data_2YPT
# 
_entry.id   2YPT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2YPT         
PDBE  EBI-54683    
WWPDB D_1290054683 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2YPT 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-11-01 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pike, A.C.W.'      1  
'Dong, Y.Y.'        2  
'Quigley, A.'       3  
'Dong, L.'          4  
'Savitsky, P.'      5  
'Cooper, C.D.O.'    6  
'Chaikuad, A.'      7  
'Goubin, S.'        8  
'Shrestha, L.'      9  
'Li, Q.'            10 
'Mukhopadhyay, S.'  11 
'Yang, J.'          12 
'Xia, X.'           13 
'Shintre, C.A.'     14 
'Barr, A.J.'        15 
'Berridge, G.'      16 
'Chalk, R.'         17 
'Bray, J.E.'        18 
'von Delft, F.'     19 
'Bullock, A.'       20 
'Bountra, C.'       21 
'Arrowsmith, C.H.'  22 
'Edwards, A.'       23 
'Burgess-Brown, N.' 24 
'Carpenter, E.P.'   25 
# 
_citation.id                        primary 
_citation.title                     'The Structural Basis of Zmpste24-Dependent Laminopathies.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            339 
_citation.page_first                1604 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23539603 
_citation.pdbx_database_id_DOI      10.1126/SCIENCE.1231513 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Quigley, A.'         1  
primary 'Dong, Y.Y.'          2  
primary 'Pike, A.C.W.'        3  
primary 'Dong, L.'            4  
primary 'Shrestha, L.'        5  
primary 'Berridge, G.'        6  
primary 'Stansfeld, P.J.'     7  
primary 'Sansom, M.S.P.'      8  
primary 'Edwards, A.M.'       9  
primary 'Bountra, C.'         10 
primary 'von Delft, F.'       11 
primary 'Bullock, A.N.'       12 
primary 'Burgess-Brown, N.A.' 13 
primary 'Carpenter, E.P.'     14 
# 
_cell.entry_id           2YPT 
_cell.length_a           61.320 
_cell.length_b           95.540 
_cell.length_c           132.030 
_cell.angle_alpha        76.26 
_cell.angle_beta         79.67 
_cell.angle_gamma        72.30 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2YPT 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CAAX PRENYL PROTEASE 1 HOMOLOG' 55648.473 4 3.4.24.84 YES ?                                           ? 
2 polymer     syn PRELAMIN-A/C                     452.589   4 ?         ?   'C-TERMINAL TETRAPEPTIDE, RESIDUES 661-664' ? 
3 non-polymer syn 'ZINC ION'                       65.409    4 ?         ?   ?                                           ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
'FARNESYLATED PROTEINS-CONVERTING ENZYME 1, FACE-1, PRENYL PROTEIN-SPECIFIC ENDOPROTEASE 1, ZINC METALLOPROTEINASE STE24 HOMOLOG' 
2 '70 KDA LAMIN, RENAL CARCINOMA ANTIGEN NY-REN-32, PRELAMIN A' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFW
SGLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALAGLPWSLYNTFVIEEKHGFNQQTL
GFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEV
MAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNK
KQGCKNEEVLAVLGHALGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYN
EVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQHAENLY
FQ
;
;MGMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFW
SGLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALAGLPWSLYNTFVIEEKHGFNQQTL
GFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEV
MAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNK
KQGCKNEEVLAVLGHALGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYN
EVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQHAENLY
FQ
;
A,B,D,E ? 
2 'polypeptide(L)' no no CSIM CSIM F,G,H,I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   MET n 
1 4   TRP n 
1 5   ALA n 
1 6   SER n 
1 7   LEU n 
1 8   ASP n 
1 9   ALA n 
1 10  LEU n 
1 11  TRP n 
1 12  GLU n 
1 13  MET n 
1 14  PRO n 
1 15  ALA n 
1 16  GLU n 
1 17  LYS n 
1 18  ARG n 
1 19  ILE n 
1 20  PHE n 
1 21  GLY n 
1 22  ALA n 
1 23  VAL n 
1 24  LEU n 
1 25  LEU n 
1 26  PHE n 
1 27  SER n 
1 28  TRP n 
1 29  THR n 
1 30  VAL n 
1 31  TYR n 
1 32  LEU n 
1 33  TRP n 
1 34  GLU n 
1 35  THR n 
1 36  PHE n 
1 37  LEU n 
1 38  ALA n 
1 39  GLN n 
1 40  ARG n 
1 41  GLN n 
1 42  ARG n 
1 43  ARG n 
1 44  ILE n 
1 45  TYR n 
1 46  LYS n 
1 47  THR n 
1 48  THR n 
1 49  THR n 
1 50  HIS n 
1 51  VAL n 
1 52  PRO n 
1 53  PRO n 
1 54  GLU n 
1 55  LEU n 
1 56  GLY n 
1 57  GLN n 
1 58  ILE n 
1 59  MET n 
1 60  ASP n 
1 61  SER n 
1 62  GLU n 
1 63  THR n 
1 64  PHE n 
1 65  GLU n 
1 66  LYS n 
1 67  SER n 
1 68  ARG n 
1 69  LEU n 
1 70  TYR n 
1 71  GLN n 
1 72  LEU n 
1 73  ASP n 
1 74  LYS n 
1 75  SER n 
1 76  THR n 
1 77  PHE n 
1 78  SER n 
1 79  PHE n 
1 80  TRP n 
1 81  SER n 
1 82  GLY n 
1 83  LEU n 
1 84  TYR n 
1 85  SER n 
1 86  GLU n 
1 87  THR n 
1 88  GLU n 
1 89  GLY n 
1 90  THR n 
1 91  LEU n 
1 92  ILE n 
1 93  LEU n 
1 94  LEU n 
1 95  PHE n 
1 96  GLY n 
1 97  GLY n 
1 98  ILE n 
1 99  PRO n 
1 100 TYR n 
1 101 LEU n 
1 102 TRP n 
1 103 ARG n 
1 104 LEU n 
1 105 SER n 
1 106 GLY n 
1 107 ARG n 
1 108 PHE n 
1 109 CYS n 
1 110 GLY n 
1 111 TYR n 
1 112 ALA n 
1 113 GLY n 
1 114 PHE n 
1 115 GLY n 
1 116 PRO n 
1 117 GLU n 
1 118 TYR n 
1 119 GLU n 
1 120 ILE n 
1 121 THR n 
1 122 GLN n 
1 123 SER n 
1 124 LEU n 
1 125 VAL n 
1 126 PHE n 
1 127 LEU n 
1 128 LEU n 
1 129 LEU n 
1 130 ALA n 
1 131 THR n 
1 132 LEU n 
1 133 PHE n 
1 134 SER n 
1 135 ALA n 
1 136 LEU n 
1 137 ALA n 
1 138 GLY n 
1 139 LEU n 
1 140 PRO n 
1 141 TRP n 
1 142 SER n 
1 143 LEU n 
1 144 TYR n 
1 145 ASN n 
1 146 THR n 
1 147 PHE n 
1 148 VAL n 
1 149 ILE n 
1 150 GLU n 
1 151 GLU n 
1 152 LYS n 
1 153 HIS n 
1 154 GLY n 
1 155 PHE n 
1 156 ASN n 
1 157 GLN n 
1 158 GLN n 
1 159 THR n 
1 160 LEU n 
1 161 GLY n 
1 162 PHE n 
1 163 PHE n 
1 164 MET n 
1 165 LYS n 
1 166 ASP n 
1 167 ALA n 
1 168 ILE n 
1 169 LYS n 
1 170 LYS n 
1 171 PHE n 
1 172 VAL n 
1 173 VAL n 
1 174 THR n 
1 175 GLN n 
1 176 CYS n 
1 177 ILE n 
1 178 LEU n 
1 179 LEU n 
1 180 PRO n 
1 181 VAL n 
1 182 SER n 
1 183 SER n 
1 184 LEU n 
1 185 LEU n 
1 186 LEU n 
1 187 TYR n 
1 188 ILE n 
1 189 ILE n 
1 190 LYS n 
1 191 ILE n 
1 192 GLY n 
1 193 GLY n 
1 194 ASP n 
1 195 TYR n 
1 196 PHE n 
1 197 PHE n 
1 198 ILE n 
1 199 TYR n 
1 200 ALA n 
1 201 TRP n 
1 202 LEU n 
1 203 PHE n 
1 204 THR n 
1 205 LEU n 
1 206 VAL n 
1 207 VAL n 
1 208 SER n 
1 209 LEU n 
1 210 VAL n 
1 211 LEU n 
1 212 VAL n 
1 213 THR n 
1 214 ILE n 
1 215 TYR n 
1 216 ALA n 
1 217 ASP n 
1 218 TYR n 
1 219 ILE n 
1 220 ALA n 
1 221 PRO n 
1 222 LEU n 
1 223 PHE n 
1 224 ASP n 
1 225 LYS n 
1 226 PHE n 
1 227 THR n 
1 228 PRO n 
1 229 LEU n 
1 230 PRO n 
1 231 GLU n 
1 232 GLY n 
1 233 LYS n 
1 234 LEU n 
1 235 LYS n 
1 236 GLU n 
1 237 GLU n 
1 238 ILE n 
1 239 GLU n 
1 240 VAL n 
1 241 MET n 
1 242 ALA n 
1 243 LYS n 
1 244 SER n 
1 245 ILE n 
1 246 ASP n 
1 247 PHE n 
1 248 PRO n 
1 249 LEU n 
1 250 THR n 
1 251 LYS n 
1 252 VAL n 
1 253 TYR n 
1 254 VAL n 
1 255 VAL n 
1 256 GLU n 
1 257 GLY n 
1 258 SER n 
1 259 LYS n 
1 260 ARG n 
1 261 SER n 
1 262 SER n 
1 263 HIS n 
1 264 SER n 
1 265 ASN n 
1 266 ALA n 
1 267 TYR n 
1 268 PHE n 
1 269 TYR n 
1 270 GLY n 
1 271 PHE n 
1 272 PHE n 
1 273 LYS n 
1 274 ASN n 
1 275 LYS n 
1 276 ARG n 
1 277 ILE n 
1 278 VAL n 
1 279 LEU n 
1 280 PHE n 
1 281 ASP n 
1 282 THR n 
1 283 LEU n 
1 284 LEU n 
1 285 GLU n 
1 286 GLU n 
1 287 TYR n 
1 288 SER n 
1 289 VAL n 
1 290 LEU n 
1 291 ASN n 
1 292 LYS n 
1 293 ASP n 
1 294 ILE n 
1 295 GLN n 
1 296 GLU n 
1 297 ASP n 
1 298 SER n 
1 299 GLY n 
1 300 MET n 
1 301 GLU n 
1 302 PRO n 
1 303 ARG n 
1 304 ASN n 
1 305 GLU n 
1 306 GLU n 
1 307 GLU n 
1 308 GLY n 
1 309 ASN n 
1 310 SER n 
1 311 GLU n 
1 312 GLU n 
1 313 ILE n 
1 314 LYS n 
1 315 ALA n 
1 316 LYS n 
1 317 VAL n 
1 318 LYS n 
1 319 ASN n 
1 320 LYS n 
1 321 LYS n 
1 322 GLN n 
1 323 GLY n 
1 324 CYS n 
1 325 LYS n 
1 326 ASN n 
1 327 GLU n 
1 328 GLU n 
1 329 VAL n 
1 330 LEU n 
1 331 ALA n 
1 332 VAL n 
1 333 LEU n 
1 334 GLY n 
1 335 HIS n 
1 336 ALA n 
1 337 LEU n 
1 338 GLY n 
1 339 HIS n 
1 340 TRP n 
1 341 LYS n 
1 342 LEU n 
1 343 GLY n 
1 344 HIS n 
1 345 THR n 
1 346 VAL n 
1 347 LYS n 
1 348 ASN n 
1 349 ILE n 
1 350 ILE n 
1 351 ILE n 
1 352 SER n 
1 353 GLN n 
1 354 MET n 
1 355 ASN n 
1 356 SER n 
1 357 PHE n 
1 358 LEU n 
1 359 CYS n 
1 360 PHE n 
1 361 PHE n 
1 362 LEU n 
1 363 PHE n 
1 364 ALA n 
1 365 VAL n 
1 366 LEU n 
1 367 ILE n 
1 368 GLY n 
1 369 ARG n 
1 370 LYS n 
1 371 GLU n 
1 372 LEU n 
1 373 PHE n 
1 374 ALA n 
1 375 ALA n 
1 376 PHE n 
1 377 GLY n 
1 378 PHE n 
1 379 TYR n 
1 380 ASP n 
1 381 SER n 
1 382 GLN n 
1 383 PRO n 
1 384 THR n 
1 385 LEU n 
1 386 ILE n 
1 387 GLY n 
1 388 LEU n 
1 389 LEU n 
1 390 ILE n 
1 391 ILE n 
1 392 PHE n 
1 393 GLN n 
1 394 PHE n 
1 395 ILE n 
1 396 PHE n 
1 397 SER n 
1 398 PRO n 
1 399 TYR n 
1 400 ASN n 
1 401 GLU n 
1 402 VAL n 
1 403 LEU n 
1 404 SER n 
1 405 PHE n 
1 406 CYS n 
1 407 LEU n 
1 408 THR n 
1 409 VAL n 
1 410 LEU n 
1 411 SER n 
1 412 ARG n 
1 413 ARG n 
1 414 PHE n 
1 415 GLU n 
1 416 PHE n 
1 417 GLN n 
1 418 ALA n 
1 419 ASP n 
1 420 ALA n 
1 421 PHE n 
1 422 ALA n 
1 423 LYS n 
1 424 LYS n 
1 425 LEU n 
1 426 GLY n 
1 427 LYS n 
1 428 ALA n 
1 429 LYS n 
1 430 ASP n 
1 431 LEU n 
1 432 TYR n 
1 433 SER n 
1 434 ALA n 
1 435 LEU n 
1 436 ILE n 
1 437 LYS n 
1 438 LEU n 
1 439 ASN n 
1 440 LYS n 
1 441 ASP n 
1 442 ASN n 
1 443 LEU n 
1 444 GLY n 
1 445 PHE n 
1 446 PRO n 
1 447 VAL n 
1 448 SER n 
1 449 ASP n 
1 450 TRP n 
1 451 LEU n 
1 452 PHE n 
1 453 SER n 
1 454 MET n 
1 455 TRP n 
1 456 HIS n 
1 457 TYR n 
1 458 SER n 
1 459 HIS n 
1 460 PRO n 
1 461 PRO n 
1 462 LEU n 
1 463 LEU n 
1 464 GLU n 
1 465 ARG n 
1 466 LEU n 
1 467 GLN n 
1 468 ALA n 
1 469 LEU n 
1 470 LYS n 
1 471 THR n 
1 472 MET n 
1 473 LYS n 
1 474 GLN n 
1 475 HIS n 
1 476 ALA n 
1 477 GLU n 
1 478 ASN n 
1 479 LEU n 
1 480 TYR n 
1 481 PHE n 
1 482 GLN n 
2 1   CYS n 
2 2   SER n 
2 3   ILE n 
2 4   MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'FALL ARMYWORM' 
_entity_src_gen.pdbx_host_org_scientific_name      'SPODOPTERA FRUGIPERDA' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PFB-CT10HF-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP FACE1_HUMAN 1 ? ? O75844 ? 
2 UNP LMNA_HUMAN  2 ? ? P02545 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2YPT A 1 ? 475 ? O75844 1   ? 475 ? 1   475 
2 1 2YPT B 1 ? 475 ? O75844 1   ? 475 ? 1   475 
3 1 2YPT D 1 ? 475 ? O75844 1   ? 475 ? 1   475 
4 1 2YPT E 1 ? 475 ? O75844 1   ? 475 ? 1   475 
5 2 2YPT F 1 ? 4   ? P02545 661 ? 664 ? 661 664 
6 2 2YPT G 1 ? 4   ? P02545 661 ? 664 ? 661 664 
7 2 2YPT H 1 ? 4   ? P02545 661 ? 664 ? 661 664 
8 2 2YPT I 1 ? 4   ? P02545 661 ? 664 ? 661 664 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2YPT ALA A 137 ? UNP O75844 THR 137 variant               137 1  
1 2YPT ALA A 336 ? UNP O75844 GLU 336 'engineered mutation' 336 2  
1 2YPT ALA A 476 ? UNP O75844 ?   ?   'expression tag'      476 3  
1 2YPT GLU A 477 ? UNP O75844 ?   ?   'expression tag'      477 4  
1 2YPT ASN A 478 ? UNP O75844 ?   ?   'expression tag'      478 5  
1 2YPT LEU A 479 ? UNP O75844 ?   ?   'expression tag'      479 6  
1 2YPT TYR A 480 ? UNP O75844 ?   ?   'expression tag'      480 7  
1 2YPT PHE A 481 ? UNP O75844 ?   ?   'expression tag'      481 8  
1 2YPT GLN A 482 ? UNP O75844 ?   ?   'expression tag'      482 9  
2 2YPT ALA B 137 ? UNP O75844 THR 137 variant               137 10 
2 2YPT ALA B 336 ? UNP O75844 GLU 336 'engineered mutation' 336 11 
2 2YPT ALA B 476 ? UNP O75844 ?   ?   'expression tag'      476 12 
2 2YPT GLU B 477 ? UNP O75844 ?   ?   'expression tag'      477 13 
2 2YPT ASN B 478 ? UNP O75844 ?   ?   'expression tag'      478 14 
2 2YPT LEU B 479 ? UNP O75844 ?   ?   'expression tag'      479 15 
2 2YPT TYR B 480 ? UNP O75844 ?   ?   'expression tag'      480 16 
2 2YPT PHE B 481 ? UNP O75844 ?   ?   'expression tag'      481 17 
2 2YPT GLN B 482 ? UNP O75844 ?   ?   'expression tag'      482 18 
3 2YPT ALA D 137 ? UNP O75844 THR 137 variant               137 19 
3 2YPT ALA D 336 ? UNP O75844 GLU 336 'engineered mutation' 336 20 
3 2YPT ALA D 476 ? UNP O75844 ?   ?   'expression tag'      476 21 
3 2YPT GLU D 477 ? UNP O75844 ?   ?   'expression tag'      477 22 
3 2YPT ASN D 478 ? UNP O75844 ?   ?   'expression tag'      478 23 
3 2YPT LEU D 479 ? UNP O75844 ?   ?   'expression tag'      479 24 
3 2YPT TYR D 480 ? UNP O75844 ?   ?   'expression tag'      480 25 
3 2YPT PHE D 481 ? UNP O75844 ?   ?   'expression tag'      481 26 
3 2YPT GLN D 482 ? UNP O75844 ?   ?   'expression tag'      482 27 
4 2YPT ALA E 137 ? UNP O75844 THR 137 variant               137 28 
4 2YPT ALA E 336 ? UNP O75844 GLU 336 'engineered mutation' 336 29 
4 2YPT ALA E 476 ? UNP O75844 ?   ?   'expression tag'      476 30 
4 2YPT GLU E 477 ? UNP O75844 ?   ?   'expression tag'      477 31 
4 2YPT ASN E 478 ? UNP O75844 ?   ?   'expression tag'      478 32 
4 2YPT LEU E 479 ? UNP O75844 ?   ?   'expression tag'      479 33 
4 2YPT TYR E 480 ? UNP O75844 ?   ?   'expression tag'      480 34 
4 2YPT PHE E 481 ? UNP O75844 ?   ?   'expression tag'      481 35 
4 2YPT GLN E 482 ? UNP O75844 ?   ?   'expression tag'      482 36 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          2YPT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.2 
_exptl_crystal.density_percent_sol   61.55 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M HEPES PH 7.0, 0.1M CALCIUM CHLORIDE, 29%(V/V) PEG 400' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2012-02-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9686 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_wavelength             0.9686 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2YPT 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             38.50 
_reflns.d_resolution_high            3.80 
_reflns.number_obs                   26943 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.80 
_reflns.B_iso_Wilson_estimate        134.21 
_reflns.pdbx_redundancy              3.3 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.80 
_reflns_shell.d_res_low              3.90 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.69 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.60 
_reflns_shell.pdbx_redundancy        3.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2YPT 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     26939 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.50 
_refine.ls_d_res_high                            3.80 
_refine.ls_percent_reflns_obs                    99.33 
_refine.ls_R_factor_obs                          0.2635 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2625 
_refine.ls_R_factor_R_free                       0.2811 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.27 
_refine.ls_number_reflns_R_free                  1420 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.8843 
_refine.correlation_coeff_Fo_to_Fc_free          0.8837 
_refine.B_iso_mean                               173.48 
_refine.aniso_B[1][1]                            -10.3701 
_refine.aniso_B[2][2]                            12.8077 
_refine.aniso_B[3][3]                            -2.4377 
_refine.aniso_B[1][2]                            -5.7593 
_refine.aniso_B[1][3]                            -8.3756 
_refine.aniso_B[2][3]                            -3.6883 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'4AW6 USED AS LSSR TARGET REST OF 0.1. AUTONCS AND TLS. ONE TLS GROUP PER ENZYME PEPTIDE COMPLEX EMPLOYED' 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.687 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2YPT 
_refine_analyze.Luzzati_coordinate_error_obs    1.324 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12481 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12485 
_refine_hist.d_res_high                       3.80 
_refine_hist.d_res_low                        38.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.008 ? 2.00  12864 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               0.86  ? 2.00  17608 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  5406  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  177   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  1966  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 12864 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? 5.00  0     'X-RAY DIFFRACTION' SEMIHARMONIC 
t_omega_torsion           1.73  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_other_torsion           2.63  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  1757  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? 1.00  16    'X-RAY DIFFRACTION' HARMONIC     
t_utility_angle           ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  14868 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   14 
_refine_ls_shell.d_res_high                       3.80 
_refine_ls_shell.d_res_low                        3.94 
_refine_ls_shell.number_reflns_R_work             2668 
_refine_ls_shell.R_factor_R_work                  0.2242 
_refine_ls_shell.percent_reflns_obs               99.33 
_refine_ls_shell.R_factor_R_free                  0.2487 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.22 
_refine_ls_shell.number_reflns_R_free             147 
_refine_ls_shell.number_reflns_all                2815 
_refine_ls_shell.R_factor_all                     0.2256 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.999960 -0.004940 -0.006770 -0.004170 -0.406610 0.913590  -0.007270 0.913590  0.406580  297.16388 88.52379  -55.95213 
2 given ? -0.999750 -0.006380 0.021540  -0.022360 0.379090  -0.925090 -0.002260 -0.925340 -0.379130 300.23688 243.94095 398.61621 
3 given ? 0.999980  -0.001390 -0.005960 -0.001270 -0.999820 0.018680  -0.005990 -0.018670 -0.999810 -5.96792  355.48517 323.57315 
# 
_struct.entry_id                  2YPT 
_struct.title                     
;Crystal structure of the human nuclear membrane zinc metalloprotease ZMPSTE24 mutant (E336A) in complex with a synthetic CSIM tetrapeptide from the C-terminus of prelamin A
;
_struct.pdbx_descriptor           'CAAX PRENYL PROTEASE 1 HOMOLOG (E.C.3.4.24.84), PRELAMIN-A/C' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2YPT 
_struct_keywords.pdbx_keywords   HYDROLASE/PEPTIDE 
_struct_keywords.text            
'HYDROLASE-PEPTIDE COMPLEX, M48 PEPTIDASE, INTEGRAL MEMBRANE PROTEIN, PRELAMIN A PROCESSING, AGEING, PROGERIA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 15  ? THR A 48  ? ALA A 15  THR A 48  1 ? 34 
HELX_P HELX_P2  2  ASP A 60  ? GLY A 96  ? ASP A 60  GLY A 96  1 ? 37 
HELX_P HELX_P3  3  GLY A 96  ? SER A 105 ? GLY A 96  SER A 105 1 ? 10 
HELX_P HELX_P4  4  PRO A 116 ? HIS A 153 ? PRO A 116 HIS A 153 1 ? 38 
HELX_P HELX_P5  5  THR A 159 ? GLY A 192 ? THR A 159 GLY A 192 1 ? 34 
HELX_P HELX_P6  6  TYR A 195 ? ILE A 219 ? TYR A 195 ILE A 219 1 ? 25 
HELX_P HELX_P7  7  ILE A 219 ? ASP A 224 ? ILE A 219 ASP A 224 1 ? 6  
HELX_P HELX_P8  8  GLY A 232 ? ILE A 245 ? GLY A 232 ILE A 245 1 ? 14 
HELX_P HELX_P9  9  GLY A 257 ? ARG A 260 ? GLY A 257 ARG A 260 5 ? 4  
HELX_P HELX_P10 10 ASP A 281 ? GLU A 285 ? ASP A 281 GLU A 285 1 ? 5  
HELX_P HELX_P11 11 LYS A 325 ? LEU A 342 ? LYS A 325 LEU A 342 1 ? 18 
HELX_P HELX_P12 12 GLY A 343 ? ILE A 367 ? GLY A 343 ILE A 367 1 ? 25 
HELX_P HELX_P13 13 LYS A 370 ? PHE A 376 ? LYS A 370 PHE A 376 1 ? 7  
HELX_P HELX_P14 14 PRO A 383 ? PHE A 394 ? PRO A 383 PHE A 394 1 ? 12 
HELX_P HELX_P15 15 PHE A 396 ? LEU A 425 ? PHE A 396 LEU A 425 1 ? 30 
HELX_P HELX_P16 16 LYS A 427 ? ASN A 442 ? LYS A 427 ASN A 442 1 ? 16 
HELX_P HELX_P17 17 ASP A 449 ? HIS A 456 ? ASP A 449 HIS A 456 1 ? 8  
HELX_P HELX_P18 18 PRO A 461 ? MET A 472 ? PRO A 461 MET A 472 1 ? 12 
HELX_P HELX_P19 19 ALA B 15  ? THR B 48  ? ALA B 15  THR B 48  1 ? 34 
HELX_P HELX_P20 20 ASP B 60  ? GLY B 96  ? ASP B 60  GLY B 96  1 ? 37 
HELX_P HELX_P21 21 GLY B 96  ? SER B 105 ? GLY B 96  SER B 105 1 ? 10 
HELX_P HELX_P22 22 PRO B 116 ? HIS B 153 ? PRO B 116 HIS B 153 1 ? 38 
HELX_P HELX_P23 23 THR B 159 ? GLY B 192 ? THR B 159 GLY B 192 1 ? 34 
HELX_P HELX_P24 24 TYR B 195 ? ALA B 216 ? TYR B 195 ALA B 216 1 ? 22 
HELX_P HELX_P25 25 ILE B 219 ? PHE B 223 ? ILE B 219 PHE B 223 5 ? 5  
HELX_P HELX_P26 26 GLY B 232 ? ILE B 245 ? GLY B 232 ILE B 245 1 ? 14 
HELX_P HELX_P27 27 GLY B 257 ? ARG B 260 ? GLY B 257 ARG B 260 5 ? 4  
HELX_P HELX_P28 28 ASP B 281 ? GLU B 285 ? ASP B 281 GLU B 285 1 ? 5  
HELX_P HELX_P29 29 LYS B 325 ? LEU B 342 ? LYS B 325 LEU B 342 1 ? 18 
HELX_P HELX_P30 30 GLY B 343 ? ILE B 367 ? GLY B 343 ILE B 367 1 ? 25 
HELX_P HELX_P31 31 LYS B 370 ? PHE B 376 ? LYS B 370 PHE B 376 1 ? 7  
HELX_P HELX_P32 32 PRO B 383 ? PHE B 394 ? PRO B 383 PHE B 394 1 ? 12 
HELX_P HELX_P33 33 PHE B 396 ? LEU B 425 ? PHE B 396 LEU B 425 1 ? 30 
HELX_P HELX_P34 34 LYS B 427 ? ASN B 442 ? LYS B 427 ASN B 442 1 ? 16 
HELX_P HELX_P35 35 ASP B 449 ? HIS B 456 ? ASP B 449 HIS B 456 1 ? 8  
HELX_P HELX_P36 36 PRO B 461 ? MET B 472 ? PRO B 461 MET B 472 1 ? 12 
HELX_P HELX_P37 37 ALA C 15  ? THR C 48  ? ALA D 15  THR D 48  1 ? 34 
HELX_P HELX_P38 38 ASP C 60  ? GLY C 96  ? ASP D 60  GLY D 96  1 ? 37 
HELX_P HELX_P39 39 GLY C 96  ? SER C 105 ? GLY D 96  SER D 105 1 ? 10 
HELX_P HELX_P40 40 PRO C 116 ? HIS C 153 ? PRO D 116 HIS D 153 1 ? 38 
HELX_P HELX_P41 41 THR C 159 ? GLY C 192 ? THR D 159 GLY D 192 1 ? 34 
HELX_P HELX_P42 42 TYR C 195 ? ALA C 216 ? TYR D 195 ALA D 216 1 ? 22 
HELX_P HELX_P43 43 ILE C 219 ? PHE C 223 ? ILE D 219 PHE D 223 5 ? 5  
HELX_P HELX_P44 44 GLY C 232 ? ILE C 245 ? GLY D 232 ILE D 245 1 ? 14 
HELX_P HELX_P45 45 GLY C 257 ? ARG C 260 ? GLY D 257 ARG D 260 5 ? 4  
HELX_P HELX_P46 46 ASP C 281 ? GLU C 285 ? ASP D 281 GLU D 285 1 ? 5  
HELX_P HELX_P47 47 LYS C 325 ? LEU C 342 ? LYS D 325 LEU D 342 1 ? 18 
HELX_P HELX_P48 48 GLY C 343 ? ILE C 367 ? GLY D 343 ILE D 367 1 ? 25 
HELX_P HELX_P49 49 LYS C 370 ? PHE C 376 ? LYS D 370 PHE D 376 1 ? 7  
HELX_P HELX_P50 50 PRO C 383 ? PHE C 394 ? PRO D 383 PHE D 394 1 ? 12 
HELX_P HELX_P51 51 PHE C 396 ? LEU C 425 ? PHE D 396 LEU D 425 1 ? 30 
HELX_P HELX_P52 52 LYS C 427 ? ASN C 442 ? LYS D 427 ASN D 442 1 ? 16 
HELX_P HELX_P53 53 ASP C 449 ? HIS C 456 ? ASP D 449 HIS D 456 1 ? 8  
HELX_P HELX_P54 54 PRO C 461 ? THR C 471 ? PRO D 461 THR D 471 1 ? 11 
HELX_P HELX_P55 55 ALA D 15  ? THR D 48  ? ALA E 15  THR E 48  1 ? 34 
HELX_P HELX_P56 56 ASP D 60  ? GLY D 96  ? ASP E 60  GLY E 96  1 ? 37 
HELX_P HELX_P57 57 GLY D 96  ? SER D 105 ? GLY E 96  SER E 105 1 ? 10 
HELX_P HELX_P58 58 PRO D 116 ? HIS D 153 ? PRO E 116 HIS E 153 1 ? 38 
HELX_P HELX_P59 59 THR D 159 ? GLY D 192 ? THR E 159 GLY E 192 1 ? 34 
HELX_P HELX_P60 60 TYR D 195 ? ILE D 219 ? TYR E 195 ILE E 219 1 ? 25 
HELX_P HELX_P61 61 ALA D 220 ? PHE D 223 ? ALA E 220 PHE E 223 5 ? 4  
HELX_P HELX_P62 62 GLY D 232 ? ILE D 245 ? GLY E 232 ILE E 245 1 ? 14 
HELX_P HELX_P63 63 GLY D 257 ? ARG D 260 ? GLY E 257 ARG E 260 5 ? 4  
HELX_P HELX_P64 64 ASP D 281 ? GLU D 285 ? ASP E 281 GLU E 285 1 ? 5  
HELX_P HELX_P65 65 LYS D 325 ? LEU D 342 ? LYS E 325 LEU E 342 1 ? 18 
HELX_P HELX_P66 66 GLY D 343 ? ILE D 367 ? GLY E 343 ILE E 367 1 ? 25 
HELX_P HELX_P67 67 LYS D 370 ? PHE D 376 ? LYS E 370 PHE E 376 1 ? 7  
HELX_P HELX_P68 68 PRO D 383 ? PHE D 394 ? PRO E 383 PHE E 394 1 ? 12 
HELX_P HELX_P69 69 PHE D 396 ? LEU D 425 ? PHE E 396 LEU E 425 1 ? 30 
HELX_P HELX_P70 70 LYS D 427 ? ASN D 442 ? LYS E 427 ASN E 442 1 ? 16 
HELX_P HELX_P71 71 ASP D 449 ? HIS D 456 ? ASP E 449 HIS E 456 1 ? 8  
HELX_P HELX_P72 72 PRO D 461 ? THR D 471 ? PRO E 461 THR E 471 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? I ZN . ZN ? ? ? 1_555 E SER 2   O   ? ? A ZN 600 F SER 662 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc2  metalc ? ? I ZN . ZN ? ? ? 1_555 A HIS 335 NE2 ? ? A ZN 600 A HIS 335 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc3  metalc ? ? I ZN . ZN ? ? ? 1_555 A GLU 415 OE2 ? ? A ZN 600 A GLU 415 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc4  metalc ? ? I ZN . ZN ? ? ? 1_555 A HIS 339 NE2 ? ? A ZN 600 A HIS 339 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc5  metalc ? ? J ZN . ZN ? ? ? 1_555 B HIS 335 NE2 ? ? B ZN 600 B HIS 335 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc6  metalc ? ? J ZN . ZN ? ? ? 1_555 B HIS 339 NE2 ? ? B ZN 600 B HIS 339 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc7  metalc ? ? J ZN . ZN ? ? ? 1_555 B GLU 415 OE2 ? ? B ZN 600 B GLU 415 1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc8  metalc ? ? J ZN . ZN ? ? ? 1_555 F SER 2   O   ? ? B ZN 600 G SER 662 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc9  metalc ? ? K ZN . ZN ? ? ? 1_555 C GLU 415 OE2 ? ? D ZN 600 D GLU 415 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc10 metalc ? ? K ZN . ZN ? ? ? 1_555 G SER 2   O   ? ? D ZN 600 H SER 662 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc11 metalc ? ? K ZN . ZN ? ? ? 1_555 C HIS 335 NE2 ? ? D ZN 600 D HIS 335 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc12 metalc ? ? K ZN . ZN ? ? ? 1_555 C HIS 339 NE2 ? ? D ZN 600 D HIS 339 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc13 metalc ? ? L ZN . ZN ? ? ? 1_555 D GLU 415 OE2 ? ? E ZN 600 E GLU 415 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc14 metalc ? ? L ZN . ZN ? ? ? 1_555 H SER 2   O   ? ? E ZN 600 I SER 662 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc15 metalc ? ? L ZN . ZN ? ? ? 1_555 D HIS 335 NE2 ? ? E ZN 600 E HIS 335 1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc16 metalc ? ? L ZN . ZN ? ? ? 1_555 D HIS 339 NE2 ? ? E ZN 600 E HIS 339 1_555 ? ? ? ? ? ? ? 2.197 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 193 A . ? GLY 193 A ASP 194 A ? ASP 194 A 1 -0.48 
2 GLY 193 B . ? GLY 193 B ASP 194 B ? ASP 194 B 1 -0.52 
3 GLY 193 C . ? GLY 193 D ASP 194 C ? ASP 194 D 1 0.28  
4 GLY 193 D . ? GLY 193 E ASP 194 D ? ASP 194 E 1 -0.56 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
BA ? 4 ? 
DA ? 4 ? 
EA ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? parallel      
BA 3 4 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? parallel      
DA 3 4 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? parallel      
EA 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 226 ? PRO A 228 ? PHE A 226 PRO A 228 
AA 2 VAL A 252 ? VAL A 255 ? VAL A 252 VAL A 255 
AA 3 ARG A 276 ? PHE A 280 ? ARG A 276 PHE A 280 
AA 4 ALA A 266 ? TYR A 269 ? ALA A 266 TYR A 269 
BA 1 PHE B 226 ? PRO B 228 ? PHE B 226 PRO B 228 
BA 2 VAL B 252 ? VAL B 255 ? VAL B 252 VAL B 255 
BA 3 ARG B 276 ? PHE B 280 ? ARG B 276 PHE B 280 
BA 4 ALA B 266 ? TYR B 269 ? ALA B 266 TYR B 269 
DA 1 PHE C 226 ? PRO C 228 ? PHE D 226 PRO D 228 
DA 2 VAL C 252 ? VAL C 255 ? VAL D 252 VAL D 255 
DA 3 ARG C 276 ? PHE C 280 ? ARG D 276 PHE D 280 
DA 4 ALA C 266 ? TYR C 269 ? ALA D 266 TYR D 269 
EA 1 PHE D 226 ? PRO D 228 ? PHE E 226 PRO E 228 
EA 2 VAL D 252 ? VAL D 255 ? VAL E 252 VAL E 255 
EA 3 ARG D 276 ? PHE D 280 ? ARG E 276 PHE E 280 
EA 4 ALA D 266 ? TYR D 269 ? ALA E 266 TYR E 269 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 227 ? N THR A 227 O VAL A 254 ? O VAL A 254 
AA 2 3 N TYR A 253 ? N TYR A 253 O ILE A 277 ? O ILE A 277 
AA 3 4 N VAL A 278 ? N VAL A 278 O TYR A 267 ? O TYR A 267 
BA 1 2 N THR B 227 ? N THR B 227 O VAL B 254 ? O VAL B 254 
BA 2 3 N TYR B 253 ? N TYR B 253 O ILE B 277 ? O ILE B 277 
BA 3 4 N VAL B 278 ? N VAL B 278 O TYR B 267 ? O TYR B 267 
DA 1 2 N THR C 227 ? N THR D 227 O VAL C 254 ? O VAL D 254 
DA 2 3 N TYR C 253 ? N TYR D 253 O ILE C 277 ? O ILE D 277 
DA 3 4 N VAL C 278 ? N VAL D 278 O TYR C 267 ? O TYR D 267 
EA 1 2 N THR D 227 ? N THR E 227 O VAL D 254 ? O VAL E 254 
EA 2 3 N TYR D 253 ? N TYR E 253 O ILE D 277 ? O ILE E 277 
EA 3 4 N VAL D 278 ? N VAL E 278 O TYR D 267 ? O TYR E 267 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 600' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 600' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 600' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN E 600' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 335 ? HIS A 335 . ? 1_555 ? 
2  AC1 4 HIS A 339 ? HIS A 339 . ? 1_555 ? 
3  AC1 4 GLU A 415 ? GLU A 415 . ? 1_555 ? 
4  AC1 4 SER E 2   ? SER F 662 . ? 1_555 ? 
5  AC2 4 HIS B 335 ? HIS B 335 . ? 1_555 ? 
6  AC2 4 HIS B 339 ? HIS B 339 . ? 1_555 ? 
7  AC2 4 GLU B 415 ? GLU B 415 . ? 1_555 ? 
8  AC2 4 SER F 2   ? SER G 662 . ? 1_555 ? 
9  AC3 4 HIS C 335 ? HIS D 335 . ? 1_555 ? 
10 AC3 4 HIS C 339 ? HIS D 339 . ? 1_555 ? 
11 AC3 4 GLU C 415 ? GLU D 415 . ? 1_555 ? 
12 AC3 4 SER G 2   ? SER H 662 . ? 1_555 ? 
13 AC4 4 HIS D 335 ? HIS E 335 . ? 1_555 ? 
14 AC4 4 HIS D 339 ? HIS E 339 . ? 1_555 ? 
15 AC4 4 GLU D 415 ? GLU E 415 . ? 1_555 ? 
16 AC4 4 SER H 2   ? SER I 662 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2YPT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2YPT 
_atom_sites.fract_transf_matrix[1][1]   0.016308 
_atom_sites.fract_transf_matrix[1][2]   -0.005205 
_atom_sites.fract_transf_matrix[1][3]   -0.001995 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010987 
_atom_sites.fract_transf_matrix[2][3]   -0.002187 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007850 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLY A 1 2   ? 111.909 212.365 187.683 1.00 255.58 ? 2   GLY A N   1 
ATOM   2     C  CA  . GLY A 1 2   ? 113.335 212.462 187.968 1.00 253.93 ? 2   GLY A CA  1 
ATOM   3     C  C   . GLY A 1 2   ? 113.685 212.161 189.411 1.00 255.90 ? 2   GLY A C   1 
ATOM   4     O  O   . GLY A 1 2   ? 114.580 211.352 189.677 1.00 254.09 ? 2   GLY A O   1 
ATOM   5     N  N   . MET A 1 3   ? 112.978 212.818 190.352 1.00 254.88 ? 3   MET A N   1 
ATOM   6     C  CA  . MET A 1 3   ? 113.170 212.660 191.796 1.00 254.63 ? 3   MET A CA  1 
ATOM   7     C  C   . MET A 1 3   ? 112.022 211.864 192.440 1.00 257.58 ? 3   MET A C   1 
ATOM   8     O  O   . MET A 1 3   ? 112.275 211.078 193.357 1.00 256.83 ? 3   MET A O   1 
ATOM   9     C  CB  . MET A 1 3   ? 113.306 214.032 192.475 1.00 257.14 ? 3   MET A CB  1 
ATOM   10    N  N   . TRP A 1 4   ? 110.772 212.067 191.960 1.00 256.05 ? 4   TRP A N   1 
ATOM   11    C  CA  . TRP A 1 4   ? 109.567 211.390 192.459 1.00 256.66 ? 4   TRP A CA  1 
ATOM   12    C  C   . TRP A 1 4   ? 109.541 209.897 192.089 1.00 257.20 ? 4   TRP A C   1 
ATOM   13    O  O   . TRP A 1 4   ? 108.918 209.108 192.802 1.00 257.44 ? 4   TRP A O   1 
ATOM   14    C  CB  . TRP A 1 4   ? 108.302 212.077 191.931 1.00 257.73 ? 4   TRP A CB  1 
ATOM   15    C  CG  . TRP A 1 4   ? 108.125 213.480 192.428 1.00 259.67 ? 4   TRP A CG  1 
ATOM   16    C  CD1 . TRP A 1 4   ? 108.602 214.619 191.850 1.00 261.68 ? 4   TRP A CD1 1 
ATOM   17    C  CD2 . TRP A 1 4   ? 107.416 213.892 193.605 1.00 260.96 ? 4   TRP A CD2 1 
ATOM   18    N  NE1 . TRP A 1 4   ? 108.232 215.717 192.591 1.00 262.66 ? 4   TRP A NE1 1 
ATOM   19    C  CE2 . TRP A 1 4   ? 107.503 215.300 193.675 1.00 263.15 ? 4   TRP A CE2 1 
ATOM   20    C  CE3 . TRP A 1 4   ? 106.711 213.206 194.611 1.00 262.26 ? 4   TRP A CE3 1 
ATOM   21    C  CZ2 . TRP A 1 4   ? 106.913 216.038 194.711 1.00 262.96 ? 4   TRP A CZ2 1 
ATOM   22    C  CZ3 . TRP A 1 4   ? 106.128 213.938 195.637 1.00 262.79 ? 4   TRP A CZ3 1 
ATOM   23    C  CH2 . TRP A 1 4   ? 106.231 215.335 195.680 1.00 263.03 ? 4   TRP A CH2 1 
ATOM   24    N  N   . ALA A 1 5   ? 110.208 209.517 190.980 1.00 252.66 ? 5   ALA A N   1 
ATOM   25    C  CA  . ALA A 1 5   ? 110.289 208.136 190.496 1.00 251.12 ? 5   ALA A CA  1 
ATOM   26    C  C   . ALA A 1 5   ? 111.374 207.327 191.233 1.00 250.51 ? 5   ALA A C   1 
ATOM   27    O  O   . ALA A 1 5   ? 111.288 206.097 191.275 1.00 249.87 ? 5   ALA A O   1 
ATOM   28    C  CB  . ALA A 1 5   ? 110.559 208.125 188.999 1.00 251.17 ? 5   ALA A CB  1 
ATOM   29    N  N   . SER A 1 6   ? 112.382 208.015 191.816 1.00 246.04 ? 6   SER A N   1 
ATOM   30    C  CA  . SER A 1 6   ? 113.496 207.403 192.554 1.00 243.79 ? 6   SER A CA  1 
ATOM   31    C  C   . SER A 1 6   ? 113.101 206.998 193.994 1.00 245.32 ? 6   SER A C   1 
ATOM   32    O  O   . SER A 1 6   ? 113.849 206.259 194.645 1.00 243.94 ? 6   SER A O   1 
ATOM   33    C  CB  . SER A 1 6   ? 114.688 208.356 192.594 1.00 245.03 ? 6   SER A CB  1 
ATOM   34    O  OG  . SER A 1 6   ? 115.125 208.701 191.290 1.00 249.33 ? 6   SER A OG  1 
ATOM   35    N  N   . LEU A 1 7   ? 111.928 207.473 194.475 1.00 243.40 ? 7   LEU A N   1 
ATOM   36    C  CA  . LEU A 1 7   ? 111.385 207.217 195.818 1.00 243.47 ? 7   LEU A CA  1 
ATOM   37    C  C   . LEU A 1 7   ? 110.444 205.981 195.854 1.00 245.02 ? 7   LEU A C   1 
ATOM   38    O  O   . LEU A 1 7   ? 110.010 205.577 196.938 1.00 245.38 ? 7   LEU A O   1 
ATOM   39    C  CB  . LEU A 1 7   ? 110.634 208.476 196.307 1.00 245.08 ? 7   LEU A CB  1 
ATOM   40    C  CG  . LEU A 1 7   ? 110.511 208.685 197.822 1.00 248.90 ? 7   LEU A CG  1 
ATOM   41    C  CD1 . LEU A 1 7   ? 111.765 209.328 198.399 1.00 248.19 ? 7   LEU A CD1 1 
ATOM   42    C  CD2 . LEU A 1 7   ? 109.307 209.546 198.150 1.00 252.36 ? 7   LEU A CD2 1 
ATOM   43    N  N   . ASP A 1 8   ? 110.151 205.374 194.682 1.00 241.22 ? 8   ASP A N   1 
ATOM   44    C  CA  . ASP A 1 8   ? 109.278 204.200 194.563 1.00 241.03 ? 8   ASP A CA  1 
ATOM   45    C  C   . ASP A 1 8   ? 109.951 202.938 195.126 1.00 240.69 ? 8   ASP A C   1 
ATOM   46    O  O   . ASP A 1 8   ? 111.106 202.654 194.796 1.00 239.01 ? 8   ASP A O   1 
ATOM   47    C  CB  . ASP A 1 8   ? 108.861 203.974 193.096 1.00 242.47 ? 8   ASP A CB  1 
ATOM   48    C  CG  . ASP A 1 8   ? 108.119 205.132 192.448 1.00 251.07 ? 8   ASP A CG  1 
ATOM   49    O  OD1 . ASP A 1 8   ? 107.395 205.860 193.169 1.00 252.75 ? 8   ASP A OD1 1 
ATOM   50    O  OD2 . ASP A 1 8   ? 108.227 205.286 191.214 1.00 255.19 ? 8   ASP A OD2 1 
ATOM   51    N  N   . ALA A 1 9   ? 109.219 202.191 195.981 1.00 237.51 ? 9   ALA A N   1 
ATOM   52    C  CA  . ALA A 1 9   ? 109.701 200.966 196.629 1.00 235.72 ? 9   ALA A CA  1 
ATOM   53    C  C   . ALA A 1 9   ? 109.086 199.703 196.006 1.00 236.07 ? 9   ALA A C   1 
ATOM   54    O  O   . ALA A 1 9   ? 107.882 199.671 195.729 1.00 237.33 ? 9   ALA A O   1 
ATOM   55    C  CB  . ALA A 1 9   ? 109.396 201.013 198.119 1.00 237.02 ? 9   ALA A CB  1 
ATOM   56    N  N   . LEU A 1 10  ? 109.925 198.663 195.801 1.00 230.22 ? 10  LEU A N   1 
ATOM   57    C  CA  . LEU A 1 10  ? 109.545 197.370 195.218 1.00 229.17 ? 10  LEU A CA  1 
ATOM   58    C  C   . LEU A 1 10  ? 109.380 196.296 196.293 1.00 229.10 ? 10  LEU A C   1 
ATOM   59    O  O   . LEU A 1 10  ? 110.278 196.120 197.121 1.00 227.90 ? 10  LEU A O   1 
ATOM   60    C  CB  . LEU A 1 10  ? 110.600 196.911 194.194 1.00 227.69 ? 10  LEU A CB  1 
ATOM   61    C  CG  . LEU A 1 10  ? 110.512 197.513 192.801 1.00 230.86 ? 10  LEU A CG  1 
ATOM   62    C  CD1 . LEU A 1 10  ? 111.454 198.700 192.656 1.00 229.94 ? 10  LEU A CD1 1 
ATOM   63    C  CD2 . LEU A 1 10  ? 110.840 196.472 191.753 1.00 231.95 ? 10  LEU A CD2 1 
ATOM   64    N  N   . TRP A 1 11  ? 108.242 195.568 196.265 1.00 225.77 ? 11  TRP A N   1 
ATOM   65    C  CA  . TRP A 1 11  ? 107.936 194.486 197.209 1.00 225.09 ? 11  TRP A CA  1 
ATOM   66    C  C   . TRP A 1 11  ? 108.326 193.115 196.613 1.00 224.30 ? 11  TRP A C   1 
ATOM   67    O  O   . TRP A 1 11  ? 107.882 192.070 197.102 1.00 224.71 ? 11  TRP A O   1 
ATOM   68    C  CB  . TRP A 1 11  ? 106.446 194.518 197.593 1.00 226.33 ? 11  TRP A CB  1 
ATOM   69    N  N   . GLU A 1 12  ? 109.180 193.135 195.567 1.00 218.65 ? 12  GLU A N   1 
ATOM   70    C  CA  . GLU A 1 12  ? 109.659 191.954 194.845 1.00 216.99 ? 12  GLU A CA  1 
ATOM   71    C  C   . GLU A 1 12  ? 111.183 191.992 194.601 1.00 216.28 ? 12  GLU A C   1 
ATOM   72    O  O   . GLU A 1 12  ? 111.783 190.932 194.415 1.00 215.41 ? 12  GLU A O   1 
ATOM   73    C  CB  . GLU A 1 12  ? 108.933 191.831 193.492 1.00 218.52 ? 12  GLU A CB  1 
ATOM   74    C  CG  . GLU A 1 12  ? 107.448 191.518 193.592 1.00 223.86 ? 12  GLU A CG  1 
ATOM   75    C  CD  . GLU A 1 12  ? 106.608 192.068 192.455 1.00 227.59 ? 12  GLU A CD  1 
ATOM   76    O  OE1 . GLU A 1 12  ? 106.793 191.608 191.306 1.00 218.21 ? 12  GLU A OE1 1 
ATOM   77    O  OE2 . GLU A 1 12  ? 105.750 192.943 192.714 1.00 217.88 ? 12  GLU A OE2 1 
ATOM   78    N  N   . MET A 1 13  ? 111.802 193.197 194.582 1.00 212.03 ? 13  MET A N   1 
ATOM   79    C  CA  . MET A 1 13  ? 113.240 193.352 194.312 1.00 209.63 ? 13  MET A CA  1 
ATOM   80    C  C   . MET A 1 13  ? 113.977 194.207 195.379 1.00 210.06 ? 13  MET A C   1 
ATOM   81    O  O   . MET A 1 13  ? 113.369 195.135 195.920 1.00 210.77 ? 13  MET A O   1 
ATOM   82    C  CB  . MET A 1 13  ? 113.441 193.980 192.923 1.00 210.78 ? 13  MET A CB  1 
ATOM   83    N  N   . PRO A 1 14  ? 115.283 193.942 195.678 1.00 204.84 ? 14  PRO A N   1 
ATOM   84    C  CA  . PRO A 1 14  ? 115.991 194.767 196.680 1.00 203.59 ? 14  PRO A CA  1 
ATOM   85    C  C   . PRO A 1 14  ? 116.544 196.071 196.090 1.00 204.20 ? 14  PRO A C   1 
ATOM   86    O  O   . PRO A 1 14  ? 116.499 196.258 194.872 1.00 203.71 ? 14  PRO A O   1 
ATOM   87    C  CB  . PRO A 1 14  ? 117.114 193.851 197.181 1.00 203.67 ? 14  PRO A CB  1 
ATOM   88    C  CG  . PRO A 1 14  ? 117.169 192.690 196.224 1.00 206.56 ? 14  PRO A CG  1 
ATOM   89    C  CD  . PRO A 1 14  ? 116.169 192.895 195.133 1.00 204.58 ? 14  PRO A CD  1 
ATOM   90    N  N   . ALA A 1 15  ? 117.053 196.979 196.954 1.00 200.68 ? 15  ALA A N   1 
ATOM   91    C  CA  . ALA A 1 15  ? 117.562 198.287 196.537 1.00 199.67 ? 15  ALA A CA  1 
ATOM   92    C  C   . ALA A 1 15  ? 119.088 198.308 196.374 1.00 199.62 ? 15  ALA A C   1 
ATOM   93    O  O   . ALA A 1 15  ? 119.566 198.487 195.252 1.00 198.36 ? 15  ALA A O   1 
ATOM   94    C  CB  . ALA A 1 15  ? 117.124 199.360 197.526 1.00 201.11 ? 15  ALA A CB  1 
ATOM   95    N  N   . GLU A 1 16  ? 119.842 198.142 197.478 1.00 194.96 ? 16  GLU A N   1 
ATOM   96    C  CA  . GLU A 1 16  ? 121.307 198.170 197.483 1.00 188.64 ? 16  GLU A CA  1 
ATOM   97    C  C   . GLU A 1 16  ? 121.907 196.983 196.728 1.00 187.20 ? 16  GLU A C   1 
ATOM   98    O  O   . GLU A 1 16  ? 122.946 197.138 196.088 1.00 182.98 ? 16  GLU A O   1 
ATOM   99    C  CB  . GLU A 1 16  ? 121.841 198.200 198.920 1.00 188.90 ? 16  GLU A CB  1 
ATOM   100   N  N   . LYS A 1 17  ? 121.249 195.808 196.794 1.00 183.91 ? 17  LYS A N   1 
ATOM   101   C  CA  . LYS A 1 17  ? 121.689 194.583 196.119 1.00 179.85 ? 17  LYS A CA  1 
ATOM   102   C  C   . LYS A 1 17  ? 121.523 194.685 194.596 1.00 183.20 ? 17  LYS A C   1 
ATOM   103   O  O   . LYS A 1 17  ? 122.314 194.087 193.863 1.00 178.96 ? 17  LYS A O   1 
ATOM   104   C  CB  . LYS A 1 17  ? 120.927 193.360 196.651 1.00 184.11 ? 17  LYS A CB  1 
ATOM   105   N  N   . ARG A 1 18  ? 120.508 195.446 194.128 1.00 183.92 ? 18  ARG A N   1 
ATOM   106   C  CA  . ARG A 1 18  ? 120.210 195.645 192.707 1.00 184.72 ? 18  ARG A CA  1 
ATOM   107   C  C   . ARG A 1 18  ? 121.264 196.515 192.004 1.00 185.05 ? 18  ARG A C   1 
ATOM   108   O  O   . ARG A 1 18  ? 121.629 196.199 190.870 1.00 183.09 ? 18  ARG A O   1 
ATOM   109   C  CB  . ARG A 1 18  ? 118.819 196.265 192.525 1.00 190.98 ? 18  ARG A CB  1 
ATOM   110   N  N   . ILE A 1 19  ? 121.746 197.602 192.662 1.00 180.54 ? 19  ILE A N   1 
ATOM   111   C  CA  . ILE A 1 19  ? 122.750 198.519 192.091 1.00 177.34 ? 19  ILE A CA  1 
ATOM   112   C  C   . ILE A 1 19  ? 124.154 197.888 192.086 1.00 173.43 ? 19  ILE A C   1 
ATOM   113   O  O   . ILE A 1 19  ? 124.953 198.202 191.201 1.00 170.29 ? 19  ILE A O   1 
ATOM   114   C  CB  . ILE A 1 19  ? 122.762 199.929 192.739 1.00 182.94 ? 19  ILE A CB  1 
ATOM   115   C  CG1 . ILE A 1 19  ? 122.666 199.877 194.280 1.00 184.21 ? 19  ILE A CG1 1 
ATOM   116   C  CG2 . ILE A 1 19  ? 121.661 200.800 192.117 1.00 189.61 ? 19  ILE A CG2 1 
ATOM   117   C  CD1 . ILE A 1 19  ? 123.050 201.153 195.001 1.00 194.55 ? 19  ILE A CD1 1 
ATOM   118   N  N   . PHE A 1 20  ? 124.443 196.993 193.047 1.00 167.01 ? 20  PHE A N   1 
ATOM   119   C  CA  . PHE A 1 20  ? 125.721 196.287 193.107 1.00 161.27 ? 20  PHE A CA  1 
ATOM   120   C  C   . PHE A 1 20  ? 125.824 195.313 191.927 1.00 161.56 ? 20  PHE A C   1 
ATOM   121   O  O   . PHE A 1 20  ? 126.853 195.272 191.255 1.00 157.59 ? 20  PHE A O   1 
ATOM   122   C  CB  . PHE A 1 20  ? 125.896 195.553 194.452 1.00 162.33 ? 20  PHE A CB  1 
ATOM   123   C  CG  . PHE A 1 20  ? 127.124 194.669 194.520 1.00 159.61 ? 20  PHE A CG  1 
ATOM   124   C  CD1 . PHE A 1 20  ? 128.390 195.218 194.699 1.00 159.91 ? 20  PHE A CD1 1 
ATOM   125   C  CD2 . PHE A 1 20  ? 127.017 193.289 194.382 1.00 161.13 ? 20  PHE A CD2 1 
ATOM   126   C  CE1 . PHE A 1 20  ? 129.527 194.401 194.743 1.00 156.81 ? 20  PHE A CE1 1 
ATOM   127   C  CE2 . PHE A 1 20  ? 128.155 192.474 194.421 1.00 159.95 ? 20  PHE A CE2 1 
ATOM   128   C  CZ  . PHE A 1 20  ? 129.400 193.035 194.615 1.00 154.93 ? 20  PHE A CZ  1 
ATOM   129   N  N   . GLY A 1 21  ? 124.753 194.555 191.695 1.00 159.81 ? 21  GLY A N   1 
ATOM   130   C  CA  . GLY A 1 21  ? 124.654 193.594 190.603 1.00 158.77 ? 21  GLY A CA  1 
ATOM   131   C  C   . GLY A 1 21  ? 124.724 194.257 189.243 1.00 161.85 ? 21  GLY A C   1 
ATOM   132   O  O   . GLY A 1 21  ? 125.334 193.708 188.324 1.00 159.39 ? 21  GLY A O   1 
ATOM   133   N  N   . ALA A 1 22  ? 124.124 195.462 189.122 1.00 160.35 ? 22  ALA A N   1 
ATOM   134   C  CA  . ALA A 1 22  ? 124.113 196.279 187.907 1.00 160.89 ? 22  ALA A CA  1 
ATOM   135   C  C   . ALA A 1 22  ? 125.536 196.646 187.477 1.00 159.96 ? 22  ALA A C   1 
ATOM   136   O  O   . ALA A 1 22  ? 125.839 196.609 186.284 1.00 159.07 ? 22  ALA A O   1 
ATOM   137   C  CB  . ALA A 1 22  ? 123.296 197.539 188.135 1.00 165.94 ? 22  ALA A CB  1 
ATOM   138   N  N   . VAL A 1 23  ? 126.409 196.965 188.460 1.00 153.18 ? 23  VAL A N   1 
ATOM   139   C  CA  . VAL A 1 23  ? 127.825 197.312 188.278 1.00 148.54 ? 23  VAL A CA  1 
ATOM   140   C  C   . VAL A 1 23  ? 128.571 196.108 187.671 1.00 147.63 ? 23  VAL A C   1 
ATOM   141   O  O   . VAL A 1 23  ? 129.244 196.260 186.651 1.00 145.18 ? 23  VAL A O   1 
ATOM   142   C  CB  . VAL A 1 23  ? 128.448 197.777 189.631 1.00 151.17 ? 23  VAL A CB  1 
ATOM   143   C  CG1 . VAL A 1 23  ? 129.975 197.685 189.634 1.00 146.55 ? 23  VAL A CG1 1 
ATOM   144   C  CG2 . VAL A 1 23  ? 127.988 199.184 189.997 1.00 154.34 ? 23  VAL A CG2 1 
ATOM   145   N  N   . LEU A 1 24  ? 128.415 194.919 188.292 1.00 143.23 ? 24  LEU A N   1 
ATOM   146   C  CA  . LEU A 1 24  ? 129.043 193.666 187.883 1.00 140.43 ? 24  LEU A CA  1 
ATOM   147   C  C   . LEU A 1 24  ? 128.498 193.157 186.558 1.00 146.04 ? 24  LEU A C   1 
ATOM   148   O  O   . LEU A 1 24  ? 129.277 192.627 185.764 1.00 143.83 ? 24  LEU A O   1 
ATOM   149   C  CB  . LEU A 1 24  ? 128.871 192.595 188.965 1.00 140.24 ? 24  LEU A CB  1 
ATOM   150   C  CG  . LEU A 1 24  ? 130.019 192.497 189.966 1.00 142.07 ? 24  LEU A CG  1 
ATOM   151   C  CD1 . LEU A 1 24  ? 129.853 193.503 191.099 1.00 143.38 ? 24  LEU A CD1 1 
ATOM   152   C  CD2 . LEU A 1 24  ? 130.131 191.099 190.526 1.00 144.24 ? 24  LEU A CD2 1 
ATOM   153   N  N   . LEU A 1 25  ? 127.178 193.322 186.309 1.00 146.51 ? 25  LEU A N   1 
ATOM   154   C  CA  . LEU A 1 25  ? 126.541 192.896 185.059 1.00 148.78 ? 25  LEU A CA  1 
ATOM   155   C  C   . LEU A 1 25  ? 127.076 193.712 183.880 1.00 153.19 ? 25  LEU A C   1 
ATOM   156   O  O   . LEU A 1 25  ? 127.280 193.156 182.800 1.00 152.80 ? 25  LEU A O   1 
ATOM   157   C  CB  . LEU A 1 25  ? 125.015 193.007 185.133 1.00 153.80 ? 25  LEU A CB  1 
ATOM   158   C  CG  . LEU A 1 25  ? 124.269 192.142 184.129 1.00 161.27 ? 25  LEU A CG  1 
ATOM   159   C  CD1 . LEU A 1 25  ? 123.627 190.948 184.809 1.00 162.89 ? 25  LEU A CD1 1 
ATOM   160   C  CD2 . LEU A 1 25  ? 123.251 192.954 183.365 1.00 168.69 ? 25  LEU A CD2 1 
ATOM   161   N  N   . PHE A 1 26  ? 127.337 195.015 184.102 1.00 150.13 ? 26  PHE A N   1 
ATOM   162   C  CA  . PHE A 1 26  ? 127.884 195.896 183.076 1.00 149.76 ? 26  PHE A CA  1 
ATOM   163   C  C   . PHE A 1 26  ? 129.353 195.578 182.824 1.00 149.85 ? 26  PHE A C   1 
ATOM   164   O  O   . PHE A 1 26  ? 129.768 195.510 181.667 1.00 148.91 ? 26  PHE A O   1 
ATOM   165   C  CB  . PHE A 1 26  ? 127.712 197.373 183.461 1.00 153.18 ? 26  PHE A CB  1 
ATOM   166   C  CG  . PHE A 1 26  ? 128.124 198.325 182.363 1.00 155.10 ? 26  PHE A CG  1 
ATOM   167   C  CD1 . PHE A 1 26  ? 127.302 198.543 181.264 1.00 161.73 ? 26  PHE A CD1 1 
ATOM   168   C  CD2 . PHE A 1 26  ? 129.338 198.997 182.423 1.00 154.32 ? 26  PHE A CD2 1 
ATOM   169   C  CE1 . PHE A 1 26  ? 127.689 199.415 180.246 1.00 163.17 ? 26  PHE A CE1 1 
ATOM   170   C  CE2 . PHE A 1 26  ? 129.724 199.864 181.402 1.00 157.67 ? 26  PHE A CE2 1 
ATOM   171   C  CZ  . PHE A 1 26  ? 128.897 200.068 180.321 1.00 159.19 ? 26  PHE A CZ  1 
ATOM   172   N  N   . SER A 1 27  ? 130.130 195.375 183.906 1.00 144.16 ? 27  SER A N   1 
ATOM   173   C  CA  . SER A 1 27  ? 131.558 195.060 183.857 1.00 140.32 ? 27  SER A CA  1 
ATOM   174   C  C   . SER A 1 27  ? 131.825 193.773 183.080 1.00 143.03 ? 27  SER A C   1 
ATOM   175   O  O   . SER A 1 27  ? 132.869 193.668 182.435 1.00 140.63 ? 27  SER A O   1 
ATOM   176   C  CB  . SER A 1 27  ? 132.126 194.936 185.267 1.00 142.96 ? 27  SER A CB  1 
ATOM   177   O  OG  . SER A 1 27  ? 131.947 196.132 186.010 1.00 156.29 ? 27  SER A OG  1 
ATOM   178   N  N   . TRP A 1 28  ? 130.876 192.813 183.122 1.00 141.28 ? 28  TRP A N   1 
ATOM   179   C  CA  . TRP A 1 28  ? 130.995 191.535 182.426 1.00 140.90 ? 28  TRP A CA  1 
ATOM   180   C  C   . TRP A 1 28  ? 130.515 191.608 180.977 1.00 145.29 ? 28  TRP A C   1 
ATOM   181   O  O   . TRP A 1 28  ? 131.125 190.956 180.129 1.00 144.14 ? 28  TRP A O   1 
ATOM   182   C  CB  . TRP A 1 28  ? 130.269 190.418 183.176 1.00 141.32 ? 28  TRP A CB  1 
ATOM   183   C  CG  . TRP A 1 28  ? 131.145 189.778 184.205 1.00 139.47 ? 28  TRP A CG  1 
ATOM   184   C  CD1 . TRP A 1 28  ? 131.176 190.056 185.539 1.00 141.43 ? 28  TRP A CD1 1 
ATOM   185   C  CD2 . TRP A 1 28  ? 132.206 188.844 183.964 1.00 137.07 ? 28  TRP A CD2 1 
ATOM   186   N  NE1 . TRP A 1 28  ? 132.156 189.315 186.154 1.00 138.34 ? 28  TRP A NE1 1 
ATOM   187   C  CE2 . TRP A 1 28  ? 132.810 188.565 185.210 1.00 138.96 ? 28  TRP A CE2 1 
ATOM   188   C  CE3 . TRP A 1 28  ? 132.695 188.195 182.814 1.00 138.40 ? 28  TRP A CE3 1 
ATOM   189   C  CZ2 . TRP A 1 28  ? 133.871 187.657 185.344 1.00 136.09 ? 28  TRP A CZ2 1 
ATOM   190   C  CZ3 . TRP A 1 28  ? 133.744 187.296 182.947 1.00 137.80 ? 28  TRP A CZ3 1 
ATOM   191   C  CH2 . TRP A 1 28  ? 134.323 187.037 184.198 1.00 136.30 ? 28  TRP A CH2 1 
ATOM   192   N  N   . THR A 1 29  ? 129.457 192.392 180.680 1.00 143.71 ? 29  THR A N   1 
ATOM   193   C  CA  . THR A 1 29  ? 128.962 192.539 179.302 1.00 146.14 ? 29  THR A CA  1 
ATOM   194   C  C   . THR A 1 29  ? 130.000 193.285 178.448 1.00 147.31 ? 29  THR A C   1 
ATOM   195   O  O   . THR A 1 29  ? 130.235 192.897 177.301 1.00 147.44 ? 29  THR A O   1 
ATOM   196   C  CB  . THR A 1 29  ? 127.585 193.220 179.246 1.00 158.11 ? 29  THR A CB  1 
ATOM   197   O  OG1 . THR A 1 29  ? 127.600 194.423 180.015 1.00 156.88 ? 29  THR A OG1 1 
ATOM   198   C  CG2 . THR A 1 29  ? 126.457 192.303 179.698 1.00 159.84 ? 29  THR A CG2 1 
ATOM   199   N  N   . VAL A 1 30  ? 130.644 194.326 179.030 1.00 140.85 ? 30  VAL A N   1 
ATOM   200   C  CA  . VAL A 1 30  ? 131.704 195.118 178.397 1.00 138.10 ? 30  VAL A CA  1 
ATOM   201   C  C   . VAL A 1 30  ? 132.878 194.183 178.127 1.00 138.95 ? 30  VAL A C   1 
ATOM   202   O  O   . VAL A 1 30  ? 133.406 194.190 177.013 1.00 138.81 ? 30  VAL A O   1 
ATOM   203   C  CB  . VAL A 1 30  ? 132.091 196.351 179.260 1.00 140.38 ? 30  VAL A CB  1 
ATOM   204   C  CG1 . VAL A 1 30  ? 133.474 196.894 178.910 1.00 137.36 ? 30  VAL A CG1 1 
ATOM   205   C  CG2 . VAL A 1 30  ? 131.044 197.445 179.131 1.00 143.91 ? 30  VAL A CG2 1 
ATOM   206   N  N   . TYR A 1 31  ? 133.235 193.337 179.126 1.00 133.00 ? 31  TYR A N   1 
ATOM   207   C  CA  . TYR A 1 31  ? 134.299 192.341 179.012 1.00 129.81 ? 31  TYR A CA  1 
ATOM   208   C  C   . TYR A 1 31  ? 133.994 191.352 177.884 1.00 135.00 ? 31  TYR A C   1 
ATOM   209   O  O   . TYR A 1 31  ? 134.866 191.125 177.044 1.00 133.47 ? 31  TYR A O   1 
ATOM   210   C  CB  . TYR A 1 31  ? 134.521 191.586 180.334 1.00 129.05 ? 31  TYR A CB  1 
ATOM   211   C  CG  . TYR A 1 31  ? 135.511 190.450 180.188 1.00 129.45 ? 31  TYR A CG  1 
ATOM   212   C  CD1 . TYR A 1 31  ? 136.871 190.701 180.011 1.00 129.44 ? 31  TYR A CD1 1 
ATOM   213   C  CD2 . TYR A 1 31  ? 135.087 189.124 180.183 1.00 131.30 ? 31  TYR A CD2 1 
ATOM   214   C  CE1 . TYR A 1 31  ? 137.786 189.661 179.840 1.00 129.05 ? 31  TYR A CE1 1 
ATOM   215   C  CE2 . TYR A 1 31  ? 135.994 188.075 180.018 1.00 130.99 ? 31  TYR A CE2 1 
ATOM   216   C  CZ  . TYR A 1 31  ? 137.344 188.350 179.848 1.00 135.99 ? 31  TYR A CZ  1 
ATOM   217   O  OH  . TYR A 1 31  ? 138.252 187.340 179.660 1.00 136.00 ? 31  TYR A OH  1 
ATOM   218   N  N   . LEU A 1 32  ? 132.761 190.784 177.858 1.00 134.05 ? 32  LEU A N   1 
ATOM   219   C  CA  . LEU A 1 32  ? 132.320 189.822 176.839 1.00 135.94 ? 32  LEU A CA  1 
ATOM   220   C  C   . LEU A 1 32  ? 132.278 190.454 175.446 1.00 140.59 ? 32  LEU A C   1 
ATOM   221   O  O   . LEU A 1 32  ? 132.553 189.763 174.464 1.00 141.01 ? 32  LEU A O   1 
ATOM   222   C  CB  . LEU A 1 32  ? 130.956 189.207 177.187 1.00 139.37 ? 32  LEU A CB  1 
ATOM   223   C  CG  . LEU A 1 32  ? 130.937 188.176 178.324 1.00 143.11 ? 32  LEU A CG  1 
ATOM   224   C  CD1 . LEU A 1 32  ? 129.525 187.911 178.786 1.00 147.18 ? 32  LEU A CD1 1 
ATOM   225   C  CD2 . LEU A 1 32  ? 131.606 186.871 177.920 1.00 144.93 ? 32  LEU A CD2 1 
ATOM   226   N  N   . TRP A 1 33  ? 131.972 191.763 175.365 1.00 137.44 ? 33  TRP A N   1 
ATOM   227   C  CA  . TRP A 1 33  ? 131.967 192.513 174.109 1.00 139.25 ? 33  TRP A CA  1 
ATOM   228   C  C   . TRP A 1 33  ? 133.397 192.628 173.577 1.00 141.11 ? 33  TRP A C   1 
ATOM   229   O  O   . TRP A 1 33  ? 133.638 192.384 172.394 1.00 141.80 ? 33  TRP A O   1 
ATOM   230   C  CB  . TRP A 1 33  ? 131.339 193.907 174.312 1.00 139.46 ? 33  TRP A CB  1 
ATOM   231   C  CG  . TRP A 1 33  ? 131.670 194.912 173.243 1.00 141.11 ? 33  TRP A CG  1 
ATOM   232   C  CD1 . TRP A 1 33  ? 132.480 196.001 173.368 1.00 142.02 ? 33  TRP A CD1 1 
ATOM   233   C  CD2 . TRP A 1 33  ? 131.223 194.897 171.879 1.00 144.16 ? 33  TRP A CD2 1 
ATOM   234   N  NE1 . TRP A 1 33  ? 132.544 196.684 172.177 1.00 143.22 ? 33  TRP A NE1 1 
ATOM   235   C  CE2 . TRP A 1 33  ? 131.787 196.025 171.243 1.00 147.77 ? 33  TRP A CE2 1 
ATOM   236   C  CE3 . TRP A 1 33  ? 130.393 194.043 171.131 1.00 148.80 ? 33  TRP A CE3 1 
ATOM   237   C  CZ2 . TRP A 1 33  ? 131.538 196.328 169.900 1.00 150.11 ? 33  TRP A CZ2 1 
ATOM   238   C  CZ3 . TRP A 1 33  ? 130.161 194.335 169.797 1.00 153.31 ? 33  TRP A CZ3 1 
ATOM   239   C  CH2 . TRP A 1 33  ? 130.728 195.465 169.195 1.00 153.53 ? 33  TRP A CH2 1 
ATOM   240   N  N   . GLU A 1 34  ? 134.339 192.979 174.469 1.00 135.06 ? 34  GLU A N   1 
ATOM   241   C  CA  . GLU A 1 34  ? 135.757 193.129 174.163 1.00 132.69 ? 34  GLU A CA  1 
ATOM   242   C  C   . GLU A 1 34  ? 136.396 191.770 173.846 1.00 137.44 ? 34  GLU A C   1 
ATOM   243   O  O   . GLU A 1 34  ? 137.307 191.716 173.015 1.00 136.65 ? 34  GLU A O   1 
ATOM   244   C  CB  . GLU A 1 34  ? 136.484 193.819 175.326 1.00 131.12 ? 34  GLU A CB  1 
ATOM   245   C  CG  . GLU A 1 34  ? 136.175 195.307 175.426 1.00 144.11 ? 34  GLU A CG  1 
ATOM   246   C  CD  . GLU A 1 34  ? 136.871 196.104 176.517 1.00 167.28 ? 34  GLU A CD  1 
ATOM   247   O  OE1 . GLU A 1 34  ? 137.455 195.492 177.442 1.00 162.59 ? 34  GLU A OE1 1 
ATOM   248   O  OE2 . GLU A 1 34  ? 136.815 197.354 176.452 1.00 162.64 ? 34  GLU A OE2 1 
ATOM   249   N  N   . THR A 1 35  ? 135.904 190.681 174.485 1.00 135.26 ? 35  THR A N   1 
ATOM   250   C  CA  . THR A 1 35  ? 136.381 189.308 174.271 1.00 135.38 ? 35  THR A CA  1 
ATOM   251   C  C   . THR A 1 35  ? 135.881 188.814 172.907 1.00 142.94 ? 35  THR A C   1 
ATOM   252   O  O   . THR A 1 35  ? 136.640 188.155 172.193 1.00 142.53 ? 35  THR A O   1 
ATOM   253   C  CB  . THR A 1 35  ? 135.967 188.393 175.438 1.00 146.39 ? 35  THR A CB  1 
ATOM   254   O  OG1 . THR A 1 35  ? 136.477 188.949 176.649 1.00 145.65 ? 35  THR A OG1 1 
ATOM   255   C  CG2 . THR A 1 35  ? 136.499 186.971 175.296 1.00 145.80 ? 35  THR A CG2 1 
ATOM   256   N  N   . PHE A 1 36  ? 134.628 189.160 172.535 1.00 143.21 ? 36  PHE A N   1 
ATOM   257   C  CA  . PHE A 1 36  ? 134.056 188.814 171.227 1.00 147.20 ? 36  PHE A CA  1 
ATOM   258   C  C   . PHE A 1 36  ? 134.899 189.470 170.119 1.00 150.10 ? 36  PHE A C   1 
ATOM   259   O  O   . PHE A 1 36  ? 135.205 188.824 169.115 1.00 151.54 ? 36  PHE A O   1 
ATOM   260   C  CB  . PHE A 1 36  ? 132.571 189.234 171.135 1.00 152.91 ? 36  PHE A CB  1 
ATOM   261   C  CG  . PHE A 1 36  ? 132.040 189.449 169.734 1.00 158.74 ? 36  PHE A CG  1 
ATOM   262   C  CD1 . PHE A 1 36  ? 131.821 188.372 168.881 1.00 165.12 ? 36  PHE A CD1 1 
ATOM   263   C  CD2 . PHE A 1 36  ? 131.750 190.727 169.271 1.00 162.38 ? 36  PHE A CD2 1 
ATOM   264   C  CE1 . PHE A 1 36  ? 131.339 188.573 167.583 1.00 170.29 ? 36  PHE A CE1 1 
ATOM   265   C  CE2 . PHE A 1 36  ? 131.264 190.927 167.975 1.00 169.33 ? 36  PHE A CE2 1 
ATOM   266   C  CZ  . PHE A 1 36  ? 131.059 189.849 167.141 1.00 170.41 ? 36  PHE A CZ  1 
ATOM   267   N  N   . LEU A 1 37  ? 135.287 190.742 170.332 1.00 143.74 ? 37  LEU A N   1 
ATOM   268   C  CA  . LEU A 1 37  ? 136.132 191.535 169.443 1.00 142.46 ? 37  LEU A CA  1 
ATOM   269   C  C   . LEU A 1 37  ? 137.525 190.930 169.362 1.00 143.41 ? 37  LEU A C   1 
ATOM   270   O  O   . LEU A 1 37  ? 138.084 190.840 168.270 1.00 143.95 ? 37  LEU A O   1 
ATOM   271   C  CB  . LEU A 1 37  ? 136.207 192.974 169.970 1.00 140.93 ? 37  LEU A CB  1 
ATOM   272   C  CG  . LEU A 1 37  ? 135.378 194.030 169.252 1.00 148.33 ? 37  LEU A CG  1 
ATOM   273   C  CD1 . LEU A 1 37  ? 133.903 193.693 169.260 1.00 151.87 ? 37  LEU A CD1 1 
ATOM   274   C  CD2 . LEU A 1 37  ? 135.568 195.363 169.902 1.00 149.08 ? 37  LEU A CD2 1 
ATOM   275   N  N   . ALA A 1 38  ? 138.071 190.493 170.520 1.00 137.12 ? 38  ALA A N   1 
ATOM   276   C  CA  . ALA A 1 38  ? 139.382 189.848 170.617 1.00 135.11 ? 38  ALA A CA  1 
ATOM   277   C  C   . ALA A 1 38  ? 139.388 188.528 169.855 1.00 140.43 ? 38  ALA A C   1 
ATOM   278   O  O   . ALA A 1 38  ? 140.365 188.230 169.173 1.00 140.21 ? 38  ALA A O   1 
ATOM   279   C  CB  . ALA A 1 38  ? 139.752 189.616 172.074 1.00 133.25 ? 38  ALA A CB  1 
ATOM   280   N  N   . GLN A 1 39  ? 138.279 187.763 169.943 1.00 138.77 ? 39  GLN A N   1 
ATOM   281   C  CA  . GLN A 1 39  ? 138.077 186.491 169.243 1.00 141.38 ? 39  GLN A CA  1 
ATOM   282   C  C   . GLN A 1 39  ? 137.989 186.726 167.733 1.00 146.99 ? 39  GLN A C   1 
ATOM   283   O  O   . GLN A 1 39  ? 138.563 185.963 166.954 1.00 147.73 ? 39  GLN A O   1 
ATOM   284   C  CB  . GLN A 1 39  ? 136.802 185.793 169.751 1.00 145.15 ? 39  GLN A CB  1 
ATOM   285   N  N   . ARG A 1 40  ? 137.283 187.804 167.338 1.00 144.25 ? 40  ARG A N   1 
ATOM   286   C  CA  . ARG A 1 40  ? 137.074 188.226 165.954 1.00 146.97 ? 40  ARG A CA  1 
ATOM   287   C  C   . ARG A 1 40  ? 138.407 188.576 165.278 1.00 148.60 ? 40  ARG A C   1 
ATOM   288   O  O   . ARG A 1 40  ? 138.613 188.194 164.126 1.00 151.19 ? 40  ARG A O   1 
ATOM   289   C  CB  . ARG A 1 40  ? 136.114 189.425 165.910 1.00 148.65 ? 40  ARG A CB  1 
ATOM   290   C  CG  . ARG A 1 40  ? 135.260 189.478 164.659 1.00 164.75 ? 40  ARG A CG  1 
ATOM   291   C  CD  . ARG A 1 40  ? 134.087 190.427 164.821 1.00 177.84 ? 40  ARG A CD  1 
ATOM   292   N  NE  . ARG A 1 40  ? 133.295 190.520 163.595 1.00 194.42 ? 40  ARG A NE  1 
ATOM   293   C  CZ  . ARG A 1 40  ? 132.307 189.691 163.268 1.00 217.83 ? 40  ARG A CZ  1 
ATOM   294   N  NH1 . ARG A 1 40  ? 131.975 188.692 164.080 1.00 204.72 ? 40  ARG A NH1 1 
ATOM   295   N  NH2 . ARG A 1 40  ? 131.647 189.850 162.130 1.00 214.40 ? 40  ARG A NH2 1 
ATOM   296   N  N   . GLN A 1 41  ? 139.315 189.266 166.004 1.00 140.12 ? 41  GLN A N   1 
ATOM   297   C  CA  . GLN A 1 41  ? 140.622 189.659 165.480 1.00 138.05 ? 41  GLN A CA  1 
ATOM   298   C  C   . GLN A 1 41  ? 141.641 188.529 165.576 1.00 140.81 ? 41  GLN A C   1 
ATOM   299   O  O   . GLN A 1 41  ? 142.582 188.513 164.783 1.00 140.82 ? 41  GLN A O   1 
ATOM   300   C  CB  . GLN A 1 41  ? 141.154 190.908 166.176 1.00 136.16 ? 41  GLN A CB  1 
ATOM   301   C  CG  . GLN A 1 41  ? 141.595 191.968 165.173 1.00 151.97 ? 41  GLN A CG  1 
ATOM   302   C  CD  . GLN A 1 41  ? 143.079 192.238 165.145 1.00 168.36 ? 41  GLN A CD  1 
ATOM   303   O  OE1 . GLN A 1 41  ? 143.687 192.351 164.078 1.00 163.02 ? 41  GLN A OE1 1 
ATOM   304   N  NE2 . GLN A 1 41  ? 143.691 192.411 166.308 1.00 160.21 ? 41  GLN A NE2 1 
ATOM   305   N  N   . ARG A 1 42  ? 141.462 187.585 166.526 1.00 136.74 ? 42  ARG A N   1 
ATOM   306   C  CA  . ARG A 1 42  ? 142.339 186.417 166.676 1.00 136.50 ? 42  ARG A CA  1 
ATOM   307   C  C   . ARG A 1 42  ? 142.155 185.486 165.480 1.00 145.45 ? 42  ARG A C   1 
ATOM   308   O  O   . ARG A 1 42  ? 143.117 184.850 165.040 1.00 145.71 ? 42  ARG A O   1 
ATOM   309   C  CB  . ARG A 1 42  ? 142.060 185.671 167.988 1.00 134.88 ? 42  ARG A CB  1 
ATOM   310   N  N   . ARG A 1 43  ? 140.918 185.438 164.935 1.00 145.75 ? 43  ARG A N   1 
ATOM   311   C  CA  . ARG A 1 43  ? 140.556 184.650 163.758 1.00 150.34 ? 43  ARG A CA  1 
ATOM   312   C  C   . ARG A 1 43  ? 141.291 185.174 162.527 1.00 156.01 ? 43  ARG A C   1 
ATOM   313   O  O   . ARG A 1 43  ? 141.746 184.369 161.721 1.00 158.50 ? 43  ARG A O   1 
ATOM   314   C  CB  . ARG A 1 43  ? 139.037 184.668 163.530 1.00 153.78 ? 43  ARG A CB  1 
ATOM   315   N  N   . ILE A 1 44  ? 141.443 186.517 162.409 1.00 151.11 ? 44  ILE A N   1 
ATOM   316   C  CA  . ILE A 1 44  ? 142.143 187.195 161.306 1.00 152.09 ? 44  ILE A CA  1 
ATOM   317   C  C   . ILE A 1 44  ? 143.615 186.740 161.263 1.00 156.03 ? 44  ILE A C   1 
ATOM   318   O  O   . ILE A 1 44  ? 144.113 186.417 160.184 1.00 158.75 ? 44  ILE A O   1 
ATOM   319   C  CB  . ILE A 1 44  ? 142.020 188.752 161.401 1.00 153.14 ? 44  ILE A CB  1 
ATOM   320   C  CG1 . ILE A 1 44  ? 140.559 189.252 161.632 1.00 154.88 ? 44  ILE A CG1 1 
ATOM   321   C  CG2 . ILE A 1 44  ? 142.700 189.474 160.229 1.00 154.79 ? 44  ILE A CG2 1 
ATOM   322   C  CD1 . ILE A 1 44  ? 139.435 188.838 160.594 1.00 167.90 ? 44  ILE A CD1 1 
ATOM   323   N  N   . TYR A 1 45  ? 144.284 186.679 162.435 1.00 149.37 ? 45  TYR A N   1 
ATOM   324   C  CA  . TYR A 1 45  ? 145.679 186.246 162.560 1.00 148.36 ? 45  TYR A CA  1 
ATOM   325   C  C   . TYR A 1 45  ? 145.855 184.780 162.148 1.00 156.74 ? 45  TYR A C   1 
ATOM   326   O  O   . TYR A 1 45  ? 146.862 184.442 161.523 1.00 157.83 ? 45  TYR A O   1 
ATOM   327   C  CB  . TYR A 1 45  ? 146.191 186.444 164.000 1.00 145.27 ? 45  TYR A CB  1 
ATOM   328   C  CG  . TYR A 1 45  ? 146.194 187.877 164.493 1.00 143.98 ? 45  TYR A CG  1 
ATOM   329   C  CD1 . TYR A 1 45  ? 146.761 188.896 163.732 1.00 146.27 ? 45  TYR A CD1 1 
ATOM   330   C  CD2 . TYR A 1 45  ? 145.711 188.201 165.758 1.00 141.88 ? 45  TYR A CD2 1 
ATOM   331   C  CE1 . TYR A 1 45  ? 146.779 190.214 164.186 1.00 144.82 ? 45  TYR A CE1 1 
ATOM   332   C  CE2 . TYR A 1 45  ? 145.742 189.514 166.231 1.00 140.52 ? 45  TYR A CE2 1 
ATOM   333   C  CZ  . TYR A 1 45  ? 146.284 190.517 165.443 1.00 147.44 ? 45  TYR A CZ  1 
ATOM   334   O  OH  . TYR A 1 45  ? 146.328 191.814 165.896 1.00 145.10 ? 45  TYR A OH  1 
ATOM   335   N  N   . LYS A 1 46  ? 144.869 183.921 162.485 1.00 155.56 ? 46  LYS A N   1 
ATOM   336   C  CA  . LYS A 1 46  ? 144.881 182.487 162.187 1.00 159.06 ? 46  LYS A CA  1 
ATOM   337   C  C   . LYS A 1 46  ? 144.477 182.181 160.739 1.00 168.83 ? 46  LYS A C   1 
ATOM   338   O  O   . LYS A 1 46  ? 145.000 181.224 160.165 1.00 171.50 ? 46  LYS A O   1 
ATOM   339   C  CB  . LYS A 1 46  ? 143.956 181.731 163.153 1.00 161.38 ? 46  LYS A CB  1 
ATOM   340   N  N   . THR A 1 47  ? 143.544 182.966 160.159 1.00 167.46 ? 47  THR A N   1 
ATOM   341   C  CA  . THR A 1 47  ? 143.049 182.749 158.798 1.00 172.92 ? 47  THR A CA  1 
ATOM   342   C  C   . THR A 1 47  ? 144.014 183.335 157.754 1.00 178.95 ? 47  THR A C   1 
ATOM   343   O  O   . THR A 1 47  ? 144.466 182.588 156.882 1.00 182.71 ? 47  THR A O   1 
ATOM   344   C  CB  . THR A 1 47  ? 141.620 183.304 158.623 1.00 183.60 ? 47  THR A CB  1 
ATOM   345   O  OG1 . THR A 1 47  ? 140.808 182.884 159.720 1.00 181.58 ? 47  THR A OG1 1 
ATOM   346   C  CG2 . THR A 1 47  ? 140.969 182.852 157.318 1.00 189.91 ? 47  THR A CG2 1 
ATOM   347   N  N   . THR A 1 48  ? 144.314 184.654 157.822 1.00 172.77 ? 48  THR A N   1 
ATOM   348   C  CA  . THR A 1 48  ? 145.183 185.326 156.844 1.00 173.40 ? 48  THR A CA  1 
ATOM   349   C  C   . THR A 1 48  ? 146.652 184.884 157.038 1.00 176.76 ? 48  THR A C   1 
ATOM   350   O  O   . THR A 1 48  ? 147.437 185.558 157.711 1.00 172.42 ? 48  THR A O   1 
ATOM   351   C  CB  . THR A 1 48  ? 145.001 186.861 156.875 1.00 177.16 ? 48  THR A CB  1 
ATOM   352   O  OG1 . THR A 1 48  ? 145.446 187.376 158.127 1.00 172.62 ? 48  THR A OG1 1 
ATOM   353   C  CG2 . THR A 1 48  ? 143.560 187.298 156.605 1.00 176.20 ? 48  THR A CG2 1 
ATOM   354   N  N   . THR A 1 49  ? 146.998 183.728 156.439 1.00 177.88 ? 49  THR A N   1 
ATOM   355   C  CA  . THR A 1 49  ? 148.334 183.121 156.475 1.00 178.28 ? 49  THR A CA  1 
ATOM   356   C  C   . THR A 1 49  ? 149.148 183.569 155.236 1.00 186.21 ? 49  THR A C   1 
ATOM   357   O  O   . THR A 1 49  ? 150.380 183.604 155.292 1.00 185.16 ? 49  THR A O   1 
ATOM   358   C  CB  . THR A 1 49  ? 148.239 181.581 156.623 1.00 187.01 ? 49  THR A CB  1 
ATOM   359   O  OG1 . THR A 1 49  ? 149.549 181.031 156.767 1.00 186.40 ? 49  THR A OG1 1 
ATOM   360   C  CG2 . THR A 1 49  ? 147.496 180.896 155.468 1.00 190.49 ? 49  THR A CG2 1 
ATOM   361   N  N   . HIS A 1 50  ? 148.449 183.925 154.136 1.00 186.77 ? 50  HIS A N   1 
ATOM   362   C  CA  . HIS A 1 50  ? 149.037 184.412 152.887 1.00 189.61 ? 50  HIS A CA  1 
ATOM   363   C  C   . HIS A 1 50  ? 149.048 185.946 152.878 1.00 191.60 ? 50  HIS A C   1 
ATOM   364   O  O   . HIS A 1 50  ? 148.104 186.569 153.373 1.00 189.03 ? 50  HIS A O   1 
ATOM   365   C  CB  . HIS A 1 50  ? 148.261 183.868 151.679 1.00 195.99 ? 50  HIS A CB  1 
ATOM   366   N  N   . VAL A 1 51  ? 150.118 186.549 152.321 1.00 189.28 ? 51  VAL A N   1 
ATOM   367   C  CA  . VAL A 1 51  ? 150.303 188.008 152.234 1.00 187.32 ? 51  VAL A CA  1 
ATOM   368   C  C   . VAL A 1 51  ? 149.290 188.598 151.214 1.00 194.91 ? 51  VAL A C   1 
ATOM   369   O  O   . VAL A 1 51  ? 149.222 188.086 150.091 1.00 199.15 ? 51  VAL A O   1 
ATOM   370   C  CB  . VAL A 1 51  ? 151.773 188.394 151.878 1.00 191.29 ? 51  VAL A CB  1 
ATOM   371   C  CG1 . VAL A 1 51  ? 152.032 189.881 152.108 1.00 188.33 ? 51  VAL A CG1 1 
ATOM   372   C  CG2 . VAL A 1 51  ? 152.776 187.561 152.669 1.00 189.70 ? 51  VAL A CG2 1 
ATOM   373   N  N   . PRO A 1 52  ? 148.495 189.647 151.576 1.00 189.66 ? 52  PRO A N   1 
ATOM   374   C  CA  . PRO A 1 52  ? 147.522 190.206 150.611 1.00 192.80 ? 52  PRO A CA  1 
ATOM   375   C  C   . PRO A 1 52  ? 148.191 190.931 149.426 1.00 199.61 ? 52  PRO A C   1 
ATOM   376   O  O   . PRO A 1 52  ? 149.308 191.427 149.597 1.00 197.67 ? 52  PRO A O   1 
ATOM   377   C  CB  . PRO A 1 52  ? 146.696 191.189 151.460 1.00 191.31 ? 52  PRO A CB  1 
ATOM   378   C  CG  . PRO A 1 52  ? 147.033 190.883 152.883 1.00 191.05 ? 52  PRO A CG  1 
ATOM   379   C  CD  . PRO A 1 52  ? 148.429 190.365 152.865 1.00 186.13 ? 52  PRO A CD  1 
ATOM   380   N  N   . PRO A 1 53  ? 147.550 191.021 148.228 1.00 200.28 ? 53  PRO A N   1 
ATOM   381   C  CA  . PRO A 1 53  ? 148.199 191.715 147.095 1.00 202.65 ? 53  PRO A CA  1 
ATOM   382   C  C   . PRO A 1 53  ? 148.338 193.228 147.309 1.00 203.95 ? 53  PRO A C   1 
ATOM   383   O  O   . PRO A 1 53  ? 149.302 193.819 146.826 1.00 203.56 ? 53  PRO A O   1 
ATOM   384   C  CB  . PRO A 1 53  ? 147.278 191.408 145.907 1.00 210.00 ? 53  PRO A CB  1 
ATOM   385   C  CG  . PRO A 1 53  ? 146.389 190.290 146.364 1.00 215.10 ? 53  PRO A CG  1 
ATOM   386   C  CD  . PRO A 1 53  ? 146.232 190.487 147.832 1.00 205.13 ? 53  PRO A CD  1 
ATOM   387   N  N   . GLU A 1 54  ? 147.389 193.845 148.041 1.00 199.07 ? 54  GLU A N   1 
ATOM   388   C  CA  . GLU A 1 54  ? 147.403 195.274 148.375 1.00 197.14 ? 54  GLU A CA  1 
ATOM   389   C  C   . GLU A 1 54  ? 148.528 195.567 149.378 1.00 196.64 ? 54  GLU A C   1 
ATOM   390   O  O   . GLU A 1 54  ? 149.254 196.548 149.212 1.00 196.04 ? 54  GLU A O   1 
ATOM   391   C  CB  . GLU A 1 54  ? 146.042 195.715 148.942 1.00 197.90 ? 54  GLU A CB  1 
ATOM   392   N  N   . LEU A 1 55  ? 148.691 194.684 150.390 1.00 189.85 ? 55  LEU A N   1 
ATOM   393   C  CA  . LEU A 1 55  ? 149.725 194.770 151.425 1.00 185.42 ? 55  LEU A CA  1 
ATOM   394   C  C   . LEU A 1 55  ? 150.990 193.960 151.020 1.00 189.68 ? 55  LEU A C   1 
ATOM   395   O  O   . LEU A 1 55  ? 151.754 193.529 151.888 1.00 186.77 ? 55  LEU A O   1 
ATOM   396   C  CB  . LEU A 1 55  ? 149.158 194.277 152.769 1.00 181.90 ? 55  LEU A CB  1 
ATOM   397   N  N   . GLY A 1 56  ? 151.196 193.792 149.709 1.00 189.61 ? 56  GLY A N   1 
ATOM   398   C  CA  . GLY A 1 56  ? 152.326 193.070 149.129 1.00 191.32 ? 56  GLY A CA  1 
ATOM   399   C  C   . GLY A 1 56  ? 153.630 193.842 149.165 1.00 193.93 ? 56  GLY A C   1 
ATOM   400   O  O   . GLY A 1 56  ? 154.690 193.254 149.399 1.00 193.33 ? 56  GLY A O   1 
ATOM   401   N  N   . GLN A 1 57  ? 153.562 195.167 148.928 1.00 190.09 ? 57  GLN A N   1 
ATOM   402   C  CA  . GLN A 1 57  ? 154.721 196.064 148.961 1.00 189.35 ? 57  GLN A CA  1 
ATOM   403   C  C   . GLN A 1 57  ? 155.058 196.490 150.398 1.00 188.35 ? 57  GLN A C   1 
ATOM   404   O  O   . GLN A 1 57  ? 156.196 196.888 150.660 1.00 187.64 ? 57  GLN A O   1 
ATOM   405   C  CB  . GLN A 1 57  ? 154.468 197.305 148.097 1.00 192.98 ? 57  GLN A CB  1 
ATOM   406   N  N   . ILE A 1 58  ? 154.068 196.403 151.319 1.00 181.25 ? 58  ILE A N   1 
ATOM   407   C  CA  . ILE A 1 58  ? 154.192 196.777 152.729 1.00 176.48 ? 58  ILE A CA  1 
ATOM   408   C  C   . ILE A 1 58  ? 155.094 195.787 153.506 1.00 178.33 ? 58  ILE A C   1 
ATOM   409   O  O   . ILE A 1 58  ? 155.962 196.238 154.251 1.00 176.06 ? 58  ILE A O   1 
ATOM   410   C  CB  . ILE A 1 58  ? 152.794 196.909 153.377 1.00 177.46 ? 58  ILE A CB  1 
ATOM   411   N  N   . MET A 1 59  ? 154.912 194.460 153.330 1.00 175.73 ? 59  MET A N   1 
ATOM   412   C  CA  . MET A 1 59  ? 155.738 193.467 154.031 1.00 174.43 ? 59  MET A CA  1 
ATOM   413   C  C   . MET A 1 59  ? 155.933 192.185 153.219 1.00 181.70 ? 59  MET A C   1 
ATOM   414   O  O   . MET A 1 59  ? 154.985 191.692 152.603 1.00 183.19 ? 59  MET A O   1 
ATOM   415   C  CB  . MET A 1 59  ? 155.130 193.118 155.401 1.00 172.99 ? 59  MET A CB  1 
ATOM   416   N  N   . ASP A 1 60  ? 157.165 191.635 153.246 1.00 179.38 ? 60  ASP A N   1 
ATOM   417   C  CA  . ASP A 1 60  ? 157.519 190.373 152.580 1.00 182.63 ? 60  ASP A CA  1 
ATOM   418   C  C   . ASP A 1 60  ? 156.986 189.181 153.398 1.00 184.29 ? 60  ASP A C   1 
ATOM   419   O  O   . ASP A 1 60  ? 156.658 189.356 154.572 1.00 180.38 ? 60  ASP A O   1 
ATOM   420   C  CB  . ASP A 1 60  ? 159.043 190.259 152.364 1.00 186.65 ? 60  ASP A CB  1 
ATOM   421   C  CG  . ASP A 1 60  ? 159.877 190.375 153.624 1.00 194.98 ? 60  ASP A CG  1 
ATOM   422   O  OD1 . ASP A 1 60  ? 160.024 191.507 154.134 1.00 193.48 ? 60  ASP A OD1 1 
ATOM   423   O  OD2 . ASP A 1 60  ? 160.414 189.341 154.077 1.00 201.40 ? 60  ASP A OD2 1 
ATOM   424   N  N   . SER A 1 61  ? 156.904 187.981 152.779 1.00 183.15 ? 61  SER A N   1 
ATOM   425   C  CA  . SER A 1 61  ? 156.389 186.743 153.384 1.00 182.18 ? 61  SER A CA  1 
ATOM   426   C  C   . SER A 1 61  ? 157.079 186.373 154.708 1.00 181.47 ? 61  SER A C   1 
ATOM   427   O  O   . SER A 1 61  ? 156.404 185.887 155.618 1.00 178.81 ? 61  SER A O   1 
ATOM   428   C  CB  . SER A 1 61  ? 156.511 185.578 152.406 1.00 191.01 ? 61  SER A CB  1 
ATOM   429   O  OG  . SER A 1 61  ? 155.746 184.462 152.830 1.00 200.20 ? 61  SER A OG  1 
ATOM   430   N  N   . GLU A 1 62  ? 158.406 186.607 154.815 1.00 177.14 ? 62  GLU A N   1 
ATOM   431   C  CA  . GLU A 1 62  ? 159.184 186.308 156.018 1.00 174.35 ? 62  GLU A CA  1 
ATOM   432   C  C   . GLU A 1 62  ? 158.800 187.256 157.157 1.00 172.19 ? 62  GLU A C   1 
ATOM   433   O  O   . GLU A 1 62  ? 158.546 186.787 158.265 1.00 169.49 ? 62  GLU A O   1 
ATOM   434   C  CB  . GLU A 1 62  ? 160.697 186.370 155.730 1.00 178.17 ? 62  GLU A CB  1 
ATOM   435   C  CG  . GLU A 1 62  ? 161.594 185.974 156.900 1.00 188.47 ? 62  GLU A CG  1 
ATOM   436   C  CD  . GLU A 1 62  ? 161.397 184.581 157.471 1.00 213.05 ? 62  GLU A CD  1 
ATOM   437   O  OE1 . GLU A 1 62  ? 161.698 183.597 156.757 1.00 216.30 ? 62  GLU A OE1 1 
ATOM   438   O  OE2 . GLU A 1 62  ? 160.959 184.473 158.639 1.00 203.63 ? 62  GLU A OE2 1 
ATOM   439   N  N   . THR A 1 63  ? 158.741 188.573 156.876 1.00 166.79 ? 63  THR A N   1 
ATOM   440   C  CA  . THR A 1 63  ? 158.380 189.617 157.841 1.00 162.34 ? 63  THR A CA  1 
ATOM   441   C  C   . THR A 1 63  ? 156.902 189.472 158.254 1.00 163.60 ? 63  THR A C   1 
ATOM   442   O  O   . THR A 1 63  ? 156.585 189.657 159.430 1.00 159.60 ? 63  THR A O   1 
ATOM   443   C  CB  . THR A 1 63  ? 158.684 191.008 157.251 1.00 170.75 ? 63  THR A CB  1 
ATOM   444   O  OG1 . THR A 1 63  ? 160.032 191.027 156.781 1.00 172.75 ? 63  THR A OG1 1 
ATOM   445   C  CG2 . THR A 1 63  ? 158.488 192.139 158.257 1.00 166.09 ? 63  THR A CG2 1 
ATOM   446   N  N   . PHE A 1 64  ? 156.017 189.117 157.295 1.00 162.38 ? 64  PHE A N   1 
ATOM   447   C  CA  . PHE A 1 64  ? 154.579 188.927 157.517 1.00 161.06 ? 64  PHE A CA  1 
ATOM   448   C  C   . PHE A 1 64  ? 154.304 187.747 158.455 1.00 163.33 ? 64  PHE A C   1 
ATOM   449   O  O   . PHE A 1 64  ? 153.467 187.881 159.345 1.00 160.65 ? 64  PHE A O   1 
ATOM   450   C  CB  . PHE A 1 64  ? 153.839 188.727 156.183 1.00 166.58 ? 64  PHE A CB  1 
ATOM   451   C  CG  . PHE A 1 64  ? 152.332 188.694 156.284 1.00 167.90 ? 64  PHE A CG  1 
ATOM   452   C  CD1 . PHE A 1 64  ? 151.596 189.873 156.329 1.00 169.72 ? 64  PHE A CD1 1 
ATOM   453   C  CD2 . PHE A 1 64  ? 151.646 187.485 156.303 1.00 171.69 ? 64  PHE A CD2 1 
ATOM   454   C  CE1 . PHE A 1 64  ? 150.201 189.842 156.413 1.00 170.83 ? 64  PHE A CE1 1 
ATOM   455   C  CE2 . PHE A 1 64  ? 150.251 187.455 156.388 1.00 174.65 ? 64  PHE A CE2 1 
ATOM   456   C  CZ  . PHE A 1 64  ? 149.538 188.633 156.432 1.00 171.42 ? 64  PHE A CZ  1 
ATOM   457   N  N   . GLU A 1 65  ? 154.992 186.603 158.258 1.00 161.33 ? 65  GLU A N   1 
ATOM   458   C  CA  . GLU A 1 65  ? 154.817 185.422 159.107 1.00 160.26 ? 65  GLU A CA  1 
ATOM   459   C  C   . GLU A 1 65  ? 155.433 185.658 160.495 1.00 159.04 ? 65  GLU A C   1 
ATOM   460   O  O   . GLU A 1 65  ? 154.902 185.151 161.485 1.00 156.64 ? 65  GLU A O   1 
ATOM   461   C  CB  . GLU A 1 65  ? 155.402 184.163 158.444 1.00 165.96 ? 65  GLU A CB  1 
ATOM   462   C  CG  . GLU A 1 65  ? 154.897 182.849 159.032 1.00 179.16 ? 65  GLU A CG  1 
ATOM   463   C  CD  . GLU A 1 65  ? 153.392 182.676 159.168 1.00 205.31 ? 65  GLU A CD  1 
ATOM   464   O  OE1 . GLU A 1 65  ? 152.662 182.938 158.184 1.00 203.58 ? 65  GLU A OE1 1 
ATOM   465   O  OE2 . GLU A 1 65  ? 152.945 182.257 160.260 1.00 200.93 ? 65  GLU A OE2 1 
ATOM   466   N  N   . LYS A 1 66  ? 156.526 186.450 160.565 1.00 153.82 ? 66  LYS A N   1 
ATOM   467   C  CA  . LYS A 1 66  ? 157.183 186.831 161.819 1.00 150.14 ? 66  LYS A CA  1 
ATOM   468   C  C   . LYS A 1 66  ? 156.236 187.707 162.643 1.00 149.63 ? 66  LYS A C   1 
ATOM   469   O  O   . LYS A 1 66  ? 156.185 187.575 163.866 1.00 146.62 ? 66  LYS A O   1 
ATOM   470   C  CB  . LYS A 1 66  ? 158.504 187.570 161.546 1.00 153.24 ? 66  LYS A CB  1 
ATOM   471   C  CG  . LYS A 1 66  ? 159.713 186.660 161.395 1.00 166.00 ? 66  LYS A CG  1 
ATOM   472   C  CD  . LYS A 1 66  ? 160.972 187.463 161.097 1.00 174.84 ? 66  LYS A CD  1 
ATOM   473   N  N   . SER A 1 67  ? 155.468 188.577 161.953 1.00 145.79 ? 67  SER A N   1 
ATOM   474   C  CA  . SER A 1 67  ? 154.465 189.472 162.531 1.00 142.69 ? 67  SER A CA  1 
ATOM   475   C  C   . SER A 1 67  ? 153.210 188.690 162.925 1.00 145.18 ? 67  SER A C   1 
ATOM   476   O  O   . SER A 1 67  ? 152.631 188.976 163.975 1.00 142.27 ? 67  SER A O   1 
ATOM   477   C  CB  . SER A 1 67  ? 154.107 190.578 161.542 1.00 147.50 ? 67  SER A CB  1 
ATOM   478   O  OG  . SER A 1 67  ? 153.079 191.426 162.031 1.00 154.38 ? 67  SER A OG  1 
ATOM   479   N  N   . ARG A 1 68  ? 152.795 187.711 162.080 1.00 143.71 ? 68  ARG A N   1 
ATOM   480   C  CA  . ARG A 1 68  ? 151.622 186.850 162.282 1.00 143.65 ? 68  ARG A CA  1 
ATOM   481   C  C   . ARG A 1 68  ? 151.746 186.056 163.589 1.00 144.65 ? 68  ARG A C   1 
ATOM   482   O  O   . ARG A 1 68  ? 150.818 186.070 164.403 1.00 142.88 ? 68  ARG A O   1 
ATOM   483   C  CB  . ARG A 1 68  ? 151.445 185.894 161.087 1.00 148.10 ? 68  ARG A CB  1 
ATOM   484   C  CG  . ARG A 1 68  ? 150.082 185.225 161.019 1.00 160.29 ? 68  ARG A CG  1 
ATOM   485   C  CD  . ARG A 1 68  ? 150.003 184.264 159.852 1.00 177.73 ? 68  ARG A CD  1 
ATOM   486   N  NE  . ARG A 1 68  ? 148.944 183.273 160.040 1.00 191.75 ? 68  ARG A NE  1 
ATOM   487   C  CZ  . ARG A 1 68  ? 149.117 182.084 160.610 1.00 208.93 ? 68  ARG A CZ  1 
ATOM   488   N  NH1 . ARG A 1 68  ? 150.316 181.719 161.053 1.00 195.17 ? 68  ARG A NH1 1 
ATOM   489   N  NH2 . ARG A 1 68  ? 148.096 181.250 160.743 1.00 199.54 ? 68  ARG A NH2 1 
ATOM   490   N  N   . LEU A 1 69  ? 152.911 185.389 163.782 1.00 140.29 ? 69  LEU A N   1 
ATOM   491   C  CA  . LEU A 1 69  ? 153.239 184.596 164.964 1.00 138.02 ? 69  LEU A CA  1 
ATOM   492   C  C   . LEU A 1 69  ? 153.283 185.470 166.218 1.00 137.08 ? 69  LEU A C   1 
ATOM   493   O  O   . LEU A 1 69  ? 152.719 185.084 167.240 1.00 135.43 ? 69  LEU A O   1 
ATOM   494   C  CB  . LEU A 1 69  ? 154.583 183.880 164.771 1.00 140.02 ? 69  LEU A CB  1 
ATOM   495   N  N   . TYR A 1 70  ? 153.904 186.664 166.120 1.00 131.32 ? 70  TYR A N   1 
ATOM   496   C  CA  . TYR A 1 70  ? 154.081 187.622 167.217 1.00 127.47 ? 70  TYR A CA  1 
ATOM   497   C  C   . TYR A 1 70  ? 152.744 188.145 167.732 1.00 129.09 ? 70  TYR A C   1 
ATOM   498   O  O   . TYR A 1 70  ? 152.534 188.158 168.947 1.00 126.63 ? 70  TYR A O   1 
ATOM   499   C  CB  . TYR A 1 70  ? 154.996 188.789 166.781 1.00 128.14 ? 70  TYR A CB  1 
ATOM   500   C  CG  . TYR A 1 70  ? 155.130 189.932 167.770 1.00 125.85 ? 70  TYR A CG  1 
ATOM   501   C  CD1 . TYR A 1 70  ? 155.618 189.717 169.055 1.00 125.51 ? 70  TYR A CD1 1 
ATOM   502   C  CD2 . TYR A 1 70  ? 154.839 191.237 167.395 1.00 126.17 ? 70  TYR A CD2 1 
ATOM   503   C  CE1 . TYR A 1 70  ? 155.775 190.767 169.955 1.00 123.33 ? 70  TYR A CE1 1 
ATOM   504   C  CE2 . TYR A 1 70  ? 154.990 192.296 168.287 1.00 125.15 ? 70  TYR A CE2 1 
ATOM   505   C  CZ  . TYR A 1 70  ? 155.461 192.056 169.566 1.00 129.25 ? 70  TYR A CZ  1 
ATOM   506   O  OH  . TYR A 1 70  ? 155.606 193.096 170.449 1.00 128.40 ? 70  TYR A OH  1 
ATOM   507   N  N   . GLN A 1 71  ? 151.846 188.556 166.819 1.00 126.33 ? 71  GLN A N   1 
ATOM   508   C  CA  . GLN A 1 71  ? 150.529 189.077 167.180 1.00 125.05 ? 71  GLN A CA  1 
ATOM   509   C  C   . GLN A 1 71  ? 149.613 187.962 167.699 1.00 130.64 ? 71  GLN A C   1 
ATOM   510   O  O   . GLN A 1 71  ? 148.708 188.244 168.488 1.00 129.35 ? 71  GLN A O   1 
ATOM   511   C  CB  . GLN A 1 71  ? 149.875 189.813 166.004 1.00 127.72 ? 71  GLN A CB  1 
ATOM   512   C  CG  . GLN A 1 71  ? 150.600 191.088 165.552 1.00 136.08 ? 71  GLN A CG  1 
ATOM   513   C  CD  . GLN A 1 71  ? 150.719 192.181 166.595 1.00 151.02 ? 71  GLN A CD  1 
ATOM   514   O  OE1 . GLN A 1 71  ? 149.838 192.390 167.439 1.00 146.74 ? 71  GLN A OE1 1 
ATOM   515   N  NE2 . GLN A 1 71  ? 151.805 192.936 166.521 1.00 140.77 ? 71  GLN A NE2 1 
ATOM   516   N  N   . LEU A 1 72  ? 149.863 186.702 167.279 1.00 129.55 ? 72  LEU A N   1 
ATOM   517   C  CA  . LEU A 1 72  ? 149.101 185.533 167.721 1.00 130.34 ? 72  LEU A CA  1 
ATOM   518   C  C   . LEU A 1 72  ? 149.430 185.210 169.185 1.00 133.11 ? 72  LEU A C   1 
ATOM   519   O  O   . LEU A 1 72  ? 148.513 184.974 169.974 1.00 131.87 ? 72  LEU A O   1 
ATOM   520   C  CB  . LEU A 1 72  ? 149.377 184.323 166.819 1.00 133.72 ? 72  LEU A CB  1 
ATOM   521   N  N   . ASP A 1 73  ? 150.737 185.234 169.548 1.00 129.87 ? 73  ASP A N   1 
ATOM   522   C  CA  . ASP A 1 73  ? 151.235 184.988 170.908 1.00 128.31 ? 73  ASP A CA  1 
ATOM   523   C  C   . ASP A 1 73  ? 150.770 186.090 171.853 1.00 130.24 ? 73  ASP A C   1 
ATOM   524   O  O   . ASP A 1 73  ? 150.480 185.818 173.022 1.00 128.84 ? 73  ASP A O   1 
ATOM   525   C  CB  . ASP A 1 73  ? 152.774 184.904 170.918 1.00 130.82 ? 73  ASP A CB  1 
ATOM   526   C  CG  . ASP A 1 73  ? 153.365 183.611 170.382 1.00 146.68 ? 73  ASP A CG  1 
ATOM   527   O  OD1 . ASP A 1 73  ? 152.683 182.927 169.584 1.00 150.24 ? 73  ASP A OD1 1 
ATOM   528   O  OD2 . ASP A 1 73  ? 154.527 183.305 170.725 1.00 153.83 ? 73  ASP A OD2 1 
ATOM   529   N  N   . LYS A 1 74  ? 150.700 187.334 171.336 1.00 126.08 ? 74  LYS A N   1 
ATOM   530   C  CA  . LYS A 1 74  ? 150.255 188.513 172.072 1.00 123.59 ? 74  LYS A CA  1 
ATOM   531   C  C   . LYS A 1 74  ? 148.757 188.412 172.378 1.00 127.31 ? 74  LYS A C   1 
ATOM   532   O  O   . LYS A 1 74  ? 148.349 188.740 173.493 1.00 124.83 ? 74  LYS A O   1 
ATOM   533   C  CB  . LYS A 1 74  ? 150.578 189.793 171.285 1.00 125.93 ? 74  LYS A CB  1 
ATOM   534   C  CG  . LYS A 1 74  ? 151.763 190.566 171.857 1.00 135.29 ? 74  LYS A CG  1 
ATOM   535   C  CD  . LYS A 1 74  ? 152.267 191.637 170.905 1.00 146.76 ? 74  LYS A CD  1 
ATOM   536   C  CE  . LYS A 1 74  ? 151.495 192.934 170.972 1.00 162.68 ? 74  LYS A CE  1 
ATOM   537   N  NZ  . LYS A 1 74  ? 151.971 193.911 169.957 1.00 176.59 ? 74  LYS A NZ  1 
ATOM   538   N  N   . SER A 1 75  ? 147.956 187.910 171.405 1.00 126.39 ? 75  SER A N   1 
ATOM   539   C  CA  . SER A 1 75  ? 146.504 187.730 171.524 1.00 127.20 ? 75  SER A CA  1 
ATOM   540   C  C   . SER A 1 75  ? 146.147 186.676 172.585 1.00 130.53 ? 75  SER A C   1 
ATOM   541   O  O   . SER A 1 75  ? 145.226 186.897 173.380 1.00 129.42 ? 75  SER A O   1 
ATOM   542   C  CB  . SER A 1 75  ? 145.898 187.340 170.177 1.00 134.20 ? 75  SER A CB  1 
ATOM   543   O  OG  . SER A 1 75  ? 144.479 187.325 170.226 1.00 144.81 ? 75  SER A OG  1 
ATOM   544   N  N   . THR A 1 76  ? 146.885 185.546 172.601 1.00 127.53 ? 76  THR A N   1 
ATOM   545   C  CA  . THR A 1 76  ? 146.692 184.442 173.548 1.00 127.15 ? 76  THR A CA  1 
ATOM   546   C  C   . THR A 1 76  ? 146.930 184.936 174.980 1.00 126.64 ? 76  THR A C   1 
ATOM   547   O  O   . THR A 1 76  ? 146.098 184.678 175.855 1.00 125.15 ? 76  THR A O   1 
ATOM   548   C  CB  . THR A 1 76  ? 147.612 183.255 173.200 1.00 141.07 ? 76  THR A CB  1 
ATOM   549   O  OG1 . THR A 1 76  ? 147.689 183.087 171.782 1.00 146.10 ? 76  THR A OG1 1 
ATOM   550   C  CG2 . THR A 1 76  ? 147.157 181.956 173.852 1.00 141.59 ? 76  THR A CG2 1 
ATOM   551   N  N   . PHE A 1 77  ? 148.051 185.666 175.201 1.00 121.28 ? 77  PHE A N   1 
ATOM   552   C  CA  . PHE A 1 77  ? 148.419 186.238 176.498 1.00 118.64 ? 77  PHE A CA  1 
ATOM   553   C  C   . PHE A 1 77  ? 147.387 187.266 176.925 1.00 120.77 ? 77  PHE A C   1 
ATOM   554   O  O   . PHE A 1 77  ? 146.952 187.237 178.077 1.00 119.01 ? 77  PHE A O   1 
ATOM   555   C  CB  . PHE A 1 77  ? 149.829 186.874 176.460 1.00 119.76 ? 77  PHE A CB  1 
ATOM   556   C  CG  . PHE A 1 77  ? 150.235 187.597 177.731 1.00 119.22 ? 77  PHE A CG  1 
ATOM   557   C  CD1 . PHE A 1 77  ? 150.717 186.894 178.828 1.00 121.64 ? 77  PHE A CD1 1 
ATOM   558   C  CD2 . PHE A 1 77  ? 150.133 188.981 177.827 1.00 120.03 ? 77  PHE A CD2 1 
ATOM   559   C  CE1 . PHE A 1 77  ? 151.081 187.559 180.002 1.00 121.03 ? 77  PHE A CE1 1 
ATOM   560   C  CE2 . PHE A 1 77  ? 150.489 189.643 179.003 1.00 121.45 ? 77  PHE A CE2 1 
ATOM   561   C  CZ  . PHE A 1 77  ? 150.959 188.927 180.082 1.00 119.20 ? 77  PHE A CZ  1 
ATOM   562   N  N   . SER A 1 78  ? 146.994 188.164 175.987 1.00 117.55 ? 78  SER A N   1 
ATOM   563   C  CA  . SER A 1 78  ? 146.012 189.232 176.189 1.00 116.87 ? 78  SER A CA  1 
ATOM   564   C  C   . SER A 1 78  ? 144.704 188.694 176.770 1.00 120.40 ? 78  SER A C   1 
ATOM   565   O  O   . SER A 1 78  ? 144.115 189.353 177.634 1.00 119.35 ? 78  SER A O   1 
ATOM   566   C  CB  . SER A 1 78  ? 145.737 189.956 174.876 1.00 122.24 ? 78  SER A CB  1 
ATOM   567   O  OG  . SER A 1 78  ? 144.856 191.052 175.054 1.00 132.69 ? 78  SER A OG  1 
ATOM   568   N  N   . PHE A 1 79  ? 144.276 187.488 176.323 1.00 117.47 ? 79  PHE A N   1 
ATOM   569   C  CA  . PHE A 1 79  ? 143.052 186.846 176.795 1.00 117.75 ? 79  PHE A CA  1 
ATOM   570   C  C   . PHE A 1 79  ? 143.157 186.402 178.257 1.00 119.10 ? 79  PHE A C   1 
ATOM   571   O  O   . PHE A 1 79  ? 142.351 186.849 179.072 1.00 118.14 ? 79  PHE A O   1 
ATOM   572   C  CB  . PHE A 1 79  ? 142.665 185.647 175.914 1.00 122.06 ? 79  PHE A CB  1 
ATOM   573   C  CG  . PHE A 1 79  ? 141.567 184.801 176.520 1.00 125.00 ? 79  PHE A CG  1 
ATOM   574   C  CD1 . PHE A 1 79  ? 140.274 185.297 176.653 1.00 129.43 ? 79  PHE A CD1 1 
ATOM   575   C  CD2 . PHE A 1 79  ? 141.833 183.521 176.986 1.00 127.98 ? 79  PHE A CD2 1 
ATOM   576   C  CE1 . PHE A 1 79  ? 139.269 184.522 177.233 1.00 132.10 ? 79  PHE A CE1 1 
ATOM   577   C  CE2 . PHE A 1 79  ? 140.824 182.747 177.564 1.00 132.58 ? 79  PHE A CE2 1 
ATOM   578   C  CZ  . PHE A 1 79  ? 139.548 183.250 177.677 1.00 131.71 ? 79  PHE A CZ  1 
ATOM   579   N  N   . TRP A 1 80  ? 144.111 185.496 178.566 1.00 114.31 ? 80  TRP A N   1 
ATOM   580   C  CA  . TRP A 1 80  ? 144.316 184.919 179.897 1.00 112.38 ? 80  TRP A CA  1 
ATOM   581   C  C   . TRP A 1 80  ? 144.709 185.960 180.947 1.00 115.12 ? 80  TRP A C   1 
ATOM   582   O  O   . TRP A 1 80  ? 144.233 185.862 182.081 1.00 114.87 ? 80  TRP A O   1 
ATOM   583   C  CB  . TRP A 1 80  ? 145.353 183.801 179.850 1.00 110.90 ? 80  TRP A CB  1 
ATOM   584   C  CG  . TRP A 1 80  ? 144.893 182.616 179.064 1.00 113.87 ? 80  TRP A CG  1 
ATOM   585   C  CD1 . TRP A 1 80  ? 145.303 182.251 177.818 1.00 118.43 ? 80  TRP A CD1 1 
ATOM   586   C  CD2 . TRP A 1 80  ? 143.900 181.661 179.458 1.00 115.20 ? 80  TRP A CD2 1 
ATOM   587   N  NE1 . TRP A 1 80  ? 144.654 181.105 177.422 1.00 120.57 ? 80  TRP A NE1 1 
ATOM   588   C  CE2 . TRP A 1 80  ? 143.783 180.723 178.409 1.00 122.01 ? 80  TRP A CE2 1 
ATOM   589   C  CE3 . TRP A 1 80  ? 143.100 181.498 180.603 1.00 116.03 ? 80  TRP A CE3 1 
ATOM   590   C  CZ2 . TRP A 1 80  ? 142.891 179.641 178.466 1.00 123.90 ? 80  TRP A CZ2 1 
ATOM   591   C  CZ3 . TRP A 1 80  ? 142.221 180.423 180.661 1.00 119.79 ? 80  TRP A CZ3 1 
ATOM   592   C  CH2 . TRP A 1 80  ? 142.120 179.511 179.602 1.00 123.29 ? 80  TRP A CH2 1 
ATOM   593   N  N   . SER A 1 81  ? 145.551 186.954 180.583 1.00 110.59 ? 81  SER A N   1 
ATOM   594   C  CA  . SER A 1 81  ? 145.926 188.032 181.502 1.00 109.03 ? 81  SER A CA  1 
ATOM   595   C  C   . SER A 1 81  ? 144.699 188.925 181.766 1.00 113.30 ? 81  SER A C   1 
ATOM   596   O  O   . SER A 1 81  ? 144.509 189.391 182.892 1.00 112.82 ? 81  SER A O   1 
ATOM   597   C  CB  . SER A 1 81  ? 147.096 188.845 180.954 1.00 112.34 ? 81  SER A CB  1 
ATOM   598   O  OG  . SER A 1 81  ? 146.754 189.546 179.770 1.00 123.54 ? 81  SER A OG  1 
ATOM   599   N  N   . GLY A 1 82  ? 143.866 189.099 180.734 1.00 110.04 ? 82  GLY A N   1 
ATOM   600   C  CA  . GLY A 1 82  ? 142.629 189.866 180.796 1.00 110.32 ? 82  GLY A CA  1 
ATOM   601   C  C   . GLY A 1 82  ? 141.539 189.143 181.561 1.00 114.14 ? 82  GLY A C   1 
ATOM   602   O  O   . GLY A 1 82  ? 140.785 189.769 182.314 1.00 114.69 ? 82  GLY A O   1 
ATOM   603   N  N   . LEU A 1 83  ? 141.457 187.809 181.377 1.00 109.69 ? 83  LEU A N   1 
ATOM   604   C  CA  . LEU A 1 83  ? 140.479 186.945 182.041 1.00 109.57 ? 83  LEU A CA  1 
ATOM   605   C  C   . LEU A 1 83  ? 140.759 186.883 183.536 1.00 112.28 ? 83  LEU A C   1 
ATOM   606   O  O   . LEU A 1 83  ? 139.813 186.979 184.320 1.00 112.59 ? 83  LEU A O   1 
ATOM   607   C  CB  . LEU A 1 83  ? 140.472 185.531 181.417 1.00 110.36 ? 83  LEU A CB  1 
ATOM   608   C  CG  . LEU A 1 83  ? 139.533 184.477 182.011 1.00 114.99 ? 83  LEU A CG  1 
ATOM   609   C  CD1 . LEU A 1 83  ? 138.073 184.891 181.906 1.00 116.57 ? 83  LEU A CD1 1 
ATOM   610   C  CD2 . LEU A 1 83  ? 139.749 183.146 181.347 1.00 117.81 ? 83  LEU A CD2 1 
ATOM   611   N  N   . TYR A 1 84  ? 142.053 186.756 183.925 1.00 107.58 ? 84  TYR A N   1 
ATOM   612   C  CA  . TYR A 1 84  ? 142.488 186.706 185.322 1.00 106.73 ? 84  TYR A CA  1 
ATOM   613   C  C   . TYR A 1 84  ? 142.064 187.990 186.043 1.00 112.06 ? 84  TYR A C   1 
ATOM   614   O  O   . TYR A 1 84  ? 141.532 187.915 187.151 1.00 112.59 ? 84  TYR A O   1 
ATOM   615   C  CB  . TYR A 1 84  ? 144.012 186.485 185.427 1.00 106.57 ? 84  TYR A CB  1 
ATOM   616   C  CG  . TYR A 1 84  ? 144.528 186.395 186.848 1.00 108.06 ? 84  TYR A CG  1 
ATOM   617   C  CD1 . TYR A 1 84  ? 144.435 185.208 187.571 1.00 110.80 ? 84  TYR A CD1 1 
ATOM   618   C  CD2 . TYR A 1 84  ? 145.133 187.489 187.462 1.00 108.23 ? 84  TYR A CD2 1 
ATOM   619   C  CE1 . TYR A 1 84  ? 144.912 185.117 188.881 1.00 111.84 ? 84  TYR A CE1 1 
ATOM   620   C  CE2 . TYR A 1 84  ? 145.612 187.412 188.772 1.00 109.15 ? 84  TYR A CE2 1 
ATOM   621   C  CZ  . TYR A 1 84  ? 145.506 186.220 189.477 1.00 118.44 ? 84  TYR A CZ  1 
ATOM   622   O  OH  . TYR A 1 84  ? 145.987 186.130 190.765 1.00 119.36 ? 84  TYR A OH  1 
ATOM   623   N  N   . SER A 1 85  ? 142.258 189.153 185.386 1.00 108.27 ? 85  SER A N   1 
ATOM   624   C  CA  . SER A 1 85  ? 141.905 190.476 185.904 1.00 107.64 ? 85  SER A CA  1 
ATOM   625   C  C   . SER A 1 85  ? 140.402 190.580 186.151 1.00 110.46 ? 85  SER A C   1 
ATOM   626   O  O   . SER A 1 85  ? 139.997 190.932 187.260 1.00 109.96 ? 85  SER A O   1 
ATOM   627   C  CB  . SER A 1 85  ? 142.355 191.568 184.934 1.00 112.16 ? 85  SER A CB  1 
ATOM   628   O  OG  . SER A 1 85  ? 143.724 191.431 184.586 1.00 122.52 ? 85  SER A OG  1 
ATOM   629   N  N   . GLU A 1 86  ? 139.584 190.229 185.132 1.00 106.77 ? 86  GLU A N   1 
ATOM   630   C  CA  . GLU A 1 86  ? 138.126 190.278 185.197 1.00 107.99 ? 86  GLU A CA  1 
ATOM   631   C  C   . GLU A 1 86  ? 137.583 189.313 186.252 1.00 110.56 ? 86  GLU A C   1 
ATOM   632   O  O   . GLU A 1 86  ? 136.592 189.639 186.904 1.00 111.76 ? 86  GLU A O   1 
ATOM   633   C  CB  . GLU A 1 86  ? 137.506 189.990 183.824 1.00 111.21 ? 86  GLU A CB  1 
ATOM   634   C  CG  . GLU A 1 86  ? 136.019 190.319 183.728 1.00 126.92 ? 86  GLU A CG  1 
ATOM   635   C  CD  . GLU A 1 86  ? 135.604 191.755 183.995 1.00 151.78 ? 86  GLU A CD  1 
ATOM   636   O  OE1 . GLU A 1 86  ? 136.223 192.676 183.415 1.00 155.85 ? 86  GLU A OE1 1 
ATOM   637   O  OE2 . GLU A 1 86  ? 134.635 191.956 184.763 1.00 144.28 ? 86  GLU A OE2 1 
ATOM   638   N  N   . THR A 1 87  ? 138.236 188.150 186.440 1.00 104.68 ? 87  THR A N   1 
ATOM   639   C  CA  . THR A 1 87  ? 137.832 187.181 187.459 1.00 104.33 ? 87  THR A CA  1 
ATOM   640   C  C   . THR A 1 87  ? 138.204 187.737 188.836 1.00 108.55 ? 87  THR A C   1 
ATOM   641   O  O   . THR A 1 87  ? 137.367 187.717 189.739 1.00 109.70 ? 87  THR A O   1 
ATOM   642   C  CB  . THR A 1 87  ? 138.446 185.805 187.193 1.00 102.68 ? 87  THR A CB  1 
ATOM   643   O  OG1 . THR A 1 87  ? 138.122 185.414 185.864 1.00 102.34 ? 87  THR A OG1 1 
ATOM   644   C  CG2 . THR A 1 87  ? 137.946 184.750 188.153 1.00 99.04  ? 87  THR A CG2 1 
ATOM   645   N  N   . GLU A 1 88  ? 139.435 188.274 188.977 1.00 103.79 ? 88  GLU A N   1 
ATOM   646   C  CA  . GLU A 1 88  ? 139.928 188.840 190.230 1.00 103.21 ? 88  GLU A CA  1 
ATOM   647   C  C   . GLU A 1 88  ? 139.046 189.965 190.741 1.00 108.57 ? 88  GLU A C   1 
ATOM   648   O  O   . GLU A 1 88  ? 138.688 189.959 191.919 1.00 108.90 ? 88  GLU A O   1 
ATOM   649   C  CB  . GLU A 1 88  ? 141.368 189.344 190.094 1.00 103.22 ? 88  GLU A CB  1 
ATOM   650   C  CG  . GLU A 1 88  ? 142.408 188.328 190.527 1.00 113.62 ? 88  GLU A CG  1 
ATOM   651   C  CD  . GLU A 1 88  ? 142.524 187.987 192.003 1.00 133.24 ? 88  GLU A CD  1 
ATOM   652   O  OE1 . GLU A 1 88  ? 141.707 188.467 192.823 1.00 119.06 ? 88  GLU A OE1 1 
ATOM   653   O  OE2 . GLU A 1 88  ? 143.448 187.213 192.335 1.00 133.27 ? 88  GLU A OE2 1 
ATOM   654   N  N   . GLY A 1 89  ? 138.697 190.898 189.855 1.00 105.87 ? 89  GLY A N   1 
ATOM   655   C  CA  . GLY A 1 89  ? 137.842 192.035 190.175 1.00 107.30 ? 89  GLY A CA  1 
ATOM   656   C  C   . GLY A 1 89  ? 136.507 191.591 190.730 1.00 112.49 ? 89  GLY A C   1 
ATOM   657   O  O   . GLY A 1 89  ? 136.111 192.018 191.818 1.00 112.80 ? 89  GLY A O   1 
ATOM   658   N  N   . THR A 1 90  ? 135.851 190.666 190.009 1.00 109.48 ? 90  THR A N   1 
ATOM   659   C  CA  . THR A 1 90  ? 134.565 190.079 190.362 1.00 111.41 ? 90  THR A CA  1 
ATOM   660   C  C   . THR A 1 90  ? 134.674 189.361 191.713 1.00 115.40 ? 90  THR A C   1 
ATOM   661   O  O   . THR A 1 90  ? 133.850 189.631 192.584 1.00 117.26 ? 90  THR A O   1 
ATOM   662   C  CB  . THR A 1 90  ? 134.095 189.156 189.231 1.00 118.36 ? 90  THR A CB  1 
ATOM   663   O  OG1 . THR A 1 90  ? 133.961 189.937 188.048 1.00 118.71 ? 90  THR A OG1 1 
ATOM   664   C  CG2 . THR A 1 90  ? 132.771 188.487 189.523 1.00 119.62 ? 90  THR A CG2 1 
ATOM   665   N  N   . LEU A 1 91  ? 135.711 188.508 191.906 1.00 109.63 ? 91  LEU A N   1 
ATOM   666   C  CA  . LEU A 1 91  ? 135.915 187.742 193.146 1.00 109.04 ? 91  LEU A CA  1 
ATOM   667   C  C   . LEU A 1 91  ? 136.176 188.630 194.367 1.00 111.91 ? 91  LEU A C   1 
ATOM   668   O  O   . LEU A 1 91  ? 135.602 188.357 195.417 1.00 112.33 ? 91  LEU A O   1 
ATOM   669   C  CB  . LEU A 1 91  ? 137.041 186.706 193.012 1.00 107.47 ? 91  LEU A CB  1 
ATOM   670   C  CG  . LEU A 1 91  ? 136.790 185.513 192.069 1.00 113.41 ? 91  LEU A CG  1 
ATOM   671   C  CD1 . LEU A 1 91  ? 138.013 184.668 191.949 1.00 112.20 ? 91  LEU A CD1 1 
ATOM   672   C  CD2 . LEU A 1 91  ? 135.633 184.640 192.529 1.00 118.96 ? 91  LEU A CD2 1 
ATOM   673   N  N   . ILE A 1 92  ? 137.006 189.689 194.231 1.00 107.21 ? 92  ILE A N   1 
ATOM   674   C  CA  . ILE A 1 92  ? 137.314 190.624 195.326 1.00 107.06 ? 92  ILE A CA  1 
ATOM   675   C  C   . ILE A 1 92  ? 136.022 191.325 195.770 1.00 114.29 ? 92  ILE A C   1 
ATOM   676   O  O   . ILE A 1 92  ? 135.760 191.404 196.973 1.00 115.58 ? 92  ILE A O   1 
ATOM   677   C  CB  . ILE A 1 92  ? 138.435 191.631 194.928 1.00 108.47 ? 92  ILE A CB  1 
ATOM   678   C  CG1 . ILE A 1 92  ? 139.809 190.935 194.951 1.00 106.48 ? 92  ILE A CG1 1 
ATOM   679   C  CG2 . ILE A 1 92  ? 138.442 192.884 195.837 1.00 110.54 ? 92  ILE A CG2 1 
ATOM   680   C  CD1 . ILE A 1 92  ? 140.832 191.513 194.020 1.00 111.88 ? 92  ILE A CD1 1 
ATOM   681   N  N   . LEU A 1 93  ? 135.205 191.787 194.795 1.00 111.93 ? 93  LEU A N   1 
ATOM   682   C  CA  . LEU A 1 93  ? 133.931 192.470 195.032 1.00 114.65 ? 93  LEU A CA  1 
ATOM   683   C  C   . LEU A 1 93  ? 132.921 191.558 195.739 1.00 120.42 ? 93  LEU A C   1 
ATOM   684   O  O   . LEU A 1 93  ? 132.339 191.981 196.743 1.00 122.43 ? 93  LEU A O   1 
ATOM   685   C  CB  . LEU A 1 93  ? 133.328 192.993 193.714 1.00 115.78 ? 93  LEU A CB  1 
ATOM   686   C  CG  . LEU A 1 93  ? 134.006 194.194 193.056 1.00 119.56 ? 93  LEU A CG  1 
ATOM   687   C  CD1 . LEU A 1 93  ? 133.574 194.327 191.620 1.00 120.40 ? 93  LEU A CD1 1 
ATOM   688   C  CD2 . LEU A 1 93  ? 133.717 195.483 193.802 1.00 124.04 ? 93  LEU A CD2 1 
ATOM   689   N  N   . LEU A 1 94  ? 132.729 190.311 195.222 1.00 115.67 ? 94  LEU A N   1 
ATOM   690   C  CA  . LEU A 1 94  ? 131.802 189.298 195.750 1.00 116.82 ? 94  LEU A CA  1 
ATOM   691   C  C   . LEU A 1 94  ? 132.229 188.793 197.127 1.00 122.74 ? 94  LEU A C   1 
ATOM   692   O  O   . LEU A 1 94  ? 131.380 188.627 198.005 1.00 125.27 ? 94  LEU A O   1 
ATOM   693   C  CB  . LEU A 1 94  ? 131.664 188.094 194.798 1.00 115.82 ? 94  LEU A CB  1 
ATOM   694   C  CG  . LEU A 1 94  ? 131.075 188.312 193.412 1.00 120.14 ? 94  LEU A CG  1 
ATOM   695   C  CD1 . LEU A 1 94  ? 131.203 187.057 192.599 1.00 119.40 ? 94  LEU A CD1 1 
ATOM   696   C  CD2 . LEU A 1 94  ? 129.626 188.742 193.474 1.00 125.89 ? 94  LEU A CD2 1 
ATOM   697   N  N   . PHE A 1 95  ? 133.537 188.538 197.311 1.00 117.69 ? 95  PHE A N   1 
ATOM   698   C  CA  . PHE A 1 95  ? 134.112 188.065 198.569 1.00 117.63 ? 95  PHE A CA  1 
ATOM   699   C  C   . PHE A 1 95  ? 134.100 189.184 199.636 1.00 122.00 ? 95  PHE A C   1 
ATOM   700   O  O   . PHE A 1 95  ? 134.140 188.884 200.830 1.00 122.87 ? 95  PHE A O   1 
ATOM   701   C  CB  . PHE A 1 95  ? 135.542 187.563 198.318 1.00 117.31 ? 95  PHE A CB  1 
ATOM   702   C  CG  . PHE A 1 95  ? 136.138 186.632 199.342 1.00 119.36 ? 95  PHE A CG  1 
ATOM   703   C  CD1 . PHE A 1 95  ? 136.003 185.254 199.212 1.00 123.61 ? 95  PHE A CD1 1 
ATOM   704   C  CD2 . PHE A 1 95  ? 136.912 187.127 200.388 1.00 121.59 ? 95  PHE A CD2 1 
ATOM   705   C  CE1 . PHE A 1 95  ? 136.594 184.388 200.141 1.00 124.84 ? 95  PHE A CE1 1 
ATOM   706   C  CE2 . PHE A 1 95  ? 137.501 186.262 201.318 1.00 124.54 ? 95  PHE A CE2 1 
ATOM   707   C  CZ  . PHE A 1 95  ? 137.341 184.899 201.187 1.00 123.22 ? 95  PHE A CZ  1 
ATOM   708   N  N   . GLY A 1 96  ? 134.022 190.442 199.195 1.00 117.92 ? 96  GLY A N   1 
ATOM   709   C  CA  . GLY A 1 96  ? 134.014 191.615 200.064 1.00 118.85 ? 96  GLY A CA  1 
ATOM   710   C  C   . GLY A 1 96  ? 135.399 191.961 200.578 1.00 120.92 ? 96  GLY A C   1 
ATOM   711   O  O   . GLY A 1 96  ? 135.591 192.144 201.785 1.00 121.83 ? 96  GLY A O   1 
ATOM   712   N  N   . GLY A 1 97  ? 136.360 192.042 199.654 1.00 114.38 ? 97  GLY A N   1 
ATOM   713   C  CA  . GLY A 1 97  ? 137.756 192.350 199.942 1.00 111.98 ? 97  GLY A CA  1 
ATOM   714   C  C   . GLY A 1 97  ? 137.992 193.773 200.407 1.00 116.32 ? 97  GLY A C   1 
ATOM   715   O  O   . GLY A 1 97  ? 138.578 193.982 201.472 1.00 116.17 ? 97  GLY A O   1 
ATOM   716   N  N   . ILE A 1 98  ? 137.526 194.759 199.609 1.00 113.89 ? 98  ILE A N   1 
ATOM   717   C  CA  . ILE A 1 98  ? 137.653 196.211 199.846 1.00 115.84 ? 98  ILE A CA  1 
ATOM   718   C  C   . ILE A 1 98  ? 137.146 196.636 201.269 1.00 122.71 ? 98  ILE A C   1 
ATOM   719   O  O   . ILE A 1 98  ? 137.918 197.313 201.959 1.00 122.85 ? 98  ILE A O   1 
ATOM   720   C  CB  . ILE A 1 98  ? 136.959 197.037 198.720 1.00 120.15 ? 98  ILE A CB  1 
ATOM   721   C  CG1 . ILE A 1 98  ? 137.416 196.569 197.314 1.00 118.21 ? 98  ILE A CG1 1 
ATOM   722   C  CG2 . ILE A 1 98  ? 137.177 198.549 198.910 1.00 123.05 ? 98  ILE A CG2 1 
ATOM   723   C  CD1 . ILE A 1 98  ? 136.403 196.801 196.184 1.00 128.31 ? 98  ILE A CD1 1 
ATOM   724   N  N   . PRO A 1 99  ? 135.915 196.275 201.746 1.00 121.51 ? 99  PRO A N   1 
ATOM   725   C  CA  . PRO A 1 99  ? 135.509 196.697 203.103 1.00 124.25 ? 99  PRO A CA  1 
ATOM   726   C  C   . PRO A 1 99  ? 136.351 196.068 204.213 1.00 126.77 ? 99  PRO A C   1 
ATOM   727   O  O   . PRO A 1 99  ? 136.627 196.737 205.204 1.00 128.25 ? 99  PRO A O   1 
ATOM   728   C  CB  . PRO A 1 99  ? 134.048 196.239 203.204 1.00 128.06 ? 99  PRO A CB  1 
ATOM   729   C  CG  . PRO A 1 99  ? 133.618 195.965 201.810 1.00 131.36 ? 99  PRO A CG  1 
ATOM   730   C  CD  . PRO A 1 99  ? 134.839 195.491 201.105 1.00 123.17 ? 99  PRO A CD  1 
ATOM   731   N  N   . TYR A 1 100 ? 136.765 194.798 204.041 1.00 120.70 ? 100 TYR A N   1 
ATOM   732   C  CA  . TYR A 1 100 ? 137.582 194.071 205.009 1.00 119.91 ? 100 TYR A CA  1 
ATOM   733   C  C   . TYR A 1 100 ? 139.000 194.631 205.034 1.00 123.27 ? 100 TYR A C   1 
ATOM   734   O  O   . TYR A 1 100 ? 139.590 194.712 206.110 1.00 123.80 ? 100 TYR A O   1 
ATOM   735   C  CB  . TYR A 1 100 ? 137.578 192.567 204.700 1.00 119.20 ? 100 TYR A CB  1 
ATOM   736   C  CG  . TYR A 1 100 ? 138.508 191.728 205.555 1.00 120.22 ? 100 TYR A CG  1 
ATOM   737   C  CD1 . TYR A 1 100 ? 138.298 191.589 206.926 1.00 124.29 ? 100 TYR A CD1 1 
ATOM   738   C  CD2 . TYR A 1 100 ? 139.558 191.020 204.983 1.00 118.35 ? 100 TYR A CD2 1 
ATOM   739   C  CE1 . TYR A 1 100 ? 139.136 190.794 207.710 1.00 124.53 ? 100 TYR A CE1 1 
ATOM   740   C  CE2 . TYR A 1 100 ? 140.393 190.212 205.752 1.00 118.89 ? 100 TYR A CE2 1 
ATOM   741   C  CZ  . TYR A 1 100 ? 140.186 190.111 207.116 1.00 129.02 ? 100 TYR A CZ  1 
ATOM   742   O  OH  . TYR A 1 100 ? 141.019 189.315 207.862 1.00 131.41 ? 100 TYR A OH  1 
ATOM   743   N  N   . LEU A 1 101 ? 139.543 195.037 203.869 1.00 119.19 ? 101 LEU A N   1 
ATOM   744   C  CA  . LEU A 1 101 ? 140.873 195.651 203.808 1.00 119.21 ? 101 LEU A CA  1 
ATOM   745   C  C   . LEU A 1 101 ? 140.821 196.996 204.532 1.00 128.92 ? 101 LEU A C   1 
ATOM   746   O  O   . LEU A 1 101 ? 141.761 197.326 205.263 1.00 130.17 ? 101 LEU A O   1 
ATOM   747   C  CB  . LEU A 1 101 ? 141.376 195.813 202.353 1.00 116.87 ? 101 LEU A CB  1 
ATOM   748   C  CG  . LEU A 1 101 ? 142.779 196.440 202.145 1.00 120.59 ? 101 LEU A CG  1 
ATOM   749   C  CD1 . LEU A 1 101 ? 143.887 195.567 202.719 1.00 119.15 ? 101 LEU A CD1 1 
ATOM   750   C  CD2 . LEU A 1 101 ? 143.042 196.729 200.678 1.00 121.41 ? 101 LEU A CD2 1 
ATOM   751   N  N   . TRP A 1 102 ? 139.687 197.735 204.377 1.00 128.38 ? 102 TRP A N   1 
ATOM   752   C  CA  . TRP A 1 102 ? 139.450 199.023 205.031 1.00 132.22 ? 102 TRP A CA  1 
ATOM   753   C  C   . TRP A 1 102 ? 139.483 198.867 206.554 1.00 139.44 ? 102 TRP A C   1 
ATOM   754   O  O   . TRP A 1 102 ? 140.045 199.722 207.236 1.00 141.74 ? 102 TRP A O   1 
ATOM   755   C  CB  . TRP A 1 102 ? 138.120 199.642 204.579 1.00 132.98 ? 102 TRP A CB  1 
ATOM   756   C  CG  . TRP A 1 102 ? 137.899 201.018 205.136 1.00 138.21 ? 102 TRP A CG  1 
ATOM   757   C  CD1 . TRP A 1 102 ? 137.161 201.348 206.234 1.00 144.71 ? 102 TRP A CD1 1 
ATOM   758   C  CD2 . TRP A 1 102 ? 138.502 202.237 204.678 1.00 139.47 ? 102 TRP A CD2 1 
ATOM   759   N  NE1 . TRP A 1 102 ? 137.236 202.703 206.465 1.00 147.89 ? 102 TRP A NE1 1 
ATOM   760   C  CE2 . TRP A 1 102 ? 138.054 203.273 205.526 1.00 147.96 ? 102 TRP A CE2 1 
ATOM   761   C  CE3 . TRP A 1 102 ? 139.361 202.559 203.614 1.00 138.93 ? 102 TRP A CE3 1 
ATOM   762   C  CZ2 . TRP A 1 102 ? 138.449 204.606 205.354 1.00 150.07 ? 102 TRP A CZ2 1 
ATOM   763   C  CZ3 . TRP A 1 102 ? 139.738 203.881 203.435 1.00 143.07 ? 102 TRP A CZ3 1 
ATOM   764   C  CH2 . TRP A 1 102 ? 139.276 204.888 204.291 1.00 148.32 ? 102 TRP A CH2 1 
ATOM   765   N  N   . ARG A 1 103 ? 138.911 197.764 207.074 1.00 136.03 ? 103 ARG A N   1 
ATOM   766   C  CA  . ARG A 1 103 ? 138.886 197.445 208.505 1.00 138.22 ? 103 ARG A CA  1 
ATOM   767   C  C   . ARG A 1 103 ? 140.303 197.175 209.011 1.00 140.79 ? 103 ARG A C   1 
ATOM   768   O  O   . ARG A 1 103 ? 140.668 197.651 210.089 1.00 143.12 ? 103 ARG A O   1 
ATOM   769   C  CB  . ARG A 1 103 ? 137.981 196.230 208.782 1.00 140.16 ? 103 ARG A CB  1 
ATOM   770   C  CG  . ARG A 1 103 ? 136.499 196.485 208.549 1.00 161.19 ? 103 ARG A CG  1 
ATOM   771   C  CD  . ARG A 1 103 ? 135.733 195.200 208.307 1.00 181.69 ? 103 ARG A CD  1 
ATOM   772   N  NE  . ARG A 1 103 ? 134.389 195.484 207.808 1.00 202.23 ? 103 ARG A NE  1 
ATOM   773   C  CZ  . ARG A 1 103 ? 133.486 194.558 207.505 1.00 220.56 ? 103 ARG A CZ  1 
ATOM   774   N  NH1 . ARG A 1 103 ? 133.776 193.269 207.639 1.00 207.64 ? 103 ARG A NH1 1 
ATOM   775   N  NH2 . ARG A 1 103 ? 132.287 194.912 207.062 1.00 210.27 ? 103 ARG A NH2 1 
ATOM   776   N  N   . LEU A 1 104 ? 141.107 196.446 208.197 1.00 133.70 ? 104 LEU A N   1 
ATOM   777   C  CA  . LEU A 1 104 ? 142.494 196.058 208.485 1.00 132.43 ? 104 LEU A CA  1 
ATOM   778   C  C   . LEU A 1 104 ? 143.463 197.237 208.444 1.00 138.18 ? 104 LEU A C   1 
ATOM   779   O  O   . LEU A 1 104 ? 144.521 197.178 209.079 1.00 139.02 ? 104 LEU A O   1 
ATOM   780   C  CB  . LEU A 1 104 ? 142.973 194.972 207.514 1.00 128.59 ? 104 LEU A CB  1 
ATOM   781   C  CG  . LEU A 1 104 ? 142.422 193.575 207.756 1.00 131.70 ? 104 LEU A CG  1 
ATOM   782   C  CD1 . LEU A 1 104 ? 142.826 192.654 206.649 1.00 128.95 ? 104 LEU A CD1 1 
ATOM   783   C  CD2 . LEU A 1 104 ? 142.881 193.020 209.089 1.00 134.57 ? 104 LEU A CD2 1 
ATOM   784   N  N   . SER A 1 105 ? 143.109 198.300 207.705 1.00 134.96 ? 105 SER A N   1 
ATOM   785   C  CA  . SER A 1 105 ? 143.927 199.506 207.620 1.00 136.49 ? 105 SER A CA  1 
ATOM   786   C  C   . SER A 1 105 ? 143.420 200.568 208.647 1.00 144.41 ? 105 SER A C   1 
ATOM   787   O  O   . SER A 1 105 ? 143.531 201.774 208.418 1.00 146.67 ? 105 SER A O   1 
ATOM   788   C  CB  . SER A 1 105 ? 143.963 200.038 206.185 1.00 137.75 ? 105 SER A CB  1 
ATOM   789   O  OG  . SER A 1 105 ? 142.707 199.992 205.529 1.00 143.93 ? 105 SER A OG  1 
ATOM   790   N  N   . GLY A 1 106 ? 142.917 200.091 209.788 1.00 141.50 ? 106 GLY A N   1 
ATOM   791   C  CA  . GLY A 1 106 ? 142.414 200.936 210.863 1.00 145.66 ? 106 GLY A CA  1 
ATOM   792   C  C   . GLY A 1 106 ? 143.283 200.921 212.101 1.00 151.83 ? 106 GLY A C   1 
ATOM   793   O  O   . GLY A 1 106 ? 144.513 200.950 211.995 1.00 150.71 ? 106 GLY A O   1 
ATOM   794   N  N   . ARG A 1 107 ? 142.627 200.877 213.289 1.00 151.46 ? 107 ARG A N   1 
ATOM   795   C  CA  . ARG A 1 107 ? 143.203 200.864 214.644 1.00 183.54 ? 107 ARG A CA  1 
ATOM   796   C  C   . ARG A 1 107 ? 144.116 202.066 214.876 1.00 210.23 ? 107 ARG A C   1 
ATOM   797   O  O   . ARG A 1 107 ? 143.737 202.993 215.587 1.00 174.48 ? 107 ARG A O   1 
ATOM   798   C  CB  . ARG A 1 107 ? 143.958 199.556 214.933 1.00 181.47 ? 107 ARG A CB  1 
ATOM   799   N  N   . PRO A 1 116 ? 139.171 214.263 211.270 1.00 195.45 ? 116 PRO A N   1 
ATOM   800   C  CA  . PRO A 1 116 ? 139.425 214.110 209.830 1.00 193.85 ? 116 PRO A CA  1 
ATOM   801   C  C   . PRO A 1 116 ? 140.794 213.500 209.539 1.00 195.45 ? 116 PRO A C   1 
ATOM   802   O  O   . PRO A 1 116 ? 140.934 212.802 208.534 1.00 189.72 ? 116 PRO A O   1 
ATOM   803   C  CB  . PRO A 1 116 ? 139.322 215.538 209.291 1.00 195.71 ? 116 PRO A CB  1 
ATOM   804   C  CG  . PRO A 1 116 ? 139.618 216.412 210.459 1.00 200.46 ? 116 PRO A CG  1 
ATOM   805   C  CD  . PRO A 1 116 ? 139.176 215.676 211.691 1.00 198.06 ? 116 PRO A CD  1 
ATOM   806   N  N   . GLU A 1 117 ? 141.793 213.757 210.415 1.00 194.23 ? 117 GLU A N   1 
ATOM   807   C  CA  . GLU A 1 117 ? 143.166 213.254 210.296 1.00 191.21 ? 117 GLU A CA  1 
ATOM   808   C  C   . GLU A 1 117 ? 143.206 211.718 210.343 1.00 188.20 ? 117 GLU A C   1 
ATOM   809   O  O   . GLU A 1 117 ? 143.966 211.113 209.585 1.00 183.56 ? 117 GLU A O   1 
ATOM   810   C  CB  . GLU A 1 117 ? 144.055 213.843 211.405 1.00 195.91 ? 117 GLU A CB  1 
ATOM   811   C  CG  . GLU A 1 117 ? 145.546 213.708 211.134 1.00 203.46 ? 117 GLU A CG  1 
ATOM   812   C  CD  . GLU A 1 117 ? 146.431 213.668 212.366 1.00 220.76 ? 117 GLU A CD  1 
ATOM   813   O  OE1 . GLU A 1 117 ? 146.418 214.650 213.143 1.00 222.32 ? 117 GLU A OE1 1 
ATOM   814   O  OE2 . GLU A 1 117 ? 147.161 212.664 212.539 1.00 215.56 ? 117 GLU A OE2 1 
ATOM   815   N  N   . TYR A 1 118 ? 142.387 211.103 211.221 1.00 183.70 ? 118 TYR A N   1 
ATOM   816   C  CA  . TYR A 1 118 ? 142.299 209.650 211.386 1.00 177.93 ? 118 TYR A CA  1 
ATOM   817   C  C   . TYR A 1 118 ? 141.785 208.959 210.108 1.00 174.89 ? 118 TYR A C   1 
ATOM   818   O  O   . TYR A 1 118 ? 142.339 207.930 209.709 1.00 169.40 ? 118 TYR A O   1 
ATOM   819   C  CB  . TYR A 1 118 ? 141.393 209.304 212.576 1.00 181.47 ? 118 TYR A CB  1 
ATOM   820   N  N   . GLU A 1 119 ? 140.746 209.535 209.465 1.00 171.55 ? 119 GLU A N   1 
ATOM   821   C  CA  . GLU A 1 119 ? 140.145 208.991 208.245 1.00 166.41 ? 119 GLU A CA  1 
ATOM   822   C  C   . GLU A 1 119 ? 141.095 209.118 207.058 1.00 165.61 ? 119 GLU A C   1 
ATOM   823   O  O   . GLU A 1 119 ? 141.152 208.200 206.242 1.00 160.62 ? 119 GLU A O   1 
ATOM   824   C  CB  . GLU A 1 119 ? 138.806 209.673 207.931 1.00 170.93 ? 119 GLU A CB  1 
ATOM   825   C  CG  . GLU A 1 119 ? 137.815 208.753 207.236 1.00 179.32 ? 119 GLU A CG  1 
ATOM   826   C  CD  . GLU A 1 119 ? 137.262 209.258 205.917 1.00 204.74 ? 119 GLU A CD  1 
ATOM   827   O  OE1 . GLU A 1 119 ? 136.537 210.280 205.926 1.00 206.07 ? 119 GLU A OE1 1 
ATOM   828   O  OE2 . GLU A 1 119 ? 137.523 208.610 204.877 1.00 194.63 ? 119 GLU A OE2 1 
ATOM   829   N  N   . ILE A 1 120 ? 141.854 210.236 206.975 1.00 163.87 ? 120 ILE A N   1 
ATOM   830   C  CA  . ILE A 1 120 ? 142.825 210.484 205.900 1.00 161.11 ? 120 ILE A CA  1 
ATOM   831   C  C   . ILE A 1 120 ? 144.010 209.499 206.056 1.00 159.59 ? 120 ILE A C   1 
ATOM   832   O  O   . ILE A 1 120 ? 144.487 208.972 205.047 1.00 154.89 ? 120 ILE A O   1 
ATOM   833   C  CB  . ILE A 1 120 ? 143.268 211.984 205.837 1.00 169.55 ? 120 ILE A CB  1 
ATOM   834   C  CG1 . ILE A 1 120 ? 142.075 212.887 205.416 1.00 173.27 ? 120 ILE A CG1 1 
ATOM   835   C  CG2 . ILE A 1 120 ? 144.458 212.193 204.873 1.00 168.60 ? 120 ILE A CG2 1 
ATOM   836   C  CD1 . ILE A 1 120 ? 142.201 214.388 205.752 1.00 187.94 ? 120 ILE A CD1 1 
ATOM   837   N  N   . THR A 1 121 ? 144.433 209.215 207.310 1.00 156.58 ? 121 THR A N   1 
ATOM   838   C  CA  . THR A 1 121 ? 145.518 208.268 207.607 1.00 153.20 ? 121 THR A CA  1 
ATOM   839   C  C   . THR A 1 121 ? 145.072 206.847 207.231 1.00 150.54 ? 121 THR A C   1 
ATOM   840   O  O   . THR A 1 121 ? 145.824 206.145 206.548 1.00 146.60 ? 121 THR A O   1 
ATOM   841   C  CB  . THR A 1 121 ? 145.958 208.369 209.073 1.00 166.06 ? 121 THR A CB  1 
ATOM   842   O  OG1 . THR A 1 121 ? 146.225 209.736 209.381 1.00 173.90 ? 121 THR A OG1 1 
ATOM   843   C  CG2 . THR A 1 121 ? 147.201 207.538 209.372 1.00 162.27 ? 121 THR A CG2 1 
ATOM   844   N  N   . GLN A 1 122 ? 143.842 206.444 207.649 1.00 145.56 ? 122 GLN A N   1 
ATOM   845   C  CA  . GLN A 1 122 ? 143.238 205.142 207.327 1.00 140.08 ? 122 GLN A CA  1 
ATOM   846   C  C   . GLN A 1 122 ? 143.159 204.983 205.804 1.00 139.67 ? 122 GLN A C   1 
ATOM   847   O  O   . GLN A 1 122 ? 143.496 203.920 205.291 1.00 134.99 ? 122 GLN A O   1 
ATOM   848   C  CB  . GLN A 1 122 ? 141.849 204.996 207.982 1.00 142.69 ? 122 GLN A CB  1 
ATOM   849   C  CG  . GLN A 1 122 ? 141.107 203.705 207.616 1.00 143.96 ? 122 GLN A CG  1 
ATOM   850   C  CD  . GLN A 1 122 ? 139.923 203.390 208.498 1.00 161.64 ? 122 GLN A CD  1 
ATOM   851   O  OE1 . GLN A 1 122 ? 139.213 204.272 208.994 1.00 162.74 ? 122 GLN A OE1 1 
ATOM   852   N  NE2 . GLN A 1 122 ? 139.660 202.110 208.682 1.00 148.71 ? 122 GLN A NE2 1 
ATOM   853   N  N   . SER A 1 123 ? 142.764 206.061 205.091 1.00 138.08 ? 123 SER A N   1 
ATOM   854   C  CA  . SER A 1 123 ? 142.687 206.110 203.631 1.00 135.27 ? 123 SER A CA  1 
ATOM   855   C  C   . SER A 1 123 ? 144.071 205.909 203.018 1.00 137.12 ? 123 SER A C   1 
ATOM   856   O  O   . SER A 1 123 ? 144.207 205.153 202.054 1.00 132.81 ? 123 SER A O   1 
ATOM   857   C  CB  . SER A 1 123 ? 142.105 207.445 203.164 1.00 141.66 ? 123 SER A CB  1 
ATOM   858   O  OG  . SER A 1 123 ? 140.811 207.712 203.679 1.00 150.38 ? 123 SER A OG  1 
ATOM   859   N  N   . LEU A 1 124 ? 145.095 206.570 203.607 1.00 136.54 ? 124 LEU A N   1 
ATOM   860   C  CA  . LEU A 1 124 ? 146.484 206.548 203.150 1.00 135.38 ? 124 LEU A CA  1 
ATOM   861   C  C   . LEU A 1 124 ? 147.117 205.171 203.284 1.00 134.35 ? 124 LEU A C   1 
ATOM   862   O  O   . LEU A 1 124 ? 147.741 204.715 202.326 1.00 131.29 ? 124 LEU A O   1 
ATOM   863   C  CB  . LEU A 1 124 ? 147.322 207.596 203.893 1.00 140.48 ? 124 LEU A CB  1 
ATOM   864   C  CG  . LEU A 1 124 ? 148.146 208.556 203.018 1.00 147.55 ? 124 LEU A CG  1 
ATOM   865   C  CD1 . LEU A 1 124 ? 147.258 209.397 202.094 1.00 148.89 ? 124 LEU A CD1 1 
ATOM   866   C  CD2 . LEU A 1 124 ? 148.971 209.488 203.877 1.00 156.21 ? 124 LEU A CD2 1 
ATOM   867   N  N   . VAL A 1 125 ? 146.935 204.496 204.437 1.00 130.01 ? 125 VAL A N   1 
ATOM   868   C  CA  . VAL A 1 125 ? 147.478 203.146 204.650 1.00 126.24 ? 125 VAL A CA  1 
ATOM   869   C  C   . VAL A 1 125 ? 146.677 202.113 203.795 1.00 124.58 ? 125 VAL A C   1 
ATOM   870   O  O   . VAL A 1 125 ? 147.286 201.173 203.278 1.00 120.93 ? 125 VAL A O   1 
ATOM   871   C  CB  . VAL A 1 125 ? 147.591 202.757 206.152 1.00 132.02 ? 125 VAL A CB  1 
ATOM   872   C  CG1 . VAL A 1 125 ? 146.252 202.814 206.871 1.00 133.18 ? 125 VAL A CG1 1 
ATOM   873   C  CG2 . VAL A 1 125 ? 148.267 201.401 206.345 1.00 129.11 ? 125 VAL A CG2 1 
ATOM   874   N  N   . PHE A 1 126 ? 145.347 202.336 203.591 1.00 120.33 ? 126 PHE A N   1 
ATOM   875   C  CA  . PHE A 1 126 ? 144.489 201.501 202.734 1.00 116.21 ? 126 PHE A CA  1 
ATOM   876   C  C   . PHE A 1 126 ? 144.995 201.560 201.291 1.00 117.80 ? 126 PHE A C   1 
ATOM   877   O  O   . PHE A 1 126 ? 145.004 200.540 200.605 1.00 114.76 ? 126 PHE A O   1 
ATOM   878   C  CB  . PHE A 1 126 ? 143.016 201.952 202.804 1.00 119.36 ? 126 PHE A CB  1 
ATOM   879   C  CG  . PHE A 1 126 ? 142.081 201.256 201.839 1.00 118.23 ? 126 PHE A CG  1 
ATOM   880   C  CD1 . PHE A 1 126 ? 141.464 200.060 202.183 1.00 119.67 ? 126 PHE A CD1 1 
ATOM   881   C  CD2 . PHE A 1 126 ? 141.802 201.809 200.594 1.00 119.96 ? 126 PHE A CD2 1 
ATOM   882   C  CE1 . PHE A 1 126 ? 140.590 199.423 201.294 1.00 118.79 ? 126 PHE A CE1 1 
ATOM   883   C  CE2 . PHE A 1 126 ? 140.940 201.165 199.701 1.00 120.89 ? 126 PHE A CE2 1 
ATOM   884   C  CZ  . PHE A 1 126 ? 140.342 199.976 200.057 1.00 117.57 ? 126 PHE A CZ  1 
ATOM   885   N  N   . LEU A 1 127 ? 145.406 202.761 200.843 1.00 115.48 ? 127 LEU A N   1 
ATOM   886   C  CA  . LEU A 1 127 ? 145.938 203.036 199.511 1.00 113.28 ? 127 LEU A CA  1 
ATOM   887   C  C   . LEU A 1 127 ? 147.259 202.305 199.301 1.00 113.63 ? 127 LEU A C   1 
ATOM   888   O  O   . LEU A 1 127 ? 147.415 201.624 198.288 1.00 110.02 ? 127 LEU A O   1 
ATOM   889   C  CB  . LEU A 1 127 ? 146.124 204.553 199.349 1.00 116.77 ? 127 LEU A CB  1 
ATOM   890   C  CG  . LEU A 1 127 ? 145.851 205.157 197.980 1.00 121.16 ? 127 LEU A CG  1 
ATOM   891   C  CD1 . LEU A 1 127 ? 144.406 204.928 197.537 1.00 120.67 ? 127 LEU A CD1 1 
ATOM   892   C  CD2 . LEU A 1 127 ? 146.120 206.633 198.010 1.00 127.49 ? 127 LEU A CD2 1 
ATOM   893   N  N   . LEU A 1 128 ? 148.178 202.409 200.289 1.00 111.56 ? 128 LEU A N   1 
ATOM   894   C  CA  . LEU A 1 128 ? 149.502 201.776 200.306 1.00 110.41 ? 128 LEU A CA  1 
ATOM   895   C  C   . LEU A 1 128 ? 149.412 200.244 200.197 1.00 112.02 ? 128 LEU A C   1 
ATOM   896   O  O   . LEU A 1 128 ? 150.219 199.634 199.485 1.00 109.37 ? 128 LEU A O   1 
ATOM   897   C  CB  . LEU A 1 128 ? 150.257 202.156 201.591 1.00 113.34 ? 128 LEU A CB  1 
ATOM   898   C  CG  . LEU A 1 128 ? 150.889 203.540 201.648 1.00 121.12 ? 128 LEU A CG  1 
ATOM   899   C  CD1 . LEU A 1 128 ? 150.957 204.034 203.069 1.00 125.11 ? 128 LEU A CD1 1 
ATOM   900   C  CD2 . LEU A 1 128 ? 152.280 203.536 201.053 1.00 122.44 ? 128 LEU A CD2 1 
ATOM   901   N  N   . LEU A 1 129 ? 148.436 199.633 200.912 1.00 109.12 ? 129 LEU A N   1 
ATOM   902   C  CA  . LEU A 1 129 ? 148.199 198.188 200.912 1.00 106.81 ? 129 LEU A CA  1 
ATOM   903   C  C   . LEU A 1 129 ? 147.553 197.749 199.600 1.00 109.63 ? 129 LEU A C   1 
ATOM   904   O  O   . LEU A 1 129 ? 147.999 196.760 199.011 1.00 108.12 ? 129 LEU A O   1 
ATOM   905   C  CB  . LEU A 1 129 ? 147.320 197.757 202.105 1.00 107.66 ? 129 LEU A CB  1 
ATOM   906   C  CG  . LEU A 1 129 ? 147.989 197.705 203.478 1.00 114.74 ? 129 LEU A CG  1 
ATOM   907   C  CD1 . LEU A 1 129 ? 146.961 197.829 204.586 1.00 116.99 ? 129 LEU A CD1 1 
ATOM   908   C  CD2 . LEU A 1 129 ? 148.783 196.428 203.658 1.00 116.03 ? 129 LEU A CD2 1 
ATOM   909   N  N   . ALA A 1 130 ? 146.515 198.484 199.139 1.00 106.24 ? 130 ALA A N   1 
ATOM   910   C  CA  . ALA A 1 130 ? 145.801 198.181 197.902 1.00 104.18 ? 130 ALA A CA  1 
ATOM   911   C  C   . ALA A 1 130 ? 146.753 198.156 196.707 1.00 107.29 ? 130 ALA A C   1 
ATOM   912   O  O   . ALA A 1 130 ? 146.737 197.171 195.968 1.00 105.08 ? 130 ALA A O   1 
ATOM   913   C  CB  . ALA A 1 130 ? 144.687 199.184 197.670 1.00 106.66 ? 130 ALA A CB  1 
ATOM   914   N  N   . THR A 1 131 ? 147.624 199.192 196.557 1.00 105.51 ? 131 THR A N   1 
ATOM   915   C  CA  . THR A 1 131 ? 148.606 199.271 195.458 1.00 104.48 ? 131 THR A CA  1 
ATOM   916   C  C   . THR A 1 131 ? 149.726 198.229 195.631 1.00 106.28 ? 131 THR A C   1 
ATOM   917   O  O   . THR A 1 131 ? 150.291 197.797 194.625 1.00 104.53 ? 131 THR A O   1 
ATOM   918   C  CB  . THR A 1 131 ? 149.198 200.678 195.295 1.00 116.90 ? 131 THR A CB  1 
ATOM   919   O  OG1 . THR A 1 131 ? 149.890 201.051 196.488 1.00 123.24 ? 131 THR A OG1 1 
ATOM   920   C  CG2 . THR A 1 131 ? 148.155 201.721 194.918 1.00 115.98 ? 131 THR A CG2 1 
ATOM   921   N  N   . LEU A 1 132 ? 150.042 197.825 196.887 1.00 102.56 ? 132 LEU A N   1 
ATOM   922   C  CA  . LEU A 1 132 ? 151.040 196.789 197.144 1.00 101.30 ? 132 LEU A CA  1 
ATOM   923   C  C   . LEU A 1 132 ? 150.545 195.456 196.574 1.00 102.81 ? 132 LEU A C   1 
ATOM   924   O  O   . LEU A 1 132 ? 151.296 194.800 195.855 1.00 101.36 ? 132 LEU A O   1 
ATOM   925   C  CB  . LEU A 1 132 ? 151.369 196.664 198.646 1.00 103.00 ? 132 LEU A CB  1 
ATOM   926   C  CG  . LEU A 1 132 ? 152.203 195.443 199.094 1.00 107.10 ? 132 LEU A CG  1 
ATOM   927   C  CD1 . LEU A 1 132 ? 153.611 195.467 198.510 1.00 107.52 ? 132 LEU A CD1 1 
ATOM   928   C  CD2 . LEU A 1 132 ? 152.268 195.354 200.602 1.00 111.64 ? 132 LEU A CD2 1 
ATOM   929   N  N   . PHE A 1 133 ? 149.282 195.079 196.865 1.00 99.25  ? 133 PHE A N   1 
ATOM   930   C  CA  . PHE A 1 133 ? 148.672 193.843 196.366 1.00 97.72  ? 133 PHE A CA  1 
ATOM   931   C  C   . PHE A 1 133 ? 148.555 193.911 194.842 1.00 102.78 ? 133 PHE A C   1 
ATOM   932   O  O   . PHE A 1 133 ? 148.934 192.950 194.174 1.00 101.15 ? 133 PHE A O   1 
ATOM   933   C  CB  A PHE A 1 133 ? 147.324 193.577 197.055 0.50 99.64  ? 133 PHE A CB  1 
ATOM   934   C  CB  B PHE A 1 133 ? 147.279 193.618 197.010 0.50 99.45  ? 133 PHE A CB  1 
ATOM   935   C  CG  A PHE A 1 133 ? 147.396 193.446 198.566 0.50 102.39 ? 133 PHE A CG  1 
ATOM   936   C  CG  B PHE A 1 133 ? 146.429 192.470 196.489 0.50 99.35  ? 133 PHE A CG  1 
ATOM   937   C  CD1 A PHE A 1 133 ? 148.458 192.784 199.177 0.50 105.51 ? 133 PHE A CD1 1 
ATOM   938   C  CD1 B PHE A 1 133 ? 146.539 191.196 197.034 0.50 101.65 ? 133 PHE A CD1 1 
ATOM   939   C  CD2 A PHE A 1 133 ? 146.383 193.947 199.372 0.50 105.84 ? 133 PHE A CD2 1 
ATOM   940   C  CD2 B PHE A 1 133 ? 145.461 192.683 195.513 0.50 100.60 ? 133 PHE A CD2 1 
ATOM   941   C  CE1 A PHE A 1 133 ? 148.515 192.652 200.566 0.50 107.85 ? 133 PHE A CE1 1 
ATOM   942   C  CE1 B PHE A 1 133 ? 145.725 190.147 196.582 0.50 101.41 ? 133 PHE A CE1 1 
ATOM   943   C  CE2 A PHE A 1 133 ? 146.443 193.812 200.763 0.50 110.01 ? 133 PHE A CE2 1 
ATOM   944   C  CE2 B PHE A 1 133 ? 144.657 191.630 195.055 0.50 102.32 ? 133 PHE A CE2 1 
ATOM   945   C  CZ  A PHE A 1 133 ? 147.506 193.164 201.350 0.50 108.14 ? 133 PHE A CZ  1 
ATOM   946   C  CZ  B PHE A 1 133 ? 144.792 190.371 195.597 0.50 99.83  ? 133 PHE A CZ  1 
ATOM   947   N  N   . SER A 1 134 ? 148.114 195.071 194.301 1.00 102.27 ? 134 SER A N   1 
ATOM   948   C  CA  . SER A 1 134 ? 147.967 195.330 192.865 1.00 102.62 ? 134 SER A CA  1 
ATOM   949   C  C   . SER A 1 134 ? 149.272 195.090 192.111 1.00 107.79 ? 134 SER A C   1 
ATOM   950   O  O   . SER A 1 134 ? 149.262 194.399 191.092 1.00 107.08 ? 134 SER A O   1 
ATOM   951   C  CB  . SER A 1 134 ? 147.498 196.763 192.619 1.00 108.50 ? 134 SER A CB  1 
ATOM   952   O  OG  . SER A 1 134 ? 146.208 196.991 193.156 1.00 121.59 ? 134 SER A OG  1 
ATOM   953   N  N   . ALA A 1 135 ? 150.393 195.634 192.631 1.00 105.66 ? 135 ALA A N   1 
ATOM   954   C  CA  . ALA A 1 135 ? 151.717 195.519 192.024 1.00 105.60 ? 135 ALA A CA  1 
ATOM   955   C  C   . ALA A 1 135 ? 152.234 194.083 192.038 1.00 108.01 ? 135 ALA A C   1 
ATOM   956   O  O   . ALA A 1 135 ? 152.681 193.601 190.997 1.00 106.55 ? 135 ALA A O   1 
ATOM   957   C  CB  . ALA A 1 135 ? 152.704 196.435 192.736 1.00 108.51 ? 135 ALA A CB  1 
ATOM   958   N  N   . LEU A 1 136 ? 152.151 193.401 193.200 1.00 105.24 ? 136 LEU A N   1 
ATOM   959   C  CA  . LEU A 1 136 ? 152.644 192.036 193.383 1.00 105.21 ? 136 LEU A CA  1 
ATOM   960   C  C   . LEU A 1 136 ? 151.863 191.004 192.574 1.00 108.54 ? 136 LEU A C   1 
ATOM   961   O  O   . LEU A 1 136 ? 152.486 190.092 192.032 1.00 108.54 ? 136 LEU A O   1 
ATOM   962   C  CB  . LEU A 1 136 ? 152.639 191.625 194.865 1.00 106.16 ? 136 LEU A CB  1 
ATOM   963   C  CG  . LEU A 1 136 ? 153.613 192.344 195.814 1.00 113.29 ? 136 LEU A CG  1 
ATOM   964   C  CD1 . LEU A 1 136 ? 153.299 192.005 197.251 1.00 114.64 ? 136 LEU A CD1 1 
ATOM   965   C  CD2 . LEU A 1 136 ? 155.071 191.992 195.520 1.00 116.93 ? 136 LEU A CD2 1 
ATOM   966   N  N   . ALA A 1 137 ? 150.522 191.134 192.492 1.00 104.30 ? 137 ALA A N   1 
ATOM   967   C  CA  . ALA A 1 137 ? 149.663 190.181 191.775 1.00 103.18 ? 137 ALA A CA  1 
ATOM   968   C  C   . ALA A 1 137 ? 149.838 190.235 190.258 1.00 105.66 ? 137 ALA A C   1 
ATOM   969   O  O   . ALA A 1 137 ? 149.639 189.216 189.588 1.00 104.80 ? 137 ALA A O   1 
ATOM   970   C  CB  . ALA A 1 137 ? 148.204 190.416 192.125 1.00 104.00 ? 137 ALA A CB  1 
ATOM   971   N  N   . GLY A 1 138 ? 150.194 191.415 189.746 1.00 102.11 ? 138 GLY A N   1 
ATOM   972   C  CA  . GLY A 1 138 ? 150.385 191.675 188.319 1.00 101.56 ? 138 GLY A CA  1 
