ATOM 10644 N N    . PRO A 1 20  ? -16.253 5.220   -4.683  1.00 0.00 ? 412 PRO A N    5  
ATOM 10645 C CA   . PRO A 1 20  ? -16.515 3.796   -4.449  1.00 0.00 ? 412 PRO A CA   5  
ATOM 10646 C C    . PRO A 1 20  ? -18.022 3.523   -4.439  1.00 0.00 ? 412 PRO A C    5  
ATOM 10647 O O    . PRO A 1 20  ? -18.512 2.573   -5.070  1.00 0.00 ? 412 PRO A O    5  
ATOM 10648 C CB   . PRO A 1 20  ? -15.913 3.547   -3.058  1.00 0.00 ? 412 PRO A CB   5  
ATOM 10649 C CG   . PRO A 1 20  ? -14.882 4.613   -2.898  1.00 0.00 ? 412 PRO A CG   5  
ATOM 10650 C CD   . PRO A 1 20  ? -15.430 5.816   -3.608  1.00 0.00 ? 412 PRO A CD   5  
ATOM 10651 H HA   . PRO A 1 20  ? -16.034 3.174   -5.189  1.00 0.00 ? 412 PRO A HA   5  
ATOM 10652 H HB2  . PRO A 1 20  ? -16.688 3.632   -2.310  1.00 0.00 ? 412 PRO A HB2  5  
ATOM 10653 H HB3  . PRO A 1 20  ? -15.471 2.562   -3.018  1.00 0.00 ? 412 PRO A HB3  5  
ATOM 10654 H HG2  . PRO A 1 20  ? -14.735 4.830   -1.850  1.00 0.00 ? 412 PRO A HG2  5  
ATOM 10655 H HG3  . PRO A 1 20  ? -13.955 4.300   -3.354  1.00 0.00 ? 412 PRO A HG3  5  
ATOM 10656 H HD2  . PRO A 1 20  ? -16.033 6.409   -2.937  1.00 0.00 ? 412 PRO A HD2  5  
ATOM 10657 H HD3  . PRO A 1 20  ? -14.631 6.412   -4.024  1.00 0.00 ? 412 PRO A HD3  5  
ATOM 10658 N N    . LYS A 1 21  ? -18.752 4.365   -3.737  1.00 0.00 ? 413 LYS A N    5  
ATOM 10659 C CA   . LYS A 1 21  ? -20.190 4.272   -3.686  1.00 0.00 ? 413 LYS A CA   5  
ATOM 10660 C C    . LYS A 1 21  ? -20.819 5.672   -3.803  1.00 0.00 ? 413 LYS A C    5  
ATOM 10661 O O    . LYS A 1 21  ? -20.800 6.467   -2.846  1.00 0.00 ? 413 LYS A O    5  
ATOM 10662 C CB   . LYS A 1 21  ? -20.673 3.519   -2.418  1.00 0.00 ? 413 LYS A CB   5  
ATOM 10663 C CG   . LYS A 1 21  ? -20.195 4.096   -1.091  1.00 0.00 ? 413 LYS A CG   5  
ATOM 10664 C CD   . LYS A 1 21  ? -20.824 3.370   0.078   1.00 0.00 ? 413 LYS A CD   5  
ATOM 10665 C CE   . LYS A 1 21  ? -20.404 3.977   1.402   1.00 0.00 ? 413 LYS A CE   5  
ATOM 10666 N NZ   . LYS A 1 21  ? -18.950 3.844   1.660   1.00 0.00 ? 413 LYS A NZ   5  
ATOM 10667 H H    . LYS A 1 21  ? -18.304 5.086   -3.243  1.00 0.00 ? 413 LYS A H    5  
ATOM 10668 H HA   . LYS A 1 21  ? -20.484 3.708   -4.559  1.00 0.00 ? 413 LYS A HA   5  
ATOM 10669 H HB2  . LYS A 1 21  ? -21.751 3.523   -2.407  1.00 0.00 ? 413 LYS A HB2  5  
ATOM 10670 H HB3  . LYS A 1 21  ? -20.336 2.495   -2.480  1.00 0.00 ? 413 LYS A HB3  5  
ATOM 10671 H HG2  . LYS A 1 21  ? -19.121 4.000   -1.032  1.00 0.00 ? 413 LYS A HG2  5  
ATOM 10672 H HG3  . LYS A 1 21  ? -20.467 5.141   -1.047  1.00 0.00 ? 413 LYS A HG3  5  
ATOM 10673 H HD2  . LYS A 1 21  ? -21.898 3.435   -0.008  1.00 0.00 ? 413 LYS A HD2  5  
ATOM 10674 H HD3  . LYS A 1 21  ? -20.523 2.333   0.053   1.00 0.00 ? 413 LYS A HD3  5  
ATOM 10675 H HE2  . LYS A 1 21  ? -20.656 5.027   1.398   1.00 0.00 ? 413 LYS A HE2  5  
ATOM 10676 H HE3  . LYS A 1 21  ? -20.949 3.485   2.193   1.00 0.00 ? 413 LYS A HE3  5  
ATOM 10677 H HZ1  . LYS A 1 21  ? -18.367 4.280   0.921   1.00 0.00 ? 413 LYS A HZ1  5  
ATOM 10678 H HZ2  . LYS A 1 21  ? -18.724 4.331   2.553   1.00 0.00 ? 413 LYS A HZ2  5  
ATOM 10679 H HZ3  . LYS A 1 21  ? -18.678 2.845   1.771   1.00 0.00 ? 413 LYS A HZ3  5  
ATOM 10680 N N    . PRO A 1 22  ? -21.302 6.035   -4.992  1.00 0.00 ? 414 PRO A N    5  
ATOM 10681 C CA   . PRO A 1 22  ? -21.930 7.326   -5.210  1.00 0.00 ? 414 PRO A CA   5  
ATOM 10682 C C    . PRO A 1 22  ? -23.338 7.372   -4.615  1.00 0.00 ? 414 PRO A C    5  
ATOM 10683 O O    . PRO A 1 22  ? -24.037 6.346   -4.550  1.00 0.00 ? 414 PRO A O    5  
ATOM 10684 C CB   . PRO A 1 22  ? -22.002 7.458   -6.746  1.00 0.00 ? 414 PRO A CB   5  
ATOM 10685 C CG   . PRO A 1 22  ? -21.241 6.289   -7.293  1.00 0.00 ? 414 PRO A CG   5  
ATOM 10686 C CD   . PRO A 1 22  ? -21.263 5.237   -6.228  1.00 0.00 ? 414 PRO A CD   5  
ATOM 10687 H HA   . PRO A 1 22  ? -21.339 8.131   -4.799  1.00 0.00 ? 414 PRO A HA   5  
ATOM 10688 H HB2  . PRO A 1 22  ? -23.036 7.434   -7.056  1.00 0.00 ? 414 PRO A HB2  5  
ATOM 10689 H HB3  . PRO A 1 22  ? -21.555 8.393   -7.051  1.00 0.00 ? 414 PRO A HB3  5  
ATOM 10690 H HG2  . PRO A 1 22  ? -21.720 5.924   -8.189  1.00 0.00 ? 414 PRO A HG2  5  
ATOM 10691 H HG3  . PRO A 1 22  ? -20.225 6.585   -7.508  1.00 0.00 ? 414 PRO A HG3  5  
ATOM 10692 H HD2  . PRO A 1 22  ? -22.139 4.613   -6.325  1.00 0.00 ? 414 PRO A HD2  5  
ATOM 10693 H HD3  . PRO A 1 22  ? -20.360 4.649   -6.283  1.00 0.00 ? 414 PRO A HD3  5  
ATOM 10694 N N    . ALA A 1 23  ? -23.741 8.536   -4.165  1.00 0.00 ? 415 ALA A N    5  
ATOM 10695 C CA   . ALA A 1 23  ? -25.078 8.734   -3.640  1.00 0.00 ? 415 ALA A CA   5  
ATOM 10696 C C    . ALA A 1 23  ? -26.054 8.888   -4.803  1.00 0.00 ? 415 ALA A C    5  
ATOM 10697 O O    . ALA A 1 23  ? -27.263 8.699   -4.661  1.00 0.00 ? 415 ALA A O    5  
ATOM 10698 C CB   . ALA A 1 23  ? -25.110 9.955   -2.731  1.00 0.00 ? 415 ALA A CB   5  
ATOM 10699 H H    . ALA A 1 23  ? -23.116 9.293   -4.168  1.00 0.00 ? 415 ALA A H    5  
ATOM 10700 H HA   . ALA A 1 23  ? -25.347 7.856   -3.069  1.00 0.00 ? 415 ALA A HA   5  
ATOM 10701 H HB1  . ALA A 1 23  ? -24.829 10.834  -3.291  1.00 0.00 ? 415 ALA A HB1  5  
ATOM 10702 H HB2  . ALA A 1 23  ? -24.414 9.811   -1.917  1.00 0.00 ? 415 ALA A HB2  5  
ATOM 10703 H HB3  . ALA A 1 23  ? -26.105 10.085  -2.334  1.00 0.00 ? 415 ALA A HB3  5  
ATOM 10704 N N    . SER A 1 24  ? -25.507 9.218   -5.948  1.00 0.00 ? 416 SER A N    5  
ATOM 10705 C CA   . SER A 1 24  ? -26.254 9.358   -7.161  1.00 0.00 ? 416 SER A CA   5  
ATOM 10706 C C    . SER A 1 24  ? -26.355 7.989   -7.853  1.00 0.00 ? 416 SER A C    5  
ATOM 10707 O O    . SER A 1 24  ? -25.611 7.066   -7.516  1.00 0.00 ? 416 SER A O    5  
ATOM 10708 C CB   . SER A 1 24  ? -25.538 10.375  -8.043  1.00 0.00 ? 416 SER A CB   5  
ATOM 10709 O OG   . SER A 1 24  ? -25.323 11.577  -7.311  1.00 0.00 ? 416 SER A OG   5  
ATOM 10710 H H    . SER A 1 24  ? -24.541 9.379   -5.979  1.00 0.00 ? 416 SER A H    5  
ATOM 10711 H HA   . SER A 1 24  ? -27.242 9.723   -6.922  1.00 0.00 ? 416 SER A HA   5  
ATOM 10712 H HB2  . SER A 1 24  ? -24.584 9.973   -8.350  1.00 0.00 ? 416 SER A HB2  5  
ATOM 10713 H HB3  . SER A 1 24  ? -26.134 10.598  -8.916  1.00 0.00 ? 416 SER A HB3  5  
ATOM 10714 H HG   . SER A 1 24  ? -24.401 11.593  -7.028  1.00 0.00 ? 416 SER A HG   5  
ATOM 10715 N N    . VAL A 1 25  ? -27.263 7.855   -8.800  1.00 0.00 ? 417 VAL A N    5  
ATOM 10716 C CA   . VAL A 1 25  ? -27.449 6.593   -9.525  1.00 0.00 ? 417 VAL A CA   5  
ATOM 10717 C C    . VAL A 1 25  ? -26.366 6.426   -10.585 1.00 0.00 ? 417 VAL A C    5  
ATOM 10718 O O    . VAL A 1 25  ? -26.168 5.339   -11.145 1.00 0.00 ? 417 VAL A O    5  
ATOM 10719 C CB   . VAL A 1 25  ? -28.858 6.504   -10.190 1.00 0.00 ? 417 VAL A CB   5  
ATOM 10720 C CG1  . VAL A 1 25  ? -29.949 6.617   -9.143  1.00 0.00 ? 417 VAL A CG1  5  
ATOM 10721 C CG2  . VAL A 1 25  ? -29.046 7.572   -11.272 1.00 0.00 ? 417 VAL A CG2  5  
ATOM 10722 H H    . VAL A 1 25  ? -27.845 8.616   -9.015  1.00 0.00 ? 417 VAL A H    5  
ATOM 10723 H HA   . VAL A 1 25  ? -27.350 5.790   -8.809  1.00 0.00 ? 417 VAL A HA   5  
ATOM 10724 H HB   . VAL A 1 25  ? -28.947 5.530   -10.649 1.00 0.00 ? 417 VAL A HB   5  
ATOM 10725 H HG11 . VAL A 1 25  ? -29.837 5.823   -8.420  1.00 0.00 ? 417 VAL A HG11 5  
ATOM 10726 H HG12 . VAL A 1 25  ? -29.870 7.571   -8.642  1.00 0.00 ? 417 VAL A HG12 5  
ATOM 10727 H HG13 . VAL A 1 25  ? -30.916 6.541   -9.618  1.00 0.00 ? 417 VAL A HG13 5  
ATOM 10728 H HG21 . VAL A 1 25  ? -28.294 7.442   -12.037 1.00 0.00 ? 417 VAL A HG21 5  
ATOM 10729 H HG22 . VAL A 1 25  ? -30.028 7.473   -11.711 1.00 0.00 ? 417 VAL A HG22 5  
ATOM 10730 H HG23 . VAL A 1 25  ? -28.946 8.553   -10.834 1.00 0.00 ? 417 VAL A HG23 5  
ATOM 10731 N N    . ASP A 1 26  ? -25.676 7.504   -10.843 1.00 0.00 ? 418 ASP A N    5  
ATOM 10732 C CA   . ASP A 1 26  ? -24.631 7.559   -11.826 1.00 0.00 ? 418 ASP A CA   5  
ATOM 10733 C C    . ASP A 1 26  ? -23.361 8.004   -11.137 1.00 0.00 ? 418 ASP A C    5  
ATOM 10734 O O    . ASP A 1 26  ? -23.399 8.915   -10.300 1.00 0.00 ? 418 ASP A O    5  
ATOM 10735 C CB   . ASP A 1 26  ? -25.021 8.554   -12.918 1.00 0.00 ? 418 ASP A CB   5  
ATOM 10736 C CG   . ASP A 1 26  ? -24.026 8.643   -14.043 1.00 0.00 ? 418 ASP A CG   5  
ATOM 10737 O OD1  . ASP A 1 26  ? -24.151 7.907   -15.020 1.00 0.00 ? 418 ASP A OD1  5  
ATOM 10738 O OD2  . ASP A 1 26  ? -23.137 9.490   -13.999 1.00 0.00 ? 418 ASP A OD2  5  
ATOM 10739 H H    . ASP A 1 26  ? -25.866 8.309   -10.321 1.00 0.00 ? 418 ASP A H    5  
ATOM 10740 H HA   . ASP A 1 26  ? -24.498 6.579   -12.260 1.00 0.00 ? 418 ASP A HA   5  
ATOM 10741 H HB2  . ASP A 1 26  ? -25.971 8.256   -13.334 1.00 0.00 ? 418 ASP A HB2  5  
ATOM 10742 H HB3  . ASP A 1 26  ? -25.126 9.533   -12.474 1.00 0.00 ? 418 ASP A HB3  5  
ATOM 10743 N N    . ALA A 1 27  ? -22.255 7.371   -11.467 1.00 0.00 ? 419 ALA A N    5  
ATOM 10744 C CA   . ALA A 1 27  ? -20.973 7.655   -10.836 1.00 0.00 ? 419 ALA A CA   5  
ATOM 10745 C C    . ALA A 1 27  ? -20.364 8.953   -11.346 1.00 0.00 ? 419 ALA A C    5  
ATOM 10746 O O    . ALA A 1 27  ? -19.471 9.515   -10.707 1.00 0.00 ? 419 ALA A O    5  
ATOM 10747 C CB   . ALA A 1 27  ? -20.010 6.497   -11.045 1.00 0.00 ? 419 ALA A CB   5  
ATOM 10748 H H    . ALA A 1 27  ? -22.303 6.681   -12.162 1.00 0.00 ? 419 ALA A H    5  
ATOM 10749 H HA   . ALA A 1 27  ? -21.150 7.755   -9.775  1.00 0.00 ? 419 ALA A HA   5  
ATOM 10750 H HB1  . ALA A 1 27  ? -20.459 5.583   -10.686 1.00 0.00 ? 419 ALA A HB1  5  
ATOM 10751 H HB2  . ALA A 1 27  ? -19.788 6.399   -12.098 1.00 0.00 ? 419 ALA A HB2  5  
ATOM 10752 H HB3  . ALA A 1 27  ? -19.096 6.687   -10.502 1.00 0.00 ? 419 ALA A HB3  5  
ATOM 10753 N N    . ASN A 1 28  ? -20.865 9.424   -12.485 1.00 0.00 ? 420 ASN A N    5  
ATOM 10754 C CA   . ASN A 1 28  ? -20.436 10.660  -13.159 1.00 0.00 ? 420 ASN A CA   5  
ATOM 10755 C C    . ASN A 1 28  ? -19.004 10.588  -13.674 1.00 0.00 ? 420 ASN A C    5  