ATOM   973   C  C   . GLY A 1 138 ? 151.805 191.529 187.803 1.00 103.75 ? 138 GLY A C   1 
ATOM   974   O  O   . GLY A 1 138 ? 152.015 191.432 186.589 1.00 103.28 ? 138 GLY A O   1 
ATOM   975   N  N   . LEU A 1 139 ? 152.785 191.507 188.724 1.00 98.99  ? 139 LEU A N   1 
ATOM   976   C  CA  . LEU A 1 139 ? 154.206 191.357 188.427 1.00 98.74  ? 139 LEU A CA  1 
ATOM   977   C  C   . LEU A 1 139 ? 154.525 190.019 187.700 1.00 101.22 ? 139 LEU A C   1 
ATOM   978   O  O   . LEU A 1 139 ? 155.301 190.102 186.747 1.00 101.56 ? 139 LEU A O   1 
ATOM   979   C  CB  . LEU A 1 139 ? 155.038 191.497 189.711 1.00 99.67  ? 139 LEU A CB  1 
ATOM   980   C  CG  . LEU A 1 139 ? 156.445 192.075 189.580 1.00 105.69 ? 139 LEU A CG  1 
ATOM   981   C  CD1 . LEU A 1 139 ? 156.436 193.449 188.921 1.00 106.12 ? 139 LEU A CD1 1 
ATOM   982   C  CD2 . LEU A 1 139 ? 157.097 192.176 190.939 1.00 109.75 ? 139 LEU A CD2 1 
ATOM   983   N  N   . PRO A 1 140 ? 153.945 188.816 188.031 1.00 96.23  ? 140 PRO A N   1 
ATOM   984   C  CA  . PRO A 1 140 ? 154.288 187.607 187.259 1.00 96.59  ? 140 PRO A CA  1 
ATOM   985   C  C   . PRO A 1 140 ? 153.815 187.677 185.809 1.00 101.97 ? 140 PRO A C   1 
ATOM   986   O  O   . PRO A 1 140 ? 154.498 187.153 184.929 1.00 102.88 ? 140 PRO A O   1 
ATOM   987   C  CB  . PRO A 1 140 ? 153.576 186.479 188.017 1.00 97.97  ? 140 PRO A CB  1 
ATOM   988   C  CG  . PRO A 1 140 ? 153.301 187.025 189.353 1.00 101.85 ? 140 PRO A CG  1 
ATOM   989   C  CD  . PRO A 1 140 ? 153.010 188.469 189.119 1.00 96.88  ? 140 PRO A CD  1 
ATOM   990   N  N   . TRP A 1 141 ? 152.667 188.342 185.558 1.00 98.78  ? 141 TRP A N   1 
ATOM   991   C  CA  . TRP A 1 141 ? 152.092 188.525 184.221 1.00 98.85  ? 141 TRP A CA  1 
ATOM   992   C  C   . TRP A 1 141 ? 152.997 189.432 183.393 1.00 104.44 ? 141 TRP A C   1 
ATOM   993   O  O   . TRP A 1 141 ? 153.313 189.098 182.251 1.00 104.18 ? 141 TRP A O   1 
ATOM   994   C  CB  . TRP A 1 141 ? 150.671 189.087 184.324 1.00 96.64  ? 141 TRP A CB  1 
ATOM   995   C  CG  . TRP A 1 141 ? 149.740 188.151 185.034 1.00 97.28  ? 141 TRP A CG  1 
ATOM   996   C  CD1 . TRP A 1 141 ? 149.465 188.124 186.371 1.00 99.76  ? 141 TRP A CD1 1 
ATOM   997   C  CD2 . TRP A 1 141 ? 149.045 187.039 184.457 1.00 98.01  ? 141 TRP A CD2 1 
ATOM   998   N  NE1 . TRP A 1 141 ? 148.610 187.086 186.658 1.00 99.42  ? 141 TRP A NE1 1 
ATOM   999   C  CE2 . TRP A 1 141 ? 148.332 186.403 185.500 1.00 101.86 ? 141 TRP A CE2 1 
ATOM   1000  C  CE3 . TRP A 1 141 ? 148.940 186.523 183.151 1.00 100.20 ? 141 TRP A CE3 1 
ATOM   1001  C  CZ2 . TRP A 1 141 ? 147.516 185.284 185.276 1.00 102.22 ? 141 TRP A CZ2 1 
ATOM   1002  C  CZ3 . TRP A 1 141 ? 148.132 185.416 182.931 1.00 102.67 ? 141 TRP A CZ3 1 
ATOM   1003  C  CH2 . TRP A 1 141 ? 147.428 184.811 183.982 1.00 103.30 ? 141 TRP A CH2 1 
ATOM   1004  N  N   . SER A 1 142 ? 153.470 190.537 184.013 1.00 102.62 ? 142 SER A N   1 
ATOM   1005  C  CA  . SER A 1 142 ? 154.395 191.530 183.452 1.00 103.79 ? 142 SER A CA  1 
ATOM   1006  C  C   . SER A 1 142 ? 155.740 190.893 183.107 1.00 107.30 ? 142 SER A C   1 
ATOM   1007  O  O   . SER A 1 142 ? 156.317 191.203 182.063 1.00 107.70 ? 142 SER A O   1 
ATOM   1008  C  CB  . SER A 1 142 ? 154.606 192.671 184.445 1.00 109.52 ? 142 SER A CB  1 
ATOM   1009  O  OG  . SER A 1 142 ? 155.474 193.665 183.924 1.00 123.17 ? 142 SER A OG  1 
ATOM   1010  N  N   . LEU A 1 143 ? 156.226 190.006 183.994 1.00 103.58 ? 143 LEU A N   1 
ATOM   1011  C  CA  . LEU A 1 143 ? 157.472 189.262 183.845 1.00 105.18 ? 143 LEU A CA  1 
ATOM   1012  C  C   . LEU A 1 143 ? 157.355 188.285 182.677 1.00 110.76 ? 143 LEU A C   1 
ATOM   1013  O  O   . LEU A 1 143 ? 158.333 188.097 181.952 1.00 112.33 ? 143 LEU A O   1 
ATOM   1014  C  CB  . LEU A 1 143 ? 157.800 188.521 185.153 1.00 105.48 ? 143 LEU A CB  1 
ATOM   1015  C  CG  . LEU A 1 143 ? 159.179 187.904 185.259 1.00 112.25 ? 143 LEU A CG  1 
ATOM   1016  C  CD1 . LEU A 1 143 ? 160.079 188.746 186.117 1.00 113.33 ? 143 LEU A CD1 1 
ATOM   1017  C  CD2 . LEU A 1 143 ? 159.093 186.517 185.831 1.00 116.30 ? 143 LEU A CD2 1 
ATOM   1018  N  N   . TYR A 1 144 ? 156.154 187.694 182.476 1.00 106.93 ? 144 TYR A N   1 
ATOM   1019  C  CA  . TYR A 1 144 ? 155.901 186.759 181.381 1.00 108.13 ? 144 TYR A CA  1 
ATOM   1020  C  C   . TYR A 1 144 ? 155.930 187.482 180.044 1.00 113.05 ? 144 TYR A C   1 
ATOM   1021  O  O   . TYR A 1 144 ? 156.573 186.999 179.118 1.00 114.16 ? 144 TYR A O   1 
ATOM   1022  C  CB  . TYR A 1 144 ? 154.565 186.015 181.554 1.00 108.75 ? 144 TYR A CB  1 
ATOM   1023  C  CG  . TYR A 1 144 ? 154.386 184.874 180.572 1.00 112.42 ? 144 TYR A CG  1 
ATOM   1024  C  CD1 . TYR A 1 144 ? 154.899 183.608 180.841 1.00 116.18 ? 144 TYR A CD1 1 
ATOM   1025  C  CD2 . TYR A 1 144 ? 153.699 185.057 179.376 1.00 113.43 ? 144 TYR A CD2 1 
ATOM   1026  C  CE1 . TYR A 1 144 ? 154.749 182.557 179.935 1.00 118.73 ? 144 TYR A CE1 1 
ATOM   1027  C  CE2 . TYR A 1 144 ? 153.545 184.015 178.461 1.00 116.22 ? 144 TYR A CE2 1 
ATOM   1028  C  CZ  . TYR A 1 144 ? 154.068 182.765 178.748 1.00 125.17 ? 144 TYR A CZ  1 
ATOM   1029  O  OH  . TYR A 1 144 ? 153.921 181.735 177.852 1.00 128.84 ? 144 TYR A OH  1 
ATOM   1030  N  N   . ASN A 1 145 ? 155.245 188.633 179.941 1.00 108.95 ? 145 ASN A N   1 
ATOM   1031  C  CA  . ASN A 1 145 ? 155.188 189.402 178.699 1.00 109.22 ? 145 ASN A CA  1 
ATOM   1032  C  C   . ASN A 1 145 ? 156.583 189.782 178.197 1.00 114.63 ? 145 ASN A C   1 
ATOM   1033  O  O   . ASN A 1 145 ? 156.891 189.506 177.039 1.00 116.04 ? 145 ASN A O   1 
ATOM   1034  C  CB  . ASN A 1 145 ? 154.316 190.652 178.848 1.00 108.52 ? 145 ASN A CB  1 
ATOM   1035  C  CG  . ASN A 1 145 ? 154.239 191.483 177.587 1.00 133.20 ? 145 ASN A CG  1 
ATOM   1036  O  OD1 . ASN A 1 145 ? 153.636 191.089 176.580 1.00 131.06 ? 145 ASN A OD1 1 
ATOM   1037  N  ND2 . ASN A 1 145 ? 154.888 192.636 177.605 1.00 124.33 ? 145 ASN A ND2 1 
ATOM   1038  N  N   . THR A 1 146 ? 157.429 190.370 179.061 1.00 110.91 ? 146 THR A N   1 
ATOM   1039  C  CA  . THR A 1 146 ? 158.759 190.818 178.650 1.00 112.36 ? 146 THR A CA  1 
ATOM   1040  C  C   . THR A 1 146 ? 159.722 189.649 178.427 1.00 117.14 ? 146 THR A C   1 
ATOM   1041  O  O   . THR A 1 146 ? 160.428 189.654 177.417 1.00 119.21 ? 146 THR A O   1 
ATOM   1042  C  CB  . THR A 1 146 ? 159.370 191.847 179.634 1.00 121.42 ? 146 THR A CB  1 
ATOM   1043  O  OG1 . THR A 1 146 ? 159.768 191.205 180.844 1.00 120.25 ? 146 THR A OG1 1 
ATOM   1044  C  CG2 . THR A 1 146 ? 158.443 193.035 179.925 1.00 119.28 ? 146 THR A CG2 1 
ATOM   1045  N  N   . PHE A 1 147 ? 159.755 188.659 179.339 1.00 112.25 ? 147 PHE A N   1 
ATOM   1046  C  CA  . PHE A 1 147 ? 160.730 187.569 179.236 1.00 113.98 ? 147 PHE A CA  1 
ATOM   1047  C  C   . PHE A 1 147 ? 160.253 186.324 178.472 1.00 118.38 ? 147 PHE A C   1 
ATOM   1048  O  O   . PHE A 1 147 ? 161.067 185.423 178.251 1.00 120.39 ? 147 PHE A O   1 
ATOM   1049  C  CB  . PHE A 1 147 ? 161.264 187.175 180.622 1.00 115.78 ? 147 PHE A CB  1 
ATOM   1050  C  CG  . PHE A 1 147 ? 162.062 188.289 181.253 1.00 117.23 ? 147 PHE A CG  1 
ATOM   1051  C  CD1 . PHE A 1 147 ? 163.247 188.734 180.674 1.00 122.18 ? 147 PHE A CD1 1 
ATOM   1052  C  CD2 . PHE A 1 147 ? 161.612 188.919 182.405 1.00 117.32 ? 147 PHE A CD2 1 
ATOM   1053  C  CE1 . PHE A 1 147 ? 163.964 189.787 181.237 1.00 123.98 ? 147 PHE A CE1 1 
ATOM   1054  C  CE2 . PHE A 1 147 ? 162.339 189.962 182.975 1.00 120.99 ? 147 PHE A CE2 1 
ATOM   1055  C  CZ  . PHE A 1 147 ? 163.505 190.394 182.383 1.00 121.59 ? 147 PHE A CZ  1 
ATOM   1056  N  N   . VAL A 1 148 ? 158.993 186.274 178.021 1.00 113.16 ? 148 VAL A N   1 
ATOM   1057  C  CA  . VAL A 1 148 ? 158.568 185.116 177.237 1.00 114.26 ? 148 VAL A CA  1 
ATOM   1058  C  C   . VAL A 1 148 ? 158.068 185.600 175.867 1.00 119.45 ? 148 VAL A C   1 
ATOM   1059  O  O   . VAL A 1 148 ? 158.615 185.145 174.871 1.00 121.25 ? 148 VAL A O   1 
ATOM   1060  C  CB  . VAL A 1 148 ? 157.569 184.164 177.951 1.00 116.95 ? 148 VAL A CB  1 
ATOM   1061  C  CG1 . VAL A 1 148 ? 157.152 183.013 177.039 1.00 118.74 ? 148 VAL A CG1 1 
ATOM   1062  C  CG2 . VAL A 1 148 ? 158.172 183.611 179.240 1.00 116.86 ? 148 VAL A CG2 1 
ATOM   1063  N  N   . ILE A 1 149 ? 157.090 186.532 175.800 1.00 114.95 ? 149 ILE A N   1 
ATOM   1064  C  CA  . ILE A 1 149 ? 156.566 187.022 174.513 1.00 115.57 ? 149 ILE A CA  1 
ATOM   1065  C  C   . ILE A 1 149 ? 157.606 187.927 173.812 1.00 122.30 ? 149 ILE A C   1 
ATOM   1066  O  O   . ILE A 1 149 ? 158.032 187.596 172.704 1.00 124.61 ? 149 ILE A O   1 
ATOM   1067  C  CB  . ILE A 1 149 ? 155.175 187.714 174.644 1.00 116.45 ? 149 ILE A CB  1 
ATOM   1068  C  CG1 . ILE A 1 149 ? 154.110 186.711 175.093 1.00 116.53 ? 149 ILE A CG1 1 
ATOM   1069  C  CG2 . ILE A 1 149 ? 154.736 188.385 173.338 1.00 117.54 ? 149 ILE A CG2 1 
ATOM   1070  C  CD1 . ILE A 1 149 ? 153.539 187.036 176.366 1.00 123.45 ? 149 ILE A CD1 1 
ATOM   1071  N  N   . GLU A 1 150 ? 158.025 189.035 174.454 1.00 118.26 ? 150 GLU A N   1 
ATOM   1072  C  CA  . GLU A 1 150 ? 158.989 189.978 173.872 1.00 119.57 ? 150 GLU A CA  1 
ATOM   1073  C  C   . GLU A 1 150 ? 160.364 189.335 173.671 1.00 126.18 ? 150 GLU A C   1 
ATOM   1074  O  O   . GLU A 1 150 ? 161.098 189.753 172.778 1.00 127.61 ? 150 GLU A O   1 
ATOM   1075  C  CB  . GLU A 1 150 ? 159.119 191.257 174.721 1.00 119.95 ? 150 GLU A CB  1 
ATOM   1076  C  CG  . GLU A 1 150 ? 157.834 192.065 174.873 1.00 131.68 ? 150 GLU A CG  1 
ATOM   1077  C  CD  . GLU A 1 150 ? 157.119 192.482 173.599 1.00 158.87 ? 150 GLU A CD  1 
ATOM   1078  O  OE1 . GLU A 1 150 ? 157.793 192.984 172.671 1.00 159.59 ? 150 GLU A OE1 1 
ATOM   1079  O  OE2 . GLU A 1 150 ? 155.876 192.329 173.542 1.00 153.11 ? 150 GLU A OE2 1 
ATOM   1080  N  N   . GLU A 1 151 ? 160.697 188.308 174.465 1.00 123.82 ? 151 GLU A N   1 
ATOM   1081  C  CA  . GLU A 1 151 ? 161.980 187.626 174.343 1.00 127.19 ? 151 GLU A CA  1 
ATOM   1082  C  C   . GLU A 1 151 ? 161.953 186.589 173.215 1.00 134.47 ? 151 GLU A C   1 
ATOM   1083  O  O   . GLU A 1 151 ? 162.946 186.481 172.495 1.00 137.35 ? 151 GLU A O   1 
ATOM   1084  C  CB  . GLU A 1 151 ? 162.395 186.978 175.673 1.00 128.69 ? 151 GLU A CB  1 
ATOM   1085  C  CG  . GLU A 1 151 ? 163.896 186.813 175.845 1.00 144.26 ? 151 GLU A CG  1 
ATOM   1086  C  CD  . GLU A 1 151 ? 164.705 188.096 175.784 1.00 174.29 ? 151 GLU A CD  1 
ATOM   1087  O  OE1 . GLU A 1 151 ? 164.683 188.858 176.777 1.00 172.10 ? 151 GLU A OE1 1 
ATOM   1088  O  OE2 . GLU A 1 151 ? 165.353 188.342 174.740 1.00 173.83 ? 151 GLU A OE2 1 
ATOM   1089  N  N   . LYS A 1 152 ? 160.833 185.838 173.054 1.00 130.60 ? 152 LYS A N   1 
ATOM   1090  C  CA  . LYS A 1 152 ? 160.660 184.813 172.008 1.00 133.08 ? 152 LYS A CA  1 
ATOM   1091  C  C   . LYS A 1 152 ? 160.726 185.437 170.615 1.00 139.18 ? 152 LYS A C   1 
ATOM   1092  O  O   . LYS A 1 152 ? 161.323 184.847 169.709 1.00 142.29 ? 152 LYS A O   1 
ATOM   1093  C  CB  . LYS A 1 152 ? 159.319 184.067 172.177 1.00 134.35 ? 152 LYS A CB  1 
ATOM   1094  C  CG  . LYS A 1 152 ? 159.157 182.812 171.324 1.00 152.08 ? 152 LYS A CG  1 
ATOM   1095  N  N   . HIS A 1 153 ? 160.128 186.633 170.456 1.00 133.66 ? 153 HIS A N   1 
ATOM   1096  C  CA  . HIS A 1 153 ? 160.072 187.342 169.180 1.00 134.62 ? 153 HIS A CA  1 
ATOM   1097  C  C   . HIS A 1 153 ? 161.191 188.407 169.066 1.00 140.93 ? 153 HIS A C   1 
ATOM   1098  O  O   . HIS A 1 153 ? 161.099 189.324 168.247 1.00 140.15 ? 153 HIS A O   1 
ATOM   1099  C  CB  . HIS A 1 153 ? 158.671 187.927 168.976 1.00 132.97 ? 153 HIS A CB  1 
ATOM   1100  C  CG  . HIS A 1 153 ? 157.598 186.878 169.053 1.00 135.87 ? 153 HIS A CG  1 
ATOM   1101  N  ND1 . HIS A 1 153 ? 157.356 186.013 168.000 1.00 140.04 ? 153 HIS A ND1 1 
ATOM   1102  C  CD2 . HIS A 1 153 ? 156.772 186.556 170.077 1.00 135.26 ? 153 HIS A CD2 1 
ATOM   1103  C  CE1 . HIS A 1 153 ? 156.391 185.206 168.412 1.00 138.76 ? 153 HIS A CE1 1 
ATOM   1104  N  NE2 . HIS A 1 153 ? 156.003 185.500 169.653 1.00 136.21 ? 153 HIS A NE2 1 
ATOM   1105  N  N   . GLY A 1 154 ? 162.254 188.207 169.855 1.00 140.59 ? 154 GLY A N   1 
ATOM   1106  C  CA  . GLY A 1 154 ? 163.491 188.985 169.893 1.00 142.91 ? 154 GLY A CA  1 
ATOM   1107  C  C   . GLY A 1 154 ? 163.424 190.490 170.049 1.00 147.47 ? 154 GLY A C   1 
ATOM   1108  O  O   . GLY A 1 154 ? 164.330 191.188 169.582 1.00 149.46 ? 154 GLY A O   1 
ATOM   1109  N  N   . PHE A 1 155 ? 162.383 191.004 170.719 1.00 142.02 ? 155 PHE A N   1 
ATOM   1110  C  CA  . PHE A 1 155 ? 162.238 192.442 170.940 1.00 141.21 ? 155 PHE A CA  1 
ATOM   1111  C  C   . PHE A 1 155 ? 162.966 192.874 172.207 1.00 144.86 ? 155 PHE A C   1 
ATOM   1112  O  O   . PHE A 1 155 ? 163.741 193.828 172.154 1.00 145.96 ? 155 PHE A O   1 
ATOM   1113  C  CB  . PHE A 1 155 ? 160.760 192.856 171.010 1.00 140.70 ? 155 PHE A CB  1 
ATOM   1114  C  CG  . PHE A 1 155 ? 160.070 192.963 169.672 1.00 143.31 ? 155 PHE A CG  1 
ATOM   1115  C  CD1 . PHE A 1 155 ? 160.280 194.064 168.848 1.00 148.00 ? 155 PHE A CD1 1 
ATOM   1116  C  CD2 . PHE A 1 155 ? 159.186 191.978 169.247 1.00 145.52 ? 155 PHE A CD2 1 
ATOM   1117  C  CE1 . PHE A 1 155 ? 159.623 194.172 167.619 1.00 149.99 ? 155 PHE A CE1 1 
ATOM   1118  C  CE2 . PHE A 1 155 ? 158.540 192.081 168.012 1.00 149.53 ? 155 PHE A CE2 1 
ATOM   1119  C  CZ  . PHE A 1 155 ? 158.757 193.181 167.210 1.00 148.88 ? 155 PHE A CZ  1 
ATOM   1120  N  N   . ASN A 1 156 ? 162.732 192.159 173.334 1.00 139.76 ? 156 ASN A N   1 
ATOM   1121  C  CA  . ASN A 1 156 ? 163.297 192.448 174.655 1.00 139.00 ? 156 ASN A CA  1 
ATOM   1122  C  C   . ASN A 1 156 ? 164.823 192.428 174.673 1.00 144.63 ? 156 ASN A C   1 
ATOM   1123  O  O   . ASN A 1 156 ? 165.456 191.549 174.086 1.00 146.25 ? 156 ASN A O   1 
ATOM   1124  C  CB  . ASN A 1 156 ? 162.763 191.479 175.707 1.00 137.95 ? 156 ASN A CB  1 
ATOM   1125  C  CG  . ASN A 1 156 ? 162.978 191.953 177.123 1.00 158.86 ? 156 ASN A CG  1 
ATOM   1126  O  OD1 . ASN A 1 156 ? 162.378 192.935 177.576 1.00 152.48 ? 156 ASN A OD1 1 
ATOM   1127  N  ND2 . ASN A 1 156 ? 163.840 191.264 177.852 1.00 151.64 ? 156 ASN A ND2 1 
ATOM   1128  N  N   . GLN A 1 157 ? 165.391 193.430 175.357 1.00 141.13 ? 157 GLN A N   1 
ATOM   1129  C  CA  . GLN A 1 157 ? 166.824 193.654 175.555 1.00 144.13 ? 157 GLN A CA  1 
ATOM   1130  C  C   . GLN A 1 157 ? 167.123 193.757 177.062 1.00 148.13 ? 157 GLN A C   1 
ATOM   1131  O  O   . GLN A 1 157 ? 168.285 193.863 177.468 1.00 150.65 ? 157 GLN A O   1 
ATOM   1132  C  CB  . GLN A 1 157 ? 167.286 194.931 174.815 1.00 147.25 ? 157 GLN A CB  1 
ATOM   1133  C  CG  . GLN A 1 157 ? 166.841 195.051 173.347 1.00 161.00 ? 157 GLN A CG  1 
ATOM   1134  C  CD  . GLN A 1 157 ? 167.405 193.982 172.444 1.00 182.12 ? 157 GLN A CD  1 
ATOM   1135  O  OE1 . GLN A 1 157 ? 168.620 193.771 172.365 1.00 181.81 ? 157 GLN A OE1 1 
ATOM   1136  N  NE2 . GLN A 1 157 ? 166.532 193.306 171.714 1.00 171.20 ? 157 GLN A NE2 1 
ATOM   1137  N  N   . GLN A 1 158 ? 166.056 193.717 177.883 1.00 141.72 ? 158 GLN A N   1 
ATOM   1138  C  CA  . GLN A 1 158 ? 166.099 193.791 179.343 1.00 141.02 ? 158 GLN A CA  1 
ATOM   1139  C  C   . GLN A 1 158 ? 166.665 192.530 179.978 1.00 145.10 ? 158 GLN A C   1 
ATOM   1140  O  O   . GLN A 1 158 ? 166.460 191.424 179.471 1.00 144.58 ? 158 GLN A O   1 
ATOM   1141  C  CB  . GLN A 1 158 ? 164.682 194.000 179.907 1.00 138.89 ? 158 GLN A CB  1 
ATOM   1142  C  CG  . GLN A 1 158 ? 164.163 195.421 179.862 1.00 153.47 ? 158 GLN A CG  1 
ATOM   1143  C  CD  . GLN A 1 158 ? 162.887 195.527 180.654 1.00 171.85 ? 158 GLN A CD  1 
ATOM   1144  O  OE1 . GLN A 1 158 ? 162.904 195.751 181.868 1.00 168.13 ? 158 GLN A OE1 1 
ATOM   1145  N  NE2 . GLN A 1 158 ? 161.752 195.336 179.993 1.00 161.90 ? 158 GLN A NE2 1 
ATOM   1146  N  N   . THR A 1 159 ? 167.326 192.701 181.124 1.00 142.05 ? 159 THR A N   1 
ATOM   1147  C  CA  . THR A 1 159 ? 167.822 191.610 181.957 1.00 142.61 ? 159 THR A CA  1 
ATOM   1148  C  C   . THR A 1 159 ? 166.854 191.505 183.143 1.00 142.07 ? 159 THR A C   1 
ATOM   1149  O  O   . THR A 1 159 ? 166.105 192.455 183.391 1.00 139.63 ? 159 THR A O   1 
ATOM   1150  C  CB  . THR A 1 159 ? 169.303 191.809 182.350 1.00 158.66 ? 159 THR A CB  1 
ATOM   1151  O  OG1 . THR A 1 159 ? 169.675 190.806 183.301 1.00 161.52 ? 159 THR A OG1 1 
ATOM   1152  C  CG2 . THR A 1 159 ? 169.605 193.204 182.908 1.00 159.18 ? 159 THR A CG2 1 
ATOM   1153  N  N   . LEU A 1 160 ? 166.843 190.362 183.859 1.00 137.90 ? 160 LEU A N   1 
ATOM   1154  C  CA  . LEU A 1 160 ? 165.942 190.159 185.002 1.00 135.26 ? 160 LEU A CA  1 
ATOM   1155  C  C   . LEU A 1 160 ? 166.205 191.184 186.107 1.00 140.16 ? 160 LEU A C   1 
ATOM   1156  O  O   . LEU A 1 160 ? 165.262 191.607 186.777 1.00 137.62 ? 160 LEU A O   1 
ATOM   1157  C  CB  . LEU A 1 160 ? 166.046 188.736 185.558 1.00 135.81 ? 160 LEU A CB  1 
ATOM   1158  N  N   . GLY A 1 161 ? 167.469 191.587 186.251 1.00 140.32 ? 161 GLY A N   1 
ATOM   1159  C  CA  . GLY A 1 161 ? 167.914 192.577 187.224 1.00 142.04 ? 161 GLY A CA  1 
ATOM   1160  C  C   . GLY A 1 161 ? 167.359 193.955 186.939 1.00 144.91 ? 161 GLY A C   1 
ATOM   1161  O  O   . GLY A 1 161 ? 166.841 194.608 187.849 1.00 143.99 ? 161 GLY A O   1 
ATOM   1162  N  N   . PHE A 1 162 ? 167.447 194.391 185.661 1.00 141.57 ? 162 PHE A N   1 
ATOM   1163  C  CA  . PHE A 1 162 ? 166.941 195.688 185.200 1.00 140.68 ? 162 PHE A CA  1 
ATOM   1164  C  C   . PHE A 1 162 ? 165.433 195.755 185.376 1.00 139.63 ? 162 PHE A C   1 
ATOM   1165  O  O   . PHE A 1 162 ? 164.929 196.781 185.830 1.00 138.80 ? 162 PHE A O   1 
ATOM   1166  C  CB  . PHE A 1 162 ? 167.322 195.957 183.732 1.00 143.61 ? 162 PHE A CB  1 
ATOM   1167  C  CG  . PHE A 1 162 ? 166.885 197.307 183.211 1.00 145.31 ? 162 PHE A CG  1 
ATOM   1168  C  CD1 . PHE A 1 162 ? 167.679 198.433 183.395 1.00 151.25 ? 162 PHE A CD1 1 
ATOM   1169  C  CD2 . PHE A 1 162 ? 165.676 197.455 182.540 1.00 145.57 ? 162 PHE A CD2 1 
ATOM   1170  C  CE1 . PHE A 1 162 ? 167.269 199.684 182.920 1.00 154.49 ? 162 PHE A CE1 1 
ATOM   1171  C  CE2 . PHE A 1 162 ? 165.264 198.707 182.071 1.00 146.93 ? 162 PHE A CE2 1 
ATOM   1172  C  CZ  . PHE A 1 162 ? 166.064 199.812 182.260 1.00 149.44 ? 162 PHE A CZ  1 
ATOM   1173  N  N   . PHE A 1 163 ? 164.722 194.665 185.018 1.00 132.91 ? 163 PHE A N   1 
ATOM   1174  C  CA  . PHE A 1 163 ? 163.270 194.556 185.146 1.00 129.03 ? 163 PHE A CA  1 
ATOM   1175  C  C   . PHE A 1 163 ? 162.857 194.719 186.607 1.00 130.32 ? 163 PHE A C   1 
ATOM   1176  O  O   . PHE A 1 163 ? 161.956 195.506 186.899 1.00 128.75 ? 163 PHE A O   1 
ATOM   1177  C  CB  . PHE A 1 163 ? 162.769 193.211 184.584 1.00 129.28 ? 163 PHE A CB  1 
ATOM   1178  C  CG  . PHE A 1 163 ? 161.264 193.038 184.608 1.00 128.00 ? 163 PHE A CG  1 
ATOM   1179  C  CD1 . PHE A 1 163 ? 160.472 193.551 183.587 1.00 130.12 ? 163 PHE A CD1 1 
ATOM   1180  C  CD2 . PHE A 1 163 ? 160.642 192.360 185.649 1.00 128.94 ? 163 PHE A CD2 1 
ATOM   1181  C  CE1 . PHE A 1 163 ? 159.081 193.399 183.616 1.00 128.81 ? 163 PHE A CE1 1 
ATOM   1182  C  CE2 . PHE A 1 163 ? 159.250 192.219 185.681 1.00 129.48 ? 163 PHE A CE2 1 
ATOM   1183  C  CZ  . PHE A 1 163 ? 158.481 192.733 184.663 1.00 126.60 ? 163 PHE A CZ  1 
ATOM   1184  N  N   . MET A 1 164 ? 163.538 193.995 187.517 1.00 126.55 ? 164 MET A N   1 
ATOM   1185  C  CA  . MET A 1 164 ? 163.275 194.026 188.951 1.00 125.80 ? 164 MET A CA  1 
ATOM   1186  C  C   . MET A 1 164 ? 163.587 195.392 189.555 1.00 130.98 ? 164 MET A C   1 
ATOM   1187  O  O   . MET A 1 164 ? 162.728 195.944 190.242 1.00 129.87 ? 164 MET A O   1 
ATOM   1188  C  CB  . MET A 1 164 ? 164.060 192.926 189.685 1.00 129.56 ? 164 MET A CB  1 
ATOM   1189  C  CG  . MET A 1 164 ? 163.360 191.573 189.700 1.00 130.59 ? 164 MET A CG  1 
ATOM   1190  S  SD  . MET A 1 164 ? 161.601 191.598 190.160 1.00 130.83 ? 164 MET A SD  1 
ATOM   1191  C  CE  . MET A 1 164 ? 161.667 192.232 191.865 1.00 128.76 ? 164 MET A CE  1 
ATOM   1192  N  N   . LYS A 1 165 ? 164.791 195.945 189.284 1.00 129.90 ? 165 LYS A N   1 
ATOM   1193  C  CA  . LYS A 1 165 ? 165.220 197.255 189.788 1.00 131.99 ? 165 LYS A CA  1 
ATOM   1194  C  C   . LYS A 1 165 ? 164.275 198.361 189.328 1.00 133.36 ? 165 LYS A C   1 
ATOM   1195  O  O   . LYS A 1 165 ? 163.974 199.260 190.112 1.00 134.05 ? 165 LYS A O   1 
ATOM   1196  C  CB  . LYS A 1 165 ? 166.657 197.580 189.356 1.00 138.22 ? 165 LYS A CB  1 
ATOM   1197  C  CG  . LYS A 1 165 ? 167.714 197.140 190.353 1.00 153.06 ? 165 LYS A CG  1 
ATOM   1198  C  CD  . LYS A 1 165 ? 169.062 197.753 190.023 1.00 167.89 ? 165 LYS A CD  1 
ATOM   1199  N  N   . ASP A 1 166 ? 163.782 198.269 188.076 1.00 126.79 ? 166 ASP A N   1 
ATOM   1200  C  CA  . ASP A 1 166 ? 162.857 199.238 187.494 1.00 125.15 ? 166 ASP A CA  1 
ATOM   1201  C  C   . ASP A 1 166 ? 161.463 199.140 188.123 1.00 124.49 ? 166 ASP A C   1 
ATOM   1202  O  O   . ASP A 1 166 ? 160.826 200.172 188.340 1.00 124.27 ? 166 ASP A O   1 
ATOM   1203  C  CB  . ASP A 1 166 ? 162.766 199.056 185.975 1.00 126.16 ? 166 ASP A CB  1 
ATOM   1204  C  CG  . ASP A 1 166 ? 162.855 200.358 185.208 1.00 139.11 ? 166 ASP A CG  1 
ATOM   1205  O  OD1 . ASP A 1 166 ? 163.977 200.907 185.096 1.00 142.29 ? 166 ASP A OD1 1 
ATOM   1206  O  OD2 . ASP A 1 166 ? 161.802 200.832 184.721 1.00 144.52 ? 166 ASP A OD2 1 
ATOM   1207  N  N   . ALA A 1 167 ? 160.992 197.911 188.412 1.00 117.82 ? 167 ALA A N   1 
ATOM   1208  C  CA  . ALA A 1 167 ? 159.681 197.665 189.028 1.00 115.05 ? 167 ALA A CA  1 
ATOM   1209  C  C   . ALA A 1 167 ? 159.584 198.321 190.405 1.00 119.05 ? 167 ALA A C   1 
ATOM   1210  O  O   . ALA A 1 167 ? 158.567 198.949 190.700 1.00 118.13 ? 167 ALA A O   1 
ATOM   1211  C  CB  . ALA A 1 167 ? 159.421 196.171 189.145 1.00 113.90 ? 167 ALA A CB  1 
ATOM   1212  N  N   . ILE A 1 168 ? 160.658 198.205 191.224 1.00 116.55 ? 168 ILE A N   1 
ATOM   1213  C  CA  . ILE A 1 168 ? 160.750 198.795 192.562 1.00 117.56 ? 168 ILE A CA  1 
ATOM   1214  C  C   . ILE A 1 168 ? 160.861 200.317 192.406 1.00 122.72 ? 168 ILE A C   1 
ATOM   1215  O  O   . ILE A 1 168 ? 160.115 201.038 193.069 1.00 122.87 ? 168 ILE A O   1 
ATOM   1216  C  CB  . ILE A 1 168 ? 161.911 198.192 193.405 1.00 122.73 ? 168 ILE A CB  1 
ATOM   1217  C  CG1 . ILE A 1 168 ? 161.851 196.649 193.423 1.00 121.17 ? 168 ILE A CG1 1 
ATOM   1218  C  CG2 . ILE A 1 168 ? 161.884 198.734 194.839 1.00 125.32 ? 168 ILE A CG2 1 
ATOM   1219  C  CD1 . ILE A 1 168 ? 163.191 195.957 193.581 1.00 132.36 ? 168 ILE A CD1 1 
ATOM   1220  N  N   . LYS A 1 169 ? 161.741 200.792 191.486 1.00 120.06 ? 169 LYS A N   1 
ATOM   1221  C  CA  . LYS A 1 169 ? 161.938 202.215 191.176 1.00 122.36 ? 169 LYS A CA  1 
ATOM   1222  C  C   . LYS A 1 169 ? 160.602 202.899 190.888 1.00 125.18 ? 169 LYS A C   1 
ATOM   1223  O  O   . LYS A 1 169 ? 160.271 203.888 191.541 1.00 126.34 ? 169 LYS A O   1 
ATOM   1224  C  CB  . LYS A 1 169 ? 162.876 202.397 189.968 1.00 125.71 ? 169 LYS A CB  1 
ATOM   1225  C  CG  . LYS A 1 169 ? 164.349 202.607 190.308 1.00 138.68 ? 169 LYS A CG  1 
ATOM   1226  C  CD  . LYS A 1 169 ? 165.148 203.116 189.100 1.00 145.40 ? 169 LYS A CD  1 
ATOM   1227  C  CE  . LYS A 1 169 ? 165.553 202.023 188.135 1.00 150.53 ? 169 LYS A CE  1 
ATOM   1228  N  NZ  . LYS A 1 169 ? 165.857 202.567 186.787 1.00 159.49 ? 169 LYS A NZ  1 
ATOM   1229  N  N   . LYS A 1 170 ? 159.820 202.331 189.943 1.00 119.57 ? 170 LYS A N   1 
ATOM   1230  C  CA  . LYS A 1 170 ? 158.511 202.830 189.520 1.00 118.25 ? 170 LYS A CA  1 
ATOM   1231  C  C   . LYS A 1 170 ? 157.490 202.779 190.665 1.00 121.70 ? 170 LYS A C   1 
ATOM   1232  O  O   . LYS A 1 170 ? 156.787 203.765 190.872 1.00 122.47 ? 170 LYS A O   1 
ATOM   1233  C  CB  . LYS A 1 170 ? 158.001 202.052 188.296 1.00 117.72 ? 170 LYS A CB  1 
ATOM   1234  N  N   . PHE A 1 171 ? 157.441 201.665 191.426 1.00 117.08 ? 171 PHE A N   1 
ATOM   1235  C  CA  . PHE A 1 171 ? 156.529 201.495 192.561 1.00 116.88 ? 171 PHE A CA  1 
ATOM   1236  C  C   . PHE A 1 171 ? 156.798 202.537 193.661 1.00 124.87 ? 171 PHE A C   1 
ATOM   1237  O  O   . PHE A 1 171 ? 155.842 203.104 194.193 1.00 125.30 ? 171 PHE A O   1 
ATOM   1238  C  CB  . PHE A 1 171 ? 156.627 200.068 193.136 1.00 117.17 ? 171 PHE A CB  1 
ATOM   1239  C  CG  . PHE A 1 171 ? 155.723 199.777 194.314 1.00 118.69 ? 171 PHE A CG  1 
ATOM   1240  C  CD1 . PHE A 1 171 ? 154.369 199.530 194.127 1.00 120.20 ? 171 PHE A CD1 1 
ATOM   1241  C  CD2 . PHE A 1 171 ? 156.231 199.724 195.606 1.00 123.03 ? 171 PHE A CD2 1 
ATOM   1242  C  CE1 . PHE A 1 171 ? 153.531 199.271 195.217 1.00 121.17 ? 171 PHE A CE1 1 
ATOM   1243  C  CE2 . PHE A 1 171 ? 155.394 199.457 196.695 1.00 125.80 ? 171 PHE A CE2 1 
ATOM   1244  C  CZ  . PHE A 1 171 ? 154.049 199.238 196.494 1.00 121.93 ? 171 PHE A CZ  1 
ATOM   1245  N  N   . VAL A 1 172 ? 158.088 202.794 193.984 1.00 124.12 ? 172 VAL A N   1 
ATOM   1246  C  CA  . VAL A 1 172 ? 158.515 203.759 195.009 1.00 127.79 ? 172 VAL A CA  1 
ATOM   1247  C  C   . VAL A 1 172 ? 158.085 205.182 194.594 1.00 134.16 ? 172 VAL A C   1 
ATOM   1248  O  O   . VAL A 1 172 ? 157.421 205.867 195.376 1.00 135.24 ? 172 VAL A O   1 
ATOM   1249  C  CB  . VAL A 1 172 ? 160.042 203.658 195.292 1.00 134.12 ? 172 VAL A CB  1 
ATOM   1250  C  CG1 . VAL A 1 172 ? 160.562 204.873 196.054 1.00 138.89 ? 172 VAL A CG1 1 
ATOM   1251  C  CG2 . VAL A 1 172 ? 160.372 202.382 196.054 1.00 132.64 ? 172 VAL A CG2 1 
ATOM   1252  N  N   . VAL A 1 173 ? 158.424 205.593 193.357 1.00 131.27 ? 173 VAL A N   1 
ATOM   1253  C  CA  . VAL A 1 173 ? 158.101 206.906 192.791 1.00 133.72 ? 173 VAL A CA  1 
ATOM   1254  C  C   . VAL A 1 173 ? 156.561 207.089 192.719 1.00 137.12 ? 173 VAL A C   1 
ATOM   1255  O  O   . VAL A 1 173 ? 156.083 208.201 192.958 1.00 139.11 ? 173 VAL A O   1 
ATOM   1256  C  CB  . VAL A 1 173 ? 158.809 207.106 191.419 1.00 137.80 ? 173 VAL A CB  1 
ATOM   1257  C  CG1 . VAL A 1 173 ? 158.323 208.360 190.700 1.00 139.64 ? 173 VAL A CG1 1 
ATOM   1258  C  CG2 . VAL A 1 173 ? 160.326 207.161 191.592 1.00 140.52 ? 173 VAL A CG2 1 
ATOM   1259  N  N   . THR A 1 174 ? 155.797 205.997 192.458 1.00 131.43 ? 174 THR A N   1 
ATOM   1260  C  CA  . THR A 1 174 ? 154.325 206.005 192.408 1.00 130.69 ? 174 THR A CA  1 
ATOM   1261  C  C   . THR A 1 174 ? 153.759 206.488 193.748 1.00 138.79 ? 174 THR A C   1 
ATOM   1262  O  O   . THR A 1 174 ? 152.965 207.425 193.750 1.00 140.48 ? 174 THR A O   1 
ATOM   1263  C  CB  . THR A 1 174 ? 153.766 204.610 192.032 1.00 135.99 ? 174 THR A CB  1 
ATOM   1264  O  OG1 . THR A 1 174 ? 154.203 204.267 190.719 1.00 136.52 ? 174 THR A OG1 1 
ATOM   1265  C  CG2 . THR A 1 174 ? 152.234 204.534 192.095 1.00 132.14 ? 174 THR A CG2 1 
ATOM   1266  N  N   . GLN A 1 175 ? 154.194 205.868 194.870 1.00 136.78 ? 175 GLN A N   1 
ATOM   1267  C  CA  . GLN A 1 175 ? 153.751 206.187 196.233 1.00 139.52 ? 175 GLN A CA  1 
ATOM   1268  C  C   . GLN A 1 175 ? 154.120 207.622 196.629 1.00 150.84 ? 175 GLN A C   1 
ATOM   1269  O  O   . GLN A 1 175 ? 153.303 208.318 197.233 1.00 152.57 ? 175 GLN A O   1 
ATOM   1270  C  CB  . GLN A 1 175 ? 154.341 205.194 197.260 1.00 140.05 ? 175 GLN A CB  1 
ATOM   1271  C  CG  . GLN A 1 175 ? 154.277 203.710 196.883 1.00 144.54 ? 175 GLN A CG  1 
ATOM   1272  C  CD  . GLN A 1 175 ? 152.880 203.153 196.752 1.00 156.88 ? 175 GLN A CD  1 
ATOM   1273  O  OE1 . GLN A 1 175 ? 152.303 202.620 197.706 1.00 150.63 ? 175 GLN A OE1 1 
ATOM   1274  N  NE2 . GLN A 1 175 ? 152.329 203.209 195.549 1.00 147.63 ? 175 GLN A NE2 1 
ATOM   1275  N  N   . CYS A 1 176 ? 155.331 208.072 196.247 1.00 151.36 ? 176 CYS A N   1 
ATOM   1276  C  CA  . CYS A 1 176 ? 155.849 209.411 196.543 1.00 157.34 ? 176 CYS A CA  1 
ATOM   1277  C  C   . CYS A 1 176 ? 155.033 210.519 195.849 1.00 163.78 ? 176 CYS A C   1 
ATOM   1278  O  O   . CYS A 1 176 ? 155.125 211.678 196.252 1.00 168.50 ? 176 CYS A O   1 
ATOM   1279  C  CB  . CYS A 1 176 ? 157.327 209.502 196.180 1.00 159.80 ? 176 CYS A CB  1 
ATOM   1280  S  SG  . CYS A 1 176 ? 158.404 208.480 197.217 1.00 164.06 ? 176 CYS A SG  1 
ATOM   1281  N  N   . ILE A 1 177 ? 154.243 210.166 194.820 1.00 157.11 ? 177 ILE A N   1 
ATOM   1282  C  CA  . ILE A 1 177 ? 153.374 211.098 194.099 1.00 158.33 ? 177 ILE A CA  1 
ATOM   1283  C  C   . ILE A 1 177 ? 151.931 210.894 194.600 1.00 161.04 ? 177 ILE A C   1 
ATOM   1284  O  O   . ILE A 1 177 ? 151.245 211.870 194.903 1.00 163.76 ? 177 ILE A O   1 
ATOM   1285  C  CB  . ILE A 1 177 ? 153.511 210.923 192.553 1.00 159.11 ? 177 ILE A CB  1 
ATOM   1286  C  CG1 . ILE A 1 177 ? 154.937 211.297 192.076 1.00 161.57 ? 177 ILE A CG1 1 
ATOM   1287  C  CG2 . ILE A 1 177 ? 152.445 211.736 191.790 1.00 161.02 ? 177 ILE A CG2 1 
ATOM   1288  C  CD1 . ILE A 1 177 ? 155.356 210.724 190.707 1.00 166.83 ? 177 ILE A CD1 1 
ATOM   1289  N  N   . LEU A 1 178 ? 151.500 209.618 194.703 1.00 153.34 ? 178 LEU A N   1 
ATOM   1290  C  CA  . LEU A 1 178 ? 150.172 209.163 195.122 1.00 151.47 ? 178 LEU A CA  1 
ATOM   1291  C  C   . LEU A 1 178 ? 149.789 209.643 196.528 1.00 157.76 ? 178 LEU A C   1 
ATOM   1292  O  O   . LEU A 1 178 ? 148.735 210.258 196.676 1.00 159.45 ? 178 LEU A O   1 
ATOM   1293  C  CB  . LEU A 1 178 ? 150.119 207.621 195.064 1.00 146.90 ? 178 LEU A CB  1 
ATOM   1294  C  CG  . LEU A 1 178 ? 148.773 206.931 195.277 1.00 149.79 ? 178 LEU A CG  1 
ATOM   1295  C  CD1 . LEU A 1 178 ? 147.923 206.974 194.016 1.00 148.90 ? 178 LEU A CD1 1 
ATOM   1296  C  CD2 . LEU A 1 178 ? 148.975 205.491 195.701 1.00 148.68 ? 178 LEU A CD2 1 
ATOM   1297  N  N   . LEU A 1 179 ? 150.624 209.350 197.545 1.00 154.29 ? 179 LEU A N   1 
ATOM   1298  C  CA  . LEU A 1 179 ? 150.367 209.682 198.951 1.00 156.92 ? 179 LEU A CA  1 
ATOM   1299  C  C   . LEU A 1 179 ? 150.159 211.198 199.213 1.00 165.15 ? 179 LEU A C   1 
ATOM   1300  O  O   . LEU A 1 179 ? 149.134 211.520 199.820 1.00 166.70 ? 179 LEU A O   1 
ATOM   1301  C  CB  . LEU A 1 179 ? 151.472 209.128 199.868 1.00 157.38 ? 179 LEU A CB  1 
ATOM   1302  C  CG  . LEU A 1 179 ? 151.234 207.735 200.453 1.00 158.67 ? 179 LEU A CG  1 
ATOM   1303  C  CD1 . LEU A 1 179 ? 151.406 206.652 199.404 1.00 154.18 ? 179 LEU A CD1 1 
ATOM   1304  C  CD2 . LEU A 1 179 ? 152.182 207.464 201.596 1.00 163.16 ? 179 LEU A CD2 1 
ATOM   1305  N  N   . PRO A 1 180 ? 151.040 212.146 198.782 1.00 163.32 ? 180 PRO A N   1 
ATOM   1306  C  CA  . PRO A 1 180 ? 150.777 213.563 199.080 1.00 168.17 ? 180 PRO A CA  1 
ATOM   1307  C  C   . PRO A 1 180 ? 149.557 214.114 198.340 1.00 170.67 ? 180 PRO A C   1 
ATOM   1308  O  O   . PRO A 1 180 ? 148.759 214.810 198.964 1.00 173.91 ? 180 PRO A O   1 
ATOM   1309  C  CB  . PRO A 1 180 ? 152.065 214.269 198.641 1.00 172.81 ? 180 PRO A CB  1 
ATOM   1310  C  CG  . PRO A 1 180 ? 153.086 213.194 198.530 1.00 173.92 ? 180 PRO A CG  1 
ATOM   1311  C  CD  . PRO A 1 180 ? 152.321 212.005 198.063 1.00 163.77 ? 180 PRO A CD  1 
ATOM   1312  N  N   . VAL A 1 181 ? 149.393 213.781 197.035 1.00 162.42 ? 181 VAL A N   1 
ATOM   1313  C  CA  . VAL A 1 181 ? 148.276 214.245 196.197 1.00 161.86 ? 181 VAL A CA  1 
ATOM   1314  C  C   . VAL A 1 181 ? 146.931 213.757 196.784 1.00 164.06 ? 181 VAL A C   1 
ATOM   1315  O  O   . VAL A 1 181 ? 146.007 214.566 196.895 1.00 167.35 ? 181 VAL A O   1 
ATOM   1316  C  CB  . VAL A 1 181 ? 148.455 213.849 194.701 1.00 161.65 ? 181 VAL A CB  1 
ATOM   1317  C  CG1 . VAL A 1 181 ? 147.184 214.089 193.886 1.00 161.15 ? 181 VAL A CG1 1 
ATOM   1318  C  CG2 . VAL A 1 181 ? 149.624 214.601 194.077 1.00 163.67 ? 181 VAL A CG2 1 
ATOM   1319  N  N   . SER A 1 182 ? 146.844 212.473 197.202 1.00 155.51 ? 182 SER A N   1 
ATOM   1320  C  CA  . SER A 1 182 ? 145.625 211.886 197.774 1.00 153.89 ? 182 SER A CA  1 
ATOM   1321  C  C   . SER A 1 182 ? 145.258 212.508 199.118 1.00 160.83 ? 182 SER A C   1 
ATOM   1322  O  O   . SER A 1 182 ? 144.103 212.894 199.302 1.00 162.28 ? 182 SER A O   1 
ATOM   1323  C  CB  . SER A 1 182 ? 145.765 210.377 197.931 1.00 152.79 ? 182 SER A CB  1 
ATOM   1324  O  OG  . SER A 1 182 ? 145.882 209.746 196.667 1.00 159.04 ? 182 SER A OG  1 
ATOM   1325  N  N   . SER A 1 183 ? 146.235 212.619 200.042 1.00 158.54 ? 183 SER A N   1 
ATOM   1326  C  CA  . SER A 1 183 ? 146.045 213.202 201.373 1.00 162.83 ? 183 SER A CA  1 
ATOM   1327  C  C   . SER A 1 183 ? 145.547 214.656 201.286 1.00 171.83 ? 183 SER A C   1 
ATOM   1328  O  O   . SER A 1 183 ? 144.677 215.045 202.067 1.00 175.10 ? 183 SER A O   1 
ATOM   1329  C  CB  . SER A 1 183 ? 147.336 213.130 202.183 1.00 167.58 ? 183 SER A CB  1 
ATOM   1330  O  OG  . SER A 1 183 ? 148.428 213.696 201.478 1.00 177.16 ? 183 SER A OG  1 
ATOM   1331  N  N   . LEU A 1 184 ? 146.070 215.438 200.316 1.00 168.56 ? 184 LEU A N   1 
ATOM   1332  C  CA  . LEU A 1 184 ? 145.659 216.826 200.099 1.00 173.40 ? 184 LEU A CA  1 
ATOM   1333  C  C   . LEU A 1 184 ? 144.286 216.890 199.423 1.00 176.29 ? 184 LEU A C   1 
ATOM   1334  O  O   . LEU A 1 184 ? 143.507 217.786 199.743 1.00 181.05 ? 184 LEU A O   1 
ATOM   1335  C  CB  . LEU A 1 184 ? 146.696 217.603 199.272 1.00 175.00 ? 184 LEU A CB  1 
ATOM   1336  C  CG  . LEU A 1 184 ? 148.027 217.936 199.949 1.00 182.25 ? 184 LEU A CG  1 
ATOM   1337  C  CD1 . LEU A 1 184 ? 149.077 218.296 198.920 1.00 182.17 ? 184 LEU A CD1 1 
ATOM   1338  C  CD2 . LEU A 1 184 ? 147.877 219.056 200.965 1.00 190.36 ? 184 LEU A CD2 1 
ATOM   1339  N  N   . LEU A 1 185 ? 143.984 215.936 198.509 1.00 166.78 ? 185 LEU A N   1 
ATOM   1340  C  CA  . LEU A 1 185 ? 142.696 215.849 197.808 1.00 165.68 ? 185 LEU A CA  1 
ATOM   1341  C  C   . LEU A 1 185 ? 141.563 215.515 198.793 1.00 171.32 ? 185 LEU A C   1 
ATOM   1342  O  O   . LEU A 1 185 ? 140.523 216.178 198.764 1.00 175.14 ? 185 LEU A O   1 
ATOM   1343  C  CB  . LEU A 1 185 ? 142.750 214.805 196.675 1.00 159.44 ? 185 LEU A CB  1 
ATOM   1344  C  CG  . LEU A 1 185 ? 141.434 214.497 195.954 1.00 162.71 ? 185 LEU A CG  1 
ATOM   1345  C  CD1 . LEU A 1 185 ? 141.171 215.484 194.838 1.00 165.58 ? 185 LEU A CD1 1 
ATOM   1346  C  CD2 . LEU A 1 185 ? 141.428 213.085 195.424 1.00 159.11 ? 185 LEU A CD2 1 
ATOM   1347  N  N   . LEU A 1 186 ? 141.774 214.495 199.660 1.00 164.67 ? 186 LEU A N   1 
ATOM   1348  C  CA  . LEU A 1 186 ? 140.820 214.048 200.685 1.00 165.03 ? 186 LEU A CA  1 
ATOM   1349  C  C   . LEU A 1 186 ? 140.511 215.168 201.687 1.00 175.81 ? 186 LEU A C   1 
ATOM   1350  O  O   . LEU A 1 186 ? 139.376 215.278 202.156 1.00 177.96 ? 186 LEU A O   1 
ATOM   1351  C  CB  . LEU A 1 186 ? 141.371 212.823 201.438 1.00 160.84 ? 186 LEU A CB  1 
ATOM   1352  C  CG  . LEU A 1 186 ? 141.352 211.487 200.709 1.00 158.66 ? 186 LEU A CG  1 
ATOM   1353  C  CD1 . LEU A 1 186 ? 142.509 210.622 201.158 1.00 155.53 ? 186 LEU A CD1 1 
ATOM   1354  C  CD2 . LEU A 1 186 ? 140.039 210.761 200.931 1.00 159.21 ? 186 LEU A CD2 1 
ATOM   1355  N  N   . TYR A 1 187 ? 141.532 215.994 202.001 1.00 175.64 ? 187 TYR A N   1 
ATOM   1356  C  CA  . TYR A 1 187 ? 141.458 217.132 202.914 1.00 182.52 ? 187 TYR A CA  1 
ATOM   1357  C  C   . TYR A 1 187 ? 140.473 218.182 202.381 1.00 188.19 ? 187 TYR A C   1 
ATOM   1358  O  O   . TYR A 1 187 ? 139.629 218.648 203.140 1.00 189.19 ? 187 TYR A O   1 
ATOM   1359  C  CB  . TYR A 1 187 ? 142.865 217.735 203.109 1.00 186.02 ? 187 TYR A CB  1 
ATOM   1360  C  CG  . TYR A 1 187 ? 142.926 218.924 204.044 1.00 189.51 ? 187 TYR A CG  1 
ATOM   1361  C  CD1 . TYR A 1 187 ? 143.044 218.749 205.419 1.00 191.56 ? 187 TYR A CD1 1 
ATOM   1362  C  CD2 . TYR A 1 187 ? 142.919 220.226 203.549 1.00 191.06 ? 187 TYR A CD2 1 
ATOM   1363  C  CE1 . TYR A 1 187 ? 143.119 219.841 206.284 1.00 193.87 ? 187 TYR A CE1 1 
ATOM   1364  C  CE2 . TYR A 1 187 ? 142.985 221.326 204.404 1.00 193.39 ? 187 TYR A CE2 1 
ATOM   1365  C  CZ  . TYR A 1 187 ? 143.086 221.128 205.772 1.00 198.93 ? 187 TYR A CZ  1 
ATOM   1366  O  OH  . TYR A 1 187 ? 143.159 222.209 206.618 1.00 201.02 ? 187 TYR A OH  1 
ATOM   1367  N  N   . ILE A 1 188 ? 140.562 218.517 201.079 1.00 184.92 ? 188 ILE A N   1 
ATOM   1368  C  CA  . ILE A 1 188 ? 139.715 219.506 200.404 1.00 185.31 ? 188 ILE A CA  1 
ATOM   1369  C  C   . ILE A 1 188 ? 138.231 219.067 200.406 1.00 187.52 ? 188 ILE A C   1 
ATOM   1370  O  O   . ILE A 1 188 ? 137.359 219.904 200.646 1.00 188.09 ? 188 ILE A O   1 
ATOM   1371  C  CB  . ILE A 1 188 ? 140.261 219.777 198.973 1.00 186.86 ? 188 ILE A CB  1 
ATOM   1372  C  CG1 . ILE A 1 188 ? 141.559 220.613 199.057 1.00 187.99 ? 188 ILE A CG1 1 
ATOM   1373  C  CG2 . ILE A 1 188 ? 139.223 220.476 198.077 1.00 187.84 ? 188 ILE A CG2 1 
ATOM   1374  C  CD1 . ILE A 1 188 ? 142.519 220.458 197.916 1.00 192.26 ? 188 ILE A CD1 1 
ATOM   1375  N  N   . ILE A 1 189 ? 137.955 217.772 200.167 1.00 183.95 ? 189 ILE A N   1 
ATOM   1376  C  CA  . ILE A 1 189 ? 136.589 217.227 200.138 1.00 183.61 ? 189 ILE A CA  1 
ATOM   1377  C  C   . ILE A 1 189 ? 135.976 217.235 201.561 1.00 188.78 ? 189 ILE A C   1 
ATOM   1378  O  O   . ILE A 1 189 ? 134.836 217.681 201.726 1.00 189.26 ? 189 ILE A O   1 
ATOM   1379  C  CB  . ILE A 1 189 ? 136.553 215.811 199.482 1.00 179.11 ? 189 ILE A CB  1 
ATOM   1380  C  CG1 . ILE A 1 189 ? 137.084 215.869 198.030 1.00 176.68 ? 189 ILE A CG1 1 
ATOM   1381  C  CG2 . ILE A 1 189 ? 135.134 215.214 199.493 1.00 179.33 ? 189 ILE A CG2 1 
ATOM   1382  C  CD1 . ILE A 1 189 ? 137.684 214.567 197.503 1.00 178.94 ? 189 ILE A CD1 1 
ATOM   1383  N  N   . LYS A 1 190 ? 136.739 216.771 202.573 1.00 187.44 ? 190 LYS A N   1 
ATOM   1384  C  CA  . LYS A 1 190 ? 136.301 216.693 203.970 1.00 188.69 ? 190 LYS A CA  1 
ATOM   1385  C  C   . LYS A 1 190 ? 136.148 218.082 204.628 1.00 194.66 ? 190 LYS A C   1 
ATOM   1386  O  O   . LYS A 1 190 ? 135.143 218.314 205.303 1.00 195.21 ? 190 LYS A O   1 
ATOM   1387  C  CB  . LYS A 1 190 ? 137.263 215.823 204.797 1.00 189.74 ? 190 LYS A CB  1 
ATOM   1388  C  CG  . LYS A 1 190 ? 137.062 214.324 204.604 1.00 195.53 ? 190 LYS A CG  1 
ATOM   1389  N  N   . ILE A 1 191 ? 137.130 218.990 204.440 1.00 194.33 ? 191 ILE A N   1 
ATOM   1390  C  CA  . ILE A 1 191 ? 137.116 220.330 205.043 1.00 196.72 ? 191 ILE A CA  1 
ATOM   1391  C  C   . ILE A 1 191 ? 136.167 221.267 204.268 1.00 201.68 ? 191 ILE A C   1 
ATOM   1392  O  O   . ILE A 1 191 ? 135.251 221.826 204.874 1.00 202.61 ? 191 ILE A O   1 
ATOM   1393  C  CB  . ILE A 1 191 ? 138.560 220.920 205.177 1.00 199.34 ? 191 ILE A CB  1 
ATOM   1394  C  CG1 . ILE A 1 191 ? 139.457 220.086 206.140 1.00 199.41 ? 191 ILE A CG1 1 
ATOM   1395  C  CG2 . ILE A 1 191 ? 138.577 222.420 205.523 1.00 201.83 ? 191 ILE A CG2 1 
ATOM   1396  C  CD1 . ILE A 1 191 ? 139.024 219.976 207.667 1.00 206.29 ? 191 ILE A CD1 1 
ATOM   1397  N  N   . GLY A 1 192 ? 136.403 221.431 202.965 1.00 200.10 ? 192 GLY A N   1 
ATOM   1398  C  CA  . GLY A 1 192 ? 135.612 222.300 202.098 1.00 201.24 ? 192 GLY A CA  1 
ATOM   1399  C  C   . GLY A 1 192 ? 134.161 221.892 201.929 1.00 205.23 ? 192 GLY A C   1 
ATOM   1400  O  O   . GLY A 1 192 ? 133.804 220.732 202.155 1.00 204.09 ? 192 GLY A O   1 
ATOM   1401  N  N   . GLY A 1 193 ? 133.334 222.854 201.533 1.00 205.09 ? 193 GLY A N   1 
ATOM   1402  C  CA  . GLY A 1 193 ? 131.907 222.649 201.321 1.00 205.74 ? 193 GLY A CA  1 
ATOM   1403  C  C   . GLY A 1 193 ? 131.094 223.930 201.376 1.00 212.20 ? 193 GLY A C   1 
ATOM   1404  O  O   . GLY A 1 193 ? 131.602 224.955 201.838 1.00 213.63 ? 193 GLY A O   1 
ATOM   1405  N  N   . ASP A 1 194 ? 129.819 223.916 200.916 1.00 211.02 ? 194 ASP A N   1 
ATOM   1406  C  CA  . ASP A 1 194 ? 129.092 222.775 200.337 1.00 209.75 ? 194 ASP A CA  1 
ATOM   1407  C  C   . ASP A 1 194 ? 129.454 222.569 198.852 1.00 211.11 ? 194 ASP A C   1 
ATOM   1408  O  O   . ASP A 1 194 ? 129.050 221.572 198.248 1.00 209.41 ? 194 ASP A O   1 
ATOM   1409  C  CB  . ASP A 1 194 ? 127.575 222.984 200.493 1.00 212.01 ? 194 ASP A CB  1 
ATOM   1410  N  N   . TYR A 1 195 ? 130.237 223.502 198.285 1.00 209.50 ? 195 TYR A N   1 
ATOM   1411  C  CA  . TYR A 1 195 ? 130.693 223.474 196.900 1.00 208.72 ? 195 TYR A CA  1 
ATOM   1412  C  C   . TYR A 1 195 ? 132.157 222.995 196.840 1.00 210.77 ? 195 TYR A C   1 
ATOM   1413  O  O   . TYR A 1 195 ? 132.989 223.594 196.151 1.00 210.82 ? 195 TYR A O   1 
ATOM   1414  C  CB  . TYR A 1 195 ? 130.516 224.863 196.260 1.00 210.94 ? 195 TYR A CB  1 
ATOM   1415  C  CG  . TYR A 1 195 ? 129.074 225.319 196.198 1.00 213.34 ? 195 TYR A CG  1 
ATOM   1416  C  CD1 . TYR A 1 195 ? 128.234 224.902 195.169 1.00 214.11 ? 195 TYR A CD1 1 
ATOM   1417  C  CD2 . TYR A 1 195 ? 128.552 226.177 197.161 1.00 215.60 ? 195 TYR A CD2 1 
ATOM   1418  C  CE1 . TYR A 1 195 ? 126.906 225.322 195.104 1.00 215.81 ? 195 TYR A CE1 1 
ATOM   1419  C  CE2 . TYR A 1 195 ? 127.226 226.602 197.108 1.00 217.32 ? 195 TYR A CE2 1 
ATOM   1420  C  CZ  . TYR A 1 195 ? 126.408 226.177 196.074 1.00 221.92 ? 195 TYR A CZ  1 
ATOM   1421  O  OH  . TYR A 1 195 ? 125.101 226.598 196.013 1.00 224.00 ? 195 TYR A OH  1 
ATOM   1422  N  N   . PHE A 1 196 ? 132.447 221.880 197.551 1.00 207.52 ? 196 PHE A N   1 
ATOM   1423  C  CA  . PHE A 1 196 ? 133.767 221.248 197.657 1.00 206.27 ? 196 PHE A CA  1 
ATOM   1424  C  C   . PHE A 1 196 ? 134.276 220.702 196.322 1.00 206.70 ? 196 PHE A C   1 
ATOM   1425  O  O   . PHE A 1 196 ? 135.490 220.598 196.140 1.00 205.94 ? 196 PHE A O   1 
ATOM   1426  C  CB  . PHE A 1 196 ? 133.749 220.116 198.703 1.00 206.90 ? 196 PHE A CB  1 
ATOM   1427  C  CG  . PHE A 1 196 ? 132.849 218.942 198.388 1.00 206.97 ? 196 PHE A CG  1 
ATOM   1428  C  CD1 . PHE A 1 196 ? 133.325 217.851 197.670 1.00 207.66 ? 196 PHE A CD1 1 
ATOM   1429  C  CD2 . PHE A 1 196 ? 131.534 218.914 198.835 1.00 209.14 ? 196 PHE A CD2 1 
ATOM   1430  C  CE1 . PHE A 1 196 ? 132.492 216.768 197.377 1.00 207.41 ? 196 PHE A CE1 1 
ATOM   1431  C  CE2 . PHE A 1 196 ? 130.704 217.827 198.549 1.00 210.18 ? 196 PHE A CE2 1 
ATOM   1432  C  CZ  . PHE A 1 196 ? 131.190 216.760 197.826 1.00 207.42 ? 196 PHE A CZ  1 
ATOM   1433  N  N   . PHE A 1 197 ? 133.355 220.343 195.408 1.00 203.34 ? 197 PHE A N   1 
ATOM   1434  C  CA  . PHE A 1 197 ? 133.682 219.770 194.105 1.00 201.85 ? 197 PHE A CA  1 
ATOM   1435  C  C   . PHE A 1 197 ? 134.451 220.758 193.207 1.00 204.03 ? 197 PHE A C   1 
ATOM   1436  O  O   . PHE A 1 197 ? 135.222 220.304 192.362 1.00 202.84 ? 197 PHE A O   1 
ATOM   1437  C  CB  . PHE A 1 197 ? 132.416 219.245 193.398 1.00 202.69 ? 197 PHE A CB  1 
ATOM   1438  C  CG  . PHE A 1 197 ? 131.487 220.269 192.787 1.00 204.91 ? 197 PHE A CG  1 
ATOM   1439  C  CD1 . PHE A 1 197 ? 130.544 220.929 193.565 1.00 208.18 ? 197 PHE A CD1 1 
ATOM   1440  C  CD2 . PHE A 1 197 ? 131.517 220.531 191.422 1.00 206.27 ? 197 PHE A CD2 1 
ATOM   1441  C  CE1 . PHE A 1 197 ? 129.673 221.861 192.993 1.00 209.96 ? 197 PHE A CE1 1 
ATOM   1442  C  CE2 . PHE A 1 197 ? 130.645 221.462 190.851 1.00 209.22 ? 197 PHE A CE2 1 
ATOM   1443  C  CZ  . PHE A 1 197 ? 129.730 222.121 191.640 1.00 209.21 ? 197 PHE A CZ  1 
ATOM   1444  N  N   . ILE A 1 198 ? 134.262 222.086 193.402 1.00 202.25 ? 198 ILE A N   1 
ATOM   1445  C  CA  . ILE A 1 198 ? 134.932 223.131 192.614 1.00 202.37 ? 198 ILE A CA  1 
ATOM   1446  C  C   . ILE A 1 198 ? 136.415 223.259 193.045 1.00 204.45 ? 198 ILE A C   1 
ATOM   1447  O  O   . ILE A 1 198 ? 137.281 223.348 192.170 1.00 204.10 ? 198 ILE A O   1 
ATOM   1448  C  CB  . ILE A 1 198 ? 134.165 224.483 192.672 1.00 205.93 ? 198 ILE A CB  1 
ATOM   1449  C  CG1 . ILE A 1 198 ? 132.762 224.331 192.038 1.00 206.13 ? 198 ILE A CG1 1 
ATOM   1450  C  CG2 . ILE A 1 198 ? 134.944 225.611 191.971 1.00 207.17 ? 198 ILE A CG2 1 
ATOM   1451  C  CD1 . ILE A 1 198 ? 131.682 225.224 192.620 1.00 213.15 ? 198 ILE A CD1 1 
ATOM   1452  N  N   . TYR A 1 199 ? 136.708 223.247 194.366 1.00 201.72 ? 199 TYR A N   1 
ATOM   1453  C  CA  . TYR A 1 199 ? 138.084 223.341 194.885 1.00 201.31 ? 199 TYR A CA  1 
ATOM   1454  C  C   . TYR A 1 199 ? 138.857 222.033 194.627 1.00 201.32 ? 199 TYR A C   1 
ATOM   1455  O  O   . TYR A 1 199 ? 140.055 222.083 194.334 1.00 200.85 ? 199 TYR A O   1 
ATOM   1456  C  CB  . TYR A 1 199 ? 138.135 223.696 196.390 1.00 202.97 ? 199 TYR A CB  1 
ATOM   1457  C  CG  . TYR A 1 199 ? 136.964 224.489 196.934 1.00 205.32 ? 199 TYR A CG  1 
ATOM   1458  C  CD1 . TYR A 1 199 ? 136.755 225.813 196.557 1.00 208.06 ? 199 TYR A CD1 1 
ATOM   1459  C  CD2 . TYR A 1 199 ? 136.121 223.948 197.899 1.00 205.75 ? 199 TYR A CD2 1 
ATOM   1460  C  CE1 . TYR A 1 199 ? 135.689 226.553 197.071 1.00 209.73 ? 199 TYR A CE1 1 
ATOM   1461  C  CE2 . TYR A 1 199 ? 135.058 224.680 198.428 1.00 207.60 ? 199 TYR A CE2 1 
ATOM   1462  C  CZ  . TYR A 1 199 ? 134.842 225.981 198.008 1.00 213.26 ? 199 TYR A CZ  1 
ATOM   1463  O  OH  . TYR A 1 199 ? 133.793 226.699 198.529 1.00 214.53 ? 199 TYR A OH  1 
ATOM   1464  N  N   . ALA A 1 200 ? 138.161 220.872 194.732 1.00 197.08 ? 200 ALA A N   1 
ATOM   1465  C  CA  . ALA A 1 200 ? 138.725 219.540 194.484 1.00 195.01 ? 200 ALA A CA  1 
ATOM   1466  C  C   . ALA A 1 200 ? 139.078 219.377 193.011 1.00 196.42 ? 200 ALA A C   1 
ATOM   1467  O  O   . ALA A 1 200 ? 140.108 218.778 192.700 1.00 195.14 ? 200 ALA A O   1 
ATOM   1468  C  CB  . ALA A 1 200 ? 137.748 218.457 194.916 1.00 194.59 ? 200 ALA A CB  1 
ATOM   1469  N  N   . TRP A 1 201 ? 138.237 219.933 192.109 1.00 194.04 ? 201 TRP A N   1 
ATOM   1470  C  CA  . TRP A 1 201 ? 138.449 219.911 190.660 1.00 193.27 ? 201 TRP A CA  1 
ATOM   1471  C  C   . TRP A 1 201 ? 139.613 220.835 190.275 1.00 195.89 ? 201 TRP A C   1 
ATOM   1472  O  O   . TRP A 1 201 ? 140.417 220.472 189.412 1.00 195.31 ? 201 TRP A O   1 
ATOM   1473  C  CB  . TRP A 1 201 ? 137.166 220.314 189.913 1.00 192.78 ? 201 TRP A CB  1 
ATOM   1474  C  CG  . TRP A 1 201 ? 137.356 220.554 188.447 1.00 193.33 ? 201 TRP A CG  1 
ATOM   1475  C  CD1 . TRP A 1 201 ? 137.597 219.617 187.487 1.00 194.10 ? 201 TRP A CD1 1 
ATOM   1476  C  CD2 . TRP A 1 201 ? 137.357 221.822 187.781 1.00 194.46 ? 201 TRP A CD2 1 
ATOM   1477  N  NE1 . TRP A 1 201 ? 137.728 220.220 186.259 1.00 194.17 ? 201 TRP A NE1 1 
ATOM   1478  C  CE2 . TRP A 1 201 ? 137.585 221.574 186.410 1.00 196.60 ? 201 TRP A CE2 1 
ATOM   1479  C  CE3 . TRP A 1 201 ? 137.182 223.148 188.210 1.00 196.86 ? 201 TRP A CE3 1 
ATOM   1480  C  CZ2 . TRP A 1 201 ? 137.626 222.601 185.462 1.00 197.19 ? 201 TRP A CZ2 1 
ATOM   1481  C  CZ3 . TRP A 1 201 ? 137.233 224.165 187.271 1.00 198.88 ? 201 TRP A CZ3 1 
ATOM   1482  C  CH2 . TRP A 1 201 ? 137.460 223.890 185.917 1.00 198.81 ? 201 TRP A CH2 1 
ATOM   1483  N  N   . LEU A 1 202 ? 139.700 222.018 190.921 1.00 193.83 ? 202 LEU A N   1 
ATOM   1484  C  CA  . LEU A 1 202 ? 140.756 223.002 190.684 1.00 194.15 ? 202 LEU A CA  1 
ATOM   1485  C  C   . LEU A 1 202 ? 142.103 222.506 191.220 1.00 195.13 ? 202 LEU A C   1 
ATOM   1486  O  O   . LEU A 1 202 ? 143.138 222.855 190.650 1.00 195.29 ? 202 LEU A O   1 
ATOM   1487  C  CB  . LEU A 1 202 ? 140.398 224.356 191.305 1.00 195.83 ? 202 LEU A CB  1 
ATOM   1488  C  CG  . LEU A 1 202 ? 140.991 225.567 190.597 1.00 200.25 ? 202 LEU A CG  1 
ATOM   1489  C  CD1 . LEU A 1 202 ? 140.195 225.919 189.344 1.00 200.64 ? 202 LEU A CD1 1 
ATOM   1490  C  CD2 . LEU A 1 202 ? 141.058 226.756 191.524 1.00 203.44 ? 202 LEU A CD2 1 
ATOM   1491  N  N   . PHE A 1 203 ? 142.088 221.683 192.298 1.00 190.95 ? 203 PHE A N   1 
ATOM   1492  C  CA  . PHE A 1 203 ? 143.298 221.090 192.876 1.00 189.85 ? 203 PHE A CA  1 
ATOM   1493  C  C   . PHE A 1 203 ? 143.889 220.074 191.902 1.00 186.27 ? 203 PHE A C   1 
ATOM   1494  O  O   . PHE A 1 203 ? 145.094 220.105 191.656 1.00 184.79 ? 203 PHE A O   1 
ATOM   1495  C  CB  . PHE A 1 203 ? 143.013 220.438 194.241 1.00 190.74 ? 203 PHE A CB  1 
ATOM   1496  C  CG  . PHE A 1 203 ? 144.131 219.577 194.791 1.00 189.06 ? 203 PHE A CG  1 
ATOM   1497  C  CD1 . PHE A 1 203 ? 145.287 220.152 195.308 1.00 194.10 ? 203 PHE A CD1 1 
ATOM   1498  C  CD2 . PHE A 1 203 ? 144.020 218.192 194.809 1.00 184.96 ? 203 PHE A CD2 1 
ATOM   1499  C  CE1 . PHE A 1 203 ? 146.317 219.356 195.816 1.00 192.65 ? 203 PHE A CE1 1 
ATOM   1500  C  CE2 . PHE A 1 203 ? 145.051 217.397 195.316 1.00 184.45 ? 203 PHE A CE2 1 
ATOM   1501  C  CZ  . PHE A 1 203 ? 146.193 217.984 195.813 1.00 185.46 ? 203 PHE A CZ  1 
ATOM   1502  N  N   . THR A 1 204 ? 143.031 219.193 191.334 1.00 177.87 ? 204 THR A N   1 
ATOM   1503  C  CA  . THR A 1 204 ? 143.423 218.182 190.346 1.00 171.53 ? 204 THR A CA  1 
ATOM   1504  C  C   . THR A 1 204 ? 143.887 218.869 189.056 1.00 175.97 ? 204 THR A C   1 
ATOM   1505  O  O   . THR A 1 204 ? 144.788 218.358 188.399 1.00 172.22 ? 204 THR A O   1 
ATOM   1506  C  CB  . THR A 1 204 ? 142.291 217.178 190.072 1.00 175.23 ? 204 THR A CB  1 
ATOM   1507  O  OG1 . THR A 1 204 ? 141.109 217.870 189.675 1.00 178.56 ? 204 THR A OG1 1 
ATOM   1508  C  CG2 . THR A 1 204 ? 142.003 216.276 191.260 1.00 170.77 ? 204 THR A CG2 1 
ATOM   1509  N  N   . LEU A 1 205 ? 143.300 220.040 188.725 1.00 177.10 ? 205 LEU A N   1 
ATOM   1510  C  CA  . LEU A 1 205 ? 143.650 220.861 187.562 1.00 178.99 ? 205 LEU A CA  1 
ATOM   1511  C  C   . LEU A 1 205 ? 145.092 221.383 187.693 1.00 183.88 ? 205 LEU A C   1 
ATOM   1512  O  O   . LEU A 1 205 ? 145.831 221.368 186.708 1.00 182.28 ? 205 LEU A O   1 
ATOM   1513  C  CB  . LEU A 1 205 ? 142.656 222.032 187.432 1.00 185.19 ? 205 LEU A CB  1 
ATOM   1514  C  CG  . LEU A 1 205 ? 142.606 222.755 186.094 1.00 190.38 ? 205 LEU A CG  1 
ATOM   1515  C  CD1 . LEU A 1 205 ? 141.184 223.058 185.705 1.00 190.58 ? 205 LEU A CD1 1 
ATOM   1516  C  CD2 . LEU A 1 205 ? 143.407 224.040 186.136 1.00 193.55 ? 205 LEU A CD2 1 
ATOM   1517  N  N   . VAL A 1 206 ? 145.484 221.829 188.909 1.00 182.80 ? 206 VAL A N   1 
ATOM   1518  C  CA  . VAL A 1 206 ? 146.827 222.338 189.210 1.00 184.44 ? 206 VAL A CA  1 
ATOM   1519  C  C   . VAL A 1 206 ? 147.817 221.165 189.226 1.00 182.89 ? 206 VAL A C   1 
ATOM   1520  O  O   . VAL A 1 206 ? 148.836 221.226 188.538 1.00 181.78 ? 206 VAL A O   1 
ATOM   1521  C  CB  . VAL A 1 206 ? 146.863 223.153 190.531 1.00 190.47 ? 206 VAL A CB  1 
ATOM   1522  C  CG1 . VAL A 1 206 ? 148.295 223.485 190.947 1.00 191.09 ? 206 VAL A CG1 1 
ATOM   1523  C  CG2 . VAL A 1 206 ? 146.036 224.428 190.410 1.00 191.60 ? 206 VAL A CG2 1 
ATOM   1524  N  N   . VAL A 1 207 ? 147.492 220.092 189.978 1.00 176.09 ? 207 VAL A N   1 
ATOM   1525  C  CA  . VAL A 1 207 ? 148.297 218.871 190.120 1.00 171.08 ? 207 VAL A CA  1 
ATOM   1526  C  C   . VAL A 1 207 ? 148.574 218.246 188.728 1.00 172.69 ? 207 VAL A C   1 
ATOM   1527  O  O   . VAL A 1 207 ? 149.696 217.790 188.490 1.00 170.51 ? 207 VAL A O   1 
ATOM   1528  C  CB  . VAL A 1 207 ? 147.625 217.875 191.115 1.00 171.65 ? 207 VAL A CB  1 
ATOM   1529  C  CG1 . VAL A 1 207 ? 148.145 216.445 190.959 1.00 165.26 ? 207 VAL A CG1 1 
ATOM   1530  C  CG2 . VAL A 1 207 ? 147.804 218.347 192.552 1.00 175.21 ? 207 VAL A CG2 1 
ATOM   1531  N  N   . SER A 1 208 ? 147.582 218.280 187.807 1.00 169.59 ? 208 SER A N   1 
ATOM   1532  C  CA  . SER A 1 208 ? 147.728 217.750 186.448 1.00 166.61 ? 208 SER A CA  1 
ATOM   1533  C  C   . SER A 1 208 ? 148.790 218.520 185.662 1.00 173.76 ? 208 SER A C   1 
ATOM   1534  O  O   . SER A 1 208 ? 149.756 217.908 185.209 1.00 170.73 ? 208 SER A O   1 
ATOM   1535  C  CB  . SER A 1 208 ? 146.399 217.784 185.697 1.00 170.90 ? 208 SER A CB  1 
ATOM   1536  O  OG  . SER A 1 208 ? 145.442 216.927 186.296 1.00 178.98 ? 208 SER A OG  1 
ATOM   1537  N  N   . LEU A 1 209 ? 148.638 219.858 185.545 1.00 176.30 ? 209 LEU A N   1 
ATOM   1538  C  CA  . LEU A 1 209 ? 149.551 220.742 184.812 1.00 179.45 ? 209 LEU A CA  1 
ATOM   1539  C  C   . LEU A 1 209 ? 150.967 220.767 185.416 1.00 183.76 ? 209 LEU A C   1 
ATOM   1540  O  O   . LEU A 1 209 ? 151.930 220.920 184.662 1.00 184.13 ? 209 LEU A O   1 
ATOM   1541  C  CB  . LEU A 1 209 ? 148.987 222.167 184.745 1.00 186.00 ? 209 LEU A CB  1 
ATOM   1542  N  N   . VAL A 1 210 ? 151.094 220.606 186.755 1.00 179.95 ? 210 VAL A N   1 
ATOM   1543  C  CA  . VAL A 1 210 ? 152.386 220.595 187.452 1.00 180.76 ? 210 VAL A CA  1 
ATOM   1544  C  C   . VAL A 1 210 ? 153.131 219.291 187.110 1.00 179.67 ? 210 VAL A C   1 
ATOM   1545  O  O   . VAL A 1 210 ? 154.276 219.352 186.659 1.00 179.59 ? 210 VAL A O   1 
ATOM   1546  C  CB  . VAL A 1 210 ? 152.239 220.816 188.986 1.00 187.04 ? 210 VAL A CB  1 
ATOM   1547  C  CG1 . VAL A 1 210 ? 153.531 220.485 189.732 1.00 186.98 ? 210 VAL A CG1 1 
ATOM   1548  C  CG2 . VAL A 1 210 ? 151.806 222.245 189.296 1.00 193.79 ? 210 VAL A CG2 1 
ATOM   1549  N  N   . LEU A 1 211 ? 152.464 218.127 187.281 1.00 172.26 ? 211 LEU A N   1 
ATOM   1550  C  CA  . LEU A 1 211 ? 153.033 216.803 187.002 1.00 167.33 ? 211 LEU A CA  1 
ATOM   1551  C  C   . LEU A 1 211 ? 153.370 216.608 185.508 1.00 171.17 ? 211 LEU A C   1 
ATOM   1552  O  O   . LEU A 1 211 ? 154.279 215.837 185.198 1.00 168.84 ? 211 LEU A O   1 
ATOM   1553  C  CB  . LEU A 1 211 ? 152.089 215.690 187.476 1.00 162.83 ? 211 LEU A CB  1 
ATOM   1554  N  N   . VAL A 1 212 ? 152.656 217.306 184.596 1.00 169.68 ? 212 VAL A N   1 
ATOM   1555  C  CA  . VAL A 1 212 ? 152.885 217.232 183.149 1.00 168.50 ? 212 VAL A CA  1 
ATOM   1556  C  C   . VAL A 1 212 ? 154.257 217.865 182.818 1.00 176.03 ? 212 VAL A C   1 
ATOM   1557  O  O   . VAL A 1 212 ? 155.031 217.272 182.061 1.00 173.59 ? 212 VAL A O   1 
ATOM   1558  C  CB  . VAL A 1 212 ? 151.705 217.873 182.357 1.00 173.94 ? 212 VAL A CB  1 
ATOM   1559  C  CG1 . VAL A 1 212 ? 152.136 218.406 180.988 1.00 175.46 ? 212 VAL A CG1 1 
ATOM   1560  C  CG2 . VAL A 1 212 ? 150.557 216.879 182.205 1.00 169.50 ? 212 VAL A CG2 1 
ATOM   1561  N  N   . THR A 1 213 ? 154.563 219.033 183.425 1.00 178.14 ? 213 THR A N   1 
ATOM   1562  C  CA  . THR A 1 213 ? 155.814 219.771 183.213 1.00 182.07 ? 213 THR A CA  1 
ATOM   1563  C  C   . THR A 1 213 ? 156.997 219.100 183.945 1.00 185.27 ? 213 THR A C   1 
ATOM   1564  O  O   . THR A 1 213 ? 158.108 219.101 183.414 1.00 185.90 ? 213 THR A O   1 
ATOM   1565  C  CB  . THR A 1 213 ? 155.659 221.248 183.641 1.00 195.08 ? 213 THR A CB  1 
ATOM   1566  O  OG1 . THR A 1 213 ? 154.365 221.728 183.265 1.00 195.24 ? 213 THR A OG1 1 
ATOM   1567  C  CG2 . THR A 1 213 ? 156.725 222.155 183.027 1.00 197.35 ? 213 THR A CG2 1 
ATOM   1568  N  N   . ILE A 1 214 ? 156.761 218.534 185.146 1.00 180.41 ? 214 ILE A N   1 
ATOM   1569  C  CA  . ILE A 1 214 ? 157.801 217.899 185.961 1.00 179.89 ? 214 ILE A CA  1 
ATOM   1570  C  C   . ILE A 1 214 ? 158.269 216.553 185.361 1.00 180.36 ? 214 ILE A C   1 
ATOM   1571  O  O   . ILE A 1 214 ? 159.481 216.348 185.254 1.00 180.61 ? 214 ILE A O   1 
ATOM   1572  C  CB  . ILE A 1 214 ? 157.330 217.742 187.444 1.00 182.91 ? 214 ILE A CB  1 
ATOM   1573  C  CG1 . ILE A 1 214 ? 157.153 219.114 188.157 1.00 189.72 ? 214 ILE A CG1 1 
ATOM   1574  C  CG2 . ILE A 1 214 ? 158.218 216.787 188.265 1.00 181.49 ? 214 ILE A CG2 1 
ATOM   1575  C  CD1 . ILE A 1 214 ? 158.411 220.063 188.265 1.00 204.83 ? 214 ILE A CD1 1 
ATOM   1576  N  N   . TYR A 1 215 ? 157.320 215.655 184.986 1.00 173.74 ? 215 TYR A N   1 
ATOM   1577  C  CA  . TYR A 1 215 ? 157.536 214.285 184.477 1.00 169.21 ? 215 TYR A CA  1 
ATOM   1578  C  C   . TYR A 1 215 ? 158.775 214.111 183.570 1.00 175.19 ? 215 TYR A C   1 
ATOM   1579  O  O   . TYR A 1 215 ? 159.751 213.508 184.016 1.00 174.72 ? 215 TYR A O   1 
ATOM   1580  C  CB  . TYR A 1 215 ? 156.294 213.747 183.746 1.00 166.56 ? 215 TYR A CB  1 
ATOM   1581  N  N   . ALA A 1 216 ? 158.738 214.630 182.325 1.00 173.65 ? 216 ALA A N   1 
ATOM   1582  C  CA  . ALA A 1 216 ? 159.806 214.501 181.322 1.00 174.48 ? 216 ALA A CA  1 
ATOM   1583  C  C   . ALA A 1 216 ? 161.155 215.095 181.760 1.00 183.08 ? 216 ALA A C   1 
ATOM   1584  O  O   . ALA A 1 216 ? 162.199 214.644 181.281 1.00 182.70 ? 216 ALA A O   1 
ATOM   1585  C  CB  . ALA A 1 216 ? 159.372 215.148 180.020 1.00 176.37 ? 216 ALA A CB  1 
ATOM   1586  N  N   . ASP A 1 217 ? 161.131 216.095 182.655 1.00 183.94 ? 217 ASP A N   1 
ATOM   1587  C  CA  . ASP A 1 217 ? 162.332 216.775 183.131 1.00 189.11 ? 217 ASP A CA  1 
ATOM   1588  C  C   . ASP A 1 217 ? 162.944 216.158 184.399 1.00 193.09 ? 217 ASP A C   1 
ATOM   1589  O  O   . ASP A 1 217 ? 164.158 216.282 184.586 1.00 196.02 ? 217 ASP A O   1 
ATOM   1590  C  CB  . ASP A 1 217 ? 162.029 218.255 183.393 1.00 196.50 ? 217 ASP A CB  1 
ATOM   1591  C  CG  . ASP A 1 217 ? 162.406 219.171 182.248 1.00 210.89 ? 217 ASP A CG  1 
ATOM   1592  O  OD1 . ASP A 1 217 ? 163.622 219.355 182.009 1.00 214.31 ? 217 ASP A OD1 1 
ATOM   1593  O  OD2 . ASP A 1 217 ? 161.489 219.722 181.604 1.00 217.62 ? 217 ASP A OD2 1 
ATOM   1594  N  N   . TYR A 1 218 ? 162.131 215.527 185.275 1.00 186.36 ? 218 TYR A N   1 
ATOM   1595  C  CA  . TYR A 1 218 ? 162.646 214.992 186.537 1.00 186.45 ? 218 TYR A CA  1 
ATOM   1596  C  C   . TYR A 1 218 ? 162.287 213.519 186.796 1.00 184.81 ? 218 TYR A C   1 
ATOM   1597  O  O   . TYR A 1 218 ? 163.177 212.758 187.176 1.00 184.03 ? 218 TYR A O   1 
ATOM   1598  C  CB  . TYR A 1 218 ? 162.163 215.853 187.718 1.00 191.23 ? 218 TYR A CB  1 
ATOM   1599  C  CG  . TYR A 1 218 ? 162.538 217.317 187.603 1.00 199.73 ? 218 TYR A CG  1 
ATOM   1600  C  CD1 . TYR A 1 218 ? 163.791 217.771 188.007 1.00 206.87 ? 218 TYR A CD1 1 
ATOM   1601  C  CD2 . TYR A 1 218 ? 161.638 218.249 187.093 1.00 202.00 ? 218 TYR A CD2 1 
ATOM   1602  C  CE1 . TYR A 1 218 ? 164.145 219.117 187.894 1.00 210.06 ? 218 TYR A CE1 1 
ATOM   1603  C  CE2 . TYR A 1 218 ? 161.981 219.596 186.974 1.00 208.72 ? 218 TYR A CE2 1 
ATOM   1604  C  CZ  . TYR A 1 218 ? 163.235 220.026 187.379 1.00 214.57 ? 218 TYR A CZ  1 
ATOM   1605  O  OH  . TYR A 1 218 ? 163.574 221.353 187.265 1.00 216.50 ? 218 TYR A OH  1 
ATOM   1606  N  N   . ILE A 1 219 ? 161.009 213.121 186.617 1.00 177.74 ? 219 ILE A N   1 
ATOM   1607  C  CA  . ILE A 1 219 ? 160.537 211.751 186.879 1.00 172.54 ? 219 ILE A CA  1 
ATOM   1608  C  C   . ILE A 1 219 ? 161.042 210.771 185.791 1.00 174.10 ? 219 ILE A C   1 
ATOM   1609  O  O   . ILE A 1 219 ? 161.629 209.747 186.141 1.00 172.13 ? 219 ILE A O   1 
ATOM   1610  C  CB  . ILE A 1 219 ? 158.984 211.694 187.038 1.00 172.92 ? 219 ILE A CB  1 
ATOM   1611  C  CG1 . ILE A 1 219 ? 158.501 212.616 188.183 1.00 176.53 ? 219 ILE A CG1 1 
ATOM   1612  C  CG2 . ILE A 1 219 ? 158.490 210.253 187.257 1.00 168.66 ? 219 ILE A CG2 1 
ATOM   1613  C  CD1 . ILE A 1 219 ? 157.042 213.095 188.072 1.00 182.55 ? 219 ILE A CD1 1 
ATOM   1614  N  N   . ALA A 1 220 ? 160.823 211.091 184.495 1.00 170.74 ? 220 ALA A N   1 
ATOM   1615  C  CA  . ALA A 1 220 ? 161.206 210.263 183.343 1.00 168.36 ? 220 ALA A CA  1 
ATOM   1616  C  C   . ALA A 1 220 ? 162.734 209.977 183.231 1.00 174.49 ? 220 ALA A C   1 
ATOM   1617  O  O   . ALA A 1 220 ? 163.056 208.813 182.977 1.00 171.60 ? 220 ALA A O   1 
ATOM   1618  C  CB  . ALA A 1 220 ? 160.702 210.883 182.051 1.00 169.44 ? 220 ALA A CB  1 
ATOM   1619  N  N   . PRO A 1 221 ? 163.690 210.933 183.434 1.00 175.94 ? 221 PRO A N   1 
ATOM   1620  C  CA  . PRO A 1 221 ? 165.120 210.581 183.291 1.00 178.12 ? 221 PRO A CA  1 
ATOM   1621  C  C   . PRO A 1 221 ? 165.677 209.620 184.363 1.00 182.02 ? 221 PRO A C   1 
ATOM   1622  O  O   . PRO A 1 221 ? 166.856 209.261 184.286 1.00 183.51 ? 221 PRO A O   1 
ATOM   1623  C  CB  . PRO A 1 221 ? 165.832 211.940 183.367 1.00 185.66 ? 221 PRO A CB  1 
ATOM   1624  C  CG  . PRO A 1 221 ? 164.776 212.952 183.096 1.00 190.51 ? 221 PRO A CG  1 
ATOM   1625  C  CD  . PRO A 1 221 ? 163.544 212.376 183.707 1.00 181.75 ? 221 PRO A CD  1 
ATOM   1626  N  N   . LEU A 1 222 ? 164.844 209.186 185.337 1.00 176.64 ? 222 LEU A N   1 
ATOM   1627  C  CA  . LEU A 1 222 ? 165.238 208.250 186.401 1.00 175.86 ? 222 LEU A CA  1 
ATOM   1628  C  C   . LEU A 1 222 ? 165.185 206.796 185.914 1.00 177.07 ? 222 LEU A C   1 
ATOM   1629  O  O   . LEU A 1 222 ? 166.069 206.004 186.246 1.00 177.31 ? 222 LEU A O   1 
ATOM   1630  C  CB  . LEU A 1 222 ? 164.338 208.403 187.648 1.00 174.90 ? 222 LEU A CB  1 
ATOM   1631  C  CG  . LEU A 1 222 ? 164.325 209.755 188.363 1.00 183.59 ? 222 LEU A CG  1 
ATOM   1632  C  CD1 . LEU A 1 222 ? 163.077 209.906 189.212 1.00 181.92 ? 222 LEU A CD1 1 
ATOM   1633  C  CD2 . LEU A 1 222 ? 165.574 209.953 189.212 1.00 190.47 ? 222 LEU A CD2 1 
ATOM   1634  N  N   . PHE A 1 223 ? 164.138 206.453 185.140 1.00 170.91 ? 223 PHE A N   1 
ATOM   1635  C  CA  . PHE A 1 223 ? 163.900 205.108 184.617 1.00 167.47 ? 223 PHE A CA  1 
ATOM   1636  C  C   . PHE A 1 223 ? 164.629 204.869 183.296 1.00 173.22 ? 223 PHE A C   1 
ATOM   1637  O  O   . PHE A 1 223 ? 165.159 203.775 183.095 1.00 171.63 ? 223 PHE A O   1 
ATOM   1638  C  CB  . PHE A 1 223 ? 162.390 204.857 184.441 1.00 165.52 ? 223 PHE A CB  1 
ATOM   1639  C  CG  . PHE A 1 223 ? 161.529 205.353 185.583 1.00 167.12 ? 223 PHE A CG  1 
ATOM   1640  C  CD1 . PHE A 1 223 ? 161.546 204.716 186.818 1.00 169.46 ? 223 PHE A CD1 1 
ATOM   1641  C  CD2 . PHE A 1 223 ? 160.700 206.457 185.421 1.00 170.34 ? 223 PHE A CD2 1 
ATOM   1642  C  CE1 . PHE A 1 223 ? 160.760 205.183 187.875 1.00 170.58 ? 223 PHE A CE1 1 
ATOM   1643  C  CE2 . PHE A 1 223 ? 159.904 206.915 186.476 1.00 173.41 ? 223 PHE A CE2 1 
ATOM   1644  C  CZ  . PHE A 1 223 ? 159.939 206.274 187.694 1.00 170.71 ? 223 PHE A CZ  1 
ATOM   1645  N  N   . ASP A 1 224 ? 164.657 205.880 182.401 1.00 173.11 ? 224 ASP A N   1 
ATOM   1646  C  CA  . ASP A 1 224 ? 165.316 205.779 181.094 1.00 174.62 ? 224 ASP A CA  1 
ATOM   1647  C  C   . ASP A 1 224 ? 166.382 206.860 180.901 1.00 184.40 ? 224 ASP A C   1 
ATOM   1648  O  O   . ASP A 1 224 ? 166.183 208.003 181.317 1.00 186.47 ? 224 ASP A O   1 
ATOM   1649  C  CB  . ASP A 1 224 ? 164.285 205.851 179.962 1.00 174.22 ? 224 ASP A CB  1 
ATOM   1650  C  CG  . ASP A 1 224 ? 163.389 204.634 179.902 1.00 181.61 ? 224 ASP A CG  1 
ATOM   1651  O  OD1 . ASP A 1 224 ? 163.848 203.583 179.400 1.00 181.74 ? 224 ASP A OD1 1 
ATOM   1652  O  OD2 . ASP A 1 224 ? 162.232 204.727 180.369 1.00 185.39 ? 224 ASP A OD2 1 
ATOM   1653  N  N   . LYS A 1 225 ? 167.507 206.493 180.252 1.00 183.26 ? 225 LYS A N   1 
ATOM   1654  C  CA  . LYS A 1 225 ? 168.629 207.397 179.996 1.00 188.29 ? 225 LYS A CA  1 
ATOM   1655  C  C   . LYS A 1 225 ? 168.280 208.407 178.900 1.00 193.60 ? 225 LYS A C   1 
ATOM   1656  O  O   . LYS A 1 225 ? 168.112 208.034 177.736 1.00 191.65 ? 225 LYS A O   1 
ATOM   1657  C  CB  . LYS A 1 225 ? 169.897 206.609 179.631 1.00 192.82 ? 225 LYS A CB  1 
ATOM   1658  N  N   . PHE A 1 226 ? 168.153 209.685 179.294 1.00 193.44 ? 226 PHE A N   1 
ATOM   1659  C  CA  . PHE A 1 226 ? 167.841 210.802 178.403 1.00 195.30 ? 226 PHE A CA  1 
ATOM   1660  C  C   . PHE A 1 226 ? 169.112 211.577 178.068 1.00 205.01 ? 226 PHE A C   1 
ATOM   1661  O  O   . PHE A 1 226 ? 169.811 212.037 178.975 1.00 208.33 ? 226 PHE A O   1 
ATOM   1662  C  CB  . PHE A 1 226 ? 166.792 211.729 179.038 1.00 197.15 ? 226 PHE A CB  1 
ATOM   1663  N  N   . THR A 1 227 ? 169.426 211.693 176.767 1.00 202.48 ? 227 THR A N   1 
ATOM   1664  C  CA  . THR A 1 227 ? 170.604 212.412 176.271 1.00 207.79 ? 227 THR A CA  1 
ATOM   1665  C  C   . THR A 1 227 ? 170.222 213.292 175.076 1.00 213.18 ? 227 THR A C   1 
ATOM   1666  O  O   . THR A 1 227 ? 169.451 212.838 174.226 1.00 209.01 ? 227 THR A O   1 
ATOM   1667  C  CB  . THR A 1 227 ? 171.744 211.447 175.895 1.00 216.02 ? 227 THR A CB  1 
ATOM   1668  O  OG1 . THR A 1 227 ? 171.233 210.376 175.099 1.00 210.94 ? 227 THR A OG1 1 
ATOM   1669  C  CG2 . THR A 1 227 ? 172.492 210.907 177.113 1.00 215.55 ? 227 THR A CG2 1 
ATOM   1670  N  N   . PRO A 1 228 ? 170.743 214.542 174.975 1.00 215.52 ? 228 PRO A N   1 
ATOM   1671  C  CA  . PRO A 1 228 ? 170.395 215.390 173.821 1.00 216.93 ? 228 PRO A CA  1 
ATOM   1672  C  C   . PRO A 1 228 ? 170.985 214.849 172.519 1.00 220.76 ? 228 PRO A C   1 
ATOM   1673  O  O   . PRO A 1 228 ? 172.048 214.224 172.537 1.00 221.64 ? 228 PRO A O   1 
ATOM   1674  C  CB  . PRO A 1 228 ? 170.990 216.760 174.183 1.00 225.13 ? 228 PRO A CB  1 
ATOM   1675  C  CG  . PRO A 1 228 ? 171.329 216.682 175.642 1.00 227.35 ? 228 PRO A CG  1 
ATOM   1676  C  CD  . PRO A 1 228 ? 171.663 215.249 175.887 1.00 222.46 ? 228 PRO A CD  1 
ATOM   1677  N  N   . LEU A 1 229 ? 170.272 215.072 171.398 1.00 216.16 ? 229 LEU A N   1 
ATOM   1678  C  CA  . LEU A 1 229 ? 170.642 214.622 170.055 1.00 216.12 ? 229 LEU A CA  1 
ATOM   1679  C  C   . LEU A 1 229 ? 172.014 215.179 169.637 1.00 227.30 ? 229 LEU A C   1 
ATOM   1680  O  O   . LEU A 1 229 ? 172.229 216.390 169.738 1.00 231.08 ? 229 LEU A O   1 
ATOM   1681  C  CB  . LEU A 1 229 ? 169.564 215.037 169.038 1.00 214.53 ? 229 LEU A CB  1 
ATOM   1682  C  CG  . LEU A 1 229 ? 169.568 214.309 167.697 1.00 217.41 ? 229 LEU A CG  1 
ATOM   1683  C  CD1 . LEU A 1 229 ? 168.739 213.039 167.758 1.00 211.72 ? 229 LEU A CD1 1 
ATOM   1684  C  CD2 . LEU A 1 229 ? 169.028 215.197 166.611 1.00 221.44 ? 229 LEU A CD2 1 
ATOM   1685  N  N   . PRO A 1 230 ? 172.960 214.312 169.198 1.00 225.37 ? 230 PRO A N   1 
ATOM   1686  C  CA  . PRO A 1 230 ? 174.290 214.812 168.801 1.00 229.40 ? 230 PRO A CA  1 
ATOM   1687  C  C   . PRO A 1 230 ? 174.242 215.614 167.502 1.00 234.44 ? 230 PRO A C   1 
ATOM   1688  O  O   . PRO A 1 230 ? 173.401 215.343 166.642 1.00 234.03 ? 230 PRO A O   1 
ATOM   1689  C  CB  . PRO A 1 230 ? 175.124 213.534 168.633 1.00 229.41 ? 230 PRO A CB  1 
ATOM   1690  C  CG  . PRO A 1 230 ? 174.291 212.421 169.213 1.00 229.96 ? 230 PRO A CG  1 
ATOM   1691  C  CD  . PRO A 1 230 ? 172.876 212.848 169.036 1.00 222.70 ? 230 PRO A CD  1 
ATOM   1692  N  N   . GLU A 1 231 ? 175.143 216.608 167.373 1.00 234.38 ? 231 GLU A N   1 
ATOM   1693  C  CA  . GLU A 1 231 ? 175.239 217.490 166.209 1.00 236.64 ? 231 GLU A CA  1 
ATOM   1694  C  C   . GLU A 1 231 ? 175.625 216.705 164.951 1.00 239.44 ? 231 GLU A C   1 
ATOM   1695  O  O   . GLU A 1 231 ? 176.585 215.931 164.970 1.00 238.44 ? 231 GLU A O   1 
ATOM   1696  C  CB  . GLU A 1 231 ? 176.244 218.624 166.466 1.00 239.68 ? 231 GLU A CB  1 
ATOM   1697  N  N   . GLY A 1 232 ? 174.843 216.895 163.892 1.00 238.13 ? 232 GLY A N   1 
ATOM   1698  C  CA  . GLY A 1 232 ? 175.037 216.242 162.602 1.00 238.25 ? 232 GLY A CA  1 
ATOM   1699  C  C   . GLY A 1 232 ? 174.086 216.734 161.529 1.00 242.37 ? 232 GLY A C   1 
ATOM   1700  O  O   . GLY A 1 232 ? 173.537 217.835 161.643 1.00 243.67 ? 232 GLY A O   1 
ATOM   1701  N  N   . LYS A 1 233 ? 173.889 215.917 160.473 1.00 239.42 ? 233 LYS A N   1 
ATOM   1702  C  CA  . LYS A 1 233 ? 172.998 216.220 159.346 1.00 240.15 ? 233 LYS A CA  1 
ATOM   1703  C  C   . LYS A 1 233 ? 171.531 216.211 159.785 1.00 240.13 ? 233 LYS A C   1 
ATOM   1704  O  O   . LYS A 1 233 ? 170.741 217.015 159.288 1.00 240.12 ? 233 LYS A O   1 
ATOM   1705  C  CB  . LYS A 1 233 ? 173.213 215.222 158.199 1.00 240.91 ? 233 LYS A CB  1 
ATOM   1706  N  N   . LEU A 1 234 ? 171.181 215.310 160.724 1.00 231.94 ? 234 LEU A N   1 
ATOM   1707  C  CA  . LEU A 1 234 ? 169.832 215.183 161.271 1.00 227.15 ? 234 LEU A CA  1 
ATOM   1708  C  C   . LEU A 1 234 ? 169.527 216.329 162.235 1.00 232.95 ? 234 LEU A C   1 
ATOM   1709  O  O   . LEU A 1 234 ? 168.434 216.891 162.174 1.00 231.53 ? 234 LEU A O   1 
ATOM   1710  C  CB  . LEU A 1 234 ? 169.663 213.834 161.976 1.00 222.27 ? 234 LEU A CB  1 
ATOM   1711  N  N   . LYS A 1 235 ? 170.497 216.679 163.111 1.00 232.66 ? 235 LYS A N   1 
ATOM   1712  C  CA  . LYS A 1 235 ? 170.375 217.745 164.111 1.00 234.88 ? 235 LYS A CA  1 
ATOM   1713  C  C   . LYS A 1 235 ? 170.237 219.127 163.467 1.00 243.95 ? 235 LYS A C   1 
ATOM   1714  O  O   . LYS A 1 235 ? 169.490 219.959 163.985 1.00 243.85 ? 235 LYS A O   1 
ATOM   1715  C  CB  . LYS A 1 235 ? 171.576 217.733 165.063 1.00 239.32 ? 235 LYS A CB  1 
ATOM   1716  N  N   . GLU A 1 236 ? 170.949 219.367 162.347 1.00 244.00 ? 236 GLU A N   1 
ATOM   1717  C  CA  . GLU A 1 236 ? 170.920 220.638 161.618 1.00 246.88 ? 236 GLU A CA  1 
ATOM   1718  C  C   . GLU A 1 236 ? 169.605 220.813 160.849 1.00 250.44 ? 236 GLU A C   1 
ATOM   1719  O  O   . GLU A 1 236 ? 169.022 221.896 160.900 1.00 251.25 ? 236 GLU A O   1 
ATOM   1720  C  CB  . GLU A 1 236 ? 172.116 220.750 160.660 1.00 249.62 ? 236 GLU A CB  1 
ATOM   1721  N  N   . GLU A 1 237 ? 169.138 219.747 160.155 1.00 245.62 ? 237 GLU A N   1 
ATOM   1722  C  CA  . GLU A 1 237 ? 167.901 219.743 159.366 1.00 243.56 ? 237 GLU A CA  1 
ATOM   1723  C  C   . GLU A 1 237 ? 166.651 219.892 160.248 1.00 244.87 ? 237 GLU A C   1 
ATOM   1724  O  O   . GLU A 1 237 ? 165.651 220.447 159.786 1.00 244.90 ? 237 GLU A O   1 
ATOM   1725  C  CB  . GLU A 1 237 ? 167.802 218.464 158.525 1.00 241.46 ? 237 GLU A CB  1 
ATOM   1726  N  N   . ILE A 1 238 ? 166.713 219.401 161.508 1.00 238.90 ? 238 ILE A N   1 
ATOM   1727  C  CA  . ILE A 1 238 ? 165.624 219.491 162.484 1.00 235.93 ? 238 ILE A CA  1 
ATOM   1728  C  C   . ILE A 1 238 ? 165.443 220.942 162.938 1.00 244.79 ? 238 ILE A C   1 
ATOM   1729  O  O   . ILE A 1 238 ? 164.305 221.386 163.072 1.00 243.71 ? 238 ILE A O   1 
ATOM   1730  C  CB  . ILE A 1 238 ? 165.861 218.552 163.686 1.00 235.15 ? 238 ILE A CB  1 
ATOM   1731  N  N   . GLU A 1 239 ? 166.561 221.680 163.150 1.00 246.15 ? 239 GLU A N   1 
ATOM   1732  C  CA  . GLU A 1 239 ? 166.570 223.094 163.551 1.00 247.24 ? 239 GLU A CA  1 
ATOM   1733  C  C   . GLU A 1 239 ? 166.017 223.980 162.429 1.00 251.63 ? 239 GLU A C   1 
ATOM   1734  O  O   . GLU A 1 239 ? 165.349 224.976 162.715 1.00 251.31 ? 239 GLU A O   1 
ATOM   1735  C  CB  . GLU A 1 239 ? 167.987 223.543 163.934 1.00 249.63 ? 239 GLU A CB  1 
ATOM   1736  N  N   . VAL A 1 240 ? 166.290 223.603 161.159 1.00 250.88 ? 240 VAL A N   1 
ATOM   1737  C  CA  . VAL A 1 240 ? 165.813 224.280 159.945 1.00 252.24 ? 240 VAL A CA  1 
ATOM   1738  C  C   . VAL A 1 240 ? 164.280 224.117 159.874 1.00 252.77 ? 240 VAL A C   1 
ATOM   1739  O  O   . VAL A 1 240 ? 163.571 225.093 159.615 1.00 252.75 ? 240 VAL A O   1 
ATOM   1740  C  CB  . VAL A 1 240 ? 166.540 223.740 158.675 1.00 256.59 ? 240 VAL A CB  1 
ATOM   1741  C  CG1 . VAL A 1 240 ? 165.855 224.194 157.387 1.00 257.10 ? 240 VAL A CG1 1 
ATOM   1742  C  CG2 . VAL A 1 240 ? 168.011 224.149 158.667 1.00 257.60 ? 240 VAL A CG2 1 
ATOM   1743  N  N   . MET A 1 241 ? 163.786 222.891 160.152 1.00 248.34 ? 241 MET A N   1 
ATOM   1744  C  CA  . MET A 1 241 ? 162.364 222.542 160.181 1.00 245.65 ? 241 MET A CA  1 
ATOM   1745  C  C   . MET A 1 241 ? 161.659 223.220 161.371 1.00 247.32 ? 241 MET A C   1 
ATOM   1746  O  O   . MET A 1 241 ? 160.526 223.680 161.214 1.00 246.16 ? 241 MET A O   1 
ATOM   1747  C  CB  . MET A 1 241 ? 162.188 221.017 160.246 1.00 243.69 ? 241 MET A CB  1 
ATOM   1748  N  N   . ALA A 1 242 ? 162.337 223.294 162.545 1.00 245.13 ? 242 ALA A N   1 
ATOM   1749  C  CA  . ALA A 1 242 ? 161.826 223.918 163.776 1.00 244.03 ? 242 ALA A CA  1 
ATOM   1750  C  C   . ALA A 1 242 ? 161.626 225.425 163.600 1.00 248.14 ? 242 ALA A C   1 
ATOM   1751  O  O   . ALA A 1 242 ? 160.630 225.965 164.085 1.00 246.87 ? 242 ALA A O   1 
ATOM   1752  C  CB  . ALA A 1 242 ? 162.770 223.652 164.939 1.00 244.42 ? 242 ALA A CB  1 
ATOM   1753  N  N   . LYS A 1 243 ? 162.566 226.096 162.902 1.00 248.36 ? 243 LYS A N   1 
ATOM   1754  C  CA  . LYS A 1 243 ? 162.511 227.529 162.613 1.00 250.14 ? 243 LYS A CA  1 
ATOM   1755  C  C   . LYS A 1 243 ? 161.426 227.814 161.567 1.00 252.47 ? 243 LYS A C   1 
ATOM   1756  O  O   . LYS A 1 243 ? 160.785 228.864 161.625 1.00 252.65 ? 243 LYS A O   1 
ATOM   1757  C  CB  . LYS A 1 243 ? 163.881 228.031 162.124 1.00 254.62 ? 243 LYS A CB  1 
ATOM   1758  C  CG  . LYS A 1 243 ? 164.070 229.539 162.244 1.00 263.09 ? 243 LYS A CG  1 
ATOM   1759  C  CD  . LYS A 1 243 ? 165.366 229.997 161.596 1.00 266.70 ? 243 LYS A CD  1 
ATOM   1760  N  N   . SER A 1 244 ? 161.221 226.868 160.624 1.00 249.46 ? 244 SER A N   1 
ATOM   1761  C  CA  . SER A 1 244 ? 160.237 226.949 159.541 1.00 248.93 ? 244 SER A CA  1 
ATOM   1762  C  C   . SER A 1 244 ? 158.795 226.915 160.073 1.00 249.12 ? 244 SER A C   1 
ATOM   1763  O  O   . SER A 1 244 ? 157.957 227.682 159.593 1.00 249.40 ? 244 SER A O   1 
ATOM   1764  C  CB  . SER A 1 244 ? 160.450 225.814 158.545 1.00 250.81 ? 244 SER A CB  1 
ATOM   1765  O  OG  . SER A 1 244 ? 159.624 225.958 157.401 1.00 256.92 ? 244 SER A OG  1 
ATOM   1766  N  N   . ILE A 1 245 ? 158.512 226.037 161.059 1.00 244.21 ? 245 ILE A N   1 
ATOM   1767  C  CA  . ILE A 1 245 ? 157.187 225.887 161.668 1.00 241.72 ? 245 ILE A CA  1 
ATOM   1768  C  C   . ILE A 1 245 ? 157.009 226.825 162.879 1.00 244.60 ? 245 ILE A C   1 
ATOM   1769  O  O   . ILE A 1 245 ? 155.934 226.833 163.489 1.00 242.78 ? 245 ILE A O   1 
ATOM   1770  C  CB  . ILE A 1 245 ? 156.961 224.415 162.070 1.00 241.25 ? 245 ILE A CB  1 
ATOM   1771  N  N   . ASP A 1 246 ? 158.058 227.622 163.209 1.00 244.42 ? 246 ASP A N   1 
ATOM   1772  C  CA  . ASP A 1 246 ? 158.136 228.577 164.326 1.00 244.99 ? 246 ASP A CA  1 
ATOM   1773  C  C   . ASP A 1 246 ? 157.968 227.859 165.685 1.00 245.45 ? 246 ASP A C   1 
ATOM   1774  O  O   . ASP A 1 246 ? 157.441 228.441 166.639 1.00 244.79 ? 246 ASP A O   1 
ATOM   1775  C  CB  . ASP A 1 246 ? 157.125 229.733 164.167 1.00 246.95 ? 246 ASP A CB  1 
ATOM   1776  C  CG  . ASP A 1 246 ? 157.427 230.643 162.997 1.00 257.23 ? 246 ASP A CG  1 
ATOM   1777  O  OD1 . ASP A 1 246 ? 158.280 231.544 163.151 1.00 260.03 ? 246 ASP A OD1 1 
ATOM   1778  O  OD2 . ASP A 1 246 ? 156.807 230.459 161.927 1.00 261.24 ? 246 ASP A OD2 1 
ATOM   1779  N  N   . PHE A 1 247 ? 158.446 226.600 165.766 1.00 241.94 ? 247 PHE A N   1 
ATOM   1780  C  CA  . PHE A 1 247 ? 158.393 225.782 166.976 1.00 239.93 ? 247 PHE A CA  1 
ATOM   1781  C  C   . PHE A 1 247 ? 159.500 226.231 167.941 1.00 243.72 ? 247 PHE A C   1 
ATOM   1782  O  O   . PHE A 1 247 ? 160.670 226.226 167.545 1.00 244.97 ? 247 PHE A O   1 
ATOM   1783  C  CB  . PHE A 1 247 ? 158.524 224.288 166.634 1.00 239.63 ? 247 PHE A CB  1 
ATOM   1784  N  N   . PRO A 1 248 ? 159.164 226.656 169.190 1.00 240.75 ? 248 PRO A N   1 
ATOM   1785  C  CA  . PRO A 1 248 ? 160.220 227.107 170.118 1.00 241.41 ? 248 PRO A CA  1 
ATOM   1786  C  C   . PRO A 1 248 ? 161.021 225.926 170.686 1.00 241.77 ? 248 PRO A C   1 
ATOM   1787  O  O   . PRO A 1 248 ? 160.822 225.500 171.829 1.00 239.89 ? 248 PRO A O   1 
ATOM   1788  C  CB  . PRO A 1 248 ? 159.450 227.887 171.191 1.00 242.28 ? 248 PRO A CB  1 
ATOM   1789  C  CG  . PRO A 1 248 ? 158.080 227.328 171.170 1.00 243.38 ? 248 PRO A CG  1 
ATOM   1790  C  CD  . PRO A 1 248 ? 157.823 226.743 169.809 1.00 240.27 ? 248 PRO A CD  1 
ATOM   1791  N  N   . LEU A 1 249 ? 161.940 225.402 169.857 1.00 239.54 ? 249 LEU A N   1 
ATOM   1792  C  CA  . LEU A 1 249 ? 162.794 224.268 170.185 1.00 238.31 ? 249 LEU A CA  1 
ATOM   1793  C  C   . LEU A 1 249 ? 163.937 224.687 171.111 1.00 241.29 ? 249 LEU A C   1 
ATOM   1794  O  O   . LEU A 1 249 ? 164.658 225.646 170.820 1.00 242.99 ? 249 LEU A O   1 
ATOM   1795  C  CB  . LEU A 1 249 ? 163.347 223.625 168.895 1.00 239.08 ? 249 LEU A CB  1 
ATOM   1796  C  CG  . LEU A 1 249 ? 164.299 222.432 169.055 1.00 241.60 ? 249 LEU A CG  1 
ATOM   1797  C  CD1 . LEU A 1 249 ? 163.551 221.169 169.465 1.00 239.38 ? 249 LEU A CD1 1 
ATOM   1798  C  CD2 . LEU A 1 249 ? 165.081 222.191 167.784 1.00 244.68 ? 249 LEU A CD2 1 
ATOM   1799  N  N   . THR A 1 250 ? 164.092 223.950 172.224 1.00 237.03 ? 250 THR A N   1 
ATOM   1800  C  CA  . THR A 1 250 ? 165.157 224.140 173.211 1.00 237.04 ? 250 THR A CA  1 
ATOM   1801  C  C   . THR A 1 250 ? 166.262 223.128 172.880 1.00 238.25 ? 250 THR A C   1 
ATOM   1802  O  O   . THR A 1 250 ? 167.424 223.512 172.734 1.00 239.35 ? 250 THR A O   1 
ATOM   1803  C  CB  . THR A 1 250 ? 164.606 224.006 174.652 1.00 242.14 ? 250 THR A CB  1 
ATOM   1804  O  OG1 . THR A 1 250 ? 163.417 224.789 174.795 1.00 242.28 ? 250 THR A OG1 1 
ATOM   1805  C  CG2 . THR A 1 250 ? 165.622 224.414 175.715 1.00 242.23 ? 250 THR A CG2 1 
ATOM   1806  N  N   . LYS A 1 251 ? 165.878 221.841 172.727 1.00 233.39 ? 251 LYS A N   1 
ATOM   1807  C  CA  . LYS A 1 251 ? 166.761 220.725 172.389 1.00 232.57 ? 251 LYS A CA  1 
ATOM   1808  C  C   . LYS A 1 251 ? 165.957 219.517 171.885 1.00 230.62 ? 251 LYS A C   1 
ATOM   1809  O  O   . LYS A 1 251 ? 164.759 219.411 172.156 1.00 227.17 ? 251 LYS A O   1 
ATOM   1810  C  CB  . LYS A 1 251 ? 167.611 220.317 173.607 1.00 233.44 ? 251 LYS A CB  1 
ATOM   1811  N  N   . VAL A 1 252 ? 166.626 218.614 171.146 1.00 224.45 ? 252 VAL A N   1 
ATOM   1812  C  CA  . VAL A 1 252 ? 166.065 217.354 170.640 1.00 217.96 ? 252 VAL A CA  1 
ATOM   1813  C  C   . VAL A 1 252 ? 166.687 216.236 171.487 1.00 218.28 ? 252 VAL A C   1 
ATOM   1814  O  O   . VAL A 1 252 ? 167.900 216.250 171.699 1.00 221.23 ? 252 VAL A O   1 
ATOM   1815  C  CB  . VAL A 1 252 ? 166.305 217.164 169.116 1.00 221.99 ? 252 VAL A CB  1 
ATOM   1816  C  CG1 . VAL A 1 252 ? 165.835 215.792 168.636 1.00 216.34 ? 252 VAL A CG1 1 
ATOM   1817  C  CG2 . VAL A 1 252 ? 165.627 218.265 168.310 1.00 224.46 ? 252 VAL A CG2 1 
ATOM   1818  N  N   . TYR A 1 253 ? 165.865 215.302 172.003 1.00 208.21 ? 253 TYR A N   1 
ATOM   1819  C  CA  . TYR A 1 253 ? 166.353 214.221 172.861 1.00 204.71 ? 253 TYR A CA  1 
ATOM   1820  C  C   . TYR A 1 253 ? 166.345 212.853 172.171 1.00 202.58 ? 253 TYR A C   1 
ATOM   1821  O  O   . TYR A 1 253 ? 165.412 212.525 171.433 1.00 199.19 ? 253 TYR A O   1 
ATOM   1822  C  CB  . TYR A 1 253 ? 165.529 214.149 174.153 1.00 203.56 ? 253 TYR A CB  1 
ATOM   1823  N  N   . VAL A 1 254 ? 167.398 212.055 172.434 1.00 197.92 ? 254 VAL A N   1 
ATOM   1824  C  CA  . VAL A 1 254 ? 167.547 210.694 171.931 1.00 193.90 ? 254 VAL A CA  1 
ATOM   1825  C  C   . VAL A 1 254 ? 167.489 209.746 173.151 1.00 193.32 ? 254 VAL A C   1 
ATOM   1826  O  O   . VAL A 1 254 ? 168.489 209.546 173.851 1.00 195.09 ? 254 VAL A O   1 
ATOM   1827  C  CB  . VAL A 1 254 ? 168.804 210.497 171.043 1.00 200.81 ? 254 VAL A CB  1 
ATOM   1828  N  N   . VAL A 1 255 ? 166.272 209.231 173.436 1.00 183.93 ? 255 VAL A N   1 
ATOM   1829  C  CA  . VAL A 1 255 ? 165.977 208.344 174.567 1.00 179.99 ? 255 VAL A CA  1 
ATOM   1830  C  C   . VAL A 1 255 ? 166.567 206.958 174.299 1.00 181.41 ? 255 VAL A C   1 
ATOM   1831  O  O   . VAL A 1 255 ? 166.295 206.362 173.254 1.00 179.50 ? 255 VAL A O   1 
ATOM   1832  C  CB  . VAL A 1 255 ? 164.452 208.284 174.867 1.00 180.07 ? 255 VAL A CB  1 
ATOM   1833  C  CG1 . VAL A 1 255 ? 164.116 207.228 175.919 1.00 176.55 ? 255 VAL A CG1 1 
ATOM   1834  C  CG2 . VAL A 1 255 ? 163.931 209.645 175.305 1.00 181.96 ? 255 VAL A CG2 1 
ATOM   1835  N  N   . GLU A 1 256 ? 167.372 206.453 175.257 1.00 178.07 ? 256 GLU A N   1 
ATOM   1836  C  CA  . GLU A 1 256 ? 168.016 205.141 175.189 1.00 176.77 ? 256 GLU A CA  1 
ATOM   1837  C  C   . GLU A 1 256 ? 166.974 204.031 175.425 1.00 174.96 ? 256 GLU A C   1 
ATOM   1838  O  O   . GLU A 1 256 ? 166.922 203.416 176.498 1.00 173.12 ? 256 GLU A O   1 
ATOM   1839  C  CB  . GLU A 1 256 ? 169.181 205.055 176.191 1.00 181.05 ? 256 GLU A CB  1 
ATOM   1840  N  N   . GLY A 1 257 ? 166.145 203.814 174.405 1.00 168.62 ? 257 GLY A N   1 
ATOM   1841  C  CA  . GLY A 1 257 ? 165.085 202.812 174.395 1.00 164.02 ? 257 GLY A CA  1 
ATOM   1842  C  C   . GLY A 1 257 ? 165.566 201.439 173.975 1.00 166.29 ? 257 GLY A C   1 
ATOM   1843  O  O   . GLY A 1 257 ? 164.814 200.468 174.079 1.00 163.12 ? 257 GLY A O   1 
ATOM   1844  N  N   . SER A 1 258 ? 166.829 201.353 173.506 1.00 165.14 ? 258 SER A N   1 
ATOM   1845  C  CA  . SER A 1 258 ? 167.479 200.114 173.078 1.00 165.24 ? 258 SER A CA  1 
ATOM   1846  C  C   . SER A 1 258 ? 167.870 199.246 174.283 1.00 168.50 ? 258 SER A C   1 
ATOM   1847  O  O   . SER A 1 258 ? 168.107 198.050 174.116 1.00 167.95 ? 258 SER A O   1 
ATOM   1848  C  CB  . SER A 1 258 ? 168.707 200.420 172.226 1.00 172.69 ? 258 SER A CB  1 
ATOM   1849  O  OG  . SER A 1 258 ? 169.666 201.170 172.952 1.00 184.65 ? 258 SER A OG  1 
ATOM   1850  N  N   . LYS A 1 259 ? 167.933 199.848 175.492 1.00 164.99 ? 259 LYS A N   1 
ATOM   1851  C  CA  . LYS A 1 259 ? 168.255 199.158 176.746 1.00 164.33 ? 259 LYS A CA  1 
ATOM   1852  C  C   . LYS A 1 259 ? 167.090 198.267 177.197 1.00 163.78 ? 259 LYS A C   1 
ATOM   1853  O  O   . LYS A 1 259 ? 167.305 197.307 177.941 1.00 162.83 ? 259 LYS A O   1 
ATOM   1854  C  CB  . LYS A 1 259 ? 168.598 200.177 177.844 1.00 168.48 ? 259 LYS A CB  1 
ATOM   1855  N  N   . ARG A 1 260 ? 165.864 198.587 176.736 1.00 157.67 ? 260 ARG A N   1 
ATOM   1856  C  CA  . ARG A 1 260 ? 164.638 197.863 177.063 1.00 153.92 ? 260 ARG A CA  1 
ATOM   1857  C  C   . ARG A 1 260 ? 164.175 196.940 175.925 1.00 156.64 ? 260 ARG A C   1 
ATOM   1858  O  O   . ARG A 1 260 ? 164.030 195.738 176.154 1.00 155.27 ? 260 ARG A O   1 
ATOM   1859  C  CB  . ARG A 1 260 ? 163.504 198.838 177.417 1.00 152.47 ? 260 ARG A CB  1 
ATOM   1860  C  CG  . ARG A 1 260 ? 163.645 199.531 178.758 1.00 161.63 ? 260 ARG A CG  1 
ATOM   1861  C  CD  . ARG A 1 260 ? 162.374 200.289 179.069 1.00 167.33 ? 260 ARG A CD  1 
ATOM   1862  N  NE  . ARG A 1 260 ? 162.567 201.263 180.138 1.00 176.52 ? 260 ARG A NE  1 
ATOM   1863  C  CZ  . ARG A 1 260 ? 162.280 201.043 181.415 1.00 191.50 ? 260 ARG A CZ  1 
ATOM   1864  N  NH1 . ARG A 1 260 ? 161.779 199.876 181.799 1.00 175.76 ? 260 ARG A NH1 1 
ATOM   1865  N  NH2 . ARG A 1 260 ? 162.487 201.991 182.318 1.00 183.02 ? 260 ARG A NH2 1 
ATOM   1866  N  N   . SER A 1 261 ? 163.903 197.502 174.719 1.00 153.43 ? 261 SER A N   1 
ATOM   1867  C  CA  . SER A 1 261 ? 163.398 196.735 173.576 1.00 152.42 ? 261 SER A CA  1 
ATOM   1868  C  C   . SER A 1 261 ? 163.785 197.332 172.208 1.00 157.96 ? 261 SER A C   1 
ATOM   1869  O  O   . SER A 1 261 ? 164.216 198.481 172.120 1.00 158.93 ? 261 SER A O   1 
ATOM   1870  C  CB  . SER A 1 261 ? 161.878 196.606 173.657 1.00 153.28 ? 261 SER A CB  1 
ATOM   1871  O  OG  . SER A 1 261 ? 161.246 197.875 173.614 1.00 162.67 ? 261 SER A OG  1 
ATOM   1872  N  N   . SER A 1 262 ? 163.585 196.537 171.139 1.00 154.81 ? 262 SER A N   1 
ATOM   1873  C  CA  . SER A 1 262 ? 163.866 196.888 169.744 1.00 156.86 ? 262 SER A CA  1 
ATOM   1874  C  C   . SER A 1 262 ? 162.739 197.732 169.110 1.00 159.47 ? 262 SER A C   1 
ATOM   1875  O  O   . SER A 1 262 ? 162.846 198.103 167.936 1.00 160.94 ? 262 SER A O   1 
ATOM   1876  C  CB  . SER A 1 262 ? 164.081 195.619 168.922 1.00 162.04 ? 262 SER A CB  1 
ATOM   1877  O  OG  . SER A 1 262 ? 165.109 194.807 169.466 1.00 173.81 ? 262 SER A OG  1 
ATOM   1878  N  N   . HIS A 1 263 ? 161.671 198.034 169.878 1.00 153.34 ? 263 HIS A N   1 
ATOM   1879  C  CA  . HIS A 1 263 ? 160.523 198.820 169.420 1.00 152.46 ? 263 HIS A CA  1 
ATOM   1880  C  C   . HIS A 1 263 ? 160.895 200.295 169.208 1.00 159.05 ? 263 HIS A C   1 
ATOM   1881  O  O   . HIS A 1 263 ? 161.662 200.857 169.996 1.00 159.53 ? 263 HIS A O   1 
ATOM   1882  C  CB  . HIS A 1 263 ? 159.358 198.703 170.409 1.00 150.27 ? 263 HIS A CB  1 
ATOM   1883  C  CG  . HIS A 1 263 ? 158.722 197.349 170.441 1.00 151.75 ? 263 HIS A CG  1 
ATOM   1884  N  ND1 . HIS A 1 263 ? 157.730 196.998 169.543 1.00 153.21 ? 263 HIS A ND1 1 
ATOM   1885  C  CD2 . HIS A 1 263 ? 158.939 196.311 171.279 1.00 152.10 ? 263 HIS A CD2 1 
ATOM   1886  C  CE1 . HIS A 1 263 ? 157.380 195.763 169.860 1.00 151.32 ? 263 HIS A CE1 1 
ATOM   1887  N  NE2 . HIS A 1 263 ? 158.079 195.309 170.899 1.00 150.96 ? 263 HIS A NE2 1 
ATOM   1888  N  N   . SER A 1 264 ? 160.341 200.912 168.138 1.00 156.98 ? 264 SER A N   1 
ATOM   1889  C  CA  . SER A 1 264 ? 160.599 202.302 167.743 1.00 159.23 ? 264 SER A CA  1 
ATOM   1890  C  C   . SER A 1 264 ? 159.337 203.180 167.834 1.00 163.13 ? 264 SER A C   1 
ATOM   1891  O  O   . SER A 1 264 ? 158.251 202.727 167.465 1.00 161.54 ? 264 SER A O   1 
ATOM   1892  C  CB  . SER A 1 264 ? 161.146 202.351 166.318 1.00 165.08 ? 264 SER A CB  1 
ATOM   1893  O  OG  . SER A 1 264 ? 162.157 201.384 166.083 1.00 174.07 ? 264 SER A OG  1 
ATOM   1894  N  N   . ASN A 1 265 ? 159.496 204.441 168.312 1.00 161.49 ? 265 ASN A N   1 
ATOM   1895  C  CA  . ASN A 1 265 ? 158.432 205.454 168.454 1.00 161.80 ? 265 ASN A CA  1 
ATOM   1896  C  C   . ASN A 1 265 ? 159.033 206.872 168.670 1.00 168.80 ? 265 ASN A C   1 
ATOM   1897  O  O   . ASN A 1 265 ? 160.257 207.011 168.709 1.00 170.15 ? 265 ASN A O   1 
ATOM   1898  C  CB  . ASN A 1 265 ? 157.480 205.085 169.609 1.00 161.45 ? 265 ASN A CB  1 
ATOM   1899  C  CG  . ASN A 1 265 ? 156.093 205.675 169.480 1.00 190.15 ? 265 ASN A CG  1 
ATOM   1900  O  OD1 . ASN A 1 265 ? 155.354 205.410 168.522 1.00 184.59 ? 265 ASN A OD1 1 
ATOM   1901  N  ND2 . ASN A 1 265 ? 155.711 206.488 170.452 1.00 183.82 ? 265 ASN A ND2 1 
ATOM   1902  N  N   . ALA A 1 266 ? 158.177 207.919 168.775 1.00 166.68 ? 266 ALA A N   1 
ATOM   1903  C  CA  . ALA A 1 266 ? 158.583 209.314 169.010 1.00 170.10 ? 266 ALA A CA  1 
ATOM   1904  C  C   . ALA A 1 266 ? 157.453 210.131 169.658 1.00 175.86 ? 266 ALA A C   1 
ATOM   1905  O  O   . ALA A 1 266 ? 156.279 209.830 169.443 1.00 173.88 ? 266 ALA A O   1 
ATOM   1906  C  CB  . ALA A 1 266 ? 159.018 209.968 167.707 1.00 173.96 ? 266 ALA A CB  1 
ATOM   1907  N  N   . TYR A 1 267 ? 157.814 211.167 170.446 1.00 176.28 ? 267 TYR A N   1 
ATOM   1908  C  CA  . TYR A 1 267 ? 156.874 212.059 171.145 1.00 177.72 ? 267 TYR A CA  1 
ATOM   1909  C  C   . TYR A 1 267 ? 157.445 213.499 171.281 1.00 187.58 ? 267 TYR A C   1 
ATOM   1910  O  O   . TYR A 1 267 ? 158.557 213.771 170.818 1.00 189.69 ? 267 TYR A O   1 
ATOM   1911  C  CB  . TYR A 1 267 ? 156.530 211.479 172.529 1.00 176.21 ? 267 TYR A CB  1 
ATOM   1912  N  N   . PHE A 1 268 ? 156.674 214.421 171.898 1.00 186.52 ? 268 PHE A N   1 
ATOM   1913  C  CA  . PHE A 1 268 ? 157.088 215.816 172.106 1.00 191.33 ? 268 PHE A CA  1 
ATOM   1914  C  C   . PHE A 1 268 ? 156.491 216.377 173.407 1.00 196.15 ? 268 PHE A C   1 
ATOM   1915  O  O   . PHE A 1 268 ? 155.388 215.980 173.799 1.00 193.37 ? 268 PHE A O   1 
ATOM   1916  C  CB  . PHE A 1 268 ? 156.699 216.690 170.896 1.00 196.35 ? 268 PHE A CB  1 
ATOM   1917  C  CG  . PHE A 1 268 ? 155.221 216.954 170.704 1.00 197.85 ? 268 PHE A CG  1 
ATOM   1918  C  CD1 . PHE A 1 268 ? 154.373 215.958 170.230 1.00 197.19 ? 268 PHE A CD1 1 
ATOM   1919  C  CD2 . PHE A 1 268 ? 154.686 218.214 170.950 1.00 203.97 ? 268 PHE A CD2 1 
ATOM   1920  C  CE1 . PHE A 1 268 ? 153.013 216.206 170.049 1.00 198.40 ? 268 PHE A CE1 1 
ATOM   1921  C  CE2 . PHE A 1 268 ? 153.326 218.463 170.761 1.00 207.04 ? 268 PHE A CE2 1 
ATOM   1922  C  CZ  . PHE A 1 268 ? 152.500 217.457 170.316 1.00 201.48 ? 268 PHE A CZ  1 
ATOM   1923  N  N   . TYR A 1 269 ? 157.223 217.296 174.072 1.00 196.50 ? 269 TYR A N   1 
ATOM   1924  C  CA  . TYR A 1 269 ? 156.779 217.913 175.325 1.00 198.19 ? 269 TYR A CA  1 
ATOM   1925  C  C   . TYR A 1 269 ? 157.232 219.387 175.435 1.00 207.72 ? 269 TYR A C   1 
ATOM   1926  O  O   . TYR A 1 269 ? 158.054 219.842 174.640 1.00 209.94 ? 269 TYR A O   1 
ATOM   1927  C  CB  . TYR A 1 269 ? 157.276 217.090 176.536 1.00 197.12 ? 269 TYR A CB  1 
ATOM   1928  C  CG  . TYR A 1 269 ? 158.738 217.271 176.890 1.00 201.68 ? 269 TYR A CG  1 
ATOM   1929  C  CD1 . TYR A 1 269 ? 159.728 216.531 176.251 1.00 202.31 ? 269 TYR A CD1 1 
ATOM   1930  C  CD2 . TYR A 1 269 ? 159.127 218.137 177.910 1.00 206.52 ? 269 TYR A CD2 1 
ATOM   1931  C  CE1 . TYR A 1 269 ? 161.072 216.669 176.595 1.00 205.75 ? 269 TYR A CE1 1 
ATOM   1932  C  CE2 . TYR A 1 269 ? 160.468 218.290 178.257 1.00 210.15 ? 269 TYR A CE2 1 
ATOM   1933  C  CZ  . TYR A 1 269 ? 161.438 217.549 177.600 1.00 216.62 ? 269 TYR A CZ  1 
ATOM   1934  O  OH  . TYR A 1 269 ? 162.762 217.693 177.935 1.00 221.24 ? 269 TYR A OH  1 
ATOM   1935  N  N   . GLY A 1 270 ? 156.695 220.094 176.431 1.00 206.33 ? 270 GLY A N   1 
ATOM   1936  C  CA  . GLY A 1 270 ? 157.025 221.487 176.708 1.00 212.27 ? 270 GLY A CA  1 
ATOM   1937  C  C   . GLY A 1 270 ? 156.022 222.221 177.576 1.00 218.46 ? 270 GLY A C   1 
ATOM   1938  O  O   . GLY A 1 270 ? 155.130 221.604 178.174 1.00 214.58 ? 270 GLY A O   1 
ATOM   1939  N  N   . PHE A 1 271 ? 156.177 223.558 177.651 1.00 218.41 ? 271 PHE A N   1 
ATOM   1940  C  CA  . PHE A 1 271 ? 155.312 224.448 178.429 1.00 233.21 ? 271 PHE A CA  1 
ATOM   1941  C  C   . PHE A 1 271 ? 154.872 225.641 177.586 1.00 240.19 ? 271 PHE A C   1 
ATOM   1942  O  O   . PHE A 1 271 ? 153.928 225.531 176.806 1.00 209.76 ? 271 PHE A O   1 
ATOM   1943  C  CB  . PHE A 1 271 ? 156.032 224.928 179.696 1.00 235.07 ? 271 PHE A CB  1 
ATOM   1944  N  N   . LYS A 1 275 ? 159.982 224.093 175.010 1.00 235.64 ? 275 LYS A N   1 
ATOM   1945  C  CA  . LYS A 1 275 ? 159.530 222.908 174.281 1.00 234.11 ? 275 LYS A CA  1 
ATOM   1946  C  C   . LYS A 1 275 ? 160.719 222.071 173.787 1.00 236.49 ? 275 LYS A C   1 
ATOM   1947  O  O   . LYS A 1 275 ? 161.710 222.630 173.309 1.00 237.98 ? 275 LYS A O   1 
ATOM   1948  C  CB  . LYS A 1 275 ? 158.625 223.301 173.100 1.00 236.25 ? 275 LYS A CB  1 
ATOM   1949  C  CG  . LYS A 1 275 ? 157.197 223.662 173.494 1.00 245.16 ? 275 LYS A CG  1 
ATOM   1950  C  CD  . LYS A 1 275 ? 156.219 222.534 173.185 1.00 249.61 ? 275 LYS A CD  1 
ATOM   1951  N  N   . ARG A 1 276 ? 160.616 220.731 173.912 1.00 230.72 ? 276 ARG A N   1 
ATOM   1952  C  CA  . ARG A 1 276 ? 161.663 219.782 173.509 1.00 227.92 ? 276 ARG A CA  1 
ATOM   1953  C  C   . ARG A 1 276 ? 161.075 218.516 172.851 1.00 224.45 ? 276 ARG A C   1 
ATOM   1954  O  O   . ARG A 1 276 ? 160.048 217.996 173.300 1.00 220.34 ? 276 ARG A O   1 
ATOM   1955  C  CB  . ARG A 1 276 ? 162.531 219.387 174.717 1.00 228.57 ? 276 ARG A CB  1 
ATOM   1956  C  CG  . ARG A 1 276 ? 163.540 220.449 175.158 1.00 239.97 ? 276 ARG A CG  1 
ATOM   1957  C  CD  . ARG A 1 276 ? 163.407 220.799 176.632 1.00 245.39 ? 276 ARG A CD  1 
ATOM   1958  N  NE  . ARG A 1 276 ? 162.233 221.635 176.904 1.00 250.05 ? 276 ARG A NE  1 
ATOM   1959  C  CZ  . ARG A 1 276 ? 161.775 221.920 178.120 1.00 258.01 ? 276 ARG A CZ  1 
ATOM   1960  N  NH1 . ARG A 1 276 ? 162.383 221.435 179.197 1.00 248.33 ? 276 ARG A NH1 1 
ATOM   1961  N  NH2 . ARG A 1 276 ? 160.702 222.685 178.269 1.00 249.08 ? 276 ARG A NH2 1 
ATOM   1962  N  N   . ILE A 1 277 ? 161.757 218.018 171.798 1.00 219.09 ? 277 ILE A N   1 
ATOM   1963  C  CA  . ILE A 1 277 ? 161.381 216.826 171.023 1.00 213.46 ? 277 ILE A CA  1 
ATOM   1964  C  C   . ILE A 1 277 ? 161.985 215.552 171.659 1.00 211.37 ? 277 ILE A C   1 
ATOM   1965  O  O   . ILE A 1 277 ? 163.095 215.604 172.193 1.00 213.42 ? 277 ILE A O   1 
ATOM   1966  C  CB  . ILE A 1 277 ? 161.835 217.022 169.546 1.00 218.56 ? 277 ILE A CB  1 
ATOM   1967  C  CG1 . ILE A 1 277 ? 160.850 217.940 168.790 1.00 221.03 ? 277 ILE A CG1 1 
ATOM   1968  C  CG2 . ILE A 1 277 ? 162.037 215.695 168.803 1.00 215.68 ? 277 ILE A CG2 1 
ATOM   1969  C  CD1 . ILE A 1 277 ? 161.437 218.698 167.586 1.00 232.88 ? 277 ILE A CD1 1 
ATOM   1970  N  N   . VAL A 1 278 ? 161.254 214.412 171.582 1.00 200.33 ? 278 VAL A N   1 
ATOM   1971  C  CA  . VAL A 1 278 ? 161.690 213.115 172.116 1.00 195.40 ? 278 VAL A CA  1 
ATOM   1972  C  C   . VAL A 1 278 ? 161.631 212.043 171.000 1.00 193.87 ? 278 VAL A C   1 
ATOM   1973  O  O   . VAL A 1 278 ? 160.559 211.755 170.465 1.00 191.27 ? 278 VAL A O   1 
ATOM   1974  C  CB  . VAL A 1 278 ? 160.865 212.715 173.374 1.00 196.30 ? 278 VAL A CB  1 
ATOM   1975  C  CG1 . VAL A 1 278 ? 161.002 211.231 173.706 1.00 192.04 ? 278 VAL A CG1 1 
ATOM   1976  C  CG2 . VAL A 1 278 ? 161.255 213.567 174.576 1.00 199.03 ? 278 VAL A CG2 1 
ATOM   1977  N  N   . LEU A 1 279 ? 162.792 211.456 170.665 1.00 188.95 ? 279 LEU A N   1 
ATOM   1978  C  CA  . LEU A 1 279 ? 162.907 210.418 169.637 1.00 185.94 ? 279 LEU A CA  1 
ATOM   1979  C  C   . LEU A 1 279 ? 163.720 209.227 170.148 1.00 186.04 ? 279 LEU A C   1 
ATOM   1980  O  O   . LEU A 1 279 ? 164.753 209.424 170.787 1.00 188.04 ? 279 LEU A O   1 
ATOM   1981  C  CB  . LEU A 1 279 ? 163.550 210.993 168.369 1.00 189.38 ? 279 LEU A CB  1 
ATOM   1982  N  N   . PHE A 1 280 ? 163.244 207.996 169.873 1.00 177.14 ? 280 PHE A N   1 
ATOM   1983  C  CA  . PHE A 1 280 ? 163.894 206.739 170.269 1.00 174.50 ? 280 PHE A CA  1 
ATOM   1984  C  C   . PHE A 1 280 ? 165.202 206.531 169.522 1.00 180.43 ? 280 PHE A C   1 
ATOM   1985  O  O   . PHE A 1 280 ? 165.292 206.900 168.350 1.00 182.24 ? 280 PHE A O   1 
ATOM   1986  C  CB  . PHE A 1 280 ? 162.965 205.551 169.979 1.00 172.31 ? 280 PHE A CB  1 
ATOM   1987  C  CG  . PHE A 1 280 ? 162.038 205.127 171.091 1.00 170.34 ? 280 PHE A CG  1 
ATOM   1988  C  CD1 . PHE A 1 280 ? 161.068 205.993 171.580 1.00 172.79 ? 280 PHE A CD1 1 
ATOM   1989  C  CD2 . PHE A 1 280 ? 162.085 203.836 171.601 1.00 169.96 ? 280 PHE A CD2 1 
ATOM   1990  C  CE1 . PHE A 1 280 ? 160.190 205.589 172.586 1.00 170.93 ? 280 PHE A CE1 1 
ATOM   1991  C  CE2 . PHE A 1 280 ? 161.209 203.433 172.609 1.00 170.00 ? 280 PHE A CE2 1 
ATOM   1992  C  CZ  . PHE A 1 280 ? 160.265 204.312 173.093 1.00 167.69 ? 280 PHE A CZ  1 
ATOM   1993  N  N   . ASP A 1 281 ? 166.201 205.905 170.174 1.00 176.52 ? 281 ASP A N   1 
ATOM   1994  C  CA  . ASP A 1 281 ? 167.486 205.611 169.538 1.00 179.00 ? 281 ASP A CA  1 
ATOM   1995  C  C   . ASP A 1 281 ? 167.334 204.453 168.538 1.00 180.85 ? 281 ASP A C   1 
ATOM   1996  O  O   . ASP A 1 281 ? 168.148 204.326 167.623 1.00 183.13 ? 281 ASP A O   1 
ATOM   1997  C  CB  . ASP A 1 281 ? 168.578 205.311 170.582 1.00 182.49 ? 281 ASP A CB  1 
ATOM   1998  C  CG  . ASP A 1 281 ? 168.323 204.148 171.527 1.00 190.86 ? 281 ASP A CG  1 
ATOM   1999  O  OD1 . ASP A 1 281 ? 167.163 203.685 171.607 1.00 188.05 ? 281 ASP A OD1 1 
ATOM   2000  O  OD2 . ASP A 1 281 ? 169.273 203.732 172.220 1.00 198.74 ? 281 ASP A OD2 1 
ATOM   2001  N  N   . THR A 1 282 ? 166.272 203.636 168.704 1.00 173.18 ? 282 THR A N   1 
ATOM   2002  C  CA  . THR A 1 282 ? 165.926 202.513 167.827 1.00 171.58 ? 282 THR A CA  1 
ATOM   2003  C  C   . THR A 1 282 ? 165.336 203.029 166.505 1.00 176.00 ? 282 THR A C   1 
ATOM   2004  O  O   . THR A 1 282 ? 165.460 202.358 165.479 1.00 176.76 ? 282 THR A O   1 
ATOM   2005  C  CB  . THR A 1 282 ? 164.950 201.552 168.524 1.00 176.64 ? 282 THR A CB  1 
ATOM   2006  O  OG1 . THR A 1 282 ? 163.872 202.297 169.095 1.00 174.76 ? 282 THR A OG1 1 
ATOM   2007  C  CG2 . THR A 1 282 ? 165.624 200.699 169.591 1.00 175.59 ? 282 THR A CG2 1 
ATOM   2008  N  N   . LEU A 1 283 ? 164.695 204.215 166.539 1.00 171.89 ? 283 LEU A N   1 
ATOM   2009  C  CA  . LEU A 1 283 ? 164.090 204.879 165.379 1.00 172.34 ? 283 LEU A CA  1 
ATOM   2010  C  C   . LEU A 1 283 ? 165.162 205.572 164.527 1.00 179.62 ? 283 LEU A C   1 
ATOM   2011  O  O   . LEU A 1 283 ? 165.020 205.631 163.307 1.00 180.68 ? 283 LEU A O   1 
ATOM   2012  C  CB  . LEU A 1 283 ? 163.045 205.909 165.863 1.00 171.42 ? 283 LEU A CB  1 
ATOM   2013  C  CG  . LEU A 1 283 ? 162.133 206.570 164.819 1.00 176.75 ? 283 LEU A CG  1 
ATOM   2014  C  CD1 . LEU A 1 283 ? 160.729 206.724 165.350 1.00 174.45 ? 283 LEU A CD1 1 
ATOM   2015  C  CD2 . LEU A 1 283 ? 162.643 207.944 164.434 1.00 182.79 ? 283 LEU A CD2 1 
ATOM   2016  N  N   . LEU A 1 284 ? 166.212 206.113 165.172 1.00 177.96 ? 284 LEU A N   1 
ATOM   2017  C  CA  . LEU A 1 284 ? 167.294 206.859 164.523 1.00 182.11 ? 284 LEU A CA  1 
ATOM   2018  C  C   . LEU A 1 284 ? 168.380 205.964 163.904 1.00 187.85 ? 284 LEU A C   1 
ATOM   2019  O  O   . LEU A 1 284 ? 168.917 206.319 162.850 1.00 190.56 ? 284 LEU A O   1 
ATOM   2020  C  CB  . LEU A 1 284 ? 167.941 207.823 165.529 1.00 184.33 ? 284 LEU A CB  1 
ATOM   2021  C  CG  . LEU A 1 284 ? 167.102 209.037 165.933 1.00 188.93 ? 284 LEU A CG  1 
ATOM   2022  C  CD1 . LEU A 1 284 ? 167.377 209.437 167.369 1.00 189.23 ? 284 LEU A CD1 1 
ATOM   2023  C  CD2 . LEU A 1 284 ? 167.333 210.210 164.990 1.00 195.54 ? 284 LEU A CD2 1 
ATOM   2024  N  N   . GLU A 1 285 ? 168.721 204.832 164.562 1.00 182.81 ? 285 GLU A N   1 
ATOM   2025  C  CA  . GLU A 1 285 ? 169.762 203.896 164.114 1.00 212.75 ? 285 GLU A CA  1 
ATOM   2026  C  C   . GLU A 1 285 ? 169.406 203.246 162.771 1.00 235.92 ? 285 GLU A C   1 
ATOM   2027  O  O   . GLU A 1 285 ? 169.941 203.643 161.735 1.00 196.16 ? 285 GLU A O   1 
ATOM   2028  C  CB  . GLU A 1 285 ? 170.024 202.813 165.178 1.00 212.19 ? 285 GLU A CB  1 
ATOM   2029  C  CG  . GLU A 1 285 ? 171.024 203.241 166.242 1.00 223.34 ? 285 GLU A CG  1 
ATOM   2030  C  CD  . GLU A 1 285 ? 171.282 202.240 167.354 1.00 237.81 ? 285 GLU A CD  1 
ATOM   2031  O  OE1 . GLU A 1 285 ? 171.765 201.125 167.053 1.00 230.77 ? 285 GLU A OE1 1 
ATOM   2032  O  OE2 . GLU A 1 285 ? 171.053 202.592 168.533 1.00 228.04 ? 285 GLU A OE2 1 
ATOM   2033  N  N   . GLN A 1 322 ? 167.293 198.507 160.568 1.00 186.68 ? 322 GLN A N   1 
ATOM   2034  C  CA  . GLN A 1 322 ? 167.716 198.929 161.902 1.00 185.30 ? 322 GLN A CA  1 
ATOM   2035  C  C   . GLN A 1 322 ? 166.720 199.927 162.513 1.00 186.07 ? 322 GLN A C   1 
ATOM   2036  O  O   . GLN A 1 322 ? 166.284 199.735 163.652 1.00 182.91 ? 322 GLN A O   1 
ATOM   2037  C  CB  . GLN A 1 322 ? 169.129 199.536 161.855 1.00 190.53 ? 322 GLN A CB  1 
ATOM   2038  N  N   . GLY A 1 323 ? 166.377 200.966 161.751 1.00 183.31 ? 323 GLY A N   1 
ATOM   2039  C  CA  . GLY A 1 323 ? 165.445 202.011 162.155 1.00 181.19 ? 323 GLY A CA  1 
ATOM   2040  C  C   . GLY A 1 323 ? 164.895 202.775 160.969 1.00 186.18 ? 323 GLY A C   1 
ATOM   2041  O  O   . GLY A 1 323 ? 164.319 202.172 160.061 1.00 185.91 ? 323 GLY A O   1 
ATOM   2042  N  N   . CYS A 1 324 ? 165.087 204.109 160.965 1.00 183.66 ? 324 CYS A N   1 
ATOM   2043  C  CA  . CYS A 1 324 ? 164.638 205.015 159.900 1.00 184.71 ? 324 CYS A CA  1 
ATOM   2044  C  C   . CYS A 1 324 ? 165.764 205.965 159.490 1.00 191.40 ? 324 CYS A C   1 
ATOM   2045  O  O   . CYS A 1 324 ? 166.529 206.421 160.345 1.00 191.90 ? 324 CYS A O   1 
ATOM   2046  C  CB  . CYS A 1 324 ? 163.397 205.795 160.330 1.00 182.92 ? 324 CYS A CB  1 
ATOM   2047  S  SG  . CYS A 1 324 ? 161.833 204.929 160.046 1.00 183.56 ? 324 CYS A SG  1 
ATOM   2048  N  N   . LYS A 1 325 ? 165.839 206.283 158.180 1.00 189.64 ? 325 LYS A N   1 
ATOM   2049  C  CA  . LYS A 1 325 ? 166.815 207.220 157.612 1.00 193.16 ? 325 LYS A CA  1 
ATOM   2050  C  C   . LYS A 1 325 ? 166.465 208.648 158.043 1.00 196.47 ? 325 LYS A C   1 
ATOM   2051  O  O   . LYS A 1 325 ? 165.305 208.913 158.368 1.00 193.92 ? 325 LYS A O   1 
ATOM   2052  C  CB  . LYS A 1 325 ? 166.850 207.105 156.079 1.00 198.21 ? 325 LYS A CB  1 
ATOM   2053  N  N   . ASN A 1 326 ? 167.457 209.562 158.048 1.00 195.37 ? 326 ASN A N   1 
ATOM   2054  C  CA  . ASN A 1 326 ? 167.295 210.963 158.462 1.00 196.33 ? 326 ASN A CA  1 
ATOM   2055  C  C   . ASN A 1 326 ? 166.124 211.668 157.750 1.00 198.63 ? 326 ASN A C   1 
ATOM   2056  O  O   . ASN A 1 326 ? 165.429 212.461 158.388 1.00 197.37 ? 326 ASN A O   1 
ATOM   2057  C  CB  . ASN A 1 326 ? 168.592 211.745 158.254 1.00 202.74 ? 326 ASN A CB  1 
ATOM   2058  C  CG  . ASN A 1 326 ? 169.709 211.382 159.215 1.00 226.08 ? 326 ASN A CG  1 
ATOM   2059  O  OD1 . ASN A 1 326 ? 169.490 210.891 160.330 1.00 216.66 ? 326 ASN A OD1 1 
ATOM   2060  N  ND2 . ASN A 1 326 ? 170.943 211.652 158.814 1.00 222.34 ? 326 ASN A ND2 1 
ATOM   2061  N  N   . GLU A 1 327 ? 165.883 211.342 156.459 1.00 195.13 ? 327 GLU A N   1 
ATOM   2062  C  CA  . GLU A 1 327 ? 164.782 211.888 155.655 1.00 194.95 ? 327 GLU A CA  1 
ATOM   2063  C  C   . GLU A 1 327 ? 163.416 211.412 156.190 1.00 193.12 ? 327 GLU A C   1 
ATOM   2064  O  O   . GLU A 1 327 ? 162.455 212.187 156.199 1.00 192.95 ? 327 GLU A O   1 
ATOM   2065  C  CB  . GLU A 1 327 ? 164.946 211.494 154.179 1.00 198.52 ? 327 GLU A CB  1 
ATOM   2066  N  N   . GLU A 1 328 ? 163.345 210.144 156.646 1.00 184.70 ? 328 GLU A N   1 
ATOM   2067  C  CA  . GLU A 1 328 ? 162.137 209.532 157.205 1.00 179.70 ? 328 GLU A CA  1 
ATOM   2068  C  C   . GLU A 1 328 ? 161.865 210.052 158.614 1.00 179.94 ? 328 GLU A C   1 
ATOM   2069  O  O   . GLU A 1 328 ? 160.702 210.237 158.971 1.00 177.84 ? 328 GLU A O   1 
ATOM   2070  C  CB  . GLU A 1 328 ? 162.256 207.999 157.218 1.00 178.51 ? 328 GLU A CB  1 
ATOM   2071  C  CG  . GLU A 1 328 ? 162.050 207.362 155.857 1.00 190.49 ? 328 GLU A CG  1 
ATOM   2072  C  CD  . GLU A 1 328 ? 162.511 205.922 155.762 1.00 210.58 ? 328 GLU A CD  1 
ATOM   2073  O  OE1 . GLU A 1 328 ? 163.731 205.700 155.588 1.00 208.42 ? 328 GLU A OE1 1 
ATOM   2074  O  OE2 . GLU A 1 328 ? 161.650 205.017 155.843 1.00 202.50 ? 328 GLU A OE2 1 
ATOM   2075  N  N   . VAL A 1 329 ? 162.936 210.287 159.407 1.00 175.90 ? 329 VAL A N   1 
ATOM   2076  C  CA  . VAL A 1 329 ? 162.880 210.793 160.787 1.00 173.96 ? 329 VAL A CA  1 
ATOM   2077  C  C   . VAL A 1 329 ? 162.244 212.199 160.791 1.00 178.60 ? 329 VAL A C   1 
ATOM   2078  O  O   . VAL A 1 329 ? 161.348 212.455 161.597 1.00 175.98 ? 329 VAL A O   1 
ATOM   2079  C  CB  . VAL A 1 329 ? 164.284 210.772 161.468 1.00 179.18 ? 329 VAL A CB  1 
ATOM   2080  C  CG1 . VAL A 1 329 ? 164.281 211.510 162.806 1.00 178.92 ? 329 VAL A CG1 1 
ATOM   2081  C  CG2 . VAL A 1 329 ? 164.790 209.342 161.655 1.00 176.65 ? 329 VAL A CG2 1 
ATOM   2082  N  N   . LEU A 1 330 ? 162.677 213.076 159.863 1.00 178.83 ? 330 LEU A N   1 
ATOM   2083  C  CA  . LEU A 1 330 ? 162.166 214.443 159.712 1.00 181.52 ? 330 LEU A CA  1 
ATOM   2084  C  C   . LEU A 1 330 ? 160.669 214.452 159.363 1.00 182.94 ? 330 LEU A C   1 
ATOM   2085  O  O   . LEU A 1 330 ? 159.936 215.321 159.843 1.00 183.51 ? 330 LEU A O   1 
ATOM   2086  C  CB  . LEU A 1 330 ? 162.966 215.203 158.644 1.00 186.54 ? 330 LEU A CB  1 
ATOM   2087  C  CG  . LEU A 1 330 ? 164.387 215.635 159.036 1.00 194.52 ? 330 LEU A CG  1 
ATOM   2088  C  CD1 . LEU A 1 330 ? 165.258 215.792 157.813 1.00 198.57 ? 330 LEU A CD1 1 
ATOM   2089  C  CD2 . LEU A 1 330 ? 164.381 216.927 159.851 1.00 200.14 ? 330 LEU A CD2 1 
ATOM   2090  N  N   . ALA A 1 331 ? 160.222 213.471 158.552 1.00 176.65 ? 331 ALA A N   1 
ATOM   2091  C  CA  . ALA A 1 331 ? 158.822 213.298 158.160 1.00 174.76 ? 331 ALA A CA  1 
ATOM   2092  C  C   . ALA A 1 331 ? 157.973 212.875 159.364 1.00 174.31 ? 331 ALA A C   1 
ATOM   2093  O  O   . ALA A 1 331 ? 156.836 213.333 159.503 1.00 174.18 ? 331 ALA A O   1 
ATOM   2094  C  CB  . ALA A 1 331 ? 158.718 212.265 157.056 1.00 174.79 ? 331 ALA A CB  1 
ATOM   2095  N  N   . VAL A 1 332 ? 158.546 212.015 160.243 1.00 167.06 ? 332 VAL A N   1 
ATOM   2096  C  CA  . VAL A 1 332 ? 157.930 211.527 161.482 1.00 162.86 ? 332 VAL A CA  1 
ATOM   2097  C  C   . VAL A 1 332 ? 157.805 212.722 162.442 1.00 167.38 ? 332 VAL A C   1 
ATOM   2098  O  O   . VAL A 1 332 ? 156.791 212.844 163.132 1.00 165.32 ? 332 VAL A O   1 
ATOM   2099  C  CB  . VAL A 1 332 ? 158.731 210.328 162.079 1.00 163.89 ? 332 VAL A CB  1 
ATOM   2100  C  CG1 . VAL A 1 332 ? 158.382 210.063 163.542 1.00 160.72 ? 332 VAL A CG1 1 
ATOM   2101  C  CG2 . VAL A 1 332 ? 158.521 209.065 161.251 1.00 162.16 ? 332 VAL A CG2 1 
ATOM   2102  N  N   . LEU A 1 333 ? 158.810 213.630 162.431 1.00 167.11 ? 333 LEU A N   1 
ATOM   2103  C  CA  . LEU A 1 333 ? 158.816 214.853 163.239 1.00 169.37 ? 333 LEU A CA  1 
ATOM   2104  C  C   . LEU A 1 333 ? 157.723 215.805 162.770 1.00 175.96 ? 333 LEU A C   1 
ATOM   2105  O  O   . LEU A 1 333 ? 156.988 216.332 163.605 1.00 175.47 ? 333 LEU A O   1 
ATOM   2106  C  CB  . LEU A 1 333 ? 160.185 215.554 163.201 1.00 173.03 ? 333 LEU A CB  1 
ATOM   2107  C  CG  . LEU A 1 333 ? 161.326 214.860 163.933 1.00 176.54 ? 333 LEU A CG  1 
ATOM   2108  C  CD1 . LEU A 1 333 ? 162.657 215.429 163.519 1.00 180.81 ? 333 LEU A CD1 1 
ATOM   2109  C  CD2 . LEU A 1 333 ? 161.157 214.945 165.437 1.00 177.83 ? 333 LEU A CD2 1 
ATOM   2110  N  N   . GLY A 1 334 ? 157.591 215.955 161.447 1.00 174.88 ? 334 GLY A N   1 
ATOM   2111  C  CA  . GLY A 1 334 ? 156.577 216.784 160.799 1.00 177.34 ? 334 GLY A CA  1 
ATOM   2112  C  C   . GLY A 1 334 ? 155.157 216.413 161.185 1.00 178.72 ? 334 GLY A C   1 
ATOM   2113  O  O   . GLY A 1 334 ? 154.285 217.282 161.266 1.00 180.49 ? 334 GLY A O   1 
ATOM   2114  N  N   . HIS A 1 335 ? 154.928 215.109 161.444 1.00 170.95 ? 335 HIS A N   1 
ATOM   2115  C  CA  . HIS A 1 335 ? 153.658 214.545 161.900 1.00 167.99 ? 335 HIS A CA  1 
ATOM   2116  C  C   . HIS A 1 335 ? 153.423 214.974 163.353 1.00 170.59 ? 335 HIS A C   1 
ATOM   2117  O  O   . HIS A 1 335 ? 152.361 215.514 163.661 1.00 171.35 ? 335 HIS A O   1 
ATOM   2118  C  CB  . HIS A 1 335 ? 153.679 213.006 161.749 1.00 164.92 ? 335 HIS A CB  1 
ATOM   2119  C  CG  . HIS A 1 335 ? 152.606 212.277 162.504 1.00 165.26 ? 335 HIS A CG  1 
ATOM   2120  N  ND1 . HIS A 1 335 ? 151.373 212.013 161.934 1.00 167.23 ? 335 HIS A ND1 1 
ATOM   2121  C  CD2 . HIS A 1 335 ? 152.633 211.746 163.751 1.00 164.06 ? 335 HIS A CD2 1 
ATOM   2122  C  CE1 . HIS A 1 335 ? 150.689 211.346 162.851 1.00 163.83 ? 335 HIS A CE1 1 
ATOM   2123  N  NE2 . HIS A 1 335 ? 151.399 211.177 163.968 1.00 162.12 ? 335 HIS A NE2 1 
ATOM   2124  N  N   . ALA A 1 336 ? 154.434 214.751 164.229 1.00 165.32 ? 336 ALA A N   1 
ATOM   2125  C  CA  . ALA A 1 336 ? 154.416 215.086 165.658 1.00 164.36 ? 336 ALA A CA  1 
ATOM   2126  C  C   . ALA A 1 336 ? 154.280 216.593 165.882 1.00 171.55 ? 336 ALA A C   1 
ATOM   2127  O  O   . ALA A 1 336 ? 153.575 217.006 166.806 1.00 171.48 ? 336 ALA A O   1 
ATOM   2128  C  CB  . ALA A 1 336 ? 155.676 214.569 166.332 1.00 163.63 ? 336 ALA A CB  1 
ATOM   2129  N  N   . LEU A 1 337 ? 154.924 217.410 165.016 1.00 170.89 ? 337 LEU A N   1 
ATOM   2130  C  CA  . LEU A 1 337 ? 154.850 218.873 165.054 1.00 175.17 ? 337 LEU A CA  1 
ATOM   2131  C  C   . LEU A 1 337 ? 153.440 219.336 164.679 1.00 180.12 ? 337 LEU A C   1 
ATOM   2132  O  O   . LEU A 1 337 ? 153.034 220.437 165.050 1.00 182.96 ? 337 LEU A O   1 
ATOM   2133  C  CB  . LEU A 1 337 ? 155.895 219.508 164.118 1.00 178.78 ? 337 LEU A CB  1 
ATOM   2134  C  CG  . LEU A 1 337 ? 157.354 219.455 164.583 1.00 183.66 ? 337 LEU A CG  1 
ATOM   2135  C  CD1 . LEU A 1 337 ? 158.304 219.468 163.404 1.00 185.66 ? 337 LEU A CD1 1 
ATOM   2136  C  CD2 . LEU A 1 337 ? 157.676 220.587 165.546 1.00 189.81 ? 337 LEU A CD2 1 
ATOM   2137  N  N   . GLY A 1 338 ? 152.716 218.472 163.965 1.00 174.57 ? 338 GLY A N   1 
ATOM   2138  C  CA  . GLY A 1 338 ? 151.339 218.688 163.541 1.00 175.87 ? 338 GLY A CA  1 
ATOM   2139  C  C   . GLY A 1 338 ? 150.369 218.788 164.698 1.00 179.77 ? 338 GLY A C   1 
ATOM   2140  O  O   . GLY A 1 338 ? 149.484 219.644 164.675 1.00 182.88 ? 338 GLY A O   1 
ATOM   2141  N  N   . HIS A 1 339 ? 150.551 217.937 165.736 1.00 172.69 ? 339 HIS A N   1 
ATOM   2142  C  CA  . HIS A 1 339 ? 149.722 217.917 166.951 1.00 171.65 ? 339 HIS A CA  1 
ATOM   2143  C  C   . HIS A 1 339 ? 149.865 219.223 167.747 1.00 180.42 ? 339 HIS A C   1 
ATOM   2144  O  O   . HIS A 1 339 ? 148.913 219.659 168.402 1.00 181.01 ? 339 HIS A O   1 
ATOM   2145  C  CB  . HIS A 1 339 ? 150.083 216.720 167.837 1.00 167.31 ? 339 HIS A CB  1 
ATOM   2146  C  CG  . HIS A 1 339 ? 149.770 215.391 167.230 1.00 166.89 ? 339 HIS A CG  1 
ATOM   2147  N  ND1 . HIS A 1 339 ? 148.469 215.019 166.949 1.00 168.14 ? 339 HIS A ND1 1 
ATOM   2148  C  CD2 . HIS A 1 339 ? 150.598 214.370 166.907 1.00 165.62 ? 339 HIS A CD2 1 
ATOM   2149  C  CE1 . HIS A 1 339 ? 148.546 213.798 166.450 1.00 164.44 ? 339 HIS A CE1 1 
ATOM   2150  N  NE2 . HIS A 1 339 ? 149.807 213.364 166.407 1.00 163.16 ? 339 HIS A NE2 1 
ATOM   2151  N  N   . TRP A 1 340 ? 151.055 219.845 167.670 1.00 180.25 ? 340 TRP A N   1 
ATOM   2152  C  CA  . TRP A 1 340 ? 151.366 221.120 168.304 1.00 184.93 ? 340 TRP A CA  1 
ATOM   2153  C  C   . TRP A 1 340 ? 150.680 222.265 167.533 1.00 193.01 ? 340 TRP A C   1 
ATOM   2154  O  O   . TRP A 1 340 ? 149.967 223.063 168.143 1.00 195.58 ? 340 TRP A O   1 
ATOM   2155  C  CB  . TRP A 1 340 ? 152.896 221.321 168.369 1.00 185.03 ? 340 TRP A CB  1 
ATOM   2156  C  CG  . TRP A 1 340 ? 153.324 222.681 168.843 1.00 191.80 ? 340 TRP A CG  1 
ATOM   2157  C  CD1 . TRP A 1 340 ? 153.390 223.115 170.134 1.00 196.10 ? 340 TRP A CD1 1 
ATOM   2158  C  CD2 . TRP A 1 340 ? 153.738 223.787 168.024 1.00 197.04 ? 340 TRP A CD2 1 
ATOM   2159  N  NE1 . TRP A 1 340 ? 153.811 224.426 170.173 1.00 201.65 ? 340 TRP A NE1 1 
ATOM   2160  C  CE2 . TRP A 1 340 ? 154.031 224.864 168.891 1.00 205.63 ? 340 TRP A CE2 1 
ATOM   2161  C  CE3 . TRP A 1 340 ? 153.880 223.977 166.638 1.00 200.01 ? 340 TRP A CE3 1 
ATOM   2162  C  CZ2 . TRP A 1 340 ? 154.460 226.112 168.417 1.00 210.30 ? 340 TRP A CZ2 1 
ATOM   2163  C  CZ3 . TRP A 1 340 ? 154.314 225.210 166.171 1.00 207.41 ? 340 TRP A CZ3 1 
ATOM   2164  C  CH2 . TRP A 1 340 ? 154.600 226.260 167.054 1.00 211.32 ? 340 TRP A CH2 1 
ATOM   2165  N  N   . LYS A 1 341 ? 150.885 222.322 166.196 1.00 190.04 ? 341 LYS A N   1 
ATOM   2166  C  CA  . LYS A 1 341 ? 150.352 223.349 165.294 1.00 194.60 ? 341 LYS A CA  1 
ATOM   2167  C  C   . LYS A 1 341 ? 148.823 223.295 165.154 1.00 198.19 ? 341 LYS A C   1 
ATOM   2168  O  O   . LYS A 1 341 ? 148.190 224.353 165.125 1.00 202.71 ? 341 LYS A O   1 
ATOM   2169  C  CB  . LYS A 1 341 ? 150.999 223.235 163.908 1.00 197.76 ? 341 LYS A CB  1 
ATOM   2170  N  N   . LEU A 1 342 ? 148.233 222.082 165.064 1.00 189.59 ? 342 LEU A N   1 
ATOM   2171  C  CA  . LEU A 1 342 ? 146.779 221.901 164.930 1.00 189.65 ? 342 LEU A CA  1 
ATOM   2172  C  C   . LEU A 1 342 ? 146.060 221.985 166.295 1.00 193.78 ? 342 LEU A C   1 
ATOM   2173  O  O   . LEU A 1 342 ? 144.829 221.901 166.345 1.00 194.43 ? 342 LEU A O   1 
ATOM   2174  C  CB  . LEU A 1 342 ? 146.438 220.573 164.224 1.00 185.41 ? 342 LEU A CB  1 
ATOM   2175  C  CG  . LEU A 1 342 ? 146.738 220.512 162.725 1.00 191.34 ? 342 LEU A CG  1 
ATOM   2176  C  CD1 . LEU A 1 342 ? 147.137 219.120 162.306 1.00 186.59 ? 342 LEU A CD1 1 
ATOM   2177  C  CD2 . LEU A 1 342 ? 145.553 220.988 161.901 1.00 198.35 ? 342 LEU A CD2 1 
ATOM   2178  N  N   . GLY A 1 343 ? 146.833 222.175 167.368 1.00 189.70 ? 343 GLY A N   1 
ATOM   2179  C  CA  . GLY A 1 343 ? 146.338 222.319 168.734 1.00 189.45 ? 343 GLY A CA  1 
ATOM   2180  C  C   . GLY A 1 343 ? 145.672 221.091 169.315 1.00 188.24 ? 343 GLY A C   1 
ATOM   2181  O  O   . GLY A 1 343 ? 144.771 221.220 170.149 1.00 188.54 ? 343 GLY A O   1 
ATOM   2182  N  N   . HIS A 1 344 ? 146.116 219.892 168.887 1.00 180.17 ? 344 HIS A N   1 
ATOM   2183  C  CA  . HIS A 1 344 ? 145.594 218.609 169.367 1.00 175.43 ? 344 HIS A CA  1 
ATOM   2184  C  C   . HIS A 1 344 ? 145.927 218.420 170.848 1.00 176.63 ? 344 HIS A C   1 
ATOM   2185  O  O   . HIS A 1 344 ? 145.113 217.872 171.593 1.00 174.12 ? 344 HIS A O   1 
ATOM   2186  C  CB  . HIS A 1 344 ? 146.151 217.440 168.531 1.00 172.57 ? 344 HIS A CB  1 
ATOM   2187  C  CG  . HIS A 1 344 ? 145.684 217.424 167.105 1.00 177.92 ? 344 HIS A CG  1 
ATOM   2188  N  ND1 . HIS A 1 344 ? 146.478 216.914 166.092 1.00 178.57 ? 344 HIS A ND1 1 
ATOM   2189  C  CD2 . HIS A 1 344 ? 144.516 217.852 166.567 1.00 183.08 ? 344 HIS A CD2 1 
ATOM   2190  C  CE1 . HIS A 1 344 ? 145.778 217.058 164.977 1.00 180.46 ? 344 HIS A CE1 1 
ATOM   2191  N  NE2 . HIS A 1 344 ? 144.591 217.615 165.213 1.00 183.56 ? 344 HIS A NE2 1 
ATOM   2192  N  N   . THR A 1 345 ? 147.110 218.919 171.269 1.00 173.68 ? 345 THR A N   1 
ATOM   2193  C  CA  . THR A 1 345 ? 147.617 218.872 172.645 1.00 171.98 ? 345 THR A CA  1 
ATOM   2194  C  C   . THR A 1 345 ? 146.685 219.669 173.577 1.00 177.28 ? 345 THR A C   1 
ATOM   2195  O  O   . THR A 1 345 ? 146.205 219.118 174.568 1.00 174.45 ? 345 THR A O   1 
ATOM   2196  C  CB  . THR A 1 345 ? 149.069 219.407 172.697 1.00 182.79 ? 345 THR A CB  1 
ATOM   2197  O  OG1 . THR A 1 345 ? 149.837 218.867 171.616 1.00 182.22 ? 345 THR A OG1 1 
ATOM   2198  C  CG2 . THR A 1 345 ? 149.758 219.123 174.033 1.00 178.81 ? 345 THR A CG2 1 
ATOM   2199  N  N   . VAL A 1 346 ? 146.417 220.948 173.230 1.00 178.04 ? 346 VAL A N   1 
ATOM   2200  C  CA  . VAL A 1 346 ? 145.573 221.872 173.991 1.00 181.55 ? 346 VAL A CA  1 
ATOM   2201  C  C   . VAL A 1 346 ? 144.119 221.397 174.047 1.00 183.72 ? 346 VAL A C   1 
ATOM   2202  O  O   . VAL A 1 346 ? 143.494 221.510 175.104 1.00 184.42 ? 346 VAL A O   1 
ATOM   2203  C  CB  . VAL A 1 346 ? 145.656 223.303 173.424 1.00 191.73 ? 346 VAL A CB  1 
ATOM   2204  N  N   . LYS A 1 347 ? 143.588 220.862 172.924 1.00 178.14 ? 347 LYS A N   1 
ATOM   2205  C  CA  . LYS A 1 347 ? 142.217 220.353 172.827 1.00 177.13 ? 347 LYS A CA  1 
ATOM   2206  C  C   . LYS A 1 347 ? 142.001 219.162 173.773 1.00 175.03 ? 347 LYS A C   1 
ATOM   2207  O  O   . LYS A 1 347 ? 140.956 219.087 174.420 1.00 175.38 ? 347 LYS A O   1 
ATOM   2208  C  CB  . LYS A 1 347 ? 141.881 219.960 171.381 1.00 179.28 ? 347 LYS A CB  1 
ATOM   2209  N  N   . ASN A 1 348 ? 143.006 218.266 173.883 1.00 166.16 ? 348 ASN A N   1 
ATOM   2210  C  CA  . ASN A 1 348 ? 142.973 217.081 174.748 1.00 160.92 ? 348 ASN A CA  1 
ATOM   2211  C  C   . ASN A 1 348 ? 142.916 217.453 176.235 1.00 163.99 ? 348 ASN A C   1 
ATOM   2212  O  O   . ASN A 1 348 ? 142.265 216.744 177.002 1.00 161.49 ? 348 ASN A O   1 
ATOM   2213  C  CB  . ASN A 1 348 ? 144.178 216.172 174.478 1.00 158.46 ? 348 ASN A CB  1 
ATOM   2214  C  CG  . ASN A 1 348 ? 144.085 215.364 173.202 1.00 182.57 ? 348 ASN A CG  1 
ATOM   2215  O  OD1 . ASN A 1 348 ? 143.029 214.832 172.834 1.00 178.22 ? 348 ASN A OD1 1 
ATOM   2216  N  ND2 . ASN A 1 348 ? 145.206 215.225 172.510 1.00 172.89 ? 348 ASN A ND2 1 
ATOM   2217  N  N   . ILE A 1 349 ? 143.581 218.560 176.637 1.00 162.69 ? 349 ILE A N   1 
ATOM   2218  C  CA  . ILE A 1 349 ? 143.591 219.042 178.026 1.00 163.63 ? 349 ILE A CA  1 
ATOM   2219  C  C   . ILE A 1 349 ? 142.212 219.635 178.365 1.00 170.68 ? 349 ILE A C   1 
ATOM   2220  O  O   . ILE A 1 349 ? 141.685 219.372 179.449 1.00 169.56 ? 349 ILE A O   1 
ATOM   2221  C  CB  . ILE A 1 349 ? 144.745 220.053 178.302 1.00 169.58 ? 349 ILE A CB  1 
ATOM   2222  C  CG1 . ILE A 1 349 ? 146.114 219.489 177.843 1.00 166.45 ? 349 ILE A CG1 1 
ATOM   2223  C  CG2 . ILE A 1 349 ? 144.787 220.444 179.794 1.00 172.04 ? 349 ILE A CG2 1 
ATOM   2224  C  CD1 . ILE A 1 349 ? 147.172 220.536 177.469 1.00 177.09 ? 349 ILE A CD1 1 
ATOM   2225  N  N   . ILE A 1 350 ? 141.625 220.405 177.420 1.00 171.09 ? 350 ILE A N   1 
ATOM   2226  C  CA  . ILE A 1 350 ? 140.306 221.037 177.547 1.00 175.22 ? 350 ILE A CA  1 
ATOM   2227  C  C   . ILE A 1 350 ? 139.215 219.970 177.749 1.00 176.20 ? 350 ILE A C   1 
ATOM   2228  O  O   . ILE A 1 350 ? 138.303 220.193 178.543 1.00 178.70 ? 350 ILE A O   1 
ATOM   2229  C  CB  . ILE A 1 350 ? 139.996 221.945 176.331 1.00 182.68 ? 350 ILE A CB  1 
ATOM   2230  N  N   . ILE A 1 351 ? 139.338 218.805 177.073 1.00 167.04 ? 351 ILE A N   1 
ATOM   2231  C  CA  . ILE A 1 351 ? 138.396 217.689 177.201 1.00 163.63 ? 351 ILE A CA  1 
ATOM   2232  C  C   . ILE A 1 351 ? 138.563 217.042 178.586 1.00 163.74 ? 351 ILE A C   1 
ATOM   2233  O  O   . ILE A 1 351 ? 137.561 216.830 179.272 1.00 164.13 ? 351 ILE A O   1 
ATOM   2234  C  CB  . ILE A 1 351 ? 138.567 216.650 176.048 1.00 162.91 ? 351 ILE A CB  1 
ATOM   2235  C  CG1 . ILE A 1 351 ? 138.203 217.264 174.683 1.00 166.99 ? 351 ILE A CG1 1 
ATOM   2236  C  CG2 . ILE A 1 351 ? 137.744 215.373 176.297 1.00 160.38 ? 351 ILE A CG2 1 
ATOM   2237  C  CD1 . ILE A 1 351 ? 138.877 216.591 173.485 1.00 172.70 ? 351 ILE A CD1 1 
ATOM   2238  N  N   . SER A 1 352 ? 139.823 216.752 178.995 1.00 156.65 ? 352 SER A N   1 
ATOM   2239  C  CA  . SER A 1 352 ? 140.167 216.097 180.264 1.00 153.17 ? 352 SER A CA  1 
ATOM   2240  C  C   . SER A 1 352 ? 139.703 216.884 181.493 1.00 160.13 ? 352 SER A C   1 
ATOM   2241  O  O   . SER A 1 352 ? 139.279 216.264 182.468 1.00 158.21 ? 352 SER A O   1 
ATOM   2242  C  CB  . SER A 1 352 ? 141.669 215.835 180.357 1.00 153.63 ? 352 SER A CB  1 
ATOM   2243  O  OG  . SER A 1 352 ? 142.421 217.016 180.584 1.00 165.43 ? 352 SER A OG  1 
ATOM   2244  N  N   . GLN A 1 353 ? 139.779 218.229 181.452 1.00 161.58 ? 353 GLN A N   1 
ATOM   2245  C  CA  . GLN A 1 353 ? 139.362 219.072 182.576 1.00 165.80 ? 353 GLN A CA  1 
ATOM   2246  C  C   . GLN A 1 353 ? 137.847 219.300 182.572 1.00 173.66 ? 353 GLN A C   1 
ATOM   2247  O  O   . GLN A 1 353 ? 137.269 219.576 183.625 1.00 175.43 ? 353 GLN A O   1 
ATOM   2248  C  CB  . GLN A 1 353 ? 140.124 220.409 182.600 1.00 171.61 ? 353 GLN A CB  1 
ATOM   2249  C  CG  . GLN A 1 353 ? 141.625 220.281 182.918 1.00 179.02 ? 353 GLN A CG  1 
ATOM   2250  C  CD  . GLN A 1 353 ? 141.957 219.488 184.170 1.00 187.75 ? 353 GLN A CD  1 
ATOM   2251  O  OE1 . GLN A 1 353 ? 141.373 219.670 185.249 1.00 184.29 ? 353 GLN A OE1 1 
ATOM   2252  N  NE2 . GLN A 1 353 ? 142.924 218.593 184.052 1.00 171.46 ? 353 GLN A NE2 1 
ATOM   2253  N  N   . MET A 1 354 ? 137.207 219.159 181.398 1.00 171.50 ? 354 MET A N   1 
ATOM   2254  C  CA  . MET A 1 354 ? 135.757 219.277 181.234 1.00 175.08 ? 354 MET A CA  1 
ATOM   2255  C  C   . MET A 1 354 ? 135.092 218.011 181.777 1.00 174.57 ? 354 MET A C   1 
ATOM   2256  O  O   . MET A 1 354 ? 134.014 218.082 182.374 1.00 176.88 ? 354 MET A O   1 
ATOM   2257  C  CB  . MET A 1 354 ? 135.414 219.488 179.755 1.00 179.28 ? 354 MET A CB  1 
ATOM   2258  C  CG  . MET A 1 354 ? 134.008 219.977 179.509 1.00 185.63 ? 354 MET A CG  1 
ATOM   2259  S  SD  . MET A 1 354 ? 133.813 220.614 177.827 1.00 189.65 ? 354 MET A SD  1 
ATOM   2260  C  CE  . MET A 1 354 ? 133.905 219.070 176.860 1.00 186.01 ? 354 MET A CE  1 
ATOM   2261  N  N   . ASN A 1 355 ? 135.759 216.856 181.569 1.00 164.63 ? 355 ASN A N   1 
ATOM   2262  C  CA  . ASN A 1 355 ? 135.339 215.532 182.015 1.00 160.31 ? 355 ASN A CA  1 
ATOM   2263  C  C   . ASN A 1 355 ? 135.392 215.446 183.549 1.00 164.14 ? 355 ASN A C   1 
ATOM   2264  O  O   . ASN A 1 355 ? 134.423 214.983 184.152 1.00 164.61 ? 355 ASN A O   1 
ATOM   2265  C  CB  . ASN A 1 355 ? 136.220 214.458 181.359 1.00 155.56 ? 355 ASN A CB  1 