ATOM 10756 O O    . ASN A 1 28  ? -18.765 10.517  -14.888 1.00 0.00 ? 420 ASN A O    5  
ATOM 10757 C CB   . ASN A 1 28  ? -20.669 11.905  -12.280 1.00 0.00 ? 420 ASN A CB   5  
ATOM 10758 C CG   . ASN A 1 28  ? -20.249 13.198  -12.946 1.00 0.00 ? 420 ASN A CG   5  
ATOM 10759 O OD1  . ASN A 1 28  ? -19.107 13.648  -12.796 1.00 0.00 ? 420 ASN A OD1  5  
ATOM 10760 N ND2  . ASN A 1 28  ? -21.148 13.802  -13.690 1.00 0.00 ? 420 ASN A ND2  5  
ATOM 10761 H H    . ASN A 1 28  ? -21.597 8.931   -12.919 1.00 0.00 ? 420 ASN A H    5  
ATOM 10762 H HA   . ASN A 1 28  ? -21.067 10.743  -14.031 1.00 0.00 ? 420 ASN A HA   5  
ATOM 10763 H HB2  . ASN A 1 28  ? -21.717 11.978  -12.032 1.00 0.00 ? 420 ASN A HB2  5  
ATOM 10764 H HB3  . ASN A 1 28  ? -20.099 11.790  -11.371 1.00 0.00 ? 420 ASN A HB3  5  
ATOM 10765 H HD21 . ASN A 1 28  ? -22.035 13.386  -13.777 1.00 0.00 ? 420 ASN A HD21 5  
ATOM 10766 H HD22 . ASN A 1 28  ? -20.914 14.640  -14.141 1.00 0.00 ? 420 ASN A HD22 5  
ATOM 10767 N N    . THR A 1 29  ? -18.066 10.567  -12.780 1.00 0.00 ? 421 THR A N    5  
ATOM 10768 C CA   . THR A 1 29  ? -16.689 10.541  -13.126 1.00 0.00 ? 421 THR A CA   5  
ATOM 10769 C C    . THR A 1 29  ? -15.912 9.508   -12.325 1.00 0.00 ? 421 THR A C    5  
ATOM 10770 O O    . THR A 1 29  ? -15.357 9.815   -11.278 1.00 0.00 ? 421 THR A O    5  
ATOM 10771 C CB   . THR A 1 29  ? -16.048 11.942  -12.982 1.00 0.00 ? 421 THR A CB   5  
ATOM 10772 O OG1  . THR A 1 29  ? -16.651 12.651  -11.868 1.00 0.00 ? 421 THR A OG1  5  
ATOM 10773 C CG2  . THR A 1 29  ? -16.194 12.752  -14.265 1.00 0.00 ? 421 THR A CG2  5  
ATOM 10774 H H    . THR A 1 29  ? -18.306 10.545  -11.828 1.00 0.00 ? 421 THR A H    5  
ATOM 10775 H HA   . THR A 1 29  ? -16.630 10.265  -14.169 1.00 0.00 ? 421 THR A HA   5  
ATOM 10776 H HB   . THR A 1 29  ? -15.000 11.807  -12.760 1.00 0.00 ? 421 THR A HB   5  
ATOM 10777 H HG1  . THR A 1 29  ? -17.505 12.988  -12.176 1.00 0.00 ? 421 THR A HG1  5  
ATOM 10778 H HG21 . THR A 1 29  ? -17.242 12.876  -14.495 1.00 0.00 ? 421 THR A HG21 5  
ATOM 10779 H HG22 . THR A 1 29  ? -15.738 13.721  -14.131 1.00 0.00 ? 421 THR A HG22 5  
ATOM 10780 H HG23 . THR A 1 29  ? -15.705 12.236  -15.078 1.00 0.00 ? 421 THR A HG23 5  
ATOM 10781 N N    . LYS A 1 30  ? -15.922 8.267   -12.777 1.00 0.00 ? 422 LYS A N    5  
ATOM 10782 C CA   . LYS A 1 30  ? -15.106 7.263   -12.139 1.00 0.00 ? 422 LYS A CA   5  
ATOM 10783 C C    . LYS A 1 30  ? -13.712 7.287   -12.752 1.00 0.00 ? 422 LYS A C    5  
ATOM 10784 O O    . LYS A 1 30  ? -13.384 6.544   -13.678 1.00 0.00 ? 422 LYS A O    5  
ATOM 10785 C CB   . LYS A 1 30  ? -15.745 5.851   -12.131 1.00 0.00 ? 422 LYS A CB   5  
ATOM 10786 C CG   . LYS A 1 30  ? -16.165 5.306   -13.496 1.00 0.00 ? 422 LYS A CG   5  
ATOM 10787 C CD   . LYS A 1 30  ? -16.646 3.860   -13.409 1.00 0.00 ? 422 LYS A CD   5  
ATOM 10788 C CE   . LYS A 1 30  ? -17.877 3.703   -12.521 1.00 0.00 ? 422 LYS A CE   5  
ATOM 10789 N NZ   . LYS A 1 30  ? -18.368 2.306   -12.495 1.00 0.00 ? 422 LYS A NZ   5  
ATOM 10790 H H    . LYS A 1 30  ? -16.476 8.031   -13.551 1.00 0.00 ? 422 LYS A H    5  
ATOM 10791 H HA   . LYS A 1 30  ? -14.991 7.610   -11.122 1.00 0.00 ? 422 LYS A HA   5  
ATOM 10792 H HB2  . LYS A 1 30  ? -15.039 5.153   -11.704 1.00 0.00 ? 422 LYS A HB2  5  
ATOM 10793 H HB3  . LYS A 1 30  ? -16.618 5.885   -11.497 1.00 0.00 ? 422 LYS A HB3  5  
ATOM 10794 H HG2  . LYS A 1 30  ? -16.974 5.909   -13.879 1.00 0.00 ? 422 LYS A HG2  5  
ATOM 10795 H HG3  . LYS A 1 30  ? -15.324 5.362   -14.171 1.00 0.00 ? 422 LYS A HG3  5  
ATOM 10796 H HD2  . LYS A 1 30  ? -16.886 3.513   -14.403 1.00 0.00 ? 422 LYS A HD2  5  
ATOM 10797 H HD3  . LYS A 1 30  ? -15.845 3.257   -13.009 1.00 0.00 ? 422 LYS A HD3  5  
ATOM 10798 H HE2  . LYS A 1 30  ? -17.626 4.000   -11.515 1.00 0.00 ? 422 LYS A HE2  5  
ATOM 10799 H HE3  . LYS A 1 30  ? -18.661 4.345   -12.895 1.00 0.00 ? 422 LYS A HE3  5  
ATOM 10800 H HZ1  . LYS A 1 30  ? -17.634 1.654   -12.153 1.00 0.00 ? 422 LYS A HZ1  5  
ATOM 10801 H HZ2  . LYS A 1 30  ? -19.205 2.219   -11.883 1.00 0.00 ? 422 LYS A HZ2  5  
ATOM 10802 H HZ3  . LYS A 1 30  ? -18.649 2.006   -13.449 1.00 0.00 ? 422 LYS A HZ3  5  
ATOM 10803 N N    . LEU A 1 31  ? -12.950 8.231   -12.296 1.00 0.00 ? 423 LEU A N    5  
ATOM 10804 C CA   . LEU A 1 31  ? -11.618 8.463   -12.778 1.00 0.00 ? 423 LEU A CA   5  
ATOM 10805 C C    . LEU A 1 31  ? -10.636 7.731   -11.911 1.00 0.00 ? 423 LEU A C    5  
ATOM 10806 O O    . LEU A 1 31  ? -10.916 7.456   -10.741 1.00 0.00 ? 423 LEU A O    5  
ATOM 10807 C CB   . LEU A 1 31  ? -11.301 9.964   -12.757 1.00 0.00 ? 423 LEU A CB   5  
ATOM 10808 C CG   . LEU A 1 31  ? -12.246 10.866  -13.554 1.00 0.00 ? 423 LEU A CG   5  
ATOM 10809 C CD1  . LEU A 1 31  ? -11.848 12.323  -13.405 1.00 0.00 ? 423 LEU A CD1  5  
ATOM 10810 C CD2  . LEU A 1 31  ? -12.263 10.466  -15.021 1.00 0.00 ? 423 LEU A CD2  5  
ATOM 10811 H H    . LEU A 1 31  ? -13.306 8.803   -11.583 1.00 0.00 ? 423 LEU A H    5  
ATOM 10812 H HA   . LEU A 1 31  ? -11.546 8.107   -13.795 1.00 0.00 ? 423 LEU A HA   5  
ATOM 10813 H HB2  . LEU A 1 31  ? -11.310 10.295  -11.730 1.00 0.00 ? 423 LEU A HB2  5  
ATOM 10814 H HB3  . LEU A 1 31  ? -10.302 10.100  -13.147 1.00 0.00 ? 423 LEU A HB3  5  
ATOM 10815 H HG   . LEU A 1 31  ? -13.245 10.751  -13.162 1.00 0.00 ? 423 LEU A HG   5  
ATOM 10816 H HD11 . LEU A 1 31  ? -10.841 12.459  -13.770 1.00 0.00 ? 423 LEU A HD11 5  
ATOM 10817 H HD12 . LEU A 1 31  ? -12.522 12.943  -13.978 1.00 0.00 ? 423 LEU A HD12 5  
ATOM 10818 H HD13 . LEU A 1 31  ? -11.893 12.609  -12.365 1.00 0.00 ? 423 LEU A HD13 5  
ATOM 10819 H HD21 . LEU A 1 31  ? -11.265 10.533  -15.427 1.00 0.00 ? 423 LEU A HD21 5  
ATOM 10820 H HD22 . LEU A 1 31  ? -12.626 9.454   -15.116 1.00 0.00 ? 423 LEU A HD22 5  
ATOM 10821 H HD23 . LEU A 1 31  ? -12.919 11.132  -15.562 1.00 0.00 ? 423 LEU A HD23 5  
ATOM 10822 N N    . THR A 1 32  ? -9.532  7.382   -12.468 1.00 0.00 ? 424 THR A N    5  
ATOM 10823 C CA   . THR A 1 32  ? -8.510  6.758   -11.718 1.00 0.00 ? 424 THR A CA   5  
ATOM 10824 C C    . THR A 1 32  ? -7.599  7.837   -11.146 1.00 0.00 ? 424 THR A C    5  
ATOM 10825 O O    . THR A 1 32  ? -7.198  8.787   -11.849 1.00 0.00 ? 424 THR A O    5  
ATOM 10826 C CB   . THR A 1 32  ? -7.684  5.836   -12.606 1.00 0.00 ? 424 THR A CB   5  
ATOM 10827 O OG1  . THR A 1 32  ? -8.573  5.040   -13.422 1.00 0.00 ? 424 THR A OG1  5  
ATOM 10828 C CG2  . THR A 1 32  ? -6.834  4.903   -11.761 1.00 0.00 ? 424 THR A CG2  5  
ATOM 10829 H H    . THR A 1 32  ? -9.373  7.529   -13.422 1.00 0.00 ? 424 THR A H    5  
ATOM 10830 H HA   . THR A 1 32  ? -8.955  6.181   -10.921 1.00 0.00 ? 424 THR A HA   5  
ATOM 10831 H HB   . THR A 1 32  ? -7.036  6.481   -13.179 1.00 0.00 ? 424 THR A HB   5  
ATOM 10832 H HG1  . THR A 1 32  ? -8.634  4.176   -12.998 1.00 0.00 ? 424 THR A HG1  5  
ATOM 10833 H HG21 . THR A 1 32  ? -6.182  5.487   -11.130 1.00 0.00 ? 424 THR A HG21 5  
ATOM 10834 H HG22 . THR A 1 32  ? -7.473  4.287   -11.144 1.00 0.00 ? 424 THR A HG22 5  
ATOM 10835 H HG23 . THR A 1 32  ? -6.239  4.272   -12.405 1.00 0.00 ? 424 THR A HG23 5  
ATOM 10836 N N    . ARG A 1 33  ? -7.324  7.732   -9.894  1.00 0.00 ? 425 ARG A N    5  
ATOM 10837 C CA   . ARG A 1 33  ? -6.402  8.600   -9.248  1.00 0.00 ? 425 ARG A CA   5  
ATOM 10838 C C    . ARG A 1 33  ? -5.141  7.832   -9.143  1.00 0.00 ? 425 ARG A C    5  
ATOM 10839 O O    . ARG A 1 33  ? -5.183  6.629   -9.006  1.00 0.00 ? 425 ARG A O    5  
ATOM 10840 C CB   . ARG A 1 33  ? -6.904  8.946   -7.856  1.00 0.00 ? 425 ARG A CB   5  
ATOM 10841 C CG   . ARG A 1 33  ? -8.214  9.679   -7.864  1.00 0.00 ? 425 ARG A CG   5  
ATOM 10842 C CD   . ARG A 1 33  ? -8.065  11.091  -8.396  1.00 0.00 ? 425 ARG A CD   5  
ATOM 10843 N NE   . ARG A 1 33  ? -9.331  11.798  -8.370  1.00 0.00 ? 425 ARG A NE   5  
ATOM 10844 C CZ   . ARG A 1 33  ? -9.617  12.921  -9.037  1.00 0.00 ? 425 ARG A CZ   5  
ATOM 10845 N NH1  . ARG A 1 33  ? -8.695  13.525  -9.771  1.00 0.00 ? 425 ARG A NH1  5  
ATOM 10846 N NH2  . ARG A 1 33  ? -10.837 13.429  -8.980  1.00 0.00 ? 425 ARG A NH2  5  
ATOM 10847 H H    . ARG A 1 33  ? -7.725  6.992   -9.382  1.00 0.00 ? 425 ARG A H    5  
ATOM 10848 H HA   . ARG A 1 33  ? -6.266  9.497   -9.832  1.00 0.00 ? 425 ARG A HA   5  
ATOM 10849 H HB2  . ARG A 1 33  ? -7.028  8.030   -7.297  1.00 0.00 ? 425 ARG A HB2  5  
ATOM 10850 H HB3  . ARG A 1 33  ? -6.168  9.563   -7.360  1.00 0.00 ? 425 ARG A HB3  5  
ATOM 10851 H HG2  . ARG A 1 33  ? -8.841  9.133   -8.558  1.00 0.00 ? 425 ARG A HG2  5  
ATOM 10852 H HG3  . ARG A 1 33  ? -8.651  9.690   -6.877  1.00 0.00 ? 425 ARG A HG3  5  
ATOM 10853 H HD2  . ARG A 1 33  ? -7.350  11.628  -7.790  1.00 0.00 ? 425 ARG A HD2  5  
ATOM 10854 H HD3  . ARG A 1 33  ? -7.715  11.041  -9.415  1.00 0.00 ? 425 ARG A HD3  5  
ATOM 10855 H HE   . ARG A 1 33  ? -10.016 11.352  -7.806  1.00 0.00 ? 425 ARG A HE   5  
ATOM 10856 H HH11 . ARG A 1 33  ? -7.762  13.175  -9.858  1.00 0.00 ? 425 ARG A HH11 5  
ATOM 10857 H HH12 . ARG A 1 33  ? -8.901  14.370  -10.276 1.00 0.00 ? 425 ARG A HH12 5  
ATOM 10858 H HH21 . ARG A 1 33  ? -11.567 12.978  -8.443  1.00 0.00 ? 425 ARG A HH21 5  
ATOM 10859 H HH22 . ARG A 1 33  ? -11.074 14.272  -9.468  1.00 0.00 ? 425 ARG A HH22 5  
ATOM 10860 N N    . SER A 1 34  ? -4.056  8.461   -9.251  1.00 0.00 ? 426 SER A N    5  
ATOM 10861 C CA   . SER A 1 34  ? -2.828  7.775   -9.141  1.00 0.00 ? 426 SER A CA   5  
ATOM 10862 C C    . SER A 1 34  ? -1.831  8.657   -8.459  1.00 0.00 ? 426 SER A C    5  
ATOM 10863 O O    . SER A 1 34  ? -2.015  9.879   -8.400  1.00 0.00 ? 426 SER A O    5  
ATOM 10864 C CB   . SER A 1 34  ? -2.342  7.334   -10.522 1.00 0.00 ? 426 SER A CB   5  
ATOM 10865 O OG   . SER A 1 34  ? -2.243  8.439   -11.426 1.00 0.00 ? 426 SER A OG   5  
ATOM 10866 H H    . SER A 1 34  ? -4.024  9.432   -9.398  1.00 0.00 ? 426 SER A H    5  
ATOM 10867 H HA   . SER A 1 34  ? -3.013  6.898   -8.525  1.00 0.00 ? 426 SER A HA   5  