ATOM   2266  C  CG  . ASN A 1 355 ? 136.309 213.148 182.107 1.00 181.13 ? 355 ASN A CG  1 
ATOM   2267  O  OD1 . ASN A 1 355 ? 135.325 212.419 182.258 1.00 175.69 ? 355 ASN A OD1 1 
ATOM   2268  N  ND2 . ASN A 1 355 ? 137.501 212.822 182.594 1.00 171.75 ? 355 ASN A ND2 1 
ATOM   2269  N  N   . SER A 1 356 ? 136.510 215.909 184.172 1.00 159.92 ? 356 SER A N   1 
ATOM   2270  C  CA  . SER A 1 356 ? 136.710 215.890 185.628 1.00 159.36 ? 356 SER A CA  1 
ATOM   2271  C  C   . SER A 1 356 ? 135.748 216.832 186.352 1.00 168.20 ? 356 SER A C   1 
ATOM   2272  O  O   . SER A 1 356 ? 135.366 216.527 187.481 1.00 167.41 ? 356 SER A O   1 
ATOM   2273  C  CB  . SER A 1 356 ? 138.153 216.219 186.001 1.00 161.67 ? 356 SER A CB  1 
ATOM   2274  O  OG  . SER A 1 356 ? 138.551 217.513 185.581 1.00 174.47 ? 356 SER A OG  1 
ATOM   2275  N  N   . PHE A 1 357 ? 135.334 217.950 185.707 1.00 169.93 ? 357 PHE A N   1 
ATOM   2276  C  CA  . PHE A 1 357 ? 134.369 218.878 186.302 1.00 176.07 ? 357 PHE A CA  1 
ATOM   2277  C  C   . PHE A 1 357 ? 132.994 218.223 186.349 1.00 180.95 ? 357 PHE A C   1 
ATOM   2278  O  O   . PHE A 1 357 ? 132.330 218.289 187.384 1.00 181.90 ? 357 PHE A O   1 
ATOM   2279  C  CB  . PHE A 1 357 ? 134.310 220.231 185.566 1.00 181.37 ? 357 PHE A CB  1 
ATOM   2280  C  CG  . PHE A 1 357 ? 133.379 221.224 186.232 1.00 183.74 ? 357 PHE A CG  1 
ATOM   2281  C  CD1 . PHE A 1 357 ? 133.780 221.930 187.362 1.00 186.51 ? 357 PHE A CD1 1 
ATOM   2282  C  CD2 . PHE A 1 357 ? 132.092 221.430 185.747 1.00 185.66 ? 357 PHE A CD2 1 
ATOM   2283  C  CE1 . PHE A 1 357 ? 132.909 222.824 187.995 1.00 188.35 ? 357 PHE A CE1 1 
ATOM   2284  C  CE2 . PHE A 1 357 ? 131.222 222.325 186.382 1.00 188.76 ? 357 PHE A CE2 1 
ATOM   2285  C  CZ  . PHE A 1 357 ? 131.638 223.017 187.499 1.00 188.21 ? 357 PHE A CZ  1 
ATOM   2286  N  N   . LEU A 1 358 ? 132.583 217.576 185.238 1.00 175.70 ? 358 LEU A N   1 
ATOM   2287  C  CA  . LEU A 1 358 ? 131.313 216.857 185.124 1.00 176.31 ? 358 LEU A CA  1 
ATOM   2288  C  C   . LEU A 1 358 ? 131.268 215.701 186.130 1.00 177.67 ? 358 LEU A C   1 
ATOM   2289  O  O   . LEU A 1 358 ? 130.229 215.474 186.752 1.00 179.35 ? 358 LEU A O   1 
ATOM   2290  C  CB  . LEU A 1 358 ? 131.132 216.332 183.689 1.00 174.47 ? 358 LEU A CB  1 
ATOM   2291  C  CG  . LEU A 1 358 ? 129.754 215.774 183.345 1.00 181.07 ? 358 LEU A CG  1 
ATOM   2292  C  CD1 . LEU A 1 358 ? 128.939 216.783 182.558 1.00 183.11 ? 358 LEU A CD1 1 
ATOM   2293  C  CD2 . LEU A 1 358 ? 129.873 214.477 182.577 1.00 178.46 ? 358 LEU A CD2 1 
ATOM   2294  N  N   . CYS A 1 359 ? 132.413 215.004 186.304 1.00 169.96 ? 359 CYS A N   1 
ATOM   2295  C  CA  . CYS A 1 359 ? 132.585 213.876 187.220 1.00 166.02 ? 359 CYS A CA  1 
ATOM   2296  C  C   . CYS A 1 359 ? 132.491 214.322 188.682 1.00 172.47 ? 359 CYS A C   1 
ATOM   2297  O  O   . CYS A 1 359 ? 131.726 213.715 189.433 1.00 172.52 ? 359 CYS A O   1 
ATOM   2298  C  CB  . CYS A 1 359 ? 133.900 213.154 186.947 1.00 160.82 ? 359 CYS A CB  1 
ATOM   2299  S  SG  . CYS A 1 359 ? 133.823 211.973 185.578 1.00 160.69 ? 359 CYS A SG  1 
ATOM   2300  N  N   . PHE A 1 360 ? 133.248 215.375 189.085 1.00 170.76 ? 360 PHE A N   1 
ATOM   2301  C  CA  . PHE A 1 360 ? 133.242 215.891 190.460 1.00 173.08 ? 360 PHE A CA  1 
ATOM   2302  C  C   . PHE A 1 360 ? 131.878 216.456 190.845 1.00 181.32 ? 360 PHE A C   1 
ATOM   2303  O  O   . PHE A 1 360 ? 131.488 216.340 192.009 1.00 182.33 ? 360 PHE A O   1 
ATOM   2304  C  CB  . PHE A 1 360 ? 134.339 216.945 190.685 1.00 176.94 ? 360 PHE A CB  1 
ATOM   2305  C  CG  . PHE A 1 360 ? 135.643 216.364 191.185 1.00 173.86 ? 360 PHE A CG  1 
ATOM   2306  C  CD1 . PHE A 1 360 ? 135.755 215.879 192.484 1.00 175.90 ? 360 PHE A CD1 1 
ATOM   2307  C  CD2 . PHE A 1 360 ? 136.761 216.313 190.364 1.00 172.82 ? 360 PHE A CD2 1 
ATOM   2308  C  CE1 . PHE A 1 360 ? 136.957 215.336 192.943 1.00 172.77 ? 360 PHE A CE1 1 
ATOM   2309  C  CE2 . PHE A 1 360 ? 137.965 215.778 190.827 1.00 171.69 ? 360 PHE A CE2 1 
ATOM   2310  C  CZ  . PHE A 1 360 ? 138.055 215.293 192.113 1.00 168.84 ? 360 PHE A CZ  1 
ATOM   2311  N  N   . PHE A 1 361 ? 131.140 217.024 189.868 1.00 180.20 ? 361 PHE A N   1 
ATOM   2312  C  CA  . PHE A 1 361 ? 129.800 217.559 190.091 1.00 180.96 ? 361 PHE A CA  1 
ATOM   2313  C  C   . PHE A 1 361 ? 128.830 216.423 190.429 1.00 182.70 ? 361 PHE A C   1 
ATOM   2314  O  O   . PHE A 1 361 ? 128.144 216.504 191.450 1.00 182.94 ? 361 PHE A O   1 
ATOM   2315  C  CB  . PHE A 1 361 ? 129.308 218.369 188.875 1.00 182.78 ? 361 PHE A CB  1 
ATOM   2316  C  CG  . PHE A 1 361 ? 127.846 218.749 188.926 1.00 184.69 ? 361 PHE A CG  1 
ATOM   2317  C  CD1 . PHE A 1 361 ? 127.400 219.752 189.779 1.00 187.94 ? 361 PHE A CD1 1 
ATOM   2318  C  CD2 . PHE A 1 361 ? 126.913 218.092 188.133 1.00 185.75 ? 361 PHE A CD2 1 
ATOM   2319  C  CE1 . PHE A 1 361 ? 126.046 220.086 189.841 1.00 189.61 ? 361 PHE A CE1 1 
ATOM   2320  C  CE2 . PHE A 1 361 ? 125.559 218.430 188.193 1.00 188.65 ? 361 PHE A CE2 1 
ATOM   2321  C  CZ  . PHE A 1 361 ? 125.135 219.426 189.044 1.00 188.72 ? 361 PHE A CZ  1 
ATOM   2322  N  N   . LEU A 1 362 ? 128.805 215.356 189.597 1.00 179.20 ? 362 LEU A N   1 
ATOM   2323  C  CA  . LEU A 1 362 ? 127.946 214.182 189.796 1.00 177.40 ? 362 LEU A CA  1 
ATOM   2324  C  C   . LEU A 1 362 ? 128.363 213.399 191.051 1.00 178.34 ? 362 LEU A C   1 
ATOM   2325  O  O   . LEU A 1 362 ? 127.517 212.747 191.664 1.00 178.62 ? 362 LEU A O   1 
ATOM   2326  C  CB  . LEU A 1 362 ? 127.950 213.265 188.561 1.00 173.40 ? 362 LEU A CB  1 
ATOM   2327  C  CG  . LEU A 1 362 ? 127.330 213.829 187.275 1.00 181.17 ? 362 LEU A CG  1 
ATOM   2328  C  CD1 . LEU A 1 362 ? 127.836 213.081 186.059 1.00 177.42 ? 362 LEU A CD1 1 
ATOM   2329  C  CD2 . LEU A 1 362 ? 125.806 213.801 187.321 1.00 183.27 ? 362 LEU A CD2 1 
ATOM   2330  N  N   . PHE A 1 363 ? 129.655 213.493 191.442 1.00 172.01 ? 363 PHE A N   1 
ATOM   2331  C  CA  . PHE A 1 363 ? 130.201 212.875 192.654 1.00 169.00 ? 363 PHE A CA  1 
ATOM   2332  C  C   . PHE A 1 363 ? 129.602 213.566 193.877 1.00 178.03 ? 363 PHE A C   1 
ATOM   2333  O  O   . PHE A 1 363 ? 129.115 212.886 194.776 1.00 176.93 ? 363 PHE A O   1 
ATOM   2334  C  CB  . PHE A 1 363 ? 131.742 212.950 192.668 1.00 167.15 ? 363 PHE A CB  1 
ATOM   2335  C  CG  . PHE A 1 363 ? 132.412 212.566 193.969 1.00 167.04 ? 363 PHE A CG  1 
ATOM   2336  C  CD1 . PHE A 1 363 ? 132.554 211.231 194.332 1.00 165.51 ? 363 PHE A CD1 1 
ATOM   2337  C  CD2 . PHE A 1 363 ? 132.929 213.539 194.818 1.00 172.76 ? 363 PHE A CD2 1 
ATOM   2338  C  CE1 . PHE A 1 363 ? 133.185 210.876 195.528 1.00 165.04 ? 363 PHE A CE1 1 
ATOM   2339  C  CE2 . PHE A 1 363 ? 133.557 213.183 196.017 1.00 174.32 ? 363 PHE A CE2 1 
ATOM   2340  C  CZ  . PHE A 1 363 ? 133.691 211.853 196.356 1.00 167.55 ? 363 PHE A CZ  1 
ATOM   2341  N  N   . ALA A 1 364 ? 129.604 214.918 193.881 1.00 180.22 ? 364 ALA A N   1 
ATOM   2342  C  CA  . ALA A 1 364 ? 129.048 215.757 194.945 1.00 182.21 ? 364 ALA A CA  1 
ATOM   2343  C  C   . ALA A 1 364 ? 127.546 215.507 195.123 1.00 185.83 ? 364 ALA A C   1 
ATOM   2344  O  O   . ALA A 1 364 ? 127.035 215.625 196.239 1.00 186.54 ? 364 ALA A O   1 
ATOM   2345  C  CB  . ALA A 1 364 ? 129.298 217.224 194.631 1.00 183.80 ? 364 ALA A CB  1 
ATOM   2346  N  N   . VAL A 1 365 ? 126.855 215.140 194.023 1.00 183.28 ? 365 VAL A N   1 
ATOM   2347  C  CA  . VAL A 1 365 ? 125.422 214.834 193.981 1.00 183.73 ? 365 VAL A CA  1 
ATOM   2348  C  C   . VAL A 1 365 ? 125.171 213.412 194.549 1.00 185.67 ? 365 VAL A C   1 
ATOM   2349  O  O   . VAL A 1 365 ? 124.199 213.217 195.286 1.00 186.36 ? 365 VAL A O   1 
ATOM   2350  C  CB  . VAL A 1 365 ? 124.862 214.997 192.529 1.00 186.26 ? 365 VAL A CB  1 
ATOM   2351  C  CG1 . VAL A 1 365 ? 123.441 214.451 192.391 1.00 186.53 ? 365 VAL A CG1 1 
ATOM   2352  C  CG2 . VAL A 1 365 ? 124.911 216.455 192.078 1.00 187.21 ? 365 VAL A CG2 1 
ATOM   2353  N  N   . LEU A 1 366 ? 126.054 212.441 194.224 1.00 181.61 ? 366 LEU A N   1 
ATOM   2354  C  CA  . LEU A 1 366 ? 125.900 211.041 194.630 1.00 178.77 ? 366 LEU A CA  1 
ATOM   2355  C  C   . LEU A 1 366 ? 126.633 210.639 195.933 1.00 180.86 ? 366 LEU A C   1 
ATOM   2356  O  O   . LEU A 1 366 ? 126.338 209.559 196.452 1.00 178.27 ? 366 LEU A O   1 
ATOM   2357  C  CB  . LEU A 1 366 ? 126.358 210.118 193.492 1.00 173.22 ? 366 LEU A CB  1 
ATOM   2358  C  CG  . LEU A 1 366 ? 125.439 210.028 192.273 1.00 179.72 ? 366 LEU A CG  1 
ATOM   2359  C  CD1 . LEU A 1 366 ? 126.218 209.617 191.041 1.00 175.39 ? 366 LEU A CD1 1 
ATOM   2360  C  CD2 . LEU A 1 366 ? 124.287 209.062 192.513 1.00 183.13 ? 366 LEU A CD2 1 
ATOM   2361  N  N   . ILE A 1 367 ? 127.554 211.477 196.469 1.00 178.90 ? 367 ILE A N   1 
ATOM   2362  C  CA  . ILE A 1 367 ? 128.310 211.165 197.700 1.00 177.35 ? 367 ILE A CA  1 
ATOM   2363  C  C   . ILE A 1 367 ? 127.365 211.050 198.933 1.00 186.25 ? 367 ILE A C   1 
ATOM   2364  O  O   . ILE A 1 367 ? 127.626 210.241 199.829 1.00 183.40 ? 367 ILE A O   1 
ATOM   2365  C  CB  . ILE A 1 367 ? 129.494 212.157 197.952 1.00 181.27 ? 367 ILE A CB  1 
ATOM   2366  C  CG1 . ILE A 1 367 ? 130.457 211.633 199.060 1.00 178.94 ? 367 ILE A CG1 1 
ATOM   2367  C  CG2 . ILE A 1 367 ? 129.024 213.616 198.180 1.00 186.81 ? 367 ILE A CG2 1 
ATOM   2368  C  CD1 . ILE A 1 367 ? 131.774 212.412 199.291 1.00 187.31 ? 367 ILE A CD1 1 
ATOM   2369  N  N   . GLY A 1 368 ? 126.279 211.827 198.934 1.00 186.15 ? 368 GLY A N   1 
ATOM   2370  C  CA  . GLY A 1 368 ? 125.281 211.841 200.000 1.00 187.34 ? 368 GLY A CA  1 
ATOM   2371  C  C   . GLY A 1 368 ? 124.448 210.576 200.110 1.00 189.61 ? 368 GLY A C   1 
ATOM   2372  O  O   . GLY A 1 368 ? 123.928 210.274 201.190 1.00 190.11 ? 368 GLY A O   1 
ATOM   2373  N  N   . ARG A 1 369 ? 124.312 209.829 198.990 1.00 185.99 ? 369 ARG A N   1 
ATOM   2374  C  CA  . ARG A 1 369 ? 123.545 208.583 198.922 1.00 185.23 ? 369 ARG A CA  1 
ATOM   2375  C  C   . ARG A 1 369 ? 124.292 207.454 199.633 1.00 184.68 ? 369 ARG A C   1 
ATOM   2376  O  O   . ARG A 1 369 ? 125.415 207.113 199.256 1.00 178.82 ? 369 ARG A O   1 
ATOM   2377  C  CB  . ARG A 1 369 ? 123.240 208.207 197.465 1.00 184.77 ? 369 ARG A CB  1 
ATOM   2378  N  N   . LYS A 1 370 ? 123.668 206.904 200.687 1.00 182.69 ? 370 LYS A N   1 
ATOM   2379  C  CA  . LYS A 1 370 ? 124.220 205.820 201.503 1.00 178.24 ? 370 LYS A CA  1 
ATOM   2380  C  C   . LYS A 1 370 ? 123.939 204.441 200.877 1.00 177.67 ? 370 LYS A C   1 
ATOM   2381  O  O   . LYS A 1 370 ? 124.527 203.444 201.308 1.00 172.94 ? 370 LYS A O   1 
ATOM   2382  C  CB  . LYS A 1 370 ? 123.647 205.888 202.929 1.00 184.85 ? 370 LYS A CB  1 
ATOM   2383  N  N   . GLU A 1 371 ? 123.047 204.395 199.862 1.00 175.66 ? 371 GLU A N   1 
ATOM   2384  C  CA  . GLU A 1 371 ? 122.649 203.177 199.153 1.00 172.94 ? 371 GLU A CA  1 
ATOM   2385  C  C   . GLU A 1 371 ? 123.802 202.598 198.324 1.00 170.73 ? 371 GLU A C   1 
ATOM   2386  O  O   . GLU A 1 371 ? 123.943 201.374 198.264 1.00 167.04 ? 371 GLU A O   1 
ATOM   2387  C  CB  . GLU A 1 371 ? 121.435 203.451 198.254 1.00 178.68 ? 371 GLU A CB  1 
ATOM   2388  N  N   . LEU A 1 372 ? 124.625 203.471 197.699 1.00 166.04 ? 372 LEU A N   1 
ATOM   2389  C  CA  . LEU A 1 372 ? 125.764 203.059 196.870 1.00 160.31 ? 372 LEU A CA  1 
ATOM   2390  C  C   . LEU A 1 372 ? 126.910 202.469 197.705 1.00 159.89 ? 372 LEU A C   1 
ATOM   2391  O  O   . LEU A 1 372 ? 127.631 201.606 197.201 1.00 154.82 ? 372 LEU A O   1 
ATOM   2392  C  CB  . LEU A 1 372 ? 126.284 204.184 195.959 1.00 160.64 ? 372 LEU A CB  1 
ATOM   2393  C  CG  . LEU A 1 372 ? 126.257 205.622 196.407 1.00 169.31 ? 372 LEU A CG  1 
ATOM   2394  C  CD1 . LEU A 1 372 ? 127.641 206.081 196.790 1.00 166.75 ? 372 LEU A CD1 1 
ATOM   2395  C  CD2 . LEU A 1 372 ? 125.742 206.496 195.287 1.00 174.81 ? 372 LEU A CD2 1 
ATOM   2396  N  N   . PHE A 1 373 ? 127.061 202.912 198.973 1.00 158.52 ? 373 PHE A N   1 
ATOM   2397  C  CA  . PHE A 1 373 ? 128.080 202.403 199.902 1.00 155.26 ? 373 PHE A CA  1 
ATOM   2398  C  C   . PHE A 1 373 ? 127.690 201.015 200.414 1.00 158.34 ? 373 PHE A C   1 
ATOM   2399  O  O   . PHE A 1 373 ? 128.526 200.107 200.429 1.00 153.49 ? 373 PHE A O   1 
ATOM   2400  C  CB  . PHE A 1 373 ? 128.277 203.362 201.089 1.00 159.98 ? 373 PHE A CB  1 
ATOM   2401  C  CG  . PHE A 1 373 ? 129.041 204.625 200.782 1.00 162.15 ? 373 PHE A CG  1 
ATOM   2402  C  CD1 . PHE A 1 373 ? 128.379 205.770 200.360 1.00 169.84 ? 373 PHE A CD1 1 
ATOM   2403  C  CD2 . PHE A 1 373 ? 130.418 204.685 200.961 1.00 160.87 ? 373 PHE A CD2 1 
ATOM   2404  C  CE1 . PHE A 1 373 ? 129.083 206.948 200.097 1.00 172.01 ? 373 PHE A CE1 1 
ATOM   2405  C  CE2 . PHE A 1 373 ? 131.122 205.861 200.694 1.00 164.98 ? 373 PHE A CE2 1 
ATOM   2406  C  CZ  . PHE A 1 373 ? 130.449 206.986 200.269 1.00 167.68 ? 373 PHE A CZ  1 
ATOM   2407  N  N   . ALA A 1 374 ? 126.407 200.859 200.823 1.00 159.48 ? 374 ALA A N   1 
ATOM   2408  C  CA  . ALA A 1 374 ? 125.806 199.622 201.333 1.00 159.41 ? 374 ALA A CA  1 
ATOM   2409  C  C   . ALA A 1 374 ? 125.824 198.515 200.278 1.00 160.28 ? 374 ALA A C   1 
ATOM   2410  O  O   . ALA A 1 374 ? 125.888 197.335 200.631 1.00 157.97 ? 374 ALA A O   1 
ATOM   2411  C  CB  . ALA A 1 374 ? 124.377 199.887 201.785 1.00 165.86 ? 374 ALA A CB  1 
ATOM   2412  N  N   . ALA A 1 375 ? 125.776 198.905 198.988 1.00 156.73 ? 375 ALA A N   1 
ATOM   2413  C  CA  . ALA A 1 375 ? 125.816 198.013 197.832 1.00 154.16 ? 375 ALA A CA  1 
ATOM   2414  C  C   . ALA A 1 375 ? 127.110 197.197 197.810 1.00 153.01 ? 375 ALA A C   1 
ATOM   2415  O  O   . ALA A 1 375 ? 127.057 195.987 197.593 1.00 151.09 ? 375 ALA A O   1 
ATOM   2416  C  CB  . ALA A 1 375 ? 125.698 198.825 196.549 1.00 155.79 ? 375 ALA A CB  1 
ATOM   2417  N  N   . PHE A 1 376 ? 128.257 197.858 198.083 1.00 147.19 ? 376 PHE A N   1 
ATOM   2418  C  CA  . PHE A 1 376 ? 129.589 197.260 198.054 1.00 142.19 ? 376 PHE A CA  1 
ATOM   2419  C  C   . PHE A 1 376 ? 130.061 196.716 199.422 1.00 145.57 ? 376 PHE A C   1 
ATOM   2420  O  O   . PHE A 1 376 ? 131.174 196.195 199.509 1.00 142.18 ? 376 PHE A O   1 
ATOM   2421  C  CB  . PHE A 1 376 ? 130.603 198.262 197.479 1.00 142.25 ? 376 PHE A CB  1 
ATOM   2422  C  CG  . PHE A 1 376 ? 130.414 198.486 195.994 1.00 143.44 ? 376 PHE A CG  1 
ATOM   2423  C  CD1 . PHE A 1 376 ? 131.002 197.635 195.065 1.00 142.95 ? 376 PHE A CD1 1 
ATOM   2424  C  CD2 . PHE A 1 376 ? 129.629 199.532 195.525 1.00 149.19 ? 376 PHE A CD2 1 
ATOM   2425  C  CE1 . PHE A 1 376 ? 130.811 197.829 193.692 1.00 143.88 ? 376 PHE A CE1 1 
ATOM   2426  C  CE2 . PHE A 1 376 ? 129.442 199.727 194.152 1.00 151.99 ? 376 PHE A CE2 1 
ATOM   2427  C  CZ  . PHE A 1 376 ? 130.039 198.878 193.245 1.00 146.43 ? 376 PHE A CZ  1 
ATOM   2428  N  N   . GLY A 1 377 ? 129.203 196.779 200.441 1.00 145.30 ? 377 GLY A N   1 
ATOM   2429  C  CA  . GLY A 1 377 ? 129.499 196.235 201.763 1.00 145.13 ? 377 GLY A CA  1 
ATOM   2430  C  C   . GLY A 1 377 ? 129.823 197.212 202.877 1.00 152.49 ? 377 GLY A C   1 
ATOM   2431  O  O   . GLY A 1 377 ? 130.160 196.777 203.982 1.00 152.07 ? 377 GLY A O   1 
ATOM   2432  N  N   . PHE A 1 378 ? 129.716 198.530 202.616 1.00 152.24 ? 378 PHE A N   1 
ATOM   2433  C  CA  . PHE A 1 378 ? 129.991 199.572 203.612 1.00 154.80 ? 378 PHE A CA  1 
ATOM   2434  C  C   . PHE A 1 378 ? 128.683 200.017 204.261 1.00 164.06 ? 378 PHE A C   1 
ATOM   2435  O  O   . PHE A 1 378 ? 127.918 200.774 203.661 1.00 166.44 ? 378 PHE A O   1 
ATOM   2436  C  CB  . PHE A 1 378 ? 130.736 200.756 202.972 1.00 156.55 ? 378 PHE A CB  1 
ATOM   2437  C  CG  . PHE A 1 378 ? 132.131 200.414 202.511 1.00 153.92 ? 378 PHE A CG  1 
ATOM   2438  C  CD1 . PHE A 1 378 ? 132.347 199.822 201.270 1.00 154.26 ? 378 PHE A CD1 1 
ATOM   2439  C  CD2 . PHE A 1 378 ? 133.232 200.688 203.312 1.00 155.66 ? 378 PHE A CD2 1 
ATOM   2440  C  CE1 . PHE A 1 378 ? 133.638 199.487 200.851 1.00 151.59 ? 378 PHE A CE1 1 
ATOM   2441  C  CE2 . PHE A 1 378 ? 134.525 200.363 202.887 1.00 154.97 ? 378 PHE A CE2 1 
ATOM   2442  C  CZ  . PHE A 1 378 ? 134.720 199.771 201.656 1.00 150.10 ? 378 PHE A CZ  1 
ATOM   2443  N  N   . TYR A 1 379 ? 128.415 199.518 205.478 1.00 162.53 ? 379 TYR A N   1 
ATOM   2444  C  CA  . TYR A 1 379 ? 127.180 199.813 206.206 1.00 167.87 ? 379 TYR A CA  1 
ATOM   2445  C  C   . TYR A 1 379 ? 127.418 200.730 207.413 1.00 176.15 ? 379 TYR A C   1 
ATOM   2446  O  O   . TYR A 1 379 ? 126.651 201.674 207.614 1.00 180.56 ? 379 TYR A O   1 
ATOM   2447  C  CB  . TYR A 1 379 ? 126.496 198.513 206.673 1.00 168.99 ? 379 TYR A CB  1 
ATOM   2448  C  CG  . TYR A 1 379 ? 126.283 197.485 205.582 1.00 167.86 ? 379 TYR A CG  1 
ATOM   2449  C  CD1 . TYR A 1 379 ? 125.179 197.553 204.737 1.00 172.24 ? 379 TYR A CD1 1 
ATOM   2450  C  CD2 . TYR A 1 379 ? 127.162 196.417 205.422 1.00 164.00 ? 379 TYR A CD2 1 
ATOM   2451  C  CE1 . TYR A 1 379 ? 124.971 196.601 203.739 1.00 170.69 ? 379 TYR A CE1 1 
ATOM   2452  C  CE2 . TYR A 1 379 ? 126.964 195.459 204.428 1.00 162.67 ? 379 TYR A CE2 1 
ATOM   2453  C  CZ  . TYR A 1 379 ? 125.866 195.554 203.589 1.00 171.48 ? 379 TYR A CZ  1 
ATOM   2454  O  OH  . TYR A 1 379 ? 125.663 194.612 202.610 1.00 169.40 ? 379 TYR A OH  1 
ATOM   2455  N  N   . ASP A 1 380 ? 128.465 200.441 208.214 1.00 171.20 ? 380 ASP A N   1 
ATOM   2456  C  CA  . ASP A 1 380 ? 128.826 201.172 209.434 1.00 174.19 ? 380 ASP A CA  1 
ATOM   2457  C  C   . ASP A 1 380 ? 129.307 202.607 209.162 1.00 178.92 ? 380 ASP A C   1 
ATOM   2458  O  O   . ASP A 1 380 ? 129.067 203.481 209.995 1.00 183.16 ? 380 ASP A O   1 
ATOM   2459  C  CB  . ASP A 1 380 ? 129.913 200.412 210.216 1.00 173.62 ? 380 ASP A CB  1 
ATOM   2460  C  CG  . ASP A 1 380 ? 129.547 198.991 210.604 1.00 185.97 ? 380 ASP A CG  1 
ATOM   2461  O  OD1 . ASP A 1 380 ? 128.776 198.821 211.575 1.00 190.31 ? 380 ASP A OD1 1 
ATOM   2462  O  OD2 . ASP A 1 380 ? 130.063 198.047 209.962 1.00 188.99 ? 380 ASP A OD2 1 
ATOM   2463  N  N   . SER A 1 381 ? 130.003 202.845 208.031 1.00 171.57 ? 381 SER A N   1 
ATOM   2464  C  CA  . SER A 1 381 ? 130.533 204.168 207.689 1.00 172.92 ? 381 SER A CA  1 
ATOM   2465  C  C   . SER A 1 381 ? 130.537 204.431 206.180 1.00 174.83 ? 381 SER A C   1 
ATOM   2466  O  O   . SER A 1 381 ? 130.496 203.492 205.381 1.00 170.96 ? 381 SER A O   1 
ATOM   2467  C  CB  . SER A 1 381 ? 131.950 204.333 208.241 1.00 174.54 ? 381 SER A CB  1 
ATOM   2468  O  OG  . SER A 1 381 ? 132.870 203.425 207.657 1.00 176.87 ? 381 SER A OG  1 
ATOM   2469  N  N   . GLN A 1 382 ? 130.608 205.721 205.802 1.00 174.00 ? 382 GLN A N   1 
ATOM   2470  C  CA  . GLN A 1 382 ? 130.684 206.183 204.416 1.00 172.51 ? 382 GLN A CA  1 
ATOM   2471  C  C   . GLN A 1 382 ? 132.043 206.906 204.208 1.00 174.44 ? 382 GLN A C   1 
ATOM   2472  O  O   . GLN A 1 382 ? 132.103 208.137 204.318 1.00 177.92 ? 382 GLN A O   1 
ATOM   2473  C  CB  . GLN A 1 382 ? 129.484 207.085 204.075 1.00 179.07 ? 382 GLN A CB  1 
ATOM   2474  N  N   . PRO A 1 383 ? 133.158 206.157 203.971 1.00 165.39 ? 383 PRO A N   1 
ATOM   2475  C  CA  . PRO A 1 383 ? 134.473 206.814 203.821 1.00 164.16 ? 383 PRO A CA  1 
ATOM   2476  C  C   . PRO A 1 383 ? 134.608 207.613 202.522 1.00 166.91 ? 383 PRO A C   1 
ATOM   2477  O  O   . PRO A 1 383 ? 134.009 207.247 201.509 1.00 165.12 ? 383 PRO A O   1 
ATOM   2478  C  CB  . PRO A 1 383 ? 135.463 205.644 203.852 1.00 160.74 ? 383 PRO A CB  1 
ATOM   2479  C  CG  . PRO A 1 383 ? 134.678 204.455 204.351 1.00 163.96 ? 383 PRO A CG  1 
ATOM   2480  C  CD  . PRO A 1 383 ? 133.292 204.692 203.854 1.00 162.05 ? 383 PRO A CD  1 
ATOM   2481  N  N   . THR A 1 384 ? 135.403 208.705 202.562 1.00 164.19 ? 384 THR A N   1 
ATOM   2482  C  CA  . THR A 1 384 ? 135.623 209.623 201.438 1.00 164.14 ? 384 THR A CA  1 
ATOM   2483  C  C   . THR A 1 384 ? 136.364 208.928 200.283 1.00 160.28 ? 384 THR A C   1 
ATOM   2484  O  O   . THR A 1 384 ? 135.884 208.996 199.151 1.00 159.10 ? 384 THR A O   1 
ATOM   2485  C  CB  . THR A 1 384 ? 136.354 210.898 201.907 1.00 177.72 ? 384 THR A CB  1 
ATOM   2486  O  OG1 . THR A 1 384 ? 135.704 211.418 203.072 1.00 183.02 ? 384 THR A OG1 1 
ATOM   2487  C  CG2 . THR A 1 384 ? 136.408 211.977 200.828 1.00 178.99 ? 384 THR A CG2 1 
ATOM   2488  N  N   . LEU A 1 385 ? 137.509 208.266 200.564 1.00 151.77 ? 385 LEU A N   1 
ATOM   2489  C  CA  . LEU A 1 385 ? 138.319 207.563 199.556 1.00 145.92 ? 385 LEU A CA  1 
ATOM   2490  C  C   . LEU A 1 385 ? 137.521 206.451 198.879 1.00 145.33 ? 385 LEU A C   1 
ATOM   2491  O  O   . LEU A 1 385 ? 137.633 206.274 197.667 1.00 142.49 ? 385 LEU A O   1 
ATOM   2492  C  CB  . LEU A 1 385 ? 139.595 206.990 200.191 1.00 143.41 ? 385 LEU A CB  1 
ATOM   2493  C  CG  . LEU A 1 385 ? 140.661 206.450 199.235 1.00 143.75 ? 385 LEU A CG  1 
ATOM   2494  C  CD1 . LEU A 1 385 ? 141.559 207.564 198.713 1.00 145.62 ? 385 LEU A CD1 1 
ATOM   2495  C  CD2 . LEU A 1 385 ? 141.505 205.409 199.919 1.00 143.31 ? 385 LEU A CD2 1 
ATOM   2496  N  N   . ILE A 1 386 ? 136.712 205.721 199.666 1.00 141.67 ? 386 ILE A N   1 
ATOM   2497  C  CA  . ILE A 1 386 ? 135.842 204.638 199.202 1.00 139.23 ? 386 ILE A CA  1 
ATOM   2498  C  C   . ILE A 1 386 ? 134.748 205.226 198.287 1.00 145.36 ? 386 ILE A C   1 
ATOM   2499  O  O   . ILE A 1 386 ? 134.431 204.622 197.257 1.00 143.24 ? 386 ILE A O   1 
ATOM   2500  C  CB  . ILE A 1 386 ? 135.265 203.851 200.416 1.00 142.66 ? 386 ILE A CB  1 
ATOM   2501  C  CG1 . ILE A 1 386 ? 136.374 203.118 201.236 1.00 140.41 ? 386 ILE A CG1 1 
ATOM   2502  C  CG2 . ILE A 1 386 ? 134.119 202.920 200.030 1.00 142.36 ? 386 ILE A CG2 1 
ATOM   2503  C  CD1 . ILE A 1 386 ? 137.358 202.149 200.477 1.00 142.36 ? 386 ILE A CD1 1 
ATOM   2504  N  N   . GLY A 1 387 ? 134.232 206.408 198.652 1.00 145.67 ? 387 GLY A N   1 
ATOM   2505  C  CA  . GLY A 1 387 ? 133.238 207.137 197.866 1.00 148.37 ? 387 GLY A CA  1 
ATOM   2506  C  C   . GLY A 1 387 ? 133.773 207.496 196.492 1.00 149.64 ? 387 GLY A C   1 
ATOM   2507  O  O   . GLY A 1 387 ? 133.064 207.364 195.489 1.00 149.17 ? 387 GLY A O   1 
ATOM   2508  N  N   . LEU A 1 388 ? 135.058 207.905 196.445 1.00 144.06 ? 388 LEU A N   1 
ATOM   2509  C  CA  . LEU A 1 388 ? 135.771 208.234 195.214 1.00 141.90 ? 388 LEU A CA  1 
ATOM   2510  C  C   . LEU A 1 388 ? 135.936 206.983 194.359 1.00 141.92 ? 388 LEU A C   1 
ATOM   2511  O  O   . LEU A 1 388 ? 135.821 207.065 193.142 1.00 141.36 ? 388 LEU A O   1 
ATOM   2512  C  CB  . LEU A 1 388 ? 137.145 208.858 195.521 1.00 141.50 ? 388 LEU A CB  1 
ATOM   2513  C  CG  . LEU A 1 388 ? 137.164 210.320 195.962 1.00 150.66 ? 388 LEU A CG  1 
ATOM   2514  C  CD1 . LEU A 1 388 ? 138.353 210.594 196.854 1.00 151.03 ? 388 LEU A CD1 1 
ATOM   2515  C  CD2 . LEU A 1 388 ? 137.196 211.259 194.767 1.00 154.11 ? 388 LEU A CD2 1 
ATOM   2516  N  N   . LEU A 1 389 ? 136.158 205.823 195.002 1.00 135.73 ? 389 LEU A N   1 
ATOM   2517  C  CA  . LEU A 1 389 ? 136.333 204.544 194.322 1.00 131.74 ? 389 LEU A CA  1 
ATOM   2518  C  C   . LEU A 1 389 ? 135.020 204.020 193.740 1.00 137.12 ? 389 LEU A C   1 
ATOM   2519  O  O   . LEU A 1 389 ? 134.989 203.662 192.565 1.00 135.58 ? 389 LEU A O   1 
ATOM   2520  C  CB  . LEU A 1 389 ? 136.936 203.502 195.273 1.00 129.19 ? 389 LEU A CB  1 
ATOM   2521  C  CG  . LEU A 1 389 ? 138.419 203.648 195.581 1.00 132.72 ? 389 LEU A CG  1 
ATOM   2522  C  CD1 . LEU A 1 389 ? 138.742 203.089 196.948 1.00 132.76 ? 389 LEU A CD1 1 
ATOM   2523  C  CD2 . LEU A 1 389 ? 139.265 202.961 194.527 1.00 132.25 ? 389 LEU A CD2 1 
ATOM   2524  N  N   . ILE A 1 390 ? 133.946 203.977 194.548 1.00 136.46 ? 390 ILE A N   1 
ATOM   2525  C  CA  . ILE A 1 390 ? 132.634 203.457 194.154 1.00 137.91 ? 390 ILE A CA  1 
ATOM   2526  C  C   . ILE A 1 390 ? 132.008 204.296 193.020 1.00 145.85 ? 390 ILE A C   1 
ATOM   2527  O  O   . ILE A 1 390 ? 131.625 203.723 192.001 1.00 144.70 ? 390 ILE A O   1 
ATOM   2528  C  CB  . ILE A 1 390 ? 131.688 203.329 195.389 1.00 143.65 ? 390 ILE A CB  1 
ATOM   2529  C  CG1 . ILE A 1 390 ? 132.131 202.143 196.287 1.00 141.09 ? 390 ILE A CG1 1 
ATOM   2530  C  CG2 . ILE A 1 390 ? 130.206 203.188 194.979 1.00 147.25 ? 390 ILE A CG2 1 
ATOM   2531  C  CD1 . ILE A 1 390 ? 131.443 202.018 197.664 1.00 150.34 ? 390 ILE A CD1 1 
ATOM   2532  N  N   . ILE A 1 391 ? 131.921 205.628 193.183 1.00 146.74 ? 391 ILE A N   1 
ATOM   2533  C  CA  . ILE A 1 391 ? 131.282 206.509 192.198 1.00 150.02 ? 391 ILE A CA  1 
ATOM   2534  C  C   . ILE A 1 391 ? 132.141 206.647 190.915 1.00 152.03 ? 391 ILE A C   1 
ATOM   2535  O  O   . ILE A 1 391 ? 131.607 206.446 189.823 1.00 152.11 ? 391 ILE A O   1 
ATOM   2536  C  CB  . ILE A 1 391 ? 130.910 207.892 192.826 1.00 158.08 ? 391 ILE A CB  1 
ATOM   2537  C  CG1 . ILE A 1 391 ? 129.886 207.708 193.975 1.00 161.44 ? 391 ILE A CG1 1 
ATOM   2538  C  CG2 . ILE A 1 391 ? 130.357 208.865 191.775 1.00 162.02 ? 391 ILE A CG2 1 
ATOM   2539  C  CD1 . ILE A 1 391 ? 129.880 208.798 195.057 1.00 173.71 ? 391 ILE A CD1 1 
ATOM   2540  N  N   . PHE A 1 392 ? 133.443 206.969 191.042 1.00 146.57 ? 392 PHE A N   1 
ATOM   2541  C  CA  . PHE A 1 392 ? 134.313 207.182 189.883 1.00 144.61 ? 392 PHE A CA  1 
ATOM   2542  C  C   . PHE A 1 392 ? 134.670 205.903 189.116 1.00 146.15 ? 392 PHE A C   1 
ATOM   2543  O  O   . PHE A 1 392 ? 134.735 205.957 187.885 1.00 145.69 ? 392 PHE A O   1 
ATOM   2544  C  CB  . PHE A 1 392 ? 135.606 207.906 190.280 1.00 145.59 ? 392 PHE A CB  1 
ATOM   2545  C  CG  . PHE A 1 392 ? 135.484 209.400 190.454 1.00 151.46 ? 392 PHE A CG  1 
ATOM   2546  C  CD1 . PHE A 1 392 ? 135.046 209.942 191.654 1.00 157.83 ? 392 PHE A CD1 1 
ATOM   2547  C  CD2 . PHE A 1 392 ? 135.842 210.267 189.431 1.00 154.86 ? 392 PHE A CD2 1 
ATOM   2548  C  CE1 . PHE A 1 392 ? 134.948 211.327 191.817 1.00 163.64 ? 392 PHE A CE1 1 
ATOM   2549  C  CE2 . PHE A 1 392 ? 135.751 211.650 189.600 1.00 162.38 ? 392 PHE A CE2 1 
ATOM   2550  C  CZ  . PHE A 1 392 ? 135.298 212.171 190.788 1.00 163.97 ? 392 PHE A CZ  1 
ATOM   2551  N  N   . GLN A 1 393 ? 134.923 204.775 189.811 1.00 140.95 ? 393 GLN A N   1 
ATOM   2552  C  CA  . GLN A 1 393 ? 135.343 203.547 189.126 1.00 137.58 ? 393 GLN A CA  1 
ATOM   2553  C  C   . GLN A 1 393 ? 134.207 202.535 188.867 1.00 142.80 ? 393 GLN A C   1 
ATOM   2554  O  O   . GLN A 1 393 ? 134.420 201.621 188.062 1.00 141.02 ? 393 GLN A O   1 
ATOM   2555  C  CB  . GLN A 1 393 ? 136.487 202.853 189.884 1.00 135.50 ? 393 GLN A CB  1 
ATOM   2556  N  N   . PHE A 1 394 ? 133.020 202.678 189.506 1.00 141.69 ? 394 PHE A N   1 
ATOM   2557  C  CA  . PHE A 1 394 ? 131.953 201.700 189.275 1.00 141.83 ? 394 PHE A CA  1 
ATOM   2558  C  C   . PHE A 1 394 ? 130.655 202.317 188.753 1.00 149.01 ? 394 PHE A C   1 
ATOM   2559  O  O   . PHE A 1 394 ? 130.109 201.794 187.785 1.00 148.98 ? 394 PHE A O   1 
ATOM   2560  C  CB  . PHE A 1 394 ? 131.670 200.865 190.533 1.00 143.28 ? 394 PHE A CB  1 
ATOM   2561  C  CG  . PHE A 1 394 ? 132.848 200.058 191.028 1.00 141.03 ? 394 PHE A CG  1 
ATOM   2562  C  CD1 . PHE A 1 394 ? 133.370 199.015 190.267 1.00 141.26 ? 394 PHE A CD1 1 
ATOM   2563  C  CD2 . PHE A 1 394 ? 133.425 200.326 192.264 1.00 142.83 ? 394 PHE A CD2 1 
ATOM   2564  C  CE1 . PHE A 1 394 ? 134.460 198.271 190.725 1.00 138.83 ? 394 PHE A CE1 1 
ATOM   2565  C  CE2 . PHE A 1 394 ? 134.511 199.577 192.726 1.00 142.27 ? 394 PHE A CE2 1 
ATOM   2566  C  CZ  . PHE A 1 394 ? 135.020 198.554 191.954 1.00 137.50 ? 394 PHE A CZ  1 
ATOM   2567  N  N   . ILE A 1 395 ? 130.146 203.390 189.392 1.00 148.55 ? 395 ILE A N   1 
ATOM   2568  C  CA  . ILE A 1 395 ? 128.890 204.052 188.994 1.00 152.76 ? 395 ILE A CA  1 
ATOM   2569  C  C   . ILE A 1 395 ? 129.080 204.782 187.643 1.00 158.25 ? 395 ILE A C   1 
ATOM   2570  O  O   . ILE A 1 395 ? 128.192 204.725 186.789 1.00 160.24 ? 395 ILE A O   1 
ATOM   2571  C  CB  . ILE A 1 395 ? 128.366 205.006 190.118 1.00 159.11 ? 395 ILE A CB  1 
ATOM   2572  C  CG1 . ILE A 1 395 ? 128.234 204.298 191.501 1.00 157.86 ? 395 ILE A CG1 1 
ATOM   2573  C  CG2 . ILE A 1 395 ? 127.073 205.746 189.731 1.00 165.58 ? 395 ILE A CG2 1 
ATOM   2574  C  CD1 . ILE A 1 395 ? 127.250 203.076 191.615 1.00 161.19 ? 395 ILE A CD1 1 
ATOM   2575  N  N   . PHE A 1 396 ? 130.247 205.425 187.446 1.00 153.41 ? 396 PHE A N   1 
ATOM   2576  C  CA  . PHE A 1 396 ? 130.575 206.156 186.223 1.00 154.21 ? 396 PHE A CA  1 
ATOM   2577  C  C   . PHE A 1 396 ? 131.049 205.235 185.089 1.00 155.83 ? 396 PHE A C   1 
ATOM   2578  O  O   . PHE A 1 396 ? 131.236 205.728 183.975 1.00 156.55 ? 396 PHE A O   1 
ATOM   2579  C  CB  . PHE A 1 396 ? 131.651 207.223 186.497 1.00 155.75 ? 396 PHE A CB  1 
ATOM   2580  C  CG  . PHE A 1 396 ? 131.238 208.446 187.284 1.00 161.83 ? 396 PHE A CG  1 
ATOM   2581  C  CD1 . PHE A 1 396 ? 129.895 208.767 187.459 1.00 169.75 ? 396 PHE A CD1 1 
ATOM   2582  C  CD2 . PHE A 1 396 ? 132.195 209.307 187.809 1.00 164.26 ? 396 PHE A CD2 1 
ATOM   2583  C  CE1 . PHE A 1 396 ? 129.519 209.904 188.179 1.00 175.42 ? 396 PHE A CE1 1 
ATOM   2584  C  CE2 . PHE A 1 396 ? 131.819 210.443 188.529 1.00 171.92 ? 396 PHE A CE2 1 
ATOM   2585  C  CZ  . PHE A 1 396 ? 130.484 210.738 188.702 1.00 174.67 ? 396 PHE A CZ  1 
ATOM   2586  N  N   . SER A 1 397 ? 131.237 203.913 185.358 1.00 149.25 ? 397 SER A N   1 
ATOM   2587  C  CA  . SER A 1 397 ? 131.693 202.912 184.376 1.00 146.05 ? 397 SER A CA  1 
ATOM   2588  C  C   . SER A 1 397 ? 130.981 203.046 183.002 1.00 151.41 ? 397 SER A C   1 
ATOM   2589  O  O   . SER A 1 397 ? 131.710 203.150 182.015 1.00 150.04 ? 397 SER A O   1 
ATOM   2590  C  CB  . SER A 1 397 ? 131.546 201.492 184.913 1.00 148.05 ? 397 SER A CB  1 
ATOM   2591  O  OG  . SER A 1 397 ? 132.452 201.249 185.976 1.00 155.44 ? 397 SER A OG  1 
ATOM   2592  N  N   . PRO A 1 398 ? 129.623 203.136 182.879 1.00 150.63 ? 398 PRO A N   1 
ATOM   2593  C  CA  . PRO A 1 398 ? 129.031 203.315 181.539 1.00 152.77 ? 398 PRO A CA  1 
ATOM   2594  C  C   . PRO A 1 398 ? 129.501 204.592 180.837 1.00 156.59 ? 398 PRO A C   1 
ATOM   2595  O  O   . PRO A 1 398 ? 129.842 204.520 179.657 1.00 155.46 ? 398 PRO A O   1 
ATOM   2596  C  CB  . PRO A 1 398 ? 127.523 203.336 181.805 1.00 159.38 ? 398 PRO A CB  1 
ATOM   2597  C  CG  . PRO A 1 398 ? 127.383 203.648 183.248 1.00 164.34 ? 398 PRO A CG  1 
ATOM   2598  C  CD  . PRO A 1 398 ? 128.567 203.036 183.909 1.00 154.62 ? 398 PRO A CD  1 
ATOM   2599  N  N   . TYR A 1 399 ? 129.572 205.732 181.568 1.00 154.36 ? 399 TYR A N   1 
ATOM   2600  C  CA  . TYR A 1 399 ? 130.028 207.026 181.045 1.00 155.87 ? 399 TYR A CA  1 
ATOM   2601  C  C   . TYR A 1 399 ? 131.504 206.948 180.640 1.00 156.05 ? 399 TYR A C   1 
ATOM   2602  O  O   . TYR A 1 399 ? 131.860 207.377 179.541 1.00 156.52 ? 399 TYR A O   1 
ATOM   2603  C  CB  . TYR A 1 399 ? 129.797 208.153 182.076 1.00 159.78 ? 399 TYR A CB  1 
ATOM   2604  C  CG  . TYR A 1 399 ? 130.602 209.415 181.828 1.00 162.29 ? 399 TYR A CG  1 
ATOM   2605  C  CD1 . TYR A 1 399 ? 130.200 210.347 180.875 1.00 168.21 ? 399 TYR A CD1 1 
ATOM   2606  C  CD2 . TYR A 1 399 ? 131.751 209.689 182.565 1.00 160.42 ? 399 TYR A CD2 1 
ATOM   2607  C  CE1 . TYR A 1 399 ? 130.936 211.510 180.643 1.00 170.12 ? 399 TYR A CE1 1 
ATOM   2608  C  CE2 . TYR A 1 399 ? 132.493 210.849 182.343 1.00 162.76 ? 399 TYR A CE2 1 
ATOM   2609  C  CZ  . TYR A 1 399 ? 132.079 211.761 181.385 1.00 173.66 ? 399 TYR A CZ  1 
ATOM   2610  O  OH  . TYR A 1 399 ? 132.804 212.911 181.168 1.00 175.60 ? 399 TYR A OH  1 
ATOM   2611  N  N   . ASN A 1 400 ? 132.348 206.394 181.529 1.00 148.60 ? 400 ASN A N   1 
ATOM   2612  C  CA  . ASN A 1 400 ? 133.783 206.226 181.317 1.00 144.59 ? 400 ASN A CA  1 
ATOM   2613  C  C   . ASN A 1 400 ? 134.067 205.404 180.056 1.00 146.28 ? 400 ASN A C   1 
ATOM   2614  O  O   . ASN A 1 400 ? 135.011 205.730 179.343 1.00 144.96 ? 400 ASN A O   1 
ATOM   2615  C  CB  . ASN A 1 400 ? 134.437 205.567 182.539 1.00 143.26 ? 400 ASN A CB  1 
ATOM   2616  C  CG  . ASN A 1 400 ? 134.387 206.377 183.819 1.00 172.07 ? 400 ASN A CG  1 
ATOM   2617  O  OD1 . ASN A 1 400 ? 134.380 207.619 183.816 1.00 171.98 ? 400 ASN A OD1 1 
ATOM   2618  N  ND2 . ASN A 1 400 ? 134.392 205.681 184.952 1.00 160.71 ? 400 ASN A ND2 1 
ATOM   2619  N  N   . GLU A 1 401 ? 133.245 204.365 179.772 1.00 142.47 ? 401 GLU A N   1 
ATOM   2620  C  CA  . GLU A 1 401 ? 133.389 203.498 178.598 1.00 140.90 ? 401 GLU A CA  1 
ATOM   2621  C  C   . GLU A 1 401 ? 133.008 204.216 177.311 1.00 146.55 ? 401 GLU A C   1 
ATOM   2622  O  O   . GLU A 1 401 ? 133.676 204.012 176.294 1.00 145.21 ? 401 GLU A O   1 
ATOM   2623  C  CB  . GLU A 1 401 ? 132.561 202.213 178.737 1.00 142.37 ? 401 GLU A CB  1 
ATOM   2624  C  CG  . GLU A 1 401 ? 133.302 201.074 179.424 1.00 152.78 ? 401 GLU A CG  1 
ATOM   2625  C  CD  . GLU A 1 401 ? 134.569 200.564 178.757 1.00 181.78 ? 401 GLU A CD  1 
ATOM   2626  O  OE1 . GLU A 1 401 ? 134.603 200.466 177.507 1.00 185.25 ? 401 GLU A OE1 1 
ATOM   2627  O  OE2 . GLU A 1 401 ? 135.528 200.244 179.496 1.00 176.98 ? 401 GLU A OE2 1 
ATOM   2628  N  N   . VAL A 1 402 ? 131.939 205.042 177.348 1.00 146.06 ? 402 VAL A N   1 
ATOM   2629  C  CA  . VAL A 1 402 ? 131.457 205.813 176.195 1.00 149.18 ? 402 VAL A CA  1 
ATOM   2630  C  C   . VAL A 1 402 ? 132.492 206.903 175.875 1.00 151.87 ? 402 VAL A C   1 
ATOM   2631  O  O   . VAL A 1 402 ? 132.932 206.989 174.727 1.00 151.25 ? 402 VAL A O   1 
ATOM   2632  C  CB  . VAL A 1 402 ? 130.020 206.383 176.415 1.00 158.13 ? 402 VAL A CB  1 
ATOM   2633  C  CG1 . VAL A 1 402 ? 129.638 207.402 175.342 1.00 162.27 ? 402 VAL A CG1 1 
ATOM   2634  C  CG2 . VAL A 1 402 ? 128.985 205.262 176.471 1.00 158.76 ? 402 VAL A CG2 1 
ATOM   2635  N  N   . LEU A 1 403 ? 132.915 207.684 176.897 1.00 148.17 ? 403 LEU A N   1 
ATOM   2636  C  CA  . LEU A 1 403 ? 133.909 208.758 176.780 1.00 148.42 ? 403 LEU A CA  1 
ATOM   2637  C  C   . LEU A 1 403 ? 135.232 208.234 176.200 1.00 149.89 ? 403 LEU A C   1 
ATOM   2638  O  O   . LEU A 1 403 ? 135.817 208.900 175.344 1.00 150.74 ? 403 LEU A O   1 
ATOM   2639  C  CB  . LEU A 1 403 ? 134.154 209.417 178.146 1.00 148.63 ? 403 LEU A CB  1 
ATOM   2640  C  CG  . LEU A 1 403 ? 135.029 210.667 178.151 1.00 154.65 ? 403 LEU A CG  1 
ATOM   2641  C  CD1 . LEU A 1 403 ? 134.189 211.920 178.121 1.00 160.51 ? 403 LEU A CD1 1 
ATOM   2642  C  CD2 . LEU A 1 403 ? 135.934 210.686 179.358 1.00 155.18 ? 403 LEU A CD2 1 
ATOM   2643  N  N   . SER A 1 404 ? 135.685 207.041 176.651 1.00 143.02 ? 404 SER A N   1 
ATOM   2644  C  CA  . SER A 1 404 ? 136.915 206.397 176.178 1.00 139.32 ? 404 SER A CA  1 
ATOM   2645  C  C   . SER A 1 404 ? 136.804 206.015 174.711 1.00 143.87 ? 404 SER A C   1 
ATOM   2646  O  O   . SER A 1 404 ? 137.782 206.171 173.980 1.00 143.00 ? 404 SER A O   1 
ATOM   2647  C  CB  . SER A 1 404 ? 137.242 205.163 177.008 1.00 139.42 ? 404 SER A CB  1 
ATOM   2648  O  OG  . SER A 1 404 ? 137.655 205.531 178.314 1.00 148.32 ? 404 SER A OG  1 
ATOM   2649  N  N   . PHE A 1 405 ? 135.615 205.536 174.278 1.00 141.94 ? 405 PHE A N   1 
ATOM   2650  C  CA  . PHE A 1 405 ? 135.363 205.173 172.884 1.00 143.00 ? 405 PHE A CA  1 
ATOM   2651  C  C   . PHE A 1 405 ? 135.364 206.428 172.010 1.00 149.81 ? 405 PHE A C   1 
ATOM   2652  O  O   . PHE A 1 405 ? 135.929 206.402 170.917 1.00 149.33 ? 405 PHE A O   1 
ATOM   2653  C  CB  . PHE A 1 405 ? 134.047 204.390 172.723 1.00 146.69 ? 405 PHE A CB  1 
ATOM   2654  C  CG  . PHE A 1 405 ? 133.685 204.103 171.280 1.00 150.38 ? 405 PHE A CG  1 
ATOM   2655  C  CD1 . PHE A 1 405 ? 134.389 203.156 170.542 1.00 151.20 ? 405 PHE A CD1 1 
ATOM   2656  C  CD2 . PHE A 1 405 ? 132.664 204.801 170.652 1.00 157.24 ? 405 PHE A CD2 1 
ATOM   2657  C  CE1 . PHE A 1 405 ? 134.068 202.905 169.205 1.00 154.47 ? 405 PHE A CE1 1 
ATOM   2658  C  CE2 . PHE A 1 405 ? 132.345 204.550 169.314 1.00 162.57 ? 405 PHE A CE2 1 
ATOM   2659  C  CZ  . PHE A 1 405 ? 133.048 203.602 168.600 1.00 158.28 ? 405 PHE A CZ  1 
ATOM   2660  N  N   . CYS A 1 406 ? 134.751 207.520 172.503 1.00 149.28 ? 406 CYS A N   1 
ATOM   2661  C  CA  . CYS A 1 406 ? 134.682 208.803 171.809 1.00 153.02 ? 406 CYS A CA  1 
ATOM   2662  C  C   . CYS A 1 406 ? 136.078 209.413 171.674 1.00 154.93 ? 406 CYS A C   1 
ATOM   2663  O  O   . CYS A 1 406 ? 136.398 209.956 170.620 1.00 156.85 ? 406 CYS A O   1 
ATOM   2664  C  CB  . CYS A 1 406 ? 133.725 209.757 172.517 1.00 157.43 ? 406 CYS A CB  1 
ATOM   2665  S  SG  . CYS A 1 406 ? 131.986 209.253 172.446 1.00 164.92 ? 406 CYS A SG  1 
ATOM   2666  N  N   . LEU A 1 407 ? 136.914 209.294 172.718 1.00 147.91 ? 407 LEU A N   1 
ATOM   2667  C  CA  . LEU A 1 407 ? 138.277 209.817 172.699 1.00 146.72 ? 407 LEU A CA  1 
ATOM   2668  C  C   . LEU A 1 407 ? 139.207 208.974 171.795 1.00 148.72 ? 407 LEU A C   1 
ATOM   2669  O  O   . LEU A 1 407 ? 140.185 209.515 171.272 1.00 149.08 ? 407 LEU A O   1 
ATOM   2670  C  CB  . LEU A 1 407 ? 138.843 209.920 174.118 1.00 144.87 ? 407 LEU A CB  1 
ATOM   2671  C  CG  . LEU A 1 407 ? 138.400 211.155 174.903 1.00 153.21 ? 407 LEU A CG  1 
ATOM   2672  C  CD1 . LEU A 1 407 ? 138.407 210.884 176.388 1.00 151.79 ? 407 LEU A CD1 1 
ATOM   2673  C  CD2 . LEU A 1 407 ? 139.261 212.372 174.572 1.00 158.15 ? 407 LEU A CD2 1 
ATOM   2674  N  N   . THR A 1 408 ? 138.886 207.674 171.588 1.00 142.67 ? 408 THR A N   1 
ATOM   2675  C  CA  . THR A 1 408 ? 139.629 206.770 170.700 1.00 140.02 ? 408 THR A CA  1 
ATOM   2676  C  C   . THR A 1 408 ? 139.309 207.158 169.247 1.00 146.73 ? 408 THR A C   1 
ATOM   2677  O  O   . THR A 1 408 ? 140.213 207.172 168.409 1.00 146.45 ? 408 THR A O   1 
ATOM   2678  C  CB  . THR A 1 408 ? 139.297 205.302 171.022 1.00 145.06 ? 408 THR A CB  1 
ATOM   2679  O  OG1 . THR A 1 408 ? 139.664 205.040 172.377 1.00 141.87 ? 408 THR A OG1 1 
ATOM   2680  C  CG2 . THR A 1 408 ? 140.010 204.310 170.102 1.00 142.49 ? 408 THR A CG2 1 
ATOM   2681  N  N   . VAL A 1 409 ? 138.025 207.494 168.966 1.00 145.77 ? 409 VAL A N   1 
ATOM   2682  C  CA  . VAL A 1 409 ? 137.536 207.945 167.657 1.00 148.86 ? 409 VAL A CA  1 
ATOM   2683  C  C   . VAL A 1 409 ? 138.232 209.277 167.322 1.00 154.67 ? 409 VAL A C   1 
ATOM   2684  O  O   . VAL A 1 409 ? 138.730 209.437 166.207 1.00 155.01 ? 409 VAL A O   1 
ATOM   2685  C  CB  . VAL A 1 409 ? 135.981 208.056 167.630 1.00 156.17 ? 409 VAL A CB  1 
ATOM   2686  C  CG1 . VAL A 1 409 ? 135.474 208.786 166.387 1.00 160.75 ? 409 VAL A CG1 1 
ATOM   2687  C  CG2 . VAL A 1 409 ? 135.329 206.683 167.735 1.00 154.50 ? 409 VAL A CG2 1 
ATOM   2688  N  N   . LEU A 1 410 ? 138.308 210.195 168.313 1.00 152.51 ? 410 LEU A N   1 
ATOM   2689  C  CA  . LEU A 1 410 ? 138.951 211.506 168.201 1.00 155.07 ? 410 LEU A CA  1 
ATOM   2690  C  C   . LEU A 1 410 ? 140.451 211.358 167.938 1.00 158.62 ? 410 LEU A C   1 
ATOM   2691  O  O   . LEU A 1 410 ? 140.978 212.062 167.077 1.00 160.89 ? 410 LEU A O   1 
ATOM   2692  C  CB  . LEU A 1 410 ? 138.713 212.340 169.466 1.00 156.16 ? 410 LEU A CB  1 
ATOM   2693  N  N   . SER A 1 411 ? 141.123 210.423 168.651 1.00 151.98 ? 411 SER A N   1 
ATOM   2694  C  CA  . SER A 1 411 ? 142.556 210.139 168.512 1.00 149.94 ? 411 SER A CA  1 
ATOM   2695  C  C   . SER A 1 411 ? 142.915 209.741 167.071 1.00 155.58 ? 411 SER A C   1 
ATOM   2696  O  O   . SER A 1 411 ? 143.945 210.188 166.561 1.00 155.92 ? 411 SER A O   1 
ATOM   2697  C  CB  . SER A 1 411 ? 142.978 209.039 169.482 1.00 149.61 ? 411 SER A CB  1 
ATOM   2698  O  OG  . SER A 1 411 ? 144.345 208.691 169.326 1.00 156.77 ? 411 SER A OG  1 
ATOM   2699  N  N   . ARG A 1 412 ? 142.057 208.923 166.419 1.00 152.88 ? 412 ARG A N   1 
ATOM   2700  C  CA  . ARG A 1 412 ? 142.238 208.473 165.036 1.00 153.73 ? 412 ARG A CA  1 
ATOM   2701  C  C   . ARG A 1 412 ? 142.117 209.649 164.071 1.00 163.22 ? 412 ARG A C   1 
ATOM   2702  O  O   . ARG A 1 412 ? 142.926 209.759 163.148 1.00 163.41 ? 412 ARG A O   1 
ATOM   2703  C  CB  . ARG A 1 412 ? 141.228 207.379 164.666 1.00 152.57 ? 412 ARG A CB  1 
ATOM   2704  C  CG  . ARG A 1 412 ? 141.499 206.035 165.327 1.00 153.59 ? 412 ARG A CG  1 
ATOM   2705  C  CD  . ARG A 1 412 ? 140.751 204.906 164.647 1.00 160.74 ? 412 ARG A CD  1 
ATOM   2706  N  NE  . ARG A 1 412 ? 139.302 205.000 164.835 1.00 170.81 ? 412 ARG A NE  1 
ATOM   2707  C  CZ  . ARG A 1 412 ? 138.625 204.402 165.810 1.00 182.08 ? 412 ARG A CZ  1 
ATOM   2708  N  NH1 . ARG A 1 412 ? 139.259 203.655 166.707 1.00 163.78 ? 412 ARG A NH1 1 
ATOM   2709  N  NH2 . ARG A 1 412 ? 137.311 204.539 165.895 1.00 171.69 ? 412 ARG A NH2 1 
ATOM   2710  N  N   . ARG A 1 413 ? 141.126 210.539 164.303 1.00 164.18 ? 413 ARG A N   1 
ATOM   2711  C  CA  . ARG A 1 413 ? 140.890 211.740 163.497 1.00 169.31 ? 413 ARG A CA  1 
ATOM   2712  C  C   . ARG A 1 413 ? 142.038 212.738 163.674 1.00 175.41 ? 413 ARG A C   1 
ATOM   2713  O  O   . ARG A 1 413 ? 142.422 213.399 162.708 1.00 178.02 ? 413 ARG A O   1 
ATOM   2714  C  CB  . ARG A 1 413 ? 139.547 212.392 163.861 1.00 172.93 ? 413 ARG A CB  1 
ATOM   2715  N  N   . PHE A 1 414 ? 142.598 212.818 164.903 1.00 170.39 ? 414 PHE A N   1 
ATOM   2716  C  CA  . PHE A 1 414 ? 143.724 213.685 165.262 1.00 171.03 ? 414 PHE A CA  1 
ATOM   2717  C  C   . PHE A 1 414 ? 145.020 213.203 164.604 1.00 174.12 ? 414 PHE A C   1 
ATOM   2718  O  O   . PHE A 1 414 ? 145.887 214.021 164.293 1.00 175.76 ? 414 PHE A O   1 
ATOM   2719  C  CB  . PHE A 1 414 ? 143.896 213.743 166.787 1.00 170.81 ? 414 PHE A CB  1 
ATOM   2720  N  N   . GLU A 1 415 ? 145.151 211.877 164.396 1.00 167.92 ? 415 GLU A N   1 
ATOM   2721  C  CA  . GLU A 1 415 ? 146.318 211.271 163.756 1.00 166.33 ? 415 GLU A CA  1 
ATOM   2722  C  C   . GLU A 1 415 ? 146.296 211.530 162.247 1.00 173.57 ? 415 GLU A C   1 
ATOM   2723  O  O   . GLU A 1 415 ? 147.340 211.839 161.673 1.00 173.74 ? 415 GLU A O   1 
ATOM   2724  C  CB  . GLU A 1 415 ? 146.398 209.768 164.063 1.00 163.75 ? 415 GLU A CB  1 
ATOM   2725  C  CG  . GLU A 1 415 ? 147.048 209.460 165.404 1.00 170.78 ? 415 GLU A CG  1 
ATOM   2726  C  CD  . GLU A 1 415 ? 148.526 209.796 165.487 1.00 191.32 ? 415 GLU A CD  1 
ATOM   2727  O  OE1 . GLU A 1 415 ? 149.314 209.184 164.731 1.00 186.85 ? 415 GLU A OE1 1 
ATOM   2728  O  OE2 . GLU A 1 415 ? 148.899 210.677 166.295 1.00 186.26 ? 415 GLU A OE2 1 
ATOM   2729  N  N   . PHE A 1 416 ? 145.102 211.440 161.621 1.00 172.93 ? 416 PHE A N   1 
ATOM   2730  C  CA  . PHE A 1 416 ? 144.899 211.708 160.196 1.00 176.78 ? 416 PHE A CA  1 
ATOM   2731  C  C   . PHE A 1 416 ? 145.206 213.165 159.866 1.00 184.83 ? 416 PHE A C   1 
ATOM   2732  O  O   . PHE A 1 416 ? 145.758 213.441 158.799 1.00 186.63 ? 416 PHE A O   1 
ATOM   2733  C  CB  . PHE A 1 416 ? 143.460 211.379 159.768 1.00 180.80 ? 416 PHE A CB  1 
ATOM   2734  C  CG  . PHE A 1 416 ? 143.206 209.963 159.308 1.00 180.95 ? 416 PHE A CG  1 
ATOM   2735  C  CD1 . PHE A 1 416 ? 143.854 209.450 158.186 1.00 184.73 ? 416 PHE A CD1 1 
ATOM   2736  C  CD2 . PHE A 1 416 ? 142.264 209.167 159.947 1.00 181.86 ? 416 PHE A CD2 1 
ATOM   2737  C  CE1 . PHE A 1 416 ? 143.606 208.145 157.751 1.00 184.63 ? 416 PHE A CE1 1 
ATOM   2738  C  CE2 . PHE A 1 416 ? 142.000 207.871 159.498 1.00 183.78 ? 416 PHE A CE2 1 
ATOM   2739  C  CZ  . PHE A 1 416 ? 142.681 207.364 158.410 1.00 182.36 ? 416 PHE A CZ  1 
ATOM   2740  N  N   . GLN A 1 417 ? 144.840 214.091 160.784 1.00 182.61 ? 417 GLN A N   1 
ATOM   2741  C  CA  . GLN A 1 417 ? 145.068 215.534 160.667 1.00 186.24 ? 417 GLN A CA  1 
ATOM   2742  C  C   . GLN A 1 417 ? 146.567 215.837 160.726 1.00 188.66 ? 417 GLN A C   1 
ATOM   2743  O  O   . GLN A 1 417 ? 147.046 216.680 159.965 1.00 191.67 ? 417 GLN A O   1 
ATOM   2744  C  CB  . GLN A 1 417 ? 144.312 216.298 161.768 1.00 188.94 ? 417 GLN A CB  1 
ATOM   2745  N  N   . ALA A 1 418 ? 147.304 215.121 161.605 1.00 180.23 ? 418 ALA A N   1 
ATOM   2746  C  CA  . ALA A 1 418 ? 148.753 215.244 161.770 1.00 178.73 ? 418 ALA A CA  1 
ATOM   2747  C  C   . ALA A 1 418 ? 149.495 214.672 160.556 1.00 181.61 ? 418 ALA A C   1 
ATOM   2748  O  O   . ALA A 1 418 ? 150.563 215.181 160.210 1.00 182.66 ? 418 ALA A O   1 
ATOM   2749  C  CB  . ALA A 1 418 ? 149.192 214.538 163.035 1.00 175.39 ? 418 ALA A CB  1 
ATOM   2750  N  N   . ASP A 1 419 ? 148.920 213.629 159.906 1.00 176.21 ? 419 ASP A N   1 
ATOM   2751  C  CA  . ASP A 1 419 ? 149.476 213.003 158.699 1.00 175.95 ? 419 ASP A CA  1 
ATOM   2752  C  C   . ASP A 1 419 ? 149.267 213.920 157.497 1.00 182.05 ? 419 ASP A C   1 
ATOM   2753  O  O   . ASP A 1 419 ? 150.139 214.003 156.634 1.00 182.65 ? 419 ASP A O   1 
ATOM   2754  C  CB  . ASP A 1 419 ? 148.848 211.624 158.442 1.00 175.88 ? 419 ASP A CB  1 
ATOM   2755  C  CG  . ASP A 1 419 ? 149.279 210.538 159.413 1.00 186.08 ? 419 ASP A CG  1 
ATOM   2756  O  OD1 . ASP A 1 419 ? 150.490 210.466 159.731 1.00 185.94 ? 419 ASP A OD1 1 
ATOM   2757  O  OD2 . ASP A 1 419 ? 148.414 209.734 159.823 1.00 191.90 ? 419 ASP A OD2 1 
ATOM   2758  N  N   . ALA A 1 420 ? 148.113 214.622 157.464 1.00 180.12 ? 420 ALA A N   1 
ATOM   2759  C  CA  . ALA A 1 420 ? 147.744 215.598 156.437 1.00 184.38 ? 420 ALA A CA  1 
ATOM   2760  C  C   . ALA A 1 420 ? 148.643 216.832 156.530 1.00 189.72 ? 420 ALA A C   1 
ATOM   2761  O  O   . ALA A 1 420 ? 148.945 217.446 155.504 1.00 193.06 ? 420 ALA A O   1 
ATOM   2762  C  CB  . ALA A 1 420 ? 146.284 215.997 156.594 1.00 187.23 ? 420 ALA A CB  1 
ATOM   2763  N  N   . PHE A 1 421 ? 149.074 217.184 157.764 1.00 183.59 ? 421 PHE A N   1 
ATOM   2764  C  CA  . PHE A 1 421 ? 149.976 218.299 158.047 1.00 185.42 ? 421 PHE A CA  1 
ATOM   2765  C  C   . PHE A 1 421 ? 151.383 217.968 157.546 1.00 186.80 ? 421 PHE A C   1 
ATOM   2766  O  O   . PHE A 1 421 ? 152.078 218.861 157.060 1.00 190.43 ? 421 PHE A O   1 
ATOM   2767  C  CB  . PHE A 1 421 ? 149.993 218.621 159.552 1.00 185.99 ? 421 PHE A CB  1 
ATOM   2768  C  CG  . PHE A 1 421 ? 150.775 219.860 159.927 1.00 191.20 ? 421 PHE A CG  1 
ATOM   2769  C  CD1 . PHE A 1 421 ? 150.173 221.113 159.916 1.00 199.52 ? 421 PHE A CD1 1 
ATOM   2770  C  CD2 . PHE A 1 421 ? 152.110 219.773 160.300 1.00 192.31 ? 421 PHE A CD2 1 
ATOM   2771  C  CE1 . PHE A 1 421 ? 150.896 222.257 160.267 1.00 204.20 ? 421 PHE A CE1 1 
ATOM   2772  C  CE2 . PHE A 1 421 ? 152.829 220.915 160.660 1.00 198.94 ? 421 PHE A CE2 1 
ATOM   2773  C  CZ  . PHE A 1 421 ? 152.221 222.150 160.632 1.00 201.97 ? 421 PHE A CZ  1 
ATOM   2774  N  N   . ALA A 1 422 ? 151.797 216.688 157.664 1.00 177.18 ? 422 ALA A N   1 
ATOM   2775  C  CA  . ALA A 1 422 ? 153.097 216.197 157.196 1.00 175.54 ? 422 ALA A CA  1 
ATOM   2776  C  C   . ALA A 1 422 ? 153.165 216.246 155.665 1.00 180.96 ? 422 ALA A C   1 
ATOM   2777  O  O   . ALA A 1 422 ? 154.225 216.542 155.109 1.00 182.40 ? 422 ALA A O   1 
ATOM   2778  C  CB  . ALA A 1 422 ? 153.333 214.780 157.694 1.00 171.43 ? 422 ALA A CB  1 
ATOM   2779  N  N   . LYS A 1 423 ? 152.018 215.983 154.995 1.00 177.24 ? 423 LYS A N   1 
ATOM   2780  C  CA  . LYS A 1 423 ? 151.863 216.044 153.538 1.00 179.58 ? 423 LYS A CA  1 
ATOM   2781  C  C   . LYS A 1 423 ? 151.880 217.498 153.085 1.00 187.04 ? 423 LYS A C   1 
ATOM   2782  O  O   . LYS A 1 423 ? 152.402 217.794 152.010 1.00 189.50 ? 423 LYS A O   1 
ATOM   2783  C  CB  . LYS A 1 423 ? 150.566 215.352 153.092 1.00 181.44 ? 423 LYS A CB  1 
ATOM   2784  N  N   . LYS A 1 424 ? 151.331 218.404 153.927 1.00 183.96 ? 424 LYS A N   1 
ATOM   2785  C  CA  . LYS A 1 424 ? 151.287 219.851 153.704 1.00 188.66 ? 424 LYS A CA  1 
ATOM   2786  C  C   . LYS A 1 424 ? 152.694 220.458 153.810 1.00 193.66 ? 424 LYS A C   1 
ATOM   2787  O  O   . LYS A 1 424 ? 152.937 221.521 153.237 1.00 198.71 ? 424 LYS A O   1 
ATOM   2788  C  CB  . LYS A 1 424 ? 150.330 220.528 154.697 1.00 191.86 ? 424 LYS A CB  1 
ATOM   2789  N  N   . LEU A 1 425 ? 153.615 219.779 154.529 1.00 185.35 ? 425 LEU A N   1 
ATOM   2790  C  CA  . LEU A 1 425 ? 155.012 220.193 154.677 1.00 186.13 ? 425 LEU A CA  1 
ATOM   2791  C  C   . LEU A 1 425 ? 155.856 219.697 153.494 1.00 190.73 ? 425 LEU A C   1 
ATOM   2792  O  O   . LEU A 1 425 ? 156.968 220.188 153.288 1.00 192.77 ? 425 LEU A O   1 
ATOM   2793  C  CB  . LEU A 1 425 ? 155.603 219.678 155.999 1.00 182.23 ? 425 LEU A CB  1 
ATOM   2794  C  CG  . LEU A 1 425 ? 155.150 220.378 157.281 1.00 186.98 ? 425 LEU A CG  1 
ATOM   2795  C  CD1 . LEU A 1 425 ? 155.385 219.494 158.479 1.00 182.48 ? 425 LEU A CD1 1 
ATOM   2796  C  CD2 . LEU A 1 425 ? 155.863 221.709 157.475 1.00 193.76 ? 425 LEU A CD2 1 
ATOM   2797  N  N   . GLY A 1 426 ? 155.313 218.737 152.739 1.00 185.61 ? 426 GLY A N   1 
ATOM   2798  C  CA  . GLY A 1 426 ? 155.950 218.149 151.564 1.00 186.33 ? 426 GLY A CA  1 
ATOM   2799  C  C   . GLY A 1 426 ? 156.634 216.817 151.801 1.00 186.31 ? 426 GLY A C   1 
ATOM   2800  O  O   . GLY A 1 426 ? 157.068 216.170 150.844 1.00 186.65 ? 426 GLY A O   1 
ATOM   2801  N  N   . LYS A 1 427 ? 156.727 216.388 153.075 1.00 178.84 ? 427 LYS A N   1 
ATOM   2802  C  CA  . LYS A 1 427 ? 157.377 215.140 153.480 1.00 174.77 ? 427 LYS A CA  1 
ATOM   2803  C  C   . LYS A 1 427 ? 156.386 213.948 153.477 1.00 174.88 ? 427 LYS A C   1 
ATOM   2804  O  O   . LYS A 1 427 ? 156.511 213.037 154.300 1.00 170.76 ? 427 LYS A O   1 
ATOM   2805  C  CB  . LYS A 1 427 ? 158.030 215.314 154.867 1.00 175.59 ? 427 LYS A CB  1 
ATOM   2806  C  CG  . LYS A 1 427 ? 159.228 216.259 154.878 1.00 193.60 ? 427 LYS A CG  1 
ATOM   2807  N  N   . ALA A 1 428 ? 155.431 213.944 152.523 1.00 173.08 ? 428 ALA A N   1 
ATOM   2808  C  CA  . ALA A 1 428 ? 154.413 212.900 152.365 1.00 170.81 ? 428 ALA A CA  1 
ATOM   2809  C  C   . ALA A 1 428 ? 155.020 211.570 151.896 1.00 173.54 ? 428 ALA A C   1 
ATOM   2810  O  O   . ALA A 1 428 ? 154.640 210.517 152.411 1.00 169.49 ? 428 ALA A O   1 
ATOM   2811  C  CB  . ALA A 1 428 ? 153.345 213.356 151.383 1.00 174.85 ? 428 ALA A CB  1 
ATOM   2812  N  N   . LYS A 1 429 ? 155.952 211.621 150.921 1.00 173.72 ? 429 LYS A N   1 
ATOM   2813  C  CA  . LYS A 1 429 ? 156.633 210.448 150.363 1.00 173.40 ? 429 LYS A CA  1 
ATOM   2814  C  C   . LYS A 1 429 ? 157.580 209.812 151.387 1.00 175.39 ? 429 LYS A C   1 
ATOM   2815  O  O   . LYS A 1 429 ? 157.717 208.587 151.414 1.00 172.91 ? 429 LYS A O   1 
ATOM   2816  C  CB  . LYS A 1 429 ? 157.408 210.829 149.094 1.00 180.17 ? 429 LYS A CB  1 
ATOM   2817  N  N   . ASP A 1 430 ? 158.222 210.644 152.230 1.00 172.97 ? 430 ASP A N   1 
ATOM   2818  C  CA  . ASP A 1 430 ? 159.148 210.202 153.272 1.00 170.84 ? 430 ASP A CA  1 
ATOM   2819  C  C   . ASP A 1 430 ? 158.393 209.594 154.471 1.00 171.43 ? 430 ASP A C   1 
ATOM   2820  O  O   . ASP A 1 430 ? 158.913 208.665 155.085 1.00 168.60 ? 430 ASP A O   1 
ATOM   2821  C  CB  . ASP A 1 430 ? 160.056 211.355 153.721 1.00 174.80 ? 430 ASP A CB  1 
ATOM   2822  N  N   . LEU A 1 431 ? 157.177 210.102 154.794 1.00 168.22 ? 431 LEU A N   1 
ATOM   2823  C  CA  . LEU A 1 431 ? 156.338 209.577 155.882 1.00 164.77 ? 431 LEU A CA  1 
ATOM   2824  C  C   . LEU A 1 431 ? 155.712 208.241 155.473 1.00 168.27 ? 431 LEU A C   1 
ATOM   2825  O  O   . LEU A 1 431 ? 155.565 207.360 156.322 1.00 164.89 ? 431 LEU A O   1 
ATOM   2826  C  CB  . LEU A 1 431 ? 155.250 210.579 156.292 1.00 165.39 ? 431 LEU A CB  1 
ATOM   2827  N  N   . TYR A 1 432 ? 155.364 208.089 154.171 1.00 167.97 ? 432 TYR A N   1 
ATOM   2828  C  CA  . TYR A 1 432 ? 154.804 206.868 153.576 1.00 167.54 ? 432 TYR A CA  1 
ATOM   2829  C  C   . TYR A 1 432 ? 155.793 205.715 153.760 1.00 169.32 ? 432 TYR A C   1 
ATOM   2830  O  O   . TYR A 1 432 ? 155.392 204.622 154.159 1.00 166.42 ? 432 TYR A O   1 
ATOM   2831  C  CB  . TYR A 1 432 ? 154.497 207.094 152.081 1.00 173.19 ? 432 TYR A CB  1 
ATOM   2832  C  CG  . TYR A 1 432 ? 153.756 205.958 151.403 1.00 175.99 ? 432 TYR A CG  1 
ATOM   2833  C  CD1 . TYR A 1 432 ? 154.445 204.881 150.849 1.00 178.54 ? 432 TYR A CD1 1 
ATOM   2834  C  CD2 . TYR A 1 432 ? 152.375 205.998 151.245 1.00 177.57 ? 432 TYR A CD2 1 
ATOM   2835  C  CE1 . TYR A 1 432 ? 153.771 203.843 150.207 1.00 180.44 ? 432 TYR A CE1 1 
ATOM   2836  C  CE2 . TYR A 1 432 ? 151.690 204.968 150.600 1.00 179.48 ? 432 TYR A CE2 1 
ATOM   2837  C  CZ  . TYR A 1 432 ? 152.392 203.889 150.086 1.00 188.00 ? 432 TYR A CZ  1 
ATOM   2838  O  OH  . TYR A 1 432 ? 151.726 202.870 149.448 1.00 190.84 ? 432 TYR A OH  1 
ATOM   2839  N  N   . SER A 1 433 ? 157.087 205.978 153.485 1.00 167.43 ? 433 SER A N   1 
ATOM   2840  C  CA  . SER A 1 433 ? 158.175 205.013 153.628 1.00 166.59 ? 433 SER A CA  1 
ATOM   2841  C  C   . SER A 1 433 ? 158.467 204.734 155.107 1.00 167.17 ? 433 SER A C   1 
ATOM   2842  O  O   . SER A 1 433 ? 158.752 203.587 155.461 1.00 165.11 ? 433 SER A O   1 
ATOM   2843  C  CB  . SER A 1 433 ? 159.431 205.522 152.926 1.00 173.24 ? 433 SER A CB  1 
ATOM   2844  O  OG  . SER A 1 433 ? 160.484 204.576 152.997 1.00 181.87 ? 433 SER A OG  1 
ATOM   2845  N  N   . ALA A 1 434 ? 158.384 205.782 155.963 1.00 162.90 ? 434 ALA A N   1 
ATOM   2846  C  CA  . ALA A 1 434 ? 158.637 205.707 157.406 1.00 159.65 ? 434 ALA A CA  1 
ATOM   2847  C  C   . ALA A 1 434 ? 157.610 204.827 158.123 1.00 159.91 ? 434 ALA A C   1 
ATOM   2848  O  O   . ALA A 1 434 ? 158.013 203.938 158.870 1.00 157.69 ? 434 ALA A O   1 
ATOM   2849  C  CB  . ALA A 1 434 ? 158.642 207.100 158.015 1.00 161.11 ? 434 ALA A CB  1 
ATOM   2850  N  N   . LEU A 1 435 ? 156.296 205.056 157.877 1.00 155.71 ? 435 LEU A N   1 
ATOM   2851  C  CA  . LEU A 1 435 ? 155.175 204.317 158.473 1.00 152.57 ? 435 LEU A CA  1 
ATOM   2852  C  C   . LEU A 1 435 ? 155.273 202.811 158.221 1.00 154.57 ? 435 LEU A C   1 
ATOM   2853  O  O   . LEU A 1 435 ? 155.006 202.029 159.135 1.00 151.89 ? 435 LEU A O   1 
ATOM   2854  C  CB  . LEU A 1 435 ? 153.844 204.855 157.932 1.00 154.03 ? 435 LEU A CB  1 
ATOM   2855  C  CG  . LEU A 1 435 ? 152.984 205.677 158.894 1.00 158.08 ? 435 LEU A CG  1 
ATOM   2856  C  CD1 . LEU A 1 435 ? 153.704 206.939 159.374 1.00 159.40 ? 435 LEU A CD1 1 
ATOM   2857  C  CD2 . LEU A 1 435 ? 151.693 206.079 158.228 1.00 163.14 ? 435 LEU A CD2 1 
ATOM   2858  N  N   . ILE A 1 436 ? 155.687 202.411 157.006 1.00 152.37 ? 436 ILE A N   1 
ATOM   2859  C  CA  . ILE A 1 436 ? 155.873 201.010 156.629 1.00 151.62 ? 436 ILE A CA  1 
ATOM   2860  C  C   . ILE A 1 436 ? 157.101 200.448 157.365 1.00 152.65 ? 436 ILE A C   1 
ATOM   2861  O  O   . ILE A 1 436 ? 157.009 199.370 157.957 1.00 150.38 ? 436 ILE A O   1 
ATOM   2862  C  CB  . ILE A 1 436 ? 155.992 200.878 155.085 1.00 158.53 ? 436 ILE A CB  1 
ATOM   2863  C  CG1 . ILE A 1 436 ? 154.632 201.142 154.407 1.00 160.31 ? 436 ILE A CG1 1 
ATOM   2864  C  CG2 . ILE A 1 436 ? 156.560 199.510 154.673 1.00 160.36 ? 436 ILE A CG2 1 
ATOM   2865  C  CD1 . ILE A 1 436 ? 154.696 201.541 152.923 1.00 171.70 ? 436 ILE A CD1 1 
ATOM   2866  N  N   . LYS A 1 437 ? 158.236 201.190 157.336 1.00 149.24 ? 437 LYS A N   1 
ATOM   2867  C  CA  . LYS A 1 437 ? 159.498 200.805 157.975 1.00 148.03 ? 437 LYS A CA  1 
ATOM   2868  C  C   . LYS A 1 437 ? 159.337 200.651 159.496 1.00 147.36 ? 437 LYS A C   1 
ATOM   2869  O  O   . LYS A 1 437 ? 159.899 199.712 160.059 1.00 146.03 ? 437 LYS A O   1 
ATOM   2870  C  CB  . LYS A 1 437 ? 160.595 201.828 157.641 1.00 153.03 ? 437 LYS A CB  1 
ATOM   2871  C  CG  . LYS A 1 437 ? 162.021 201.367 157.887 1.00 170.19 ? 437 LYS A CG  1 
ATOM   2872  C  CD  . LYS A 1 437 ? 162.457 200.200 156.999 1.00 183.23 ? 437 LYS A CD  1 
ATOM   2873  C  CE  . LYS A 1 437 ? 163.398 199.267 157.726 1.00 193.70 ? 437 LYS A CE  1 
ATOM   2874  N  NZ  . LYS A 1 437 ? 162.682 198.395 158.696 1.00 198.62 ? 437 LYS A NZ  1 
ATOM   2875  N  N   . LEU A 1 438 ? 158.557 201.544 160.146 1.00 141.55 ? 438 LEU A N   1 
ATOM   2876  C  CA  . LEU A 1 438 ? 158.285 201.476 161.587 1.00 137.88 ? 438 LEU A CA  1 
ATOM   2877  C  C   . LEU A 1 438 ? 157.397 200.284 161.897 1.00 139.78 ? 438 LEU A C   1 
ATOM   2878  O  O   . LEU A 1 438 ? 157.579 199.656 162.938 1.00 137.43 ? 438 LEU A O   1 
ATOM   2879  C  CB  . LEU A 1 438 ? 157.641 202.768 162.126 1.00 137.27 ? 438 LEU A CB  1 
ATOM   2880  C  CG  . LEU A 1 438 ? 158.533 204.008 162.216 1.00 143.47 ? 438 LEU A CG  1 
ATOM   2881  C  CD1 . LEU A 1 438 ? 157.717 205.235 162.540 1.00 143.61 ? 438 LEU A CD1 1 
ATOM   2882  C  CD2 . LEU A 1 438 ? 159.645 203.831 163.234 1.00 145.09 ? 438 LEU A CD2 1 
ATOM   2883  N  N   . ASN A 1 439 ? 156.457 199.962 160.983 1.00 137.43 ? 439 ASN A N   1 
ATOM   2884  C  CA  . ASN A 1 439 ? 155.550 198.818 161.097 1.00 136.29 ? 439 ASN A CA  1 
ATOM   2885  C  C   . ASN A 1 439 ? 156.352 197.512 161.055 1.00 141.08 ? 439 ASN A C   1 
ATOM   2886  O  O   . ASN A 1 439 ? 156.123 196.631 161.887 1.00 138.66 ? 439 ASN A O   1 
ATOM   2887  C  CB  . ASN A 1 439 ? 154.498 198.853 159.985 1.00 139.50 ? 439 ASN A CB  1 
ATOM   2888  C  CG  . ASN A 1 439 ? 153.540 197.692 159.997 1.00 164.22 ? 439 ASN A CG  1 
ATOM   2889  O  OD1 . ASN A 1 439 ? 152.599 197.638 160.798 1.00 157.93 ? 439 ASN A OD1 1 
ATOM   2890  N  ND2 . ASN A 1 439 ? 153.744 196.755 159.084 1.00 157.87 ? 439 ASN A ND2 1 
ATOM   2891  N  N   . LYS A 1 440 ? 157.319 197.414 160.114 1.00 140.89 ? 440 LYS A N   1 
ATOM   2892  C  CA  . LYS A 1 440 ? 158.204 196.259 159.952 1.00 142.07 ? 440 LYS A CA  1 
ATOM   2893  C  C   . LYS A 1 440 ? 159.095 196.083 161.181 1.00 146.11 ? 440 LYS A C   1 
ATOM   2894  O  O   . LYS A 1 440 ? 159.330 194.951 161.602 1.00 145.35 ? 440 LYS A O   1 
ATOM   2895  C  CB  . LYS A 1 440 ? 159.062 196.407 158.689 1.00 147.88 ? 440 LYS A CB  1 
ATOM   2896  N  N   . ASP A 1 441 ? 159.557 197.207 161.768 1.00 143.68 ? 441 ASP A N   1 
ATOM   2897  C  CA  . ASP A 1 441 ? 160.413 197.253 162.958 1.00 143.23 ? 441 ASP A CA  1 
ATOM   2898  C  C   . ASP A 1 441 ? 159.698 196.765 164.226 1.00 144.48 ? 441 ASP A C   1 
ATOM   2899  O  O   . ASP A 1 441 ? 160.349 196.164 165.085 1.00 143.63 ? 441 ASP A O   1 
ATOM   2900  C  CB  . ASP A 1 441 ? 160.930 198.683 163.191 1.00 146.39 ? 441 ASP A CB  1 
ATOM   2901  C  CG  . ASP A 1 441 ? 162.080 199.125 162.301 1.00 164.35 ? 441 ASP A CG  1 
ATOM   2902  O  OD1 . ASP A 1 441 ? 162.541 198.307 161.464 1.00 167.06 ? 441 ASP A OD1 1 
ATOM   2903  O  OD2 . ASP A 1 441 ? 162.523 200.288 162.440 1.00 173.29 ? 441 ASP A OD2 1 
ATOM   2904  N  N   . ASN A 1 442 ? 158.380 197.049 164.353 1.00 139.24 ? 442 ASN A N   1 
ATOM   2905  C  CA  . ASN A 1 442 ? 157.550 196.679 165.504 1.00 136.13 ? 442 ASN A CA  1 
ATOM   2906  C  C   . ASN A 1 442 ? 156.646 195.468 165.203 1.00 140.39 ? 442 ASN A C   1 
ATOM   2907  O  O   . ASN A 1 442 ? 155.767 195.153 166.011 1.00 137.64 ? 442 ASN A O   1 
ATOM   2908  C  CB  . ASN A 1 442 ? 156.694 197.877 165.946 1.00 134.30 ? 442 ASN A CB  1 
ATOM   2909  C  CG  . ASN A 1 442 ? 157.458 199.144 166.263 1.00 150.10 ? 442 ASN A CG  1 
ATOM   2910  O  OD1 . ASN A 1 442 ? 158.637 199.130 166.633 1.00 137.98 ? 442 ASN A OD1 1 
ATOM   2911  N  ND2 . ASN A 1 442 ? 156.784 200.278 166.147 1.00 144.39 ? 442 ASN A ND2 1 
ATOM   2912  N  N   . LEU A 1 443 ? 156.881 194.782 164.057 1.00 140.61 ? 443 LEU A N   1 
ATOM   2913  C  CA  . LEU A 1 443 ? 156.149 193.600 163.571 1.00 141.96 ? 443 LEU A CA  1 
ATOM   2914  C  C   . LEU A 1 443 ? 154.610 193.777 163.690 1.00 147.50 ? 443 LEU A C   1 
ATOM   2915  O  O   . LEU A 1 443 ? 153.913 192.931 164.259 1.00 145.87 ? 443 LEU A O   1 
ATOM   2916  C  CB  . LEU A 1 443 ? 156.617 192.316 164.286 1.00 141.37 ? 443 LEU A CB  1 
ATOM   2917  N  N   . GLY A 1 444 ? 154.114 194.888 163.155 1.00 146.92 ? 444 GLY A N   1 
ATOM   2918  C  CA  . GLY A 1 444 ? 152.693 195.212 163.153 1.00 147.39 ? 444 GLY A CA  1 
ATOM   2919  C  C   . GLY A 1 444 ? 151.975 194.530 162.010 1.00 156.25 ? 444 GLY A C   1 
ATOM   2920  O  O   . GLY A 1 444 ? 152.395 194.649 160.855 1.00 158.48 ? 444 GLY A O   1 
ATOM   2921  N  N   . PHE A 1 445 ? 150.900 193.789 162.327 1.00 154.29 ? 445 PHE A N   1 
ATOM   2922  C  CA  . PHE A 1 445 ? 150.103 193.071 161.333 1.00 157.62 ? 445 PHE A CA  1 
ATOM   2923  C  C   . PHE A 1 445 ? 149.260 194.071 160.524 1.00 166.49 ? 445 PHE A C   1 
ATOM   2924  O  O   . PHE A 1 445 ? 148.520 194.857 161.128 1.00 165.11 ? 445 PHE A O   1 
ATOM   2925  C  CB  . PHE A 1 445 ? 149.224 192.013 162.013 1.00 158.46 ? 445 PHE A CB  1 
ATOM   2926  C  CG  . PHE A 1 445 ? 148.848 190.834 161.149 1.00 162.73 ? 445 PHE A CG  1 
ATOM   2927  C  CD1 . PHE A 1 445 ? 149.784 189.859 160.827 1.00 166.76 ? 445 PHE A CD1 1 
ATOM   2928  C  CD2 . PHE A 1 445 ? 147.543 190.663 160.710 1.00 166.97 ? 445 PHE A CD2 1 
ATOM   2929  C  CE1 . PHE A 1 445 ? 149.427 188.759 160.046 1.00 170.92 ? 445 PHE A CE1 1 
ATOM   2930  C  CE2 . PHE A 1 445 ? 147.185 189.559 159.936 1.00 172.96 ? 445 PHE A CE2 1 
ATOM   2931  C  CZ  . PHE A 1 445 ? 148.128 188.611 159.616 1.00 172.14 ? 445 PHE A CZ  1 
ATOM   2932  N  N   . PRO A 1 446 ? 149.398 194.096 159.171 1.00 168.27 ? 446 PRO A N   1 
ATOM   2933  C  CA  . PRO A 1 446 ? 148.640 195.083 158.373 1.00 170.97 ? 446 PRO A CA  1 
ATOM   2934  C  C   . PRO A 1 446 ? 147.124 194.841 158.347 1.00 178.31 ? 446 PRO A C   1 
ATOM   2935  O  O   . PRO A 1 446 ? 146.365 195.810 158.301 1.00 179.00 ? 446 PRO A O   1 
ATOM   2936  C  CB  . PRO A 1 446 ? 149.242 194.952 156.971 1.00 175.90 ? 446 PRO A CB  1 
ATOM   2937  C  CG  . PRO A 1 446 ? 149.824 193.588 156.923 1.00 180.51 ? 446 PRO A CG  1 
ATOM   2938  C  CD  . PRO A 1 446 ? 150.266 193.257 158.317 1.00 172.22 ? 446 PRO A CD  1 
ATOM   2939  N  N   . VAL A 1 447 ? 146.687 193.565 158.387 1.00 176.48 ? 447 VAL A N   1 
ATOM   2940  C  CA  . VAL A 1 447 ? 145.268 193.184 158.372 1.00 178.21 ? 447 VAL A CA  1 
ATOM   2941  C  C   . VAL A 1 447 ? 144.706 193.263 159.797 1.00 180.04 ? 447 VAL A C   1 
ATOM   2942  O  O   . VAL A 1 447 ? 145.373 192.857 160.747 1.00 176.91 ? 447 VAL A O   1 
ATOM   2943  C  CB  . VAL A 1 447 ? 145.025 191.784 157.743 1.00 184.91 ? 447 VAL A CB  1 
ATOM   2944  C  CG1 . VAL A 1 447 ? 143.582 191.646 157.262 1.00 187.95 ? 447 VAL A CG1 1 
ATOM   2945  C  CG2 . VAL A 1 447 ? 145.991 191.509 156.590 1.00 187.11 ? 447 VAL A CG2 1 
ATOM   2946  N  N   . SER A 1 448 ? 143.490 193.810 159.942 1.00 178.29 ? 448 SER A N   1 
ATOM   2947  C  CA  . SER A 1 448 ? 142.821 193.959 161.236 1.00 176.22 ? 448 SER A CA  1 
ATOM   2948  C  C   . SER A 1 448 ? 141.310 193.979 161.065 1.00 183.70 ? 448 SER A C   1 
ATOM   2949  O  O   . SER A 1 448 ? 140.810 194.557 160.095 1.00 186.52 ? 448 SER A O   1 
ATOM   2950  C  CB  . SER A 1 448 ? 143.283 195.236 161.936 1.00 177.30 ? 448 SER A CB  1 
ATOM   2951  O  OG  . SER A 1 448 ? 142.724 195.360 163.234 1.00 183.84 ? 448 SER A OG  1 
ATOM   2952  N  N   . ASP A 1 449 ? 140.582 193.353 162.014 1.00 179.76 ? 449 ASP A N   1 
ATOM   2953  C  CA  . ASP A 1 449 ? 139.118 193.320 162.015 1.00 182.42 ? 449 ASP A CA  1 
ATOM   2954  C  C   . ASP A 1 449 ? 138.594 194.739 162.263 1.00 186.21 ? 449 ASP A C   1 
ATOM   2955  O  O   . ASP A 1 449 ? 139.031 195.394 163.216 1.00 183.01 ? 449 ASP A O   1 
ATOM   2956  C  CB  . ASP A 1 449 ? 138.590 192.330 163.067 1.00 183.35 ? 449 ASP A CB  1 
ATOM   2957  C  CG  . ASP A 1 449 ? 137.088 192.155 163.036 1.00 199.41 ? 449 ASP A CG  1 
ATOM   2958  O  OD1 . ASP A 1 449 ? 136.596 191.400 162.169 1.00 204.27 ? 449 ASP A OD1 1 
ATOM   2959  O  OD2 . ASP A 1 449 ? 136.404 192.772 163.877 1.00 205.23 ? 449 ASP A OD2 1 
ATOM   2960  N  N   . TRP A 1 450 ? 137.703 195.226 161.371 1.00 185.87 ? 450 TRP A N   1 
ATOM   2961  C  CA  . TRP A 1 450 ? 137.134 196.577 161.410 1.00 186.51 ? 450 TRP A CA  1 
ATOM   2962  C  C   . TRP A 1 450 ? 136.462 196.905 162.747 1.00 186.43 ? 450 TRP A C   1 
ATOM   2963  O  O   . TRP A 1 450 ? 136.635 198.019 163.241 1.00 184.74 ? 450 TRP A O   1 
ATOM   2964  C  CB  . TRP A 1 450 ? 136.135 196.785 160.264 1.00 190.86 ? 450 TRP A CB  1 
ATOM   2965  C  CG  . TRP A 1 450 ? 135.497 198.146 160.263 1.00 194.10 ? 450 TRP A CG  1 
ATOM   2966  C  CD1 . TRP A 1 450 ? 136.016 199.293 159.742 1.00 197.61 ? 450 TRP A CD1 1 
ATOM   2967  C  CD2 . TRP A 1 450 ? 134.240 198.505 160.855 1.00 196.01 ? 450 TRP A CD2 1 
ATOM   2968  N  NE1 . TRP A 1 450 ? 135.151 200.343 159.951 1.00 199.44 ? 450 TRP A NE1 1 
ATOM   2969  C  CE2 . TRP A 1 450 ? 134.053 199.888 160.636 1.00 201.79 ? 450 TRP A CE2 1 
ATOM   2970  C  CE3 . TRP A 1 450 ? 133.248 197.790 161.550 1.00 198.06 ? 450 TRP A CE3 1 
ATOM   2971  C  CZ2 . TRP A 1 450 ? 132.913 200.569 161.079 1.00 203.71 ? 450 TRP A CZ2 1 
ATOM   2972  C  CZ3 . TRP A 1 450 ? 132.120 198.466 161.989 1.00 202.06 ? 450 TRP A CZ3 1 
ATOM   2973  C  CH2 . TRP A 1 450 ? 131.960 199.838 161.754 1.00 204.53 ? 450 TRP A CH2 1 
ATOM   2974  N  N   . LEU A 1 451 ? 135.693 195.956 163.314 1.00 181.61 ? 451 LEU A N   1 
ATOM   2975  C  CA  . LEU A 1 451 ? 134.984 196.132 164.582 1.00 179.54 ? 451 LEU A CA  1 
ATOM   2976  C  C   . LEU A 1 451 ? 135.963 196.250 165.766 1.00 177.53 ? 451 LEU A C   1 
ATOM   2977  O  O   . LEU A 1 451 ? 135.671 196.967 166.725 1.00 175.96 ? 451 LEU A O   1 
ATOM   2978  C  CB  . LEU A 1 451 ? 134.005 194.965 164.798 1.00 181.25 ? 451 LEU A CB  1 
ATOM   2979  C  CG  . LEU A 1 451 ? 132.787 195.232 165.678 1.00 187.07 ? 451 LEU A CG  1 
ATOM   2980  C  CD1 . LEU A 1 451 ? 131.825 196.214 165.020 1.00 191.59 ? 451 LEU A CD1 1 
ATOM   2981  C  CD2 . LEU A 1 451 ? 132.055 193.946 165.969 1.00 190.59 ? 451 LEU A CD2 1 
ATOM   2982  N  N   . PHE A 1 452 ? 137.126 195.572 165.679 1.00 170.84 ? 452 PHE A N   1 
ATOM   2983  C  CA  . PHE A 1 452 ? 138.175 195.583 166.700 1.00 166.19 ? 452 PHE A CA  1 
ATOM   2984  C  C   . PHE A 1 452 ? 138.946 196.908 166.685 1.00 168.72 ? 452 PHE A C   1 
ATOM   2985  O  O   . PHE A 1 452 ? 139.127 197.519 167.742 1.00 166.33 ? 452 PHE A O   1 
ATOM   2986  C  CB  . PHE A 1 452 ? 139.138 194.405 166.484 1.00 166.45 ? 452 PHE A CB  1 
ATOM   2987  C  CG  . PHE A 1 452 ? 140.194 194.221 167.548 1.00 164.15 ? 452 PHE A CG  1 
ATOM   2988  C  CD1 . PHE A 1 452 ? 141.437 194.831 167.431 1.00 164.49 ? 452 PHE A CD1 1 
ATOM   2989  C  CD2 . PHE A 1 452 ? 139.963 193.401 168.643 1.00 165.95 ? 452 PHE A CD2 1 
ATOM   2990  C  CE1 . PHE A 1 452 ? 142.416 194.649 168.410 1.00 164.41 ? 452 PHE A CE1 1 
ATOM   2991  C  CE2 . PHE A 1 452 ? 140.948 193.208 169.613 1.00 163.77 ? 452 PHE A CE2 1 
ATOM   2992  C  CZ  . PHE A 1 452 ? 142.166 193.836 169.492 1.00 161.22 ? 452 PHE A CZ  1 
ATOM   2993  N  N   . SER A 1 453 ? 139.422 197.329 165.495 1.00 166.77 ? 453 SER A N   1 
ATOM   2994  C  CA  . SER A 1 453 ? 140.192 198.559 165.298 1.00 166.30 ? 453 SER A CA  1 
ATOM   2995  C  C   . SER A 1 453 ? 139.356 199.821 165.575 1.00 172.55 ? 453 SER A C   1 
ATOM   2996  O  O   . SER A 1 453 ? 139.908 200.823 166.028 1.00 171.46 ? 453 SER A O   1 
ATOM   2997  C  CB  . SER A 1 453 ? 140.769 198.607 163.888 1.00 171.31 ? 453 SER A CB  1 
ATOM   2998  O  OG  . SER A 1 453 ? 139.751 198.468 162.911 1.00 183.74 ? 453 SER A OG  1 
ATOM   2999  N  N   . MET A 1 454 ? 138.034 199.771 165.321 1.00 171.90 ? 454 MET A N   1 
ATOM   3000  C  CA  . MET A 1 454 ? 137.119 200.889 165.576 1.00 173.90 ? 454 MET A CA  1 
ATOM   3001  C  C   . MET A 1 454 ? 136.964 201.159 167.082 1.00 174.14 ? 454 MET A C   1 
ATOM   3002  O  O   . MET A 1 454 ? 136.858 202.316 167.497 1.00 174.65 ? 454 MET A O   1 
ATOM   3003  C  CB  . MET A 1 454 ? 135.740 200.597 164.967 1.00 180.48 ? 454 MET A CB  1 
ATOM   3004  C  CG  . MET A 1 454 ? 135.477 201.300 163.664 1.00 188.26 ? 454 MET A CG  1 
ATOM   3005  S  SD  . MET A 1 454 ? 134.469 202.796 163.879 1.00 196.38 ? 454 MET A SD  1 
ATOM   3006  C  CE  . MET A 1 454 ? 132.929 202.097 164.536 1.00 195.06 ? 454 MET A CE  1 
ATOM   3007  N  N   . TRP A 1 455 ? 136.960 200.088 167.891 1.00 166.78 ? 455 TRP A N   1 
ATOM   3008  C  CA  . TRP A 1 455 ? 136.765 200.146 169.334 1.00 164.01 ? 455 TRP A CA  1 
ATOM   3009  C  C   . TRP A 1 455 ? 138.069 200.348 170.111 1.00 163.49 ? 455 TRP A C   1 
ATOM   3010  O  O   . TRP A 1 455 ? 138.055 201.082 171.103 1.00 162.62 ? 455 TRP A O   1 
ATOM   3011  C  CB  . TRP A 1 455 ? 136.077 198.856 169.799 1.00 162.26 ? 455 TRP A CB  1 
ATOM   3012  C  CG  . TRP A 1 455 ? 135.728 198.804 171.257 1.00 161.81 ? 455 TRP A CG  1 
ATOM   3013  C  CD1 . TRP A 1 455 ? 136.478 198.263 172.258 1.00 161.26 ? 455 TRP A CD1 1 
ATOM   3014  C  CD2 . TRP A 1 455 ? 134.514 199.265 171.867 1.00 163.96 ? 455 TRP A CD2 1 
ATOM   3015  N  NE1 . TRP A 1 455 ? 135.820 198.384 173.461 1.00 160.73 ? 455 TRP A NE1 1 
ATOM   3016  C  CE2 . TRP A 1 455 ? 134.610 198.992 173.251 1.00 165.67 ? 455 TRP A CE2 1 
ATOM   3017  C  CE3 . TRP A 1 455 ? 133.348 199.882 171.380 1.00 169.40 ? 455 TRP A CE3 1 
ATOM   3018  C  CZ2 . TRP A 1 455 ? 133.593 199.327 174.154 1.00 166.62 ? 455 TRP A CZ2 1 
ATOM   3019  C  CZ3 . TRP A 1 455 ? 132.344 200.215 172.275 1.00 172.64 ? 455 TRP A CZ3 1 
ATOM   3020  C  CH2 . TRP A 1 455 ? 132.470 199.937 173.644 1.00 170.88 ? 455 TRP A CH2 1 
ATOM   3021  N  N   . HIS A 1 456 ? 139.174 199.686 169.698 1.00 157.22 ? 456 HIS A N   1 
ATOM   3022  C  CA  . HIS A 1 456 ? 140.440 199.729 170.435 1.00 153.44 ? 456 HIS A CA  1 
ATOM   3023  C  C   . HIS A 1 456 ? 141.511 200.670 169.864 1.00 157.65 ? 456 HIS A C   1 
ATOM   3024  O  O   . HIS A 1 456 ? 142.061 201.471 170.624 1.00 156.25 ? 456 HIS A O   1 
ATOM   3025  C  CB  . HIS A 1 456 ? 141.041 198.319 170.547 1.00 151.59 ? 456 HIS A CB  1 
ATOM   3026  C  CG  . HIS A 1 456 ? 140.244 197.384 171.397 1.00 154.01 ? 456 HIS A CG  1 
ATOM   3027  N  ND1 . HIS A 1 456 ? 139.606 196.289 170.854 1.00 156.88 ? 456 HIS A ND1 1 
ATOM   3028  C  CD2 . HIS A 1 456 ? 140.016 197.408 172.730 1.00 154.02 ? 456 HIS A CD2 1 
ATOM   3029  C  CE1 . HIS A 1 456 ? 139.011 195.682 171.867 1.00 155.39 ? 456 HIS A CE1 1 
ATOM   3030  N  NE2 . HIS A 1 456 ? 139.227 196.322 173.014 1.00 154.04 ? 456 HIS A NE2 1 
ATOM   3031  N  N   . TYR A 1 457 ? 141.849 200.531 168.564 1.00 155.81 ? 457 TYR A N   1 
ATOM   3032  C  CA  . TYR A 1 457 ? 142.928 201.266 167.889 1.00 156.21 ? 457 TYR A CA  1 
ATOM   3033  C  C   . TYR A 1 457 ? 142.791 202.790 168.005 1.00 161.20 ? 457 TYR A C   1 
ATOM   3034  O  O   . TYR A 1 457 ? 141.869 203.377 167.440 1.00 163.75 ? 457 TYR A O   1 
ATOM   3035  C  CB  . TYR A 1 457 ? 143.028 200.863 166.399 1.00 159.76 ? 457 TYR A CB  1 
ATOM   3036  C  CG  . TYR A 1 457 ? 143.658 199.515 166.097 1.00 160.94 ? 457 TYR A CG  1 
ATOM   3037  C  CD1 . TYR A 1 457 ? 143.512 198.439 166.969 1.00 161.12 ? 457 TYR A CD1 1 
ATOM   3038  C  CD2 . TYR A 1 457 ? 144.324 199.291 164.898 1.00 163.20 ? 457 TYR A CD2 1 
ATOM   3039  C  CE1 . TYR A 1 457 ? 144.070 197.194 166.684 1.00 161.49 ? 457 TYR A CE1 1 
ATOM   3040  C  CE2 . TYR A 1 457 ? 144.878 198.047 164.597 1.00 163.66 ? 457 TYR A CE2 1 
ATOM   3041  C  CZ  . TYR A 1 457 ? 144.747 197.000 165.492 1.00 170.30 ? 457 TYR A CZ  1 
ATOM   3042  O  OH  . TYR A 1 457 ? 145.296 195.773 165.200 1.00 172.74 ? 457 TYR A OH  1 
ATOM   3043  N  N   . SER A 1 458 ? 143.728 203.418 168.744 1.00 155.90 ? 458 SER A N   1 
ATOM   3044  C  CA  . SER A 1 458 ? 143.813 204.872 168.923 1.00 157.41 ? 458 SER A CA  1 
ATOM   3045  C  C   . SER A 1 458 ? 144.400 205.508 167.660 1.00 163.64 ? 458 SER A C   1 
ATOM   3046  O  O   . SER A 1 458 ? 144.122 206.669 167.360 1.00 166.01 ? 458 SER A O   1 
ATOM   3047  C  CB  . SER A 1 458 ? 144.665 205.214 170.138 1.00 159.06 ? 458 SER A CB  1 
ATOM   3048  O  OG  . SER A 1 458 ? 145.989 204.725 169.990 1.00 167.15 ? 458 SER A OG  1 
ATOM   3049  N  N   . HIS A 1 459 ? 145.225 204.729 166.934 1.00 159.20 ? 459 HIS A N   1 
ATOM   3050  C  CA  . HIS A 1 459 ? 145.850 205.082 165.661 1.00 160.70 ? 459 HIS A CA  1 
ATOM   3051  C  C   . HIS A 1 459 ? 145.141 204.330 164.531 1.00 164.52 ? 459 HIS A C   1 
ATOM   3052  O  O   . HIS A 1 459 ? 144.934 203.120 164.665 1.00 162.71 ? 459 HIS A O   1 
ATOM   3053  C  CB  . HIS A 1 459 ? 147.348 204.734 165.677 1.00 160.05 ? 459 HIS A CB  1 
ATOM   3054  C  CG  . HIS A 1 459 ? 148.174 205.619 166.554 1.00 163.38 ? 459 HIS A CG  1 
ATOM   3055  N  ND1 . HIS A 1 459 ? 147.945 205.707 167.917 1.00 163.78 ? 459 HIS A ND1 1 
ATOM   3056  C  CD2 . HIS A 1 459 ? 149.237 206.393 166.240 1.00 166.63 ? 459 HIS A CD2 1 
ATOM   3057  C  CE1 . HIS A 1 459 ? 148.851 206.552 168.380 1.00 163.81 ? 459 HIS A CE1 1 
ATOM   3058  N  NE2 . HIS A 1 459 ? 149.652 206.990 167.409 1.00 165.87 ? 459 HIS A NE2 1 
ATOM   3059  N  N   . PRO A 1 460 ? 144.765 204.997 163.415 1.00 163.01 ? 460 PRO A N   1 
ATOM   3060  C  CA  . PRO A 1 460 ? 144.086 204.273 162.322 1.00 164.23 ? 460 PRO A CA  1 
ATOM   3061  C  C   . PRO A 1 460 ? 144.985 203.221 161.651 1.00 166.13 ? 460 PRO A C   1 
ATOM   3062  O  O   . PRO A 1 460 ? 146.208 203.344 161.758 1.00 164.57 ? 460 PRO A O   1 
ATOM   3063  C  CB  . PRO A 1 460 ? 143.705 205.383 161.342 1.00 169.93 ? 460 PRO A CB  1 
ATOM   3064  C  CG  . PRO A 1 460 ? 144.616 206.500 161.644 1.00 174.46 ? 460 PRO A CG  1 
ATOM   3065  C  CD  . PRO A 1 460 ? 144.922 206.430 163.100 1.00 167.00 ? 460 PRO A CD  1 
ATOM   3066  N  N   . PRO A 1 461 ? 144.421 202.184 160.970 1.00 162.90 ? 461 PRO A N   1 
ATOM   3067  C  CA  . PRO A 1 461 ? 145.276 201.146 160.350 1.00 161.92 ? 461 PRO A CA  1 
ATOM   3068  C  C   . PRO A 1 461 ? 146.284 201.689 159.338 1.00 166.03 ? 461 PRO A C   1 
ATOM   3069  O  O   . PRO A 1 461 ? 146.039 202.728 158.722 1.00 168.22 ? 461 PRO A O   1 
ATOM   3070  C  CB  . PRO A 1 461 ? 144.270 200.221 159.660 1.00 165.85 ? 461 PRO A CB  1 
ATOM   3071  C  CG  . PRO A 1 461 ? 142.999 200.434 160.388 1.00 170.58 ? 461 PRO A CG  1 
ATOM   3072  C  CD  . PRO A 1 461 ? 142.990 201.880 160.763 1.00 166.44 ? 461 PRO A CD  1 
ATOM   3073  N  N   . LEU A 1 462 ? 147.421 200.980 159.183 1.00 160.32 ? 462 LEU A N   1 
ATOM   3074  C  CA  . LEU A 1 462 ? 148.520 201.349 158.290 1.00 161.27 ? 462 LEU A CA  1 
ATOM   3075  C  C   . LEU A 1 462 ? 148.031 201.606 156.866 1.00 168.37 ? 462 LEU A C   1 
ATOM   3076  O  O   . LEU A 1 462 ? 148.360 202.652 156.311 1.00 170.04 ? 462 LEU A O   1 
ATOM   3077  C  CB  . LEU A 1 462 ? 149.623 200.274 158.295 1.00 160.05 ? 462 LEU A CB  1 
ATOM   3078  C  CG  . LEU A 1 462 ? 150.920 200.613 157.537 1.00 166.32 ? 462 LEU A CG  1 
ATOM   3079  C  CD1 . LEU A 1 462 ? 151.736 201.675 158.255 1.00 165.54 ? 462 LEU A CD1 1 
ATOM   3080  C  CD2 . LEU A 1 462 ? 151.765 199.385 157.333 1.00 168.61 ? 462 LEU A CD2 1 
ATOM   3081  N  N   . LEU A 1 463 ? 147.210 200.691 156.305 1.00 165.74 ? 463 LEU A N   1 
ATOM   3082  C  CA  . LEU A 1 463 ? 146.652 200.794 154.950 1.00 169.23 ? 463 LEU A CA  1 
ATOM   3083  C  C   . LEU A 1 463 ? 145.770 202.041 154.770 1.00 173.35 ? 463 LEU A C   1 
ATOM   3084  O  O   . LEU A 1 463 ? 145.790 202.638 153.694 1.00 175.78 ? 463 LEU A O   1 
ATOM   3085  C  CB  . LEU A 1 463 ? 145.861 199.536 154.589 1.00 170.65 ? 463 LEU A CB  1 
ATOM   3086  C  CG  . LEU A 1 463 ? 146.716 198.329 154.207 1.00 175.41 ? 463 LEU A CG  1 
ATOM   3087  C  CD1 . LEU A 1 463 ? 146.526 197.195 155.191 1.00 172.89 ? 463 LEU A CD1 1 
ATOM   3088  C  CD2 . LEU A 1 463 ? 146.430 197.879 152.781 1.00 182.57 ? 463 LEU A CD2 1 
ATOM   3089  N  N   . GLU A 1 464 ? 145.030 202.443 155.825 1.00 167.30 ? 464 GLU A N   1 
ATOM   3090  C  CA  . GLU A 1 464 ? 144.170 203.633 155.829 1.00 168.73 ? 464 GLU A CA  1 
ATOM   3091  C  C   . GLU A 1 464 ? 145.017 204.913 155.835 1.00 171.64 ? 464 GLU A C   1 
ATOM   3092  O  O   . GLU A 1 464 ? 144.692 205.859 155.116 1.00 174.75 ? 464 GLU A O   1 
ATOM   3093  C  CB  . GLU A 1 464 ? 143.213 203.623 157.035 1.00 168.43 ? 464 GLU A CB  1 
ATOM   3094  C  CG  . GLU A 1 464 ? 142.125 202.568 156.963 1.00 179.55 ? 464 GLU A CG  1 
ATOM   3095  N  N   . ARG A 1 465 ? 146.105 204.933 156.638 1.00 163.93 ? 465 ARG A N   1 
ATOM   3096  C  CA  . ARG A 1 465 ? 147.031 206.063 156.761 1.00 163.62 ? 465 ARG A CA  1 
ATOM   3097  C  C   . ARG A 1 465 ? 147.870 206.248 155.498 1.00 170.34 ? 465 ARG A C   1 
ATOM   3098  O  O   . ARG A 1 465 ? 148.139 207.389 155.118 1.00 172.49 ? 465 ARG A O   1 
ATOM   3099  C  CB  . ARG A 1 465 ? 147.957 205.876 157.968 1.00 158.94 ? 465 ARG A CB  1 
ATOM   3100  C  CG  . ARG A 1 465 ? 147.333 206.282 159.291 1.00 164.10 ? 465 ARG A CG  1 
ATOM   3101  C  CD  . ARG A 1 465 ? 148.210 205.924 160.478 1.00 163.92 ? 465 ARG A CD  1 
ATOM   3102  N  NE  . ARG A 1 465 ? 149.290 206.892 160.679 1.00 165.78 ? 465 ARG A NE  1 
ATOM   3103  C  CZ  . ARG A 1 465 ? 150.118 206.892 161.719 1.00 172.39 ? 465 ARG A CZ  1 
ATOM   3104  N  NH1 . ARG A 1 465 ? 150.000 205.974 162.671 1.00 156.37 ? 465 ARG A NH1 1 
ATOM   3105  N  NH2 . ARG A 1 465 ? 151.067 207.813 161.818 1.00 156.50 ? 465 ARG A NH2 1 
ATOM   3106  N  N   . LEU A 1 466 ? 148.296 205.133 154.861 1.00 166.70 ? 466 LEU A N   1 
ATOM   3107  C  CA  . LEU A 1 466 ? 149.108 205.145 153.638 1.00 168.92 ? 466 LEU A CA  1 
ATOM   3108  C  C   . LEU A 1 466 ? 148.312 205.656 152.440 1.00 177.40 ? 466 LEU A C   1 
ATOM   3109  O  O   . LEU A 1 466 ? 148.862 206.401 151.629 1.00 179.80 ? 466 LEU A O   1 
ATOM   3110  C  CB  . LEU A 1 466 ? 149.676 203.746 153.317 1.00 167.89 ? 466 LEU A CB  1 
ATOM   3111  C  CG  . LEU A 1 466 ? 150.750 203.162 154.245 1.00 168.93 ? 466 LEU A CG  1 
ATOM   3112  C  CD1 . LEU A 1 466 ? 150.989 201.705 153.924 1.00 168.61 ? 466 LEU A CD1 1 
ATOM   3113  C  CD2 . LEU A 1 466 ? 152.054 203.942 154.181 1.00 171.75 ? 466 LEU A CD2 1 
ATOM   3114  N  N   . GLN A 1 467 ? 147.026 205.254 152.327 1.00 175.20 ? 467 GLN A N   1 
ATOM   3115  C  CA  . GLN A 1 467 ? 146.130 205.652 151.235 1.00 179.61 ? 467 GLN A CA  1 
ATOM   3116  C  C   . GLN A 1 467 ? 145.817 207.151 151.280 1.00 185.35 ? 467 GLN A C   1 
ATOM   3117  O  O   . GLN A 1 467 ? 145.723 207.774 150.222 1.00 188.75 ? 467 GLN A O   1 
ATOM   3118  C  CB  . GLN A 1 467 ? 144.839 204.825 151.251 1.00 181.77 ? 467 GLN A CB  1 
ATOM   3119  C  CG  . GLN A 1 467 ? 145.011 203.472 150.561 1.00 203.11 ? 467 GLN A CG  1 
ATOM   3120  C  CD  . GLN A 1 467 ? 143.858 202.520 150.779 1.00 225.56 ? 467 GLN A CD  1 
ATOM   3121  O  OE1 . GLN A 1 467 ? 143.391 202.302 151.903 1.00 218.73 ? 467 GLN A OE1 1 
ATOM   3122  N  NE2 . GLN A 1 467 ? 143.417 201.877 149.708 1.00 223.44 ? 467 GLN A NE2 1 
ATOM   3123  N  N   . ALA A 1 468 ? 145.694 207.729 152.494 1.00 179.56 ? 468 ALA A N   1 
ATOM   3124  C  CA  . ALA A 1 468 ? 145.446 209.158 152.704 1.00 181.47 ? 468 ALA A CA  1 
ATOM   3125  C  C   . ALA A 1 468 ? 146.665 209.994 152.279 1.00 187.17 ? 468 ALA A C   1 
ATOM   3126  O  O   . ALA A 1 468 ? 146.500 211.104 151.769 1.00 190.03 ? 468 ALA A O   1 
ATOM   3127  C  CB  . ALA A 1 468 ? 145.109 209.421 154.165 1.00 179.39 ? 468 ALA A CB  1 
ATOM   3128  N  N   . LEU A 1 469 ? 147.881 209.444 152.476 1.00 182.12 ? 469 LEU A N   1 
ATOM   3129  C  CA  . LEU A 1 469 ? 149.151 210.074 152.107 1.00 183.59 ? 469 LEU A CA  1 
ATOM   3130  C  C   . LEU A 1 469 ? 149.397 209.980 150.595 1.00 193.28 ? 469 LEU A C   1 
ATOM   3131  O  O   . LEU A 1 469 ? 149.953 210.914 150.014 1.00 196.18 ? 469 LEU A O   1 
ATOM   3132  C  CB  . LEU A 1 469 ? 150.319 209.430 152.873 1.00 179.79 ? 469 LEU A CB  1 
ATOM   3133  C  CG  . LEU A 1 469 ? 150.517 209.872 154.323 1.00 181.51 ? 469 LEU A CG  1 
ATOM   3134  C  CD1 . LEU A 1 469 ? 151.251 208.809 155.116 1.00 177.61 ? 469 LEU A CD1 1 
ATOM   3135  C  CD2 . LEU A 1 469 ? 151.264 211.196 154.401 1.00 186.15 ? 469 LEU A CD2 1 
ATOM   3136  N  N   . LYS A 1 470 ? 148.989 208.849 149.969 1.00 191.00 ? 470 LYS A N   1 
ATOM   3137  C  CA  . LYS A 1 470 ? 149.113 208.588 148.530 1.00 194.88 ? 470 LYS A CA  1 
ATOM   3138  C  C   . LYS A 1 470 ? 148.214 209.533 147.727 1.00 205.19 ? 470 LYS A C   1 
ATOM   3139  O  O   . LYS A 1 470 ? 148.598 209.962 146.636 1.00 208.67 ? 470 LYS A O   1 
ATOM   3140  C  CB  . LYS A 1 470 ? 148.763 207.126 148.213 1.00 196.31 ? 470 LYS A CB  1 
ATOM   3141  C  CG  . LYS A 1 470 ? 149.930 206.323 147.662 1.00 208.85 ? 470 LYS A CG  1 
ATOM   3142  N  N   . THR A 1 471 ? 147.023 209.859 148.279 1.00 202.92 ? 471 THR A N   1 
ATOM   3143  C  CA  . THR A 1 471 ? 146.036 210.767 147.684 1.00 207.62 ? 471 THR A CA  1 
ATOM   3144  C  C   . THR A 1 471 ? 146.582 212.209 147.726 1.00 211.43 ? 471 THR A C   1 
ATOM   3145  O  O   . THR A 1 471 ? 146.506 212.919 146.718 1.00 212.68 ? 471 THR A O   1 
ATOM   3146  C  CB  . THR A 1 471 ? 144.678 210.631 148.413 1.00 213.82 ? 471 THR A CB  1 
ATOM   3147  O  OG1 . THR A 1 471 ? 144.308 209.252 148.489 1.00 213.19 ? 471 THR A OG1 1 
ATOM   3148  C  CG2 . THR A 1 471 ? 143.559 211.418 147.732 1.00 214.67 ? 471 THR A CG2 1 
ATOM   3149  N  N   . MET A 1 472 ? 147.149 212.616 148.889 1.00 207.18 ? 472 MET A N   1 
ATOM   3150  C  CA  . MET A 1 472 ? 147.730 213.939 149.132 1.00 227.57 ? 472 MET A CA  1 
ATOM   3151  C  C   . MET A 1 472 ? 149.034 214.116 148.354 1.00 247.47 ? 472 MET A C   1 
ATOM   3152  O  O   . MET A 1 472 ? 149.010 214.496 147.183 1.00 222.84 ? 472 MET A O   1 
ATOM   3153  C  CB  . MET A 1 472 ? 147.978 214.144 150.633 1.00 227.92 ? 472 MET A CB  1 
ATOM   3154  N  N   . LEU B 1 10  ? 185.376 186.272 203.697 1.00 208.73 ? 10  LEU B N   1 
ATOM   3155  C  CA  . LEU B 1 10  ? 185.587 186.279 202.254 1.00 207.99 ? 10  LEU B CA  1 
ATOM   3156  C  C   . LEU B 1 10  ? 185.642 187.706 201.704 1.00 209.99 ? 10  LEU B C   1 
ATOM   3157  O  O   . LEU B 1 10  ? 184.726 188.496 201.949 1.00 208.61 ? 10  LEU B O   1 
ATOM   3158  C  CB  . LEU B 1 10  ? 184.477 185.487 201.543 1.00 205.79 ? 10  LEU B CB  1 
ATOM   3159  N  N   . TRP B 1 11  ? 186.711 188.022 200.946 1.00 208.43 ? 11  TRP B N   1 
ATOM   3160  C  CA  . TRP B 1 11  ? 186.923 189.323 200.298 1.00 208.06 ? 11  TRP B CA  1 
ATOM   3161  C  C   . TRP B 1 11  ? 186.411 189.293 198.837 1.00 208.15 ? 11  TRP B C   1 
ATOM   3162  O  O   . TRP B 1 11  ? 186.782 190.150 198.027 1.00 208.22 ? 11  TRP B O   1 
ATOM   3163  C  CB  . TRP B 1 11  ? 188.413 189.706 200.350 1.00 209.88 ? 11  TRP B CB  1 
ATOM   3164  N  N   . GLU B 1 12  ? 185.549 188.303 198.517 1.00 203.36 ? 12  GLU B N   1 
ATOM   3165  C  CA  . GLU B 1 12  ? 184.972 188.078 197.190 1.00 201.47 ? 12  GLU B CA  1 
ATOM   3166  C  C   . GLU B 1 12  ? 183.467 187.793 197.255 1.00 202.42 ? 12  GLU B C   1 
ATOM   3167  O  O   . GLU B 1 12  ? 182.779 188.015 196.257 1.00 201.06 ? 12  GLU B O   1 
ATOM   3168  C  CB  . GLU B 1 12  ? 185.675 186.898 196.490 1.00 203.13 ? 12  GLU B CB  1 
ATOM   3169  C  CG  . GLU B 1 12  ? 187.137 187.122 196.141 1.00 209.60 ? 12  GLU B CG  1 
ATOM   3170  C  CD  . GLU B 1 12  ? 187.983 185.863 196.162 1.00 216.55 ? 12  GLU B CD  1 
ATOM   3171  O  OE1 . GLU B 1 12  ? 187.721 184.957 195.338 1.00 210.20 ? 12  GLU B OE1 1 
ATOM   3172  O  OE2 . GLU B 1 12  ? 188.912 185.784 197.000 1.00 207.38 ? 12  GLU B OE2 1 
ATOM   3173  N  N   . MET B 1 13  ? 182.955 187.280 198.402 1.00 200.05 ? 13  MET B N   1 
ATOM   3174  C  CA  . MET B 1 13  ? 181.535 186.924 198.551 1.00 197.97 ? 13  MET B CA  1 
ATOM   3175  C  C   . MET B 1 13  ? 180.868 187.542 199.811 1.00 200.12 ? 13  MET B C   1 
ATOM   3176  O  O   . MET B 1 13  ? 181.538 187.656 200.846 1.00 201.53 ? 13  MET B O   1 
ATOM   3177  C  CB  . MET B 1 13  ? 181.381 185.394 198.592 1.00 199.42 ? 13  MET B CB  1 
ATOM   3178  N  N   . PRO B 1 14  ? 179.549 187.909 199.756 1.00 195.47 ? 14  PRO B N   1 
ATOM   3179  C  CA  . PRO B 1 14  ? 178.888 188.472 200.952 1.00 194.86 ? 14  PRO B CA  1 
ATOM   3180  C  C   . PRO B 1 14  ? 178.361 187.383 201.898 1.00 197.12 ? 14  PRO B C   1 
ATOM   3181  O  O   . PRO B 1 14  ? 178.409 186.202 201.553 1.00 196.75 ? 14  PRO B O   1 
ATOM   3182  C  CB  . PRO B 1 14  ? 177.748 189.321 200.371 1.00 193.36 ? 14  PRO B CB  1 
ATOM   3183  C  CG  . PRO B 1 14  ? 177.657 188.959 198.906 1.00 195.34 ? 14  PRO B CG  1 
ATOM   3184  C  CD  . PRO B 1 14  ? 178.607 187.841 198.621 1.00 194.61 ? 14  PRO B CD  1 
ATOM   3185  N  N   . ALA B 1 15  ? 177.870 187.776 203.095 1.00 194.73 ? 15  ALA B N   1 
ATOM   3186  C  CA  . ALA B 1 15  ? 177.378 186.836 204.109 1.00 194.33 ? 15  ALA B CA  1 
ATOM   3187  C  C   . ALA B 1 15  ? 175.847 186.680 204.088 1.00 192.72 ? 15  ALA B C   1 
ATOM   3188  O  O   . ALA B 1 15  ? 175.362 185.585 203.794 1.00 189.47 ? 15  ALA B O   1 
ATOM   3189  C  CB  . ALA B 1 15  ? 177.840 187.266 205.493 1.00 196.41 ? 15  ALA B CB  1 
ATOM   3190  N  N   . GLU B 1 16  ? 175.095 187.756 204.416 1.00 186.67 ? 16  GLU B N   1 
ATOM   3191  C  CA  . GLU B 1 16  ? 173.629 187.755 204.464 1.00 180.45 ? 16  GLU B CA  1 
ATOM   3192  C  C   . GLU B 1 16  ? 173.018 187.562 203.076 1.00 178.99 ? 16  GLU B C   1 
ATOM   3193  O  O   . GLU B 1 16  ? 171.983 186.911 202.956 1.00 174.67 ? 16  GLU B O   1 
ATOM   3194  C  CB  . GLU B 1 16  ? 173.101 189.054 205.092 1.00 181.40 ? 16  GLU B CB  1 
ATOM   3195  N  N   . LYS B 1 17  ? 173.661 188.113 202.032 1.00 175.66 ? 17  LYS B N   1 
ATOM   3196  C  CA  . LYS B 1 17  ? 173.191 188.015 200.647 1.00 171.01 ? 17  LYS B CA  1 
ATOM   3197  C  C   . LYS B 1 17  ? 173.362 186.589 200.097 1.00 174.42 ? 17  LYS B C   1 
ATOM   3198  O  O   . LYS B 1 17  ? 172.572 186.169 199.250 1.00 169.63 ? 17  LYS B O   1 
ATOM   3199  C  CB  . LYS B 1 17  ? 173.915 189.037 199.751 1.00 174.62 ? 17  LYS B CB  1 
ATOM   3200  C  CG  . LYS B 1 17  ? 173.544 190.487 200.070 1.00 176.66 ? 17  LYS B CG  1 
ATOM   3201  C  CD  . LYS B 1 17  ? 174.104 191.474 199.059 1.00 179.87 ? 17  LYS B CD  1 
ATOM   3202  C  CE  . LYS B 1 17  ? 174.213 192.879 199.610 1.00 182.55 ? 17  LYS B CE  1 
ATOM   3203  N  NZ  . LYS B 1 17  ? 172.891 193.535 199.774 1.00 179.32 ? 17  LYS B NZ  1 
ATOM   3204  N  N   . ARG B 1 18  ? 174.371 185.847 200.604 1.00 175.85 ? 18  ARG B N   1 
ATOM   3205  C  CA  . ARG B 1 18  ? 174.674 184.471 200.201 1.00 176.58 ? 18  ARG B CA  1 
ATOM   3206  C  C   . ARG B 1 18  ? 173.615 183.471 200.698 1.00 177.82 ? 18  ARG B C   1 
ATOM   3207  O  O   . ARG B 1 18  ? 173.231 182.581 199.934 1.00 175.36 ? 18  ARG B O   1 
ATOM   3208  C  CB  . ARG B 1 18  ? 176.061 184.051 200.703 1.00 182.55 ? 18  ARG B CB  1 
ATOM   3209  N  N   . ILE B 1 19  ? 173.151 183.608 201.965 1.00 174.33 ? 19  ILE B N   1 
ATOM   3210  C  CA  . ILE B 1 19  ? 172.148 182.711 202.562 1.00 171.30 ? 19  ILE B CA  1 
ATOM   3211  C  C   . ILE B 1 19  ? 170.755 182.966 201.974 1.00 168.41 ? 19  ILE B C   1 
ATOM   3212  O  O   . ILE B 1 19  ? 169.964 182.028 201.887 1.00 164.87 ? 19  ILE B O   1 
ATOM   3213  C  CB  . ILE B 1 19  ? 172.126 182.728 204.114 1.00 177.08 ? 19  ILE B CB  1 
ATOM   3214  C  CG1 . ILE B 1 19  ? 172.250 184.152 204.701 1.00 178.81 ? 19  ILE B CG1 1 
ATOM   3215  C  CG2 . ILE B 1 19  ? 173.207 181.791 204.661 1.00 183.75 ? 19  ILE B CG2 1 
ATOM   3216  C  CD1 . ILE B 1 19  ? 171.858 184.293 206.165 1.00 188.07 ? 19  ILE B CD1 1 
ATOM   3217  N  N   . PHE B 1 20  ? 170.469 184.212 201.547 1.00 163.62 ? 20  PHE B N   1 
ATOM   3218  C  CA  . PHE B 1 20  ? 169.201 184.564 200.907 1.00 158.73 ? 20  PHE B CA  1 
ATOM   3219  C  C   . PHE B 1 20  ? 169.111 183.897 199.528 1.00 161.46 ? 20  PHE B C   1 
ATOM   3220  O  O   . PHE B 1 20  ? 168.062 183.354 199.174 1.00 157.48 ? 20  PHE B O   1 
ATOM   3221  C  CB  . PHE B 1 20  ? 169.040 186.092 200.783 1.00 160.00 ? 20  PHE B CB  1 
ATOM   3222  C  CG  . PHE B 1 20  ? 167.875 186.525 199.917 1.00 157.14 ? 20  PHE B CG  1 
ATOM   3223  C  CD1 . PHE B 1 20  ? 166.575 186.516 200.413 1.00 157.32 ? 20  PHE B CD1 1 
ATOM   3224  C  CD2 . PHE B 1 20  ? 168.075 186.923 198.600 1.00 158.79 ? 20  PHE B CD2 1 
ATOM   3225  C  CE1 . PHE B 1 20  ? 165.497 186.899 199.606 1.00 154.21 ? 20  PHE B CE1 1 
ATOM   3226  C  CE2 . PHE B 1 20  ? 166.996 187.297 197.792 1.00 157.66 ? 20  PHE B CE2 1 
ATOM   3227  C  CZ  . PHE B 1 20  ? 165.716 187.295 198.304 1.00 152.53 ? 20  PHE B CZ  1 
ATOM   3228  N  N   . GLY B 1 21  ? 170.205 183.973 198.769 1.00 161.40 ? 21  GLY B N   1 
ATOM   3229  C  CA  . GLY B 1 21  ? 170.331 183.384 197.441 1.00 160.70 ? 21  GLY B CA  1 
ATOM   3230  C  C   . GLY B 1 21  ? 170.246 181.872 197.474 1.00 164.95 ? 21  GLY B C   1 
ATOM   3231  O  O   . GLY B 1 21  ? 169.639 181.270 196.585 1.00 162.65 ? 21  GLY B O   1 
ATOM   3232  N  N   . ALA B 1 22  ? 170.829 181.258 198.530 1.00 163.94 ? 22  ALA B N   1 
ATOM   3233  C  CA  . ALA B 1 22  ? 170.831 179.815 198.776 1.00 164.59 ? 22  ALA B CA  1 
ATOM   3234  C  C   . ALA B 1 22  ? 169.404 179.280 198.923 1.00 163.95 ? 22  ALA B C   1 
ATOM   3235  O  O   . ALA B 1 22  ? 169.104 178.202 198.407 1.00 162.73 ? 22  ALA B O   1 
ATOM   3236  C  CB  . ALA B 1 22  ? 171.636 179.506 200.026 1.00 169.81 ? 22  ALA B CB  1 
ATOM   3237  N  N   . VAL B 1 23  ? 168.526 180.054 199.604 1.00 157.84 ? 23  VAL B N   1 
ATOM   3238  C  CA  . VAL B 1 23  ? 167.108 179.751 199.836 1.00 153.46 ? 23  VAL B CA  1 
ATOM   3239  C  C   . VAL B 1 23  ? 166.369 179.686 198.485 1.00 152.74 ? 23  VAL B C   1 
ATOM   3240  O  O   . VAL B 1 23  ? 165.695 178.692 198.205 1.00 150.29 ? 23  VAL B O   1 
ATOM   3241  C  CB  . VAL B 1 23  ? 166.482 180.794 200.810 1.00 156.08 ? 23  VAL B CB  1 
ATOM   3242  C  CG1 . VAL B 1 23  ? 164.956 180.832 200.715 1.00 151.34 ? 23  VAL B CG1 1 
ATOM   3243  C  CG2 . VAL B 1 23  ? 166.929 180.540 202.247 1.00 159.34 ? 23  VAL B CG2 1 
ATOM   3244  N  N   . LEU B 1 24  ? 166.533 180.735 197.653 1.00 148.34 ? 24  LEU B N   1 
ATOM   3245  C  CA  . LEU B 1 24  ? 165.915 180.865 196.337 1.00 145.59 ? 24  LEU B CA  1 
ATOM   3246  C  C   . LEU B 1 24  ? 166.465 179.857 195.338 1.00 151.20 ? 24  LEU B C   1 
ATOM   3247  O  O   . LEU B 1 24  ? 165.691 179.344 194.527 1.00 149.15 ? 24  LEU B O   1 
ATOM   3248  C  CB  . LEU B 1 24  ? 166.097 182.284 195.797 1.00 145.45 ? 24  LEU B CB  1 
ATOM   3249  C  CG  . LEU B 1 24  ? 164.949 183.243 196.095 1.00 147.61 ? 24  LEU B CG  1 
ATOM   3250  C  CD1 . LEU B 1 24  ? 165.088 183.867 197.482 1.00 149.31 ? 24  LEU B CD1 1 
ATOM   3251  C  CD2 . LEU B 1 24  ? 164.869 184.325 195.045 1.00 149.45 ? 24  LEU B CD2 1 
ATOM   3252  N  N   . LEU B 1 25  ? 167.785 179.563 195.395 1.00 151.42 ? 25  LEU B N   1 
ATOM   3253  C  CA  . LEU B 1 25  ? 168.430 178.592 194.507 1.00 153.29 ? 25  LEU B CA  1 
ATOM   3254  C  C   . LEU B 1 25  ? 167.889 177.187 194.772 1.00 156.90 ? 25  LEU B C   1 
ATOM   3255  O  O   . LEU B 1 25  ? 167.692 176.426 193.825 1.00 155.87 ? 25  LEU B O   1 
ATOM   3256  C  CB  . LEU B 1 25  ? 169.956 178.612 194.660 1.00 158.24 ? 25  LEU B CB  1 
ATOM   3257  C  CG  . LEU B 1 25  ? 170.727 178.027 193.487 1.00 165.74 ? 25  LEU B CG  1 
ATOM   3258  C  CD1 . LEU B 1 25  ? 171.392 179.120 192.675 1.00 167.16 ? 25  LEU B CD1 1 
ATOM   3259  C  CD2 . LEU B 1 25  ? 171.738 176.994 193.955 1.00 173.07 ? 25  LEU B CD2 1 
ATOM   3260  N  N   . PHE B 1 26  ? 167.619 176.862 196.052 1.00 154.40 ? 26  PHE B N   1 
ATOM   3261  C  CA  . PHE B 1 26  ? 167.072 175.568 196.443 1.00 154.72 ? 26  PHE B CA  1 
ATOM   3262  C  C   . PHE B 1 26  ? 165.610 175.464 196.040 1.00 155.59 ? 26  PHE B C   1 
ATOM   3263  O  O   . PHE B 1 26  ? 165.200 174.432 195.509 1.00 154.78 ? 26  PHE B O   1 
ATOM   3264  C  CB  . PHE B 1 26  ? 167.232 175.323 197.951 1.00 158.47 ? 26  PHE B CB  1 
ATOM   3265  C  CG  . PHE B 1 26  ? 166.825 173.931 198.374 1.00 160.99 ? 26  PHE B CG  1 
ATOM   3266  C  CD1 . PHE B 1 26  ? 167.654 172.842 198.128 1.00 168.01 ? 26  PHE B CD1 1 
ATOM   3267  C  CD2 . PHE B 1 26  ? 165.607 173.708 199.006 1.00 160.51 ? 26  PHE B CD2 1 
ATOM   3268  C  CE1 . PHE B 1 26  ? 167.270 171.554 198.503 1.00 169.94 ? 26  PHE B CE1 1 
ATOM   3269  C  CE2 . PHE B 1 26  ? 165.224 172.419 199.381 1.00 164.32 ? 26  PHE B CE2 1 
ATOM   3270  C  CZ  . PHE B 1 26  ? 166.058 171.351 199.126 1.00 166.15 ? 26  PHE B CZ  1 
ATOM   3271  N  N   . SER B 1 27  ? 164.831 176.534 196.286 1.00 150.75 ? 27  SER B N   1 
ATOM   3272  C  CA  . SER B 1 27  ? 163.404 176.614 195.969 1.00 147.51 ? 27  SER B CA  1 
ATOM   3273  C  C   . SER B 1 27  ? 163.144 176.415 194.478 1.00 150.42 ? 27  SER B C   1 
ATOM   3274  O  O   . SER B 1 27  ? 162.104 175.860 194.118 1.00 148.49 ? 27  SER B O   1 
ATOM   3275  C  CB  . SER B 1 27  ? 162.831 177.956 196.417 1.00 150.24 ? 27  SER B CB  1 
ATOM   3276  O  OG  . SER B 1 27  ? 163.003 178.157 197.811 1.00 164.09 ? 27  SER B OG  1 
ATOM   3277  N  N   . TRP B 1 28  ? 164.095 176.846 193.621 1.00 148.21 ? 28  TRP B N   1 
ATOM   3278  C  CA  . TRP B 1 28  ? 163.982 176.723 192.171 1.00 147.61 ? 28  TRP B CA  1 
ATOM   3279  C  C   . TRP B 1 28  ? 164.468 175.370 191.659 1.00 153.64 ? 28  TRP B C   1 
ATOM   3280  O  O   . TRP B 1 28  ? 163.863 174.856 190.719 1.00 152.64 ? 28  TRP B O   1 
ATOM   3281  C  CB  . TRP B 1 28  ? 164.706 177.861 191.452 1.00 147.20 ? 28  TRP B CB  1 
ATOM   3282  C  CG  . TRP B 1 28  ? 163.830 179.059 191.282 1.00 144.95 ? 28  TRP B CG  1 
ATOM   3283  C  CD1 . TRP B 1 28  ? 163.801 180.169 192.072 1.00 146.96 ? 28  TRP B CD1 1 
ATOM   3284  C  CD2 . TRP B 1 28  ? 162.763 179.211 190.334 1.00 142.42 ? 28  TRP B CD2 1 
ATOM   3285  N  NE1 . TRP B 1 28  ? 162.817 181.029 191.645 1.00 143.64 ? 28  TRP B NE1 1 
ATOM   3286  C  CE2 . TRP B 1 28  ? 162.156 180.462 190.585 1.00 144.11 ? 28  TRP B CE2 1 
ATOM   3287  C  CE3 . TRP B 1 28  ? 162.274 178.419 189.278 1.00 143.62 ? 28  TRP B CE3 1 
ATOM   3288  C  CZ2 . TRP B 1 28  ? 161.085 180.945 189.816 1.00 140.91 ? 28  TRP B CZ2 1 
ATOM   3289  C  CZ3 . TRP B 1 28  ? 161.215 178.899 188.517 1.00 142.76 ? 28  TRP B CZ3 1 
ATOM   3290  C  CH2 . TRP B 1 28  ? 160.631 180.146 188.789 1.00 141.03 ? 28  TRP B CH2 1 
ATOM   3291  N  N   . THR B 1 29  ? 165.530 174.786 192.262 1.00 152.96 ? 29  THR B N   1 
ATOM   3292  C  CA  . THR B 1 29  ? 166.036 173.468 191.843 1.00 155.60 ? 29  THR B CA  1 
ATOM   3293  C  C   . THR B 1 29  ? 165.004 172.379 192.176 1.00 157.28 ? 29  THR B C   1 
ATOM   3294  O  O   . THR B 1 29  ? 164.781 171.486 191.356 1.00 157.39 ? 29  THR B O   1 
ATOM   3295  C  CB  . THR B 1 29  ? 167.412 173.151 192.447 1.00 167.14 ? 29  THR B CB  1 
ATOM   3296  O  OG1 . THR B 1 29  ? 167.388 173.369 193.859 1.00 167.11 ? 29  THR B OG1 1 
ATOM   3297  C  CG2 . THR B 1 29  ? 168.537 173.943 191.793 1.00 167.15 ? 29  THR B CG2 1 
ATOM   3298  N  N   . VAL B 1 30  ? 164.350 172.488 193.358 1.00 151.54 ? 30  VAL B N   1 
ATOM   3299  C  CA  . VAL B 1 30  ? 163.292 171.582 193.820 1.00 149.80 ? 30  VAL B CA  1 
ATOM   3300  C  C   . VAL B 1 30  ? 162.124 171.702 192.847 1.00 151.25 ? 30  VAL B C   1 
ATOM   3301  O  O   . VAL B 1 30  ? 161.601 170.678 192.402 1.00 151.40 ? 30  VAL B O   1 
ATOM   3302  C  CB  . VAL B 1 30  ? 162.888 171.877 195.293 1.00 152.30 ? 30  VAL B CB  1 
ATOM   3303  C  CG1 . VAL B 1 30  ? 161.506 171.324 195.637 1.00 149.80 ? 30  VAL B CG1 1 
ATOM   3304  C  CG2 . VAL B 1 30  ? 163.929 171.326 196.249 1.00 155.89 ? 30  VAL B CG2 1 
ATOM   3305  N  N   . TYR B 1 31  ? 161.765 172.955 192.475 1.00 145.58 ? 31  TYR B N   1 
ATOM   3306  C  CA  . TYR B 1 31  ? 160.706 173.246 191.514 1.00 142.95 ? 31  TYR B CA  1 
ATOM   3307  C  C   . TYR B 1 31  ? 161.024 172.620 190.154 1.00 148.54 ? 31  TYR B C   1 
ATOM   3308  O  O   . TYR B 1 31  ? 160.162 171.940 189.598 1.00 147.93 ? 31  TYR B O   1 
ATOM   3309  C  CB  . TYR B 1 31  ? 160.470 174.758 191.363 1.00 142.05 ? 31  TYR B CB  1 
ATOM   3310  C  CG  . TYR B 1 31  ? 159.484 175.078 190.261 1.00 143.09 ? 31  TYR B CG  1 
ATOM   3311  C  CD1 . TYR B 1 31  ? 158.128 174.797 190.409 1.00 143.53 ? 31  TYR B CD1 1 
ATOM   3312  C  CD2 . TYR B 1 31  ? 159.911 175.617 189.051 1.00 144.89 ? 31  TYR B CD2 1 
ATOM   3313  C  CE1 . TYR B 1 31  ? 157.218 175.055 189.385 1.00 143.67 ? 31  TYR B CE1 1 
ATOM   3314  C  CE2 . TYR B 1 31  ? 159.009 175.885 188.020 1.00 144.66 ? 31  TYR B CE2 1 
ATOM   3315  C  CZ  . TYR B 1 31  ? 157.662 175.606 188.195 1.00 150.60 ? 31  TYR B CZ  1 
ATOM   3316  O  OH  . TYR B 1 31  ? 156.759 175.848 187.191 1.00 150.03 ? 31  TYR B OH  1 
ATOM   3317  N  N   . LEU B 1 32  ? 162.259 172.837 189.634 1.00 147.01 ? 32  LEU B N   1 
ATOM   3318  C  CA  . LEU B 1 32  ? 162.710 172.301 188.345 1.00 149.05 ? 32  LEU B CA  1 
ATOM   3319  C  C   . LEU B 1 32  ? 162.763 170.774 188.358 1.00 155.41 ? 32  LEU B C   1 
ATOM   3320  O  O   . LEU B 1 32  ? 162.502 170.157 187.325 1.00 156.43 ? 32  LEU B O   1 
ATOM   3321  C  CB  . LEU B 1 32  ? 164.072 172.875 187.930 1.00 151.67 ? 32  LEU B CB  1 
ATOM   3322  C  CG  . LEU B 1 32  ? 164.084 174.330 187.443 1.00 154.53 ? 32  LEU B CG  1 
ATOM   3323  C  CD1 . LEU B 1 32  ? 165.498 174.866 187.393 1.00 157.84 ? 32  LEU B CD1 1 
ATOM   3324  C  CD2 . LEU B 1 32  ? 163.419 174.482 186.079 1.00 155.51 ? 32  LEU B CD2 1 
ATOM   3325  N  N   . TRP B 1 33  ? 163.066 170.168 189.522 1.00 152.91 ? 33  TRP B N   1 
ATOM   3326  C  CA  . TRP B 1 33  ? 163.080 168.714 189.696 1.00 155.35 ? 33  TRP B CA  1 
ATOM   3327  C  C   . TRP B 1 33  ? 161.652 168.170 189.574 1.00 155.99 ? 33  TRP B C   1 
ATOM   3328  O  O   . TRP B 1 33  ? 161.423 167.187 188.869 1.00 157.26 ? 33  TRP B O   1 
ATOM   3329  C  CB  . TRP B 1 33  ? 163.705 168.335 191.053 1.00 155.97 ? 33  TRP B CB  1 
ATOM   3330  C  CG  . TRP B 1 33  ? 163.380 166.947 191.529 1.00 158.73 ? 33  TRP B CG  1 
ATOM   3331  C  CD1 . TRP B 1 33  ? 162.558 166.609 192.563 1.00 160.17 ? 33  TRP B CD1 1 
ATOM   3332  C  CD2 . TRP B 1 33  ? 163.843 165.712 190.962 1.00 162.41 ? 33  TRP B CD2 1 
ATOM   3333  N  NE1 . TRP B 1 33  ? 162.499 165.241 192.693 1.00 162.36 ? 33  TRP B NE1 1 
ATOM   3334  C  CE2 . TRP B 1 33  ? 163.276 164.665 191.722 1.00 167.01 ? 33  TRP B CE2 1 
ATOM   3335  C  CE3 . TRP B 1 33  ? 164.690 165.387 189.888 1.00 166.91 ? 33  TRP B CE3 1 
ATOM   3336  C  CZ2 . TRP B 1 33  ? 163.541 163.316 191.453 1.00 170.06 ? 33  TRP B CZ2 1 
ATOM   3337  C  CZ3 . TRP B 1 33  ? 164.936 164.051 189.611 1.00 172.15 ? 33  TRP B CZ3 1 
ATOM   3338  C  CH2 . TRP B 1 33  ? 164.366 163.033 190.388 1.00 173.30 ? 33  TRP B CH2 1 
ATOM   3339  N  N   . GLU B 1 34  ? 160.702 168.837 190.247 1.00 148.45 ? 34  GLU B N   1 
ATOM   3340  C  CA  . GLU B 1 34  ? 159.285 168.489 190.248 1.00 146.06 ? 34  GLU B CA  1 
ATOM   3341  C  C   . GLU B 1 34  ? 158.654 168.750 188.874 1.00 148.65 ? 34  GLU B C   1 
ATOM   3342  O  O   . GLU B 1 34  ? 157.751 168.009 188.477 1.00 148.72 ? 34  GLU B O   1 
ATOM   3343  C  CB  . GLU B 1 34  ? 158.541 169.262 191.349 1.00 144.26 ? 34  GLU B CB  1 
ATOM   3344  C  CG  . GLU B 1 34  ? 158.848 168.747 192.750 1.00 156.09 ? 34  GLU B CG  1 
ATOM   3345  C  CD  . GLU B 1 34  ? 158.137 169.408 193.917 1.00 170.70 ? 34  GLU B CD  1 
ATOM   3346  O  OE1 . GLU B 1 34  ? 157.553 170.501 193.735 1.00 159.46 ? 34  GLU B OE1 1 
ATOM   3347  O  OE2 . GLU B 1 34  ? 158.185 168.835 195.029 1.00 164.17 ? 34  GLU B OE2 1 
ATOM   3348  N  N   . THR B 1 35  ? 159.143 169.784 188.147 1.00 143.85 ? 35  THR B N   1 
ATOM   3349  C  CA  . THR B 1 35  ? 158.671 170.144 186.804 1.00 142.94 ? 35  THR B CA  1 
ATOM   3350  C  C   . THR B 1 35  ? 159.185 169.103 185.801 1.00 149.69 ? 35  THR B C   1 
ATOM   3351  O  O   . THR B 1 35  ? 158.435 168.718 184.901 1.00 150.10 ? 35  THR B O   1 
ATOM   3352  C  CB  . THR B 1 35  ? 159.073 171.581 186.442 1.00 149.68 ? 35  THR B CB  1 
ATOM   3353  O  OG1 . THR B 1 35  ? 158.570 172.459 187.447 1.00 147.22 ? 35  THR B OG1 1 
ATOM   3354  C  CG2 . THR B 1 35  ? 158.527 172.026 185.090 1.00 147.89 ? 35  THR B CG2 1 
ATOM   3355  N  N   . PHE B 1 36  ? 160.443 168.627 185.974 1.00 148.07 ? 36  PHE B N   1 
ATOM   3356  C  CA  . PHE B 1 36  ? 161.034 167.581 185.128 1.00 151.41 ? 36  PHE B CA  1 
ATOM   3357  C  C   . PHE B 1 36  ? 160.200 166.301 185.263 1.00 153.64 ? 36  PHE B C   1 
ATOM   3358  O  O   . PHE B 1 36  ? 159.904 165.650 184.260 1.00 154.96 ? 36  PHE B O   1 
ATOM   3359  C  CB  . PHE B 1 36  ? 162.517 167.336 185.490 1.00 156.63 ? 36  PHE B CB  1 
ATOM   3360  C  CG  . PHE B 1 36  ? 163.066 165.977 185.114 1.00 163.02 ? 36  PHE B CG  1 
ATOM   3361  C  CD1 . PHE B 1 36  ? 163.296 165.643 183.783 1.00 169.37 ? 36  PHE B CD1 1 
ATOM   3362  C  CD2 . PHE B 1 36  ? 163.357 165.032 186.090 1.00 167.06 ? 36  PHE B CD2 1 
ATOM   3363  C  CE1 . PHE B 1 36  ? 163.787 164.380 183.435 1.00 175.00 ? 36  PHE B CE1 1 
ATOM   3364  C  CE2 . PHE B 1 36  ? 163.852 163.771 185.742 1.00 174.52 ? 36  PHE B CE2 1 
ATOM   3365  C  CZ  . PHE B 1 36  ? 164.066 163.455 184.417 1.00 175.61 ? 36  PHE B CZ  1 
ATOM   3366  N  N   . LEU B 1 37  ? 159.801 165.979 186.508 1.00 147.47 ? 37  LEU B N   1 
ATOM   3367  C  CA  . LEU B 1 37  ? 158.959 164.842 186.862 1.00 147.43 ? 37  LEU B CA  1 
ATOM   3368  C  C   . LEU B 1 37  ? 157.576 165.004 186.258 1.00 148.66 ? 37  LEU B C   1 
ATOM   3369  O  O   . LEU B 1 37  ? 157.036 164.040 185.716 1.00 150.84 ? 37  LEU B O   1 
ATOM   3370  C  CB  . LEU B 1 37  ? 158.861 164.736 188.387 1.00 146.03 ? 37  LEU B CB  1 
ATOM   3371  C  CG  . LEU B 1 37  ? 159.618 163.600 189.041 1.00 154.10 ? 37  LEU B CG  1 
ATOM   3372  C  CD1 . LEU B 1 37  ? 161.114 163.773 188.888 1.00 157.10 ? 37  LEU B CD1 1 
ATOM   3373  C  CD2 . LEU B 1 37  ? 159.288 163.533 190.493 1.00 154.77 ? 37  LEU B CD2 1 
ATOM   3374  N  N   . ALA B 1 38  ? 157.016 166.231 186.333 1.00 140.37 ? 38  ALA B N   1 
ATOM   3375  C  CA  . ALA B 1 38  ? 155.712 166.569 185.773 1.00 138.01 ? 38  ALA B CA  1 
ATOM   3376  C  C   . ALA B 1 38  ? 155.726 166.416 184.254 1.00 143.90 ? 38  ALA B C   1 
ATOM   3377  O  O   . ALA B 1 38  ? 154.760 165.905 183.697 1.00 144.36 ? 38  ALA B O   1 
ATOM   3378  C  CB  . ALA B 1 38  ? 155.326 167.985 186.157 1.00 134.98 ? 38  ALA B CB  1 
ATOM   3379  N  N   . GLN B 1 39  ? 156.839 166.821 183.599 1.00 142.01 ? 39  GLN B N   1 
ATOM   3380  C  CA  . GLN B 1 39  ? 157.060 166.703 182.152 1.00 144.81 ? 39  GLN B CA  1 
ATOM   3381  C  C   . GLN B 1 39  ? 157.158 165.227 181.757 1.00 152.98 ? 39  GLN B C   1 
ATOM   3382  O  O   . GLN B 1 39  ? 156.599 164.828 180.735 1.00 154.06 ? 39  GLN B O   1 
ATOM   3383  C  CB  . GLN B 1 39  ? 158.343 167.460 181.746 1.00 147.28 ? 39  GLN B CB  1 
ATOM   3384  C  CG  . GLN B 1 39  ? 158.661 167.452 180.251 1.00 165.55 ? 39  GLN B CG  1 
ATOM   3385  N  N   . ARG B 1 40  ? 157.862 164.428 182.584 1.00 151.93 ? 40  ARG B N   1 
ATOM   3386  C  CA  . ARG B 1 40  ? 158.081 162.992 182.404 1.00 156.16 ? 40  ARG B CA  1 
ATOM   3387  C  C   . ARG B 1 40  ? 156.753 162.218 182.430 1.00 159.95 ? 40  ARG B C   1 
ATOM   3388  O  O   . ARG B 1 40  ? 156.566 161.325 181.603 1.00 163.20 ? 40  ARG B O   1 
ATOM   3389  C  CB  . ARG B 1 40  ? 159.034 162.466 183.488 1.00 157.84 ? 40  ARG B CB  1 
ATOM   3390  C  CG  . ARG B 1 40  ? 159.903 161.314 183.027 1.00 174.25 ? 40  ARG B CG  1 
ATOM   3391  C  CD  . ARG B 1 40  ? 161.073 161.081 183.964 1.00 187.01 ? 40  ARG B CD  1 
ATOM   3392  N  NE  . ARG B 1 40  ? 161.876 159.929 183.547 1.00 205.11 ? 40  ARG B NE  1 
ATOM   3393  C  CZ  . ARG B 1 40  ? 162.867 159.981 182.660 1.00 226.31 ? 40  ARG B CZ  1 
ATOM   3394  N  NH1 . ARG B 1 40  ? 163.197 161.132 182.087 1.00 213.05 ? 40  ARG B NH1 1 
ATOM   3395  N  NH2 . ARG B 1 40  ? 163.533 158.880 182.338 1.00 219.82 ? 40  ARG B NH2 1 
ATOM   3396  N  N   . GLN B 1 41  ? 155.833 162.577 183.354 1.00 152.57 ? 41  GLN B N   1 
ATOM   3397  C  CA  . GLN B 1 41  ? 154.525 161.929 183.476 1.00 152.20 ? 41  GLN B CA  1 
ATOM   3398  C  C   . GLN B 1 41  ? 153.515 162.490 182.474 1.00 155.09 ? 41  GLN B C   1 
ATOM   3399  O  O   . GLN B 1 41  ? 152.579 161.777 182.114 1.00 155.95 ? 41  GLN B O   1 
ATOM   3400  C  CB  . GLN B 1 41  ? 153.974 162.033 184.900 1.00 150.60 ? 41  GLN B CB  1 
ATOM   3401  C  CG  . GLN B 1 41  ? 153.570 160.675 185.465 1.00 174.07 ? 41  GLN B CG  1 
ATOM   3402  C  CD  . GLN B 1 41  ? 152.082 160.452 185.531 1.00 199.57 ? 41  GLN B CD  1 
ATOM   3403  O  OE1 . GLN B 1 41  ? 151.523 159.614 184.813 1.00 199.13 ? 41  GLN B OE1 1 
ATOM   3404  N  NE2 . GLN B 1 41  ? 151.415 161.143 186.444 1.00 191.38 ? 41  GLN B NE2 1 
ATOM   3405  N  N   . ARG B 1 42  ? 153.697 163.751 182.020 1.00 150.02 ? 42  ARG B N   1 
ATOM   3406  C  CA  . ARG B 1 42  ? 152.823 164.369 181.015 1.00 149.64 ? 42  ARG B CA  1 
ATOM   3407  C  C   . ARG B 1 42  ? 153.024 163.673 179.671 1.00 158.78 ? 42  ARG B C   1 
ATOM   3408  O  O   . ARG B 1 42  ? 152.072 163.537 178.903 1.00 159.77 ? 42  ARG B O   1 
ATOM   3409  C  CB  . ARG B 1 42  ? 153.084 165.876 180.890 1.00 147.14 ? 42  ARG B CB  1 
ATOM   3410  N  N   . ARG B 1 43  ? 154.263 163.202 179.413 1.00 158.82 ? 43  ARG B N   1 
ATOM   3411  C  CA  . ARG B 1 43  ? 154.636 162.463 178.207 1.00 164.03 ? 43  ARG B CA  1 
ATOM   3412  C  C   . ARG B 1 43  ? 153.908 161.124 178.165 1.00 170.90 ? 43  ARG B C   1 
ATOM   3413  O  O   . ARG B 1 43  ? 153.459 160.727 177.095 1.00 173.97 ? 43  ARG B O   1 
ATOM   3414  C  CB  . ARG B 1 43  ? 156.158 162.259 178.134 1.00 167.98 ? 43  ARG B CB  1 
ATOM   3415  C  CG  . ARG B 1 43  ? 156.908 163.502 177.663 1.00 180.30 ? 43  ARG B CG  1 
ATOM   3416  C  CD  . ARG B 1 43  ? 158.365 163.496 178.079 1.00 195.76 ? 43  ARG B CD  1 
ATOM   3417  N  NE  . ARG B 1 43  ? 159.194 162.714 177.159 1.00 215.50 ? 43  ARG B NE  1 
ATOM   3418  C  CZ  . ARG B 1 43  ? 160.517 162.613 177.245 1.00 236.20 ? 43  ARG B CZ  1 
ATOM   3419  N  NH1 . ARG B 1 43  ? 161.179 163.240 178.209 1.00 222.43 ? 43  ARG B NH1 1 
ATOM   3420  N  NH2 . ARG B 1 43  ? 161.189 161.881 176.363 1.00 229.51 ? 43  ARG B NH2 1 
ATOM   3421  N  N   . ILE B 1 44  ? 153.748 160.459 179.335 1.00 166.43 ? 44  ILE B N   1 
ATOM   3422  C  CA  . ILE B 1 44  ? 153.055 159.171 179.490 1.00 168.99 ? 44  ILE B CA  1 
ATOM   3423  C  C   . ILE B 1 44  ? 151.585 159.318 179.045 1.00 171.79 ? 44  ILE B C   1 
ATOM   3424  O  O   . ILE B 1 44  ? 151.097 158.472 178.298 1.00 175.11 ? 44  ILE B O   1 
ATOM   3425  C  CB  . ILE B 1 44  ? 153.173 158.611 180.951 1.00 170.90 ? 44  ILE B CB  1 
ATOM   3426  C  CG1 . ILE B 1 44  ? 154.633 158.618 181.512 1.00 171.87 ? 44  ILE B CG1 1 
ATOM   3427  C  CG2 . ILE B 1 44  ? 152.496 157.245 181.119 1.00 174.80 ? 44  ILE B CG2 1 
ATOM   3428  C  CD1 . ILE B 1 44  ? 155.757 157.841 180.718 1.00 185.46 ? 44  ILE B CD1 1 
ATOM   3429  N  N   . TYR B 1 45  ? 150.907 160.406 179.469 1.00 163.92 ? 45  TYR B N   1 
ATOM   3430  C  CA  . TYR B 1 45  ? 149.513 160.698 179.119 1.00 163.01 ? 45  TYR B CA  1 
ATOM   3431  C  C   . TYR B 1 45  ? 149.346 160.935 177.617 1.00 168.81 ? 45  TYR B C   1 
ATOM   3432  O  O   . TYR B 1 45  ? 148.344 160.507 177.048 1.00 170.51 ? 45  TYR B O   1 
ATOM   3433  C  CB  . TYR B 1 45  ? 148.987 161.926 179.895 1.00 159.30 ? 45  TYR B CB  1 
ATOM   3434  C  CG  . TYR B 1 45  ? 148.973 161.783 181.404 1.00 159.09 ? 45  TYR B CG  1 
ATOM   3435  C  CD1 . TYR B 1 45  ? 148.411 160.665 182.015 1.00 163.18 ? 45  TYR B CD1 1 
ATOM   3436  C  CD2 . TYR B 1 45  ? 149.444 162.803 182.224 1.00 155.97 ? 45  TYR B CD2 1 
ATOM   3437  C  CE1 . TYR B 1 45  ? 148.386 160.533 183.403 1.00 162.43 ? 45  TYR B CE1 1 
ATOM   3438  C  CE2 . TYR B 1 45  ? 149.408 162.691 183.615 1.00 155.06 ? 45  TYR B CE2 1 
ATOM   3439  C  CZ  . TYR B 1 45  ? 148.871 161.555 184.201 1.00 166.08 ? 45  TYR B CZ  1 
ATOM   3440  O  OH  . TYR B 1 45  ? 148.818 161.432 185.570 1.00 167.58 ? 45  TYR B OH  1 
ATOM   3441  N  N   . LYS B 1 46  ? 150.328 161.605 176.984 1.00 165.42 ? 46  LYS B N   1 
ATOM   3442  C  CA  . LYS B 1 46  ? 150.321 161.934 175.557 1.00 168.18 ? 46  LYS B CA  1 
ATOM   3443  C  C   . LYS B 1 46  ? 150.741 160.748 174.672 1.00 178.35 ? 46  LYS B C   1 
ATOM   3444  O  O   . LYS B 1 46  ? 150.228 160.623 173.557 1.00 181.28 ? 46  LYS B O   1 
ATOM   3445  C  CB  . LYS B 1 46  ? 151.238 163.136 175.282 1.00 168.63 ? 46  LYS B CB  1 
ATOM   3446  N  N   . THR B 1 47  ? 151.673 159.895 175.151 1.00 176.75 ? 47  THR B N   1 
ATOM   3447  C  CA  . THR B 1 47  ? 152.175 158.747 174.390 1.00 182.57 ? 47  THR B CA  1 
ATOM   3448  C  C   . THR B 1 47  ? 151.210 157.554 174.482 1.00 189.29 ? 47  THR B C   1 
ATOM   3449  O  O   . THR B 1 47  ? 150.757 157.078 173.439 1.00 193.44 ? 47  THR B O   1 
ATOM   3450  C  CB  . THR B 1 47  ? 153.602 158.356 174.832 1.00 191.92 ? 47  THR B CB  1 
ATOM   3451  O  OG1 . THR B 1 47  ? 154.413 159.528 174.917 1.00 189.44 ? 47  THR B OG1 1 
ATOM   3452  C  CG2 . THR B 1 47  ? 154.260 157.358 173.885 1.00 197.35 ? 47  THR B CG2 1 
ATOM   3453  N  N   . THR B 1 48  ? 150.908 157.064 175.707 1.00 183.85 ? 48  THR B N   1 
ATOM   3454  C  CA  . THR B 1 48  ? 150.041 155.897 175.908 1.00 186.76 ? 48  THR B CA  1 
ATOM   3455  C  C   . THR B 1 48  ? 148.574 156.257 175.586 1.00 191.07 ? 48  THR B C   1 
ATOM   3456  O  O   . THR B 1 48  ? 147.788 156.583 176.477 1.00 186.82 ? 48  THR B O   1 
ATOM   3457  C  CB  . THR B 1 48  ? 150.217 155.284 177.319 1.00 193.17 ? 48  THR B CB  1 
ATOM   3458  O  OG1 . THR B 1 48  ? 149.773 156.208 178.308 1.00 189.34 ? 48  THR B OG1 1 
ATOM   3459  C  CG2 . THR B 1 48  ? 151.652 154.855 177.610 1.00 192.68 ? 48  THR B CG2 1 
ATOM   3460  N  N   . THR B 1 49  ? 148.229 156.196 174.288 1.00 193.26 ? 49  THR B N   1 
ATOM   3461  C  CA  . THR B 1 49  ? 146.891 156.479 173.758 1.00 194.60 ? 49  THR B CA  1 
ATOM   3462  C  C   . THR B 1 49  ? 146.078 155.162 173.656 1.00 205.68 ? 49  THR B C   1 
ATOM   3463  O  O   . THR B 1 49  ? 144.847 155.194 173.733 1.00 205.24 ? 49  THR B O   1 
ATOM   3464  C  CB  . THR B 1 49  ? 146.980 157.255 172.417 1.00 205.00 ? 49  THR B CB  1 
ATOM   3465  O  OG1 . THR B 1 49  ? 145.668 157.608 171.975 1.00 205.74 ? 49  THR B OG1 1 
ATOM   3466  C  CG2 . THR B 1 49  ? 147.714 156.492 171.313 1.00 210.23 ? 49  THR B CG2 1 
ATOM   3467  N  N   . HIS B 1 50  ? 146.778 154.014 173.499 1.00 208.12 ? 50  HIS B N   1 
ATOM   3468  C  CA  . HIS B 1 50  ? 146.193 152.672 173.422 1.00 213.36 ? 50  HIS B CA  1 
ATOM   3469  C  C   . HIS B 1 50  ? 146.209 152.016 174.807 1.00 216.12 ? 50  HIS B C   1 
ATOM   3470  O  O   . HIS B 1 50  ? 147.162 152.218 175.564 1.00 213.18 ? 50  HIS B O   1 
ATOM   3471  C  CB  . HIS B 1 50  ? 146.957 151.811 172.406 1.00 220.63 ? 50  HIS B CB  1 
ATOM   3472  N  N   . VAL B 1 51  ? 145.157 151.241 175.139 1.00 214.66 ? 51  VAL B N   1 
ATOM   3473  C  CA  . VAL B 1 51  ? 145.029 150.559 176.432 1.00 213.41 ? 51  VAL B CA  1 
ATOM   3474  C  C   . VAL B 1 51  ? 146.069 149.418 176.561 1.00 221.95 ? 51  VAL B C   1 
ATOM   3475  O  O   . VAL B 1 51  ? 146.182 148.596 175.642 1.00 227.70 ? 51  VAL B O   1 
ATOM   3476  C  CB  . VAL B 1 51  ? 143.594 150.034 176.659 1.00 219.06 ? 51  VAL B CB  1 
ATOM   3477  N  N   . PRO B 1 52  ? 146.841 149.358 177.682 1.00 215.61 ? 52  PRO B N   1 
ATOM   3478  C  CA  . PRO B 1 52  ? 147.848 148.287 177.832 1.00 219.29 ? 52  PRO B CA  1 
ATOM   3479  C  C   . PRO B 1 52  ? 147.224 146.895 178.024 1.00 227.85 ? 52  PRO B C   1 
ATOM   3480  O  O   . PRO B 1 52  ? 146.094 146.808 178.514 1.00 226.37 ? 52  PRO B O   1 
ATOM   3481  C  CB  . PRO B 1 52  ? 148.638 148.709 179.084 1.00 216.31 ? 52  PRO B CB  1 
ATOM   3482  C  CG  . PRO B 1 52  ? 148.257 150.127 179.345 1.00 214.54 ? 52  PRO B CG  1 
ATOM   3483  C  CD  . PRO B 1 52  ? 146.855 150.256 178.854 1.00 210.60 ? 52  PRO B CD  1 
ATOM   3484  N  N   . PRO B 1 53  ? 147.930 145.793 177.661 1.00 229.46 ? 53  PRO B N   1 
ATOM   3485  C  CA  . PRO B 1 53  ? 147.340 144.451 177.836 1.00 232.18 ? 53  PRO B CA  1 
ATOM   3486  C  C   . PRO B 1 53  ? 147.173 144.050 179.306 1.00 233.45 ? 53  PRO B C   1 
ATOM   3487  O  O   . PRO B 1 53  ? 146.244 143.304 179.624 1.00 234.39 ? 53  PRO B O   1 
ATOM   3488  C  CB  . PRO B 1 53  ? 148.333 143.522 177.121 1.00 237.08 ? 53  PRO B CB  1 
ATOM   3489  C  CG  . PRO B 1 53  ? 149.203 144.422 176.297 1.00 239.57 ? 53  PRO B CG  1 
ATOM   3490  C  CD  . PRO B 1 53  ? 149.272 145.703 177.054 1.00 232.18 ? 53  PRO B CD  1 
ATOM   3491  N  N   . GLU B 1 54  ? 148.060 144.547 180.196 1.00 228.74 ? 54  GLU B N   1 
ATOM   3492  C  CA  . GLU B 1 54  ? 148.024 144.274 181.636 1.00 227.07 ? 54  GLU B CA  1 
ATOM   3493  C  C   . GLU B 1 54  ? 146.802 144.941 182.290 1.00 225.70 ? 54  GLU B C   1 
ATOM   3494  O  O   . GLU B 1 54  ? 146.089 144.287 183.054 1.00 226.61 ? 54  GLU B O   1 
ATOM   3495  C  CB  . GLU B 1 54  ? 149.322 144.746 182.312 1.00 225.44 ? 54  GLU B CB  1 
ATOM   3496  N  N   . LEU B 1 55  ? 146.549 146.229 181.967 1.00 216.52 ? 55  LEU B N   1 
ATOM   3497  C  CA  . LEU B 1 55  ? 145.422 147.008 182.489 1.00 211.46 ? 55  LEU B CA  1 
ATOM   3498  C  C   . LEU B 1 55  ? 144.182 146.905 181.568 1.00 216.60 ? 55  LEU B C   1 
ATOM   3499  O  O   . LEU B 1 55  ? 143.259 147.716 181.680 1.00 212.45 ? 55  LEU B O   1 
ATOM   3500  C  CB  . LEU B 1 55  ? 145.848 148.474 182.667 1.00 205.20 ? 55  LEU B CB  1 
ATOM   3501  N  N   . GLY B 1 56  ? 144.172 145.891 180.697 1.00 219.12 ? 56  GLY B N   1 
ATOM   3502  C  CA  . GLY B 1 56  ? 143.097 145.619 179.746 1.00 222.71 ? 56  GLY B CA  1 
ATOM   3503  C  C   . GLY B 1 56  ? 141.776 145.245 180.389 1.00 226.75 ? 56  GLY B C   1 
ATOM   3504  O  O   . GLY B 1 56  ? 140.718 145.688 179.932 1.00 226.38 ? 56  GLY B O   1 
ATOM   3505  N  N   . GLN B 1 57  ? 141.829 144.428 181.456 1.00 224.27 ? 57  GLN B N   1 
ATOM   3506  C  CA  . GLN B 1 57  ? 140.653 143.988 182.210 1.00 224.85 ? 57  GLN B CA  1 
ATOM   3507  C  C   . GLN B 1 57  ? 140.226 145.045 183.241 1.00 221.64 ? 57  GLN B C   1 
ATOM   3508  O  O   . GLN B 1 57  ? 139.069 145.047 183.667 1.00 221.05 ? 57  GLN B O   1 
ATOM   3509  C  CB  . GLN B 1 57  ? 140.936 142.649 182.907 1.00 228.04 ? 57  GLN B CB  1 
ATOM   3510  N  N   . ILE B 1 58  ? 141.159 145.940 183.630 1.00 212.81 ? 58  ILE B N   1 
ATOM   3511  C  CA  . ILE B 1 58  ? 140.946 147.000 184.615 1.00 206.48 ? 58  ILE B CA  1 
ATOM   3512  C  C   . ILE B 1 58  ? 140.054 148.132 184.063 1.00 207.78 ? 58  ILE B C   1 
ATOM   3513  O  O   . ILE B 1 58  ? 139.108 148.526 184.747 1.00 205.51 ? 58  ILE B O   1 
ATOM   3514  C  CB  . ILE B 1 58  ? 142.301 147.548 185.115 1.00 205.61 ? 58  ILE B CB  1 
ATOM   3515  N  N   . MET B 1 59  ? 140.351 148.659 182.851 1.00 204.26 ? 59  MET B N   1 
ATOM   3516  C  CA  . MET B 1 59  ? 139.576 149.749 182.242 1.00 201.53 ? 59  MET B CA  1 
ATOM   3517  C  C   . MET B 1 59  ? 139.422 149.573 180.726 1.00 208.62 ? 59  MET B C   1 
ATOM   3518  O  O   . MET B 1 59  ? 140.375 149.187 180.046 1.00 209.99 ? 59  MET B O   1 
ATOM   3519  C  CB  . MET B 1 59  ? 140.221 151.113 182.549 1.00 197.54 ? 59  MET B CB  1 
ATOM   3520  N  N   . ASP B 1 60  ? 138.218 149.876 180.206 1.00 206.44 ? 60  ASP B N   1 
ATOM   3521  C  CA  . ASP B 1 60  ? 137.886 149.791 178.780 1.00 210.78 ? 60  ASP B CA  1 
ATOM   3522  C  C   . ASP B 1 60  ? 138.402 151.033 178.036 1.00 211.39 ? 60  ASP B C   1 
ATOM   3523  O  O   . ASP B 1 60  ? 138.710 152.038 178.678 1.00 205.28 ? 60  ASP B O   1 
ATOM   3524  C  CB  . ASP B 1 60  ? 136.368 149.608 178.576 1.00 215.99 ? 60  ASP B CB  1 
ATOM   3525  C  CG  . ASP B 1 60  ? 135.507 150.691 179.196 1.00 222.72 ? 60  ASP B CG  1 
ATOM   3526  O  OD1 . ASP B 1 60  ? 135.354 150.690 180.437 1.00 220.29 ? 60  ASP B OD1 1 
ATOM   3527  O  OD2 . ASP B 1 60  ? 134.954 151.515 178.438 1.00 229.52 ? 60  ASP B OD2 1 
ATOM   3528  N  N   . SER B 1 61  ? 138.494 150.959 176.688 1.00 211.92 ? 61  SER B N   1 
ATOM   3529  C  CA  . SER B 1 61  ? 138.998 152.025 175.810 1.00 209.72 ? 61  SER B CA  1 
ATOM   3530  C  C   . SER B 1 61  ? 138.272 153.370 175.995 1.00 208.20 ? 61  SER B C   1 
ATOM   3531  O  O   . SER B 1 61  ? 138.921 154.415 175.919 1.00 203.32 ? 61  SER B O   1 
ATOM   3532  C  CB  . SER B 1 61  ? 138.911 151.600 174.348 1.00 219.96 ? 61  SER B CB  1 
ATOM   3533  O  OG  . SER B 1 61  ? 139.706 152.443 173.531 1.00 229.31 ? 61  SER B OG  1 
ATOM   3534  N  N   . GLU B 1 62  ? 136.943 153.341 176.239 1.00 205.51 ? 62  GLU B N   1 
ATOM   3535  C  CA  . GLU B 1 62  ? 136.132 154.543 176.448 1.00 201.36 ? 62  GLU B CA  1 
ATOM   3536  C  C   . GLU B 1 62  ? 136.487 155.210 177.779 1.00 198.43 ? 62  GLU B C   1 
ATOM   3537  O  O   . GLU B 1 62  ? 136.711 156.420 177.803 1.00 193.85 ? 62  GLU B O   1 
ATOM   3538  C  CB  . GLU B 1 62  ? 134.632 154.215 176.389 1.00 206.34 ? 62  GLU B CB  1 
ATOM   3539  N  N   . THR B 1 63  ? 136.566 154.418 178.872 1.00 194.30 ? 63  THR B N   1 
ATOM   3540  C  CA  . THR B 1 63  ? 136.910 154.882 180.223 1.00 188.53 ? 63  THR B CA  1 
ATOM   3541  C  C   . THR B 1 63  ? 138.374 155.350 180.260 1.00 188.48 ? 63  THR B C   1 
ATOM   3542  O  O   . THR B 1 63  ? 138.663 156.358 180.904 1.00 182.98 ? 63  THR B O   1 
ATOM   3543  C  CB  . THR B 1 63  ? 136.628 153.772 181.256 1.00 197.44 ? 63  THR B CB  1 
ATOM   3544  O  OG1 . THR B 1 63  ? 135.290 153.304 181.076 1.00 201.30 ? 63  THR B OG1 1 
ATOM   3545  C  CG2 . THR B 1 63  ? 136.809 154.238 182.700 1.00 189.98 ? 63  THR B CG2 1 
ATOM   3546  N  N   . PHE B 1 64  ? 139.278 154.632 179.554 1.00 187.75 ? 64  PHE B N   1 
ATOM   3547  C  CA  . PHE B 1 64  ? 140.709 154.943 179.467 1.00 185.22 ? 64  PHE B CA  1 
ATOM   3548  C  C   . PHE B 1 64  ? 140.952 156.291 178.775 1.00 185.55 ? 64  PHE B C   1 
ATOM   3549  O  O   . PHE B 1 64  ? 141.762 157.069 179.276 1.00 181.11 ? 64  PHE B O   1 
ATOM   3550  C  CB  . PHE B 1 64  ? 141.468 153.824 178.736 1.00 192.14 ? 64  PHE B CB  1 
ATOM   3551  C  CG  . PHE B 1 64  ? 142.956 154.039 178.583 1.00 192.49 ? 64  PHE B CG  1 
ATOM   3552  C  CD1 . PHE B 1 64  ? 143.830 153.737 179.622 1.00 193.58 ? 64  PHE B CD1 1 
ATOM   3553  C  CD2 . PHE B 1 64  ? 143.488 154.507 177.387 1.00 195.96 ? 64  PHE B CD2 1 
ATOM   3554  C  CE1 . PHE B 1 64  ? 145.208 153.919 179.473 1.00 193.84 ? 64  PHE B CE1 1 
ATOM   3555  C  CE2 . PHE B 1 64  ? 144.865 154.693 177.239 1.00 198.05 ? 64  PHE B CE2 1 
ATOM   3556  C  CZ  . PHE B 1 64  ? 145.716 154.389 178.280 1.00 194.26 ? 64  PHE B CZ  1 
ATOM   3557  N  N   . GLU B 1 65  ? 140.271 156.562 177.636 1.00 183.93 ? 65  GLU B N   1 
ATOM   3558  C  CA  . GLU B 1 65  ? 140.418 157.826 176.905 1.00 181.17 ? 65  GLU B CA  1 
ATOM   3559  C  C   . GLU B 1 65  ? 139.773 158.981 177.684 1.00 179.08 ? 65  GLU B C   1 
ATOM   3560  O  O   . GLU B 1 65  ? 140.278 160.106 177.624 1.00 175.09 ? 65  GLU B O   1 
ATOM   3561  C  CB  . GLU B 1 65  ? 139.845 157.732 175.480 1.00 187.41 ? 65  GLU B CB  1 
ATOM   3562  C  CG  . GLU B 1 65  ? 140.318 158.839 174.539 1.00 196.54 ? 65  GLU B CG  1 
ATOM   3563  C  CD  . GLU B 1 65  ? 141.817 159.073 174.439 1.00 214.28 ? 65  GLU B CD  1 
ATOM   3564  O  OE1 . GLU B 1 65  ? 142.567 158.086 174.259 1.00 216.28 ? 65  GLU B OE1 1 
ATOM   3565  O  OE2 . GLU B 1 65  ? 142.240 160.248 174.525 1.00 201.16 ? 65  GLU B OE2 1 
ATOM   3566  N  N   . LYS B 1 66  ? 138.687 158.695 178.438 1.00 174.92 ? 66  LYS B N   1 
ATOM   3567  C  CA  . LYS B 1 66  ? 138.009 159.671 179.296 1.00 170.14 ? 66  LYS B CA  1 
ATOM   3568  C  C   . LYS B 1 66  ? 138.948 160.081 180.442 1.00 168.08 ? 66  LYS B C   1 
ATOM   3569  O  O   . LYS B 1 66  ? 138.982 161.254 180.822 1.00 163.06 ? 66  LYS B O   1 
ATOM   3570  C  CB  . LYS B 1 66  ? 136.693 159.094 179.841 1.00 174.70 ? 66  LYS B CB  1 
ATOM   3571  N  N   . SER B 1 67  ? 139.734 159.102 180.951 1.00 165.11 ? 67  SER B N   1 
ATOM   3572  C  CA  . SER B 1 67  ? 140.734 159.263 182.007 1.00 161.22 ? 67  SER B CA  1 
ATOM   3573  C  C   . SER B 1 67  ? 141.986 159.952 181.461 1.00 163.63 ? 67  SER B C   1 
ATOM   3574  O  O   . SER B 1 67  ? 142.569 160.780 182.159 1.00 159.57 ? 67  SER B O   1 
ATOM   3575  C  CB  . SER B 1 67  ? 141.097 157.906 182.606 1.00 166.61 ? 67  SER B CB  1 
ATOM   3576  O  OG  . SER B 1 67  ? 142.102 158.002 183.602 1.00 171.25 ? 67  SER B OG  1 
ATOM   3577  N  N   . ARG B 1 68  ? 142.393 159.611 180.219 1.00 163.48 ? 68  ARG B N   1 
ATOM   3578  C  CA  . ARG B 1 68  ? 143.561 160.169 179.527 1.00 162.80 ? 68  ARG B CA  1 
ATOM   3579  C  C   . ARG B 1 68  ? 143.412 161.681 179.334 1.00 163.47 ? 68  ARG B C   1 
ATOM   3580  O  O   . ARG B 1 68  ? 144.331 162.424 179.682 1.00 160.29 ? 68  ARG B O   1 
ATOM   3581  C  CB  . ARG B 1 68  ? 143.760 159.473 178.168 1.00 168.22 ? 68  ARG B CB  1 
ATOM   3582  C  CG  . ARG B 1 68  ? 145.122 159.710 177.536 1.00 176.91 ? 68  ARG B CG  1 
ATOM   3583  C  CD  . ARG B 1 68  ? 145.211 159.057 176.173 1.00 189.39 ? 68  ARG B CD  1 
ATOM   3584  N  NE  . ARG B 1 68  ? 146.269 159.651 175.356 1.00 195.21 ? 68  ARG B NE  1 
ATOM   3585  C  CZ  . ARG B 1 68  ? 146.088 160.658 174.505 1.00 205.54 ? 68  ARG B CZ  1 
ATOM   3586  N  NH1 . ARG B 1 68  ? 144.882 161.192 174.345 1.00 189.11 ? 68  ARG B NH1 1 
ATOM   3587  N  NH2 . ARG B 1 68  ? 147.108 161.136 173.807 1.00 192.60 ? 68  ARG B NH2 1 
ATOM   3588  N  N   . LEU B 1 69  ? 142.252 162.126 178.797 1.00 160.57 ? 69  LEU B N   1 
ATOM   3589  C  CA  . LEU B 1 69  ? 141.928 163.533 178.547 1.00 157.41 ? 69  LEU B CA  1 
ATOM   3590  C  C   . LEU B 1 69  ? 141.804 164.330 179.861 1.00 156.26 ? 69  LEU B C   1 
ATOM   3591  O  O   . LEU B 1 69  ? 142.229 165.486 179.905 1.00 152.70 ? 69  LEU B O   1 
ATOM   3592  C  CB  . LEU B 1 69  ? 140.629 163.642 177.737 1.00 160.01 ? 69  LEU B CB  1 
ATOM   3593  N  N   . TYR B 1 70  ? 141.244 163.705 180.924 1.00 152.08 ? 70  TYR B N   1 
ATOM   3594  C  CA  . TYR B 1 70  ? 141.050 164.310 182.248 1.00 147.57 ? 70  TYR B CA  1 
ATOM   3595  C  C   . TYR B 1 70  ? 142.385 164.570 182.940 1.00 148.73 ? 70  TYR B C   1 
ATOM   3596  O  O   . TYR B 1 70  ? 142.587 165.669 183.456 1.00 145.07 ? 70  TYR B O   1 
ATOM   3597  C  CB  . TYR B 1 70  ? 140.140 163.427 183.129 1.00 149.80 ? 70  TYR B CB  1 
ATOM   3598  C  CG  . TYR B 1 70  ? 140.000 163.862 184.576 1.00 148.01 ? 70  TYR B CG  1 
ATOM   3599  C  CD1 . TYR B 1 70  ? 139.496 165.119 184.903 1.00 146.72 ? 70  TYR B CD1 1 
ATOM   3600  C  CD2 . TYR B 1 70  ? 140.300 162.991 185.617 1.00 149.41 ? 70  TYR B CD2 1 
ATOM   3601  C  CE1 . TYR B 1 70  ? 139.335 165.514 186.231 1.00 144.76 ? 70  TYR B CE1 1 
ATOM   3602  C  CE2 . TYR B 1 70  ? 140.147 163.375 186.950 1.00 147.95 ? 70  TYR B CE2 1 
ATOM   3603  C  CZ  . TYR B 1 70  ? 139.665 164.639 187.252 1.00 152.05 ? 70  TYR B CZ  1 
ATOM   3604  O  OH  . TYR B 1 70  ? 139.507 165.022 188.562 1.00 150.69 ? 70  TYR B OH  1 
ATOM   3605  N  N   . GLN B 1 71  ? 143.291 163.574 182.945 1.00 147.24 ? 71  GLN B N   1 
ATOM   3606  C  CA  . GLN B 1 71  ? 144.606 163.696 183.576 1.00 145.45 ? 71  GLN B CA  1 
ATOM   3607  C  C   . GLN B 1 71  ? 145.519 164.633 182.782 1.00 149.27 ? 71  GLN B C   1 
ATOM   3608  O  O   . GLN B 1 71  ? 146.415 165.240 183.375 1.00 146.58 ? 71  GLN B O   1 
ATOM   3609  C  CB  . GLN B 1 71  ? 145.270 162.325 183.761 1.00 149.77 ? 71  GLN B CB  1 
ATOM   3610  C  CG  . GLN B 1 71  ? 144.552 161.382 184.741 1.00 165.35 ? 71  GLN B CG  1 
ATOM   3611  C  CD  . GLN B 1 71  ? 144.430 161.884 186.163 1.00 182.10 ? 71  GLN B CD  1 
ATOM   3612  O  OE1 . GLN B 1 71  ? 145.309 162.571 186.699 1.00 176.54 ? 71  GLN B OE1 1 
ATOM   3613  N  NE2 . GLN B 1 71  ? 143.344 161.509 186.821 1.00 173.44 ? 71  GLN B NE2 1 
ATOM   3614  N  N   . LEU B 1 72  ? 145.277 164.770 181.457 1.00 148.50 ? 72  LEU B N   1 
ATOM   3615  C  CA  . LEU B 1 72  ? 146.036 165.661 180.574 1.00 148.25 ? 72  LEU B CA  1 
ATOM   3616  C  C   . LEU B 1 72  ? 145.697 167.126 180.884 1.00 148.85 ? 72  LEU B C   1 
ATOM   3617  O  O   . LEU B 1 72  ? 146.608 167.948 181.004 1.00 146.27 ? 72  LEU B O   1 
ATOM   3618  C  CB  . LEU B 1 72  ? 145.766 165.339 179.097 1.00 152.23 ? 72  LEU B CB  1 
ATOM   3619  N  N   . ASP B 1 73  ? 144.388 167.437 181.045 1.00 145.18 ? 73  ASP B N   1 
ATOM   3620  C  CA  . ASP B 1 73  ? 143.878 168.772 181.384 1.00 141.95 ? 73  ASP B CA  1 
ATOM   3621  C  C   . ASP B 1 73  ? 144.323 169.178 182.786 1.00 142.06 ? 73  ASP B C   1 
ATOM   3622  O  O   . ASP B 1 73  ? 144.603 170.355 183.024 1.00 139.09 ? 73  ASP B O   1 
ATOM   3623  C  CB  . ASP B 1 73  ? 142.342 168.807 181.295 1.00 144.94 ? 73  ASP B CB  1 
ATOM   3624  C  CG  . ASP B 1 73  ? 141.766 168.846 179.889 1.00 162.24 ? 73  ASP B CG  1 
ATOM   3625  O  OD1 . ASP B 1 73  ? 142.459 168.397 178.945 1.00 165.70 ? 73  ASP B OD1 1 
ATOM   3626  O  OD2 . ASP B 1 73  ? 140.605 169.284 179.738 1.00 170.65 ? 73  ASP B OD2 1 
ATOM   3627  N  N   . LYS B 1 74  ? 144.391 168.195 183.706 1.00 138.69 ? 74  LYS B N   1 
ATOM   3628  C  CA  . LYS B 1 74  ? 144.822 168.376 185.089 1.00 135.75 ? 74  LYS B CA  1 
ATOM   3629  C  C   . LYS B 1 74  ? 146.320 168.702 185.137 1.00 138.60 ? 74  LYS B C   1 
ATOM   3630  O  O   . LYS B 1 74  ? 146.719 169.578 185.906 1.00 135.75 ? 74  LYS B O   1 
ATOM   3631  C  CB  . LYS B 1 74  ? 144.503 167.124 185.921 1.00 139.43 ? 74  LYS B CB  1 
ATOM   3632  N  N   . SER B 1 75  ? 147.132 168.029 184.285 1.00 137.21 ? 75  SER B N   1 
ATOM   3633  C  CA  . SER B 1 75  ? 148.583 168.222 184.185 1.00 137.12 ? 75  SER B CA  1 
ATOM   3634  C  C   . SER B 1 75  ? 148.930 169.627 183.668 1.00 138.66 ? 75  SER B C   1 
ATOM   3635  O  O   . SER B 1 75  ? 149.841 170.265 184.207 1.00 136.99 ? 75  SER B O   1 
ATOM   3636  C  CB  . SER B 1 75  ? 149.209 167.161 183.281 1.00 144.77 ? 75  SER B CB  1 
ATOM   3637  O  OG  . SER B 1 75  ? 150.628 167.226 183.280 1.00 154.80 ? 75  SER B OG  1 
ATOM   3638  N  N   . THR B 1 76  ? 148.196 170.105 182.639 1.00 134.80 ? 76  THR B N   1 
ATOM   3639  C  CA  . THR B 1 76  ? 148.386 171.424 182.026 1.00 133.01 ? 76  THR B CA  1 
ATOM   3640  C  C   . THR B 1 76  ? 148.128 172.523 183.063 1.00 131.44 ? 76  THR B C   1 
ATOM   3641  O  O   . THR B 1 76  ? 148.951 173.432 183.196 1.00 129.27 ? 76  THR B O   1 
ATOM   3642  C  CB  . THR B 1 76  ? 147.488 171.590 180.787 1.00 146.29 ? 76  THR B CB  1 
ATOM   3643  O  OG1 . THR B 1 76  ? 147.434 170.364 180.050 1.00 152.13 ? 76  THR B OG1 1 
ATOM   3644  C  CG2 . THR B 1 76  ? 147.959 172.715 179.874 1.00 145.08 ? 76  THR B CG2 1 
ATOM   3645  N  N   . PHE B 1 77  ? 147.003 172.415 183.810 1.00 126.07 ? 77  PHE B N   1 
ATOM   3646  C  CA  . PHE B 1 77  ? 146.624 173.359 184.865 1.00 122.57 ? 77  PHE B CA  1 
ATOM   3647  C  C   . PHE B 1 77  ? 147.649 173.329 185.986 1.00 123.65 ? 77  PHE B C   1 
ATOM   3648  O  O   . PHE B 1 77  ? 148.077 174.391 186.439 1.00 121.44 ? 77  PHE B O   1 
ATOM   3649  C  CB  . PHE B 1 77  ? 145.216 173.055 185.420 1.00 124.27 ? 77  PHE B CB  1 
ATOM   3650  C  CG  . PHE B 1 77  ? 144.802 173.920 186.597 1.00 123.50 ? 77  PHE B CG  1 
ATOM   3651  C  CD1 . PHE B 1 77  ? 144.316 175.209 186.400 1.00 125.45 ? 77  PHE B CD1 1 
ATOM   3652  C  CD2 . PHE B 1 77  ? 144.895 173.443 187.901 1.00 124.90 ? 77  PHE B CD2 1 
ATOM   3653  C  CE1 . PHE B 1 77  ? 143.936 176.007 187.486 1.00 124.24 ? 77  PHE B CE1 1 
ATOM   3654  C  CE2 . PHE B 1 77  ? 144.523 174.246 188.987 1.00 125.62 ? 77  PHE B CE2 1 
ATOM   3655  C  CZ  . PHE B 1 77  ? 144.046 175.520 188.771 1.00 122.40 ? 77  PHE B CZ  1 
ATOM   3656  N  N   . SER B 1 78  ? 148.044 172.109 186.420 1.00 120.23 ? 78  SER B N   1 
ATOM   3657  C  CA  . SER B 1 78  ? 149.021 171.860 187.480 1.00 119.15 ? 78  SER B CA  1 
ATOM   3658  C  C   . SER B 1 78  ? 150.326 172.621 187.235 1.00 120.30 ? 78  SER B C   1 
ATOM   3659  O  O   . SER B 1 78  ? 150.908 173.142 188.191 1.00 118.84 ? 78  SER B O   1 
ATOM   3660  C  CB  . SER B 1 78  ? 149.304 170.365 187.599 1.00 126.22 ? 78  SER B CB  1 
ATOM   3661  O  OG  . SER B 1 78  ? 150.183 170.071 188.671 1.00 138.51 ? 78  SER B OG  1 
ATOM   3662  N  N   . PHE B 1 79  ? 150.759 172.715 185.956 1.00 116.08 ? 79  PHE B N   1 
ATOM   3663  C  CA  . PHE B 1 79  ? 151.982 173.414 185.573 1.00 115.38 ? 79  PHE B CA  1 
ATOM   3664  C  C   . PHE B 1 79  ? 151.867 174.925 185.769 1.00 115.49 ? 79  PHE B C   1 
ATOM   3665  O  O   . PHE B 1 79  ? 152.667 175.489 186.513 1.00 113.84 ? 79  PHE B O   1 
ATOM   3666  C  CB  . PHE B 1 79  ? 152.378 173.104 184.118 1.00 119.70 ? 79  PHE B CB  1 
ATOM   3667  C  CG  . PHE B 1 79  ? 153.471 174.007 183.595 1.00 121.54 ? 79  PHE B CG  1 
ATOM   3668  C  CD1 . PHE B 1 79  ? 154.763 173.929 184.101 1.00 125.45 ? 79  PHE B CD1 1 
ATOM   3669  C  CD2 . PHE B 1 79  ? 153.201 174.958 182.622 1.00 123.41 ? 79  PHE B CD2 1 
ATOM   3670  C  CE1 . PHE B 1 79  ? 155.765 174.780 183.635 1.00 127.02 ? 79  PHE B CE1 1 
ATOM   3671  C  CE2 . PHE B 1 79  ? 154.206 175.808 182.156 1.00 126.83 ? 79  PHE B CE2 1 
ATOM   3672  C  CZ  . PHE B 1 79  ? 155.483 175.707 182.660 1.00 125.78 ? 79  PHE B CZ  1 
ATOM   3673  N  N   . TRP B 1 80  ? 150.912 175.573 185.068 1.00 110.82 ? 80  TRP B N   1 
ATOM   3674  C  CA  . TRP B 1 80  ? 150.698 177.024 185.091 1.00 108.31 ? 80  TRP B CA  1 
ATOM   3675  C  C   . TRP B 1 80  ? 150.298 177.552 186.472 1.00 111.24 ? 80  TRP B C   1 
ATOM   3676  O  O   . TRP B 1 80  ? 150.763 178.629 186.849 1.00 109.24 ? 80  TRP B O   1 
ATOM   3677  C  CB  . TRP B 1 80  ? 149.662 177.437 184.049 1.00 106.44 ? 80  TRP B CB  1 
ATOM   3678  C  CG  . TRP B 1 80  ? 150.132 177.216 182.647 1.00 109.21 ? 80  TRP B CG  1 
ATOM   3679  C  CD1 . TRP B 1 80  ? 149.730 176.232 181.798 1.00 114.27 ? 80  TRP B CD1 1 
ATOM   3680  C  CD2 . TRP B 1 80  ? 151.130 177.971 181.945 1.00 109.56 ? 80  TRP B CD2 1 
ATOM   3681  N  NE1 . TRP B 1 80  ? 150.385 176.347 180.595 1.00 115.92 ? 80  TRP B NE1 1 
ATOM   3682  C  CE2 . TRP B 1 80  ? 151.254 177.405 180.659 1.00 116.28 ? 80  TRP B CE2 1 
ATOM   3683  C  CE3 . TRP B 1 80  ? 151.923 179.083 182.273 1.00 109.49 ? 80  TRP B CE3 1 
ATOM   3684  C  CZ2 . TRP B 1 80  ? 152.140 177.910 179.700 1.00 117.31 ? 80  TRP B CZ2 1 
ATOM   3685  C  CZ3 . TRP B 1 80  ? 152.799 179.585 181.322 1.00 112.57 ? 80  TRP B CZ3 1 
ATOM   3686  C  CH2 . TRP B 1 80  ? 152.903 179.000 180.054 1.00 116.03 ? 80  TRP B CH2 1 
ATOM   3687  N  N   . SER B 1 81  ? 149.460 176.805 187.227 1.00 108.80 ? 81  SER B N   1 
ATOM   3688  C  CA  . SER B 1 81  ? 149.076 177.194 188.588 1.00 107.38 ? 81  SER B CA  1 
ATOM   3689  C  C   . SER B 1 81  ? 150.299 177.075 189.509 1.00 113.14 ? 81  SER B C   1 
ATOM   3690  O  O   . SER B 1 81  ? 150.484 177.913 190.393 1.00 112.97 ? 81  SER B O   1 
ATOM   3691  C  CB  . SER B 1 81  ? 147.910 176.351 189.101 1.00 110.47 ? 81  SER B CB  1 
ATOM   3692  O  OG  . SER B 1 81  ? 148.258 174.986 189.254 1.00 119.83 ? 81  SER B OG  1 
ATOM   3693  N  N   . GLY B 1 82  ? 151.138 176.068 189.247 1.00 110.84 ? 82  GLY B N   1 
ATOM   3694  C  CA  . GLY B 1 82  ? 152.379 175.821 189.974 1.00 111.23 ? 82  GLY B CA  1 
ATOM   3695  C  C   . GLY B 1 82  ? 153.464 176.823 189.629 1.00 113.56 ? 82  GLY B C   1 
ATOM   3696  O  O   . GLY B 1 82  ? 154.214 177.258 190.512 1.00 113.42 ? 82  GLY B O   1 
ATOM   3697  N  N   . LEU B 1 83  ? 153.546 177.204 188.337 1.00 108.55 ? 83  LEU B N   1 
ATOM   3698  C  CA  . LEU B 1 83  ? 154.517 178.170 187.826 1.00 107.94 ? 83  LEU B CA  1 
ATOM   3699  C  C   . LEU B 1 83  ? 154.224 179.558 188.382 1.00 109.02 ? 83  LEU B C   1 
ATOM   3700  O  O   . LEU B 1 83  ? 155.160 180.249 188.785 1.00 107.94 ? 83  LEU B O   1 
ATOM   3701  C  CB  . LEU B 1 83  ? 154.526 178.177 186.282 1.00 108.95 ? 83  LEU B CB  1 
ATOM   3702  C  CG  . LEU B 1 83  ? 155.463 179.159 185.564 1.00 113.97 ? 83  LEU B CG  1 
ATOM   3703  C  CD1 . LEU B 1 83  ? 156.921 178.897 185.888 1.00 115.84 ? 83  LEU B CD1 1 
ATOM   3704  C  CD2 . LEU B 1 83  ? 155.256 179.098 184.076 1.00 117.64 ? 83  LEU B CD2 1 
ATOM   3705  N  N   . TYR B 1 84  ? 152.929 179.950 188.429 1.00 104.67 ? 84  TYR B N   1 
ATOM   3706  C  CA  . TYR B 1 84  ? 152.481 181.245 188.956 1.00 103.10 ? 84  TYR B CA  1 
ATOM   3707  C  C   . TYR B 1 84  ? 152.899 181.379 190.418 1.00 107.09 ? 84  TYR B C   1 
ATOM   3708  O  O   . TYR B 1 84  ? 153.421 182.426 190.801 1.00 107.01 ? 84  TYR B O   1 
ATOM   3709  C  CB  . TYR B 1 84  ? 150.956 181.424 188.796 1.00 102.82 ? 84  TYR B CB  1 
ATOM   3710  C  CG  . TYR B 1 84  ? 150.430 182.755 189.294 1.00 103.05 ? 84  TYR B CG  1 
ATOM   3711  C  CD1 . TYR B 1 84  ? 150.518 183.902 188.509 1.00 105.19 ? 84  TYR B CD1 1 
ATOM   3712  C  CD2 . TYR B 1 84  ? 149.814 182.863 190.539 1.00 102.85 ? 84  TYR B CD2 1 
ATOM   3713  C  CE1 . TYR B 1 84  ? 150.026 185.129 188.958 1.00 105.60 ? 84  TYR B CE1 1 
ATOM   3714  C  CE2 . TYR B 1 84  ? 149.321 184.085 191.001 1.00 102.94 ? 84  TYR B CE2 1 
ATOM   3715  C  CZ  . TYR B 1 84  ? 149.424 185.217 190.205 1.00 110.45 ? 84  TYR B CZ  1 
ATOM   3716  O  OH  . TYR B 1 84  ? 148.933 186.425 190.652 1.00 108.79 ? 84  TYR B OH  1 
ATOM   3717  N  N   . SER B 1 85  ? 152.712 180.301 191.210 1.00 103.29 ? 85  SER B N   1 
ATOM   3718  C  CA  . SER B 1 85  ? 153.065 180.234 192.627 1.00 102.98 ? 85  SER B CA  1 
ATOM   3719  C  C   . SER B 1 85  ? 154.560 180.439 192.818 1.00 107.57 ? 85  SER B C   1 
ATOM   3720  O  O   . SER B 1 85  ? 154.955 181.319 193.585 1.00 107.03 ? 85  SER B O   1 
ATOM   3721  C  CB  . SER B 1 85  ? 152.643 178.893 193.221 1.00 107.40 ? 85  SER B CB  1 
ATOM   3722  O  OG  . SER B 1 85  ? 151.278 178.612 192.960 1.00 116.96 ? 85  SER B OG  1 
ATOM   3723  N  N   . GLU B 1 86  ? 155.383 179.654 192.079 1.00 105.19 ? 86  GLU B N   1 
ATOM   3724  C  CA  . GLU B 1 86  ? 156.845 179.697 192.125 1.00 106.55 ? 86  GLU B CA  1 
ATOM   3725  C  C   . GLU B 1 86  ? 157.382 181.069 191.684 1.00 110.19 ? 86  GLU B C   1 
ATOM   3726  O  O   . GLU B 1 86  ? 158.381 181.532 192.242 1.00 111.90 ? 86  GLU B O   1 
ATOM   3727  C  CB  . GLU B 1 86  ? 157.453 178.573 191.273 1.00 109.61 ? 86  GLU B CB  1 
ATOM   3728  C  CG  . GLU B 1 86  ? 158.931 178.321 191.540 1.00 120.94 ? 86  GLU B CG  1 
ATOM   3729  C  CD  . GLU B 1 86  ? 159.310 177.921 192.955 1.00 141.52 ? 86  GLU B CD  1 
ATOM   3730  O  OE1 . GLU B 1 86  ? 158.588 177.092 193.556 1.00 139.87 ? 86  GLU B OE1 1 
ATOM   3731  O  OE2 . GLU B 1 86  ? 160.343 178.423 193.455 1.00 134.24 ? 86  GLU B OE2 1 
ATOM   3732  N  N   . THR B 1 87  ? 156.713 181.723 190.710 1.00 103.91 ? 87  THR B N   1 
ATOM   3733  C  CA  . THR B 1 87  ? 157.104 183.052 190.244 1.00 103.08 ? 87  THR B CA  1 
ATOM   3734  C  C   . THR B 1 87  ? 156.722 184.076 191.310 1.00 105.58 ? 87  THR B C   1 
ATOM   3735  O  O   . THR B 1 87  ? 157.550 184.917 191.652 1.00 106.00 ? 87  THR B O   1 
ATOM   3736  C  CB  . THR B 1 87  ? 156.488 183.369 188.880 1.00 107.16 ? 87  THR B CB  1 
ATOM   3737  O  OG1 . THR B 1 87  ? 156.807 182.319 187.973 1.00 108.30 ? 87  THR B OG1 1 
ATOM   3738  C  CG2 . THR B 1 87  ? 156.990 184.681 188.309 1.00 104.59 ? 87  THR B CG2 1 
ATOM   3739  N  N   . GLU B 1 88  ? 155.494 183.970 191.865 1.00 100.63 ? 88  GLU B N   1 
ATOM   3740  C  CA  . GLU B 1 88  ? 154.995 184.873 192.902 1.00 99.67  ? 88  GLU B CA  1 
ATOM   3741  C  C   . GLU B 1 88  ? 155.880 184.879 194.134 1.00 105.44 ? 88  GLU B C   1 
ATOM   3742  O  O   . GLU B 1 88  ? 156.232 185.956 194.610 1.00 105.90 ? 88  GLU B O   1 
ATOM   3743  C  CB  . GLU B 1 88  ? 153.561 184.531 193.312 1.00 99.45  ? 88  GLU B CB  1 
ATOM   3744  C  CG  . GLU B 1 88  ? 152.517 185.332 192.563 1.00 110.71 ? 88  GLU B CG  1 
ATOM   3745  C  CD  . GLU B 1 88  ? 152.406 186.826 192.826 1.00 136.88 ? 88  GLU B CD  1 
ATOM   3746  O  OE1 . GLU B 1 88  ? 153.207 187.383 193.613 1.00 118.34 ? 88  GLU B OE1 1 
ATOM   3747  O  OE2 . GLU B 1 88  ? 151.501 187.444 192.223 1.00 143.99 ? 88  GLU B OE2 1 
ATOM   3748  N  N   . GLY B 1 89  ? 156.237 183.690 194.624 1.00 102.82 ? 89  GLY B N   1 
ATOM   3749  C  CA  . GLY B 1 89  ? 157.099 183.523 195.787 1.00 104.52 ? 89  GLY B CA  1 
ATOM   3750  C  C   . GLY B 1 89  ? 158.429 184.218 195.593 1.00 110.59 ? 89  GLY B C   1 
ATOM   3751  O  O   . GLY B 1 89  ? 158.826 185.043 196.422 1.00 111.69 ? 89  GLY B O   1 
ATOM   3752  N  N   . THR B 1 90  ? 159.077 183.942 194.447 1.00 107.21 ? 90  THR B N   1 
ATOM   3753  C  CA  . THR B 1 90  ? 160.361 184.516 194.050 1.00 108.90 ? 90  THR B CA  1 
ATOM   3754  C  C   . THR B 1 90  ? 160.247 186.042 193.949 1.00 111.86 ? 90  THR B C   1 
ATOM   3755  O  O   . THR B 1 90  ? 161.066 186.729 194.550 1.00 113.44 ? 90  THR B O   1 
ATOM   3756  C  CB  . THR B 1 90  ? 160.840 183.871 192.740 1.00 117.39 ? 90  THR B CB  1 
ATOM   3757  O  OG1 . THR B 1 90  ? 160.944 182.463 192.936 1.00 118.00 ? 90  THR B OG1 1 
ATOM   3758  C  CG2 . THR B 1 90  ? 162.181 184.403 192.274 1.00 118.67 ? 90  THR B CG2 1 
ATOM   3759  N  N   . LEU B 1 91  ? 159.217 186.564 193.250 1.00 106.33 ? 91  LEU B N   1 
ATOM   3760  C  CA  . LEU B 1 91  ? 159.014 188.006 193.064 1.00 106.15 ? 91  LEU B CA  1 
ATOM   3761  C  C   . LEU B 1 91  ? 158.753 188.747 194.376 1.00 110.04 ? 91  LEU B C   1 
ATOM   3762  O  O   . LEU B 1 91  ? 159.321 189.820 194.558 1.00 110.89 ? 91  LEU B O   1 
ATOM   3763  C  CB  . LEU B 1 91  ? 157.884 188.316 192.071 1.00 104.45 ? 91  LEU B CB  1 
ATOM   3764  C  CG  . LEU B 1 91  ? 158.121 187.953 190.598 1.00 110.63 ? 91  LEU B CG  1 
ATOM   3765  C  CD1 . LEU B 1 91  ? 156.885 188.178 189.800 1.00 109.43 ? 91  LEU B CD1 1 
ATOM   3766  C  CD2 . LEU B 1 91  ? 159.258 188.754 189.978 1.00 116.01 ? 91  LEU B CD2 1 
ATOM   3767  N  N   . ILE B 1 92  ? 157.920 188.187 195.285 1.00 105.57 ? 92  ILE B N   1 
ATOM   3768  C  CA  . ILE B 1 92  ? 157.607 188.800 196.584 1.00 105.59 ? 92  ILE B CA  1 
ATOM   3769  C  C   . ILE B 1 92  ? 158.900 188.933 197.401 1.00 113.30 ? 92  ILE B C   1 
ATOM   3770  O  O   . ILE B 1 92  ? 159.149 190.009 197.949 1.00 115.80 ? 92  ILE B O   1 
ATOM   3771  C  CB  . ILE B 1 92  ? 156.493 188.019 197.342 1.00 106.98 ? 92  ILE B CB  1 
ATOM   3772  C  CG1 . ILE B 1 92  ? 155.122 188.327 196.727 1.00 104.75 ? 92  ILE B CG1 1 
ATOM   3773  C  CG2 . ILE B 1 92  ? 156.485 188.327 198.853 1.00 109.50 ? 92  ILE B CG2 1 
ATOM   3774  C  CD1 . ILE B 1 92  ? 154.102 187.235 196.889 1.00 112.16 ? 92  ILE B CD1 1 
ATOM   3775  N  N   . LEU B 1 93  ? 159.731 187.869 197.441 1.00 109.60 ? 93  LEU B N   1 
ATOM   3776  C  CA  . LEU B 1 93  ? 160.992 187.872 198.182 1.00 112.01 ? 93  LEU B CA  1 
ATOM   3777  C  C   . LEU B 1 93  ? 161.999 188.883 197.600 1.00 117.73 ? 93  LEU B C   1 
ATOM   3778  O  O   . LEU B 1 93  ? 162.557 189.667 198.369 1.00 119.19 ? 93  LEU B O   1 
ATOM   3779  C  CB  . LEU B 1 93  ? 161.611 186.468 198.232 1.00 113.00 ? 93  LEU B CB  1 
ATOM   3780  C  CG  . LEU B 1 93  ? 160.858 185.411 199.039 1.00 116.08 ? 93  LEU B CG  1 
ATOM   3781  C  CD1 . LEU B 1 93  ? 161.232 184.032 198.581 1.00 116.80 ? 93  LEU B CD1 1 
ATOM   3782  C  CD2 . LEU B 1 93  ? 161.137 185.535 200.518 1.00 120.00 ? 93  LEU B CD2 1 
ATOM   3783  N  N   . LEU B 1 94  ? 162.197 188.885 196.255 1.00 114.30 ? 94  LEU B N   1 
ATOM   3784  C  CA  . LEU B 1 94  ? 163.117 189.787 195.546 1.00 116.65 ? 94  LEU B CA  1 
ATOM   3785  C  C   . LEU B 1 94  ? 162.675 191.245 195.645 1.00 124.97 ? 94  LEU B C   1 
ATOM   3786  O  O   . LEU B 1 94  ? 163.519 192.118 195.863 1.00 128.11 ? 94  LEU B O   1 
ATOM   3787  C  CB  . LEU B 1 94  ? 163.259 189.416 194.059 1.00 115.58 ? 94  LEU B CB  1 
ATOM   3788  C  CG  . LEU B 1 94  ? 163.860 188.072 193.686 1.00 120.69 ? 94  LEU B CG  1 
ATOM   3789  C  CD1 . LEU B 1 94  ? 163.714 187.833 192.206 1.00 119.80 ? 94  LEU B CD1 1 
ATOM   3790  C  CD2 . LEU B 1 94  ? 165.313 187.972 194.090 1.00 127.26 ? 94  LEU B CD2 1 
ATOM   3791  N  N   . PHE B 1 95  ? 161.361 191.507 195.470 1.00 121.13 ? 95  PHE B N   1 
ATOM   3792  C  CA  . PHE B 1 95  ? 160.762 192.843 195.544 1.00 121.73 ? 95  PHE B CA  1 
ATOM   3793  C  C   . PHE B 1 95  ? 160.761 193.366 196.997 1.00 128.18 ? 95  PHE B C   1 
ATOM   3794  O  O   . PHE B 1 95  ? 160.695 194.578 197.208 1.00 129.22 ? 95  PHE B O   1 
ATOM   3795  C  CB  . PHE B 1 95  ? 159.336 192.796 194.984 1.00 120.98 ? 95  PHE B CB  1 
ATOM   3796  C  CG  . PHE B 1 95  ? 158.723 194.103 194.545 1.00 123.03 ? 95  PHE B CG  1 
ATOM   3797  C  CD1 . PHE B 1 95  ? 158.865 194.551 193.235 1.00 126.97 ? 95  PHE B CD1 1 
ATOM   3798  C  CD2 . PHE B 1 95  ? 157.927 194.842 195.414 1.00 125.34 ? 95  PHE B CD2 1 
ATOM   3799  C  CE1 . PHE B 1 95  ? 158.259 195.743 192.816 1.00 127.78 ? 95  PHE B CE1 1 
ATOM   3800  C  CE2 . PHE B 1 95  ? 157.323 196.035 194.996 1.00 128.06 ? 95  PHE B CE2 1 
ATOM   3801  C  CZ  . PHE B 1 95  ? 157.491 196.475 193.699 1.00 126.35 ? 95  PHE B CZ  1 
ATOM   3802  N  N   . GLY B 1 96  ? 160.856 192.452 197.967 1.00 125.40 ? 96  GLY B N   1 
ATOM   3803  C  CA  . GLY B 1 96  ? 160.864 192.760 199.392 1.00 127.04 ? 96  GLY B CA  1 
ATOM   3804  C  C   . GLY B 1 96  ? 159.478 193.074 199.912 1.00 129.71 ? 96  GLY B C   1 
ATOM   3805  O  O   . GLY B 1 96  ? 159.279 194.100 200.566 1.00 130.35 ? 96  GLY B O   1 
ATOM   3806  N  N   . GLY B 1 97  ? 158.528 192.187 199.611 1.00 124.29 ? 97  GLY B N   1 
ATOM   3807  C  CA  . GLY B 1 97  ? 157.127 192.307 200.004 1.00 122.22 ? 97  GLY B CA  1 
ATOM   3808  C  C   . GLY B 1 97  ? 156.891 192.156 201.492 1.00 127.62 ? 97  GLY B C   1 
ATOM   3809  O  O   . GLY B 1 97  ? 156.299 193.043 202.111 1.00 127.89 ? 97  GLY B O   1 
ATOM   3810  N  N   . ILE B 1 98  ? 157.369 191.033 202.071 1.00 125.12 ? 98  ILE B N   1 
ATOM   3811  C  CA  . ILE B 1 98  ? 157.245 190.665 203.494 1.00 126.94 ? 98  ILE B CA  1 
ATOM   3812  C  C   . ILE B 1 98  ? 157.746 191.801 204.453 1.00 133.73 ? 98  ILE B C   1 
ATOM   3813  O  O   . ILE B 1 98  ? 156.973 192.157 205.348 1.00 133.29 ? 98  ILE B O   1 
ATOM   3814  C  CB  . ILE B 1 98  ? 157.949 189.307 203.801 1.00 131.28 ? 98  ILE B CB  1 
ATOM   3815  C  CG1 . ILE B 1 98  ? 157.513 188.207 202.799 1.00 128.77 ? 98  ILE B CG1 1 
ATOM   3816  C  CG2 . ILE B 1 98  ? 157.712 188.870 205.264 1.00 134.16 ? 98  ILE B CG2 1 
ATOM   3817  C  CD1 . ILE B 1 98  ? 158.513 187.102 202.572 1.00 136.70 ? 98  ILE B CD1 1 
ATOM   3818  N  N   . PRO B 1 99  ? 158.973 192.390 204.316 1.00 133.24 ? 99  PRO B N   1 
ATOM   3819  C  CA  . PRO B 1 99  ? 159.371 193.462 205.249 1.00 136.57 ? 99  PRO B CA  1 
ATOM   3820  C  C   . PRO B 1 99  ? 158.515 194.720 205.120 1.00 139.66 ? 99  PRO B C   1 
ATOM   3821  O  O   . PRO B 1 99  ? 158.222 195.347 206.135 1.00 141.87 ? 99  PRO B O   1 
ATOM   3822  C  CB  . PRO B 1 99  ? 160.833 193.750 204.875 1.00 141.03 ? 99  PRO B CB  1 
ATOM   3823  C  CG  . PRO B 1 99  ? 161.275 192.585 204.067 1.00 144.16 ? 99  PRO B CG  1 
ATOM   3824  C  CD  . PRO B 1 99  ? 160.055 192.124 203.344 1.00 135.36 ? 99  PRO B CD  1 
ATOM   3825  N  N   . TYR B 1 100 ? 158.112 195.079 203.885 1.00 132.87 ? 100 TYR B N   1 
ATOM   3826  C  CA  . TYR B 1 100 ? 157.277 196.245 203.604 1.00 131.65 ? 100 TYR B CA  1 
ATOM   3827  C  C   . TYR B 1 100 ? 155.847 196.028 204.112 1.00 132.98 ? 100 TYR B C   1 
ATOM   3828  O  O   . TYR B 1 100 ? 155.250 196.978 204.619 1.00 133.69 ? 100 TYR B O   1 
ATOM   3829  C  CB  . TYR B 1 100 ? 157.294 196.569 202.104 1.00 130.89 ? 100 TYR B CB  1 
ATOM   3830  C  CG  . TYR B 1 100 ? 156.390 197.710 201.688 1.00 132.23 ? 100 TYR B CG  1 
ATOM   3831  C  CD1 . TYR B 1 100 ? 156.621 199.010 202.134 1.00 137.04 ? 100 TYR B CD1 1 
ATOM   3832  C  CD2 . TYR B 1 100 ? 155.339 197.501 200.804 1.00 130.01 ? 100 TYR B CD2 1 
ATOM   3833  C  CE1 . TYR B 1 100 ? 155.801 200.067 201.739 1.00 137.65 ? 100 TYR B CE1 1 
ATOM   3834  C  CE2 . TYR B 1 100 ? 154.525 198.552 200.386 1.00 130.68 ? 100 TYR B CE2 1 
ATOM   3835  C  CZ  . TYR B 1 100 ? 154.752 199.832 200.866 1.00 141.92 ? 100 TYR B CZ  1 
ATOM   3836  O  OH  . TYR B 1 100 ? 153.941 200.862 200.462 1.00 144.12 ? 100 TYR B OH  1 
ATOM   3837  N  N   . LEU B 1 101 ? 155.318 194.790 204.020 1.00 126.64 ? 101 LEU B N   1 
ATOM   3838  C  CA  . LEU B 1 101 ? 153.989 194.452 204.538 1.00 124.98 ? 101 LEU B CA  1 
ATOM   3839  C  C   . LEU B 1 101 ? 154.013 194.542 206.069 1.00 132.88 ? 101 LEU B C   1 
ATOM   3840  O  O   . LEU B 1 101 ? 153.022 194.966 206.669 1.00 133.20 ? 101 LEU B O   1 
ATOM   3841  C  CB  . LEU B 1 101 ? 153.533 193.054 204.059 1.00 122.15 ? 101 LEU B CB  1 
ATOM   3842  C  CG  . LEU B 1 101 ? 152.162 192.524 204.542 1.00 125.13 ? 101 LEU B CG  1 
ATOM   3843  C  CD1 . LEU B 1 101 ? 151.015 193.410 204.085 1.00 123.57 ? 101 LEU B CD1 1 
ATOM   3844  C  CD2 . LEU B 1 101 ? 151.935 191.094 204.083 1.00 125.11 ? 101 LEU B CD2 1 
ATOM   3845  N  N   . TRP B 1 102 ? 155.167 194.188 206.686 1.00 132.40 ? 102 TRP B N   1 
ATOM   3846  C  CA  . TRP B 1 102 ? 155.390 194.263 208.129 1.00 136.20 ? 102 TRP B CA  1 
ATOM   3847  C  C   . TRP B 1 102 ? 155.348 195.725 208.599 1.00 142.49 ? 102 TRP B C   1 
ATOM   3848  O  O   . TRP B 1 102 ? 154.784 196.008 209.659 1.00 144.30 ? 102 TRP B O   1 
ATOM   3849  C  CB  . TRP B 1 102 ? 156.722 193.606 208.516 1.00 137.71 ? 102 TRP B CB  1 
ATOM   3850  C  CG  . TRP B 1 102 ? 156.938 193.556 209.995 1.00 143.11 ? 102 TRP B CG  1 
ATOM   3851  C  CD1 . TRP B 1 102 ? 157.668 194.428 210.747 1.00 150.36 ? 102 TRP B CD1 1 
ATOM   3852  C  CD2 . TRP B 1 102 ? 156.339 192.637 210.914 1.00 143.79 ? 102 TRP B CD2 1 
ATOM   3853  N  NE1 . TRP B 1 102 ? 157.590 194.088 212.076 1.00 153.42 ? 102 TRP B NE1 1 
ATOM   3854  C  CE2 . TRP B 1 102 ? 156.778 192.992 212.208 1.00 152.69 ? 102 TRP B CE2 1 
ATOM   3855  C  CE3 . TRP B 1 102 ? 155.485 191.533 210.769 1.00 142.49 ? 102 TRP B CE3 1 
ATOM   3856  C  CZ2 . TRP B 1 102 ? 156.387 192.288 213.349 1.00 154.21 ? 102 TRP B CZ2 1 
ATOM   3857  C  CZ3 . TRP B 1 102 ? 155.106 190.831 211.901 1.00 146.15 ? 102 TRP B CZ3 1 
ATOM   3858  C  CH2 . TRP B 1 102 ? 155.562 191.205 213.171 1.00 151.55 ? 102 TRP B CH2 1 
ATOM   3859  N  N   . ARG B 1 103 ? 155.926 196.645 207.797 1.00 138.99 ? 103 ARG B N   1 
ATOM   3860  C  CA  . ARG B 1 103 ? 155.941 198.077 208.086 1.00 141.41 ? 103 ARG B CA  1 
ATOM   3861  C  C   . ARG B 1 103 ? 154.526 198.658 208.032 1.00 142.38 ? 103 ARG B C   1 
ATOM   3862  O  O   . ARG B 1 103 ? 154.175 199.455 208.903 1.00 144.42 ? 103 ARG B O   1 
ATOM   3863  C  CB  . ARG B 1 103 ? 156.861 198.831 207.107 1.00 144.07 ? 103 ARG B CB  1 
ATOM   3864  C  CG  . ARG B 1 103 ? 158.349 198.485 207.253 1.00 163.28 ? 103 ARG B CG  1 
ATOM   3865  C  CD  . ARG B 1 103 ? 159.337 199.535 206.717 1.00 182.91 ? 103 ARG B CD  1 
ATOM   3866  N  NE  . ARG B 1 103 ? 159.076 200.021 205.350 1.00 193.24 ? 103 ARG B NE  1 
ATOM   3867  C  CZ  . ARG B 1 103 ? 159.845 199.797 204.279 1.00 207.87 ? 103 ARG B CZ  1 
ATOM   3868  N  NH1 . ARG B 1 103 ? 160.958 199.081 204.385 1.00 194.90 ? 103 ARG B NH1 1 
ATOM   3869  N  NH2 . ARG B 1 103 ? 159.506 200.292 203.097 1.00 194.95 ? 103 ARG B NH2 1 
ATOM   3870  N  N   . LEU B 1 104 ? 153.713 198.237 207.027 1.00 134.12 ? 104 LEU B N   1 
ATOM   3871  C  CA  . LEU B 1 104 ? 152.333 198.698 206.806 1.00 131.98 ? 104 LEU B CA  1 
ATOM   3872  C  C   . LEU B 1 104 ? 151.364 198.179 207.871 1.00 139.12 ? 104 LEU B C   1 
ATOM   3873  O  O   . LEU B 1 104 ? 150.306 198.782 208.087 1.00 139.26 ? 104 LEU B O   1 
ATOM   3874  C  CB  . LEU B 1 104 ? 151.827 198.303 205.409 1.00 127.20 ? 104 LEU B CB  1 
ATOM   3875  C  CG  . LEU B 1 104 ? 152.518 198.952 204.214 1.00 130.07 ? 104 LEU B CG  1 
ATOM   3876  C  CD1 . LEU B 1 104 ? 151.987 198.393 202.936 1.00 126.73 ? 104 LEU B CD1 1 
ATOM   3877  C  CD2 . LEU B 1 104 ? 152.340 200.456 204.207 1.00 133.08 ? 104 LEU B CD2 1 
ATOM   3878  N  N   . SER B 1 105 ? 151.729 197.077 208.545 1.00 137.91 ? 105 SER B N   1 
ATOM   3879  C  CA  . SER B 1 105 ? 150.919 196.498 209.612 1.00 139.68 ? 105 SER B CA  1 
ATOM   3880  C  C   . SER B 1 105 ? 151.397 197.037 210.989 1.00 149.60 ? 105 SER B C   1 
ATOM   3881  O  O   . SER B 1 105 ? 151.293 196.352 212.008 1.00 151.13 ? 105 SER B O   1 
ATOM   3882  C  CB  . SER B 1 105 ? 150.940 194.971 209.537 1.00 141.62 ? 105 SER B CB  1 
ATOM   3883  O  OG  . SER B 1 105 ? 152.246 194.433 209.411 1.00 151.33 ? 105 SER B OG  1 
ATOM   3884  N  N   . GLY B 1 106 ? 151.876 198.284 210.993 1.00 149.31 ? 106 GLY B N   1 
ATOM   3885  C  CA  . GLY B 1 106 ? 152.350 198.983 212.183 1.00 154.56 ? 106 GLY B CA  1 
ATOM   3886  C  C   . GLY B 1 106 ? 151.477 200.155 212.592 1.00 161.01 ? 106 GLY B C   1 
ATOM   3887  O  O   . GLY B 1 106 ? 150.245 200.066 212.526 1.00 159.53 ? 106 GLY B O   1 
ATOM   3888  N  N   . ARG B 1 107 ? 152.127 201.268 213.020 1.00 160.98 ? 107 ARG B N   1 
ATOM   3889  C  CA  . ARG B 1 107 ? 151.533 202.535 213.477 1.00 188.29 ? 107 ARG B CA  1 
ATOM   3890  C  C   . ARG B 1 107 ? 150.549 202.316 214.626 1.00 210.77 ? 107 ARG B C   1 
ATOM   3891  O  O   . ARG B 1 107 ? 150.866 202.629 215.770 1.00 175.92 ? 107 ARG B O   1 
ATOM   3892  C  CB  . ARG B 1 107 ? 150.847 203.294 212.328 1.00 185.57 ? 107 ARG B CB  1 
ATOM   3893  N  N   . PRO B 1 116 ? 155.713 193.862 224.602 1.00 200.84 ? 116 PRO B N   1 
ATOM   3894  C  CA  . PRO B 1 116 ? 155.450 192.619 223.861 1.00 197.46 ? 116 PRO B CA  1 
ATOM   3895  C  C   . PRO B 1 116 ? 154.094 192.634 223.163 1.00 195.93 ? 116 PRO B C   1 
ATOM   3896  O  O   . PRO B 1 116 ? 153.963 192.020 222.106 1.00 190.15 ? 116 PRO B O   1 
ATOM   3897  C  CB  . PRO B 1 116 ? 155.513 191.535 224.939 1.00 200.92 ? 116 PRO B CB  1 
ATOM   3898  C  CG  . PRO B 1 116 ? 155.214 192.240 226.216 1.00 206.10 ? 116 PRO B CG  1 
ATOM   3899  C  CD  . PRO B 1 116 ? 155.683 193.660 226.063 1.00 203.93 ? 116 PRO B CD  1 
ATOM   3900  N  N   . GLU B 1 117 ? 153.095 193.332 223.749 1.00 194.56 ? 117 GLU B N   1 
ATOM   3901  C  CA  . GLU B 1 117 ? 151.732 193.455 223.221 1.00 190.46 ? 117 GLU B CA  1 
ATOM   3902  C  C   . GLU B 1 117 ? 151.720 194.151 221.851 1.00 187.84 ? 117 GLU B C   1 
ATOM   3903  O  O   . GLU B 1 117 ? 150.962 193.738 220.975 1.00 182.18 ? 117 GLU B O   1 
ATOM   3904  C  CB  . GLU B 1 117 ? 150.836 194.222 224.210 1.00 196.49 ? 117 GLU B CB  1 
ATOM   3905  C  CG  . GLU B 1 117 ? 149.347 194.010 223.974 1.00 206.74 ? 117 GLU B CG  1 
ATOM   3906  C  CD  . GLU B 1 117 ? 148.440 195.141 224.421 1.00 224.59 ? 117 GLU B CD  1 
ATOM   3907  O  OE1 . GLU B 1 117 ? 148.471 195.497 225.622 1.00 225.16 ? 117 GLU B OE1 1 
ATOM   3908  O  OE2 . GLU B 1 117 ? 147.671 195.648 223.572 1.00 219.13 ? 117 GLU B OE2 1 
ATOM   3909  N  N   . TYR B 1 118 ? 152.569 195.186 221.671 1.00 185.06 ? 118 TYR B N   1 
ATOM   3910  C  CA  . TYR B 1 118 ? 152.695 195.969 220.438 1.00 180.34 ? 118 TYR B CA  1 
ATOM   3911  C  C   . TYR B 1 118 ? 153.244 195.137 219.270 1.00 177.68 ? 118 TYR B C   1 
ATOM   3912  O  O   . TYR B 1 118 ? 152.819 195.345 218.130 1.00 172.45 ? 118 TYR B O   1 
ATOM   3913  C  CB  . TYR B 1 118 ? 153.594 197.189 220.671 1.00 185.42 ? 118 TYR B CB  1 
ATOM   3914  N  N   . GLU B 1 119 ? 154.190 194.214 219.549 1.00 174.39 ? 119 GLU B N   1 
ATOM   3915  C  CA  . GLU B 1 119 ? 154.793 193.346 218.537 1.00 169.56 ? 119 GLU B CA  1 
ATOM   3916  C  C   . GLU B 1 119 ? 153.825 192.225 218.137 1.00 167.64 ? 119 GLU B C   1 
ATOM   3917  O  O   . GLU B 1 119 ? 153.755 191.892 216.956 1.00 162.57 ? 119 GLU B O   1 
ATOM   3918  C  CB  . GLU B 1 119 ? 156.126 192.758 219.031 1.00 174.54 ? 119 GLU B CB  1 
ATOM   3919  C  CG  . GLU B 1 119 ? 157.098 192.424 217.906 1.00 183.05 ? 119 GLU B CG  1 
ATOM   3920  C  CD  . GLU B 1 119 ? 157.590 190.988 217.860 1.00 206.27 ? 119 GLU B CD  1 
ATOM   3921  O  OE1 . GLU B 1 119 ? 158.290 190.564 218.809 1.00 203.88 ? 119 GLU B OE1 1 
ATOM   3922  O  OE2 . GLU B 1 119 ? 157.300 190.293 216.858 1.00 198.06 ? 119 GLU B OE2 1 
ATOM   3923  N  N   . ILE B 1 120 ? 153.087 191.649 219.109 1.00 165.04 ? 120 ILE B N   1 
ATOM   3924  C  CA  . ILE B 1 120 ? 152.131 190.563 218.865 1.00 161.34 ? 120 ILE B CA  1 
ATOM   3925  C  C   . ILE B 1 120 ? 150.915 191.120 218.083 1.00 159.44 ? 120 ILE B C   1 
ATOM   3926  O  O   . ILE B 1 120 ? 150.417 190.427 217.194 1.00 154.92 ? 120 ILE B O   1 
ATOM   3927  C  CB  . ILE B 1 120 ? 151.750 189.814 220.184 1.00 168.90 ? 120 ILE B CB  1 
ATOM   3928  C  CG1 . ILE B 1 120 ? 152.991 189.072 220.756 1.00 172.76 ? 120 ILE B CG1 1 
ATOM   3929  C  CG2 . ILE B 1 120 ? 150.587 188.818 219.976 1.00 167.32 ? 120 ILE B CG2 1 
ATOM   3930  C  CD1 . ILE B 1 120 ? 152.951 188.732 222.257 1.00 187.34 ? 120 ILE B CD1 1 
ATOM   3931  N  N   . THR B 1 121 ? 150.488 192.374 218.358 1.00 156.06 ? 121 THR B N   1 
ATOM   3932  C  CA  . THR B 1 121 ? 149.387 193.016 217.626 1.00 152.20 ? 121 THR B CA  1 
ATOM   3933  C  C   . THR B 1 121 ? 149.820 193.225 216.172 1.00 149.71 ? 121 THR B C   1 
ATOM   3934  O  O   . THR B 1 121 ? 149.044 192.925 215.266 1.00 145.31 ? 121 THR B O   1 
ATOM   3935  C  CB  . THR B 1 121 ? 148.960 194.324 218.299 1.00 166.33 ? 121 THR B CB  1 
ATOM   3936  O  OG1 . THR B 1 121 ? 148.700 194.069 219.678 1.00 174.15 ? 121 THR B OG1 1 
ATOM   3937  C  CG2 . THR B 1 121 ? 147.720 194.941 217.652 1.00 162.04 ? 121 THR B CG2 1 
ATOM   3938  N  N   . GLN B 1 122 ? 151.077 193.692 215.962 1.00 145.94 ? 122 GLN B N   1 
ATOM   3939  C  CA  . GLN B 1 122 ? 151.681 193.888 214.641 1.00 141.47 ? 122 GLN B CA  1 
ATOM   3940  C  C   . GLN B 1 122 ? 151.772 192.537 213.923 1.00 141.54 ? 122 GLN B C   1 
ATOM   3941  O  O   . GLN B 1 122 ? 151.443 192.460 212.742 1.00 137.40 ? 122 GLN B O   1 
ATOM   3942  C  CB  . GLN B 1 122 ? 153.063 194.561 214.752 1.00 145.17 ? 122 GLN B CB  1 
ATOM   3943  C  CG  . GLN B 1 122 ? 153.748 194.798 213.404 1.00 150.98 ? 122 GLN B CG  1 
ATOM   3944  C  CD  . GLN B 1 122 ? 154.863 195.808 213.455 1.00 173.86 ? 122 GLN B CD  1 
ATOM   3945  O  OE1 . GLN B 1 122 ? 155.726 195.790 214.340 1.00 175.40 ? 122 GLN B OE1 1 
ATOM   3946  N  NE2 . GLN B 1 122 ? 154.904 196.681 212.461 1.00 163.06 ? 122 GLN B NE2 1 
ATOM   3947  N  N   . SER B 1 123 ? 152.161 191.471 214.655 1.00 139.49 ? 123 SER B N   1 
ATOM   3948  C  CA  . SER B 1 123 ? 152.240 190.105 214.135 1.00 136.63 ? 123 SER B CA  1 
ATOM   3949  C  C   . SER B 1 123 ? 150.853 189.599 213.718 1.00 137.90 ? 123 SER B C   1 
ATOM   3950  O  O   . SER B 1 123 ? 150.735 188.898 212.714 1.00 134.06 ? 123 SER B O   1 
ATOM   3951  C  CB  . SER B 1 123 ? 152.838 189.166 215.179 1.00 142.84 ? 123 SER B CB  1 
ATOM   3952  O  OG  . SER B 1 123 ? 154.162 189.517 215.542 1.00 152.38 ? 123 SER B OG  1 
ATOM   3953  N  N   . LEU B 1 124 ? 149.810 189.986 214.479 1.00 136.08 ? 124 LEU B N   1 
ATOM   3954  C  CA  . LEU B 1 124 ? 148.424 189.579 214.262 1.00 133.83 ? 124 LEU B CA  1 
ATOM   3955  C  C   . LEU B 1 124 ? 147.802 190.262 213.045 1.00 133.12 ? 124 LEU B C   1 
ATOM   3956  O  O   . LEU B 1 124 ? 147.183 189.570 212.239 1.00 130.09 ? 124 LEU B O   1 
ATOM   3957  C  CB  . LEU B 1 124 ? 147.584 189.852 215.518 1.00 137.79 ? 124 LEU B CB  1 
ATOM   3958  C  CG  . LEU B 1 124 ? 146.727 188.694 216.040 1.00 143.62 ? 124 LEU B CG  1 
ATOM   3959  C  CD1 . LEU B 1 124 ? 147.580 187.493 216.442 1.00 145.14 ? 124 LEU B CD1 1 
ATOM   3960  C  CD2 . LEU B 1 124 ? 145.905 189.134 217.234 1.00 150.76 ? 124 LEU B CD2 1 
ATOM   3961  N  N   . VAL B 1 125 ? 147.973 191.595 212.896 1.00 128.99 ? 125 VAL B N   1 
ATOM   3962  C  CA  . VAL B 1 125 ? 147.425 192.341 211.758 1.00 125.37 ? 125 VAL B CA  1 
ATOM   3963  C  C   . VAL B 1 125 ? 148.195 191.970 210.467 1.00 125.86 ? 125 VAL B C   1 
ATOM   3964  O  O   . VAL B 1 125 ? 147.558 191.846 209.420 1.00 122.74 ? 125 VAL B O   1 
ATOM   3965  C  CB  . VAL B 1 125 ? 147.335 193.873 212.000 1.00 131.14 ? 125 VAL B CB  1 
ATOM   3966  C  CG1 . VAL B 1 125 ? 148.675 194.482 212.382 1.00 133.41 ? 125 VAL B CG1 1 
ATOM   3967  C  CG2 . VAL B 1 125 ? 146.712 194.608 210.816 1.00 128.12 ? 125 VAL B CG2 1 
ATOM   3968  N  N   . PHE B 1 126 ? 149.527 191.731 210.551 1.00 123.24 ? 126 PHE B N   1 
ATOM   3969  C  CA  . PHE B 1 126 ? 150.349 191.296 209.410 1.00 120.63 ? 126 PHE B CA  1 
ATOM   3970  C  C   . PHE B 1 126 ? 149.812 189.960 208.876 1.00 122.99 ? 126 PHE B C   1 
ATOM   3971  O  O   . PHE B 1 126 ? 149.641 189.796 207.665 1.00 120.33 ? 126 PHE B O   1 
ATOM   3972  C  CB  . PHE B 1 126 ? 151.835 191.169 209.818 1.00 124.63 ? 126 PHE B CB  1 
ATOM   3973  C  CG  . PHE B 1 126 ? 152.722 190.378 208.880 1.00 124.23 ? 126 PHE B CG  1 
ATOM   3974  C  CD1 . PHE B 1 126 ? 152.887 189.007 209.043 1.00 126.95 ? 126 PHE B CD1 1 
ATOM   3975  C  CD2 . PHE B 1 126 ? 153.414 191.008 207.854 1.00 125.22 ? 126 PHE B CD2 1 
ATOM   3976  C  CE1 . PHE B 1 126 ? 153.706 188.277 208.181 1.00 126.57 ? 126 PHE B CE1 1 
ATOM   3977  C  CE2 . PHE B 1 126 ? 154.239 190.276 206.993 1.00 126.74 ? 126 PHE B CE2 1 
ATOM   3978  C  CZ  . PHE B 1 126 ? 154.377 188.915 207.163 1.00 124.68 ? 126 PHE B CZ  1 
ATOM   3979  N  N   . LEU B 1 127 ? 149.544 189.023 209.800 1.00 120.57 ? 127 LEU B N   1 
ATOM   3980  C  CA  . LEU B 1 127 ? 149.013 187.690 209.542 1.00 118.45 ? 127 LEU B CA  1 
ATOM   3981  C  C   . LEU B 1 127 ? 147.660 187.765 208.822 1.00 119.09 ? 127 LEU B C   1 
ATOM   3982  O  O   . LEU B 1 127 ? 147.462 187.041 207.845 1.00 116.54 ? 127 LEU B O   1 
ATOM   3983  C  CB  . LEU B 1 127 ? 148.872 186.969 210.885 1.00 121.52 ? 127 LEU B CB  1 
ATOM   3984  C  CG  . LEU B 1 127 ? 148.838 185.463 210.878 1.00 125.77 ? 127 LEU B CG  1 
ATOM   3985  C  CD1 . LEU B 1 127 ? 150.228 184.880 210.668 1.00 126.28 ? 127 LEU B CD1 1 
ATOM   3986  C  CD2 . LEU B 1 127 ? 148.281 184.972 212.177 1.00 131.43 ? 127 LEU B CD2 1 
ATOM   3987  N  N   . LEU B 1 128 ? 146.756 188.664 209.287 1.00 115.49 ? 128 LEU B N   1 
ATOM   3988  C  CA  . LEU B 1 128 ? 145.416 188.901 208.733 1.00 113.29 ? 128 LEU B CA  1 
ATOM   3989  C  C   . LEU B 1 128 ? 145.483 189.381 207.280 1.00 113.29 ? 128 LEU B C   1 
ATOM   3990  O  O   . LEU B 1 128 ? 144.683 188.942 206.448 1.00 110.80 ? 128 LEU B O   1 
ATOM   3991  C  CB  . LEU B 1 128 ? 144.664 189.940 209.582 1.00 115.73 ? 128 LEU B CB  1 
ATOM   3992  C  CG  . LEU B 1 128 ? 144.043 189.480 210.901 1.00 123.58 ? 128 LEU B CG  1 
ATOM   3993  C  CD1 . LEU B 1 128 ? 143.975 190.630 211.898 1.00 127.08 ? 128 LEU B CD1 1 
ATOM   3994  C  CD2 . LEU B 1 128 ? 142.648 188.912 210.686 1.00 125.13 ? 128 LEU B CD2 1 
ATOM   3995  N  N   . LEU B 1 129 ? 146.442 190.282 206.986 1.00 109.53 ? 129 LEU B N   1 
ATOM   3996  C  CA  . LEU B 1 129 ? 146.670 190.848 205.656 1.00 107.14 ? 129 LEU B CA  1 
ATOM   3997  C  C   . LEU B 1 129 ? 147.294 189.807 204.729 1.00 110.12 ? 129 LEU B C   1 
ATOM   3998  O  O   . LEU B 1 129 ? 146.868 189.685 203.577 1.00 108.90 ? 129 LEU B O   1 
ATOM   3999  C  CB  . LEU B 1 129 ? 147.570 192.099 205.727 1.00 108.24 ? 129 LEU B CB  1 
ATOM   4000  C  CG  . LEU B 1 129 ? 146.981 193.353 206.370 1.00 114.66 ? 129 LEU B CG  1 
ATOM   4001  C  CD1 . LEU B 1 129 ? 148.076 194.238 206.921 1.00 117.06 ? 129 LEU B CD1 1 
ATOM   4002  C  CD2 . LEU B 1 129 ? 146.135 194.133 205.387 1.00 115.70 ? 129 LEU B CD2 1 
ATOM   4003  N  N   . ALA B 1 130 ? 148.300 189.060 205.234 1.00 106.55 ? 130 ALA B N   1 
ATOM   4004  C  CA  . ALA B 1 130 ? 149.000 188.024 204.482 1.00 104.69 ? 130 ALA B CA  1 
ATOM   4005  C  C   . ALA B 1 130 ? 148.039 186.943 204.000 1.00 105.55 ? 130 ALA B C   1 
ATOM   4006  O  O   . ALA B 1 130 ? 148.089 186.594 202.823 1.00 103.35 ? 130 ALA B O   1 
ATOM   4007  C  CB  . ALA B 1 130 ? 150.094 187.409 205.334 1.00 107.80 ? 130 ALA B CB  1 
ATOM   4008  N  N   . THR B 1 131 ? 147.133 186.459 204.884 1.00 102.32 ? 131 THR B N   1 
ATOM   4009  C  CA  . THR B 1 131 ? 146.139 185.426 204.551 1.00 101.01 ? 131 THR B CA  1 
ATOM   4010  C  C   . THR B 1 131 ? 145.028 185.979 203.653 1.00 102.67 ? 131 THR B C   1 
ATOM   4011  O  O   . THR B 1 131 ? 144.413 185.206 202.915 1.00 100.39 ? 131 THR B O   1 
ATOM   4012  C  CB  . THR B 1 131 ? 145.538 184.775 205.803 1.00 110.76 ? 131 THR B CB  1 
ATOM   4013  O  OG1 . THR B 1 131 ? 144.930 185.770 206.623 1.00 112.56 ? 131 THR B OG1 1 
ATOM   4014  C  CG2 . THR B 1 131 ? 146.553 183.968 206.594 1.00 110.61 ? 131 THR B CG2 1 
ATOM   4015  N  N   . LEU B 1 132 ? 144.766 187.300 203.716 1.00 100.11 ? 132 LEU B N   1 
ATOM   4016  C  CA  . LEU B 1 132 ? 143.765 187.936 202.863 1.00 99.36  ? 132 LEU B CA  1 
ATOM   4017  C  C   . LEU B 1 132 ? 144.267 187.943 201.418 1.00 102.21 ? 132 LEU B C   1 
ATOM   4018  O  O   . LEU B 1 132 ? 143.519 187.544 200.527 1.00 100.91 ? 132 LEU B O   1 
ATOM   4019  C  CB  . LEU B 1 132 ? 143.418 189.362 203.345 1.00 100.69 ? 132 LEU B CB  1 
ATOM   4020  C  CG  . LEU B 1 132 ? 142.550 190.231 202.410 1.00 104.49 ? 132 LEU B CG  1 
ATOM   4021  C  CD1 . LEU B 1 132 ? 141.159 189.633 202.202 1.00 104.58 ? 132 LEU B CD1 1 
ATOM   4022  C  CD2 . LEU B 1 132 ? 142.470 191.662 202.905 1.00 108.38 ? 132 LEU B CD2 1 
ATOM   4023  N  N   . PHE B 1 133 ? 145.533 188.362 201.195 1.00 99.34  ? 133 PHE B N   1 
ATOM   4024  C  CA  . PHE B 1 133 ? 146.159 188.384 199.868 1.00 98.40  ? 133 PHE B CA  1 
ATOM   4025  C  C   . PHE B 1 133 ? 146.272 186.942 199.338 1.00 105.33 ? 133 PHE B C   1 
ATOM   4026  O  O   . PHE B 1 133 ? 145.937 186.702 198.174 1.00 104.58 ? 133 PHE B O   1 
ATOM   4027  C  CB  A PHE B 1 133 ? 147.559 189.067 199.895 0.50 100.49 ? 133 PHE B CB  1 
ATOM   4028  C  CB  B PHE B 1 133 ? 147.521 189.102 199.929 0.50 100.62 ? 133 PHE B CB  1 
ATOM   4029  C  CG  A PHE B 1 133 ? 148.466 188.849 198.684 0.50 100.73 ? 133 PHE B CG  1 
ATOM   4030  C  CG  B PHE B 1 133 ? 147.516 190.549 200.398 0.50 102.93 ? 133 PHE B CG  1 
ATOM   4031  C  CD1 A PHE B 1 133 ? 148.432 189.720 197.599 0.50 102.48 ? 133 PHE B CD1 1 
ATOM   4032  C  CD1 B PHE B 1 133 ? 146.321 191.245 200.568 0.50 105.79 ? 133 PHE B CD1 1 
ATOM   4033  C  CD2 A PHE B 1 133 ? 149.377 187.797 198.652 0.50 102.51 ? 133 PHE B CD2 1 
ATOM   4034  C  CD2 B PHE B 1 133 ? 148.707 191.220 200.643 0.50 106.23 ? 133 PHE B CD2 1 
ATOM   4035  C  CE1 A PHE B 1 133 ? 149.279 189.531 196.497 0.50 102.34 ? 133 PHE B CE1 1 
ATOM   4036  C  CE1 B PHE B 1 133 ? 146.320 192.573 200.998 0.50 107.95 ? 133 PHE B CE1 1 
ATOM   4037  C  CE2 A PHE B 1 133 ? 150.205 187.598 197.539 0.50 104.30 ? 133 PHE B CE2 1 
ATOM   4038  C  CE2 B PHE B 1 133 ? 148.704 192.554 201.065 0.50 110.23 ? 133 PHE B CE2 1 
ATOM   4039  C  CZ  A PHE B 1 133 ? 150.154 188.470 196.474 0.50 101.36 ? 133 PHE B CZ  1 
ATOM   4040  C  CZ  B PHE B 1 133 ? 147.511 193.220 201.239 0.50 108.29 ? 133 PHE B CZ  1 
ATOM   4041  N  N   . SER B 1 134 ? 146.694 185.985 200.207 1.00 104.26 ? 134 SER B N   1 
ATOM   4042  C  CA  . SER B 1 134 ? 146.843 184.563 199.882 1.00 104.44 ? 134 SER B CA  1 
ATOM   4043  C  C   . SER B 1 134 ? 145.549 183.977 199.339 1.00 109.32 ? 134 SER B C   1 
ATOM   4044  O  O   . SER B 1 134 ? 145.577 183.323 198.298 1.00 108.80 ? 134 SER B O   1 
ATOM   4045  C  CB  . SER B 1 134 ? 147.283 183.772 201.109 1.00 110.13 ? 134 SER B CB  1 
ATOM   4046  O  OG  . SER B 1 134 ? 148.581 184.156 201.527 1.00 123.54 ? 134 SER B OG  1 
ATOM   4047  N  N   . ALA B 1 135 ? 144.415 184.246 200.021 1.00 107.16 ? 135 ALA B N   1 
ATOM   4048  C  CA  . ALA B 1 135 ? 143.088 183.747 199.651 1.00 107.08 ? 135 ALA B CA  1 
ATOM   4049  C  C   . ALA B 1 135 ? 142.587 184.340 198.333 1.00 109.88 ? 135 ALA B C   1 
ATOM   4050  O  O   . ALA B 1 135 ? 142.146 183.586 197.465 1.00 109.13 ? 135 ALA B O   1 
ATOM   4051  C  CB  . ALA B 1 135 ? 142.091 184.039 200.760 1.00 109.17 ? 135 ALA B CB  1 
ATOM   4052  N  N   . LEU B 1 136 ? 142.675 185.678 198.178 1.00 106.32 ? 136 LEU B N   1 
ATOM   4053  C  CA  . LEU B 1 136 ? 142.204 186.396 196.995 1.00 105.64 ? 136 LEU B CA  1 
ATOM   4054  C  C   . LEU B 1 136 ? 143.008 186.069 195.742 1.00 108.86 ? 136 LEU B C   1 
ATOM   4055  O  O   . LEU B 1 136 ? 142.401 185.936 194.680 1.00 109.06 ? 136 LEU B O   1 
ATOM   4056  C  CB  . LEU B 1 136 ? 142.211 187.921 197.215 1.00 105.96 ? 136 LEU B CB  1 
ATOM   4057  C  CG  . LEU B 1 136 ? 141.214 188.503 198.234 1.00 112.14 ? 136 LEU B CG  1 
ATOM   4058  C  CD1 . LEU B 1 136 ? 141.520 189.951 198.497 1.00 113.22 ? 136 LEU B CD1 1 
ATOM   4059  C  CD2 . LEU B 1 136 ? 139.766 188.380 197.763 1.00 114.54 ? 136 LEU B CD2 1 
ATOM   4060  N  N   . ALA B 1 137 ? 144.350 185.946 195.850 1.00 104.41 ? 137 ALA B N   1 
ATOM   4061  C  CA  . ALA B 1 137 ? 145.228 185.673 194.705 1.00 103.70 ? 137 ALA B CA  1 
ATOM   4062  C  C   . ALA B 1 137 ? 145.062 184.261 194.138 1.00 107.63 ? 137 ALA B C   1 
ATOM   4063  O  O   . ALA B 1 137 ? 145.285 184.055 192.941 1.00 106.67 ? 137 ALA B O   1 
ATOM   4064  C  CB  . ALA B 1 137 ? 146.678 185.901 195.086 1.00 104.66 ? 137 ALA B CB  1 
ATOM   4065  N  N   . GLY B 1 138 ? 144.681 183.319 194.999 1.00 105.26 ? 138 GLY B N   1 
ATOM   4066  C  CA  . GLY B 1 138 ? 144.492 181.913 194.651 1.00 105.73 ? 138 GLY B CA  1 
ATOM   4067  C  C   . GLY B 1 138 ? 143.078 181.507 194.284 1.00 109.09 ? 138 GLY B C   1 
ATOM   4068  O  O   . GLY B 1 138 ? 142.875 180.439 193.699 1.00 109.37 ? 138 GLY B O   1 
ATOM   4069  N  N   . LEU B 1 139 ? 142.098 182.357 194.620 1.00 104.95 ? 139 LEU B N   1 
ATOM   4070  C  CA  . LEU B 1 139 ? 140.683 182.144 194.341 1.00 105.56 ? 139 LEU B CA  1 
ATOM   4071  C  C   . LEU B 1 139 ? 140.383 182.025 192.817 1.00 109.45 ? 139 LEU B C   1 
ATOM   4072  O  O   . LEU B 1 139 ? 139.607 181.122 192.492 1.00 110.91 ? 139 LEU B O   1 
ATOM   4073  C  CB  . LEU B 1 139 ? 139.841 183.257 194.983 1.00 105.93 ? 139 LEU B CB  1 
ATOM   4074  C  CG  . LEU B 1 139 ? 138.423 182.892 195.448 1.00 112.20 ? 139 LEU B CG  1 
ATOM   4075  C  CD1 . LEU B 1 139 ? 138.425 181.725 196.429 1.00 113.00 ? 139 LEU B CD1 1 
ATOM   4076  C  CD2 . LEU B 1 139 ? 137.756 184.084 196.102 1.00 115.63 ? 139 LEU B CD2 1 
ATOM   4077  N  N   . PRO B 1 140 ? 140.979 182.817 191.863 1.00 103.92 ? 140 PRO B N   1 
ATOM   4078  C  CA  . PRO B 1 140 ? 140.660 182.604 190.436 1.00 103.98 ? 140 PRO B CA  1 
ATOM   4079  C  C   . PRO B 1 140 ? 141.142 181.249 189.919 1.00 109.46 ? 140 PRO B C   1 
ATOM   4080  O  O   . PRO B 1 140 ? 140.470 180.657 189.075 1.00 110.50 ? 140 PRO B O   1 
ATOM   4081  C  CB  . PRO B 1 140 ? 141.388 183.753 189.726 1.00 104.71 ? 140 PRO B CB  1 
ATOM   4082  C  CG  . PRO B 1 140 ? 141.651 184.747 190.771 1.00 108.42 ? 140 PRO B CG  1 
ATOM   4083  C  CD  . PRO B 1 140 ? 141.916 183.949 192.004 1.00 104.10 ? 140 PRO B CD  1 
ATOM   4084  N  N   . TRP B 1 141 ? 142.284 180.751 190.441 1.00 106.19 ? 141 TRP B N   1 
ATOM   4085  C  CA  . TRP B 1 141 ? 142.866 179.456 190.075 1.00 107.14 ? 141 TRP B CA  1 
ATOM   4086  C  C   . TRP B 1 141 ? 141.961 178.331 190.553 1.00 112.77 ? 141 TRP B C   1 
ATOM   4087  O  O   . TRP B 1 141 ? 141.667 177.419 189.783 1.00 113.73 ? 141 TRP B O   1 
ATOM   4088  C  CB  . TRP B 1 141 ? 144.279 179.321 190.653 1.00 105.45 ? 141 TRP B CB  1 
ATOM   4089  C  CG  . TRP B 1 141 ? 145.221 180.348 190.105 1.00 105.91 ? 141 TRP B CG  1 
ATOM   4090  C  CD1 . TRP B 1 141 ? 145.487 181.579 190.631 1.00 107.85 ? 141 TRP B CD1 1 
ATOM   4091  C  CD2 . TRP B 1 141 ? 145.934 180.278 188.864 1.00 106.50 ? 141 TRP B CD2 1 
ATOM   4092  N  NE1 . TRP B 1 141 ? 146.350 182.266 189.811 1.00 107.48 ? 141 TRP B NE1 1 
ATOM   4093  C  CE2 . TRP B 1 141 ? 146.641 181.491 188.718 1.00 109.98 ? 141 TRP B CE2 1 
ATOM   4094  C  CE3 . TRP B 1 141 ? 146.051 179.302 187.860 1.00 109.20 ? 141 TRP B CE3 1 
ATOM   4095  C  CZ2 . TRP B 1 141 ? 147.462 181.751 187.614 1.00 110.08 ? 141 TRP B CZ2 1 
ATOM   4096  C  CZ3 . TRP B 1 141 ? 146.866 179.559 186.770 1.00 111.52 ? 141 TRP B CZ3 1 
ATOM   4097  C  CH2 . TRP B 1 141 ? 147.565 180.768 186.657 1.00 111.50 ? 141 TRP B CH2 1 
ATOM   4098  N  N   . SER B 1 142 ? 141.467 178.449 191.805 1.00 110.05 ? 142 SER B N   1 
ATOM   4099  C  CA  . SER B 1 142 ? 140.538 177.528 192.469 1.00 111.68 ? 142 SER B CA  1 
ATOM   4100  C  C   . SER B 1 142 ? 139.204 177.462 191.724 1.00 115.86 ? 142 SER B C   1 
ATOM   4101  O  O   . SER B 1 142 ? 138.637 176.376 191.571 1.00 116.83 ? 142 SER B O   1 
ATOM   4102  C  CB  . SER B 1 142 ? 140.301 177.971 193.911 1.00 116.42 ? 142 SER B CB  1 
ATOM   4103  O  OG  . SER B 1 142 ? 139.427 177.086 194.594 1.00 129.98 ? 142 SER B OG  1 
ATOM   4104  N  N   . LEU B 1 143 ? 138.716 178.635 191.266 1.00 111.58 ? 143 LEU B N   1 
ATOM   4105  C  CA  . LEU B 1 143 ? 137.480 178.797 190.506 1.00 112.75 ? 143 LEU B CA  1 
ATOM   4106  C  C   . LEU B 1 143 ? 137.620 178.124 189.142 1.00 118.74 ? 143 LEU B C   1 
ATOM   4107  O  O   . LEU B 1 143 ? 136.657 177.527 188.662 1.00 120.18 ? 143 LEU B O   1 
ATOM   4108  C  CB  . LEU B 1 143 ? 137.148 180.292 190.355 1.00 111.82 ? 143 LEU B CB  1 
ATOM   4109  C  CG  . LEU B 1 143 ? 135.768 180.630 189.807 1.00 117.93 ? 143 LEU B CG  1 
ATOM   4110  C  CD1 . LEU B 1 143 ? 134.830 181.056 190.903 1.00 118.44 ? 143 LEU B CD1 1 
ATOM   4111  C  CD2 . LEU B 1 143 ? 135.856 181.720 188.790 1.00 120.27 ? 143 LEU B CD2 1 
ATOM   4112  N  N   . TYR B 1 144 ? 138.825 178.190 188.540 1.00 115.63 ? 144 TYR B N   1 
ATOM   4113  C  CA  . TYR B 1 144 ? 139.104 177.570 187.247 1.00 117.67 ? 144 TYR B CA  1 
ATOM   4114  C  C   . TYR B 1 144 ? 139.086 176.056 187.362 1.00 122.35 ? 144 TYR B C   1 
ATOM   4115  O  O   . TYR B 1 144 ? 138.461 175.405 186.534 1.00 124.49 ? 144 TYR B O   1 
ATOM   4116  C  CB  . TYR B 1 144 ? 140.450 178.042 186.660 1.00 118.77 ? 144 TYR B CB  1 
ATOM   4117  C  CG  . TYR B 1 144 ? 140.652 177.620 185.221 1.00 123.60 ? 144 TYR B CG  1 
ATOM   4118  C  CD1 . TYR B 1 144 ? 140.140 178.381 184.172 1.00 126.97 ? 144 TYR B CD1 1 
ATOM   4119  C  CD2 . TYR B 1 144 ? 141.353 176.462 184.904 1.00 125.76 ? 144 TYR B CD2 1 
ATOM   4120  C  CE1 . TYR B 1 144 ? 140.306 177.990 182.844 1.00 130.24 ? 144 TYR B CE1 1 
ATOM   4121  C  CE2 . TYR B 1 144 ? 141.525 176.059 183.581 1.00 129.22 ? 144 TYR B CE2 1 
ATOM   4122  C  CZ  . TYR B 1 144 ? 141.006 176.832 182.552 1.00 138.93 ? 144 TYR B CZ  1 
ATOM   4123  O  OH  . TYR B 1 144 ? 141.166 176.452 181.242 1.00 144.06 ? 144 TYR B OH  1 
ATOM   4124  N  N   . ASN B 1 145 ? 139.761 175.496 188.379 1.00 117.28 ? 145 ASN B N   1 
ATOM   4125  C  CA  . ASN B 1 145 ? 139.826 174.051 188.573 1.00 118.52 ? 145 ASN B CA  1 
ATOM   4126  C  C   . ASN B 1 145 ? 138.434 173.427 188.697 1.00 124.73 ? 145 ASN B C   1 
ATOM   4127  O  O   . ASN B 1 145 ? 138.142 172.477 187.968 1.00 127.37 ? 145 ASN B O   1 
ATOM   4128  C  CB  . ASN B 1 145 ? 140.684 173.681 189.784 1.00 116.87 ? 145 ASN B CB  1 
ATOM   4129  C  CG  . ASN B 1 145 ? 140.771 172.190 190.026 1.00 137.78 ? 145 ASN B CG  1 
ATOM   4130  O  OD1 . ASN B 1 145 ? 141.383 171.436 189.259 1.00 130.93 ? 145 ASN B OD1 1 
ATOM   4131  N  ND2 . ASN B 1 145 ? 140.119 171.725 191.080 1.00 130.69 ? 145 ASN B ND2 1 
ATOM   4132  N  N   . THR B 1 146 ? 137.573 173.971 189.576 1.00 119.99 ? 146 THR B N   1 
ATOM   4133  C  CA  . THR B 1 146 ? 136.244 173.400 189.800 1.00 121.63 ? 146 THR B CA  1 
ATOM   4134  C  C   . THR B 1 146 ? 135.293 173.665 188.630 1.00 125.64 ? 146 THR B C   1 
ATOM   4135  O  O   . THR B 1 146 ? 134.600 172.737 188.217 1.00 128.07 ? 146 THR B O   1 
ATOM   4136  C  CB  . THR B 1 146 ? 135.613 173.878 191.134 1.00 131.60 ? 146 THR B CB  1 
ATOM   4137  O  OG1 . THR B 1 146 ? 135.209 175.244 191.037 1.00 131.55 ? 146 THR B OG1 1 
ATOM   4138  C  CG2 . THR B 1 146 ? 136.527 173.670 192.347 1.00 129.70 ? 146 THR B CG2 1 
ATOM   4139  N  N   . PHE B 1 147 ? 135.255 174.903 188.096 1.00 119.77 ? 147 PHE B N   1 
ATOM   4140  C  CA  . PHE B 1 147 ? 134.293 175.246 187.047 1.00 121.09 ? 147 PHE B CA  1 
ATOM   4141  C  C   . PHE B 1 147 ? 134.791 175.059 185.605 1.00 125.59 ? 147 PHE B C   1 
ATOM   4142  O  O   . PHE B 1 147 ? 133.989 175.217 184.680 1.00 127.79 ? 147 PHE B O   1 
ATOM   4143  C  CB  . PHE B 1 147 ? 133.742 176.664 187.244 1.00 121.51 ? 147 PHE B CB  1 
ATOM   4144  C  CG  . PHE B 1 147 ? 132.930 176.781 188.510 1.00 122.66 ? 147 PHE B CG  1 
ATOM   4145  C  CD1 . PHE B 1 147 ? 131.749 176.063 188.668 1.00 127.94 ? 147 PHE B CD1 1 
ATOM   4146  C  CD2 . PHE B 1 147 ? 133.363 177.580 189.560 1.00 122.45 ? 147 PHE B CD2 1 
ATOM   4147  C  CE1 . PHE B 1 147 ? 131.018 176.142 189.853 1.00 129.31 ? 147 PHE B CE1 1 
ATOM   4148  C  CE2 . PHE B 1 147 ? 132.622 177.672 190.738 1.00 125.64 ? 147 PHE B CE2 1 
ATOM   4149  C  CZ  . PHE B 1 147 ? 131.459 176.946 190.879 1.00 126.36 ? 147 PHE B CZ  1 
ATOM   4150  N  N   . VAL B 1 148 ? 136.055 174.676 185.392 1.00 120.32 ? 148 VAL B N   1 
ATOM   4151  C  CA  . VAL B 1 148 ? 136.504 174.438 184.021 1.00 121.53 ? 148 VAL B CA  1 
ATOM   4152  C  C   . VAL B 1 148 ? 137.010 172.995 183.912 1.00 127.16 ? 148 VAL B C   1 
ATOM   4153  O  O   . VAL B 1 148 ? 136.471 172.269 183.086 1.00 130.31 ? 148 VAL B O   1 
ATOM   4154  C  CB  . VAL B 1 148 ? 137.509 175.486 183.455 1.00 123.37 ? 148 VAL B CB  1 
ATOM   4155  C  CG1 . VAL B 1 148 ? 137.952 175.127 182.037 1.00 125.33 ? 148 VAL B CG1 1 
ATOM   4156  C  CG2 . VAL B 1 148 ? 136.899 176.886 183.471 1.00 122.14 ? 148 VAL B CG2 1 
ATOM   4157  N  N   . ILE B 1 149 ? 137.984 172.560 184.746 1.00 121.86 ? 149 ILE B N   1 
ATOM   4158  C  CA  . ILE B 1 149 ? 138.516 171.189 184.673 1.00 123.72 ? 149 ILE B CA  1 
ATOM   4159  C  C   . ILE B 1 149 ? 137.476 170.173 185.198 1.00 132.43 ? 149 ILE B C   1 
ATOM   4160  O  O   . ILE B 1 149 ? 137.063 169.292 184.438 1.00 136.17 ? 149 ILE B O   1 
ATOM   4161  C  CB  . ILE B 1 149 ? 139.897 171.036 185.374 1.00 124.34 ? 149 ILE B CB  1 
ATOM   4162  C  CG1 . ILE B 1 149 ? 140.963 171.862 184.657 1.00 123.61 ? 149 ILE B CG1 1 
ATOM   4163  C  CG2 . ILE B 1 149 ? 140.346 169.573 185.456 1.00 126.73 ? 149 ILE B CG2 1 
ATOM   4164  C  CD1 . ILE B 1 149 ? 141.517 172.899 185.480 1.00 129.42 ? 149 ILE B CD1 1 
ATOM   4165  N  N   . GLU B 1 150 ? 137.044 170.303 186.469 1.00 128.28 ? 150 GLU B N   1 
ATOM   4166  C  CA  . GLU B 1 150 ? 136.081 169.380 187.080 1.00 130.64 ? 150 GLU B CA  1 
ATOM   4167  C  C   . GLU B 1 150 ? 134.711 169.445 186.395 1.00 138.16 ? 150 GLU B C   1 
ATOM   4168  O  O   . GLU B 1 150 ? 133.984 168.453 186.405 1.00 140.43 ? 150 GLU B O   1 
ATOM   4169  C  CB  . GLU B 1 150 ? 135.934 169.633 188.593 1.00 130.21 ? 150 GLU B CB  1 
ATOM   4170  C  CG  . GLU B 1 150 ? 137.210 169.449 189.407 1.00 139.79 ? 150 GLU B CG  1 
ATOM   4171  C  CD  . GLU B 1 150 ? 137.938 168.124 189.274 1.00 163.66 ? 150 GLU B CD  1 
ATOM   4172  O  OE1 . GLU B 1 150 ? 137.273 167.066 189.348 1.00 155.97 ? 150 GLU B OE1 1 
ATOM   4173  O  OE2 . GLU B 1 150 ? 139.181 168.144 189.122 1.00 160.63 ? 150 GLU B OE2 1 
ATOM   4174  N  N   . GLU B 1 151 ? 134.373 170.589 185.777 1.00 135.29 ? 151 GLU B N   1 
ATOM   4175  C  CA  . GLU B 1 151 ? 133.097 170.745 185.091 1.00 138.59 ? 151 GLU B CA  1 
ATOM   4176  C  C   . GLU B 1 151 ? 133.141 170.138 183.684 1.00 147.15 ? 151 GLU B C   1 
ATOM   4177  O  O   . GLU B 1 151 ? 132.158 169.514 183.282 1.00 150.51 ? 151 GLU B O   1 
ATOM   4178  C  CB  . GLU B 1 151 ? 132.672 172.219 185.037 1.00 138.38 ? 151 GLU B CB  1 
ATOM   4179  C  CG  . GLU B 1 151 ? 131.169 172.430 184.940 1.00 153.17 ? 151 GLU B CG  1 
ATOM   4180  C  CD  . GLU B 1 151 ? 130.353 171.847 186.080 1.00 182.21 ? 151 GLU B CD  1 
ATOM   4181  O  OE1 . GLU B 1 151 ? 130.357 172.442 187.181 1.00 174.64 ? 151 GLU B OE1 1 
ATOM   4182  O  OE2 . GLU B 1 151 ? 129.714 170.789 185.873 1.00 185.67 ? 151 GLU B OE2 1 
ATOM   4183  N  N   . LYS B 1 152 ? 134.267 170.309 182.945 1.00 143.71 ? 152 LYS B N   1 
ATOM   4184  C  CA  . LYS B 1 152 ? 134.458 169.775 181.584 1.00 147.12 ? 152 LYS B CA  1 
ATOM   4185  C  C   . LYS B 1 152 ? 134.399 168.250 181.584 1.00 155.76 ? 152 LYS B C   1 
ATOM   4186  O  O   . LYS B 1 152 ? 133.810 167.658 180.674 1.00 159.72 ? 152 LYS B O   1 
ATOM   4187  C  CB  . LYS B 1 152 ? 135.803 170.245 180.988 1.00 147.61 ? 152 LYS B CB  1 
ATOM   4188  C  CG  . LYS B 1 152 ? 135.980 169.987 179.496 1.00 165.04 ? 152 LYS B CG  1 
ATOM   4189  N  N   . HIS B 1 153 ? 134.996 167.621 182.613 1.00 151.56 ? 153 HIS B N   1 
ATOM   4190  C  CA  . HIS B 1 153 ? 135.060 166.167 182.740 1.00 154.62 ? 153 HIS B CA  1 
ATOM   4191  C  C   . HIS B 1 153 ? 133.936 165.615 183.658 1.00 160.20 ? 153 HIS B C   1 
ATOM   4192  O  O   . HIS B 1 153 ? 134.035 164.494 184.168 1.00 161.44 ? 153 HIS B O   1 
ATOM   4193  C  CB  . HIS B 1 153 ? 136.461 165.754 183.205 1.00 153.63 ? 153 HIS B CB  1 
ATOM   4194  C  CG  . HIS B 1 153 ? 137.535 166.262 182.289 1.00 156.34 ? 153 HIS B CG  1 
ATOM   4195  N  ND1 . HIS B 1 153 ? 137.790 165.657 181.069 1.00 161.73 ? 153 HIS B ND1 1 
ATOM   4196  C  CD2 . HIS B 1 153 ? 138.348 167.335 182.421 1.00 154.54 ? 153 HIS B CD2 1 
ATOM   4197  C  CE1 . HIS B 1 153 ? 138.753 166.372 180.509 1.00 159.58 ? 153 HIS B CE1 1 
ATOM   4198  N  NE2 . HIS B 1 153 ? 139.125 167.387 181.289 1.00 155.62 ? 153 HIS B NE2 1 
ATOM   4199  N  N   . GLY B 1 154 ? 132.865 166.407 183.788 1.00 156.43 ? 154 GLY B N   1 
ATOM   4200  C  CA  . GLY B 1 154 ? 131.627 166.110 184.506 1.00 157.66 ? 154 GLY B CA  1 
ATOM   4201  C  C   . GLY B 1 154 ? 131.692 165.637 185.945 1.00 158.99 ? 154 GLY B C   1 
ATOM   4202  O  O   . GLY B 1 154 ? 130.795 164.911 186.385 1.00 161.78 ? 154 GLY B O   1 
ATOM   4203  N  N   . PHE B 1 155 ? 132.722 166.054 186.697 1.00 150.16 ? 155 PHE B N   1 
ATOM   4204  C  CA  . PHE B 1 155 ? 132.858 165.672 188.101 1.00 148.27 ? 155 PHE B CA  1 
ATOM   4205  C  C   . PHE B 1 155 ? 132.111 166.649 189.002 1.00 150.10 ? 155 PHE B C   1 
ATOM   4206  O  O   . PHE B 1 155 ? 131.334 166.207 189.848 1.00 151.29 ? 155 PHE B O   1 
ATOM   4207  C  CB  . PHE B 1 155 ? 134.334 165.578 188.522 1.00 147.10 ? 155 PHE B CB  1 
ATOM   4208  C  CG  . PHE B 1 155 ? 135.042 164.320 188.083 1.00 150.51 ? 155 PHE B CG  1 
ATOM   4209  C  CD1 . PHE B 1 155 ? 134.844 163.120 188.756 1.00 155.75 ? 155 PHE B CD1 1 
ATOM   4210  C  CD2 . PHE B 1 155 ? 135.933 164.341 187.019 1.00 152.31 ? 155 PHE B CD2 1 
ATOM   4211  C  CE1 . PHE B 1 155 ? 135.518 161.961 188.363 1.00 158.98 ? 155 PHE B CE1 1 
ATOM   4212  C  CE2 . PHE B 1 155 ? 136.597 163.179 186.620 1.00 157.46 ? 155 PHE B CE2 1 
ATOM   4213  C  CZ  . PHE B 1 155 ? 136.391 161.999 187.299 1.00 157.96 ? 155 PHE B CZ  1 
ATOM   4214  N  N   . ASN B 1 156 ? 132.330 167.971 188.804 1.00 143.55 ? 156 ASN B N   1 
ATOM   4215  C  CA  . ASN B 1 156 ? 131.750 169.056 189.602 1.00 141.45 ? 156 ASN B CA  1 
ATOM   4216  C  C   . ASN B 1 156 ? 130.228 169.067 189.581 1.00 148.08 ? 156 ASN B C   1 
ATOM   4217  O  O   . ASN B 1 156 ? 129.605 168.881 188.534 1.00 150.43 ? 156 ASN B O   1 
ATOM   4218  C  CB  . ASN B 1 156 ? 132.273 170.416 189.152 1.00 139.01 ? 156 ASN B CB  1 
ATOM   4219  C  CG  . ASN B 1 156 ? 132.041 171.513 190.162 1.00 162.83 ? 156 ASN B CG  1 
ATOM   4220  O  OD1 . ASN B 1 156 ? 132.632 171.534 191.250 1.00 157.75 ? 156 ASN B OD1 1 
ATOM   4221  N  ND2 . ASN B 1 156 ? 131.175 172.452 189.822 1.00 156.07 ? 156 ASN B ND2 1 
ATOM   4222  N  N   . GLN B 1 157 ? 129.649 169.281 190.770 1.00 144.44 ? 157 GLN B N   1 
ATOM   4223  C  CA  . GLN B 1 157 ? 128.212 169.359 191.042 1.00 147.13 ? 157 GLN B CA  1 
ATOM   4224  C  C   . GLN B 1 157 ? 127.895 170.694 191.747 1.00 149.10 ? 157 GLN B C   1 
ATOM   4225  O  O   . GLN B 1 157 ? 126.727 171.012 191.994 1.00 151.27 ? 157 GLN B O   1 
ATOM   4226  C  CB  . GLN B 1 157 ? 127.753 168.160 191.902 1.00 151.06 ? 157 GLN B CB  1 
ATOM   4227  C  CG  . GLN B 1 157 ? 128.216 166.777 191.421 1.00 164.89 ? 157 GLN B CG  1 
ATOM   4228  C  CD  . GLN B 1 157 ? 127.666 166.383 190.072 1.00 188.84 ? 157 GLN B CD  1 
ATOM   4229  O  OE1 . GLN B 1 157 ? 126.454 166.397 189.831 1.00 188.51 ? 157 GLN B OE1 1 
ATOM   4230  N  NE2 . GLN B 1 157 ? 128.549 165.996 189.167 1.00 181.59 ? 157 GLN B NE2 1 
ATOM   4231  N  N   . GLN B 1 158 ? 128.954 171.469 192.059 1.00 141.04 ? 158 GLN B N   1 
ATOM   4232  C  CA  . GLN B 1 158 ? 128.892 172.770 192.720 1.00 138.38 ? 158 GLN B CA  1 
ATOM   4233  C  C   . GLN B 1 158 ? 128.324 173.856 191.822 1.00 142.10 ? 158 GLN B C   1 
ATOM   4234  O  O   . GLN B 1 158 ? 128.535 173.844 190.607 1.00 141.90 ? 158 GLN B O   1 
ATOM   4235  C  CB  . GLN B 1 158 ? 130.298 173.214 193.153 1.00 135.82 ? 158 GLN B CB  1 
ATOM   4236  C  CG  . GLN B 1 158 ? 130.809 172.604 194.438 1.00 148.97 ? 158 GLN B CG  1 
ATOM   4237  C  CD  . GLN B 1 158 ? 132.074 173.298 194.872 1.00 166.30 ? 158 GLN B CD  1 
ATOM   4238  O  OE1 . GLN B 1 158 ? 132.042 174.317 195.571 1.00 161.10 ? 158 GLN B OE1 1 
ATOM   4239  N  NE2 . GLN B 1 158 ? 133.216 172.786 194.435 1.00 156.94 ? 158 GLN B NE2 1 
ATOM   4240  N  N   . THR B 1 159 ? 127.649 174.825 192.442 1.00 138.68 ? 159 THR B N   1 
ATOM   4241  C  CA  . THR B 1 159 ? 127.142 176.025 191.783 1.00 138.63 ? 159 THR B CA  1 
ATOM   4242  C  C   . THR B 1 159 ? 128.099 177.159 192.176 1.00 137.79 ? 159 THR B C   1 
ATOM   4243  O  O   . THR B 1 159 ? 128.841 177.008 193.152 1.00 135.40 ? 159 THR B O   1 
ATOM   4244  C  CB  . THR B 1 159 ? 125.653 176.286 192.116 1.00 153.47 ? 159 THR B CB  1 
ATOM   4245  O  OG1 . THR B 1 159 ? 125.266 177.557 191.585 1.00 155.86 ? 159 THR B OG1 1 
ATOM   4246  C  CG2 . THR B 1 159 ? 125.342 176.226 193.612 1.00 152.37 ? 159 THR B CG2 1 
ATOM   4247  N  N   . LEU B 1 160 ? 128.105 178.275 191.421 1.00 133.06 ? 160 LEU B N   1 
ATOM   4248  C  CA  . LEU B 1 160 ? 128.991 179.407 191.709 1.00 129.75 ? 160 LEU B CA  1 
ATOM   4249  C  C   . LEU B 1 160 ? 128.707 180.003 193.093 1.00 133.10 ? 160 LEU B C   1 
ATOM   4250  O  O   . LEU B 1 160 ? 129.636 180.460 193.761 1.00 130.73 ? 160 LEU B O   1 
ATOM   4251  C  CB  . LEU B 1 160 ? 128.890 180.488 190.629 1.00 129.90 ? 160 LEU B CB  1 
ATOM   4252  C  CG  . LEU B 1 160 ? 130.138 181.351 190.464 1.00 131.93 ? 160 LEU B CG  1 
ATOM   4253  C  CD1 . LEU B 1 160 ? 130.523 181.474 189.009 1.00 132.33 ? 160 LEU B CD1 1 
ATOM   4254  C  CD2 . LEU B 1 160 ? 129.958 182.725 191.110 1.00 134.33 ? 160 LEU B CD2 1 
ATOM   4255  N  N   . GLY B 1 161 ? 127.441 179.962 193.505 1.00 131.87 ? 161 GLY B N   1 
ATOM   4256  C  CA  . GLY B 1 161 ? 126.985 180.448 194.799 1.00 132.39 ? 161 GLY B CA  1 
ATOM   4257  C  C   . GLY B 1 161 ? 127.533 179.631 195.948 1.00 136.01 ? 161 GLY B C   1 
ATOM   4258  O  O   . GLY B 1 161 ? 128.031 180.199 196.923 1.00 134.05 ? 161 GLY B O   1 
ATOM   4259  N  N   . PHE B 1 162 ? 127.463 178.286 195.826 1.00 134.84 ? 162 PHE B N   1 
ATOM   4260  C  CA  . PHE B 1 162 ? 127.964 177.346 196.832 1.00 135.20 ? 162 PHE B CA  1 
ATOM   4261  C  C   . PHE B 1 162 ? 129.463 177.496 196.984 1.00 136.63 ? 162 PHE B C   1 
ATOM   4262  O  O   . PHE B 1 162 ? 129.949 177.506 198.112 1.00 135.64 ? 162 PHE B O   1 
ATOM   4263  C  CB  . PHE B 1 162 ? 127.604 175.890 196.478 1.00 139.52 ? 162 PHE B CB  1 
ATOM   4264  C  CG  . PHE B 1 162 ? 128.041 174.870 197.505 1.00 141.97 ? 162 PHE B CG  1 
ATOM   4265  C  CD1 . PHE B 1 162 ? 127.240 174.575 198.602 1.00 147.37 ? 162 PHE B CD1 1 
ATOM   4266  C  CD2 . PHE B 1 162 ? 129.257 174.209 197.379 1.00 143.64 ? 162 PHE B CD2 1 
ATOM   4267  C  CE1 . PHE B 1 162 ? 127.651 173.638 199.558 1.00 151.14 ? 162 PHE B CE1 1 
ATOM   4268  C  CE2 . PHE B 1 162 ? 129.670 173.276 198.336 1.00 145.49 ? 162 PHE B CE2 1 
ATOM   4269  C  CZ  . PHE B 1 162 ? 128.863 172.994 199.417 1.00 147.28 ? 162 PHE B CZ  1 
ATOM   4270  N  N   . PHE B 1 163 ? 130.188 177.613 195.852 1.00 132.32 ? 163 PHE B N   1 
ATOM   4271  C  CA  . PHE B 1 163 ? 131.640 177.791 195.818 1.00 129.63 ? 163 PHE B CA  1 
ATOM   4272  C  C   . PHE B 1 163 ? 132.034 179.068 196.563 1.00 131.72 ? 163 PHE B C   1 
ATOM   4273  O  O   . PHE B 1 163 ? 132.927 179.023 197.411 1.00 130.08 ? 163 PHE B O   1 
ATOM   4274  C  CB  . PHE B 1 163 ? 132.153 177.829 194.364 1.00 130.58 ? 163 PHE B CB  1 
ATOM   4275  C  CG  . PHE B 1 163 ? 133.654 177.933 194.226 1.00 129.61 ? 163 PHE B CG  1 
ATOM   4276  C  CD1 . PHE B 1 163 ? 134.455 176.799 194.289 1.00 132.70 ? 163 PHE B CD1 1 
ATOM   4277  C  CD2 . PHE B 1 163 ? 134.267 179.162 194.028 1.00 129.77 ? 163 PHE B CD2 1 
ATOM   4278  C  CE1 . PHE B 1 163 ? 135.843 176.897 194.174 1.00 131.60 ? 163 PHE B CE1 1 
ATOM   4279  C  CE2 . PHE B 1 163 ? 135.657 179.259 193.925 1.00 130.60 ? 163 PHE B CE2 1 
ATOM   4280  C  CZ  . PHE B 1 163 ? 136.433 178.126 193.993 1.00 128.65 ? 163 PHE B CZ  1 
ATOM   4281  N  N   . MET B 1 164 ? 131.343 180.189 196.262 1.00 128.36 ? 164 MET B N   1 
ATOM   4282  C  CA  . MET B 1 164 ? 131.581 181.491 196.874 1.00 127.04 ? 164 MET B CA  1 
ATOM   4283  C  C   . MET B 1 164 ? 131.250 181.488 198.364 1.00 129.99 ? 164 MET B C   1 
ATOM   4284  O  O   . MET B 1 164 ? 132.095 181.903 199.157 1.00 128.17 ? 164 MET B O   1 
ATOM   4285  C  CB  . MET B 1 164 ? 130.792 182.597 196.155 1.00 130.57 ? 164 MET B CB  1 
ATOM   4286  C  CG  . MET B 1 164 ? 131.499 183.164 194.930 1.00 133.01 ? 164 MET B CG  1 
ATOM   4287  S  SD  . MET B 1 164 ? 133.255 183.595 195.157 1.00 134.86 ? 164 MET B SD  1 
ATOM   4288  C  CE  . MET B 1 164 ? 133.163 184.911 196.434 1.00 131.75 ? 164 MET B CE  1 
ATOM   4289  N  N   . LYS B 1 165 ? 130.047 181.003 198.745 1.00 128.10 ? 165 LYS B N   1 
ATOM   4290  C  CA  . LYS B 1 165 ? 129.600 180.932 200.141 1.00 129.36 ? 165 LYS B CA  1 
ATOM   4291  C  C   . LYS B 1 165 ? 130.541 180.074 200.981 1.00 131.02 ? 165 LYS B C   1 
ATOM   4292  O  O   . LYS B 1 165 ? 130.825 180.432 202.124 1.00 130.85 ? 165 LYS B O   1 
ATOM   4293  C  CB  . LYS B 1 165 ? 128.168 180.388 200.239 1.00 135.62 ? 165 LYS B CB  1 
ATOM   4294  C  CG  . LYS B 1 165 ? 127.098 181.468 200.238 1.00 155.82 ? 165 LYS B CG  1 
ATOM   4295  C  CD  . LYS B 1 165 ? 125.744 180.893 200.645 1.00 172.17 ? 165 LYS B CD  1 
ATOM   4296  C  CE  . LYS B 1 165 ? 124.760 181.958 201.063 1.00 186.04 ? 165 LYS B CE  1 
ATOM   4297  N  N   . ASP B 1 166 ? 131.045 178.968 200.402 1.00 126.00 ? 166 ASP B N   1 
ATOM   4298  C  CA  . ASP B 1 166 ? 131.970 178.053 201.065 1.00 125.24 ? 166 ASP B CA  1 
ATOM   4299  C  C   . ASP B 1 166 ? 133.357 178.684 201.247 1.00 124.85 ? 166 ASP B C   1 
ATOM   4300  O  O   . ASP B 1 166 ? 133.978 178.472 202.292 1.00 125.29 ? 166 ASP B O   1 
ATOM   4301  C  CB  . ASP B 1 166 ? 132.089 176.743 200.278 1.00 127.79 ? 166 ASP B CB  1 
ATOM   4302  C  CG  . ASP B 1 166 ? 132.016 175.511 201.147 1.00 144.63 ? 166 ASP B CG  1 
ATOM   4303  O  OD1 . ASP B 1 166 ? 130.899 175.168 201.597 1.00 147.89 ? 166 ASP B OD1 1 
ATOM   4304  O  OD2 . ASP B 1 166 ? 133.077 174.883 201.373 1.00 152.91 ? 166 ASP B OD2 1 
ATOM   4305  N  N   . ALA B 1 167 ? 133.840 179.450 200.238 1.00 116.75 ? 167 ALA B N   1 
ATOM   4306  C  CA  . ALA B 1 167 ? 135.144 180.123 200.272 1.00 113.03 ? 167 ALA B CA  1 
ATOM   4307  C  C   . ALA B 1 167 ? 135.224 181.118 201.423 1.00 114.09 ? 167 ALA B C   1 
ATOM   4308  O  O   . ALA B 1 167 ? 136.238 181.148 202.120 1.00 112.76 ? 167 ALA B O   1 
ATOM   4309  C  CB  . ALA B 1 167 ? 135.408 180.832 198.956 1.00 111.98 ? 167 ALA B CB  1 
ATOM   4310  N  N   . ILE B 1 168 ? 134.145 181.902 201.638 1.00 110.33 ? 168 ILE B N   1 
ATOM   4311  C  CA  . ILE B 1 168 ? 134.041 182.887 202.715 1.00 110.65 ? 168 ILE B CA  1 
ATOM   4312  C  C   . ILE B 1 168 ? 133.931 182.136 204.046 1.00 116.55 ? 168 ILE B C   1 
ATOM   4313  O  O   . ILE B 1 168 ? 134.680 182.451 204.971 1.00 116.78 ? 168 ILE B O   1 
ATOM   4314  C  CB  . ILE B 1 168 ? 132.866 183.889 202.496 1.00 114.74 ? 168 ILE B CB  1 
ATOM   4315  C  CG1 . ILE B 1 168 ? 132.925 184.533 201.094 1.00 113.04 ? 168 ILE B CG1 1 
ATOM   4316  C  CG2 . ILE B 1 168 ? 132.862 184.974 203.583 1.00 116.92 ? 168 ILE B CG2 1 
ATOM   4317  C  CD1 . ILE B 1 168 ? 131.591 184.943 200.521 1.00 121.41 ? 168 ILE B CD1 1 
ATOM   4318  N  N   . LYS B 1 169 ? 133.027 181.127 204.122 1.00 114.49 ? 169 LYS B N   1 
ATOM   4319  C  CA  . LYS B 1 169 ? 132.821 180.285 205.306 1.00 116.64 ? 169 LYS B CA  1 
ATOM   4320  C  C   . LYS B 1 169 ? 134.152 179.738 205.814 1.00 118.45 ? 169 LYS B C   1 
ATOM   4321  O  O   . LYS B 1 169 ? 134.499 179.958 206.977 1.00 119.39 ? 169 LYS B O   1 
ATOM   4322  C  CB  . LYS B 1 169 ? 131.872 179.116 204.992 1.00 121.26 ? 169 LYS B CB  1 
ATOM   4323  C  CG  . LYS B 1 169 ? 130.403 179.360 205.325 1.00 139.12 ? 169 LYS B CG  1 
ATOM   4324  C  CD  . LYS B 1 169 ? 129.618 178.038 205.449 1.00 151.24 ? 169 LYS B CD  1 
ATOM   4325  C  CE  . LYS B 1 169 ? 129.318 177.362 204.126 1.00 159.58 ? 169 LYS B CE  1 
ATOM   4326  N  NZ  . LYS B 1 169 ? 128.798 175.986 204.319 1.00 171.03 ? 169 LYS B NZ  1 
ATOM   4327  N  N   . LYS B 1 170 ? 134.916 179.081 204.915 1.00 112.11 ? 170 LYS B N   1 
ATOM   4328  C  CA  . LYS B 1 170 ? 136.217 178.492 205.213 1.00 111.11 ? 170 LYS B CA  1 
ATOM   4329  C  C   . LYS B 1 170 ? 137.225 179.561 205.661 1.00 113.48 ? 170 LYS B C   1 
ATOM   4330  O  O   . LYS B 1 170 ? 137.841 179.390 206.713 1.00 113.89 ? 170 LYS B O   1 
ATOM   4331  C  CB  . LYS B 1 170 ? 136.745 177.706 204.005 1.00 112.09 ? 170 LYS B CB  1 
ATOM   4332  N  N   . PHE B 1 171 ? 137.346 180.676 204.902 1.00 108.52 ? 171 PHE B N   1 
ATOM   4333  C  CA  . PHE B 1 171 ? 138.252 181.782 205.222 1.00 107.81 ? 171 PHE B CA  1 
ATOM   4334  C  C   . PHE B 1 171 ? 137.977 182.336 206.627 1.00 114.00 ? 171 PHE B C   1 
ATOM   4335  O  O   . PHE B 1 171 ? 138.928 182.540 207.381 1.00 114.45 ? 171 PHE B O   1 
ATOM   4336  C  CB  . PHE B 1 171 ? 138.164 182.910 204.173 1.00 107.97 ? 171 PHE B CB  1 
ATOM   4337  C  CG  . PHE B 1 171 ? 139.093 184.081 204.421 1.00 109.51 ? 171 PHE B CG  1 
ATOM   4338  C  CD1 . PHE B 1 171 ? 140.453 183.988 204.137 1.00 112.11 ? 171 PHE B CD1 1 
ATOM   4339  C  CD2 . PHE B 1 171 ? 138.610 185.278 204.933 1.00 113.34 ? 171 PHE B CD2 1 
ATOM   4340  C  CE1 . PHE B 1 171 ? 141.315 185.070 204.374 1.00 113.16 ? 171 PHE B CE1 1 
ATOM   4341  C  CE2 . PHE B 1 171 ? 139.474 186.359 205.170 1.00 116.40 ? 171 PHE B CE2 1 
ATOM   4342  C  CZ  . PHE B 1 171 ? 140.819 186.249 204.885 1.00 113.28 ? 171 PHE B CZ  1 
ATOM   4343  N  N   . VAL B 1 172 ? 136.687 182.545 206.979 1.00 111.81 ? 172 VAL B N   1 
ATOM   4344  C  CA  . VAL B 1 172 ? 136.245 183.077 208.274 1.00 114.07 ? 172 VAL B CA  1 
ATOM   4345  C  C   . VAL B 1 172 ? 136.678 182.123 209.400 1.00 120.63 ? 172 VAL B C   1 
ATOM   4346  O  O   . VAL B 1 172 ? 137.359 182.560 210.328 1.00 121.45 ? 172 VAL B O   1 
ATOM   4347  C  CB  . VAL B 1 172 ? 134.716 183.365 208.284 1.00 119.12 ? 172 VAL B CB  1 
ATOM   4348  C  CG1 . VAL B 1 172 ? 134.177 183.542 209.701 1.00 122.64 ? 172 VAL B CG1 1 
ATOM   4349  C  CG2 . VAL B 1 172 ? 134.390 184.590 207.437 1.00 117.32 ? 172 VAL B CG2 1 
ATOM   4350  N  N   . VAL B 1 173 ? 136.333 180.828 209.280 1.00 118.58 ? 173 VAL B N   1 
ATOM   4351  C  CA  . VAL B 1 173 ? 136.656 179.775 210.248 1.00 121.45 ? 173 VAL B CA  1 
ATOM   4352  C  C   . VAL B 1 173 ? 138.196 179.651 210.421 1.00 126.34 ? 173 VAL B C   1 
ATOM   4353  O  O   . VAL B 1 173 ? 138.659 179.492 211.554 1.00 128.20 ? 173 VAL B O   1 
ATOM   4354  C  CB  . VAL B 1 173 ? 135.976 178.435 209.834 1.00 125.90 ? 173 VAL B CB  1 
ATOM   4355  C  CG1 . VAL B 1 173 ? 136.544 177.228 210.583 1.00 127.57 ? 173 VAL B CG1 1 
ATOM   4356  C  CG2 . VAL B 1 173 ? 134.463 178.515 210.026 1.00 127.94 ? 173 VAL B CG2 1 
ATOM   4357  N  N   . THR B 1 174 ? 138.974 179.782 209.319 1.00 121.60 ? 174 THR B N   1 
ATOM   4358  C  CA  . THR B 1 174 ? 140.445 179.710 209.330 1.00 121.52 ? 174 THR B CA  1 
ATOM   4359  C  C   . THR B 1 174 ? 141.031 180.775 210.256 1.00 128.20 ? 174 THR B C   1 
ATOM   4360  O  O   . THR B 1 174 ? 141.837 180.434 211.120 1.00 129.97 ? 174 THR B O   1 
ATOM   4361  C  CB  . THR B 1 174 ? 141.024 179.850 207.906 1.00 129.17 ? 174 THR B CB  1 
ATOM   4362  O  OG1 . THR B 1 174 ? 140.425 178.878 207.047 1.00 131.36 ? 174 THR B OG1 1 
ATOM   4363  C  CG2 . THR B 1 174 ? 142.552 179.706 207.866 1.00 125.86 ? 174 THR B CG2 1 
ATOM   4364  N  N   . GLN B 1 175 ? 140.614 182.048 210.077 1.00 125.23 ? 175 GLN B N   1 
ATOM   4365  C  CA  . GLN B 1 175 ? 141.065 183.198 210.867 1.00 127.38 ? 175 GLN B CA  1 
ATOM   4366  C  C   . GLN B 1 175 ? 140.734 183.024 212.363 1.00 137.61 ? 175 GLN B C   1 
ATOM   4367  O  O   . GLN B 1 175 ? 141.585 183.293 213.217 1.00 139.62 ? 175 GLN B O   1 
ATOM   4368  C  CB  . GLN B 1 175 ? 140.433 184.507 210.347 1.00 127.59 ? 175 GLN B CB  1 
ATOM   4369  C  CG  . GLN B 1 175 ? 140.605 184.788 208.854 1.00 138.28 ? 175 GLN B CG  1 
ATOM   4370  C  CD  . GLN B 1 175 ? 142.025 185.067 208.438 1.00 156.73 ? 175 GLN B CD  1 
ATOM   4371  O  OE1 . GLN B 1 175 ? 142.615 186.095 208.786 1.00 152.72 ? 175 GLN B OE1 1 
ATOM   4372  N  NE2 . GLN B 1 175 ? 142.584 184.172 207.639 1.00 148.17 ? 175 GLN B NE2 1 
ATOM   4373  N  N   . CYS B 1 176 ? 139.512 182.532 212.665 1.00 136.63 ? 176 CYS B N   1 
ATOM   4374  C  CA  . CYS B 1 176 ? 138.995 182.307 214.019 1.00 141.05 ? 176 CYS B CA  1 
ATOM   4375  C  C   . CYS B 1 176 ? 139.781 181.223 214.783 1.00 147.15 ? 176 CYS B C   1 
ATOM   4376  O  O   . CYS B 1 176 ? 139.675 181.146 216.009 1.00 150.86 ? 176 CYS B O   1 
ATOM   4377  C  CB  . CYS B 1 176 ? 137.508 181.977 213.967 1.00 142.60 ? 176 CYS B CB  1 
ATOM   4378  S  SG  . CYS B 1 176 ? 136.467 183.362 213.438 1.00 145.82 ? 176 CYS B SG  1 
ATOM   4379  N  N   . ILE B 1 177 ? 140.559 180.397 214.069 1.00 141.26 ? 177 ILE B N   1 
ATOM   4380  C  CA  . ILE B 1 177 ? 141.405 179.363 214.665 1.00 142.80 ? 177 ILE B CA  1 
ATOM   4381  C  C   . ILE B 1 177 ? 142.852 179.893 214.696 1.00 145.43 ? 177 ILE B C   1 
ATOM   4382  O  O   . ILE B 1 177 ? 143.529 179.774 215.717 1.00 147.88 ? 177 ILE B O   1 
ATOM   4383  C  CB  . ILE B 1 177 ? 141.273 178.006 213.903 1.00 144.51 ? 177 ILE B CB  1 
ATOM   4384  C  CG1 . ILE B 1 177 ? 139.834 177.447 213.999 1.00 146.15 ? 177 ILE B CG1 1 
ATOM   4385  C  CG2 . ILE B 1 177 ? 142.302 176.969 214.408 1.00 147.27 ? 177 ILE B CG2 1 
ATOM   4386  C  CD1 . ILE B 1 177 ? 139.460 176.409 212.916 1.00 151.79 ? 177 ILE B CD1 1 
ATOM   4387  N  N   . LEU B 1 178 ? 143.292 180.506 213.579 1.00 137.89 ? 178 LEU B N   1 
ATOM   4388  C  CA  . LEU B 1 178 ? 144.632 181.045 213.372 1.00 136.55 ? 178 LEU B CA  1 
ATOM   4389  C  C   . LEU B 1 178 ? 144.996 182.111 214.402 1.00 143.58 ? 178 LEU B C   1 
ATOM   4390  O  O   . LEU B 1 178 ? 145.924 181.884 215.171 1.00 146.27 ? 178 LEU B O   1 
ATOM   4391  C  CB  . LEU B 1 178 ? 144.763 181.611 211.946 1.00 132.24 ? 178 LEU B CB  1 
ATOM   4392  C  CG  . LEU B 1 178 ? 146.168 181.927 211.431 1.00 135.36 ? 178 LEU B CG  1 
ATOM   4393  C  CD1 . LEU B 1 178 ? 146.973 180.658 211.162 1.00 135.50 ? 178 LEU B CD1 1 
ATOM   4394  C  CD2 . LEU B 1 178 ? 146.088 182.722 210.167 1.00 134.09 ? 178 LEU B CD2 1 
ATOM   4395  N  N   . LEU B 1 179 ? 144.259 183.239 214.440 1.00 139.75 ? 179 LEU B N   1 
ATOM   4396  C  CA  . LEU B 1 179 ? 144.503 184.391 215.322 1.00 142.08 ? 179 LEU B CA  1 
ATOM   4397  C  C   . LEU B 1 179 ? 144.664 184.033 216.828 1.00 149.95 ? 179 LEU B C   1 
ATOM   4398  O  O   . LEU B 1 179 ? 145.679 184.458 217.393 1.00 151.72 ? 179 LEU B O   1 
ATOM   4399  C  CB  . LEU B 1 179 ? 143.413 185.460 215.145 1.00 141.61 ? 179 LEU B CB  1 
ATOM   4400  C  CG  . LEU B 1 179 ? 143.743 186.608 214.189 1.00 143.49 ? 179 LEU B CG  1 
ATOM   4401  C  CD1 . LEU B 1 179 ? 143.890 186.124 212.743 1.00 139.30 ? 179 LEU B CD1 1 
ATOM   4402  C  CD2 . LEU B 1 179 ? 142.684 187.682 214.269 1.00 146.75 ? 179 LEU B CD2 1 
ATOM   4403  N  N   . PRO B 1 180 ? 143.764 183.264 217.504 1.00 147.70 ? 180 PRO B N   1 
ATOM   4404  C  CA  . PRO B 1 180 ? 143.993 182.970 218.931 1.00 152.21 ? 180 PRO B CA  1 
ATOM   4405  C  C   . PRO B 1 180 ? 145.190 182.041 219.170 1.00 155.79 ? 180 PRO B C   1 
ATOM   4406  O  O   . PRO B 1 180 ? 145.926 182.262 220.129 1.00 159.06 ? 180 PRO B O   1 
ATOM   4407  C  CB  . PRO B 1 180 ? 142.680 182.317 219.381 1.00 155.82 ? 180 PRO B CB  1 
ATOM   4408  C  CG  . PRO B 1 180 ? 141.688 182.636 218.303 1.00 156.64 ? 180 PRO B CG  1 
ATOM   4409  C  CD  . PRO B 1 180 ? 142.491 182.667 217.051 1.00 147.67 ? 180 PRO B CD  1 
ATOM   4410  N  N   . VAL B 1 181 ? 145.399 181.031 218.293 1.00 148.45 ? 181 VAL B N   1 
ATOM   4411  C  CA  . VAL B 1 181 ? 146.515 180.076 218.378 1.00 148.80 ? 181 VAL B CA  1 
ATOM   4412  C  C   . VAL B 1 181 ? 147.847 180.820 218.145 1.00 151.22 ? 181 VAL B C   1 
ATOM   4413  O  O   . VAL B 1 181 ? 148.782 180.632 218.928 1.00 154.49 ? 181 VAL B O   1 
ATOM   4414  C  CB  . VAL B 1 181 ? 146.329 178.876 217.399 1.00 149.74 ? 181 VAL B CB  1 
ATOM   4415  C  CG1 . VAL B 1 181 ? 147.621 178.081 217.205 1.00 149.82 ? 181 VAL B CG1 1 
ATOM   4416  C  CG2 . VAL B 1 181 ? 145.210 177.956 217.873 1.00 151.45 ? 181 VAL B CG2 1 
ATOM   4417  N  N   . SER B 1 182 ? 147.908 181.678 217.094 1.00 142.66 ? 182 SER B N   1 
ATOM   4418  C  CA  . SER B 1 182 ? 149.086 182.467 216.708 1.00 141.21 ? 182 SER B CA  1 
ATOM   4419  C  C   . SER B 1 182 ? 149.542 183.400 217.820 1.00 148.46 ? 182 SER B C   1 
ATOM   4420  O  O   . SER B 1 182 ? 150.716 183.354 218.193 1.00 150.68 ? 182 SER B O   1 
ATOM   4421  C  CB  . SER B 1 182 ? 148.808 183.281 215.452 1.00 140.08 ? 182 SER B CB  1 
ATOM   4422  O  OG  . SER B 1 182 ? 148.365 182.446 214.397 1.00 146.53 ? 182 SER B OG  1 
ATOM   4423  N  N   . SER B 1 183 ? 148.616 184.229 218.357 1.00 145.19 ? 183 SER B N   1 
ATOM   4424  C  CA  . SER B 1 183 ? 148.877 185.181 219.443 1.00 148.75 ? 183 SER B CA  1 
ATOM   4425  C  C   . SER B 1 183 ? 149.444 184.472 220.686 1.00 156.40 ? 183 SER B C   1 
ATOM   4426  O  O   . SER B 1 183 ? 150.448 184.932 221.233 1.00 159.47 ? 183 SER B O   1 
ATOM   4427  C  CB  . SER B 1 183 ? 147.609 185.951 219.803 1.00 152.78 ? 183 SER B CB  1 
ATOM   4428  O  OG  . SER B 1 183 ? 146.522 185.080 220.070 1.00 161.59 ? 183 SER B OG  1 
ATOM   4429  N  N   . LEU B 1 184 ? 148.835 183.331 221.091 1.00 152.21 ? 184 LEU B N   1 
ATOM   4430  C  CA  . LEU B 1 184 ? 149.269 182.531 222.239 1.00 156.05 ? 184 LEU B CA  1 
ATOM   4431  C  C   . LEU B 1 184 ? 150.631 181.887 221.988 1.00 159.56 ? 184 LEU B C   1 
ATOM   4432  O  O   . LEU B 1 184 ? 151.441 181.840 222.912 1.00 163.91 ? 184 LEU B O   1 
ATOM   4433  C  CB  . LEU B 1 184 ? 148.236 181.452 222.592 1.00 156.52 ? 184 LEU B CB  1 
ATOM   4434  C  CG  . LEU B 1 184 ? 146.979 181.909 223.324 1.00 163.08 ? 184 LEU B CG  1 
ATOM   4435  C  CD1 . LEU B 1 184 ? 145.892 180.869 223.220 1.00 162.33 ? 184 LEU B CD1 1 
ATOM   4436  C  CD2 . LEU B 1 184 ? 147.262 182.198 224.782 1.00 172.08 ? 184 LEU B CD2 1 
ATOM   4437  N  N   . LEU B 1 185 ? 150.889 181.408 220.746 1.00 151.17 ? 185 LEU B N   1 
ATOM   4438  C  CA  . LEU B 1 185 ? 152.166 180.795 220.355 1.00 151.12 ? 185 LEU B CA  1 
ATOM   4439  C  C   . LEU B 1 185 ? 153.296 181.828 220.440 1.00 157.66 ? 185 LEU B C   1 
ATOM   4440  O  O   . LEU B 1 185 ? 154.373 181.508 220.949 1.00 161.06 ? 185 LEU B O   1 
ATOM   4441  C  CB  . LEU B 1 185 ? 152.085 180.186 218.938 1.00 145.73 ? 185 LEU B CB  1 
ATOM   4442  C  CG  . LEU B 1 185 ? 153.374 179.588 218.344 1.00 150.01 ? 185 LEU B CG  1 
ATOM   4443  C  CD1 . LEU B 1 185 ? 153.719 178.248 218.977 1.00 153.64 ? 185 LEU B CD1 1 
ATOM   4444  C  CD2 . LEU B 1 185 ? 153.260 179.438 216.843 1.00 146.83 ? 185 LEU B CD2 1 
ATOM   4445  N  N   . LEU B 1 186 ? 153.035 183.065 219.963 1.00 152.54 ? 186 LEU B N   1 
ATOM   4446  C  CA  . LEU B 1 186 ? 153.980 184.188 220.006 1.00 154.18 ? 186 LEU B CA  1 
ATOM   4447  C  C   . LEU B 1 186 ? 154.230 184.631 221.451 1.00 165.63 ? 186 LEU B C   1 
ATOM   4448  O  O   . LEU B 1 186 ? 155.357 184.996 221.797 1.00 168.43 ? 186 LEU B O   1 
ATOM   4449  C  CB  . LEU B 1 186 ? 153.453 185.377 219.183 1.00 150.26 ? 186 LEU B CB  1 
ATOM   4450  C  CG  . LEU B 1 186 ? 153.498 185.235 217.673 1.00 148.93 ? 186 LEU B CG  1 
ATOM   4451  C  CD1 . LEU B 1 186 ? 152.378 186.015 217.031 1.00 145.51 ? 186 LEU B CD1 1 
ATOM   4452  C  CD2 . LEU B 1 186 ? 154.835 185.672 217.123 1.00 150.64 ? 186 LEU B CD2 1 
ATOM   4453  N  N   . TYR B 1 187 ? 153.170 184.591 222.284 1.00 164.94 ? 187 TYR B N   1 
ATOM   4454  C  CA  . TYR B 1 187 ? 153.197 184.956 223.696 1.00 171.31 ? 187 TYR B CA  1 
ATOM   4455  C  C   . TYR B 1 187 ? 154.176 184.059 224.460 1.00 180.02 ? 187 TYR B C   1 
ATOM   4456  O  O   . TYR B 1 187 ? 154.999 184.575 225.209 1.00 184.55 ? 187 TYR B O   1 
ATOM   4457  C  CB  . TYR B 1 187 ? 151.777 184.865 224.290 1.00 173.66 ? 187 TYR B CB  1 
ATOM   4458  C  CG  . TYR B 1 187 ? 151.675 185.238 225.753 1.00 182.78 ? 187 TYR B CG  1 
ATOM   4459  C  CD1 . TYR B 1 187 ? 151.536 186.566 226.145 1.00 187.06 ? 187 TYR B CD1 1 
ATOM   4460  C  CD2 . TYR B 1 187 ? 151.670 184.260 226.744 1.00 188.27 ? 187 TYR B CD2 1 
ATOM   4461  C  CE1 . TYR B 1 187 ? 151.428 186.915 227.491 1.00 193.52 ? 187 TYR B CE1 1 
ATOM   4462  C  CE2 . TYR B 1 187 ? 151.569 184.596 228.093 1.00 193.40 ? 187 TYR B CE2 1 
ATOM   4463  C  CZ  . TYR B 1 187 ? 151.447 185.926 228.462 1.00 199.44 ? 187 TYR B CZ  1 
ATOM   4464  O  OH  . TYR B 1 187 ? 151.340 186.265 229.791 1.00 202.16 ? 187 TYR B OH  1 
ATOM   4465  N  N   . ILE B 1 188 ? 154.111 182.732 224.238 1.00 175.50 ? 188 ILE B N   1 
ATOM   4466  C  CA  . ILE B 1 188 ? 154.960 181.729 224.892 1.00 179.78 ? 188 ILE B CA  1 
ATOM   4467  C  C   . ILE B 1 188 ? 156.447 181.931 224.520 1.00 184.54 ? 188 ILE B C   1 
ATOM   4468  O  O   . ILE B 1 188 ? 157.302 181.831 225.403 1.00 189.37 ? 188 ILE B O   1 
ATOM   4469  C  CB  . ILE B 1 188 ? 154.445 180.299 224.557 1.00 180.81 ? 188 ILE B CB  1 
ATOM   4470  C  CG1 . ILE B 1 188 ? 153.142 180.018 225.335 1.00 182.88 ? 188 ILE B CG1 1 
ATOM   4471  C  CG2 . ILE B 1 188 ? 155.496 179.210 224.845 1.00 185.07 ? 188 ILE B CG2 1 
ATOM   4472  C  CD1 . ILE B 1 188 ? 152.210 179.047 224.694 1.00 185.64 ? 188 ILE B CD1 1 
ATOM   4473  N  N   . ILE B 1 189 ? 156.746 182.231 223.239 1.00 176.42 ? 189 ILE B N   1 
ATOM   4474  C  CA  . ILE B 1 189 ? 158.117 182.446 222.764 1.00 176.98 ? 189 ILE B CA  1 
ATOM   4475  C  C   . ILE B 1 189 ? 158.708 183.741 223.360 1.00 185.27 ? 189 ILE B C   1 
ATOM   4476  O  O   . ILE B 1 189 ? 159.837 183.719 223.860 1.00 189.34 ? 189 ILE B O   1 
ATOM   4477  C  CB  . ILE B 1 189 ? 158.181 182.450 221.214 1.00 173.51 ? 189 ILE B CB  1 
ATOM   4478  N  N   . LYS B 1 190 ? 157.932 184.848 223.335 1.00 180.78 ? 190 LYS B N   1 
ATOM   4479  C  CA  . LYS B 1 190 ? 158.346 186.161 223.840 1.00 184.14 ? 190 LYS B CA  1 
ATOM   4480  C  C   . LYS B 1 190 ? 158.465 186.195 225.374 1.00 193.23 ? 190 LYS B C   1 
ATOM   4481  O  O   . LYS B 1 190 ? 159.456 186.721 225.881 1.00 194.08 ? 190 LYS B O   1 
ATOM   4482  C  CB  . LYS B 1 190 ? 157.382 187.264 223.361 1.00 182.85 ? 190 LYS B CB  1 
ATOM   4483  C  CG  . LYS B 1 190 ? 157.608 187.706 221.919 1.00 187.48 ? 190 LYS B CG  1 
ATOM   4484  N  N   . ILE B 1 191 ? 157.470 185.645 226.104 1.00 192.13 ? 191 ILE B N   1 
ATOM   4485  C  CA  . ILE B 1 191 ? 157.448 185.649 227.572 1.00 194.84 ? 191 ILE B CA  1 
ATOM   4486  C  C   . ILE B 1 191 ? 158.397 184.571 228.134 1.00 199.77 ? 191 ILE B C   1 
ATOM   4487  O  O   . ILE B 1 191 ? 159.289 184.908 228.917 1.00 201.41 ? 191 ILE B O   1 
ATOM   4488  C  CB  . ILE B 1 191 ? 155.991 185.514 228.131 1.00 197.14 ? 191 ILE B CB  1 
ATOM   4489  C  CG1 . ILE B 1 191 ? 155.089 186.725 227.739 1.00 196.68 ? 191 ILE B CG1 1 
ATOM   4490  C  CG2 . ILE B 1 191 ? 155.942 185.219 229.644 1.00 200.22 ? 191 ILE B CG2 1 
ATOM   4491  C  CD1 . ILE B 1 191 ? 155.489 188.165 228.275 1.00 204.48 ? 191 ILE B CD1 1 
ATOM   4492  N  N   . GLY B 1 192 ? 158.187 183.312 227.744 1.00 197.36 ? 192 GLY B N   1 
ATOM   4493  C  CA  . GLY B 1 192 ? 158.981 182.175 228.204 1.00 198.76 ? 192 GLY B CA  1 
ATOM   4494  C  C   . GLY B 1 192 ? 160.441 182.204 227.794 1.00 202.07 ? 192 GLY B C   1 
ATOM   4495  O  O   . GLY B 1 192 ? 160.814 182.886 226.835 1.00 200.69 ? 192 GLY B O   1 
ATOM   4496  N  N   . GLY B 1 193 ? 161.259 181.460 228.529 1.00 201.65 ? 193 GLY B N   1 
ATOM   4497  C  CA  . GLY B 1 193 ? 162.692 181.373 228.284 1.00 202.32 ? 193 GLY B CA  1 
ATOM   4498  C  C   . GLY B 1 193 ? 163.490 180.928 229.497 1.00 208.23 ? 193 GLY B C   1 
ATOM   4499  O  O   . GLY B 1 193 ? 162.959 180.929 230.610 1.00 209.67 ? 193 GLY B O   1 
ATOM   4500  N  N   . ASP B 1 194 ? 164.778 180.540 229.324 1.00 206.95 ? 194 ASP B N   1 
ATOM   4501  C  CA  . ASP B 1 194 ? 165.516 180.488 228.053 1.00 205.23 ? 194 ASP B CA  1 
ATOM   4502  C  C   . ASP B 1 194 ? 165.193 179.202 227.262 1.00 206.07 ? 194 ASP B C   1 
ATOM   4503  O  O   . ASP B 1 194 ? 165.619 179.062 226.112 1.00 203.99 ? 194 ASP B O   1 
ATOM   4504  C  CB  . ASP B 1 194 ? 167.027 180.589 228.320 1.00 208.37 ? 194 ASP B CB  1 
ATOM   4505  N  N   . TYR B 1 195 ? 164.416 178.288 227.880 1.00 204.41 ? 195 TYR B N   1 
ATOM   4506  C  CA  . TYR B 1 195 ? 163.991 177.015 227.303 1.00 203.29 ? 195 TYR B CA  1 
ATOM   4507  C  C   . TYR B 1 195 ? 162.531 177.122 226.798 1.00 204.04 ? 195 TYR B C   1 
ATOM   4508  O  O   . TYR B 1 195 ? 161.708 176.233 227.044 1.00 203.86 ? 195 TYR B O   1 
ATOM   4509  C  CB  . TYR B 1 195 ? 164.161 175.898 228.346 1.00 206.34 ? 195 TYR B CB  1 
ATOM   4510  N  N   . PHE B 1 196 ? 162.237 178.213 226.054 1.00 200.02 ? 196 PHE B N   1 
ATOM   4511  C  CA  . PHE B 1 196 ? 160.922 178.538 225.487 1.00 197.87 ? 196 PHE B CA  1 
ATOM   4512  C  C   . PHE B 1 196 ? 160.446 177.521 224.439 1.00 198.06 ? 196 PHE B C   1 
ATOM   4513  O  O   . PHE B 1 196 ? 159.237 177.384 224.247 1.00 196.76 ? 196 PHE B O   1 
ATOM   4514  C  CB  . PHE B 1 196 ? 160.929 179.952 224.865 1.00 197.96 ? 196 PHE B CB  1 
ATOM   4515  C  CG  . PHE B 1 196 ? 161.835 180.130 223.665 1.00 197.95 ? 196 PHE B CG  1 
ATOM   4516  C  CD1 . PHE B 1 196 ? 163.153 180.539 223.823 1.00 200.70 ? 196 PHE B CD1 1 
ATOM   4517  C  CD2 . PHE B 1 196 ? 161.361 179.913 222.375 1.00 197.95 ? 196 PHE B CD2 1 
ATOM   4518  C  CE1 . PHE B 1 196 ? 163.991 180.698 222.714 1.00 201.64 ? 196 PHE B CE1 1 
ATOM   4519  C  CE2 . PHE B 1 196 ? 162.201 180.069 221.267 1.00 197.60 ? 196 PHE B CE2 1 
ATOM   4520  C  CZ  . PHE B 1 196 ? 163.508 180.469 221.444 1.00 198.17 ? 196 PHE B CZ  1 
ATOM   4521  N  N   . PHE B 1 197 ? 161.389 176.839 223.748 1.00 195.13 ? 197 PHE B N   1 
ATOM   4522  C  CA  . PHE B 1 197 ? 161.090 175.884 222.680 1.00 193.44 ? 197 PHE B CA  1 
ATOM   4523  C  C   . PHE B 1 197 ? 160.394 174.600 223.183 1.00 196.47 ? 197 PHE B C   1 
ATOM   4524  O  O   . PHE B 1 197 ? 159.866 173.849 222.360 1.00 193.94 ? 197 PHE B O   1 
ATOM   4525  C  CB  . PHE B 1 197 ? 162.355 175.539 221.872 1.00 194.48 ? 197 PHE B CB  1 
ATOM   4526  C  CG  . PHE B 1 197 ? 163.355 174.600 222.505 1.00 197.52 ? 197 PHE B CG  1 
ATOM   4527  C  CD1 . PHE B 1 197 ? 164.364 175.086 223.326 1.00 201.38 ? 197 PHE B CD1 1 
ATOM   4528  C  CD2 . PHE B 1 197 ? 163.329 173.238 222.226 1.00 199.17 ? 197 PHE B CD2 1 
ATOM   4529  C  CE1 . PHE B 1 197 ? 165.310 174.222 223.885 1.00 204.05 ? 197 PHE B CE1 1 
ATOM   4530  C  CE2 . PHE B 1 197 ? 164.274 172.374 222.786 1.00 203.06 ? 197 PHE B CE2 1 
ATOM   4531  C  CZ  . PHE B 1 197 ? 165.258 172.872 223.611 1.00 203.61 ? 197 PHE B CZ  1 
ATOM   4532  N  N   . ILE B 1 198 ? 160.389 174.350 224.506 1.00 196.02 ? 198 ILE B N   1 
ATOM   4533  C  CA  . ILE B 1 198 ? 159.728 173.180 225.089 1.00 196.84 ? 198 ILE B CA  1 
ATOM   4534  C  C   . ILE B 1 198 ? 158.255 173.518 225.319 1.00 198.94 ? 198 ILE B C   1 
ATOM   4535  O  O   . ILE B 1 198 ? 157.389 172.735 224.918 1.00 197.86 ? 198 ILE B O   1 
ATOM   4536  C  CB  . ILE B 1 198 ? 160.443 172.686 226.379 1.00 201.56 ? 198 ILE B CB  1 
ATOM   4537  C  CG1 . ILE B 1 198 ? 161.823 172.102 226.046 1.00 202.48 ? 198 ILE B CG1 1 
ATOM   4538  C  CG2 . ILE B 1 198 ? 159.611 171.648 227.141 1.00 203.35 ? 198 ILE B CG2 1 
ATOM   4539  C  CD1 . ILE B 1 198 ? 162.941 172.965 226.428 1.00 207.90 ? 198 ILE B CD1 1 
ATOM   4540  N  N   . TYR B 1 199 ? 157.974 174.689 225.939 1.00 197.27 ? 199 TYR B N   1 
ATOM   4541  C  CA  . TYR B 1 199 ? 156.600 175.128 226.207 1.00 196.91 ? 199 TYR B CA  1 
ATOM   4542  C  C   . TYR B 1 199 ? 155.844 175.413 224.898 1.00 197.73 ? 199 TYR B C   1 
ATOM   4543  O  O   . TYR B 1 199 ? 154.655 175.108 224.820 1.00 195.85 ? 199 TYR B O   1 
ATOM   4544  C  CB  . TYR B 1 199 ? 156.530 176.361 227.135 1.00 198.55 ? 199 TYR B CB  1 
ATOM   4545  C  CG  . TYR B 1 199 ? 157.686 176.550 228.094 1.00 201.74 ? 199 TYR B CG  1 
ATOM   4546  C  CD1 . TYR B 1 199 ? 157.888 175.674 229.158 1.00 205.34 ? 199 TYR B CD1 1 
ATOM   4547  C  CD2 . TYR B 1 199 ? 158.517 177.661 228.000 1.00 202.23 ? 199 TYR B CD2 1 
ATOM   4548  C  CE1 . TYR B 1 199 ? 158.934 175.863 230.062 1.00 208.21 ? 199 TYR B CE1 1 
ATOM   4549  C  CE2 . TYR B 1 199 ? 159.561 177.864 228.901 1.00 204.99 ? 199 TYR B CE2 1 
ATOM   4550  C  CZ  . TYR B 1 199 ? 159.768 176.962 229.931 1.00 212.20 ? 199 TYR B CZ  1 
ATOM   4551  O  OH  . TYR B 1 199 ? 160.796 177.167 230.821 1.00 214.56 ? 199 TYR B OH  1 
ATOM   4552  N  N   . ALA B 1 200 ? 156.534 175.976 223.875 1.00 191.67 ? 200 ALA B N   1 
ATOM   4553  C  CA  . ALA B 1 200 ? 155.960 176.282 222.556 1.00 184.68 ? 200 ALA B CA  1 
ATOM   4554  C  C   . ALA B 1 200 ? 155.671 175.001 221.763 1.00 185.32 ? 200 ALA B C   1 
ATOM   4555  O  O   . ALA B 1 200 ? 154.714 174.966 220.987 1.00 179.93 ? 200 ALA B O   1 
ATOM   4556  C  CB  . ALA B 1 200 ? 156.893 177.189 221.769 1.00 183.31 ? 200 ALA B CB  1 
ATOM   4557  N  N   . TRP B 1 201 ? 156.495 173.953 221.966 1.00 185.10 ? 201 TRP B N   1 
ATOM   4558  C  CA  . TRP B 1 201 ? 156.308 172.649 221.332 1.00 183.30 ? 201 TRP B CA  1 
ATOM   4559  C  C   . TRP B 1 201 ? 155.160 171.908 222.021 1.00 188.51 ? 201 TRP B C   1 
ATOM   4560  O  O   . TRP B 1 201 ? 154.354 171.266 221.342 1.00 185.26 ? 201 TRP B O   1 
ATOM   4561  C  CB  . TRP B 1 201 ? 157.607 171.825 221.365 1.00 185.42 ? 201 TRP B CB  1 
ATOM   4562  C  CG  . TRP B 1 201 ? 157.425 170.360 221.090 1.00 186.56 ? 201 TRP B CG  1 
ATOM   4563  C  CD1 . TRP B 1 201 ? 157.123 169.779 219.893 1.00 185.02 ? 201 TRP B CD1 1 
ATOM   4564  C  CD2 . TRP B 1 201 ? 157.513 169.297 222.042 1.00 191.77 ? 201 TRP B CD2 1 
ATOM   4565  N  NE1 . TRP B 1 201 ? 157.034 168.415 220.038 1.00 186.63 ? 201 TRP B NE1 1 
ATOM   4566  C  CE2 . TRP B 1 201 ? 157.268 168.091 221.349 1.00 194.05 ? 201 TRP B CE2 1 
ATOM   4567  C  CE3 . TRP B 1 201 ? 157.782 169.243 223.420 1.00 198.43 ? 201 TRP B CE3 1 
ATOM   4568  C  CZ2 . TRP B 1 201 ? 157.292 166.845 221.983 1.00 197.98 ? 201 TRP B CZ2 1 
ATOM   4569  C  CZ3 . TRP B 1 201 ? 157.804 168.008 224.048 1.00 201.39 ? 201 TRP B CZ3 1 
ATOM   4570  C  CH2 . TRP B 1 201 ? 157.554 166.828 223.335 1.00 201.65 ? 201 TRP B CH2 1 
ATOM   4571  N  N   . LEU B 1 202 ? 155.082 172.012 223.367 1.00 189.37 ? 202 LEU B N   1 
ATOM   4572  C  CA  . LEU B 1 202 ? 154.027 171.388 224.162 1.00 191.08 ? 202 LEU B CA  1 
ATOM   4573  C  C   . LEU B 1 202 ? 152.680 172.074 223.920 1.00 190.36 ? 202 LEU B C   1 
ATOM   4574  O  O   . LEU B 1 202 ? 151.649 171.408 224.006 1.00 189.72 ? 202 LEU B O   1 
ATOM   4575  C  CB  . LEU B 1 202 ? 154.375 171.401 225.653 1.00 197.35 ? 202 LEU B CB  1 
ATOM   4576  C  CG  . LEU B 1 202 ? 153.791 170.248 226.460 1.00 202.31 ? 202 LEU B CG  1 
ATOM   4577  C  CD1 . LEU B 1 202 ? 154.607 168.975 226.275 1.00 203.30 ? 202 LEU B CD1 1 
ATOM   4578  C  CD2 . LEU B 1 202 ? 153.708 170.600 227.924 1.00 206.17 ? 202 LEU B CD2 1 
ATOM   4579  N  N   . PHE B 1 203 ? 152.690 173.392 223.602 1.00 183.56 ? 203 PHE B N   1 
ATOM   4580  C  CA  . PHE B 1 203 ? 151.480 174.158 223.283 1.00 179.60 ? 203 PHE B CA  1 
ATOM   4581  C  C   . PHE B 1 203 ? 150.901 173.673 221.957 1.00 177.28 ? 203 PHE B C   1 
ATOM   4582  O  O   . PHE B 1 203 ? 149.696 173.431 221.880 1.00 175.77 ? 203 PHE B O   1 
ATOM   4583  C  CB  . PHE B 1 203 ? 151.757 175.671 223.237 1.00 180.32 ? 203 PHE B CB  1 
ATOM   4584  C  CG  . PHE B 1 203 ? 150.639 176.516 222.661 1.00 177.66 ? 203 PHE B CG  1 
ATOM   4585  C  CD1 . PHE B 1 203 ? 149.481 176.759 223.391 1.00 182.62 ? 203 PHE B CD1 1 
ATOM   4586  C  CD2 . PHE B 1 203 ? 150.756 177.085 221.397 1.00 174.48 ? 203 PHE B CD2 1 
ATOM   4587  C  CE1 . PHE B 1 203 ? 148.452 177.540 222.858 1.00 180.19 ? 203 PHE B CE1 1 
ATOM   4588  C  CE2 . PHE B 1 203 ? 149.726 177.867 220.865 1.00 173.83 ? 203 PHE B CE2 1 
ATOM   4589  C  CZ  . PHE B 1 203 ? 148.580 178.086 221.597 1.00 173.93 ? 203 PHE B CZ  1 
ATOM   4590  N  N   . THR B 1 204 ? 151.766 173.510 220.926 1.00 170.04 ? 204 THR B N   1 
ATOM   4591  C  CA  . THR B 1 204 ? 151.380 173.010 219.601 1.00 164.42 ? 204 THR B CA  1 
ATOM   4592  C  C   . THR B 1 204 ? 150.916 171.554 219.711 1.00 168.85 ? 204 THR B C   1 
ATOM   4593  O  O   . THR B 1 204 ? 150.017 171.156 218.977 1.00 165.51 ? 204 THR B O   1 
ATOM   4594  C  CB  . THR B 1 204 ? 152.515 173.168 218.576 1.00 168.69 ? 204 THR B CB  1 
ATOM   4595  O  OG1 . THR B 1 204 ? 153.701 172.542 219.060 1.00 171.78 ? 204 THR B OG1 1 
ATOM   4596  C  CG2 . THR B 1 204 ? 152.790 174.622 218.221 1.00 164.74 ? 204 THR B CG2 1 
ATOM   4597  N  N   . LEU B 1 205 ? 151.502 170.781 220.654 1.00 169.53 ? 205 LEU B N   1 
ATOM   4598  C  CA  . LEU B 1 205 ? 151.154 169.386 220.939 1.00 171.39 ? 205 LEU B CA  1 
ATOM   4599  C  C   . LEU B 1 205 ? 149.710 169.292 221.468 1.00 174.98 ? 205 LEU B C   1 
ATOM   4600  O  O   . LEU B 1 205 ? 148.974 168.391 221.061 1.00 173.99 ? 205 LEU B O   1 
ATOM   4601  C  CB  . LEU B 1 205 ? 152.146 168.799 221.958 1.00 177.35 ? 205 LEU B CB  1 
ATOM   4602  C  CG  . LEU B 1 205 ? 152.200 167.281 222.079 1.00 185.02 ? 205 LEU B CG  1 
ATOM   4603  C  CD1 . LEU B 1 205 ? 153.625 166.808 222.204 1.00 188.45 ? 205 LEU B CD1 1 
ATOM   4604  C  CD2 . LEU B 1 205 ? 151.391 166.795 223.268 1.00 192.33 ? 205 LEU B CD2 1 
ATOM   4605  N  N   . VAL B 1 206 ? 149.313 170.228 222.361 1.00 172.27 ? 206 VAL B N   1 
ATOM   4606  C  CA  . VAL B 1 206 ? 147.968 170.297 222.946 1.00 172.91 ? 206 VAL B CA  1 
ATOM   4607  C  C   . VAL B 1 206 ? 146.981 170.780 221.874 1.00 171.01 ? 206 VAL B C   1 
ATOM   4608  O  O   . VAL B 1 206 ? 145.963 170.125 221.654 1.00 169.89 ? 206 VAL B O   1 
ATOM   4609  C  CB  . VAL B 1 206 ? 147.926 171.181 224.223 1.00 180.84 ? 206 VAL B CB  1 
ATOM   4610  C  CG1 . VAL B 1 206 ? 146.492 171.427 224.690 1.00 181.54 ? 206 VAL B CG1 1 
ATOM   4611  C  CG2 . VAL B 1 206 ? 148.748 170.557 225.345 1.00 186.82 ? 206 VAL B CG2 1 
ATOM   4612  N  N   . VAL B 1 207 ? 147.308 171.899 221.191 1.00 164.18 ? 207 VAL B N   1 
ATOM   4613  C  CA  . VAL B 1 207 ? 146.506 172.516 220.127 1.00 159.49 ? 207 VAL B CA  1 
ATOM   4614  C  C   . VAL B 1 207 ? 146.234 171.490 218.999 1.00 161.98 ? 207 VAL B C   1 
ATOM   4615  O  O   . VAL B 1 207 ? 145.113 171.453 218.487 1.00 159.34 ? 207 VAL B O   1 
ATOM   4616  C  CB  . VAL B 1 207 ? 147.175 173.828 219.613 1.00 160.45 ? 207 VAL B CB  1 
ATOM   4617  C  CG1 . VAL B 1 207 ? 146.664 174.256 218.236 1.00 154.76 ? 207 VAL B CG1 1 
ATOM   4618  C  CG2 . VAL B 1 207 ? 146.986 174.957 220.618 1.00 162.87 ? 207 VAL B CG2 1 
ATOM   4619  N  N   . SER B 1 208 ? 147.227 170.633 218.663 1.00 160.30 ? 208 SER B N   1 
ATOM   4620  C  CA  . SER B 1 208 ? 147.087 169.597 217.635 1.00 158.76 ? 208 SER B CA  1 
ATOM   4621  C  C   . SER B 1 208 ? 146.022 168.571 218.025 1.00 167.45 ? 208 SER B C   1 
ATOM   4622  O  O   . SER B 1 208 ? 145.060 168.402 217.279 1.00 164.56 ? 208 SER B O   1 
ATOM   4623  C  CB  . SER B 1 208 ? 148.416 168.895 217.372 1.00 163.07 ? 208 SER B CB  1 
ATOM   4624  O  OG  . SER B 1 208 ? 149.372 169.787 216.824 1.00 170.05 ? 208 SER B OG  1 
ATOM   4625  N  N   . LEU B 1 209 ? 146.169 167.927 219.207 1.00 170.96 ? 209 LEU B N   1 
ATOM   4626  C  CA  . LEU B 1 209 ? 145.252 166.904 219.725 1.00 174.60 ? 209 LEU B CA  1 
ATOM   4627  C  C   . LEU B 1 209 ? 143.834 167.449 219.979 1.00 179.92 ? 209 LEU B C   1 
ATOM   4628  O  O   . LEU B 1 209 ? 142.868 166.699 219.812 1.00 180.34 ? 209 LEU B O   1 
ATOM   4629  C  CB  . LEU B 1 209 ? 145.812 166.282 221.011 1.00 180.45 ? 209 LEU B CB  1 
ATOM   4630  N  N   . VAL B 1 210 ? 143.709 168.740 220.369 1.00 176.74 ? 210 VAL B N   1 
ATOM   4631  C  CA  . VAL B 1 210 ? 142.416 169.387 220.630 1.00 177.04 ? 210 VAL B CA  1 
ATOM   4632  C  C   . VAL B 1 210 ? 141.680 169.598 219.292 1.00 177.73 ? 210 VAL B C   1 
ATOM   4633  O  O   . VAL B 1 210 ? 140.535 169.162 219.161 1.00 177.98 ? 210 VAL B O   1 
ATOM   4634  C  CB  . VAL B 1 210 ? 142.560 170.704 221.447 1.00 181.98 ? 210 VAL B CB  1 
ATOM   4635  C  CG1 . VAL B 1 210 ? 141.267 171.518 221.438 1.00 180.91 ? 210 VAL B CG1 1 
ATOM   4636  C  CG2 . VAL B 1 210 ? 142.989 170.414 222.883 1.00 187.78 ? 210 VAL B CG2 1 
ATOM   4637  N  N   . LEU B 1 211 ? 142.354 170.222 218.299 1.00 171.04 ? 211 LEU B N   1 
ATOM   4638  C  CA  . LEU B 1 211 ? 141.793 170.496 216.970 1.00 166.78 ? 211 LEU B CA  1 
ATOM   4639  C  C   . LEU B 1 211 ? 141.464 169.208 216.189 1.00 170.80 ? 211 LEU B C   1 
ATOM   4640  O  O   . LEU B 1 211 ? 140.565 169.237 215.350 1.00 168.21 ? 211 LEU B O   1 
ATOM   4641  C  CB  . LEU B 1 211 ? 142.737 171.379 216.147 1.00 163.02 ? 211 LEU B CB  1 
ATOM   4642  N  N   . VAL B 1 212 ? 142.171 168.092 216.468 1.00 170.15 ? 212 VAL B N   1 
ATOM   4643  C  CA  . VAL B 1 212 ? 141.943 166.798 215.817 1.00 170.52 ? 212 VAL B CA  1 
ATOM   4644  C  C   . VAL B 1 212 ? 140.565 166.245 216.253 1.00 178.72 ? 212 VAL B C   1 
ATOM   4645  O  O   . VAL B 1 212 ? 139.796 165.794 215.400 1.00 177.09 ? 212 VAL B O   1 
ATOM   4646  C  CB  . VAL B 1 212 ? 143.116 165.811 216.094 1.00 176.59 ? 212 VAL B CB  1 
ATOM   4647  C  CG1 . VAL B 1 212 ? 142.681 164.348 216.021 1.00 178.93 ? 212 VAL B CG1 1 
ATOM   4648  C  CG2 . VAL B 1 212 ? 144.273 166.066 215.134 1.00 173.06 ? 212 VAL B CG2 1 
ATOM   4649  N  N   . THR B 1 213 ? 140.250 166.333 217.564 1.00 180.32 ? 213 THR B N   1 
ATOM   4650  C  CA  . THR B 1 213 ? 138.992 165.849 218.145 1.00 183.86 ? 213 THR B CA  1 
ATOM   4651  C  C   . THR B 1 213 ? 137.816 166.794 217.812 1.00 187.00 ? 213 THR B C   1 
ATOM   4652  O  O   . THR B 1 213 ? 136.707 166.310 217.584 1.00 187.79 ? 213 THR B O   1 
ATOM   4653  C  CB  . THR B 1 213 ? 139.133 165.649 219.673 1.00 194.73 ? 213 THR B CB  1 
ATOM   4654  O  OG1 . THR B 1 213 ? 140.425 165.114 219.974 1.00 194.39 ? 213 THR B OG1 1 
ATOM   4655  C  CG2 . THR B 1 213 ? 138.062 164.721 220.249 1.00 196.83 ? 213 THR B CG2 1 
ATOM   4656  N  N   . ILE B 1 214 ? 138.054 168.119 217.781 1.00 181.77 ? 214 ILE B N   1 
ATOM   4657  C  CA  . ILE B 1 214 ? 137.020 169.126 217.518 1.00 180.49 ? 214 ILE B CA  1 
ATOM   4658  C  C   . ILE B 1 214 ? 136.571 169.123 216.039 1.00 182.45 ? 214 ILE B C   1 
ATOM   4659  O  O   . ILE B 1 214 ? 135.363 169.111 215.794 1.00 182.67 ? 214 ILE B O   1 
ATOM   4660  C  CB  . ILE B 1 214 ? 137.490 170.545 217.978 1.00 182.48 ? 214 ILE B CB  1 
ATOM   4661  C  CG1 . ILE B 1 214 ? 137.654 170.644 219.521 1.00 188.09 ? 214 ILE B CG1 1 
ATOM   4662  C  CG2 . ILE B 1 214 ? 136.610 171.683 217.431 1.00 180.23 ? 214 ILE B CG2 1 
ATOM   4663  C  CD1 . ILE B 1 214 ? 136.384 170.358 220.420 1.00 202.70 ? 214 ILE B CD1 1 
ATOM   4664  N  N   . TYR B 1 215 ? 137.531 169.140 215.076 1.00 176.93 ? 215 TYR B N   1 
ATOM   4665  C  CA  . TYR B 1 215 ? 137.331 169.231 213.616 1.00 173.40 ? 215 TYR B CA  1 
ATOM   4666  C  C   . TYR B 1 215 ? 136.099 168.474 213.076 1.00 179.46 ? 215 TYR B C   1 
ATOM   4667  O  O   . TYR B 1 215 ? 135.130 169.127 212.693 1.00 178.60 ? 215 TYR B O   1 
ATOM   4668  C  CB  . TYR B 1 215 ? 138.581 168.778 212.842 1.00 172.24 ? 215 TYR B CB  1 
ATOM   4669  N  N   . ALA B 1 216 ? 136.134 167.125 213.048 1.00 178.49 ? 216 ALA B N   1 
ATOM   4670  C  CA  . ALA B 1 216 ? 135.073 166.264 212.507 1.00 179.86 ? 216 ALA B CA  1 
ATOM   4671  C  C   . ALA B 1 216 ? 133.715 166.432 213.208 1.00 186.81 ? 216 ALA B C   1 
ATOM   4672  O  O   . ALA B 1 216 ? 132.677 166.192 212.586 1.00 186.65 ? 216 ALA B O   1 
ATOM   4673  C  CB  . ALA B 1 216 ? 135.503 164.808 212.582 1.00 183.05 ? 216 ALA B CB  1 
ATOM   4674  N  N   . ASP B 1 217 ? 133.724 166.838 214.486 1.00 186.18 ? 217 ASP B N   1 
ATOM   4675  C  CA  . ASP B 1 217 ? 132.515 167.000 215.287 1.00 189.94 ? 217 ASP B CA  1 
ATOM   4676  C  C   . ASP B 1 217 ? 131.906 168.405 215.225 1.00 192.37 ? 217 ASP B C   1 
ATOM   4677  O  O   . ASP B 1 217 ? 130.690 168.521 215.387 1.00 194.28 ? 217 ASP B O   1 
ATOM   4678  C  CB  . ASP B 1 217 ? 132.800 166.643 216.754 1.00 196.51 ? 217 ASP B CB  1 
ATOM   4679  C  CG  . ASP B 1 217 ? 132.423 165.222 217.127 1.00 212.92 ? 217 ASP B CG  1 
ATOM   4680  O  OD1 . ASP B 1 217 ? 131.209 164.924 217.183 1.00 216.21 ? 217 ASP B OD1 1 
ATOM   4681  O  OD2 . ASP B 1 217 ? 133.339 164.413 217.387 1.00 220.58 ? 217 ASP B OD2 1 
ATOM   4682  N  N   . TYR B 1 218 ? 132.722 169.465 215.020 1.00 185.65 ? 218 TYR B N   1 
ATOM   4683  C  CA  . TYR B 1 218 ? 132.213 170.842 215.034 1.00 184.38 ? 218 TYR B CA  1 
ATOM   4684  C  C   . TYR B 1 218 ? 132.590 171.675 213.796 1.00 183.10 ? 218 TYR B C   1 
ATOM   4685  O  O   . TYR B 1 218 ? 131.709 172.331 213.242 1.00 181.83 ? 218 TYR B O   1 
ATOM   4686  C  CB  . TYR B 1 218 ? 132.682 171.574 216.304 1.00 187.64 ? 218 TYR B CB  1 
ATOM   4687  C  CG  . TYR B 1 218 ? 132.290 170.877 217.591 1.00 195.03 ? 218 TYR B CG  1 
ATOM   4688  C  CD1 . TYR B 1 218 ? 131.031 171.066 218.155 1.00 200.75 ? 218 TYR B CD1 1 
ATOM   4689  C  CD2 . TYR B 1 218 ? 133.179 170.032 218.248 1.00 197.73 ? 218 TYR B CD2 1 
ATOM   4690  C  CE1 . TYR B 1 218 ? 130.661 170.418 219.333 1.00 206.94 ? 218 TYR B CE1 1 
ATOM   4691  C  CE2 . TYR B 1 218 ? 132.820 169.377 219.426 1.00 204.06 ? 218 TYR B CE2 1 
ATOM   4692  C  CZ  . TYR B 1 218 ? 131.560 169.576 219.967 1.00 215.11 ? 218 TYR B CZ  1 
ATOM   4693  O  OH  . TYR B 1 218 ? 131.204 168.938 221.130 1.00 221.73 ? 218 TYR B OH  1 
ATOM   4694  N  N   . ILE B 1 219 ? 133.877 171.673 213.377 1.00 176.54 ? 219 ILE B N   1 
ATOM   4695  C  CA  . ILE B 1 219 ? 134.361 172.463 212.235 1.00 171.72 ? 219 ILE B CA  1 
ATOM   4696  C  C   . ILE B 1 219 ? 133.886 171.882 210.888 1.00 174.39 ? 219 ILE B C   1 
ATOM   4697  O  O   . ILE B 1 219 ? 133.281 172.615 210.107 1.00 172.45 ? 219 ILE B O   1 
ATOM   4698  C  CB  . ILE B 1 219 ? 135.901 172.617 212.263 1.00 172.71 ? 219 ILE B CB  1 
ATOM   4699  N  N   . ALA B 1 220 ? 134.158 170.581 210.621 1.00 171.81 ? 220 ALA B N   1 
ATOM   4700  C  CA  . ALA B 1 220 ? 133.815 169.868 209.378 1.00 170.31 ? 220 ALA B CA  1 
ATOM   4701  C  C   . ALA B 1 220 ? 132.303 169.895 209.011 1.00 174.78 ? 220 ALA B C   1 
ATOM   4702  O  O   . ALA B 1 220 ? 132.022 170.137 207.834 1.00 172.16 ? 220 ALA B O   1 
ATOM   4703  C  CB  . ALA B 1 220 ? 134.302 168.428 209.439 1.00 172.75 ? 220 ALA B CB  1 
ATOM   4704  N  N   . PRO B 1 221 ? 131.318 169.699 209.933 1.00 174.70 ? 221 PRO B N   1 
ATOM   4705  C  CA  . PRO B 1 221 ? 129.907 169.722 209.505 1.00 176.48 ? 221 PRO B CA  1 
ATOM   4706  C  C   . PRO B 1 221 ? 129.391 171.090 209.031 1.00 179.73 ? 221 PRO B C   1 
ATOM   4707  O  O   . PRO B 1 221 ? 128.301 171.142 208.459 1.00 180.44 ? 221 PRO B O   1 
ATOM   4708  C  CB  . PRO B 1 221 ? 129.150 169.268 210.757 1.00 182.96 ? 221 PRO B CB  1 
ATOM   4709  C  CG  . PRO B 1 221 ? 130.167 168.585 211.599 1.00 188.10 ? 221 PRO B CG  1 
ATOM   4710  C  CD  . PRO B 1 221 ? 131.411 169.362 211.366 1.00 179.52 ? 221 PRO B CD  1 
ATOM   4711  N  N   . LEU B 1 222 ? 130.160 172.181 209.243 1.00 174.97 ? 222 LEU B N   1 
ATOM   4712  C  CA  . LEU B 1 222 ? 129.790 173.543 208.820 1.00 173.67 ? 222 LEU B CA  1 
ATOM   4713  C  C   . LEU B 1 222 ? 129.889 173.723 207.304 1.00 175.82 ? 222 LEU B C   1 
ATOM   4714  O  O   . LEU B 1 222 ? 129.195 174.575 206.744 1.00 174.94 ? 222 LEU B O   1 
ATOM   4715  C  CB  . LEU B 1 222 ? 130.679 174.606 209.500 1.00 172.25 ? 222 LEU B CB  1 
ATOM   4716  C  CG  . LEU B 1 222 ? 130.639 174.706 211.024 1.00 180.23 ? 222 LEU B CG  1 
ATOM   4717  C  CD1 . LEU B 1 222 ? 131.888 175.378 211.551 1.00 178.64 ? 222 LEU B CD1 1 
ATOM   4718  C  CD2 . LEU B 1 222 ? 129.411 175.460 211.499 1.00 185.74 ? 222 LEU B CD2 1 
ATOM   4719  N  N   . PHE B 1 223 ? 130.774 172.949 206.653 1.00 171.69 ? 223 PHE B N   1 
ATOM   4720  C  CA  . PHE B 1 223 ? 131.021 173.030 205.216 1.00 169.42 ? 223 PHE B CA  1 
ATOM   4721  C  C   . PHE B 1 223 ? 130.301 171.921 204.439 1.00 176.82 ? 223 PHE B C   1 
ATOM   4722  O  O   . PHE B 1 223 ? 129.832 172.173 203.327 1.00 175.66 ? 223 PHE B O   1 
ATOM   4723  C  CB  . PHE B 1 223 ? 132.535 172.989 204.928 1.00 168.22 ? 223 PHE B CB  1 
ATOM   4724  C  CG  . PHE B 1 223 ? 133.371 173.880 205.824 1.00 168.84 ? 223 PHE B CG  1 
ATOM   4725  C  CD1 . PHE B 1 223 ? 133.257 175.265 205.760 1.00 170.52 ? 223 PHE B CD1 1 
ATOM   4726  C  CD2 . PHE B 1 223 ? 134.273 173.334 206.728 1.00 171.97 ? 223 PHE B CD2 1 
ATOM   4727  C  CE1 . PHE B 1 223 ? 134.015 176.085 206.600 1.00 170.91 ? 223 PHE B CE1 1 
ATOM   4728  C  CE2 . PHE B 1 223 ? 135.043 174.159 207.560 1.00 174.31 ? 223 PHE B CE2 1 
ATOM   4729  C  CZ  . PHE B 1 223 ? 134.911 175.528 207.486 1.00 170.97 ? 223 PHE B CZ  1 
ATOM   4730  N  N   . ASP B 1 224 ? 130.209 170.706 205.015 1.00 177.33 ? 224 ASP B N   1 
ATOM   4731  C  CA  . ASP B 1 224 ? 129.560 169.557 204.375 1.00 179.90 ? 224 ASP B CA  1 
ATOM   4732  C  C   . ASP B 1 224 ? 128.475 168.945 205.265 1.00 189.62 ? 224 ASP B C   1 
ATOM   4733  O  O   . ASP B 1 224 ? 128.640 168.891 206.485 1.00 190.88 ? 224 ASP B O   1 
ATOM   4734  C  CB  . ASP B 1 224 ? 130.602 168.493 204.006 1.00 180.89 ? 224 ASP B CB  1 
ATOM   4735  C  CG  . ASP B 1 224 ? 131.521 168.925 202.885 1.00 187.75 ? 224 ASP B CG  1 
ATOM   4736  O  OD1 . ASP B 1 224 ? 131.089 168.879 201.714 1.00 188.36 ? 224 ASP B OD1 1 
ATOM   4737  O  OD2 . ASP B 1 224 ? 132.670 169.315 203.178 1.00 191.42 ? 224 ASP B OD2 1 
ATOM   4738  N  N   . LYS B 1 225 ? 127.370 168.474 204.648 1.00 189.39 ? 225 LYS B N   1 
ATOM   4739  C  CA  . LYS B 1 225 ? 126.240 167.865 205.356 1.00 194.14 ? 225 LYS B CA  1 
ATOM   4740  C  C   . LYS B 1 225 ? 126.599 166.458 205.845 1.00 201.13 ? 225 LYS B C   1 
ATOM   4741  O  O   . LYS B 1 225 ? 126.797 165.543 205.041 1.00 200.65 ? 225 LYS B O   1 
ATOM   4742  C  CB  . LYS B 1 225 ? 124.984 167.831 204.469 1.00 198.80 ? 225 LYS B CB  1 
ATOM   4743  N  N   . PHE B 1 226 ? 126.707 166.308 207.174 1.00 200.75 ? 226 PHE B N   1 
ATOM   4744  C  CA  . PHE B 1 226 ? 127.028 165.052 207.851 1.00 203.86 ? 226 PHE B CA  1 
ATOM   4745  C  C   . PHE B 1 226 ? 125.753 164.414 208.394 1.00 215.04 ? 226 PHE B C   1 
ATOM   4746  O  O   . PHE B 1 226 ? 125.024 165.050 209.162 1.00 216.58 ? 226 PHE B O   1 
ATOM   4747  C  CB  . PHE B 1 226 ? 128.027 165.300 209.000 1.00 204.76 ? 226 PHE B CB  1 
ATOM   4748  C  CG  . PHE B 1 226 ? 129.499 165.271 208.661 1.00 202.46 ? 226 PHE B CG  1 
ATOM   4749  C  CD1 . PHE B 1 226 ? 130.076 166.284 207.904 1.00 201.07 ? 226 PHE B CD1 1 
ATOM   4750  C  CD2 . PHE B 1 226 ? 130.328 164.285 209.181 1.00 205.71 ? 226 PHE B CD2 1 
ATOM   4751  C  CE1 . PHE B 1 226 ? 131.445 166.276 207.621 1.00 198.90 ? 226 PHE B CE1 1 
ATOM   4752  C  CE2 . PHE B 1 226 ? 131.697 164.280 208.903 1.00 205.48 ? 226 PHE B CE2 1 
ATOM   4753  C  CZ  . PHE B 1 226 ? 132.246 165.275 208.125 1.00 199.26 ? 226 PHE B CZ  1 
ATOM   4754  N  N   . THR B 1 227 ? 125.473 163.168 207.979 1.00 215.71 ? 227 THR B N   1 
ATOM   4755  C  CA  . THR B 1 227 ? 124.300 162.406 208.422 1.00 221.66 ? 227 THR B CA  1 
ATOM   4756  C  C   . THR B 1 227 ? 124.703 160.965 208.754 1.00 229.57 ? 227 THR B C   1 
ATOM   4757  O  O   . THR B 1 227 ? 125.495 160.382 208.010 1.00 227.16 ? 227 THR B O   1 
ATOM   4758  C  CB  . THR B 1 227 ? 123.172 162.431 207.372 1.00 231.84 ? 227 THR B CB  1 
ATOM   4759  O  OG1 . THR B 1 227 ? 123.706 162.139 206.078 1.00 229.24 ? 227 THR B OG1 1 
ATOM   4760  C  CG2 . THR B 1 227 ? 122.401 163.749 207.357 1.00 229.81 ? 227 THR B CG2 1 
ATOM   4761  N  N   . PRO B 1 228 ? 124.179 160.366 209.853 1.00 231.99 ? 228 PRO B N   1 
ATOM   4762  C  CA  . PRO B 1 228 ? 124.542 158.972 210.169 1.00 235.18 ? 228 PRO B CA  1 
ATOM   4763  C  C   . PRO B 1 228 ? 123.969 157.992 209.145 1.00 242.10 ? 228 PRO B C   1 
ATOM   4764  O  O   . PRO B 1 228 ? 122.907 158.253 208.572 1.00 243.02 ? 228 PRO B O   1 
ATOM   4765  C  CB  . PRO B 1 228 ? 123.941 158.748 211.564 1.00 241.88 ? 228 PRO B CB  1 
ATOM   4766  C  CG  . PRO B 1 228 ? 123.578 160.115 212.074 1.00 245.01 ? 228 PRO B CG  1 
ATOM   4767  C  CD  . PRO B 1 228 ? 123.237 160.903 210.853 1.00 237.03 ? 228 PRO B CD  1 
ATOM   4768  N  N   . LEU B 1 229 ? 124.693 156.883 208.900 1.00 239.94 ? 229 LEU B N   1 
ATOM   4769  C  CA  . LEU B 1 229 ? 124.338 155.833 207.942 1.00 242.54 ? 229 LEU B CA  1 
ATOM   4770  C  C   . LEU B 1 229 ? 122.967 155.219 208.265 1.00 250.46 ? 229 LEU B C   1 
ATOM   4771  O  O   . LEU B 1 229 ? 122.740 154.821 209.413 1.00 251.94 ? 229 LEU B O   1 
ATOM   4772  C  CB  . LEU B 1 229 ? 125.417 154.741 207.918 1.00 242.84 ? 229 LEU B CB  1 
ATOM   4773  N  N   . PRO B 1 230 ? 122.031 155.169 207.282 1.00 248.91 ? 230 PRO B N   1 
ATOM   4774  C  CA  . PRO B 1 230 ? 120.699 154.600 207.561 1.00 251.26 ? 230 PRO B CA  1 
ATOM   4775  C  C   . PRO B 1 230 ? 120.750 153.090 207.778 1.00 256.24 ? 230 PRO B C   1 
ATOM   4776  O  O   . PRO B 1 230 ? 121.600 152.413 207.195 1.00 255.98 ? 230 PRO B O   1 
ATOM   4777  C  CB  . PRO B 1 230 ? 119.884 154.953 206.308 1.00 251.84 ? 230 PRO B CB  1 
ATOM   4778  C  CG  . PRO B 1 230 ? 120.718 155.943 205.542 1.00 251.92 ? 230 PRO B CG  1 
ATOM   4779  C  CD  . PRO B 1 230 ? 122.131 155.615 205.880 1.00 248.23 ? 230 PRO B CD  1 
ATOM   4780  N  N   . GLU B 1 231 ? 119.844 152.573 208.627 1.00 255.32 ? 231 GLU B N   1 
ATOM   4781  C  CA  . GLU B 1 231 ? 119.749 151.153 208.974 1.00 255.38 ? 231 GLU B CA  1 
ATOM   4782  C  C   . GLU B 1 231 ? 119.379 150.312 207.746 1.00 256.61 ? 231 GLU B C   1 
ATOM   4783  O  O   . GLU B 1 231 ? 118.423 150.637 207.037 1.00 256.28 ? 231 GLU B O   1 
ATOM   4784  C  CB  . GLU B 1 231 ? 118.730 150.931 210.109 1.00 255.99 ? 231 GLU B CB  1 
ATOM   4785  C  CG  . GLU B 1 231 ? 119.073 151.622 211.424 1.00 259.58 ? 231 GLU B CG  1 
ATOM   4786  C  CD  . GLU B 1 231 ? 120.289 151.103 212.167 1.00 266.04 ? 231 GLU B CD  1 
ATOM   4787  O  OE1 . GLU B 1 231 ? 120.378 149.873 212.387 1.00 263.69 ? 231 GLU B OE1 1 
ATOM   4788  O  OE2 . GLU B 1 231 ? 121.137 151.933 212.566 1.00 263.49 ? 231 GLU B OE2 1 
ATOM   4789  N  N   . GLY B 1 232 ? 120.168 149.269 207.499 1.00 255.62 ? 232 GLY B N   1 
ATOM   4790  C  CA  . GLY B 1 232 ? 119.986 148.353 206.376 1.00 255.41 ? 232 GLY B CA  1 
ATOM   4791  C  C   . GLY B 1 232 ? 120.942 147.177 206.393 1.00 256.90 ? 232 GLY B C   1 
ATOM   4792  O  O   . GLY B 1 232 ? 121.483 146.833 207.448 1.00 257.04 ? 232 GLY B O   1 
ATOM   4793  N  N   . LYS B 1 233 ? 121.150 146.548 205.216 1.00 255.51 ? 233 LYS B N   1 
ATOM   4794  C  CA  . LYS B 1 233 ? 122.046 145.397 205.036 1.00 255.37 ? 233 LYS B CA  1 
ATOM   4795  C  C   . LYS B 1 233 ? 123.509 145.802 205.223 1.00 256.45 ? 233 LYS B C   1 
ATOM   4796  O  O   . LYS B 1 233 ? 124.297 145.021 205.763 1.00 256.36 ? 233 LYS B O   1 
ATOM   4797  C  CB  . LYS B 1 233 ? 121.844 144.763 203.651 1.00 255.94 ? 233 LYS B CB  1 
ATOM   4798  N  N   . LEU B 1 234 ? 123.862 147.027 204.783 1.00 255.07 ? 234 LEU B N   1 
ATOM   4799  C  CA  . LEU B 1 234 ? 125.207 147.585 204.902 1.00 254.96 ? 234 LEU B CA  1 
ATOM   4800  C  C   . LEU B 1 234 ? 125.496 148.003 206.345 1.00 256.29 ? 234 LEU B C   1 
ATOM   4801  O  O   . LEU B 1 234 ? 126.586 147.724 206.843 1.00 256.28 ? 234 LEU B O   1 
ATOM   4802  C  CB  . LEU B 1 234 ? 125.381 148.778 203.956 1.00 254.77 ? 234 LEU B CB  1 
ATOM   4803  N  N   . LYS B 1 235 ? 124.519 148.657 207.013 1.00 255.03 ? 235 LYS B N   1 
ATOM   4804  C  CA  . LYS B 1 235 ? 124.627 149.135 208.395 1.00 255.18 ? 235 LYS B CA  1 
ATOM   4805  C  C   . LYS B 1 235 ? 124.762 147.984 209.396 1.00 256.54 ? 235 LYS B C   1 
ATOM   4806  O  O   . LYS B 1 235 ? 125.501 148.120 210.372 1.00 256.58 ? 235 LYS B O   1 
ATOM   4807  C  CB  . LYS B 1 235 ? 123.417 150.005 208.765 1.00 256.05 ? 235 LYS B CB  1 
ATOM   4808  N  N   . GLU B 1 236 ? 124.056 146.859 209.155 1.00 255.28 ? 236 GLU B N   1 
ATOM   4809  C  CA  . GLU B 1 236 ? 124.083 145.676 210.019 1.00 255.33 ? 236 GLU B CA  1 
ATOM   4810  C  C   . GLU B 1 236 ? 125.402 144.909 209.877 1.00 256.55 ? 236 GLU B C   1 
ATOM   4811  O  O   . GLU B 1 236 ? 125.981 144.520 210.892 1.00 256.58 ? 236 GLU B O   1 
ATOM   4812  C  CB  . GLU B 1 236 ? 122.894 144.752 209.720 1.00 255.67 ? 236 GLU B CB  1 
ATOM   4813  N  N   . GLU B 1 237 ? 125.879 144.708 208.625 1.00 255.15 ? 237 GLU B N   1 
ATOM   4814  C  CA  . GLU B 1 237 ? 127.123 143.995 208.308 1.00 255.02 ? 237 GLU B CA  1 
ATOM   4815  C  C   . GLU B 1 237 ? 128.367 144.746 208.813 1.00 256.45 ? 237 GLU B C   1 
ATOM   4816  O  O   . GLU B 1 237 ? 129.367 144.103 209.141 1.00 256.39 ? 237 GLU B O   1 
ATOM   4817  C  CB  . GLU B 1 237 ? 127.236 143.750 206.798 1.00 255.15 ? 237 GLU B CB  1 
ATOM   4818  N  N   . ILE B 1 238 ? 128.300 146.097 208.876 1.00 255.30 ? 238 ILE B N   1 
ATOM   4819  C  CA  . ILE B 1 238 ? 129.383 146.958 209.361 1.00 255.34 ? 238 ILE B CA  1 
ATOM   4820  C  C   . ILE B 1 238 ? 129.553 146.787 210.874 1.00 256.85 ? 238 ILE B C   1 
ATOM   4821  O  O   . ILE B 1 238 ? 130.688 146.734 211.344 1.00 256.81 ? 238 ILE B O   1 
ATOM   4822  C  CB  . ILE B 1 238 ? 129.142 148.436 208.986 1.00 256.32 ? 238 ILE B CB  1 
ATOM   4823  N  N   . GLU B 1 239 ? 128.430 146.677 211.624 1.00 255.76 ? 239 GLU B N   1 
ATOM   4824  C  CA  . GLU B 1 239 ? 128.410 146.472 213.077 1.00 255.95 ? 239 GLU B CA  1 
ATOM   4825  C  C   . GLU B 1 239 ? 128.964 145.091 213.438 1.00 257.30 ? 239 GLU B C   1 
ATOM   4826  O  O   . GLU B 1 239 ? 129.624 144.951 214.469 1.00 257.30 ? 239 GLU B O   1 
ATOM   4827  C  CB  . GLU B 1 239 ? 126.989 146.636 213.632 1.00 256.45 ? 239 GLU B CB  1 
ATOM   4828  N  N   . VAL B 1 240 ? 128.702 144.080 212.576 1.00 256.07 ? 240 VAL B N   1 
ATOM   4829  C  CA  . VAL B 1 240 ? 129.183 142.698 212.708 1.00 256.06 ? 240 VAL B CA  1 
ATOM   4830  C  C   . VAL B 1 240 ? 130.718 142.705 212.546 1.00 257.42 ? 240 VAL B C   1 
ATOM   4831  O  O   . VAL B 1 240 ? 131.421 142.078 213.342 1.00 257.43 ? 240 VAL B O   1 
ATOM   4832  C  CB  . VAL B 1 240 ? 128.470 141.753 211.692 1.00 257.16 ? 240 VAL B CB  1 
ATOM   4833  C  CG1 . VAL B 1 240 ? 129.161 140.394 211.589 1.00 257.08 ? 240 VAL B CG1 1 
ATOM   4834  C  CG2 . VAL B 1 240 ? 126.998 141.572 212.050 1.00 257.12 ? 240 VAL B CG2 1 
ATOM   4835  N  N   . MET B 1 241 ? 131.221 143.456 211.543 1.00 256.15 ? 241 MET B N   1 
ATOM   4836  C  CA  . MET B 1 241 ? 132.646 143.627 211.248 1.00 256.09 ? 241 MET B CA  1 
ATOM   4837  C  C   . MET B 1 241 ? 133.337 144.443 212.359 1.00 257.74 ? 241 MET B C   1 
ATOM   4838  O  O   . MET B 1 241 ? 134.467 144.118 212.728 1.00 257.64 ? 241 MET B O   1 
ATOM   4839  C  CB  . MET B 1 241 ? 132.825 144.307 209.877 1.00 256.59 ? 241 MET B CB  1 
ATOM   4840  C  CG  . MET B 1 241 ? 134.243 144.250 209.339 1.00 257.72 ? 241 MET B CG  1 
ATOM   4841  S  SD  . MET B 1 241 ? 134.406 144.971 207.687 1.00 258.74 ? 241 MET B SD  1 
ATOM   4842  C  CE  . MET B 1 241 ? 133.991 143.560 206.679 1.00 257.38 ? 241 MET B CE  1 
ATOM   4843  N  N   . ALA B 1 242 ? 132.651 145.487 212.889 1.00 256.87 ? 242 ALA B N   1 
ATOM   4844  C  CA  . ALA B 1 242 ? 133.148 146.363 213.961 1.00 257.14 ? 242 ALA B CA  1 
ATOM   4845  C  C   . ALA B 1 242 ? 133.336 145.595 215.273 1.00 258.88 ? 242 ALA B C   1 
ATOM   4846  O  O   . ALA B 1 242 ? 134.325 145.823 215.971 1.00 258.92 ? 242 ALA B O   1 
ATOM   4847  C  CB  . ALA B 1 242 ? 132.198 147.534 214.177 1.00 257.43 ? 242 ALA B CB  1 
ATOM   4848  N  N   . LYS B 1 243 ? 132.393 144.684 215.596 1.00 257.86 ? 243 LYS B N   1 
ATOM   4849  C  CA  . LYS B 1 243 ? 132.436 143.842 216.793 1.00 258.04 ? 243 LYS B CA  1 
ATOM   4850  C  C   . LYS B 1 243 ? 133.525 142.772 216.645 1.00 259.41 ? 243 LYS B C   1 
ATOM   4851  O  O   . LYS B 1 243 ? 134.155 142.405 217.638 1.00 259.49 ? 243 LYS B O   1 
ATOM   4852  C  CB  . LYS B 1 243 ? 131.064 143.189 217.040 1.00 258.88 ? 243 LYS B CB  1 