ATOM 10868 H HB2  . SER A 1 34  ? -1.371  6.869   -10.434 1.00 0.00 ? 426 SER A HB2  5  
ATOM 10869 H HB3  . SER A 1 34  ? -3.050  6.627   -10.928 1.00 0.00 ? 426 SER A HB3  5  
ATOM 10870 H HG   . SER A 1 34  ? -2.563  8.102   -12.271 1.00 0.00 ? 426 SER A HG   5  
ATOM 10871 N N    . LEU A 1 35  ? -0.819  8.072   -7.928  1.00 0.00 ? 427 LEU A N    5  
ATOM 10872 C CA   . LEU A 1 35  ? 0.209   8.818   -7.312  1.00 0.00 ? 427 LEU A CA   5  
ATOM 10873 C C    . LEU A 1 35  ? 1.532   8.092   -7.529  1.00 0.00 ? 427 LEU A C    5  
ATOM 10874 O O    . LEU A 1 35  ? 1.662   6.919   -7.152  1.00 0.00 ? 427 LEU A O    5  
ATOM 10875 C CB   . LEU A 1 35  ? -0.130  8.994   -5.829  1.00 0.00 ? 427 LEU A CB   5  
ATOM 10876 C CG   . LEU A 1 35  ? 0.730   9.955   -5.019  1.00 0.00 ? 427 LEU A CG   5  
ATOM 10877 C CD1  . LEU A 1 35  ? 0.786   11.334  -5.673  1.00 0.00 ? 427 LEU A CD1  5  
ATOM 10878 C CD2  . LEU A 1 35  ? 0.156   10.071  -3.627  1.00 0.00 ? 427 LEU A CD2  5  
ATOM 10879 H H    . LEU A 1 35  ? -0.767  7.088   -7.940  1.00 0.00 ? 427 LEU A H    5  
ATOM 10880 H HA   . LEU A 1 35  ? 0.239   9.787   -7.785  1.00 0.00 ? 427 LEU A HA   5  
ATOM 10881 H HB2  . LEU A 1 35  ? -1.153  9.330   -5.760  1.00 0.00 ? 427 LEU A HB2  5  
ATOM 10882 H HB3  . LEU A 1 35  ? -0.069  8.021   -5.364  1.00 0.00 ? 427 LEU A HB3  5  
ATOM 10883 H HG   . LEU A 1 35  ? 1.735   9.571   -4.936  1.00 0.00 ? 427 LEU A HG   5  
ATOM 10884 H HD11 . LEU A 1 35  ? -0.216  11.720  -5.782  1.00 0.00 ? 427 LEU A HD11 5  
ATOM 10885 H HD12 . LEU A 1 35  ? 1.367   12.004  -5.056  1.00 0.00 ? 427 LEU A HD12 5  
ATOM 10886 H HD13 . LEU A 1 35  ? 1.244   11.255  -6.647  1.00 0.00 ? 427 LEU A HD13 5  
ATOM 10887 H HD21 . LEU A 1 35  ? 0.144   9.096   -3.160  1.00 0.00 ? 427 LEU A HD21 5  
ATOM 10888 H HD22 . LEU A 1 35  ? 0.778   10.735  -3.046  1.00 0.00 ? 427 LEU A HD22 5  
ATOM 10889 H HD23 . LEU A 1 35  ? -0.849  10.461  -3.674  1.00 0.00 ? 427 LEU A HD23 5  
ATOM 10890 N N    . PRO A 1 36  ? 2.487   8.725   -8.240  1.00 0.00 ? 428 PRO A N    5  
ATOM 10891 C CA   . PRO A 1 36  ? 3.814   8.151   -8.464  1.00 0.00 ? 428 PRO A CA   5  
ATOM 10892 C C    . PRO A 1 36  ? 4.612   8.123   -7.170  1.00 0.00 ? 428 PRO A C    5  
ATOM 10893 O O    . PRO A 1 36  ? 4.678   9.122   -6.432  1.00 0.00 ? 428 PRO A O    5  
ATOM 10894 C CB   . PRO A 1 36  ? 4.469   9.102   -9.479  1.00 0.00 ? 428 PRO A CB   5  
ATOM 10895 C CG   . PRO A 1 36  ? 3.355   9.941   -10.006 1.00 0.00 ? 428 PRO A CG   5  
ATOM 10896 C CD   . PRO A 1 36  ? 2.350   10.030  -8.904  1.00 0.00 ? 428 PRO A CD   5  
ATOM 10897 H HA   . PRO A 1 36  ? 3.751   7.152   -8.869  1.00 0.00 ? 428 PRO A HA   5  
ATOM 10898 H HB2  . PRO A 1 36  ? 5.212   9.698   -8.972  1.00 0.00 ? 428 PRO A HB2  5  
ATOM 10899 H HB3  . PRO A 1 36  ? 4.938   8.527   -10.263 1.00 0.00 ? 428 PRO A HB3  5  
ATOM 10900 H HG2  . PRO A 1 36  ? 3.723   10.925  -10.262 1.00 0.00 ? 428 PRO A HG2  5  
ATOM 10901 H HG3  . PRO A 1 36  ? 2.917   9.466   -10.871 1.00 0.00 ? 428 PRO A HG3  5  
ATOM 10902 H HD2  . PRO A 1 36  ? 2.598   10.841  -8.234  1.00 0.00 ? 428 PRO A HD2  5  
ATOM 10903 H HD3  . PRO A 1 36  ? 1.364   10.155  -9.327  1.00 0.00 ? 428 PRO A HD3  5  
ATOM 10904 N N    . CYS A 1 37  ? 5.204   7.002   -6.895  1.00 0.00 ? 429 CYS A N    5  
ATOM 10905 C CA   . CYS A 1 37  ? 5.908   6.806   -5.668  1.00 0.00 ? 429 CYS A CA   5  
ATOM 10906 C C    . CYS A 1 37  ? 7.318   6.352   -5.949  1.00 0.00 ? 429 CYS A C    5  
ATOM 10907 O O    . CYS A 1 37  ? 7.614   5.815   -7.036  1.00 0.00 ? 429 CYS A O    5  
ATOM 10908 C CB   . CYS A 1 37  ? 5.226   5.700   -4.876  1.00 0.00 ? 429 CYS A CB   5  
ATOM 10909 S SG   . CYS A 1 37  ? 3.539   5.322   -5.408  1.00 0.00 ? 429 CYS A SG   5  
ATOM 10910 H H    . CYS A 1 37  ? 5.189   6.254   -7.535  1.00 0.00 ? 429 CYS A H    5  
ATOM 10911 H HA   . CYS A 1 37  ? 5.893   7.709   -5.079  1.00 0.00 ? 429 CYS A HA   5  
ATOM 10912 H HB2  . CYS A 1 37  ? 5.815   4.801   -4.958  1.00 0.00 ? 429 CYS A HB2  5  
ATOM 10913 H HB3  . CYS A 1 37  ? 5.184   5.996   -3.838  1.00 0.00 ? 429 CYS A HB3  5  
ATOM 10914 H HG   . CYS A 1 37  ? 3.029   6.348   -6.079  1.00 0.00 ? 429 CYS A HG   5  
ATOM 10915 N N    . GLN A 1 38  ? 8.168   6.567   -5.002  1.00 0.00 ? 430 GLN A N    5  
ATOM 10916 C CA   . GLN A 1 38  ? 9.491   6.037   -5.017  1.00 0.00 ? 430 GLN A CA   5  
ATOM 10917 C C    . GLN A 1 38  ? 9.551   5.122   -3.828  1.00 0.00 ? 430 GLN A C    5  
ATOM 10918 O O    . GLN A 1 38  ? 9.153   5.528   -2.711  1.00 0.00 ? 430 GLN A O    5  
ATOM 10919 C CB   . GLN A 1 38  ? 10.512  7.155   -4.850  1.00 0.00 ? 430 GLN A CB   5  
ATOM 10920 C CG   . GLN A 1 38  ? 10.429  8.229   -5.919  1.00 0.00 ? 430 GLN A CG   5  
ATOM 10921 C CD   . GLN A 1 38  ? 11.353  9.397   -5.648  1.00 0.00 ? 430 GLN A CD   5  
ATOM 10922 O OE1  . GLN A 1 38  ? 11.059  10.534  -6.022  1.00 0.00 ? 430 GLN A OE1  5  
ATOM 10923 N NE2  . GLN A 1 38  ? 12.465  9.144   -5.019  1.00 0.00 ? 430 GLN A NE2  5  
ATOM 10924 H H    . GLN A 1 38  ? 7.914   7.117   -4.226  1.00 0.00 ? 430 GLN A H    5  
ATOM 10925 H HA   . GLN A 1 38  ? 9.660   5.492   -5.933  1.00 0.00 ? 430 GLN A HA   5  
ATOM 10926 H HB2  . GLN A 1 38  ? 10.364  7.621   -3.887  1.00 0.00 ? 430 GLN A HB2  5  
ATOM 10927 H HB3  . GLN A 1 38  ? 11.501  6.723   -4.882  1.00 0.00 ? 430 GLN A HB3  5  
ATOM 10928 H HG2  . GLN A 1 38  ? 10.693  7.798   -6.873  1.00 0.00 ? 430 GLN A HG2  5  
ATOM 10929 H HG3  . GLN A 1 38  ? 9.414   8.594   -5.962  1.00 0.00 ? 430 GLN A HG3  5  
ATOM 10930 H HE21 . GLN A 1 38  ? 12.677  8.226   -4.747  1.00 0.00 ? 430 GLN A HE21 5  
ATOM 10931 H HE22 . GLN A 1 38  ? 13.072  9.886   -4.817  1.00 0.00 ? 430 GLN A HE22 5  
ATOM 10932 N N    . VAL A 1 39  ? 9.988   3.909   -4.040  1.00 0.00 ? 431 VAL A N    5  
ATOM 10933 C CA   . VAL A 1 39  ? 10.010  2.936   -2.991  1.00 0.00 ? 431 VAL A CA   5  
ATOM 10934 C C    . VAL A 1 39  ? 11.419  2.454   -2.757  1.00 0.00 ? 431 VAL A C    5  
ATOM 10935 O O    . VAL A 1 39  ? 12.112  1.929   -3.676  1.00 0.00 ? 431 VAL A O    5  
ATOM 10936 C CB   . VAL A 1 39  ? 9.099   1.718   -3.310  1.00 0.00 ? 431 VAL A CB   5  
ATOM 10937 C CG1  . VAL A 1 39  ? 9.004   0.760   -2.128  1.00 0.00 ? 431 VAL A CG1  5  
ATOM 10938 C CG2  . VAL A 1 39  ? 7.724   2.176   -3.746  1.00 0.00 ? 431 VAL A CG2  5  
ATOM 10939 H H    . VAL A 1 39  ? 10.311  3.619   -4.923  1.00 0.00 ? 431 VAL A H    5  
ATOM 10940 H HA   . VAL A 1 39  ? 9.641   3.408   -2.092  1.00 0.00 ? 431 VAL A HA   5  
ATOM 10941 H HB   . VAL A 1 39  ? 9.542   1.166   -4.126  1.00 0.00 ? 431 VAL A HB   5  
ATOM 10942 H HG11 . VAL A 1 39  ? 9.992   0.403   -1.873  1.00 0.00 ? 431 VAL A HG11 5  
ATOM 10943 H HG12 . VAL A 1 39  ? 8.579   1.278   -1.281  1.00 0.00 ? 431 VAL A HG12 5  
ATOM 10944 H HG13 . VAL A 1 39  ? 8.373   -0.077  -2.387  1.00 0.00 ? 431 VAL A HG13 5  
ATOM 10945 H HG21 . VAL A 1 39  ? 7.289   2.791   -2.973  1.00 0.00 ? 431 VAL A HG21 5  
ATOM 10946 H HG22 . VAL A 1 39  ? 7.808   2.753   -4.656  1.00 0.00 ? 431 VAL A HG22 5  
ATOM 10947 H HG23 . VAL A 1 39  ? 7.091   1.317   -3.920  1.00 0.00 ? 431 VAL A HG23 5  
ATOM 10948 N N    . TYR A 1 40  ? 11.830  2.616   -1.555  1.00 0.00 ? 432 TYR A N    5  
ATOM 10949 C CA   . TYR A 1 40  ? 13.100  2.188   -1.100  1.00 0.00 ? 432 TYR A CA   5  
ATOM 10950 C C    . TYR A 1 40  ? 12.849  1.111   -0.104  1.00 0.00 ? 432 TYR A C    5  
ATOM 10951 O O    . TYR A 1 40  ? 11.773  1.064   0.479   1.00 0.00 ? 432 TYR A O    5  
ATOM 10952 C CB   . TYR A 1 40  ? 13.859  3.355   -0.456  1.00 0.00 ? 432 TYR A CB   5  
ATOM 10953 C CG   . TYR A 1 40  ? 14.138  4.489   -1.412  1.00 0.00 ? 432 TYR A CG   5  
ATOM 10954 C CD1  . TYR A 1 40  ? 15.291  4.498   -2.173  1.00 0.00 ? 432 TYR A CD1  5  
ATOM 10955 C CD2  . TYR A 1 40  ? 13.239  5.540   -1.566  1.00 0.00 ? 432 TYR A CD2  5  
ATOM 10956 C CE1  . TYR A 1 40  ? 15.549  5.518   -3.064  1.00 0.00 ? 432 TYR A CE1  5  
ATOM 10957 C CE2  . TYR A 1 40  ? 13.488  6.566   -2.454  1.00 0.00 ? 432 TYR A CE2  5  
ATOM 10958 C CZ   . TYR A 1 40  ? 14.645  6.549   -3.201  1.00 0.00 ? 432 TYR A CZ   5  
ATOM 10959 O OH   . TYR A 1 40  ? 14.893  7.562   -4.094  1.00 0.00 ? 432 TYR A OH   5  
ATOM 10960 H H    . TYR A 1 40  ? 11.220  3.037   -0.905  1.00 0.00 ? 432 TYR A H    5  
ATOM 10961 H HA   . TYR A 1 40  ? 13.663  1.800   -1.936  1.00 0.00 ? 432 TYR A HA   5  
ATOM 10962 H HB2  . TYR A 1 40  ? 13.278  3.750   0.364   1.00 0.00 ? 432 TYR A HB2  5  
ATOM 10963 H HB3  . TYR A 1 40  ? 14.805  2.994   -0.081  1.00 0.00 ? 432 TYR A HB3  5  
ATOM 10964 H HD1  . TYR A 1 40  ? 15.990  3.683   -2.057  1.00 0.00 ? 432 TYR A HD1  5  
ATOM 10965 H HD2  . TYR A 1 40  ? 12.335  5.546   -0.975  1.00 0.00 ? 432 TYR A HD2  5  
ATOM 10966 H HE1  . TYR A 1 40  ? 16.455  5.505   -3.650  1.00 0.00 ? 432 TYR A HE1  5  
ATOM 10967 H HE2  . TYR A 1 40  ? 12.780  7.375   -2.563  1.00 0.00 ? 432 TYR A HE2  5  
ATOM 10968 H HH   . TYR A 1 40  ? 15.248  7.181   -4.904  1.00 0.00 ? 432 TYR A HH   5  
ATOM 10969 N N    . VAL A 1 41  ? 13.774  0.247   0.091   1.00 0.00 ? 433 VAL A N    5  
ATOM 10970 C CA   . VAL A 1 41  ? 13.570  -0.809  1.029   1.00 0.00 ? 433 VAL A CA   5  
ATOM 10971 C C    . VAL A 1 41  ? 14.620  -0.801  2.090   1.00 0.00 ? 433 VAL A C    5  
ATOM 10972 O O    . VAL A 1 41  ? 15.775  -0.481  1.840   1.00 0.00 ? 433 VAL A O    5  
ATOM 10973 C CB   . VAL A 1 41  ? 13.506  -2.215  0.359   1.00 0.00 ? 433 VAL A CB   5  
ATOM 10974 C CG1  . VAL A 1 41  ? 12.280  -2.337  -0.522  1.00 0.00 ? 433 VAL A CG1  5  
ATOM 10975 C CG2  . VAL A 1 41  ? 14.765  -2.499  -0.454  1.00 0.00 ? 433 VAL A CG2  5  
ATOM 10976 H H    . VAL A 1 41  ? 14.622  0.312   -0.404  1.00 0.00 ? 433 VAL A H    5  
ATOM 10977 H HA   . VAL A 1 41  ? 12.621  -0.627  1.506   1.00 0.00 ? 433 VAL A HA   5  
ATOM 10978 H HB   . VAL A 1 41  ? 13.432  -2.954  1.143   1.00 0.00 ? 433 VAL A HB   5  
ATOM 10979 H HG11 . VAL A 1 41  ? 11.404  -2.070  0.044   1.00 0.00 ? 433 VAL A HG11 5  