ATOM   4853  C  CG  . LYS B 1 243 ? 130.861 142.685 218.466 1.00 264.52 ? 243 LYS B CG  1 
ATOM   4854  C  CD  . LYS B 1 243 ? 129.568 141.897 218.607 1.00 268.06 ? 243 LYS B CD  1 
ATOM   4855  N  N   . SER B 1 244 ? 133.744 142.287 215.403 1.00 258.02 ? 244 SER B N   1 
ATOM   4856  C  CA  . SER B 1 244 ? 134.733 141.264 215.055 1.00 257.89 ? 244 SER B CA  1 
ATOM   4857  C  C   . SER B 1 244 ? 136.172 141.764 215.257 1.00 259.37 ? 244 SER B C   1 
ATOM   4858  O  O   . SER B 1 244 ? 137.002 141.019 215.780 1.00 259.33 ? 244 SER B O   1 
ATOM   4859  C  CB  . SER B 1 244 ? 134.537 140.808 213.612 1.00 258.68 ? 244 SER B CB  1 
ATOM   4860  O  OG  . SER B 1 244 ? 135.365 139.701 213.299 1.00 261.31 ? 244 SER B OG  1 
ATOM   4861  N  N   . ILE B 1 245 ? 136.459 143.019 214.851 1.00 258.25 ? 245 ILE B N   1 
ATOM   4862  C  CA  . ILE B 1 245 ? 137.782 143.639 214.971 1.00 258.29 ? 245 ILE B CA  1 
ATOM   4863  C  C   . ILE B 1 245 ? 137.945 144.374 216.318 1.00 259.86 ? 245 ILE B C   1 
ATOM   4864  O  O   . ILE B 1 245 ? 139.017 144.929 216.581 1.00 259.83 ? 245 ILE B O   1 
ATOM   4865  C  CB  . ILE B 1 245 ? 138.017 144.600 213.783 1.00 259.16 ? 245 ILE B CB  1 
ATOM   4866  N  N   . ASP B 1 246 ? 136.885 144.359 217.167 1.00 258.83 ? 246 ASP B N   1 
ATOM   4867  C  CA  . ASP B 1 246 ? 136.792 145.005 218.487 1.00 259.01 ? 246 ASP B CA  1 
ATOM   4868  C  C   . ASP B 1 246 ? 136.964 146.538 218.372 1.00 260.48 ? 246 ASP B C   1 
ATOM   4869  O  O   . ASP B 1 246 ? 137.487 147.182 219.289 1.00 260.57 ? 246 ASP B O   1 
ATOM   4870  C  CB  . ASP B 1 246 ? 137.788 144.398 219.497 1.00 259.74 ? 246 ASP B CB  1 
ATOM   4871  C  CG  . ASP B 1 246 ? 137.474 142.966 219.865 1.00 262.77 ? 246 ASP B CG  1 
ATOM   4872  O  OD1 . ASP B 1 246 ? 136.609 142.756 220.742 1.00 262.94 ? 246 ASP B OD1 1 
ATOM   4873  O  OD2 . ASP B 1 246 ? 138.097 142.054 219.281 1.00 264.66 ? 246 ASP B OD2 1 
ATOM   4874  N  N   . PHE B 1 247 ? 136.497 147.116 217.244 1.00 259.16 ? 247 PHE B N   1 
ATOM   4875  C  CA  . PHE B 1 247 ? 136.552 148.553 216.978 1.00 259.11 ? 247 PHE B CA  1 
ATOM   4876  C  C   . PHE B 1 247 ? 135.439 149.258 217.766 1.00 260.55 ? 247 PHE B C   1 
ATOM   4877  O  O   . PHE B 1 247 ? 134.269 148.896 217.597 1.00 260.26 ? 247 PHE B O   1 
ATOM   4878  C  CB  . PHE B 1 247 ? 136.434 148.836 215.471 1.00 259.09 ? 247 PHE B CB  1 
ATOM   4879  N  N   . PRO B 1 248 ? 135.769 150.233 218.656 1.00 259.46 ? 248 PRO B N   1 
ATOM   4880  C  CA  . PRO B 1 248 ? 134.709 150.897 219.439 1.00 259.68 ? 248 PRO B CA  1 
ATOM   4881  C  C   . PRO B 1 248 ? 133.906 151.890 218.586 1.00 259.67 ? 248 PRO B C   1 
ATOM   4882  O  O   . PRO B 1 248 ? 134.094 153.108 218.666 1.00 257.05 ? 248 PRO B O   1 
ATOM   4883  C  CB  . PRO B 1 248 ? 135.473 151.568 220.588 1.00 260.38 ? 248 PRO B CB  1 
ATOM   4884  C  CG  . PRO B 1 248 ? 136.843 151.780 220.071 1.00 261.37 ? 248 PRO B CG  1 
ATOM   4885  C  CD  . PRO B 1 248 ? 137.107 150.766 218.990 1.00 258.82 ? 248 PRO B CD  1 
ATOM   4886  N  N   . LEU B 1 249 ? 132.993 151.340 217.767 1.00 257.94 ? 249 LEU B N   1 
ATOM   4887  C  CA  . LEU B 1 249 ? 132.138 152.096 216.863 1.00 256.28 ? 249 LEU B CA  1 
ATOM   4888  C  C   . LEU B 1 249 ? 130.986 152.765 217.617 1.00 259.02 ? 249 LEU B C   1 
ATOM   4889  O  O   . LEU B 1 249 ? 130.265 152.105 218.371 1.00 259.69 ? 249 LEU B O   1 
ATOM   4890  C  CB  . LEU B 1 249 ? 131.596 151.173 215.750 1.00 257.56 ? 249 LEU B CB  1 
ATOM   4891  C  CG  . LEU B 1 249 ? 130.642 151.798 214.721 1.00 259.71 ? 249 LEU B CG  1 
ATOM   4892  C  CD1 . LEU B 1 249 ? 131.388 152.688 213.735 1.00 257.07 ? 249 LEU B CD1 1 
ATOM   4893  C  CD2 . LEU B 1 249 ? 129.874 150.726 213.982 1.00 260.28 ? 249 LEU B CD2 1 
ATOM   4894  N  N   . THR B 1 250 ? 130.823 154.081 217.396 1.00 254.24 ? 250 THR B N   1 
ATOM   4895  C  CA  . THR B 1 250 ? 129.749 154.897 217.967 1.00 254.00 ? 250 THR B CA  1 
ATOM   4896  C  C   . THR B 1 250 ? 128.650 155.000 216.903 1.00 255.50 ? 250 THR B C   1 
ATOM   4897  O  O   . THR B 1 250 ? 127.488 154.704 217.189 1.00 256.99 ? 250 THR B O   1 
ATOM   4898  C  CB  . THR B 1 250 ? 130.287 156.273 218.434 1.00 258.02 ? 250 THR B CB  1 
ATOM   4899  O  OG1 . THR B 1 250 ? 131.470 156.094 219.215 1.00 258.61 ? 250 THR B OG1 1 
ATOM   4900  C  CG2 . THR B 1 250 ? 129.260 157.071 219.233 1.00 257.29 ? 250 THR B CG2 1 
ATOM   4901  N  N   . LYS B 1 251 ? 129.039 155.389 215.667 1.00 250.32 ? 251 LYS B N   1 
ATOM   4902  C  CA  . LYS B 1 251 ? 128.162 155.534 214.504 1.00 249.33 ? 251 LYS B CA  1 
ATOM   4903  C  C   . LYS B 1 251 ? 128.973 155.566 213.202 1.00 247.17 ? 251 LYS B C   1 
ATOM   4904  O  O   . LYS B 1 251 ? 130.169 155.864 213.222 1.00 243.34 ? 251 LYS B O   1 
ATOM   4905  C  CB  . LYS B 1 251 ? 127.310 156.814 214.620 1.00 249.78 ? 251 LYS B CB  1 
ATOM   4906  N  N   . VAL B 1 252 ? 128.313 155.248 212.074 1.00 242.11 ? 252 VAL B N   1 
ATOM   4907  C  CA  . VAL B 1 252 ? 128.882 155.299 210.725 1.00 237.05 ? 252 VAL B CA  1 
ATOM   4908  C  C   . VAL B 1 252 ? 128.265 156.512 210.030 1.00 235.38 ? 252 VAL B C   1 
ATOM   4909  O  O   . VAL B 1 252 ? 127.051 156.699 210.122 1.00 237.26 ? 252 VAL B O   1 
ATOM   4910  C  CB  . VAL B 1 252 ? 128.649 153.985 209.942 1.00 243.86 ? 252 VAL B CB  1 
ATOM   4911  N  N   . TYR B 1 253 ? 129.088 157.363 209.389 1.00 225.02 ? 253 TYR B N   1 
ATOM   4912  C  CA  . TYR B 1 253 ? 128.599 158.584 208.743 1.00 220.73 ? 253 TYR B CA  1 
ATOM   4913  C  C   . TYR B 1 253 ? 128.619 158.508 207.216 1.00 218.83 ? 253 TYR B C   1 
ATOM   4914  O  O   . TYR B 1 253 ? 129.559 157.971 206.624 1.00 216.72 ? 253 TYR B O   1 
ATOM   4915  C  CB  . TYR B 1 253 ? 129.408 159.808 209.206 1.00 218.50 ? 253 TYR B CB  1 
ATOM   4916  C  CG  . TYR B 1 253 ? 129.010 160.321 210.572 1.00 223.15 ? 253 TYR B CG  1 
ATOM   4917  C  CD1 . TYR B 1 253 ? 127.979 161.245 210.719 1.00 225.56 ? 253 TYR B CD1 1 
ATOM   4918  C  CD2 . TYR B 1 253 ? 129.669 159.891 211.720 1.00 226.28 ? 253 TYR B CD2 1 
ATOM   4919  C  CE1 . TYR B 1 253 ? 127.603 161.716 211.977 1.00 229.05 ? 253 TYR B CE1 1 
ATOM   4920  C  CE2 . TYR B 1 253 ? 129.304 160.357 212.982 1.00 229.83 ? 253 TYR B CE2 1 
ATOM   4921  C  CZ  . TYR B 1 253 ? 128.270 161.271 213.106 1.00 238.20 ? 253 TYR B CZ  1 
ATOM   4922  O  OH  . TYR B 1 253 ? 127.910 161.738 214.347 1.00 242.38 ? 253 TYR B OH  1 
ATOM   4923  N  N   . VAL B 1 254 ? 127.570 159.070 206.589 1.00 212.91 ? 254 VAL B N   1 
ATOM   4924  C  CA  . VAL B 1 254 ? 127.424 159.157 205.137 1.00 209.78 ? 254 VAL B CA  1 
ATOM   4925  C  C   . VAL B 1 254 ? 127.479 160.662 204.767 1.00 206.73 ? 254 VAL B C   1 
ATOM   4926  O  O   . VAL B 1 254 ? 126.477 161.378 204.857 1.00 207.08 ? 254 VAL B O   1 
ATOM   4927  C  CB  . VAL B 1 254 ? 126.192 158.381 204.567 1.00 217.96 ? 254 VAL B CB  1 
ATOM   4928  C  CG1 . VAL B 1 254 ? 124.865 158.788 205.215 1.00 220.86 ? 254 VAL B CG1 1 
ATOM   4929  C  CG2 . VAL B 1 254 ? 126.122 158.467 203.045 1.00 216.19 ? 254 VAL B CG2 1 
ATOM   4930  N  N   . VAL B 1 255 ? 128.693 161.135 204.423 1.00 196.80 ? 255 VAL B N   1 
ATOM   4931  C  CA  . VAL B 1 255 ? 128.982 162.532 204.078 1.00 191.20 ? 255 VAL B CA  1 
ATOM   4932  C  C   . VAL B 1 255 ? 128.404 162.843 202.693 1.00 192.02 ? 255 VAL B C   1 
ATOM   4933  O  O   . VAL B 1 255 ? 128.694 162.130 201.728 1.00 191.68 ? 255 VAL B O   1 
ATOM   4934  C  CB  . VAL B 1 255 ? 130.506 162.843 204.167 1.00 191.21 ? 255 VAL B CB  1 
ATOM   4935  C  CG1 . VAL B 1 255 ? 130.833 164.236 203.633 1.00 186.80 ? 255 VAL B CG1 1 
ATOM   4936  C  CG2 . VAL B 1 255 ? 131.009 162.697 205.599 1.00 192.16 ? 255 VAL B CG2 1 
ATOM   4937  N  N   . GLU B 1 256 ? 127.590 163.915 202.609 1.00 186.51 ? 256 GLU B N   1 
ATOM   4938  C  CA  . GLU B 1 256 ? 126.958 164.376 201.375 1.00 185.09 ? 256 GLU B CA  1 
ATOM   4939  C  C   . GLU B 1 256 ? 128.007 165.050 200.468 1.00 182.58 ? 256 GLU B C   1 
ATOM   4940  O  O   . GLU B 1 256 ? 128.053 166.280 200.343 1.00 179.29 ? 256 GLU B O   1 
ATOM   4941  C  CB  . GLU B 1 256 ? 125.779 165.316 201.685 1.00 187.71 ? 256 GLU B CB  1 
ATOM   4942  N  N   . GLY B 1 257 ? 128.850 164.210 199.866 1.00 177.24 ? 257 GLY B N   1 
ATOM   4943  C  CA  . GLY B 1 257 ? 129.916 164.613 198.957 1.00 172.74 ? 257 GLY B CA  1 
ATOM   4944  C  C   . GLY B 1 257 ? 129.448 164.781 197.526 1.00 175.06 ? 257 GLY B C   1 
ATOM   4945  O  O   . GLY B 1 257 ? 130.205 165.271 196.686 1.00 171.68 ? 257 GLY B O   1 
ATOM   4946  N  N   . SER B 1 258 ? 128.190 164.380 197.244 1.00 174.30 ? 258 SER B N   1 
ATOM   4947  C  CA  . SER B 1 258 ? 127.551 164.487 195.932 1.00 174.84 ? 258 SER B CA  1 
ATOM   4948  C  C   . SER B 1 258 ? 127.155 165.936 195.624 1.00 176.25 ? 258 SER B C   1 
ATOM   4949  O  O   . SER B 1 258 ? 126.924 166.264 194.461 1.00 176.07 ? 258 SER B O   1 
ATOM   4950  C  CB  . SER B 1 258 ? 126.327 163.580 195.853 1.00 182.68 ? 258 SER B CB  1 
ATOM   4951  O  OG  . SER B 1 258 ? 125.354 163.936 196.822 1.00 191.69 ? 258 SER B OG  1 
ATOM   4952  N  N   . LYS B 1 259 ? 127.078 166.797 196.663 1.00 170.66 ? 259 LYS B N   1 
ATOM   4953  C  CA  . LYS B 1 259 ? 126.746 168.219 196.539 1.00 168.21 ? 259 LYS B CA  1 
ATOM   4954  C  C   . LYS B 1 259 ? 127.909 168.996 195.923 1.00 167.53 ? 259 LYS B C   1 
ATOM   4955  O  O   . LYS B 1 259 ? 127.691 170.063 195.347 1.00 165.49 ? 259 LYS B O   1 
ATOM   4956  C  CB  . LYS B 1 259 ? 126.382 168.807 197.910 1.00 170.66 ? 259 LYS B CB  1 
ATOM   4957  N  N   . ARG B 1 260 ? 129.140 168.452 196.040 1.00 162.69 ? 260 ARG B N   1 
ATOM   4958  C  CA  . ARG B 1 260 ? 130.368 169.054 195.523 1.00 159.05 ? 260 ARG B CA  1 
ATOM   4959  C  C   . ARG B 1 260 ? 130.845 168.390 194.222 1.00 163.95 ? 260 ARG B C   1 
ATOM   4960  O  O   . ARG B 1 260 ? 130.989 169.088 193.217 1.00 162.68 ? 260 ARG B O   1 
ATOM   4961  C  CB  . ARG B 1 260 ? 131.496 168.992 196.568 1.00 156.81 ? 260 ARG B CB  1 
ATOM   4962  C  CG  . ARG B 1 260 ? 131.335 169.935 197.746 1.00 163.95 ? 260 ARG B CG  1 
ATOM   4963  C  CD  . ARG B 1 260 ? 132.596 169.921 198.581 1.00 170.68 ? 260 ARG B CD  1 
ATOM   4964  N  NE  . ARG B 1 260 ? 132.384 170.506 199.903 1.00 179.92 ? 260 ARG B NE  1 
ATOM   4965  C  CZ  . ARG B 1 260 ? 132.656 171.766 200.224 1.00 193.09 ? 260 ARG B CZ  1 
ATOM   4966  N  NH1 . ARG B 1 260 ? 133.156 172.597 199.317 1.00 177.17 ? 260 ARG B NH1 1 
ATOM   4967  N  NH2 . ARG B 1 260 ? 132.434 172.206 201.454 1.00 182.43 ? 260 ARG B NH2 1 
ATOM   4968  N  N   . SER B 1 261 ? 131.127 167.061 194.247 1.00 162.22 ? 261 SER B N   1 
ATOM   4969  C  CA  . SER B 1 261 ? 131.649 166.332 193.086 1.00 162.80 ? 261 SER B CA  1 
ATOM   4970  C  C   . SER B 1 261 ? 131.277 164.839 193.073 1.00 170.27 ? 261 SER B C   1 
ATOM   4971  O  O   . SER B 1 261 ? 130.843 164.291 194.086 1.00 171.18 ? 261 SER B O   1 
ATOM   4972  C  CB  . SER B 1 261 ? 133.169 166.470 193.016 1.00 163.82 ? 261 SER B CB  1 
ATOM   4973  O  OG  . SER B 1 261 ? 133.796 165.923 194.164 1.00 173.35 ? 261 SER B OG  1 
ATOM   4974  N  N   . SER B 1 262 ? 131.495 164.185 191.913 1.00 168.92 ? 262 SER B N   1 
ATOM   4975  C  CA  . SER B 1 262 ? 131.231 162.765 191.664 1.00 173.01 ? 262 SER B CA  1 
ATOM   4976  C  C   . SER B 1 262 ? 132.361 161.853 192.187 1.00 177.44 ? 262 SER B C   1 
ATOM   4977  O  O   . SER B 1 262 ? 132.265 160.630 192.048 1.00 180.49 ? 262 SER B O   1 
ATOM   4978  C  CB  . SER B 1 262 ? 131.029 162.524 190.170 1.00 178.77 ? 262 SER B CB  1 
ATOM   4979  O  OG  . SER B 1 262 ? 129.994 163.338 189.643 1.00 189.09 ? 262 SER B OG  1 
ATOM   4980  N  N   . HIS B 1 263 ? 133.419 162.440 192.784 1.00 171.10 ? 263 HIS B N   1 
ATOM   4981  C  CA  . HIS B 1 263 ? 134.568 161.710 193.329 1.00 171.15 ? 263 HIS B CA  1 
ATOM   4982  C  C   . HIS B 1 263 ? 134.188 160.918 194.588 1.00 177.55 ? 263 HIS B C   1 
ATOM   4983  O  O   . HIS B 1 263 ? 133.412 161.407 195.415 1.00 176.75 ? 263 HIS B O   1 
ATOM   4984  C  CB  . HIS B 1 263 ? 135.723 162.667 193.636 1.00 168.11 ? 263 HIS B CB  1 
ATOM   4985  C  CG  . HIS B 1 263 ? 136.366 163.250 192.418 1.00 169.99 ? 263 HIS B CG  1 
ATOM   4986  N  ND1 . HIS B 1 263 ? 137.374 162.583 191.745 1.00 172.64 ? 263 HIS B ND1 1 
ATOM   4987  C  CD2 . HIS B 1 263 ? 136.141 164.435 191.806 1.00 169.75 ? 263 HIS B CD2 1 
ATOM   4988  C  CE1 . HIS B 1 263 ? 137.724 163.376 190.746 1.00 170.46 ? 263 HIS B CE1 1 
ATOM   4989  N  NE2 . HIS B 1 263 ? 137.012 164.504 190.745 1.00 168.99 ? 263 HIS B NE2 1 
ATOM   4990  N  N   . SER B 1 264 ? 134.747 159.693 194.721 1.00 176.92 ? 264 SER B N   1 
ATOM   4991  C  CA  . SER B 1 264 ? 134.481 158.766 195.827 1.00 179.61 ? 264 SER B CA  1 
ATOM   4992  C  C   . SER B 1 264 ? 135.732 158.495 196.679 1.00 183.18 ? 264 SER B C   1 
ATOM   4993  O  O   . SER B 1 264 ? 136.822 158.323 196.125 1.00 181.91 ? 264 SER B O   1 
ATOM   4994  C  CB  . SER B 1 264 ? 133.943 157.442 195.286 1.00 187.26 ? 264 SER B CB  1 
ATOM   4995  O  OG  . SER B 1 264 ? 132.943 157.617 194.295 1.00 196.17 ? 264 SER B OG  1 
ATOM   4996  N  N   . ASN B 1 265 ? 135.561 158.433 198.026 1.00 180.90 ? 265 ASN B N   1 
ATOM   4997  C  CA  . ASN B 1 265 ? 136.615 158.159 199.020 1.00 180.80 ? 265 ASN B CA  1 
ATOM   4998  C  C   . ASN B 1 265 ? 136.001 157.780 200.397 1.00 187.53 ? 265 ASN B C   1 
ATOM   4999  O  O   . ASN B 1 265 ? 134.776 157.754 200.530 1.00 188.66 ? 265 ASN B O   1 
ATOM   5000  C  CB  . ASN B 1 265 ? 137.559 159.369 199.160 1.00 177.94 ? 265 ASN B CB  1 
ATOM   5001  C  CG  . ASN B 1 265 ? 138.943 159.016 199.655 1.00 201.92 ? 265 ASN B CG  1 
ATOM   5002  O  OD1 . ASN B 1 265 ? 139.690 158.254 199.028 1.00 194.65 ? 265 ASN B OD1 1 
ATOM   5003  N  ND2 . ASN B 1 265 ? 139.316 159.571 200.798 1.00 195.33 ? 265 ASN B ND2 1 
ATOM   5004  N  N   . ALA B 1 266 ? 136.851 157.455 201.404 1.00 185.28 ? 266 ALA B N   1 
ATOM   5005  C  CA  . ALA B 1 266 ? 136.438 157.097 202.770 1.00 188.01 ? 266 ALA B CA  1 
ATOM   5006  C  C   . ALA B 1 266 ? 137.562 157.354 203.790 1.00 191.88 ? 266 ALA B C   1 
ATOM   5007  O  O   . ALA B 1 266 ? 138.742 157.277 203.438 1.00 190.16 ? 266 ALA B O   1 
ATOM   5008  C  CB  . ALA B 1 266 ? 136.009 155.640 202.829 1.00 193.52 ? 266 ALA B CB  1 
ATOM   5009  N  N   . TYR B 1 267 ? 137.186 157.655 205.054 1.00 190.33 ? 267 TYR B N   1 
ATOM   5010  C  CA  . TYR B 1 267 ? 138.112 157.930 206.162 1.00 190.44 ? 267 TYR B CA  1 
ATOM   5011  C  C   . TYR B 1 267 ? 137.528 157.469 207.526 1.00 199.04 ? 267 TYR B C   1 
ATOM   5012  O  O   . TYR B 1 267 ? 136.416 156.938 207.574 1.00 201.45 ? 267 TYR B O   1 
ATOM   5013  C  CB  . TYR B 1 267 ? 138.457 159.429 206.199 1.00 187.50 ? 267 TYR B CB  1 
ATOM   5014  N  N   . PHE B 1 268 ? 138.291 157.653 208.626 1.00 196.53 ? 268 PHE B N   1 
ATOM   5015  C  CA  . PHE B 1 268 ? 137.871 157.276 209.983 1.00 200.24 ? 268 PHE B CA  1 
ATOM   5016  C  C   . PHE B 1 268 ? 138.462 158.240 211.025 1.00 202.88 ? 268 PHE B C   1 
ATOM   5017  O  O   . PHE B 1 268 ? 139.568 158.756 210.831 1.00 199.77 ? 268 PHE B O   1 
ATOM   5018  C  CB  . PHE B 1 268 ? 138.258 155.816 210.297 1.00 206.44 ? 268 PHE B CB  1 
ATOM   5019  C  CG  . PHE B 1 268 ? 139.735 155.532 210.468 1.00 208.23 ? 268 PHE B CG  1 
ATOM   5020  C  CD1 . PHE B 1 268 ? 140.589 155.506 209.369 1.00 208.86 ? 268 PHE B CD1 1 
ATOM   5021  C  CD2 . PHE B 1 268 ? 140.264 155.246 211.721 1.00 213.59 ? 268 PHE B CD2 1 
ATOM   5022  C  CE1 . PHE B 1 268 ? 141.952 155.240 209.528 1.00 210.32 ? 268 PHE B CE1 1 
ATOM   5023  C  CE2 . PHE B 1 268 ? 141.625 154.968 211.877 1.00 216.98 ? 268 PHE B CE2 1 
ATOM   5024  C  CZ  . PHE B 1 268 ? 142.458 154.971 210.781 1.00 212.52 ? 268 PHE B CZ  1 
ATOM   5025  N  N   . TYR B 1 269 ? 137.717 158.488 212.122 1.00 201.68 ? 269 TYR B N   1 
ATOM   5026  C  CA  . TYR B 1 269 ? 138.138 159.402 213.190 1.00 201.33 ? 269 TYR B CA  1 
ATOM   5027  C  C   . TYR B 1 269 ? 137.650 158.933 214.573 1.00 209.78 ? 269 TYR B C   1 
ATOM   5028  O  O   . TYR B 1 269 ? 136.835 158.014 214.662 1.00 212.58 ? 269 TYR B O   1 
ATOM   5029  C  CB  . TYR B 1 269 ? 137.630 160.827 212.903 1.00 198.93 ? 269 TYR B CB  1 
ATOM   5030  N  N   . GLY B 1 270 ? 138.164 159.570 215.629 1.00 206.94 ? 270 GLY B N   1 
ATOM   5031  C  CA  . GLY B 1 270 ? 137.810 159.268 217.013 1.00 211.52 ? 270 GLY B CA  1 
ATOM   5032  C  C   . GLY B 1 270 ? 138.808 159.749 218.047 1.00 216.11 ? 270 GLY B C   1 
ATOM   5033  O  O   . GLY B 1 270 ? 139.689 160.559 217.741 1.00 212.43 ? 270 GLY B O   1 
ATOM   5034  N  N   . PHE B 1 271 ? 138.665 159.248 219.288 1.00 217.31 ? 271 PHE B N   1 
ATOM   5035  C  CA  . PHE B 1 271 ? 139.531 159.584 220.418 1.00 239.71 ? 271 PHE B CA  1 
ATOM   5036  C  C   . PHE B 1 271 ? 139.993 158.316 221.136 1.00 239.62 ? 271 PHE B C   1 
ATOM   5037  O  O   . PHE B 1 271 ? 140.929 157.655 220.687 1.00 193.58 ? 271 PHE B O   1 
ATOM   5038  C  CB  . PHE B 1 271 ? 138.805 160.522 221.394 1.00 241.29 ? 271 PHE B CB  1 
ATOM   5039  N  N   . LYS B 1 275 ? 134.901 156.600 218.687 1.00 238.88 ? 275 LYS B N   1 
ATOM   5040  C  CA  . LYS B 1 275 ? 135.364 156.422 217.314 1.00 234.40 ? 275 LYS B CA  1 
ATOM   5041  C  C   . LYS B 1 275 ? 134.184 156.298 216.342 1.00 237.11 ? 275 LYS B C   1 
ATOM   5042  O  O   . LYS B 1 275 ? 133.198 155.626 216.651 1.00 240.72 ? 275 LYS B O   1 
ATOM   5043  C  CB  . LYS B 1 275 ? 136.281 155.196 217.205 1.00 239.03 ? 275 LYS B CB  1 
ATOM   5044  N  N   . ARG B 1 276 ? 134.290 156.956 215.167 1.00 228.36 ? 276 ARG B N   1 
ATOM   5045  C  CA  . ARG B 1 276 ? 133.252 156.961 214.129 1.00 226.49 ? 276 ARG B CA  1 
ATOM   5046  C  C   . ARG B 1 276 ? 133.850 156.868 212.710 1.00 224.17 ? 276 ARG B C   1 
ATOM   5047  O  O   . ARG B 1 276 ? 134.879 157.490 212.424 1.00 220.08 ? 276 ARG B O   1 
ATOM   5048  C  CB  . ARG B 1 276 ? 132.377 158.225 214.248 1.00 225.80 ? 276 ARG B CB  1 
ATOM   5049  C  CG  . ARG B 1 276 ? 131.361 158.191 215.394 1.00 242.05 ? 276 ARG B CG  1 
ATOM   5050  C  CD  . ARG B 1 276 ? 131.475 159.400 216.312 1.00 250.38 ? 276 ARG B CD  1 
ATOM   5051  N  NE  . ARG B 1 276 ? 132.635 159.317 217.202 1.00 255.70 ? 276 ARG B NE  1 
ATOM   5052  C  CZ  . ARG B 1 276 ? 133.083 160.318 217.954 1.00 264.56 ? 276 ARG B CZ  1 
ATOM   5053  N  NH1 . ARG B 1 276 ? 132.478 161.501 217.925 1.00 255.70 ? 276 ARG B NH1 1 
ATOM   5054  N  NH2 . ARG B 1 276 ? 134.143 160.150 218.730 1.00 255.62 ? 276 ARG B NH2 1 
ATOM   5055  N  N   . ILE B 1 277 ? 133.180 156.097 211.826 1.00 219.72 ? 277 ILE B N   1 
ATOM   5056  C  CA  . ILE B 1 277 ? 133.570 155.876 210.427 1.00 215.62 ? 277 ILE B CA  1 
ATOM   5057  C  C   . ILE B 1 277 ? 132.969 156.960 209.509 1.00 213.01 ? 277 ILE B C   1 
ATOM   5058  O  O   . ILE B 1 277 ? 131.852 157.421 209.762 1.00 213.85 ? 277 ILE B O   1 
ATOM   5059  C  CB  . ILE B 1 277 ? 133.124 154.461 209.986 1.00 222.56 ? 277 ILE B CB  1 
ATOM   5060  N  N   . VAL B 1 278 ? 133.709 157.358 208.445 1.00 202.88 ? 278 VAL B N   1 
ATOM   5061  C  CA  . VAL B 1 278 ? 133.277 158.375 207.476 1.00 197.65 ? 278 VAL B CA  1 
ATOM   5062  C  C   . VAL B 1 278 ? 133.354 157.818 206.041 1.00 197.82 ? 278 VAL B C   1 
ATOM   5063  O  O   . VAL B 1 278 ? 134.435 157.469 205.567 1.00 195.97 ? 278 VAL B O   1 
ATOM   5064  C  CB  . VAL B 1 278 ? 134.089 159.683 207.621 1.00 197.12 ? 278 VAL B CB  1 
ATOM   5065  N  N   . LEU B 1 279 ? 132.195 157.724 205.361 1.00 193.47 ? 279 LEU B N   1 
ATOM   5066  C  CA  . LEU B 1 279 ? 132.096 157.209 203.993 1.00 192.25 ? 279 LEU B CA  1 
ATOM   5067  C  C   . LEU B 1 279 ? 131.282 158.152 203.106 1.00 192.09 ? 279 LEU B C   1 
ATOM   5068  O  O   . LEU B 1 279 ? 130.239 158.646 203.535 1.00 192.72 ? 279 LEU B O   1 
ATOM   5069  C  CB  . LEU B 1 279 ? 131.465 155.810 203.996 1.00 197.29 ? 279 LEU B CB  1 
ATOM   5070  N  N   . PHE B 1 280 ? 131.769 158.405 201.874 1.00 184.44 ? 280 PHE B N   1 
ATOM   5071  C  CA  . PHE B 1 280 ? 131.123 159.269 200.879 1.00 181.66 ? 280 PHE B CA  1 
ATOM   5072  C  C   . PHE B 1 280 ? 129.824 158.662 200.373 1.00 188.50 ? 280 PHE B C   1 
ATOM   5073  O  O   . PHE B 1 280 ? 129.743 157.441 200.234 1.00 191.79 ? 280 PHE B O   1 
ATOM   5074  C  CB  . PHE B 1 280 ? 132.065 159.488 199.685 1.00 180.34 ? 280 PHE B CB  1 
ATOM   5075  C  CG  . PHE B 1 280 ? 132.987 160.681 199.760 1.00 177.15 ? 280 PHE B CG  1 
ATOM   5076  C  CD1 . PHE B 1 280 ? 133.944 160.782 200.764 1.00 178.90 ? 280 PHE B CD1 1 
ATOM   5077  C  CD2 . PHE B 1 280 ? 132.947 161.670 198.785 1.00 176.39 ? 280 PHE B CD2 1 
ATOM   5078  C  CE1 . PHE B 1 280 ? 134.815 161.870 200.814 1.00 175.88 ? 280 PHE B CE1 1 
ATOM   5079  C  CE2 . PHE B 1 280 ? 133.819 162.758 198.836 1.00 175.25 ? 280 PHE B CE2 1 
ATOM   5080  C  CZ  . PHE B 1 280 ? 134.747 162.851 199.851 1.00 172.26 ? 280 PHE B CZ  1 
ATOM   5081  N  N   . ASP B 1 281 ? 128.823 159.506 200.056 1.00 184.07 ? 281 ASP B N   1 
ATOM   5082  C  CA  . ASP B 1 281 ? 127.545 159.036 199.513 1.00 187.66 ? 281 ASP B CA  1 
ATOM   5083  C  C   . ASP B 1 281 ? 127.715 158.597 198.048 1.00 192.18 ? 281 ASP B C   1 
ATOM   5084  O  O   . ASP B 1 281 ? 126.910 157.810 197.548 1.00 195.88 ? 281 ASP B O   1 
ATOM   5085  C  CB  . ASP B 1 281 ? 126.441 160.100 199.654 1.00 189.29 ? 281 ASP B CB  1 
ATOM   5086  C  CG  . ASP B 1 281 ? 126.695 161.435 198.979 1.00 194.91 ? 281 ASP B CG  1 
ATOM   5087  O  OD1 . ASP B 1 281 ? 127.857 161.704 198.602 1.00 192.08 ? 281 ASP B OD1 1 
ATOM   5088  O  OD2 . ASP B 1 281 ? 125.741 162.230 198.870 1.00 201.31 ? 281 ASP B OD2 1 
ATOM   5089  N  N   . THR B 1 282 ? 128.785 159.085 197.384 1.00 185.01 ? 282 THR B N   1 
ATOM   5090  C  CA  . THR B 1 282 ? 129.149 158.743 196.005 1.00 185.05 ? 282 THR B CA  1 
ATOM   5091  C  C   . THR B 1 282 ? 129.744 157.330 195.944 1.00 190.90 ? 282 THR B C   1 
ATOM   5092  O  O   . THR B 1 282 ? 129.633 156.667 194.912 1.00 192.98 ? 282 THR B O   1 
ATOM   5093  C  CB  . THR B 1 282 ? 130.128 159.772 195.423 1.00 191.43 ? 282 THR B CB  1 
ATOM   5094  O  OG1 . THR B 1 282 ? 131.196 159.996 196.347 1.00 189.36 ? 282 THR B OG1 1 
ATOM   5095  C  CG2 . THR B 1 282 ? 129.451 161.089 195.070 1.00 189.06 ? 282 THR B CG2 1 
ATOM   5096  N  N   . LEU B 1 283 ? 130.377 156.882 197.047 1.00 186.69 ? 283 LEU B N   1 
ATOM   5097  C  CA  . LEU B 1 283 ? 130.985 155.557 197.190 1.00 188.91 ? 283 LEU B CA  1 
ATOM   5098  C  C   . LEU B 1 283 ? 129.912 154.493 197.463 1.00 197.74 ? 283 LEU B C   1 
ATOM   5099  O  O   . LEU B 1 283 ? 130.064 153.358 197.016 1.00 200.85 ? 283 LEU B O   1 
ATOM   5100  C  CB  . LEU B 1 283 ? 132.017 155.584 198.339 1.00 187.03 ? 283 LEU B CB  1 
ATOM   5101  C  CG  . LEU B 1 283 ? 132.933 154.366 198.525 1.00 193.74 ? 283 LEU B CG  1 
ATOM   5102  C  CD1 . LEU B 1 283 ? 134.326 154.796 198.898 1.00 190.58 ? 283 LEU B CD1 1 
ATOM   5103  C  CD2 . LEU B 1 283 ? 132.420 153.461 199.618 1.00 199.99 ? 283 LEU B CD2 1 
ATOM   5104  N  N   . LEU B 1 284 ? 128.850 154.856 198.212 1.00 194.88 ? 284 LEU B N   1 
ATOM   5105  C  CA  . LEU B 1 284 ? 127.765 153.957 198.615 1.00 199.80 ? 284 LEU B CA  1 
ATOM   5106  C  C   . LEU B 1 284 ? 126.696 153.752 197.528 1.00 206.90 ? 284 LEU B C   1 
ATOM   5107  O  O   . LEU B 1 284 ? 126.167 152.641 197.416 1.00 211.68 ? 284 LEU B O   1 
ATOM   5108  C  CB  . LEU B 1 284 ? 127.099 154.485 199.891 1.00 200.02 ? 284 LEU B CB  1 
ATOM   5109  N  N   . GLU B 1 285 ? 126.361 154.813 196.755 1.00 200.50 ? 285 GLU B N   1 
ATOM   5110  C  CA  . GLU B 1 285 ? 125.335 154.777 195.701 1.00 221.10 ? 285 GLU B CA  1 
ATOM   5111  C  C   . GLU B 1 285 ? 125.708 153.810 194.566 1.00 228.23 ? 285 GLU B C   1 
ATOM   5112  O  O   . GLU B 1 285 ? 125.175 152.700 194.500 1.00 180.19 ? 285 GLU B O   1 
ATOM   5113  C  CB  . GLU B 1 285 ? 125.081 156.187 195.135 1.00 218.78 ? 285 GLU B CB  1 
ATOM   5114  C  CG  . GLU B 1 285 ? 124.064 156.990 195.931 1.00 226.26 ? 285 GLU B CG  1 
ATOM   5115  C  CD  . GLU B 1 285 ? 123.825 158.416 195.468 1.00 230.76 ? 285 GLU B CD  1 
ATOM   5116  O  OE1 . GLU B 1 285 ? 123.408 158.613 194.303 1.00 214.97 ? 285 GLU B OE1 1 
ATOM   5117  O  OE2 . GLU B 1 285 ? 124.007 159.338 196.295 1.00 217.28 ? 285 GLU B OE2 1 
ATOM   5118  N  N   . GLN B 1 322 ? 127.887 153.755 189.359 1.00 206.90 ? 322 GLN B N   1 
ATOM   5119  C  CA  . GLN B 1 322 ? 127.444 154.790 190.288 1.00 203.51 ? 322 GLN B CA  1 
ATOM   5120  C  C   . GLN B 1 322 ? 128.429 154.946 191.459 1.00 203.75 ? 322 GLN B C   1 
ATOM   5121  O  O   . GLN B 1 322 ? 128.859 156.065 191.753 1.00 198.79 ? 322 GLN B O   1 
ATOM   5122  C  CB  . GLN B 1 322 ? 126.028 154.484 190.805 1.00 208.95 ? 322 GLN B CB  1 
ATOM   5123  N  N   . GLY B 1 323 ? 128.768 153.828 192.102 1.00 202.48 ? 323 GLY B N   1 
ATOM   5124  C  CA  . GLY B 1 323 ? 129.687 153.779 193.233 1.00 199.61 ? 323 GLY B CA  1 
ATOM   5125  C  C   . GLY B 1 323 ? 130.245 152.391 193.456 1.00 206.77 ? 323 GLY B C   1 
ATOM   5126  O  O   . GLY B 1 323 ? 130.847 151.817 192.545 1.00 207.67 ? 323 GLY B O   1 
ATOM   5127  N  N   . CYS B 1 324 ? 130.035 151.842 194.668 1.00 205.00 ? 324 CYS B N   1 
ATOM   5128  C  CA  . CYS B 1 324 ? 130.485 150.504 195.068 1.00 208.26 ? 324 CYS B CA  1 
ATOM   5129  C  C   . CYS B 1 324 ? 129.357 149.740 195.765 1.00 215.44 ? 324 CYS B C   1 
ATOM   5130  O  O   . CYS B 1 324 ? 128.585 150.334 196.524 1.00 214.24 ? 324 CYS B O   1 
ATOM   5131  C  CB  . CYS B 1 324 ? 131.723 150.586 195.959 1.00 205.85 ? 324 CYS B CB  1 
ATOM   5132  S  SG  . CYS B 1 324 ? 133.292 150.680 195.054 1.00 206.97 ? 324 CYS B SG  1 
ATOM   5133  N  N   . LYS B 1 325 ? 129.285 148.415 195.523 1.00 216.02 ? 325 LYS B N   1 
ATOM   5134  C  CA  . LYS B 1 325 ? 128.305 147.515 196.144 1.00 220.75 ? 325 LYS B CA  1 
ATOM   5135  C  C   . LYS B 1 325 ? 128.643 147.329 197.627 1.00 223.43 ? 325 LYS B C   1 
ATOM   5136  O  O   . LYS B 1 325 ? 129.799 147.525 198.009 1.00 219.99 ? 325 LYS B O   1 
ATOM   5137  C  CB  . LYS B 1 325 ? 128.276 146.162 195.416 1.00 228.70 ? 325 LYS B CB  1 
ATOM   5138  N  N   . ASN B 1 326 ? 127.645 146.953 198.457 1.00 222.73 ? 326 ASN B N   1 
ATOM   5139  C  CA  . ASN B 1 326 ? 127.798 146.761 199.908 1.00 222.72 ? 326 ASN B CA  1 
ATOM   5140  C  C   . ASN B 1 326 ? 128.972 145.831 200.269 1.00 226.22 ? 326 ASN B C   1 
ATOM   5141  O  O   . ASN B 1 326 ? 129.656 146.090 201.262 1.00 223.61 ? 326 ASN B O   1 
ATOM   5142  C  CB  . ASN B 1 326 ? 126.503 146.242 200.533 1.00 229.69 ? 326 ASN B CB  1 
ATOM   5143  C  CG  . ASN B 1 326 ? 125.378 147.255 200.588 1.00 247.06 ? 326 ASN B CG  1 
ATOM   5144  O  OD1 . ASN B 1 326 ? 125.586 148.478 200.592 1.00 240.43 ? 326 ASN B OD1 1 
ATOM   5145  N  ND2 . ASN B 1 326 ? 124.149 146.761 200.667 1.00 244.36 ? 326 ASN B ND2 1 
ATOM   5146  N  N   . GLU B 1 327 ? 129.225 144.788 199.446 1.00 225.15 ? 327 GLU B N   1 
ATOM   5147  C  CA  . GLU B 1 327 ? 130.330 143.839 199.626 1.00 226.13 ? 327 GLU B CA  1 
ATOM   5148  C  C   . GLU B 1 327 ? 131.691 144.528 199.417 1.00 223.26 ? 327 GLU B C   1 
ATOM   5149  O  O   . GLU B 1 327 ? 132.646 144.227 200.137 1.00 222.85 ? 327 GLU B O   1 
ATOM   5150  C  CB  . GLU B 1 327 ? 130.182 142.649 198.664 1.00 231.33 ? 327 GLU B CB  1 
ATOM   5151  N  N   . GLU B 1 328 ? 131.766 145.460 198.445 1.00 214.12 ? 328 GLU B N   1 
ATOM   5152  C  CA  . GLU B 1 328 ? 132.974 146.226 198.122 1.00 207.76 ? 328 GLU B CA  1 
ATOM   5153  C  C   . GLU B 1 328 ? 133.231 147.305 199.171 1.00 204.34 ? 328 GLU B C   1 
ATOM   5154  O  O   . GLU B 1 328 ? 134.389 147.560 199.492 1.00 200.77 ? 328 GLU B O   1 
ATOM   5155  C  CB  . GLU B 1 328 ? 132.864 146.857 196.726 1.00 206.98 ? 328 GLU B CB  1 
ATOM   5156  C  CG  . GLU B 1 328 ? 133.080 145.869 195.593 1.00 222.59 ? 328 GLU B CG  1 
ATOM   5157  C  CD  . GLU B 1 328 ? 132.623 146.362 194.235 1.00 242.06 ? 328 GLU B CD  1 
ATOM   5158  O  OE1 . GLU B 1 328 ? 131.404 146.291 193.957 1.00 239.18 ? 328 GLU B OE1 1 
ATOM   5159  O  OE2 . GLU B 1 328 ? 133.484 146.805 193.442 1.00 236.13 ? 328 GLU B OE2 1 
ATOM   5160  N  N   . VAL B 1 329 ? 132.153 147.931 199.700 1.00 199.25 ? 329 VAL B N   1 
ATOM   5161  C  CA  . VAL B 1 329 ? 132.195 148.984 200.726 1.00 195.04 ? 329 VAL B CA  1 
ATOM   5162  C  C   . VAL B 1 329 ? 132.824 148.420 202.016 1.00 200.57 ? 329 VAL B C   1 
ATOM   5163  O  O   . VAL B 1 329 ? 133.712 149.057 202.586 1.00 196.35 ? 329 VAL B O   1 
ATOM   5164  C  CB  . VAL B 1 329 ? 130.784 149.600 200.975 1.00 199.13 ? 329 VAL B CB  1 
ATOM   5165  C  CG1 . VAL B 1 329 ? 130.771 150.519 202.196 1.00 196.42 ? 329 VAL B CG1 1 
ATOM   5166  C  CG2 . VAL B 1 329 ? 130.280 150.347 199.741 1.00 196.70 ? 329 VAL B CG2 1 
ATOM   5167  N  N   . LEU B 1 330 ? 132.392 147.210 202.439 1.00 203.28 ? 330 LEU B N   1 
ATOM   5168  C  CA  . LEU B 1 330 ? 132.894 146.514 203.631 1.00 205.97 ? 330 LEU B CA  1 
ATOM   5169  C  C   . LEU B 1 330 ? 134.392 146.203 203.508 1.00 208.87 ? 330 LEU B C   1 
ATOM   5170  O  O   . LEU B 1 330 ? 135.117 146.290 204.503 1.00 208.44 ? 330 LEU B O   1 
ATOM   5171  C  CB  . LEU B 1 330 ? 132.101 145.224 203.873 1.00 212.52 ? 330 LEU B CB  1 
ATOM   5172  N  N   . ALA B 1 331 ? 134.851 145.866 202.284 1.00 204.66 ? 331 ALA B N   1 
ATOM   5173  C  CA  . ALA B 1 331 ? 136.254 145.582 201.975 1.00 203.39 ? 331 ALA B CA  1 
ATOM   5174  C  C   . ALA B 1 331 ? 137.097 146.850 202.084 1.00 201.28 ? 331 ALA B C   1 
ATOM   5175  O  O   . ALA B 1 331 ? 138.228 146.789 202.570 1.00 200.48 ? 331 ALA B O   1 
ATOM   5176  C  CB  . ALA B 1 331 ? 136.371 144.998 200.583 1.00 205.56 ? 331 ALA B CB  1 
ATOM   5177  N  N   . VAL B 1 332 ? 136.527 148.001 201.650 1.00 193.44 ? 332 VAL B N   1 
ATOM   5178  C  CA  . VAL B 1 332 ? 137.138 149.334 201.713 1.00 187.36 ? 332 VAL B CA  1 
ATOM   5179  C  C   . VAL B 1 332 ? 137.251 149.727 203.199 1.00 190.85 ? 332 VAL B C   1 
ATOM   5180  O  O   . VAL B 1 332 ? 138.264 150.306 203.598 1.00 187.70 ? 332 VAL B O   1 
ATOM   5181  C  CB  . VAL B 1 332 ? 136.341 150.362 200.851 1.00 187.62 ? 332 VAL B CB  1 
ATOM   5182  C  CG1 . VAL B 1 332 ? 136.676 151.806 201.208 1.00 182.20 ? 332 VAL B CG1 1 
ATOM   5183  C  CG2 . VAL B 1 332 ? 136.568 150.121 199.361 1.00 187.34 ? 332 VAL B CG2 1 
ATOM   5184  N  N   . LEU B 1 333 ? 136.239 149.347 204.017 1.00 190.82 ? 333 LEU B N   1 
ATOM   5185  C  CA  . LEU B 1 333 ? 136.221 149.584 205.463 1.00 191.54 ? 333 LEU B CA  1 
ATOM   5186  C  C   . LEU B 1 333 ? 137.310 148.766 206.149 1.00 199.03 ? 333 LEU B C   1 
ATOM   5187  O  O   . LEU B 1 333 ? 138.037 149.310 206.976 1.00 197.12 ? 333 LEU B O   1 
ATOM   5188  C  CB  . LEU B 1 333 ? 134.848 149.262 206.076 1.00 195.00 ? 333 LEU B CB  1 
ATOM   5189  C  CG  . LEU B 1 333 ? 133.708 150.213 205.734 1.00 197.43 ? 333 LEU B CG  1 
ATOM   5190  C  CD1 . LEU B 1 333 ? 132.371 149.591 206.076 1.00 202.20 ? 333 LEU B CD1 1 
ATOM   5191  C  CD2 . LEU B 1 333 ? 133.870 151.558 206.434 1.00 195.98 ? 333 LEU B CD2 1 
ATOM   5192  N  N   . GLY B 1 334 ? 137.444 147.497 205.749 1.00 200.35 ? 334 GLY B N   1 
ATOM   5193  C  CA  . GLY B 1 334 ? 138.454 146.569 206.252 1.00 203.76 ? 334 GLY B CA  1 
ATOM   5194  C  C   . GLY B 1 334 ? 139.876 147.071 206.079 1.00 205.37 ? 334 GLY B C   1 
ATOM   5195  O  O   . GLY B 1 334 ? 140.742 146.789 206.913 1.00 206.88 ? 334 GLY B O   1 
ATOM   5196  N  N   . HIS B 1 335 ? 140.113 147.838 204.995 1.00 197.90 ? 335 HIS B N   1 
ATOM   5197  C  CA  . HIS B 1 335 ? 141.386 148.478 204.673 1.00 194.50 ? 335 HIS B CA  1 
ATOM   5198  C  C   . HIS B 1 335 ? 141.614 149.632 205.656 1.00 195.53 ? 335 HIS B C   1 
ATOM   5199  O  O   . HIS B 1 335 ? 142.672 149.691 206.284 1.00 195.42 ? 335 HIS B O   1 
ATOM   5200  C  CB  . HIS B 1 335 ? 141.379 148.961 203.203 1.00 192.19 ? 335 HIS B CB  1 
ATOM   5201  C  CG  . HIS B 1 335 ? 142.458 149.941 202.848 1.00 191.56 ? 335 HIS B CG  1 
ATOM   5202  N  ND1 . HIS B 1 335 ? 143.696 149.523 202.389 1.00 194.21 ? 335 HIS B ND1 1 
ATOM   5203  C  CD2 . HIS B 1 335 ? 142.434 151.295 202.863 1.00 188.82 ? 335 HIS B CD2 1 
ATOM   5204  C  CE1 . HIS B 1 335 ? 144.386 150.628 202.155 1.00 189.52 ? 335 HIS B CE1 1 
ATOM   5205  N  NE2 . HIS B 1 335 ? 143.674 151.720 202.442 1.00 186.50 ? 335 HIS B NE2 1 
ATOM   5206  N  N   . ALA B 1 336 ? 140.604 150.528 205.799 1.00 189.72 ? 336 ALA B N   1 
ATOM   5207  C  CA  . ALA B 1 336 ? 140.613 151.698 206.687 1.00 186.71 ? 336 ALA B CA  1 
ATOM   5208  C  C   . ALA B 1 336 ? 140.735 151.288 208.159 1.00 193.92 ? 336 ALA B C   1 
ATOM   5209  O  O   . ALA B 1 336 ? 141.431 151.965 208.918 1.00 192.45 ? 336 ALA B O   1 
ATOM   5210  C  CB  . ALA B 1 336 ? 139.356 152.526 206.479 1.00 185.19 ? 336 ALA B CB  1 
ATOM   5211  N  N   . LEU B 1 337 ? 140.089 150.163 208.548 1.00 194.77 ? 337 LEU B N   1 
ATOM   5212  C  CA  . LEU B 1 337 ? 140.153 149.603 209.902 1.00 198.58 ? 337 LEU B CA  1 
ATOM   5213  C  C   . LEU B 1 337 ? 141.560 149.071 210.182 1.00 204.23 ? 337 LEU B C   1 
ATOM   5214  O  O   . LEU B 1 337 ? 141.956 148.962 211.344 1.00 206.42 ? 337 LEU B O   1 
ATOM   5215  C  CB  . LEU B 1 337 ? 139.107 148.488 210.093 1.00 203.38 ? 337 LEU B CB  1 
ATOM   5216  C  CG  . LEU B 1 337 ? 137.647 148.927 210.224 1.00 207.77 ? 337 LEU B CG  1 
ATOM   5217  C  CD1 . LEU B 1 337 ? 136.706 147.835 209.750 1.00 211.82 ? 337 LEU B CD1 1 
ATOM   5218  C  CD2 . LEU B 1 337 ? 137.313 149.337 211.649 1.00 211.83 ? 337 LEU B CD2 1 
ATOM   5219  N  N   . GLY B 1 338 ? 142.294 148.769 209.106 1.00 199.60 ? 338 GLY B N   1 
ATOM   5220  C  CA  . GLY B 1 338 ? 143.670 148.292 209.141 1.00 200.97 ? 338 GLY B CA  1 
ATOM   5221  C  C   . GLY B 1 338 ? 144.634 149.309 209.710 1.00 202.44 ? 338 GLY B C   1 
ATOM   5222  O  O   . GLY B 1 338 ? 145.513 148.942 210.490 1.00 204.98 ? 338 GLY B O   1 
ATOM   5223  N  N   . HIS B 1 339 ? 144.454 150.602 209.352 1.00 193.89 ? 339 HIS B N   1 
ATOM   5224  C  CA  . HIS B 1 339 ? 145.275 151.723 209.833 1.00 190.98 ? 339 HIS B CA  1 
ATOM   5225  C  C   . HIS B 1 339 ? 145.120 151.917 211.346 1.00 197.00 ? 339 HIS B C   1 
ATOM   5226  O  O   . HIS B 1 339 ? 146.066 152.338 212.015 1.00 196.73 ? 339 HIS B O   1 
ATOM   5227  C  CB  . HIS B 1 339 ? 144.917 153.020 209.095 1.00 186.33 ? 339 HIS B CB  1 
ATOM   5228  C  CG  . HIS B 1 339 ? 145.248 153.004 207.635 1.00 187.47 ? 339 HIS B CG  1 
ATOM   5229  N  ND1 . HIS B 1 339 ? 146.556 152.896 207.191 1.00 189.25 ? 339 HIS B ND1 1 
ATOM   5230  C  CD2 . HIS B 1 339 ? 144.430 153.119 206.562 1.00 187.25 ? 339 HIS B CD2 1 
ATOM   5231  C  CE1 . HIS B 1 339 ? 146.491 152.935 205.870 1.00 186.62 ? 339 HIS B CE1 1 
ATOM   5232  N  NE2 . HIS B 1 339 ? 145.233 153.069 205.444 1.00 185.70 ? 339 HIS B NE2 1 
ATOM   5233  N  N   . TRP B 1 340 ? 143.928 151.593 211.877 1.00 195.75 ? 340 TRP B N   1 
ATOM   5234  C  CA  . TRP B 1 340 ? 143.610 151.655 213.300 1.00 198.58 ? 340 TRP B CA  1 
ATOM   5235  C  C   . TRP B 1 340 ? 144.291 150.486 214.038 1.00 206.70 ? 340 TRP B C   1 
ATOM   5236  O  O   . TRP B 1 340 ? 144.998 150.720 215.019 1.00 208.19 ? 340 TRP B O   1 
ATOM   5237  C  CB  . TRP B 1 340 ? 142.080 151.633 213.508 1.00 198.31 ? 340 TRP B CB  1 
ATOM   5238  C  CG  . TRP B 1 340 ? 141.649 151.513 214.943 1.00 203.48 ? 340 TRP B CG  1 
ATOM   5239  C  CD1 . TRP B 1 340 ? 141.585 152.513 215.868 1.00 205.78 ? 340 TRP B CD1 1 
ATOM   5240  C  CD2 . TRP B 1 340 ? 141.225 150.317 215.614 1.00 209.04 ? 340 TRP B CD2 1 
ATOM   5241  N  NE1 . TRP B 1 340 ? 141.154 152.016 217.076 1.00 210.30 ? 340 TRP B NE1 1 
ATOM   5242  C  CE2 . TRP B 1 340 ? 140.923 150.670 216.949 1.00 215.62 ? 340 TRP B CE2 1 
ATOM   5243  C  CE3 . TRP B 1 340 ? 141.079 148.976 215.220 1.00 213.77 ? 340 TRP B CE3 1 
ATOM   5244  C  CZ2 . TRP B 1 340 ? 140.480 149.733 217.890 1.00 220.91 ? 340 TRP B CZ2 1 
ATOM   5245  C  CZ3 . TRP B 1 340 ? 140.635 148.049 216.152 1.00 221.09 ? 340 TRP B CZ3 1 
ATOM   5246  C  CH2 . TRP B 1 340 ? 140.340 148.429 217.468 1.00 224.24 ? 340 TRP B CH2 1 
ATOM   5247  N  N   . LYS B 1 341 ? 144.088 149.240 213.547 1.00 204.84 ? 341 LYS B N   1 
ATOM   5248  C  CA  . LYS B 1 341 ? 144.618 148.002 214.124 1.00 209.76 ? 341 LYS B CA  1 
ATOM   5249  C  C   . LYS B 1 341 ? 146.147 147.897 214.028 1.00 213.10 ? 341 LYS B C   1 
ATOM   5250  O  O   . LYS B 1 341 ? 146.773 147.443 214.988 1.00 216.84 ? 341 LYS B O   1 
ATOM   5251  C  CB  . LYS B 1 341 ? 143.976 146.783 213.454 1.00 214.94 ? 341 LYS B CB  1 
ATOM   5252  N  N   . LEU B 1 342 ? 146.746 148.307 212.886 1.00 205.28 ? 342 LEU B N   1 
ATOM   5253  C  CA  . LEU B 1 342 ? 148.202 148.259 212.678 1.00 205.41 ? 342 LEU B CA  1 
ATOM   5254  C  C   . LEU B 1 342 ? 148.917 149.474 213.312 1.00 206.93 ? 342 LEU B C   1 
ATOM   5255  O  O   . LEU B 1 342 ? 150.147 149.559 213.260 1.00 206.99 ? 342 LEU B O   1 
ATOM   5256  C  CB  . LEU B 1 342 ? 148.553 148.150 211.181 1.00 202.78 ? 342 LEU B CB  1 
ATOM   5257  C  CG  . LEU B 1 342 ? 148.258 146.802 210.517 1.00 210.94 ? 342 LEU B CG  1 
ATOM   5258  C  CD1 . LEU B 1 342 ? 147.868 146.983 209.070 1.00 207.57 ? 342 LEU B CD1 1 
ATOM   5259  C  CD2 . LEU B 1 342 ? 149.442 145.855 210.630 1.00 217.99 ? 342 LEU B CD2 1 
ATOM   5260  N  N   . GLY B 1 343 ? 148.140 150.375 213.917 1.00 201.51 ? 343 GLY B N   1 
ATOM   5261  C  CA  . GLY B 1 343 ? 148.632 151.565 214.602 1.00 199.53 ? 343 GLY B CA  1 
ATOM   5262  C  C   . GLY B 1 343 ? 149.298 152.598 213.717 1.00 198.35 ? 343 GLY B C   1 
ATOM   5263  O  O   . GLY B 1 343 ? 150.193 153.313 214.176 1.00 197.44 ? 343 GLY B O   1 
ATOM   5264  N  N   . HIS B 1 344 ? 148.860 152.692 212.445 1.00 191.59 ? 344 HIS B N   1 
ATOM   5265  C  CA  . HIS B 1 344 ? 149.382 153.654 211.470 1.00 186.67 ? 344 HIS B CA  1 
ATOM   5266  C  C   . HIS B 1 344 ? 149.036 155.084 211.892 1.00 187.00 ? 344 HIS B C   1 
ATOM   5267  O  O   . HIS B 1 344 ? 149.841 155.995 211.689 1.00 184.46 ? 344 HIS B O   1 
ATOM   5268  C  CB  . HIS B 1 344 ? 148.835 153.356 210.060 1.00 185.03 ? 344 HIS B CB  1 
ATOM   5269  C  CG  . HIS B 1 344 ? 149.314 152.060 209.470 1.00 191.70 ? 344 HIS B CG  1 
ATOM   5270  N  ND1 . HIS B 1 344 ? 148.529 151.338 208.587 1.00 193.60 ? 344 HIS B ND1 1 
ATOM   5271  C  CD2 . HIS B 1 344 ? 150.481 151.396 209.655 1.00 196.91 ? 344 HIS B CD2 1 
ATOM   5272  C  CE1 . HIS B 1 344 ? 149.236 150.265 208.271 1.00 196.55 ? 344 HIS B CE1 1 
ATOM   5273  N  NE2 . HIS B 1 344 ? 150.417 150.257 208.887 1.00 198.84 ? 344 HIS B NE2 1 
ATOM   5274  N  N   . THR B 1 345 ? 147.849 155.260 212.514 1.00 183.24 ? 345 THR B N   1 
ATOM   5275  C  CA  . THR B 1 345 ? 147.332 156.534 213.025 1.00 180.00 ? 345 THR B CA  1 
ATOM   5276  C  C   . THR B 1 345 ? 148.251 157.061 214.139 1.00 183.92 ? 345 THR B C   1 
ATOM   5277  O  O   . THR B 1 345 ? 148.722 158.197 214.046 1.00 180.24 ? 345 THR B O   1 
ATOM   5278  C  CB  . THR B 1 345 ? 145.878 156.362 213.525 1.00 190.68 ? 345 THR B CB  1 
ATOM   5279  O  OG1 . THR B 1 345 ? 145.120 155.597 212.585 1.00 191.97 ? 345 THR B OG1 1 
ATOM   5280  C  CG2 . THR B 1 345 ? 145.183 157.696 213.798 1.00 185.47 ? 345 THR B CG2 1 
ATOM   5281  N  N   . VAL B 1 346 ? 148.520 156.221 215.167 1.00 184.54 ? 346 VAL B N   1 
ATOM   5282  C  CA  . VAL B 1 346 ? 149.356 156.543 216.327 1.00 186.83 ? 346 VAL B CA  1 
ATOM   5283  C  C   . VAL B 1 346 ? 150.814 156.800 215.923 1.00 189.03 ? 346 VAL B C   1 
ATOM   5284  O  O   . VAL B 1 346 ? 151.430 157.724 216.459 1.00 188.65 ? 346 VAL B O   1 
ATOM   5285  C  CB  . VAL B 1 346 ? 149.273 155.442 217.403 1.00 196.75 ? 346 VAL B CB  1 
ATOM   5286  N  N   . LYS B 1 347 ? 151.354 155.998 214.978 1.00 184.43 ? 347 LYS B N   1 
ATOM   5287  C  CA  . LYS B 1 347 ? 152.726 156.130 214.477 1.00 183.54 ? 347 LYS B CA  1 
ATOM   5288  C  C   . LYS B 1 347 ? 152.933 157.484 213.777 1.00 181.37 ? 347 LYS B C   1 
ATOM   5289  O  O   . LYS B 1 347 ? 153.971 158.116 213.982 1.00 181.32 ? 347 LYS B O   1 
ATOM   5290  C  CB  . LYS B 1 347 ? 153.072 154.974 213.525 1.00 187.01 ? 347 LYS B CB  1 
ATOM   5291  N  N   . ASN B 1 348 ? 151.927 157.942 212.996 1.00 172.58 ? 348 ASN B N   1 
ATOM   5292  C  CA  . ASN B 1 348 ? 151.951 159.213 212.267 1.00 166.82 ? 348 ASN B CA  1 
ATOM   5293  C  C   . ASN B 1 348 ? 151.988 160.421 213.219 1.00 169.31 ? 348 ASN B C   1 
ATOM   5294  O  O   . ASN B 1 348 ? 152.634 161.418 212.891 1.00 166.84 ? 348 ASN B O   1 
ATOM   5295  C  CB  . ASN B 1 348 ? 150.754 159.319 211.326 1.00 163.22 ? 348 ASN B CB  1 
ATOM   5296  N  N   . ILE B 1 349 ? 151.314 160.331 214.392 1.00 167.36 ? 349 ILE B N   1 
ATOM   5297  C  CA  . ILE B 1 349 ? 151.295 161.403 215.397 1.00 167.04 ? 349 ILE B CA  1 
ATOM   5298  C  C   . ILE B 1 349 ? 152.664 161.485 216.083 1.00 174.27 ? 349 ILE B C   1 
ATOM   5299  O  O   . ILE B 1 349 ? 153.180 162.588 216.285 1.00 172.29 ? 349 ILE B O   1 
ATOM   5300  C  CB  . ILE B 1 349 ? 150.148 161.222 216.422 1.00 172.27 ? 349 ILE B CB  1 
ATOM   5301  N  N   . ILE B 1 350 ? 153.264 160.312 216.402 1.00 175.98 ? 350 ILE B N   1 
ATOM   5302  C  CA  . ILE B 1 350 ? 154.580 160.183 217.039 1.00 180.25 ? 350 ILE B CA  1 
ATOM   5303  C  C   . ILE B 1 350 ? 155.669 160.815 216.155 1.00 182.42 ? 350 ILE B C   1 
ATOM   5304  O  O   . ILE B 1 350 ? 156.574 161.457 216.688 1.00 183.89 ? 350 ILE B O   1 
ATOM   5305  C  CB  . ILE B 1 350 ? 154.905 158.706 217.373 1.00 188.30 ? 350 ILE B CB  1 
ATOM   5306  N  N   . ILE B 1 351 ? 155.555 160.671 214.814 1.00 175.33 ? 351 ILE B N   1 
ATOM   5307  C  CA  . ILE B 1 351 ? 156.496 161.250 213.850 1.00 172.67 ? 351 ILE B CA  1 
ATOM   5308  C  C   . ILE B 1 351 ? 156.318 162.777 213.824 1.00 174.18 ? 351 ILE B C   1 
ATOM   5309  O  O   . ILE B 1 351 ? 157.313 163.497 213.917 1.00 174.27 ? 351 ILE B O   1 
ATOM   5310  C  CB  . ILE B 1 351 ? 156.342 160.618 212.431 1.00 172.79 ? 351 ILE B CB  1 
ATOM   5311  C  CG1 . ILE B 1 351 ? 156.720 159.126 212.439 1.00 177.22 ? 351 ILE B CG1 1 
ATOM   5312  C  CG2 . ILE B 1 351 ? 157.177 161.369 211.381 1.00 170.39 ? 351 ILE B CG2 1 
ATOM   5313  C  CD1 . ILE B 1 351 ? 156.066 158.298 211.338 1.00 181.99 ? 351 ILE B CD1 1 
ATOM   5314  N  N   . SER B 1 352 ? 155.055 163.257 213.719 1.00 168.61 ? 352 SER B N   1 
ATOM   5315  C  CA  . SER B 1 352 ? 154.700 164.680 213.637 1.00 165.41 ? 352 SER B CA  1 
ATOM   5316  C  C   . SER B 1 352 ? 155.153 165.488 214.862 1.00 171.81 ? 352 SER B C   1 
ATOM   5317  O  O   . SER B 1 352 ? 155.567 166.638 214.695 1.00 169.22 ? 352 SER B O   1 
ATOM   5318  C  CB  . SER B 1 352 ? 153.197 164.857 213.429 1.00 166.92 ? 352 SER B CB  1 
ATOM   5319  O  OG  . SER B 1 352 ? 152.440 164.574 214.595 1.00 179.97 ? 352 SER B OG  1 
ATOM   5320  N  N   . GLN B 1 353 ? 155.075 164.898 216.075 1.00 173.12 ? 353 GLN B N   1 
ATOM   5321  C  CA  . GLN B 1 353 ? 155.479 165.582 217.307 1.00 176.33 ? 353 GLN B CA  1 
ATOM   5322  C  C   . GLN B 1 353 ? 156.994 165.498 217.523 1.00 184.29 ? 353 GLN B C   1 
ATOM   5323  O  O   . GLN B 1 353 ? 157.561 166.353 218.208 1.00 185.49 ? 353 GLN B O   1 
ATOM   5324  C  CB  . GLN B 1 353 ? 154.717 165.050 218.532 1.00 181.44 ? 353 GLN B CB  1 
ATOM   5325  C  CG  . GLN B 1 353 ? 153.215 165.384 218.537 1.00 194.66 ? 353 GLN B CG  1 
ATOM   5326  C  CD  . GLN B 1 353 ? 152.873 166.850 218.318 1.00 210.80 ? 353 GLN B CD  1 
ATOM   5327  O  OE1 . GLN B 1 353 ? 153.447 167.766 218.926 1.00 207.83 ? 353 GLN B OE1 1 
ATOM   5328  N  NE2 . GLN B 1 353 ? 151.907 167.100 217.447 1.00 198.27 ? 353 GLN B NE2 1 
ATOM   5329  N  N   . MET B 1 354 ? 157.645 164.486 216.920 1.00 182.77 ? 354 MET B N   1 
ATOM   5330  C  CA  . MET B 1 354 ? 159.096 164.300 216.968 1.00 186.36 ? 354 MET B CA  1 
ATOM   5331  C  C   . MET B 1 354 ? 159.759 165.322 216.038 1.00 186.49 ? 354 MET B C   1 
ATOM   5332  O  O   . MET B 1 354 ? 160.830 165.844 216.352 1.00 188.61 ? 354 MET B O   1 
ATOM   5333  C  CB  . MET B 1 354 ? 159.448 162.866 216.553 1.00 191.16 ? 354 MET B CB  1 
ATOM   5334  C  CG  . MET B 1 354 ? 160.857 162.450 216.893 1.00 200.37 ? 354 MET B CG  1 
ATOM   5335  S  SD  . MET B 1 354 ? 161.060 160.654 216.782 1.00 207.72 ? 354 MET B SD  1 
ATOM   5336  C  CE  . MET B 1 354 ? 160.989 160.408 214.994 1.00 200.78 ? 354 MET B CE  1 
ATOM   5337  N  N   . ASN B 1 355 ? 159.095 165.602 214.896 1.00 177.09 ? 355 ASN B N   1 
ATOM   5338  C  CA  . ASN B 1 355 ? 159.513 166.553 213.870 1.00 172.75 ? 355 ASN B CA  1 
ATOM   5339  C  C   . ASN B 1 355 ? 159.445 167.988 214.415 1.00 175.08 ? 355 ASN B C   1 
ATOM   5340  O  O   . ASN B 1 355 ? 160.410 168.735 214.245 1.00 175.18 ? 355 ASN B O   1 
ATOM   5341  C  CB  . ASN B 1 355 ? 158.642 166.382 212.615 1.00 168.63 ? 355 ASN B CB  1 
ATOM   5342  C  CG  . ASN B 1 355 ? 158.553 167.589 211.717 1.00 191.06 ? 355 ASN B CG  1 
ATOM   5343  O  OD1 . ASN B 1 355 ? 159.540 168.027 211.120 1.00 185.64 ? 355 ASN B OD1 1 
ATOM   5344  N  ND2 . ASN B 1 355 ? 157.357 168.149 211.600 1.00 180.35 ? 355 ASN B ND2 1 
ATOM   5345  N  N   . SER B 1 356 ? 158.321 168.361 215.080 1.00 170.32 ? 356 SER B N   1 
ATOM   5346  C  CA  . SER B 1 356 ? 158.112 169.699 215.650 1.00 169.30 ? 356 SER B CA  1 
ATOM   5347  C  C   . SER B 1 356 ? 159.067 169.986 216.809 1.00 177.21 ? 356 SER B C   1 
ATOM   5348  O  O   . SER B 1 356 ? 159.448 171.144 216.980 1.00 176.62 ? 356 SER B O   1 
ATOM   5349  C  CB  . SER B 1 356 ? 156.666 169.894 216.098 1.00 171.90 ? 356 SER B CB  1 
ATOM   5350  O  OG  . SER B 1 356 ? 156.255 168.942 217.064 1.00 185.74 ? 356 SER B OG  1 
ATOM   5351  N  N   . PHE B 1 357 ? 159.474 168.947 217.582 1.00 177.89 ? 357 PHE B N   1 
ATOM   5352  C  CA  . PHE B 1 357 ? 160.431 169.120 218.681 1.00 183.08 ? 357 PHE B CA  1 
ATOM   5353  C  C   . PHE B 1 357 ? 161.811 169.434 218.112 1.00 187.19 ? 357 PHE B C   1 
ATOM   5354  O  O   . PHE B 1 357 ? 162.471 170.351 218.603 1.00 188.59 ? 357 PHE B O   1 
ATOM   5355  C  CB  . PHE B 1 357 ? 160.486 167.895 219.613 1.00 190.14 ? 357 PHE B CB  1 
ATOM   5356  C  CG  . PHE B 1 357 ? 161.421 168.082 220.791 1.00 197.37 ? 357 PHE B CG  1 
ATOM   5357  C  CD1 . PHE B 1 357 ? 161.026 168.815 221.904 1.00 200.07 ? 357 PHE B CD1 1 
ATOM   5358  C  CD2 . PHE B 1 357 ? 162.701 167.542 220.776 1.00 200.05 ? 357 PHE B CD2 1 
ATOM   5359  C  CE1 . PHE B 1 357 ? 161.895 169.002 222.982 1.00 202.60 ? 357 PHE B CE1 1 
ATOM   5360  C  CE2 . PHE B 1 357 ? 163.571 167.733 221.853 1.00 203.85 ? 357 PHE B CE2 1 
ATOM   5361  C  CZ  . PHE B 1 357 ? 163.161 168.460 222.949 1.00 203.23 ? 357 PHE B CZ  1 
ATOM   5362  N  N   . LEU B 1 358 ? 162.230 168.687 217.068 1.00 182.46 ? 358 LEU B N   1 
ATOM   5363  C  CA  . LEU B 1 358 ? 163.504 168.878 216.372 1.00 183.29 ? 358 LEU B CA  1 
ATOM   5364  C  C   . LEU B 1 358 ? 163.545 170.264 215.722 1.00 183.68 ? 358 LEU B C   1 
ATOM   5365  O  O   . LEU B 1 358 ? 164.582 170.927 215.770 1.00 185.36 ? 358 LEU B O   1 
ATOM   5366  C  CB  . LEU B 1 358 ? 163.701 167.780 215.315 1.00 182.28 ? 358 LEU B CB  1 
ATOM   5367  C  CG  . LEU B 1 358 ? 165.087 167.696 214.680 1.00 189.36 ? 358 LEU B CG  1 
ATOM   5368  C  CD1 . LEU B 1 358 ? 165.894 166.565 215.282 1.00 195.87 ? 358 LEU B CD1 1 
ATOM   5369  C  CD2 . LEU B 1 358 ? 164.985 167.516 213.184 1.00 187.62 ? 358 LEU B CD2 1 
ATOM   5370  N  N   . CYS B 1 359 ? 162.401 170.704 215.151 1.00 175.30 ? 359 CYS B N   1 
ATOM   5371  C  CA  . CYS B 1 359 ? 162.227 171.998 214.492 1.00 171.11 ? 359 CYS B CA  1 
ATOM   5372  C  C   . CYS B 1 359 ? 162.316 173.156 215.495 1.00 176.41 ? 359 CYS B C   1 
ATOM   5373  O  O   . CYS B 1 359 ? 163.081 174.091 215.251 1.00 176.64 ? 359 CYS B O   1 
ATOM   5374  C  CB  . CYS B 1 359 ? 160.914 172.039 213.717 1.00 166.02 ? 359 CYS B CB  1 
ATOM   5375  S  SG  . CYS B 1 359 ? 161.000 171.270 212.082 1.00 166.62 ? 359 CYS B SG  1 
ATOM   5376  N  N   . PHE B 1 360 ? 161.553 173.094 216.617 1.00 173.40 ? 360 PHE B N   1 
ATOM   5377  C  CA  . PHE B 1 360 ? 161.554 174.140 217.649 1.00 174.70 ? 360 PHE B CA  1 
ATOM   5378  C  C   . PHE B 1 360 ? 162.915 174.260 218.327 1.00 182.05 ? 360 PHE B C   1 
ATOM   5379  O  O   . PHE B 1 360 ? 163.299 175.371 218.696 1.00 183.12 ? 360 PHE B O   1 
ATOM   5380  C  CB  . PHE B 1 360 ? 160.455 173.918 218.698 1.00 177.76 ? 360 PHE B CB  1 
ATOM   5381  C  CG  . PHE B 1 360 ? 159.151 174.606 218.365 1.00 174.55 ? 360 PHE B CG  1 
ATOM   5382  C  CD1 . PHE B 1 360 ? 159.034 175.989 218.450 1.00 176.41 ? 360 PHE B CD1 1 
ATOM   5383  C  CD2 . PHE B 1 360 ? 158.039 173.872 217.976 1.00 173.91 ? 360 PHE B CD2 1 
ATOM   5384  C  CE1 . PHE B 1 360 ? 157.829 176.625 218.135 1.00 173.36 ? 360 PHE B CE1 1 
ATOM   5385  C  CE2 . PHE B 1 360 ? 156.833 174.508 217.667 1.00 172.80 ? 360 PHE B CE2 1 
ATOM   5386  C  CZ  . PHE B 1 360 ? 156.736 175.880 217.749 1.00 169.77 ? 360 PHE B CZ  1 
ATOM   5387  N  N   . PHE B 1 361 ? 163.654 173.136 218.454 1.00 180.39 ? 361 PHE B N   1 
ATOM   5388  C  CA  . PHE B 1 361 ? 164.994 173.118 219.039 1.00 185.44 ? 361 PHE B CA  1 
ATOM   5389  C  C   . PHE B 1 361 ? 165.963 173.896 218.144 1.00 187.62 ? 361 PHE B C   1 
ATOM   5390  O  O   . PHE B 1 361 ? 166.644 174.794 218.640 1.00 190.38 ? 361 PHE B O   1 
ATOM   5391  C  CB  . PHE B 1 361 ? 165.488 171.677 219.283 1.00 190.67 ? 361 PHE B CB  1 
ATOM   5392  C  CG  . PHE B 1 361 ? 166.952 171.569 219.647 1.00 193.24 ? 361 PHE B CG  1 
ATOM   5393  C  CD1 . PHE B 1 361 ? 167.400 171.933 220.911 1.00 197.00 ? 361 PHE B CD1 1 
ATOM   5394  C  CD2 . PHE B 1 361 ? 167.884 171.114 218.722 1.00 194.39 ? 361 PHE B CD2 1 
ATOM   5395  C  CE1 . PHE B 1 361 ? 168.755 171.851 221.240 1.00 199.47 ? 361 PHE B CE1 1 
ATOM   5396  C  CE2 . PHE B 1 361 ? 169.238 171.032 219.052 1.00 198.09 ? 361 PHE B CE2 1 
ATOM   5397  C  CZ  . PHE B 1 361 ? 169.665 171.398 220.309 1.00 198.74 ? 361 PHE B CZ  1 
ATOM   5398  N  N   . LEU B 1 362 ? 165.994 173.576 216.829 1.00 179.19 ? 362 LEU B N   1 
ATOM   5399  C  CA  . LEU B 1 362 ? 166.856 174.239 215.844 1.00 177.30 ? 362 LEU B CA  1 
ATOM   5400  C  C   . LEU B 1 362 ? 166.438 175.703 215.644 1.00 177.04 ? 362 LEU B C   1 
ATOM   5401  O  O   . LEU B 1 362 ? 167.285 176.533 215.306 1.00 177.94 ? 362 LEU B O   1 
ATOM   5402  C  CB  . LEU B 1 362 ? 166.859 173.487 214.501 1.00 173.73 ? 362 LEU B CB  1 
ATOM   5403  C  CG  . LEU B 1 362 ? 167.484 172.083 214.489 1.00 181.89 ? 362 LEU B CG  1 
ATOM   5404  C  CD1 . LEU B 1 362 ? 166.987 171.275 213.309 1.00 177.84 ? 362 LEU B CD1 1 
ATOM   5405  C  CD2 . LEU B 1 362 ? 169.007 172.143 214.485 1.00 189.30 ? 362 LEU B CD2 1 
ATOM   5406  N  N   . PHE B 1 363 ? 165.146 176.019 215.884 1.00 169.02 ? 363 PHE B N   1 
ATOM   5407  C  CA  . PHE B 1 363 ? 164.601 177.378 215.814 1.00 165.43 ? 363 PHE B CA  1 
ATOM   5408  C  C   . PHE B 1 363 ? 165.190 178.212 216.951 1.00 174.33 ? 363 PHE B C   1 
ATOM   5409  O  O   . PHE B 1 363 ? 165.679 179.310 216.703 1.00 173.90 ? 363 PHE B O   1 
ATOM   5410  C  CB  . PHE B 1 363 ? 163.058 177.362 215.877 1.00 162.71 ? 363 PHE B CB  1 
ATOM   5411  C  CG  . PHE B 1 363 ? 162.386 178.707 216.053 1.00 161.53 ? 363 PHE B CG  1 
ATOM   5412  C  CD1 . PHE B 1 363 ? 162.252 179.582 214.981 1.00 159.40 ? 363 PHE B CD1 1 
ATOM   5413  C  CD2 . PHE B 1 363 ? 161.858 179.084 217.283 1.00 165.74 ? 363 PHE B CD2 1 
ATOM   5414  C  CE1 . PHE B 1 363 ? 161.619 180.816 215.140 1.00 158.44 ? 363 PHE B CE1 1 
ATOM   5415  C  CE2 . PHE B 1 363 ? 161.228 180.321 217.442 1.00 166.70 ? 363 PHE B CE2 1 
ATOM   5416  C  CZ  . PHE B 1 363 ? 161.104 181.173 216.366 1.00 160.25 ? 363 PHE B CZ  1 
ATOM   5417  N  N   . ALA B 1 364 ? 165.178 177.662 218.185 1.00 175.74 ? 364 ALA B N   1 
ATOM   5418  C  CA  . ALA B 1 364 ? 165.723 178.291 219.390 1.00 181.63 ? 364 ALA B CA  1 
ATOM   5419  C  C   . ALA B 1 364 ? 167.225 178.557 219.247 1.00 189.57 ? 364 ALA B C   1 
ATOM   5420  O  O   . ALA B 1 364 ? 167.729 179.528 219.814 1.00 190.34 ? 364 ALA B O   1 
ATOM   5421  C  CB  . ALA B 1 364 ? 165.463 177.407 220.597 1.00 186.75 ? 364 ALA B CB  1 
ATOM   5422  N  N   . VAL B 1 365 ? 167.925 177.704 218.466 1.00 187.77 ? 365 VAL B N   1 
ATOM   5423  C  CA  . VAL B 1 365 ? 169.361 177.790 218.177 1.00 189.02 ? 365 VAL B CA  1 
ATOM   5424  C  C   . VAL B 1 365 ? 169.619 178.891 217.119 1.00 191.52 ? 365 VAL B C   1 
ATOM   5425  O  O   . VAL B 1 365 ? 170.590 179.642 217.254 1.00 192.67 ? 365 VAL B O   1 
ATOM   5426  C  CB  . VAL B 1 365 ? 169.923 176.402 217.730 1.00 191.80 ? 365 VAL B CB  1 
ATOM   5427  C  CG1 . VAL B 1 365 ? 171.346 176.501 217.181 1.00 192.49 ? 365 VAL B CG1 1 
ATOM   5428  C  CG2 . VAL B 1 365 ? 169.870 175.395 218.872 1.00 193.44 ? 365 VAL B CG2 1 
ATOM   5429  N  N   . LEU B 1 366 ? 168.745 178.995 216.094 1.00 184.43 ? 366 LEU B N   1 
ATOM   5430  C  CA  . LEU B 1 366 ? 168.907 179.939 214.985 1.00 180.95 ? 366 LEU B CA  1 
ATOM   5431  C  C   . LEU B 1 366 ? 168.173 181.291 215.149 1.00 184.10 ? 366 LEU B C   1 
ATOM   5432  O  O   . LEU B 1 366 ? 168.472 182.207 214.380 1.00 182.58 ? 366 LEU B O   1 
ATOM   5433  C  CB  . LEU B 1 366 ? 168.460 179.282 213.669 1.00 175.45 ? 366 LEU B CB  1 
ATOM   5434  C  CG  . LEU B 1 366 ? 169.383 178.204 213.094 1.00 181.89 ? 366 LEU B CG  1 
ATOM   5435  C  CD1 . LEU B 1 366 ? 168.608 177.244 212.210 1.00 177.42 ? 366 LEU B CD1 1 
ATOM   5436  C  CD2 . LEU B 1 366 ? 170.552 178.815 212.328 1.00 185.39 ? 366 LEU B CD2 1 
ATOM   5437  N  N   . ILE B 1 367 ? 167.245 181.436 216.129 1.00 181.46 ? 367 ILE B N   1 
ATOM   5438  C  CA  . ILE B 1 367 ? 166.485 182.686 216.345 1.00 179.68 ? 367 ILE B CA  1 
ATOM   5439  C  C   . ILE B 1 367 ? 167.425 183.858 216.756 1.00 188.40 ? 367 ILE B C   1 
ATOM   5440  O  O   . ILE B 1 367 ? 167.169 185.007 216.385 1.00 185.79 ? 367 ILE B O   1 
ATOM   5441  C  CB  . ILE B 1 367 ? 165.292 182.509 217.342 1.00 182.78 ? 367 ILE B CB  1 
ATOM   5442  C  CG1 . ILE B 1 367 ? 164.329 183.732 217.311 1.00 180.33 ? 367 ILE B CG1 1 
ATOM   5443  C  CG2 . ILE B 1 367 ? 165.749 182.119 218.769 1.00 190.12 ? 367 ILE B CG2 1 
ATOM   5444  C  CD1 . ILE B 1 367 ? 163.012 183.618 218.099 1.00 187.58 ? 367 ILE B CD1 1 
ATOM   5445  N  N   . GLY B 1 368 ? 168.503 183.537 217.473 1.00 191.39 ? 368 GLY B N   1 
ATOM   5446  C  CA  . GLY B 1 368 ? 169.494 184.505 217.935 1.00 193.15 ? 368 GLY B CA  1 
ATOM   5447  C  C   . GLY B 1 368 ? 170.338 185.123 216.835 1.00 195.45 ? 368 GLY B C   1 
ATOM   5448  O  O   . GLY B 1 368 ? 170.857 186.232 217.007 1.00 196.62 ? 368 GLY B O   1 
ATOM   5449  N  N   . ARG B 1 369 ? 170.486 184.410 215.699 1.00 191.19 ? 369 ARG B N   1 
ATOM   5450  C  CA  . ARG B 1 369 ? 171.267 184.865 214.551 1.00 190.40 ? 369 ARG B CA  1 
ATOM   5451  C  C   . ARG B 1 369 ? 170.525 185.978 213.799 1.00 188.26 ? 369 ARG B C   1 
ATOM   5452  O  O   . ARG B 1 369 ? 169.407 185.771 213.320 1.00 182.27 ? 369 ARG B O   1 
ATOM   5453  C  CB  . ARG B 1 369 ? 171.594 183.689 213.618 1.00 189.07 ? 369 ARG B CB  1 
ATOM   5454  N  N   . LYS B 1 370 ? 171.149 187.165 213.728 1.00 186.49 ? 370 LYS B N   1 
ATOM   5455  C  CA  . LYS B 1 370 ? 170.603 188.348 213.058 1.00 182.12 ? 370 LYS B CA  1 
ATOM   5456  C  C   . LYS B 1 370 ? 170.900 188.334 211.545 1.00 181.09 ? 370 LYS B C   1 
ATOM   5457  O  O   . LYS B 1 370 ? 170.318 189.126 210.799 1.00 176.37 ? 370 LYS B O   1 
ATOM   5458  C  CB  . LYS B 1 370 ? 171.163 189.625 213.702 1.00 189.40 ? 370 LYS B CB  1 
ATOM   5459  N  N   . GLU B 1 371 ? 171.796 187.428 211.102 1.00 178.71 ? 371 GLU B N   1 
ATOM   5460  C  CA  . GLU B 1 371 ? 172.208 187.267 209.706 1.00 175.72 ? 371 GLU B CA  1 
ATOM   5461  C  C   . GLU B 1 371 ? 171.069 186.738 208.828 1.00 171.58 ? 371 GLU B C   1 
ATOM   5462  O  O   . GLU B 1 371 ? 170.943 187.178 207.683 1.00 167.56 ? 371 GLU B O   1 
ATOM   5463  C  CB  . GLU B 1 371 ? 173.424 186.332 209.607 1.00 181.45 ? 371 GLU B CB  1 
ATOM   5464  N  N   . LEU B 1 372 ? 170.242 185.809 209.362 1.00 166.14 ? 372 LEU B N   1 
ATOM   5465  C  CA  . LEU B 1 372 ? 169.113 185.213 208.640 1.00 160.21 ? 372 LEU B CA  1 
ATOM   5466  C  C   . LEU B 1 372 ? 167.971 186.223 208.420 1.00 160.45 ? 372 LEU B C   1 
ATOM   5467  O  O   . LEU B 1 372 ? 167.260 186.114 207.416 1.00 155.68 ? 372 LEU B O   1 
ATOM   5468  C  CB  . LEU B 1 372 ? 168.590 183.964 209.361 1.00 160.24 ? 372 LEU B CB  1 
ATOM   5469  N  N   . PHE B 1 373 ? 167.807 187.203 209.340 1.00 158.80 ? 373 PHE B N   1 
ATOM   5470  C  CA  . PHE B 1 373 ? 166.788 188.258 209.239 1.00 155.27 ? 373 PHE B CA  1 
ATOM   5471  C  C   . PHE B 1 373 ? 167.187 189.289 208.179 1.00 159.15 ? 373 PHE B C   1 
ATOM   5472  O  O   . PHE B 1 373 ? 166.360 189.671 207.346 1.00 153.59 ? 373 PHE B O   1 
ATOM   5473  C  CB  . PHE B 1 373 ? 166.575 188.952 210.594 1.00 159.87 ? 373 PHE B CB  1 
ATOM   5474  C  CG  . PHE B 1 373 ? 165.804 188.158 211.618 1.00 161.14 ? 373 PHE B CG  1 
ATOM   5475  C  CD1 . PHE B 1 373 ? 166.459 187.309 212.501 1.00 168.27 ? 373 PHE B CD1 1 
ATOM   5476  C  CD2 . PHE B 1 373 ? 164.427 188.294 211.733 1.00 159.39 ? 373 PHE B CD2 1 
ATOM   5477  C  CE1 . PHE B 1 373 ? 165.746 186.588 213.463 1.00 169.82 ? 373 PHE B CE1 1 
ATOM   5478  C  CE2 . PHE B 1 373 ? 163.715 187.572 212.694 1.00 162.82 ? 373 PHE B CE2 1 
ATOM   5479  C  CZ  . PHE B 1 373 ? 164.380 186.727 213.555 1.00 165.17 ? 373 PHE B CZ  1 
ATOM   5480  N  N   . ALA B 1 374 ? 168.468 189.725 208.217 1.00 161.88 ? 374 ALA B N   1 
ATOM   5481  C  CA  . ALA B 1 374 ? 169.079 190.694 207.299 1.00 162.65 ? 374 ALA B CA  1 
ATOM   5482  C  C   . ALA B 1 374 ? 169.076 190.180 205.857 1.00 163.74 ? 374 ALA B C   1 
ATOM   5483  O  O   . ALA B 1 374 ? 169.021 190.980 204.919 1.00 161.56 ? 374 ALA B O   1 
ATOM   5484  C  CB  . ALA B 1 374 ? 170.504 191.002 207.742 1.00 169.62 ? 374 ALA B CB  1 
ATOM   5485  N  N   . ALA B 1 375 ? 169.125 188.845 205.695 1.00 160.00 ? 375 ALA B N   1 
ATOM   5486  C  CA  . ALA B 1 375 ? 169.099 188.152 204.412 1.00 157.18 ? 375 ALA B CA  1 
ATOM   5487  C  C   . ALA B 1 375 ? 167.816 188.468 203.640 1.00 156.40 ? 375 ALA B C   1 
ATOM   5488  O  O   . ALA B 1 375 ? 167.881 188.767 202.447 1.00 154.42 ? 375 ALA B O   1 
ATOM   5489  C  CB  . ALA B 1 375 ? 169.212 186.650 204.638 1.00 158.40 ? 375 ALA B CB  1 
ATOM   5490  N  N   . PHE B 1 376 ? 166.662 188.447 204.340 1.00 151.04 ? 376 PHE B N   1 
ATOM   5491  C  CA  . PHE B 1 376 ? 165.337 188.661 203.760 1.00 146.08 ? 376 PHE B CA  1 
ATOM   5492  C  C   . PHE B 1 376 ? 164.860 190.131 203.810 1.00 150.15 ? 376 PHE B C   1 
ATOM   5493  O  O   . PHE B 1 376 ? 163.747 190.419 203.358 1.00 146.13 ? 376 PHE B O   1 
ATOM   5494  C  CB  . PHE B 1 376 ? 164.316 187.730 204.437 1.00 145.89 ? 376 PHE B CB  1 
ATOM   5495  C  CG  . PHE B 1 376 ? 164.506 186.284 204.047 1.00 146.86 ? 376 PHE B CG  1 
ATOM   5496  C  CD1 . PHE B 1 376 ? 163.938 185.782 202.882 1.00 146.42 ? 376 PHE B CD1 1 
ATOM   5497  C  CD2 . PHE B 1 376 ? 165.278 185.431 204.828 1.00 152.44 ? 376 PHE B CD2 1 
ATOM   5498  C  CE1 . PHE B 1 376 ? 164.129 184.450 202.509 1.00 147.34 ? 376 PHE B CE1 1 
ATOM   5499  C  CE2 . PHE B 1 376 ? 165.471 184.098 204.452 1.00 155.21 ? 376 PHE B CE2 1 
ATOM   5500  C  CZ  . PHE B 1 376 ? 164.890 183.616 203.297 1.00 149.75 ? 376 PHE B CZ  1 
ATOM   5501  N  N   . GLY B 1 377 ? 165.710 191.037 204.296 1.00 151.00 ? 377 GLY B N   1 
ATOM   5502  C  CA  . GLY B 1 377 ? 165.409 192.466 204.335 1.00 151.27 ? 377 GLY B CA  1 
ATOM   5503  C  C   . GLY B 1 377 ? 165.073 193.082 205.679 1.00 158.74 ? 377 GLY B C   1 
ATOM   5504  O  O   . GLY B 1 377 ? 164.730 194.267 205.730 1.00 158.67 ? 377 GLY B O   1 
ATOM   5505  N  N   . PHE B 1 378 ? 165.170 192.307 206.777 1.00 158.09 ? 378 PHE B N   1 
ATOM   5506  C  CA  . PHE B 1 378 ? 164.876 192.791 208.130 1.00 160.97 ? 378 PHE B CA  1 
ATOM   5507  C  C   . PHE B 1 378 ? 166.175 193.206 208.813 1.00 172.45 ? 378 PHE B C   1 
ATOM   5508  O  O   . PHE B 1 378 ? 166.937 192.350 209.268 1.00 175.27 ? 378 PHE B O   1 
ATOM   5509  C  CB  . PHE B 1 378 ? 164.128 191.718 208.941 1.00 161.87 ? 378 PHE B CB  1 
ATOM   5510  C  CG  . PHE B 1 378 ? 162.740 191.426 208.429 1.00 158.43 ? 378 PHE B CG  1 
ATOM   5511  C  CD1 . PHE B 1 378 ? 162.538 190.531 207.384 1.00 158.10 ? 378 PHE B CD1 1 
ATOM   5512  C  CD2 . PHE B 1 378 ? 161.631 192.042 208.993 1.00 159.88 ? 378 PHE B CD2 1 
ATOM   5513  C  CE1 . PHE B 1 378 ? 161.255 190.275 206.897 1.00 154.72 ? 378 PHE B CE1 1 
ATOM   5514  C  CE2 . PHE B 1 378 ? 160.345 191.777 208.514 1.00 158.44 ? 378 PHE B CE2 1 
ATOM   5515  C  CZ  . PHE B 1 378 ? 160.165 190.889 207.474 1.00 153.10 ? 378 PHE B CZ  1 
ATOM   5516  N  N   . TYR B 1 379 ? 166.442 194.522 208.858 1.00 172.18 ? 379 TYR B N   1 
ATOM   5517  C  CA  . TYR B 1 379 ? 167.677 195.057 209.438 1.00 178.47 ? 379 TYR B CA  1 
ATOM   5518  C  C   . TYR B 1 379 ? 167.439 195.776 210.771 1.00 186.47 ? 379 TYR B C   1 
ATOM   5519  O  O   . TYR B 1 379 ? 168.195 195.557 211.719 1.00 191.25 ? 379 TYR B O   1 
ATOM   5520  C  CB  . TYR B 1 379 ? 168.373 196.015 208.449 1.00 180.59 ? 379 TYR B CB  1 
ATOM   5521  C  CG  . TYR B 1 379 ? 168.598 195.439 207.067 1.00 179.25 ? 379 TYR B CG  1 
ATOM   5522  C  CD1 . TYR B 1 379 ? 169.705 194.639 206.795 1.00 183.64 ? 379 TYR B CD1 1 
ATOM   5523  C  CD2 . TYR B 1 379 ? 167.729 195.728 206.019 1.00 174.98 ? 379 TYR B CD2 1 
ATOM   5524  C  CE1 . TYR B 1 379 ? 169.925 194.116 205.521 1.00 181.71 ? 379 TYR B CE1 1 
ATOM   5525  C  CE2 . TYR B 1 379 ? 167.940 195.213 204.740 1.00 173.23 ? 379 TYR B CE2 1 
ATOM   5526  C  CZ  . TYR B 1 379 ? 169.040 194.407 204.496 1.00 182.55 ? 379 TYR B CZ  1 
ATOM   5527  O  OH  . TYR B 1 379 ? 169.259 193.898 203.240 1.00 180.72 ? 379 TYR B OH  1 
ATOM   5528  N  N   . ASP B 1 380 ? 166.406 196.643 210.832 1.00 180.96 ? 380 ASP B N   1 
ATOM   5529  C  CA  . ASP B 1 380 ? 166.055 197.451 212.006 1.00 184.06 ? 380 ASP B CA  1 
ATOM   5530  C  C   . ASP B 1 380 ? 165.534 196.617 213.186 1.00 188.24 ? 380 ASP B C   1 
ATOM   5531  O  O   . ASP B 1 380 ? 165.758 197.007 214.334 1.00 192.81 ? 380 ASP B O   1 
ATOM   5532  C  CB  . ASP B 1 380 ? 165.010 198.514 211.634 1.00 183.10 ? 380 ASP B CB  1 
ATOM   5533  N  N   . SER B 1 381 ? 164.827 195.501 212.915 1.00 179.87 ? 381 SER B N   1 
ATOM   5534  C  CA  . SER B 1 381 ? 164.263 194.653 213.967 1.00 180.41 ? 381 SER B CA  1 
ATOM   5535  C  C   . SER B 1 381 ? 164.265 193.169 213.596 1.00 181.15 ? 381 SER B C   1 
ATOM   5536  O  O   . SER B 1 381 ? 164.317 192.820 212.415 1.00 177.00 ? 381 SER B O   1 
ATOM   5537  C  CB  . SER B 1 381 ? 162.837 195.092 214.296 1.00 181.67 ? 381 SER B CB  1 
ATOM   5538  O  OG  . SER B 1 381 ? 161.958 194.925 213.194 1.00 182.92 ? 381 SER B OG  1 
ATOM   5539  N  N   . GLN B 1 382 ? 164.189 192.302 214.622 1.00 179.52 ? 382 GLN B N   1 
ATOM   5540  C  CA  . GLN B 1 382 ? 164.125 190.848 214.486 1.00 177.20 ? 382 GLN B CA  1 
ATOM   5541  C  C   . GLN B 1 382 ? 162.775 190.365 215.062 1.00 177.59 ? 382 GLN B C   1 
ATOM   5542  O  O   . GLN B 1 382 ? 162.713 189.971 216.231 1.00 180.67 ? 382 GLN B O   1 
ATOM   5543  C  CB  . GLN B 1 382 ? 165.330 190.182 215.178 1.00 184.00 ? 382 GLN B CB  1 
ATOM   5544  N  N   . PRO B 1 383 ? 161.669 190.438 214.277 1.00 167.88 ? 383 PRO B N   1 
ATOM   5545  C  CA  . PRO B 1 383 ? 160.355 190.042 214.816 1.00 166.02 ? 383 PRO B CA  1 
ATOM   5546  C  C   . PRO B 1 383 ? 160.207 188.533 214.994 1.00 169.24 ? 383 PRO B C   1 
ATOM   5547  O  O   . PRO B 1 383 ? 160.776 187.761 214.219 1.00 167.68 ? 383 PRO B O   1 
ATOM   5548  C  CB  . PRO B 1 383 ? 159.369 190.572 213.772 1.00 162.47 ? 383 PRO B CB  1 
ATOM   5549  C  CG  . PRO B 1 383 ? 160.169 191.484 212.875 1.00 166.34 ? 383 PRO B CG  1 
ATOM   5550  C  CD  . PRO B 1 383 ? 161.540 190.911 212.887 1.00 164.71 ? 383 PRO B CD  1 
ATOM   5551  N  N   . THR B 1 384 ? 159.428 188.122 216.017 1.00 166.53 ? 384 THR B N   1 
ATOM   5552  C  CA  . THR B 1 384 ? 159.196 186.724 216.392 1.00 166.09 ? 384 THR B CA  1 
ATOM   5553  C  C   . THR B 1 384 ? 158.454 185.954 215.285 1.00 161.92 ? 384 THR B C   1 
ATOM   5554  O  O   . THR B 1 384 ? 158.931 184.892 214.884 1.00 160.94 ? 384 THR B O   1 
ATOM   5555  C  CB  . THR B 1 384 ? 158.460 186.637 217.740 1.00 180.81 ? 384 THR B CB  1 
ATOM   5556  O  OG1 . THR B 1 384 ? 159.100 187.495 218.691 1.00 186.75 ? 384 THR B OG1 1 
ATOM   5557  C  CG2 . THR B 1 384 ? 158.410 185.213 218.288 1.00 182.26 ? 384 THR B CG2 1 
ATOM   5558  N  N   . LEU B 1 385 ? 157.314 186.484 214.792 1.00 153.14 ? 385 LEU B N   1 
ATOM   5559  C  CA  . LEU B 1 385 ? 156.516 185.850 213.734 1.00 147.46 ? 385 LEU B CA  1 
ATOM   5560  C  C   . LEU B 1 385 ? 157.328 185.693 212.445 1.00 146.96 ? 385 LEU B C   1 
ATOM   5561  O  O   . LEU B 1 385 ? 157.218 184.664 211.777 1.00 144.31 ? 385 LEU B O   1 
ATOM   5562  C  CB  . LEU B 1 385 ? 155.234 186.659 213.462 1.00 144.83 ? 385 LEU B CB  1 
ATOM   5563  C  CG  . LEU B 1 385 ? 154.178 185.996 212.566 1.00 145.27 ? 385 LEU B CG  1 
ATOM   5564  C  CD1 . LEU B 1 385 ? 153.272 185.068 213.363 1.00 146.53 ? 385 LEU B CD1 1 
ATOM   5565  C  CD2 . LEU B 1 385 ? 153.339 187.030 211.886 1.00 144.87 ? 385 LEU B CD2 1 
ATOM   5566  N  N   . ILE B 1 386 ? 158.160 186.703 212.127 1.00 142.84 ? 386 ILE B N   1 
ATOM   5567  C  CA  . ILE B 1 386 ? 159.043 186.743 210.959 1.00 140.32 ? 386 ILE B CA  1 
ATOM   5568  C  C   . ILE B 1 386 ? 160.139 185.675 211.113 1.00 145.76 ? 386 ILE B C   1 
ATOM   5569  O  O   . ILE B 1 386 ? 160.507 185.028 210.130 1.00 143.25 ? 386 ILE B O   1 
ATOM   5570  C  CB  . ILE B 1 386 ? 159.608 188.181 210.772 1.00 144.17 ? 386 ILE B CB  1 
ATOM   5571  C  CG1 . ILE B 1 386 ? 158.497 189.204 210.377 1.00 141.48 ? 386 ILE B CG1 1 
ATOM   5572  C  CG2 . ILE B 1 386 ? 160.818 188.240 209.833 1.00 144.72 ? 386 ILE B CG2 1 
ATOM   5573  C  CD1 . ILE B 1 386 ? 157.562 188.866 209.140 1.00 142.64 ? 386 ILE B CD1 1 
ATOM   5574  N  N   . GLY B 1 387 ? 160.609 185.483 212.345 1.00 146.50 ? 387 GLY B N   1 
ATOM   5575  C  CA  . GLY B 1 387 ? 161.597 184.466 212.682 1.00 149.60 ? 387 GLY B CA  1 
ATOM   5576  C  C   . GLY B 1 387 ? 161.055 183.071 212.437 1.00 151.45 ? 387 GLY B C   1 
ATOM   5577  O  O   . GLY B 1 387 ? 161.767 182.205 211.918 1.00 151.49 ? 387 GLY B O   1 
ATOM   5578  N  N   . LEU B 1 388 ? 159.764 182.866 212.777 1.00 145.75 ? 388 LEU B N   1 
ATOM   5579  C  CA  . LEU B 1 388 ? 159.048 181.610 212.568 1.00 143.47 ? 388 LEU B CA  1 
ATOM   5580  C  C   . LEU B 1 388 ? 158.896 181.333 211.072 1.00 143.43 ? 388 LEU B C   1 
ATOM   5581  O  O   . LEU B 1 388 ? 159.017 180.186 210.659 1.00 142.35 ? 388 LEU B O   1 
ATOM   5582  C  CB  . LEU B 1 388 ? 157.668 181.638 213.253 1.00 142.55 ? 388 LEU B CB  1 
ATOM   5583  C  CG  . LEU B 1 388 ? 157.639 181.442 214.769 1.00 151.35 ? 388 LEU B CG  1 
ATOM   5584  C  CD1 . LEU B 1 388 ? 156.452 182.152 215.380 1.00 151.01 ? 388 LEU B CD1 1 
ATOM   5585  C  CD2 . LEU B 1 388 ? 157.602 179.965 215.139 1.00 154.99 ? 388 LEU B CD2 1 
ATOM   5586  N  N   . LEU B 1 389 ? 158.669 182.382 210.258 1.00 137.93 ? 389 LEU B N   1 
ATOM   5587  C  CA  . LEU B 1 389 ? 158.519 182.243 208.809 1.00 134.55 ? 389 LEU B CA  1 
ATOM   5588  C  C   . LEU B 1 389 ? 159.857 181.932 208.132 1.00 140.64 ? 389 LEU B C   1 
ATOM   5589  O  O   . LEU B 1 389 ? 159.928 180.977 207.364 1.00 138.91 ? 389 LEU B O   1 
ATOM   5590  C  CB  . LEU B 1 389 ? 157.894 183.504 208.171 1.00 131.90 ? 389 LEU B CB  1 
ATOM   5591  C  CG  . LEU B 1 389 ? 156.458 183.879 208.565 1.00 135.31 ? 389 LEU B CG  1 
ATOM   5592  C  CD1 . LEU B 1 389 ? 156.132 185.292 208.129 1.00 133.84 ? 389 LEU B CD1 1 
ATOM   5593  C  CD2 . LEU B 1 389 ? 155.443 182.918 207.971 1.00 135.64 ? 389 LEU B CD2 1 
ATOM   5594  N  N   . ILE B 1 390 ? 160.912 182.725 208.423 1.00 141.04 ? 390 ILE B N   1 
ATOM   5595  C  CA  . ILE B 1 390 ? 162.240 182.582 207.813 1.00 142.91 ? 390 ILE B CA  1 
ATOM   5596  C  C   . ILE B 1 390 ? 162.871 181.206 208.119 1.00 150.39 ? 390 ILE B C   1 
ATOM   5597  O  O   . ILE B 1 390 ? 163.261 180.507 207.184 1.00 148.95 ? 390 ILE B O   1 
ATOM   5598  C  CB  . ILE B 1 390 ? 163.187 183.747 208.217 1.00 148.86 ? 390 ILE B CB  1 
ATOM   5599  N  N   . ILE B 1 391 ? 162.940 180.807 209.401 1.00 151.11 ? 391 ILE B N   1 
ATOM   5600  C  CA  . ILE B 1 391 ? 163.572 179.550 209.811 1.00 154.46 ? 391 ILE B CA  1 
ATOM   5601  C  C   . ILE B 1 391 ? 162.715 178.326 209.404 1.00 157.09 ? 391 ILE B C   1 
ATOM   5602  O  O   . ILE B 1 391 ? 163.256 177.409 208.782 1.00 157.33 ? 391 ILE B O   1 
ATOM   5603  C  CB  . ILE B 1 391 ? 163.924 179.562 211.334 1.00 162.37 ? 391 ILE B CB  1 
ATOM   5604  C  CG1 . ILE B 1 391 ? 164.947 180.685 211.648 1.00 165.89 ? 391 ILE B CG1 1 
ATOM   5605  C  CG2 . ILE B 1 391 ? 164.474 178.207 211.797 1.00 166.70 ? 391 ILE B CG2 1 
ATOM   5606  C  CD1 . ILE B 1 391 ? 164.943 181.236 213.084 1.00 175.88 ? 391 ILE B CD1 1 
ATOM   5607  N  N   . PHE B 1 392 ? 161.407 178.313 209.735 1.00 152.13 ? 392 PHE B N   1 
ATOM   5608  C  CA  . PHE B 1 392 ? 160.535 177.169 209.449 1.00 150.43 ? 392 PHE B CA  1 
ATOM   5609  C  C   . PHE B 1 392 ? 160.192 176.990 207.965 1.00 151.49 ? 392 PHE B C   1 
ATOM   5610  O  O   . PHE B 1 392 ? 160.125 175.845 207.512 1.00 151.21 ? 392 PHE B O   1 
ATOM   5611  C  CB  . PHE B 1 392 ? 159.234 177.232 210.262 1.00 151.31 ? 392 PHE B CB  1 
ATOM   5612  C  CG  . PHE B 1 392 ? 159.346 176.783 211.701 1.00 157.24 ? 392 PHE B CG  1 
ATOM   5613  C  CD1 . PHE B 1 392 ? 159.776 177.658 212.690 1.00 163.33 ? 392 PHE B CD1 1 
ATOM   5614  C  CD2 . PHE B 1 392 ? 158.987 175.494 212.074 1.00 160.88 ? 392 PHE B CD2 1 
ATOM   5615  C  CE1 . PHE B 1 392 ? 159.865 177.242 214.024 1.00 168.56 ? 392 PHE B CE1 1 
ATOM   5616  C  CE2 . PHE B 1 392 ? 159.070 175.084 213.410 1.00 167.86 ? 392 PHE B CE2 1 
ATOM   5617  C  CZ  . PHE B 1 392 ? 159.515 175.958 214.373 1.00 168.84 ? 392 PHE B CZ  1 
ATOM   5618  N  N   . GLN B 1 393 ? 159.955 178.082 207.216 1.00 145.82 ? 393 GLN B N   1 
ATOM   5619  C  CA  . GLN B 1 393 ? 159.551 177.950 205.813 1.00 142.65 ? 393 GLN B CA  1 
ATOM   5620  C  C   . GLN B 1 393 ? 160.697 178.127 204.797 1.00 147.77 ? 393 GLN B C   1 
ATOM   5621  O  O   . GLN B 1 393 ? 160.498 177.765 203.633 1.00 145.72 ? 393 GLN B O   1 
ATOM   5622  C  CB  . GLN B 1 393 ? 158.406 178.928 205.477 1.00 140.74 ? 393 GLN B CB  1 
ATOM   5623  C  CG  . GLN B 1 393 ? 157.386 178.396 204.461 1.00 164.33 ? 393 GLN B CG  1 
ATOM   5624  C  CD  . GLN B 1 393 ? 156.579 177.211 204.959 1.00 196.80 ? 393 GLN B CD  1 
ATOM   5625  O  OE1 . GLN B 1 393 ? 155.891 177.275 205.986 1.00 195.85 ? 393 GLN B OE1 1 
ATOM   5626  N  NE2 . GLN B 1 393 ? 156.625 176.104 204.223 1.00 191.80 ? 393 GLN B NE2 1 
ATOM   5627  N  N   . PHE B 1 394 ? 161.879 178.654 205.200 1.00 147.28 ? 394 PHE B N   1 
ATOM   5628  C  CA  . PHE B 1 394 ? 162.960 178.847 204.224 1.00 147.67 ? 394 PHE B CA  1 
ATOM   5629  C  C   . PHE B 1 394 ? 164.254 178.117 204.584 1.00 155.67 ? 394 PHE B C   1 
ATOM   5630  O  O   . PHE B 1 394 ? 164.808 177.443 203.716 1.00 155.50 ? 394 PHE B O   1 
ATOM   5631  C  CB  . PHE B 1 394 ? 163.246 180.337 203.980 1.00 148.80 ? 394 PHE B CB  1 
ATOM   5632  C  CG  . PHE B 1 394 ? 162.073 181.119 203.435 1.00 146.06 ? 394 PHE B CG  1 
ATOM   5633  C  CD1 . PHE B 1 394 ? 161.563 180.851 202.168 1.00 146.01 ? 394 PHE B CD1 1 
ATOM   5634  C  CD2 . PHE B 1 394 ? 161.490 182.136 204.180 1.00 147.53 ? 394 PHE B CD2 1 
ATOM   5635  C  CE1 . PHE B 1 394 ? 160.479 181.572 201.669 1.00 143.48 ? 394 PHE B CE1 1 
ATOM   5636  C  CE2 . PHE B 1 394 ? 160.412 182.863 203.676 1.00 146.81 ? 394 PHE B CE2 1 
ATOM   5637  C  CZ  . PHE B 1 394 ? 159.914 182.577 202.424 1.00 142.08 ? 394 PHE B CZ  1 
ATOM   5638  N  N   . ILE B 1 395 ? 164.753 178.265 205.830 1.00 156.07 ? 395 ILE B N   1 
ATOM   5639  C  CA  . ILE B 1 395 ? 165.999 177.625 206.278 1.00 160.68 ? 395 ILE B CA  1 
ATOM   5640  C  C   . ILE B 1 395 ? 165.813 176.098 206.391 1.00 164.82 ? 395 ILE B C   1 
ATOM   5641  O  O   . ILE B 1 395 ? 166.707 175.347 205.996 1.00 166.61 ? 395 ILE B O   1 
ATOM   5642  C  CB  . ILE B 1 395 ? 166.507 178.242 207.606 1.00 167.58 ? 395 ILE B CB  1 
ATOM   5643  N  N   . PHE B 1 396 ? 164.639 175.650 206.885 1.00 159.20 ? 396 PHE B N   1 
ATOM   5644  C  CA  . PHE B 1 396 ? 164.309 174.234 207.051 1.00 159.68 ? 396 PHE B CA  1 
ATOM   5645  C  C   . PHE B 1 396 ? 163.854 173.569 205.741 1.00 161.67 ? 396 PHE B C   1 
ATOM   5646  O  O   . PHE B 1 396 ? 163.664 172.350 205.739 1.00 162.56 ? 396 PHE B O   1 
ATOM   5647  C  CB  . PHE B 1 396 ? 163.218 174.050 208.125 1.00 160.65 ? 396 PHE B CB  1 
ATOM   5648  C  CG  . PHE B 1 396 ? 163.614 174.270 209.568 1.00 165.88 ? 396 PHE B CG  1 
ATOM   5649  C  CD1 . PHE B 1 396 ? 164.952 174.300 209.946 1.00 173.58 ? 396 PHE B CD1 1 
ATOM   5650  C  CD2 . PHE B 1 396 ? 162.647 174.400 210.556 1.00 167.56 ? 396 PHE B CD2 1 
ATOM   5651  C  CE1 . PHE B 1 396 ? 165.314 174.500 211.280 1.00 178.86 ? 396 PHE B CE1 1 
ATOM   5652  C  CE2 . PHE B 1 396 ? 163.009 174.597 211.891 1.00 174.81 ? 396 PHE B CE2 1 
ATOM   5653  C  CZ  . PHE B 1 396 ? 164.340 174.638 212.244 1.00 177.64 ? 396 PHE B CZ  1 
ATOM   5654  N  N   . SER B 1 397 ? 163.698 174.349 204.634 1.00 155.46 ? 397 SER B N   1 
ATOM   5655  C  CA  . SER B 1 397 ? 163.261 173.856 203.312 1.00 152.90 ? 397 SER B CA  1 
ATOM   5656  C  C   . SER B 1 397 ? 163.960 172.539 202.894 1.00 158.85 ? 397 SER B C   1 
ATOM   5657  O  O   . SER B 1 397 ? 163.228 171.597 202.569 1.00 157.37 ? 397 SER B O   1 
ATOM   5658  C  CB  . SER B 1 397 ? 163.453 174.913 202.228 1.00 155.21 ? 397 SER B CB  1 
ATOM   5659  O  OG  . SER B 1 397 ? 162.647 176.052 202.471 1.00 162.99 ? 397 SER B OG  1 
ATOM   5660  N  N   . PRO B 1 398 ? 165.318 172.392 202.954 1.00 158.70 ? 398 PRO B N   1 
ATOM   5661  C  CA  . PRO B 1 398 ? 165.917 171.099 202.579 1.00 161.43 ? 398 PRO B CA  1 
ATOM   5662  C  C   . PRO B 1 398 ? 165.443 169.935 203.456 1.00 166.63 ? 398 PRO B C   1 
ATOM   5663  O  O   . PRO B 1 398 ? 165.110 168.884 202.909 1.00 166.13 ? 398 PRO B O   1 
ATOM   5664  C  CB  . PRO B 1 398 ? 167.423 171.342 202.716 1.00 167.59 ? 398 PRO B CB  1 
ATOM   5665  C  CG  . PRO B 1 398 ? 167.552 172.532 203.587 1.00 172.03 ? 398 PRO B CG  1 
ATOM   5666  C  CD  . PRO B 1 398 ? 166.368 173.378 203.294 1.00 162.35 ? 398 PRO B CD  1 
ATOM   5667  N  N   . TYR B 1 399 ? 165.363 170.139 204.792 1.00 164.46 ? 399 TYR B N   1 
ATOM   5668  C  CA  . TYR B 1 399 ? 164.908 169.133 205.760 1.00 166.04 ? 399 TYR B CA  1 
ATOM   5669  C  C   . TYR B 1 399 ? 163.447 168.768 205.509 1.00 165.78 ? 399 TYR B C   1 
ATOM   5670  O  O   . TYR B 1 399 ? 163.112 167.585 205.454 1.00 166.22 ? 399 TYR B O   1 
ATOM   5671  C  CB  . TYR B 1 399 ? 165.106 169.636 207.210 1.00 169.62 ? 399 TYR B CB  1 
ATOM   5672  C  CG  . TYR B 1 399 ? 164.293 168.894 208.254 1.00 172.17 ? 399 TYR B CG  1 
ATOM   5673  C  CD1 . TYR B 1 399 ? 164.702 167.652 208.734 1.00 178.23 ? 399 TYR B CD1 1 
ATOM   5674  C  CD2 . TYR B 1 399 ? 163.126 169.445 208.777 1.00 170.02 ? 399 TYR B CD2 1 
ATOM   5675  C  CE1 . TYR B 1 399 ? 163.957 166.965 209.693 1.00 179.92 ? 399 TYR B CE1 1 
ATOM   5676  C  CE2 . TYR B 1 399 ? 162.375 168.768 209.737 1.00 172.15 ? 399 TYR B CE2 1 
ATOM   5677  C  CZ  . TYR B 1 399 ? 162.797 167.531 210.198 1.00 182.78 ? 399 TYR B CZ  1 
ATOM   5678  O  OH  . TYR B 1 399 ? 162.064 166.864 211.151 1.00 183.99 ? 399 TYR B OH  1 
ATOM   5679  N  N   . ASN B 1 400 ? 162.589 169.787 205.362 1.00 158.49 ? 400 ASN B N   1 
ATOM   5680  C  CA  . ASN B 1 400 ? 161.161 169.627 205.118 1.00 154.98 ? 400 ASN B CA  1 
ATOM   5681  C  C   . ASN B 1 400 ? 160.909 168.798 203.860 1.00 158.06 ? 400 ASN B C   1 
ATOM   5682  O  O   . ASN B 1 400 ? 160.044 167.925 203.887 1.00 157.08 ? 400 ASN B O   1 
ATOM   5683  C  CB  . ASN B 1 400 ? 160.478 170.995 205.008 1.00 152.56 ? 400 ASN B CB  1 
ATOM   5684  C  CG  . ASN B 1 400 ? 160.531 171.844 206.265 1.00 175.91 ? 400 ASN B CG  1 
ATOM   5685  O  OD1 . ASN B 1 400 ? 160.528 171.346 207.401 1.00 173.04 ? 400 ASN B OD1 1 
ATOM   5686  N  ND2 . ASN B 1 400 ? 160.541 173.159 206.085 1.00 164.54 ? 400 ASN B ND2 1 
ATOM   5687  N  N   . GLU B 1 401 ? 161.700 169.029 202.786 1.00 155.25 ? 401 GLU B N   1 
ATOM   5688  C  CA  . GLU B 1 401 ? 161.576 168.311 201.514 1.00 154.79 ? 401 GLU B CA  1 
ATOM   5689  C  C   . GLU B 1 401 ? 161.969 166.843 201.642 1.00 161.97 ? 401 GLU B C   1 
ATOM   5690  O  O   . GLU B 1 401 ? 161.306 165.993 201.043 1.00 161.33 ? 401 GLU B O   1 
ATOM   5691  C  CB  . GLU B 1 401 ? 162.409 168.978 200.408 1.00 156.05 ? 401 GLU B CB  1 
ATOM   5692  C  CG  . GLU B 1 401 ? 161.666 170.072 199.654 1.00 165.51 ? 401 GLU B CG  1 
ATOM   5693  C  CD  . GLU B 1 401 ? 160.405 169.663 198.908 1.00 188.70 ? 401 GLU B CD  1 
ATOM   5694  O  OE1 . GLU B 1 401 ? 160.388 168.568 198.297 1.00 189.19 ? 401 GLU B OE1 1 
ATOM   5695  O  OE2 . GLU B 1 401 ? 159.434 170.454 198.924 1.00 179.71 ? 401 GLU B OE2 1 
ATOM   5696  N  N   . VAL B 1 402 ? 163.040 166.547 202.414 1.00 161.76 ? 402 VAL B N   1 
ATOM   5697  C  CA  . VAL B 1 402 ? 163.531 165.183 202.646 1.00 165.31 ? 402 VAL B CA  1 
ATOM   5698  C  C   . VAL B 1 402 ? 162.500 164.433 203.509 1.00 168.99 ? 402 VAL B C   1 
ATOM   5699  O  O   . VAL B 1 402 ? 162.073 163.345 203.119 1.00 169.08 ? 402 VAL B O   1 
ATOM   5700  C  CB  . VAL B 1 402 ? 164.964 165.163 203.257 1.00 173.57 ? 402 VAL B CB  1 
ATOM   5701  C  CG1 . VAL B 1 402 ? 165.359 163.767 203.735 1.00 178.01 ? 402 VAL B CG1 1 
ATOM   5702  C  CG2 . VAL B 1 402 ? 165.994 165.689 202.261 1.00 173.88 ? 402 VAL B CG2 1 
ATOM   5703  N  N   . LEU B 1 403 ? 162.067 165.044 204.639 1.00 165.13 ? 403 LEU B N   1 
ATOM   5704  C  CA  . LEU B 1 403 ? 161.073 164.490 205.567 1.00 165.50 ? 403 LEU B CA  1 
ATOM   5705  C  C   . LEU B 1 403 ? 159.762 164.155 204.845 1.00 167.13 ? 403 LEU B C   1 
ATOM   5706  O  O   . LEU B 1 403 ? 159.193 163.092 205.102 1.00 168.24 ? 403 LEU B O   1 
ATOM   5707  C  CB  . LEU B 1 403 ? 160.809 165.476 206.722 1.00 165.04 ? 403 LEU B CB  1 
ATOM   5708  C  CG  . LEU B 1 403 ? 159.921 164.975 207.862 1.00 171.06 ? 403 LEU B CG  1 
ATOM   5709  C  CD1 . LEU B 1 403 ? 160.751 164.455 209.012 1.00 176.49 ? 403 LEU B CD1 1 
ATOM   5710  C  CD2 . LEU B 1 403 ? 158.994 166.067 208.350 1.00 170.83 ? 403 LEU B CD2 1 
ATOM   5711  N  N   . SER B 1 404 ? 159.300 165.051 203.937 1.00 160.39 ? 404 SER B N   1 
ATOM   5712  C  CA  . SER B 1 404 ? 158.076 164.870 203.147 1.00 157.42 ? 404 SER B CA  1 
ATOM   5713  C  C   . SER B 1 404 ? 158.200 163.685 202.199 1.00 162.88 ? 404 SER B C   1 
ATOM   5714  O  O   . SER B 1 404 ? 157.230 162.943 202.037 1.00 162.34 ? 404 SER B O   1 
ATOM   5715  C  CB  . SER B 1 404 ? 157.741 166.129 202.358 1.00 157.30 ? 404 SER B CB  1 
ATOM   5716  O  OG  . SER B 1 404 ? 157.312 167.161 203.229 1.00 166.56 ? 404 SER B OG  1 
ATOM   5717  N  N   . PHE B 1 405 ? 159.395 163.497 201.592 1.00 161.07 ? 405 PHE B N   1 
ATOM   5718  C  CA  . PHE B 1 405 ? 159.661 162.375 200.693 1.00 162.73 ? 405 PHE B CA  1 
ATOM   5719  C  C   . PHE B 1 405 ? 159.668 161.065 201.481 1.00 169.42 ? 405 PHE B C   1 
ATOM   5720  O  O   . PHE B 1 405 ? 159.116 160.073 201.008 1.00 169.62 ? 405 PHE B O   1 
ATOM   5721  C  CB  . PHE B 1 405 ? 160.982 162.562 199.925 1.00 166.21 ? 405 PHE B CB  1 
ATOM   5722  C  CG  . PHE B 1 405 ? 161.364 161.368 199.076 1.00 170.75 ? 405 PHE B CG  1 
ATOM   5723  C  CD1 . PHE B 1 405 ? 160.673 161.075 197.905 1.00 172.25 ? 405 PHE B CD1 1 
ATOM   5724  C  CD2 . PHE B 1 405 ? 162.395 160.522 199.462 1.00 177.61 ? 405 PHE B CD2 1 
ATOM   5725  C  CE1 . PHE B 1 405 ? 161.014 159.962 197.132 1.00 176.31 ? 405 PHE B CE1 1 
ATOM   5726  C  CE2 . PHE B 1 405 ? 162.733 159.408 198.689 1.00 183.58 ? 405 PHE B CE2 1 
ATOM   5727  C  CZ  . PHE B 1 405 ? 162.042 159.138 197.528 1.00 180.06 ? 405 PHE B CZ  1 
ATOM   5728  N  N   . CYS B 1 406 ? 160.276 161.076 202.682 1.00 168.23 ? 406 CYS B N   1 
ATOM   5729  C  CA  . CYS B 1 406 ? 160.354 159.918 203.570 1.00 172.27 ? 406 CYS B CA  1 
ATOM   5730  C  C   . CYS B 1 406 ? 158.960 159.529 204.062 1.00 174.50 ? 406 CYS B C   1 
ATOM   5731  O  O   . CYS B 1 406 ? 158.652 158.341 204.123 1.00 176.90 ? 406 CYS B O   1 
ATOM   5732  C  CB  . CYS B 1 406 ? 161.302 160.188 204.736 1.00 175.79 ? 406 CYS B CB  1 
ATOM   5733  S  SG  . CYS B 1 406 ? 163.046 160.342 204.260 1.00 182.85 ? 406 CYS B SG  1 
ATOM   5734  N  N   . LEU B 1 407 ? 158.112 160.523 204.375 1.00 167.17 ? 407 LEU B N   1 
ATOM   5735  C  CA  . LEU B 1 407 ? 156.747 160.282 204.838 1.00 166.09 ? 407 LEU B CA  1 
ATOM   5736  C  C   . LEU B 1 407 ? 155.831 159.789 203.699 1.00 168.54 ? 407 LEU B C   1 
ATOM   5737  O  O   . LEU B 1 407 ? 154.862 159.079 203.977 1.00 169.05 ? 407 LEU B O   1 
ATOM   5738  C  CB  . LEU B 1 407 ? 156.166 161.532 205.506 1.00 163.30 ? 407 LEU B CB  1 
ATOM   5739  C  CG  . LEU B 1 407 ? 156.598 161.753 206.956 1.00 170.81 ? 407 LEU B CG  1 
ATOM   5740  C  CD1 . LEU B 1 407 ? 156.576 163.221 207.312 1.00 168.39 ? 407 LEU B CD1 1 
ATOM   5741  C  CD2 . LEU B 1 407 ? 155.730 160.962 207.918 1.00 175.93 ? 407 LEU B CD2 1 
ATOM   5742  N  N   . THR B 1 408 ? 156.153 160.135 202.428 1.00 162.90 ? 408 THR B N   1 
ATOM   5743  C  CA  . THR B 1 408 ? 155.419 159.685 201.235 1.00 161.19 ? 408 THR B CA  1 
ATOM   5744  C  C   . THR B 1 408 ? 155.753 158.203 200.998 1.00 169.42 ? 408 THR B C   1 
ATOM   5745  O  O   . THR B 1 408 ? 154.858 157.424 200.663 1.00 169.93 ? 408 THR B O   1 
ATOM   5746  C  CB  . THR B 1 408 ? 155.749 160.582 200.028 1.00 163.21 ? 408 THR B CB  1 
ATOM   5747  O  OG1 . THR B 1 408 ? 155.368 161.921 200.339 1.00 158.33 ? 408 THR B OG1 1 
ATOM   5748  C  CG2 . THR B 1 408 ? 155.047 160.143 198.745 1.00 159.95 ? 408 THR B CG2 1 
ATOM   5749  N  N   . VAL B 1 409 ? 157.038 157.821 201.198 1.00 168.92 ? 409 VAL B N   1 
ATOM   5750  C  CA  . VAL B 1 409 ? 157.540 156.445 201.078 1.00 173.24 ? 409 VAL B CA  1 
ATOM   5751  C  C   . VAL B 1 409 ? 156.842 155.588 202.154 1.00 179.20 ? 409 VAL B C   1 
ATOM   5752  O  O   . VAL B 1 409 ? 156.351 154.500 201.844 1.00 181.12 ? 409 VAL B O   1 
ATOM   5753  C  CB  . VAL B 1 409 ? 159.097 156.388 201.177 1.00 180.32 ? 409 VAL B CB  1 
ATOM   5754  C  CG1 . VAL B 1 409 ? 159.612 154.958 201.336 1.00 185.56 ? 409 VAL B CG1 1 
ATOM   5755  C  CG2 . VAL B 1 409 ? 159.753 157.055 199.972 1.00 178.55 ? 409 VAL B CG2 1 
ATOM   5756  N  N   . LEU B 1 410 ? 156.755 156.119 203.396 1.00 175.12 ? 410 LEU B N   1 
ATOM   5757  C  CA  . LEU B 1 410 ? 156.109 155.477 204.543 1.00 177.05 ? 410 LEU B CA  1 
ATOM   5758  C  C   . LEU B 1 410 ? 154.609 155.288 204.290 1.00 179.42 ? 410 LEU B C   1 
ATOM   5759  O  O   . LEU B 1 410 ? 154.083 154.214 204.585 1.00 182.10 ? 410 LEU B O   1 
ATOM   5760  C  CB  . LEU B 1 410 ? 156.338 156.305 205.820 1.00 176.69 ? 410 LEU B CB  1 
ATOM   5761  C  CG  . LEU B 1 410 ? 155.823 155.708 207.126 1.00 184.06 ? 410 LEU B CG  1 
ATOM   5762  C  CD1 . LEU B 1 410 ? 156.935 155.012 207.885 1.00 189.37 ? 410 LEU B CD1 1 
ATOM   5763  C  CD2 . LEU B 1 410 ? 155.180 156.773 207.985 1.00 183.68 ? 410 LEU B CD2 1 
ATOM   5764  N  N   . SER B 1 411 ? 153.935 156.316 203.726 1.00 171.51 ? 411 SER B N   1 
ATOM   5765  C  CA  . SER B 1 411 ? 152.504 156.297 203.401 1.00 169.52 ? 411 SER B CA  1 
ATOM   5766  C  C   . SER B 1 411 ? 152.157 155.139 202.449 1.00 175.67 ? 411 SER B C   1 
ATOM   5767  O  O   . SER B 1 411 ? 151.127 154.488 202.640 1.00 176.28 ? 411 SER B O   1 
ATOM   5768  C  CB  . SER B 1 411 ? 152.076 157.627 202.788 1.00 168.40 ? 411 SER B CB  1 
ATOM   5769  O  OG  . SER B 1 411 ? 150.711 157.621 202.399 1.00 175.69 ? 411 SER B OG  1 
ATOM   5770  N  N   . ARG B 1 412 ? 153.025 154.879 201.444 1.00 173.36 ? 412 ARG B N   1 
ATOM   5771  C  CA  . ARG B 1 412 ? 152.857 153.799 200.470 1.00 175.89 ? 412 ARG B CA  1 
ATOM   5772  C  C   . ARG B 1 412 ? 152.973 152.442 201.159 1.00 187.11 ? 412 ARG B C   1 
ATOM   5773  O  O   . ARG B 1 412 ? 152.166 151.553 200.880 1.00 188.99 ? 412 ARG B O   1 
ATOM   5774  C  CB  . ARG B 1 412 ? 153.879 153.910 199.327 1.00 174.93 ? 412 ARG B CB  1 
ATOM   5775  C  CG  . ARG B 1 412 ? 153.611 155.060 198.364 1.00 177.21 ? 412 ARG B CG  1 
ATOM   5776  C  CD  . ARG B 1 412 ? 154.368 154.908 197.059 1.00 184.46 ? 412 ARG B CD  1 
ATOM   5777  N  NE  . ARG B 1 412 ? 155.815 155.057 197.229 1.00 190.27 ? 412 ARG B NE  1 
ATOM   5778  C  CZ  . ARG B 1 412 ? 156.482 156.198 197.083 1.00 198.55 ? 412 ARG B CZ  1 
ATOM   5779  N  NH1 . ARG B 1 412 ? 155.840 157.315 196.762 1.00 179.41 ? 412 ARG B NH1 1 
ATOM   5780  N  NH2 . ARG B 1 412 ? 157.796 156.231 197.252 1.00 185.99 ? 412 ARG B NH2 1 
ATOM   5781  N  N   . ARG B 1 413 ? 153.958 152.296 202.076 1.00 187.34 ? 413 ARG B N   1 
ATOM   5782  C  CA  . ARG B 1 413 ? 154.190 151.073 202.852 1.00 192.71 ? 413 ARG B CA  1 
ATOM   5783  C  C   . ARG B 1 413 ? 153.032 150.826 203.830 1.00 197.99 ? 413 ARG B C   1 
ATOM   5784  O  O   . ARG B 1 413 ? 152.644 149.675 204.037 1.00 201.34 ? 413 ARG B O   1 
ATOM   5785  C  CB  . ARG B 1 413 ? 155.526 151.148 203.605 1.00 194.87 ? 413 ARG B CB  1 
ATOM   5786  N  N   . PHE B 1 414 ? 152.466 151.915 204.397 1.00 191.45 ? 414 PHE B N   1 
ATOM   5787  C  CA  . PHE B 1 414 ? 151.331 151.887 205.325 1.00 191.68 ? 414 PHE B CA  1 
ATOM   5788  C  C   . PHE B 1 414 ? 150.038 151.483 204.606 1.00 195.22 ? 414 PHE B C   1 
ATOM   5789  O  O   . PHE B 1 414 ? 149.165 150.868 205.222 1.00 197.11 ? 414 PHE B O   1 
ATOM   5790  C  CB  . PHE B 1 414 ? 151.157 153.260 206.000 1.00 189.99 ? 414 PHE B CB  1 
ATOM   5791  C  CG  . PHE B 1 414 ? 151.939 153.500 207.277 1.00 193.82 ? 414 PHE B CG  1 
ATOM   5792  C  CD1 . PHE B 1 414 ? 153.035 152.706 207.606 1.00 201.61 ? 414 PHE B CD1 1 
ATOM   5793  C  CD2 . PHE B 1 414 ? 151.599 154.541 208.133 1.00 194.12 ? 414 PHE B CD2 1 
ATOM   5794  C  CE1 . PHE B 1 414 ? 153.752 152.930 208.786 1.00 205.06 ? 414 PHE B CE1 1 
ATOM   5795  C  CE2 . PHE B 1 414 ? 152.317 154.764 209.313 1.00 199.48 ? 414 PHE B CE2 1 
ATOM   5796  C  CZ  . PHE B 1 414 ? 153.390 153.958 209.630 1.00 202.09 ? 414 PHE B CZ  1 
ATOM   5797  N  N   . GLU B 1 415 ? 149.918 151.831 203.309 1.00 189.08 ? 415 GLU B N   1 
ATOM   5798  C  CA  . GLU B 1 415 ? 148.759 151.488 202.484 1.00 188.33 ? 415 GLU B CA  1 
ATOM   5799  C  C   . GLU B 1 415 ? 148.788 150.002 202.113 1.00 196.57 ? 415 GLU B C   1 
ATOM   5800  O  O   . GLU B 1 415 ? 147.744 149.350 202.159 1.00 198.12 ? 415 GLU B O   1 
ATOM   5801  C  CB  . GLU B 1 415 ? 148.692 152.374 201.233 1.00 185.63 ? 415 GLU B CB  1 
ATOM   5802  C  CG  . GLU B 1 415 ? 148.037 153.723 201.486 1.00 191.54 ? 415 GLU B CG  1 
ATOM   5803  C  CD  . GLU B 1 415 ? 146.556 153.663 201.814 1.00 214.36 ? 415 GLU B CD  1 
ATOM   5804  O  OE1 . GLU B 1 415 ? 145.777 153.216 200.942 1.00 213.88 ? 415 GLU B OE1 1 
ATOM   5805  O  OE2 . GLU B 1 415 ? 146.171 154.048 202.942 1.00 208.34 ? 415 GLU B OE2 1 
ATOM   5806  N  N   . PHE B 1 416 ? 149.987 149.466 201.785 1.00 195.06 ? 416 PHE B N   1 
ATOM   5807  C  CA  . PHE B 1 416 ? 150.201 148.054 201.458 1.00 199.90 ? 416 PHE B CA  1 
ATOM   5808  C  C   . PHE B 1 416 ? 149.876 147.163 202.654 1.00 206.88 ? 416 PHE B C   1 
ATOM   5809  O  O   . PHE B 1 416 ? 149.317 146.080 202.472 1.00 210.25 ? 416 PHE B O   1 
ATOM   5810  C  CB  . PHE B 1 416 ? 151.650 147.804 201.006 1.00 203.88 ? 416 PHE B CB  1 
ATOM   5811  C  CG  . PHE B 1 416 ? 151.925 147.959 199.528 1.00 204.78 ? 416 PHE B CG  1 
ATOM   5812  C  CD1 . PHE B 1 416 ? 151.298 147.138 198.595 1.00 210.57 ? 416 PHE B CD1 1 
ATOM   5813  C  CD2 . PHE B 1 416 ? 152.873 148.867 199.073 1.00 204.61 ? 416 PHE B CD2 1 
ATOM   5814  C  CE1 . PHE B 1 416 ? 151.572 147.264 197.229 1.00 211.09 ? 416 PHE B CE1 1 
ATOM   5815  C  CE2 . PHE B 1 416 ? 153.159 148.982 197.709 1.00 207.12 ? 416 PHE B CE2 1 
ATOM   5816  C  CZ  . PHE B 1 416 ? 152.499 148.187 196.795 1.00 207.45 ? 416 PHE B CZ  1 
ATOM   5817  N  N   . GLN B 1 417 ? 150.230 147.627 203.874 1.00 202.31 ? 417 GLN B N   1 
ATOM   5818  C  CA  . GLN B 1 417 ? 149.980 146.937 205.143 1.00 205.69 ? 417 GLN B CA  1 
ATOM   5819  C  C   . GLN B 1 417 ? 148.475 146.874 205.426 1.00 209.04 ? 417 GLN B C   1 
ATOM   5820  O  O   . GLN B 1 417 ? 147.983 145.843 205.892 1.00 212.83 ? 417 GLN B O   1 
ATOM   5821  C  CB  . GLN B 1 417 ? 150.723 147.634 206.295 1.00 206.36 ? 417 GLN B CB  1 
ATOM   5822  C  CG  . GLN B 1 417 ? 152.206 147.274 206.379 1.00 219.58 ? 417 GLN B CG  1 
ATOM   5823  C  CD  . GLN B 1 417 ? 152.957 148.045 207.441 1.00 232.46 ? 417 GLN B CD  1 
ATOM   5824  O  OE1 . GLN B 1 417 ? 152.450 148.326 208.536 1.00 229.14 ? 417 GLN B OE1 1 
ATOM   5825  N  NE2 . GLN B 1 417 ? 154.210 148.367 207.157 1.00 225.96 ? 417 GLN B NE2 1 
ATOM   5826  N  N   . ALA B 1 418 ? 147.748 147.961 205.093 1.00 200.77 ? 418 ALA B N   1 
ATOM   5827  C  CA  . ALA B 1 418 ? 146.298 148.082 205.255 1.00 199.82 ? 418 ALA B CA  1 
ATOM   5828  C  C   . ALA B 1 418 ? 145.543 147.239 204.216 1.00 205.29 ? 418 ALA B C   1 
ATOM   5829  O  O   . ALA B 1 418 ? 144.414 146.817 204.480 1.00 206.64 ? 418 ALA B O   1 
ATOM   5830  C  CB  . ALA B 1 418 ? 145.885 149.536 205.151 1.00 195.11 ? 418 ALA B CB  1 
ATOM   5831  N  N   . ASP B 1 419 ? 146.159 147.002 203.040 1.00 201.45 ? 419 ASP B N   1 
ATOM   5832  C  CA  . ASP B 1 419 ? 145.600 146.160 201.978 1.00 203.39 ? 419 ASP B CA  1 
ATOM   5833  C  C   . ASP B 1 419 ? 145.801 144.692 202.341 1.00 212.14 ? 419 ASP B C   1 
ATOM   5834  O  O   . ASP B 1 419 ? 144.933 143.866 202.058 1.00 214.65 ? 419 ASP B O   1 
ATOM   5835  C  CB  . ASP B 1 419 ? 146.240 146.480 200.614 1.00 203.53 ? 419 ASP B CB  1 
ATOM   5836  C  CG  . ASP B 1 419 ? 145.831 147.816 200.020 1.00 211.06 ? 419 ASP B CG  1 
ATOM   5837  O  OD1 . ASP B 1 419 ? 144.623 148.145 200.066 1.00 211.03 ? 419 ASP B OD1 1 
ATOM   5838  O  OD2 . ASP B 1 419 ? 146.708 148.511 199.466 1.00 215.25 ? 419 ASP B OD2 1 
ATOM   5839  N  N   . ALA B 1 420 ? 146.946 144.381 202.991 1.00 210.07 ? 420 ALA B N   1 
ATOM   5840  C  CA  . ALA B 1 420 ? 147.307 143.046 203.473 1.00 215.59 ? 420 ALA B CA  1 
ATOM   5841  C  C   . ALA B 1 420 ? 146.396 142.631 204.631 1.00 221.52 ? 420 ALA B C   1 
ATOM   5842  O  O   . ALA B 1 420 ? 146.087 141.445 204.771 1.00 226.32 ? 420 ALA B O   1 
ATOM   5843  C  CB  . ALA B 1 420 ? 148.762 143.025 203.915 1.00 217.46 ? 420 ALA B CB  1 
ATOM   5844  N  N   . PHE B 1 421 ? 145.963 143.615 205.450 1.00 214.35 ? 421 PHE B N   1 
ATOM   5845  C  CA  . PHE B 1 421 ? 145.051 143.420 206.577 1.00 216.06 ? 421 PHE B CA  1 
ATOM   5846  C  C   . PHE B 1 421 ? 143.646 143.101 206.061 1.00 220.07 ? 421 PHE B C   1 
ATOM   5847  O  O   . PHE B 1 421 ? 142.944 142.299 206.676 1.00 223.93 ? 421 PHE B O   1 
ATOM   5848  C  CB  . PHE B 1 421 ? 145.032 144.662 207.484 1.00 214.21 ? 421 PHE B CB  1 
ATOM   5849  C  CG  . PHE B 1 421 ? 144.238 144.506 208.761 1.00 218.46 ? 421 PHE B CG  1 
ATOM   5850  C  CD1 . PHE B 1 421 ? 144.829 143.989 209.907 1.00 225.74 ? 421 PHE B CD1 1 
ATOM   5851  C  CD2 . PHE B 1 421 ? 142.903 144.886 208.820 1.00 219.38 ? 421 PHE B CD2 1 
ATOM   5852  C  CE1 . PHE B 1 421 ? 144.095 143.849 211.088 1.00 229.46 ? 421 PHE B CE1 1 
ATOM   5853  C  CE2 . PHE B 1 421 ? 142.173 144.756 210.004 1.00 224.98 ? 421 PHE B CE2 1 
ATOM   5854  C  CZ  . PHE B 1 421 ? 142.771 144.228 211.126 1.00 227.19 ? 421 PHE B CZ  1 
ATOM   5855  N  N   . ALA B 1 422 ? 143.241 143.733 204.935 1.00 212.48 ? 422 ALA B N   1 
ATOM   5856  C  CA  . ALA B 1 422 ? 141.945 143.511 204.283 1.00 212.88 ? 422 ALA B CA  1 
ATOM   5857  C  C   . ALA B 1 422 ? 141.874 142.095 203.704 1.00 222.30 ? 422 ALA B C   1 
ATOM   5858  O  O   . ALA B 1 422 ? 140.811 141.472 203.738 1.00 225.33 ? 422 ALA B O   1 
ATOM   5859  C  CB  . ALA B 1 422 ? 141.721 144.541 203.188 1.00 208.49 ? 422 ALA B CB  1 
ATOM   5860  N  N   . LYS B 1 423 ? 143.023 141.586 203.201 1.00 219.89 ? 423 LYS B N   1 
ATOM   5861  C  CA  . LYS B 1 423 ? 143.177 140.230 202.667 1.00 224.96 ? 423 LYS B CA  1 
ATOM   5862  C  C   . LYS B 1 423 ? 143.149 139.222 203.810 1.00 231.29 ? 423 LYS B C   1 
ATOM   5863  O  O   . LYS B 1 423 ? 142.627 138.120 203.641 1.00 233.70 ? 423 LYS B O   1 
ATOM   5864  C  CB  . LYS B 1 423 ? 144.480 140.103 201.868 1.00 227.46 ? 423 LYS B CB  1 
ATOM   5865  N  N   . LYS B 1 424 ? 143.691 139.619 204.984 1.00 228.31 ? 424 LYS B N   1 
ATOM   5866  C  CA  . LYS B 1 424 ? 143.721 138.824 206.213 1.00 230.83 ? 424 LYS B CA  1 
ATOM   5867  C  C   . LYS B 1 424 ? 142.309 138.679 206.799 1.00 234.61 ? 424 LYS B C   1 
ATOM   5868  O  O   . LYS B 1 424 ? 142.056 137.722 207.532 1.00 237.42 ? 424 LYS B O   1 
ATOM   5869  C  CB  . LYS B 1 424 ? 144.672 139.451 207.244 1.00 231.56 ? 424 LYS B CB  1 
ATOM   5870  N  N   . LEU B 1 425 ? 141.394 139.619 206.467 1.00 230.17 ? 425 LEU B N   1 
ATOM   5871  C  CA  . LEU B 1 425 ? 139.991 139.598 206.893 1.00 231.28 ? 425 LEU B CA  1 
ATOM   5872  C  C   . LEU B 1 425 ? 139.149 138.726 205.954 1.00 235.58 ? 425 LEU B C   1 
ATOM   5873  O  O   . LEU B 1 425 ? 138.030 138.345 206.309 1.00 237.13 ? 425 LEU B O   1 
ATOM   5874  C  CB  . LEU B 1 425 ? 139.408 141.018 206.956 1.00 226.22 ? 425 LEU B CB  1 
ATOM   5875  C  CG  . LEU B 1 425 ? 139.858 141.900 208.121 1.00 228.68 ? 425 LEU B CG  1 
ATOM   5876  C  CD1 . LEU B 1 425 ? 139.633 143.355 207.802 1.00 222.49 ? 425 LEU B CD1 1 
ATOM   5877  C  CD2 . LEU B 1 425 ? 139.139 141.533 209.417 1.00 235.03 ? 425 LEU B CD2 1 
ATOM   5878  N  N   . GLY B 1 426 ? 139.699 138.424 204.776 1.00 232.92 ? 426 GLY B N   1 
ATOM   5879  C  CA  . GLY B 1 426 ? 139.064 137.590 203.760 1.00 234.51 ? 426 GLY B CA  1 
ATOM   5880  C  C   . GLY B 1 426 ? 138.396 138.347 202.629 1.00 235.12 ? 426 GLY B C   1 
ATOM   5881  O  O   . GLY B 1 426 ? 137.977 137.733 201.643 1.00 235.91 ? 426 GLY B O   1 
ATOM   5882  N  N   . LYS B 1 427 ? 138.304 139.686 202.755 1.00 230.07 ? 427 LYS B N   1 
ATOM   5883  C  CA  . LYS B 1 427 ? 137.668 140.562 201.769 1.00 226.25 ? 427 LYS B CA  1 
ATOM   5884  C  C   . LYS B 1 427 ? 138.672 141.041 200.690 1.00 226.84 ? 427 LYS B C   1 
ATOM   5885  O  O   . LYS B 1 427 ? 138.553 142.162 200.188 1.00 221.19 ? 427 LYS B O   1 
ATOM   5886  C  CB  . LYS B 1 427 ? 137.012 141.754 202.482 1.00 224.70 ? 427 LYS B CB  1 
ATOM   5887  N  N   . ALA B 1 428 ? 139.628 140.166 200.308 1.00 226.90 ? 428 ALA B N   1 
ATOM   5888  C  CA  . ALA B 1 428 ? 140.657 140.439 199.298 1.00 224.71 ? 428 ALA B CA  1 
ATOM   5889  C  C   . ALA B 1 428 ? 140.059 140.549 197.890 1.00 228.48 ? 428 ALA B C   1 
ATOM   5890  O  O   . ALA B 1 428 ? 140.445 141.447 197.139 1.00 223.57 ? 428 ALA B O   1 
ATOM   5891  C  CB  . ALA B 1 428 ? 141.720 139.351 199.327 1.00 228.86 ? 428 ALA B CB  1 
ATOM   5892  N  N   . LYS B 1 429 ? 139.126 139.634 197.536 1.00 229.03 ? 429 LYS B N   1 
ATOM   5893  C  CA  . LYS B 1 429 ? 138.450 139.592 196.235 1.00 229.25 ? 429 LYS B CA  1 
ATOM   5894  C  C   . LYS B 1 429 ? 137.515 140.792 196.058 1.00 229.80 ? 429 LYS B C   1 
ATOM   5895  O  O   . LYS B 1 429 ? 137.389 141.313 194.948 1.00 228.39 ? 429 LYS B O   1 
ATOM   5896  C  CB  . LYS B 1 429 ? 137.667 138.281 196.077 1.00 234.36 ? 429 LYS B CB  1 
ATOM   5897  N  N   . ASP B 1 430 ? 136.872 141.228 197.157 1.00 226.15 ? 430 ASP B N   1 
ATOM   5898  C  CA  . ASP B 1 430 ? 135.954 142.363 197.173 1.00 222.21 ? 430 ASP B CA  1 
ATOM   5899  C  C   . ASP B 1 430 ? 136.716 143.698 197.065 1.00 219.40 ? 430 ASP B C   1 
ATOM   5900  O  O   . ASP B 1 430 ? 136.222 144.616 196.407 1.00 215.78 ? 430 ASP B O   1 
ATOM   5901  C  CB  . ASP B 1 430 ? 135.083 142.332 198.435 1.00 225.34 ? 430 ASP B CB  1 
ATOM   5902  N  N   . LEU B 1 431 ? 137.913 143.800 197.696 1.00 214.12 ? 431 LEU B N   1 
ATOM   5903  C  CA  . LEU B 1 431 ? 138.757 145.004 197.656 1.00 208.02 ? 431 LEU B CA  1 
ATOM   5904  C  C   . LEU B 1 431 ? 139.396 145.165 196.272 1.00 210.36 ? 431 LEU B C   1 
ATOM   5905  O  O   . LEU B 1 431 ? 139.550 146.296 195.806 1.00 205.36 ? 431 LEU B O   1 
ATOM   5906  C  CB  . LEU B 1 431 ? 139.836 144.972 198.749 1.00 207.47 ? 431 LEU B CB  1 
ATOM   5907  N  N   . TYR B 1 432 ? 139.746 144.030 195.614 1.00 211.06 ? 432 TYR B N   1 
ATOM   5908  C  CA  . TYR B 1 432 ? 140.317 143.973 194.263 1.00 211.05 ? 432 TYR B CA  1 
ATOM   5909  C  C   . TYR B 1 432 ? 139.338 144.606 193.270 1.00 212.83 ? 432 TYR B C   1 
ATOM   5910  O  O   . TYR B 1 432 ? 139.748 145.410 192.431 1.00 209.30 ? 432 TYR B O   1 
ATOM   5911  C  CB  . TYR B 1 432 ? 140.622 142.511 193.874 1.00 218.71 ? 432 TYR B CB  1 
ATOM   5912  C  CG  . TYR B 1 432 ? 141.378 142.342 192.571 1.00 221.85 ? 432 TYR B CG  1 
ATOM   5913  C  CD1 . TYR B 1 432 ? 140.704 142.263 191.355 1.00 225.48 ? 432 TYR B CD1 1 
ATOM   5914  C  CD2 . TYR B 1 432 ? 142.761 142.186 192.560 1.00 222.83 ? 432 TYR B CD2 1 
ATOM   5915  C  CE1 . TYR B 1 432 ? 141.392 142.089 190.155 1.00 227.54 ? 432 TYR B CE1 1 
ATOM   5916  C  CE2 . TYR B 1 432 ? 143.460 142.009 191.366 1.00 225.23 ? 432 TYR B CE2 1 
ATOM   5917  C  CZ  . TYR B 1 432 ? 142.772 141.967 190.165 1.00 231.47 ? 432 TYR B CZ  1 
ATOM   5918  O  OH  . TYR B 1 432 ? 143.454 141.791 188.986 1.00 232.66 ? 432 TYR B OH  1 
ATOM   5919  N  N   . SER B 1 433 ? 138.043 144.253 193.389 1.00 211.40 ? 433 SER B N   1 
ATOM   5920  C  CA  . SER B 1 433 ? 136.963 144.775 192.555 1.00 210.29 ? 433 SER B CA  1 
ATOM   5921  C  C   . SER B 1 433 ? 136.668 146.239 192.895 1.00 207.11 ? 433 SER B C   1 
ATOM   5922  O  O   . SER B 1 433 ? 136.387 147.022 191.986 1.00 204.41 ? 433 SER B O   1 
ATOM   5923  C  CB  . SER B 1 433 ? 135.704 143.931 192.724 1.00 218.68 ? 433 SER B CB  1 
ATOM   5924  N  N   . ALA B 1 434 ? 136.746 146.604 194.199 1.00 200.70 ? 434 ALA B N   1 
ATOM   5925  C  CA  . ALA B 1 434 ? 136.491 147.955 194.710 1.00 195.06 ? 434 ALA B CA  1 
ATOM   5926  C  C   . ALA B 1 434 ? 137.523 148.966 194.192 1.00 193.42 ? 434 ALA B C   1 
ATOM   5927  O  O   . ALA B 1 434 ? 137.124 150.004 193.668 1.00 190.19 ? 434 ALA B O   1 
ATOM   5928  C  CB  . ALA B 1 434 ? 136.479 147.953 196.233 1.00 195.42 ? 434 ALA B CB  1 
ATOM   5929  N  N   . LEU B 1 435 ? 138.835 148.646 194.309 1.00 188.75 ? 435 LEU B N   1 
ATOM   5930  C  CA  . LEU B 1 435 ? 139.960 149.485 193.871 1.00 184.11 ? 435 LEU B CA  1 
ATOM   5931  C  C   . LEU B 1 435 ? 139.867 149.839 192.380 1.00 186.75 ? 435 LEU B C   1 
ATOM   5932  O  O   . LEU B 1 435 ? 140.149 150.980 192.013 1.00 182.20 ? 435 LEU B O   1 
ATOM   5933  C  CB  . LEU B 1 435 ? 141.289 148.778 194.160 1.00 185.73 ? 435 LEU B CB  1 
ATOM   5934  N  N   . ILE B 1 436 ? 139.441 148.871 191.539 1.00 187.26 ? 436 ILE B N   1 
ATOM   5935  C  CA  . ILE B 1 436 ? 139.247 149.028 190.093 1.00 187.53 ? 436 ILE B CA  1 
ATOM   5936  C  C   . ILE B 1 436 ? 138.032 149.944 189.837 1.00 189.23 ? 436 ILE B C   1 
ATOM   5937  O  O   . ILE B 1 436 ? 138.128 150.871 189.027 1.00 186.19 ? 436 ILE B O   1 
ATOM   5938  C  CB  . ILE B 1 436 ? 139.097 147.633 189.411 1.00 196.59 ? 436 ILE B CB  1 
ATOM   5939  C  CG1 . ILE B 1 436 ? 140.460 146.909 189.345 1.00 198.54 ? 436 ILE B CG1 1 
ATOM   5940  C  CG2 . ILE B 1 436 ? 138.456 147.736 188.014 1.00 199.19 ? 436 ILE B CG2 1 
ATOM   5941  C  CD1 . ILE B 1 436 ? 140.408 145.414 189.093 1.00 210.18 ? 436 ILE B CD1 1 
ATOM   5942  N  N   . LYS B 1 437 ? 136.905 149.680 190.535 1.00 187.10 ? 437 LYS B N   1 
ATOM   5943  C  CA  . LYS B 1 437 ? 135.652 150.432 190.427 1.00 185.73 ? 437 LYS B CA  1 
ATOM   5944  C  C   . LYS B 1 437 ? 135.821 151.890 190.886 1.00 184.40 ? 437 LYS B C   1 
ATOM   5945  O  O   . LYS B 1 437 ? 135.261 152.784 190.252 1.00 182.49 ? 437 LYS B O   1 
ATOM   5946  C  CB  . LYS B 1 437 ? 134.536 149.743 191.225 1.00 191.27 ? 437 LYS B CB  1 
ATOM   5947  N  N   . LEU B 1 438 ? 136.612 152.128 191.960 1.00 178.39 ? 438 LEU B N   1 
ATOM   5948  C  CA  . LEU B 1 438 ? 136.896 153.468 192.489 1.00 172.95 ? 438 LEU B CA  1 
ATOM   5949  C  C   . LEU B 1 438 ? 137.821 154.240 191.549 1.00 175.00 ? 438 LEU B C   1 
ATOM   5950  O  O   . LEU B 1 438 ? 137.735 155.468 191.485 1.00 171.09 ? 438 LEU B O   1 
ATOM   5951  C  CB  . LEU B 1 438 ? 137.512 153.398 193.895 1.00 171.61 ? 438 LEU B CB  1 
ATOM   5952  C  CG  . LEU B 1 438 ? 136.571 153.001 195.031 1.00 178.04 ? 438 LEU B CG  1 
ATOM   5953  C  CD1 . LEU B 1 438 ? 137.348 152.480 196.218 1.00 178.87 ? 438 LEU B CD1 1 
ATOM   5954  C  CD2 . LEU B 1 438 ? 135.675 154.150 195.443 1.00 177.37 ? 438 LEU B CD2 1 
ATOM   5955  N  N   . ASN B 1 439 ? 138.698 153.518 190.819 1.00 174.17 ? 439 ASN B N   1 
ATOM   5956  C  CA  . ASN B 1 439 ? 139.620 154.094 189.840 1.00 172.44 ? 439 ASN B CA  1 
ATOM   5957  C  C   . ASN B 1 439 ? 138.837 154.613 188.631 1.00 176.83 ? 439 ASN B C   1 
ATOM   5958  O  O   . ASN B 1 439 ? 139.149 155.692 188.127 1.00 173.61 ? 439 ASN B O   1 
ATOM   5959  C  CB  . ASN B 1 439 ? 140.671 153.068 189.412 1.00 177.13 ? 439 ASN B CB  1 
ATOM   5960  C  CG  . ASN B 1 439 ? 141.803 153.653 188.604 1.00 199.20 ? 439 ASN B CG  1 
ATOM   5961  O  OD1 . ASN B 1 439 ? 142.645 154.404 189.113 1.00 188.30 ? 439 ASN B OD1 1 
ATOM   5962  N  ND2 . ASN B 1 439 ? 141.860 153.299 187.328 1.00 194.82 ? 439 ASN B ND2 1 
ATOM   5963  N  N   . LYS B 1 440 ? 137.808 153.857 188.188 1.00 177.18 ? 440 LYS B N   1 
ATOM   5964  C  CA  . LYS B 1 440 ? 136.934 154.234 187.075 1.00 178.13 ? 440 LYS B CA  1 
ATOM   5965  C  C   . LYS B 1 440 ? 136.056 155.425 187.476 1.00 179.13 ? 440 LYS B C   1 
ATOM   5966  O  O   . LYS B 1 440 ? 135.835 156.321 186.660 1.00 177.33 ? 440 LYS B O   1 
ATOM   5967  C  CB  . LYS B 1 440 ? 136.070 153.043 186.636 1.00 186.22 ? 440 LYS B CB  1 
ATOM   5968  N  N   . ASP B 1 441 ? 135.587 155.439 188.747 1.00 174.96 ? 441 ASP B N   1 
ATOM   5969  C  CA  . ASP B 1 441 ? 134.756 156.490 189.347 1.00 172.01 ? 441 ASP B CA  1 
ATOM   5970  C  C   . ASP B 1 441 ? 135.468 157.839 189.382 1.00 170.03 ? 441 ASP B C   1 
ATOM   5971  O  O   . ASP B 1 441 ? 134.825 158.867 189.168 1.00 167.80 ? 441 ASP B O   1 
ATOM   5972  C  CB  . ASP B 1 441 ? 134.358 156.108 190.789 1.00 174.53 ? 441 ASP B CB  1 
ATOM   5973  C  CG  . ASP B 1 441 ? 133.183 155.159 190.948 1.00 191.96 ? 441 ASP B CG  1 
ATOM   5974  O  OD1 . ASP B 1 441 ? 132.753 154.561 189.933 1.00 196.76 ? 441 ASP B OD1 1 
ATOM   5975  O  OD2 . ASP B 1 441 ? 132.708 154.994 192.094 1.00 198.98 ? 441 ASP B OD2 1 
ATOM   5976  N  N   . ASN B 1 442 ? 136.786 157.831 189.680 1.00 164.04 ? 442 ASN B N   1 
ATOM   5977  C  CA  . ASN B 1 442 ? 137.615 159.030 189.811 1.00 159.17 ? 442 ASN B CA  1 
ATOM   5978  C  C   . ASN B 1 442 ? 138.528 159.254 188.590 1.00 162.60 ? 442 ASN B C   1 
ATOM   5979  O  O   . ASN B 1 442 ? 139.400 160.127 188.635 1.00 158.79 ? 442 ASN B O   1 
ATOM   5980  C  CB  . ASN B 1 442 ? 138.457 158.944 191.095 1.00 158.14 ? 442 ASN B CB  1 
ATOM   5981  C  CG  . ASN B 1 442 ? 137.673 158.711 192.371 1.00 182.06 ? 442 ASN B CG  1 
ATOM   5982  O  OD1 . ASN B 1 442 ? 136.491 159.053 192.497 1.00 176.62 ? 442 ASN B OD1 1 
ATOM   5983  N  ND2 . ASN B 1 442 ? 138.330 158.134 193.362 1.00 174.99 ? 442 ASN B ND2 1 
ATOM   5984  N  N   . LEU B 1 443 ? 138.302 158.487 187.495 1.00 162.95 ? 443 LEU B N   1 
ATOM   5985  C  CA  . LEU B 1 443 ? 139.041 158.527 186.223 1.00 163.61 ? 443 LEU B CA  1 
ATOM   5986  C  C   . LEU B 1 443 ? 140.572 158.568 186.436 1.00 166.73 ? 443 LEU B C   1 
ATOM   5987  O  O   . LEU B 1 443 ? 141.264 159.440 185.903 1.00 163.93 ? 443 LEU B O   1 
ATOM   5988  C  CB  . LEU B 1 443 ? 138.582 159.702 185.332 1.00 161.83 ? 443 LEU B CB  1 
ATOM   5989  C  CG  . LEU B 1 443 ? 137.264 159.537 184.577 1.00 169.38 ? 443 LEU B CG  1 
ATOM   5990  C  CD1 . LEU B 1 443 ? 136.922 160.798 183.816 1.00 167.51 ? 443 LEU B CD1 1 
ATOM   5991  C  CD2 . LEU B 1 443 ? 137.317 158.370 183.601 1.00 177.25 ? 443 LEU B CD2 1 
ATOM   5992  N  N   . GLY B 1 444 ? 141.069 157.621 187.224 1.00 165.54 ? 444 GLY B N   1 
ATOM   5993  C  CA  . GLY B 1 444 ? 142.490 157.487 187.517 1.00 164.86 ? 444 GLY B CA  1 
ATOM   5994  C  C   . GLY B 1 444 ? 143.210 156.731 186.421 1.00 172.49 ? 444 GLY B C   1 
ATOM   5995  O  O   . GLY B 1 444 ? 142.796 155.627 186.056 1.00 175.78 ? 444 GLY B O   1 
ATOM   5996  N  N   . PHE B 1 445 ? 144.282 157.327 185.878 1.00 168.53 ? 445 PHE B N   1 
ATOM   5997  C  CA  . PHE B 1 445 ? 145.085 156.725 184.815 1.00 171.99 ? 445 PHE B CA  1 
ATOM   5998  C  C   . PHE B 1 445 ? 145.927 155.574 185.391 1.00 181.03 ? 445 PHE B C   1 
ATOM   5999  O  O   . PHE B 1 445 ? 146.662 155.793 186.360 1.00 178.66 ? 445 PHE B O   1 
ATOM   6000  C  CB  . PHE B 1 445 ? 145.970 157.786 184.145 1.00 171.17 ? 445 PHE B CB  1 
ATOM   6001  C  CG  . PHE B 1 445 ? 146.353 157.496 182.714 1.00 175.54 ? 445 PHE B CG  1 
ATOM   6002  C  CD1 . PHE B 1 445 ? 145.424 157.619 181.689 1.00 179.67 ? 445 PHE B CD1 1 
ATOM   6003  C  CD2 . PHE B 1 445 ? 147.661 157.167 182.382 1.00 179.04 ? 445 PHE B CD2 1 
ATOM   6004  C  CE1 . PHE B 1 445 ? 145.788 157.374 180.364 1.00 183.89 ? 445 PHE B CE1 1 
ATOM   6005  C  CE2 . PHE B 1 445 ? 148.025 156.932 181.056 1.00 185.02 ? 445 PHE B CE2 1 
ATOM   6006  C  CZ  . PHE B 1 445 ? 147.088 157.043 180.056 1.00 184.67 ? 445 PHE B CZ  1 
ATOM   6007  N  N   . PRO B 1 446 ? 145.799 154.336 184.848 1.00 184.52 ? 446 PRO B N   1 
ATOM   6008  C  CA  . PRO B 1 446 ? 146.555 153.200 185.418 1.00 188.19 ? 446 PRO B CA  1 
ATOM   6009  C  C   . PRO B 1 446 ? 148.073 153.279 185.201 1.00 194.86 ? 446 PRO B C   1 
ATOM   6010  O  O   . PRO B 1 446 ? 148.828 152.814 186.062 1.00 195.50 ? 446 PRO B O   1 
ATOM   6011  C  CB  . PRO B 1 446 ? 145.959 151.980 184.710 1.00 195.25 ? 446 PRO B CB  1 
ATOM   6012  C  CG  . PRO B 1 446 ? 145.387 152.506 183.442 1.00 199.77 ? 446 PRO B CG  1 
ATOM   6013  C  CD  . PRO B 1 446 ? 144.941 153.909 183.722 1.00 189.79 ? 446 PRO B CD  1 
ATOM   6014  N  N   . VAL B 1 447 ? 148.517 153.860 184.066 1.00 192.50 ? 447 VAL B N   1 
ATOM   6015  C  CA  . VAL B 1 447 ? 149.936 154.014 183.719 1.00 193.24 ? 447 VAL B CA  1 
ATOM   6016  C  C   . VAL B 1 447 ? 150.487 155.281 184.397 1.00 192.27 ? 447 VAL B C   1 
ATOM   6017  O  O   . VAL B 1 447 ? 149.815 156.313 184.424 1.00 188.04 ? 447 VAL B O   1 
ATOM   6018  C  CB  . VAL B 1 447 ? 150.188 154.034 182.183 1.00 199.99 ? 447 VAL B CB  1 
ATOM   6019  C  CG1 . VAL B 1 447 ? 151.634 153.663 181.864 1.00 202.63 ? 447 VAL B CG1 1 
ATOM   6020  C  CG2 . VAL B 1 447 ? 149.229 153.102 181.442 1.00 204.04 ? 447 VAL B CG2 1 
ATOM   6021  N  N   . SER B 1 448 ? 151.700 155.188 184.961 1.00 189.15 ? 448 SER B N   1 
ATOM   6022  C  CA  . SER B 1 448 ? 152.360 156.299 185.645 1.00 185.04 ? 448 SER B CA  1 
ATOM   6023  C  C   . SER B 1 448 ? 153.871 156.140 185.603 1.00 190.94 ? 448 SER B C   1 
ATOM   6024  O  O   . SER B 1 448 ? 154.372 155.021 185.739 1.00 194.38 ? 448 SER B O   1 
ATOM   6025  C  CB  . SER B 1 448 ? 151.889 156.392 187.095 1.00 186.60 ? 448 SER B CB  1 
ATOM   6026  O  OG  . SER B 1 448 ? 152.435 157.527 187.750 1.00 193.59 ? 448 SER B OG  1 
ATOM   6027  N  N   . ASP B 1 449 ? 154.598 157.263 185.430 1.00 185.49 ? 449 ASP B N   1 
ATOM   6028  C  CA  . ASP B 1 449 ? 156.061 157.286 185.411 1.00 187.46 ? 449 ASP B CA  1 
ATOM   6029  C  C   . ASP B 1 449 ? 156.578 156.936 186.809 1.00 191.87 ? 449 ASP B C   1 
ATOM   6030  O  O   . ASP B 1 449 ? 156.130 157.533 187.792 1.00 187.84 ? 449 ASP B O   1 
ATOM   6031  C  CB  . ASP B 1 449 ? 156.584 158.654 184.941 1.00 186.75 ? 449 ASP B CB  1 
ATOM   6032  C  CG  . ASP B 1 449 ? 158.086 158.709 184.779 1.00 201.48 ? 449 ASP B CG  1 
ATOM   6033  O  OD1 . ASP B 1 449 ? 158.586 158.238 183.736 1.00 205.89 ? 449 ASP B OD1 1 
ATOM   6034  O  OD2 . ASP B 1 449 ? 158.761 159.225 185.692 1.00 207.54 ? 449 ASP B OD2 1 
ATOM   6035  N  N   . TRP B 1 450 ? 157.475 155.932 186.892 1.00 193.45 ? 450 TRP B N   1 
ATOM   6036  C  CA  . TRP B 1 450 ? 158.039 155.414 188.144 1.00 194.81 ? 450 TRP B CA  1 
ATOM   6037  C  C   . TRP B 1 450 ? 158.700 156.502 188.998 1.00 194.13 ? 450 TRP B C   1 
ATOM   6038  O  O   . TRP B 1 450 ? 158.523 156.492 190.216 1.00 192.51 ? 450 TRP B O   1 
ATOM   6039  C  CB  . TRP B 1 450 ? 159.045 154.289 187.870 1.00 199.92 ? 450 TRP B CB  1 
ATOM   6040  C  CG  . TRP B 1 450 ? 159.674 153.732 189.116 1.00 203.26 ? 450 TRP B CG  1 
ATOM   6041  C  CD1 . TRP B 1 450 ? 159.151 152.785 189.946 1.00 207.92 ? 450 TRP B CD1 1 
ATOM   6042  C  CD2 . TRP B 1 450 ? 160.926 154.128 189.694 1.00 204.02 ? 450 TRP B CD2 1 
ATOM   6043  N  NE1 . TRP B 1 450 ? 160.009 152.550 190.997 1.00 209.33 ? 450 TRP B NE1 1 
ATOM   6044  C  CE2 . TRP B 1 450 ? 161.107 153.362 190.868 1.00 210.31 ? 450 TRP B CE2 1 
ATOM   6045  C  CE3 . TRP B 1 450 ? 161.918 155.058 189.333 1.00 204.70 ? 450 TRP B CE3 1 
ATOM   6046  C  CZ2 . TRP B 1 450 ? 162.244 153.487 191.676 1.00 211.28 ? 450 TRP B CZ2 1 
ATOM   6047  C  CZ3 . TRP B 1 450 ? 163.042 155.181 190.134 1.00 207.84 ? 450 TRP B CZ3 1 
ATOM   6048  C  CH2 . TRP B 1 450 ? 163.198 154.402 191.290 1.00 210.72 ? 450 TRP B CH2 1 
ATOM   6049  N  N   . LEU B 1 451 ? 159.467 157.412 188.371 1.00 188.64 ? 451 LEU B N   1 
ATOM   6050  C  CA  . LEU B 1 451 ? 160.164 158.500 189.059 1.00 185.42 ? 451 LEU B CA  1 
ATOM   6051  C  C   . LEU B 1 451 ? 159.173 159.524 189.646 1.00 183.77 ? 451 LEU B C   1 
ATOM   6052  O  O   . LEU B 1 451 ? 159.453 160.104 190.697 1.00 181.71 ? 451 LEU B O   1 
ATOM   6053  C  CB  . LEU B 1 451 ? 161.146 159.182 188.093 1.00 186.12 ? 451 LEU B CB  1 
ATOM   6054  C  CG  . LEU B 1 451 ? 162.354 159.888 188.710 1.00 190.58 ? 451 LEU B CG  1 
ATOM   6055  C  CD1 . LEU B 1 451 ? 163.319 158.895 189.349 1.00 195.20 ? 451 LEU B CD1 1 
ATOM   6056  C  CD2 . LEU B 1 451 ? 163.087 160.695 187.665 1.00 193.05 ? 451 LEU B CD2 1 
ATOM   6057  N  N   . PHE B 1 452 ? 158.013 159.716 188.983 1.00 178.02 ? 452 PHE B N   1 
ATOM   6058  C  CA  . PHE B 1 452 ? 156.953 160.636 189.405 1.00 173.23 ? 452 PHE B CA  1 
ATOM   6059  C  C   . PHE B 1 452 ? 156.179 160.071 190.602 1.00 176.46 ? 452 PHE B C   1 
ATOM   6060  O  O   . PHE B 1 452 ? 155.988 160.781 191.592 1.00 173.66 ? 452 PHE B O   1 
ATOM   6061  C  CB  . PHE B 1 452 ? 155.996 160.914 188.233 1.00 173.96 ? 452 PHE B CB  1 
ATOM   6062  C  CG  . PHE B 1 452 ? 154.931 161.952 188.497 1.00 171.44 ? 452 PHE B CG  1 
ATOM   6063  C  CD1 . PHE B 1 452 ? 155.155 163.292 188.204 1.00 172.17 ? 452 PHE B CD1 1 
ATOM   6064  C  CD2 . PHE B 1 452 ? 153.686 161.585 188.994 1.00 172.97 ? 452 PHE B CD2 1 
ATOM   6065  C  CE1 . PHE B 1 452 ? 154.162 164.251 188.424 1.00 169.59 ? 452 PHE B CE1 1 
ATOM   6066  C  CE2 . PHE B 1 452 ? 152.697 162.547 189.228 1.00 172.44 ? 452 PHE B CE2 1 
ATOM   6067  C  CZ  . PHE B 1 452 ? 152.941 163.872 188.940 1.00 167.90 ? 452 PHE B CZ  1 
ATOM   6068  N  N   . SER B 1 453 ? 155.712 158.808 190.495 1.00 175.45 ? 453 SER B N   1 
ATOM   6069  C  CA  . SER B 1 453 ? 154.942 158.115 191.531 1.00 175.55 ? 453 SER B CA  1 
ATOM   6070  C  C   . SER B 1 453 ? 155.772 157.858 192.802 1.00 181.04 ? 453 SER B C   1 
ATOM   6071  O  O   . SER B 1 453 ? 155.212 157.853 193.897 1.00 179.90 ? 453 SER B O   1 
ATOM   6072  C  CB  . SER B 1 453 ? 154.380 156.803 190.995 1.00 182.38 ? 453 SER B CB  1 
ATOM   6073  O  OG  . SER B 1 453 ? 155.405 155.976 190.472 1.00 195.43 ? 453 SER B OG  1 
ATOM   6074  N  N   . MET B 1 454 ? 157.099 157.664 192.660 1.00 179.93 ? 454 MET B N   1 
ATOM   6075  C  CA  . MET B 1 454 ? 158.006 157.442 193.791 1.00 181.40 ? 454 MET B CA  1 
ATOM   6076  C  C   . MET B 1 454 ? 158.145 158.707 194.655 1.00 181.46 ? 454 MET B C   1 
ATOM   6077  O  O   . MET B 1 454 ? 158.242 158.610 195.881 1.00 181.75 ? 454 MET B O   1 
ATOM   6078  C  CB  . MET B 1 454 ? 159.391 156.999 193.293 1.00 187.59 ? 454 MET B CB  1 
ATOM   6079  N  N   . TRP B 1 455 ? 158.143 159.885 194.009 1.00 174.19 ? 455 TRP B N   1 
ATOM   6080  C  CA  . TRP B 1 455 ? 158.318 161.180 194.656 1.00 170.69 ? 455 TRP B CA  1 
ATOM   6081  C  C   . TRP B 1 455 ? 157.005 161.793 195.149 1.00 170.27 ? 455 TRP B C   1 
ATOM   6082  O  O   . TRP B 1 455 ? 157.003 162.396 196.226 1.00 168.73 ? 455 TRP B O   1 
ATOM   6083  C  CB  . TRP B 1 455 ? 159.005 162.143 193.678 1.00 168.43 ? 455 TRP B CB  1 
ATOM   6084  C  CG  . TRP B 1 455 ? 159.333 163.503 194.233 1.00 166.98 ? 455 TRP B CG  1 
ATOM   6085  C  CD1 . TRP B 1 455 ? 158.570 164.630 194.145 1.00 166.01 ? 455 TRP B CD1 1 
ATOM   6086  C  CD2 . TRP B 1 455 ? 160.537 163.887 194.914 1.00 168.45 ? 455 TRP B CD2 1 
ATOM   6087  N  NE1 . TRP B 1 455 ? 159.211 165.687 194.754 1.00 164.41 ? 455 TRP B NE1 1 
ATOM   6088  C  CE2 . TRP B 1 455 ? 160.421 165.260 195.231 1.00 169.14 ? 455 TRP B CE2 1 
ATOM   6089  C  CE3 . TRP B 1 455 ? 161.707 163.204 195.284 1.00 173.88 ? 455 TRP B CE3 1 
ATOM   6090  C  CZ2 . TRP B 1 455 ? 161.424 165.960 195.912 1.00 169.29 ? 455 TRP B CZ2 1 
ATOM   6091  C  CZ3 . TRP B 1 455 ? 162.698 163.896 195.963 1.00 176.27 ? 455 TRP B CZ3 1 
ATOM   6092  C  CH2 . TRP B 1 455 ? 162.554 165.259 196.267 1.00 173.71 ? 455 TRP B CH2 1 
ATOM   6093  N  N   . HIS B 1 456 ? 155.909 161.677 194.368 1.00 164.91 ? 456 HIS B N   1 
ATOM   6094  C  CA  . HIS B 1 456 ? 154.635 162.318 194.702 1.00 161.15 ? 456 HIS B CA  1 
ATOM   6095  C  C   . HIS B 1 456 ? 153.567 161.401 195.315 1.00 166.06 ? 456 HIS B C   1 
ATOM   6096  O  O   . HIS B 1 456 ? 153.006 161.761 196.353 1.00 164.28 ? 456 HIS B O   1 
ATOM   6097  C  CB  . HIS B 1 456 ? 154.037 162.995 193.460 1.00 159.39 ? 456 HIS B CB  1 
ATOM   6098  C  CG  . HIS B 1 456 ? 154.827 164.164 192.963 1.00 160.92 ? 456 HIS B CG  1 
ATOM   6099  N  ND1 . HIS B 1 456 ? 155.474 164.128 191.744 1.00 163.89 ? 456 HIS B ND1 1 
ATOM   6100  C  CD2 . HIS B 1 456 ? 155.040 165.371 193.536 1.00 159.97 ? 456 HIS B CD2 1 
ATOM   6101  C  CE1 . HIS B 1 456 ? 156.058 165.307 191.612 1.00 161.38 ? 456 HIS B CE1 1 
ATOM   6102  N  NE2 . HIS B 1 456 ? 155.827 166.088 192.667 1.00 159.39 ? 456 HIS B NE2 1 
ATOM   6103  N  N   . TYR B 1 457 ? 153.243 160.269 194.653 1.00 165.19 ? 457 TYR B N   1 
ATOM   6104  C  CA  . TYR B 1 457 ? 152.171 159.341 195.039 1.00 166.55 ? 457 TYR B CA  1 
ATOM   6105  C  C   . TYR B 1 457 ? 152.303 158.823 196.479 1.00 171.78 ? 457 TYR B C   1 
ATOM   6106  O  O   . TYR B 1 457 ? 153.229 158.074 196.791 1.00 174.34 ? 457 TYR B O   1 
ATOM   6107  C  CB  . TYR B 1 457 ? 152.089 158.145 194.063 1.00 171.39 ? 457 TYR B CB  1 
ATOM   6108  C  CG  . TYR B 1 457 ? 151.465 158.416 192.706 1.00 172.71 ? 457 TYR B CG  1 
ATOM   6109  C  CD1 . TYR B 1 457 ? 151.605 159.655 192.084 1.00 171.81 ? 457 TYR B CD1 1 
ATOM   6110  C  CD2 . TYR B 1 457 ? 150.811 157.409 192.005 1.00 176.36 ? 457 TYR B CD2 1 
ATOM   6111  C  CE1 . TYR B 1 457 ? 151.052 159.903 190.829 1.00 172.49 ? 457 TYR B CE1 1 
ATOM   6112  C  CE2 . TYR B 1 457 ? 150.263 157.641 190.743 1.00 177.11 ? 457 TYR B CE2 1 
ATOM   6113  C  CZ  . TYR B 1 457 ? 150.388 158.891 190.158 1.00 181.95 ? 457 TYR B CZ  1 
ATOM   6114  O  OH  . TYR B 1 457 ? 149.847 159.134 188.917 1.00 183.54 ? 457 TYR B OH  1 
ATOM   6115  N  N   . SER B 1 458 ? 151.355 159.232 197.347 1.00 166.34 ? 458 SER B N   1 
ATOM   6116  C  CA  . SER B 1 458 ? 151.261 158.803 198.746 1.00 167.56 ? 458 SER B CA  1 
ATOM   6117  C  C   . SER B 1 458 ? 150.686 157.388 198.808 1.00 174.53 ? 458 SER B C   1 
ATOM   6118  O  O   . SER B 1 458 ? 150.960 156.645 199.749 1.00 176.95 ? 458 SER B O   1 
ATOM   6119  C  CB  . SER B 1 458 ? 150.392 159.768 199.545 1.00 168.25 ? 458 SER B CB  1 
ATOM   6120  O  OG  . SER B 1 458 ? 149.074 159.827 199.024 1.00 175.48 ? 458 SER B OG  1 
ATOM   6121  N  N   . HIS B 1 459 ? 149.874 157.036 197.796 1.00 171.03 ? 459 HIS B N   1 
ATOM   6122  C  CA  . HIS B 1 459 ? 149.260 155.726 197.597 1.00 174.18 ? 459 HIS B CA  1 
ATOM   6123  C  C   . HIS B 1 459 ? 149.982 155.004 196.455 1.00 179.50 ? 459 HIS B C   1 
ATOM   6124  O  O   . HIS B 1 459 ? 150.192 155.621 195.404 1.00 177.19 ? 459 HIS B O   1 
ATOM   6125  C  CB  . HIS B 1 459 ? 147.762 155.870 197.274 1.00 173.82 ? 459 HIS B CB  1 
ATOM   6126  C  CG  . HIS B 1 459 ? 146.924 156.313 198.429 1.00 176.03 ? 459 HIS B CG  1 
ATOM   6127  N  ND1 . HIS B 1 459 ? 147.135 157.531 199.051 1.00 174.65 ? 459 HIS B ND1 1 
ATOM   6128  C  CD2 . HIS B 1 459 ? 145.860 155.709 199.004 1.00 179.58 ? 459 HIS B CD2 1 
ATOM   6129  C  CE1 . HIS B 1 459 ? 146.220 157.611 200.002 1.00 174.14 ? 459 HIS B CE1 1 
ATOM   6130  N  NE2 . HIS B 1 459 ? 145.428 156.539 200.010 1.00 177.39 ? 459 HIS B NE2 1 
ATOM   6131  N  N   . PRO B 1 460 ? 150.364 153.712 196.616 1.00 179.67 ? 460 PRO B N   1 
ATOM   6132  C  CA  . PRO B 1 460 ? 151.052 153.007 195.515 1.00 181.89 ? 460 PRO B CA  1 
ATOM   6133  C  C   . PRO B 1 460 ? 150.154 152.822 194.276 1.00 185.28 ? 460 PRO B C   1 
ATOM   6134  O  O   . PRO B 1 460 ? 148.928 152.865 194.427 1.00 184.15 ? 460 PRO B O   1 
ATOM   6135  C  CB  . PRO B 1 460 ? 151.439 151.663 196.137 1.00 188.38 ? 460 PRO B CB  1 
ATOM   6136  C  CG  . PRO B 1 460 ? 150.523 151.482 197.276 1.00 192.89 ? 460 PRO B CG  1 
ATOM   6137  C  CD  . PRO B 1 460 ? 150.201 152.840 197.797 1.00 183.99 ? 460 PRO B CD  1 
ATOM   6138  N  N   . PRO B 1 461 ? 150.723 152.633 193.051 1.00 182.35 ? 461 PRO B N   1 
ATOM   6139  C  CA  . PRO B 1 461 ? 149.871 152.496 191.847 1.00 182.12 ? 461 PRO B CA  1 
ATOM   6140  C  C   . PRO B 1 461 ? 148.858 151.352 191.921 1.00 187.24 ? 461 PRO B C   1 
ATOM   6141  O  O   . PRO B 1 461 ? 149.089 150.369 192.628 1.00 190.03 ? 461 PRO B O   1 
ATOM   6142  C  CB  . PRO B 1 461 ? 150.879 152.244 190.724 1.00 186.34 ? 461 PRO B CB  1 
ATOM   6143  C  CG  . PRO B 1 461 ? 152.150 152.830 191.218 1.00 189.67 ? 461 PRO B CG  1 
ATOM   6144  C  CD  . PRO B 1 461 ? 152.156 152.578 192.693 1.00 185.32 ? 461 PRO B CD  1 
ATOM   6145  N  N   . LEU B 1 462 ? 147.731 151.498 191.190 1.00 181.71 ? 462 LEU B N   1 