ATOM 10980 H HG12 . VAL A 1 41  ? 12.379  -1.649  -1.348  1.00 0.00 ? 433 VAL A HG12 5  
ATOM 10981 H HG13 . VAL A 1 41  ? 12.189  -3.344  -0.902  1.00 0.00 ? 433 VAL A HG13 5  
ATOM 10982 H HG21 . VAL A 1 41  ? 14.911  -1.715  -1.180  1.00 0.00 ? 433 VAL A HG21 5  
ATOM 10983 H HG22 . VAL A 1 41  ? 15.617  -2.541  0.208   1.00 0.00 ? 433 VAL A HG22 5  
ATOM 10984 H HG23 . VAL A 1 41  ? 14.656  -3.443  -0.968  1.00 0.00 ? 433 VAL A HG23 5  
ATOM 10985 N N    . ASN A 1 42  ? 14.205  -1.069  3.275   1.00 0.00 ? 434 ASN A N    5  
ATOM 10986 C CA   . ASN A 1 42  ? 15.102  -1.232  4.343   1.00 0.00 ? 434 ASN A CA   5  
ATOM 10987 C C    . ASN A 1 42  ? 15.393  -2.715  4.499   1.00 0.00 ? 434 ASN A C    5  
ATOM 10988 O O    . ASN A 1 42  ? 14.404  -3.595  4.518   1.00 0.00 ? 434 ASN A O    5  
ATOM 10989 C CB   . ASN A 1 42  ? 14.631  -0.540  5.635   1.00 0.00 ? 434 ASN A CB   5  
ATOM 10990 C CG   . ASN A 1 42  ? 15.577  -0.753  6.803   1.00 0.00 ? 434 ASN A CG   5  
ATOM 10991 O OD1  . ASN A 1 42  ? 15.440  -1.705  7.551   1.00 0.00 ? 434 ASN A OD1  5  
ATOM 10992 N ND2  . ASN A 1 42  ? 16.533  0.135   6.972   1.00 0.00 ? 434 ASN A ND2  5  
ATOM 10993 H H    . ASN A 1 42  ? 13.246  -1.236  3.409   1.00 0.00 ? 434 ASN A H    5  
ATOM 10994 H HA   . ASN A 1 42  ? 16.025  -0.777  4.009   1.00 0.00 ? 434 ASN A HA   5  
ATOM 10995 H HB2  . ASN A 1 42  ? 14.591  0.523   5.442   1.00 0.00 ? 434 ASN A HB2  5  
ATOM 10996 H HB3  . ASN A 1 42  ? 13.643  -0.864  5.917   1.00 0.00 ? 434 ASN A HB3  5  
ATOM 10997 H HD21 . ASN A 1 42  ? 16.601  0.892   6.353   1.00 0.00 ? 434 ASN A HD21 5  
ATOM 10998 H HD22 . ASN A 1 42  ? 17.152  0.005   7.721   1.00 0.00 ? 434 ASN A HD22 5  
ATOM 10999 N N    . HIS A 1 43  ? 16.728  -2.957  4.610   1.00 0.00 ? 435 HIS A N    5  
ATOM 11000 C CA   . HIS A 1 43  ? 17.444  -4.248  4.603   1.00 0.00 ? 435 HIS A CA   5  
ATOM 11001 C C    . HIS A 1 43  ? 16.720  -5.442  5.247   1.00 0.00 ? 435 HIS A C    5  
ATOM 11002 O O    . HIS A 1 43  ? 15.832  -5.299  6.087   1.00 0.00 ? 435 HIS A O    5  
ATOM 11003 C CB   . HIS A 1 43  ? 18.841  -4.098  5.246   1.00 0.00 ? 435 HIS A CB   5  
ATOM 11004 C CG   . HIS A 1 43  ? 19.916  -3.555  4.338   1.00 0.00 ? 435 HIS A CG   5  
ATOM 11005 N ND1  . HIS A 1 43  ? 20.274  -2.216  4.230   1.00 0.00 ? 435 HIS A ND1  5  
ATOM 11006 C CD2  . HIS A 1 43  ? 20.747  -4.225  3.501   1.00 0.00 ? 435 HIS A CD2  5  
ATOM 11007 C CE1  . HIS A 1 43  ? 21.286  -2.134  3.354   1.00 0.00 ? 435 HIS A CE1  5  
ATOM 11008 N NE2  . HIS A 1 43  ? 21.610  -3.329  2.879   1.00 0.00 ? 435 HIS A NE2  5  
ATOM 11009 H H    . HIS A 1 43  ? 17.292  -2.165  4.708   1.00 0.00 ? 435 HIS A H    5  
ATOM 11010 H HA   . HIS A 1 43  ? 17.617  -4.411  3.544   1.00 0.00 ? 435 HIS A HA   5  
ATOM 11011 H HB2  . HIS A 1 43  ? 18.766  -3.433  6.093   1.00 0.00 ? 435 HIS A HB2  5  
ATOM 11012 H HB3  . HIS A 1 43  ? 19.162  -5.069  5.597   1.00 0.00 ? 435 HIS A HB3  5  
ATOM 11013 H HD1  . HIS A 1 43  ? 19.871  -1.443  4.683   1.00 0.00 ? 435 HIS A HD1  5  
ATOM 11014 H HD2  . HIS A 1 43  ? 20.750  -5.292  3.340   1.00 0.00 ? 435 HIS A HD2  5  
ATOM 11015 H HE1  . HIS A 1 43  ? 21.773  -1.213  3.072   1.00 0.00 ? 435 HIS A HE1  5  
ATOM 11016 N N    . GLY A 1 44  ? 17.189  -6.627  4.895   1.00 0.00 ? 436 GLY A N    5  
ATOM 11017 C CA   . GLY A 1 44  ? 16.544  -7.856  5.310   1.00 0.00 ? 436 GLY A CA   5  
ATOM 11018 C C    . GLY A 1 44  ? 15.833  -8.459  4.127   1.00 0.00 ? 436 GLY A C    5  
ATOM 11019 O O    . GLY A 1 44  ? 15.272  -9.557  4.180   1.00 0.00 ? 436 GLY A O    5  
ATOM 11020 H H    . GLY A 1 44  ? 18.003  -6.675  4.350   1.00 0.00 ? 436 GLY A H    5  
ATOM 11021 H HA2  . GLY A 1 44  ? 17.288  -8.545  5.679   1.00 0.00 ? 436 GLY A HA2  5  
ATOM 11022 H HA3  . GLY A 1 44  ? 15.821  -7.645  6.085   1.00 0.00 ? 436 GLY A HA3  5  
ATOM 11023 N N    . GLU A 1 45  ? 15.898  -7.737  3.046   1.00 0.00 ? 437 GLU A N    5  
ATOM 11024 C CA   . GLU A 1 45  ? 15.216  -8.038  1.827   1.00 0.00 ? 437 GLU A CA   5  
ATOM 11025 C C    . GLU A 1 45  ? 16.092  -8.709  0.777   1.00 0.00 ? 437 GLU A C    5  
ATOM 11026 O O    . GLU A 1 45  ? 17.318  -8.751  0.892   1.00 0.00 ? 437 GLU A O    5  
ATOM 11027 C CB   . GLU A 1 45  ? 14.596  -6.746  1.242   1.00 0.00 ? 437 GLU A CB   5  
ATOM 11028 C CG   . GLU A 1 45  ? 15.466  -5.477  1.364   1.00 0.00 ? 437 GLU A CG   5  
ATOM 11029 C CD   . GLU A 1 45  ? 16.878  -5.637  0.847   1.00 0.00 ? 437 GLU A CD   5  
ATOM 11030 O OE1  . GLU A 1 45  ? 17.771  -5.936  1.669   1.00 0.00 ? 437 GLU A OE1  5  
ATOM 11031 O OE2  . GLU A 1 45  ? 17.107  -5.525  -0.371  1.00 0.00 ? 437 GLU A OE2  5  
ATOM 11032 H H    . GLU A 1 45  ? 16.473  -6.939  3.047   1.00 0.00 ? 437 GLU A H    5  
ATOM 11033 H HA   . GLU A 1 45  ? 14.396  -8.698  2.063   1.00 0.00 ? 437 GLU A HA   5  
ATOM 11034 H HB2  . GLU A 1 45  ? 14.404  -6.911  0.193   1.00 0.00 ? 437 GLU A HB2  5  
ATOM 11035 H HB3  . GLU A 1 45  ? 13.656  -6.556  1.736   1.00 0.00 ? 437 GLU A HB3  5  
ATOM 11036 H HG2  . GLU A 1 45  ? 14.994  -4.684  0.804   1.00 0.00 ? 437 GLU A HG2  5  
ATOM 11037 H HG3  . GLU A 1 45  ? 15.507  -5.191  2.405   1.00 0.00 ? 437 GLU A HG3  5  
ATOM 11038 N N    . ASN A 1 46  ? 15.429  -9.313  -0.163  1.00 0.00 ? 438 ASN A N    5  
ATOM 11039 C CA   . ASN A 1 46  ? 15.997  -9.760  -1.413  1.00 0.00 ? 438 ASN A CA   5  
ATOM 11040 C C    . ASN A 1 46  ? 14.830  -10.052 -2.311  1.00 0.00 ? 438 ASN A C    5  
ATOM 11041 O O    . ASN A 1 46  ? 14.176  -11.085 -2.181  1.00 0.00 ? 438 ASN A O    5  
ATOM 11042 C CB   . ASN A 1 46  ? 16.866  -11.025 -1.252  1.00 0.00 ? 438 ASN A CB   5  
ATOM 11043 C CG   . ASN A 1 46  ? 17.468  -11.503 -2.573  1.00 0.00 ? 438 ASN A CG   5  
ATOM 11044 O OD1  . ASN A 1 46  ? 16.876  -12.314 -3.282  1.00 0.00 ? 438 ASN A OD1  5  
ATOM 11045 N ND2  . ASN A 1 46  ? 18.643  -11.015 -2.908  1.00 0.00 ? 438 ASN A ND2  5  
ATOM 11046 H H    . ASN A 1 46  ? 14.483  -9.526  -0.023  1.00 0.00 ? 438 ASN A H    5  
ATOM 11047 H HA   . ASN A 1 46  ? 16.575  -8.951  -1.833  1.00 0.00 ? 438 ASN A HA   5  
ATOM 11048 H HB2  . ASN A 1 46  ? 17.671  -10.824 -0.561  1.00 0.00 ? 438 ASN A HB2  5  
ATOM 11049 H HB3  . ASN A 1 46  ? 16.251  -11.817 -0.854  1.00 0.00 ? 438 ASN A HB3  5  
ATOM 11050 H HD21 . ASN A 1 46  ? 19.078  -10.373 -2.304  1.00 0.00 ? 438 ASN A HD21 5  
ATOM 11051 H HD22 . ASN A 1 46  ? 19.042  -11.310 -3.756  1.00 0.00 ? 438 ASN A HD22 5  
ATOM 11052 N N    . LEU A 1 47  ? 14.483  -9.093  -3.118  1.00 0.00 ? 439 LEU A N    5  
ATOM 11053 C CA   . LEU A 1 47  ? 13.399  -9.245  -4.045  1.00 0.00 ? 439 LEU A CA   5  
ATOM 11054 C C    . LEU A 1 47  ? 13.744  -8.591  -5.354  1.00 0.00 ? 439 LEU A C    5  
ATOM 11055 O O    . LEU A 1 47  ? 14.388  -7.535  -5.359  1.00 0.00 ? 439 LEU A O    5  
ATOM 11056 C CB   . LEU A 1 47  ? 12.043  -8.719  -3.484  1.00 0.00 ? 439 LEU A CB   5  
ATOM 11057 C CG   . LEU A 1 47  ? 11.858  -7.202  -3.223  1.00 0.00 ? 439 LEU A CG   5  
ATOM 11058 C CD1  . LEU A 1 47  ? 10.421  -6.937  -2.856  1.00 0.00 ? 439 LEU A CD1  5  
ATOM 11059 C CD2  . LEU A 1 47  ? 12.740  -6.693  -2.098  1.00 0.00 ? 439 LEU A CD2  5  
ATOM 11060 H H    . LEU A 1 47  ? 14.977  -8.245  -3.133  1.00 0.00 ? 439 LEU A H    5  
ATOM 11061 H HA   . LEU A 1 47  ? 13.307  -10.306 -4.230  1.00 0.00 ? 439 LEU A HA   5  
ATOM 11062 H HB2  . LEU A 1 47  ? 11.271  -9.015  -4.179  1.00 0.00 ? 439 LEU A HB2  5  
ATOM 11063 H HB3  . LEU A 1 47  ? 11.861  -9.239  -2.555  1.00 0.00 ? 439 LEU A HB3  5  
ATOM 11064 H HG   . LEU A 1 47  ? 12.085  -6.654  -4.126  1.00 0.00 ? 439 LEU A HG   5  
ATOM 11065 H HD11 . LEU A 1 47  ? 9.784   -7.258  -3.665  1.00 0.00 ? 439 LEU A HD11 5  
ATOM 11066 H HD12 . LEU A 1 47  ? 10.169  -7.486  -1.960  1.00 0.00 ? 439 LEU A HD12 5  
ATOM 11067 H HD13 . LEU A 1 47  ? 10.284  -5.880  -2.685  1.00 0.00 ? 439 LEU A HD13 5  
ATOM 11068 H HD21 . LEU A 1 47  ? 12.490  -7.219  -1.188  1.00 0.00 ? 439 LEU A HD21 5  
ATOM 11069 H HD22 . LEU A 1 47  ? 13.781  -6.848  -2.340  1.00 0.00 ? 439 LEU A HD22 5  
ATOM 11070 H HD23 . LEU A 1 47  ? 12.546  -5.638  -1.967  1.00 0.00 ? 439 LEU A HD23 5  
ATOM 11071 N N    . LYS A 1 48  ? 13.364  -9.194  -6.442  1.00 0.00 ? 440 LYS A N    5  
ATOM 11072 C CA   . LYS A 1 48  ? 13.549  -8.581  -7.728  1.00 0.00 ? 440 LYS A CA   5  
ATOM 11073 C C    . LYS A 1 48  ? 12.278  -7.889  -8.136  1.00 0.00 ? 440 LYS A C    5  
ATOM 11074 O O    . LYS A 1 48  ? 11.243  -8.534  -8.337  1.00 0.00 ? 440 LYS A O    5  
ATOM 11075 C CB   . LYS A 1 48  ? 13.951  -9.576  -8.812  1.00 0.00 ? 440 LYS A CB   5  
ATOM 11076 C CG   . LYS A 1 48  ? 15.345  -10.172 -8.667  1.00 0.00 ? 440 LYS A CG   5  
ATOM 11077 C CD   . LYS A 1 48  ? 15.678  -11.085 -9.852  1.00 0.00 ? 440 LYS A CD   5  
ATOM 11078 C CE   . LYS A 1 48  ? 15.692  -10.308 -11.167 1.00 0.00 ? 440 LYS A CE   5  
ATOM 11079 N NZ   . LYS A 1 48  ? 15.904  -11.172 -12.340 1.00 0.00 ? 440 LYS A NZ   5  
ATOM 11080 H H    . LYS A 1 48  ? 12.933  -10.075 -6.380  1.00 0.00 ? 440 LYS A H    5  
ATOM 11081 H HA   . LYS A 1 48  ? 14.326  -7.842  -7.618  1.00 0.00 ? 440 LYS A HA   5  
ATOM 11082 H HB2  . LYS A 1 48  ? 13.238  -10.388 -8.827  1.00 0.00 ? 440 LYS A HB2  5  
ATOM 11083 H HB3  . LYS A 1 48  ? 13.898  -9.051  -9.753  1.00 0.00 ? 440 LYS A HB3  5  
ATOM 11084 H HG2  . LYS A 1 48  ? 16.069  -9.371  -8.621  1.00 0.00 ? 440 LYS A HG2  5  
ATOM 11085 H HG3  . LYS A 1 48  ? 15.386  -10.746 -7.754  1.00 0.00 ? 440 LYS A HG3  5  
ATOM 11086 H HD2  . LYS A 1 48  ? 16.651  -11.526 -9.695  1.00 0.00 ? 440 LYS A HD2  5  
ATOM 11087 H HD3  . LYS A 1 48  ? 14.934  -11.865 -9.914  1.00 0.00 ? 440 LYS A HD3  5  
ATOM 11088 H HE2  . LYS A 1 48  ? 14.748  -9.804  -11.301 1.00 0.00 ? 440 LYS A HE2  5  
ATOM 11089 H HE3  . LYS A 1 48  ? 16.486  -9.578  -11.124 1.00 0.00 ? 440 LYS A HE3  5  
ATOM 11090 H HZ1  . LYS A 1 48  ? 15.217  -11.953 -12.351 1.00 0.00 ? 440 LYS A HZ1  5  
ATOM 11091 H HZ2  . LYS A 1 48  ? 15.747  -10.612 -13.208 1.00 0.00 ? 440 LYS A HZ2  5  