ATOM   6146  C  CA  . LEU B 1 462 ? 146.627 150.533 191.141 1.00 184.15 ? 462 LEU B CA  1 
ATOM   6147  C  C   . LEU B 1 462 ? 147.117 149.121 190.818 1.00 192.98 ? 462 LEU B C   1 
ATOM   6148  O  O   . LEU B 1 462 ? 146.780 148.193 191.552 1.00 195.54 ? 462 LEU B O   1 
ATOM   6149  C  CB  . LEU B 1 462 ? 145.566 150.968 190.119 1.00 183.31 ? 462 LEU B CB  1 
ATOM   6150  N  N   . LEU B 1 463 ? 147.956 148.974 189.766 1.00 190.82 ? 463 LEU B N   1 
ATOM   6151  C  CA  . LEU B 1 463 ? 148.524 147.694 189.323 1.00 196.02 ? 463 LEU B CA  1 
ATOM   6152  C  C   . LEU B 1 463 ? 149.385 147.030 190.414 1.00 200.58 ? 463 LEU B C   1 
ATOM   6153  O  O   . LEU B 1 463 ? 149.363 145.804 190.534 1.00 205.20 ? 463 LEU B O   1 
ATOM   6154  C  CB  . LEU B 1 463 ? 149.353 147.889 188.047 1.00 197.20 ? 463 LEU B CB  1 
ATOM   6155  N  N   . GLU B 1 464 ? 150.121 147.837 191.209 1.00 192.33 ? 464 GLU B N   1 
ATOM   6156  C  CA  . GLU B 1 464 ? 150.966 147.363 192.311 1.00 193.17 ? 464 GLU B CA  1 
ATOM   6157  C  C   . GLU B 1 464 ? 150.100 146.867 193.479 1.00 196.76 ? 464 GLU B C   1 
ATOM   6158  O  O   . GLU B 1 464 ? 150.409 145.835 194.076 1.00 199.99 ? 464 GLU B O   1 
ATOM   6159  C  CB  . GLU B 1 464 ? 151.926 148.469 192.787 1.00 190.68 ? 464 GLU B CB  1 
ATOM   6160  C  CG  . GLU B 1 464 ? 153.019 148.828 191.794 1.00 200.41 ? 464 GLU B CG  1 
ATOM   6161  N  N   . ARG B 1 465 ? 149.003 147.598 193.775 1.00 189.47 ? 465 ARG B N   1 
ATOM   6162  C  CA  . ARG B 1 465 ? 148.046 147.293 194.845 1.00 189.36 ? 465 ARG B CA  1 
ATOM   6163  C  C   . ARG B 1 465 ? 147.222 146.044 194.528 1.00 197.62 ? 465 ARG B C   1 
ATOM   6164  O  O   . ARG B 1 465 ? 146.948 145.257 195.436 1.00 199.92 ? 465 ARG B O   1 
ATOM   6165  C  CB  . ARG B 1 465 ? 147.106 148.486 195.094 1.00 183.59 ? 465 ARG B CB  1 
ATOM   6166  C  CG  . ARG B 1 465 ? 147.770 149.661 195.806 1.00 188.87 ? 465 ARG B CG  1 
ATOM   6167  C  CD  . ARG B 1 465 ? 146.806 150.795 196.119 1.00 191.49 ? 465 ARG B CD  1 
ATOM   6168  N  NE  . ARG B 1 465 ? 145.948 150.495 197.268 1.00 195.86 ? 465 ARG B NE  1 
ATOM   6169  C  CZ  . ARG B 1 465 ? 145.003 151.307 197.735 1.00 199.65 ? 465 ARG B CZ  1 
ATOM   6170  N  NH1 . ARG B 1 465 ? 144.782 152.482 197.157 1.00 178.66 ? 465 ARG B NH1 1 
ATOM   6171  N  NH2 . ARG B 1 465 ? 144.272 150.950 198.782 1.00 183.49 ? 465 ARG B NH2 1 
ATOM   6172  N  N   . LEU B 1 466 ? 146.824 145.871 193.248 1.00 195.19 ? 466 LEU B N   1 
ATOM   6173  C  CA  . LEU B 1 466 ? 146.023 144.739 192.769 1.00 199.82 ? 466 LEU B CA  1 
ATOM   6174  C  C   . LEU B 1 466 ? 146.823 143.437 192.769 1.00 210.46 ? 466 LEU B C   1 
ATOM   6175  O  O   . LEU B 1 466 ? 146.272 142.393 193.121 1.00 214.51 ? 466 LEU B O   1 
ATOM   6176  C  CB  . LEU B 1 466 ? 145.472 145.001 191.352 1.00 199.58 ? 466 LEU B CB  1 
ATOM   6177  C  CG  . LEU B 1 466 ? 144.400 146.082 191.178 1.00 199.90 ? 466 LEU B CG  1 
ATOM   6178  C  CD1 . LEU B 1 466 ? 144.176 146.372 189.717 1.00 200.25 ? 466 LEU B CD1 1 
ATOM   6179  C  CD2 . LEU B 1 466 ? 143.087 145.700 191.844 1.00 203.54 ? 466 LEU B CD2 1 
ATOM   6180  N  N   . GLN B 1 467 ? 148.114 143.497 192.366 1.00 208.09 ? 467 GLN B N   1 
ATOM   6181  C  CA  . GLN B 1 467 ? 149.014 142.341 192.303 1.00 213.74 ? 467 GLN B CA  1 
ATOM   6182  C  C   . GLN B 1 467 ? 149.306 141.780 193.698 1.00 220.62 ? 467 GLN B C   1 
ATOM   6183  O  O   . GLN B 1 467 ? 149.400 140.562 193.848 1.00 225.18 ? 467 GLN B O   1 
ATOM   6184  C  CB  . GLN B 1 467 ? 150.323 142.704 191.587 1.00 214.71 ? 467 GLN B CB  1 
ATOM   6185  N  N   . ALA B 1 468 ? 149.417 142.662 194.715 1.00 214.21 ? 468 ALA B N   1 
ATOM   6186  C  CA  . ALA B 1 468 ? 149.652 142.285 196.113 1.00 216.16 ? 468 ALA B CA  1 
ATOM   6187  C  C   . ALA B 1 468 ? 148.431 141.557 196.694 1.00 224.13 ? 468 ALA B C   1 
ATOM   6188  O  O   . ALA B 1 468 ? 148.593 140.648 197.511 1.00 227.01 ? 468 ALA B O   1 
ATOM   6189  C  CB  . ALA B 1 468 ? 149.973 143.520 196.943 1.00 211.74 ? 468 ALA B CB  1 
ATOM   6190  N  N   . LEU B 1 469 ? 147.216 141.952 196.255 1.00 219.92 ? 469 LEU B N   1 
ATOM   6191  C  CA  . LEU B 1 469 ? 145.944 141.357 196.672 1.00 222.70 ? 469 LEU B CA  1 
ATOM   6192  C  C   . LEU B 1 469 ? 145.710 140.009 195.983 1.00 231.26 ? 469 LEU B C   1 
ATOM   6193  O  O   . LEU B 1 469 ? 145.152 139.100 196.602 1.00 233.09 ? 469 LEU B O   1 
ATOM   6194  C  CB  . LEU B 1 469 ? 144.776 142.310 196.373 1.00 218.60 ? 469 LEU B CB  1 
ATOM   6195  C  CG  . LEU B 1 469 ? 144.564 143.455 197.356 1.00 218.49 ? 469 LEU B CG  1 
ATOM   6196  C  CD1 . LEU B 1 469 ? 143.841 144.607 196.693 1.00 214.03 ? 469 LEU B CD1 1 
ATOM   6197  C  CD2 . LEU B 1 469 ? 143.804 142.990 198.595 1.00 223.34 ? 469 LEU B CD2 1 
ATOM   6198  N  N   . LYS B 1 470 ? 146.131 139.889 194.702 1.00 230.17 ? 470 LYS B N   1 
ATOM   6199  C  CA  . LYS B 1 470 ? 146.014 138.673 193.890 1.00 233.61 ? 470 LYS B CA  1 
ATOM   6200  C  C   . LYS B 1 470 ? 146.909 137.562 194.447 1.00 240.31 ? 470 LYS B C   1 
ATOM   6201  O  O   . LYS B 1 470 ? 146.524 136.390 194.408 1.00 243.07 ? 470 LYS B O   1 
ATOM   6202  C  CB  . LYS B 1 470 ? 146.375 138.963 192.426 1.00 234.87 ? 470 LYS B CB  1 
ATOM   6203  N  N   . THR B 1 471 ? 148.098 137.942 194.975 1.00 238.12 ? 471 THR B N   1 
ATOM   6204  C  CA  . THR B 1 471 ? 149.085 137.040 195.581 1.00 240.73 ? 471 THR B CA  1 
ATOM   6205  C  C   . THR B 1 471 ? 148.531 136.499 196.914 1.00 244.83 ? 471 THR B C   1 
ATOM   6206  O  O   . THR B 1 471 ? 148.608 135.291 197.162 1.00 244.79 ? 471 THR B O   1 
ATOM   6207  C  CB  . THR B 1 471 ? 150.439 137.769 195.761 1.00 245.56 ? 471 THR B CB  1 
ATOM   6208  O  OG1 . THR B 1 471 ? 150.818 138.389 194.530 1.00 244.14 ? 471 THR B OG1 1 
ATOM   6209  C  CG2 . THR B 1 471 ? 151.557 136.838 196.227 1.00 246.45 ? 471 THR B CG2 1 
ATOM   6210  N  N   . MET B 1 472 ? 147.955 137.402 197.748 1.00 240.38 ? 472 MET B N   1 
ATOM   6211  C  CA  . MET B 1 472 ? 147.364 137.093 199.050 1.00 255.44 ? 472 MET B CA  1 
ATOM   6212  C  C   . MET B 1 472 ? 146.062 136.305 198.890 1.00 273.37 ? 472 MET B C   1 
ATOM   6213  O  O   . MET B 1 472 ? 146.086 135.079 198.779 1.00 262.80 ? 472 MET B O   1 
ATOM   6214  C  CB  . MET B 1 472 ? 147.106 138.386 199.834 1.00 256.29 ? 472 MET B CB  1 
ATOM   6215  N  N   . LEU C 1 10  ? 192.197 171.559 115.557 1.00 215.53 ? 10  LEU D N   1 
ATOM   6216  C  CA  . LEU C 1 10  ? 192.402 171.561 117.001 1.00 216.17 ? 10  LEU D CA  1 
ATOM   6217  C  C   . LEU C 1 10  ? 192.486 170.136 117.551 1.00 219.57 ? 10  LEU D C   1 
ATOM   6218  O  O   . LEU C 1 10  ? 191.594 169.324 117.289 1.00 218.02 ? 10  LEU D O   1 
ATOM   6219  C  CB  . LEU C 1 10  ? 191.272 172.328 117.703 1.00 213.89 ? 10  LEU D CB  1 
ATOM   6220  N  N   . TRP C 1 11  ? 193.554 169.844 118.327 1.00 219.37 ? 11  TRP D N   1 
ATOM   6221  C  CA  . TRP C 1 11  ? 193.780 168.541 118.967 1.00 220.30 ? 11  TRP D CA  1 
ATOM   6222  C  C   . TRP C 1 11  ? 193.242 168.548 120.420 1.00 222.02 ? 11  TRP D C   1 
ATOM   6223  O  O   . TRP C 1 11  ? 193.604 167.682 121.227 1.00 223.42 ? 11  TRP D O   1 
ATOM   6224  C  CB  . TRP C 1 11  ? 195.276 168.183 118.933 1.00 222.79 ? 11  TRP D CB  1 
ATOM   6225  N  N   . GLU C 1 12  ? 192.364 169.529 120.735 1.00 217.06 ? 12  GLU D N   1 
ATOM   6226  C  CA  . GLU C 1 12  ? 191.762 169.740 122.053 1.00 216.09 ? 12  GLU D CA  1 
ATOM   6227  C  C   . GLU C 1 12  ? 190.253 170.006 121.969 1.00 214.94 ? 12  GLU D C   1 
ATOM   6228  O  O   . GLU C 1 12  ? 189.558 169.787 122.962 1.00 214.20 ? 12  GLU D O   1 
ATOM   6229  C  CB  . GLU C 1 12  ? 192.444 170.922 122.768 1.00 218.35 ? 12  GLU D CB  1 
ATOM   6230  C  CG  . GLU C 1 12  ? 193.894 170.676 123.162 1.00 227.32 ? 12  GLU D CG  1 
ATOM   6231  C  CD  . GLU C 1 12  ? 194.763 171.918 123.192 1.00 235.69 ? 12  GLU D CD  1 
ATOM   6232  O  OE1 . GLU C 1 12  ? 194.512 172.794 124.050 1.00 229.55 ? 12  GLU D OE1 1 
ATOM   6233  O  OE2 . GLU C 1 12  ? 195.709 172.007 122.375 1.00 228.32 ? 12  GLU D OE2 1 
ATOM   6234  N  N   . MET C 1 13  ? 189.745 170.489 120.809 1.00 210.27 ? 13  MET D N   1 
ATOM   6235  C  CA  . MET C 1 13  ? 188.319 170.815 120.637 1.00 207.01 ? 13  MET D CA  1 
ATOM   6236  C  C   . MET C 1 13  ? 187.679 170.166 119.372 1.00 206.80 ? 13  MET D C   1 
ATOM   6237  O  O   . MET C 1 13  ? 188.361 170.055 118.342 1.00 207.64 ? 13  MET D O   1 
ATOM   6238  C  CB  . MET C 1 13  ? 188.133 172.340 120.580 1.00 207.73 ? 13  MET D CB  1 
ATOM   6239  N  N   . PRO C 1 14  ? 186.366 169.770 119.428 1.00 200.65 ? 14  PRO D N   1 
ATOM   6240  C  CA  . PRO C 1 14  ? 185.713 169.174 118.241 1.00 198.41 ? 14  PRO D CA  1 
ATOM   6241  C  C   . PRO C 1 14  ? 185.170 170.234 117.273 1.00 197.57 ? 14  PRO D C   1 
ATOM   6242  O  O   . PRO C 1 14  ? 185.218 171.425 117.584 1.00 197.10 ? 14  PRO D O   1 
ATOM   6243  C  CB  . PRO C 1 14  ? 184.582 168.323 118.840 1.00 198.35 ? 14  PRO D CB  1 
ATOM   6244  C  CG  . PRO C 1 14  ? 184.498 168.702 120.296 1.00 201.98 ? 14  PRO D CG  1 
ATOM   6245  C  CD  . PRO C 1 14  ? 185.424 169.840 120.561 1.00 200.38 ? 14  PRO D CD  1 
ATOM   6246  N  N   . ALA C 1 15  ? 184.661 169.806 116.095 1.00 192.83 ? 15  ALA D N   1 
ATOM   6247  C  CA  . ALA C 1 15  ? 184.159 170.713 115.058 1.00 190.74 ? 15  ALA D CA  1 
ATOM   6248  C  C   . ALA C 1 15  ? 182.625 170.891 115.097 1.00 189.46 ? 15  ALA D C   1 
ATOM   6249  O  O   . ALA C 1 15  ? 182.151 171.997 115.370 1.00 187.94 ? 15  ALA D O   1 
ATOM   6250  C  CB  . ALA C 1 15  ? 184.593 170.224 113.683 1.00 191.92 ? 15  ALA D CB  1 
ATOM   6251  N  N   . GLU C 1 16  ? 181.862 169.817 114.802 1.00 185.35 ? 16  GLU D N   1 
ATOM   6252  C  CA  . GLU C 1 16  ? 180.396 169.829 114.769 1.00 182.48 ? 16  GLU D CA  1 
ATOM   6253  C  C   . GLU C 1 16  ? 179.805 170.050 116.161 1.00 183.22 ? 16  GLU D C   1 
ATOM   6254  O  O   . GLU C 1 16  ? 178.768 170.697 116.278 1.00 181.75 ? 16  GLU D O   1 
ATOM   6255  C  CB  . GLU C 1 16  ? 179.856 168.523 114.169 1.00 183.12 ? 16  GLU D CB  1 
ATOM   6256  N  N   . LYS C 1 17  ? 180.465 169.527 117.212 1.00 181.09 ? 17  LYS D N   1 
ATOM   6257  C  CA  . LYS C 1 17  ? 180.016 169.664 118.602 1.00 180.19 ? 17  LYS D CA  1 
ATOM   6258  C  C   . LYS C 1 17  ? 180.195 171.104 119.111 1.00 182.81 ? 17  LYS D C   1 
ATOM   6259  O  O   . LYS C 1 17  ? 179.410 171.553 119.953 1.00 181.42 ? 17  LYS D O   1 
ATOM   6260  C  CB  . LYS C 1 17  ? 180.750 168.671 119.517 1.00 182.80 ? 17  LYS D CB  1 
ATOM   6261  C  CG  . LYS C 1 17  ? 180.370 167.216 119.256 1.00 182.69 ? 17  LYS D CG  1 
ATOM   6262  C  CD  . LYS C 1 17  ? 180.885 166.281 120.338 1.00 185.34 ? 17  LYS D CD  1 
ATOM   6263  C  CE  . LYS C 1 17  ? 180.974 164.847 119.867 1.00 188.94 ? 17  LYS D CE  1 
ATOM   6264  N  NZ  . LYS C 1 17  ? 179.639 164.226 119.669 1.00 191.69 ? 17  LYS D NZ  1 
ATOM   6265  N  N   . ARG C 1 18  ? 181.199 171.829 118.571 1.00 181.68 ? 18  ARG D N   1 
ATOM   6266  C  CA  . ARG C 1 18  ? 181.504 173.216 118.931 1.00 181.87 ? 18  ARG D CA  1 
ATOM   6267  C  C   . ARG C 1 18  ? 180.432 174.205 118.421 1.00 182.91 ? 18  ARG D C   1 
ATOM   6268  O  O   . ARG C 1 18  ? 180.048 175.112 119.166 1.00 182.28 ? 18  ARG D O   1 
ATOM   6269  C  CB  . ARG C 1 18  ? 182.887 173.617 118.398 1.00 183.45 ? 18  ARG D CB  1 
ATOM   6270  N  N   . ILE C 1 19  ? 179.957 174.033 117.164 1.00 179.72 ? 19  ILE D N   1 
ATOM   6271  C  CA  . ILE C 1 19  ? 178.944 174.907 116.551 1.00 177.94 ? 19  ILE D CA  1 
ATOM   6272  C  C   . ILE C 1 19  ? 177.554 174.663 117.164 1.00 175.11 ? 19  ILE D C   1 
ATOM   6273  O  O   . ILE C 1 19  ? 176.752 175.598 117.218 1.00 170.40 ? 19  ILE D O   1 
ATOM   6274  C  CB  . ILE C 1 19  ? 178.908 174.852 115.001 1.00 179.88 ? 19  ILE D CB  1 
ATOM   6275  C  CG1 . ILE C 1 19  ? 179.025 173.417 114.452 1.00 180.66 ? 19  ILE D CG1 1 
ATOM   6276  C  CG2 . ILE C 1 19  ? 179.985 175.774 114.421 1.00 181.98 ? 19  ILE D CG2 1 
ATOM   6277  C  CD1 . ILE C 1 19  ? 178.606 173.247 113.001 1.00 185.38 ? 19  ILE D CD1 1 
ATOM   6278  N  N   . PHE C 1 20  ? 177.285 173.432 117.653 1.00 170.33 ? 20  PHE D N   1 
ATOM   6279  C  CA  . PHE C 1 20  ? 176.031 173.104 118.331 1.00 163.72 ? 20  PHE D CA  1 
ATOM   6280  C  C   . PHE C 1 20  ? 175.995 173.817 119.688 1.00 166.02 ? 20  PHE D C   1 
ATOM   6281  O  O   . PHE C 1 20  ? 174.963 174.378 120.061 1.00 160.20 ? 20  PHE D O   1 
ATOM   6282  C  CB  . PHE C 1 20  ? 175.856 171.578 118.499 1.00 165.68 ? 20  PHE D CB  1 
ATOM   6283  C  CG  . PHE C 1 20  ? 174.647 171.158 119.317 1.00 161.59 ? 20  PHE D CG  1 
ATOM   6284  C  CD1 . PHE C 1 20  ? 173.371 171.154 118.758 1.00 159.71 ? 20  PHE D CD1 1 
ATOM   6285  C  CD2 . PHE C 1 20  ? 174.787 170.758 120.642 1.00 163.70 ? 20  PHE D CD2 1 
ATOM   6286  C  CE1 . PHE C 1 20  ? 172.258 170.764 119.513 1.00 155.42 ? 20  PHE D CE1 1 
ATOM   6287  C  CE2 . PHE C 1 20  ? 173.672 170.374 121.398 1.00 161.34 ? 20  PHE D CE2 1 
ATOM   6288  C  CZ  . PHE C 1 20  ? 172.418 170.372 120.825 1.00 154.39 ? 20  PHE D CZ  1 
ATOM   6289  N  N   . GLY C 1 21  ? 177.129 173.796 120.390 1.00 167.82 ? 21  GLY D N   1 
ATOM   6290  C  CA  . GLY C 1 21  ? 177.295 174.441 121.688 1.00 167.59 ? 21  GLY D CA  1 
ATOM   6291  C  C   . GLY C 1 21  ? 177.169 175.948 121.610 1.00 170.16 ? 21  GLY D C   1 
ATOM   6292  O  O   . GLY C 1 21  ? 176.612 176.571 122.516 1.00 166.40 ? 21  GLY D O   1 
ATOM   6293  N  N   . ALA C 1 22  ? 177.667 176.529 120.503 1.00 169.81 ? 22  ALA D N   1 
ATOM   6294  C  CA  . ALA C 1 22  ? 177.645 177.961 120.202 1.00 169.80 ? 22  ALA D CA  1 
ATOM   6295  C  C   . ALA C 1 22  ? 176.214 178.479 120.054 1.00 167.02 ? 22  ALA D C   1 
ATOM   6296  O  O   . ALA C 1 22  ? 175.907 179.576 120.534 1.00 165.30 ? 22  ALA D O   1 
ATOM   6297  C  CB  . ALA C 1 22  ? 178.431 178.231 118.930 1.00 175.75 ? 22  ALA D CB  1 
ATOM   6298  N  N   . VAL C 1 23  ? 175.339 177.673 119.412 1.00 159.74 ? 23  VAL D N   1 
ATOM   6299  C  CA  . VAL C 1 23  ? 173.917 177.960 119.187 1.00 153.23 ? 23  VAL D CA  1 
ATOM   6300  C  C   . VAL C 1 23  ? 173.193 178.060 120.545 1.00 152.20 ? 23  VAL D C   1 
ATOM   6301  O  O   . VAL C 1 23  ? 172.509 179.055 120.803 1.00 147.81 ? 23  VAL D O   1 
ATOM   6302  C  CB  . VAL C 1 23  ? 173.284 176.883 118.254 1.00 155.53 ? 23  VAL D CB  1 
ATOM   6303  C  CG1 . VAL C 1 23  ? 171.762 176.837 118.376 1.00 148.92 ? 23  VAL D CG1 1 
ATOM   6304  C  CG2 . VAL C 1 23  ? 173.705 177.096 116.802 1.00 158.98 ? 23  VAL D CG2 1 
ATOM   6305  N  N   . LEU C 1 24  ? 173.383 177.038 121.408 1.00 149.79 ? 24  LEU D N   1 
ATOM   6306  C  CA  . LEU C 1 24  ? 172.785 176.935 122.735 1.00 146.94 ? 24  LEU D CA  1 
ATOM   6307  C  C   . LEU C 1 24  ? 173.334 177.984 123.693 1.00 153.52 ? 24  LEU D C   1 
ATOM   6308  O  O   . LEU C 1 24  ? 172.562 178.511 124.496 1.00 150.25 ? 24  LEU D O   1 
ATOM   6309  C  CB  . LEU C 1 24  ? 172.996 175.531 123.315 1.00 148.29 ? 24  LEU D CB  1 
ATOM   6310  C  CG  . LEU C 1 24  ? 171.858 174.545 123.063 1.00 149.14 ? 24  LEU D CG  1 
ATOM   6311  C  CD1 . LEU C 1 24  ? 171.978 173.889 121.694 1.00 150.51 ? 24  LEU D CD1 1 
ATOM   6312  C  CD2 . LEU C 1 24  ? 171.809 173.486 124.141 1.00 152.57 ? 24  LEU D CD2 1 
ATOM   6313  N  N   . LEU C 1 25  ? 174.650 178.297 123.607 1.00 155.74 ? 25  LEU D N   1 
ATOM   6314  C  CA  . LEU C 1 25  ? 175.289 179.308 124.456 1.00 158.46 ? 25  LEU D CA  1 
ATOM   6315  C  C   . LEU C 1 25  ? 174.721 180.693 124.155 1.00 159.86 ? 25  LEU D C   1 
ATOM   6316  O  O   . LEU C 1 25  ? 174.523 181.477 125.083 1.00 158.80 ? 25  LEU D O   1 
ATOM   6317  C  CB  . LEU C 1 25  ? 176.811 179.310 124.283 1.00 165.93 ? 25  LEU D CB  1 
ATOM   6318  C  CG  . LEU C 1 25  ? 177.589 179.940 125.429 1.00 175.19 ? 25  LEU D CG  1 
ATOM   6319  C  CD1 . LEU C 1 25  ? 178.309 178.881 126.234 1.00 179.56 ? 25  LEU D CD1 1 
ATOM   6320  C  CD2 . LEU C 1 25  ? 178.561 180.990 124.920 1.00 182.99 ? 25  LEU D CD2 1 
ATOM   6321  N  N   . PHE C 1 26  ? 174.431 180.976 122.868 1.00 155.46 ? 26  PHE D N   1 
ATOM   6322  C  CA  . PHE C 1 26  ? 173.857 182.249 122.447 1.00 153.45 ? 26  PHE D CA  1 
ATOM   6323  C  C   . PHE C 1 26  ? 172.396 182.341 122.867 1.00 151.16 ? 26  PHE D C   1 
ATOM   6324  O  O   . PHE C 1 26  ? 171.973 183.380 123.374 1.00 149.24 ? 26  PHE D O   1 
ATOM   6325  C  CB  . PHE C 1 26  ? 173.995 182.457 120.931 1.00 156.77 ? 26  PHE D CB  1 
ATOM   6326  C  CG  . PHE C 1 26  ? 173.562 183.837 120.482 1.00 157.49 ? 26  PHE D CG  1 
ATOM   6327  C  CD1 . PHE C 1 26  ? 174.379 184.944 120.690 1.00 164.63 ? 26  PHE D CD1 1 
ATOM   6328  C  CD2 . PHE C 1 26  ? 172.328 184.033 119.869 1.00 155.02 ? 26  PHE D CD2 1 
ATOM   6329  C  CE1 . PHE C 1 26  ? 173.971 186.220 120.293 1.00 164.88 ? 26  PHE D CE1 1 
ATOM   6330  C  CE2 . PHE C 1 26  ? 171.922 185.312 119.471 1.00 157.13 ? 26  PHE D CE2 1 
ATOM   6331  C  CZ  . PHE C 1 26  ? 172.746 186.396 119.688 1.00 159.22 ? 26  PHE D CZ  1 
ATOM   6332  N  N   . SER C 1 27  ? 171.635 181.251 122.663 1.00 144.83 ? 27  SER D N   1 
ATOM   6333  C  CA  . SER C 1 27  ? 170.215 181.155 123.004 1.00 139.38 ? 27  SER D CA  1 
ATOM   6334  C  C   . SER C 1 27  ? 169.969 181.388 124.491 1.00 142.07 ? 27  SER D C   1 
ATOM   6335  O  O   . SER C 1 27  ? 168.923 181.932 124.849 1.00 138.19 ? 27  SER D O   1 
ATOM   6336  C  CB  . SER C 1 27  ? 169.660 179.794 122.601 1.00 141.99 ? 27  SER D CB  1 
ATOM   6337  O  OG  . SER C 1 27  ? 169.820 179.565 121.210 1.00 154.66 ? 27  SER D OG  1 
ATOM   6338  N  N   . TRP C 1 28  ? 170.939 181.001 125.347 1.00 142.30 ? 28  TRP D N   1 
ATOM   6339  C  CA  . TRP C 1 28  ? 170.844 181.165 126.794 1.00 142.53 ? 28  TRP D CA  1 
ATOM   6340  C  C   . TRP C 1 28  ? 171.312 182.541 127.258 1.00 148.01 ? 28  TRP D C   1 
ATOM   6341  O  O   . TRP C 1 28  ? 170.711 183.071 128.192 1.00 146.27 ? 28  TRP D O   1 
ATOM   6342  C  CB  . TRP C 1 28  ? 171.598 180.062 127.537 1.00 144.93 ? 28  TRP D CB  1 
ATOM   6343  C  CG  . TRP C 1 28  ? 170.746 178.853 127.758 1.00 142.93 ? 28  TRP D CG  1 
ATOM   6344  C  CD1 . TRP C 1 28  ? 170.727 177.717 127.005 1.00 145.51 ? 28  TRP D CD1 1 
ATOM   6345  C  CD2 . TRP C 1 28  ? 169.703 178.708 128.732 1.00 139.70 ? 28  TRP D CD2 1 
ATOM   6346  N  NE1 . TRP C 1 28  ? 169.770 176.850 127.479 1.00 142.06 ? 28  TRP D NE1 1 
ATOM   6347  C  CE2 . TRP C 1 28  ? 169.119 177.436 128.535 1.00 141.75 ? 28  TRP D CE2 1 
ATOM   6348  C  CE3 . TRP C 1 28  ? 169.218 179.521 129.770 1.00 140.18 ? 28  TRP D CE3 1 
ATOM   6349  C  CZ2 . TRP C 1 28  ? 168.073 176.958 129.336 1.00 138.28 ? 28  TRP D CZ2 1 
ATOM   6350  C  CZ3 . TRP C 1 28  ? 168.188 179.045 130.567 1.00 139.04 ? 28  TRP D CZ3 1 
ATOM   6351  C  CH2 . TRP C 1 28  ? 167.624 177.780 130.346 1.00 137.72 ? 28  TRP D CH2 1 
ATOM   6352  N  N   . THR C 1 29  ? 172.352 183.130 126.621 1.00 147.74 ? 29  THR D N   1 
ATOM   6353  C  CA  . THR C 1 29  ? 172.837 184.469 126.993 1.00 150.23 ? 29  THR D CA  1 
ATOM   6354  C  C   . THR C 1 29  ? 171.782 185.526 126.641 1.00 148.97 ? 29  THR D C   1 
ATOM   6355  O  O   . THR C 1 29  ? 171.555 186.440 127.436 1.00 148.49 ? 29  THR D O   1 
ATOM   6356  C  CB  . THR C 1 29  ? 174.195 184.796 126.365 1.00 166.01 ? 29  THR D CB  1 
ATOM   6357  O  OG1 . THR C 1 29  ? 174.155 184.535 124.963 1.00 165.85 ? 29  THR D OG1 1 
ATOM   6358  C  CG2 . THR C 1 29  ? 175.346 184.044 127.026 1.00 170.87 ? 29  THR D CG2 1 
ATOM   6359  N  N   . VAL C 1 30  ? 171.113 185.368 125.473 1.00 141.69 ? 30  VAL D N   1 
ATOM   6360  C  CA  . VAL C 1 30  ? 170.029 186.239 125.000 1.00 137.46 ? 30  VAL D CA  1 
ATOM   6361  C  C   . VAL C 1 30  ? 168.874 186.126 125.991 1.00 137.14 ? 30  VAL D C   1 
ATOM   6362  O  O   . VAL C 1 30  ? 168.339 187.153 126.416 1.00 136.13 ? 30  VAL D O   1 
ATOM   6363  C  CB  . VAL C 1 30  ? 169.609 185.899 123.545 1.00 139.34 ? 30  VAL D CB  1 
ATOM   6364  C  CG1 . VAL C 1 30  ? 168.215 186.427 123.207 1.00 134.51 ? 30  VAL D CG1 1 
ATOM   6365  C  CG2 . VAL C 1 30  ? 170.628 186.442 122.561 1.00 143.71 ? 30  VAL D CG2 1 
ATOM   6366  N  N   . TYR C 1 31  ? 168.544 184.880 126.401 1.00 131.44 ? 31  TYR D N   1 
ATOM   6367  C  CA  . TYR C 1 31  ? 167.508 184.600 127.387 1.00 128.02 ? 31  TYR D CA  1 
ATOM   6368  C  C   . TYR C 1 31  ? 167.836 185.274 128.724 1.00 134.52 ? 31  TYR D C   1 
ATOM   6369  O  O   . TYR C 1 31  ? 166.972 185.959 129.272 1.00 132.49 ? 31  TYR D O   1 
ATOM   6370  C  CB  . TYR C 1 31  ? 167.309 183.085 127.588 1.00 128.07 ? 31  TYR D CB  1 
ATOM   6371  C  CG  . TYR C 1 31  ? 166.349 182.773 128.714 1.00 128.15 ? 31  TYR D CG  1 
ATOM   6372  C  CD1 . TYR C 1 31  ? 164.986 183.026 128.585 1.00 126.46 ? 31  TYR D CD1 1 
ATOM   6373  C  CD2 . TYR C 1 31  ? 166.808 182.279 129.932 1.00 131.48 ? 31  TYR D CD2 1 
ATOM   6374  C  CE1 . TYR C 1 31  ? 164.104 182.786 129.635 1.00 126.27 ? 31  TYR D CE1 1 
ATOM   6375  C  CE2 . TYR C 1 31  ? 165.933 182.026 130.986 1.00 130.98 ? 31  TYR D CE2 1 
ATOM   6376  C  CZ  . TYR C 1 31  ? 164.582 182.281 130.832 1.00 135.39 ? 31  TYR D CZ  1 
ATOM   6377  O  OH  . TYR C 1 31  ? 163.719 182.048 131.871 1.00 136.87 ? 31  TYR D OH  1 
ATOM   6378  N  N   . LEU C 1 32  ? 169.080 185.093 129.233 1.00 135.54 ? 32  LEU D N   1 
ATOM   6379  C  CA  . LEU C 1 32  ? 169.540 185.674 130.499 1.00 138.73 ? 32  LEU D CA  1 
ATOM   6380  C  C   . LEU C 1 32  ? 169.566 187.199 130.436 1.00 144.06 ? 32  LEU D C   1 
ATOM   6381  O  O   . LEU C 1 32  ? 169.307 187.839 131.454 1.00 145.06 ? 32  LEU D O   1 
ATOM   6382  C  CB  . LEU C 1 32  ? 170.916 185.134 130.915 1.00 144.25 ? 32  LEU D CB  1 
ATOM   6383  C  CG  . LEU C 1 32  ? 170.959 183.694 131.445 1.00 148.82 ? 32  LEU D CG  1 
ATOM   6384  C  CD1 . LEU C 1 32  ? 172.375 183.181 131.492 1.00 155.10 ? 32  LEU D CD1 1 
ATOM   6385  C  CD2 . LEU C 1 32  ? 170.323 183.574 132.822 1.00 149.75 ? 32  LEU D CD2 1 
ATOM   6386  N  N   . TRP C 1 33  ? 169.840 187.774 129.244 1.00 140.55 ? 33  TRP D N   1 
ATOM   6387  C  CA  . TRP C 1 33  ? 169.825 189.221 129.021 1.00 141.61 ? 33  TRP D CA  1 
ATOM   6388  C  C   . TRP C 1 33  ? 168.395 189.745 129.158 1.00 141.38 ? 33  TRP D C   1 
ATOM   6389  O  O   . TRP C 1 33  ? 168.160 190.746 129.838 1.00 141.99 ? 33  TRP D O   1 
ATOM   6390  C  CB  . TRP C 1 33  ? 170.404 189.569 127.636 1.00 141.71 ? 33  TRP D CB  1 
ATOM   6391  C  CG  . TRP C 1 33  ? 170.048 190.941 127.135 1.00 142.30 ? 33  TRP D CG  1 
ATOM   6392  C  CD1 . TRP C 1 33  ? 169.193 191.245 126.117 1.00 141.68 ? 33  TRP D CD1 1 
ATOM   6393  C  CD2 . TRP C 1 33  ? 170.513 192.194 127.656 1.00 145.87 ? 33  TRP D CD2 1 
ATOM   6394  N  NE1 . TRP C 1 33  ? 169.115 192.608 125.955 1.00 142.42 ? 33  TRP D NE1 1 
ATOM   6395  C  CE2 . TRP C 1 33  ? 169.915 193.216 126.888 1.00 148.21 ? 33  TRP D CE2 1 
ATOM   6396  C  CE3 . TRP C 1 33  ? 171.395 192.553 128.691 1.00 152.05 ? 33  TRP D CE3 1 
ATOM   6397  C  CZ2 . TRP C 1 33  ? 170.179 194.571 127.110 1.00 150.84 ? 33  TRP D CZ2 1 
ATOM   6398  C  CZ3 . TRP C 1 33  ? 171.642 193.896 128.922 1.00 156.77 ? 33  TRP D CZ3 1 
ATOM   6399  C  CH2 . TRP C 1 33  ? 171.041 194.888 128.136 1.00 155.78 ? 33  TRP D CH2 1 
ATOM   6400  N  N   . GLU C 1 34  ? 167.447 189.045 128.522 1.00 133.96 ? 34  GLU D N   1 
ATOM   6401  C  CA  . GLU C 1 34  ? 166.029 189.378 128.535 1.00 130.14 ? 34  GLU D CA  1 
ATOM   6402  C  C   . GLU C 1 34  ? 165.431 189.152 129.927 1.00 134.41 ? 34  GLU D C   1 
ATOM   6403  O  O   . GLU C 1 34  ? 164.519 189.887 130.311 1.00 132.88 ? 34  GLU D O   1 
ATOM   6404  C  CB  . GLU C 1 34  ? 165.278 188.567 127.470 1.00 127.78 ? 34  GLU D CB  1 
ATOM   6405  C  CG  . GLU C 1 34  ? 165.552 189.053 126.053 1.00 139.76 ? 34  GLU D CG  1 
ATOM   6406  C  CD  . GLU C 1 34  ? 164.829 188.350 124.919 1.00 157.99 ? 34  GLU D CD  1 
ATOM   6407  O  OE1 . GLU C 1 34  ? 164.271 187.251 125.142 1.00 149.66 ? 34  GLU D OE1 1 
ATOM   6408  O  OE2 . GLU C 1 34  ? 164.845 188.896 123.792 1.00 153.03 ? 34  GLU D OE2 1 
ATOM   6409  N  N   . THR C 1 35  ? 165.961 188.158 130.684 1.00 132.60 ? 35  THR D N   1 
ATOM   6410  C  CA  . THR C 1 35  ? 165.530 187.827 132.050 1.00 132.51 ? 35  THR D CA  1 
ATOM   6411  C  C   . THR C 1 35  ? 166.060 188.908 133.006 1.00 140.29 ? 35  THR D C   1 
ATOM   6412  O  O   . THR C 1 35  ? 165.325 189.330 133.902 1.00 139.99 ? 35  THR D O   1 
ATOM   6413  C  CB  . THR C 1 35  ? 165.962 186.396 132.434 1.00 138.49 ? 35  THR D CB  1 
ATOM   6414  O  OG1 . THR C 1 35  ? 165.398 185.487 131.491 1.00 133.95 ? 35  THR D OG1 1 
ATOM   6415  C  CG2 . THR C 1 35  ? 165.507 185.987 133.830 1.00 136.62 ? 35  THR D CG2 1 
ATOM   6416  N  N   . PHE C 1 36  ? 167.312 189.378 132.794 1.00 140.40 ? 36  PHE D N   1 
ATOM   6417  C  CA  . PHE C 1 36  ? 167.906 190.457 133.592 1.00 144.91 ? 36  PHE D CA  1 
ATOM   6418  C  C   . PHE C 1 36  ? 167.064 191.722 133.413 1.00 147.06 ? 36  PHE D C   1 
ATOM   6419  O  O   . PHE C 1 36  ? 166.792 192.427 134.387 1.00 148.64 ? 36  PHE D O   1 
ATOM   6420  C  CB  . PHE C 1 36  ? 169.384 190.701 133.201 1.00 151.83 ? 36  PHE D CB  1 
ATOM   6421  C  CG  . PHE C 1 36  ? 169.931 192.082 133.506 1.00 157.80 ? 36  PHE D CG  1 
ATOM   6422  C  CD1 . PHE C 1 36  ? 170.181 192.478 134.817 1.00 164.94 ? 36  PHE D CD1 1 
ATOM   6423  C  CD2 . PHE C 1 36  ? 170.196 192.985 132.483 1.00 160.43 ? 36  PHE D CD2 1 
ATOM   6424  C  CE1 . PHE C 1 36  ? 170.667 193.759 135.098 1.00 170.24 ? 36  PHE D CE1 1 
ATOM   6425  C  CE2 . PHE C 1 36  ? 170.689 194.262 132.765 1.00 167.62 ? 36  PHE D CE2 1 
ATOM   6426  C  CZ  . PHE C 1 36  ? 170.923 194.640 134.069 1.00 169.65 ? 36  PHE D CZ  1 
ATOM   6427  N  N   . LEU C 1 37  ? 166.627 191.968 132.162 1.00 140.12 ? 37  LEU D N   1 
ATOM   6428  C  CA  . LEU C 1 37  ? 165.774 193.084 131.762 1.00 137.91 ? 37  LEU D CA  1 
ATOM   6429  C  C   . LEU C 1 37  ? 164.401 192.954 132.415 1.00 139.18 ? 37  LEU D C   1 
ATOM   6430  O  O   . LEU C 1 37  ? 163.889 193.936 132.954 1.00 139.38 ? 37  LEU D O   1 
ATOM   6431  C  CB  . LEU C 1 37  ? 165.648 193.099 130.230 1.00 135.27 ? 37  LEU D CB  1 
ATOM   6432  C  CG  . LEU C 1 37  ? 166.392 194.188 129.463 1.00 142.31 ? 37  LEU D CG  1 
ATOM   6433  C  CD1 . LEU C 1 37  ? 167.853 194.269 129.867 1.00 147.86 ? 37  LEU D CD1 1 
ATOM   6434  C  CD2 . LEU C 1 37  ? 166.299 193.934 127.988 1.00 141.84 ? 37  LEU D CD2 1 
ATOM   6435  N  N   . ALA C 1 38  ? 163.831 191.729 132.396 1.00 133.19 ? 38  ALA D N   1 
ATOM   6436  C  CA  . ALA C 1 38  ? 162.541 191.396 133.000 1.00 130.45 ? 38  ALA D CA  1 
ATOM   6437  C  C   . ALA C 1 38  ? 162.588 191.623 134.505 1.00 137.80 ? 38  ALA D C   1 
ATOM   6438  O  O   . ALA C 1 38  ? 161.630 192.160 135.057 1.00 136.85 ? 38  ALA D O   1 
ATOM   6439  C  CB  . ALA C 1 38  ? 162.173 189.952 132.692 1.00 128.34 ? 38  ALA D CB  1 
ATOM   6440  N  N   . GLN C 1 39  ? 163.716 191.252 135.154 1.00 138.75 ? 39  GLN D N   1 
ATOM   6441  C  CA  . GLN C 1 39  ? 163.962 191.436 136.587 1.00 143.02 ? 39  GLN D CA  1 
ATOM   6442  C  C   . GLN C 1 39  ? 164.063 192.930 136.916 1.00 149.35 ? 39  GLN D C   1 
ATOM   6443  O  O   . GLN C 1 39  ? 163.526 193.371 137.936 1.00 150.85 ? 39  GLN D O   1 
ATOM   6444  C  CB  . GLN C 1 39  ? 165.248 190.703 137.009 1.00 148.63 ? 39  GLN D CB  1 
ATOM   6445  C  CG  . GLN C 1 39  ? 165.520 190.727 138.513 1.00 174.03 ? 39  GLN D CG  1 
ATOM   6446  C  CD  . GLN C 1 39  ? 166.992 190.815 138.829 1.00 204.80 ? 39  GLN D CD  1 
ATOM   6447  O  OE1 . GLN C 1 39  ? 167.736 191.624 138.260 1.00 202.28 ? 39  GLN D OE1 1 
ATOM   6448  N  NE2 . GLN C 1 39  ? 167.437 190.008 139.779 1.00 204.32 ? 39  GLN D NE2 1 
ATOM   6449  N  N   . ARG C 1 40  ? 164.743 193.697 136.036 1.00 145.95 ? 40  ARG D N   1 
ATOM   6450  C  CA  . ARG C 1 40  ? 164.953 195.140 136.151 1.00 148.32 ? 40  ARG D CA  1 
ATOM   6451  C  C   . ARG C 1 40  ? 163.620 195.900 136.126 1.00 148.07 ? 40  ARG D C   1 
ATOM   6452  O  O   . ARG C 1 40  ? 163.448 196.824 136.921 1.00 150.61 ? 40  ARG D O   1 
ATOM   6453  C  CB  . ARG C 1 40  ? 165.876 195.633 135.028 1.00 149.82 ? 40  ARG D CB  1 
ATOM   6454  C  CG  . ARG C 1 40  ? 166.743 196.811 135.433 1.00 165.91 ? 40  ARG D CG  1 
ATOM   6455  C  CD  . ARG C 1 40  ? 167.894 197.023 134.468 1.00 177.42 ? 40  ARG D CD  1 
ATOM   6456  N  NE  . ARG C 1 40  ? 168.699 198.190 134.834 1.00 193.79 ? 40  ARG D NE  1 
ATOM   6457  C  CZ  . ARG C 1 40  ? 169.701 198.169 135.710 1.00 219.30 ? 40  ARG D CZ  1 
ATOM   6458  N  NH1 . ARG C 1 40  ? 170.038 197.041 136.324 1.00 208.06 ? 40  ARG D NH1 1 
ATOM   6459  N  NH2 . ARG C 1 40  ? 170.373 199.282 135.981 1.00 216.20 ? 40  ARG D NH2 1 
ATOM   6460  N  N   . GLN C 1 41  ? 162.672 195.488 135.253 1.00 138.31 ? 41  GLN D N   1 
ATOM   6461  C  CA  . GLN C 1 41  ? 161.354 196.117 135.142 1.00 134.86 ? 41  GLN D CA  1 
ATOM   6462  C  C   . GLN C 1 41  ? 160.383 195.596 136.189 1.00 136.83 ? 41  GLN D C   1 
ATOM   6463  O  O   . GLN C 1 41  ? 159.462 196.320 136.556 1.00 136.50 ? 41  GLN D O   1 
ATOM   6464  C  CB  . GLN C 1 41  ? 160.758 195.935 133.751 1.00 131.74 ? 41  GLN D CB  1 
ATOM   6465  C  CG  . GLN C 1 41  ? 160.333 197.259 133.138 1.00 147.35 ? 41  GLN D CG  1 
ATOM   6466  C  CD  . GLN C 1 41  ? 158.851 197.379 132.899 1.00 166.20 ? 41  GLN D CD  1 
ATOM   6467  O  OE1 . GLN C 1 41  ? 158.238 198.402 133.216 1.00 165.81 ? 41  GLN D OE1 1 
ATOM   6468  N  NE2 . GLN C 1 41  ? 158.246 196.368 132.288 1.00 152.77 ? 41  GLN D NE2 1 
ATOM   6469  N  N   . ARG C 1 42  ? 160.581 194.359 136.675 1.00 132.87 ? 42  ARG D N   1 
ATOM   6470  C  CA  . ARG C 1 42  ? 159.739 193.785 137.727 1.00 132.94 ? 42  ARG D CA  1 
ATOM   6471  C  C   . ARG C 1 42  ? 159.967 194.557 139.033 1.00 142.77 ? 42  ARG D C   1 
ATOM   6472  O  O   . ARG C 1 42  ? 159.029 194.735 139.812 1.00 143.30 ? 42  ARG D O   1 
ATOM   6473  C  CB  . ARG C 1 42  ? 160.031 192.290 137.908 1.00 132.66 ? 42  ARG D CB  1 
ATOM   6474  C  CG  . ARG C 1 42  ? 159.018 191.552 138.765 1.00 143.28 ? 42  ARG D CG  1 
ATOM   6475  C  CD  . ARG C 1 42  ? 159.218 190.049 138.711 1.00 151.10 ? 42  ARG D CD  1 
ATOM   6476  N  NE  . ARG C 1 42  ? 158.584 189.376 139.846 1.00 159.69 ? 42  ARG D NE  1 
ATOM   6477  C  CZ  . ARG C 1 42  ? 157.294 189.062 139.909 1.00 171.58 ? 42  ARG D CZ  1 
ATOM   6478  N  NH1 . ARG C 1 42  ? 156.481 189.363 138.904 1.00 152.62 ? 42  ARG D NH1 1 
ATOM   6479  N  NH2 . ARG C 1 42  ? 156.804 188.458 140.983 1.00 163.76 ? 42  ARG D NH2 1 
ATOM   6480  N  N   . ARG C 1 43  ? 161.210 195.044 139.239 1.00 143.63 ? 43  ARG D N   1 
ATOM   6481  C  CA  . ARG C 1 43  ? 161.608 195.850 140.393 1.00 149.14 ? 43  ARG D CA  1 
ATOM   6482  C  C   . ARG C 1 43  ? 160.875 197.192 140.376 1.00 153.12 ? 43  ARG D C   1 
ATOM   6483  O  O   . ARG C 1 43  ? 160.460 197.653 141.433 1.00 155.60 ? 43  ARG D O   1 
ATOM   6484  C  CB  . ARG C 1 43  ? 163.130 196.064 140.417 1.00 153.97 ? 43  ARG D CB  1 
ATOM   6485  N  N   . ILE C 1 44  ? 160.678 197.786 139.173 1.00 147.05 ? 44  ILE D N   1 
ATOM   6486  C  CA  . ILE C 1 44  ? 159.972 199.062 138.972 1.00 147.43 ? 44  ILE D CA  1 
ATOM   6487  C  C   . ILE C 1 44  ? 158.520 198.931 139.444 1.00 150.07 ? 44  ILE D C   1 
ATOM   6488  O  O   . ILE C 1 44  ? 158.036 199.819 140.145 1.00 152.88 ? 44  ILE D O   1 
ATOM   6489  C  CB  . ILE C 1 44  ? 160.049 199.561 137.494 1.00 147.88 ? 44  ILE D CB  1 
ATOM   6490  C  CG1 . ILE C 1 44  ? 161.496 199.532 136.913 1.00 150.74 ? 44  ILE D CG1 1 
ATOM   6491  C  CG2 . ILE C 1 44  ? 159.360 200.926 137.286 1.00 148.98 ? 44  ILE D CG2 1 
ATOM   6492  C  CD1 . ILE C 1 44  ? 162.657 200.337 137.686 1.00 166.63 ? 44  ILE D CD1 1 
ATOM   6493  N  N   . TYR C 1 45  ? 157.847 197.817 139.092 1.00 142.62 ? 45  TYR D N   1 
ATOM   6494  C  CA  . TYR C 1 45  ? 156.465 197.537 139.485 1.00 141.06 ? 45  TYR D CA  1 
ATOM   6495  C  C   . TYR C 1 45  ? 156.336 197.391 141.012 1.00 150.85 ? 45  TYR D C   1 
ATOM   6496  O  O   . TYR C 1 45  ? 155.351 197.859 141.584 1.00 151.64 ? 45  TYR D O   1 
ATOM   6497  C  CB  . TYR C 1 45  ? 155.938 196.270 138.779 1.00 137.17 ? 45  TYR D CB  1 
ATOM   6498  C  CG  . TYR C 1 45  ? 155.891 196.355 137.265 1.00 134.93 ? 45  TYR D CG  1 
ATOM   6499  C  CD1 . TYR C 1 45  ? 155.311 197.447 136.624 1.00 136.53 ? 45  TYR D CD1 1 
ATOM   6500  C  CD2 . TYR C 1 45  ? 156.354 195.306 136.475 1.00 132.84 ? 45  TYR D CD2 1 
ATOM   6501  C  CE1 . TYR C 1 45  ? 155.254 197.525 135.232 1.00 134.62 ? 45  TYR D CE1 1 
ATOM   6502  C  CE2 . TYR C 1 45  ? 156.292 195.367 135.081 1.00 130.83 ? 45  TYR D CE2 1 
ATOM   6503  C  CZ  . TYR C 1 45  ? 155.733 196.477 134.464 1.00 138.38 ? 45  TYR D CZ  1 
ATOM   6504  O  OH  . TYR C 1 45  ? 155.657 196.549 133.092 1.00 136.68 ? 45  TYR D OH  1 
ATOM   6505  N  N   . LYS C 1 46  ? 157.351 196.788 141.666 1.00 151.63 ? 46  LYS D N   1 
ATOM   6506  C  CA  . LYS C 1 46  ? 157.394 196.557 143.116 1.00 156.80 ? 46  LYS D CA  1 
ATOM   6507  C  C   . LYS C 1 46  ? 157.816 197.802 143.908 1.00 168.03 ? 46  LYS D C   1 
ATOM   6508  O  O   . LYS C 1 46  ? 157.321 198.002 145.019 1.00 171.37 ? 46  LYS D O   1 
ATOM   6509  C  CB  . LYS C 1 46  ? 158.353 195.401 143.456 1.00 160.41 ? 46  LYS D CB  1 
ATOM   6510  C  CG  . LYS C 1 46  ? 157.838 194.014 143.100 1.00 168.95 ? 46  LYS D CG  1 
ATOM   6511  N  N   . THR C 1 47  ? 158.742 198.616 143.359 1.00 167.23 ? 47  THR D N   1 
ATOM   6512  C  CA  . THR C 1 47  ? 159.265 199.806 144.035 1.00 173.76 ? 47  THR D CA  1 
ATOM   6513  C  C   . THR C 1 47  ? 158.310 200.999 143.888 1.00 180.03 ? 47  THR D C   1 
ATOM   6514  O  O   . THR C 1 47  ? 157.904 201.557 144.910 1.00 184.58 ? 47  THR D O   1 
ATOM   6515  C  CB  . THR C 1 47  ? 160.684 200.157 143.539 1.00 182.60 ? 47  THR D CB  1 
ATOM   6516  O  OG1 . THR C 1 47  ? 161.483 198.975 143.507 1.00 181.65 ? 47  THR D OG1 1 
ATOM   6517  C  CG2 . THR C 1 47  ? 161.371 201.203 144.412 1.00 188.23 ? 47  THR D CG2 1 
ATOM   6518  N  N   . THR C 1 48  ? 157.967 201.402 142.641 1.00 173.39 ? 48  THR D N   1 
ATOM   6519  C  CA  . THR C 1 48  ? 157.105 202.564 142.396 1.00 174.04 ? 48  THR D CA  1 
ATOM   6520  C  C   . THR C 1 48  ? 155.648 202.250 142.789 1.00 179.56 ? 48  THR D C   1 
ATOM   6521  O  O   . THR C 1 48  ? 154.827 201.872 141.948 1.00 174.07 ? 48  THR D O   1 
ATOM   6522  C  CB  . THR C 1 48  ? 157.235 203.084 140.954 1.00 174.97 ? 48  THR D CB  1 
ATOM   6523  O  OG1 . THR C 1 48  ? 156.738 202.107 140.042 1.00 167.17 ? 48  THR D OG1 1 
ATOM   6524  C  CG2 . THR C 1 48  ? 158.666 203.488 140.593 1.00 175.21 ? 48  THR D CG2 1 
ATOM   6525  N  N   . THR C 1 49  ? 155.351 202.408 144.092 1.00 183.78 ? 49  THR D N   1 
ATOM   6526  C  CA  . THR C 1 49  ? 154.031 202.190 144.694 1.00 185.00 ? 49  THR D CA  1 
ATOM   6527  C  C   . THR C 1 49  ? 153.250 203.531 144.748 1.00 192.77 ? 49  THR D C   1 
ATOM   6528  O  O   . THR C 1 49  ? 152.017 203.518 144.732 1.00 191.55 ? 49  THR D O   1 
ATOM   6529  C  CB  . THR C 1 49  ? 154.164 201.502 146.073 1.00 200.30 ? 49  THR D CB  1 
ATOM   6530  O  OG1 . THR C 1 49  ? 152.865 201.180 146.572 1.00 202.97 ? 49  THR D OG1 1 
ATOM   6531  C  CG2 . THR C 1 49  ? 154.959 202.330 147.102 1.00 205.16 ? 49  THR D CG2 1 
ATOM   6532  N  N   . HIS C 1 50  ? 153.979 204.670 144.791 1.00 193.34 ? 50  HIS D N   1 
ATOM   6533  C  CA  . HIS C 1 50  ? 153.458 206.040 144.802 1.00 196.23 ? 50  HIS D CA  1 
ATOM   6534  C  C   . HIS C 1 50  ? 153.351 206.577 143.367 1.00 197.09 ? 50  HIS D C   1 
ATOM   6535  O  O   . HIS C 1 50  ? 154.250 206.325 142.557 1.00 194.13 ? 50  HIS D O   1 
ATOM   6536  C  CB  . HIS C 1 50  ? 154.408 206.937 145.616 1.00 203.69 ? 50  HIS D CB  1 
ATOM   6537  C  CG  . HIS C 1 50  ? 153.802 207.599 146.814 1.00 213.13 ? 50  HIS D CG  1 
ATOM   6538  N  ND1 . HIS C 1 50  ? 152.947 208.680 146.690 1.00 216.35 ? 50  HIS D ND1 1 
ATOM   6539  C  CD2 . HIS C 1 50  ? 154.026 207.370 148.128 1.00 220.45 ? 50  HIS D CD2 1 
ATOM   6540  C  CE1 . HIS C 1 50  ? 152.647 209.044 147.928 1.00 221.96 ? 50  HIS D CE1 1 
ATOM   6541  N  NE2 . HIS C 1 50  ? 153.269 208.282 148.826 1.00 223.55 ? 50  HIS D NE2 1 
ATOM   6542  N  N   . VAL C 1 51  ? 152.272 207.333 143.061 1.00 194.46 ? 51  VAL D N   1 
ATOM   6543  C  CA  . VAL C 1 51  ? 152.019 207.930 141.734 1.00 191.39 ? 51  VAL D CA  1 
ATOM   6544  C  C   . VAL C 1 51  ? 153.027 209.081 141.491 1.00 198.41 ? 51  VAL D C   1 
ATOM   6545  O  O   . VAL C 1 51  ? 153.158 209.946 142.363 1.00 203.62 ? 51  VAL D O   1 
ATOM   6546  C  CB  . VAL C 1 51  ? 150.545 208.409 141.560 1.00 195.15 ? 51  VAL D CB  1 
ATOM   6547  C  CG1 . VAL C 1 51  ? 150.228 208.725 140.099 1.00 191.12 ? 51  VAL D CG1 1 
ATOM   6548  C  CG2 . VAL C 1 51  ? 149.552 207.384 142.106 1.00 193.59 ? 51  VAL D CG2 1 
ATOM   6549  N  N   . PRO C 1 52  ? 153.749 209.107 140.336 1.00 191.98 ? 52  PRO D N   1 
ATOM   6550  C  CA  . PRO C 1 52  ? 154.737 210.180 140.100 1.00 195.36 ? 52  PRO D CA  1 
ATOM   6551  C  C   . PRO C 1 52  ? 154.101 211.562 139.902 1.00 201.46 ? 52  PRO D C   1 
ATOM   6552  O  O   . PRO C 1 52  ? 152.950 211.624 139.463 1.00 198.43 ? 52  PRO D O   1 
ATOM   6553  C  CB  . PRO C 1 52  ? 155.460 209.730 138.821 1.00 193.22 ? 52  PRO D CB  1 
ATOM   6554  C  CG  . PRO C 1 52  ? 155.094 208.298 138.638 1.00 192.52 ? 52  PRO D CG  1 
ATOM   6555  C  CD  . PRO C 1 52  ? 153.731 208.153 139.211 1.00 187.50 ? 52  PRO D CD  1 
ATOM   6556  N  N   . PRO C 1 53  ? 154.817 212.680 140.206 1.00 203.20 ? 53  PRO D N   1 
ATOM   6557  C  CA  . PRO C 1 53  ? 154.209 214.015 140.033 1.00 206.06 ? 53  PRO D CA  1 
ATOM   6558  C  C   . PRO C 1 53  ? 153.966 214.382 138.567 1.00 206.34 ? 53  PRO D C   1 
ATOM   6559  O  O   . PRO C 1 53  ? 153.009 215.102 138.278 1.00 206.45 ? 53  PRO D O   1 
ATOM   6560  C  CB  . PRO C 1 53  ? 155.229 214.965 140.677 1.00 214.61 ? 53  PRO D CB  1 
ATOM   6561  C  CG  . PRO C 1 53  ? 156.140 214.091 141.485 1.00 220.04 ? 53  PRO D CG  1 
ATOM   6562  C  CD  . PRO C 1 53  ? 156.185 212.793 140.750 1.00 208.93 ? 53  PRO D CD  1 
ATOM   6563  N  N   . GLU C 1 54  ? 154.818 213.878 137.650 1.00 199.91 ? 54  GLU D N   1 
ATOM   6564  C  CA  . GLU C 1 54  ? 154.722 214.109 136.203 1.00 197.01 ? 54  GLU D CA  1 
ATOM   6565  C  C   . GLU C 1 54  ? 153.474 213.428 135.629 1.00 196.12 ? 54  GLU D C   1 
ATOM   6566  O  O   . GLU C 1 54  ? 152.712 214.063 134.895 1.00 195.44 ? 54  GLU D O   1 
ATOM   6567  C  CB  . GLU C 1 54  ? 155.981 213.598 135.476 1.00 196.94 ? 54  GLU D CB  1 
ATOM   6568  C  CG  . GLU C 1 54  ? 157.281 214.268 135.893 1.00 211.52 ? 54  GLU D CG  1 
ATOM   6569  C  CD  . GLU C 1 54  ? 158.532 213.655 135.293 1.00 226.33 ? 54  GLU D CD  1 
ATOM   6570  O  OE1 . GLU C 1 54  ? 158.766 212.443 135.502 1.00 212.10 ? 54  GLU D OE1 1 
ATOM   6571  O  OE2 . GLU C 1 54  ? 159.299 214.399 134.641 1.00 222.52 ? 54  GLU D OE2 1 
ATOM   6572  N  N   . LEU C 1 55  ? 153.266 212.138 135.980 1.00 189.34 ? 55  LEU D N   1 
ATOM   6573  C  CA  . LEU C 1 55  ? 152.129 211.322 135.545 1.00 184.52 ? 55  LEU D CA  1 
ATOM   6574  C  C   . LEU C 1 55  ? 150.957 211.399 136.560 1.00 189.89 ? 55  LEU D C   1 
ATOM   6575  O  O   . LEU C 1 55  ? 150.098 210.511 136.586 1.00 186.63 ? 55  LEU D O   1 
ATOM   6576  C  CB  . LEU C 1 55  ? 152.581 209.865 135.335 1.00 180.04 ? 55  LEU D CB  1 
ATOM   6577  N  N   . GLY C 1 56  ? 150.930 212.474 137.355 1.00 191.00 ? 56  GLY D N   1 
ATOM   6578  C  CA  . GLY C 1 56  ? 149.900 212.733 138.358 1.00 193.23 ? 56  GLY D CA  1 
ATOM   6579  C  C   . GLY C 1 56  ? 148.539 213.042 137.766 1.00 195.50 ? 56  GLY D C   1 
ATOM   6580  O  O   . GLY C 1 56  ? 147.518 212.564 138.274 1.00 194.69 ? 56  GLY D O   1 
ATOM   6581  N  N   . GLN C 1 57  ? 148.520 213.842 136.684 1.00 191.66 ? 57  GLN D N   1 
ATOM   6582  C  CA  . GLN C 1 57  ? 147.300 214.228 135.974 1.00 190.93 ? 57  GLN D CA  1 
ATOM   6583  C  C   . GLN C 1 57  ? 146.852 213.134 134.989 1.00 188.80 ? 57  GLN D C   1 
ATOM   6584  O  O   . GLN C 1 57  ? 145.670 213.074 134.642 1.00 188.00 ? 57  GLN D O   1 
ATOM   6585  C  CB  . GLN C 1 57  ? 147.511 215.556 135.232 1.00 195.38 ? 57  GLN D CB  1 
ATOM   6586  N  N   . ILE C 1 58  ? 147.795 212.274 134.551 1.00 181.08 ? 58  ILE D N   1 
ATOM   6587  C  CA  . ILE C 1 58  ? 147.557 211.178 133.609 1.00 175.59 ? 58  ILE D CA  1 
ATOM   6588  C  C   . ILE C 1 58  ? 146.755 210.035 134.255 1.00 177.12 ? 58  ILE D C   1 
ATOM   6589  O  O   . ILE C 1 58  ? 145.814 209.534 133.637 1.00 174.62 ? 58  ILE D O   1 
ATOM   6590  C  CB  . ILE C 1 58  ? 148.900 210.656 133.048 1.00 176.27 ? 58  ILE D CB  1 
ATOM   6591  N  N   . MET C 1 59  ? 147.124 209.627 135.487 1.00 174.31 ? 59  MET D N   1 
ATOM   6592  C  CA  . MET C 1 59  ? 146.488 208.524 136.211 1.00 172.29 ? 59  MET D CA  1 
ATOM   6593  C  C   . MET C 1 59  ? 146.186 208.855 137.666 1.00 178.33 ? 59  MET D C   1 
ATOM   6594  O  O   . MET C 1 59  ? 146.956 209.573 138.306 1.00 181.11 ? 59  MET D O   1 
ATOM   6595  C  CB  . MET C 1 59  ? 147.412 207.296 136.188 1.00 171.33 ? 59  MET D CB  1 
ATOM   6596  C  CG  . MET C 1 59  ? 147.110 206.320 135.092 1.00 170.51 ? 59  MET D CG  1 
ATOM   6597  S  SD  . MET C 1 59  ? 148.015 204.785 135.380 1.00 171.62 ? 59  MET D SD  1 
ATOM   6598  C  CE  . MET C 1 59  ? 147.104 203.686 134.335 1.00 164.05 ? 59  MET D CE  1 
ATOM   6599  N  N   . ASP C 1 60  ? 145.098 208.277 138.206 1.00 173.94 ? 60  ASP D N   1 
ATOM   6600  C  CA  . ASP C 1 60  ? 144.754 208.421 139.620 1.00 177.75 ? 60  ASP D CA  1 
ATOM   6601  C  C   . ASP C 1 60  ? 145.312 207.220 140.400 1.00 179.58 ? 60  ASP D C   1 
ATOM   6602  O  O   . ASP C 1 60  ? 145.629 206.196 139.788 1.00 174.92 ? 60  ASP D O   1 
ATOM   6603  C  CB  . ASP C 1 60  ? 143.237 208.576 139.830 1.00 181.67 ? 60  ASP D CB  1 
ATOM   6604  C  CG  . ASP C 1 60  ? 142.395 207.448 139.277 1.00 186.60 ? 60  ASP D CG  1 
ATOM   6605  O  OD1 . ASP C 1 60  ? 142.218 207.393 138.042 1.00 184.09 ? 60  ASP D OD1 1 
ATOM   6606  O  OD2 . ASP C 1 60  ? 141.874 206.647 140.084 1.00 191.84 ? 60  ASP D OD2 1 
ATOM   6607  N  N   . SER C 1 61  ? 145.431 207.350 141.743 1.00 179.56 ? 61  SER D N   1 
ATOM   6608  C  CA  . SER C 1 61  ? 145.972 206.334 142.662 1.00 179.09 ? 61  SER D CA  1 
ATOM   6609  C  C   . SER C 1 61  ? 145.280 204.971 142.529 1.00 177.89 ? 61  SER D C   1 
ATOM   6610  O  O   . SER C 1 61  ? 145.957 203.945 142.620 1.00 174.95 ? 61  SER D O   1 
ATOM   6611  C  CB  . SER C 1 61  ? 145.878 206.798 144.115 1.00 189.31 ? 61  SER D CB  1 
ATOM   6612  O  OG  . SER C 1 61  ? 145.631 208.187 144.265 1.00 202.96 ? 61  SER D OG  1 
ATOM   6613  N  N   . GLU C 1 62  ? 143.946 204.964 142.321 1.00 173.62 ? 62  GLU D N   1 
ATOM   6614  C  CA  . GLU C 1 62  ? 143.156 203.737 142.172 1.00 170.50 ? 62  GLU D CA  1 
ATOM   6615  C  C   . GLU C 1 62  ? 143.500 203.019 140.861 1.00 167.44 ? 62  GLU D C   1 
ATOM   6616  O  O   . GLU C 1 62  ? 143.753 201.815 140.884 1.00 164.45 ? 62  GLU D O   1 
ATOM   6617  C  CB  . GLU C 1 62  ? 141.649 204.034 142.249 1.00 174.35 ? 62  GLU D CB  1 
ATOM   6618  N  N   . THR C 1 63  ? 143.538 203.764 139.735 1.00 161.53 ? 63  THR D N   1 
ATOM   6619  C  CA  . THR C 1 63  ? 143.862 203.250 138.399 1.00 156.07 ? 63  THR D CA  1 
ATOM   6620  C  C   . THR C 1 63  ? 145.334 202.808 138.341 1.00 157.11 ? 63  THR D C   1 
ATOM   6621  O  O   . THR C 1 63  ? 145.630 201.778 137.730 1.00 153.09 ? 63  THR D O   1 
ATOM   6622  C  CB  . THR C 1 63  ? 143.540 204.311 137.332 1.00 164.43 ? 63  THR D CB  1 
ATOM   6623  O  OG1 . THR C 1 63  ? 142.198 204.759 137.517 1.00 168.58 ? 63  THR D OG1 1 
ATOM   6624  C  CG2 . THR C 1 63  ? 143.696 203.788 135.908 1.00 158.21 ? 63  THR D CG2 1 
ATOM   6625  N  N   . PHE C 1 64  ? 146.241 203.577 138.990 1.00 155.71 ? 64  PHE D N   1 
ATOM   6626  C  CA  . PHE C 1 64  ? 147.682 203.310 139.054 1.00 154.21 ? 64  PHE D CA  1 
ATOM   6627  C  C   . PHE C 1 64  ? 147.972 201.987 139.773 1.00 154.80 ? 64  PHE D C   1 
ATOM   6628  O  O   . PHE C 1 64  ? 148.793 201.212 139.284 1.00 151.45 ? 64  PHE D O   1 
ATOM   6629  C  CB  . PHE C 1 64  ? 148.427 204.471 139.745 1.00 160.76 ? 64  PHE D CB  1 
ATOM   6630  C  CG  . PHE C 1 64  ? 149.925 204.305 139.867 1.00 162.80 ? 64  PHE D CG  1 
ATOM   6631  C  CD1 . PHE C 1 64  ? 150.760 204.571 138.789 1.00 163.99 ? 64  PHE D CD1 1 
ATOM   6632  C  CD2 . PHE C 1 64  ? 150.501 203.913 141.071 1.00 168.05 ? 64  PHE D CD2 1 
ATOM   6633  C  CE1 . PHE C 1 64  ? 152.144 204.417 138.903 1.00 165.87 ? 64  PHE D CE1 1 
ATOM   6634  C  CE2 . PHE C 1 64  ? 151.886 203.759 141.183 1.00 171.83 ? 64  PHE D CE2 1 
ATOM   6635  C  CZ  . PHE C 1 64  ? 152.698 204.018 140.101 1.00 167.92 ? 64  PHE D CZ  1 
ATOM   6636  N  N   . GLU C 1 65  ? 147.305 201.732 140.918 1.00 152.33 ? 65  GLU D N   1 
ATOM   6637  C  CA  . GLU C 1 65  ? 147.486 200.507 141.699 1.00 151.24 ? 65  GLU D CA  1 
ATOM   6638  C  C   . GLU C 1 65  ? 146.850 199.307 140.983 1.00 149.52 ? 65  GLU D C   1 
ATOM   6639  O  O   . GLU C 1 65  ? 147.390 198.202 141.062 1.00 147.07 ? 65  GLU D O   1 
ATOM   6640  C  CB  . GLU C 1 65  ? 146.926 200.672 143.124 1.00 157.56 ? 65  GLU D CB  1 
ATOM   6641  C  CG  . GLU C 1 65  ? 147.453 199.664 144.137 1.00 165.17 ? 65  GLU D CG  1 
ATOM   6642  C  CD  . GLU C 1 65  ? 148.961 199.509 144.231 1.00 173.04 ? 65  GLU D CD  1 
ATOM   6643  O  OE1 . GLU C 1 65  ? 149.677 200.536 144.295 1.00 152.48 ? 65  GLU D OE1 1 
ATOM   6644  O  OE2 . GLU C 1 65  ? 149.425 198.347 144.242 1.00 164.91 ? 65  GLU D OE2 1 
ATOM   6645  N  N   . LYS C 1 66  ? 145.727 199.534 140.265 1.00 144.26 ? 66  LYS D N   1 
ATOM   6646  C  CA  . LYS C 1 66  ? 145.041 198.507 139.473 1.00 140.51 ? 66  LYS D CA  1 
ATOM   6647  C  C   . LYS C 1 66  ? 145.952 198.046 138.329 1.00 140.67 ? 66  LYS D C   1 
ATOM   6648  O  O   . LYS C 1 66  ? 145.975 196.856 137.993 1.00 137.65 ? 66  LYS D O   1 
ATOM   6649  C  CB  . LYS C 1 66  ? 143.712 199.044 138.922 1.00 143.24 ? 66  LYS D CB  1 
ATOM   6650  C  CG  . LYS C 1 66  ? 142.533 198.862 139.862 1.00 161.29 ? 66  LYS D CG  1 
ATOM   6651  C  CD  . LYS C 1 66  ? 141.261 199.444 139.267 1.00 173.15 ? 66  LYS D CD  1 
ATOM   6652  N  N   . SER C 1 67  ? 146.723 199.005 137.765 1.00 137.20 ? 67  SER D N   1 
ATOM   6653  C  CA  . SER C 1 67  ? 147.702 198.829 136.692 1.00 133.92 ? 67  SER D CA  1 
ATOM   6654  C  C   . SER C 1 67  ? 148.997 198.197 137.217 1.00 138.74 ? 67  SER D C   1 
ATOM   6655  O  O   . SER C 1 67  ? 149.624 197.427 136.494 1.00 135.73 ? 67  SER D O   1 
ATOM   6656  C  CB  . SER C 1 67  ? 148.010 200.175 136.040 1.00 137.62 ? 67  SER D CB  1 
ATOM   6657  O  OG  . SER C 1 67  ? 149.120 200.109 135.161 1.00 142.18 ? 67  SER D OG  1 
ATOM   6658  N  N   . ARG C 1 68  ? 149.397 198.535 138.463 1.00 139.23 ? 68  ARG D N   1 
ATOM   6659  C  CA  . ARG C 1 68  ? 150.602 198.038 139.140 1.00 140.28 ? 68  ARG D CA  1 
ATOM   6660  C  C   . ARG C 1 68  ? 150.522 196.523 139.357 1.00 142.39 ? 68  ARG D C   1 
ATOM   6661  O  O   . ARG C 1 68  ? 151.442 195.807 138.968 1.00 140.23 ? 68  ARG D O   1 
ATOM   6662  C  CB  . ARG C 1 68  ? 150.793 198.772 140.485 1.00 145.42 ? 68  ARG D CB  1 
ATOM   6663  C  CG  . ARG C 1 68  ? 152.172 198.633 141.109 1.00 156.31 ? 68  ARG D CG  1 
ATOM   6664  C  CD  . ARG C 1 68  ? 152.267 199.404 142.417 1.00 170.51 ? 68  ARG D CD  1 
ATOM   6665  N  NE  . ARG C 1 68  ? 153.345 198.898 143.262 1.00 181.44 ? 68  ARG D NE  1 
ATOM   6666  C  CZ  . ARG C 1 68  ? 153.201 197.936 144.167 1.00 197.15 ? 68  ARG D CZ  1 
ATOM   6667  N  NH1 . ARG C 1 68  ? 152.015 197.369 144.358 1.00 183.55 ? 68  ARG D NH1 1 
ATOM   6668  N  NH2 . ARG C 1 68  ? 154.239 197.526 144.880 1.00 187.08 ? 68  ARG D NH2 1 
ATOM   6669  N  N   . LEU C 1 69  ? 149.415 196.037 139.936 1.00 139.49 ? 69  LEU D N   1 
ATOM   6670  C  CA  . LEU C 1 69  ? 149.200 194.617 140.214 1.00 137.97 ? 69  LEU D CA  1 
ATOM   6671  C  C   . LEU C 1 69  ? 148.979 193.809 138.929 1.00 135.49 ? 69  LEU D C   1 
ATOM   6672  O  O   . LEU C 1 69  ? 149.442 192.670 138.861 1.00 133.59 ? 69  LEU D O   1 
ATOM   6673  C  CB  . LEU C 1 69  ? 148.017 194.433 141.175 1.00 141.05 ? 69  LEU D CB  1 
ATOM   6674  C  CG  . LEU C 1 69  ? 148.180 195.082 142.550 1.00 151.70 ? 69  LEU D CG  1 
ATOM   6675  C  CD1 . LEU C 1 69  ? 146.837 195.454 143.146 1.00 155.05 ? 69  LEU D CD1 1 
ATOM   6676  C  CD2 . LEU C 1 69  ? 148.984 194.200 143.488 1.00 157.05 ? 69  LEU D CD2 1 
ATOM   6677  N  N   . TYR C 1 70  ? 148.281 194.389 137.918 1.00 128.87 ? 70  TYR D N   1 
ATOM   6678  C  CA  . TYR C 1 70  ? 148.020 193.732 136.630 1.00 124.28 ? 70  TYR D CA  1 
ATOM   6679  C  C   . TYR C 1 70  ? 149.329 193.442 135.897 1.00 125.18 ? 70  TYR D C   1 
ATOM   6680  O  O   . TYR C 1 70  ? 149.520 192.320 135.423 1.00 122.62 ? 70  TYR D O   1 
ATOM   6681  C  CB  . TYR C 1 70  ? 147.072 194.576 135.749 1.00 124.69 ? 70  TYR D CB  1 
ATOM   6682  C  CG  . TYR C 1 70  ? 146.893 194.089 134.321 1.00 122.86 ? 70  TYR D CG  1 
ATOM   6683  C  CD1 . TYR C 1 70  ? 146.401 192.813 134.051 1.00 123.11 ? 70  TYR D CD1 1 
ATOM   6684  C  CD2 . TYR C 1 70  ? 147.147 194.928 133.242 1.00 122.72 ? 70  TYR D CD2 1 
ATOM   6685  C  CE1 . TYR C 1 70  ? 146.205 192.371 132.743 1.00 121.41 ? 70  TYR D CE1 1 
ATOM   6686  C  CE2 . TYR C 1 70  ? 146.956 194.497 131.929 1.00 121.36 ? 70  TYR D CE2 1 
ATOM   6687  C  CZ  . TYR C 1 70  ? 146.485 193.217 131.684 1.00 127.60 ? 70  TYR D CZ  1 
ATOM   6688  O  OH  . TYR C 1 70  ? 146.295 192.789 130.393 1.00 127.85 ? 70  TYR D OH  1 
ATOM   6689  N  N   . GLN C 1 71  ? 150.233 194.436 135.831 1.00 122.38 ? 71  GLN D N   1 
ATOM   6690  C  CA  . GLN C 1 71  ? 151.529 194.292 135.167 1.00 120.99 ? 71  GLN D CA  1 
ATOM   6691  C  C   . GLN C 1 71  ? 152.464 193.388 135.978 1.00 126.15 ? 71  GLN D C   1 
ATOM   6692  O  O   . GLN C 1 71  ? 153.355 192.763 135.399 1.00 124.00 ? 71  GLN D O   1 
ATOM   6693  C  CB  . GLN C 1 71  ? 152.179 195.662 134.912 1.00 123.99 ? 71  GLN D CB  1 
ATOM   6694  C  CG  . GLN C 1 71  ? 151.413 196.584 133.945 1.00 136.77 ? 71  GLN D CG  1 
ATOM   6695  C  CD  . GLN C 1 71  ? 151.238 196.051 132.542 1.00 151.85 ? 71  GLN D CD  1 
ATOM   6696  O  OE1 . GLN C 1 71  ? 152.104 195.361 131.989 1.00 148.12 ? 71  GLN D OE1 1 
ATOM   6697  N  NE2 . GLN C 1 71  ? 150.123 196.408 131.917 1.00 140.70 ? 71  GLN D NE2 1 
ATOM   6698  N  N   . LEU C 1 72  ? 152.243 193.302 137.308 1.00 126.28 ? 72  LEU D N   1 
ATOM   6699  C  CA  . LEU C 1 72  ? 153.021 192.449 138.206 1.00 128.21 ? 72  LEU D CA  1 
ATOM   6700  C  C   . LEU C 1 72  ? 152.675 190.969 137.967 1.00 131.52 ? 72  LEU D C   1 
ATOM   6701  O  O   . LEU C 1 72  ? 153.587 190.144 137.876 1.00 131.55 ? 72  LEU D O   1 
ATOM   6702  C  CB  . LEU C 1 72  ? 152.783 192.836 139.672 1.00 132.26 ? 72  LEU D CB  1 
ATOM   6703  C  CG  . LEU C 1 72  ? 153.793 192.302 140.670 1.00 139.82 ? 72  LEU D CG  1 
ATOM   6704  C  CD1 . LEU C 1 72  ? 155.085 193.101 140.630 1.00 141.73 ? 72  LEU D CD1 1 
ATOM   6705  C  CD2 . LEU C 1 72  ? 153.208 192.298 142.059 1.00 147.13 ? 72  LEU D CD2 1 
ATOM   6706  N  N   . ASP C 1 73  ? 151.365 190.643 137.839 1.00 126.82 ? 73  ASP D N   1 
ATOM   6707  C  CA  . ASP C 1 73  ? 150.864 189.290 137.566 1.00 124.59 ? 73  ASP D CA  1 
ATOM   6708  C  C   . ASP C 1 73  ? 151.298 188.830 136.181 1.00 124.60 ? 73  ASP D C   1 
ATOM   6709  O  O   . ASP C 1 73  ? 151.587 187.645 135.987 1.00 123.59 ? 73  ASP D O   1 
ATOM   6710  C  CB  . ASP C 1 73  ? 149.331 189.250 137.673 1.00 126.74 ? 73  ASP D CB  1 
ATOM   6711  C  CG  . ASP C 1 73  ? 148.776 189.252 139.085 1.00 146.86 ? 73  ASP D CG  1 
ATOM   6712  O  OD1 . ASP C 1 73  ? 149.477 189.741 140.003 1.00 151.93 ? 73  ASP D OD1 1 
ATOM   6713  O  OD2 . ASP C 1 73  ? 147.621 188.810 139.266 1.00 155.22 ? 73  ASP D OD2 1 
ATOM   6714  N  N   . LYS C 1 74  ? 151.348 189.780 135.221 1.00 118.76 ? 74  LYS D N   1 
ATOM   6715  C  CA  . LYS C 1 74  ? 151.766 189.543 133.844 1.00 115.27 ? 74  LYS D CA  1 
ATOM   6716  C  C   . LYS C 1 74  ? 153.267 189.210 133.804 1.00 118.84 ? 74  LYS D C   1 
ATOM   6717  O  O   . LYS C 1 74  ? 153.656 188.286 133.089 1.00 116.90 ? 74  LYS D O   1 
ATOM   6718  C  CB  . LYS C 1 74  ? 151.433 190.760 132.962 1.00 116.72 ? 74  LYS D CB  1 
ATOM   6719  N  N   . SER C 1 75  ? 154.088 189.923 134.615 1.00 117.24 ? 75  SER D N   1 
ATOM   6720  C  CA  . SER C 1 75  ? 155.543 189.743 134.722 1.00 118.21 ? 75  SER D CA  1 
ATOM   6721  C  C   . SER C 1 75  ? 155.906 188.360 135.290 1.00 121.11 ? 75  SER D C   1 
ATOM   6722  O  O   . SER C 1 75  ? 156.817 187.709 134.769 1.00 120.60 ? 75  SER D O   1 
ATOM   6723  C  CB  . SER C 1 75  ? 156.157 190.843 135.585 1.00 125.42 ? 75  SER D CB  1 
ATOM   6724  O  OG  . SER C 1 75  ? 157.573 190.786 135.594 1.00 136.25 ? 75  SER D OG  1 
ATOM   6725  N  N   . THR C 1 76  ? 155.183 187.917 136.343 1.00 117.25 ? 76  THR D N   1 
ATOM   6726  C  CA  . THR C 1 76  ? 155.384 186.623 137.002 1.00 117.67 ? 76  THR D CA  1 
ATOM   6727  C  C   . THR C 1 76  ? 155.129 185.488 136.008 1.00 117.94 ? 76  THR D C   1 
ATOM   6728  O  O   . THR C 1 76  ? 155.959 184.579 135.901 1.00 117.59 ? 76  THR D O   1 
ATOM   6729  C  CB  . THR C 1 76  ? 154.484 186.493 138.243 1.00 129.11 ? 76  THR D CB  1 
ATOM   6730  O  OG1 . THR C 1 76  ? 154.418 187.739 138.936 1.00 133.22 ? 76  THR D OG1 1 
ATOM   6731  C  CG2 . THR C 1 76  ? 154.954 185.399 139.192 1.00 130.77 ? 76  THR D CG2 1 
ATOM   6732  N  N   . PHE C 1 77  ? 153.993 185.562 135.266 1.00 111.97 ? 77  PHE D N   1 
ATOM   6733  C  CA  . PHE C 1 77  ? 153.606 184.576 134.253 1.00 109.14 ? 77  PHE D CA  1 
ATOM   6734  C  C   . PHE C 1 77  ? 154.618 184.567 133.119 1.00 111.16 ? 77  PHE D C   1 
ATOM   6735  O  O   . PHE C 1 77  ? 155.044 183.489 132.702 1.00 109.52 ? 77  PHE D O   1 
ATOM   6736  C  CB  . PHE C 1 77  ? 152.188 184.846 133.711 1.00 109.25 ? 77  PHE D CB  1 
ATOM   6737  C  CG  . PHE C 1 77  ? 151.767 183.937 132.572 1.00 108.85 ? 77  PHE D CG  1 
ATOM   6738  C  CD1 . PHE C 1 77  ? 151.292 182.652 132.822 1.00 112.41 ? 77  PHE D CD1 1 
ATOM   6739  C  CD2 . PHE C 1 77  ? 151.839 184.368 131.253 1.00 109.30 ? 77  PHE D CD2 1 
ATOM   6740  C  CE1 . PHE C 1 77  ? 150.906 181.812 131.769 1.00 111.59 ? 77  PHE D CE1 1 
ATOM   6741  C  CE2 . PHE C 1 77  ? 151.458 183.527 130.203 1.00 110.63 ? 77  PHE D CE2 1 
ATOM   6742  C  CZ  . PHE C 1 77  ? 150.997 182.255 130.468 1.00 108.83 ? 77  PHE D CZ  1 
ATOM   6743  N  N   . SER C 1 78  ? 155.007 185.771 132.639 1.00 108.04 ? 78  SER D N   1 
ATOM   6744  C  CA  . SER C 1 78  ? 155.975 185.989 131.560 1.00 107.39 ? 78  SER D CA  1 
ATOM   6745  C  C   . SER C 1 78  ? 157.287 185.245 131.819 1.00 111.26 ? 78  SER D C   1 
ATOM   6746  O  O   . SER C 1 78  ? 157.865 184.696 130.877 1.00 110.23 ? 78  SER D O   1 
ATOM   6747  C  CB  . SER C 1 78  ? 156.253 187.481 131.386 1.00 112.87 ? 78  SER D CB  1 
ATOM   6748  O  OG  . SER C 1 78  ? 157.125 187.740 130.298 1.00 123.89 ? 78  SER D OG  1 
ATOM   6749  N  N   . PHE C 1 79  ? 157.731 185.199 133.095 1.00 108.92 ? 79  PHE D N   1 
ATOM   6750  C  CA  . PHE C 1 79  ? 158.959 184.518 133.488 1.00 110.56 ? 79  PHE D CA  1 
ATOM   6751  C  C   . PHE C 1 79  ? 158.846 182.996 133.347 1.00 112.26 ? 79  PHE D C   1 
ATOM   6752  O  O   . PHE C 1 79  ? 159.637 182.409 132.610 1.00 111.18 ? 79  PHE D O   1 
ATOM   6753  C  CB  . PHE C 1 79  ? 159.373 184.880 134.926 1.00 115.86 ? 79  PHE D CB  1 
ATOM   6754  C  CG  . PHE C 1 79  ? 160.477 183.997 135.465 1.00 120.15 ? 79  PHE D CG  1 
ATOM   6755  C  CD1 . PHE C 1 79  ? 161.760 184.058 134.936 1.00 124.53 ? 79  PHE D CD1 1 
ATOM   6756  C  CD2 . PHE C 1 79  ? 160.224 183.079 136.476 1.00 123.90 ? 79  PHE D CD2 1 
ATOM   6757  C  CE1 . PHE C 1 79  ? 162.771 183.225 135.415 1.00 128.63 ? 79  PHE D CE1 1 
ATOM   6758  C  CE2 . PHE C 1 79  ? 161.239 182.246 136.955 1.00 129.73 ? 79  PHE D CE2 1 
ATOM   6759  C  CZ  . PHE C 1 79  ? 162.505 182.330 136.427 1.00 129.25 ? 79  PHE D CZ  1 
ATOM   6760  N  N   . TRP C 1 80  ? 157.900 182.369 134.086 1.00 108.00 ? 80  TRP D N   1 
ATOM   6761  C  CA  . TRP C 1 80  ? 157.694 180.919 134.118 1.00 107.43 ? 80  TRP D CA  1 
ATOM   6762  C  C   . TRP C 1 80  ? 157.281 180.338 132.763 1.00 110.37 ? 80  TRP D C   1 
ATOM   6763  O  O   . TRP C 1 80  ? 157.752 179.250 132.416 1.00 110.63 ? 80  TRP D O   1 
ATOM   6764  C  CB  . TRP C 1 80  ? 156.675 180.543 135.184 1.00 106.55 ? 80  TRP D CB  1 
ATOM   6765  C  CG  . TRP C 1 80  ? 157.161 180.818 136.570 1.00 111.19 ? 80  TRP D CG  1 
ATOM   6766  C  CD1 . TRP C 1 80  ? 156.770 181.836 137.388 1.00 115.52 ? 80  TRP D CD1 1 
ATOM   6767  C  CD2 . TRP C 1 80  ? 158.162 180.086 137.287 1.00 114.44 ? 80  TRP D CD2 1 
ATOM   6768  N  NE1 . TRP C 1 80  ? 157.439 181.763 138.588 1.00 119.12 ? 80  TRP D NE1 1 
ATOM   6769  C  CE2 . TRP C 1 80  ? 158.304 180.699 138.551 1.00 121.94 ? 80  TRP D CE2 1 
ATOM   6770  C  CE3 . TRP C 1 80  ? 158.953 178.960 136.987 1.00 116.61 ? 80  TRP D CE3 1 
ATOM   6771  C  CZ2 . TRP C 1 80  ? 159.207 180.226 139.516 1.00 125.78 ? 80  TRP D CZ2 1 
ATOM   6772  C  CZ3 . TRP C 1 80  ? 159.847 178.493 137.941 1.00 122.30 ? 80  TRP D CZ3 1 
ATOM   6773  C  CH2 . TRP C 1 80  ? 159.969 179.123 139.187 1.00 126.55 ? 80  TRP D CH2 1 
ATOM   6774  N  N   . SER C 1 81  ? 156.427 181.054 131.993 1.00 105.26 ? 81  SER D N   1 
ATOM   6775  C  CA  . SER C 1 81  ? 156.028 180.615 130.651 1.00 102.77 ? 81  SER D CA  1 
ATOM   6776  C  C   . SER C 1 81  ? 157.236 180.707 129.707 1.00 106.68 ? 81  SER D C   1 
ATOM   6777  O  O   . SER C 1 81  ? 157.411 179.842 128.848 1.00 106.68 ? 81  SER D O   1 
ATOM   6778  C  CB  . SER C 1 81  ? 154.853 181.435 130.125 1.00 104.32 ? 81  SER D CB  1 
ATOM   6779  O  OG  . SER C 1 81  ? 155.193 182.796 129.920 1.00 112.97 ? 81  SER D OG  1 
ATOM   6780  N  N   . GLY C 1 82  ? 158.072 181.727 129.923 1.00 102.93 ? 82  GLY D N   1 
ATOM   6781  C  CA  . GLY C 1 82  ? 159.295 181.959 129.167 1.00 103.21 ? 82  GLY D CA  1 
ATOM   6782  C  C   . GLY C 1 82  ? 160.387 180.974 129.528 1.00 107.34 ? 82  GLY D C   1 
ATOM   6783  O  O   . GLY C 1 82  ? 161.121 180.513 128.646 1.00 107.79 ? 82  GLY D O   1 
ATOM   6784  N  N   . LEU C 1 83  ? 160.495 180.641 130.835 1.00 103.41 ? 83  LEU D N   1 
ATOM   6785  C  CA  . LEU C 1 83  ? 161.483 179.701 131.366 1.00 105.04 ? 83  LEU D CA  1 
ATOM   6786  C  C   . LEU C 1 83  ? 161.196 178.294 130.861 1.00 108.26 ? 83  LEU D C   1 
ATOM   6787  O  O   . LEU C 1 83  ? 162.138 177.608 130.454 1.00 109.45 ? 83  LEU D O   1 
ATOM   6788  C  CB  . LEU C 1 83  ? 161.515 179.744 132.907 1.00 106.92 ? 83  LEU D CB  1 
ATOM   6789  C  CG  . LEU C 1 83  ? 162.472 178.801 133.639 1.00 114.28 ? 83  LEU D CG  1 
ATOM   6790  C  CD1 . LEU C 1 83  ? 163.924 179.068 133.274 1.00 117.02 ? 83  LEU D CD1 1 
ATOM   6791  C  CD2 . LEU C 1 83  ? 162.277 178.900 135.131 1.00 118.67 ? 83  LEU D CD2 1 
ATOM   6792  N  N   . TYR C 1 84  ? 159.901 177.882 130.854 1.00 102.67 ? 84  TYR D N   1 
ATOM   6793  C  CA  . TYR C 1 84  ? 159.461 176.569 130.374 1.00 101.77 ? 84  TYR D CA  1 
ATOM   6794  C  C   . TYR C 1 84  ? 159.857 176.391 128.907 1.00 105.89 ? 84  TYR D C   1 
ATOM   6795  O  O   . TYR C 1 84  ? 160.387 175.339 128.548 1.00 107.07 ? 84  TYR D O   1 
ATOM   6796  C  CB  . TYR C 1 84  ? 157.943 176.381 130.565 1.00 100.72 ? 84  TYR D CB  1 
ATOM   6797  C  CG  . TYR C 1 84  ? 157.421 175.030 130.108 1.00 102.45 ? 84  TYR D CG  1 
ATOM   6798  C  CD1 . TYR C 1 84  ? 157.529 173.903 130.923 1.00 106.52 ? 84  TYR D CD1 1 
ATOM   6799  C  CD2 . TYR C 1 84  ? 156.791 174.883 128.874 1.00 101.30 ? 84  TYR D CD2 1 
ATOM   6800  C  CE1 . TYR C 1 84  ? 157.045 172.659 130.510 1.00 107.05 ? 84  TYR D CE1 1 
ATOM   6801  C  CE2 . TYR C 1 84  ? 156.298 173.645 128.453 1.00 102.16 ? 84  TYR D CE2 1 
ATOM   6802  C  CZ  . TYR C 1 84  ? 156.423 172.536 129.276 1.00 110.39 ? 84  TYR D CZ  1 
ATOM   6803  O  OH  . TYR C 1 84  ? 155.935 171.316 128.870 1.00 109.58 ? 84  TYR D OH  1 
ATOM   6804  N  N   . SER C 1 85  ? 159.636 177.434 128.082 1.00 101.09 ? 85  SER D N   1 
ATOM   6805  C  CA  . SER C 1 85  ? 159.962 177.456 126.658 1.00 100.75 ? 85  SER D CA  1 
ATOM   6806  C  C   . SER C 1 85  ? 161.464 177.290 126.433 1.00 106.77 ? 85  SER D C   1 
ATOM   6807  O  O   . SER C 1 85  ? 161.863 176.428 125.650 1.00 107.28 ? 85  SER D O   1 
ATOM   6808  C  CB  . SER C 1 85  ? 159.479 178.756 126.022 1.00 103.80 ? 85  SER D CB  1 
ATOM   6809  O  OG  . SER C 1 85  ? 158.117 179.008 126.323 1.00 112.83 ? 85  SER D OG  1 
ATOM   6810  N  N   . GLU C 1 86  ? 162.291 178.084 127.149 1.00 104.64 ? 86  GLU D N   1 
ATOM   6811  C  CA  . GLU C 1 86  ? 163.751 178.042 127.038 1.00 107.77 ? 86  GLU D CA  1 
ATOM   6812  C  C   . GLU C 1 86  ? 164.297 176.694 127.497 1.00 112.84 ? 86  GLU D C   1 
ATOM   6813  O  O   . GLU C 1 86  ? 165.250 176.199 126.891 1.00 115.38 ? 86  GLU D O   1 
ATOM   6814  C  CB  . GLU C 1 86  ? 164.405 179.189 127.829 1.00 111.29 ? 86  GLU D CB  1 
ATOM   6815  C  CG  . GLU C 1 86  ? 165.879 179.427 127.505 1.00 126.27 ? 86  GLU D CG  1 
ATOM   6816  C  CD  . GLU C 1 86  ? 166.215 179.845 126.084 1.00 149.96 ? 86  GLU D CD  1 
ATOM   6817  O  OE1 . GLU C 1 86  ? 165.715 180.901 125.631 1.00 153.67 ? 86  GLU D OE1 1 
ATOM   6818  O  OE2 . GLU C 1 86  ? 167.005 179.126 125.432 1.00 143.16 ? 86  GLU D OE2 1 
ATOM   6819  N  N   . THR C 1 87  ? 163.687 176.094 128.544 1.00 107.34 ? 87  THR D N   1 
ATOM   6820  C  CA  . THR C 1 87  ? 164.097 174.782 129.048 1.00 108.67 ? 87  THR D CA  1 
ATOM   6821  C  C   . THR C 1 87  ? 163.708 173.717 128.023 1.00 110.22 ? 87  THR D C   1 
ATOM   6822  O  O   . THR C 1 87  ? 164.544 172.882 127.685 1.00 112.32 ? 87  THR D O   1 
ATOM   6823  C  CB  . THR C 1 87  ? 163.506 174.512 130.435 1.00 114.98 ? 87  THR D CB  1 
ATOM   6824  O  OG1 . THR C 1 87  ? 163.851 175.596 131.295 1.00 114.81 ? 87  THR D OG1 1 
ATOM   6825  C  CG2 . THR C 1 87  ? 163.999 173.207 131.043 1.00 116.19 ? 87  THR D CG2 1 
ATOM   6826  N  N   . GLU C 1 88  ? 162.465 173.779 127.498 1.00 102.82 ? 88  GLU D N   1 
ATOM   6827  C  CA  . GLU C 1 88  ? 161.961 172.840 126.497 1.00 101.72 ? 88  GLU D CA  1 
ATOM   6828  C  C   . GLU C 1 88  ? 162.828 172.814 125.249 1.00 106.08 ? 88  GLU D C   1 
ATOM   6829  O  O   . GLU C 1 88  ? 163.196 171.730 124.800 1.00 107.59 ? 88  GLU D O   1 
ATOM   6830  C  CB  . GLU C 1 88  ? 160.516 173.157 126.104 1.00 100.10 ? 88  GLU D CB  1 
ATOM   6831  C  CG  . GLU C 1 88  ? 159.494 172.345 126.875 1.00 112.29 ? 88  GLU D CG  1 
ATOM   6832  C  CD  . GLU C 1 88  ? 159.322 170.878 126.515 1.00 133.89 ? 88  GLU D CD  1 
ATOM   6833  O  OE1 . GLU C 1 88  ? 160.193 170.300 125.826 1.00 118.00 ? 88  GLU D OE1 1 
ATOM   6834  O  OE2 . GLU C 1 88  ? 158.300 170.301 126.946 1.00 134.22 ? 88  GLU D OE2 1 
ATOM   6835  N  N   . GLY C 1 89  ? 163.153 173.994 124.719 1.00 101.50 ? 89  GLY D N   1 
ATOM   6836  C  CA  . GLY C 1 89  ? 163.987 174.146 123.533 1.00 103.02 ? 89  GLY D CA  1 
ATOM   6837  C  C   . GLY C 1 89  ? 165.331 173.477 123.709 1.00 110.17 ? 89  GLY D C   1 
ATOM   6838  O  O   . GLY C 1 89  ? 165.720 172.637 122.893 1.00 111.66 ? 89  GLY D O   1 
ATOM   6839  N  N   . THR C 1 90  ? 166.004 173.798 124.828 1.00 107.71 ? 90  THR D N   1 
ATOM   6840  C  CA  . THR C 1 90  ? 167.305 173.256 125.210 1.00 111.42 ? 90  THR D CA  1 
ATOM   6841  C  C   . THR C 1 90  ? 167.209 171.728 125.351 1.00 117.25 ? 90  THR D C   1 
ATOM   6842  O  O   . THR C 1 90  ? 168.021 171.034 124.749 1.00 119.88 ? 90  THR D O   1 
ATOM   6843  C  CB  . THR C 1 90  ? 167.806 173.947 126.489 1.00 113.85 ? 90  THR D CB  1 
ATOM   6844  O  OG1 . THR C 1 90  ? 167.883 175.349 126.248 1.00 108.30 ? 90  THR D OG1 1 
ATOM   6845  C  CG2 . THR C 1 90  ? 169.163 173.451 126.933 1.00 116.53 ? 90  THR D CG2 1 
ATOM   6846  N  N   . LEU C 1 91  ? 166.194 171.216 126.083 1.00 112.64 ? 91  LEU D N   1 
ATOM   6847  C  CA  . LEU C 1 91  ? 165.998 169.780 126.313 1.00 114.15 ? 91  LEU D CA  1 
ATOM   6848  C  C   . LEU C 1 91  ? 165.718 169.001 125.026 1.00 118.07 ? 91  LEU D C   1 
ATOM   6849  O  O   . LEU C 1 91  ? 166.293 167.929 124.863 1.00 121.01 ? 91  LEU D O   1 
ATOM   6850  C  CB  . LEU C 1 91  ? 164.880 169.499 127.333 1.00 112.42 ? 91  LEU D CB  1 
ATOM   6851  C  CG  . LEU C 1 91  ? 165.150 169.869 128.797 1.00 119.13 ? 91  LEU D CG  1 
ATOM   6852  C  CD1 . LEU C 1 91  ? 163.920 169.667 129.624 1.00 117.54 ? 91  LEU D CD1 1 
ATOM   6853  C  CD2 . LEU C 1 91  ? 166.289 169.062 129.391 1.00 126.35 ? 91  LEU D CD2 1 
ATOM   6854  N  N   . ILE C 1 92  ? 164.860 169.523 124.120 1.00 111.32 ? 92  ILE D N   1 
ATOM   6855  C  CA  . ILE C 1 92  ? 164.534 168.866 122.847 1.00 111.17 ? 92  ILE D CA  1 
ATOM   6856  C  C   . ILE C 1 92  ? 165.812 168.722 122.010 1.00 119.32 ? 92  ILE D C   1 
ATOM   6857  O  O   . ILE C 1 92  ? 166.062 167.636 121.485 1.00 122.01 ? 92  ILE D O   1 
ATOM   6858  C  CB  . ILE C 1 92  ? 163.402 169.608 122.083 1.00 110.95 ? 92  ILE D CB  1 
ATOM   6859  C  CG1 . ILE C 1 92  ? 162.039 169.312 122.723 1.00 108.56 ? 92  ILE D CG1 1 
ATOM   6860  C  CG2 . ILE C 1 92  ? 163.375 169.252 120.582 1.00 113.11 ? 92  ILE D CG2 1 
ATOM   6861  C  CD1 . ILE C 1 92  ? 161.007 170.404 122.525 1.00 114.28 ? 92  ILE D CD1 1 
ATOM   6862  N  N   . LEU C 1 93  ? 166.632 169.791 121.927 1.00 116.21 ? 93  LEU D N   1 
ATOM   6863  C  CA  . LEU C 1 93  ? 167.888 169.780 121.174 1.00 119.63 ? 93  LEU D CA  1 
ATOM   6864  C  C   . LEU C 1 93  ? 168.890 168.774 121.761 1.00 126.47 ? 93  LEU D C   1 
ATOM   6865  O  O   . LEU C 1 93  ? 169.399 167.943 121.007 1.00 128.43 ? 93  LEU D O   1 
ATOM   6866  C  CB  . LEU C 1 93  ? 168.514 171.181 121.121 1.00 120.25 ? 93  LEU D CB  1 
ATOM   6867  C  CG  . LEU C 1 93  ? 167.758 172.241 120.333 1.00 121.99 ? 93  LEU D CG  1 
ATOM   6868  C  CD1 . LEU C 1 93  ? 168.173 173.615 120.770 1.00 122.31 ? 93  LEU D CD1 1 
ATOM   6869  C  CD2 . LEU C 1 93  ? 167.982 172.094 118.844 1.00 126.85 ? 93  LEU D CD2 1 
ATOM   6870  N  N   . LEU C 1 94  ? 169.139 168.833 123.099 1.00 123.58 ? 94  LEU D N   1 
ATOM   6871  C  CA  . LEU C 1 94  ? 170.070 167.955 123.826 1.00 127.89 ? 94  LEU D CA  1 
ATOM   6872  C  C   . LEU C 1 94  ? 169.633 166.494 123.788 1.00 135.72 ? 94  LEU D C   1 
ATOM   6873  O  O   . LEU C 1 94  ? 170.478 165.613 123.604 1.00 140.64 ? 94  LEU D O   1 
ATOM   6874  C  CB  . LEU C 1 94  ? 170.241 168.380 125.294 1.00 127.80 ? 94  LEU D CB  1 
ATOM   6875  C  CG  . LEU C 1 94  ? 170.851 169.741 125.600 1.00 132.75 ? 94  LEU D CG  1 
ATOM   6876  C  CD1 . LEU C 1 94  ? 170.749 170.030 127.077 1.00 132.90 ? 94  LEU D CD1 1 
ATOM   6877  C  CD2 . LEU C 1 94  ? 172.297 169.836 125.139 1.00 140.25 ? 94  LEU D CD2 1 
ATOM   6878  N  N   . PHE C 1 95  ? 168.324 166.235 123.972 1.00 129.81 ? 95  PHE D N   1 
ATOM   6879  C  CA  . PHE C 1 95  ? 167.740 164.892 123.942 1.00 130.71 ? 95  PHE D CA  1 
ATOM   6880  C  C   . PHE C 1 95  ? 167.729 164.332 122.504 1.00 137.75 ? 95  PHE D C   1 
ATOM   6881  O  O   . PHE C 1 95  ? 167.692 163.114 122.324 1.00 140.31 ? 95  PHE D O   1 
ATOM   6882  C  CB  . PHE C 1 95  ? 166.319 164.933 124.521 1.00 128.47 ? 95  PHE D CB  1 
ATOM   6883  C  CG  . PHE C 1 95  ? 165.739 163.626 125.000 1.00 131.30 ? 95  PHE D CG  1 
ATOM   6884  C  CD1 . PHE C 1 95  ? 165.907 163.213 126.317 1.00 136.67 ? 95  PHE D CD1 1 
ATOM   6885  C  CD2 . PHE C 1 95  ? 164.956 162.843 124.157 1.00 133.22 ? 95  PHE D CD2 1 
ATOM   6886  C  CE1 . PHE C 1 95  ? 165.338 162.013 126.770 1.00 138.99 ? 95  PHE D CE1 1 
ATOM   6887  C  CE2 . PHE C 1 95  ? 164.392 161.642 124.607 1.00 137.25 ? 95  PHE D CE2 1 
ATOM   6888  C  CZ  . PHE C 1 95  ? 164.586 161.235 125.910 1.00 137.21 ? 95  PHE D CZ  1 
ATOM   6889  N  N   . GLY C 1 96  ? 167.793 165.223 121.510 1.00 133.78 ? 96  GLY D N   1 
ATOM   6890  C  CA  . GLY C 1 96  ? 167.788 164.878 120.092 1.00 135.03 ? 96  GLY D CA  1 
ATOM   6891  C  C   . GLY C 1 96  ? 166.400 164.531 119.600 1.00 136.17 ? 96  GLY D C   1 
ATOM   6892  O  O   . GLY C 1 96  ? 166.208 163.487 118.975 1.00 137.77 ? 96  GLY D O   1 
ATOM   6893  N  N   . GLY C 1 97  ? 165.440 165.408 119.893 1.00 128.47 ? 97  GLY D N   1 
ATOM   6894  C  CA  . GLY C 1 97  ? 164.038 165.253 119.525 1.00 125.23 ? 97  GLY D CA  1 
ATOM   6895  C  C   . GLY C 1 97  ? 163.776 165.362 118.039 1.00 129.77 ? 97  GLY D C   1 
ATOM   6896  O  O   . GLY C 1 97  ? 163.191 164.448 117.457 1.00 129.87 ? 97  GLY D O   1 
ATOM   6897  N  N   . ILE C 1 98  ? 164.218 166.479 117.422 1.00 127.31 ? 98  ILE D N   1 
ATOM   6898  C  CA  . ILE C 1 98  ? 164.063 166.808 115.993 1.00 129.12 ? 98  ILE D CA  1 
ATOM   6899  C  C   . ILE C 1 98  ? 164.571 165.658 115.058 1.00 139.88 ? 98  ILE D C   1 
ATOM   6900  O  O   . ILE C 1 98  ? 163.787 165.266 114.187 1.00 140.27 ? 98  ILE D O   1 
ATOM   6901  C  CB  . ILE C 1 98  ? 164.731 168.167 115.635 1.00 132.53 ? 98  ILE D CB  1 
ATOM   6902  C  CG1 . ILE C 1 98  ? 164.293 169.288 116.613 1.00 128.94 ? 98  ILE D CG1 1 
ATOM   6903  C  CG2 . ILE C 1 98  ? 164.463 168.555 114.166 1.00 134.85 ? 98  ILE D CG2 1 
ATOM   6904  C  CD1 . ILE C 1 98  ? 165.303 170.428 116.799 1.00 136.54 ? 98  ILE D CD1 1 
ATOM   6905  N  N   . PRO C 1 99  ? 165.812 165.093 115.186 1.00 141.42 ? 99  PRO D N   1 
ATOM   6906  C  CA  . PRO C 1 99  ? 166.210 164.002 114.271 1.00 146.10 ? 99  PRO D CA  1 
ATOM   6907  C  C   . PRO C 1 99  ? 165.383 162.728 114.452 1.00 150.73 ? 99  PRO D C   1 
ATOM   6908  O  O   . PRO C 1 99  ? 165.090 162.062 113.461 1.00 153.08 ? 99  PRO D O   1 
ATOM   6909  C  CB  . PRO C 1 99  ? 167.681 163.749 114.624 1.00 151.68 ? 99  PRO D CB  1 
ATOM   6910  C  CG  . PRO C 1 99  ? 168.115 164.940 115.398 1.00 153.97 ? 99  PRO D CG  1 
ATOM   6911  C  CD  . PRO C 1 99  ? 166.905 165.401 116.131 1.00 143.99 ? 99  PRO D CD  1 
ATOM   6912  N  N   . TYR C 1 100 ? 164.997 162.403 115.703 1.00 145.03 ? 100 TYR D N   1 
ATOM   6913  C  CA  . TYR C 1 100 ? 164.196 161.224 116.033 1.00 144.76 ? 100 TYR D CA  1 
ATOM   6914  C  C   . TYR C 1 100 ? 162.759 161.407 115.551 1.00 144.07 ? 100 TYR D C   1 
ATOM   6915  O  O   . TYR C 1 100 ? 162.160 160.440 115.083 1.00 145.15 ? 100 TYR D O   1 
ATOM   6916  C  CB  . TYR C 1 100 ? 164.249 160.933 117.542 1.00 145.35 ? 100 TYR D CB  1 
ATOM   6917  C  CG  . TYR C 1 100 ? 163.361 159.798 118.011 1.00 148.19 ? 100 TYR D CG  1 
ATOM   6918  C  CD1 . TYR C 1 100 ? 163.606 158.485 117.620 1.00 154.48 ? 100 TYR D CD1 1 
ATOM   6919  C  CD2 . TYR C 1 100 ? 162.311 160.029 118.894 1.00 145.72 ? 100 TYR D CD2 1 
ATOM   6920  C  CE1 . TYR C 1 100 ? 162.799 157.435 118.061 1.00 156.15 ? 100 TYR D CE1 1 
ATOM   6921  C  CE2 . TYR C 1 100 ? 161.503 158.988 119.349 1.00 147.30 ? 100 TYR D CE2 1 
ATOM   6922  C  CZ  . TYR C 1 100 ? 161.747 157.693 118.926 1.00 159.97 ? 100 TYR D CZ  1 
ATOM   6923  O  OH  . TYR C 1 100 ? 160.942 156.675 119.373 1.00 163.53 ? 100 TYR D OH  1 
ATOM   6924  N  N   . LEU C 1 101 ? 162.222 162.646 115.630 1.00 136.03 ? 101 LEU D N   1 
ATOM   6925  C  CA  . LEU C 1 101 ? 160.880 162.980 115.141 1.00 133.59 ? 101 LEU D CA  1 
ATOM   6926  C  C   . LEU C 1 101 ? 160.853 162.877 113.616 1.00 141.59 ? 101 LEU D C   1 
ATOM   6927  O  O   . LEU C 1 101 ? 159.825 162.495 113.052 1.00 141.87 ? 101 LEU D O   1 
ATOM   6928  C  CB  . LEU C 1 101 ? 160.442 164.384 115.605 1.00 129.44 ? 101 LEU D CB  1 
ATOM   6929  C  CG  . LEU C 1 101 ? 159.038 164.867 115.196 1.00 131.76 ? 101 LEU D CG  1 
ATOM   6930  C  CD1 . LEU C 1 101 ? 157.951 163.959 115.734 1.00 131.06 ? 101 LEU D CD1 1 
ATOM   6931  C  CD2 . LEU C 1 101 ? 158.799 166.298 115.640 1.00 130.91 ? 101 LEU D CD2 1 
ATOM   6932  N  N   . TRP C 1 102 ? 161.995 163.194 112.960 1.00 141.36 ? 102 TRP D N   1 
ATOM   6933  C  CA  . TRP C 1 102 ? 162.178 163.094 111.513 1.00 145.27 ? 102 TRP D CA  1 
ATOM   6934  C  C   . TRP C 1 102 ? 162.131 161.621 111.081 1.00 153.73 ? 102 TRP D C   1 
ATOM   6935  O  O   . TRP C 1 102 ? 161.550 161.308 110.041 1.00 155.91 ? 102 TRP D O   1 
ATOM   6936  C  CB  . TRP C 1 102 ? 163.500 163.750 111.079 1.00 146.47 ? 102 TRP D CB  1 
ATOM   6937  C  CG  . TRP C 1 102 ? 163.702 163.738 109.595 1.00 152.17 ? 102 TRP D CG  1 
ATOM   6938  C  CD1 . TRP C 1 102 ? 164.438 162.846 108.876 1.00 160.30 ? 102 TRP D CD1 1 
ATOM   6939  C  CD2 . TRP C 1 102 ? 163.080 164.605 108.644 1.00 152.08 ? 102 TRP D CD2 1 
ATOM   6940  N  NE1 . TRP C 1 102 ? 164.340 163.124 107.533 1.00 163.38 ? 102 TRP D NE1 1 
ATOM   6941  C  CE2 . TRP C 1 102 ? 163.515 164.203 107.362 1.00 161.69 ? 102 TRP D CE2 1 
ATOM   6942  C  CE3 . TRP C 1 102 ? 162.213 165.704 108.749 1.00 149.84 ? 102 TRP D CE3 1 
ATOM   6943  C  CZ2 . TRP C 1 102 ? 163.102 164.851 106.194 1.00 163.20 ? 102 TRP D CZ2 1 
ATOM   6944  C  CZ3 . TRP C 1 102 ? 161.824 166.361 107.592 1.00 153.46 ? 102 TRP D CZ3 1 
ATOM   6945  C  CH2 . TRP C 1 102 ? 162.275 165.940 106.334 1.00 159.77 ? 102 TRP D CH2 1 
ATOM   6946  N  N   . ARG C 1 103 ? 162.722 160.724 111.894 1.00 151.57 ? 103 ARG D N   1 
ATOM   6947  C  CA  . ARG C 1 103 ? 162.756 159.283 111.644 1.00 155.60 ? 103 ARG D CA  1 
ATOM   6948  C  C   . ARG C 1 103 ? 161.356 158.691 111.732 1.00 158.06 ? 103 ARG D C   1 
ATOM   6949  O  O   . ARG C 1 103 ? 161.002 157.874 110.887 1.00 161.36 ? 103 ARG D O   1 
ATOM   6950  C  CB  . ARG C 1 103 ? 163.700 158.568 112.631 1.00 159.52 ? 103 ARG D CB  1 
ATOM   6951  C  CG  . ARG C 1 103 ? 165.179 158.881 112.424 1.00 181.31 ? 103 ARG D CG  1 
ATOM   6952  C  CD  . ARG C 1 103 ? 165.994 158.625 113.674 1.00 200.20 ? 103 ARG D CD  1 
ATOM   6953  N  NE  . ARG C 1 103 ? 167.329 159.210 113.554 1.00 215.42 ? 103 ARG D NE  1 
ATOM   6954  C  CZ  . ARG C 1 103 ? 168.265 159.137 114.493 1.00 227.15 ? 103 ARG D CZ  1 
ATOM   6955  N  NH1 . ARG C 1 103 ? 168.024 158.511 115.637 1.00 218.94 ? 103 ARG D NH1 1 
ATOM   6956  N  NH2 . ARG C 1 103 ? 169.454 159.693 114.293 1.00 219.71 ? 103 ARG D NH2 1 
ATOM   6957  N  N   . LEU C 1 104 ? 160.555 159.111 112.739 1.00 150.20 ? 104 LEU D N   1 
ATOM   6958  C  CA  . LEU C 1 104 ? 159.186 158.616 112.958 1.00 148.97 ? 104 LEU D CA  1 
ATOM   6959  C  C   . LEU C 1 104 ? 158.189 159.130 111.894 1.00 153.99 ? 104 LEU D C   1 
ATOM   6960  O  O   . LEU C 1 104 ? 157.106 158.551 111.745 1.00 154.61 ? 104 LEU D O   1 
ATOM   6961  C  CB  . LEU C 1 104 ? 158.669 158.965 114.373 1.00 144.37 ? 104 LEU D CB  1 
ATOM   6962  C  CG  . LEU C 1 104 ? 159.401 158.358 115.583 1.00 148.61 ? 104 LEU D CG  1 
ATOM   6963  C  CD1 . LEU C 1 104 ? 158.732 158.774 116.875 1.00 144.96 ? 104 LEU D CD1 1 
ATOM   6964  C  CD2 . LEU C 1 104 ? 159.459 156.840 115.513 1.00 153.93 ? 104 LEU D CD2 1 
ATOM   6965  N  N   . SER C 1 105 ? 158.557 160.192 111.147 1.00 150.39 ? 105 SER D N   1 
ATOM   6966  C  CA  . SER C 1 105 ? 157.711 160.745 110.090 1.00 150.92 ? 105 SER D CA  1 
ATOM   6967  C  C   . SER C 1 105 ? 158.097 160.148 108.715 1.00 160.31 ? 105 SER D C   1 
ATOM   6968  O  O   . SER C 1 105 ? 157.680 160.655 107.678 1.00 161.72 ? 105 SER D O   1 
ATOM   6969  C  CB  . SER C 1 105 ? 157.780 162.271 110.083 1.00 151.38 ? 105 SER D CB  1 
ATOM   6970  O  OG  . SER C 1 105 ? 159.109 162.748 109.968 1.00 161.77 ? 105 SER D OG  1 
ATOM   6971  N  N   . GLY C 1 106 ? 158.837 159.044 108.732 1.00 160.21 ? 106 GLY D N   1 
ATOM   6972  C  CA  . GLY C 1 106 ? 159.266 158.337 107.531 1.00 166.19 ? 106 GLY D CA  1 
ATOM   6973  C  C   . GLY C 1 106 ? 158.441 157.097 107.238 1.00 173.15 ? 106 GLY D C   1 
ATOM   6974  O  O   . GLY C 1 106 ? 157.216 157.113 107.408 1.00 171.12 ? 106 GLY D O   1 
ATOM   6975  N  N   . ARG C 1 107 ? 159.129 156.010 106.792 1.00 174.39 ? 107 ARG D N   1 
ATOM   6976  C  CA  . ARG C 1 107 ? 158.594 154.684 106.448 1.00 205.77 ? 107 ARG D CA  1 
ATOM   6977  C  C   . ARG C 1 107 ? 157.470 154.772 105.417 1.00 226.63 ? 107 ARG D C   1 
ATOM   6978  O  O   . ARG C 1 107 ? 157.668 154.408 104.261 1.00 199.72 ? 107 ARG D O   1 
ATOM   6979  C  CB  . ARG C 1 107 ? 158.111 153.929 107.698 1.00 203.71 ? 107 ARG D CB  1 
ATOM   6980  N  N   . PRO C 1 116 ? 162.441 163.140 95.057  1.00 196.68 ? 116 PRO D N   1 
ATOM   6981  C  CA  . PRO C 1 116 ? 162.153 164.424 95.714  1.00 194.41 ? 116 PRO D CA  1 
ATOM   6982  C  C   . PRO C 1 116 ? 160.782 164.443 96.386  1.00 196.47 ? 116 PRO D C   1 
ATOM   6983  O  O   . PRO C 1 116 ? 160.626 165.108 97.409  1.00 194.25 ? 116 PRO D O   1 
ATOM   6984  C  CB  . PRO C 1 116 ? 162.232 165.441 94.571  1.00 196.39 ? 116 PRO D CB  1 
ATOM   6985  C  CG  . PRO C 1 116 ? 161.978 164.658 93.335  1.00 202.09 ? 116 PRO D CG  1 
ATOM   6986  C  CD  . PRO C 1 116 ? 162.440 163.251 93.586  1.00 199.95 ? 116 PRO D CD  1 
ATOM   6987  N  N   . GLU C 1 117 ? 159.797 163.715 95.814  1.00 196.12 ? 117 GLU D N   1 
ATOM   6988  C  CA  . GLU C 1 117 ? 158.422 163.613 96.316  1.00 195.91 ? 117 GLU D CA  1 
ATOM   6989  C  C   . GLU C 1 117 ? 158.381 162.978 97.711  1.00 196.40 ? 117 GLU D C   1 
ATOM   6990  O  O   . GLU C 1 117 ? 157.609 163.434 98.556  1.00 194.89 ? 117 GLU D O   1 
ATOM   6991  C  CB  . GLU C 1 117 ? 157.552 162.797 95.343  1.00 199.72 ? 117 GLU D CB  1 
ATOM   6992  C  CG  . GLU C 1 117 ? 156.057 162.985 95.548  1.00 208.61 ? 117 GLU D CG  1 
ATOM   6993  C  CD  . GLU C 1 117 ? 155.190 161.818 95.116  1.00 228.86 ? 117 GLU D CD  1 
ATOM   6994  O  OE1 . GLU C 1 117 ? 155.249 161.429 93.926  1.00 227.47 ? 117 GLU D OE1 1 
ATOM   6995  O  OE2 . GLU C 1 117 ? 154.426 161.309 95.969  1.00 227.75 ? 117 GLU D OE2 1 
ATOM   6996  N  N   . TYR C 1 118 ? 159.208 161.934 97.941  1.00 193.80 ? 118 TYR D N   1 
ATOM   6997  C  CA  . TYR C 1 118 ? 159.300 161.201 99.207  1.00 192.20 ? 118 TYR D CA  1 
ATOM   6998  C  C   . TYR C 1 118 ? 159.814 162.092 100.347 1.00 190.46 ? 118 TYR D C   1 
ATOM   6999  O  O   . TYR C 1 118 ? 159.259 162.045 101.446 1.00 184.41 ? 118 TYR D O   1 
ATOM   7000  C  CB  . TYR C 1 118 ? 160.203 159.969 99.050  1.00 194.17 ? 118 TYR D CB  1 
ATOM   7001  N  N   . GLU C 1 119 ? 160.856 162.906 100.080 1.00 186.52 ? 119 GLU D N   1 
ATOM   7002  C  CA  . GLU C 1 119 ? 161.444 163.814 101.064 1.00 180.37 ? 119 GLU D CA  1 
ATOM   7003  C  C   . GLU C 1 119 ? 160.475 164.957 101.391 1.00 177.62 ? 119 GLU D C   1 
ATOM   7004  O  O   . GLU C 1 119 ? 160.412 165.375 102.546 1.00 171.39 ? 119 GLU D O   1 
ATOM   7005  C  CB  . GLU C 1 119 ? 162.789 164.369 100.559 1.00 184.73 ? 119 GLU D CB  1 
ATOM   7006  C  CG  . GLU C 1 119 ? 163.768 164.735 101.667 1.00 190.91 ? 119 GLU D CG  1 
ATOM   7007  C  CD  . GLU C 1 119 ? 164.275 166.168 101.667 1.00 204.39 ? 119 GLU D CD  1 
ATOM   7008  O  OE1 . GLU C 1 119 ? 164.949 166.568 100.689 1.00 202.45 ? 119 GLU D OE1 1 
ATOM   7009  O  OE2 . GLU C 1 119 ? 164.032 166.879 102.670 1.00 197.05 ? 119 GLU D OE2 1 
ATOM   7010  N  N   . ILE C 1 120 ? 159.718 165.445 100.383 1.00 175.68 ? 120 ILE D N   1 
ATOM   7011  C  CA  . ILE C 1 120 ? 158.740 166.530 100.521 1.00 171.49 ? 120 ILE D CA  1 
ATOM   7012  C  C   . ILE C 1 120 ? 157.546 166.037 101.367 1.00 169.03 ? 120 ILE D C   1 
ATOM   7013  O  O   . ILE C 1 120 ? 157.048 166.793 102.206 1.00 163.06 ? 120 ILE D O   1 
ATOM   7014  C  CB  . ILE C 1 120 ? 158.330 167.080 99.118  1.00 180.43 ? 120 ILE D CB  1 
ATOM   7015  C  CG1 . ILE C 1 120 ? 159.396 168.077 98.604  1.00 183.46 ? 120 ILE D CG1 1 
ATOM   7016  C  CG2 . ILE C 1 120 ? 156.931 167.731 99.114  1.00 179.32 ? 120 ILE D CG2 1 
ATOM   7017  C  CD1 . ILE C 1 120 ? 159.428 168.310 97.074  1.00 192.25 ? 120 ILE D CD1 1 
ATOM   7018  N  N   . THR C 1 121 ? 157.129 164.766 101.172 1.00 166.90 ? 121 THR D N   1 
ATOM   7019  C  CA  . THR C 1 121 ? 156.037 164.128 101.918 1.00 163.03 ? 121 THR D CA  1 
ATOM   7020  C  C   . THR C 1 121 ? 156.469 163.938 103.382 1.00 158.83 ? 121 THR D C   1 
ATOM   7021  O  O   . THR C 1 121 ? 155.692 164.257 104.284 1.00 153.29 ? 121 THR D O   1 
ATOM   7022  C  CB  . THR C 1 121 ? 155.618 162.806 101.251 1.00 178.92 ? 121 THR D CB  1 
ATOM   7023  O  OG1 . THR C 1 121 ? 155.359 163.033 99.862  1.00 185.81 ? 121 THR D OG1 1 
ATOM   7024  C  CG2 . THR C 1 121 ? 154.384 162.188 101.897 1.00 176.29 ? 121 THR D CG2 1 
ATOM   7025  N  N   . GLN C 1 122 ? 157.715 163.449 103.606 1.00 155.02 ? 122 GLN D N   1 
ATOM   7026  C  CA  . GLN C 1 122 ? 158.309 163.260 104.932 1.00 149.86 ? 122 GLN D CA  1 
ATOM   7027  C  C   . GLN C 1 122 ? 158.400 164.612 105.647 1.00 148.24 ? 122 GLN D C   1 
ATOM   7028  O  O   . GLN C 1 122 ? 158.054 164.695 106.823 1.00 143.41 ? 122 GLN D O   1 
ATOM   7029  C  CB  . GLN C 1 122 ? 159.692 162.590 104.836 1.00 154.22 ? 122 GLN D CB  1 
ATOM   7030  C  CG  . GLN C 1 122 ? 160.273 162.179 106.193 1.00 163.57 ? 122 GLN D CG  1 
ATOM   7031  C  CD  . GLN C 1 122 ? 161.631 161.520 106.122 1.00 188.72 ? 122 GLN D CD  1 
ATOM   7032  O  OE1 . GLN C 1 122 ? 162.420 161.725 105.190 1.00 190.01 ? 122 GLN D OE1 1 
ATOM   7033  N  NE2 . GLN C 1 122 ? 161.953 160.738 107.141 1.00 179.94 ? 122 GLN D NE2 1 
ATOM   7034  N  N   . SER C 1 123 ? 158.817 165.671 104.920 1.00 145.85 ? 123 SER D N   1 
ATOM   7035  C  CA  . SER C 1 123 ? 158.907 167.037 105.439 1.00 141.67 ? 123 SER D CA  1 
ATOM   7036  C  C   . SER C 1 123 ? 157.527 167.558 105.834 1.00 142.71 ? 123 SER D C   1 
ATOM   7037  O  O   . SER C 1 123 ? 157.399 168.253 106.844 1.00 137.62 ? 123 SER D O   1 
ATOM   7038  C  CB  . SER C 1 123 ? 159.527 167.970 104.401 1.00 147.76 ? 123 SER D CB  1 
ATOM   7039  O  OG  . SER C 1 123 ? 160.844 167.591 104.037 1.00 157.87 ? 123 SER D OG  1 
ATOM   7040  N  N   . LEU C 1 124 ? 156.496 167.199 105.042 1.00 142.43 ? 124 LEU D N   1 
ATOM   7041  C  CA  . LEU C 1 124 ? 155.114 167.630 105.242 1.00 140.14 ? 124 LEU D CA  1 
ATOM   7042  C  C   . LEU C 1 124 ? 154.501 166.999 106.485 1.00 138.75 ? 124 LEU D C   1 
ATOM   7043  O  O   . LEU C 1 124 ? 153.887 167.723 107.268 1.00 133.90 ? 124 LEU D O   1 
ATOM   7044  C  CB  . LEU C 1 124 ? 154.261 167.320 103.998 1.00 145.55 ? 124 LEU D CB  1 
ATOM   7045  C  CG  . LEU C 1 124 ? 153.427 168.480 103.428 1.00 151.22 ? 124 LEU D CG  1 
ATOM   7046  C  CD1 . LEU C 1 124 ? 154.310 169.642 102.968 1.00 152.31 ? 124 LEU D CD1 1 
ATOM   7047  C  CD2 . LEU C 1 124 ? 152.599 168.014 102.250 1.00 159.37 ? 124 LEU D CD2 1 
ATOM   7048  N  N   . VAL C 1 125 ? 154.689 165.676 106.689 1.00 136.36 ? 125 VAL D N   1 
ATOM   7049  C  CA  . VAL C 1 125 ? 154.154 164.969 107.859 1.00 133.00 ? 125 VAL D CA  1 
ATOM   7050  C  C   . VAL C 1 125 ? 154.950 165.379 109.126 1.00 132.53 ? 125 VAL D C   1 
ATOM   7051  O  O   . VAL C 1 125 ? 154.331 165.542 110.181 1.00 128.57 ? 125 VAL D O   1 
ATOM   7052  C  CB  . VAL C 1 125 ? 154.049 163.428 107.662 1.00 140.14 ? 125 VAL D CB  1 
ATOM   7053  C  CG1 . VAL C 1 125 ? 155.386 162.793 107.324 1.00 142.66 ? 125 VAL D CG1 1 
ATOM   7054  C  CG2 . VAL C 1 125 ? 153.400 162.738 108.858 1.00 137.42 ? 125 VAL D CG2 1 
ATOM   7055  N  N   . PHE C 1 126 ? 156.286 165.611 109.006 1.00 129.83 ? 126 PHE D N   1 
ATOM   7056  C  CA  . PHE C 1 126 ? 157.135 166.072 110.118 1.00 126.30 ? 126 PHE D CA  1 
ATOM   7057  C  C   . PHE C 1 126 ? 156.605 167.407 110.657 1.00 126.66 ? 126 PHE D C   1 
ATOM   7058  O  O   . PHE C 1 126 ? 156.506 167.585 111.870 1.00 122.45 ? 126 PHE D O   1 
ATOM   7059  C  CB  . PHE C 1 126 ? 158.610 166.209 109.682 1.00 130.54 ? 126 PHE D CB  1 
ATOM   7060  C  CG  . PHE C 1 126 ? 159.497 166.989 110.629 1.00 129.41 ? 126 PHE D CG  1 
ATOM   7061  C  CD1 . PHE C 1 126 ? 160.129 166.361 111.693 1.00 131.77 ? 126 PHE D CD1 1 
ATOM   7062  C  CD2 . PHE C 1 126 ? 159.710 168.350 110.445 1.00 130.51 ? 126 PHE D CD2 1 
ATOM   7063  C  CE1 . PHE C 1 126 ? 160.946 167.084 112.568 1.00 130.87 ? 126 PHE D CE1 1 
ATOM   7064  C  CE2 . PHE C 1 126 ? 160.528 169.071 111.318 1.00 131.50 ? 126 PHE D CE2 1 
ATOM   7065  C  CZ  . PHE C 1 126 ? 161.141 168.434 112.373 1.00 128.89 ? 126 PHE D CZ  1 
ATOM   7066  N  N   . LEU C 1 127 ? 156.265 168.329 109.735 1.00 124.78 ? 127 LEU D N   1 
ATOM   7067  C  CA  . LEU C 1 127 ? 155.723 169.660 109.996 1.00 121.68 ? 127 LEU D CA  1 
ATOM   7068  C  C   . LEU C 1 127 ? 154.378 169.568 110.719 1.00 123.63 ? 127 LEU D C   1 
ATOM   7069  O  O   . LEU C 1 127 ? 154.191 170.254 111.723 1.00 119.41 ? 127 LEU D O   1 
ATOM   7070  C  CB  . LEU C 1 127 ? 155.571 170.398 108.657 1.00 124.52 ? 127 LEU D CB  1 
ATOM   7071  C  CG  . LEU C 1 127 ? 155.806 171.897 108.639 1.00 127.21 ? 127 LEU D CG  1 
ATOM   7072  C  CD1 . LEU C 1 127 ? 157.244 172.241 108.981 1.00 126.88 ? 127 LEU D CD1 1 
ATOM   7073  C  CD2 . LEU C 1 127 ? 155.496 172.445 107.280 1.00 133.24 ? 127 LEU D CD2 1 
ATOM   7074  N  N   . LEU C 1 128 ? 153.468 168.689 110.226 1.00 123.39 ? 128 LEU D N   1 
ATOM   7075  C  CA  . LEU C 1 128 ? 152.137 168.419 110.790 1.00 122.31 ? 128 LEU D CA  1 
ATOM   7076  C  C   . LEU C 1 128 ? 152.233 167.951 112.248 1.00 123.81 ? 128 LEU D C   1 
ATOM   7077  O  O   . LEU C 1 128 ? 151.434 168.385 113.084 1.00 120.12 ? 128 LEU D O   1 
ATOM   7078  C  CB  . LEU C 1 128 ? 151.409 167.347 109.957 1.00 126.47 ? 128 LEU D CB  1 
ATOM   7079  C  CG  . LEU C 1 128 ? 150.760 167.777 108.639 1.00 134.68 ? 128 LEU D CG  1 
ATOM   7080  C  CD1 . LEU C 1 128 ? 150.695 166.613 107.666 1.00 139.83 ? 128 LEU D CD1 1 
ATOM   7081  C  CD2 . LEU C 1 128 ? 149.359 168.327 108.860 1.00 135.69 ? 128 LEU D CD2 1 
ATOM   7082  N  N   . LEU C 1 129 ? 153.220 167.069 112.538 1.00 122.67 ? 129 LEU D N   1 
ATOM   7083  C  CA  . LEU C 1 129 ? 153.507 166.527 113.871 1.00 121.31 ? 129 LEU D CA  1 
ATOM   7084  C  C   . LEU C 1 129 ? 154.192 167.575 114.742 1.00 124.00 ? 129 LEU D C   1 
ATOM   7085  O  O   . LEU C 1 129 ? 153.866 167.690 115.927 1.00 121.83 ? 129 LEU D O   1 
ATOM   7086  C  CB  . LEU C 1 129 ? 154.396 165.270 113.784 1.00 123.95 ? 129 LEU D CB  1 
ATOM   7087  C  CG  . LEU C 1 129 ? 153.761 163.994 113.241 1.00 132.24 ? 129 LEU D CG  1 
ATOM   7088  C  CD1 . LEU C 1 129 ? 154.806 163.102 112.620 1.00 136.03 ? 129 LEU D CD1 1 
ATOM   7089  C  CD2 . LEU C 1 129 ? 153.028 163.231 114.328 1.00 134.28 ? 129 LEU D CD2 1 
ATOM   7090  N  N   . ALA C 1 130 ? 155.147 168.332 114.155 1.00 121.31 ? 130 ALA D N   1 
ATOM   7091  C  CA  . ALA C 1 130 ? 155.890 169.382 114.844 1.00 119.07 ? 130 ALA D CA  1 
ATOM   7092  C  C   . ALA C 1 130 ? 154.953 170.475 115.359 1.00 120.44 ? 130 ALA D C   1 
ATOM   7093  O  O   . ALA C 1 130 ? 155.067 170.848 116.526 1.00 118.19 ? 130 ALA D O   1 
ATOM   7094  C  CB  . ALA C 1 130 ? 156.936 169.981 113.922 1.00 121.91 ? 130 ALA D CB  1 
ATOM   7095  N  N   . THR C 1 131 ? 154.006 170.952 114.514 1.00 117.16 ? 131 THR D N   1 
ATOM   7096  C  CA  . THR C 1 131 ? 153.038 171.998 114.882 1.00 114.47 ? 131 THR D CA  1 
ATOM   7097  C  C   . THR C 1 131 ? 151.950 171.457 115.819 1.00 115.56 ? 131 THR D C   1 
ATOM   7098  O  O   . THR C 1 131 ? 151.394 172.235 116.600 1.00 113.38 ? 131 THR D O   1 
ATOM   7099  C  CB  . THR C 1 131 ? 152.405 172.653 113.650 1.00 125.28 ? 131 THR D CB  1 
ATOM   7100  O  OG1 . THR C 1 131 ? 151.759 171.654 112.859 1.00 130.50 ? 131 THR D OG1 1 
ATOM   7101  C  CG2 . THR C 1 131 ? 153.408 173.446 112.821 1.00 124.35 ? 131 THR D CG2 1 
ATOM   7102  N  N   . LEU C 1 132 ? 151.646 170.146 115.749 1.00 112.16 ? 132 LEU D N   1 
ATOM   7103  C  CA  . LEU C 1 132 ? 150.652 169.542 116.632 1.00 111.29 ? 132 LEU D CA  1 
ATOM   7104  C  C   . LEU C 1 132 ? 151.174 169.548 118.067 1.00 112.24 ? 132 LEU D C   1 
ATOM   7105  O  O   . LEU C 1 132 ? 150.433 169.943 118.967 1.00 110.11 ? 132 LEU D O   1 
ATOM   7106  C  CB  . LEU C 1 132 ? 150.267 168.116 116.182 1.00 114.46 ? 132 LEU D CB  1 
ATOM   7107  C  CG  . LEU C 1 132 ? 149.437 167.247 117.160 1.00 119.26 ? 132 LEU D CG  1 
ATOM   7108  C  CD1 . LEU C 1 132 ? 148.044 167.823 117.404 1.00 118.53 ? 132 LEU D CD1 1 
ATOM   7109  C  CD2 . LEU C 1 132 ? 149.366 165.806 116.687 1.00 125.14 ? 132 LEU D CD2 1 
ATOM   7110  N  N   . PHE C 1 133 ? 152.446 169.146 118.279 1.00 109.26 ? 133 PHE D N   1 
ATOM   7111  C  CA  . PHE C 1 133 ? 153.041 169.140 119.620 1.00 108.09 ? 133 PHE D CA  1 
ATOM   7112  C  C   . PHE C 1 133 ? 153.147 170.579 120.141 1.00 111.70 ? 133 PHE D C   1 
ATOM   7113  O  O   . PHE C 1 133 ? 152.725 170.842 121.271 1.00 110.30 ? 133 PHE D O   1 
ATOM   7114  C  CB  A PHE C 1 133 ? 154.398 168.408 119.625 0.50 111.36 ? 133 PHE D CB  1 
ATOM   7115  C  CB  B PHE C 1 133 ? 154.435 168.457 119.627 0.50 110.88 ? 133 PHE D CB  1 
ATOM   7116  C  CG  A PHE C 1 133 ? 154.363 166.969 119.145 0.50 115.43 ? 133 PHE D CG  1 
ATOM   7117  C  CG  B PHE C 1 133 ? 155.268 168.659 120.884 0.50 110.90 ? 133 PHE D CG  1 
ATOM   7118  C  CD1 A PHE C 1 133 ? 153.278 166.144 119.429 0.50 118.98 ? 133 PHE D CD1 1 
ATOM   7119  C  CD1 B PHE C 1 133 ? 155.133 167.808 121.974 0.50 112.84 ? 133 PHE D CD1 1 
ATOM   7120  C  CD2 A PHE C 1 133 ? 155.437 166.424 118.454 0.50 119.92 ? 133 PHE D CD2 1 
ATOM   7121  C  CD2 B PHE C 1 133 ? 156.194 169.693 120.968 0.50 112.57 ? 133 PHE D CD2 1 
ATOM   7122  C  CE1 A PHE C 1 133 ? 153.251 164.818 118.993 0.50 122.63 ? 133 PHE D CE1 1 
ATOM   7123  C  CE1 B PHE C 1 133 ? 155.903 167.993 123.128 0.50 115.01 ? 133 PHE D CE1 1 
ATOM   7124  C  CE2 A PHE C 1 133 ? 155.410 165.095 118.023 0.50 125.45 ? 133 PHE D CE2 1 
ATOM   7125  C  CE2 B PHE C 1 133 ? 156.952 169.884 122.128 0.50 112.87 ? 133 PHE D CE2 1 
ATOM   7126  C  CZ  A PHE C 1 133 ? 154.320 164.301 118.298 0.50 123.93 ? 133 PHE D CZ  1 
ATOM   7127  C  CZ  B PHE C 1 133 ? 156.806 169.028 123.196 0.50 112.21 ? 133 PHE D CZ  1 
ATOM   7128  N  N   . SER C 1 134 ? 153.650 171.507 119.296 1.00 109.07 ? 134 SER D N   1 
ATOM   7129  C  CA  . SER C 1 134 ? 153.797 172.928 119.614 1.00 107.48 ? 134 SER D CA  1 
ATOM   7130  C  C   . SER C 1 134 ? 152.491 173.524 120.135 1.00 110.17 ? 134 SER D C   1 
ATOM   7131  O  O   . SER C 1 134 ? 152.507 174.193 121.168 1.00 108.94 ? 134 SER D O   1 
ATOM   7132  C  CB  . SER C 1 134 ? 154.264 173.708 118.389 1.00 112.41 ? 134 SER D CB  1 
ATOM   7133  O  OG  . SER C 1 134 ? 155.558 173.293 117.986 1.00 125.20 ? 134 SER D OG  1 
ATOM   7134  N  N   . ALA C 1 135 ? 151.363 173.242 119.447 1.00 106.96 ? 135 ALA D N   1 
ATOM   7135  C  CA  . ALA C 1 135 ? 150.043 173.745 119.804 1.00 106.07 ? 135 ALA D CA  1 
ATOM   7136  C  C   . ALA C 1 135 ? 149.558 173.188 121.143 1.00 110.82 ? 135 ALA D C   1 
ATOM   7137  O  O   . ALA C 1 135 ? 149.131 173.967 121.997 1.00 109.39 ? 135 ALA D O   1 
ATOM   7138  C  CB  . ALA C 1 135 ? 149.043 173.417 118.705 1.00 108.47 ? 135 ALA D CB  1 
ATOM   7139  N  N   . LEU C 1 136 ? 149.648 171.854 121.332 1.00 109.71 ? 136 LEU D N   1 
ATOM   7140  C  CA  . LEU C 1 136 ? 149.187 171.157 122.535 1.00 110.27 ? 136 LEU D CA  1 
ATOM   7141  C  C   . LEU C 1 136 ? 149.990 171.518 123.781 1.00 113.38 ? 136 LEU D C   1 
ATOM   7142  O  O   . LEU C 1 136 ? 149.388 171.666 124.841 1.00 113.46 ? 136 LEU D O   1 
ATOM   7143  C  CB  . LEU C 1 136 ? 149.214 169.629 122.349 1.00 112.59 ? 136 LEU D CB  1 
ATOM   7144  C  CG  . LEU C 1 136 ? 148.226 169.012 121.356 1.00 119.98 ? 136 LEU D CG  1 
ATOM   7145  C  CD1 . LEU C 1 136 ? 148.578 167.559 121.095 1.00 122.66 ? 136 LEU D CD1 1 
ATOM   7146  C  CD2 . LEU C 1 136 ? 146.774 169.134 121.839 1.00 123.46 ? 136 LEU D CD2 1 
ATOM   7147  N  N   . ALA C 1 137 ? 151.327 171.649 123.668 1.00 109.38 ? 137 ALA D N   1 
ATOM   7148  C  CA  . ALA C 1 137 ? 152.204 171.948 124.809 1.00 108.93 ? 137 ALA D CA  1 
ATOM   7149  C  C   . ALA C 1 137 ? 152.034 173.370 125.338 1.00 111.35 ? 137 ALA D C   1 
ATOM   7150  O  O   . ALA C 1 137 ? 152.260 173.603 126.528 1.00 110.92 ? 137 ALA D O   1 
ATOM   7151  C  CB  . ALA C 1 137 ? 153.656 171.715 124.433 1.00 110.49 ? 137 ALA D CB  1 
ATOM   7152  N  N   . GLY C 1 138 ? 151.651 174.291 124.453 1.00 107.44 ? 138 GLY D N   1 
ATOM   7153  C  CA  . GLY C 1 138 ? 151.461 175.706 124.767 1.00 106.14 ? 138 GLY D CA  1 
ATOM   7154  C  C   . GLY C 1 138 ? 150.048 176.121 125.131 1.00 108.20 ? 138 GLY D C   1 
ATOM   7155  O  O   . GLY C 1 138 ? 149.843 177.202 125.693 1.00 107.01 ? 138 GLY D O   1 
ATOM   7156  N  N   . LEU C 1 139 ? 149.069 175.260 124.814 1.00 104.52 ? 139 LEU D N   1 
ATOM   7157  C  CA  . LEU C 1 139 ? 147.651 175.470 125.094 1.00 104.34 ? 139 LEU D CA  1 
ATOM   7158  C  C   . LEU C 1 139 ? 147.359 175.628 126.616 1.00 107.64 ? 139 LEU D C   1 
ATOM   7159  O  O   . LEU C 1 139 ? 146.586 176.540 126.923 1.00 108.10 ? 139 LEU D O   1 
ATOM   7160  C  CB  . LEU C 1 139 ? 146.815 174.333 124.486 1.00 105.85 ? 139 LEU D CB  1 
ATOM   7161  C  CG  . LEU C 1 139 ? 145.404 174.673 124.012 1.00 111.46 ? 139 LEU D CG  1 
ATOM   7162  C  CD1 . LEU C 1 139 ? 145.396 175.824 123.003 1.00 110.79 ? 139 LEU D CD1 1 
ATOM   7163  C  CD2 . LEU C 1 139 ? 144.751 173.458 123.395 1.00 115.92 ? 139 LEU D CD2 1 
ATOM   7164  N  N   . PRO C 1 140 ? 147.961 174.861 127.587 1.00 102.67 ? 140 PRO D N   1 
ATOM   7165  C  CA  . PRO C 1 140 ? 147.651 175.109 129.008 1.00 102.83 ? 140 PRO D CA  1 
ATOM   7166  C  C   . PRO C 1 140 ? 148.129 176.481 129.491 1.00 104.77 ? 140 PRO D C   1 
ATOM   7167  O  O   . PRO C 1 140 ? 147.464 177.094 130.326 1.00 105.07 ? 140 PRO D O   1 
ATOM   7168  C  CB  . PRO C 1 140 ? 148.387 173.975 129.739 1.00 105.70 ? 140 PRO D CB  1 
ATOM   7169  C  CG  . PRO C 1 140 ? 148.639 172.952 128.717 1.00 109.92 ? 140 PRO D CG  1 
ATOM   7170  C  CD  . PRO C 1 140 ? 148.899 173.727 127.470 1.00 104.04 ? 140 PRO D CD  1 
ATOM   7171  N  N   . TRP C 1 141 ? 149.262 176.969 128.951 1.00 99.73  ? 141 TRP D N   1 
ATOM   7172  C  CA  . TRP C 1 141 ? 149.838 178.273 129.286 1.00 99.09  ? 141 TRP D CA  1 
ATOM   7173  C  C   . TRP C 1 141 ? 148.921 179.382 128.786 1.00 103.74 ? 141 TRP D C   1 
ATOM   7174  O  O   . TRP C 1 141 ? 148.621 180.314 129.538 1.00 103.81 ? 141 TRP D O   1 
ATOM   7175  C  CB  . TRP C 1 141 ? 151.250 178.401 128.696 1.00 97.00  ? 141 TRP D CB  1 
ATOM   7176  C  CG  . TRP C 1 141 ? 152.201 177.393 129.264 1.00 98.92  ? 141 TRP D CG  1 
ATOM   7177  C  CD1 . TRP C 1 141 ? 152.470 176.149 128.772 1.00 102.14 ? 141 TRP D CD1 1 
ATOM   7178  C  CD2 . TRP C 1 141 ? 152.919 177.501 130.498 1.00 100.25 ? 141 TRP D CD2 1 
ATOM   7179  N  NE1 . TRP C 1 141 ? 153.339 175.486 129.607 1.00 103.04 ? 141 TRP D NE1 1 
ATOM   7180  C  CE2 . TRP C 1 141 ? 153.633 176.295 130.675 1.00 105.40 ? 141 TRP D CE2 1 
ATOM   7181  C  CE3 . TRP C 1 141 ? 153.036 178.509 131.472 1.00 102.32 ? 141 TRP D CE3 1 
ATOM   7182  C  CZ2 . TRP C 1 141 ? 154.462 176.073 131.782 1.00 106.97 ? 141 TRP D CZ2 1 
ATOM   7183  C  CZ3 . TRP C 1 141 ? 153.860 178.289 132.565 1.00 106.00 ? 141 TRP D CZ3 1 
ATOM   7184  C  CH2 . TRP C 1 141 ? 154.566 177.087 132.711 1.00 107.95 ? 141 TRP D CH2 1 
ATOM   7185  N  N   . SER C 1 142 ? 148.422 179.229 127.538 1.00 100.81 ? 142 SER D N   1 
ATOM   7186  C  CA  . SER C 1 142 ? 147.487 180.131 126.854 1.00 100.89 ? 142 SER D CA  1 
ATOM   7187  C  C   . SER C 1 142 ? 146.156 180.215 127.606 1.00 104.58 ? 142 SER D C   1 
ATOM   7188  O  O   . SER C 1 142 ? 145.584 181.303 127.734 1.00 103.77 ? 142 SER D O   1 
ATOM   7189  C  CB  . SER C 1 142 ? 147.248 179.650 125.425 1.00 105.94 ? 142 SER D CB  1 
ATOM   7190  O  OG  . SER C 1 142 ? 146.373 180.519 124.723 1.00 119.15 ? 142 SER D OG  1 
ATOM   7191  N  N   . LEU C 1 143 ? 145.681 179.051 128.098 1.00 102.10 ? 143 LEU D N   1 
ATOM   7192  C  CA  . LEU C 1 143 ? 144.450 178.898 128.870 1.00 103.74 ? 143 LEU D CA  1 
ATOM   7193  C  C   . LEU C 1 143 ? 144.594 179.609 130.219 1.00 109.48 ? 143 LEU D C   1 
ATOM   7194  O  O   . LEU C 1 143 ? 143.627 180.206 130.694 1.00 110.38 ? 143 LEU D O   1 
ATOM   7195  C  CB  . LEU C 1 143 ? 144.131 177.405 129.059 1.00 104.78 ? 143 LEU D CB  1 
ATOM   7196  C  CG  . LEU C 1 143 ? 142.768 177.069 129.622 1.00 111.68 ? 143 LEU D CG  1 
ATOM   7197  C  CD1 . LEU C 1 143 ? 141.837 176.603 128.539 1.00 112.69 ? 143 LEU D CD1 1 
ATOM   7198  C  CD2 . LEU C 1 143 ? 142.881 176.007 130.678 1.00 116.35 ? 143 LEU D CD2 1 
ATOM   7199  N  N   . TYR C 1 144 ? 145.809 179.573 130.814 1.00 106.35 ? 144 TYR D N   1 
ATOM   7200  C  CA  . TYR C 1 144 ? 146.088 180.228 132.089 1.00 107.79 ? 144 TYR D CA  1 
ATOM   7201  C  C   . TYR C 1 144 ? 146.055 181.738 131.932 1.00 111.73 ? 144 TYR D C   1 
ATOM   7202  O  O   . TYR C 1 144 ? 145.430 182.409 132.746 1.00 112.82 ? 144 TYR D O   1 
ATOM   7203  C  CB  . TYR C 1 144 ? 147.439 179.784 132.681 1.00 109.33 ? 144 TYR D CB  1 
ATOM   7204  C  CG  . TYR C 1 144 ? 147.652 180.254 134.108 1.00 113.34 ? 144 TYR D CG  1 
ATOM   7205  C  CD1 . TYR C 1 144 ? 147.162 179.520 135.185 1.00 118.03 ? 144 TYR D CD1 1 
ATOM   7206  C  CD2 . TYR C 1 144 ? 148.346 181.429 134.381 1.00 113.88 ? 144 TYR D CD2 1 
ATOM   7207  C  CE1 . TYR C 1 144 ? 147.340 179.954 136.500 1.00 121.22 ? 144 TYR D CE1 1 
ATOM   7208  C  CE2 . TYR C 1 144 ? 148.526 181.876 135.690 1.00 117.35 ? 144 TYR D CE2 1 
ATOM   7209  C  CZ  . TYR C 1 144 ? 148.027 181.131 136.747 1.00 127.54 ? 144 TYR D CZ  1 
ATOM   7210  O  OH  . TYR C 1 144 ? 148.195 181.563 138.042 1.00 131.50 ? 144 TYR D OH  1 
ATOM   7211  N  N   . ASN C 1 145 ? 146.717 182.272 130.892 1.00 107.34 ? 145 ASN D N   1 
ATOM   7212  C  CA  . ASN C 1 145 ? 146.767 183.713 130.657 1.00 107.36 ? 145 ASN D CA  1 
ATOM   7213  C  C   . ASN C 1 145 ? 145.366 184.324 130.531 1.00 113.47 ? 145 ASN D C   1 
ATOM   7214  O  O   . ASN C 1 145 ? 145.075 185.293 131.234 1.00 114.80 ? 145 ASN D O   1 
ATOM   7215  C  CB  . ASN C 1 145 ? 147.611 184.057 129.425 1.00 105.74 ? 145 ASN D CB  1 
ATOM   7216  C  CG  . ASN C 1 145 ? 147.679 185.542 129.141 1.00 122.19 ? 145 ASN D CG  1 
ATOM   7217  O  OD1 . ASN C 1 145 ? 148.294 186.320 129.877 1.00 113.07 ? 145 ASN D OD1 1 
ATOM   7218  N  ND2 . ASN C 1 145 ? 147.008 185.973 128.085 1.00 114.07 ? 145 ASN D ND2 1 
ATOM   7219  N  N   . THR C 1 146 ? 144.498 183.747 129.677 1.00 110.03 ? 146 THR D N   1 
ATOM   7220  C  CA  . THR C 1 146 ? 143.161 184.299 129.452 1.00 111.15 ? 146 THR D CA  1 
ATOM   7221  C  C   . THR C 1 146 ? 142.227 184.059 130.640 1.00 116.85 ? 146 THR D C   1 
ATOM   7222  O  O   . THR C 1 146 ? 141.528 184.991 131.039 1.00 118.49 ? 146 THR D O   1 
ATOM   7223  C  CB  . THR C 1 146 ? 142.521 183.782 128.140 1.00 119.70 ? 146 THR D CB  1 
ATOM   7224  O  OG1 . THR C 1 146 ? 142.132 182.417 128.280 1.00 119.30 ? 146 THR D OG1 1 
ATOM   7225  C  CG2 . THR C 1 146 ? 143.420 183.963 126.913 1.00 117.61 ? 146 THR D CG2 1 
ATOM   7226  N  N   . PHE C 1 147 ? 142.210 182.838 131.206 1.00 113.34 ? 147 PHE D N   1 
ATOM   7227  C  CA  . PHE C 1 147 ? 141.261 182.515 132.275 1.00 115.89 ? 147 PHE D CA  1 
ATOM   7228  C  C   . PHE C 1 147 ? 141.772 182.748 133.707 1.00 120.87 ? 147 PHE D C   1 
ATOM   7229  O  O   . PHE C 1 147 ? 140.980 182.605 134.644 1.00 123.62 ? 147 PHE D O   1 
ATOM   7230  C  CB  . PHE C 1 147 ? 140.725 181.082 132.124 1.00 118.39 ? 147 PHE D CB  1 
ATOM   7231  C  CG  . PHE C 1 147 ? 139.901 180.920 130.870 1.00 119.28 ? 147 PHE D CG  1 
ATOM   7232  C  CD1 . PHE C 1 147 ? 138.711 181.618 130.705 1.00 123.60 ? 147 PHE D CD1 1 
ATOM   7233  C  CD2 . PHE C 1 147 ? 140.334 180.098 129.837 1.00 119.42 ? 147 PHE D CD2 1 
ATOM   7234  C  CE1 . PHE C 1 147 ? 137.969 181.495 129.533 1.00 124.96 ? 147 PHE D CE1 1 
ATOM   7235  C  CE2 . PHE C 1 147 ? 139.583 179.965 128.669 1.00 122.54 ? 147 PHE D CE2 1 
ATOM   7236  C  CZ  . PHE C 1 147 ? 138.411 180.670 128.523 1.00 122.64 ? 147 PHE D CZ  1 
ATOM   7237  N  N   . VAL C 1 148 ? 143.039 183.150 133.895 1.00 115.12 ? 148 VAL D N   1 
ATOM   7238  C  CA  . VAL C 1 148 ? 143.496 183.433 135.254 1.00 116.67 ? 148 VAL D CA  1 
ATOM   7239  C  C   . VAL C 1 148 ? 143.994 184.883 135.317 1.00 121.12 ? 148 VAL D C   1 
ATOM   7240  O  O   . VAL C 1 148 ? 143.466 185.629 136.131 1.00 123.58 ? 148 VAL D O   1 
ATOM   7241  C  CB  . VAL C 1 148 ? 144.509 182.412 135.838 1.00 120.33 ? 148 VAL D CB  1 
ATOM   7242  C  CG1 . VAL C 1 148 ? 144.960 182.816 137.239 1.00 122.86 ? 148 VAL D CG1 1 
ATOM   7243  C  CG2 . VAL C 1 148 ? 143.907 181.011 135.873 1.00 121.15 ? 148 VAL D CG2 1 
ATOM   7244  N  N   . ILE C 1 149 ? 144.953 185.302 134.457 1.00 115.34 ? 149 ILE D N   1 
ATOM   7245  C  CA  . ILE C 1 149 ? 145.473 186.681 134.485 1.00 115.25 ? 149 ILE D CA  1 
ATOM   7246  C  C   . ILE C 1 149 ? 144.417 187.673 133.943 1.00 121.44 ? 149 ILE D C   1 
ATOM   7247  O  O   . ILE C 1 149 ? 144.008 188.572 134.681 1.00 123.35 ? 149 ILE D O   1 
ATOM   7248  C  CB  . ILE C 1 149 ? 146.842 186.823 133.758 1.00 115.71 ? 149 ILE D CB  1 
ATOM   7249  C  CG1 . ILE C 1 149 ? 147.928 186.026 134.489 1.00 116.57 ? 149 ILE D CG1 1 
ATOM   7250  C  CG2 . ILE C 1 149 ? 147.274 188.292 133.617 1.00 116.35 ? 149 ILE D CG2 1 
ATOM   7251  C  CD1 . ILE C 1 149 ? 148.481 184.969 133.696 1.00 121.35 ? 149 ILE D CD1 1 
ATOM   7252  N  N   . GLU C 1 150 ? 143.966 187.501 132.683 1.00 117.48 ? 150 GLU D N   1 
ATOM   7253  C  CA  . GLU C 1 150 ? 142.983 188.396 132.058 1.00 118.31 ? 150 GLU D CA  1 
ATOM   7254  C  C   . GLU C 1 150 ? 141.626 188.333 132.764 1.00 126.17 ? 150 GLU D C   1 
ATOM   7255  O  O   . GLU C 1 150 ? 140.888 189.317 132.738 1.00 127.91 ? 150 GLU D O   1 
ATOM   7256  C  CB  . GLU C 1 150 ? 142.818 188.099 130.555 1.00 117.94 ? 150 GLU D CB  1 
ATOM   7257  C  CG  . GLU C 1 150 ? 144.084 188.274 129.722 1.00 126.98 ? 150 GLU D CG  1 
ATOM   7258  C  CD  . GLU C 1 150 ? 144.793 189.616 129.805 1.00 147.69 ? 150 GLU D CD  1 
ATOM   7259  O  OE1 . GLU C 1 150 ? 144.112 190.665 129.715 1.00 148.16 ? 150 GLU D OE1 1 
ATOM   7260  O  OE2 . GLU C 1 150 ? 146.040 189.613 129.938 1.00 136.20 ? 150 GLU D OE2 1 
ATOM   7261  N  N   . GLU C 1 151 ? 141.313 187.205 133.420 1.00 124.34 ? 151 GLU D N   1 
ATOM   7262  C  CA  . GLU C 1 151 ? 140.048 187.055 134.132 1.00 128.17 ? 151 GLU D CA  1 
ATOM   7263  C  C   . GLU C 1 151 ? 140.107 187.704 135.520 1.00 135.06 ? 151 GLU D C   1 
ATOM   7264  O  O   . GLU C 1 151 ? 139.122 188.323 135.921 1.00 137.77 ? 151 GLU D O   1 
ATOM   7265  C  CB  . GLU C 1 151 ? 139.641 185.578 134.232 1.00 130.47 ? 151 GLU D CB  1 
ATOM   7266  C  CG  . GLU C 1 151 ? 138.143 185.350 134.360 1.00 148.15 ? 151 GLU D CG  1 
ATOM   7267  C  CD  . GLU C 1 151 ? 137.301 185.890 133.218 1.00 181.34 ? 151 GLU D CD  1 
ATOM   7268  O  OE1 . GLU C 1 151 ? 137.297 185.264 132.134 1.00 181.33 ? 151 GLU D OE1 1 
ATOM   7269  O  OE2 . GLU C 1 151 ? 136.654 186.946 133.406 1.00 182.90 ? 151 GLU D OE2 1 
ATOM   7270  N  N   . LYS C 1 152 ? 141.249 187.572 136.245 1.00 131.16 ? 152 LYS D N   1 
ATOM   7271  C  CA  . LYS C 1 152 ? 141.457 188.154 137.585 1.00 134.00 ? 152 LYS D CA  1 
ATOM   7272  C  C   . LYS C 1 152 ? 141.386 189.681 137.536 1.00 139.03 ? 152 LYS D C   1 
ATOM   7273  O  O   . LYS C 1 152 ? 140.811 190.298 138.441 1.00 142.93 ? 152 LYS D O   1 
ATOM   7274  C  CB  . LYS C 1 152 ? 142.816 187.718 138.176 1.00 135.52 ? 152 LYS D CB  1 
ATOM   7275  C  CG  . LYS C 1 152 ? 143.020 188.040 139.653 1.00 150.56 ? 152 LYS D CG  1 
ATOM   7276  N  N   . HIS C 1 153 ? 141.953 190.284 136.471 1.00 131.49 ? 153 HIS D N   1 
ATOM   7277  C  CA  . HIS C 1 153 ? 141.997 191.732 136.299 1.00 131.29 ? 153 HIS D CA  1 
ATOM   7278  C  C   . HIS C 1 153 ? 140.844 192.236 135.397 1.00 135.60 ? 153 HIS D C   1 
ATOM   7279  O  O   . HIS C 1 153 ? 140.909 193.343 134.860 1.00 134.95 ? 153 HIS D O   1 
ATOM   7280  C  CB  . HIS C 1 153 ? 143.380 192.153 135.789 1.00 129.10 ? 153 HIS D CB  1 
ATOM   7281  C  CG  . HIS C 1 153 ? 144.484 191.698 136.696 1.00 132.56 ? 153 HIS D CG  1 
ATOM   7282  N  ND1 . HIS C 1 153 ? 144.757 192.351 137.883 1.00 137.41 ? 153 HIS D ND1 1 
ATOM   7283  C  CD2 . HIS C 1 153 ? 145.311 190.635 136.583 1.00 132.16 ? 153 HIS D CD2 1 
ATOM   7284  C  CE1 . HIS C 1 153 ? 145.743 191.672 138.446 1.00 136.76 ? 153 HIS D CE1 1 
ATOM   7285  N  NE2 . HIS C 1 153 ? 146.113 190.636 137.697 1.00 133.98 ? 153 HIS D NE2 1 
ATOM   7286  N  N   . GLY C 1 154 ? 139.785 191.425 135.314 1.00 133.78 ? 154 GLY D N   1 
ATOM   7287  C  CA  . GLY C 1 154 ? 138.528 191.685 134.614 1.00 135.32 ? 154 GLY D CA  1 
ATOM   7288  C  C   . GLY C 1 154 ? 138.556 192.116 133.162 1.00 137.52 ? 154 GLY D C   1 
ATOM   7289  O  O   . GLY C 1 154 ? 137.636 192.815 132.720 1.00 139.51 ? 154 GLY D O   1 
ATOM   7290  N  N   . PHE C 1 155 ? 139.581 191.693 132.402 1.00 129.97 ? 155 PHE D N   1 
ATOM   7291  C  CA  . PHE C 1 155 ? 139.689 192.035 130.986 1.00 127.80 ? 155 PHE D CA  1 
ATOM   7292  C  C   . PHE C 1 155 ? 138.940 191.024 130.126 1.00 130.94 ? 155 PHE D C   1 
ATOM   7293  O  O   . PHE C 1 155 ? 138.138 191.432 129.287 1.00 131.85 ? 155 PHE D O   1 
ATOM   7294  C  CB  . PHE C 1 155 ? 141.156 192.135 130.539 1.00 126.69 ? 155 PHE D CB  1 
ATOM   7295  C  CG  . PHE C 1 155 ? 141.850 193.419 130.932 1.00 129.01 ? 155 PHE D CG  1 
ATOM   7296  C  CD1 . PHE C 1 155 ? 141.613 194.600 130.235 1.00 133.29 ? 155 PHE D CD1 1 
ATOM   7297  C  CD2 . PHE C 1 155 ? 142.762 193.445 131.980 1.00 131.15 ? 155 PHE D CD2 1 
ATOM   7298  C  CE1 . PHE C 1 155 ? 142.272 195.784 130.585 1.00 135.07 ? 155 PHE D CE1 1 
ATOM   7299  C  CE2 . PHE C 1 155 ? 143.409 194.634 132.339 1.00 134.98 ? 155 PHE D CE2 1 
ATOM   7300  C  CZ  . PHE C 1 155 ? 143.165 195.793 131.634 1.00 134.02 ? 155 PHE D CZ  1 
ATOM   7301  N  N   . ASN C 1 156 ? 139.183 189.712 130.355 1.00 125.94 ? 156 ASN D N   1 
ATOM   7302  C  CA  . ASN C 1 156 ? 138.601 188.595 129.600 1.00 125.17 ? 156 ASN D CA  1 
ATOM   7303  C  C   . ASN C 1 156 ? 137.078 188.562 129.651 1.00 131.15 ? 156 ASN D C   1 
ATOM   7304  O  O   . ASN C 1 156 ? 136.472 188.767 130.702 1.00 132.67 ? 156 ASN D O   1 
ATOM   7305  C  CB  . ASN C 1 156 ? 139.153 187.253 130.077 1.00 123.70 ? 156 ASN D CB  1 
ATOM   7306  C  CG  . ASN C 1 156 ? 138.922 186.127 129.100 1.00 140.45 ? 156 ASN D CG  1 
ATOM   7307  O  OD1 . ASN C 1 156 ? 139.498 186.087 128.005 1.00 133.01 ? 156 ASN D OD1 1 
ATOM   7308  N  ND2 . ASN C 1 156 ? 138.073 185.187 129.479 1.00 132.09 ? 156 ASN D ND2 1 
ATOM   7309  N  N   . GLN C 1 157 ? 136.481 188.308 128.477 1.00 128.22 ? 157 GLN D N   1 
ATOM   7310  C  CA  . GLN C 1 157 ? 135.040 188.201 128.229 1.00 131.53 ? 157 GLN D CA  1 
ATOM   7311  C  C   . GLN C 1 157 ? 134.733 186.843 127.564 1.00 135.39 ? 157 GLN D C   1 
ATOM   7312  O  O   . GLN C 1 157 ? 133.566 186.501 127.340 1.00 138.49 ? 157 GLN D O   1 
ATOM   7313  C  CB  . GLN C 1 157 ? 134.548 189.371 127.346 1.00 134.08 ? 157 GLN D CB  1 
ATOM   7314  C  CG  . GLN C 1 157 ? 134.997 190.772 127.784 1.00 142.17 ? 157 GLN D CG  1 
ATOM   7315  C  CD  . GLN C 1 157 ? 134.464 191.192 129.133 1.00 164.89 ? 157 GLN D CD  1 
ATOM   7316  O  OE1 . GLN C 1 157 ? 133.255 191.174 129.388 1.00 164.40 ? 157 GLN D OE1 1 
ATOM   7317  N  NE2 . GLN C 1 157 ? 135.357 191.614 130.016 1.00 157.24 ? 157 GLN D NE2 1 
ATOM   7318  N  N   . GLN C 1 158 ? 135.800 186.077 127.256 1.00 127.92 ? 158 GLN D N   1 
ATOM   7319  C  CA  . GLN C 1 158 ? 135.749 184.760 126.626 1.00 127.11 ? 158 GLN D CA  1 
ATOM   7320  C  C   . GLN C 1 158 ? 135.210 183.686 127.556 1.00 132.39 ? 158 GLN D C   1 
ATOM   7321  O  O   . GLN C 1 158 ? 135.441 183.730 128.768 1.00 131.81 ? 158 GLN D O   1 
ATOM   7322  C  CB  . GLN C 1 158 ? 137.159 184.329 126.180 1.00 124.25 ? 158 GLN D CB  1 
ATOM   7323  C  CG  . GLN C 1 158 ? 137.639 184.914 124.874 1.00 127.14 ? 158 GLN D CG  1 
ATOM   7324  C  CD  . GLN C 1 158 ? 138.908 184.229 124.440 1.00 141.95 ? 158 GLN D CD  1 
ATOM   7325  O  OE1 . GLN C 1 158 ? 138.882 183.196 123.767 1.00 133.95 ? 158 GLN D OE1 1 
ATOM   7326  N  NE2 . GLN C 1 158 ? 140.048 184.769 124.846 1.00 138.44 ? 158 GLN D NE2 1 
ATOM   7327  N  N   . THR C 1 159 ? 134.542 182.688 126.966 1.00 130.70 ? 159 THR D N   1 
ATOM   7328  C  CA  . THR C 1 159 ? 134.068 181.493 127.654 1.00 132.68 ? 159 THR D CA  1 
ATOM   7329  C  C   . THR C 1 159 ? 135.039 180.367 127.273 1.00 133.44 ? 159 THR D C   1 
ATOM   7330  O  O   . THR C 1 159 ? 135.763 180.508 126.284 1.00 130.13 ? 159 THR D O   1 
ATOM   7331  C  CB  . THR C 1 159 ? 132.585 181.199 127.346 1.00 149.31 ? 159 THR D CB  1 
ATOM   7332  O  OG1 . THR C 1 159 ? 132.231 179.933 127.910 1.00 154.76 ? 159 THR D OG1 1 
ATOM   7333  C  CG2 . THR C 1 159 ? 132.256 181.221 125.853 1.00 148.46 ? 159 THR D CG2 1 
ATOM   7334  N  N   . LEU C 1 160 ? 135.077 179.269 128.051 1.00 131.47 ? 160 LEU D N   1 
ATOM   7335  C  CA  . LEU C 1 160 ? 135.986 178.147 127.775 1.00 129.66 ? 160 LEU D CA  1 
ATOM   7336  C  C   . LEU C 1 160 ? 135.700 177.515 126.411 1.00 134.21 ? 160 LEU D C   1 
ATOM   7337  O  O   . LEU C 1 160 ? 136.628 177.056 125.744 1.00 131.52 ? 160 LEU D O   1 
ATOM   7338  C  CB  . LEU C 1 160 ? 135.920 177.083 128.876 1.00 131.54 ? 160 LEU D CB  1 
ATOM   7339  C  CG  . LEU C 1 160 ? 137.188 176.249 129.048 1.00 133.60 ? 160 LEU D CG  1 
ATOM   7340  C  CD1 . LEU C 1 160 ? 137.573 176.162 130.505 1.00 134.34 ? 160 LEU D CD1 1 
ATOM   7341  C  CD2 . LEU C 1 160 ? 137.028 174.860 128.434 1.00 137.07 ? 160 LEU D CD2 1 
ATOM   7342  N  N   . GLY C 1 161 ? 134.430 177.524 126.017 1.00 134.31 ? 161 GLY D N   1 
ATOM   7343  C  CA  . GLY C 1 161 ? 133.966 176.995 124.743 1.00 136.04 ? 161 GLY D CA  1 
ATOM   7344  C  C   . GLY C 1 161 ? 134.483 177.794 123.570 1.00 137.58 ? 161 GLY D C   1 
ATOM   7345  O  O   . GLY C 1 161 ? 134.979 177.209 122.604 1.00 135.84 ? 161 GLY D O   1 
ATOM   7346  N  N   . PHE C 1 162 ? 134.388 179.141 123.662 1.00 134.38 ? 162 PHE D N   1 
ATOM   7347  C  CA  . PHE C 1 162 ? 134.856 180.069 122.629 1.00 133.09 ? 162 PHE D CA  1 
ATOM   7348  C  C   . PHE C 1 162 ? 136.358 179.944 122.463 1.00 132.55 ? 162 PHE D C   1 
ATOM   7349  O  O   . PHE C 1 162 ? 136.832 179.920 121.330 1.00 131.58 ? 162 PHE D O   1 
ATOM   7350  C  CB  . PHE C 1 162 ? 134.466 181.525 122.953 1.00 135.55 ? 162 PHE D CB  1 
ATOM   7351  C  CG  . PHE C 1 162 ? 134.869 182.529 121.899 1.00 136.40 ? 162 PHE D CG  1 
ATOM   7352  C  CD1 . PHE C 1 162 ? 134.049 182.784 120.809 1.00 142.28 ? 162 PHE D CD1 1 
ATOM   7353  C  CD2 . PHE C 1 162 ? 136.075 183.214 121.993 1.00 136.00 ? 162 PHE D CD2 1 
ATOM   7354  C  CE1 . PHE C 1 162 ? 134.431 183.703 119.827 1.00 145.01 ? 162 PHE D CE1 1 
ATOM   7355  C  CE2 . PHE C 1 162 ? 136.459 184.128 121.008 1.00 136.66 ? 162 PHE D CE2 1 
ATOM   7356  C  CZ  . PHE C 1 162 ? 135.632 184.369 119.934 1.00 139.25 ? 162 PHE D CZ  1 
ATOM   7357  N  N   . PHE C 1 163 ? 137.098 179.861 123.590 1.00 126.65 ? 163 PHE D N   1 
ATOM   7358  C  CA  . PHE C 1 163 ? 138.552 179.711 123.607 1.00 123.13 ? 163 PHE D CA  1 
ATOM   7359  C  C   . PHE C 1 163 ? 138.959 178.429 122.884 1.00 127.42 ? 163 PHE D C   1 
ATOM   7360  O  O   . PHE C 1 163 ? 139.839 178.473 122.024 1.00 125.56 ? 163 PHE D O   1 
ATOM   7361  C  CB  . PHE C 1 163 ? 139.082 179.711 125.053 1.00 123.51 ? 163 PHE D CB  1 
ATOM   7362  C  CG  . PHE C 1 163 ? 140.587 179.628 125.171 1.00 121.90 ? 163 PHE D CG  1 
ATOM   7363  C  CD1 . PHE C 1 163 ? 141.371 180.773 125.087 1.00 123.06 ? 163 PHE D CD1 1 
ATOM   7364  C  CD2 . PHE C 1 163 ? 141.219 178.407 125.372 1.00 123.42 ? 163 PHE D CD2 1 
ATOM   7365  C  CE1 . PHE C 1 163 ? 142.762 180.695 125.191 1.00 121.71 ? 163 PHE D CE1 1 
ATOM   7366  C  CE2 . PHE C 1 163 ? 142.611 178.330 125.464 1.00 123.94 ? 163 PHE D CE2 1 
ATOM   7367  C  CZ  . PHE C 1 163 ? 143.371 179.474 125.378 1.00 120.39 ? 163 PHE D CZ  1 
ATOM   7368  N  N   . MET C 1 164 ? 138.297 177.303 123.219 1.00 126.45 ? 164 MET D N   1 
ATOM   7369  C  CA  . MET C 1 164 ? 138.552 175.992 122.632 1.00 127.13 ? 164 MET D CA  1 
ATOM   7370  C  C   . MET C 1 164 ? 138.201 175.959 121.149 1.00 131.99 ? 164 MET D C   1 
ATOM   7371  O  O   . MET C 1 164 ? 139.042 175.544 120.356 1.00 130.09 ? 164 MET D O   1 
ATOM   7372  C  CB  . MET C 1 164 ? 137.788 174.887 123.382 1.00 132.47 ? 164 MET D CB  1 
ATOM   7373  C  CG  . MET C 1 164 ? 138.518 174.347 124.603 1.00 135.00 ? 164 MET D CG  1 
ATOM   7374  S  SD  . MET C 1 164 ? 140.275 173.948 124.353 1.00 136.16 ? 164 MET D SD  1 
ATOM   7375  C  CE  . MET C 1 164 ? 140.181 172.611 123.132 1.00 135.01 ? 164 MET D CE  1 
ATOM   7376  N  N   . LYS C 1 165 ? 136.979 176.410 120.772 1.00 131.94 ? 165 LYS D N   1 
ATOM   7377  C  CA  . LYS C 1 165 ? 136.511 176.446 119.381 1.00 134.46 ? 165 LYS D CA  1 
ATOM   7378  C  C   . LYS C 1 165 ? 137.428 177.305 118.512 1.00 135.29 ? 165 LYS D C   1 
ATOM   7379  O  O   . LYS C 1 165 ? 137.701 176.930 117.374 1.00 136.54 ? 165 LYS D O   1 
ATOM   7380  C  CB  . LYS C 1 165 ? 135.068 176.962 119.285 1.00 141.15 ? 165 LYS D CB  1 
ATOM   7381  C  CG  . LYS C 1 165 ? 134.016 175.869 119.340 1.00 162.80 ? 165 LYS D CG  1 
ATOM   7382  C  CD  . LYS C 1 165 ? 132.644 176.415 118.950 1.00 181.84 ? 165 LYS D CD  1 
ATOM   7383  C  CE  . LYS C 1 165 ? 131.508 175.479 119.299 1.00 201.73 ? 165 LYS D CE  1 
ATOM   7384  N  NZ  . LYS C 1 165 ? 131.175 175.510 120.751 1.00 212.15 ? 165 LYS D NZ  1 
ATOM   7385  N  N   . ASP C 1 166 ? 137.925 178.428 119.062 1.00 127.60 ? 166 ASP D N   1 
ATOM   7386  C  CA  . ASP C 1 166 ? 138.825 179.342 118.365 1.00 125.22 ? 166 ASP D CA  1 
ATOM   7387  C  C   . ASP C 1 166 ? 140.219 178.733 118.178 1.00 123.15 ? 166 ASP D C   1 
ATOM   7388  O  O   . ASP C 1 166 ? 140.822 178.930 117.120 1.00 123.34 ? 166 ASP D O   1 
ATOM   7389  C  CB  . ASP C 1 166 ? 138.930 180.672 119.118 1.00 126.19 ? 166 ASP D CB  1 
ATOM   7390  C  CG  . ASP C 1 166 ? 138.818 181.881 118.217 1.00 143.78 ? 166 ASP D CG  1 
ATOM   7391  O  OD1 . ASP C 1 166 ? 137.683 182.193 117.776 1.00 147.92 ? 166 ASP D OD1 1 
ATOM   7392  O  OD2 . ASP C 1 166 ? 139.863 182.521 117.951 1.00 150.52 ? 166 ASP D OD2 1 
ATOM   7393  N  N   . ALA C 1 167 ? 140.726 178.001 119.195 1.00 114.71 ? 167 ALA D N   1 
ATOM   7394  C  CA  . ALA C 1 167 ? 142.040 177.349 119.157 1.00 111.18 ? 167 ALA D CA  1 
ATOM   7395  C  C   . ALA C 1 167 ? 142.118 176.329 118.025 1.00 113.68 ? 167 ALA D C   1 
ATOM   7396  O  O   . ALA C 1 167 ? 143.120 176.301 117.311 1.00 112.45 ? 167 ALA D O   1 
ATOM   7397  C  CB  . ALA C 1 167 ? 142.338 176.675 120.486 1.00 110.58 ? 167 ALA D CB  1 
ATOM   7398  N  N   . ILE C 1 168 ? 141.047 175.519 117.847 1.00 111.02 ? 168 ILE D N   1 
ATOM   7399  C  CA  . ILE C 1 168 ? 140.934 174.506 116.793 1.00 112.56 ? 168 ILE D CA  1 
ATOM   7400  C  C   . ILE C 1 168 ? 140.783 175.229 115.450 1.00 117.30 ? 168 ILE D C   1 
ATOM   7401  O  O   . ILE C 1 168 ? 141.513 174.902 114.514 1.00 117.41 ? 168 ILE D O   1 
ATOM   7402  C  CB  . ILE C 1 168 ? 139.784 173.493 117.060 1.00 118.41 ? 168 ILE D CB  1 
ATOM   7403  C  CG1 . ILE C 1 168 ? 139.889 172.882 118.470 1.00 117.17 ? 168 ILE D CG1 1 
ATOM   7404  C  CG2 . ILE C 1 168 ? 139.777 172.389 116.002 1.00 122.27 ? 168 ILE D CG2 1 
ATOM   7405  C  CD1 . ILE C 1 168 ? 138.575 172.460 119.076 1.00 130.04 ? 168 ILE D CD1 1 
ATOM   7406  N  N   . LYS C 1 169 ? 139.865 176.235 115.378 1.00 114.33 ? 169 LYS D N   1 
ATOM   7407  C  CA  . LYS C 1 169 ? 139.607 177.076 114.201 1.00 116.05 ? 169 LYS D CA  1 
ATOM   7408  C  C   . LYS C 1 169 ? 140.916 177.617 113.632 1.00 117.39 ? 169 LYS D C   1 
ATOM   7409  O  O   . LYS C 1 169 ? 141.200 177.411 112.451 1.00 119.47 ? 169 LYS D O   1 
ATOM   7410  C  CB  . LYS C 1 169 ? 138.679 178.255 114.558 1.00 119.07 ? 169 LYS D CB  1 
ATOM   7411  C  CG  . LYS C 1 169 ? 137.203 178.046 114.231 1.00 139.51 ? 169 LYS D CG  1 
ATOM   7412  C  CD  . LYS C 1 169 ? 136.404 179.367 114.233 1.00 150.68 ? 169 LYS D CD  1 
ATOM   7413  C  CE  . LYS C 1 169 ? 136.009 179.846 115.615 1.00 158.66 ? 169 LYS D CE  1 
ATOM   7414  N  NZ  . LYS C 1 169 ? 135.346 181.175 115.569 1.00 168.46 ? 169 LYS D NZ  1 
ATOM   7415  N  N   . LYS C 1 170 ? 141.731 178.262 114.499 1.00 109.47 ? 170 LYS D N   1 
ATOM   7416  C  CA  . LYS C 1 170 ? 143.023 178.852 114.160 1.00 107.20 ? 170 LYS D CA  1 
ATOM   7417  C  C   . LYS C 1 170 ? 144.028 177.776 113.717 1.00 110.10 ? 170 LYS D C   1 
ATOM   7418  O  O   . LYS C 1 170 ? 144.618 177.918 112.645 1.00 111.00 ? 170 LYS D O   1 
ATOM   7419  C  CB  . LYS C 1 170 ? 143.569 179.676 115.337 1.00 106.12 ? 170 LYS D CB  1 
ATOM   7420  N  N   . PHE C 1 171 ? 144.178 176.687 114.504 1.00 105.21 ? 171 PHE D N   1 
ATOM   7421  C  CA  . PHE C 1 171 ? 145.086 175.578 114.194 1.00 105.43 ? 171 PHE D CA  1 
ATOM   7422  C  C   . PHE C 1 171 ? 144.779 174.973 112.818 1.00 112.53 ? 171 PHE D C   1 
ATOM   7423  O  O   . PHE C 1 171 ? 145.714 174.736 112.058 1.00 113.26 ? 171 PHE D O   1 
ATOM   7424  C  CB  . PHE C 1 171 ? 145.031 174.490 115.284 1.00 106.43 ? 171 PHE D CB  1 
ATOM   7425  C  CG  . PHE C 1 171 ? 145.943 173.304 115.058 1.00 109.25 ? 171 PHE D CG  1 
ATOM   7426  C  CD1 . PHE C 1 171 ? 147.303 173.390 115.326 1.00 111.64 ? 171 PHE D CD1 1 
ATOM   7427  C  CD2 . PHE C 1 171 ? 145.438 172.093 114.602 1.00 114.97 ? 171 PHE D CD2 1 
ATOM   7428  C  CE1 . PHE C 1 171 ? 148.148 172.290 115.114 1.00 114.01 ? 171 PHE D CE1 1 
ATOM   7429  C  CE2 . PHE C 1 171 ? 146.283 170.995 114.389 1.00 119.09 ? 171 PHE D CE2 1 
ATOM   7430  C  CZ  . PHE C 1 171 ? 147.631 171.100 114.648 1.00 115.51 ? 171 PHE D CZ  1 
ATOM   7431  N  N   . VAL C 1 172 ? 143.480 174.756 112.494 1.00 111.10 ? 172 VAL D N   1 
ATOM   7432  C  CA  . VAL C 1 172 ? 143.015 174.189 111.222 1.00 115.21 ? 172 VAL D CA  1 
ATOM   7433  C  C   . VAL C 1 172 ? 143.405 175.120 110.066 1.00 121.48 ? 172 VAL D C   1 
ATOM   7434  O  O   . VAL C 1 172 ? 144.058 174.670 109.126 1.00 123.52 ? 172 VAL D O   1 
ATOM   7435  C  CB  . VAL C 1 172 ? 141.492 173.887 111.247 1.00 121.73 ? 172 VAL D CB  1 
ATOM   7436  C  CG1 . VAL C 1 172 ? 140.923 173.680 109.843 1.00 126.92 ? 172 VAL D CG1 1 
ATOM   7437  C  CG2 . VAL C 1 172 ? 141.198 172.677 112.125 1.00 121.00 ? 172 VAL D CG2 1 
ATOM   7438  N  N   . VAL C 1 173 ? 143.045 176.414 110.173 1.00 117.68 ? 173 VAL D N   1 
ATOM   7439  C  CA  . VAL C 1 173 ? 143.318 177.456 109.179 1.00 119.79 ? 173 VAL D CA  1 
ATOM   7440  C  C   . VAL C 1 173 ? 144.848 177.580 108.941 1.00 122.91 ? 173 VAL D C   1 
ATOM   7441  O  O   . VAL C 1 173 ? 145.265 177.703 107.786 1.00 125.56 ? 173 VAL D O   1 
ATOM   7442  C  CB  . VAL C 1 173 ? 142.648 178.798 109.602 1.00 122.81 ? 173 VAL D CB  1 
ATOM   7443  C  CG1 . VAL C 1 173 ? 143.279 180.007 108.918 1.00 123.44 ? 173 VAL D CG1 1 
ATOM   7444  C  CG2 . VAL C 1 173 ? 141.143 178.764 109.340 1.00 126.16 ? 173 VAL D CG2 1 
ATOM   7445  N  N   . THR C 1 174 ? 145.665 177.482 110.013 1.00 116.01 ? 174 THR D N   1 
ATOM   7446  C  CA  . THR C 1 174 ? 147.129 177.556 109.946 1.00 115.23 ? 174 THR D CA  1 
ATOM   7447  C  C   . THR C 1 174 ? 147.696 176.437 109.070 1.00 123.90 ? 174 THR D C   1 
ATOM   7448  O  O   . THR C 1 174 ? 148.466 176.738 108.160 1.00 126.32 ? 174 THR D O   1 
ATOM   7449  C  CB  . THR C 1 174 ? 147.736 177.511 111.354 1.00 120.93 ? 174 THR D CB  1 
ATOM   7450  O  OG1 . THR C 1 174 ? 147.218 178.608 112.106 1.00 123.13 ? 174 THR D OG1 1 
ATOM   7451  C  CG2 . THR C 1 174 ? 149.270 177.553 111.349 1.00 117.26 ? 174 THR D CG2 1 
ATOM   7452  N  N   . GLN C 1 175 ? 147.308 175.167 109.339 1.00 121.64 ? 175 GLN D N   1 
ATOM   7453  C  CA  . GLN C 1 175 ? 147.758 173.970 108.613 1.00 124.84 ? 175 GLN D CA  1 
ATOM   7454  C  C   . GLN C 1 175 ? 147.400 174.033 107.116 1.00 136.18 ? 175 GLN D C   1 
ATOM   7455  O  O   . GLN C 1 175 ? 148.221 173.656 106.276 1.00 138.59 ? 175 GLN D O   1 
ATOM   7456  C  CB  . GLN C 1 175 ? 147.167 172.692 109.238 1.00 125.81 ? 175 GLN D CB  1 
ATOM   7457  C  CG  . GLN C 1 175 ? 147.441 172.494 110.732 1.00 135.51 ? 175 GLN D CG  1 
ATOM   7458  C  CD  . GLN C 1 175 ? 148.866 172.136 111.056 1.00 154.66 ? 175 GLN D CD  1 
ATOM   7459  O  OE1 . GLN C 1 175 ? 149.251 170.961 111.080 1.00 151.26 ? 175 GLN D OE1 1 
ATOM   7460  N  NE2 . GLN C 1 175 ? 149.666 173.141 111.368 1.00 146.60 ? 175 GLN D NE2 1 
ATOM   7461  N  N   . CYS C 1 176 ? 146.193 174.546 106.790 1.00 136.21 ? 176 CYS D N   1 
ATOM   7462  C  CA  . CYS C 1 176 ? 145.673 174.701 105.428 1.00 142.43 ? 176 CYS D CA  1 
ATOM   7463  C  C   . CYS C 1 176 ? 146.438 175.774 104.626 1.00 148.42 ? 176 CYS D C   1 
ATOM   7464  O  O   . CYS C 1 176 ? 146.323 175.811 103.402 1.00 153.39 ? 176 CYS D O   1 
ATOM   7465  C  CB  . CYS C 1 176 ? 144.179 175.001 105.466 1.00 144.72 ? 176 CYS D CB  1 
ATOM   7466  S  SG  . CYS C 1 176 ? 143.168 173.629 106.080 1.00 149.25 ? 176 CYS D SG  1 
ATOM   7467  N  N   . ILE C 1 177 ? 147.199 176.642 105.310 1.00 141.17 ? 177 ILE D N   1 
ATOM   7468  C  CA  . ILE C 1 177 ? 148.021 177.680 104.690 1.00 142.34 ? 177 ILE D CA  1 
ATOM   7469  C  C   . ILE C 1 177 ? 149.477 177.175 104.673 1.00 145.86 ? 177 ILE D C   1 
ATOM   7470  O  O   . ILE C 1 177 ? 150.147 177.279 103.648 1.00 148.84 ? 177 ILE D O   1 
ATOM   7471  C  CB  . ILE C 1 177 ? 147.850 179.054 105.417 1.00 142.10 ? 177 ILE D CB  1 
ATOM   7472  C  CG1 . ILE C 1 177 ? 146.405 179.594 105.253 1.00 144.15 ? 177 ILE D CG1 1 
ATOM   7473  C  CG2 . ILE C 1 177 ? 148.880 180.092 104.928 1.00 143.89 ? 177 ILE D CG2 1 
ATOM   7474  C  CD1 . ILE C 1 177 ? 145.970 180.658 106.278 1.00 147.53 ? 177 ILE D CD1 1 
ATOM   7475  N  N   . LEU C 1 178 ? 149.934 176.601 105.803 1.00 138.92 ? 178 LEU D N   1 
ATOM   7476  C  CA  . LEU C 1 178 ? 151.279 176.071 106.027 1.00 138.26 ? 178 LEU D CA  1 
ATOM   7477  C  C   . LEU C 1 178 ? 151.662 175.000 104.997 1.00 148.29 ? 178 LEU D C   1 
ATOM   7478  O  O   . LEU C 1 178 ? 152.604 175.217 104.237 1.00 151.18 ? 178 LEU D O   1 
ATOM   7479  C  CB  . LEU C 1 178 ? 151.367 175.494 107.459 1.00 133.39 ? 178 LEU D CB  1 
ATOM   7480  C  CG  . LEU C 1 178 ? 152.700 174.933 107.935 1.00 136.77 ? 178 LEU D CG  1 
ATOM   7481  C  CD1 . LEU C 1 178 ? 153.621 176.039 108.390 1.00 135.13 ? 178 LEU D CD1 1 
ATOM   7482  C  CD2 . LEU C 1 178 ? 152.493 173.945 109.069 1.00 135.96 ? 178 LEU D CD2 1 
ATOM   7483  N  N   . LEU C 1 179 ? 150.932 173.866 104.971 1.00 146.54 ? 179 LEU D N   1 
ATOM   7484  C  CA  . LEU C 1 179 ? 151.198 172.707 104.110 1.00 151.01 ? 179 LEU D CA  1 
ATOM   7485  C  C   . LEU C 1 179 ? 151.349 173.040 102.601 1.00 161.84 ? 179 LEU D C   1 
ATOM   7486  O  O   . LEU C 1 179 ? 152.374 172.638 102.044 1.00 163.95 ? 179 LEU D O   1 
ATOM   7487  C  CB  . LEU C 1 179 ? 150.138 171.615 104.311 1.00 151.55 ? 179 LEU D CB  1 
ATOM   7488  C  CG  . LEU C 1 179 ? 150.505 170.521 105.308 1.00 153.32 ? 179 LEU D CG  1 
ATOM   7489  C  CD1 . LEU C 1 179 ? 150.535 171.049 106.739 1.00 147.62 ? 179 LEU D CD1 1 
ATOM   7490  C  CD2 . LEU C 1 179 ? 149.545 169.366 105.207 1.00 158.17 ? 179 LEU D CD2 1 
ATOM   7491  N  N   . PRO C 1 180 ? 150.424 173.770 101.916 1.00 161.82 ? 180 PRO D N   1 
ATOM   7492  C  CA  . PRO C 1 180 ? 150.638 174.043 100.481 1.00 168.04 ? 180 PRO D CA  1 
ATOM   7493  C  C   . PRO C 1 180 ? 151.814 174.987 100.216 1.00 171.74 ? 180 PRO D C   1 
ATOM   7494  O  O   . PRO C 1 180 ? 152.549 174.760 99.257  1.00 176.20 ? 180 PRO D O   1 
ATOM   7495  C  CB  . PRO C 1 180 ? 149.312 174.664 100.027 1.00 172.27 ? 180 PRO D CB  1 
ATOM   7496  C  CG  . PRO C 1 180 ? 148.331 174.336 101.112 1.00 172.56 ? 180 PRO D CG  1 
ATOM   7497  C  CD  . PRO C 1 180 ? 149.139 174.341 102.365 1.00 161.73 ? 180 PRO D CD  1 
ATOM   7498  N  N   . VAL C 1 181 ? 152.006 176.020 101.067 1.00 163.35 ? 181 VAL D N   1 
ATOM   7499  C  CA  . VAL C 1 181 ? 153.098 176.998 100.950 1.00 163.28 ? 181 VAL D CA  1 
ATOM   7500  C  C   . VAL C 1 181 ? 154.447 176.285 101.170 1.00 166.38 ? 181 VAL D C   1 
ATOM   7501  O  O   . VAL C 1 181 ? 155.377 176.497 100.386 1.00 170.05 ? 181 VAL D O   1 
ATOM   7502  C  CB  . VAL C 1 181 ? 152.895 178.210 101.908 1.00 162.40 ? 181 VAL D CB  1 
ATOM   7503  C  CG1 . VAL C 1 181 ? 154.173 179.035 102.078 1.00 161.70 ? 181 VAL D CG1 1 
ATOM   7504  C  CG2 . VAL C 1 181 ? 151.751 179.099 101.425 1.00 164.20 ? 181 VAL D CG2 1 
ATOM   7505  N  N   . SER C 1 182 ? 154.526 175.413 102.199 1.00 158.43 ? 182 SER D N   1 
ATOM   7506  C  CA  . SER C 1 182 ? 155.729 174.646 102.536 1.00 157.82 ? 182 SER D CA  1 
ATOM   7507  C  C   . SER C 1 182 ? 156.091 173.650 101.440 1.00 167.17 ? 182 SER D C   1 
ATOM   7508  O  O   . SER C 1 182 ? 157.263 173.577 101.072 1.00 169.38 ? 182 SER D O   1 
ATOM   7509  C  CB  . SER C 1 182 ? 155.557 173.915 103.861 1.00 156.22 ? 182 SER D CB  1 
ATOM   7510  O  OG  . SER C 1 182 ? 155.322 174.834 104.915 1.00 160.29 ? 182 SER D OG  1 
ATOM   7511  N  N   . SER C 1 183 ? 155.092 172.909 100.904 1.00 166.12 ? 183 SER D N   1 
ATOM   7512  C  CA  . SER C 1 183 ? 155.291 171.921 99.837  1.00 172.02 ? 183 SER D CA  1 
ATOM   7513  C  C   . SER C 1 183 ? 155.846 172.574 98.561  1.00 181.42 ? 183 SER D C   1 
ATOM   7514  O  O   . SER C 1 183 ? 156.786 172.037 97.974  1.00 185.40 ? 183 SER D O   1 
ATOM   7515  C  CB  . SER C 1 183 ? 153.993 171.181 99.528  1.00 177.57 ? 183 SER D CB  1 
ATOM   7516  O  OG  . SER C 1 183 ? 152.978 172.068 99.090  1.00 188.06 ? 183 SER D OG  1 
ATOM   7517  N  N   . LEU C 1 184 ? 155.292 173.740 98.160  1.00 177.90 ? 184 LEU D N   1 
ATOM   7518  C  CA  . LEU C 1 184 ? 155.734 174.475 96.974  1.00 183.41 ? 184 LEU D CA  1 
ATOM   7519  C  C   . LEU C 1 184 ? 157.120 175.091 97.183  1.00 185.85 ? 184 LEU D C   1 
ATOM   7520  O  O   . LEU C 1 184 ? 157.926 175.053 96.254  1.00 186.53 ? 184 LEU D O   1 
ATOM   7521  C  CB  . LEU C 1 184 ? 154.724 175.559 96.574  1.00 184.25 ? 184 LEU D CB  1 
ATOM   7522  C  CG  . LEU C 1 184 ? 153.446 175.089 95.877  1.00 189.00 ? 184 LEU D CG  1 
ATOM   7523  C  CD1 . LEU C 1 184 ? 152.341 176.105 96.039  1.00 188.87 ? 184 LEU D CD1 1 
ATOM   7524  C  CD2 . LEU C 1 184 ? 153.680 174.830 94.401  1.00 192.64 ? 184 LEU D CD2 1 
ATOM   7525  N  N   . LEU C 1 185 ? 157.409 175.633 98.394  1.00 178.09 ? 185 LEU D N   1 
ATOM   7526  C  CA  . LEU C 1 185 ? 158.715 176.227 98.718  1.00 177.84 ? 185 LEU D CA  1 
ATOM   7527  C  C   . LEU C 1 185 ? 159.818 175.162 98.674  1.00 185.42 ? 185 LEU D C   1 
ATOM   7528  O  O   . LEU C 1 185 ? 160.863 175.411 98.071  1.00 186.11 ? 185 LEU D O   1 
ATOM   7529  C  CB  . LEU C 1 185 ? 158.714 176.944 100.085 1.00 170.59 ? 185 LEU D CB  1 
ATOM   7530  C  CG  . LEU C 1 185 ? 160.062 177.535 100.544 1.00 174.61 ? 185 LEU D CG  1 
ATOM   7531  C  CD1 . LEU C 1 185 ? 160.306 178.913 99.947  1.00 177.83 ? 185 LEU D CD1 1 
ATOM   7532  C  CD2 . LEU C 1 185 ? 160.151 177.582 102.048 1.00 170.22 ? 185 LEU D CD2 1 
ATOM   7533  N  N   . LEU C 1 186 ? 159.575 173.977 99.285  1.00 180.11 ? 186 LEU D N   1 
ATOM   7534  C  CA  . LEU C 1 186 ? 160.518 172.849 99.291  1.00 182.37 ? 186 LEU D CA  1 
ATOM   7535  C  C   . LEU C 1 186 ? 160.783 172.351 97.863  1.00 189.13 ? 186 LEU D C   1 
ATOM   7536  O  O   . LEU C 1 186 ? 161.915 171.974 97.546  1.00 189.64 ? 186 LEU D O   1 
ATOM   7537  C  CB  . LEU C 1 186 ? 159.997 171.692 100.163 1.00 178.19 ? 186 LEU D CB  1 
ATOM   7538  C  CG  . LEU C 1 186 ? 160.091 171.866 101.680 1.00 175.58 ? 186 LEU D CG  1 
ATOM   7539  C  CD1 . LEU C 1 186 ? 159.020 171.061 102.380 1.00 171.97 ? 186 LEU D CD1 1 
ATOM   7540  C  CD2 . LEU C 1 186 ? 161.449 171.460 102.201 1.00 177.49 ? 186 LEU D CD2 1 
ATOM   7541  N  N   . TYR C 1 187 ? 159.739 172.381 97.003  1.00 188.15 ? 187 TYR D N   1 
ATOM   7542  C  CA  . TYR C 1 187 ? 159.784 171.982 95.596  1.00 190.20 ? 187 TYR D CA  1 
ATOM   7543  C  C   . TYR C 1 187 ? 160.745 172.885 94.813  1.00 192.56 ? 187 TYR D C   1 
ATOM   7544  O  O   . TYR C 1 187 ? 161.578 172.373 94.074  1.00 193.56 ? 187 TYR D O   1 
ATOM   7545  C  CB  . TYR C 1 187 ? 158.365 172.029 94.993  1.00 192.42 ? 187 TYR D CB  1 
ATOM   7546  C  CG  . TYR C 1 187 ? 158.274 171.618 93.541  1.00 196.51 ? 187 TYR D CG  1 
ATOM   7547  C  CD1 . TYR C 1 187 ? 158.159 170.279 93.182  1.00 199.55 ? 187 TYR D CD1 1 
ATOM   7548  C  CD2 . TYR C 1 187 ? 158.252 172.571 92.526  1.00 198.14 ? 187 TYR D CD2 1 
ATOM   7549  C  CE1 . TYR C 1 187 ? 158.062 169.894 91.845  1.00 203.11 ? 187 TYR D CE1 1 
ATOM   7550  C  CE2 . TYR C 1 187 ? 158.163 172.198 91.185  1.00 201.32 ? 187 TYR D CE2 1 
ATOM   7551  C  CZ  . TYR C 1 187 ? 158.067 170.857 90.849  1.00 208.88 ? 187 TYR D CZ  1 
ATOM   7552  O  OH  . TYR C 1 187 ? 157.973 170.475 89.531  1.00 212.92 ? 187 TYR D OH  1 
ATOM   7553  N  N   . ILE C 1 188 ? 160.647 174.216 95.007  1.00 188.85 ? 188 ILE D N   1 
ATOM   7554  C  CA  . ILE C 1 188 ? 161.469 175.229 94.337  1.00 189.05 ? 188 ILE D CA  1 
ATOM   7555  C  C   . ILE C 1 188 ? 162.960 175.071 94.716  1.00 191.44 ? 188 ILE D C   1 
ATOM   7556  O  O   . ILE C 1 188 ? 163.813 175.181 93.836  1.00 192.51 ? 188 ILE D O   1 
ATOM   7557  C  CB  . ILE C 1 188 ? 160.917 176.656 94.637  1.00 190.00 ? 188 ILE D CB  1 
ATOM   7558  C  CG1 . ILE C 1 188 ? 159.597 176.888 93.868  1.00 191.33 ? 188 ILE D CG1 1 
ATOM   7559  C  CG2 . ILE C 1 188 ? 161.933 177.760 94.302  1.00 190.55 ? 188 ILE D CG2 1 
ATOM   7560  C  CD1 . ILE C 1 188 ? 158.643 177.864 94.495  1.00 195.34 ? 188 ILE D CD1 1 
ATOM   7561  N  N   . ILE C 1 189 ? 163.264 174.791 95.998  1.00 187.77 ? 189 ILE D N   1 
ATOM   7562  C  CA  . ILE C 1 189 ? 164.643 174.628 96.481  1.00 187.48 ? 189 ILE D CA  1 
ATOM   7563  C  C   . ILE C 1 189 ? 165.260 173.324 95.911  1.00 192.11 ? 189 ILE D C   1 
ATOM   7564  O  O   . ILE C 1 189 ? 166.388 173.357 95.410  1.00 192.52 ? 189 ILE D O   1 
ATOM   7565  C  CB  . ILE C 1 189 ? 164.713 174.694 98.042  1.00 187.52 ? 189 ILE D CB  1 
ATOM   7566  C  CG1 . ILE C 1 189 ? 164.179 176.051 98.558  1.00 186.74 ? 189 ILE D CG1 1 
ATOM   7567  C  CG2 . ILE C 1 189 ? 166.143 174.456 98.563  1.00 187.73 ? 189 ILE D CG2 1 
ATOM   7568  C  CD1 . ILE C 1 189 ? 163.623 176.041 99.987  1.00 190.60 ? 189 ILE D CD1 1 
ATOM   7569  N  N   . LYS C 1 190 ? 164.510 172.205 95.962  1.00 190.94 ? 190 LYS D N   1 
ATOM   7570  C  CA  . LYS C 1 190 ? 164.957 170.893 95.486  1.00 192.59 ? 190 LYS D CA  1 
ATOM   7571  C  C   . LYS C 1 190 ? 165.078 170.823 93.949  1.00 198.88 ? 190 LYS D C   1 
ATOM   7572  O  O   . LYS C 1 190 ? 166.080 170.304 93.453  1.00 199.73 ? 190 LYS D O   1 
ATOM   7573  C  CB  . LYS C 1 190 ? 164.019 169.783 95.993  1.00 193.84 ? 190 LYS D CB  1 
ATOM   7574  C  CG  . LYS C 1 190 ? 164.256 169.388 97.448  1.00 199.47 ? 190 LYS D CG  1 
ATOM   7575  N  N   . ILE C 1 191 ? 164.073 171.334 93.204  1.00 198.55 ? 191 ILE D N   1 
ATOM   7576  C  CA  . ILE C 1 191 ? 164.054 171.291 91.736  1.00 201.38 ? 191 ILE D CA  1 
ATOM   7577  C  C   . ILE C 1 191 ? 164.975 172.378 91.147  1.00 205.92 ? 191 ILE D C   1 
ATOM   7578  O  O   . ILE C 1 191 ? 165.876 172.042 90.377  1.00 207.21 ? 191 ILE D O   1 
ATOM   7579  C  CB  . ILE C 1 191 ? 162.597 171.372 91.171  1.00 204.37 ? 191 ILE D CB  1 
ATOM   7580  C  CG1 . ILE C 1 191 ? 161.723 170.149 91.598  1.00 204.90 ? 191 ILE D CG1 1 
ATOM   7581  C  CG2 . ILE C 1 191 ? 162.547 171.618 89.652  1.00 207.33 ? 191 ILE D CG2 1 
ATOM   7582  C  CD1 . ILE C 1 191 ? 162.159 168.698 91.115  1.00 212.31 ? 191 ILE D CD1 1 
ATOM   7583  N  N   . GLY C 1 192 ? 164.730 173.643 91.502  1.00 203.71 ? 192 GLY D N   1 
ATOM   7584  C  CA  . GLY C 1 192 ? 165.492 174.795 91.018  1.00 204.62 ? 192 GLY D CA  1 
ATOM   7585  C  C   . GLY C 1 192 ? 166.955 174.809 91.420  1.00 208.21 ? 192 GLY D C   1 
ATOM   7586  O  O   . GLY C 1 192 ? 167.346 174.154 92.392  1.00 207.02 ? 192 GLY D O   1 
ATOM   7587  N  N   . GLY C 1 193 ? 167.757 175.555 90.663  1.00 207.72 ? 193 GLY D N   1 
ATOM   7588  C  CA  . GLY C 1 193 ? 169.192 175.678 90.891  1.00 208.06 ? 193 GLY D CA  1 
ATOM   7589  C  C   . GLY C 1 193 ? 169.968 176.158 89.675  1.00 213.88 ? 193 GLY D C   1 
ATOM   7590  O  O   . GLY C 1 193 ? 169.425 176.160 88.568  1.00 215.36 ? 193 GLY D O   1 
ATOM   7591  N  N   . ASP C 1 194 ? 171.247 176.577 89.840  1.00 212.47 ? 194 ASP D N   1 
ATOM   7592  C  CA  . ASP C 1 194 ? 172.003 176.619 91.100  1.00 210.93 ? 194 ASP D CA  1 
ATOM   7593  C  C   . ASP C 1 194 ? 171.669 177.882 91.920  1.00 211.73 ? 194 ASP D C   1 
ATOM   7594  O  O   . ASP C 1 194 ? 172.094 178.002 93.073  1.00 210.03 ? 194 ASP D O   1 
ATOM   7595  C  CB  . ASP C 1 194 ? 173.513 176.545 90.813  1.00 213.65 ? 194 ASP D CB  1 
ATOM   7596  N  N   . TYR C 1 195 ? 170.884 178.798 91.325  1.00 209.53 ? 195 TYR D N   1 
ATOM   7597  C  CA  . TYR C 1 195 ? 170.443 180.050 91.934  1.00 208.00 ? 195 TYR D CA  1 
ATOM   7598  C  C   . TYR C 1 195 ? 168.979 179.915 92.405  1.00 209.57 ? 195 TYR D C   1 
ATOM   7599  O  O   . TYR C 1 195 ? 168.146 180.792 92.153  1.00 209.20 ? 195 TYR D O   1 
ATOM   7600  C  CB  . TYR C 1 195 ? 170.635 181.208 90.938  1.00 210.09 ? 195 TYR D CB  1 
ATOM   7601  C  CG  . TYR C 1 195 ? 172.088 181.452 90.585  1.00 212.29 ? 195 TYR D CG  1 
ATOM   7602  C  CD1 . TYR C 1 195 ? 172.914 182.199 91.420  1.00 212.85 ? 195 TYR D CD1 1 
ATOM   7603  C  CD2 . TYR C 1 195 ? 172.640 180.928 89.420  1.00 214.91 ? 195 TYR D CD2 1 
ATOM   7604  C  CE1 . TYR C 1 195 ? 174.255 182.418 91.106  1.00 214.74 ? 195 TYR D CE1 1 
ATOM   7605  C  CE2 . TYR C 1 195 ? 173.980 181.143 89.093  1.00 216.91 ? 195 TYR D CE2 1 
ATOM   7606  C  CZ  . TYR C 1 195 ? 174.784 181.887 89.941  1.00 220.62 ? 195 TYR D CZ  1 
ATOM   7607  O  OH  . TYR C 1 195 ? 176.104 182.106 89.626  1.00 222.14 ? 195 TYR D OH  1 
ATOM   7608  N  N   . PHE C 1 196 ? 168.693 178.809 93.128  1.00 206.59 ? 196 PHE D N   1 
ATOM   7609  C  CA  . PHE C 1 196 ? 167.379 178.438 93.668  1.00 205.35 ? 196 PHE D CA  1 
ATOM   7610  C  C   . PHE C 1 196 ? 166.836 179.436 94.696  1.00 205.99 ? 196 PHE D C   1 
ATOM   7611  O  O   . PHE C 1 196 ? 165.620 179.536 94.853  1.00 205.16 ? 196 PHE D O   1 
ATOM   7612  C  CB  . PHE C 1 196 ? 167.429 177.032 94.305  1.00 206.02 ? 196 PHE D CB  1 
ATOM   7613  C  CG  . PHE C 1 196 ? 168.365 176.874 95.485  1.00 205.94 ? 196 PHE D CG  1 
ATOM   7614  C  CD1 . PHE C 1 196 ? 167.929 177.131 96.781  1.00 206.18 ? 196 PHE D CD1 1 
ATOM   7615  C  CD2 . PHE C 1 196 ? 169.675 176.446 95.302  1.00 208.40 ? 196 PHE D CD2 1 
ATOM   7616  C  CE1 . PHE C 1 196 ? 168.796 176.998 97.869  1.00 205.86 ? 196 PHE D CE1 1 
ATOM   7617  C  CE2 . PHE C 1 196 ? 170.540 176.306 96.393  1.00 209.39 ? 196 PHE D CE2 1 
ATOM   7618  C  CZ  . PHE C 1 196 ? 170.093 176.577 97.669  1.00 206.23 ? 196 PHE D CZ  1 
ATOM   7619  N  N   . PHE C 1 197 ? 167.725 180.142 95.410  1.00 202.68 ? 197 PHE D N   1 
ATOM   7620  C  CA  . PHE C 1 197 ? 167.358 181.087 96.460  1.00 200.78 ? 197 PHE D CA  1 
ATOM   7621  C  C   . PHE C 1 197 ? 166.580 182.299 95.930  1.00 203.24 ? 197 PHE D C   1 
ATOM   7622  O  O   . PHE C 1 197 ? 165.761 182.836 96.671  1.00 201.75 ? 197 PHE D O   1 
ATOM   7623  C  CB  . PHE C 1 197 ? 168.601 181.540 97.241  1.00 201.57 ? 197 PHE D CB  1 
ATOM   7624  C  CG  . PHE C 1 197 ? 169.628 182.355 96.491  1.00 204.11 ? 197 PHE D CG  1 
ATOM   7625  C  CD1 . PHE C 1 197 ? 170.553 181.741 95.653  1.00 207.75 ? 197 PHE D CD1 1 
ATOM   7626  C  CD2 . PHE C 1 197 ? 169.717 183.729 96.675  1.00 205.54 ? 197 PHE D CD2 1 
ATOM   7627  C  CE1 . PHE C 1 197 ? 171.517 182.493 94.980  1.00 209.94 ? 197 PHE D CE1 1 
ATOM   7628  C  CE2 . PHE C 1 197 ? 170.689 184.480 96.012  1.00 208.98 ? 197 PHE D CE2 1 
ATOM   7629  C  CZ  . PHE C 1 197 ? 171.582 183.857 95.168  1.00 209.31 ? 197 PHE D CZ  1 
ATOM   7630  N  N   . ILE C 1 198 ? 166.811 182.707 94.661  1.00 202.25 ? 198 ILE D N   1 
ATOM   7631  C  CA  . ILE C 1 198 ? 166.137 183.853 94.033  1.00 202.56 ? 198 ILE D CA  1 
ATOM   7632  C  C   . ILE C 1 198 ? 164.670 183.498 93.720  1.00 204.90 ? 198 ILE D C   1 
ATOM   7633  O  O   . ILE C 1 198 ? 163.791 184.326 93.977  1.00 204.04 ? 198 ILE D O   1 
ATOM   7634  C  CB  . ILE C 1 198 ? 166.916 184.359 92.788  1.00 206.62 ? 198 ILE D CB  1 
ATOM   7635  C  CG1 . ILE C 1 198 ? 168.305 184.880 93.207  1.00 206.95 ? 198 ILE D CG1 1 
ATOM   7636  C  CG2 . ILE C 1 198 ? 166.144 185.457 92.033  1.00 208.01 ? 198 ILE D CG2 1 
ATOM   7637  C  CD1 . ILE C 1 198 ? 169.415 184.536 92.271  1.00 214.35 ? 198 ILE D CD1 1 
ATOM   7638  N  N   . TYR C 1 199 ? 164.403 182.278 93.199  1.00 203.15 ? 199 TYR D N   1 
ATOM   7639  C  CA  . TYR C 1 199 ? 163.033 181.835 92.906  1.00 203.18 ? 199 TYR D CA  1 
ATOM   7640  C  C   . TYR C 1 199 ? 162.274 181.554 94.217  1.00 202.96 ? 199 TYR D C   1 
ATOM   7641  O  O   . TYR C 1 199 ? 161.075 181.832 94.295  1.00 202.58 ? 199 TYR D O   1 
ATOM   7642  C  CB  . TYR C 1 199 ? 162.986 180.597 91.980  1.00 205.74 ? 199 TYR D CB  1 
ATOM   7643  C  CG  . TYR C 1 199 ? 164.155 180.430 91.030  1.00 209.12 ? 199 TYR D CG  1 
ATOM   7644  C  CD1 . TYR C 1 199 ? 164.363 181.325 89.982  1.00 212.29 ? 199 TYR D CD1 1 
ATOM   7645  C  CD2 . TYR C 1 199 ? 165.000 179.329 91.123  1.00 209.95 ? 199 TYR D CD2 1 
ATOM   7646  C  CE1 . TYR C 1 199 ? 165.427 181.164 89.092  1.00 214.85 ? 199 TYR D CE1 1 
ATOM   7647  C  CE2 . TYR C 1 199 ? 166.061 179.151 90.234  1.00 212.39 ? 199 TYR D CE2 1 
ATOM   7648  C  CZ  . TYR C 1 199 ? 166.274 180.075 89.221  1.00 219.04 ? 199 TYR D CZ  1 
ATOM   7649  O  OH  . TYR C 1 199 ? 167.319 179.910 88.341  1.00 220.84 ? 199 TYR D OH  1 
ATOM   7650  N  N   . ALA C 1 200 ? 162.984 181.032 95.248  1.00 198.38 ? 200 ALA D N   1 
ATOM   7651  C  CA  . ALA C 1 200 ? 162.435 180.736 96.578  1.00 195.90 ? 200 ALA D CA  1 
ATOM   7652  C  C   . ALA C 1 200 ? 162.101 182.026 97.337  1.00 196.01 ? 200 ALA D C   1 
ATOM   7653  O  O   . ALA C 1 200 ? 161.138 182.052 98.105  1.00 194.61 ? 200 ALA D O   1 
ATOM   7654  C  CB  . ALA C 1 200 ? 163.417 179.895 97.378  1.00 195.58 ? 200 ALA D CB  1 
ATOM   7655  N  N   . TRP C 1 201 ? 162.895 183.092 97.112  1.00 193.05 ? 201 TRP D N   1 
ATOM   7656  C  CA  . TRP C 1 201 ? 162.693 184.413 97.708  1.00 191.68 ? 201 TRP D CA  1 
ATOM   7657  C  C   . TRP C 1 201 ? 161.528 185.118 97.006  1.00 193.51 ? 201 TRP D C   1 
ATOM   7658  O  O   . TRP C 1 201 ? 160.722 185.770 97.674  1.00 192.68 ? 201 TRP D O   1 
ATOM   7659  C  CB  . TRP C 1 201 ? 163.983 185.251 97.630  1.00 191.29 ? 201 TRP D CB  1 
ATOM   7660  C  CG  . TRP C 1 201 ? 163.788 186.719 97.859  1.00 191.81 ? 201 TRP D CG  1 
ATOM   7661  C  CD1 . TRP C 1 201 ? 163.492 187.332 99.039  1.00 192.43 ? 201 TRP D CD1 1 
ATOM   7662  C  CD2 . TRP C 1 201 ? 163.853 187.754 96.872  1.00 193.11 ? 201 TRP D CD2 1 
ATOM   7663  N  NE1 . TRP C 1 201 ? 163.384 188.690 98.854  1.00 192.62 ? 201 TRP D NE1 1 
ATOM   7664  C  CE2 . TRP C 1 201 ? 163.601 188.978 97.532  1.00 195.23 ? 201 TRP D CE2 1 
ATOM   7665  C  CE3 . TRP C 1 201 ? 164.106 187.770 95.491  1.00 195.76 ? 201 TRP D CE3 1 
ATOM   7666  C  CZ2 . TRP C 1 201 ? 163.600 190.204 96.859  1.00 196.01 ? 201 TRP D CZ2 1 
ATOM   7667  C  CZ3 . TRP C 1 201 ? 164.103 188.985 94.826  1.00 197.97 ? 201 TRP D CZ3 1 
ATOM   7668  C  CH2 . TRP C 1 201 ? 163.846 190.183 95.506  1.00 197.85 ? 201 TRP D CH2 1 
ATOM   7669  N  N   . LEU C 1 202 ? 161.440 184.978 95.662  1.00 191.14 ? 202 LEU D N   1 
ATOM   7670  C  CA  . LEU C 1 202 ? 160.370 185.564 94.857  1.00 191.18 ? 202 LEU D CA  1 
ATOM   7671  C  C   . LEU C 1 202 ? 159.036 184.863 95.141  1.00 191.73 ? 202 LEU D C   1 
ATOM   7672  O  O   . LEU C 1 202 ? 157.994 185.510 95.052  1.00 191.72 ? 202 LEU D O   1 
ATOM   7673  C  CB  . LEU C 1 202 ? 160.705 185.503 93.365  1.00 193.22 ? 202 LEU D CB  1 
ATOM   7674  C  CG  . LEU C 1 202 ? 160.081 186.603 92.522  1.00 197.59 ? 202 LEU D CG  1 
ATOM   7675  N  N   . PHE C 1 203 ? 159.071 183.555 95.501  1.00 187.59 ? 203 PHE D N   1 
ATOM   7676  C  CA  . PHE C 1 203 ? 157.875 182.781 95.852  1.00 186.56 ? 203 PHE D CA  1 
ATOM   7677  C  C   . PHE C 1 203 ? 157.300 183.300 97.166  1.00 187.68 ? 203 PHE D C   1 
ATOM   7678  O  O   . PHE C 1 203 ? 156.094 183.531 97.243  1.00 187.57 ? 203 PHE D O   1 
ATOM   7679  C  CB  . PHE C 1 203 ? 158.177 181.273 95.938  1.00 187.38 ? 203 PHE D CB  1 
ATOM   7680  C  CG  . PHE C 1 203 ? 157.075 180.431 96.546  1.00 187.50 ? 203 PHE D CG  1 
ATOM   7681  C  CD1 . PHE C 1 203 ? 155.906 180.170 95.841  1.00 190.46 ? 203 PHE D CD1 1 
ATOM   7682  C  CD2 . PHE C 1 203 ? 157.212 179.891 97.819  1.00 187.14 ? 203 PHE D CD2 1 
ATOM   7683  C  CE1 . PHE C 1 203 ? 154.888 179.395 96.404  1.00 190.71 ? 203 PHE D CE1 1 
ATOM   7684  C  CE2 . PHE C 1 203 ? 156.193 179.118 98.383  1.00 186.99 ? 203 PHE D CE2 1 
ATOM   7685  C  CZ  . PHE C 1 203 ? 155.038 178.878 97.673  1.00 187.97 ? 203 PHE D CZ  1 
ATOM   7686  N  N   . THR C 1 204 ? 158.171 183.506 98.184  1.00 184.19 ? 204 THR D N   1 
ATOM   7687  C  CA  . THR C 1 204 ? 157.791 184.040 99.499  1.00 177.99 ? 204 THR D CA  1 
ATOM   7688  C  C   . THR C 1 204 ? 157.311 185.490 99.355  1.00 182.73 ? 204 THR D C   1 
ATOM   7689  O  O   . THR C 1 204 ? 156.418 185.900 100.091 1.00 177.59 ? 204 THR D O   1 
ATOM   7690  C  CB  . THR C 1 204 ? 158.936 183.922 100.516 1.00 182.80 ? 204 THR D CB  1 
ATOM   7691  O  OG1 . THR C 1 204 ? 160.110 184.549 100.000 1.00 187.97 ? 204 THR D OG1 1 
ATOM   7692  C  CG2 . THR C 1 204 ? 159.229 182.481 100.907 1.00 179.00 ? 204 THR D CG2 1 
ATOM   7693  N  N   . LEU C 1 205 ? 157.875 186.240 98.382  1.00 184.54 ? 205 LEU D N   1 
ATOM   7694  C  CA  . LEU C 1 205 ? 157.506 187.621 98.060  1.00 185.10 ? 205 LEU D CA  1 
ATOM   7695  C  C   . LEU C 1 205 ? 156.055 187.681 97.547  1.00 188.69 ? 205 LEU D C   1 
ATOM   7696  O  O   . LEU C 1 205 ? 155.312 188.586 97.936  1.00 188.51 ? 205 LEU D O   1 
ATOM   7697  C  CB  . LEU C 1 205 ? 158.478 188.191 97.011  1.00 186.47 ? 205 LEU D CB  1 
ATOM   7698  C  CG  . LEU C 1 205 ? 158.510 189.705 96.845  1.00 190.14 ? 205 LEU D CG  1 
ATOM   7699  C  CD1 . LEU C 1 205 ? 159.927 190.192 96.685  1.00 190.67 ? 205 LEU D CD1 1 
ATOM   7700  C  CD2 . LEU C 1 205 ? 157.681 190.145 95.653  1.00 193.53 ? 205 LEU D CD2 1 
ATOM   7701  N  N   . VAL C 1 206 ? 155.659 186.714 96.685  1.00 187.06 ? 206 VAL D N   1 
ATOM   7702  C  CA  . VAL C 1 206 ? 154.308 186.609 96.121  1.00 187.76 ? 206 VAL D CA  1 
ATOM   7703  C  C   . VAL C 1 206 ? 153.339 186.148 97.219  1.00 189.41 ? 206 VAL D C   1 
ATOM   7704  O  O   . VAL C 1 206 ? 152.316 186.798 97.432  1.00 189.29 ? 206 VAL D O   1 
ATOM   7705  C  CB  . VAL C 1 206 ? 154.264 185.684 94.876  1.00 191.76 ? 206 VAL D CB  1 
ATOM   7706  C  CG1 . VAL C 1 206 ? 152.828 185.397 94.438  1.00 192.63 ? 206 VAL D CG1 1 
ATOM   7707  C  CG2 . VAL C 1 206 ? 155.061 186.283 93.724  1.00 193.13 ? 206 VAL D CG2 1 
ATOM   7708  N  N   . VAL C 1 207 ? 153.689 185.055 97.934  1.00 184.45 ? 207 VAL D N   1 
ATOM   7709  C  CA  . VAL C 1 207 ? 152.909 184.461 99.031  1.00 178.03 ? 207 VAL D CA  1 
ATOM   7710  C  C   . VAL C 1 207 ? 152.637 185.519 100.130 1.00 177.86 ? 207 VAL D C   1 
ATOM   7711  O  O   . VAL C 1 207 ? 151.522 185.558 100.654 1.00 174.83 ? 207 VAL D O   1 
ATOM   7712  C  CB  . VAL C 1 207 ? 153.608 183.177 99.574  1.00 178.53 ? 207 VAL D CB  1 
ATOM   7713  C  CG1 . VAL C 1 207 ? 153.126 182.783 100.969 1.00 170.99 ? 207 VAL D CG1 1 
ATOM   7714  C  CG2 . VAL C 1 207 ? 153.422 182.018 98.606  1.00 183.03 ? 207 VAL D CG2 1 
ATOM   7715  N  N   . SER C 1 208 ? 153.622 186.402 100.421 1.00 174.42 ? 208 SER D N   1 
ATOM   7716  C  CA  . SER C 1 208 ? 153.479 187.468 101.417 1.00 170.37 ? 208 SER D CA  1 
ATOM   7717  C  C   . SER C 1 208 ? 152.396 188.469 101.006 1.00 177.20 ? 208 SER D C   1 
ATOM   7718  O  O   . SER C 1 208 ? 151.439 188.648 101.756 1.00 173.46 ? 208 SER D O   1 
ATOM   7719  C  CB  . SER C 1 208 ? 154.803 188.194 101.641 1.00 174.25 ? 208 SER D CB  1 
ATOM   7720  O  OG  . SER C 1 208 ? 155.779 187.332 102.203 1.00 181.11 ? 208 SER D OG  1 
ATOM   7721  N  N   . LEU C 1 209 ? 152.521 189.073 99.804  1.00 180.49 ? 209 LEU D N   1 
ATOM   7722  C  CA  . LEU C 1 209 ? 151.584 190.068 99.269  1.00 183.87 ? 209 LEU D CA  1 
ATOM   7723  C  C   . LEU C 1 209 ? 150.172 189.498 99.045  1.00 188.58 ? 209 LEU D C   1 
ATOM   7724  O  O   . LEU C 1 209 ? 149.200 190.242 99.197  1.00 188.50 ? 209 LEU D O   1 
ATOM   7725  C  CB  . LEU C 1 209 ? 152.120 190.660 97.960  1.00 189.77 ? 209 LEU D CB  1 
ATOM   7726  N  N   . VAL C 1 210 ? 150.059 188.192 98.698  1.00 185.65 ? 210 VAL D N   1 
ATOM   7727  C  CA  . VAL C 1 210 ? 148.772 187.520 98.471  1.00 186.63 ? 210 VAL D CA  1 
ATOM   7728  C  C   . VAL C 1 210 ? 148.052 187.344 99.821  1.00 184.82 ? 210 VAL D C   1 
ATOM   7729  O  O   . VAL C 1 210 ? 146.903 187.772 99.951  1.00 185.16 ? 210 VAL D O   1 
ATOM   7730  C  CB  . VAL C 1 210 ? 148.925 186.178 97.698  1.00 193.26 ? 210 VAL D CB  1 
ATOM   7731  C  CG1 . VAL C 1 210 ? 147.643 185.348 97.747  1.00 193.23 ? 210 VAL D CG1 1 
ATOM   7732  C  CG2 . VAL C 1 210 ? 149.334 186.424 96.250  1.00 194.82 ? 210 VAL D CG2 1 
ATOM   7733  N  N   . LEU C 1 211 ? 148.742 186.760 100.826 1.00 176.00 ? 211 LEU D N   1 
ATOM   7734  C  CA  . LEU C 1 211 ? 148.199 186.523 102.169 1.00 169.74 ? 211 LEU D CA  1 
ATOM   7735  C  C   . LEU C 1 211 ? 147.856 187.828 102.906 1.00 173.09 ? 211 LEU D C   1 
ATOM   7736  O  O   . LEU C 1 211 ? 146.965 187.812 103.752 1.00 170.09 ? 211 LEU D O   1 
ATOM   7737  C  CB  . LEU C 1 211 ? 149.170 185.689 103.024 1.00 164.71 ? 211 LEU D CB  1 
ATOM   7738  C  CG  . LEU C 1 211 ? 149.207 184.184 102.766 1.00 169.42 ? 211 LEU D CG  1 
ATOM   7739  C  CD1 . LEU C 1 211 ? 150.444 183.575 103.359 1.00 166.21 ? 211 LEU D CD1 1 
ATOM   7740  C  CD2 . LEU C 1 211 ? 147.983 183.484 103.339 1.00 169.80 ? 211 LEU D CD2 1 
ATOM   7741  N  N   . VAL C 1 212 ? 148.548 188.945 102.590 1.00 172.08 ? 212 VAL D N   1 
ATOM   7742  C  CA  . VAL C 1 212 ? 148.310 190.256 103.204 1.00 170.60 ? 212 VAL D CA  1 
ATOM   7743  C  C   . VAL C 1 212 ? 146.925 190.778 102.763 1.00 178.19 ? 212 VAL D C   1 
ATOM   7744  O  O   . VAL C 1 212 ? 146.157 191.245 103.610 1.00 175.20 ? 212 VAL D O   1 
ATOM   7745  C  CB  . VAL C 1 212 ? 149.470 191.247 102.887 1.00 176.55 ? 212 VAL D CB  1 
ATOM   7746  C  CG1 . VAL C 1 212 ? 149.018 192.707 102.919 1.00 178.07 ? 212 VAL D CG1 1 
ATOM   7747  C  CG2 . VAL C 1 212 ? 150.637 191.035 103.844 1.00 171.79 ? 212 VAL D CG2 1 
ATOM   7748  N  N   . THR C 1 213 ? 146.600 190.649 101.457 1.00 181.06 ? 213 THR D N   1 
ATOM   7749  C  CA  . THR C 1 213 ? 145.334 191.103 100.873 1.00 185.48 ? 213 THR D CA  1 
ATOM   7750  C  C   . THR C 1 213 ? 144.171 190.159 101.247 1.00 189.22 ? 213 THR D C   1 
ATOM   7751  O  O   . THR C 1 213 ? 143.060 190.639 101.475 1.00 190.27 ? 213 THR D O   1 
ATOM   7752  C  CB  . THR C 1 213 ? 145.458 191.259 99.340  1.00 197.84 ? 213 THR D CB  1 
ATOM   7753  O  OG1 . THR C 1 213 ? 146.741 191.796 99.010  1.00 197.14 ? 213 THR D OG1 1 
ATOM   7754  C  CG2 . THR C 1 213 ? 144.373 192.160 98.749  1.00 198.26 ? 213 THR D CG2 1 
ATOM   7755  N  N   . ILE C 1 214 ? 144.424 188.837 101.312 1.00 184.31 ? 214 ILE D N   1 
ATOM   7756  C  CA  . ILE C 1 214 ? 143.400 187.831 101.614 1.00 183.71 ? 214 ILE D CA  1 
ATOM   7757  C  C   . ILE C 1 214 ? 142.964 187.869 103.098 1.00 182.78 ? 214 ILE D C   1 
ATOM   7758  O  O   . ILE C 1 214 ? 141.759 187.873 103.358 1.00 183.27 ? 214 ILE D O   1 
ATOM   7759  C  CB  . ILE C 1 214 ? 143.881 186.404 101.187 1.00 187.30 ? 214 ILE D CB  1 
ATOM   7760  C  CG1 . ILE C 1 214 ? 144.031 186.264 99.645  1.00 195.16 ? 214 ILE D CG1 1 
ATOM   7761  C  CG2 . ILE C 1 214 ? 143.017 185.273 101.775 1.00 185.99 ? 214 ILE D CG2 1 
ATOM   7762  C  CD1 . ILE C 1 214 ? 142.749 186.509 98.752  1.00 206.47 ? 214 ILE D CD1 1 
ATOM   7763  N  N   . TYR C 1 215 ? 143.933 187.887 104.046 1.00 174.78 ? 215 TYR D N   1 
ATOM   7764  C  CA  . TYR C 1 215 ? 143.748 187.830 105.506 1.00 169.10 ? 215 TYR D CA  1 
ATOM   7765  C  C   . TYR C 1 215 ? 142.512 188.587 106.039 1.00 172.63 ? 215 TYR D C   1 
ATOM   7766  O  O   . TYR C 1 215 ? 141.559 187.932 106.458 1.00 172.10 ? 215 TYR D O   1 
ATOM   7767  C  CB  . TYR C 1 215 ? 145.004 188.301 106.269 1.00 166.42 ? 215 TYR D CB  1 
ATOM   7768  C  CG  . TYR C 1 215 ? 144.865 188.131 107.767 1.00 163.38 ? 215 TYR D CG  1 
ATOM   7769  C  CD1 . TYR C 1 215 ? 144.911 186.870 108.352 1.00 162.76 ? 215 TYR D CD1 1 
ATOM   7770  C  CD2 . TYR C 1 215 ? 144.619 189.225 108.592 1.00 162.74 ? 215 TYR D CD2 1 
ATOM   7771  C  CE1 . TYR C 1 215 ? 144.727 186.702 109.723 1.00 160.25 ? 215 TYR D CE1 1 
ATOM   7772  C  CE2 . TYR C 1 215 ? 144.436 189.070 109.965 1.00 159.66 ? 215 TYR D CE2 1 
ATOM   7773  C  CZ  . TYR C 1 215 ? 144.492 187.806 110.527 1.00 166.82 ? 215 TYR D CZ  1 
ATOM   7774  O  OH  . TYR C 1 215 ? 144.323 187.652 111.884 1.00 166.65 ? 215 TYR D OH  1 
ATOM   7775  N  N   . ALA C 1 216 ? 142.536 189.936 106.035 1.00 169.35 ? 216 ALA D N   1 
ATOM   7776  C  CA  . ALA C 1 216 ? 141.477 190.799 106.571 1.00 169.30 ? 216 ALA D CA  1 
ATOM   7777  C  C   . ALA C 1 216 ? 140.112 190.609 105.893 1.00 176.79 ? 216 ALA D C   1 
ATOM   7778  O  O   . ALA C 1 216 ? 139.081 190.863 106.522 1.00 175.93 ? 216 ALA D O   1 
ATOM   7779  C  CB  . ALA C 1 216 ? 141.896 192.255 106.462 1.00 171.21 ? 216 ALA D CB  1 
ATOM   7780  N  N   . ASP C 1 217 ? 140.109 190.167 104.628 1.00 177.82 ? 217 ASP D N   1 
ATOM   7781  C  CA  . ASP C 1 217 ? 138.891 189.973 103.846 1.00 183.53 ? 217 ASP D CA  1 
ATOM   7782  C  C   . ASP C 1 217 ? 138.295 188.559 103.950 1.00 187.03 ? 217 ASP D C   1 
ATOM   7783  O  O   . ASP C 1 217 ? 137.079 188.422 103.799 1.00 190.53 ? 217 ASP D O   1 
ATOM   7784  C  CB  . ASP C 1 217 ? 139.157 190.295 102.367 1.00 191.78 ? 217 ASP D CB  1 
ATOM   7785  C  CG  . ASP C 1 217 ? 138.765 191.700 101.966 1.00 206.11 ? 217 ASP D CG  1 
ATOM   7786  O  OD1 . ASP C 1 217 ? 137.549 191.982 101.906 1.00 208.89 ? 217 ASP D OD1 1 
ATOM   7787  O  OD2 . ASP C 1 217 ? 139.673 192.510 101.683 1.00 211.01 ? 217 ASP D OD2 1 
ATOM   7788  N  N   . TYR C 1 218 ? 139.127 187.514 104.170 1.00 179.19 ? 218 TYR D N   1 
ATOM   7789  C  CA  . TYR C 1 218 ? 138.630 186.137 104.196 1.00 178.94 ? 218 TYR D CA  1 
ATOM   7790  C  C   . TYR C 1 218 ? 139.029 185.341 105.450 1.00 175.24 ? 218 TYR D C   1 
ATOM   7791  O  O   . TYR C 1 218 ? 138.159 184.699 106.036 1.00 174.57 ? 218 TYR D O   1 
ATOM   7792  C  CB  . TYR C 1 218 ? 139.097 185.381 102.940 1.00 184.48 ? 218 TYR D CB  1 
ATOM   7793  C  CG  . TYR C 1 218 ? 138.686 186.041 101.639 1.00 193.95 ? 218 TYR D CG  1 
ATOM   7794  C  CD1 . TYR C 1 218 ? 137.424 185.826 101.092 1.00 201.90 ? 218 TYR D CD1 1 
ATOM   7795  C  CD2 . TYR C 1 218 ? 139.561 186.879 100.953 1.00 196.40 ? 218 TYR D CD2 1 
ATOM   7796  C  CE1 . TYR C 1 218 ? 137.037 186.439 99.900  1.00 205.75 ? 218 TYR D CE1 1 
ATOM   7797  C  CE2 . TYR C 1 218 ? 139.184 187.500 99.762  1.00 203.05 ? 218 TYR D CE2 1 
ATOM   7798  C  CZ  . TYR C 1 218 ? 137.921 187.276 99.238  1.00 210.31 ? 218 TYR D CZ  1 
ATOM   7799  O  OH  . TYR C 1 218 ? 137.548 187.883 98.061  1.00 213.46 ? 218 TYR D OH  1 
ATOM   7800  N  N   . ILE C 1 219 ? 140.319 185.364 105.851 1.00 166.54 ? 219 ILE D N   1 
ATOM   7801  C  CA  . ILE C 1 219 ? 140.828 184.600 107.002 1.00 160.39 ? 219 ILE D CA  1 
ATOM   7802  C  C   . ILE C 1 219 ? 140.360 185.213 108.341 1.00 160.25 ? 219 ILE D C   1 
ATOM   7803  O  O   . ILE C 1 219 ? 139.774 184.494 109.147 1.00 157.84 ? 219 ILE D O   1 
ATOM   7804  C  CB  . ILE C 1 219 ? 142.381 184.449 106.955 1.00 160.70 ? 219 ILE D CB  1 
ATOM   7805  C  CG1 . ILE C 1 219 ? 142.843 183.753 105.654 1.00 164.99 ? 219 ILE D CG1 1 
ATOM   7806  C  CG2 . ILE C 1 219 ? 142.911 183.697 108.188 1.00 156.36 ? 219 ILE D CG2 1 
ATOM   7807  C  CD1 . ILE C 1 219 ? 144.292 184.053 105.228 1.00 170.51 ? 219 ILE D CD1 1 
ATOM   7808  N  N   . ALA C 1 220 ? 140.637 186.516 108.576 1.00 156.37 ? 220 ALA D N   1 
ATOM   7809  C  CA  . ALA C 1 220 ? 140.314 187.250 109.808 1.00 153.42 ? 220 ALA D CA  1 
ATOM   7810  C  C   . ALA C 1 220 ? 138.810 187.217 110.206 1.00 160.05 ? 220 ALA D C   1 
ATOM   7811  O  O   . ALA C 1 220 ? 138.556 186.996 111.395 1.00 157.16 ? 220 ALA D O   1 
ATOM   7812  C  CB  . ALA C 1 220 ? 140.787 188.692 109.708 1.00 154.25 ? 220 ALA D CB  1 
ATOM   7813  N  N   . PRO C 1 221 ? 137.804 187.388 109.297 1.00 161.74 ? 221 PRO D N   1 
ATOM   7814  C  CA  . PRO C 1 221 ? 136.399 187.364 109.753 1.00 163.97 ? 221 PRO D CA  1 
ATOM   7815  C  C   . PRO C 1 221 ? 135.906 186.004 110.275 1.00 168.44 ? 221 PRO D C   1 
ATOM   7816  O  O   . PRO C 1 221 ? 134.828 185.954 110.872 1.00 169.25 ? 221 PRO D O   1 
ATOM   7817  C  CB  . PRO C 1 221 ? 135.615 187.780 108.504 1.00 172.13 ? 221 PRO D CB  1 
ATOM   7818  C  CG  . PRO C 1 221 ? 136.610 188.452 107.625 1.00 177.03 ? 221 PRO D CG  1 
ATOM   7819  C  CD  . PRO C 1 221 ? 137.867 187.695 107.854 1.00 168.03 ? 221 PRO D CD  1 
ATOM   7820  N  N   . LEU C 1 222 ? 136.683 184.915 110.073 1.00 164.52 ? 222 LEU D N   1 
ATOM   7821  C  CA  . LEU C 1 222 ? 136.334 183.561 110.535 1.00 164.39 ? 222 LEU D CA  1 
ATOM   7822  C  C   . LEU C 1 222 ? 136.477 183.413 112.056 1.00 164.76 ? 222 LEU D C   1 
ATOM   7823  O  O   . LEU C 1 222 ? 135.819 182.553 112.647 1.00 165.19 ? 222 LEU D O   1 
ATOM   7824  C  CB  . LEU C 1 222 ? 137.210 182.490 109.850 1.00 164.13 ? 222 LEU D CB  1 
ATOM   7825  C  CG  . LEU C 1 222 ? 137.139 182.367 108.331 1.00 173.90 ? 222 LEU D CG  1 
ATOM   7826  C  CD1 . LEU C 1 222 ? 138.382 181.690 107.791 1.00 172.70 ? 222 LEU D CD1 1 
ATOM   7827  C  CD2 . LEU C 1 222 ? 135.887 181.620 107.887 1.00 181.72 ? 222 LEU D CD2 1 
ATOM   7828  N  N   . PHE C 1 223 ? 137.352 184.223 112.679 1.00 157.62 ? 223 PHE D N   1 
ATOM   7829  C  CA  . PHE C 1 223 ? 137.625 184.159 114.113 1.00 153.56 ? 223 PHE D CA  1 
ATOM   7830  C  C   . PHE C 1 223 ? 136.939 185.288 114.886 1.00 159.64 ? 223 PHE D C   1 
ATOM   7831  O  O   . PHE C 1 223 ? 136.547 185.075 116.034 1.00 158.29 ? 223 PHE D O   1 
ATOM   7832  C  CB  . PHE C 1 223 ? 139.140 184.181 114.371 1.00 150.92 ? 223 PHE D CB  1 
ATOM   7833  C  CG  . PHE C 1 223 ? 139.939 183.293 113.443 1.00 152.62 ? 223 PHE D CG  1 
ATOM   7834  C  CD1 . PHE C 1 223 ? 139.921 181.911 113.588 1.00 155.24 ? 223 PHE D CD1 1 
ATOM   7835  C  CD2 . PHE C 1 223 ? 140.705 183.840 112.419 1.00 155.60 ? 223 PHE D CD2 1 
ATOM   7836  C  CE1 . PHE C 1 223 ? 140.642 181.093 112.716 1.00 156.82 ? 223 PHE D CE1 1 
ATOM   7837  C  CE2 . PHE C 1 223 ? 141.442 183.020 111.559 1.00 159.06 ? 223 PHE D CE2 1 
ATOM   7838  C  CZ  . PHE C 1 223 ? 141.404 181.653 111.713 1.00 156.85 ? 223 PHE D CZ  1 
ATOM   7839  N  N   . ASP C 1 224 ? 136.794 186.476 114.269 1.00 159.40 ? 224 ASP D N   1 
ATOM   7840  C  CA  . ASP C 1 224 ? 136.149 187.639 114.889 1.00 160.59 ? 224 ASP D CA  1 
ATOM   7841  C  C   . ASP C 1 224 ? 135.043 188.216 114.003 1.00 170.27 ? 224 ASP D C   1 
ATOM   7842  O  O   . ASP C 1 224 ? 135.186 188.242 112.780 1.00 172.41 ? 224 ASP D O   1 
ATOM   7843  C  CB  . ASP C 1 224 ? 137.185 188.723 115.206 1.00 159.88 ? 224 ASP D CB  1 
ATOM   7844  C  CG  . ASP C 1 224 ? 138.128 188.334 116.319 1.00 168.42 ? 224 ASP D CG  1 
ATOM   7845  O  OD1 . ASP C 1 224 ? 137.717 188.416 117.499 1.00 168.15 ? 224 ASP D OD1 1 
ATOM   7846  O  OD2 . ASP C 1 224 ? 139.276 187.946 116.013 1.00 173.66 ? 224 ASP D OD2 1 
ATOM   7847  N  N   . LYS C 1 225 ? 133.948 188.693 114.627 1.00 169.45 ? 225 LYS D N   1 
ATOM   7848  C  CA  . LYS C 1 225 ? 132.799 189.273 113.923 1.00 175.16 ? 225 LYS D CA  1 
ATOM   7849  C  C   . LYS C 1 225 ? 133.138 190.669 113.388 1.00 179.48 ? 225 LYS D C   1 
ATOM   7850  O  O   . LYS C 1 225 ? 133.337 191.608 114.163 1.00 177.04 ? 225 LYS D O   1 
ATOM   7851  C  CB  . LYS C 1 225 ? 131.551 189.324 114.829 1.00 180.54 ? 225 LYS D CB  1 
ATOM   7852  C  CG  . LYS C 1 225 ? 130.967 187.957 115.189 1.00 200.11 ? 225 LYS D CG  1 
ATOM   7853  C  CD  . LYS C 1 225 ? 129.749 187.593 114.338 1.00 217.47 ? 225 LYS D CD  1 
ATOM   7854  C  CE  . LYS C 1 225 ? 129.140 186.265 114.732 1.00 230.22 ? 225 LYS D CE  1 
ATOM   7855  N  NZ  . LYS C 1 225 ? 128.360 186.353 115.998 1.00 239.13 ? 225 LYS D NZ  1 
ATOM   7856  N  N   . PHE C 1 226 ? 133.226 190.784 112.055 1.00 179.22 ? 226 PHE D N   1 
ATOM   7857  C  CA  . PHE C 1 226 ? 133.522 192.024 111.340 1.00 181.04 ? 226 PHE D CA  1 
ATOM   7858  C  C   . PHE C 1 226 ? 132.235 192.628 110.796 1.00 192.81 ? 226 PHE D C   1 
ATOM   7859  O  O   . PHE C 1 226 ? 131.505 191.961 110.053 1.00 196.96 ? 226 PHE D O   1 
ATOM   7860  C  CB  . PHE C 1 226 ? 134.507 191.760 110.187 1.00 182.65 ? 226 PHE D CB  1 
ATOM   7861  C  CG  . PHE C 1 226 ? 135.982 191.814 110.501 1.00 178.44 ? 226 PHE D CG  1 
ATOM   7862  C  CD1 . PHE C 1 226 ? 136.581 190.828 111.273 1.00 176.38 ? 226 PHE D CD1 1 
ATOM   7863  C  CD2 . PHE C 1 226 ? 136.791 192.794 109.940 1.00 180.75 ? 226 PHE D CD2 1 
ATOM   7864  C  CE1 . PHE C 1 226 ? 137.952 190.856 111.530 1.00 173.02 ? 226 PHE D CE1 1 
ATOM   7865  C  CE2 . PHE C 1 226 ? 138.164 192.819 110.192 1.00 179.32 ? 226 PHE D CE2 1 
ATOM   7866  C  CZ  . PHE C 1 226 ? 138.735 191.850 110.987 1.00 172.74 ? 226 PHE D CZ  1 
ATOM   7867  N  N   . THR C 1 227 ? 131.946 193.881 111.180 1.00 191.07 ? 227 THR D N   1 
ATOM   7868  C  CA  . THR C 1 227 ? 130.758 194.616 110.734 1.00 197.53 ? 227 THR D CA  1 
ATOM   7869  C  C   . THR C 1 227 ? 131.139 196.050 110.355 1.00 202.37 ? 227 THR D C   1 
ATOM   7870  O  O   . THR C 1 227 ? 131.937 196.662 111.068 1.00 197.69 ? 227 THR D O   1 
ATOM   7871  C  CB  . THR C 1 227 ? 129.644 194.608 111.802 1.00 209.18 ? 227 THR D CB  1 
ATOM   7872  O  OG1 . THR C 1 227 ? 130.193 194.939 113.080 1.00 204.28 ? 227 THR D OG1 1 
ATOM   7873  C  CG2 . THR C 1 227 ? 128.888 193.282 111.865 1.00 210.33 ? 227 THR D CG2 1 
ATOM   7874  N  N   . PRO C 1 228 ? 130.593 196.613 109.249 1.00 205.01 ? 228 PRO D N   1 
ATOM   7875  C  CA  . PRO C 1 228 ? 130.936 198.000 108.891 1.00 206.56 ? 228 PRO D CA  1 
ATOM   7876  C  C   . PRO C 1 228 ? 130.365 198.997 109.900 1.00 210.20 ? 228 PRO D C   1 
ATOM   7877  O  O   . PRO C 1 228 ? 129.317 198.738 110.497 1.00 211.41 ? 228 PRO D O   1 
ATOM   7878  C  CB  . PRO C 1 228 ? 130.309 198.180 107.500 1.00 214.44 ? 228 PRO D CB  1 
ATOM   7879  C  CG  . PRO C 1 228 ? 129.953 196.797 107.032 1.00 217.34 ? 228 PRO D CG  1 
ATOM   7880  C  CD  . PRO C 1 228 ? 129.643 196.037 108.278 1.00 212.92 ? 228 PRO D CD  1 
ATOM   7881  N  N   . LEU C 1 229 ? 131.077 200.121 110.106 1.00 205.25 ? 229 LEU D N   1 
ATOM   7882  C  CA  . LEU C 1 229 ? 130.723 201.191 111.042 1.00 205.33 ? 229 LEU D CA  1 
ATOM   7883  C  C   . LEU C 1 229 ? 129.335 201.773 110.725 1.00 217.29 ? 229 LEU D C   1 
ATOM   7884  O  O   . LEU C 1 229 ? 129.085 202.138 109.572 1.00 219.61 ? 229 LEU D O   1 
ATOM   7885  C  CB  . LEU C 1 229 ? 131.790 202.300 111.010 1.00 203.66 ? 229 LEU D CB  1 
ATOM   7886  C  CG  . LEU C 1 229 ? 131.809 203.267 112.189 1.00 206.67 ? 229 LEU D CG  1 
ATOM   7887  C  CD1 . LEU C 1 229 ? 132.674 202.739 113.316 1.00 200.06 ? 229 LEU D CD1 1 
ATOM   7888  C  CD2 . LEU C 1 229 ? 132.329 204.612 111.764 1.00 211.27 ? 229 LEU D CD2 1 
ATOM   7889  N  N   . PRO C 1 230 ? 128.413 201.839 111.719 1.00 214.68 ? 230 PRO D N   1 
ATOM   7890  C  CA  . PRO C 1 230 ? 127.069 202.378 111.442 1.00 219.24 ? 230 PRO D CA  1 
ATOM   7891  C  C   . PRO C 1 230 ? 127.094 203.881 111.183 1.00 223.22 ? 230 PRO D C   1 
ATOM   7892  O  O   . PRO C 1 230 ? 127.940 204.587 111.738 1.00 222.14 ? 230 PRO D O   1 
ATOM   7893  C  CB  . PRO C 1 230 ? 126.275 202.047 112.713 1.00 220.66 ? 230 PRO D CB  1 
ATOM   7894  C  CG  . PRO C 1 230 ? 127.138 201.091 113.497 1.00 219.88 ? 230 PRO D CG  1 
ATOM   7895  C  CD  . PRO C 1 230 ? 128.540 201.433 113.131 1.00 211.07 ? 230 PRO D CD  1 
ATOM   7896  N  N   . GLU C 1 231 ? 126.171 204.360 110.328 1.00 223.21 ? 231 GLU D N   1 
ATOM   7897  C  CA  . GLU C 1 231 ? 126.051 205.769 109.941 1.00 225.04 ? 231 GLU D CA  1 
ATOM   7898  C  C   . GLU C 1 231 ? 125.674 206.638 111.146 1.00 228.49 ? 231 GLU D C   1 
ATOM   7899  O  O   . GLU C 1 231 ? 124.729 206.319 111.872 1.00 228.92 ? 231 GLU D O   1 
ATOM   7900  C  CB  . GLU C 1 231 ? 125.025 205.944 108.802 1.00 228.44 ? 231 GLU D CB  1 
ATOM   7901  C  CG  . GLU C 1 231 ? 125.380 205.229 107.503 1.00 234.31 ? 231 GLU D CG  1 
ATOM   7902  C  CD  . GLU C 1 231 ? 126.593 205.743 106.749 1.00 245.55 ? 231 GLU D CD  1 
ATOM   7903  O  OE1 . GLU C 1 231 ? 126.673 206.969 106.507 1.00 245.38 ? 231 GLU D OE1 1 
ATOM   7904  O  OE2 . GLU C 1 231 ? 127.450 204.913 106.369 1.00 237.94 ? 231 GLU D OE2 1 
ATOM   7905  N  N   . GLY C 1 232 ? 126.448 207.699 111.357 1.00 226.13 ? 232 GLY D N   1 
ATOM   7906  C  CA  . GLY C 1 232 ? 126.263 208.644 112.453 1.00 226.99 ? 232 GLY D CA  1 
ATOM   7907  C  C   . GLY C 1 232 ? 127.200 209.833 112.384 1.00 229.69 ? 232 GLY D C   1 
ATOM   7908  O  O   . GLY C 1 232 ? 127.721 210.151 111.310 1.00 229.54 ? 232 GLY D O   1 
ATOM   7909  N  N   . LYS C 1 233 ? 127.415 210.502 113.535 1.00 227.44 ? 233 LYS D N   1 
ATOM   7910  C  CA  . LYS C 1 233 ? 128.291 211.673 113.659 1.00 227.57 ? 233 LYS D CA  1 
ATOM   7911  C  C   . LYS C 1 233 ? 129.760 211.287 113.467 1.00 227.12 ? 233 LYS D C   1 
ATOM   7912  O  O   . LYS C 1 233 ? 130.528 212.061 112.889 1.00 226.87 ? 233 LYS D O   1 
ATOM   7913  C  CB  . LYS C 1 233 ? 128.094 212.356 115.021 1.00 230.26 ? 233 LYS D CB  1 
ATOM   7914  N  N   . LEU C 1 234 ? 130.139 210.085 113.942 1.00 219.77 ? 234 LEU D N   1 
ATOM   7915  C  CA  . LEU C 1 234 ? 131.493 209.550 113.824 1.00 213.81 ? 234 LEU D CA  1 
ATOM   7916  C  C   . LEU C 1 234 ? 131.771 209.090 112.392 1.00 219.65 ? 234 LEU D C   1 
ATOM   7917  O  O   . LEU C 1 234 ? 132.849 209.372 111.867 1.00 218.25 ? 234 LEU D O   1 
ATOM   7918  C  CB  . LEU C 1 234 ? 131.702 208.391 114.807 1.00 207.70 ? 234 LEU D CB  1 
ATOM   7919  N  N   . LYS C 1 235 ? 130.797 208.396 111.761 1.00 219.43 ? 235 LYS D N   1 
ATOM   7920  C  CA  . LYS C 1 235 ? 130.896 207.873 110.395 1.00 220.26 ? 235 LYS D CA  1 
ATOM   7921  C  C   . LYS C 1 235 ? 130.992 208.988 109.353 1.00 225.05 ? 235 LYS D C   1 
ATOM   7922  O  O   . LYS C 1 235 ? 131.720 208.830 108.372 1.00 224.09 ? 235 LYS D O   1 
ATOM   7923  C  CB  . LYS C 1 235 ? 129.701 206.969 110.076 1.00 222.55 ? 235 LYS D CB  1 
ATOM   7924  N  N   . GLU C 1 236 ? 130.268 210.107 109.566 1.00 225.58 ? 236 GLU D N   1 
ATOM   7925  C  CA  . GLU C 1 236 ? 130.259 211.260 108.660 1.00 227.76 ? 236 GLU D CA  1 
ATOM   7926  C  C   . GLU C 1 236 ? 131.567 212.055 108.755 1.00 229.75 ? 236 GLU D C   1 
ATOM   7927  O  O   . GLU C 1 236 ? 132.124 212.420 107.716 1.00 230.05 ? 236 GLU D O   1 
ATOM   7928  C  CB  . GLU C 1 236 ? 129.057 212.172 108.943 1.00 231.56 ? 236 GLU D CB  1 
ATOM   7929  N  N   . GLU C 1 237 ? 132.060 212.307 109.992 1.00 226.24 ? 237 GLU D N   1 
ATOM   7930  C  CA  . GLU C 1 237 ? 133.295 213.052 110.264 1.00 225.35 ? 237 GLU D CA  1 
ATOM   7931  C  C   . GLU C 1 237 ? 134.542 212.307 109.764 1.00 225.64 ? 237 GLU D C   1 
ATOM   7932  O  O   . GLU C 1 237 ? 135.524 212.957 109.397 1.00 225.40 ? 237 GLU D O   1 
ATOM   7933  C  CB  . GLU C 1 237 ? 133.427 213.350 111.763 1.00 225.71 ? 237 GLU D CB  1 
ATOM   7934  N  N   . ILE C 1 238 ? 134.499 210.953 109.747 1.00 221.49 ? 238 ILE D N   1 
ATOM   7935  C  CA  . ILE C 1 238 ? 135.589 210.094 109.272 1.00 219.10 ? 238 ILE D CA  1 
ATOM   7936  C  C   . ILE C 1 238 ? 135.734 210.218 107.753 1.00 223.09 ? 238 ILE D C   1 
ATOM   7937  O  O   . ILE C 1 238 ? 136.861 210.274 107.264 1.00 221.87 ? 238 ILE D O   1 
ATOM   7938  C  CB  . ILE C 1 238 ? 135.379 208.626 109.695 1.00 217.18 ? 238 ILE D CB  1 
ATOM   7939  N  N   . GLU C 1 239 ? 134.598 210.284 107.017 1.00 223.14 ? 239 GLU D N   1 
ATOM   7940  C  CA  . GLU C 1 239 ? 134.552 210.441 105.558 1.00 224.64 ? 239 GLU D CA  1 
ATOM   7941  C  C   . GLU C 1 239 ? 135.078 211.818 105.143 1.00 229.48 ? 239 GLU D C   1 
ATOM   7942  O  O   . GLU C 1 239 ? 135.721 211.934 104.097 1.00 229.54 ? 239 GLU D O   1 
ATOM   7943  C  CB  . GLU C 1 239 ? 133.125 210.236 105.031 1.00 227.45 ? 239 GLU D CB  1 
ATOM   7944  N  N   . VAL C 1 240 ? 134.811 212.851 105.974 1.00 228.94 ? 240 VAL D N   1 
ATOM   7945  C  CA  . VAL C 1 240 ? 135.265 214.236 105.789 1.00 230.90 ? 240 VAL D CA  1 
ATOM   7946  C  C   . VAL C 1 240 ? 136.804 214.261 105.930 1.00 232.33 ? 240 VAL D C   1 
ATOM   7947  O  O   . VAL C 1 240 ? 137.485 214.875 105.105 1.00 232.94 ? 240 VAL D O   1 
ATOM   7948  C  CB  . VAL C 1 240 ? 134.549 215.203 106.782 1.00 235.21 ? 240 VAL D CB  1 
ATOM   7949  C  CG1 . VAL C 1 240 ? 135.215 216.578 106.826 1.00 236.53 ? 240 VAL D CG1 1 
ATOM   7950  C  CG2 . VAL C 1 240 ? 133.067 215.345 106.440 1.00 237.46 ? 240 VAL D CG2 1 
ATOM   7951  N  N   . MET C 1 241 ? 137.333 213.552 106.950 1.00 228.11 ? 241 MET D N   1 
ATOM   7952  C  CA  . MET C 1 241 ? 138.764 213.414 107.231 1.00 226.38 ? 241 MET D CA  1 
ATOM   7953  C  C   . MET C 1 241 ? 139.453 212.573 106.138 1.00 228.65 ? 241 MET D C   1 
ATOM   7954  O  O   . MET C 1 241 ? 140.573 212.903 105.743 1.00 228.24 ? 241 MET D O   1 
ATOM   7955  C  CB  . MET C 1 241 ? 138.973 212.783 108.620 1.00 225.80 ? 241 MET D CB  1 
ATOM   7956  C  CG  . MET C 1 241 ? 140.401 212.872 109.132 1.00 226.72 ? 241 MET D CG  1 
ATOM   7957  S  SD  . MET C 1 241 ? 140.592 212.200 110.801 1.00 226.79 ? 241 MET D SD  1 
ATOM   7958  C  CE  . MET C 1 241 ? 140.168 213.631 111.769 1.00 225.91 ? 241 MET D CE  1 
ATOM   7959  N  N   . ALA C 1 242 ? 138.779 211.502 105.651 1.00 226.36 ? 242 ALA D N   1 
ATOM   7960  C  CA  . ALA C 1 242 ? 139.278 210.602 104.601 1.00 225.71 ? 242 ALA D CA  1 
ATOM   7961  C  C   . ALA C 1 242 ? 139.435 211.332 103.263 1.00 231.10 ? 242 ALA D C   1 
ATOM   7962  O  O   . ALA C 1 242 ? 140.419 211.098 102.558 1.00 230.46 ? 242 ALA D O   1 
ATOM   7963  C  CB  . ALA C 1 242 ? 138.346 209.410 104.437 1.00 225.64 ? 242 ALA D CB  1 
ATOM   7964  N  N   . LYS C 1 243 ? 138.474 212.217 102.925 1.00 231.58 ? 243 LYS D N   1 
ATOM   7965  C  CA  . LYS C 1 243 ? 138.489 213.021 101.702 1.00 233.99 ? 243 LYS D CA  1 
ATOM   7966  C  C   . LYS C 1 243 ? 139.560 214.115 101.802 1.00 237.48 ? 243 LYS D C   1 
ATOM   7967  O  O   . LYS C 1 243 ? 140.171 214.463 100.790 1.00 238.36 ? 243 LYS D O   1 
ATOM   7968  C  CB  . LYS C 1 243 ? 137.104 213.640 101.450 1.00 238.30 ? 243 LYS D CB  1 
ATOM   7969  C  CG  . LYS C 1 243 ? 136.876 214.077 100.008 1.00 251.78 ? 243 LYS D CG  1 
ATOM   7970  C  CD  . LYS C 1 243 ? 135.559 214.814 99.848  1.00 260.20 ? 243 LYS D CD  1 
ATOM   7971  N  N   . SER C 1 244 ? 139.787 214.638 103.025 1.00 234.80 ? 244 SER D N   1 
ATOM   7972  C  CA  . SER C 1 244 ? 140.765 215.686 103.329 1.00 235.37 ? 244 SER D CA  1 
ATOM   7973  C  C   . SER C 1 244 ? 142.210 215.202 103.126 1.00 236.74 ? 244 SER D C   1 
ATOM   7974  O  O   . SER C 1 244 ? 143.023 215.945 102.576 1.00 237.69 ? 244 SER D O   1 
ATOM   7975  C  CB  . SER C 1 244 ? 140.581 216.184 104.759 1.00 237.38 ? 244 SER D CB  1 
ATOM   7976  O  OG  . SER C 1 244 ? 141.399 217.310 105.028 1.00 244.33 ? 244 SER D OG  1 
ATOM   7977  N  N   . ILE C 1 245 ? 142.521 213.964 103.563 1.00 232.22 ? 245 ILE D N   1 
ATOM   7978  C  CA  . ILE C 1 245 ? 143.853 213.361 103.444 1.00 230.59 ? 245 ILE D CA  1 
ATOM   7979  C  C   . ILE C 1 245 ? 144.011 212.594 102.114 1.00 233.81 ? 245 ILE D C   1 
ATOM   7980  O  O   . ILE C 1 245 ? 145.088 212.046 101.852 1.00 232.37 ? 245 ILE D O   1 
ATOM   7981  C  CB  . ILE C 1 245 ? 144.117 212.435 104.654 1.00 230.06 ? 245 ILE D CB  1 
ATOM   7982  N  N   . ASP C 1 246 ? 142.941 212.571 101.279 1.00 233.48 ? 246 ASP D N   1 
ATOM   7983  C  CA  . ASP C 1 246 ? 142.841 211.891 99.977  1.00 234.10 ? 246 ASP D CA  1 
ATOM   7984  C  C   . ASP C 1 246 ? 143.035 210.364 100.128 1.00 234.52 ? 246 ASP D C   1 
ATOM   7985  O  O   . ASP C 1 246 ? 143.551 209.706 99.218  1.00 234.01 ? 246 ASP D O   1 
ATOM   7986  C  CB  . ASP C 1 246 ? 143.817 212.485 98.940  1.00 236.79 ? 246 ASP D CB  1 
ATOM   7987  C  CG  . ASP C 1 246 ? 143.482 213.908 98.542  1.00 247.35 ? 246 ASP D CG  1 
ATOM   7988  O  OD1 . ASP C 1 246 ? 142.604 214.089 97.669  1.00 249.79 ? 246 ASP D OD1 1 
ATOM   7989  O  OD2 . ASP C 1 246 ? 144.101 214.840 99.097  1.00 252.01 ? 246 ASP D OD2 1 
ATOM   7990  N  N   . PHE C 1 247 ? 142.589 209.809 101.277 1.00 230.73 ? 247 PHE D N   1 
ATOM   7991  C  CA  . PHE C 1 247 ? 142.662 208.381 101.582 1.00 228.44 ? 247 PHE D CA  1 
ATOM   7992  C  C   . PHE C 1 247 ? 141.547 207.643 100.829 1.00 231.97 ? 247 PHE D C   1 
ATOM   7993  O  O   . PHE C 1 247 ? 140.377 207.993 101.014 1.00 232.97 ? 247 PHE D O   1 
ATOM   7994  C  CB  . PHE C 1 247 ? 142.568 208.137 103.097 1.00 227.85 ? 247 PHE D CB  1 
ATOM   7995  N  N   . PRO C 1 248 ? 141.872 206.652 99.954  1.00 229.19 ? 248 PRO D N   1 
ATOM   7996  C  CA  . PRO C 1 248 ? 140.804 205.955 99.210  1.00 229.79 ? 248 PRO D CA  1 
ATOM   7997  C  C   . PRO C 1 248 ? 140.033 204.973 100.107 1.00 229.82 ? 248 PRO D C   1 
ATOM   7998  O  O   . PRO C 1 248 ? 140.239 203.757 100.057 1.00 228.17 ? 248 PRO D O   1 
ATOM   7999  C  CB  . PRO C 1 248 ? 141.552 205.266 98.060  1.00 231.10 ? 248 PRO D CB  1 
ATOM   8000  C  CG  . PRO C 1 248 ? 142.939 205.090 98.551  1.00 232.38 ? 248 PRO D CG  1 
ATOM   8001  C  CD  . PRO C 1 248 ? 143.211 206.129 99.605  1.00 229.13 ? 248 PRO D CD  1 
ATOM   8002  N  N   . LEU C 1 249 ? 139.131 205.530 100.934 1.00 227.11 ? 249 LEU D N   1 
ATOM   8003  C  CA  . LEU C 1 249 ? 138.308 204.787 101.878 1.00 225.60 ? 249 LEU D CA  1 
ATOM   8004  C  C   . LEU C 1 249 ? 137.150 204.083 101.168 1.00 228.90 ? 249 LEU D C   1 
ATOM   8005  O  O   . LEU C 1 249 ? 136.403 204.711 100.413 1.00 230.82 ? 249 LEU D O   1 
ATOM   8006  C  CB  . LEU C 1 249 ? 137.779 205.729 102.982 1.00 225.94 ? 249 LEU D CB  1 
ATOM   8007  C  CG  . LEU C 1 249 ? 136.855 205.119 104.044 1.00 228.27 ? 249 LEU D CG  1 
ATOM   8008  C  CD1 . LEU C 1 249 ? 137.633 204.269 105.041 1.00 225.84 ? 249 LEU D CD1 1 
ATOM   8009  C  CD2 . LEU C 1 249 ? 136.078 206.198 104.765 1.00 231.20 ? 249 LEU D CD2 1 
ATOM   8010  N  N   . THR C 1 250 ? 137.013 202.771 101.426 1.00 224.85 ? 250 THR D N   1 
ATOM   8011  C  CA  . THR C 1 250 ? 135.941 201.922 100.901 1.00 225.33 ? 250 THR D CA  1 
ATOM   8012  C  C   . THR C 1 250 ? 134.864 201.833 101.991 1.00 226.65 ? 250 THR D C   1 
ATOM   8013  O  O   . THR C 1 250 ? 133.693 202.109 101.721 1.00 228.23 ? 250 THR D O   1 
ATOM   8014  C  CB  . THR C 1 250 ? 136.492 200.542 100.462 1.00 229.76 ? 250 THR D CB  1 
ATOM   8015  O  OG1 . THR C 1 250 ? 137.659 200.716 99.653  1.00 229.78 ? 250 THR D OG1 1 
ATOM   8016  C  CG2 . THR C 1 250 ? 135.464 199.707 99.704  1.00 229.93 ? 250 THR D CG2 1 
ATOM   8017  N  N   . LYS C 1 251 ? 135.283 201.484 103.228 1.00 221.33 ? 251 LYS D N   1 
ATOM   8018  C  CA  . LYS C 1 251 ? 134.431 201.362 104.411 1.00 220.51 ? 251 LYS D CA  1 
ATOM   8019  C  C   . LYS C 1 251 ? 135.267 201.378 105.699 1.00 220.37 ? 251 LYS D C   1 
ATOM   8020  O  O   . LYS C 1 251 ? 136.467 201.099 105.664 1.00 218.60 ? 251 LYS D O   1 
ATOM   8021  C  CB  . LYS C 1 251 ? 133.594 200.070 104.346 1.00 222.05 ? 251 LYS D CB  1 
ATOM   8022  N  N   . VAL C 1 252 ? 134.625 201.717 106.830 1.00 217.59 ? 252 VAL D N   1 
ATOM   8023  C  CA  . VAL C 1 252 ? 135.218 201.711 108.170 1.00 210.21 ? 252 VAL D CA  1 
ATOM   8024  C  C   . VAL C 1 252 ? 134.627 200.508 108.906 1.00 209.66 ? 252 VAL D C   1 
ATOM   8025  O  O   . VAL C 1 252 ? 133.413 200.304 108.840 1.00 212.83 ? 252 VAL D O   1 
ATOM   8026  C  CB  . VAL C 1 252 ? 134.982 203.042 108.924 1.00 214.70 ? 252 VAL D CB  1 
ATOM   8027  N  N   . TYR C 1 253 ? 135.472 199.683 109.553 1.00 199.02 ? 253 TYR D N   1 
ATOM   8028  C  CA  . TYR C 1 253 ? 135.009 198.473 110.239 1.00 195.30 ? 253 TYR D CA  1 
ATOM   8029  C  C   . TYR C 1 253 ? 135.051 198.591 111.762 1.00 191.75 ? 253 TYR D C   1 
ATOM   8030  O  O   . TYR C 1 253 ? 135.993 199.154 112.324 1.00 187.58 ? 253 TYR D O   1 
ATOM   8031  C  CB  . TYR C 1 253 ? 135.827 197.246 109.795 1.00 194.15 ? 253 TYR D CB  1 
ATOM   8032  C  CG  . TYR C 1 253 ? 135.413 196.693 108.449 1.00 201.26 ? 253 TYR D CG  1 
ATOM   8033  C  CD1 . TYR C 1 253 ? 134.390 195.754 108.342 1.00 205.42 ? 253 TYR D CD1 1 
ATOM   8034  C  CD2 . TYR C 1 253 ? 136.050 197.100 107.280 1.00 205.21 ? 253 TYR D CD2 1 
ATOM   8035  C  CE1 . TYR C 1 253 ? 134.000 195.244 107.103 1.00 211.35 ? 253 TYR D CE1 1 
ATOM   8036  C  CE2 . TYR C 1 253 ? 135.670 196.597 106.035 1.00 211.35 ? 253 TYR D CE2 1 
ATOM   8037  C  CZ  . TYR C 1 253 ? 134.644 195.668 105.952 1.00 220.43 ? 253 TYR D CZ  1 
ATOM   8038  O  OH  . TYR C 1 253 ? 134.268 195.165 104.729 1.00 222.06 ? 253 TYR D OH  1 
ATOM   8039  N  N   . VAL C 1 254 ? 134.018 198.036 112.421 1.00 187.02 ? 254 VAL D N   1 
ATOM   8040  C  CA  . VAL C 1 254 ? 133.894 197.989 113.874 1.00 182.65 ? 254 VAL D CA  1 
ATOM   8041  C  C   . VAL C 1 254 ? 133.973 196.496 114.285 1.00 181.97 ? 254 VAL D C   1 
ATOM   8042  O  O   . VAL C 1 254 ? 132.979 195.767 114.232 1.00 184.07 ? 254 VAL D O   1 
ATOM   8043  C  CB  . VAL C 1 254 ? 132.660 198.768 114.440 1.00 190.09 ? 254 VAL D CB  1 
ATOM   8044  C  CG1 . VAL C 1 254 ? 131.331 198.324 113.829 1.00 195.18 ? 254 VAL D CG1 1 
ATOM   8045  C  CG2 . VAL C 1 254 ? 132.609 198.727 115.962 1.00 186.68 ? 254 VAL D CG2 1 
ATOM   8046  N  N   . VAL C 1 255 ? 135.199 196.046 114.623 1.00 172.12 ? 255 VAL D N   1 
ATOM   8047  C  CA  . VAL C 1 255 ? 135.511 194.664 115.006 1.00 167.64 ? 255 VAL D CA  1 
ATOM   8048  C  C   . VAL C 1 255 ? 134.955 194.387 116.406 1.00 168.29 ? 255 VAL D C   1 
ATOM   8049  O  O   . VAL C 1 255 ? 135.248 195.131 117.345 1.00 166.12 ? 255 VAL D O   1 
ATOM   8050  C  CB  . VAL C 1 255 ? 137.038 194.369 114.906 1.00 167.09 ? 255 VAL D CB  1 
ATOM   8051  C  CG1 . VAL C 1 255 ? 137.391 192.996 115.475 1.00 163.28 ? 255 VAL D CG1 1 
ATOM   8052  C  CG2 . VAL C 1 255 ? 137.516 194.476 113.464 1.00 169.20 ? 255 VAL D CG2 1 
ATOM   8053  N  N   . GLU C 1 256 ? 134.155 193.306 116.533 1.00 164.71 ? 256 GLU D N   1 
ATOM   8054  C  CA  . GLU C 1 256 ? 133.547 192.873 117.789 1.00 163.30 ? 256 GLU D CA  1 
ATOM   8055  C  C   . GLU C 1 256 ? 134.621 192.239 118.697 1.00 161.01 ? 256 GLU D C   1 
ATOM   8056  O  O   . GLU C 1 256 ? 134.687 191.015 118.856 1.00 159.05 ? 256 GLU D O   1 
ATOM   8057  C  CB  . GLU C 1 256 ? 132.376 191.910 117.524 1.00 168.09 ? 256 GLU D CB  1 
ATOM   8058  N  N   . GLY C 1 257 ? 135.460 193.107 119.263 1.00 154.46 ? 257 GLY D N   1 
ATOM   8059  C  CA  . GLY C 1 257 ? 136.546 192.749 120.166 1.00 149.43 ? 257 GLY D CA  1 
ATOM   8060  C  C   . GLY C 1 257 ? 136.100 192.621 121.608 1.00 151.82 ? 257 GLY D C   1 
ATOM   8061  O  O   . GLY C 1 257 ? 136.876 192.169 122.450 1.00 148.26 ? 257 GLY D O   1 
ATOM   8062  N  N   . SER C 1 258 ? 134.838 193.010 121.896 1.00 151.43 ? 258 SER D N   1 
ATOM   8063  C  CA  . SER C 1 258 ? 134.220 192.934 123.222 1.00 151.89 ? 258 SER D CA  1 
ATOM   8064  C  C   . SER C 1 258 ? 133.852 191.489 123.578 1.00 155.59 ? 258 SER D C   1 
ATOM   8065  O  O   . SER C 1 258 ? 133.650 191.192 124.755 1.00 155.48 ? 258 SER D O   1 
ATOM   8066  C  CB  . SER C 1 258 ? 132.984 193.825 123.292 1.00 159.49 ? 258 SER D CB  1 
ATOM   8067  O  OG  . SER C 1 258 ? 132.005 193.427 122.346 1.00 170.96 ? 258 SER D OG  1 
ATOM   8068  N  N   . LYS C 1 259 ? 133.769 190.598 122.565 1.00 152.02 ? 259 LYS D N   1 
ATOM   8069  C  CA  . LYS C 1 259 ? 133.463 189.174 122.732 1.00 151.63 ? 259 LYS D CA  1 
ATOM   8070  C  C   . LYS C 1 259 ? 134.651 188.432 123.349 1.00 150.53 ? 259 LYS D C   1 
ATOM   8071  O  O   . LYS C 1 259 ? 134.459 187.377 123.956 1.00 150.16 ? 259 LYS D O   1 
ATOM   8072  C  CB  . LYS C 1 259 ? 133.083 188.540 121.386 1.00 155.97 ? 259 LYS D CB  1 
ATOM   8073  N  N   . ARG C 1 260 ? 135.871 188.992 123.197 1.00 143.28 ? 260 ARG D N   1 
ATOM   8074  C  CA  . ARG C 1 260 ? 137.116 188.424 123.708 1.00 139.15 ? 260 ARG D CA  1 
ATOM   8075  C  C   . ARG C 1 260 ? 137.603 189.127 124.982 1.00 142.73 ? 260 ARG D C   1 
ATOM   8076  O  O   . ARG C 1 260 ? 137.777 188.457 126.001 1.00 141.55 ? 260 ARG D O   1 
ATOM   8077  C  CB  . ARG C 1 260 ? 138.221 188.480 122.642 1.00 136.12 ? 260 ARG D CB  1 
ATOM   8078  C  CG  . ARG C 1 260 ? 138.060 187.505 121.491 1.00 142.86 ? 260 ARG D CG  1 
ATOM   8079  C  CD  . ARG C 1 260 ? 139.307 187.523 120.638 1.00 145.22 ? 260 ARG D CD  1 
ATOM   8080  N  NE  . ARG C 1 260 ? 139.090 186.900 119.336 1.00 149.68 ? 260 ARG D NE  1 
ATOM   8081  C  CZ  . ARG C 1 260 ? 139.393 185.640 119.048 1.00 160.22 ? 260 ARG D CZ  1 
ATOM   8082  N  NH1 . ARG C 1 260 ? 139.923 184.846 119.970 1.00 141.46 ? 260 ARG D NH1 1 
ATOM   8083  N  NH2 . ARG C 1 260 ? 139.168 185.163 117.832 1.00 150.59 ? 260 ARG D NH2 1 
ATOM   8084  N  N   . SER C 1 261 ? 137.864 190.459 124.918 1.00 140.18 ? 261 SER D N   1 
ATOM   8085  C  CA  . SER C 1 261 ? 138.392 191.228 126.051 1.00 139.56 ? 261 SER D CA  1 
ATOM   8086  C  C   . SER C 1 261 ? 137.992 192.716 126.033 1.00 145.99 ? 261 SER D C   1 
ATOM   8087  O  O   . SER C 1 261 ? 137.530 193.231 125.016 1.00 146.78 ? 261 SER D O   1 
ATOM   8088  C  CB  . SER C 1 261 ? 139.916 191.117 126.099 1.00 139.87 ? 261 SER D CB  1 
ATOM   8089  O  OG  . SER C 1 261 ? 140.513 191.644 124.926 1.00 147.65 ? 261 SER D OG  1 
ATOM   8090  N  N   . SER C 1 262 ? 138.218 193.403 127.171 1.00 143.82 ? 262 SER D N   1 
ATOM   8091  C  CA  . SER C 1 262 ? 137.933 194.825 127.387 1.00 146.35 ? 262 SER D CA  1 
ATOM   8092  C  C   . SER C 1 262 ? 139.039 195.742 126.818 1.00 150.59 ? 262 SER D C   1 
ATOM   8093  O  O   . SER C 1 262 ? 138.923 196.966 126.923 1.00 152.36 ? 262 SER D O   1 
ATOM   8094  C  CB  . SER C 1 262 ? 137.759 195.101 128.877 1.00 151.22 ? 262 SER D CB  1 
ATOM   8095  O  OG  . SER C 1 262 ? 136.752 194.281 129.447 1.00 162.52 ? 262 SER D OG  1 
ATOM   8096  N  N   . HIS C 1 263 ? 140.100 195.155 126.221 1.00 145.24 ? 263 HIS D N   1 
ATOM   8097  C  CA  . HIS C 1 263 ? 141.226 195.887 125.636 1.00 144.38 ? 263 HIS D CA  1 
ATOM   8098  C  C   . HIS C 1 263 ? 140.812 196.640 124.362 1.00 150.44 ? 263 HIS D C   1 
ATOM   8099  O  O   . HIS C 1 263 ? 140.031 196.117 123.561 1.00 150.82 ? 263 HIS D O   1 
ATOM   8100  C  CB  . HIS C 1 263 ? 142.390 194.938 125.333 1.00 142.37 ? 263 HIS D CB  1 
ATOM   8101  C  CG  . HIS C 1 263 ? 143.065 194.395 126.554 1.00 144.43 ? 263 HIS D CG  1 
ATOM   8102  N  ND1 . HIS C 1 263 ? 144.074 195.095 127.190 1.00 146.17 ? 263 HIS D ND1 1 
ATOM   8103  C  CD2 . HIS C 1 263 ? 142.874 193.220 127.198 1.00 145.24 ? 263 HIS D CD2 1 
ATOM   8104  C  CE1 . HIS C 1 263 ? 144.458 194.332 128.200 1.00 144.68 ? 263 HIS D CE1 1 
ATOM   8105  N  NE2 . HIS C 1 263 ? 143.768 193.192 128.243 1.00 144.43 ? 263 HIS D NE2 1 
ATOM   8106  N  N   . SER C 1 264 ? 141.348 197.869 124.186 1.00 148.20 ? 264 SER D N   1 
ATOM   8107  C  CA  . SER C 1 264 ? 141.053 198.759 123.056 1.00 150.31 ? 264 SER D CA  1 
ATOM   8108  C  C   . SER C 1 264 ? 142.289 199.025 122.179 1.00 154.22 ? 264 SER D C   1 
ATOM   8109  O  O   . SER C 1 264 ? 143.381 199.230 122.712 1.00 152.63 ? 264 SER D O   1 
ATOM   8110  C  CB  . SER C 1 264 ? 140.503 200.090 123.564 1.00 155.68 ? 264 SER D CB  1 
ATOM   8111  O  OG  . SER C 1 264 ? 139.519 199.929 124.573 1.00 162.94 ? 264 SER D OG  1 
ATOM   8112  N  N   . ASN C 1 265 ? 142.103 199.040 120.834 1.00 152.59 ? 265 ASN D N   1 
ATOM   8113  C  CA  . ASN C 1 265 ? 143.143 199.303 119.822 1.00 152.86 ? 265 ASN D CA  1 
ATOM   8114  C  C   . ASN C 1 265 ? 142.510 199.627 118.441 1.00 160.40 ? 265 ASN D C   1 
ATOM   8115  O  O   . ASN C 1 265 ? 141.285 199.628 118.324 1.00 162.11 ? 265 ASN D O   1 
ATOM   8116  C  CB  . ASN C 1 265 ? 144.107 198.111 119.711 1.00 151.92 ? 265 ASN D CB  1 
ATOM   8117  C  CG  . ASN C 1 265 ? 145.481 198.481 119.194 1.00 182.37 ? 265 ASN D CG  1 
ATOM   8118  O  OD1 . ASN C 1 265 ? 146.215 199.284 119.789 1.00 173.54 ? 265 ASN D OD1 1 
ATOM   8119  N  ND2 . ASN C 1 265 ? 145.856 197.903 118.062 1.00 179.81 ? 265 ASN D ND2 1 
ATOM   8120  N  N   . ALA C 1 266 ? 143.344 199.939 117.414 1.00 158.39 ? 266 ALA D N   1 
ATOM   8121  C  CA  . ALA C 1 266 ? 142.909 200.248 116.042 1.00 161.97 ? 266 ALA D CA  1 
ATOM   8122  C  C   . ALA C 1 266 ? 144.022 199.967 115.016 1.00 166.94 ? 266 ALA D C   1 
ATOM   8123  O  O   . ALA C 1 266 ? 145.204 200.062 115.350 1.00 164.31 ? 266 ALA D O   1 
ATOM   8124  C  CB  . ALA C 1 266 ? 142.458 201.698 115.940 1.00 166.27 ? 266 ALA D CB  1 
ATOM   8125  N  N   . TYR C 1 267 ? 143.633 199.622 113.767 1.00 167.63 ? 267 TYR D N   1 
ATOM   8126  C  CA  . TYR C 1 267 ? 144.545 199.319 112.653 1.00 169.39 ? 267 TYR D CA  1 
ATOM   8127  C  C   . TYR C 1 267 ? 143.937 199.731 111.282 1.00 180.36 ? 267 TYR D C   1 
ATOM   8128  O  O   . TYR C 1 267 ? 142.818 200.247 111.235 1.00 182.70 ? 267 TYR D O   1 
ATOM   8129  C  CB  . TYR C 1 267 ? 144.898 197.822 112.659 1.00 167.53 ? 267 TYR D CB  1 
ATOM   8130  N  N   . PHE C 1 268 ? 144.686 199.527 110.174 1.00 180.04 ? 268 PHE D N   1 
ATOM   8131  C  CA  . PHE C 1 268 ? 144.233 199.855 108.813 1.00 185.68 ? 268 PHE D CA  1 
ATOM   8132  C  C   . PHE C 1 268 ? 144.812 198.870 107.784 1.00 191.44 ? 268 PHE D C   1 
ATOM   8133  O  O   . PHE C 1 268 ? 145.917 198.354 107.980 1.00 188.58 ? 268 PHE D O   1 
ATOM   8134  C  CB  . PHE C 1 268 ? 144.606 201.300 108.448 1.00 191.16 ? 268 PHE D CB  1 
ATOM   8135  N  N   . TYR C 1 269 ? 144.058 198.601 106.695 1.00 192.60 ? 269 TYR D N   1 
ATOM   8136  C  CA  . TYR C 1 269 ? 144.480 197.673 105.637 1.00 194.77 ? 269 TYR D CA  1 
ATOM   8137  C  C   . TYR C 1 269 ? 143.987 198.124 104.247 1.00 205.32 ? 269 TYR D C   1 
ATOM   8138  O  O   . TYR C 1 269 ? 143.154 199.027 104.152 1.00 207.96 ? 269 TYR D O   1 
ATOM   8139  C  CB  . TYR C 1 269 ? 143.998 196.236 105.952 1.00 193.39 ? 269 TYR D CB  1 
ATOM   8140  C  CG  . TYR C 1 269 ? 142.529 195.965 105.686 1.00 198.15 ? 269 TYR D CG  1 
ATOM   8141  C  CD1 . TYR C 1 269 ? 141.561 196.265 106.640 1.00 198.46 ? 269 TYR D CD1 1 
ATOM   8142  C  CD2 . TYR C 1 269 ? 142.115 195.346 104.508 1.00 203.54 ? 269 TYR D CD2 1 
ATOM   8143  C  CE1 . TYR C 1 269 ? 140.213 195.988 106.415 1.00 202.28 ? 269 TYR D CE1 1 
ATOM   8144  C  CE2 . TYR C 1 269 ? 140.769 195.071 104.268 1.00 207.47 ? 269 TYR D CE2 1 
ATOM   8145  C  CZ  . TYR C 1 269 ? 139.822 195.391 105.227 1.00 214.05 ? 269 TYR D CZ  1 
ATOM   8146  O  OH  . TYR C 1 269 ? 138.493 195.127 104.998 1.00 219.79 ? 269 TYR D OH  1 
ATOM   8147  N  N   . GLY C 1 270 ? 144.496 197.471 103.199 1.00 204.51 ? 270 GLY D N   1 
ATOM   8148  C  CA  . GLY C 1 270 ? 144.125 197.743 101.814 1.00 209.96 ? 270 GLY D CA  1 
ATOM   8149  C  C   . GLY C 1 270 ? 145.097 197.226 100.772 1.00 212.38 ? 270 GLY D C   1 
ATOM   8150  O  O   . GLY C 1 270 ? 145.992 196.435 101.084 1.00 210.60 ? 270 GLY D O   1 
ATOM   8151  N  N   . PHE C 1 271 ? 144.914 197.675 99.515  1.00 211.77 ? 271 PHE D N   1 
ATOM   8152  C  CA  . PHE C 1 271 ? 145.746 197.303 98.366  1.00 229.70 ? 271 PHE D CA  1 
ATOM   8153  C  C   . PHE C 1 271 ? 146.152 198.554 97.583  1.00 231.55 ? 271 PHE D C   1 
ATOM   8154  O  O   . PHE C 1 271 ? 147.101 199.240 97.959  1.00 196.91 ? 271 PHE D O   1 
ATOM   8155  C  CB  . PHE C 1 271 ? 144.995 196.306 97.458  1.00 231.94 ? 271 PHE D CB  1 
ATOM   8156  C  CG  . PHE C 1 271 ? 145.791 195.698 96.322  1.00 233.65 ? 271 PHE D CG  1 
ATOM   8157  C  CD1 . PHE C 1 271 ? 146.610 194.595 96.536  1.00 234.38 ? 271 PHE D CD1 1 
ATOM   8158  C  CD2 . PHE C 1 271 ? 145.676 196.193 95.028  1.00 237.18 ? 271 PHE D CD2 1 
ATOM   8159  C  CE1 . PHE C 1 271 ? 147.331 194.023 95.482  1.00 235.74 ? 271 PHE D CE1 1 
ATOM   8160  C  CE2 . PHE C 1 271 ? 146.397 195.620 93.974  1.00 239.81 ? 271 PHE D CE2 1 
ATOM   8161  C  CZ  . PHE C 1 271 ? 147.219 194.538 94.209  1.00 237.19 ? 271 PHE D CZ  1 
ATOM   8162  N  N   . LYS C 1 275 ? 141.110 200.285 100.129 1.00 213.85 ? 275 LYS D N   1 
ATOM   8163  C  CA  . LYS C 1 275 ? 141.596 200.511 101.489 1.00 212.07 ? 275 LYS D CA  1 
ATOM   8164  C  C   . LYS C 1 275 ? 140.433 200.642 102.482 1.00 214.82 ? 275 LYS D C   1 
ATOM   8165  O  O   . LYS C 1 275 ? 139.429 201.286 102.173 1.00 216.44 ? 275 LYS D O   1 
ATOM   8166  C  CB  . LYS C 1 275 ? 142.492 201.756 101.546 1.00 213.99 ? 275 LYS D CB  1 
ATOM   8167  N  N   . ARG C 1 276 ? 140.573 200.020 103.672 1.00 209.83 ? 276 ARG D N   1 
ATOM   8168  C  CA  . ARG C 1 276 ? 139.552 200.023 104.730 1.00 207.04 ? 276 ARG D CA  1 
ATOM   8169  C  C   . ARG C 1 276 ? 140.173 200.155 106.136 1.00 203.10 ? 276 ARG D C   1 
ATOM   8170  O  O   . ARG C 1 276 ? 141.213 199.550 106.420 1.00 198.45 ? 276 ARG D O   1 
ATOM   8171  C  CB  . ARG C 1 276 ? 138.692 198.747 104.659 1.00 208.62 ? 276 ARG D CB  1 
ATOM   8172  C  CG  . ARG C 1 276 ? 137.655 198.733 103.534 1.00 221.62 ? 276 ARG D CG  1 
ATOM   8173  C  CD  . ARG C 1 276 ? 137.773 197.504 102.646 1.00 229.50 ? 276 ARG D CD  1 
ATOM   8174  N  NE  . ARG C 1 276 ? 138.921 197.580 101.738 1.00 236.14 ? 276 ARG D NE  1 
ATOM   8175  C  CZ  . ARG C 1 276 ? 139.367 196.568 101.001 1.00 245.89 ? 276 ARG D CZ  1 
ATOM   8176  N  NH1 . ARG C 1 276 ? 138.768 195.383 101.056 1.00 237.29 ? 276 ARG D NH1 1 
ATOM   8177  N  NH2 . ARG C 1 276 ? 140.416 196.729 100.207 1.00 237.54 ? 276 ARG D NH2 1 
ATOM   8178  N  N   . ILE C 1 277 ? 139.507 200.937 107.014 1.00 198.04 ? 277 ILE D N   1 
ATOM   8179  C  CA  . ILE C 1 277 ? 139.916 201.199 108.399 1.00 191.87 ? 277 ILE D CA  1 
ATOM   8180  C  C   . ILE C 1 277 ? 139.344 200.131 109.353 1.00 189.93 ? 277 ILE D C   1 
ATOM   8181  O  O   . ILE C 1 277 ? 138.233 199.643 109.126 1.00 192.05 ? 277 ILE D O   1 
ATOM   8182  C  CB  . ILE C 1 277 ? 139.461 202.619 108.810 1.00 197.25 ? 277 ILE D CB  1 
ATOM   8183  N  N   . VAL C 1 278 ? 140.104 199.775 110.419 1.00 178.88 ? 278 VAL D N   1 
ATOM   8184  C  CA  . VAL C 1 278 ? 139.703 198.775 111.426 1.00 173.42 ? 278 VAL D CA  1 
ATOM   8185  C  C   . VAL C 1 278 ? 139.793 199.394 112.842 1.00 171.22 ? 278 VAL D C   1 
ATOM   8186  O  O   . VAL C 1 278 ? 140.872 199.791 113.285 1.00 167.78 ? 278 VAL D O   1 
ATOM   8187  C  CB  . VAL C 1 278 ? 140.531 197.465 111.294 1.00 173.97 ? 278 VAL D CB  1 
ATOM   8188  C  CG1 . VAL C 1 278 ? 140.427 196.592 112.541 1.00 169.20 ? 278 VAL D CG1 1 
ATOM   8189  C  CG2 . VAL C 1 278 ? 140.113 196.676 110.058 1.00 177.13 ? 278 VAL D CG2 1 
ATOM   8190  N  N   . LEU C 1 279 ? 138.648 199.470 113.539 1.00 166.93 ? 279 LEU D N   1 
ATOM   8191  C  CA  . LEU C 1 279 ? 138.557 200.028 114.889 1.00 163.98 ? 279 LEU D CA  1 
ATOM   8192  C  C   . LEU C 1 279 ? 137.770 199.097 115.814 1.00 164.73 ? 279 LEU D C   1 
ATOM   8193  O  O   . LEU C 1 279 ? 136.731 198.574 115.413 1.00 167.30 ? 279 LEU D O   1 
ATOM   8194  C  CB  . LEU C 1 279 ? 137.903 201.417 114.853 1.00 167.97 ? 279 LEU D CB  1 
ATOM   8195  N  N   . PHE C 1 280 ? 138.272 198.888 117.046 1.00 155.53 ? 280 PHE D N   1 
ATOM   8196  C  CA  . PHE C 1 280 ? 137.648 198.046 118.073 1.00 152.73 ? 280 PHE D CA  1 
ATOM   8197  C  C   . PHE C 1 280 ? 136.348 198.651 118.579 1.00 158.68 ? 280 PHE D C   1 
ATOM   8198  O  O   . PHE C 1 280 ? 136.250 199.875 118.683 1.00 160.68 ? 280 PHE D O   1 
ATOM   8199  C  CB  . PHE C 1 280 ? 138.606 197.879 119.259 1.00 150.36 ? 280 PHE D CB  1 
ATOM   8200  C  CG  . PHE C 1 280 ? 139.545 196.700 119.209 1.00 148.31 ? 280 PHE D CG  1 
ATOM   8201  C  CD1 . PHE C 1 280 ? 140.494 196.587 118.198 1.00 150.80 ? 280 PHE D CD1 1 
ATOM   8202  C  CD2 . PHE C 1 280 ? 139.533 195.742 120.213 1.00 148.20 ? 280 PHE D CD2 1 
ATOM   8203  C  CE1 . PHE C 1 280 ? 141.384 195.514 118.171 1.00 148.95 ? 280 PHE D CE1 1 
ATOM   8204  C  CE2 . PHE C 1 280 ? 140.421 194.667 120.184 1.00 148.27 ? 280 PHE D CE2 1 
ATOM   8205  C  CZ  . PHE C 1 280 ? 141.339 194.559 119.162 1.00 145.92 ? 280 PHE D CZ  1 
ATOM   8206  N  N   . ASP C 1 281 ? 135.364 197.803 118.935 1.00 155.00 ? 281 ASP D N   1 
ATOM   8207  C  CA  . ASP C 1 281 ? 134.085 198.272 119.478 1.00 158.16 ? 281 ASP D CA  1 
ATOM   8208  C  C   . ASP C 1 281 ? 134.264 198.760 120.924 1.00 160.99 ? 281 ASP D C   1 
ATOM   8209  O  O   . ASP C 1 281 ? 133.451 199.549 121.407 1.00 164.10 ? 281 ASP D O   1 
ATOM   8210  C  CB  . ASP C 1 281 ? 132.995 197.188 119.385 1.00 161.61 ? 281 ASP D CB  1 
ATOM   8211  C  CG  . ASP C 1 281 ? 133.276 195.878 120.098 1.00 165.78 ? 281 ASP D CG  1 
ATOM   8212  O  OD1 . ASP C 1 281 ? 134.445 195.638 120.468 1.00 162.04 ? 281 ASP D OD1 1 
ATOM   8213  O  OD2 . ASP C 1 281 ? 132.334 195.075 120.246 1.00 172.48 ? 281 ASP D OD2 1 
ATOM   8214  N  N   . THR C 1 282 ? 135.347 198.307 121.591 1.00 153.01 ? 282 THR D N   1 
ATOM   8215  C  CA  . THR C 1 282 ? 135.724 198.696 122.954 1.00 151.31 ? 282 THR D CA  1 
ATOM   8216  C  C   . THR C 1 282 ? 136.299 200.118 122.960 1.00 155.36 ? 282 THR D C   1 
ATOM   8217  O  O   . THR C 1 282 ? 136.192 200.810 123.972 1.00 156.44 ? 282 THR D O   1 
ATOM   8218  C  CB  . THR C 1 282 ? 136.726 197.700 123.555 1.00 156.37 ? 282 THR D CB  1 
ATOM   8219  O  OG1 . THR C 1 282 ? 137.785 197.462 122.624 1.00 153.33 ? 282 THR D OG1 1 
ATOM   8220  C  CG2 . THR C 1 282 ? 136.076 196.386 123.960 1.00 155.85 ? 282 THR D CG2 1 
ATOM   8221  N  N   . LEU C 1 283 ? 136.911 200.542 121.834 1.00 150.63 ? 283 LEU D N   1 
ATOM   8222  C  CA  . LEU C 1 283 ? 137.495 201.873 121.642 1.00 151.10 ? 283 LEU D CA  1 
ATOM   8223  C  C   . LEU C 1 283 ? 136.400 202.914 121.354 1.00 159.60 ? 283 LEU D C   1 
ATOM   8224  O  O   . LEU C 1 283 ? 136.537 204.066 121.765 1.00 160.98 ? 283 LEU D O   1 
ATOM   8225  C  CB  . LEU C 1 283 ? 138.510 201.824 120.479 1.00 149.70 ? 283 LEU D CB  1 
ATOM   8226  C  CG  . LEU C 1 283 ? 139.402 203.049 120.241 1.00 154.97 ? 283 LEU D CG  1 
ATOM   8227  C  CD1 . LEU C 1 283 ? 140.793 202.629 119.859 1.00 152.22 ? 283 LEU D CD1 1 
ATOM   8228  C  CD2 . LEU C 1 283 ? 138.854 203.922 119.133 1.00 161.63 ? 283 LEU D CD2 1 
ATOM   8229  N  N   . LEU C 1 284 ? 135.336 202.513 120.627 1.00 158.31 ? 284 LEU D N   1 
ATOM   8230  C  CA  . LEU C 1 284 ? 134.234 203.382 120.211 1.00 163.14 ? 284 LEU D CA  1 
ATOM   8231  C  C   . LEU C 1 284 ? 133.174 203.602 121.305 1.00 170.21 ? 284 LEU D C   1 
ATOM   8232  O  O   . LEU C 1 284 ? 132.628 204.708 121.392 1.00 174.28 ? 284 LEU D O   1 
ATOM   8233  C  CB  . LEU C 1 284 ? 133.563 202.805 118.960 1.00 165.43 ? 284 LEU D CB  1 
ATOM   8234  N  N   . GLU C 1 285 ? 132.865 202.561 122.113 1.00 164.77 ? 285 GLU D N   1 
ATOM   8235  C  CA  . GLU C 1 285 ? 131.851 202.612 123.178 1.00 192.65 ? 285 GLU D CA  1 
ATOM   8236  C  C   . GLU C 1 285 ? 132.223 203.614 124.283 1.00 202.01 ? 285 GLU D C   1 
ATOM   8237  O  O   . GLU C 1 285 ? 131.672 204.716 124.326 1.00 154.68 ? 285 GLU D O   1 
ATOM   8238  C  CB  . GLU C 1 285 ? 131.619 201.214 123.782 1.00 191.80 ? 285 GLU D CB  1 
ATOM   8239  C  CG  . GLU C 1 285 ? 130.604 200.385 123.010 1.00 202.40 ? 285 GLU D CG  1 
ATOM   8240  C  CD  . GLU C 1 285 ? 130.371 198.972 123.513 1.00 212.50 ? 285 GLU D CD  1 
ATOM   8241  O  OE1 . GLU C 1 285 ? 129.933 198.812 124.675 1.00 199.09 ? 285 GLU D OE1 1 
ATOM   8242  O  OE2 . GLU C 1 285 ? 130.574 198.025 122.720 1.00 203.12 ? 285 GLU D OE2 1 
ATOM   8243  N  N   . GLN C 1 322 ? 134.469 203.832 129.462 1.00 171.44 ? 322 GLN D N   1 
ATOM   8244  C  CA  . GLN C 1 322 ? 134.028 202.770 128.562 1.00 169.89 ? 322 GLN D CA  1 
ATOM   8245  C  C   . GLN C 1 322 ? 135.001 202.600 127.381 1.00 170.22 ? 322 GLN D C   1 
ATOM   8246  O  O   . GLN C 1 322 ? 135.447 201.483 127.114 1.00 166.40 ? 322 GLN D O   1 
ATOM   8247  C  CB  . GLN C 1 322 ? 132.600 203.043 128.055 1.00 175.77 ? 322 GLN D CB  1 
ATOM   8248  N  N   . GLY C 1 323 ? 135.314 203.706 126.703 1.00 167.86 ? 323 GLY D N   1 
ATOM   8249  C  CA  . GLY C 1 323 ? 136.217 203.740 125.559 1.00 165.41 ? 323 GLY D CA  1 
ATOM   8250  C  C   . GLY C 1 323 ? 136.748 205.131 125.290 1.00 171.18 ? 323 GLY D C   1 
ATOM   8251  O  O   . GLY C 1 323 ? 137.347 205.741 126.179 1.00 171.20 ? 323 GLY D O   1 
ATOM   8252  N  N   . CYS C 1 324 ? 136.516 205.645 124.064 1.00 169.14 ? 324 CYS D N   1 
ATOM   8253  C  CA  . CYS C 1 324 ? 136.936 206.981 123.623 1.00 170.87 ? 324 CYS D CA  1 
ATOM   8254  C  C   . CYS C 1 324 ? 135.785 207.710 122.928 1.00 178.38 ? 324 CYS D C   1 
ATOM   8255  O  O   . CYS C 1 324 ? 135.012 207.085 122.196 1.00 178.89 ? 324 CYS D O   1 
ATOM   8256  C  CB  . CYS C 1 324 ? 138.156 206.894 122.709 1.00 168.85 ? 324 CYS D CB  1 
ATOM   8257  S  SG  . CYS C 1 324 ? 139.742 206.844 123.582 1.00 169.16 ? 324 CYS D SG  1 
ATOM   8258  N  N   . LYS C 1 325 ? 135.696 209.040 123.139 1.00 177.60 ? 325 LYS D N   1 
ATOM   8259  C  CA  . LYS C 1 325 ? 134.691 209.909 122.514 1.00 182.41 ? 325 LYS D CA  1 
ATOM   8260  C  C   . LYS C 1 325 ? 134.999 210.066 121.023 1.00 186.29 ? 325 LYS D C   1 
ATOM   8261  O  O   . LYS C 1 325 ? 136.150 209.878 120.624 1.00 183.24 ? 325 LYS D O   1 
ATOM   8262  C  CB  . LYS C 1 325 ? 134.652 211.281 123.208 1.00 188.44 ? 325 LYS D CB  1 
ATOM   8263  N  N   . ASN C 1 326 ? 133.981 210.409 120.203 1.00 186.22 ? 326 ASN D N   1 
ATOM   8264  C  CA  . ASN C 1 326 ? 134.104 210.567 118.746 1.00 187.53 ? 326 ASN D CA  1 
ATOM   8265  C  C   . ASN C 1 326 ? 135.258 211.502 118.337 1.00 190.04 ? 326 ASN D C   1 
ATOM   8266  O  O   . ASN C 1 326 ? 135.928 211.224 117.338 1.00 188.80 ? 326 ASN D O   1 
ATOM   8267  C  CB  . ASN C 1 326 ? 132.790 211.053 118.135 1.00 194.84 ? 326 ASN D CB  1 
ATOM   8268  C  CG  . ASN C 1 326 ? 131.680 210.021 118.126 1.00 219.91 ? 326 ASN D CG  1 
ATOM   8269  O  OD1 . ASN C 1 326 ? 131.904 208.802 118.157 1.00 209.86 ? 326 ASN D OD1 1 
ATOM   8270  N  ND2 . ASN C 1 326 ? 130.446 210.493 118.048 1.00 218.03 ? 326 ASN D ND2 1 
ATOM   8271  N  N   . GLU C 1 327 ? 135.510 212.573 119.125 1.00 186.68 ? 327 GLU D N   1 
ATOM   8272  C  CA  . GLU C 1 327 ? 136.597 213.533 118.899 1.00 186.64 ? 327 GLU D CA  1 
ATOM   8273  C  C   . GLU C 1 327 ? 137.972 212.868 119.099 1.00 184.19 ? 327 GLU D C   1 
ATOM   8274  O  O   . GLU C 1 327 ? 138.910 213.160 118.352 1.00 183.96 ? 327 GLU D O   1 
ATOM   8275  C  CB  . GLU C 1 327 ? 136.446 214.744 119.831 1.00 190.88 ? 327 GLU D CB  1 
ATOM   8276  N  N   . GLU C 1 328 ? 138.077 211.965 120.095 1.00 175.65 ? 328 GLU D N   1 
ATOM   8277  C  CA  . GLU C 1 328 ? 139.299 211.224 120.417 1.00 170.16 ? 328 GLU D CA  1 
ATOM   8278  C  C   . GLU C 1 328 ? 139.552 210.122 119.393 1.00 170.50 ? 328 GLU D C   1 
ATOM   8279  O  O   . GLU C 1 328 ? 140.709 209.873 119.059 1.00 168.31 ? 328 GLU D O   1 
ATOM   8280  C  CB  . GLU C 1 328 ? 139.223 210.629 121.832 1.00 168.57 ? 328 GLU D CB  1 
ATOM   8281  C  CG  . GLU C 1 328 ? 139.440 211.648 122.937 1.00 181.75 ? 328 GLU D CG  1 
ATOM   8282  C  CD  . GLU C 1 328 ? 139.015 211.181 124.316 1.00 201.80 ? 328 GLU D CD  1 
ATOM   8283  O  OE1 . GLU C 1 328 ? 137.800 211.234 124.613 1.00 199.56 ? 328 GLU D OE1 1 
ATOM   8284  O  OE2 . GLU C 1 328 ? 139.897 210.776 125.106 1.00 193.82 ? 328 GLU D OE2 1 
ATOM   8285  N  N   . VAL C 1 329 ? 138.473 209.467 118.898 1.00 166.57 ? 329 VAL D N   1 
ATOM   8286  C  CA  . VAL C 1 329 ? 138.511 208.383 117.904 1.00 164.22 ? 329 VAL D CA  1 
ATOM   8287  C  C   . VAL C 1 329 ? 139.109 208.918 116.588 1.00 170.79 ? 329 VAL D C   1 
ATOM   8288  O  O   . VAL C 1 329 ? 139.997 208.275 116.024 1.00 168.15 ? 329 VAL D O   1 
ATOM   8289  C  CB  . VAL C 1 329 ? 137.111 207.735 117.699 1.00 169.07 ? 329 VAL D CB  1 
ATOM   8290  C  CG1 . VAL C 1 329 ? 137.096 206.777 116.510 1.00 168.49 ? 329 VAL D CG1 1 
ATOM   8291  C  CG2 . VAL C 1 329 ? 136.649 207.013 118.960 1.00 166.03 ? 329 VAL D CG2 1 
ATOM   8292  N  N   . LEU C 1 330 ? 138.654 210.109 116.138 1.00 172.51 ? 330 LEU D N   1 
ATOM   8293  C  CA  . LEU C 1 330 ? 139.127 210.775 114.918 1.00 176.02 ? 330 LEU D CA  1 
ATOM   8294  C  C   . LEU C 1 330 ? 140.626 211.108 115.006 1.00 178.28 ? 330 LEU D C   1 
ATOM   8295  O  O   . LEU C 1 330 ? 141.336 210.999 114.001 1.00 179.06 ? 330 LEU D O   1 
ATOM   8296  C  CB  . LEU C 1 330 ? 138.314 212.048 114.654 1.00 181.99 ? 330 LEU D CB  1 
ATOM   8297  N  N   . ALA C 1 331 ? 141.099 211.488 116.212 1.00 172.28 ? 331 ALA D N   1 
ATOM   8298  C  CA  . ALA C 1 331 ? 142.503 211.796 116.488 1.00 170.49 ? 331 ALA D CA  1 
ATOM   8299  C  C   . ALA C 1 331 ? 143.359 210.533 116.404 1.00 169.43 ? 331 ALA D C   1 
ATOM   8300  O  O   . ALA C 1 331 ? 144.483 210.590 115.899 1.00 169.51 ? 331 ALA D O   1 
ATOM   8301  C  CB  . ALA C 1 331 ? 142.636 212.426 117.859 1.00 170.59 ? 331 ALA D CB  1 
ATOM   8302  N  N   . VAL C 1 332 ? 142.810 209.390 116.883 1.00 161.40 ? 332 VAL D N   1 
ATOM   8303  C  CA  . VAL C 1 332 ? 143.436 208.064 116.851 1.00 156.40 ? 332 VAL D CA  1 
ATOM   8304  C  C   . VAL C 1 332 ? 143.527 207.627 115.375 1.00 162.12 ? 332 VAL D C   1 
ATOM   8305  O  O   . VAL C 1 332 ? 144.538 207.045 114.977 1.00 160.49 ? 332 VAL D O   1 
ATOM   8306  C  CB  . VAL C 1 332 ? 142.670 207.054 117.755 1.00 156.48 ? 332 VAL D CB  1 
ATOM   8307  C  CG1 . VAL C 1 332 ? 143.019 205.605 117.434 1.00 152.79 ? 332 VAL D CG1 1 
ATOM   8308  C  CG2 . VAL C 1 332 ? 142.925 207.343 119.230 1.00 154.47 ? 332 VAL D CG2 1 
ATOM   8309  N  N   . LEU C 1 333 ? 142.503 207.973 114.561 1.00 162.24 ? 333 LEU D N   1 
ATOM   8310  C  CA  . LEU C 1 333 ? 142.468 207.691 113.123 1.00 164.64 ? 333 LEU D CA  1 
ATOM   8311  C  C   . LEU C 1 333 ? 143.539 208.497 112.400 1.00 171.17 ? 333 LEU D C   1 
ATOM   8312  O  O   . LEU C 1 333 ? 144.261 207.933 111.582 1.00 170.74 ? 333 LEU D O   1 
ATOM   8313  C  CB  . LEU C 1 333 ? 141.082 207.978 112.519 1.00 168.91 ? 333 LEU D CB  1 
ATOM   8314  C  CG  . LEU C 1 333 ? 139.960 207.021 112.912 1.00 171.99 ? 333 LEU D CG  1 
ATOM   8315  C  CD1 . LEU C 1 333 ? 138.615 207.610 112.581 1.00 177.02 ? 333 LEU D CD1 1 
ATOM   8316  C  CD2 . LEU C 1 333 ? 140.129 205.656 112.254 1.00 173.02 ? 333 LEU D CD2 1 
ATOM   8317  N  N   . GLY C 1 334 ? 143.665 209.781 112.759 1.00 170.21 ? 334 GLY D N   1 
ATOM   8318  C  CA  . GLY C 1 334 ? 144.661 210.704 112.217 1.00 173.36 ? 334 GLY D CA  1 
ATOM   8319  C  C   . GLY C 1 334 ? 146.091 210.222 112.388 1.00 174.25 ? 334 GLY D C   1 
ATOM   8320  O  O   . GLY C 1 334 ? 146.944 210.488 111.536 1.00 176.92 ? 334 GLY D O   1 
ATOM   8321  N  N   . HIS C 1 335 ? 146.349 209.490 113.490 1.00 165.20 ? 335 HIS D N   1 
ATOM   8322  C  CA  . HIS C 1 335 ? 147.633 208.869 113.814 1.00 161.99 ? 335 HIS D CA  1 
ATOM   8323  C  C   . HIS C 1 335 ? 147.859 207.688 112.862 1.00 164.97 ? 335 HIS D C   1 
ATOM   8324  O  O   . HIS C 1 335 ? 148.909 207.615 112.225 1.00 165.65 ? 335 HIS D O   1 
ATOM   8325  C  CB  . HIS C 1 335 ? 147.647 208.427 115.297 1.00 158.26 ? 335 HIS D CB  1 
ATOM   8326  C  CG  . HIS C 1 335 ? 148.734 207.459 115.668 1.00 158.17 ? 335 HIS D CG  1 
ATOM   8327  N  ND1 . HIS C 1 335 ? 149.971 207.895 116.107 1.00 160.42 ? 335 HIS D ND1 1 
ATOM   8328  C  CD2 . HIS C 1 335 ? 148.716 206.104 115.690 1.00 156.34 ? 335 HIS D CD2 1 
ATOM   8329  C  CE1 . HIS C 1 335 ? 150.670 206.799 116.363 1.00 156.57 ? 335 HIS D CE1 1 
ATOM   8330  N  NE2 . HIS C 1 335 ? 149.961 205.696 116.113 1.00 154.31 ? 335 HIS D NE2 1 
ATOM   8331  N  N   . ALA C 1 336 ? 146.853 206.781 112.757 1.00 159.99 ? 336 ALA D N   1 
ATOM   8332  C  CA  . ALA C 1 336 ? 146.862 205.587 111.904 1.00 158.98 ? 336 ALA D CA  1 
ATOM   8333  C  C   . ALA C 1 336 ? 146.964 205.956 110.423 1.00 168.17 ? 336 ALA D C   1 
ATOM   8334  O  O   . ALA C 1 336 ? 147.662 205.269 109.677 1.00 168.64 ? 336 ALA D O   1 
ATOM   8335  C  CB  . ALA C 1 336 ? 145.614 204.754 112.151 1.00 157.64 ? 336 ALA D CB  1 
ATOM   8336  N  N   . LEU C 1 337 ? 146.303 207.059 110.010 1.00 168.84 ? 337 LEU D N   1 
ATOM   8337  C  CA  . LEU C 1 337 ? 146.346 207.577 108.640 1.00 174.55 ? 337 LEU D CA  1 
ATOM   8338  C  C   . LEU C 1 337 ? 147.745 208.113 108.326 1.00 181.31 ? 337 LEU D C   1 
ATOM   8339  O  O   . LEU C 1 337 ? 148.126 208.189 107.158 1.00 185.22 ? 337 LEU D O   1 
ATOM   8340  C  CB  . LEU C 1 337 ? 145.286 208.675 108.426 1.00 178.96 ? 337 LEU D CB  1 
ATOM   8341  C  CG  . LEU C 1 337 ? 143.828 208.216 108.330 1.00 183.78 ? 337 LEU D CG  1 
ATOM   8342  C  CD1 . LEU C 1 337 ? 142.882 209.309 108.782 1.00 186.42 ? 337 LEU D CD1 1 
ATOM   8343  C  CD2 . LEU C 1 337 ? 143.477 207.750 106.925 1.00 190.61 ? 337 LEU D CD2 1 
ATOM   8344  N  N   . GLY C 1 338 ? 148.488 208.452 109.383 1.00 175.99 ? 338 GLY D N   1 
ATOM   8345  C  CA  . GLY C 1 338 ? 149.859 208.940 109.317 1.00 178.03 ? 338 GLY D CA  1 
ATOM   8346  C  C   . GLY C 1 338 ? 150.827 207.914 108.767 1.00 182.18 ? 338 GLY D C   1 
ATOM   8347  O  O   . GLY C 1 338 ? 151.694 208.265 107.967 1.00 186.13 ? 338 GLY D O   1 
ATOM   8348  N  N   . HIS C 1 339 ? 150.662 206.630 109.165 1.00 174.26 ? 339 HIS D N   1 
ATOM   8349  C  CA  . HIS C 1 339 ? 151.489 205.504 108.707 1.00 173.17 ? 339 HIS D CA  1 
ATOM   8350  C  C   . HIS C 1 339 ? 151.320 205.264 107.200 1.00 181.56 ? 339 HIS D C   1 
ATOM   8351  O  O   . HIS C 1 339 ? 152.264 204.833 106.532 1.00 183.04 ? 339 HIS D O   1 
ATOM   8352  C  CB  . HIS C 1 339 ? 151.151 204.225 109.485 1.00 168.24 ? 339 HIS D CB  1 
ATOM   8353  C  CG  . HIS C 1 339 ? 151.498 204.287 110.941 1.00 167.65 ? 339 HIS D CG  1 
ATOM   8354  N  ND1 . HIS C 1 339 ? 152.809 204.416 111.365 1.00 169.35 ? 339 HIS D ND1 1 
ATOM   8355  C  CD2 . HIS C 1 339 ? 150.693 204.200 112.026 1.00 165.96 ? 339 HIS D CD2 1 
ATOM   8356  C  CE1 . HIS C 1 339 ? 152.760 204.414 112.687 1.00 165.26 ? 339 HIS D CE1 1 
ATOM   8357  N  NE2 . HIS C 1 339 ? 151.508 204.284 113.132 1.00 163.43 ? 339 HIS D NE2 1 
ATOM   8358  N  N   . TRP C 1 340 ? 150.118 205.564 106.676 1.00 180.28 ? 340 TRP D N   1 
ATOM   8359  C  CA  . TRP C 1 340 ? 149.781 205.459 105.260 1.00 185.24 ? 340 TRP D CA  1 
ATOM   8360  C  C   . TRP C 1 340 ? 150.443 206.612 104.482 1.00 194.04 ? 340 TRP D C   1 
ATOM   8361  O  O   . TRP C 1 340 ? 151.141 206.357 103.500 1.00 197.15 ? 340 TRP D O   1 
ATOM   8362  C  CB  . TRP C 1 340 ? 148.248 205.463 105.075 1.00 185.14 ? 340 TRP D CB  1 
ATOM   8363  C  CG  . TRP C 1 340 ? 147.796 205.536 103.643 1.00 192.74 ? 340 TRP D CG  1 
ATOM   8364  C  CD1 . TRP C 1 340 ? 147.727 204.507 102.751 1.00 197.12 ? 340 TRP D CD1 1 
ATOM   8365  C  CD2 . TRP C 1 340 ? 147.357 206.707 102.940 1.00 198.68 ? 340 TRP D CD2 1 
ATOM   8366  N  NE1 . TRP C 1 340 ? 147.276 204.963 101.534 1.00 199.95 ? 340 TRP D NE1 1 
ATOM   8367  C  CE2 . TRP C 1 340 ? 147.042 206.311 101.621 1.00 202.39 ? 340 TRP D CE2 1 
ATOM   8368  C  CE3 . TRP C 1 340 ? 147.208 208.061 103.295 1.00 200.87 ? 340 TRP D CE3 1 
ATOM   8369  C  CZ2 . TRP C 1 340 ? 146.586 207.218 100.654 1.00 204.25 ? 340 TRP D CZ2 1 
ATOM   8370  C  CZ3 . TRP C 1 340 ? 146.748 208.958 102.340 1.00 204.12 ? 340 TRP D CZ3 1 
ATOM   8371  C  CH2 . TRP C 1 340 ? 146.442 208.536 101.038 1.00 205.54 ? 340 TRP D CH2 1 
ATOM   8372  N  N   . LYS C 1 341 ? 150.234 207.867 104.939 1.00 191.35 ? 341 LYS D N   1 
ATOM   8373  C  CA  . LYS C 1 341 ? 150.747 209.094 104.321 1.00 197.16 ? 341 LYS D CA  1 
ATOM   8374  C  C   . LYS C 1 341 ? 152.278 209.216 104.396 1.00 199.51 ? 341 LYS D C   1 
ATOM   8375  O  O   . LYS C 1 341 ? 152.889 209.650 103.417 1.00 200.57 ? 341 LYS D O   1 
ATOM   8376  C  CB  . LYS C 1 341 ? 150.101 210.328 104.962 1.00 200.31 ? 341 LYS D CB  1 
ATOM   8377  N  N   . LEU C 1 342 ? 152.892 208.843 105.541 1.00 191.94 ? 342 LEU D N   1 
ATOM   8378  C  CA  . LEU C 1 342 ? 154.349 208.912 105.731 1.00 192.27 ? 342 LEU D CA  1 
ATOM   8379  C  C   . LEU C 1 342 ? 155.067 207.688 105.121 1.00 195.20 ? 342 LEU D C   1 
ATOM   8380  O  O   . LEU C 1 342 ? 156.298 207.620 105.158 1.00 196.08 ? 342 LEU D O   1 
ATOM   8381  C  CB  . LEU C 1 342 ? 154.718 209.065 107.220 1.00 187.51 ? 342 LEU D CB  1 
ATOM   8382  C  CG  . LEU C 1 342 ? 154.418 210.427 107.851 1.00 194.01 ? 342 LEU D CG  1 
ATOM   8383  C  CD1 . LEU C 1 342 ? 154.049 210.283 109.304 1.00 188.47 ? 342 LEU D CD1 1 
ATOM   8384  C  CD2 . LEU C 1 342 ? 155.592 211.380 107.702 1.00 201.98 ? 342 LEU D CD2 1 
ATOM   8385  N  N   . GLY C 1 343 ? 154.291 206.762 104.553 1.00 189.92 ? 343 GLY D N   1 
ATOM   8386  C  CA  . GLY C 1 343 ? 154.785 205.556 103.896 1.00 189.36 ? 343 GLY D CA  1 
ATOM   8387  C  C   . GLY C 1 343 ? 155.476 204.558 104.801 1.00 186.64 ? 343 GLY D C   1 
ATOM   8388  O  O   . GLY C 1 343 ? 156.376 203.843 104.352 1.00 187.17 ? 343 GLY D O   1 
ATOM   8389  N  N   . HIS C 1 344 ? 155.054 204.496 106.080 1.00 177.10 ? 344 HIS D N   1 
ATOM   8390  C  CA  . HIS C 1 344 ? 155.601 203.571 107.076 1.00 171.34 ? 344 HIS D CA  1 
ATOM   8391  C  C   . HIS C 1 344 ? 155.275 202.126 106.700 1.00 171.16 ? 344 HIS D C   1 
ATOM   8392  O  O   . HIS C 1 344 ? 156.096 201.231 106.920 1.00 168.82 ? 344 HIS D O   1 
ATOM   8393  C  CB  . HIS C 1 344 ? 155.066 203.899 108.481 1.00 167.73 ? 344 HIS D CB  1 
ATOM   8394  C  CG  . HIS C 1 344 ? 155.536 205.212 109.029 1.00 173.61 ? 344 HIS D CG  1 
ATOM   8395  N  ND1 . HIS C 1 344 ? 154.755 205.946 109.900 1.00 173.93 ? 344 HIS D ND1 1 
ATOM   8396  C  CD2 . HIS C 1 344 ? 156.693 205.883 108.809 1.00 179.79 ? 344 HIS D CD2 1 
ATOM   8397  C  CE1 . HIS C 1 344 ? 155.452 207.035 110.177 1.00 176.55 ? 344 HIS D CE1 1 
ATOM   8398  N  NE2 . HIS C 1 344 ? 156.627 207.040 109.546 1.00 180.47 ? 344 HIS D NE2 1 
ATOM   8399  N  N   . THR C 1 345 ? 154.085 201.916 106.101 1.00 167.11 ? 345 THR D N   1 
ATOM   8400  C  CA  . THR C 1 345 ? 153.584 200.620 105.639 1.00 164.83 ? 345 THR D CA  1 
ATOM   8401  C  C   . THR C 1 345 ? 154.501 200.068 104.531 1.00 170.53 ? 345 THR D C   1 
ATOM   8402  O  O   . THR C 1 345 ? 154.993 198.945 104.657 1.00 167.40 ? 345 THR D O   1 
ATOM   8403  C  CB  . THR C 1 345 ? 152.120 200.754 105.152 1.00 175.61 ? 345 THR D CB  1 
ATOM   8404  O  OG1 . THR C 1 345 ? 151.358 201.555 106.064 1.00 173.38 ? 345 THR D OG1 1 
ATOM   8405  C  CG2 . THR C 1 345 ? 151.444 199.395 104.939 1.00 171.79 ? 345 THR D CG2 1 
ATOM   8406  N  N   . VAL C 1 346 ? 154.745 200.879 103.470 1.00 171.93 ? 346 VAL D N   1 
ATOM   8407  C  CA  . VAL C 1 346 ? 155.574 200.537 102.310 1.00 175.93 ? 346 VAL D CA  1 
ATOM   8408  C  C   . VAL C 1 346 ? 157.037 200.317 102.705 1.00 176.99 ? 346 VAL D C   1 
ATOM   8409  O  O   . VAL C 1 346 ? 157.656 199.383 102.195 1.00 177.69 ? 346 VAL D O   1 
ATOM   8410  C  CB  . VAL C 1 346 ? 155.464 201.604 101.203 1.00 186.54 ? 346 VAL D CB  1 
ATOM   8411  N  N   . LYS C 1 347 ? 157.579 201.158 103.619 1.00 170.35 ? 347 LYS D N   1 
ATOM   8412  C  CA  . LYS C 1 347 ? 158.959 201.065 104.108 1.00 169.19 ? 347 LYS D CA  1 
ATOM   8413  C  C   . LYS C 1 347 ? 159.199 199.738 104.841 1.00 166.08 ? 347 LYS D C   1 
ATOM   8414  O  O   . LYS C 1 347 ? 160.245 199.118 104.642 1.00 167.17 ? 347 LYS D O   1 
ATOM   8415  C  CB  . LYS C 1 347 ? 159.295 202.252 105.023 1.00 170.94 ? 347 LYS D CB  1 
ATOM   8416  N  N   . ASN C 1 348 ? 158.212 199.287 105.648 1.00 155.57 ? 348 ASN D N   1 
ATOM   8417  C  CA  . ASN C 1 348 ? 158.267 198.039 106.417 1.00 149.22 ? 348 ASN D CA  1 
ATOM   8418  C  C   . ASN C 1 348 ? 158.313 196.803 105.499 1.00 152.12 ? 348 ASN D C   1 
ATOM   8419  O  O   . ASN C 1 348 ? 158.978 195.826 105.849 1.00 149.75 ? 348 ASN D O   1 
ATOM   8420  C  CB  . ASN C 1 348 ? 157.082 197.942 107.379 1.00 144.02 ? 348 ASN D CB  1 
ATOM   8421  N  N   . ILE C 1 349 ? 157.628 196.850 104.333 1.00 150.56 ? 349 ILE D N   1 
ATOM   8422  C  CA  . ILE C 1 349 ? 157.608 195.749 103.361 1.00 151.82 ? 349 ILE D CA  1 
ATOM   8423  C  C   . ILE C 1 349 ? 158.976 195.669 102.663 1.00 160.18 ? 349 ILE D C   1 
ATOM   8424  O  O   . ILE C 1 349 ? 159.506 194.570 102.488 1.00 159.45 ? 349 ILE D O   1 
ATOM   8425  C  CB  . ILE C 1 349 ? 156.438 195.871 102.338 1.00 157.87 ? 349 ILE D CB  1 
ATOM   8426  C  CG1 . ILE C 1 349 ? 155.080 196.080 103.049 1.00 153.74 ? 349 ILE D CG1 1 
ATOM   8427  C  CG2 . ILE C 1 349 ? 156.380 194.634 101.419 1.00 160.83 ? 349 ILE D CG2 1 
ATOM   8428  C  CD1 . ILE C 1 349 ? 154.002 196.816 102.224 1.00 162.28 ? 349 ILE D CD1 1 
ATOM   8429  N  N   . ILE C 1 350 ? 159.550 196.839 102.300 1.00 161.40 ? 350 ILE D N   1 
ATOM   8430  C  CA  . ILE C 1 350 ? 160.858 196.971 101.640 1.00 166.85 ? 350 ILE D CA  1 
ATOM   8431  C  C   . ILE C 1 350 ? 161.964 196.375 102.535 1.00 169.03 ? 350 ILE D C   1 
ATOM   8432  O  O   . ILE C 1 350 ? 162.873 195.730 102.012 1.00 172.46 ? 350 ILE D O   1 
ATOM   8433  C  CB  . ILE C 1 350 ? 161.145 198.452 101.244 1.00 174.71 ? 350 ILE D CB  1 
ATOM   8434  C  CG1 . ILE C 1 350 ? 160.198 198.898 100.107 1.00 176.08 ? 350 ILE D CG1 1 
ATOM   8435  C  CG2 . ILE C 1 350 ? 162.615 198.673 100.828 1.00 176.02 ? 350 ILE D CG2 1 
ATOM   8436  C  CD1 . ILE C 1 350 ? 159.937 200.393 100.014 1.00 181.75 ? 350 ILE D CD1 1 
ATOM   8437  N  N   . ILE C 1 351 ? 161.863 196.560 103.869 1.00 159.82 ? 351 ILE D N   1 
ATOM   8438  C  CA  . ILE C 1 351 ? 162.824 196.021 104.835 1.00 156.87 ? 351 ILE D CA  1 
ATOM   8439  C  C   . ILE C 1 351 ? 162.668 194.491 104.911 1.00 159.25 ? 351 ILE D C   1 
ATOM   8440  O  O   . ILE C 1 351 ? 163.672 193.779 104.827 1.00 160.20 ? 351 ILE D O   1 
ATOM   8441  C  CB  . ILE C 1 351 ? 162.681 196.696 106.232 1.00 154.96 ? 351 ILE D CB  1 
ATOM   8442  C  CG1 . ILE C 1 351 ? 163.037 198.193 106.169 1.00 159.08 ? 351 ILE D CG1 1 
ATOM   8443  C  CG2 . ILE C 1 351 ? 163.545 195.991 107.290 1.00 152.60 ? 351 ILE D CG2 1 
ATOM   8444  C  CD1 . ILE C 1 351 ? 162.390 199.041 107.241 1.00 162.09 ? 351 ILE D CD1 1 
ATOM   8445  N  N   . SER C 1 352 ? 161.412 193.999 105.046 1.00 153.67 ? 352 SER D N   1 
ATOM   8446  C  CA  . SER C 1 352 ? 161.077 192.574 105.176 1.00 151.14 ? 352 SER D CA  1 
ATOM   8447  C  C   . SER C 1 352 ? 161.526 191.735 103.969 1.00 161.17 ? 352 SER D C   1 
ATOM   8448  O  O   . SER C 1 352 ? 161.953 190.595 104.164 1.00 159.36 ? 352 SER D O   1 
ATOM   8449  C  CB  . SER C 1 352 ? 159.580 192.382 105.409 1.00 150.91 ? 352 SER D CB  1 
ATOM   8450  O  OG  . SER C 1 352 ? 158.806 192.619 104.243 1.00 163.43 ? 352 SER D OG  1 
ATOM   8451  N  N   . GLN C 1 353 ? 161.428 192.289 102.740 1.00 164.59 ? 353 GLN D N   1 
ATOM   8452  C  CA  . GLN C 1 353 ? 161.827 191.577 101.521 1.00 170.29 ? 353 GLN D CA  1 
ATOM   8453  C  C   . GLN C 1 353 ? 163.337 191.675 101.285 1.00 179.27 ? 353 GLN D C   1 
ATOM   8454  O  O   . GLN C 1 353 ? 163.907 190.810 100.616 1.00 179.25 ? 353 GLN D O   1 
ATOM   8455  C  CB  . GLN C 1 353 ? 161.043 192.065 100.292 1.00 176.46 ? 353 GLN D CB  1 
ATOM   8456  C  CG  . GLN C 1 353 ? 159.544 191.715 100.316 1.00 187.88 ? 353 GLN D CG  1 
ATOM   8457  C  CD  . GLN C 1 353 ? 159.223 190.254 100.580 1.00 200.88 ? 353 GLN D CD  1 
ATOM   8458  O  OE1 . GLN C 1 353 ? 159.801 189.328 99.990  1.00 198.53 ? 353 GLN D OE1 1 
ATOM   8459  N  NE2 . GLN C 1 353 ? 158.271 190.020 101.471 1.00 193.30 ? 353 GLN D NE2 1 
ATOM   8460  N  N   . MET C 1 354 ? 163.981 192.707 101.854 1.00 178.25 ? 354 MET D N   1 
ATOM   8461  C  CA  . MET C 1 354 ? 165.430 192.909 101.785 1.00 179.43 ? 354 MET D CA  1 
ATOM   8462  C  C   . MET C 1 354 ? 166.113 191.920 102.733 1.00 181.41 ? 354 MET D C   1 
ATOM   8463  O  O   . MET C 1 354 ? 167.187 191.401 102.421 1.00 181.88 ? 354 MET D O   1 
ATOM   8464  C  CB  . MET C 1 354 ? 165.770 194.358 102.158 1.00 181.82 ? 354 MET D CB  1 
ATOM   8465  C  CG  . MET C 1 354 ? 167.172 194.782 101.804 1.00 185.84 ? 354 MET D CG  1 
ATOM   8466  S  SD  . MET C 1 354 ? 167.341 196.583 101.878 1.00 190.29 ? 354 MET D SD  1 
ATOM   8467  C  CE  . MET C 1 354 ? 167.306 196.862 103.654 1.00 186.83 ? 354 MET D CE  1 
ATOM   8468  N  N   . ASN C 1 355 ? 165.464 191.664 103.890 1.00 174.07 ? 355 ASN D N   1 
ATOM   8469  C  CA  . ASN C 1 355 ? 165.904 190.743 104.932 1.00 169.53 ? 355 ASN D CA  1 
ATOM   8470  C  C   . ASN C 1 355 ? 165.847 189.292 104.429 1.00 173.66 ? 355 ASN D C   1 
ATOM   8471  O  O   . ASN C 1 355 ? 166.824 188.561 104.608 1.00 174.84 ? 355 ASN D O   1 
ATOM   8472  C  CB  . ASN C 1 355 ? 165.045 190.934 106.190 1.00 162.39 ? 355 ASN D CB  1 
ATOM   8473  C  CG  . ASN C 1 355 ? 164.983 189.747 107.118 1.00 183.04 ? 355 ASN D CG  1 
ATOM   8474  O  OD1 . ASN C 1 355 ? 165.983 189.328 107.711 1.00 178.01 ? 355 ASN D OD1 1 
ATOM   8475  N  ND2 . ASN C 1 355 ? 163.794 189.186 107.269 1.00 172.08 ? 355 ASN D ND2 1 
ATOM   8476  N  N   . SER C 1 356 ? 164.720 188.887 103.789 1.00 169.12 ? 356 SER D N   1 
ATOM   8477  C  CA  . SER C 1 356 ? 164.520 187.532 103.260 1.00 169.13 ? 356 SER D CA  1 
ATOM   8478  C  C   . SER C 1 356 ? 165.467 187.225 102.102 1.00 179.53 ? 356 SER D C   1 
ATOM   8479  O  O   . SER C 1 356 ? 165.860 186.067 101.960 1.00 179.24 ? 356 SER D O   1 
ATOM   8480  C  CB  . SER C 1 356 ? 163.073 187.306 102.832 1.00 170.67 ? 356 SER D CB  1 
ATOM   8481  O  OG  . SER C 1 356 ? 162.641 188.230 101.849 1.00 183.84 ? 356 SER D OG  1 
ATOM   8482  N  N   . PHE C 1 357 ? 165.853 188.248 101.296 1.00 178.51 ? 357 PHE D N   1 
ATOM   8483  C  CA  . PHE C 1 357 ? 166.799 188.058 100.191 1.00 179.96 ? 357 PHE D CA  1 
ATOM   8484  C  C   . PHE C 1 357 ? 168.186 187.772 100.753 1.00 183.21 ? 357 PHE D C   1 
ATOM   8485  O  O   . PHE C 1 357 ? 168.847 186.847 100.279 1.00 183.66 ? 357 PHE D O   1 
ATOM   8486  C  CB  . PHE C 1 357 ? 166.832 189.261 99.225  1.00 182.50 ? 357 PHE D CB  1 
ATOM   8487  C  CG  . PHE C 1 357 ? 167.758 189.060 98.043  1.00 185.04 ? 357 PHE D CG  1 
ATOM   8488  C  CD1 . PHE C 1 357 ? 167.361 188.299 96.950  1.00 187.70 ? 357 PHE D CD1 1 
ATOM   8489  C  CD2 . PHE C 1 357 ? 169.034 189.614 98.034  1.00 187.13 ? 357 PHE D CD2 1 
ATOM   8490  C  CE1 . PHE C 1 357 ? 168.223 188.096 95.869  1.00 189.84 ? 357 PHE D CE1 1 
ATOM   8491  C  CE2 . PHE C 1 357 ? 169.897 189.405 96.955  1.00 190.51 ? 357 PHE D CE2 1 
ATOM   8492  C  CZ  . PHE C 1 357 ? 169.484 188.651 95.879  1.00 189.96 ? 357 PHE D CZ  1 
ATOM   8493  N  N   . LEU C 1 358 ? 168.608 188.552 101.773 1.00 180.72 ? 358 LEU D N   1 
ATOM   8494  C  CA  . LEU C 1 358 ? 169.892 188.394 102.456 1.00 181.01 ? 358 LEU D CA  1 
ATOM   8495  C  C   . LEU C 1 358 ? 169.958 187.027 103.146 1.00 183.13 ? 358 LEU D C   1 
ATOM   8496  O  O   . LEU C 1 358 ? 171.000 186.374 103.104 1.00 183.47 ? 358 LEU D O   1 
ATOM   8497  C  CB  . LEU C 1 358 ? 170.093 189.524 103.474 1.00 180.86 ? 358 LEU D CB  1 
ATOM   8498  C  CG  . LEU C 1 358 ? 171.489 189.644 104.078 1.00 184.85 ? 358 LEU D CG  1 
ATOM   8499  C  CD1 . LEU C 1 358 ? 172.265 190.775 103.436 1.00 186.72 ? 358 LEU D CD1 1 
ATOM   8500  C  CD2 . LEU C 1 358 ? 171.413 189.861 105.567 1.00 185.84 ? 358 LEU D CD2 1 
ATOM   8501  N  N   . CYS C 1 359 ? 168.827 186.590 103.741 1.00 179.90 ? 359 CYS D N   1 
ATOM   8502  C  CA  . CYS C 1 359 ? 168.679 185.312 104.438 1.00 178.97 ? 359 CYS D CA  1 
ATOM   8503  C  C   . CYS C 1 359 ? 168.771 184.131 103.466 1.00 181.54 ? 359 CYS D C   1 
ATOM   8504  O  O   . CYS C 1 359 ? 169.552 183.213 103.723 1.00 181.62 ? 359 CYS D O   1 
ATOM   8505  C  CB  . CYS C 1 359 ? 167.375 185.274 105.229 1.00 172.36 ? 359 CYS D CB  1 
ATOM   8506  S  SG  . CYS C 1 359 ? 167.465 186.084 106.845 1.00 171.49 ? 359 CYS D SG  1 
ATOM   8507  N  N   . PHE C 1 360 ? 167.992 184.152 102.355 1.00 178.90 ? 360 PHE D N   1 
ATOM   8508  C  CA  . PHE C 1 360 ? 167.992 183.077 101.355 1.00 179.10 ? 360 PHE D CA  1 
ATOM   8509  C  C   . PHE C 1 360 ? 169.345 182.952 100.660 1.00 182.79 ? 360 PHE D C   1 
ATOM   8510  O  O   . PHE C 1 360 ? 169.739 181.834 100.320 1.00 183.22 ? 360 PHE D O   1 
ATOM   8511  C  CB  . PHE C 1 360 ? 166.874 183.257 100.318 1.00 180.62 ? 360 PHE D CB  1 
ATOM   8512  C  CG  . PHE C 1 360 ? 165.584 182.563 100.692 1.00 180.43 ? 360 PHE D CG  1 
ATOM   8513  C  CD1 . PHE C 1 360 ? 165.482 181.176 100.652 1.00 182.19 ? 360 PHE D CD1 1 
ATOM   8514  C  CD2 . PHE C 1 360 ? 164.467 183.296 101.070 1.00 180.90 ? 360 PHE D CD2 1 
ATOM   8515  C  CE1 . PHE C 1 360 ? 164.290 180.535 101.002 1.00 181.86 ? 360 PHE D CE1 1 
ATOM   8516  C  CE2 . PHE C 1 360 ? 163.274 182.655 101.411 1.00 179.46 ? 360 PHE D CE2 1 
ATOM   8517  C  CZ  . PHE C 1 360 ? 163.193 181.279 101.374 1.00 176.93 ? 360 PHE D CZ  1 
ATOM   8518  N  N   . PHE C 1 361 ? 170.068 184.081 100.488 1.00 180.75 ? 361 PHE D N   1 
ATOM   8519  C  CA  . PHE C 1 361 ? 171.399 184.098 99.882  1.00 181.92 ? 361 PHE D CA  1 
ATOM   8520  C  C   . PHE C 1 361 ? 172.393 183.362 100.784 1.00 184.19 ? 361 PHE D C   1 
ATOM   8521  O  O   . PHE C 1 361 ? 173.081 182.460 100.305 1.00 184.91 ? 361 PHE D O   1 
ATOM   8522  C  CB  . PHE C 1 361 ? 171.867 185.537 99.591  1.00 183.89 ? 361 PHE D CB  1 
ATOM   8523  C  CG  . PHE C 1 361 ? 173.321 185.658 99.201  1.00 186.27 ? 361 PHE D CG  1 
ATOM   8524  C  CD1 . PHE C 1 361 ? 173.754 185.272 97.939  1.00 189.66 ? 361 PHE D CD1 1 
ATOM   8525  C  CD2 . PHE C 1 361 ? 174.260 186.152 100.099 1.00 187.62 ? 361 PHE D CD2 1 
ATOM   8526  C  CE1 . PHE C 1 361 ? 175.101 185.371 97.586  1.00 191.83 ? 361 PHE D CE1 1 
ATOM   8527  C  CE2 . PHE C 1 361 ? 175.606 186.253 99.744  1.00 191.04 ? 361 PHE D CE2 1 
ATOM   8528  C  CZ  . PHE C 1 361 ? 176.017 185.865 98.489  1.00 191.26 ? 361 PHE D CZ  1 
ATOM   8529  N  N   . LEU C 1 362 ? 172.437 183.720 102.088 1.00 180.51 ? 362 LEU D N   1 
ATOM   8530  C  CA  . LEU C 1 362 ? 173.322 183.097 103.079 1.00 180.05 ? 362 LEU D CA  1 
ATOM   8531  C  C   . LEU C 1 362 ? 172.928 181.634 103.328 1.00 181.25 ? 362 LEU D C   1 
ATOM   8532  O  O   . LEU C 1 362 ? 173.792 180.827 103.678 1.00 181.27 ? 362 LEU D O   1 
ATOM   8533  C  CB  . LEU C 1 362 ? 173.332 183.887 104.401 1.00 179.30 ? 362 LEU D CB  1 
ATOM   8534  C  CG  . LEU C 1 362 ? 173.937 185.300 104.366 1.00 183.50 ? 362 LEU D CG  1 
ATOM   8535  C  CD1 . LEU C 1 362 ? 173.442 186.131 105.537 1.00 182.63 ? 362 LEU D CD1 1 
ATOM   8536  C  CD2 . LEU C 1 362 ? 175.463 185.266 104.342 1.00 186.64 ? 362 LEU D CD2 1 
ATOM   8537  N  N   . PHE C 1 363 ? 171.636 181.292 103.116 1.00 177.75 ? 363 PHE D N   1 
ATOM   8538  C  CA  . PHE C 1 363 ? 171.109 179.930 103.236 1.00 177.00 ? 363 PHE D CA  1 
ATOM   8539  C  C   . PHE C 1 363 ? 171.696 179.071 102.117 1.00 181.14 ? 363 PHE D C   1 
ATOM   8540  O  O   . PHE C 1 363 ? 172.204 177.986 102.391 1.00 180.94 ? 363 PHE D O   1 
ATOM   8541  C  CB  . PHE C 1 363 ? 169.566 179.926 103.194 1.00 177.10 ? 363 PHE D CB  1 
ATOM   8542  C  CG  . PHE C 1 363 ? 168.907 178.567 103.067 1.00 177.79 ? 363 PHE D CG  1 
ATOM   8543  C  CD1 . PHE C 1 363 ? 168.801 177.720 104.165 1.00 177.83 ? 363 PHE D CD1 1 
ATOM   8544  C  CD2 . PHE C 1 363 ? 168.369 178.148 101.854 1.00 180.10 ? 363 PHE D CD2 1 
ATOM   8545  C  CE1 . PHE C 1 363 ? 168.183 176.471 104.048 1.00 177.18 ? 363 PHE D CE1 1 
ATOM   8546  C  CE2 . PHE C 1 363 ? 167.754 176.896 101.739 1.00 181.76 ? 363 PHE D CE2 1 
ATOM   8547  C  CZ  . PHE C 1 363 ? 167.655 176.073 102.840 1.00 179.29 ? 363 PHE D CZ  1 
ATOM   8548  N  N   . ALA C 1 364 ? 171.661 179.583 100.869 1.00 180.24 ? 364 ALA D N   1 
ATOM   8549  C  CA  . ALA C 1 364 ? 172.200 178.925 99.677  1.00 181.90 ? 364 ALA D CA  1 
ATOM   8550  C  C   . ALA C 1 364 ? 173.708 178.684 99.809  1.00 186.12 ? 364 ALA D C   1 
ATOM   8551  O  O   . ALA C 1 364 ? 174.219 177.707 99.263  1.00 186.87 ? 364 ALA D O   1 
ATOM   8552  C  CB  . ALA C 1 364 ? 171.912 179.768 98.446  1.00 183.47 ? 364 ALA D CB  1 
ATOM   8553  N  N   . VAL C 1 365 ? 174.404 179.570 100.554 1.00 184.17 ? 365 VAL D N   1 
ATOM   8554  C  CA  . VAL C 1 365 ? 175.845 179.513 100.825 1.00 185.28 ? 365 VAL D CA  1 
ATOM   8555  C  C   . VAL C 1 365 ? 176.133 178.449 101.913 1.00 187.65 ? 365 VAL D C   1 
ATOM   8556  O  O   . VAL C 1 365 ? 177.116 177.710 101.793 1.00 188.71 ? 365 VAL D O   1 
ATOM   8557  C  CB  . VAL C 1 365 ? 176.394 180.923 101.219 1.00 188.00 ? 365 VAL D CB  1 
ATOM   8558  C  CG1 . VAL C 1 365 ? 177.826 180.859 101.752 1.00 188.87 ? 365 VAL D CG1 1 
ATOM   8559  C  CG2 . VAL C 1 365 ? 176.311 181.897 100.046 1.00 188.95 ? 365 VAL D CG2 1 
ATOM   8560  N  N   . LEU C 1 366 ? 175.272 178.364 102.952 1.00 183.54 ? 366 LEU D N   1 
ATOM   8561  C  CA  . LEU C 1 366 ? 175.462 177.455 104.087 1.00 182.71 ? 366 LEU D CA  1 
ATOM   8562  C  C   . LEU C 1 366 ? 174.746 176.086 103.974 1.00 185.33 ? 366 LEU D C   1 
ATOM   8563  O  O   . LEU C 1 366 ? 175.070 175.195 104.764 1.00 184.91 ? 366 LEU D O   1 
ATOM   8564  C  CB  . LEU C 1 366 ? 175.021 178.146 105.387 1.00 181.21 ? 366 LEU D CB  1 
ATOM   8565  C  CG  . LEU C 1 366 ? 175.937 179.251 105.917 1.00 184.67 ? 366 LEU D CG  1 
ATOM   8566  C  CD1 . LEU C 1 366 ? 175.163 180.222 106.779 1.00 183.57 ? 366 LEU D CD1 1 
ATOM   8567  C  CD2 . LEU C 1 366 ? 177.116 178.676 106.695 1.00 186.61 ? 366 LEU D CD2 1 
ATOM   8568  N  N   . ILE C 1 367 ? 173.808 175.901 103.013 1.00 183.48 ? 367 ILE D N   1 
ATOM   8569  C  CA  . ILE C 1 367 ? 173.064 174.635 102.843 1.00 183.48 ? 367 ILE D CA  1 
ATOM   8570  C  C   . ILE C 1 367 ? 174.018 173.464 102.451 1.00 188.10 ? 367 ILE D C   1 
ATOM   8571  O  O   . ILE C 1 367 ? 173.782 172.320 102.853 1.00 187.44 ? 367 ILE D O   1 
ATOM   8572  C  CB  . ILE C 1 367 ? 171.855 174.768 101.859 1.00 185.61 ? 367 ILE D CB  1 
ATOM   8573  C  CG1 . ILE C 1 367 ? 170.911 173.532 101.934 1.00 185.58 ? 367 ILE D CG1 1 
ATOM   8574  C  CG2 . ILE C 1 367 ? 172.287 175.123 100.418 1.00 187.83 ? 367 ILE D CG2 1 
ATOM   8575  C  CD1 . ILE C 1 367 ? 169.578 173.604 101.164 1.00 190.67 ? 367 ILE D CD1 1 
ATOM   8576  N  N   . GLY C 1 368 ? 175.084 173.782 101.714 1.00 188.01 ? 368 GLY D N   1 
ATOM   8577  C  CA  . GLY C 1 368 ? 176.088 172.822 101.264 1.00 189.78 ? 368 GLY D CA  1 
ATOM   8578  C  C   . GLY C 1 368 ? 176.960 172.252 102.369 1.00 192.66 ? 368 GLY D C   1 
ATOM   8579  O  O   . GLY C 1 368 ? 177.515 171.160 102.211 1.00 193.66 ? 368 GLY D O   1 
ATOM   8580  N  N   . ARG C 1 369 ? 177.094 172.988 103.494 1.00 189.07 ? 369 ARG D N   1 
ATOM   8581  C  CA  . ARG C 1 369 ? 177.893 172.571 104.647 1.00 188.90 ? 369 ARG D CA  1 
ATOM   8582  C  C   . ARG C 1 369 ? 177.172 171.458 105.420 1.00 190.18 ? 369 ARG D C   1 
ATOM   8583  O  O   . ARG C 1 369 ? 176.053 171.656 105.904 1.00 188.34 ? 369 ARG D O   1 
ATOM   8584  C  CB  . ARG C 1 369 ? 178.201 173.771 105.556 1.00 188.54 ? 369 ARG D CB  1 
ATOM   8585  N  N   . LYS C 1 370 ? 177.812 170.279 105.503 1.00 188.65 ? 370 LYS D N   1 
ATOM   8586  C  CA  . LYS C 1 370 ? 177.279 169.100 106.193 1.00 187.80 ? 370 LYS D CA  1 
ATOM   8587  C  C   . LYS C 1 370 ? 177.593 169.139 107.703 1.00 189.25 ? 370 LYS D C   1 
ATOM   8588  O  O   . LYS C 1 370 ? 177.025 168.353 108.469 1.00 188.22 ? 370 LYS D O   1 
ATOM   8589  C  CB  . LYS C 1 370 ? 177.842 167.817 105.559 1.00 191.04 ? 370 LYS D CB  1 
ATOM   8590  N  N   . GLU C 1 371 ? 178.489 170.061 108.122 1.00 186.89 ? 371 GLU D N   1 
ATOM   8591  C  CA  . GLU C 1 371 ? 178.917 170.243 109.511 1.00 186.34 ? 371 GLU D CA  1 
ATOM   8592  C  C   . GLU C 1 371 ? 177.784 170.776 110.394 1.00 186.44 ? 371 GLU D C   1 
ATOM   8593  O  O   . GLU C 1 371 ? 177.679 170.350 111.547 1.00 185.89 ? 371 GLU D O   1 
ATOM   8594  C  CB  . GLU C 1 371 ? 180.126 171.185 109.581 1.00 188.43 ? 371 GLU D CB  1 
ATOM   8595  N  N   . LEU C 1 372 ? 176.939 171.692 109.856 1.00 182.55 ? 372 LEU D N   1 
ATOM   8596  C  CA  . LEU C 1 372 ? 175.810 172.293 110.578 1.00 180.48 ? 372 LEU D CA  1 
ATOM   8597  C  C   . LEU C 1 372 ? 174.681 171.276 110.824 1.00 182.09 ? 372 LEU D C   1 
ATOM   8598  O  O   . LEU C 1 372 ? 173.980 171.398 111.830 1.00 177.39 ? 372 LEU D O   1 
ATOM   8599  C  CB  . LEU C 1 372 ? 175.266 173.525 109.845 1.00 179.74 ? 372 LEU D CB  1 
ATOM   8600  N  N   . PHE C 1 373 ? 174.514 170.277 109.924 1.00 180.33 ? 373 PHE D N   1 
ATOM   8601  C  CA  . PHE C 1 373 ? 173.505 169.215 110.056 1.00 178.63 ? 373 PHE D CA  1 
ATOM   8602  C  C   . PHE C 1 373 ? 173.926 168.209 111.129 1.00 182.28 ? 373 PHE D C   1 
ATOM   8603  O  O   . PHE C 1 373 ? 173.111 167.837 111.976 1.00 176.59 ? 373 PHE D O   1 
ATOM   8604  C  CB  . PHE C 1 373 ? 173.284 168.491 108.718 1.00 181.30 ? 373 PHE D CB  1 
ATOM   8605  C  CG  . PHE C 1 373 ? 172.493 169.255 107.686 1.00 181.77 ? 373 PHE D CG  1 
ATOM   8606  C  CD1 . PHE C 1 373 ? 173.130 170.096 106.781 1.00 184.52 ? 373 PHE D CD1 1 
ATOM   8607  C  CD2 . PHE C 1 373 ? 171.116 169.100 107.590 1.00 181.69 ? 373 PHE D CD2 1 
ATOM   8608  C  CE1 . PHE C 1 373 ? 172.401 170.783 105.807 1.00 184.93 ? 373 PHE D CE1 1 
ATOM   8609  C  CE2 . PHE C 1 373 ? 170.386 169.793 106.621 1.00 183.93 ? 373 PHE D CE2 1 
ATOM   8610  C  CZ  . PHE C 1 373 ? 171.034 170.626 105.733 1.00 183.44 ? 373 PHE D CZ  1 
ATOM   8611  N  N   . ALA C 1 374 ? 175.212 167.782 111.085 1.00 181.68 ? 374 ALA D N   1 
ATOM   8612  C  CA  . ALA C 1 374 ? 175.842 166.836 112.014 1.00 182.44 ? 374 ALA D CA  1 
ATOM   8613  C  C   . ALA C 1 374 ? 175.849 167.376 113.446 1.00 184.28 ? 374 ALA D C   1 
ATOM   8614  O  O   . ALA C 1 374 ? 175.807 166.593 114.398 1.00 184.14 ? 374 ALA D O   1 
ATOM   8615  C  CB  . ALA C 1 374 ? 177.266 166.535 111.562 1.00 184.81 ? 374 ALA D CB  1 
ATOM   8616  N  N   . ALA C 1 375 ? 175.890 168.715 113.585 1.00 181.33 ? 375 ALA D N   1 
ATOM   8617  C  CA  . ALA C 1 375 ? 175.873 169.433 114.856 1.00 178.00 ? 375 ALA D CA  1 
ATOM   8618  C  C   . ALA C 1 375 ? 174.602 169.126 115.644 1.00 175.59 ? 375 ALA D C   1 
ATOM   8619  O  O   . ALA C 1 375 ? 174.684 168.850 116.841 1.00 174.22 ? 375 ALA D O   1 
ATOM   8620  C  CB  . ALA C 1 375 ? 175.975 170.929 114.602 1.00 178.28 ? 375 ALA D CB  1 
ATOM   8621  N  N   . PHE C 1 376 ? 173.440 169.127 114.958 1.00 168.52 ? 376 PHE D N   1 
ATOM   8622  C  CA  . PHE C 1 376 ? 172.122 168.915 115.554 1.00 162.24 ? 376 PHE D CA  1 
ATOM   8623  C  C   . PHE C 1 376 ? 171.660 167.441 115.536 1.00 167.29 ? 376 PHE D C   1 
ATOM   8624  O  O   . PHE C 1 376 ? 170.560 167.152 116.010 1.00 162.57 ? 376 PHE D O   1 
ATOM   8625  C  CB  . PHE C 1 376 ? 171.086 169.826 114.872 1.00 160.04 ? 376 PHE D CB  1 
ATOM   8626  C  CG  . PHE C 1 376 ? 171.272 171.284 115.229 1.00 160.00 ? 376 PHE D CG  1 
ATOM   8627  C  CD1 . PHE C 1 376 ? 170.714 171.811 116.388 1.00 158.38 ? 376 PHE D CD1 1 
ATOM   8628  C  CD2 . PHE C 1 376 ? 172.031 172.124 114.422 1.00 165.64 ? 376 PHE D CD2 1 
ATOM   8629  C  CE1 . PHE C 1 376 ? 170.902 173.155 116.727 1.00 158.41 ? 376 PHE D CE1 1 
ATOM   8630  C  CE2 . PHE C 1 376 ? 172.216 173.467 114.761 1.00 167.58 ? 376 PHE D CE2 1 
ATOM   8631  C  CZ  . PHE C 1 376 ? 171.648 173.975 115.909 1.00 161.11 ? 376 PHE D CZ  1 
ATOM   8632  N  N   . GLY C 1 377 ? 172.511 166.532 115.056 1.00 170.06 ? 377 GLY D N   1 
ATOM   8633  C  CA  . GLY C 1 377 ? 172.226 165.099 115.048 1.00 171.34 ? 377 GLY D CA  1 
ATOM   8634  C  C   . GLY C 1 377 ? 171.878 164.448 113.722 1.00 178.71 ? 377 GLY D C   1 
ATOM   8635  O  O   . GLY C 1 377 ? 171.547 163.259 113.699 1.00 179.14 ? 377 GLY D O   1 
ATOM   8636  N  N   . PHE C 1 378 ? 171.956 165.201 112.609 1.00 177.68 ? 378 PHE D N   1 
ATOM   8637  C  CA  . PHE C 1 378 ? 171.651 164.685 111.271 1.00 180.73 ? 378 PHE D CA  1 
ATOM   8638  C  C   . PHE C 1 378 ? 172.947 164.271 110.578 1.00 189.20 ? 378 PHE D C   1 
ATOM   8639  O  O   . PHE C 1 378 ? 173.694 165.127 110.099 1.00 189.35 ? 378 PHE D O   1 
ATOM   8640  C  CB  . PHE C 1 378 ? 170.878 165.731 110.449 1.00 180.50 ? 378 PHE D CB  1 
ATOM   8641  C  CG  . PHE C 1 378 ? 169.492 166.014 110.977 1.00 175.89 ? 378 PHE D CG  1 
ATOM   8642  C  CD1 . PHE C 1 378 ? 169.294 166.931 112.006 1.00 175.10 ? 378 PHE D CD1 1 
ATOM   8643  C  CD2 . PHE C 1 378 ? 168.382 165.369 110.444 1.00 177.06 ? 378 PHE D CD2 1 
ATOM   8644  C  CE1 . PHE C 1 378 ? 168.012 167.177 112.508 1.00 170.77 ? 378 PHE D CE1 1 
ATOM   8645  C  CE2 . PHE C 1 378 ? 167.100 165.621 110.941 1.00 174.78 ? 378 PHE D CE2 1 
ATOM   8646  C  CZ  . PHE C 1 378 ? 166.922 166.530 111.964 1.00 168.81 ? 378 PHE D CZ  1 
ATOM   8647  N  N   . TYR C 1 379 ? 173.230 162.958 110.553 1.00 188.42 ? 379 TYR D N   1 
ATOM   8648  C  CA  . TYR C 1 379 ? 174.467 162.427 109.972 1.00 190.18 ? 379 TYR D CA  1 
ATOM   8649  C  C   . TYR C 1 379 ? 174.226 161.685 108.651 1.00 193.92 ? 379 TYR D C   1 
ATOM   8650  O  O   . TYR C 1 379 ? 174.967 161.904 107.690 1.00 194.77 ? 379 TYR D O   1 
ATOM   8651  C  CB  . TYR C 1 379 ? 175.179 161.491 110.971 1.00 191.94 ? 379 TYR D CB  1 
ATOM   8652  C  CG  . TYR C 1 379 ? 175.412 162.092 112.342 1.00 192.44 ? 379 TYR D CG  1 
ATOM   8653  C  CD1 . TYR C 1 379 ? 176.514 162.904 112.591 1.00 194.43 ? 379 TYR D CD1 1 
ATOM   8654  C  CD2 . TYR C 1 379 ? 174.553 161.815 113.402 1.00 191.94 ? 379 TYR D CD2 1 
ATOM   8655  C  CE1 . TYR C 1 379 ? 176.739 163.452 113.853 1.00 194.80 ? 379 TYR D CE1 1 
ATOM   8656  C  CE2 . TYR C 1 379 ? 174.767 162.357 114.669 1.00 192.21 ? 379 TYR D CE2 1 
ATOM   8657  C  CZ  . TYR C 1 379 ? 175.862 163.176 114.890 1.00 197.75 ? 379 TYR D CZ  1 
ATOM   8658  O  OH  . TYR C 1 379 ? 176.078 163.711 116.138 1.00 198.25 ? 379 TYR D OH  1 
ATOM   8659  N  N   . ASP C 1 380 ? 173.206 160.802 108.614 1.00 191.41 ? 380 ASP D N   1 
ATOM   8660  C  CA  . ASP C 1 380 ? 172.856 159.971 107.456 1.00 192.30 ? 380 ASP D CA  1 
ATOM   8661  C  C   . ASP C 1 380 ? 172.309 160.777 106.269 1.00 194.19 ? 380 ASP D C   1 
ATOM   8662  O  O   . ASP C 1 380 ? 172.535 160.384 105.122 1.00 195.27 ? 380 ASP D O   1 
ATOM   8663  C  CB  . ASP C 1 380 ? 171.832 158.897 107.854 1.00 193.43 ? 380 ASP D CB  1 
ATOM   8664  N  N   . SER C 1 381 ? 171.576 161.877 106.536 1.00 189.90 ? 381 SER D N   1 
ATOM   8665  C  CA  . SER C 1 381 ? 170.982 162.699 105.479 1.00 189.37 ? 381 SER D CA  1 
ATOM   8666  C  C   . SER C 1 381 ? 170.970 164.189 105.825 1.00 189.84 ? 381 SER D C   1 
ATOM   8667  O  O   . SER C 1 381 ? 171.036 164.562 106.999 1.00 188.54 ? 381 SER D O   1 
ATOM   8668  C  CB  . SER C 1 381 ? 169.559 162.234 105.179 1.00 191.55 ? 381 SER D CB  1 
ATOM   8669  O  OG  . SER C 1 381 ? 168.693 162.412 106.289 1.00 195.01 ? 381 SER D OG  1 
ATOM   8670  N  N   . GLN C 1 382 ? 170.871 165.033 104.785 1.00 187.06 ? 382 GLN D N   1 
ATOM   8671  C  CA  . GLN C 1 382 ? 170.802 166.487 104.893 1.00 185.48 ? 382 GLN D CA  1 
ATOM   8672  C  C   . GLN C 1 382 ? 169.439 166.946 104.328 1.00 186.10 ? 382 GLN D C   1 
ATOM   8673  O  O   . GLN C 1 382 ? 169.360 167.313 103.150 1.00 186.73 ? 382 GLN D O   1 
ATOM   8674  C  CB  . GLN C 1 382 ? 171.995 167.149 104.165 1.00 187.51 ? 382 GLN D CB  1 
ATOM   8675  C  CG  . GLN C 1 382 ? 173.335 167.064 104.905 1.00 197.91 ? 382 GLN D CG  1 
ATOM   8676  C  CD  . GLN C 1 382 ? 174.051 165.749 104.736 1.00 209.79 ? 382 GLN D CD  1 
ATOM   8677  O  OE1 . GLN C 1 382 ? 174.509 165.395 103.644 1.00 207.41 ? 382 GLN D OE1 1 
ATOM   8678  N  NE2 . GLN C 1 382 ? 174.204 165.018 105.832 1.00 203.87 ? 382 GLN D NE2 1 
ATOM   8679  N  N   . PRO C 1 383 ? 168.340 166.870 105.125 1.00 180.36 ? 383 PRO D N   1 
ATOM   8680  C  CA  . PRO C 1 383 ? 167.017 167.247 104.595 1.00 177.11 ? 383 PRO D CA  1 
ATOM   8681  C  C   . PRO C 1 383 ? 166.863 168.753 104.382 1.00 177.11 ? 383 PRO D C   1 
ATOM   8682  O  O   . PRO C 1 383 ? 167.448 169.548 105.120 1.00 174.87 ? 383 PRO D O   1 
ATOM   8683  C  CB  . PRO C 1 383 ? 166.043 166.735 105.664 1.00 173.04 ? 383 PRO D CB  1 
ATOM   8684  C  CG  . PRO C 1 383 ? 166.858 165.846 106.572 1.00 177.92 ? 383 PRO D CG  1 
ATOM   8685  C  CD  . PRO C 1 383 ? 168.230 166.422 106.527 1.00 176.99 ? 383 PRO D CD  1 
ATOM   8686  N  N   . THR C 1 384 ? 166.060 169.134 103.369 1.00 172.92 ? 384 THR D N   1 
ATOM   8687  C  CA  . THR C 1 384 ? 165.809 170.520 102.964 1.00 171.27 ? 384 THR D CA  1 
ATOM   8688  C  C   . THR C 1 384 ? 165.074 171.305 104.069 1.00 164.99 ? 384 THR D C   1 
ATOM   8689  O  O   . THR C 1 384 ? 165.545 172.377 104.444 1.00 163.05 ? 384 THR D O   1 
ATOM   8690  C  CB  . THR C 1 384 ? 165.050 170.564 101.625 1.00 183.18 ? 384 THR D CB  1 
ATOM   8691  O  OG1 . THR C 1 384 ? 165.684 169.692 100.685 1.00 185.12 ? 384 THR D OG1 1 
ATOM   8692  C  CG2 . THR C 1 384 ? 164.975 171.967 101.042 1.00 181.92 ? 384 THR D CG2 1 
ATOM   8693  N  N   . LEU C 1 385 ? 163.948 170.777 104.588 1.00 155.67 ? 385 LEU D N   1 
ATOM   8694  C  CA  . LEU C 1 385 ? 163.157 171.422 105.643 1.00 148.60 ? 385 LEU D CA  1 
ATOM   8695  C  C   . LEU C 1 385 ? 163.987 171.618 106.916 1.00 148.76 ? 385 LEU D C   1 
ATOM   8696  O  O   . LEU C 1 385 ? 163.876 172.659 107.562 1.00 145.03 ? 385 LEU D O   1 
ATOM   8697  C  CB  . LEU C 1 385 ? 161.893 170.596 105.948 1.00 145.73 ? 385 LEU D CB  1 
ATOM   8698  C  CG  . LEU C 1 385 ? 160.846 171.247 106.857 1.00 144.54 ? 385 LEU D CG  1 
ATOM   8699  C  CD1 . LEU C 1 385 ? 159.917 172.167 106.072 1.00 145.28 ? 385 LEU D CD1 1 
ATOM   8700  C  CD2 . LEU C 1 385 ? 160.032 170.203 107.553 1.00 143.88 ? 385 LEU D CD2 1 
ATOM   8701  N  N   . ILE C 1 386 ? 164.835 170.626 107.245 1.00 146.63 ? 386 ILE D N   1 
ATOM   8702  C  CA  . ILE C 1 386 ? 165.733 170.618 108.402 1.00 144.65 ? 386 ILE D CA  1 
ATOM   8703  C  C   . ILE C 1 386 ? 166.818 171.693 108.210 1.00 150.49 ? 386 ILE D C   1 
ATOM   8704  O  O   . ILE C 1 386 ? 167.192 172.368 109.172 1.00 147.54 ? 386 ILE D O   1 
ATOM   8705  C  CB  . ILE C 1 386 ? 166.309 169.185 108.613 1.00 149.96 ? 386 ILE D CB  1 
ATOM   8706  C  CG1 . ILE C 1 386 ? 165.208 168.164 109.044 1.00 147.37 ? 386 ILE D CG1 1 
ATOM   8707  C  CG2 . ILE C 1 386 ? 167.528 169.151 109.536 1.00 151.14 ? 386 ILE D CG2 1 
ATOM   8708  C  CD1 . ILE C 1 386 ? 164.279 168.519 110.300 1.00 146.32 ? 386 ILE D CD1 1 
ATOM   8709  N  N   . GLY C 1 387 ? 167.268 171.862 106.968 1.00 152.05 ? 387 GLY D N   1 
ATOM   8710  C  CA  . GLY C 1 387 ? 168.241 172.881 106.595 1.00 155.52 ? 387 GLY D CA  1 
ATOM   8711  C  C   . GLY C 1 387 ? 167.687 174.275 106.814 1.00 156.51 ? 387 GLY D C   1 
ATOM   8712  O  O   . GLY C 1 387 ? 168.396 175.160 107.303 1.00 156.31 ? 387 GLY D O   1 
ATOM   8713  N  N   . LEU C 1 388 ? 166.388 174.459 106.487 1.00 150.41 ? 388 LEU D N   1 
ATOM   8714  C  CA  . LEU C 1 388 ? 165.660 175.712 106.675 1.00 146.93 ? 388 LEU D CA  1 
ATOM   8715  C  C   . LEU C 1 388 ? 165.529 176.023 108.163 1.00 145.67 ? 388 LEU D C   1 
ATOM   8716  O  O   . LEU C 1 388 ? 165.644 177.182 108.541 1.00 143.80 ? 388 LEU D O   1 
ATOM   8717  C  CB  . LEU C 1 388 ? 164.269 175.655 106.013 1.00 145.68 ? 388 LEU D CB  1 
ATOM   8718  C  CG  . LEU C 1 388 ? 164.214 175.812 104.491 1.00 155.64 ? 388 LEU D CG  1 
ATOM   8719  C  CD1 . LEU C 1 388 ? 163.023 175.081 103.915 1.00 155.48 ? 388 LEU D CD1 1 
ATOM   8720  C  CD2 . LEU C 1 388 ? 164.154 177.275 104.084 1.00 159.54 ? 388 LEU D CD2 1 
ATOM   8721  N  N   . LEU C 1 389 ? 165.324 174.990 109.009 1.00 140.09 ? 389 LEU D N   1 
ATOM   8722  C  CA  . LEU C 1 389 ? 165.195 175.160 110.459 1.00 135.58 ? 389 LEU D CA  1 
ATOM   8723  C  C   . LEU C 1 389 ? 166.541 175.507 111.106 1.00 142.86 ? 389 LEU D C   1 
ATOM   8724  O  O   . LEU C 1 389 ? 166.611 176.483 111.849 1.00 140.64 ? 389 LEU D O   1 
ATOM   8725  C  CB  . LEU C 1 389 ? 164.599 173.907 111.137 1.00 132.70 ? 389 LEU D CB  1 
ATOM   8726  C  CG  . LEU C 1 389 ? 163.162 173.515 110.784 1.00 134.88 ? 389 LEU D CG  1 
ATOM   8727  C  CD1 . LEU C 1 389 ? 162.857 172.107 111.249 1.00 134.05 ? 389 LEU D CD1 1 
ATOM   8728  C  CD2 . LEU C 1 389 ? 162.157 174.476 111.383 1.00 133.25 ? 389 LEU D CD2 1 
ATOM   8729  N  N   . ILE C 1 390 ? 167.605 174.723 110.815 1.00 144.19 ? 390 ILE D N   1 
ATOM   8730  C  CA  . ILE C 1 390 ? 168.939 174.896 111.404 1.00 146.73 ? 390 ILE D CA  1 
ATOM   8731  C  C   . ILE C 1 390 ? 169.539 176.274 111.053 1.00 154.45 ? 390 ILE D C   1 