ATOM 11092 H HZ3  . LYS A 1 48  ? 16.868  -11.556 -12.372 1.00 0.00 ? 440 LYS A HZ3  5  
ATOM 11093 N N    . THR A 1 49  ? 12.352  -6.596  -8.306  1.00 0.00 ? 441 THR A N    5  
ATOM 11094 C CA   . THR A 1 49  ? 11.194  -5.814  -8.667  1.00 0.00 ? 441 THR A CA   5  
ATOM 11095 C C    . THR A 1 49  ? 10.922  -5.893  -10.178 1.00 0.00 ? 441 THR A C    5  
ATOM 11096 O O    . THR A 1 49  ? 10.024  -5.250  -10.706 1.00 0.00 ? 441 THR A O    5  
ATOM 11097 C CB   . THR A 1 49  ? 11.347  -4.359  -8.172  1.00 0.00 ? 441 THR A CB   5  
ATOM 11098 O OG1  . THR A 1 49  ? 12.579  -3.793  -8.668  1.00 0.00 ? 441 THR A OG1  5  
ATOM 11099 C CG2  . THR A 1 49  ? 11.361  -4.340  -6.646  1.00 0.00 ? 441 THR A CG2  5  
ATOM 11100 H H    . THR A 1 49  ? 13.206  -6.122  -8.191  1.00 0.00 ? 441 THR A H    5  
ATOM 11101 H HA   . THR A 1 49  ? 10.348  -6.261  -8.164  1.00 0.00 ? 441 THR A HA   5  
ATOM 11102 H HB   . THR A 1 49  ? 10.510  -3.773  -8.523  1.00 0.00 ? 441 THR A HB   5  
ATOM 11103 H HG1  . THR A 1 49  ? 12.943  -3.203  -7.993  1.00 0.00 ? 441 THR A HG1  5  
ATOM 11104 H HG21 . THR A 1 49  ? 12.130  -5.011  -6.290  1.00 0.00 ? 441 THR A HG21 5  
ATOM 11105 H HG22 . THR A 1 49  ? 11.560  -3.344  -6.281  1.00 0.00 ? 441 THR A HG22 5  
ATOM 11106 H HG23 . THR A 1 49  ? 10.402  -4.673  -6.278  1.00 0.00 ? 441 THR A HG23 5  
ATOM 11107 N N    . GLU A 1 50  ? 11.707  -6.727  -10.844 1.00 0.00 ? 442 GLU A N    5  
ATOM 11108 C CA   . GLU A 1 50  ? 11.579  -7.040  -12.258 1.00 0.00 ? 442 GLU A CA   5  
ATOM 11109 C C    . GLU A 1 50  ? 10.190  -7.631  -12.540 1.00 0.00 ? 442 GLU A C    5  
ATOM 11110 O O    . GLU A 1 50  ? 9.614   -7.414  -13.598 1.00 0.00 ? 442 GLU A O    5  
ATOM 11111 C CB   . GLU A 1 50  ? 12.660  -8.067  -12.607 1.00 0.00 ? 442 GLU A CB   5  
ATOM 11112 C CG   . GLU A 1 50  ? 12.786  -8.436  -14.073 1.00 0.00 ? 442 GLU A CG   5  
ATOM 11113 C CD   . GLU A 1 50  ? 13.857  -9.476  -14.278 1.00 0.00 ? 442 GLU A CD   5  
ATOM 11114 O OE1  . GLU A 1 50  ? 13.527  -10.667 -14.410 1.00 0.00 ? 442 GLU A OE1  5  
ATOM 11115 O OE2  . GLU A 1 50  ? 15.057  -9.132  -14.234 1.00 0.00 ? 442 GLU A OE2  5  
ATOM 11116 H H    . GLU A 1 50  ? 12.447  -7.124  -10.341 1.00 0.00 ? 442 GLU A H    5  
ATOM 11117 H HA   . GLU A 1 50  ? 11.738  -6.148  -12.843 1.00 0.00 ? 442 GLU A HA   5  
ATOM 11118 H HB2  . GLU A 1 50  ? 13.615  -7.682  -12.287 1.00 0.00 ? 442 GLU A HB2  5  
ATOM 11119 H HB3  . GLU A 1 50  ? 12.454  -8.969  -12.051 1.00 0.00 ? 442 GLU A HB3  5  
ATOM 11120 H HG2  . GLU A 1 50  ? 11.841  -8.830  -14.420 1.00 0.00 ? 442 GLU A HG2  5  
ATOM 11121 H HG3  . GLU A 1 50  ? 13.045  -7.554  -14.641 1.00 0.00 ? 442 GLU A HG3  5  
ATOM 11122 N N    . GLN A 1 51  ? 9.653   -8.345  -11.558 1.00 0.00 ? 443 GLN A N    5  
ATOM 11123 C CA   . GLN A 1 51  ? 8.352   -8.985  -11.697 1.00 0.00 ? 443 GLN A CA   5  
ATOM 11124 C C    . GLN A 1 51  ? 7.229   -8.066  -11.225 1.00 0.00 ? 443 GLN A C    5  
ATOM 11125 O O    . GLN A 1 51  ? 6.062   -8.457  -11.203 1.00 0.00 ? 443 GLN A O    5  
ATOM 11126 C CB   . GLN A 1 51  ? 8.302   -10.306 -10.909 1.00 0.00 ? 443 GLN A CB   5  
ATOM 11127 C CG   . GLN A 1 51  ? 9.347   -11.332 -11.330 1.00 0.00 ? 443 GLN A CG   5  
ATOM 11128 C CD   . GLN A 1 51  ? 9.265   -11.721 -12.803 1.00 0.00 ? 443 GLN A CD   5  
ATOM 11129 O OE1  . GLN A 1 51  ? 10.272  -12.046 -13.415 1.00 0.00 ? 443 GLN A OE1  5  
ATOM 11130 N NE2  . GLN A 1 51  ? 8.086   -11.714 -13.374 1.00 0.00 ? 443 GLN A NE2  5  
ATOM 11131 H H    . GLN A 1 51  ? 10.143  -8.437  -10.715 1.00 0.00 ? 443 GLN A H    5  
ATOM 11132 H HA   . GLN A 1 51  ? 8.203   -9.204  -12.745 1.00 0.00 ? 443 GLN A HA   5  
ATOM 11133 H HB2  . GLN A 1 51  ? 8.448   -10.087 -9.862  1.00 0.00 ? 443 GLN A HB2  5  
ATOM 11134 H HB3  . GLN A 1 51  ? 7.323   -10.746 -11.033 1.00 0.00 ? 443 GLN A HB3  5  
ATOM 11135 H HG2  . GLN A 1 51  ? 10.328  -10.922 -11.144 1.00 0.00 ? 443 GLN A HG2  5  
ATOM 11136 H HG3  . GLN A 1 51  ? 9.220   -12.223 -10.732 1.00 0.00 ? 443 GLN A HG3  5  
ATOM 11137 H HE21 . GLN A 1 51  ? 7.293   -11.468 -12.853 1.00 0.00 ? 443 GLN A HE21 5  
ATOM 11138 H HE22 . GLN A 1 51  ? 8.036   -11.962 -14.320 1.00 0.00 ? 443 GLN A HE22 5  
ATOM 11139 N N    . TRP A 1 52  ? 7.576   -6.856  -10.871 1.00 0.00 ? 444 TRP A N    5  
ATOM 11140 C CA   . TRP A 1 52  ? 6.612   -5.899  -10.371 1.00 0.00 ? 444 TRP A CA   5  
ATOM 11141 C C    . TRP A 1 52  ? 6.071   -5.047  -11.491 1.00 0.00 ? 444 TRP A C    5  
ATOM 11142 O O    . TRP A 1 52  ? 6.850   -4.451  -12.254 1.00 0.00 ? 444 TRP A O    5  
ATOM 11143 C CB   . TRP A 1 52  ? 7.230   -5.001  -9.295  1.00 0.00 ? 444 TRP A CB   5  
ATOM 11144 C CG   . TRP A 1 52  ? 7.424   -5.663  -7.971  1.00 0.00 ? 444 TRP A CG   5  
ATOM 11145 C CD1  . TRP A 1 52  ? 7.643   -6.992  -7.723  1.00 0.00 ? 444 TRP A CD1  5  
ATOM 11146 C CD2  . TRP A 1 52  ? 7.434   -5.014  -6.703  1.00 0.00 ? 444 TRP A CD2  5  
ATOM 11147 N NE1  . TRP A 1 52  ? 7.750   -7.202  -6.377  1.00 0.00 ? 444 TRP A NE1  5  
ATOM 11148 C CE2  . TRP A 1 52  ? 7.631   -6.005  -5.730  1.00 0.00 ? 444 TRP A CE2  5  
ATOM 11149 C CE3  . TRP A 1 52  ? 7.284   -3.684  -6.293  1.00 0.00 ? 444 TRP A CE3  5  
ATOM 11150 C CZ2  . TRP A 1 52  ? 7.676   -5.718  -4.380  1.00 0.00 ? 444 TRP A CZ2  5  
ATOM 11151 C CZ3  . TRP A 1 52  ? 7.339   -3.391  -4.946  1.00 0.00 ? 444 TRP A CZ3  5  
ATOM 11152 C CH2  . TRP A 1 52  ? 7.533   -4.411  -3.999  1.00 0.00 ? 444 TRP A CH2  5  
ATOM 11153 H H    . TRP A 1 52  ? 8.505   -6.561  -10.977 1.00 0.00 ? 444 TRP A H    5  
ATOM 11154 H HA   . TRP A 1 52  ? 5.810   -6.466  -9.925  1.00 0.00 ? 444 TRP A HA   5  
ATOM 11155 H HB2  . TRP A 1 52  ? 8.199   -4.665  -9.634  1.00 0.00 ? 444 TRP A HB2  5  
ATOM 11156 H HB3  . TRP A 1 52  ? 6.595   -4.140  -9.152  1.00 0.00 ? 444 TRP A HB3  5  
ATOM 11157 H HD1  . TRP A 1 52  ? 7.698   -7.754  -8.486  1.00 0.00 ? 444 TRP A HD1  5  
ATOM 11158 H HE1  . TRP A 1 52  ? 7.898   -8.067  -5.942  1.00 0.00 ? 444 TRP A HE1  5  
ATOM 11159 H HE3  . TRP A 1 52  ? 7.136   -2.893  -7.014  1.00 0.00 ? 444 TRP A HE3  5  
ATOM 11160 H HZ2  . TRP A 1 52  ? 7.812   -6.507  -3.656  1.00 0.00 ? 444 TRP A HZ2  5  
ATOM 11161 H HZ3  . TRP A 1 52  ? 7.225   -2.366  -4.624  1.00 0.00 ? 444 TRP A HZ3  5  
ATOM 11162 H HH2  . TRP A 1 52  ? 7.582   -4.156  -2.950  1.00 0.00 ? 444 TRP A HH2  5  
ATOM 11163 N N    . PRO A 1 53  ? 4.741   -4.985  -11.636 1.00 0.00 ? 445 PRO A N    5  
ATOM 11164 C CA   . PRO A 1 53  ? 4.105   -4.128  -12.628 1.00 0.00 ? 445 PRO A CA   5  
ATOM 11165 C C    . PRO A 1 53  ? 4.342   -2.652  -12.292 1.00 0.00 ? 445 PRO A C    5  
ATOM 11166 O O    . PRO A 1 53  ? 4.722   -2.317  -11.173 1.00 0.00 ? 445 PRO A O    5  
ATOM 11167 C CB   . PRO A 1 53  ? 2.614   -4.481  -12.530 1.00 0.00 ? 445 PRO A CB   5  
ATOM 11168 C CG   . PRO A 1 53  ? 2.445   -5.110  -11.191 1.00 0.00 ? 445 PRO A CG   5  
ATOM 11169 C CD   . PRO A 1 53  ? 3.758   -5.745  -10.844 1.00 0.00 ? 445 PRO A CD   5  
ATOM 11170 H HA   . PRO A 1 53  ? 4.480   -4.332  -13.620 1.00 0.00 ? 445 PRO A HA   5  
ATOM 11171 H HB2  . PRO A 1 53  ? 2.028   -3.578  -12.618 1.00 0.00 ? 445 PRO A HB2  5  
ATOM 11172 H HB3  . PRO A 1 53  ? 2.349   -5.164  -13.322 1.00 0.00 ? 445 PRO A HB3  5  
ATOM 11173 H HG2  . PRO A 1 53  ? 2.198   -4.353  -10.461 1.00 0.00 ? 445 PRO A HG2  5  
ATOM 11174 H HG3  . PRO A 1 53  ? 1.667   -5.857  -11.230 1.00 0.00 ? 445 PRO A HG3  5  
ATOM 11175 H HD2  . PRO A 1 53  ? 3.952   -5.627  -9.789  1.00 0.00 ? 445 PRO A HD2  5  
ATOM 11176 H HD3  . PRO A 1 53  ? 3.763   -6.790  -11.117 1.00 0.00 ? 445 PRO A HD3  5  
ATOM 11177 N N    . GLN A 1 54  ? 4.135   -1.792  -13.254 1.00 0.00 ? 446 GLN A N    5  
ATOM 11178 C CA   . GLN A 1 54  ? 4.381   -0.364  -13.083 1.00 0.00 ? 446 GLN A CA   5  
ATOM 11179 C C    . GLN A 1 54  ? 3.286   0.282   -12.257 1.00 0.00 ? 446 GLN A C    5  
ATOM 11180 O O    . GLN A 1 54  ? 3.508   1.311   -11.600 1.00 0.00 ? 446 GLN A O    5  
ATOM 11181 C CB   . GLN A 1 54  ? 4.469   0.316   -14.440 1.00 0.00 ? 446 GLN A CB   5  
ATOM 11182 C CG   . GLN A 1 54  ? 5.565   -0.232  -15.333 1.00 0.00 ? 446 GLN A CG   5  
ATOM 11183 C CD   . GLN A 1 54  ? 5.557   0.411   -16.693 1.00 0.00 ? 446 GLN A CD   5  
ATOM 11184 O OE1  . GLN A 1 54  ? 4.892   -0.070  -17.619 1.00 0.00 ? 446 GLN A OE1  5  
ATOM 11185 N NE2  . GLN A 1 54  ? 6.268   1.494   -16.834 1.00 0.00 ? 446 GLN A NE2  5  
ATOM 11186 H H    . GLN A 1 54  ? 3.802   -2.127  -14.115 1.00 0.00 ? 446 GLN A H    5  
ATOM 11187 H HA   . GLN A 1 54  ? 5.322   -0.240  -12.569 1.00 0.00 ? 446 GLN A HA   5  
ATOM 11188 H HB2  . GLN A 1 54  ? 3.525   0.190   -14.950 1.00 0.00 ? 446 GLN A HB2  5  
ATOM 11189 H HB3  . GLN A 1 54  ? 4.647   1.370   -14.289 1.00 0.00 ? 446 GLN A HB3  5  
ATOM 11190 H HG2  . GLN A 1 54  ? 6.523   -0.047  -14.870 1.00 0.00 ? 446 GLN A HG2  5  
ATOM 11191 H HG3  . GLN A 1 54  ? 5.421   -1.296  -15.449 1.00 0.00 ? 446 GLN A HG3  5  
ATOM 11192 H HE21 . GLN A 1 54  ? 6.768   1.841   -16.065 1.00 0.00 ? 446 GLN A HE21 5  
ATOM 11193 H HE22 . GLN A 1 54  ? 6.291   1.931   -17.711 1.00 0.00 ? 446 GLN A HE22 5  
ATOM 11194 N N    . LYS A 1 55  ? 2.120   -0.313  -12.295 1.00 0.00 ? 447 LYS A N    5  
ATOM 11195 C CA   . LYS A 1 55  ? 0.987   0.192   -11.576 1.00 0.00 ? 447 LYS A CA   5  
ATOM 11196 C C    . LYS A 1 55  ? 0.579   -0.764  -10.489 1.00 0.00 ? 447 LYS A C    5  
ATOM 11197 O O    . LYS A 1 55  ? 0.463   -1.970  -10.723 1.00 0.00 ? 447 LYS A O    5  
ATOM 11198 C CB   . LYS A 1 55  ? -0.199  0.413   -12.498 1.00 0.00 ? 447 LYS A CB   5  
ATOM 11199 C CG   . LYS A 1 55  ? -0.020  1.485   -13.550 1.00 0.00 ? 447 LYS A CG   5  
ATOM 11200 C CD   . LYS A 1 55  ? -1.324  1.680   -14.282 1.00 0.00 ? 447 LYS A CD   5  
ATOM 11201 C CE   . LYS A 1 55  ? -1.301  2.868   -15.209 1.00 0.00 ? 447 LYS A CE   5  
ATOM 11202 N NZ   . LYS A 1 55  ? -2.666  3.195   -15.668 1.00 0.00 ? 447 LYS A NZ   5  
ATOM 11203 H H    . LYS A 1 55  ? 2.017   -1.144  -12.802 1.00 0.00 ? 447 LYS A H    5  
ATOM 11204 H HA   . LYS A 1 55  ? 1.259   1.139   -11.137 1.00 0.00 ? 447 LYS A HA   5  
ATOM 11205 H HB2  . LYS A 1 55  ? -0.415  -0.516  -13.005 1.00 0.00 ? 447 LYS A HB2  5  
ATOM 11206 H HB3  . LYS A 1 55  ? -1.053  0.673   -11.890 1.00 0.00 ? 447 LYS A HB3  5  
ATOM 11207 H HG2  . LYS A 1 55  ? 0.268   2.408   -13.069 1.00 0.00 ? 447 LYS A HG2  5  
ATOM 11208 H HG3  . LYS A 1 55  ? 0.741   1.177   -14.252 1.00 0.00 ? 447 LYS A HG3  5  
ATOM 11209 H HD2  . LYS A 1 55  ? -1.535  0.795   -14.863 1.00 0.00 ? 447 LYS A HD2  5  
ATOM 11210 H HD3  . LYS A 1 55  ? -2.110  1.819   -13.553 1.00 0.00 ? 447 LYS A HD3  5  
ATOM 11211 H HE2  . LYS A 1 55  ? -0.890  3.719   -14.684 1.00 0.00 ? 447 LYS A HE2  5  
ATOM 11212 H HE3  . LYS A 1 55  ? -0.688  2.633   -16.065 1.00 0.00 ? 447 LYS A HE3  5  
ATOM 11213 H HZ1  . LYS A 1 55  ? -3.115  2.395   -16.156 1.00 0.00 ? 447 LYS A HZ1  5  
ATOM 11214 H HZ2  . LYS A 1 55  ? -3.242  3.416   -14.822 1.00 0.00 ? 447 LYS A HZ2  5  
ATOM 11215 H HZ3  . LYS A 1 55  ? -2.689  4.024   -16.295 1.00 0.00 ? 447 LYS A HZ3  5  
ATOM 11216 N N    . LEU A 1 56  ? 0.398   -0.239  -9.313  1.00 0.00 ? 448 LEU A N    5  
ATOM 11217 C CA   . LEU A 1 56  ? -0.074  -0.996  -8.182  1.00 0.00 ? 448 LEU A CA   5  
ATOM 11218 C C    . LEU A 1 56  ? -1.383  -0.433  -7.688  1.00 0.00 ? 448 LEU A C    5  
ATOM 11219 O O    . LEU A 1 56  ? -1.625  0.764   -7.788  1.00 0.00 ? 448 LEU A O    5  
ATOM 11220 C CB   . LEU A 1 56  ? 0.954   -1.071  -7.055  1.00 0.00 ? 448 LEU A CB   5  
ATOM 11221 C CG   . LEU A 1 56  ? 2.253   -1.815  -7.367  1.00 0.00 ? 448 LEU A CG   5  
ATOM 11222 C CD1  . LEU A 1 56  ? 3.084   -1.989  -6.118  1.00 0.00 ? 448 LEU A CD1  5  
ATOM 11223 C CD2  . LEU A 1 56  ? 1.959   -3.139  -8.010  1.00 0.00 ? 448 LEU A CD2  5  
ATOM 11224 H H    . LEU A 1 56  ? 0.594   0.718   -9.190  1.00 0.00 ? 448 LEU A H    5  
ATOM 11225 H HA   . LEU A 1 56  ? -0.278  -1.996  -8.539  1.00 0.00 ? 448 LEU A HA   5  
ATOM 11226 H HB2  . LEU A 1 56  ? 1.208   -0.061  -6.770  1.00 0.00 ? 448 LEU A HB2  5  
ATOM 11227 H HB3  . LEU A 1 56  ? 0.486   -1.553  -6.209  1.00 0.00 ? 448 LEU A HB3  5  
ATOM 11228 H HG   . LEU A 1 56  ? 2.869   -1.251  -8.048  1.00 0.00 ? 448 LEU A HG   5  
ATOM 11229 H HD11 . LEU A 1 56  ? 3.327   -1.020  -5.707  1.00 0.00 ? 448 LEU A HD11 5  
ATOM 11230 H HD12 . LEU A 1 56  ? 2.525   -2.559  -5.390  1.00 0.00 ? 448 LEU A HD12 5  
ATOM 11231 H HD13 . LEU A 1 56  ? 3.995   -2.515  -6.364  1.00 0.00 ? 448 LEU A HD13 5  
ATOM 11232 H HD21 . LEU A 1 56  ? 1.367   -3.740  -7.336  1.00 0.00 ? 448 LEU A HD21 5  
ATOM 11233 H HD22 . LEU A 1 56  ? 1.422   -2.991  -8.935  1.00 0.00 ? 448 LEU A HD22 5  
ATOM 11234 H HD23 . LEU A 1 56  ? 2.892   -3.643  -8.216  1.00 0.00 ? 448 LEU A HD23 5  
ATOM 11235 N N    . ILE A 1 57  ? -2.224  -1.277  -7.175  1.00 0.00 ? 449 ILE A N    5  
ATOM 11236 C CA   . ILE A 1 57  ? -3.529  -0.867  -6.731  1.00 0.00 ? 449 ILE A CA   5  
ATOM 11237 C C    . ILE A 1 57  ? -3.483  -0.660  -5.225  1.00 0.00 ? 449 ILE A C    5  
ATOM 11238 O O    . ILE A 1 57  ? -3.102  -1.571  -4.469  1.00 0.00 ? 449 ILE A O    5  
ATOM 11239 C CB   . ILE A 1 57  ? -4.580  -1.958  -7.066  1.00 0.00 ? 449 ILE A CB   5  
ATOM 11240 C CG1  . ILE A 1 57  ? -4.513  -2.309  -8.562  1.00 0.00 ? 449 ILE A CG1  5  
ATOM 11241 C CG2  . ILE A 1 57  ? -5.987  -1.481  -6.687  1.00 0.00 ? 449 ILE A CG2  5  
ATOM 11242 C CD1  . ILE A 1 57  ? -5.387  -3.474  -8.962  1.00 0.00 ? 449 ILE A CD1  5  
ATOM 11243 H H    . ILE A 1 57  ? -1.968  -2.217  -7.039  1.00 0.00 ? 449 ILE A H    5  
ATOM 11244 H HA   . ILE A 1 57  ? -3.801  0.054   -7.225  1.00 0.00 ? 449 ILE A HA   5  
ATOM 11245 H HB   . ILE A 1 57  ? -4.350  -2.842  -6.489  1.00 0.00 ? 449 ILE A HB   5  
ATOM 11246 H HG12 . ILE A 1 57  ? -4.831  -1.453  -9.137  1.00 0.00 ? 449 ILE A HG12 5  
ATOM 11247 H HG13 . ILE A 1 57  ? -3.492  -2.551  -8.822  1.00 0.00 ? 449 ILE A HG13 5  
ATOM 11248 H HG21 . ILE A 1 57  ? -6.021  -1.267  -5.628  1.00 0.00 ? 449 ILE A HG21 5  
ATOM 11249 H HG22 . ILE A 1 57  ? -6.225  -0.586  -7.243  1.00 0.00 ? 449 ILE A HG22 5  
ATOM 11250 H HG23 . ILE A 1 57  ? -6.705  -2.252  -6.924  1.00 0.00 ? 449 ILE A HG23 5  
ATOM 11251 H HD11 . ILE A 1 57  ? -6.414  -3.245  -8.723  1.00 0.00 ? 449 ILE A HD11 5  
ATOM 11252 H HD12 . ILE A 1 57  ? -5.293  -3.645  -10.024 1.00 0.00 ? 449 ILE A HD12 5  
ATOM 11253 H HD13 . ILE A 1 57  ? -5.077  -4.358  -8.424  1.00 0.00 ? 449 ILE A HD13 5  
ATOM 11254 N N    . MET A 1 58  ? -3.844  0.514   -4.784  1.00 0.00 ? 450 MET A N    5  
ATOM 11255 C CA   . MET A 1 58  ? -3.812  0.802   -3.375  1.00 0.00 ? 450 MET A CA   5  
ATOM 11256 C C    . MET A 1 58  ? -5.217  0.685   -2.826  1.00 0.00 ? 450 MET A C    5  
ATOM 11257 O O    . MET A 1 58  ? -6.154  1.175   -3.424  1.00 0.00 ? 450 MET A O    5  
ATOM 11258 C CB   . MET A 1 58  ? -3.230  2.208   -3.114  1.00 0.00 ? 450 MET A CB   5  
ATOM 11259 C CG   . MET A 1 58  ? -3.094  2.567   -1.632  1.00 0.00 ? 450 MET A CG   5  
ATOM 11260 S SD   . MET A 1 58  ? -2.334  4.191   -1.331  1.00 0.00 ? 450 MET A SD   5  
ATOM 11261 C CE   . MET A 1 58  ? -3.575  5.350   -1.928  1.00 0.00 ? 450 MET A CE   5  
ATOM 11262 H H    . MET A 1 58  ? -4.177  1.198   -5.411  1.00 0.00 ? 450 MET A H    5  
ATOM 11263 H HA   . MET A 1 58  ? -3.187  0.062   -2.897  1.00 0.00 ? 450 MET A HA   5  
ATOM 11264 H HB2  . MET A 1 58  ? -2.252  2.269   -3.570  1.00 0.00 ? 450 MET A HB2  5  
ATOM 11265 H HB3  . MET A 1 58  ? -3.877  2.933   -3.583  1.00 0.00 ? 450 MET A HB3  5  
ATOM 11266 H HG2  . MET A 1 58  ? -4.078  2.571   -1.189  1.00 0.00 ? 450 MET A HG2  5  
ATOM 11267 H HG3  . MET A 1 58  ? -2.493  1.808   -1.152  1.00 0.00 ? 450 MET A HG3  5  
ATOM 11268 H HE1  . MET A 1 58  ? -3.814  5.235   -2.978  1.00 0.00 ? 450 MET A HE1  5  
ATOM 11269 H HE2  . MET A 1 58  ? -4.479  5.213   -1.353  1.00 0.00 ? 450 MET A HE2  5  
ATOM 11270 H HE3  . MET A 1 58  ? -3.226  6.357   -1.764  1.00 0.00 ? 450 MET A HE3  5  
ATOM 11271 N N    . GLN A 1 59  ? -5.368  -0.002  -1.731  1.00 0.00 ? 451 GLN A N    5  
ATOM 11272 C CA   . GLN A 1 59  ? -6.659  -0.154  -1.121  1.00 0.00 ? 451 GLN A CA   5  
ATOM 11273 C C    . GLN A 1 59  ? -6.585  0.329   0.320   1.00 0.00 ? 451 GLN A C    5  
ATOM 11274 O O    . GLN A 1 59  ? -5.847  -0.226  1.133   1.00 0.00 ? 451 GLN A O    5  
ATOM 11275 C CB   . GLN A 1 59  ? -7.083  -1.616  -1.200  1.00 0.00 ? 451 GLN A CB   5  
ATOM 11276 C CG   . GLN A 1 59  ? -8.501  -1.894  -0.757  1.00 0.00 ? 451 GLN A CG   5  
ATOM 11277 C CD   . GLN A 1 59  ? -8.866  -3.346  -0.939  1.00 0.00 ? 451 GLN A CD   5  
ATOM 11278 O OE1  . GLN A 1 59  ? -8.017  -4.228  -0.844  1.00 0.00 ? 451 GLN A OE1  5  
ATOM 11279 N NE2  . GLN A 1 59  ? -10.110 -3.603  -1.254  1.00 0.00 ? 451 GLN A NE2  5  
ATOM 11280 H H    . GLN A 1 59  ? -4.605  -0.463  -1.313  1.00 0.00 ? 451 GLN A H    5  
ATOM 11281 H HA   . GLN A 1 59  ? -7.365  0.454   -1.668  1.00 0.00 ? 451 GLN A HA   5  
ATOM 11282 H HB2  . GLN A 1 59  ? -6.978  -1.948  -2.223  1.00 0.00 ? 451 GLN A HB2  5  
ATOM 11283 H HB3  . GLN A 1 59  ? -6.416  -2.197  -0.580  1.00 0.00 ? 451 GLN A HB3  5  
ATOM 11284 H HG2  . GLN A 1 59  ? -8.596  -1.636  0.287   1.00 0.00 ? 451 GLN A HG2  5  
ATOM 11285 H HG3  . GLN A 1 59  ? -9.178  -1.289  -1.344  1.00 0.00 ? 451 GLN A HG3  5  
ATOM 11286 H HE21 . GLN A 1 59  ? -10.732 -2.848  -1.365  1.00 0.00 ? 451 GLN A HE21 5  
ATOM 11287 H HE22 . GLN A 1 59  ? -10.379 -4.541  -1.352  1.00 0.00 ? 451 GLN A HE22 5  
ATOM 11288 N N    . LEU A 1 60  ? -7.316  1.375   0.622   1.00 0.00 ? 452 LEU A N    5  
ATOM 11289 C CA   . LEU A 1 60  ? -7.286  1.969   1.944   1.00 0.00 ? 452 LEU A CA   5  
ATOM 11290 C C    . LEU A 1 60  ? -8.308  1.308   2.854   1.00 0.00 ? 452 LEU A C    5  
ATOM 11291 O O    . LEU A 1 60  ? -9.517  1.370   2.613   1.00 0.00 ? 452 LEU A O    5  
ATOM 11292 C CB   . LEU A 1 60  ? -7.477  3.494   1.872   1.00 0.00 ? 452 LEU A CB   5  
ATOM 11293 C CG   . LEU A 1 60  ? -6.414  4.258   1.047   1.00 0.00 ? 452 LEU A CG   5  
ATOM 11294 C CD1  . LEU A 1 60  ? -6.740  5.733   0.961   1.00 0.00 ? 452 LEU A CD1  5  
ATOM 11295 C CD2  . LEU A 1 60  ? -5.030  4.073   1.640   1.00 0.00 ? 452 LEU A CD2  5  
ATOM 11296 H H    . LEU A 1 60  ? -7.927  1.742   -0.049  1.00 0.00 ? 452 LEU A H    5  
ATOM 11297 H HA   . LEU A 1 60  ? -6.308  1.761   2.353   1.00 0.00 ? 452 LEU A HA   5  
ATOM 11298 H HB2  . LEU A 1 60  ? -8.453  3.696   1.456   1.00 0.00 ? 452 LEU A HB2  5  
ATOM 11299 H HB3  . LEU A 1 60  ? -7.454  3.881   2.880   1.00 0.00 ? 452 LEU A HB3  5  
ATOM 11300 H HG   . LEU A 1 60  ? -6.404  3.864   0.041   1.00 0.00 ? 452 LEU A HG   5  
ATOM 11301 H HD11 . LEU A 1 60  ? -7.729  5.872   0.550   1.00 0.00 ? 452 LEU A HD11 5  
ATOM 11302 H HD12 . LEU A 1 60  ? -6.689  6.161   1.951   1.00 0.00 ? 452 LEU A HD12 5  
ATOM 11303 H HD13 . LEU A 1 60  ? -6.012  6.226   0.333   1.00 0.00 ? 452 LEU A HD13 5  
ATOM 11304 H HD21 . LEU A 1 60  ? -5.027  4.412   2.665   1.00 0.00 ? 452 LEU A HD21 5  
ATOM 11305 H HD22 . LEU A 1 60  ? -4.758  3.031   1.601   1.00 0.00 ? 452 LEU A HD22 5  
ATOM 11306 H HD23 . LEU A 1 60  ? -4.313  4.647   1.070   1.00 0.00 ? 452 LEU A HD23 5  
ATOM 11307 N N    . ILE A 1 61  ? -7.797  0.679   3.871   1.00 0.00 ? 453 ILE A N    5  
ATOM 11308 C CA   . ILE A 1 61  ? -8.552  -0.097  4.834   1.00 0.00 ? 453 ILE A CA   5  
ATOM 11309 C C    . ILE A 1 61  ? -8.344  0.515   6.222   1.00 0.00 ? 453 ILE A C    5  
ATOM 11310 O O    . ILE A 1 61  ? -7.421  1.284   6.393   1.00 0.00 ? 453 ILE A O    5  
ATOM 11311 C CB   . ILE A 1 61  ? -8.055  -1.573  4.834   1.00 0.00 ? 453 ILE A CB   5  
ATOM 11312 C CG1  . ILE A 1 61  ? -6.524  -1.625  5.067   1.00 0.00 ? 453 ILE A CG1  5  
ATOM 11313 C CG2  . ILE A 1 61  ? -8.446  -2.278  3.534   1.00 0.00 ? 453 ILE A CG2  5  
ATOM 11314 C CD1  . ILE A 1 61  ? -5.931  -3.017  5.116   1.00 0.00 ? 453 ILE A CD1  5  
ATOM 11315 H H    . ILE A 1 61  ? -6.828  0.772   4.020   1.00 0.00 ? 453 ILE A H    5  
ATOM 11316 H HA   . ILE A 1 61  ? -9.597  -0.068  4.563   1.00 0.00 ? 453 ILE A HA   5  
ATOM 11317 H HB   . ILE A 1 61  ? -8.547  -2.081  5.650   1.00 0.00 ? 453 ILE A HB   5  
ATOM 11318 H HG12 . ILE A 1 61  ? -6.031  -1.091  4.268   1.00 0.00 ? 453 ILE A HG12 5  
ATOM 11319 H HG13 . ILE A 1 61  ? -6.300  -1.133  6.001   1.00 0.00 ? 453 ILE A HG13 5  
ATOM 11320 H HG21 . ILE A 1 61  ? -8.004  -1.758  2.698   1.00 0.00 ? 453 ILE A HG21 5  
ATOM 11321 H HG22 . ILE A 1 61  ? -8.088  -3.297  3.552   1.00 0.00 ? 453 ILE A HG22 5  
ATOM 11322 H HG23 . ILE A 1 61  ? -9.521  -2.277  3.429   1.00 0.00 ? 453 ILE A HG23 5  
ATOM 11323 H HD11 . ILE A 1 61  ? -6.141  -3.536  4.192   1.00 0.00 ? 453 ILE A HD11 5  
ATOM 11324 H HD12 . ILE A 1 61  ? -4.863  -2.943  5.254   1.00 0.00 ? 453 ILE A HD12 5  
ATOM 11325 H HD13 . ILE A 1 61  ? -6.360  -3.566  5.939   1.00 0.00 ? 453 ILE A HD13 5  
ATOM 11326 N N    . PRO A 1 62  ? -9.197  0.233   7.223   1.00 0.00 ? 454 PRO A N    5  
ATOM 11327 C CA   . PRO A 1 62  ? -9.011  0.793   8.566   1.00 0.00 ? 454 PRO A CA   5  
ATOM 11328 C C    . PRO A 1 62  ? -7.755  0.220   9.231   1.00 0.00 ? 454 PRO A C    5  
ATOM 11329 O O    . PRO A 1 62  ? -7.578  -1.001  9.309   1.00 0.00 ? 454 PRO A O    5  
ATOM 11330 C CB   . PRO A 1 62  ? -10.280 0.352   9.321   1.00 0.00 ? 454 PRO A CB   5  
ATOM 11331 C CG   . PRO A 1 62  ? -11.234 -0.061  8.249   1.00 0.00 ? 454 PRO A CG   5  
ATOM 11332 C CD   . PRO A 1 62  ? -10.381 -0.621  7.152   1.00 0.00 ? 454 PRO A CD   5  
ATOM 11333 H HA   . PRO A 1 62  ? -8.942  1.871   8.540   1.00 0.00 ? 454 PRO A HA   5  
ATOM 11334 H HB2  . PRO A 1 62  ? -10.036 -0.471  9.975   1.00 0.00 ? 454 PRO A HB2  5  
ATOM 11335 H HB3  . PRO A 1 62  ? -10.668 1.175   9.900   1.00 0.00 ? 454 PRO A HB3  5  
ATOM 11336 H HG2  . PRO A 1 62  ? -11.915 -0.810  8.624   1.00 0.00 ? 454 PRO A HG2  5  
ATOM 11337 H HG3  . PRO A 1 62  ? -11.780 0.800   7.895   1.00 0.00 ? 454 PRO A HG3  5  
ATOM 11338 H HD2  . PRO A 1 62  ? -10.127 -1.650  7.358   1.00 0.00 ? 454 PRO A HD2  5  
ATOM 11339 H HD3  . PRO A 1 62  ? -10.862 -0.536  6.190   1.00 0.00 ? 454 PRO A HD3  5  
ATOM 11340 N N    . GLN A 1 63  ? -6.922  1.109   9.743   1.00 0.00 ? 455 GLN A N    5  
ATOM 11341 C CA   . GLN A 1 63  ? -5.620  0.767   10.322  1.00 0.00 ? 455 GLN A CA   5  
ATOM 11342 C C    . GLN A 1 63  ? -5.768  -0.135  11.535  1.00 0.00 ? 455 GLN A C    5  
ATOM 11343 O O    . GLN A 1 63  ? -4.989  -1.054  11.738  1.00 0.00 ? 455 GLN A O    5  
ATOM 11344 C CB   . GLN A 1 63  ? -4.887  2.052   10.709  1.00 0.00 ? 455 GLN A CB   5  
ATOM 11345 C CG   . GLN A 1 63  ? -3.488  1.869   11.244  1.00 0.00 ? 455 GLN A CG   5  
ATOM 11346 C CD   . GLN A 1 63  ? -2.890  3.179   11.709  1.00 0.00 ? 455 GLN A CD   5  
ATOM 11347 O OE1  . GLN A 1 63  ? -3.031  3.560   12.876  1.00 0.00 ? 455 GLN A OE1  5  
ATOM 11348 N NE2  . GLN A 1 63  ? -2.250  3.888   10.822  1.00 0.00 ? 455 GLN A NE2  5  
ATOM 11349 H H    . GLN A 1 63  ? -7.192  2.058   9.743   1.00 0.00 ? 455 GLN A H    5  
ATOM 11350 H HA   . GLN A 1 63  ? -5.039  0.256   9.569   1.00 0.00 ? 455 GLN A HA   5  
ATOM 11351 H HB2  . GLN A 1 63  ? -4.828  2.689   9.838   1.00 0.00 ? 455 GLN A HB2  5  
ATOM 11352 H HB3  . GLN A 1 63  ? -5.473  2.560   11.461  1.00 0.00 ? 455 GLN A HB3  5  
ATOM 11353 H HG2  . GLN A 1 63  ? -3.518  1.183   12.077  1.00 0.00 ? 455 GLN A HG2  5  
ATOM 11354 H HG3  . GLN A 1 63  ? -2.865  1.463   10.461  1.00 0.00 ? 455 GLN A HG3  5  
ATOM 11355 H HE21 . GLN A 1 63  ? -2.192  3.552   9.903   1.00 0.00 ? 455 GLN A HE21 5  
ATOM 11356 H HE22 . GLN A 1 63  ? -1.842  4.732   11.109  1.00 0.00 ? 455 GLN A HE22 5  
ATOM 11357 N N    . GLN A 1 64  ? -6.806  0.109   12.306  1.00 0.00 ? 456 GLN A N    5  
ATOM 11358 C CA   . GLN A 1 64  ? -7.038  -0.614  13.554  1.00 0.00 ? 456 GLN A CA   5  
ATOM 11359 C C    . GLN A 1 64  ? -7.346  -2.098  13.323  1.00 0.00 ? 456 GLN A C    5  
ATOM 11360 O O    . GLN A 1 64  ? -7.187  -2.931  14.217  1.00 0.00 ? 456 GLN A O    5  
ATOM 11361 C CB   . GLN A 1 64  ? -8.160  0.045   14.349  1.00 0.00 ? 456 GLN A CB   5  
ATOM 11362 C CG   . GLN A 1 64  ? -7.910  1.507   14.673  1.00 0.00 ? 456 GLN A CG   5  
ATOM 11363 C CD   . GLN A 1 64  ? -8.955  2.078   15.597  1.00 0.00 ? 456 GLN A CD   5  
ATOM 11364 O OE1  . GLN A 1 64  ? -8.801  2.046   16.817  1.00 0.00 ? 456 GLN A OE1  5  
ATOM 11365 N NE2  . GLN A 1 64  ? -10.012 2.604   15.044  1.00 0.00 ? 456 GLN A NE2  5  
ATOM 11366 H H    . GLN A 1 64  ? -7.431  0.809   12.024  1.00 0.00 ? 456 GLN A H    5  
ATOM 11367 H HA   . GLN A 1 64  ? -6.127  -0.541  14.129  1.00 0.00 ? 456 GLN A HA   5  
ATOM 11368 H HB2  . GLN A 1 64  ? -9.072  -0.018  13.773  1.00 0.00 ? 456 GLN A HB2  5  
ATOM 11369 H HB3  . GLN A 1 64  ? -8.296  -0.488  15.278  1.00 0.00 ? 456 GLN A HB3  5  
ATOM 11370 H HG2  . GLN A 1 64  ? -6.944  1.595   15.148  1.00 0.00 ? 456 GLN A HG2  5  
ATOM 11371 H HG3  . GLN A 1 64  ? -7.912  2.074   13.754  1.00 0.00 ? 456 GLN A HG3  5  
ATOM 11372 H HE21 . GLN A 1 64  ? -10.078 2.613   14.063  1.00 0.00 ? 456 GLN A HE21 5  
ATOM 11373 H HE22 . GLN A 1 64  ? -10.730 2.954   15.612  1.00 0.00 ? 456 GLN A HE22 5  
ATOM 11374 N N    . LEU A 1 65  ? -7.775  -2.429  12.130  1.00 0.00 ? 457 LEU A N    5  
ATOM 11375 C CA   . LEU A 1 65  ? -8.126  -3.798  11.800  1.00 0.00 ? 457 LEU A CA   5  
ATOM 11376 C C    . LEU A 1 65  ? -6.906  -4.592  11.330  1.00 0.00 ? 457 LEU A C    5  
ATOM 11377 O O    . LEU A 1 65  ? -6.990  -5.793  11.095  1.00 0.00 ? 457 LEU A O    5  
ATOM 11378 C CB   . LEU A 1 65  ? -9.217  -3.825  10.740  1.00 0.00 ? 457 LEU A CB   5  
ATOM 11379 C CG   . LEU A 1 65  ? -10.548 -3.160  11.107  1.00 0.00 ? 457 LEU A CG   5  
ATOM 11380 C CD1  . LEU A 1 65  ? -11.519 -3.278  9.956   1.00 0.00 ? 457 LEU A CD1  5  
ATOM 11381 C CD2  . LEU A 1 65  ? -11.147 -3.777  12.365  1.00 0.00 ? 457 LEU A CD2  5  
ATOM 11382 H H    . LEU A 1 65  ? -7.835  -1.740  11.434  1.00 0.00 ? 457 LEU A H    5  
ATOM 11383 H HA   . LEU A 1 65  ? -8.505  -4.263  12.698  1.00 0.00 ? 457 LEU A HA   5  
ATOM 11384 H HB2  . LEU A 1 65  ? -8.827  -3.313  9.873   1.00 0.00 ? 457 LEU A HB2  5  
ATOM 11385 H HB3  . LEU A 1 65  ? -9.411  -4.852  10.472  1.00 0.00 ? 457 LEU A HB3  5  
ATOM 11386 H HG   . LEU A 1 65  ? -10.375 -2.110  11.291  1.00 0.00 ? 457 LEU A HG   5  
ATOM 11387 H HD11 . LEU A 1 65  ? -11.102 -2.803  9.081   1.00 0.00 ? 457 LEU A HD11 5  
ATOM 11388 H HD12 . LEU A 1 65  ? -11.691 -4.324  9.750   1.00 0.00 ? 457 LEU A HD12 5  
ATOM 11389 H HD13 . LEU A 1 65  ? -12.454 -2.804  10.218  1.00 0.00 ? 457 LEU A HD13 5  
ATOM 11390 H HD21 . LEU A 1 65  ? -11.322 -4.829  12.197  1.00 0.00 ? 457 LEU A HD21 5  
ATOM 11391 H HD22 . LEU A 1 65  ? -10.469 -3.650  13.195  1.00 0.00 ? 457 LEU A HD22 5  
ATOM 11392 H HD23 . LEU A 1 65  ? -12.085 -3.290  12.589  1.00 0.00 ? 457 LEU A HD23 5  
ATOM 11393 N N    . LEU A 1 66  ? -5.776  -3.915  11.220  1.00 0.00 ? 458 LEU A N    5  
ATOM 11394 C CA   . LEU A 1 66  ? -4.537  -4.521  10.744  1.00 0.00 ? 458 LEU A CA   5  
ATOM 11395 C C    . LEU A 1 66  ? -3.822  -5.275  11.877  1.00 0.00 ? 458 LEU A C    5  
ATOM 11396 O O    . LEU A 1 66  ? -2.955  -6.122  11.635  1.00 0.00 ? 458 LEU A O    5  
ATOM 11397 C CB   . LEU A 1 66  ? -3.630  -3.439  10.136  1.00 0.00 ? 458 LEU A CB   5  
ATOM 11398 C CG   . LEU A 1 66  ? -2.300  -3.893  9.541   1.00 0.00 ? 458 LEU A CG   5  
ATOM 11399 C CD1  . LEU A 1 66  ? -2.539  -4.830  8.372   1.00 0.00 ? 458 LEU A CD1  5  
ATOM 11400 C CD2  . LEU A 1 66  ? -1.466  -2.685  9.112   1.00 0.00 ? 458 LEU A CD2  5  
ATOM 11401 H H    . LEU A 1 66  ? -5.763  -2.963  11.466  1.00 0.00 ? 458 LEU A H    5  
ATOM 11402 H HA   . LEU A 1 66  ? -4.802  -5.229  9.973   1.00 0.00 ? 458 LEU A HA   5  
ATOM 11403 H HB2  . LEU A 1 66  ? -4.188  -2.982  9.334   1.00 0.00 ? 458 LEU A HB2  5  
ATOM 11404 H HB3  . LEU A 1 66  ? -3.432  -2.694  10.893  1.00 0.00 ? 458 LEU A HB3  5  
ATOM 11405 H HG   . LEU A 1 66  ? -1.746  -4.438  10.293  1.00 0.00 ? 458 LEU A HG   5  
ATOM 11406 H HD11 . LEU A 1 66  ? -3.090  -5.693  8.715   1.00 0.00 ? 458 LEU A HD11 5  
ATOM 11407 H HD12 . LEU A 1 66  ? -3.105  -4.316  7.610   1.00 0.00 ? 458 LEU A HD12 5  
ATOM 11408 H HD13 . LEU A 1 66  ? -1.593  -5.153  7.965   1.00 0.00 ? 458 LEU A HD13 5  
ATOM 11409 H HD21 . LEU A 1 66  ? -1.270  -2.053  9.965   1.00 0.00 ? 458 LEU A HD21 5  
ATOM 11410 H HD22 . LEU A 1 66  ? -0.529  -3.019  8.692   1.00 0.00 ? 458 LEU A HD22 5  
ATOM 11411 H HD23 . LEU A 1 66  ? -2.005  -2.116  8.369   1.00 0.00 ? 458 LEU A HD23 5  
ATOM 11412 N N    . THR A 1 67  ? -4.226  -4.985  13.105  1.00 0.00 ? 459 THR A N    5  
ATOM 11413 C CA   . THR A 1 67  ? -3.635  -5.548  14.314  1.00 0.00 ? 459 THR A CA   5  
ATOM 11414 C C    . THR A 1 67  ? -3.683  -7.103  14.341  1.00 0.00 ? 459 THR A C    5  
ATOM 11415 O O    . THR A 1 67  ? -2.816  -7.752  14.938  1.00 0.00 ? 459 THR A O    5  
ATOM 11416 C CB   . THR A 1 67  ? -4.377  -4.964  15.536  1.00 0.00 ? 459 THR A CB   5  
ATOM 11417 O OG1  . THR A 1 67  ? -4.363  -3.530  15.428  1.00 0.00 ? 459 THR A OG1  5  
ATOM 11418 C CG2  . THR A 1 67  ? -3.721  -5.370  16.851  1.00 0.00 ? 459 THR A CG2  5  
ATOM 11419 H H    . THR A 1 67  ? -4.959  -4.344  13.222  1.00 0.00 ? 459 THR A H    5  
ATOM 11420 H HA   . THR A 1 67  ? -2.605  -5.227  14.367  1.00 0.00 ? 459 THR A HA   5  
ATOM 11421 H HB   . THR A 1 67  ? -5.401  -5.308  15.515  1.00 0.00 ? 459 THR A HB   5  
ATOM 11422 H HG1  . THR A 1 67  ? -3.450  -3.242  15.548  1.00 0.00 ? 459 THR A HG1  5  
ATOM 11423 H HG21 . THR A 1 67  ? -2.699  -5.020  16.870  1.00 0.00 ? 459 THR A HG21 5  
ATOM 11424 H HG22 . THR A 1 67  ? -4.266  -4.934  17.675  1.00 0.00 ? 459 THR A HG22 5  
ATOM 11425 H HG23 . THR A 1 67  ? -3.733  -6.446  16.940  1.00 0.00 ? 459 THR A HG23 5  
ATOM 11426 N N    . THR A 1 68  ? -4.634  -7.694  13.638  1.00 0.00 ? 460 THR A N    5  
ATOM 11427 C CA   . THR A 1 68  ? -4.770  -9.138  13.607  1.00 0.00 ? 460 THR A CA   5  
ATOM 11428 C C    . THR A 1 68  ? -3.625  -9.804  12.818  1.00 0.00 ? 460 THR A C    5  
ATOM 11429 O O    . THR A 1 68  ? -3.344  -10.987 12.991  1.00 0.00 ? 460 THR A O    5  
ATOM 11430 C CB   . THR A 1 68  ? -6.131  -9.535  13.018  1.00 0.00 ? 460 THR A CB   5  
ATOM 11431 O OG1  . THR A 1 68  ? -6.363  -8.776  11.827  1.00 0.00 ? 460 THR A OG1  5  
ATOM 11432 C CG2  . THR A 1 68  ? -7.249  -9.268  14.011  1.00 0.00 ? 460 THR A CG2  5  
ATOM 11433 H H    . THR A 1 68  ? -5.269  -7.177  13.096  1.00 0.00 ? 460 THR A H    5  
ATOM 11434 H HA   . THR A 1 68  ? -4.725  -9.488  14.627  1.00 0.00 ? 460 THR A HA   5  
ATOM 11435 H HB   . THR A 1 68  ? -6.112  -10.588 12.775  1.00 0.00 ? 460 THR A HB   5  
ATOM 11436 H HG1  . THR A 1 68  ? -6.670  -9.374  11.134  1.00 0.00 ? 460 THR A HG1  5  
ATOM 11437 H HG21 . THR A 1 68  ? -7.261  -8.216  14.255  1.00 0.00 ? 460 THR A HG21 5  
ATOM 11438 H HG22 . THR A 1 68  ? -8.195  -9.543  13.570  1.00 0.00 ? 460 THR A HG22 5  
ATOM 11439 H HG23 . THR A 1 68  ? -7.085  -9.847  14.908  1.00 0.00 ? 460 THR A HG23 5  
ATOM 11440 N N    . LEU A 1 69  ? -2.946  -9.028  11.988  1.00 0.00 ? 461 LEU A N    5  
ATOM 11441 C CA   . LEU A 1 69  ? -1.859  -9.545  11.172  1.00 0.00 ? 461 LEU A CA   5  
ATOM 11442 C C    . LEU A 1 69  ? -0.506  -9.226  11.788  1.00 0.00 ? 461 LEU A C    5  
ATOM 11443 O O    . LEU A 1 69  ? 0.532   -9.438  11.160  1.00 0.00 ? 461 LEU A O    5  
ATOM 11444 C CB   . LEU A 1 69  ? -1.942  -8.985  9.757   1.00 0.00 ? 461 LEU A CB   5  
ATOM 11445 C CG   . LEU A 1 69  ? -3.218  -9.319  8.983   1.00 0.00 ? 461 LEU A CG   5  
ATOM 11446 C CD1  . LEU A 1 69  ? -3.192  -8.668  7.624   1.00 0.00 ? 461 LEU A CD1  5  
ATOM 11447 C CD2  . LEU A 1 69  ? -3.398  -10.827 8.849   1.00 0.00 ? 461 LEU A CD2  5  
ATOM 11448 H H    . LEU A 1 69  ? -3.179  -8.075  11.916  1.00 0.00 ? 461 LEU A H    5  
ATOM 11449 H HA   . LEU A 1 69  ? -1.965  -10.617 11.125  1.00 0.00 ? 461 LEU A HA   5  
ATOM 11450 H HB2  . LEU A 1 69  ? -1.857  -7.910  9.817   1.00 0.00 ? 461 LEU A HB2  5  
ATOM 11451 H HB3  . LEU A 1 69  ? -1.098  -9.362  9.198   1.00 0.00 ? 461 LEU A HB3  5  
ATOM 11452 H HG   . LEU A 1 69  ? -4.066  -8.921  9.516   1.00 0.00 ? 461 LEU A HG   5  
ATOM 11453 H HD11 . LEU A 1 69  ? -2.324  -9.004  7.076   1.00 0.00 ? 461 LEU A HD11 5  
ATOM 11454 H HD12 . LEU A 1 69  ? -4.090  -8.930  7.085   1.00 0.00 ? 461 LEU A HD12 5  
ATOM 11455 H HD13 . LEU A 1 69  ? -3.145  -7.595  7.745   1.00 0.00 ? 461 LEU A HD13 5  
ATOM 11456 H HD21 . LEU A 1 69  ? -3.464  -11.273 9.830   1.00 0.00 ? 461 LEU A HD21 5  
ATOM 11457 H HD22 . LEU A 1 69  ? -4.308  -11.025 8.304   1.00 0.00 ? 461 LEU A HD22 5  
ATOM 11458 H HD23 . LEU A 1 69  ? -2.560  -11.248 8.315   1.00 0.00 ? 461 LEU A HD23 5  
ATOM 11459 N N    . GLY A 1 70  ? -0.529  -8.748  13.027  1.00 0.00 ? 462 GLY A N    5  
ATOM 11460 C CA   . GLY A 1 70  ? 0.690   -8.401  13.769  1.00 0.00 ? 462 GLY A CA   5  
ATOM 11461 C C    . GLY A 1 70  ? 1.783   -9.485  13.722  1.00 0.00 ? 462 GLY A C    5  
ATOM 11462 O O    . GLY A 1 70  ? 2.908   -9.195  13.297  1.00 0.00 ? 462 GLY A O    5  
ATOM 11463 H H    . GLY A 1 70  ? -1.403  -8.623  13.455  1.00 0.00 ? 462 GLY A H    5  
ATOM 11464 H HA2  . GLY A 1 70  ? 1.099   -7.499  13.343  1.00 0.00 ? 462 GLY A HA2  5  
ATOM 11465 H HA3  . GLY A 1 70  ? 0.430   -8.213  14.800  1.00 0.00 ? 462 GLY A HA3  5  
ATOM 11466 N N    . PRO A 1 71  ? 1.483   -10.759 14.117  1.00 0.00 ? 463 PRO A N    5  
ATOM 11467 C CA   . PRO A 1 71  ? 2.463   -11.856 14.079  1.00 0.00 ? 463 PRO A CA   5  
ATOM 11468 C C    . PRO A 1 71  ? 3.006   -12.136 12.670  1.00 0.00 ? 463 PRO A C    5  
ATOM 11469 O O    . PRO A 1 71  ? 4.081   -12.712 12.516  1.00 0.00 ? 463 PRO A O    5  
ATOM 11470 C CB   . PRO A 1 71  ? 1.681   -13.072 14.595  1.00 0.00 ? 463 PRO A CB   5  
ATOM 11471 C CG   . PRO A 1 71  ? 0.246   -12.694 14.475  1.00 0.00 ? 463 PRO A CG   5  
ATOM 11472 C CD   . PRO A 1 71  ? 0.197   -11.218 14.686  1.00 0.00 ? 463 PRO A CD   5  
ATOM 11473 H HA   . PRO A 1 71  ? 3.295   -11.656 14.740  1.00 0.00 ? 463 PRO A HA   5  
ATOM 11474 H HB2  . PRO A 1 71  ? 1.919   -13.933 13.988  1.00 0.00 ? 463 PRO A HB2  5  
ATOM 11475 H HB3  . PRO A 1 71  ? 1.951   -13.266 15.622  1.00 0.00 ? 463 PRO A HB3  5  
ATOM 11476 H HG2  . PRO A 1 71  ? -0.119  -12.945 13.490  1.00 0.00 ? 463 PRO A HG2  5  
ATOM 11477 H HG3  . PRO A 1 71  ? -0.332  -13.204 15.231  1.00 0.00 ? 463 PRO A HG3  5  
ATOM 11478 H HD2  . PRO A 1 71  ? -0.639  -10.784 14.157  1.00 0.00 ? 463 PRO A HD2  5  
ATOM 11479 H HD3  . PRO A 1 71  ? 0.143   -10.989 15.740  1.00 0.00 ? 463 PRO A HD3  5  
ATOM 11480 N N    . LEU A 1 72  ? 2.289   -11.704 11.655  1.00 0.00 ? 464 LEU A N    5  
ATOM 11481 C CA   . LEU A 1 72  ? 2.700   -11.930 10.288  1.00 0.00 ? 464 LEU A CA   5  
ATOM 11482 C C    . LEU A 1 72  ? 3.790   -10.926 9.904   1.00 0.00 ? 464 LEU A C    5  
ATOM 11483 O O    . LEU A 1 72  ? 4.759   -11.279 9.226   1.00 0.00 ? 464 LEU A O    5  
ATOM 11484 C CB   . LEU A 1 72  ? 1.490   -11.854 9.344   1.00 0.00 ? 464 LEU A CB   5  
ATOM 11485 C CG   . LEU A 1 72  ? 1.738   -12.143 7.859   1.00 0.00 ? 464 LEU A CG   5  
ATOM 11486 C CD1  . LEU A 1 72  ? 2.340   -13.529 7.669   1.00 0.00 ? 464 LEU A CD1  5  
ATOM 11487 C CD2  . LEU A 1 72  ? 0.434   -12.036 7.093   1.00 0.00 ? 464 LEU A CD2  5  
ATOM 11488 H H    . LEU A 1 72  ? 1.469   -11.192 11.834  1.00 0.00 ? 464 LEU A H    5  
ATOM 11489 H HA   . LEU A 1 72  ? 3.122   -12.922 10.246  1.00 0.00 ? 464 LEU A HA   5  
ATOM 11490 H HB2  . LEU A 1 72  ? 0.751   -12.557 9.696   1.00 0.00 ? 464 LEU A HB2  5  
ATOM 11491 H HB3  . LEU A 1 72  ? 1.074   -10.860 9.425   1.00 0.00 ? 464 LEU A HB3  5  
ATOM 11492 H HG   . LEU A 1 72  ? 2.426   -11.413 7.459   1.00 0.00 ? 464 LEU A HG   5  
ATOM 11493 H HD11 . LEU A 1 72  ? 1.671   -14.270 8.080   1.00 0.00 ? 464 LEU A HD11 5  
ATOM 11494 H HD12 . LEU A 1 72  ? 2.484   -13.715 6.616   1.00 0.00 ? 464 LEU A HD12 5  
ATOM 11495 H HD13 . LEU A 1 72  ? 3.291   -13.584 8.176   1.00 0.00 ? 464 LEU A HD13 5  
ATOM 11496 H HD21 . LEU A 1 72  ? -0.017  -11.073 7.279   1.00 0.00 ? 464 LEU A HD21 5  
ATOM 11497 H HD22 . LEU A 1 72  ? 0.624   -12.167 6.038   1.00 0.00 ? 464 LEU A HD22 5  
ATOM 11498 H HD23 . LEU A 1 72  ? -0.237  -12.811 7.433   1.00 0.00 ? 464 LEU A HD23 5  
ATOM 11499 N N    . PHE A 1 73  ? 3.668   -9.709  10.428  1.00 0.00 ? 465 PHE A N    5  
ATOM 11500 C CA   . PHE A 1 73  ? 4.638   -8.625  10.192  1.00 0.00 ? 465 PHE A CA   5  
ATOM 11501 C C    . PHE A 1 73  ? 5.976   -8.887  10.869  1.00 0.00 ? 465 PHE A C    5  
ATOM 11502 O O    . PHE A 1 73  ? 6.956   -8.172  10.629  1.00 0.00 ? 465 PHE A O    5  
ATOM 11503 C CB   . PHE A 1 73  ? 4.092   -7.252  10.597  1.00 0.00 ? 465 PHE A CB   5  
ATOM 11504 C CG   . PHE A 1 73  ? 3.035   -6.716  9.674   1.00 0.00 ? 465 PHE A CG   5  
ATOM 11505 C CD1  . PHE A 1 73  ? 1.706   -6.695  10.046  1.00 0.00 ? 465 PHE A CD1  5  
ATOM 11506 C CD2  . PHE A 1 73  ? 3.385   -6.232  8.424   1.00 0.00 ? 465 PHE A CD2  5  
ATOM 11507 C CE1  . PHE A 1 73  ? 0.745   -6.200  9.194   1.00 0.00 ? 465 PHE A CE1  5  
ATOM 11508 C CE2  . PHE A 1 73  ? 2.430   -5.735  7.567   1.00 0.00 ? 465 PHE A CE2  5  
ATOM 11509 C CZ   . PHE A 1 73  ? 1.109   -5.719  7.950   1.00 0.00 ? 465 PHE A CZ   5  
ATOM 11510 H H    . PHE A 1 73  ? 2.893   -9.520  11.001  1.00 0.00 ? 465 PHE A H    5  
ATOM 11511 H HA   . PHE A 1 73  ? 4.819   -8.618  9.126   1.00 0.00 ? 465 PHE A HA   5  
ATOM 11512 H HB2  . PHE A 1 73  ? 3.664   -7.322  11.586  1.00 0.00 ? 465 PHE A HB2  5  
ATOM 11513 H HB3  . PHE A 1 73  ? 4.908   -6.544  10.616  1.00 0.00 ? 465 PHE A HB3  5  
ATOM 11514 H HD1  . PHE A 1 73  ? 1.417   -7.071  11.017  1.00 0.00 ? 465 PHE A HD1  5  
ATOM 11515 H HD2  . PHE A 1 73  ? 4.421   -6.246  8.120   1.00 0.00 ? 465 PHE A HD2  5  
ATOM 11516 H HE1  . PHE A 1 73  ? -0.292  -6.188  9.498   1.00 0.00 ? 465 PHE A HE1  5  
ATOM 11517 H HE2  . PHE A 1 73  ? 2.717   -5.359  6.596   1.00 0.00 ? 465 PHE A HE2  5  
ATOM 11518 H HZ   . PHE A 1 73  ? 0.362   -5.331  7.276   1.00 0.00 ? 465 PHE A HZ   5  
ATOM 11519 N N    . ARG A 1 74  ? 5.998   -9.872  11.769  1.00 0.00 ? 466 ARG A N    5  
ATOM 11520 C CA   . ARG A 1 74  ? 7.225   -10.272 12.449  1.00 0.00 ? 466 ARG A CA   5  
ATOM 11521 C C    . ARG A 1 74  ? 8.323   -10.689 11.477  1.00 0.00 ? 466 ARG A C    5  
ATOM 11522 O O    . ARG A 1 74  ? 9.510   -10.508 11.760  1.00 0.00 ? 466 ARG A O    5  
ATOM 11523 C CB   . ARG A 1 74  ? 6.986   -11.361 13.495  1.00 0.00 ? 466 ARG A CB   5  
ATOM 11524 C CG   . ARG A 1 74  ? 6.331   -10.857 14.767  1.00 0.00 ? 466 ARG A CG   5  
ATOM 11525 C CD   . ARG A 1 74  ? 6.225   -11.956 15.808  1.00 0.00 ? 466 ARG A CD   5  
ATOM 11526 N NE   . ARG A 1 74  ? 5.784   -11.440 17.107  1.00 0.00 ? 466 ARG A NE   5  
ATOM 11527 C CZ   . ARG A 1 74  ? 5.929   -12.076 18.277  1.00 0.00 ? 466 ARG A CZ   5  
ATOM 11528 N NH1  . ARG A 1 74  ? 6.367   -13.331 18.309  1.00 0.00 ? 466 ARG A NH1  5  
ATOM 11529 N NH2  . ARG A 1 74  ? 5.599   -11.466 19.406  1.00 0.00 ? 466 ARG A NH2  5  
ATOM 11530 H H    . ARG A 1 74  ? 5.148   -10.320 11.960  1.00 0.00 ? 466 ARG A H    5  
ATOM 11531 H HA   . ARG A 1 74  ? 7.582   -9.389  12.956  1.00 0.00 ? 466 ARG A HA   5  
ATOM 11532 H HB2  . ARG A 1 74  ? 6.347   -12.116 13.064  1.00 0.00 ? 466 ARG A HB2  5  
ATOM 11533 H HB3  . ARG A 1 74  ? 7.932   -11.814 13.753  1.00 0.00 ? 466 ARG A HB3  5  
ATOM 11534 H HG2  . ARG A 1 74  ? 6.924   -10.050 15.172  1.00 0.00 ? 466 ARG A HG2  5  
ATOM 11535 H HG3  . ARG A 1 74  ? 5.342   -10.496 14.527  1.00 0.00 ? 466 ARG A HG3  5  
ATOM 11536 H HD2  . ARG A 1 74  ? 5.506   -12.686 15.471  1.00 0.00 ? 466 ARG A HD2  5  
ATOM 11537 H HD3  . ARG A 1 74  ? 7.188   -12.427 15.929  1.00 0.00 ? 466 ARG A HD3  5  
ATOM 11538 H HE   . ARG A 1 74  ? 5.386   -10.539 17.082  1.00 0.00 ? 466 ARG A HE   5  
ATOM 11539