ATOM   8732  O  O   . ILE C 1 390 ? 169.933 176.999 111.966 1.00 152.75 ? 390 ILE D O   1 
ATOM   8733  C  CB  . ILE C 1 390 ? 169.886 173.715 111.020 1.00 154.29 ? 390 ILE D CB  1 
ATOM   8734  C  CG1 . ILE C 1 390 ? 169.474 172.427 111.777 1.00 152.20 ? 390 ILE D CG1 1 
ATOM   8735  C  CG2 . ILE C 1 390 ? 171.368 174.053 111.278 1.00 159.33 ? 390 ILE D CG2 1 
ATOM   8736  C  CD1 . ILE C 1 390 ? 170.157 171.109 111.347 1.00 163.98 ? 390 ILE D CD1 1 
ATOM   8737  N  N   . ILE C 1 391 ? 169.584 176.639 109.760 1.00 155.99 ? 391 ILE D N   1 
ATOM   8738  C  CA  . ILE C 1 391 ? 170.193 177.895 109.309 1.00 159.82 ? 391 ILE D CA  1 
ATOM   8739  C  C   . ILE C 1 391 ? 169.326 179.118 109.694 1.00 161.32 ? 391 ILE D C   1 
ATOM   8740  O  O   . ILE C 1 391 ? 169.863 180.059 110.283 1.00 161.88 ? 391 ILE D O   1 
ATOM   8741  C  CB  . ILE C 1 391 ? 170.524 177.850 107.785 1.00 168.90 ? 391 ILE D CB  1 
ATOM   8742  C  CG1 . ILE C 1 391 ? 171.560 176.734 107.491 1.00 174.50 ? 391 ILE D CG1 1 
ATOM   8743  C  CG2 . ILE C 1 391 ? 171.045 179.202 107.276 1.00 173.16 ? 391 ILE D CG2 1 
ATOM   8744  C  CD1 . ILE C 1 391 ? 171.544 176.149 106.069 1.00 184.03 ? 391 ILE D CD1 1 
ATOM   8745  N  N   . PHE C 1 392 ? 168.013 179.106 109.382 1.00 154.70 ? 392 PHE D N   1 
ATOM   8746  C  CA  . PHE C 1 392 ? 167.132 180.246 109.652 1.00 150.98 ? 392 PHE D CA  1 
ATOM   8747  C  C   . PHE C 1 392 ? 166.813 180.456 111.136 1.00 150.29 ? 392 PHE D C   1 
ATOM   8748  O  O   . PHE C 1 392 ? 166.744 181.611 111.559 1.00 148.76 ? 392 PHE D O   1 
ATOM   8749  C  CB  . PHE C 1 392 ? 165.819 180.146 108.860 1.00 151.09 ? 392 PHE D CB  1 
ATOM   8750  C  CG  . PHE C 1 392 ? 165.903 180.561 107.407 1.00 157.44 ? 392 PHE D CG  1 
ATOM   8751  C  CD1 . PHE C 1 392 ? 166.332 179.667 106.434 1.00 164.89 ? 392 PHE D CD1 1 
ATOM   8752  C  CD2 . PHE C 1 392 ? 165.522 181.836 107.007 1.00 160.11 ? 392 PHE D CD2 1 
ATOM   8753  C  CE1 . PHE C 1 392 ? 166.396 180.050 105.088 1.00 170.90 ? 392 PHE D CE1 1 
ATOM   8754  C  CE2 . PHE C 1 392 ? 165.580 182.213 105.659 1.00 167.96 ? 392 PHE D CE2 1 
ATOM   8755  C  CZ  . PHE C 1 392 ? 166.022 181.320 104.710 1.00 170.54 ? 392 PHE D CZ  1 
ATOM   8756  N  N   . GLN C 1 393 ? 166.599 179.379 111.916 1.00 145.07 ? 393 GLN D N   1 
ATOM   8757  C  CA  . GLN C 1 393 ? 166.214 179.536 113.324 1.00 141.23 ? 393 GLN D CA  1 
ATOM   8758  C  C   . GLN C 1 393 ? 167.378 179.404 114.330 1.00 147.53 ? 393 GLN D C   1 
ATOM   8759  O  O   . GLN C 1 393 ? 167.182 179.789 115.491 1.00 145.07 ? 393 GLN D O   1 
ATOM   8760  C  CB  . GLN C 1 393 ? 165.091 178.555 113.708 1.00 138.63 ? 393 GLN D CB  1 
ATOM   8761  N  N   . PHE C 1 394 ? 168.565 178.887 113.921 1.00 147.73 ? 394 PHE D N   1 
ATOM   8762  C  CA  . PHE C 1 394 ? 169.661 178.734 114.885 1.00 148.96 ? 394 PHE D CA  1 
ATOM   8763  C  C   . PHE C 1 394 ? 170.933 179.478 114.487 1.00 158.00 ? 394 PHE D C   1 
ATOM   8764  O  O   . PHE C 1 394 ? 171.488 180.184 115.330 1.00 157.73 ? 394 PHE D O   1 
ATOM   8765  C  CB  . PHE C 1 394 ? 169.974 177.252 115.159 1.00 151.43 ? 394 PHE D CB  1 
ATOM   8766  C  CG  . PHE C 1 394 ? 168.821 176.468 115.747 1.00 148.14 ? 394 PHE D CG  1 
ATOM   8767  C  CD1 . PHE C 1 394 ? 168.331 176.763 117.015 1.00 147.16 ? 394 PHE D CD1 1 
ATOM   8768  C  CD2 . PHE C 1 394 ? 168.236 175.425 115.039 1.00 150.04 ? 394 PHE D CD2 1 
ATOM   8769  C  CE1 . PHE C 1 394 ? 167.266 176.042 117.555 1.00 143.99 ? 394 PHE D CE1 1 
ATOM   8770  C  CE2 . PHE C 1 394 ? 167.172 174.700 115.583 1.00 148.73 ? 394 PHE D CE2 1 
ATOM   8771  C  CZ  . PHE C 1 394 ? 166.696 175.014 116.838 1.00 143.08 ? 394 PHE D CZ  1 
ATOM   8772  N  N   . ILE C 1 395 ? 171.412 179.307 113.235 1.00 159.72 ? 395 ILE D N   1 
ATOM   8773  C  CA  . ILE C 1 395 ? 172.642 179.949 112.741 1.00 165.51 ? 395 ILE D CA  1 
ATOM   8774  C  C   . ILE C 1 395 ? 172.428 181.469 112.584 1.00 169.21 ? 395 ILE D C   1 
ATOM   8775  O  O   . ILE C 1 395 ? 173.317 182.243 112.938 1.00 171.95 ? 395 ILE D O   1 
ATOM   8776  C  CB  . ILE C 1 395 ? 173.143 179.296 111.426 1.00 173.37 ? 395 ILE D CB  1 
ATOM   8777  N  N   . PHE C 1 396 ? 171.238 181.885 112.101 1.00 162.13 ? 396 PHE D N   1 
ATOM   8778  C  CA  . PHE C 1 396 ? 170.887 183.292 111.896 1.00 161.62 ? 396 PHE D CA  1 
ATOM   8779  C  C   . PHE C 1 396 ? 170.446 183.991 113.186 1.00 162.65 ? 396 PHE D C   1 
ATOM   8780  O  O   . PHE C 1 396 ? 170.241 185.208 113.152 1.00 162.36 ? 396 PHE D O   1 
ATOM   8781  C  CB  . PHE C 1 396 ? 169.777 183.433 110.836 1.00 161.79 ? 396 PHE D CB  1 
ATOM   8782  C  CG  . PHE C 1 396 ? 170.156 183.179 109.395 1.00 168.58 ? 396 PHE D CG  1 
ATOM   8783  C  CD1 . PHE C 1 396 ? 171.489 183.156 108.999 1.00 178.47 ? 396 PHE D CD1 1 
ATOM   8784  C  CD2 . PHE C 1 396 ? 169.178 183.011 108.424 1.00 170.00 ? 396 PHE D CD2 1 
ATOM   8785  C  CE1 . PHE C 1 396 ? 171.836 182.932 107.667 1.00 183.57 ? 396 PHE D CE1 1 
ATOM   8786  C  CE2 . PHE C 1 396 ? 169.524 182.786 107.092 1.00 178.68 ? 396 PHE D CE2 1 
ATOM   8787  C  CZ  . PHE C 1 396 ? 170.851 182.756 106.722 1.00 182.64 ? 396 PHE D CZ  1 
ATOM   8788  N  N   . SER C 1 397 ? 170.311 183.242 114.316 1.00 157.13 ? 397 SER D N   1 
ATOM   8789  C  CA  . SER C 1 397 ? 169.886 183.769 115.626 1.00 153.59 ? 397 SER D CA  1 
ATOM   8790  C  C   . SER C 1 397 ? 170.588 185.100 115.997 1.00 159.17 ? 397 SER D C   1 
ATOM   8791  O  O   . SER C 1 397 ? 169.859 186.041 116.316 1.00 156.37 ? 397 SER D O   1 
ATOM   8792  C  CB  . SER C 1 397 ? 170.091 182.744 116.738 1.00 156.70 ? 397 SER D CB  1 
ATOM   8793  O  OG  . SER C 1 397 ? 169.288 181.595 116.531 1.00 164.44 ? 397 SER D OG  1 
ATOM   8794  N  N   . PRO C 1 398 ? 171.941 185.263 115.903 1.00 159.87 ? 398 PRO D N   1 
ATOM   8795  C  CA  . PRO C 1 398 ? 172.527 186.573 116.238 1.00 162.26 ? 398 PRO D CA  1 
ATOM   8796  C  C   . PRO C 1 398 ? 172.016 187.706 115.341 1.00 165.46 ? 398 PRO D C   1 
ATOM   8797  O  O   . PRO C 1 398 ? 171.667 188.764 115.866 1.00 163.84 ? 398 PRO D O   1 
ATOM   8798  C  CB  . PRO C 1 398 ? 174.034 186.348 116.081 1.00 170.81 ? 398 PRO D CB  1 
ATOM   8799  C  CG  . PRO C 1 398 ? 174.166 185.140 115.227 1.00 176.28 ? 398 PRO D CG  1 
ATOM   8800  C  CD  . PRO C 1 398 ? 172.998 184.285 115.562 1.00 165.41 ? 398 PRO D CD  1 
ATOM   8801  N  N   . TYR C 1 399 ? 171.919 187.466 114.010 1.00 162.91 ? 399 TYR D N   1 
ATOM   8802  C  CA  . TYR C 1 399 ? 171.433 188.437 113.022 1.00 163.19 ? 399 TYR D CA  1 
ATOM   8803  C  C   . TYR C 1 399 ? 169.963 188.772 113.277 1.00 160.35 ? 399 TYR D C   1 
ATOM   8804  O  O   . TYR C 1 399 ? 169.599 189.949 113.302 1.00 159.83 ? 399 TYR D O   1 
ATOM   8805  C  CB  . TYR C 1 399 ? 171.630 187.904 111.585 1.00 167.61 ? 399 TYR D CB  1 
ATOM   8806  C  CG  . TYR C 1 399 ? 170.796 188.604 110.530 1.00 168.83 ? 399 TYR D CG  1 
ATOM   8807  C  CD1 . TYR C 1 399 ? 171.177 189.841 110.019 1.00 174.88 ? 399 TYR D CD1 1 
ATOM   8808  C  CD2 . TYR C 1 399 ? 169.637 188.019 110.027 1.00 165.91 ? 399 TYR D CD2 1 
ATOM   8809  C  CE1 . TYR C 1 399 ? 170.411 190.492 109.052 1.00 175.78 ? 399 TYR D CE1 1 
ATOM   8810  C  CE2 . TYR C 1 399 ? 168.864 188.660 109.060 1.00 167.41 ? 399 TYR D CE2 1 
ATOM   8811  C  CZ  . TYR C 1 399 ? 169.258 189.895 108.570 1.00 177.69 ? 399 TYR D CZ  1 
ATOM   8812  O  OH  . TYR C 1 399 ? 168.504 190.528 107.611 1.00 178.39 ? 399 TYR D OH  1 
ATOM   8813  N  N   . ASN C 1 400 ? 169.132 187.733 113.467 1.00 152.06 ? 400 ASN D N   1 
ATOM   8814  C  CA  . ASN C 1 400 ? 167.698 187.845 113.720 1.00 146.55 ? 400 ASN D CA  1 
ATOM   8815  C  C   . ASN C 1 400 ? 167.415 188.685 114.975 1.00 147.53 ? 400 ASN D C   1 
ATOM   8816  O  O   . ASN C 1 400 ? 166.451 189.446 114.977 1.00 144.38 ? 400 ASN D O   1 
ATOM   8817  C  CB  . ASN C 1 400 ? 167.060 186.449 113.847 1.00 144.52 ? 400 ASN D CB  1 
ATOM   8818  C  CG  . ASN C 1 400 ? 167.044 185.612 112.576 1.00 165.23 ? 400 ASN D CG  1 
ATOM   8819  O  OD1 . ASN C 1 400 ? 167.034 186.121 111.444 1.00 162.70 ? 400 ASN D OD1 1 
ATOM   8820  N  ND2 . ASN C 1 400 ? 166.979 184.296 112.741 1.00 151.98 ? 400 ASN D ND2 1 
ATOM   8821  N  N   . GLU C 1 401 ? 168.270 188.574 116.015 1.00 145.42 ? 401 GLU D N   1 
ATOM   8822  C  CA  . GLU C 1 401 ? 168.138 189.320 117.268 1.00 143.88 ? 401 GLU D CA  1 
ATOM   8823  C  C   . GLU C 1 401 ? 168.495 190.789 117.088 1.00 151.08 ? 401 GLU D C   1 
ATOM   8824  O  O   . GLU C 1 401 ? 167.818 191.642 117.665 1.00 148.80 ? 401 GLU D O   1 
ATOM   8825  C  CB  . GLU C 1 401 ? 169.005 188.699 118.380 1.00 146.43 ? 401 GLU D CB  1 
ATOM   8826  C  CG  . GLU C 1 401 ? 168.306 187.606 119.178 1.00 155.03 ? 401 GLU D CG  1 
ATOM   8827  C  CD  . GLU C 1 401 ? 167.041 188.001 119.920 1.00 174.58 ? 401 GLU D CD  1 
ATOM   8828  O  OE1 . GLU C 1 401 ? 167.006 189.111 120.501 1.00 169.78 ? 401 GLU D OE1 1 
ATOM   8829  O  OE2 . GLU C 1 401 ? 166.088 187.189 119.933 1.00 167.08 ? 401 GLU D OE2 1 
ATOM   8830  N  N   . VAL C 1 402 ? 169.555 191.083 116.298 1.00 152.87 ? 402 VAL D N   1 
ATOM   8831  C  CA  . VAL C 1 402 ? 170.019 192.449 116.016 1.00 156.68 ? 402 VAL D CA  1 
ATOM   8832  C  C   . VAL C 1 402 ? 168.968 193.154 115.140 1.00 159.29 ? 402 VAL D C   1 
ATOM   8833  O  O   . VAL C 1 402 ? 168.526 194.246 115.499 1.00 158.06 ? 402 VAL D O   1 
ATOM   8834  C  CB  . VAL C 1 402 ? 171.445 192.481 115.391 1.00 167.32 ? 402 VAL D CB  1 
ATOM   8835  C  CG1 . VAL C 1 402 ? 171.807 193.872 114.872 1.00 171.73 ? 402 VAL D CG1 1 
ATOM   8836  C  CG2 . VAL C 1 402 ? 172.496 192.004 116.392 1.00 169.25 ? 402 VAL D CG2 1 
ATOM   8837  N  N   . LEU C 1 403 ? 168.534 192.505 114.037 1.00 156.15 ? 403 LEU D N   1 
ATOM   8838  C  CA  . LEU C 1 403 ? 167.521 193.019 113.109 1.00 155.75 ? 403 LEU D CA  1 
ATOM   8839  C  C   . LEU C 1 403 ? 166.203 193.349 113.834 1.00 156.50 ? 403 LEU D C   1 
ATOM   8840  O  O   . LEU C 1 403 ? 165.603 194.390 113.552 1.00 156.78 ? 403 LEU D O   1 
ATOM   8841  C  CB  . LEU C 1 403 ? 167.263 192.006 111.987 1.00 156.02 ? 403 LEU D CB  1 
ATOM   8842  C  CG  . LEU C 1 403 ? 166.360 192.470 110.850 1.00 161.31 ? 403 LEU D CG  1 
ATOM   8843  C  CD1 . LEU C 1 403 ? 167.174 192.979 109.685 1.00 168.19 ? 403 LEU D CD1 1 
ATOM   8844  C  CD2 . LEU C 1 403 ? 165.445 191.353 110.404 1.00 160.81 ? 403 LEU D CD2 1 
ATOM   8845  N  N   . SER C 1 404 ? 165.771 192.473 114.774 1.00 149.71 ? 404 SER D N   1 
ATOM   8846  C  CA  . SER C 1 404 ? 164.553 192.657 115.569 1.00 145.17 ? 404 SER D CA  1 
ATOM   8847  C  C   . SER C 1 404 ? 164.671 193.872 116.474 1.00 149.69 ? 404 SER D C   1 
ATOM   8848  O  O   . SER C 1 404 ? 163.692 194.604 116.624 1.00 147.75 ? 404 SER D O   1 
ATOM   8849  C  CB  . SER C 1 404 ? 164.251 191.417 116.400 1.00 145.83 ? 404 SER D CB  1 
ATOM   8850  O  OG  . SER C 1 404 ? 163.829 190.350 115.567 1.00 156.79 ? 404 SER D OG  1 
ATOM   8851  N  N   . PHE C 1 405 ? 165.870 194.098 117.058 1.00 148.98 ? 405 PHE D N   1 
ATOM   8852  C  CA  . PHE C 1 405 ? 166.133 195.249 117.917 1.00 150.20 ? 405 PHE D CA  1 
ATOM   8853  C  C   . PHE C 1 405 ? 166.105 196.535 117.091 1.00 157.55 ? 405 PHE D C   1 
ATOM   8854  O  O   . PHE C 1 405 ? 165.545 197.531 117.543 1.00 156.34 ? 405 PHE D O   1 
ATOM   8855  C  CB  . PHE C 1 405 ? 167.473 195.102 118.665 1.00 155.13 ? 405 PHE D CB  1 
ATOM   8856  C  CG  . PHE C 1 405 ? 167.854 196.321 119.469 1.00 159.18 ? 405 PHE D CG  1 
ATOM   8857  C  CD1 . PHE C 1 405 ? 167.185 196.633 120.642 1.00 159.33 ? 405 PHE D CD1 1 
ATOM   8858  C  CD2 . PHE C 1 405 ? 168.862 197.172 119.036 1.00 167.00 ? 405 PHE D CD2 1 
ATOM   8859  C  CE1 . PHE C 1 405 ? 167.526 197.767 121.376 1.00 163.04 ? 405 PHE D CE1 1 
ATOM   8860  C  CE2 . PHE C 1 405 ? 169.198 198.310 119.768 1.00 172.56 ? 405 PHE D CE2 1 
ATOM   8861  C  CZ  . PHE C 1 405 ? 168.530 198.599 120.933 1.00 167.72 ? 405 PHE D CZ  1 
ATOM   8862  N  N   . CYS C 1 406 ? 166.693 196.499 115.879 1.00 158.49 ? 406 CYS D N   1 
ATOM   8863  C  CA  . CYS C 1 406 ? 166.739 197.633 114.954 1.00 162.66 ? 406 CYS D CA  1 
ATOM   8864  C  C   . CYS C 1 406 ? 165.330 197.984 114.474 1.00 163.84 ? 406 CYS D C   1 
ATOM   8865  O  O   . CYS C 1 406 ? 165.000 199.166 114.381 1.00 165.07 ? 406 CYS D O   1 
ATOM   8866  C  CB  . CYS C 1 406 ? 167.672 197.343 113.781 1.00 168.07 ? 406 CYS D CB  1 
ATOM   8867  S  SG  . CYS C 1 406 ? 169.425 197.231 114.232 1.00 177.21 ? 406 CYS D SG  1 
ATOM   8868  N  N   . LEU C 1 407 ? 164.493 196.966 114.207 1.00 156.75 ? 407 LEU D N   1 
ATOM   8869  C  CA  . LEU C 1 407 ? 163.117 197.170 113.758 1.00 154.48 ? 407 LEU D CA  1 
ATOM   8870  C  C   . LEU C 1 407 ? 162.210 197.684 114.897 1.00 155.36 ? 407 LEU D C   1 
ATOM   8871  O  O   . LEU C 1 407 ? 161.225 198.372 114.615 1.00 155.40 ? 407 LEU D O   1 
ATOM   8872  C  CB  . LEU C 1 407 ? 162.550 195.888 113.140 1.00 152.22 ? 407 LEU D CB  1 
ATOM   8873  C  CG  . LEU C 1 407 ? 162.961 195.635 111.689 1.00 161.19 ? 407 LEU D CG  1 
ATOM   8874  C  CD1 . LEU C 1 407 ? 162.973 194.157 111.373 1.00 159.74 ? 407 LEU D CD1 1 
ATOM   8875  C  CD2 . LEU C 1 407 ? 162.059 196.385 110.720 1.00 165.84 ? 407 LEU D CD2 1 
ATOM   8876  N  N   . THR C 1 408 ? 162.559 197.381 116.172 1.00 148.93 ? 408 THR D N   1 
ATOM   8877  C  CA  . THR C 1 408 ? 161.836 197.854 117.361 1.00 145.38 ? 408 THR D CA  1 
ATOM   8878  C  C   . THR C 1 408 ? 162.151 199.347 117.553 1.00 151.42 ? 408 THR D C   1 
ATOM   8879  O  O   . THR C 1 408 ? 161.249 200.120 117.882 1.00 149.84 ? 408 THR D O   1 
ATOM   8880  C  CB  . THR C 1 408 ? 162.196 196.997 118.583 1.00 151.51 ? 408 THR D CB  1 
ATOM   8881  O  OG1 . THR C 1 408 ? 161.825 195.645 118.312 1.00 150.26 ? 408 THR D OG1 1 
ATOM   8882  C  CG2 . THR C 1 408 ? 161.504 197.461 119.860 1.00 147.45 ? 408 THR D CG2 1 
ATOM   8883  N  N   . VAL C 1 409 ? 163.427 199.742 117.315 1.00 151.75 ? 409 VAL D N   1 
ATOM   8884  C  CA  . VAL C 1 409 ? 163.915 201.128 117.387 1.00 155.45 ? 409 VAL D CA  1 
ATOM   8885  C  C   . VAL C 1 409 ? 163.184 201.944 116.304 1.00 159.74 ? 409 VAL D C   1 
ATOM   8886  O  O   . VAL C 1 409 ? 162.686 203.036 116.592 1.00 160.06 ? 409 VAL D O   1 
ATOM   8887  C  CB  . VAL C 1 409 ? 165.471 201.208 117.257 1.00 164.34 ? 409 VAL D CB  1 
ATOM   8888  C  CG1 . VAL C 1 409 ? 165.956 202.643 117.054 1.00 169.45 ? 409 VAL D CG1 1 
ATOM   8889  C  CG2 . VAL C 1 409 ? 166.163 200.584 118.466 1.00 163.29 ? 409 VAL D CG2 1 
ATOM   8890  N  N   . LEU C 1 410 ? 163.081 201.376 115.082 1.00 156.25 ? 410 LEU D N   1 
ATOM   8891  C  CA  . LEU C 1 410 ? 162.405 201.976 113.932 1.00 158.06 ? 410 LEU D CA  1 
ATOM   8892  C  C   . LEU C 1 410 ? 160.911 202.155 114.210 1.00 159.12 ? 410 LEU D C   1 
ATOM   8893  O  O   . LEU C 1 410 ? 160.370 203.219 113.903 1.00 161.41 ? 410 LEU D O   1 
ATOM   8894  C  CB  . LEU C 1 410 ? 162.620 201.114 112.674 1.00 159.39 ? 410 LEU D CB  1 
ATOM   8895  C  CG  . LEU C 1 410 ? 162.066 201.672 111.366 1.00 167.21 ? 410 LEU D CG  1 
ATOM   8896  C  CD1 . LEU C 1 410 ? 163.145 202.397 110.572 1.00 174.07 ? 410 LEU D CD1 1 
ATOM   8897  C  CD2 . LEU C 1 410 ? 161.423 200.572 110.549 1.00 167.72 ? 410 LEU D CD2 1 
ATOM   8898  N  N   . SER C 1 411 ? 160.258 201.132 114.811 1.00 150.64 ? 411 SER D N   1 
ATOM   8899  C  CA  . SER C 1 411 ? 158.834 201.142 115.161 1.00 147.27 ? 411 SER D CA  1 
ATOM   8900  C  C   . SER C 1 411 ? 158.487 202.320 116.085 1.00 152.53 ? 411 SER D C   1 
ATOM   8901  O  O   . SER C 1 411 ? 157.445 202.954 115.892 1.00 152.32 ? 411 SER D O   1 
ATOM   8902  C  CB  . SER C 1 411 ? 158.437 199.824 115.820 1.00 146.29 ? 411 SER D CB  1 
ATOM   8903  O  OG  . SER C 1 411 ? 157.080 199.830 116.234 1.00 153.60 ? 411 SER D OG  1 
ATOM   8904  N  N   . ARG C 1 412 ? 159.367 202.618 117.069 1.00 150.27 ? 412 ARG D N   1 
ATOM   8905  C  CA  . ARG C 1 412 ? 159.200 203.724 118.016 1.00 151.05 ? 412 ARG D CA  1 
ATOM   8906  C  C   . ARG C 1 412 ? 159.289 205.064 117.291 1.00 160.60 ? 412 ARG D C   1 
ATOM   8907  O  O   . ARG C 1 412 ? 158.478 205.952 117.559 1.00 160.59 ? 412 ARG D O   1 
ATOM   8908  C  CB  . ARG C 1 412 ? 160.243 203.657 119.142 1.00 150.86 ? 412 ARG D CB  1 
ATOM   8909  C  CG  . ARG C 1 412 ? 160.007 202.529 120.137 1.00 153.93 ? 412 ARG D CG  1 
ATOM   8910  C  CD  . ARG C 1 412 ? 160.790 202.727 121.420 1.00 164.66 ? 412 ARG D CD  1 
ATOM   8911  N  NE  . ARG C 1 412 ? 162.235 202.594 121.225 1.00 175.59 ? 412 ARG D NE  1 
ATOM   8912  C  CZ  . ARG C 1 412 ? 162.922 201.467 121.384 1.00 185.58 ? 412 ARG D CZ  1 
ATOM   8913  N  NH1 . ARG C 1 412 ? 162.302 200.346 121.742 1.00 166.26 ? 412 ARG D NH1 1 
ATOM   8914  N  NH2 . ARG C 1 412 ? 164.233 201.448 121.191 1.00 174.94 ? 412 ARG D NH2 1 
ATOM   8915  N  N   . ARG C 1 413 ? 160.254 205.196 116.357 1.00 162.18 ? 413 ARG D N   1 
ATOM   8916  C  CA  . ARG C 1 413 ? 160.462 206.401 115.552 1.00 168.10 ? 413 ARG D CA  1 
ATOM   8917  C  C   . ARG C 1 413 ? 159.293 206.609 114.583 1.00 173.41 ? 413 ARG D C   1 
ATOM   8918  O  O   . ARG C 1 413 ? 158.891 207.750 114.350 1.00 176.22 ? 413 ARG D O   1 
ATOM   8919  C  CB  . ARG C 1 413 ? 161.797 206.333 114.797 1.00 173.84 ? 413 ARG D CB  1 
ATOM   8920  C  CG  . ARG C 1 413 ? 163.011 206.500 115.710 1.00 189.20 ? 413 ARG D CG  1 
ATOM   8921  C  CD  . ARG C 1 413 ? 164.304 206.620 114.927 1.00 209.41 ? 413 ARG D CD  1 
ATOM   8922  N  NE  . ARG C 1 413 ? 165.470 206.699 115.809 1.00 221.36 ? 413 ARG D NE  1 
ATOM   8923  C  CZ  . ARG C 1 413 ? 166.085 207.829 116.150 1.00 234.43 ? 413 ARG D CZ  1 
ATOM   8924  N  NH1 . ARG C 1 413 ? 165.656 208.996 115.683 1.00 227.09 ? 413 ARG D NH1 1 
ATOM   8925  N  NH2 . ARG C 1 413 ? 167.138 207.800 116.957 1.00 227.53 ? 413 ARG D NH2 1 
ATOM   8926  N  N   . PHE C 1 414 ? 158.731 205.502 114.055 1.00 167.74 ? 414 PHE D N   1 
ATOM   8927  C  CA  . PHE C 1 414 ? 157.581 205.494 113.147 1.00 168.12 ? 414 PHE D CA  1 
ATOM   8928  C  C   . PHE C 1 414 ? 156.302 205.913 113.869 1.00 170.35 ? 414 PHE D C   1 
ATOM   8929  O  O   . PHE C 1 414 ? 155.417 206.502 113.247 1.00 171.72 ? 414 PHE D O   1 
ATOM   8930  C  CB  . PHE C 1 414 ? 157.394 204.098 112.530 1.00 167.65 ? 414 PHE D CB  1 
ATOM   8931  C  CG  . PHE C 1 414 ? 158.115 203.805 111.231 1.00 173.27 ? 414 PHE D CG  1 
ATOM   8932  C  CD1 . PHE C 1 414 ? 159.166 204.610 110.798 1.00 181.56 ? 414 PHE D CD1 1 
ATOM   8933  C  CD2 . PHE C 1 414 ? 157.777 202.695 110.467 1.00 174.54 ? 414 PHE D CD2 1 
ATOM   8934  C  CE1 . PHE C 1 414 ? 159.828 204.337 109.598 1.00 186.72 ? 414 PHE D CE1 1 
ATOM   8935  C  CE2 . PHE C 1 414 ? 158.442 202.421 109.269 1.00 181.62 ? 414 PHE D CE2 1 
ATOM   8936  C  CZ  . PHE C 1 414 ? 159.463 203.244 108.843 1.00 184.90 ? 414 PHE D CZ  1 
ATOM   8937  N  N   . GLU C 1 415 ? 156.202 205.599 115.177 1.00 163.95 ? 415 GLU D N   1 
ATOM   8938  C  CA  . GLU C 1 415 ? 155.051 205.952 116.012 1.00 161.89 ? 415 GLU D CA  1 
ATOM   8939  C  C   . GLU C 1 415 ? 155.065 207.445 116.353 1.00 169.08 ? 415 GLU D C   1 
ATOM   8940  O  O   . GLU C 1 415 ? 154.010 208.081 116.331 1.00 169.08 ? 415 GLU D O   1 
ATOM   8941  C  CB  . GLU C 1 415 ? 155.009 205.094 117.284 1.00 158.84 ? 415 GLU D CB  1 
ATOM   8942  C  CG  . GLU C 1 415 ? 154.360 203.735 117.068 1.00 165.77 ? 415 GLU D CG  1 
ATOM   8943  C  CD  . GLU C 1 415 ? 152.874 203.783 116.754 1.00 185.00 ? 415 GLU D CD  1 
ATOM   8944  O  OE1 . GLU C 1 415 ? 152.101 204.252 117.619 1.00 184.35 ? 415 GLU D OE1 1 
ATOM   8945  O  OE2 . GLU C 1 415 ? 152.482 203.368 115.639 1.00 176.35 ? 415 GLU D OE2 1 
ATOM   8946  N  N   . PHE C 1 416 ? 156.260 208.005 116.630 1.00 168.54 ? 416 PHE D N   1 
ATOM   8947  C  CA  . PHE C 1 416 ? 156.452 209.426 116.920 1.00 172.68 ? 416 PHE D CA  1 
ATOM   8948  C  C   . PHE C 1 416 ? 156.112 210.282 115.703 1.00 180.61 ? 416 PHE D C   1 
ATOM   8949  O  O   . PHE C 1 416 ? 155.560 211.373 115.861 1.00 182.69 ? 416 PHE D O   1 
ATOM   8950  C  CB  . PHE C 1 416 ? 157.897 209.706 117.358 1.00 177.41 ? 416 PHE D CB  1 
ATOM   8951  C  CG  . PHE C 1 416 ? 158.170 209.602 118.839 1.00 177.48 ? 416 PHE D CG  1 
ATOM   8952  C  CD1 . PHE C 1 416 ? 157.521 210.439 119.743 1.00 181.34 ? 416 PHE D CD1 1 
ATOM   8953  C  CD2 . PHE C 1 416 ? 159.130 208.724 119.323 1.00 178.55 ? 416 PHE D CD2 1 
ATOM   8954  C  CE1 . PHE C 1 416 ? 157.790 210.357 121.110 1.00 181.29 ? 416 PHE D CE1 1 
ATOM   8955  C  CE2 . PHE C 1 416 ? 159.417 208.661 120.688 1.00 180.53 ? 416 PHE D CE2 1 
ATOM   8956  C  CZ  . PHE C 1 416 ? 158.736 209.469 121.573 1.00 179.04 ? 416 PHE D CZ  1 
ATOM   8957  N  N   . GLN C 1 417 ? 156.451 209.781 114.494 1.00 178.33 ? 417 GLN D N   1 
ATOM   8958  C  CA  . GLN C 1 417 ? 156.191 210.438 113.211 1.00 182.71 ? 417 GLN D CA  1 
ATOM   8959  C  C   . GLN C 1 417 ? 154.687 210.493 112.932 1.00 185.18 ? 417 GLN D C   1 
ATOM   8960  O  O   . GLN C 1 417 ? 154.192 211.516 112.452 1.00 188.83 ? 417 GLN D O   1 
ATOM   8961  C  CB  . GLN C 1 417 ? 156.930 209.716 112.072 1.00 185.74 ? 417 GLN D CB  1 
ATOM   8962  C  CG  . GLN C 1 417 ? 158.408 210.087 111.968 1.00 204.78 ? 417 GLN D CG  1 
ATOM   8963  C  CD  . GLN C 1 417 ? 159.156 209.303 110.912 1.00 222.37 ? 417 GLN D CD  1 
ATOM   8964  O  OE1 . GLN C 1 417 ? 158.642 208.996 109.828 1.00 218.61 ? 417 GLN D OE1 1 
ATOM   8965  N  NE2 . GLN C 1 417 ? 160.414 209.002 111.191 1.00 218.39 ? 417 GLN D NE2 1 
ATOM   8966  N  N   . ALA C 1 418 ? 153.963 209.404 113.261 1.00 176.40 ? 418 ALA D N   1 
ATOM   8967  C  CA  . ALA C 1 418 ? 152.514 209.302 113.095 1.00 175.09 ? 418 ALA D CA  1 
ATOM   8968  C  C   . ALA C 1 418 ? 151.779 210.179 114.114 1.00 179.16 ? 418 ALA D C   1 
ATOM   8969  O  O   . ALA C 1 418 ? 150.680 210.651 113.818 1.00 180.32 ? 418 ALA D O   1 
ATOM   8970  C  CB  . ALA C 1 418 ? 152.077 207.860 113.229 1.00 170.97 ? 418 ALA D CB  1 
ATOM   8971  N  N   . ASP C 1 419 ? 152.387 210.400 115.306 1.00 174.84 ? 419 ASP D N   1 
ATOM   8972  C  CA  . ASP C 1 419 ? 151.843 211.270 116.358 1.00 175.21 ? 419 ASP D CA  1 
ATOM   8973  C  C   . ASP C 1 419 ? 152.025 212.730 115.960 1.00 183.73 ? 419 ASP D C   1 
ATOM   8974  O  O   . ASP C 1 419 ? 151.142 213.549 116.216 1.00 184.70 ? 419 ASP D O   1 
ATOM   8975  C  CB  . ASP C 1 419 ? 152.507 210.993 117.721 1.00 174.84 ? 419 ASP D CB  1 
ATOM   8976  C  CG  . ASP C 1 419 ? 152.090 209.690 118.380 1.00 183.74 ? 419 ASP D CG  1 
ATOM   8977  O  OD1 . ASP C 1 419 ? 150.884 209.353 118.328 1.00 182.97 ? 419 ASP D OD1 1 
ATOM   8978  O  OD2 . ASP C 1 419 ? 152.967 209.010 118.958 1.00 189.57 ? 419 ASP D OD2 1 
ATOM   8979  N  N   . ALA C 1 420 ? 153.169 213.042 115.314 1.00 183.37 ? 420 ALA D N   1 
ATOM   8980  C  CA  . ALA C 1 420 ? 153.517 214.367 114.799 1.00 189.26 ? 420 ALA D CA  1 
ATOM   8981  C  C   . ALA C 1 420 ? 152.594 214.749 113.634 1.00 196.20 ? 420 ALA D C   1 
ATOM   8982  O  O   . ALA C 1 420 ? 152.278 215.930 113.462 1.00 200.42 ? 420 ALA D O   1 
ATOM   8983  C  CB  . ALA C 1 420 ? 154.969 214.383 114.349 1.00 192.76 ? 420 ALA D CB  1 
ATOM   8984  N  N   . PHE C 1 421 ? 152.161 213.739 112.845 1.00 190.35 ? 421 PHE D N   1 
ATOM   8985  C  CA  . PHE C 1 421 ? 151.237 213.897 111.720 1.00 192.88 ? 421 PHE D CA  1 
ATOM   8986  C  C   . PHE C 1 421 ? 149.834 214.223 112.242 1.00 194.81 ? 421 PHE D C   1 
ATOM   8987  O  O   . PHE C 1 421 ? 149.120 215.003 111.610 1.00 198.79 ? 421 PHE D O   1 
ATOM   8988  C  CB  . PHE C 1 421 ? 151.217 212.627 110.851 1.00 192.91 ? 421 PHE D CB  1 
ATOM   8989  C  CG  . PHE C 1 421 ? 150.405 212.739 109.581 1.00 198.60 ? 421 PHE D CG  1 
ATOM   8990  C  CD1 . PHE C 1 421 ? 150.976 213.227 108.413 1.00 207.67 ? 421 PHE D CD1 1 
ATOM   8991  C  CD2 . PHE C 1 421 ? 149.072 212.345 109.550 1.00 199.42 ? 421 PHE D CD2 1 
ATOM   8992  C  CE1 . PHE C 1 421 ? 150.225 213.327 107.239 1.00 210.50 ? 421 PHE D CE1 1 
ATOM   8993  C  CE2 . PHE C 1 421 ? 148.326 212.434 108.372 1.00 206.54 ? 421 PHE D CE2 1 
ATOM   8994  C  CZ  . PHE C 1 421 ? 148.905 212.933 107.228 1.00 209.63 ? 421 PHE D CZ  1 
ATOM   8995  N  N   . ALA C 1 422 ? 149.444 213.621 113.390 1.00 185.29 ? 422 ALA D N   1 
ATOM   8996  C  CA  . ALA C 1 422 ? 148.154 213.854 114.047 1.00 183.82 ? 422 ALA D CA  1 
ATOM   8997  C  C   . ALA C 1 422 ? 148.081 215.285 114.586 1.00 191.02 ? 422 ALA D C   1 
ATOM   8998  O  O   . ALA C 1 422 ? 147.013 215.901 114.544 1.00 193.05 ? 422 ALA D O   1 
ATOM   8999  C  CB  . ALA C 1 422 ? 147.948 212.854 115.169 1.00 178.62 ? 422 ALA D CB  1 
ATOM   9000  N  N   . LYS C 1 423 ? 149.231 215.817 115.062 1.00 188.18 ? 423 LYS D N   1 
ATOM   9001  C  CA  . LYS C 1 423 ? 149.381 217.190 115.554 1.00 191.86 ? 423 LYS D CA  1 
ATOM   9002  C  C   . LYS C 1 423 ? 149.332 218.161 114.382 1.00 201.66 ? 423 LYS D C   1 
ATOM   9003  O  O   . LYS C 1 423 ? 148.802 219.264 114.526 1.00 205.20 ? 423 LYS D O   1 
ATOM   9004  C  CB  . LYS C 1 423 ? 150.693 217.354 116.332 1.00 193.95 ? 423 LYS D CB  1 
ATOM   9005  N  N   . LYS C 1 424 ? 149.866 217.732 113.214 1.00 199.22 ? 424 LYS D N   1 
ATOM   9006  C  CA  . LYS C 1 424 ? 149.878 218.490 111.961 1.00 205.06 ? 424 LYS D CA  1 
ATOM   9007  C  C   . LYS C 1 424 ? 148.456 218.610 111.387 1.00 210.16 ? 424 LYS D C   1 
ATOM   9008  O  O   . LYS C 1 424 ? 148.185 219.547 110.632 1.00 213.49 ? 424 LYS D O   1 
ATOM   9009  C  CB  . LYS C 1 424 ? 150.822 217.837 110.939 1.00 208.22 ? 424 LYS D CB  1 
ATOM   9010  N  N   . LEU C 1 425 ? 147.552 217.673 111.756 1.00 201.31 ? 425 LEU D N   1 
ATOM   9011  C  CA  . LEU C 1 425 ? 146.144 217.674 111.346 1.00 202.38 ? 425 LEU D CA  1 
ATOM   9012  C  C   . LEU C 1 425 ? 145.307 218.568 112.269 1.00 207.63 ? 425 LEU D C   1 
ATOM   9013  O  O   . LEU C 1 425 ? 144.183 218.933 111.915 1.00 210.36 ? 425 LEU D O   1 
ATOM   9014  C  CB  . LEU C 1 425 ? 145.570 216.249 111.332 1.00 197.26 ? 425 LEU D CB  1 
ATOM   9015  C  CG  . LEU C 1 425 ? 146.013 215.335 110.189 1.00 201.79 ? 425 LEU D CG  1 
ATOM   9016  C  CD1 . LEU C 1 425 ? 145.800 213.886 110.557 1.00 195.81 ? 425 LEU D CD1 1 
ATOM   9017  C  CD2 . LEU C 1 425 ? 145.271 215.655 108.895 1.00 209.75 ? 425 LEU D CD2 1 
ATOM   9018  N  N   . GLY C 1 426 ? 145.866 218.906 113.433 1.00 202.43 ? 426 GLY D N   1 
ATOM   9019  C  CA  . GLY C 1 426 ? 145.236 219.764 114.432 1.00 203.61 ? 426 GLY D CA  1 
ATOM   9020  C  C   . GLY C 1 426 ? 144.582 219.034 115.589 1.00 202.21 ? 426 GLY D C   1 
ATOM   9021  O  O   . GLY C 1 426 ? 144.159 219.670 116.560 1.00 202.49 ? 426 GLY D O   1 
ATOM   9022  N  N   . LYS C 1 427 ? 144.504 217.691 115.503 1.00 193.71 ? 427 LYS D N   1 
ATOM   9023  C  CA  . LYS C 1 427 ? 143.882 216.836 116.519 1.00 188.61 ? 427 LYS D CA  1 
ATOM   9024  C  C   . LYS C 1 427 ? 144.900 216.399 117.603 1.00 188.19 ? 427 LYS D C   1 
ATOM   9025  O  O   . LYS C 1 427 ? 144.799 215.290 118.138 1.00 182.99 ? 427 LYS D O   1 
ATOM   9026  C  CB  . LYS C 1 427 ? 143.226 215.613 115.851 1.00 188.35 ? 427 LYS D CB  1 
ATOM   9027  C  CG  . LYS C 1 427 ? 142.006 215.957 115.002 1.00 206.00 ? 427 LYS D CG  1 
ATOM   9028  C  CD  . LYS C 1 427 ? 140.847 215.012 115.268 1.00 212.68 ? 427 LYS D CD  1 
ATOM   9029  N  N   . ALA C 1 428 ? 145.853 217.295 117.947 1.00 186.81 ? 428 ALA D N   1 
ATOM   9030  C  CA  . ALA C 1 428 ? 146.896 217.063 118.950 1.00 183.73 ? 428 ALA D CA  1 
ATOM   9031  C  C   . ALA C 1 428 ? 146.320 216.986 120.365 1.00 185.07 ? 428 ALA D C   1 
ATOM   9032  O  O   . ALA C 1 428 ? 146.729 216.115 121.132 1.00 180.09 ? 428 ALA D O   1 
ATOM   9033  C  CB  . ALA C 1 428 ? 147.944 218.161 118.877 1.00 188.71 ? 428 ALA D CB  1 
ATOM   9034  N  N   . LYS C 1 429 ? 145.381 217.897 120.706 1.00 185.40 ? 429 LYS D N   1 
ATOM   9035  C  CA  . LYS C 1 429 ? 144.725 217.966 122.016 1.00 184.80 ? 429 LYS D CA  1 
ATOM   9036  C  C   . LYS C 1 429 ? 143.809 216.763 122.242 1.00 185.08 ? 429 LYS D C   1 
ATOM   9037  O  O   . LYS C 1 429 ? 143.706 216.273 123.369 1.00 181.95 ? 429 LYS D O   1 
ATOM   9038  C  CB  . LYS C 1 429 ? 143.927 219.271 122.151 1.00 192.74 ? 429 LYS D CB  1 
ATOM   9039  N  N   . ASP C 1 430 ? 143.155 216.289 121.167 1.00 182.22 ? 430 ASP D N   1 
ATOM   9040  C  CA  . ASP C 1 430 ? 142.249 215.143 121.198 1.00 179.35 ? 430 ASP D CA  1 
ATOM   9041  C  C   . ASP C 1 430 ? 143.027 213.824 121.333 1.00 178.18 ? 430 ASP D C   1 
ATOM   9042  O  O   . ASP C 1 430 ? 142.554 212.922 122.027 1.00 175.11 ? 430 ASP D O   1 
ATOM   9043  C  CB  . ASP C 1 430 ? 141.361 215.120 119.947 1.00 183.83 ? 430 ASP D CB  1 
ATOM   9044  C  CG  . ASP C 1 430 ? 140.441 216.314 119.819 1.00 202.08 ? 430 ASP D CG  1 
ATOM   9045  O  OD1 . ASP C 1 430 ? 139.369 216.305 120.458 1.00 203.81 ? 430 ASP D OD1 1 
ATOM   9046  O  OD2 . ASP C 1 430 ? 140.784 217.249 119.059 1.00 212.68 ? 430 ASP D OD2 1 
ATOM   9047  N  N   . LEU C 1 431 ? 144.216 213.717 120.683 1.00 173.48 ? 431 LEU D N   1 
ATOM   9048  C  CA  . LEU C 1 431 ? 145.076 212.525 120.744 1.00 168.26 ? 431 LEU D CA  1 
ATOM   9049  C  C   . LEU C 1 431 ? 145.735 212.412 122.124 1.00 169.22 ? 431 LEU D C   1 
ATOM   9050  O  O   . LEU C 1 431 ? 145.907 211.297 122.620 1.00 164.96 ? 431 LEU D O   1 
ATOM   9051  C  CB  . LEU C 1 431 ? 146.142 212.538 119.627 1.00 169.05 ? 431 LEU D CB  1 
ATOM   9052  C  CG  . LEU C 1 431 ? 146.991 211.264 119.457 1.00 169.72 ? 431 LEU D CG  1 
ATOM   9053  C  CD1 . LEU C 1 431 ? 146.203 210.144 118.791 1.00 167.83 ? 431 LEU D CD1 1 
ATOM   9054  C  CD2 . LEU C 1 431 ? 148.245 211.541 118.667 1.00 173.68 ? 431 LEU D CD2 1 
ATOM   9055  N  N   . TYR C 1 432 ? 146.085 213.568 122.740 1.00 168.02 ? 432 TYR D N   1 
ATOM   9056  C  CA  . TYR C 1 432 ? 146.676 213.670 124.080 1.00 166.79 ? 432 TYR D CA  1 
ATOM   9057  C  C   . TYR C 1 432 ? 145.722 213.058 125.106 1.00 166.93 ? 432 TYR D C   1 
ATOM   9058  O  O   . TYR C 1 432 ? 146.156 212.285 125.959 1.00 163.76 ? 432 TYR D O   1 
ATOM   9059  C  CB  . TYR C 1 432 ? 146.974 215.144 124.421 1.00 173.12 ? 432 TYR D CB  1 
ATOM   9060  C  CG  . TYR C 1 432 ? 147.754 215.356 125.703 1.00 175.89 ? 432 TYR D CG  1 
ATOM   9061  C  CD1 . TYR C 1 432 ? 147.104 215.459 126.930 1.00 178.55 ? 432 TYR D CD1 1 
ATOM   9062  C  CD2 . TYR C 1 432 ? 149.133 215.534 125.680 1.00 177.66 ? 432 TYR D CD2 1 
ATOM   9063  C  CE1 . TYR C 1 432 ? 147.814 215.679 128.110 1.00 180.73 ? 432 TYR D CE1 1 
ATOM   9064  C  CE2 . TYR C 1 432 ? 149.854 215.755 126.854 1.00 179.86 ? 432 TYR D CE2 1 
ATOM   9065  C  CZ  . TYR C 1 432 ? 149.190 215.822 128.068 1.00 187.91 ? 432 TYR D CZ  1 
ATOM   9066  O  OH  . TYR C 1 432 ? 149.895 216.041 129.227 1.00 190.31 ? 432 TYR D OH  1 
ATOM   9067  N  N   . SER C 1 433 ? 144.421 213.393 124.999 1.00 164.17 ? 433 SER D N   1 
ATOM   9068  C  CA  . SER C 1 433 ? 143.361 212.881 125.865 1.00 162.65 ? 433 SER D CA  1 
ATOM   9069  C  C   . SER C 1 433 ? 143.081 211.402 125.573 1.00 161.59 ? 433 SER D C   1 
ATOM   9070  O  O   . SER C 1 433 ? 142.825 210.642 126.509 1.00 159.05 ? 433 SER D O   1 
ATOM   9071  C  CB  . SER C 1 433 ? 142.089 213.703 125.688 1.00 169.81 ? 433 SER D CB  1 
ATOM   9072  O  OG  . SER C 1 433 ? 141.063 213.258 126.560 1.00 178.17 ? 433 SER D OG  1 
ATOM   9073  N  N   . ALA C 1 434 ? 143.140 211.001 124.278 1.00 156.69 ? 434 ALA D N   1 
ATOM   9074  C  CA  . ALA C 1 434 ? 142.894 209.632 123.809 1.00 152.59 ? 434 ALA D CA  1 
ATOM   9075  C  C   . ALA C 1 434 ? 143.947 208.648 124.337 1.00 152.21 ? 434 ALA D C   1 
ATOM   9076  O  O   . ALA C 1 434 ? 143.572 207.618 124.896 1.00 149.85 ? 434 ALA D O   1 
ATOM   9077  C  CB  . ALA C 1 434 ? 142.856 209.591 122.288 1.00 153.96 ? 434 ALA D CB  1 
ATOM   9078  N  N   . LEU C 1 435 ? 145.252 208.979 124.186 1.00 147.50 ? 435 LEU D N   1 
ATOM   9079  C  CA  . LEU C 1 435 ? 146.392 208.166 124.628 1.00 143.65 ? 435 LEU D CA  1 
ATOM   9080  C  C   . LEU C 1 435 ? 146.334 207.856 126.130 1.00 145.78 ? 435 LEU D C   1 
ATOM   9081  O  O   . LEU C 1 435 ? 146.636 206.730 126.523 1.00 142.26 ? 435 LEU D O   1 
ATOM   9082  C  CB  . LEU C 1 435 ? 147.704 208.884 124.286 1.00 145.36 ? 435 LEU D CB  1 
ATOM   9083  C  CG  . LEU C 1 435 ? 148.539 208.308 123.141 1.00 148.82 ? 435 LEU D CG  1 
ATOM   9084  C  CD1 . LEU C 1 435 ? 147.784 208.319 121.816 1.00 149.81 ? 435 LEU D CD1 1 
ATOM   9085  C  CD2 . LEU C 1 435 ? 149.815 209.090 122.978 1.00 154.06 ? 435 LEU D CD2 1 
ATOM   9086  N  N   . ILE C 1 436 ? 145.908 208.841 126.951 1.00 144.93 ? 436 ILE D N   1 
ATOM   9087  C  CA  . ILE C 1 436 ? 145.742 208.725 128.404 1.00 144.85 ? 436 ILE D CA  1 
ATOM   9088  C  C   . ILE C 1 436 ? 144.543 207.802 128.708 1.00 147.34 ? 436 ILE D C   1 
ATOM   9089  O  O   . ILE C 1 436 ? 144.667 206.901 129.543 1.00 145.30 ? 436 ILE D O   1 
ATOM   9090  C  CB  . ILE C 1 436 ? 145.589 210.140 129.044 1.00 152.25 ? 436 ILE D CB  1 
ATOM   9091  C  CG1 . ILE C 1 436 ? 146.947 210.875 129.067 1.00 154.30 ? 436 ILE D CG1 1 
ATOM   9092  C  CG2 . ILE C 1 436 ? 144.964 210.082 130.452 1.00 154.17 ? 436 ILE D CG2 1 
ATOM   9093  C  CD1 . ILE C 1 436 ? 146.885 212.373 129.266 1.00 165.86 ? 436 ILE D CD1 1 
ATOM   9094  N  N   . LYS C 1 437 ? 143.401 208.026 128.020 1.00 144.85 ? 437 LYS D N   1 
ATOM   9095  C  CA  . LYS C 1 437 ? 142.157 207.260 128.170 1.00 143.91 ? 437 LYS D CA  1 
ATOM   9096  C  C   . LYS C 1 437 ? 142.342 205.790 127.752 1.00 144.01 ? 437 LYS D C   1 
ATOM   9097  O  O   . LYS C 1 437 ? 141.807 204.908 128.423 1.00 142.34 ? 437 LYS D O   1 
ATOM   9098  C  CB  . LYS C 1 437 ? 141.031 207.918 127.357 1.00 149.00 ? 437 LYS D CB  1 
ATOM   9099  C  CG  . LYS C 1 437 ? 139.625 207.510 127.747 1.00 163.02 ? 437 LYS D CG  1 
ATOM   9100  N  N   . LEU C 1 438 ? 143.116 205.531 126.673 1.00 139.22 ? 438 LEU D N   1 
ATOM   9101  C  CA  . LEU C 1 438 ? 143.416 204.180 126.180 1.00 135.67 ? 438 LEU D CA  1 
ATOM   9102  C  C   . LEU C 1 438 ? 144.368 203.451 127.129 1.00 138.72 ? 438 LEU D C   1 
ATOM   9103  O  O   . LEU C 1 438 ? 144.303 202.225 127.233 1.00 135.65 ? 438 LEU D O   1 
ATOM   9104  C  CB  . LEU C 1 438 ? 144.014 204.221 124.764 1.00 135.14 ? 438 LEU D CB  1 
ATOM   9105  C  CG  . LEU C 1 438 ? 143.054 204.573 123.633 1.00 141.93 ? 438 LEU D CG  1 
ATOM   9106  C  CD1 . LEU C 1 438 ? 143.803 205.072 122.419 1.00 143.10 ? 438 LEU D CD1 1 
ATOM   9107  C  CD2 . LEU C 1 438 ? 142.179 203.400 123.269 1.00 143.45 ? 438 LEU D CD2 1 
ATOM   9108  N  N   . ASN C 1 439 ? 145.245 204.208 127.820 1.00 138.06 ? 439 ASN D N   1 
ATOM   9109  C  CA  . ASN C 1 439 ? 146.194 203.678 128.800 1.00 137.38 ? 439 ASN D CA  1 
ATOM   9110  C  C   . ASN C 1 439 ? 145.442 203.184 130.039 1.00 142.64 ? 439 ASN D C   1 
ATOM   9111  O  O   . ASN C 1 439 ? 145.783 202.128 130.574 1.00 140.51 ? 439 ASN D O   1 
ATOM   9112  C  CB  . ASN C 1 439 ? 147.234 204.734 129.178 1.00 141.75 ? 439 ASN D CB  1 
ATOM   9113  C  CG  . ASN C 1 439 ? 148.392 204.191 129.974 1.00 167.73 ? 439 ASN D CG  1 
ATOM   9114  O  OD1 . ASN C 1 439 ? 149.237 203.443 129.467 1.00 160.47 ? 439 ASN D OD1 1 
ATOM   9115  N  ND2 . ASN C 1 439 ? 148.471 204.584 131.234 1.00 162.72 ? 439 ASN D ND2 1 
ATOM   9116  N  N   . LYS C 1 440 ? 144.407 203.934 130.473 1.00 142.58 ? 440 LYS D N   1 
ATOM   9117  C  CA  . LYS C 1 440 ? 143.556 203.579 131.610 1.00 143.89 ? 440 LYS D CA  1 
ATOM   9118  C  C   . LYS C 1 440 ? 142.693 202.359 131.265 1.00 146.71 ? 440 LYS D C   1 
ATOM   9119  O  O   . LYS C 1 440 ? 142.503 201.484 132.113 1.00 145.50 ? 440 LYS D O   1 
ATOM   9120  C  CB  . LYS C 1 440 ? 142.675 204.769 132.020 1.00 150.36 ? 440 LYS D CB  1 
ATOM   9121  N  N   . ASP C 1 441 ? 142.202 202.300 130.007 1.00 143.80 ? 441 ASP D N   1 
ATOM   9122  C  CA  . ASP C 1 441 ? 141.381 201.217 129.454 1.00 142.81 ? 441 ASP D CA  1 
ATOM   9123  C  C   . ASP C 1 441 ? 142.119 199.879 129.446 1.00 142.92 ? 441 ASP D C   1 
ATOM   9124  O  O   . ASP C 1 441 ? 141.500 198.845 129.700 1.00 142.05 ? 441 ASP D O   1 
ATOM   9125  C  CB  . ASP C 1 441 ? 140.952 201.550 128.007 1.00 145.76 ? 441 ASP D CB  1 
ATOM   9126  C  CG  . ASP C 1 441 ? 139.760 202.479 127.838 1.00 165.40 ? 441 ASP D CG  1 
ATOM   9127  O  OD1 . ASP C 1 441 ? 139.337 203.102 128.842 1.00 169.69 ? 441 ASP D OD1 1 
ATOM   9128  O  OD2 . ASP C 1 441 ? 139.265 202.605 126.693 1.00 173.26 ? 441 ASP D OD2 1 
ATOM   9129  N  N   . ASN C 1 442 ? 143.430 199.901 129.125 1.00 137.11 ? 442 ASN D N   1 
ATOM   9130  C  CA  . ASN C 1 442 ? 144.278 198.712 129.016 1.00 133.76 ? 442 ASN D CA  1 
ATOM   9131  C  C   . ASN C 1 442 ? 145.217 198.543 130.224 1.00 137.40 ? 442 ASN D C   1 
ATOM   9132  O  O   . ASN C 1 442 ? 146.106 197.686 130.186 1.00 134.87 ? 442 ASN D O   1 
ATOM   9133  C  CB  . ASN C 1 442 ? 145.098 198.772 127.717 1.00 133.33 ? 442 ASN D CB  1 
ATOM   9134  C  CG  . ASN C 1 442 ? 144.292 198.955 126.451 1.00 158.54 ? 442 ASN D CG  1 
ATOM   9135  O  OD1 . ASN C 1 442 ? 143.113 198.593 126.357 1.00 153.50 ? 442 ASN D OD1 1 
ATOM   9136  N  ND2 . ASN C 1 442 ? 144.925 199.512 125.433 1.00 151.97 ? 442 ASN D ND2 1 
ATOM   9137  N  N   . LEU C 1 443 ? 145.001 199.341 131.297 1.00 136.86 ? 443 LEU D N   1 
ATOM   9138  C  CA  . LEU C 1 443 ? 145.769 199.351 132.552 1.00 138.11 ? 443 LEU D CA  1 
ATOM   9139  C  C   . LEU C 1 443 ? 147.295 199.329 132.309 1.00 142.28 ? 443 LEU D C   1 
ATOM   9140  O  O   . LEU C 1 443 ? 148.017 198.485 132.850 1.00 141.34 ? 443 LEU D O   1 
ATOM   9141  C  CB  . LEU C 1 443 ? 145.350 198.195 133.485 1.00 137.79 ? 443 LEU D CB  1 
ATOM   9142  C  CG  . LEU C 1 443 ? 144.052 198.369 134.271 1.00 144.89 ? 443 LEU D CG  1 
ATOM   9143  C  CD1 . LEU C 1 443 ? 143.741 197.117 135.067 1.00 144.70 ? 443 LEU D CD1 1 
ATOM   9144  C  CD2 . LEU C 1 443 ? 144.116 199.583 135.207 1.00 151.18 ? 443 LEU D CD2 1 
ATOM   9145  N  N   . GLY C 1 444 ? 147.756 200.263 131.486 1.00 140.08 ? 444 GLY D N   1 
ATOM   9146  C  CA  . GLY C 1 444 ? 149.167 200.402 131.158 1.00 140.04 ? 444 GLY D CA  1 
ATOM   9147  C  C   . GLY C 1 444 ? 149.904 201.198 132.212 1.00 147.24 ? 444 GLY D C   1 
ATOM   9148  O  O   . GLY C 1 444 ? 149.491 202.312 132.542 1.00 149.20 ? 444 GLY D O   1 
ATOM   9149  N  N   . PHE C 1 445 ? 150.993 200.624 132.758 1.00 144.20 ? 445 PHE D N   1 
ATOM   9150  C  CA  . PHE C 1 445 ? 151.827 201.269 133.771 1.00 147.44 ? 445 PHE D CA  1 
ATOM   9151  C  C   . PHE C 1 445 ? 152.657 202.391 133.114 1.00 154.86 ? 445 PHE D C   1 
ATOM   9152  O  O   . PHE C 1 445 ? 153.374 202.122 132.142 1.00 153.61 ? 445 PHE D O   1 
ATOM   9153  C  CB  . PHE C 1 445 ? 152.722 200.232 134.468 1.00 148.72 ? 445 PHE D CB  1 
ATOM   9154  C  CG  . PHE C 1 445 ? 153.160 200.600 135.865 1.00 153.84 ? 445 PHE D CG  1 
ATOM   9155  C  CD1 . PHE C 1 445 ? 152.260 200.584 136.921 1.00 158.14 ? 445 PHE D CD1 1 
ATOM   9156  C  CD2 . PHE C 1 445 ? 154.486 200.909 136.135 1.00 158.53 ? 445 PHE D CD2 1 
ATOM   9157  C  CE1 . PHE C 1 445 ? 152.672 200.914 138.215 1.00 163.14 ? 445 PHE D CE1 1 
ATOM   9158  C  CE2 . PHE C 1 445 ? 154.900 201.225 137.431 1.00 165.38 ? 445 PHE D CE2 1 
ATOM   9159  C  CZ  . PHE C 1 445 ? 153.992 201.217 138.463 1.00 164.82 ? 445 PHE D CZ  1 
ATOM   9160  N  N   . PRO C 1 446 ? 152.532 203.659 133.588 1.00 155.33 ? 446 PRO D N   1 
ATOM   9161  C  CA  . PRO C 1 446 ? 153.270 204.764 132.944 1.00 157.57 ? 446 PRO D CA  1 
ATOM   9162  C  C   . PRO C 1 446 ? 154.791 204.703 133.137 1.00 163.78 ? 446 PRO D C   1 
ATOM   9163  O  O   . PRO C 1 446 ? 155.523 205.107 132.233 1.00 164.15 ? 446 PRO D O   1 
ATOM   9164  C  CB  . PRO C 1 446 ? 152.682 206.019 133.599 1.00 162.97 ? 446 PRO D CB  1 
ATOM   9165  C  CG  . PRO C 1 446 ? 152.134 205.563 134.889 1.00 168.04 ? 446 PRO D CG  1 
ATOM   9166  C  CD  . PRO C 1 446 ? 151.694 204.145 134.703 1.00 159.41 ? 446 PRO D CD  1 
ATOM   9167  N  N   . VAL C 1 447 ? 155.261 204.205 134.298 1.00 161.81 ? 447 VAL D N   1 
ATOM   9168  C  CA  . VAL C 1 447 ? 156.689 204.086 134.620 1.00 164.05 ? 447 VAL D CA  1 
ATOM   9169  C  C   . VAL C 1 447 ? 157.239 202.789 134.020 1.00 165.44 ? 447 VAL D C   1 
ATOM   9170  O  O   . VAL C 1 447 ? 156.578 201.753 134.071 1.00 161.88 ? 447 VAL D O   1 
ATOM   9171  C  CB  . VAL C 1 447 ? 156.979 204.165 136.141 1.00 171.53 ? 447 VAL D CB  1 
ATOM   9172  C  CG1 . VAL C 1 447 ? 158.426 204.571 136.402 1.00 175.58 ? 447 VAL D CG1 1 
ATOM   9173  C  CG2 . VAL C 1 447 ? 156.028 205.123 136.847 1.00 173.76 ? 447 VAL D CG2 1 
ATOM   9174  N  N   . SER C 1 448 ? 158.446 202.851 133.445 1.00 163.97 ? 448 SER D N   1 
ATOM   9175  C  CA  . SER C 1 448 ? 159.098 201.700 132.828 1.00 161.90 ? 448 SER D CA  1 
ATOM   9176  C  C   . SER C 1 448 ? 160.610 201.862 132.836 1.00 170.38 ? 448 SER D C   1 
ATOM   9177  O  O   . SER C 1 448 ? 161.102 202.977 132.641 1.00 173.59 ? 448 SER D O   1 
ATOM   9178  C  CB  . SER C 1 448 ? 158.604 201.524 131.397 1.00 162.49 ? 448 SER D CB  1 
ATOM   9179  O  OG  . SER C 1 448 ? 159.137 200.354 130.802 1.00 170.84 ? 448 SER D OG  1 
ATOM   9180  N  N   . ASP C 1 449 ? 161.346 200.748 133.046 1.00 167.19 ? 449 ASP D N   1 
ATOM   9181  C  CA  . ASP C 1 449 ? 162.813 200.736 133.034 1.00 171.15 ? 449 ASP D CA  1 
ATOM   9182  C  C   . ASP C 1 449 ? 163.295 201.042 131.618 1.00 176.13 ? 449 ASP D C   1 
ATOM   9183  O  O   . ASP C 1 449 ? 162.829 200.410 130.667 1.00 171.75 ? 449 ASP D O   1 
ATOM   9184  C  CB  . ASP C 1 449 ? 163.361 199.389 133.535 1.00 172.45 ? 449 ASP D CB  1 
ATOM   9185  C  CG  . ASP C 1 449 ? 164.869 199.352 133.662 1.00 187.04 ? 449 ASP D CG  1 
ATOM   9186  O  OD1 . ASP C 1 449 ? 165.391 199.858 134.676 1.00 192.49 ? 449 ASP D OD1 1 
ATOM   9187  O  OD2 . ASP C 1 449 ? 165.527 198.813 132.751 1.00 192.16 ? 449 ASP D OD2 1 
ATOM   9188  N  N   . TRP C 1 450 ? 164.179 202.051 131.481 1.00 178.54 ? 450 TRP D N   1 
ATOM   9189  C  CA  . TRP C 1 450 ? 164.706 202.533 130.201 1.00 180.12 ? 450 TRP D CA  1 
ATOM   9190  C  C   . TRP C 1 450 ? 165.355 201.425 129.368 1.00 180.75 ? 450 TRP D C   1 
ATOM   9191  O  O   . TRP C 1 450 ? 165.142 201.394 128.158 1.00 178.38 ? 450 TRP D O   1 
ATOM   9192  C  CB  . TRP C 1 450 ? 165.705 203.677 130.416 1.00 186.09 ? 450 TRP D CB  1 
ATOM   9193  C  CG  . TRP C 1 450 ? 166.286 204.206 129.140 1.00 189.94 ? 450 TRP D CG  1 
ATOM   9194  C  CD1 . TRP C 1 450 ? 165.726 205.123 128.301 1.00 192.92 ? 450 TRP D CD1 1 
ATOM   9195  C  CD2 . TRP C 1 450 ? 167.520 203.803 128.531 1.00 193.01 ? 450 TRP D CD2 1 
ATOM   9196  N  NE1 . TRP C 1 450 ? 166.544 205.335 127.215 1.00 195.47 ? 450 TRP D NE1 1 
ATOM   9197  C  CE2 . TRP C 1 450 ? 167.654 204.537 127.331 1.00 198.94 ? 450 TRP D CE2 1 
ATOM   9198  C  CE3 . TRP C 1 450 ? 168.534 202.896 128.888 1.00 196.33 ? 450 TRP D CE3 1 
ATOM   9199  C  CZ2 . TRP C 1 450 ? 168.766 204.400 126.491 1.00 201.93 ? 450 TRP D CZ2 1 
ATOM   9200  C  CZ3 . TRP C 1 450 ? 169.635 202.761 128.056 1.00 201.39 ? 450 TRP D CZ3 1 
ATOM   9201  C  CH2 . TRP C 1 450 ? 169.744 203.507 126.873 1.00 203.79 ? 450 TRP D CH2 1 
ATOM   9202  N  N   . LEU C 1 451 ? 166.151 200.544 130.003 1.00 177.52 ? 451 LEU D N   1 
ATOM   9203  C  CA  . LEU C 1 451 ? 166.839 199.439 129.334 1.00 176.17 ? 451 LEU D CA  1 
ATOM   9204  C  C   . LEU C 1 451 ? 165.843 198.385 128.813 1.00 173.83 ? 451 LEU D C   1 
ATOM   9205  O  O   . LEU C 1 451 ? 166.101 197.771 127.778 1.00 172.36 ? 451 LEU D O   1 
ATOM   9206  C  CB  . LEU C 1 451 ? 167.852 198.795 130.285 1.00 179.39 ? 451 LEU D CB  1 
ATOM   9207  N  N   . PHE C 1 452 ? 164.699 198.204 129.510 1.00 166.74 ? 452 PHE D N   1 
ATOM   9208  C  CA  . PHE C 1 452 ? 163.636 197.259 129.146 1.00 160.92 ? 452 PHE D CA  1 
ATOM   9209  C  C   . PHE C 1 452 ? 162.824 197.775 127.953 1.00 162.00 ? 452 PHE D C   1 
ATOM   9210  O  O   . PHE C 1 452 ? 162.611 197.030 126.995 1.00 158.71 ? 452 PHE D O   1 
ATOM   9211  C  CB  . PHE C 1 452 ? 162.710 197.010 130.347 1.00 160.78 ? 452 PHE D CB  1 
ATOM   9212  C  CG  . PHE C 1 452 ? 161.654 195.948 130.144 1.00 157.47 ? 452 PHE D CG  1 
ATOM   9213  C  CD1 . PHE C 1 452 ? 160.430 196.261 129.566 1.00 157.56 ? 452 PHE D CD1 1 
ATOM   9214  C  CD2 . PHE C 1 452 ? 161.866 194.646 130.569 1.00 158.81 ? 452 PHE D CD2 1 
ATOM   9215  C  CE1 . PHE C 1 452 ? 159.458 195.276 129.374 1.00 154.92 ? 452 PHE D CE1 1 
ATOM   9216  C  CE2 . PHE C 1 452 ? 160.878 193.672 130.415 1.00 157.89 ? 452 PHE D CE2 1 
ATOM   9217  C  CZ  . PHE C 1 452 ? 159.680 193.994 129.818 1.00 153.24 ? 452 PHE D CZ  1 
ATOM   9218  N  N   . SER C 1 453 ? 162.345 199.035 128.033 1.00 159.90 ? 453 SER D N   1 
ATOM   9219  C  CA  . SER C 1 453 ? 161.541 199.687 126.997 1.00 158.55 ? 453 SER D CA  1 
ATOM   9220  C  C   . SER C 1 453 ? 162.334 199.909 125.704 1.00 165.01 ? 453 SER D C   1 
ATOM   9221  O  O   . SER C 1 453 ? 161.746 199.873 124.624 1.00 162.86 ? 453 SER D O   1 
ATOM   9222  C  CB  . SER C 1 453 ? 160.982 201.014 127.499 1.00 163.52 ? 453 SER D CB  1 
ATOM   9223  O  OG  . SER C 1 453 ? 162.014 201.871 127.958 1.00 176.61 ? 453 SER D OG  1 
ATOM   9224  N  N   . MET C 1 454 ? 163.659 200.124 125.807 1.00 166.15 ? 454 MET D N   1 
ATOM   9225  C  CA  . MET C 1 454 ? 164.533 200.320 124.647 1.00 169.02 ? 454 MET D CA  1 
ATOM   9226  C  C   . MET C 1 454 ? 164.666 199.032 123.825 1.00 170.65 ? 454 MET D C   1 
ATOM   9227  O  O   . MET C 1 454 ? 164.730 199.093 122.599 1.00 171.13 ? 454 MET D O   1 
ATOM   9228  C  CB  . MET C 1 454 ? 165.924 200.801 125.092 1.00 176.86 ? 454 MET D CB  1 
ATOM   9229  N  N   . TRP C 1 455 ? 164.690 197.874 124.505 1.00 164.45 ? 455 TRP D N   1 
ATOM   9230  C  CA  . TRP C 1 455 ? 164.870 196.561 123.899 1.00 162.28 ? 455 TRP D CA  1 
ATOM   9231  C  C   . TRP C 1 455 ? 163.557 195.918 123.455 1.00 160.90 ? 455 TRP D C   1 
ATOM   9232  O  O   . TRP C 1 455 ? 163.543 195.282 122.400 1.00 160.17 ? 455 TRP D O   1 
ATOM   9233  C  CB  . TRP C 1 455 ? 165.586 195.639 124.898 1.00 161.73 ? 455 TRP D CB  1 
ATOM   9234  C  CG  . TRP C 1 455 ? 165.924 194.269 124.385 1.00 161.74 ? 455 TRP D CG  1 
ATOM   9235  C  CD1 . TRP C 1 455 ? 165.185 193.131 124.531 1.00 160.73 ? 455 TRP D CD1 1 
ATOM   9236  C  CD2 . TRP C 1 455 ? 167.124 193.885 123.707 1.00 165.06 ? 455 TRP D CD2 1 
ATOM   9237  N  NE1 . TRP C 1 455 ? 165.836 192.067 123.953 1.00 160.73 ? 455 TRP D NE1 1 
ATOM   9238  C  CE2 . TRP C 1 455 ? 167.029 192.501 123.438 1.00 166.63 ? 455 TRP D CE2 1 
ATOM   9239  C  CE3 . TRP C 1 455 ? 168.277 194.579 123.296 1.00 171.57 ? 455 TRP D CE3 1 
ATOM   9240  C  CZ2 . TRP C 1 455 ? 168.036 191.800 122.772 1.00 168.64 ? 455 TRP D CZ2 1 
ATOM   9241  C  CZ3 . TRP C 1 455 ? 169.269 193.886 122.624 1.00 175.84 ? 455 TRP D CZ3 1 
ATOM   9242  C  CH2 . TRP C 1 455 ? 169.146 192.514 122.370 1.00 174.09 ? 455 TRP D CH2 1 
ATOM   9243  N  N   . HIS C 1 456 ? 162.474 196.044 124.255 1.00 153.69 ? 456 HIS D N   1 
ATOM   9244  C  CA  . HIS C 1 456 ? 161.201 195.379 123.968 1.00 148.90 ? 456 HIS D CA  1 
ATOM   9245  C  C   . HIS C 1 456 ? 160.108 196.270 123.350 1.00 151.57 ? 456 HIS D C   1 
ATOM   9246  O  O   . HIS C 1 456 ? 159.530 195.878 122.335 1.00 149.33 ? 456 HIS D O   1 
ATOM   9247  C  CB  . HIS C 1 456 ? 160.639 194.734 125.242 1.00 147.20 ? 456 HIS D CB  1 
ATOM   9248  C  CG  . HIS C 1 456 ? 161.456 193.590 125.758 1.00 150.77 ? 456 HIS D CG  1 
ATOM   9249  N  ND1 . HIS C 1 456 ? 162.123 193.672 126.965 1.00 154.67 ? 456 HIS D ND1 1 
ATOM   9250  C  CD2 . HIS C 1 456 ? 161.676 192.368 125.219 1.00 151.25 ? 456 HIS D CD2 1 
ATOM   9251  C  CE1 . HIS C 1 456 ? 162.728 192.503 127.124 1.00 154.06 ? 456 HIS D CE1 1 
ATOM   9252  N  NE2 . HIS C 1 456 ? 162.489 191.686 126.098 1.00 152.33 ? 456 HIS D NE2 1 
ATOM   9253  N  N   . TYR C 1 457 ? 159.788 197.417 123.982 1.00 149.73 ? 457 TYR D N   1 
ATOM   9254  C  CA  . TYR C 1 457 ? 158.698 198.326 123.595 1.00 149.48 ? 457 TYR D CA  1 
ATOM   9255  C  C   . TYR C 1 457 ? 158.787 198.804 122.143 1.00 154.93 ? 457 TYR D C   1 
ATOM   9256  O  O   . TYR C 1 457 ? 159.697 199.555 121.791 1.00 158.02 ? 457 TYR D O   1 
ATOM   9257  C  CB  . TYR C 1 457 ? 158.630 199.552 124.536 1.00 153.13 ? 457 TYR D CB  1 
ATOM   9258  C  CG  . TYR C 1 457 ? 158.043 199.319 125.916 1.00 154.07 ? 457 TYR D CG  1 
ATOM   9259  C  CD1 . TYR C 1 457 ? 158.205 198.098 126.570 1.00 154.32 ? 457 TYR D CD1 1 
ATOM   9260  C  CD2 . TYR C 1 457 ? 157.400 200.344 126.602 1.00 156.26 ? 457 TYR D CD2 1 
ATOM   9261  C  CE1 . TYR C 1 457 ? 157.685 197.885 127.843 1.00 154.67 ? 457 TYR D CE1 1 
ATOM   9262  C  CE2 . TYR C 1 457 ? 156.886 200.146 127.881 1.00 156.85 ? 457 TYR D CE2 1 
ATOM   9263  C  CZ  . TYR C 1 457 ? 157.030 198.913 128.497 1.00 163.98 ? 457 TYR D CZ  1 
ATOM   9264  O  OH  . TYR C 1 457 ? 156.522 198.699 129.755 1.00 167.10 ? 457 TYR D OH  1 
ATOM   9265  N  N   . SER C 1 458 ? 157.824 198.361 121.311 1.00 149.47 ? 458 SER D N   1 
ATOM   9266  C  CA  . SER C 1 458 ? 157.697 198.752 119.902 1.00 151.09 ? 458 SER D CA  1 
ATOM   9267  C  C   . SER C 1 458 ? 157.105 200.160 119.813 1.00 157.03 ? 458 SER D C   1 
ATOM   9268  O  O   . SER C 1 458 ? 157.353 200.881 118.846 1.00 159.58 ? 458 SER D O   1 
ATOM   9269  C  CB  . SER C 1 458 ? 156.822 197.757 119.149 1.00 152.26 ? 458 SER D CB  1 
ATOM   9270  O  OG  . SER C 1 458 ? 155.514 197.711 119.697 1.00 158.79 ? 458 SER D OG  1 
ATOM   9271  N  N   . HIS C 1 459 ? 156.306 200.529 120.833 1.00 152.39 ? 459 HIS D N   1 
ATOM   9272  C  CA  . HIS C 1 459 ? 155.682 201.838 121.011 1.00 154.06 ? 459 HIS D CA  1 
ATOM   9273  C  C   . HIS C 1 459 ? 156.424 202.598 122.116 1.00 159.18 ? 459 HIS D C   1 
ATOM   9274  O  O   . HIS C 1 459 ? 156.664 202.015 123.180 1.00 157.59 ? 459 HIS D O   1 
ATOM   9275  C  CB  . HIS C 1 459 ? 154.191 201.689 121.369 1.00 152.54 ? 459 HIS D CB  1 
ATOM   9276  C  CG  . HIS C 1 459 ? 153.335 201.219 120.239 1.00 155.20 ? 459 HIS D CG  1 
ATOM   9277  N  ND1 . HIS C 1 459 ? 153.558 200.001 119.624 1.00 155.43 ? 459 HIS D ND1 1 
ATOM   9278  C  CD2 . HIS C 1 459 ? 152.255 201.804 119.674 1.00 158.05 ? 459 HIS D CD2 1 
ATOM   9279  C  CE1 . HIS C 1 459 ? 152.629 199.897 118.690 1.00 155.13 ? 459 HIS D CE1 1 
ATOM   9280  N  NE2 . HIS C 1 459 ? 151.820 200.957 118.684 1.00 157.08 ? 459 HIS D NE2 1 
ATOM   9281  N  N   . PRO C 1 460 ? 156.788 203.887 121.911 1.00 158.15 ? 460 PRO D N   1 
ATOM   9282  C  CA  . PRO C 1 460 ? 157.491 204.630 122.976 1.00 159.76 ? 460 PRO D CA  1 
ATOM   9283  C  C   . PRO C 1 460 ? 156.621 204.850 124.224 1.00 160.42 ? 460 PRO D C   1 
ATOM   9284  O  O   . PRO C 1 460 ? 155.396 204.784 124.104 1.00 157.88 ? 460 PRO D O   1 
ATOM   9285  C  CB  . PRO C 1 460 ? 157.848 205.959 122.308 1.00 166.05 ? 460 PRO D CB  1 
ATOM   9286  C  CG  . PRO C 1 460 ? 156.897 206.098 121.183 1.00 170.24 ? 460 PRO D CG  1 
ATOM   9287  C  CD  . PRO C 1 460 ? 156.589 204.722 120.708 1.00 162.26 ? 460 PRO D CD  1 
ATOM   9288  N  N   . PRO C 1 461 ? 157.213 205.111 125.422 1.00 157.44 ? 461 PRO D N   1 
ATOM   9289  C  CA  . PRO C 1 461 ? 156.384 205.308 126.632 1.00 156.21 ? 461 PRO D CA  1 
ATOM   9290  C  C   . PRO C 1 461 ? 155.375 206.454 126.514 1.00 159.69 ? 461 PRO D C   1 
ATOM   9291  O  O   . PRO C 1 461 ? 155.613 207.416 125.782 1.00 162.15 ? 461 PRO D O   1 
ATOM   9292  C  CB  . PRO C 1 461 ? 157.415 205.614 127.720 1.00 161.07 ? 461 PRO D CB  1 
ATOM   9293  C  CG  . PRO C 1 461 ? 158.678 205.007 127.227 1.00 166.24 ? 461 PRO D CG  1 
ATOM   9294  C  CD  . PRO C 1 461 ? 158.651 205.202 125.747 1.00 161.81 ? 461 PRO D CD  1 
ATOM   9295  N  N   . LEU C 1 462 ? 154.242 206.333 127.234 1.00 153.12 ? 462 LEU D N   1 
ATOM   9296  C  CA  . LEU C 1 462 ? 153.137 207.292 127.241 1.00 153.69 ? 462 LEU D CA  1 
ATOM   9297  C  C   . LEU C 1 462 ? 153.619 208.712 127.524 1.00 161.56 ? 462 LEU D C   1 
ATOM   9298  O  O   . LEU C 1 462 ? 153.261 209.614 126.769 1.00 163.02 ? 462 LEU D O   1 
ATOM   9299  C  CB  . LEU C 1 462 ? 152.065 206.874 128.263 1.00 152.07 ? 462 LEU D CB  1 
ATOM   9300  C  CG  . LEU C 1 462 ? 150.762 207.686 128.277 1.00 158.07 ? 462 LEU D CG  1 
ATOM   9301  C  CD1 . LEU C 1 462 ? 149.908 207.399 127.058 1.00 156.72 ? 462 LEU D CD1 1 
ATOM   9302  C  CD2 . LEU C 1 462 ? 149.966 207.413 129.532 1.00 160.03 ? 462 LEU D CD2 1 
ATOM   9303  N  N   . LEU C 1 463 ? 154.462 208.898 128.568 1.00 160.14 ? 463 LEU D N   1 
ATOM   9304  C  CA  . LEU C 1 463 ? 155.016 210.198 128.976 1.00 164.76 ? 463 LEU D CA  1 
ATOM   9305  C  C   . LEU C 1 463 ? 155.855 210.846 127.862 1.00 170.80 ? 463 LEU D C   1 
ATOM   9306  O  O   . LEU C 1 463 ? 155.815 212.069 127.712 1.00 174.17 ? 463 LEU D O   1 
ATOM   9307  C  CB  . LEU C 1 463 ? 155.859 210.051 130.248 1.00 166.64 ? 463 LEU D CB  1 
ATOM   9308  N  N   . GLU C 1 464 ? 156.587 210.024 127.075 1.00 165.09 ? 464 GLU D N   1 
ATOM   9309  C  CA  . GLU C 1 464 ? 157.416 210.478 125.953 1.00 167.09 ? 464 GLU D CA  1 
ATOM   9310  C  C   . GLU C 1 464 ? 156.538 210.964 124.786 1.00 170.07 ? 464 GLU D C   1 
ATOM   9311  O  O   . GLU C 1 464 ? 156.840 211.998 124.185 1.00 173.60 ? 464 GLU D O   1 
ATOM   9312  C  CB  . GLU C 1 464 ? 158.365 209.360 125.478 1.00 166.68 ? 464 GLU D CB  1 
ATOM   9313  C  CG  . GLU C 1 464 ? 159.485 209.022 126.449 1.00 177.79 ? 464 GLU D CG  1 
ATOM   9314  C  CD  . GLU C 1 464 ? 160.759 208.491 125.817 1.00 197.44 ? 464 GLU D CD  1 
ATOM   9315  O  OE1 . GLU C 1 464 ? 160.672 207.726 124.829 1.00 187.84 ? 464 GLU D OE1 1 
ATOM   9316  O  OE2 . GLU C 1 464 ? 161.851 208.831 126.327 1.00 194.72 ? 464 GLU D OE2 1 
ATOM   9317  N  N   . ARG C 1 465 ? 155.458 210.215 124.474 1.00 161.89 ? 465 ARG D N   1 
ATOM   9318  C  CA  . ARG C 1 465 ? 154.501 210.516 123.404 1.00 161.28 ? 465 ARG D CA  1 
ATOM   9319  C  C   . ARG C 1 465 ? 153.648 211.738 123.735 1.00 167.28 ? 465 ARG D C   1 
ATOM   9320  O  O   . ARG C 1 465 ? 153.336 212.513 122.831 1.00 169.62 ? 465 ARG D O   1 
ATOM   9321  C  CB  . ARG C 1 465 ? 153.581 209.316 123.143 1.00 156.57 ? 465 ARG D CB  1 
ATOM   9322  C  CG  . ARG C 1 465 ? 154.232 208.171 122.384 1.00 162.53 ? 465 ARG D CG  1 
ATOM   9323  C  CD  . ARG C 1 465 ? 153.282 206.996 122.208 1.00 163.62 ? 465 ARG D CD  1 
ATOM   9324  N  NE  . ARG C 1 465 ? 152.275 207.248 121.175 1.00 168.58 ? 465 ARG D NE  1 
ATOM   9325  C  CZ  . ARG C 1 465 ? 151.251 206.443 120.907 1.00 178.08 ? 465 ARG D CZ  1 
ATOM   9326  N  NH1 . ARG C 1 465 ? 151.077 205.323 121.599 1.00 160.40 ? 465 ARG D NH1 1 
ATOM   9327  N  NH2 . ARG C 1 465 ? 150.388 206.755 119.948 1.00 166.20 ? 465 ARG D NH2 1 
ATOM   9328  N  N   . LEU C 1 466 ? 153.248 211.893 125.019 1.00 162.99 ? 466 LEU D N   1 
ATOM   9329  C  CA  . LEU C 1 466 ? 152.430 213.019 125.484 1.00 165.46 ? 466 LEU D CA  1 
ATOM   9330  C  C   . LEU C 1 466 ? 153.208 214.336 125.439 1.00 174.59 ? 466 LEU D C   1 
ATOM   9331  O  O   . LEU C 1 466 ? 152.636 215.361 125.066 1.00 177.39 ? 466 LEU D O   1 
ATOM   9332  C  CB  . LEU C 1 466 ? 151.901 212.784 126.912 1.00 164.36 ? 466 LEU D CB  1 
ATOM   9333  C  CG  . LEU C 1 466 ? 150.847 211.695 127.128 1.00 164.70 ? 466 LEU D CG  1 
ATOM   9334  C  CD1 . LEU C 1 466 ? 150.646 211.444 128.596 1.00 164.61 ? 466 LEU D CD1 1 
ATOM   9335  C  CD2 . LEU C 1 466 ? 149.519 212.042 126.482 1.00 167.38 ? 466 LEU D CD2 1 
ATOM   9336  N  N   . GLN C 1 467 ? 154.504 214.307 125.824 1.00 172.32 ? 467 GLN D N   1 
ATOM   9337  C  CA  . GLN C 1 467 ? 155.382 215.482 125.842 1.00 177.38 ? 467 GLN D CA  1 
ATOM   9338  C  C   . GLN C 1 467 ? 155.651 216.004 124.425 1.00 183.14 ? 467 GLN D C   1 
ATOM   9339  O  O   . GLN C 1 467 ? 155.722 217.219 124.236 1.00 187.53 ? 467 GLN D O   1 
ATOM   9340  C  CB  . GLN C 1 467 ? 156.697 215.172 126.567 1.00 179.80 ? 467 GLN D CB  1 
ATOM   9341  C  CG  . GLN C 1 467 ? 156.570 215.289 128.086 1.00 193.96 ? 467 GLN D CG  1 
ATOM   9342  C  CD  . GLN C 1 467 ? 157.763 214.744 128.836 1.00 213.34 ? 467 GLN D CD  1 
ATOM   9343  O  OE1 . GLN C 1 467 ? 158.232 213.623 128.604 1.00 204.80 ? 467 GLN D OE1 1 
ATOM   9344  N  NE2 . GLN C 1 467 ? 158.254 215.515 129.792 1.00 210.90 ? 467 GLN D NE2 1 
ATOM   9345  N  N   . ALA C 1 468 ? 155.762 215.093 123.434 1.00 176.38 ? 468 ALA D N   1 
ATOM   9346  C  CA  . ALA C 1 468 ? 155.969 215.431 122.022 1.00 178.43 ? 468 ALA D CA  1 
ATOM   9347  C  C   . ALA C 1 468 ? 154.726 216.119 121.436 1.00 183.41 ? 468 ALA D C   1 
ATOM   9348  O  O   . ALA C 1 468 ? 154.859 217.003 120.588 1.00 187.23 ? 468 ALA D O   1 
ATOM   9349  C  CB  . ALA C 1 468 ? 156.302 214.178 121.228 1.00 175.74 ? 468 ALA D CB  1 
ATOM   9350  N  N   . LEU C 1 469 ? 153.525 215.721 121.908 1.00 176.75 ? 469 LEU D N   1 
ATOM   9351  C  CA  . LEU C 1 469 ? 152.238 216.285 121.493 1.00 177.84 ? 469 LEU D CA  1 
ATOM   9352  C  C   . LEU C 1 469 ? 151.996 217.650 122.147 1.00 187.03 ? 469 LEU D C   1 
ATOM   9353  O  O   . LEU C 1 469 ? 151.415 218.533 121.513 1.00 190.39 ? 469 LEU D O   1 
ATOM   9354  C  CB  . LEU C 1 469 ? 151.088 215.325 121.842 1.00 173.16 ? 469 LEU D CB  1 
ATOM   9355  C  CG  . LEU C 1 469 ? 150.872 214.149 120.900 1.00 174.35 ? 469 LEU D CG  1 
ATOM   9356  C  CD1 . LEU C 1 469 ? 150.172 213.009 121.610 1.00 169.63 ? 469 LEU D CD1 1 
ATOM   9357  C  CD2 . LEU C 1 469 ? 150.084 214.568 119.674 1.00 179.21 ? 469 LEU D CD2 1 
ATOM   9358  N  N   . LYS C 1 470 ? 152.434 217.814 123.417 1.00 183.98 ? 470 LYS D N   1 
ATOM   9359  C  CA  . LYS C 1 470 ? 152.312 219.054 124.191 1.00 188.25 ? 470 LYS D CA  1 
ATOM   9360  C  C   . LYS C 1 470 ? 153.180 220.160 123.582 1.00 197.91 ? 470 LYS D C   1 
ATOM   9361  O  O   . LYS C 1 470 ? 152.777 221.325 123.592 1.00 201.90 ? 470 LYS D O   1 
ATOM   9362  C  CB  . LYS C 1 470 ? 152.707 218.814 125.657 1.00 189.92 ? 470 LYS D CB  1 
ATOM   9363  C  CG  . LYS C 1 470 ? 151.561 219.010 126.636 1.00 204.46 ? 470 LYS D CG  1 
ATOM   9364  N  N   . THR C 1 471 ? 154.361 219.783 123.039 1.00 194.90 ? 471 THR D N   1 
ATOM   9365  C  CA  . THR C 1 471 ? 155.323 220.682 122.394 1.00 234.60 ? 471 THR D CA  1 
ATOM   9366  C  C   . THR C 1 471 ? 154.747 221.174 121.058 1.00 251.87 ? 471 THR D C   1 
ATOM   9367  O  O   . THR C 1 471 ? 154.775 222.371 120.777 1.00 227.81 ? 471 THR D O   1 
ATOM   9368  C  CB  . THR C 1 471 ? 156.682 219.967 122.210 1.00 239.78 ? 471 THR D CB  1 
ATOM   9369  O  OG1 . THR C 1 471 ? 157.092 219.389 123.453 1.00 239.18 ? 471 THR D OG1 1 
ATOM   9370  C  CG2 . THR C 1 471 ? 157.779 220.899 121.698 1.00 241.03 ? 471 THR D CG2 1 
ATOM   9371  N  N   . LEU D 1 10  ? 116.571 159.596 123.780 1.00 211.63 ? 10  LEU E N   1 
ATOM   9372  C  CA  . LEU D 1 10  ? 116.311 160.916 124.345 1.00 209.88 ? 10  LEU E CA  1 
ATOM   9373  C  C   . LEU D 1 10  ? 116.295 161.993 123.258 1.00 210.96 ? 10  LEU E C   1 
ATOM   9374  O  O   . LEU D 1 10  ? 117.240 162.085 122.471 1.00 209.25 ? 10  LEU E O   1 
ATOM   9375  C  CB  . LEU D 1 10  ? 117.368 161.260 125.408 1.00 207.51 ? 10  LEU E CB  1 
ATOM   9376  N  N   . TRP D 1 11  ? 115.226 162.814 123.227 1.00 209.02 ? 11  TRP E N   1 
ATOM   9377  C  CA  . TRP D 1 11  ? 115.059 163.929 122.283 1.00 207.66 ? 11  TRP E CA  1 
ATOM   9378  C  C   . TRP D 1 11  ? 115.535 165.259 122.923 1.00 206.96 ? 11  TRP E C   1 
ATOM   9379  O  O   . TRP D 1 11  ? 115.190 166.347 122.448 1.00 206.06 ? 11  TRP E O   1 
ATOM   9380  C  CB  . TRP D 1 11  ? 113.591 164.029 121.831 1.00 209.44 ? 11  TRP E CB  1 
ATOM   9381  N  N   . GLU D 1 12  ? 116.343 165.154 123.997 1.00 202.63 ? 12  GLU E N   1 
ATOM   9382  C  CA  . GLU D 1 12  ? 116.881 166.279 124.764 1.00 199.97 ? 12  GLU E CA  1 
ATOM   9383  C  C   . GLU D 1 12  ? 118.380 166.111 125.062 1.00 200.93 ? 12  GLU E C   1 
ATOM   9384  O  O   . GLU D 1 12  ? 119.051 167.116 125.300 1.00 198.85 ? 12  GLU E O   1 
ATOM   9385  C  CB  . GLU D 1 12  ? 116.119 166.436 126.096 1.00 201.68 ? 12  GLU E CB  1 
ATOM   9386  C  CG  . GLU D 1 12  ? 114.655 166.827 125.969 1.00 208.30 ? 12  GLU E CG  1 
ATOM   9387  C  CD  . GLU D 1 12  ? 113.754 166.279 127.062 1.00 215.23 ? 12  GLU E CD  1 
ATOM   9388  O  OE1 . GLU D 1 12  ? 113.970 166.629 128.245 1.00 208.35 ? 12  GLU E OE1 1 
ATOM   9389  O  OE2 . GLU D 1 12  ? 112.827 165.503 126.735 1.00 206.56 ? 12  GLU E OE2 1 
ATOM   9390  N  N   . MET D 1 13  ? 118.902 164.859 125.076 1.00 199.45 ? 13  MET E N   1 
ATOM   9391  C  CA  . MET D 1 13  ? 120.314 164.582 125.389 1.00 197.60 ? 13  MET E CA  1 
ATOM   9392  C  C   . MET D 1 13  ? 121.016 163.688 124.331 1.00 200.28 ? 13  MET E C   1 
ATOM   9393  O  O   . MET D 1 13  ? 120.365 162.780 123.800 1.00 202.27 ? 13  MET E O   1 
ATOM   9394  C  CB  . MET D 1 13  ? 120.424 163.915 126.768 1.00 199.78 ? 13  MET E CB  1 
ATOM   9395  N  N   . PRO D 1 14  ? 122.338 163.899 124.036 1.00 190.77 ? 14  PRO E N   1 
ATOM   9396  C  CA  . PRO D 1 14  ? 123.020 163.033 123.051 1.00 189.74 ? 14  PRO E CA  1 
ATOM   9397  C  C   . PRO D 1 14  ? 123.540 161.730 123.678 1.00 193.75 ? 14  PRO E C   1 
ATOM   9398  O  O   . PRO D 1 14  ? 123.489 161.575 124.901 1.00 193.18 ? 14  PRO E O   1 
ATOM   9399  C  CB  . PRO D 1 14  ? 124.165 163.907 122.528 1.00 184.78 ? 14  PRO E CB  1 
ATOM   9400  C  CG  . PRO D 1 14  ? 124.245 165.093 123.459 1.00 185.89 ? 14  PRO E CG  1 
ATOM   9401  C  CD  . PRO D 1 14  ? 123.268 164.912 124.574 1.00 185.42 ? 14  PRO E CD  1 
ATOM   9402  N  N   . ALA D 1 15  ? 124.026 160.787 122.841 1.00 190.96 ? 15  ALA E N   1 
ATOM   9403  C  CA  . ALA D 1 15  ? 124.501 159.478 123.298 1.00 191.44 ? 15  ALA E CA  1 
ATOM   9404  C  C   . ALA D 1 15  ? 126.024 159.422 123.459 1.00 188.61 ? 15  ALA E C   1 
ATOM   9405  O  O   . ALA D 1 15  ? 126.502 159.253 124.582 1.00 185.54 ? 15  ALA E O   1 
ATOM   9406  C  CB  . ALA D 1 15  ? 124.034 158.387 122.343 1.00 198.15 ? 15  ALA E CB  1 
ATOM   9407  N  N   . GLU D 1 16  ? 126.779 159.545 122.346 1.00 183.04 ? 16  GLU E N   1 
ATOM   9408  C  CA  . GLU D 1 16  ? 128.242 159.485 122.333 1.00 177.26 ? 16  GLU E CA  1 
ATOM   9409  C  C   . GLU D 1 16  ? 128.868 160.675 123.067 1.00 175.91 ? 16  GLU E C   1 
ATOM   9410  O  O   . GLU D 1 16  ? 129.898 160.505 123.716 1.00 171.50 ? 16  GLU E O   1 
ATOM   9411  C  CB  . GLU D 1 16  ? 128.768 159.415 120.894 1.00 178.21 ? 16  GLU E CB  1 
ATOM   9412  N  N   . LYS D 1 17  ? 128.240 161.864 122.977 1.00 172.82 ? 17  LYS E N   1 
ATOM   9413  C  CA  . LYS D 1 17  ? 128.716 163.088 123.627 1.00 167.78 ? 17  LYS E CA  1 
ATOM   9414  C  C   . LYS D 1 17  ? 128.542 163.017 125.150 1.00 171.90 ? 17  LYS E C   1 
ATOM   9415  O  O   . LYS D 1 17  ? 129.333 163.620 125.877 1.00 166.89 ? 17  LYS E O   1 
ATOM   9416  C  CB  . LYS D 1 17  ? 127.995 164.321 123.061 1.00 171.11 ? 17  LYS E CB  1 
ATOM   9417  N  N   . ARG D 1 18  ? 127.523 162.267 125.625 1.00 174.20 ? 18  ARG E N   1 
ATOM   9418  C  CA  . ARG D 1 18  ? 127.216 162.089 127.046 1.00 175.16 ? 18  ARG E CA  1 
ATOM   9419  C  C   . ARG D 1 18  ? 128.267 161.221 127.768 1.00 176.82 ? 18  ARG E C   1 
ATOM   9420  O  O   . ARG D 1 18  ? 128.650 161.564 128.890 1.00 173.76 ? 18  ARG E O   1 
ATOM   9421  C  CB  . ARG D 1 18  ? 125.818 161.479 127.225 1.00 182.35 ? 18  ARG E CB  1 
ATOM   9422  N  N   . ILE D 1 19  ? 128.723 160.107 127.138 1.00 174.67 ? 19  ILE E N   1 
ATOM   9423  C  CA  . ILE D 1 19  ? 129.714 159.195 127.729 1.00 172.85 ? 19  ILE E CA  1 
ATOM   9424  C  C   . ILE D 1 19  ? 131.111 159.827 127.736 1.00 171.28 ? 19  ILE E C   1 
ATOM   9425  O  O   . ILE D 1 19  ? 131.896 159.524 128.634 1.00 168.20 ? 19  ILE E O   1 
ATOM   9426  C  CB  . ILE D 1 19  ? 129.732 157.806 127.053 1.00 179.56 ? 19  ILE E CB  1 
ATOM   9427  N  N   . PHE D 1 20  ? 131.414 160.709 126.760 1.00 166.66 ? 20  PHE E N   1 
ATOM   9428  C  CA  . PHE D 1 20  ? 132.692 161.428 126.690 1.00 161.32 ? 20  PHE E CA  1 
ATOM   9429  C  C   . PHE D 1 20  ? 132.785 162.429 127.848 1.00 163.06 ? 20  PHE E C   1 
ATOM   9430  O  O   . PHE D 1 20  ? 133.823 162.511 128.506 1.00 159.29 ? 20  PHE E O   1 
ATOM   9431  C  CB  . PHE D 1 20  ? 132.864 162.142 125.329 1.00 162.05 ? 20  PHE E CB  1 
ATOM   9432  C  CG  . PHE D 1 20  ? 134.012 163.129 125.258 1.00 158.48 ? 20  PHE E CG  1 
ATOM   9433  C  CD1 . PHE D 1 20  ? 135.325 162.687 125.120 1.00 159.00 ? 20  PHE E CD1 1 
ATOM   9434  C  CD2 . PHE D 1 20  ? 133.780 164.498 125.325 1.00 159.18 ? 20  PHE E CD2 1 
ATOM   9435  C  CE1 . PHE D 1 20  ? 136.386 163.598 125.060 1.00 155.31 ? 20  PHE E CE1 1 
ATOM   9436  C  CE2 . PHE D 1 20  ? 134.843 165.409 125.271 1.00 157.60 ? 20  PHE E CE2 1 
ATOM   9437  C  CZ  . PHE D 1 20  ? 136.138 164.953 125.132 1.00 152.77 ? 20  PHE E CZ  1 
ATOM   9438  N  N   . GLY D 1 21  ? 131.696 163.170 128.070 1.00 161.94 ? 21  GLY E N   1 
ATOM   9439  C  CA  . GLY D 1 21  ? 131.574 164.156 129.137 1.00 160.21 ? 21  GLY E CA  1 
ATOM   9440  C  C   . GLY D 1 21  ? 131.662 163.526 130.512 1.00 164.25 ? 21  GLY E C   1 
ATOM   9441  O  O   . GLY D 1 21  ? 132.280 164.098 131.413 1.00 160.81 ? 21  GLY E O   1 
ATOM   9442  N  N   . ALA D 1 22  ? 131.072 162.319 130.660 1.00 164.64 ? 22  ALA E N   1 
ATOM   9443  C  CA  . ALA D 1 22  ? 131.069 161.524 131.888 1.00 166.07 ? 22  ALA E CA  1 
ATOM   9444  C  C   . ALA D 1 22  ? 132.497 161.170 132.316 1.00 165.45 ? 22  ALA E C   1 
ATOM   9445  O  O   . ALA D 1 22  ? 132.809 161.224 133.507 1.00 164.39 ? 22  ALA E O   1 
ATOM   9446  C  CB  . ALA D 1 22  ? 130.252 160.256 131.682 1.00 172.43 ? 22  ALA E CB  1 
ATOM   9447  N  N   . VAL D 1 23  ? 133.362 160.838 131.331 1.00 159.27 ? 23  VAL E N   1 
ATOM   9448  C  CA  . VAL D 1 23  ? 134.776 160.492 131.510 1.00 155.43 ? 23  VAL E CA  1 
ATOM   9449  C  C   . VAL D 1 23  ? 135.530 161.702 132.092 1.00 154.93 ? 23  VAL E C   1 
ATOM   9450  O  O   . VAL D 1 23  ? 136.213 161.564 133.110 1.00 153.08 ? 23  VAL E O   1 
ATOM   9451  C  CB  . VAL D 1 23  ? 135.388 160.002 130.163 1.00 158.36 ? 23  VAL E CB  1 
ATOM   9452  C  CG1 . VAL D 1 23  ? 136.913 160.091 130.154 1.00 153.56 ? 23  VAL E CG1 1 
ATOM   9453  C  CG2 . VAL D 1 23  ? 134.928 158.586 129.833 1.00 162.92 ? 23  VAL E CG2 1 
ATOM   9454  N  N   . LEU D 1 24  ? 135.373 162.879 131.452 1.00 149.81 ? 24  LEU E N   1 
ATOM   9455  C  CA  . LEU D 1 24  ? 136.009 164.137 131.836 1.00 145.86 ? 24  LEU E CA  1 
ATOM   9456  C  C   . LEU D 1 24  ? 135.475 164.668 133.158 1.00 151.31 ? 24  LEU E C   1 
ATOM   9457  O  O   . LEU D 1 24  ? 136.263 165.206 133.938 1.00 148.54 ? 24  LEU E O   1 
ATOM   9458  C  CB  . LEU D 1 24  ? 135.826 165.190 130.738 1.00 144.61 ? 24  LEU E CB  1 
ATOM   9459  C  CG  . LEU D 1 24  ? 136.962 165.278 129.727 1.00 146.17 ? 24  LEU E CG  1 
ATOM   9460  C  CD1 . LEU D 1 24  ? 136.813 164.245 128.621 1.00 148.29 ? 24  LEU E CD1 1 
ATOM   9461  C  CD2 . LEU D 1 24  ? 137.040 166.659 129.132 1.00 146.98 ? 24  LEU E CD2 1 
ATOM   9462  N  N   . LEU D 1 25  ? 134.154 164.513 133.420 1.00 152.07 ? 25  LEU E N   1 
ATOM   9463  C  CA  . LEU D 1 25  ? 133.523 164.957 134.668 1.00 153.79 ? 25  LEU E CA  1 
ATOM   9464  C  C   . LEU D 1 25  ? 134.070 164.164 135.852 1.00 158.37 ? 25  LEU E C   1 
ATOM   9465  O  O   . LEU D 1 25  ? 134.288 164.741 136.917 1.00 157.45 ? 25  LEU E O   1 
ATOM   9466  C  CB  . LEU D 1 25  ? 131.996 164.837 134.604 1.00 158.73 ? 25  LEU E CB  1 
ATOM   9467  N  N   . PHE D 1 26  ? 134.326 162.856 135.651 1.00 156.27 ? 26  PHE E N   1 
ATOM   9468  C  CA  . PHE D 1 26  ? 134.879 161.988 136.686 1.00 156.82 ? 26  PHE E CA  1 
ATOM   9469  C  C   . PHE D 1 26  ? 136.352 162.305 136.921 1.00 156.56 ? 26  PHE E C   1 
ATOM   9470  O  O   . PHE D 1 26  ? 136.778 162.390 138.073 1.00 155.67 ? 26  PHE E O   1 
ATOM   9471  C  CB  . PHE D 1 26  ? 134.697 160.504 136.331 1.00 161.67 ? 26  PHE E CB  1 
ATOM   9472  C  CG  . PHE D 1 26  ? 135.109 159.574 137.449 1.00 164.69 ? 26  PHE E CG  1 
ATOM   9473  C  CD1 . PHE D 1 26  ? 134.292 159.389 138.558 1.00 171.27 ? 26  PHE E CD1 1 
ATOM   9474  C  CD2 . PHE D 1 26  ? 136.319 158.894 137.399 1.00 164.75 ? 26  PHE E CD2 1 
ATOM   9475  C  CE1 . PHE D 1 26  ? 134.679 158.542 139.598 1.00 173.90 ? 26  PHE E CE1 1 
ATOM   9476  C  CE2 . PHE D 1 26  ? 136.706 158.048 138.439 1.00 169.16 ? 26  PHE E CE2 1 
ATOM   9477  C  CZ  . PHE D 1 26  ? 135.884 157.879 139.532 1.00 170.91 ? 26  PHE E CZ  1 
ATOM   9478  N  N   . SER D 1 27  ? 137.118 162.487 135.831 1.00 150.70 ? 27  SER E N   1 
ATOM   9479  C  CA  . SER D 1 27  ? 138.548 162.797 135.864 1.00 146.91 ? 27  SER E CA  1 
ATOM   9480  C  C   . SER D 1 27  ? 138.831 164.093 136.619 1.00 148.24 ? 27  SER E C   1 
ATOM   9481  O  O   . SER D 1 27  ? 139.884 164.204 137.252 1.00 145.78 ? 27  SER E O   1 
ATOM   9482  C  CB  . SER D 1 27  ? 139.106 162.895 134.448 1.00 149.34 ? 27  SER E CB  1 
ATOM   9483  O  OG  . SER D 1 27  ? 138.912 161.687 133.730 1.00 163.00 ? 27  SER E OG  1 
ATOM   9484  N  N   . TRP D 1 28  ? 137.885 165.057 136.568 1.00 145.33 ? 28  TRP E N   1 
ATOM   9485  C  CA  . TRP D 1 28  ? 138.017 166.345 137.240 1.00 143.75 ? 28  TRP E CA  1 
ATOM   9486  C  C   . TRP D 1 28  ? 137.548 166.296 138.692 1.00 148.68 ? 28  TRP E C   1 
ATOM   9487  O  O   . TRP D 1 28  ? 138.165 166.960 139.523 1.00 147.44 ? 28  TRP E O   1 
ATOM   9488  C  CB  . TRP D 1 28  ? 137.292 167.455 136.477 1.00 142.72 ? 28  TRP E CB  1 
ATOM   9489  C  CG  . TRP D 1 28  ? 138.162 168.072 135.428 1.00 140.29 ? 28  TRP E CG  1 
ATOM   9490  C  CD1 . TRP D 1 28  ? 138.178 167.772 134.099 1.00 142.56 ? 28  TRP E CD1 1 
ATOM   9491  C  CD2 . TRP D 1 28  ? 139.235 169.001 135.643 1.00 137.35 ? 28  TRP E CD2 1 
ATOM   9492  N  NE1 . TRP D 1 28  ? 139.163 168.488 133.462 1.00 138.88 ? 28  TRP E NE1 1 
ATOM   9493  C  CE2 . TRP D 1 28  ? 139.832 169.250 134.386 1.00 138.96 ? 28  TRP E CE2 1 
ATOM   9494  C  CE3 . TRP D 1 28  ? 139.740 169.666 136.778 1.00 138.14 ? 28  TRP E CE3 1 
ATOM   9495  C  CZ2 . TRP D 1 28  ? 140.902 170.144 134.226 1.00 135.40 ? 28  TRP E CZ2 1 
ATOM   9496  C  CZ3 . TRP D 1 28  ? 140.798 170.552 136.619 1.00 136.91 ? 28  TRP E CZ3 1 
ATOM   9497  C  CH2 . TRP D 1 28  ? 141.371 170.781 135.357 1.00 135.18 ? 28  TRP E CH2 1 
ATOM   9498  N  N   . THR D 1 29  ? 136.489 165.518 139.010 1.00 147.57 ? 29  THR E N   1 
ATOM   9499  C  CA  . THR D 1 29  ? 136.001 165.397 140.393 1.00 149.97 ? 29  THR E CA  1 
ATOM   9500  C  C   . THR D 1 29  ? 137.038 164.661 141.250 1.00 151.14 ? 29  THR E C   1 
ATOM   9501  O  O   . THR D 1 29  ? 137.277 165.068 142.388 1.00 150.82 ? 29  THR E O   1 
ATOM   9502  C  CB  . THR D 1 29  ? 134.621 164.726 140.475 1.00 164.84 ? 29  THR E CB  1 
ATOM   9503  O  OG1 . THR D 1 29  ? 134.625 163.509 139.728 1.00 166.79 ? 29  THR E OG1 1 
ATOM   9504  C  CG2 . THR D 1 29  ? 133.491 165.641 140.016 1.00 165.23 ? 29  THR E CG2 1 
ATOM   9505  N  N   . VAL D 1 30  ? 137.677 163.611 140.682 1.00 145.80 ? 30  VAL E N   1 
ATOM   9506  C  CA  . VAL D 1 30  ? 138.737 162.826 141.323 1.00 144.71 ? 30  VAL E CA  1 
ATOM   9507  C  C   . VAL D 1 30  ? 139.915 163.759 141.575 1.00 145.23 ? 30  VAL E C   1 
ATOM   9508  O  O   . VAL D 1 30  ? 140.448 163.768 142.685 1.00 145.28 ? 30  VAL E O   1 
ATOM   9509  C  CB  . VAL D 1 30  ? 139.118 161.578 140.478 1.00 148.30 ? 30  VAL E CB  1 
ATOM   9510  C  CG1 . VAL D 1 30  ? 140.497 161.032 140.840 1.00 146.41 ? 30  VAL E CG1 1 
ATOM   9511  C  CG2 . VAL D 1 30  ? 138.068 160.492 140.627 1.00 152.77 ? 30  VAL E CG2 1 
ATOM   9512  N  N   . TYR D 1 31  ? 140.269 164.587 140.561 1.00 139.16 ? 31  TYR E N   1 
ATOM   9513  C  CA  . TYR D 1 31  ? 141.337 165.580 140.653 1.00 136.08 ? 31  TYR E CA  1 
ATOM   9514  C  C   . TYR D 1 31  ? 141.038 166.590 141.763 1.00 141.56 ? 31  TYR E C   1 
ATOM   9515  O  O   . TYR D 1 31  ? 141.912 166.831 142.596 1.00 141.34 ? 31  TYR E O   1 
ATOM   9516  C  CB  . TYR D 1 31  ? 141.560 166.309 139.316 1.00 134.62 ? 31  TYR E CB  1 
ATOM   9517  C  CG  . TYR D 1 31  ? 142.554 167.446 139.438 1.00 134.84 ? 31  TYR E CG  1 
ATOM   9518  C  CD1 . TYR D 1 31  ? 143.914 167.194 139.622 1.00 135.60 ? 31  TYR E CD1 1 
ATOM   9519  C  CD2 . TYR D 1 31  ? 142.132 168.773 139.421 1.00 135.63 ? 31  TYR E CD2 1 
ATOM   9520  C  CE1 . TYR D 1 31  ? 144.833 168.236 139.768 1.00 135.12 ? 31  TYR E CE1 1 
ATOM   9521  C  CE2 . TYR D 1 31  ? 143.043 169.824 139.565 1.00 134.94 ? 31  TYR E CE2 1 
ATOM   9522  C  CZ  . TYR D 1 31  ? 144.394 169.550 139.735 1.00 141.42 ? 31  TYR E CZ  1 
ATOM   9523  O  OH  . TYR D 1 31  ? 145.305 170.567 139.894 1.00 140.25 ? 31  TYR E OH  1 
ATOM   9524  N  N   . LEU D 1 32  ? 139.806 167.163 141.782 1.00 139.20 ? 32  LEU E N   1 
ATOM   9525  C  CA  . LEU D 1 32  ? 139.370 168.145 142.785 1.00 139.97 ? 32  LEU E CA  1 
ATOM   9526  C  C   . LEU D 1 32  ? 139.329 167.538 144.190 1.00 146.44 ? 32  LEU E C   1 
ATOM   9527  O  O   . LEU D 1 32  ? 139.609 168.246 145.156 1.00 146.82 ? 32  LEU E O   1 
ATOM   9528  C  CB  . LEU D 1 32  ? 138.006 168.757 142.431 1.00 141.69 ? 32  LEU E CB  1 
ATOM   9529  C  CG  . LEU D 1 32  ? 137.989 169.770 141.280 1.00 143.45 ? 32  LEU E CG  1 
ATOM   9530  C  CD1 . LEU D 1 32  ? 136.578 170.033 140.814 1.00 146.11 ? 32  LEU E CD1 1 
ATOM   9531  C  CD2 . LEU D 1 32  ? 138.656 171.081 141.669 1.00 144.05 ? 32  LEU E CD2 1 
ATOM   9532  N  N   . TRP D 1 33  ? 139.015 166.230 144.299 1.00 144.66 ? 33  TRP E N   1 
ATOM   9533  C  CA  . TRP D 1 33  ? 139.011 165.502 145.568 1.00 147.55 ? 33  TRP E CA  1 
ATOM   9534  C  C   . TRP D 1 33  ? 140.441 165.392 146.097 1.00 149.36 ? 33  TRP E C   1 
ATOM   9535  O  O   . TRP D 1 33  ? 140.685 165.660 147.273 1.00 150.37 ? 33  TRP E O   1 
ATOM   9536  C  CB  . TRP D 1 33  ? 138.376 164.108 145.393 1.00 149.14 ? 33  TRP E CB  1 
ATOM   9537  C  CG  . TRP D 1 33  ? 138.705 163.123 146.480 1.00 152.76 ? 33  TRP E CG  1 
ATOM   9538  C  CD1 . TRP D 1 33  ? 139.515 162.031 146.378 1.00 155.34 ? 33  TRP E CD1 1 
ATOM   9539  C  CD2 . TRP D 1 33  ? 138.257 163.162 147.844 1.00 156.37 ? 33  TRP E CD2 1 
ATOM   9540  N  NE1 . TRP D 1 33  ? 139.586 161.377 147.585 1.00 158.05 ? 33  TRP E NE1 1 
ATOM   9541  C  CE2 . TRP D 1 33  ? 138.826 162.053 148.505 1.00 161.94 ? 33  TRP E CE2 1 
ATOM   9542  C  CE3 . TRP D 1 33  ? 137.427 164.032 148.574 1.00 159.96 ? 33  TRP E CE3 1 
ATOM   9543  C  CZ2 . TRP D 1 33  ? 138.582 161.778 149.855 1.00 165.26 ? 33  TRP E CZ2 1 
ATOM   9544  C  CZ3 . TRP D 1 33  ? 137.197 163.767 149.915 1.00 165.35 ? 33  TRP E CZ3 1 
ATOM   9545  C  CH2 . TRP D 1 33  ? 137.768 162.650 150.541 1.00 167.61 ? 33  TRP E CH2 1 
ATOM   9546  N  N   . GLU D 1 34  ? 141.380 165.022 145.210 1.00 143.36 ? 34  GLU E N   1 
ATOM   9547  C  CA  . GLU D 1 34  ? 142.801 164.874 145.513 1.00 141.80 ? 34  GLU E CA  1 
ATOM   9548  C  C   . GLU D 1 34  ? 143.448 166.235 145.799 1.00 144.62 ? 34  GLU E C   1 
ATOM   9549  O  O   . GLU D 1 34  ? 144.363 166.302 146.624 1.00 144.70 ? 34  GLU E O   1 
ATOM   9550  C  CB  . GLU D 1 34  ? 143.525 164.156 144.364 1.00 140.68 ? 34  GLU E CB  1 
ATOM   9551  C  CG  . GLU D 1 34  ? 143.207 162.667 144.298 1.00 154.08 ? 34  GLU E CG  1 
ATOM   9552  C  CD  . GLU D 1 34  ? 143.895 161.845 143.223 1.00 177.16 ? 34  GLU E CD  1 
ATOM   9553  O  OE1 . GLU D 1 34  ? 144.471 162.434 142.279 1.00 175.93 ? 34  GLU E OE1 1 
ATOM   9554  O  OE2 . GLU D 1 34  ? 143.840 160.597 143.320 1.00 172.70 ? 34  GLU E OE2 1 
ATOM   9555  N  N   . THR D 1 35  ? 142.959 167.314 145.138 1.00 139.85 ? 35  THR E N   1 
ATOM   9556  C  CA  . THR D 1 35  ? 143.447 168.687 145.322 1.00 138.31 ? 35  THR E CA  1 
ATOM   9557  C  C   . THR D 1 35  ? 142.959 169.208 146.677 1.00 146.31 ? 35  THR E C   1 
ATOM   9558  O  O   . THR D 1 35  ? 143.726 169.878 147.371 1.00 146.13 ? 35  THR E O   1 
ATOM   9559  C  CB  . THR D 1 35  ? 143.037 169.589 144.146 1.00 140.88 ? 35  THR E CB  1 
ATOM   9560  O  OG1 . THR D 1 35  ? 143.522 169.004 142.940 1.00 137.52 ? 35  THR E OG1 1 
ATOM   9561  C  CG2 . THR D 1 35  ? 143.601 171.002 144.259 1.00 137.59 ? 35  THR E CG2 1 
ATOM   9562  N  N   . PHE D 1 36  ? 141.704 168.874 147.066 1.00 146.35 ? 36  PHE E N   1 
ATOM   9563  C  CA  . PHE D 1 36  ? 141.135 169.249 148.368 1.00 150.01 ? 36  PHE E CA  1 
ATOM   9564  C  C   . PHE D 1 36  ? 141.979 168.614 149.478 1.00 154.48 ? 36  PHE E C   1 
ATOM   9565  O  O   . PHE D 1 36  ? 142.298 169.280 150.464 1.00 155.93 ? 36  PHE E O   1 
ATOM   9566  C  CB  . PHE D 1 36  ? 139.650 168.830 148.474 1.00 155.27 ? 36  PHE E CB  1 
ATOM   9567  C  CG  . PHE D 1 36  ? 139.121 168.647 149.881 1.00 161.52 ? 36  PHE E CG  1 
ATOM   9568  C  CD1 . PHE D 1 36  ? 138.910 169.742 150.712 1.00 166.87 ? 36  PHE E CD1 1 
ATOM   9569  C  CD2 . PHE D 1 36  ? 138.830 167.380 150.371 1.00 166.39 ? 36  PHE E CD2 1 
ATOM   9570  C  CE1 . PHE D 1 36  ? 138.434 169.569 152.015 1.00 172.45 ? 36  PHE E CE1 1 
ATOM   9571  C  CE2 . PHE D 1 36  ? 138.351 167.209 151.674 1.00 173.83 ? 36  PHE E CE2 1 
ATOM   9572  C  CZ  . PHE D 1 36  ? 138.155 168.304 152.486 1.00 173.94 ? 36  PHE E CZ  1 
ATOM   9573  N  N   . LEU D 1 37  ? 142.354 167.333 149.281 1.00 149.74 ? 37  LEU E N   1 
ATOM   9574  C  CA  . LEU D 1 37  ? 143.199 166.539 150.168 1.00 150.54 ? 37  LEU E CA  1 
ATOM   9575  C  C   . LEU D 1 37  ? 144.593 167.145 150.245 1.00 152.95 ? 37  LEU E C   1 
ATOM   9576  O  O   . LEU D 1 37  ? 145.144 167.251 151.342 1.00 154.93 ? 37  LEU E O   1 
ATOM   9577  C  CB  . LEU D 1 37  ? 143.272 165.095 149.643 1.00 150.02 ? 37  LEU E CB  1 
ATOM   9578  C  CG  . LEU D 1 37  ? 142.472 164.024 150.380 1.00 157.99 ? 37  LEU E CG  1 
ATOM   9579  C  CD1 . LEU D 1 37  ? 141.013 164.397 150.505 1.00 160.44 ? 37  LEU E CD1 1 
ATOM   9580  C  CD2 . LEU D 1 37  ? 142.563 162.720 149.654 1.00 158.81 ? 37  LEU E CD2 1 
ATOM   9581  N  N   . ALA D 1 38  ? 145.145 167.571 149.083 1.00 145.83 ? 38  ALA E N   1 
ATOM   9582  C  CA  . ALA D 1 38  ? 146.458 168.209 148.969 1.00 143.81 ? 38  ALA E CA  1 
ATOM   9583  C  C   . ALA D 1 38  ? 146.470 169.548 149.702 1.00 149.62 ? 38  ALA E C   1 
ATOM   9584  O  O   . ALA D 1 38  ? 147.452 169.855 150.378 1.00 150.26 ? 38  ALA E O   1 
ATOM   9585  C  CB  . ALA D 1 38  ? 146.828 168.404 147.507 1.00 140.70 ? 38  ALA E CB  1 
ATOM   9586  N  N   . GLN D 1 39  ? 145.363 170.318 149.595 1.00 147.06 ? 39  GLN E N   1 
ATOM   9587  C  CA  . GLN D 1 39  ? 145.165 171.607 150.267 1.00 148.91 ? 39  GLN E CA  1 
ATOM   9588  C  C   . GLN D 1 39  ? 145.074 171.408 151.784 1.00 156.76 ? 39  GLN E C   1 
ATOM   9589  O  O   . GLN D 1 39  ? 145.645 172.193 152.544 1.00 158.00 ? 39  GLN E O   1 
ATOM   9590  C  CB  . GLN D 1 39  ? 143.896 172.299 149.743 1.00 150.73 ? 39  GLN E CB  1 
ATOM   9591  N  N   . ARG D 1 40  ? 144.372 170.336 152.209 1.00 155.08 ? 40  ARG E N   1 
ATOM   9592  C  CA  . ARG D 1 40  ? 144.166 169.948 153.603 1.00 159.09 ? 40  ARG E CA  1 
ATOM   9593  C  C   . ARG D 1 40  ? 145.497 169.619 154.285 1.00 163.27 ? 40  ARG E C   1 
ATOM   9594  O  O   . ARG D 1 40  ? 145.710 170.028 155.426 1.00 166.05 ? 40  ARG E O   1 
ATOM   9595  C  CB  . ARG D 1 40  ? 143.211 168.748 153.678 1.00 161.37 ? 40  ARG E CB  1 
ATOM   9596  C  CG  . ARG D 1 40  ? 142.360 168.723 154.934 1.00 178.04 ? 40  ARG E CG  1 
ATOM   9597  C  CD  . ARG D 1 40  ? 141.183 167.775 154.800 1.00 189.89 ? 40  ARG E CD  1 
ATOM   9598  N  NE  . ARG D 1 40  ? 140.400 167.711 156.034 1.00 206.72 ? 40  ARG E NE  1 
ATOM   9599  C  CZ  . ARG D 1 40  ? 139.417 168.551 156.348 1.00 225.20 ? 40  ARG E CZ  1 
ATOM   9600  N  NH1 . ARG D 1 40  ? 139.081 169.532 155.518 1.00 216.54 ? 40  ARG E NH1 1 
ATOM   9601  N  NH2 . ARG D 1 40  ? 138.763 168.417 157.494 1.00 220.78 ? 40  ARG E NH2 1 
ATOM   9602  N  N   . GLN D 1 41  ? 146.394 168.906 153.578 1.00 157.23 ? 41  GLN E N   1 
ATOM   9603  C  CA  . GLN D 1 41  ? 147.708 168.534 154.099 1.00 157.66 ? 41  GLN E CA  1 
ATOM   9604  C  C   . GLN D 1 41  ? 148.710 169.687 153.989 1.00 159.34 ? 41  GLN E C   1 
ATOM   9605  O  O   . GLN D 1 41  ? 149.611 169.773 154.821 1.00 161.10 ? 41  GLN E O   1 
ATOM   9606  C  CB  . GLN D 1 41  ? 148.251 167.288 153.396 1.00 157.25 ? 41  GLN E CB  1 
ATOM   9607  C  CG  . GLN D 1 41  ? 148.716 166.223 154.384 1.00 183.03 ? 41  GLN E CG  1 
ATOM   9608  C  CD  . GLN D 1 41  ? 150.215 166.096 154.475 1.00 206.08 ? 41  GLN E CD  1 
ATOM   9609  O  OE1 . GLN D 1 41  ? 150.823 166.400 155.507 1.00 205.36 ? 41  GLN E OE1 1 
ATOM   9610  N  NE2 . GLN D 1 41  ? 150.837 165.591 153.418 1.00 195.15 ? 41  GLN E NE2 1 
ATOM   9611  N  N   . ARG D 1 42  ? 148.553 170.576 152.986 1.00 152.19 ? 42  ARG E N   1 
ATOM   9612  C  CA  . ARG D 1 42  ? 149.425 171.742 152.809 1.00 150.81 ? 42  ARG E CA  1 
ATOM   9613  C  C   . ARG D 1 42  ? 149.248 172.701 153.981 1.00 159.14 ? 42  ARG E C   1 
ATOM   9614  O  O   . ARG D 1 42  ? 150.212 173.342 154.397 1.00 159.44 ? 42  ARG E O   1 
ATOM   9615  C  CB  . ARG D 1 42  ? 149.143 172.455 151.481 1.00 147.31 ? 42  ARG E CB  1 
ATOM   9616  N  N   . ARG D 1 43  ? 148.017 172.761 154.534 1.00 159.46 ? 43  ARG E N   1 
ATOM   9617  C  CA  . ARG D 1 43  ? 147.663 173.580 155.693 1.00 164.14 ? 43  ARG E CA  1 
ATOM   9618  C  C   . ARG D 1 43  ? 148.406 173.088 156.931 1.00 172.66 ? 43  ARG E C   1 
ATOM   9619  O  O   . ARG D 1 43  ? 148.872 173.912 157.711 1.00 175.06 ? 43  ARG E O   1 
ATOM   9620  C  CB  . ARG D 1 43  ? 146.145 173.569 155.933 1.00 166.53 ? 43  ARG E CB  1 
ATOM   9621  N  N   . ILE D 1 44  ? 148.554 171.749 157.082 1.00 170.50 ? 44  ILE E N   1 
ATOM   9622  C  CA  . ILE D 1 44  ? 149.259 171.097 158.197 1.00 174.39 ? 44  ILE E CA  1 
ATOM   9623  C  C   . ILE D 1 44  ? 150.732 171.552 158.217 1.00 179.00 ? 44  ILE E C   1 
ATOM   9624  O  O   . ILE D 1 44  ? 151.238 171.901 159.283 1.00 182.55 ? 44  ILE E O   1 
ATOM   9625  C  CB  . ILE D 1 44  ? 149.132 169.535 158.145 1.00 177.43 ? 44  ILE E CB  1 
ATOM   9626  C  CG1 . ILE D 1 44  ? 147.670 169.032 157.931 1.00 178.46 ? 44  ILE E CG1 1 
ATOM   9627  C  CG2 . ILE D 1 44  ? 149.819 168.839 159.331 1.00 182.07 ? 44  ILE E CG2 1 
ATOM   9628  C  CD1 . ILE D 1 44  ? 146.563 169.463 158.975 1.00 191.25 ? 44  ILE E CD1 1 
ATOM   9629  N  N   . TYR D 1 45  ? 151.395 171.583 157.039 1.00 171.90 ? 45  TYR E N   1 
ATOM   9630  C  CA  . TYR D 1 45  ? 152.791 172.008 156.891 1.00 171.30 ? 45  TYR E CA  1 
ATOM   9631  C  C   . TYR D 1 45  ? 152.975 173.482 157.264 1.00 176.86 ? 45  TYR E C   1 
ATOM   9632  O  O   . TYR D 1 45  ? 153.988 173.831 157.869 1.00 178.28 ? 45  TYR E O   1 
ATOM   9633  C  CB  . TYR D 1 45  ? 153.290 171.775 155.450 1.00 167.94 ? 45  TYR E CB  1 
ATOM   9634  C  CG  . TYR D 1 45  ? 153.285 170.333 154.982 1.00 168.47 ? 45  TYR E CG  1 
ATOM   9635  C  CD1 . TYR D 1 45  ? 153.851 169.324 155.758 1.00 173.25 ? 45  TYR E CD1 1 
ATOM   9636  C  CD2 . TYR D 1 45  ? 152.798 169.988 153.725 1.00 165.29 ? 45  TYR E CD2 1 
ATOM   9637  C  CE1 . TYR D 1 45  ? 153.865 167.998 155.325 1.00 173.32 ? 45  TYR E CE1 1 
ATOM   9638  C  CE2 . TYR D 1 45  ? 152.822 168.668 153.273 1.00 165.00 ? 45  TYR E CE2 1 
ATOM   9639  C  CZ  . TYR D 1 45  ? 153.365 167.677 154.074 1.00 175.61 ? 45  TYR E CZ  1 
ATOM   9640  O  OH  . TYR D 1 45  ? 153.401 166.372 153.640 1.00 175.90 ? 45  TYR E OH  1 
ATOM   9641  N  N   . LYS D 1 46  ? 151.992 174.336 156.913 1.00 173.60 ? 46  LYS E N   1 
ATOM   9642  C  CA  . LYS D 1 46  ? 152.013 175.777 157.173 1.00 176.02 ? 46  LYS E CA  1 
ATOM   9643  C  C   . LYS D 1 46  ? 151.619 176.127 158.615 1.00 186.83 ? 46  LYS E C   1 
ATOM   9644  O  O   . LYS D 1 46  ? 152.147 177.099 159.161 1.00 189.10 ? 46  LYS E O   1 
ATOM   9645  C  CB  . LYS D 1 46  ? 151.086 176.511 156.193 1.00 175.99 ? 46  LYS E CB  1 
ATOM   9646  N  N   . THR D 1 47  ? 150.690 175.356 159.223 1.00 186.53 ? 47  THR E N   1 
ATOM   9647  C  CA  . THR D 1 47  ? 150.207 175.605 160.585 1.00 192.56 ? 47  THR E CA  1 
ATOM   9648  C  C   . THR D 1 47  ? 151.183 175.041 161.633 1.00 201.25 ? 47  THR E C   1 
ATOM   9649  O  O   . THR D 1 47  ? 151.651 175.805 162.477 1.00 204.71 ? 47  THR E O   1 
ATOM   9650  C  CB  . THR D 1 47  ? 148.778 175.056 160.787 1.00 201.69 ? 47  THR E CB  1 
ATOM   9651  O  OG1 . THR D 1 47  ? 147.955 175.453 159.689 1.00 198.52 ? 47  THR E OG1 1 
ATOM   9652  C  CG2 . THR D 1 47  ? 148.141 175.536 162.086 1.00 205.14 ? 47  THR E CG2 1 
ATOM   9653  N  N   . THR D 1 48  ? 151.476 173.721 161.593 1.00 197.81 ? 48  THR E N   1 
ATOM   9654  C  CA  . THR D 1 48  ? 152.356 173.070 162.572 1.00 201.78 ? 48  THR E CA  1 
ATOM   9655  C  C   . THR D 1 48  ? 153.823 173.500 162.347 1.00 206.51 ? 48  THR E C   1 
ATOM   9656  O  O   . THR D 1 48  ? 154.597 172.805 161.681 1.00 202.73 ? 48  THR E O   1 
ATOM   9657  C  CB  . THR D 1 48  ? 152.173 171.535 162.581 1.00 208.40 ? 48  THR E CB  1 
ATOM   9658  O  OG1 . THR D 1 48  ? 152.600 170.986 161.336 1.00 205.24 ? 48  THR E OG1 1 
ATOM   9659  C  CG2 . THR D 1 48  ? 150.739 171.107 162.887 1.00 207.86 ? 48  THR E CG2 1 
ATOM   9660  N  N   . THR D 1 49  ? 154.183 174.667 162.913 1.00 206.88 ? 49  THR E N   1 
ATOM   9661  C  CA  . THR D 1 49  ? 155.522 175.261 162.845 1.00 208.04 ? 49  THR E CA  1 
ATOM   9662  C  C   . THR D 1 49  ? 156.349 174.830 164.083 1.00 213.88 ? 49  THR E C   1 
ATOM   9663  O  O   . THR D 1 49  ? 157.579 174.771 164.009 1.00 214.16 ? 49  THR E O   1 
ATOM   9664  C  CB  . THR D 1 49  ? 155.438 176.798 162.664 1.00 213.44 ? 49  THR E CB  1 
ATOM   9665  O  OG1 . THR D 1 49  ? 156.750 177.337 162.493 1.00 213.74 ? 49  THR E OG1 1 
ATOM   9666  C  CG2 . THR D 1 49  ? 154.715 177.514 163.812 1.00 213.89 ? 49  THR E CG2 1 
ATOM   9667  N  N   . HIS D 1 50  ? 155.661 174.518 165.203 1.00 213.59 ? 50  HIS E N   1 
ATOM   9668  C  CA  . HIS D 1 50  ? 156.259 174.053 166.457 1.00 215.60 ? 50  HIS E CA  1 
ATOM   9669  C  C   . HIS D 1 50  ? 156.239 172.520 166.507 1.00 218.28 ? 50  HIS E C   1 
ATOM   9670  O  O   . HIS D 1 50  ? 155.278 171.907 166.036 1.00 216.73 ? 50  HIS E O   1 
ATOM   9671  C  CB  . HIS D 1 50  ? 155.510 174.644 167.662 1.00 217.89 ? 50  HIS E CB  1 
ATOM   9672  N  N   . VAL D 1 51  ? 157.297 171.906 167.072 1.00 217.57 ? 51  VAL E N   1 
ATOM   9673  C  CA  . VAL D 1 51  ? 157.432 170.450 167.186 1.00 217.32 ? 51  VAL E CA  1 
ATOM   9674  C  C   . VAL D 1 51  ? 156.404 169.882 168.195 1.00 221.38 ? 51  VAL E C   1 
ATOM   9675  O  O   . VAL D 1 51  ? 156.306 170.404 169.311 1.00 222.87 ? 51  VAL E O   1 
ATOM   9676  C  CB  . VAL D 1 51  ? 158.875 170.040 167.561 1.00 220.98 ? 51  VAL E CB  1 
ATOM   9677  N  N   . PRO D 1 52  ? 155.622 168.832 167.819 1.00 218.52 ? 52  PRO E N   1 
ATOM   9678  C  CA  . PRO D 1 52  ? 154.622 168.278 168.754 1.00 219.56 ? 52  PRO E CA  1 
ATOM   9679  C  C   . PRO D 1 52  ? 155.254 167.565 169.962 1.00 224.54 ? 52  PRO E C   1 
ATOM   9680  O  O   . PRO D 1 52  ? 156.386 167.086 169.843 1.00 224.40 ? 52  PRO E O   1 
ATOM   9681  C  CB  . PRO D 1 52  ? 153.829 167.286 167.887 1.00 219.16 ? 52  PRO E CB  1 
ATOM   9682  C  CG  . PRO D 1 52  ? 154.191 167.604 166.476 1.00 220.26 ? 52  PRO E CG  1 
ATOM   9683  C  CD  . PRO D 1 52  ? 155.593 168.108 166.534 1.00 217.68 ? 52  PRO E CD  1 
ATOM   9684  N  N   . PRO D 1 53  ? 154.554 167.472 171.126 1.00 224.09 ? 53  PRO E N   1 
ATOM   9685  C  CA  . PRO D 1 53  ? 155.150 166.793 172.295 1.00 225.86 ? 53  PRO E CA  1 
ATOM   9686  C  C   . PRO D 1 53  ? 155.332 165.285 172.092 1.00 228.05 ? 53  PRO E C   1 
ATOM   9687  O  O   . PRO D 1 53  ? 156.270 164.711 172.648 1.00 228.77 ? 53  PRO E O   1 
ATOM   9688  C  CB  . PRO D 1 53  ? 154.152 167.078 173.425 1.00 228.62 ? 53  PRO E CB  1 
ATOM   9689  C  CG  . PRO D 1 53  ? 153.286 168.192 172.924 1.00 230.82 ? 53  PRO E CG  1 
ATOM   9690  C  CD  . PRO D 1 53  ? 153.210 167.990 171.451 1.00 225.50 ? 53  PRO E CD  1 
ATOM   9691  N  N   . GLU D 1 54  ? 154.444 164.652 171.293 1.00 224.42 ? 54  GLU E N   1 
ATOM   9692  C  CA  . GLU D 1 54  ? 154.487 163.220 170.968 1.00 223.86 ? 54  GLU E CA  1 
ATOM   9693  C  C   . GLU D 1 54  ? 155.704 162.910 170.097 1.00 224.93 ? 54  GLU E C   1 
ATOM   9694  O  O   . GLU D 1 54  ? 156.433 161.952 170.369 1.00 225.14 ? 54  GLU E O   1 
ATOM   9695  C  CB  . GLU D 1 54  ? 153.203 162.782 170.238 1.00 223.79 ? 54  GLU E CB  1 
ATOM   9696  C  CG  . GLU D 1 54  ? 151.916 162.963 171.024 1.00 232.33 ? 54  GLU E CG  1 
ATOM   9697  C  CD  . GLU D 1 54  ? 150.665 162.605 170.246 1.00 245.45 ? 54  GLU E CD  1 
ATOM   9698  O  OE1 . GLU D 1 54  ? 150.415 163.237 169.194 1.00 239.71 ? 54  GLU E OE1 1 
ATOM   9699  O  OE2 . GLU D 1 54  ? 149.929 161.695 170.693 1.00 242.92 ? 54  GLU E OE2 1 
ATOM   9700  N  N   . LEU D 1 55  ? 155.921 163.754 169.062 1.00 220.92 ? 55  LEU E N   1 
ATOM   9701  C  CA  . LEU D 1 55  ? 157.018 163.673 168.097 1.00 219.58 ? 55  LEU E CA  1 
ATOM   9702  C  C   . LEU D 1 55  ? 158.238 164.512 168.548 1.00 222.79 ? 55  LEU E C   1 
ATOM   9703  O  O   . LEU D 1 55  ? 159.073 164.888 167.720 1.00 221.65 ? 55  LEU E O   1 
ATOM   9704  C  CB  . LEU D 1 55  ? 156.518 164.136 166.718 1.00 217.67 ? 55  LEU E CB  1 
ATOM   9705  N  N   . GLY D 1 56  ? 158.333 164.762 169.856 1.00 222.07 ? 56  GLY E N   1 
ATOM   9706  C  CA  . GLY D 1 56  ? 159.411 165.530 170.471 1.00 223.16 ? 56  GLY E CA  1 
ATOM   9707  C  C   . GLY D 1 56  ? 160.735 164.794 170.515 1.00 225.61 ? 56  GLY E C   1 
ATOM   9708  O  O   . GLY D 1 56  ? 161.787 165.384 170.254 1.00 225.59 ? 56  GLY E O   1 
ATOM   9709  N  N   . GLN D 1 57  ? 160.688 163.499 170.858 1.00 223.08 ? 57  GLN E N   1 
ATOM   9710  C  CA  . GLN D 1 57  ? 161.859 162.626 170.945 1.00 223.31 ? 57  GLN E CA  1 
ATOM   9711  C  C   . GLN D 1 57  ? 162.263 162.085 169.560 1.00 223.45 ? 57  GLN E C   1 
ATOM   9712  O  O   . GLN D 1 57  ? 163.415 161.689 169.371 1.00 223.45 ? 57  GLN E O   1 
ATOM   9713  C  CB  . GLN D 1 57  ? 161.598 161.461 171.924 1.00 225.43 ? 57  GLN E CB  1 
ATOM   9714  C  CG  . GLN D 1 57  ? 160.327 160.642 171.637 1.00 232.05 ? 57  GLN E CG  1 
ATOM   9715  C  CD  . GLN D 1 57  ? 160.103 159.479 172.578 1.00 242.18 ? 57  GLN E CD  1 
ATOM   9716  O  OE1 . GLN D 1 57  ? 160.876 159.220 173.509 1.00 239.74 ? 57  GLN E OE1 1 
ATOM   9717  N  NE2 . GLN D 1 57  ? 159.027 158.744 172.346 1.00 235.38 ? 57  GLN E NE2 1 
ATOM   9718  N  N   . ILE D 1 58  ? 161.312 162.073 168.604 1.00 218.89 ? 58  ILE E N   1 
ATOM   9719  C  CA  . ILE D 1 58  ? 161.484 161.569 167.237 1.00 216.80 ? 58  ILE E CA  1 
ATOM   9720  C  C   . ILE D 1 58  ? 162.374 162.515 166.396 1.00 218.71 ? 58  ILE E C   1 
ATOM   9721  O  O   . ILE D 1 58  ? 163.317 162.035 165.760 1.00 218.21 ? 58  ILE E O   1 
ATOM   9722  C  CB  . ILE D 1 58  ? 160.091 161.318 166.582 1.00 217.36 ? 58  ILE E CB  1 
ATOM   9723  C  CG1 . ILE D 1 58  ? 159.389 160.110 167.254 1.00 218.23 ? 58  ILE E CG1 1 
ATOM   9724  C  CG2 . ILE D 1 58  ? 160.181 161.125 165.053 1.00 216.14 ? 58  ILE E CG2 1 
ATOM   9725  C  CD1 . ILE D 1 58  ? 157.864 160.135 167.253 1.00 222.16 ? 58  ILE E CD1 1 
ATOM   9726  N  N   . MET D 1 59  ? 162.069 163.830 166.372 1.00 216.14 ? 59  MET E N   1 
ATOM   9727  C  CA  . MET D 1 59  ? 162.836 164.805 165.588 1.00 215.50 ? 59  MET E CA  1 
ATOM   9728  C  C   . MET D 1 59  ? 163.016 166.132 166.333 1.00 219.50 ? 59  MET E C   1 
ATOM   9729  O  O   . MET D 1 59  ? 162.075 166.617 166.967 1.00 219.78 ? 59  MET E O   1 
ATOM   9730  C  CB  . MET D 1 59  ? 162.163 165.057 164.229 1.00 214.97 ? 59  MET E CB  1 
ATOM   9731  N  N   . ASP D 1 60  ? 164.227 166.717 166.240 1.00 217.87 ? 60  ASP E N   1 
ATOM   9732  C  CA  . ASP D 1 60  ? 164.583 167.995 166.866 1.00 219.24 ? 60  ASP E CA  1 
ATOM   9733  C  C   . ASP D 1 60  ? 164.058 169.168 166.021 1.00 220.45 ? 60  ASP E C   1 
ATOM   9734  O  O   . ASP D 1 60  ? 163.725 168.969 164.851 1.00 218.33 ? 60  ASP E O   1 
ATOM   9735  C  CB  . ASP D 1 60  ? 166.106 168.097 167.083 1.00 222.00 ? 60  ASP E CB  1 
ATOM   9736  C  CG  . ASP D 1 60  ? 166.940 167.940 165.828 1.00 226.86 ? 60  ASP E CG  1 
ATOM   9737  O  OD1 . ASP D 1 60  ? 167.074 166.795 165.344 1.00 225.99 ? 60  ASP E OD1 1 
ATOM   9738  O  OD2 . ASP D 1 60  ? 167.491 168.955 165.352 1.00 230.89 ? 60  ASP E OD2 1 
ATOM   9739  N  N   . SER D 1 61  ? 163.985 170.381 166.616 1.00 219.09 ? 61  SER E N   1 
ATOM   9740  C  CA  . SER D 1 61  ? 163.476 171.607 165.982 1.00 218.17 ? 61  SER E CA  1 
ATOM   9741  C  C   . SER D 1 61  ? 164.182 171.950 164.660 1.00 219.31 ? 61  SER E C   1 
ATOM   9742  O  O   . SER D 1 61  ? 163.519 172.430 163.738 1.00 217.47 ? 61  SER E O   1 
ATOM   9743  C  CB  . SER D 1 61  ? 163.588 172.791 166.935 1.00 222.67 ? 61  SER E CB  1 
ATOM   9744  O  OG  . SER D 1 61  ? 162.801 173.883 166.484 1.00 227.78 ? 61  SER E OG  1 
ATOM   9745  N  N   . GLU D 1 62  ? 165.510 171.703 164.567 1.00 217.58 ? 62  GLU E N   1 
ATOM   9746  C  CA  . GLU D 1 62  ? 166.302 171.971 163.364 1.00 216.51 ? 62  GLU E CA  1 
ATOM   9747  C  C   . GLU D 1 62  ? 165.911 171.008 162.236 1.00 215.65 ? 62  GLU E C   1 
ATOM   9748  O  O   . GLU D 1 62  ? 165.672 171.462 161.117 1.00 213.97 ? 62  GLU E O   1 
ATOM   9749  C  CB  . GLU D 1 62  ? 167.813 171.887 163.668 1.00 219.37 ? 62  GLU E CB  1 
ATOM   9750  C  CG  . GLU D 1 62  ? 168.731 172.236 162.501 1.00 227.28 ? 62  GLU E CG  1 
ATOM   9751  C  CD  . GLU D 1 62  ? 168.570 173.623 161.907 1.00 245.14 ? 62  GLU E CD  1 
ATOM   9752  O  OE1 . GLU D 1 62  ? 168.896 174.612 162.603 1.00 245.83 ? 62  GLU E OE1 1 
ATOM   9753  O  OE2 . GLU D 1 62  ? 168.138 173.721 160.735 1.00 240.67 ? 62  GLU E OE2 1 
ATOM   9754  N  N   . THR D 1 63  ? 165.828 169.694 162.540 1.00 212.26 ? 63  THR E N   1 
ATOM   9755  C  CA  . THR D 1 63  ? 165.457 168.635 161.594 1.00 209.80 ? 63  THR E CA  1 
ATOM   9756  C  C   . THR D 1 63  ? 163.986 168.794 161.177 1.00 209.31 ? 63  THR E C   1 
ATOM   9757  O  O   . THR D 1 63  ? 163.670 168.597 160.004 1.00 203.94 ? 63  THR E O   1 
ATOM   9758  C  CB  . THR D 1 63  ? 165.738 167.251 162.210 1.00 215.96 ? 63  THR E CB  1 
ATOM   9759  O  OG1 . THR D 1 63  ? 167.087 167.220 162.683 1.00 217.60 ? 63  THR E OG1 1 
ATOM   9760  C  CG2 . THR D 1 63  ? 165.522 166.103 161.226 1.00 213.27 ? 63  THR E CG2 1 
ATOM   9761  N  N   . PHE D 1 64  ? 163.105 169.171 162.131 1.00 207.36 ? 64  PHE E N   1 
ATOM   9762  C  CA  . PHE D 1 64  ? 161.671 169.383 161.905 1.00 204.12 ? 64  PHE E CA  1 
ATOM   9763  C  C   . PHE D 1 64  ? 161.417 170.546 160.936 1.00 202.71 ? 64  PHE E C   1 
ATOM   9764  O  O   . PHE D 1 64  ? 160.590 170.395 160.036 1.00 197.76 ? 64  PHE E O   1 
ATOM   9765  C  CB  . PHE D 1 64  ? 160.938 169.626 163.237 1.00 208.26 ? 64  PHE E CB  1 
ATOM   9766  C  CG  . PHE D 1 64  ? 159.448 169.857 163.123 1.00 208.42 ? 64  PHE E CG  1 
ATOM   9767  C  CD1 . PHE D 1 64  ? 158.569 168.787 162.990 1.00 209.52 ? 64  PHE E CD1 1 
ATOM   9768  C  CD2 . PHE D 1 64  ? 158.922 171.142 163.180 1.00 210.19 ? 64  PHE E CD2 1 
ATOM   9769  C  CE1 . PHE D 1 64  ? 157.191 169.002 162.898 1.00 209.52 ? 64  PHE E CE1 1 
ATOM   9770  C  CE2 . PHE D 1 64  ? 157.544 171.356 163.084 1.00 211.39 ? 64  PHE E CE2 1 
ATOM   9771  C  CZ  . PHE D 1 64  ? 156.688 170.285 162.954 1.00 209.21 ? 64  PHE E CZ  1 
ATOM   9772  N  N   . GLU D 1 65  ? 162.109 171.698 161.123 1.00 200.24 ? 65  GLU E N   1 
ATOM   9773  C  CA  . GLU D 1 65  ? 161.956 172.869 160.252 1.00 196.53 ? 65  GLU E CA  1 
ATOM   9774  C  C   . GLU D 1 65  ? 162.572 172.602 158.873 1.00 193.83 ? 65  GLU E C   1 
ATOM   9775  O  O   . GLU D 1 65  ? 162.051 173.100 157.873 1.00 189.58 ? 65  GLU E O   1 
ATOM   9776  C  CB  . GLU D 1 65  ? 162.552 174.138 160.887 1.00 202.25 ? 65  GLU E CB  1 
ATOM   9777  C  CG  . GLU D 1 65  ? 162.064 175.442 160.258 1.00 211.81 ? 65  GLU E CG  1 
ATOM   9778  C  CD  . GLU D 1 65  ? 160.562 175.631 160.110 1.00 227.71 ? 65  GLU E CD  1 
ATOM   9779  O  OE1 . GLU D 1 65  ? 159.828 175.413 161.102 1.00 227.78 ? 65  GLU E OE1 1 
ATOM   9780  O  OE2 . GLU D 1 65  ? 160.120 176.018 159.004 1.00 218.91 ? 65  GLU E OE2 1 
ATOM   9781  N  N   . LYS D 1 66  ? 163.652 171.792 158.819 1.00 189.40 ? 66  LYS E N   1 
ATOM   9782  C  CA  . LYS D 1 66  ? 164.302 171.383 157.572 1.00 184.44 ? 66  LYS E CA  1 
ATOM   9783  C  C   . LYS D 1 66  ? 163.344 170.496 156.766 1.00 181.87 ? 66  LYS E C   1 
ATOM   9784  O  O   . LYS D 1 66  ? 163.286 170.608 155.542 1.00 176.82 ? 66  LYS E O   1 
ATOM   9785  C  CB  . LYS D 1 66  ? 165.620 170.648 157.862 1.00 189.68 ? 66  LYS E CB  1 
ATOM   9786  N  N   . SER D 1 67  ? 162.566 169.648 157.476 1.00 178.73 ? 67  SER E N   1 
ATOM   9787  C  CA  . SER D 1 67  ? 161.553 168.748 156.923 1.00 174.93 ? 67  SER E CA  1 
ATOM   9788  C  C   . SER D 1 67  ? 160.300 169.527 156.525 1.00 175.44 ? 67  SER E C   1 
ATOM   9789  O  O   . SER D 1 67  ? 159.698 169.214 155.499 1.00 171.31 ? 67  SER E O   1 
ATOM   9790  C  CB  . SER D 1 67  ? 161.195 167.661 157.934 1.00 181.63 ? 67  SER E CB  1 
ATOM   9791  O  OG  . SER D 1 67  ? 160.178 166.797 157.454 1.00 187.16 ? 67  SER E OG  1 
ATOM   9792  N  N   . ARG D 1 68  ? 159.912 170.535 157.338 1.00 173.77 ? 68  ARG E N   1 
ATOM   9793  C  CA  . ARG D 1 68  ? 158.747 171.398 157.119 1.00 171.83 ? 68  ARG E CA  1 
ATOM   9794  C  C   . ARG D 1 68  ? 158.874 172.170 155.800 1.00 171.09 ? 68  ARG E C   1 
ATOM   9795  O  O   . ARG D 1 68  ? 157.940 172.147 155.001 1.00 167.42 ? 68  ARG E O   1 
ATOM   9796  C  CB  . ARG D 1 68  ? 158.575 172.375 158.298 1.00 176.29 ? 68  ARG E CB  1 
ATOM   9797  C  CG  . ARG D 1 68  ? 157.216 173.055 158.355 1.00 184.21 ? 68  ARG E CG  1 
ATOM   9798  C  CD  . ARG D 1 68  ? 157.148 174.046 159.497 1.00 196.21 ? 68  ARG E CD  1 
ATOM   9799  N  NE  . ARG D 1 68  ? 156.091 175.036 159.290 1.00 202.69 ? 68  ARG E NE  1 
ATOM   9800  C  CZ  . ARG D 1 68  ? 156.267 176.213 158.697 1.00 214.95 ? 68  ARG E CZ  1 
ATOM   9801  N  NH1 . ARG D 1 68  ? 157.467 176.564 158.247 1.00 201.72 ? 68  ARG E NH1 1 
ATOM   9802  N  NH2 . ARG D 1 68  ? 155.249 177.048 158.550 1.00 200.36 ? 68  ARG E NH2 1 
ATOM   9803  N  N   . LEU D 1 69  ? 160.033 172.822 155.569 1.00 167.88 ? 69  LEU E N   1 
ATOM   9804  C  CA  . LEU D 1 69  ? 160.314 173.609 154.365 1.00 164.39 ? 69  LEU E CA  1 
ATOM   9805  C  C   . LEU D 1 69  ? 160.458 172.727 153.128 1.00 163.81 ? 69  LEU E C   1 
ATOM   9806  O  O   . LEU D 1 69  ? 160.082 173.165 152.042 1.00 159.89 ? 69  LEU E O   1 
ATOM   9807  C  CB  . LEU D 1 69  ? 161.576 174.465 154.547 1.00 167.08 ? 69  LEU E CB  1 
ATOM   9808  C  CG  . LEU D 1 69  ? 161.476 175.607 155.567 1.00 176.66 ? 69  LEU E CG  1 
ATOM   9809  C  CD1 . LEU D 1 69  ? 162.836 175.946 156.143 1.00 180.89 ? 69  LEU E CD1 1 
ATOM   9810  C  CD2 . LEU D 1 69  ? 160.825 176.843 154.965 1.00 178.58 ? 69  LEU E CD2 1 
ATOM   9811  N  N   . TYR D 1 70  ? 160.988 171.493 153.290 1.00 161.14 ? 70  TYR E N   1 
ATOM   9812  C  CA  . TYR D 1 70  ? 161.170 170.519 152.206 1.00 157.66 ? 70  TYR E CA  1 
ATOM   9813  C  C   . TYR D 1 70  ? 159.825 169.992 151.708 1.00 157.63 ? 70  TYR E C   1 
ATOM   9814  O  O   . TYR D 1 70  ? 159.608 169.956 150.497 1.00 153.45 ? 70  TYR E O   1 
ATOM   9815  C  CB  . TYR D 1 70  ? 162.079 169.353 152.656 1.00 161.45 ? 70  TYR E CB  1 
ATOM   9816  C  CG  . TYR D 1 70  ? 162.199 168.197 151.681 1.00 161.00 ? 70  TYR E CG  1 
ATOM   9817  C  CD1 . TYR D 1 70  ? 162.689 168.390 150.393 1.00 159.74 ? 70  TYR E CD1 1 
ATOM   9818  C  CD2 . TYR D 1 70  ? 161.894 166.897 152.072 1.00 163.17 ? 70  TYR E CD2 1 
ATOM   9819  C  CE1 . TYR D 1 70  ? 162.836 167.326 149.506 1.00 158.47 ? 70  TYR E CE1 1 
ATOM   9820  C  CE2 . TYR D 1 70  ? 162.035 165.823 151.193 1.00 162.29 ? 70  TYR E CE2 1 
ATOM   9821  C  CZ  . TYR D 1 70  ? 162.506 166.043 149.910 1.00 166.67 ? 70  TYR E CZ  1 
ATOM   9822  O  OH  . TYR D 1 70  ? 162.649 164.983 149.046 1.00 166.62 ? 70  TYR E OH  1 
ATOM   9823  N  N   . GLN D 1 71  ? 158.928 169.596 152.634 1.00 155.51 ? 71  GLN E N   1 
ATOM   9824  C  CA  . GLN D 1 71  ? 157.604 169.077 152.294 1.00 153.29 ? 71  GLN E CA  1 
ATOM   9825  C  C   . GLN D 1 71  ? 156.688 170.186 151.767 1.00 155.08 ? 71  GLN E C   1 
ATOM   9826  O  O   . GLN D 1 71  ? 155.777 169.894 150.992 1.00 152.24 ? 71  GLN E O   1 
ATOM   9827  C  CB  . GLN D 1 71  ? 156.954 168.366 153.488 1.00 157.96 ? 71  GLN E CB  1 
ATOM   9828  C  CG  . GLN D 1 71  ? 157.674 167.092 153.952 1.00 177.25 ? 71  GLN E CG  1 
ATOM   9829  C  CD  . GLN D 1 71  ? 157.777 165.985 152.921 1.00 198.91 ? 71  GLN E CD  1 
ATOM   9830  O  OE1 . GLN D 1 71  ? 156.884 165.770 152.091 1.00 194.43 ? 71  GLN E OE1 1 
ATOM   9831  N  NE2 . GLN D 1 71  ? 158.859 165.223 152.984 1.00 192.17 ? 71  GLN E NE2 1 
ATOM   9832  N  N   . LEU D 1 72  ? 156.943 171.452 152.165 1.00 152.97 ? 72  LEU E N   1 
ATOM   9833  C  CA  . LEU D 1 72  ? 156.183 172.620 151.709 1.00 151.50 ? 72  LEU E CA  1 
ATOM   9834  C  C   . LEU D 1 72  ? 156.507 172.917 150.238 1.00 151.08 ? 72  LEU E C   1 
ATOM   9835  O  O   . LEU D 1 72  ? 155.587 173.138 149.449 1.00 148.34 ? 72  LEU E O   1 
ATOM   9836  C  CB  . LEU D 1 72  ? 156.470 173.846 152.589 1.00 154.88 ? 72  LEU E CB  1 
ATOM   9837  N  N   . ASP D 1 73  ? 157.812 172.888 149.871 1.00 146.83 ? 73  ASP E N   1 
ATOM   9838  C  CA  . ASP D 1 73  ? 158.305 173.108 148.507 1.00 143.34 ? 73  ASP E CA  1 
ATOM   9839  C  C   . ASP D 1 73  ? 157.841 171.990 147.583 1.00 144.35 ? 73  ASP E C   1 
ATOM   9840  O  O   . ASP D 1 73  ? 157.547 172.242 146.413 1.00 141.12 ? 73  ASP E O   1 
ATOM   9841  C  CB  . ASP D 1 73  ? 159.842 173.197 148.492 1.00 146.23 ? 73  ASP E CB  1 
ATOM   9842  C  CG  . ASP D 1 73  ? 160.431 174.498 149.008 1.00 159.54 ? 73  ASP E CG  1 
ATOM   9843  O  OD1 . ASP D 1 73  ? 159.752 175.189 149.804 1.00 161.56 ? 73  ASP E OD1 1 
ATOM   9844  O  OD2 . ASP D 1 73  ? 161.592 174.805 148.653 1.00 167.49 ? 73  ASP E OD2 1 
ATOM   9845  N  N   . LYS D 1 74  ? 157.774 170.755 148.117 1.00 142.13 ? 74  LYS E N   1 
ATOM   9846  C  CA  . LYS D 1 74  ? 157.328 169.561 147.403 1.00 140.07 ? 74  LYS E CA  1 
ATOM   9847  C  C   . LYS D 1 74  ? 155.827 169.649 147.109 1.00 142.31 ? 74  LYS E C   1 
ATOM   9848  O  O   . LYS D 1 74  ? 155.411 169.286 146.009 1.00 138.92 ? 74  LYS E O   1 
ATOM   9849  C  CB  . LYS D 1 74  ? 157.656 168.292 148.208 1.00 145.05 ? 74  LYS E CB  1 
ATOM   9850  N  N   . SER D 1 75  ? 155.030 170.167 148.077 1.00 141.03 ? 75  SER E N   1 
ATOM   9851  C  CA  . SER D 1 75  ? 153.576 170.343 147.962 1.00 140.55 ? 75  SER E CA  1 
ATOM   9852  C  C   . SER D 1 75  ? 153.219 171.379 146.885 1.00 141.46 ? 75  SER E C   1 
ATOM   9853  O  O   . SER D 1 75  ? 152.298 171.141 146.099 1.00 139.53 ? 75  SER E O   1 
ATOM   9854  C  CB  . SER D 1 75  ? 152.972 170.754 149.303 1.00 147.47 ? 75  SER E CB  1 
ATOM   9855  O  OG  . SER D 1 75  ? 151.553 170.782 149.258 1.00 156.16 ? 75  SER E OG  1 
ATOM   9856  N  N   . THR D 1 76  ? 153.955 172.513 146.847 1.00 137.33 ? 76  THR E N   1 
ATOM   9857  C  CA  . THR D 1 76  ? 153.760 173.600 145.882 1.00 134.90 ? 76  THR E CA  1 
ATOM   9858  C  C   . THR D 1 76  ? 153.994 173.081 144.458 1.00 133.60 ? 76  THR E C   1 
ATOM   9859  O  O   . THR D 1 76  ? 153.154 173.320 143.585 1.00 131.50 ? 76  THR E O   1 
ATOM   9860  C  CB  . THR D 1 76  ? 154.677 174.793 146.207 1.00 147.16 ? 76  THR E CB  1 
ATOM   9861  O  OG1 . THR D 1 76  ? 154.745 174.985 147.623 1.00 151.14 ? 76  THR E OG1 1 
ATOM   9862  C  CG2 . THR D 1 76  ? 154.219 176.079 145.535 1.00 146.89 ? 76  THR E CG2 1 
ATOM   9863  N  N   . PHE D 1 77  ? 155.120 172.350 144.242 1.00 127.97 ? 77  PHE E N   1 
ATOM   9864  C  CA  . PHE D 1 77  ? 155.480 171.755 142.953 1.00 124.37 ? 77  PHE E CA  1 
ATOM   9865  C  C   . PHE D 1 77  ? 154.450 170.713 142.552 1.00 126.43 ? 77  PHE E C   1 
ATOM   9866  O  O   . PHE D 1 77  ? 154.009 170.717 141.404 1.00 123.72 ? 77  PHE E O   1 
ATOM   9867  C  CB  . PHE D 1 77  ? 156.886 171.131 142.990 1.00 126.27 ? 77  PHE E CB  1 
ATOM   9868  C  CG  . PHE D 1 77  ? 157.283 170.391 141.727 1.00 125.59 ? 77  PHE E CG  1 
ATOM   9869  C  CD1 . PHE D 1 77  ? 157.759 171.079 140.616 1.00 126.79 ? 77  PHE E CD1 1 
ATOM   9870  C  CD2 . PHE D 1 77  ? 157.188 169.004 141.653 1.00 127.75 ? 77  PHE E CD2 1 
ATOM   9871  C  CE1 . PHE D 1 77  ? 158.123 170.395 139.451 1.00 125.92 ? 77  PHE E CE1 1 
ATOM   9872  C  CE2 . PHE D 1 77  ? 157.543 168.323 140.484 1.00 128.74 ? 77  PHE E CE2 1 
ATOM   9873  C  CZ  . PHE D 1 77  ? 158.008 169.023 139.392 1.00 124.99 ? 77  PHE E CZ  1 
ATOM   9874  N  N   . SER D 1 78  ? 154.062 169.835 143.509 1.00 124.51 ? 78  SER E N   1 
ATOM   9875  C  CA  . SER D 1 78  ? 153.079 168.761 143.334 1.00 124.20 ? 78  SER E CA  1 
ATOM   9876  C  C   . SER D 1 78  ? 151.768 169.286 142.752 1.00 125.55 ? 78  SER E C   1 
ATOM   9877  O  O   . SER D 1 78  ? 151.171 168.608 141.911 1.00 124.09 ? 78  SER E O   1 
ATOM   9878  C  CB  . SER D 1 78  ? 152.811 168.061 144.662 1.00 131.27 ? 78  SER E CB  1 
ATOM   9879  O  OG  . SER D 1 78  ? 151.930 166.961 144.514 1.00 143.53 ? 78  SER E OG  1 
ATOM   9880  N  N   . PHE D 1 79  ? 151.344 170.501 143.174 1.00 121.45 ? 79  PHE E N   1 
ATOM   9881  C  CA  . PHE D 1 79  ? 150.117 171.131 142.699 1.00 120.49 ? 79  PHE E CA  1 
ATOM   9882  C  C   . PHE D 1 79  ? 150.216 171.542 141.230 1.00 122.13 ? 79  PHE E C   1 
ATOM   9883  O  O   . PHE D 1 79  ? 149.406 171.074 140.430 1.00 121.60 ? 79  PHE E O   1 
ATOM   9884  C  CB  . PHE D 1 79  ? 149.732 172.348 143.558 1.00 123.77 ? 79  PHE E CB  1 
ATOM   9885  C  CG  . PHE D 1 79  ? 148.630 173.182 142.943 1.00 124.70 ? 79  PHE E CG  1 
ATOM   9886  C  CD1 . PHE D 1 79  ? 147.336 172.684 142.831 1.00 128.26 ? 79  PHE E CD1 1 
ATOM   9887  C  CD2 . PHE D 1 79  ? 148.894 174.451 142.445 1.00 125.97 ? 79  PHE E CD2 1 
ATOM   9888  C  CE1 . PHE D 1 79  ? 146.328 173.443 142.238 1.00 129.19 ? 79  PHE E CE1 1 
ATOM   9889  C  CE2 . PHE D 1 79  ? 147.883 175.211 141.855 1.00 128.73 ? 79  PHE E CE2 1 
ATOM   9890  C  CZ  . PHE D 1 79  ? 146.606 174.704 141.761 1.00 127.54 ? 79  PHE E CZ  1 
ATOM   9891  N  N   . TRP D 1 80  ? 151.168 172.443 140.895 1.00 116.97 ? 80  TRP E N   1 
ATOM   9892  C  CA  . TRP D 1 80  ? 151.365 172.991 139.550 1.00 114.37 ? 80  TRP E CA  1 
ATOM   9893  C  C   . TRP D 1 80  ? 151.746 171.929 138.519 1.00 117.92 ? 80  TRP E C   1 
ATOM   9894  O  O   . TRP D 1 80  ? 151.261 172.004 137.390 1.00 116.23 ? 80  TRP E O   1 
ATOM   9895  C  CB  . TRP D 1 80  ? 152.404 174.106 139.570 1.00 112.55 ? 80  TRP E CB  1 
ATOM   9896  C  CG  . TRP D 1 80  ? 151.950 175.310 140.335 1.00 115.15 ? 80  TRP E CG  1 
ATOM   9897  C  CD1 . TRP D 1 80  ? 152.368 175.703 141.572 1.00 120.11 ? 80  TRP E CD1 1 
ATOM   9898  C  CD2 . TRP D 1 80  ? 150.951 176.256 139.928 1.00 115.34 ? 80  TRP E CD2 1 
ATOM   9899  N  NE1 . TRP D 1 80  ? 151.721 176.858 141.946 1.00 121.25 ? 80  TRP E NE1 1 
ATOM   9900  C  CE2 . TRP D 1 80  ? 150.842 177.219 140.956 1.00 121.58 ? 80  TRP E CE2 1 
ATOM   9901  C  CE3 . TRP D 1 80  ? 150.142 176.394 138.783 1.00 115.31 ? 80  TRP E CE3 1 
ATOM   9902  C  CZ2 . TRP D 1 80  ? 149.960 178.303 140.876 1.00 122.10 ? 80  TRP E CZ2 1 
ATOM   9903  C  CZ3 . TRP D 1 80  ? 149.272 177.471 138.703 1.00 117.86 ? 80  TRP E CZ3 1 
ATOM   9904  C  CH2 . TRP D 1 80  ? 149.186 178.409 139.740 1.00 120.91 ? 80  TRP E CH2 1 
ATOM   9905  N  N   . SER D 1 81  ? 152.590 170.941 138.897 1.00 116.14 ? 81  SER E N   1 
ATOM   9906  C  CA  . SER D 1 81  ? 152.961 169.839 138.000 1.00 115.58 ? 81  SER E CA  1 
ATOM   9907  C  C   . SER D 1 81  ? 151.738 168.940 137.769 1.00 121.39 ? 81  SER E C   1 
ATOM   9908  O  O   . SER D 1 81  ? 151.543 168.445 136.659 1.00 120.64 ? 81  SER E O   1 
ATOM   9909  C  CB  . SER D 1 81  ? 154.136 169.037 138.555 1.00 119.81 ? 81  SER E CB  1 
ATOM   9910  O  OG  . SER D 1 81  ? 153.806 168.359 139.756 1.00 130.13 ? 81  SER E OG  1 
ATOM   9911  N  N   . GLY D 1 82  ? 150.912 168.791 138.809 1.00 119.83 ? 82  GLY E N   1 
ATOM   9912  C  CA  . GLY D 1 82  ? 149.672 168.022 138.777 1.00 120.68 ? 82  GLY E CA  1 
ATOM   9913  C  C   . GLY D 1 82  ? 148.572 168.728 138.007 1.00 122.62 ? 82  GLY E C   1 
ATOM   9914  O  O   . GLY D 1 82  ? 147.812 168.084 137.276 1.00 123.32 ? 82  GLY E O   1 
ATOM   9915  N  N   . LEU D 1 83  ? 148.491 170.064 138.160 1.00 116.42 ? 83  LEU E N   1 
ATOM   9916  C  CA  . LEU D 1 83  ? 147.510 170.909 137.482 1.00 115.13 ? 83  LEU E CA  1 
ATOM   9917  C  C   . LEU D 1 83  ? 147.784 170.935 135.981 1.00 116.72 ? 83  LEU E C   1 
ATOM   9918  O  O   . LEU D 1 83  ? 146.836 170.824 135.203 1.00 116.56 ? 83  LEU E O   1 
ATOM   9919  C  CB  . LEU D 1 83  ? 147.509 172.338 138.073 1.00 115.17 ? 83  LEU E CB  1 
ATOM   9920  C  CG  . LEU D 1 83  ? 146.567 173.379 137.463 1.00 118.88 ? 83  LEU E CG  1 
ATOM   9921  C  CD1 . LEU D 1 83  ? 145.113 172.966 137.587 1.00 120.52 ? 83  LEU E CD1 1 
ATOM   9922  C  CD2 . LEU D 1 83  ? 146.792 174.728 138.092 1.00 120.94 ? 83  LEU E CD2 1 
ATOM   9923  N  N   . TYR D 1 84  ? 149.075 171.051 135.581 1.00 111.50 ? 84  TYR E N   1 
ATOM   9924  C  CA  . TYR D 1 84  ? 149.499 171.065 134.179 1.00 109.86 ? 84  TYR E CA  1 
ATOM   9925  C  C   . TYR D 1 84  ? 149.083 169.761 133.499 1.00 114.26 ? 84  TYR E C   1 
ATOM   9926  O  O   . TYR D 1 84  ? 148.550 169.803 132.392 1.00 114.37 ? 84  TYR E O   1 
ATOM   9927  C  CB  . TYR D 1 84  ? 151.017 171.296 134.053 1.00 110.07 ? 84  TYR E CB  1 
ATOM   9928  C  CG  . TYR D 1 84  ? 151.522 171.354 132.625 1.00 111.26 ? 84  TYR E CG  1 
ATOM   9929  C  CD1 . TYR D 1 84  ? 151.417 172.523 131.872 1.00 112.88 ? 84  TYR E CD1 1 
ATOM   9930  C  CD2 . TYR D 1 84  ? 152.135 170.250 132.036 1.00 112.04 ? 84  TYR E CD2 1 
ATOM   9931  C  CE1 . TYR D 1 84  ? 151.887 172.584 130.559 1.00 113.45 ? 84  TYR E CE1 1 
ATOM   9932  C  CE2 . TYR D 1 84  ? 152.610 170.298 130.723 1.00 112.47 ? 84  TYR E CE2 1 
ATOM   9933  C  CZ  . TYR D 1 84  ? 152.487 171.470 129.989 1.00 121.37 ? 84  TYR E CZ  1 
ATOM   9934  O  OH  . TYR D 1 84  ? 152.963 171.524 128.697 1.00 123.21 ? 84  TYR E OH  1 
ATOM   9935  N  N   . SER D 1 85  ? 149.278 168.618 134.188 1.00 110.99 ? 85  SER E N   1 
ATOM   9936  C  CA  . SER D 1 85  ? 148.921 167.281 133.709 1.00 111.24 ? 85  SER E CA  1 
ATOM   9937  C  C   . SER D 1 85  ? 147.421 167.173 133.461 1.00 114.80 ? 85  SER E C   1 
ATOM   9938  O  O   . SER D 1 85  ? 147.019 166.806 132.355 1.00 114.28 ? 85  SER E O   1 
ATOM   9939  C  CB  . SER D 1 85  ? 149.359 166.216 134.712 1.00 116.45 ? 85  SER E CB  1 
ATOM   9940  O  OG  . SER D 1 85  ? 150.730 166.350 135.048 1.00 126.24 ? 85  SER E OG  1 
ATOM   9941  N  N   . GLU D 1 86  ? 146.600 167.533 134.474 1.00 111.67 ? 86  GLU E N   1 
ATOM   9942  C  CA  . GLU D 1 86  ? 145.143 167.480 134.394 1.00 112.97 ? 86  GLU E CA  1 
ATOM   9943  C  C   . GLU D 1 86  ? 144.620 168.418 133.296 1.00 115.46 ? 86  GLU E C   1 
ATOM   9944  O  O   . GLU D 1 86  ? 143.684 168.043 132.588 1.00 116.90 ? 86  GLU E O   1 
ATOM   9945  C  CB  . GLU D 1 86  ? 144.503 167.797 135.753 1.00 116.08 ? 86  GLU E CB  1 
ATOM   9946  C  CG  . GLU D 1 86  ? 143.020 167.443 135.852 1.00 131.99 ? 86  GLU E CG  1 
ATOM   9947  C  CD  . GLU D 1 86  ? 142.600 165.996 135.634 1.00 159.48 ? 86  GLU E CD  1 
ATOM   9948  O  OE1 . GLU D 1 86  ? 143.138 165.100 136.325 1.00 162.51 ? 86  GLU E OE1 1 
ATOM   9949  O  OE2 . GLU D 1 86  ? 141.683 165.768 134.812 1.00 152.55 ? 86  GLU E OE2 1 
ATOM   9950  N  N   . THR D 1 87  ? 145.252 169.598 133.117 1.00 108.91 ? 87  THR E N   1 
ATOM   9951  C  CA  . THR D 1 87  ? 144.861 170.545 132.068 1.00 107.46 ? 87  THR E CA  1 
ATOM   9952  C  C   . THR D 1 87  ? 145.228 169.949 130.712 1.00 111.26 ? 87  THR E C   1 
ATOM   9953  O  O   . THR D 1 87  ? 144.388 169.948 129.816 1.00 111.87 ? 87  THR E O   1 
ATOM   9954  C  CB  . THR D 1 87  ? 145.491 171.928 132.296 1.00 105.92 ? 87  THR E CB  1 
ATOM   9955  O  OG1 . THR D 1 87  ? 145.175 172.367 133.615 1.00 107.01 ? 87  THR E OG1 1 
ATOM   9956  C  CG2 . THR D 1 87  ? 145.017 172.965 131.295 1.00 100.47 ? 87  THR E CG2 1 
ATOM   9957  N  N   . GLU D 1 88  ? 146.452 169.393 130.585 1.00 107.29 ? 88  GLU E N   1 
ATOM   9958  C  CA  . GLU D 1 88  ? 146.941 168.784 129.348 1.00 107.15 ? 88  GLU E CA  1 
ATOM   9959  C  C   . GLU D 1 88  ? 146.053 167.648 128.873 1.00 113.14 ? 88  GLU E C   1 
ATOM   9960  O  O   . GLU D 1 88  ? 145.687 167.625 127.698 1.00 113.81 ? 88  GLU E O   1 
ATOM   9961  C  CB  . GLU D 1 88  ? 148.379 168.279 129.491 1.00 107.55 ? 88  GLU E CB  1 
ATOM   9962  C  CG  . GLU D 1 88  ? 149.418 169.286 129.031 1.00 119.77 ? 88  GLU E CG  1 
ATOM   9963  C  CD  . GLU D 1 88  ? 149.518 169.598 127.548 1.00 149.64 ? 88  GLU E CD  1 
ATOM   9964  O  OE1 . GLU D 1 88  ? 148.719 169.067 126.742 1.00 140.03 ? 88  GLU E OE1 1 
ATOM   9965  O  OE2 . GLU D 1 88  ? 150.420 170.389 127.193 1.00 153.85 ? 88  GLU E OE2 1 
ATOM   9966  N  N   . GLY D 1 89  ? 145.705 166.740 129.785 1.00 110.43 ? 89  GLY E N   1 
ATOM   9967  C  CA  . GLY D 1 89  ? 144.840 165.604 129.492 1.00 112.58 ? 89  GLY E CA  1 
ATOM   9968  C  C   . GLY D 1 89  ? 143.503 166.051 128.941 1.00 117.62 ? 89  GLY E C   1 
ATOM   9969  O  O   . GLY D 1 89  ? 143.093 165.607 127.864 1.00 118.62 ? 89  GLY E O   1 
ATOM   9970  N  N   . THR D 1 90  ? 142.863 167.000 129.649 1.00 113.72 ? 90  THR E N   1 
ATOM   9971  C  CA  . THR D 1 90  ? 141.578 167.588 129.289 1.00 115.31 ? 90  THR E CA  1 
ATOM   9972  C  C   . THR D 1 90  ? 141.679 168.271 127.915 1.00 119.59 ? 90  THR E C   1 
ATOM   9973  O  O   . THR D 1 90  ? 140.847 167.981 127.056 1.00 121.79 ? 90  THR E O   1 
ATOM   9974  C  CB  . THR D 1 90  ? 141.115 168.547 130.397 1.00 120.69 ? 90  THR E CB  1 
ATOM   9975  O  OG1 . THR D 1 90  ? 141.021 167.820 131.620 1.00 118.88 ? 90  THR E OG1 1 
ATOM   9976  C  CG2 . THR D 1 90  ? 139.774 169.191 130.100 1.00 122.16 ? 90  THR E CG2 1 
ATOM   9977  N  N   . LEU D 1 91  ? 142.713 169.121 127.692 1.00 113.66 ? 91  LEU E N   1 
ATOM   9978  C  CA  . LEU D 1 91  ? 142.909 169.850 126.430 1.00 112.95 ? 91  LEU E CA  1 
ATOM   9979  C  C   . LEU D 1 91  ? 143.153 168.929 125.233 1.00 116.98 ? 91  LEU E C   1 
ATOM   9980  O  O   . LEU D 1 91  ? 142.583 169.183 124.177 1.00 117.26 ? 91  LEU E O   1 
ATOM   9981  C  CB  . LEU D 1 91  ? 144.043 170.879 126.517 1.00 110.80 ? 91  LEU E CB  1 
ATOM   9982  C  CG  . LEU D 1 91  ? 143.826 172.100 127.421 1.00 116.30 ? 91  LEU E CG  1 
ATOM   9983  C  CD1 . LEU D 1 91  ? 145.075 172.921 127.498 1.00 114.79 ? 91  LEU E CD1 1 
ATOM   9984  C  CD2 . LEU D 1 91  ? 142.669 172.979 126.951 1.00 120.87 ? 91  LEU E CD2 1 
ATOM   9985  N  N   . ILE D 1 92  ? 143.976 167.869 125.390 1.00 113.67 ? 92  ILE E N   1 
ATOM   9986  C  CA  . ILE D 1 92  ? 144.270 166.909 124.316 1.00 114.68 ? 92  ILE E CA  1 
ATOM   9987  C  C   . ILE D 1 92  ? 142.963 166.214 123.888 1.00 123.65 ? 92  ILE E C   1 
ATOM   9988  O  O   . ILE D 1 92  ? 142.697 166.127 122.686 1.00 125.60 ? 92  ILE E O   1 
ATOM   9989  C  CB  . ILE D 1 92  ? 145.385 165.900 124.727 1.00 116.57 ? 92  ILE E CB  1 
ATOM   9990  C  CG1 . ILE D 1 92  ? 146.761 166.583 124.677 1.00 114.14 ? 92  ILE E CG1 1 
ATOM   9991  C  CG2 . ILE D 1 92  ? 145.388 164.644 123.842 1.00 119.05 ? 92  ILE E CG2 1 
ATOM   9992  C  CD1 . ILE D 1 92  ? 147.792 166.016 125.618 1.00 122.52 ? 92  ILE E CD1 1 
ATOM   9993  N  N   . LEU D 1 93  ? 142.136 165.779 124.867 1.00 121.66 ? 93  LEU E N   1 
ATOM   9994  C  CA  . LEU D 1 93  ? 140.853 165.113 124.627 1.00 125.29 ? 93  LEU E CA  1 
ATOM   9995  C  C   . LEU D 1 93  ? 139.845 166.036 123.925 1.00 130.57 ? 93  LEU E C   1 
ATOM   9996  O  O   . LEU D 1 93  ? 139.229 165.608 122.946 1.00 132.78 ? 93  LEU E O   1 
ATOM   9997  C  CB  . LEU D 1 93  ? 140.248 164.589 125.943 1.00 126.98 ? 93  LEU E CB  1 
ATOM   9998  C  CG  . LEU D 1 93  ? 140.957 163.416 126.625 1.00 131.91 ? 93  LEU E CG  1 
ATOM   9999  C  CD1 . LEU D 1 93  ? 140.475 163.248 128.051 1.00 133.12 ? 93  LEU E CD1 1 
ATOM   10000 C  CD2 . LEU D 1 93  ? 140.763 162.120 125.860 1.00 137.58 ? 93  LEU E CD2 1 
ATOM   10001 N  N   . LEU D 1 94  ? 139.686 167.290 124.420 1.00 125.68 ? 94  LEU E N   1 
ATOM   10002 C  CA  . LEU D 1 94  ? 138.768 168.300 123.873 1.00 126.96 ? 94  LEU E CA  1 
ATOM   10003 C  C   . LEU D 1 94  ? 139.198 168.772 122.486 1.00 133.62 ? 94  LEU E C   1 
ATOM   10004 O  O   . LEU D 1 94  ? 138.349 168.929 121.607 1.00 136.03 ? 94  LEU E O   1 
ATOM   10005 C  CB  . LEU D 1 94  ? 138.647 169.527 124.797 1.00 125.11 ? 94  LEU E CB  1 
ATOM   10006 C  CG  . LEU D 1 94  ? 138.055 169.351 126.184 1.00 129.91 ? 94  LEU E CG  1 
ATOM   10007 C  CD1 . LEU D 1 94  ? 138.216 170.619 126.978 1.00 128.09 ? 94  LEU E CD1 1 
ATOM   10008 C  CD2 . LEU D 1 94  ? 136.593 168.951 126.125 1.00 136.72 ? 94  LEU E CD2 1 
ATOM   10009 N  N   . PHE D 1 95  ? 140.511 169.020 122.298 1.00 129.55 ? 95  PHE E N   1 
ATOM   10010 C  CA  . PHE D 1 95  ? 141.091 169.472 121.034 1.00 130.01 ? 95  PHE E CA  1 
ATOM   10011 C  C   . PHE D 1 95  ? 141.072 168.340 119.984 1.00 136.95 ? 95  PHE E C   1 
ATOM   10012 O  O   . PHE D 1 95  ? 141.110 168.620 118.784 1.00 138.06 ? 95  PHE E O   1 
ATOM   10013 C  CB  . PHE D 1 95  ? 142.525 169.965 121.273 1.00 129.04 ? 95  PHE E CB  1 
ATOM   10014 C  CG  . PHE D 1 95  ? 143.115 170.886 120.230 1.00 130.72 ? 95  PHE E CG  1 
ATOM   10015 C  CD1 . PHE D 1 95  ? 142.988 172.265 120.345 1.00 133.85 ? 95  PHE E CD1 1 
ATOM   10016 C  CD2 . PHE D 1 95  ? 143.872 170.377 119.177 1.00 133.22 ? 95  PHE E CD2 1 
ATOM   10017 C  CE1 . PHE D 1 95  ? 143.576 173.118 119.402 1.00 134.49 ? 95  PHE E CE1 1 
ATOM   10018 C  CE2 . PHE D 1 95  ? 144.454 171.230 118.230 1.00 135.39 ? 95  PHE E CE2 1 
ATOM   10019 C  CZ  . PHE D 1 95  ? 144.307 172.593 118.352 1.00 133.16 ? 95  PHE E CZ  1 
ATOM   10020 N  N   . GLY D 1 96  ? 140.991 167.089 120.449 1.00 134.21 ? 96  GLY E N   1 
ATOM   10021 C  CA  . GLY D 1 96  ? 140.974 165.902 119.603 1.00 136.08 ? 96  GLY E CA  1 
ATOM   10022 C  C   . GLY D 1 96  ? 142.354 165.543 119.094 1.00 137.46 ? 96  GLY E C   1 
ATOM   10023 O  O   . GLY D 1 96  ? 142.547 165.345 117.892 1.00 138.51 ? 96  GLY E O   1 
ATOM   10024 N  N   . GLY D 1 97  ? 143.307 165.468 120.018 1.00 130.77 ? 97  GLY E N   1 
ATOM   10025 C  CA  . GLY D 1 97  ? 144.699 165.153 119.730 1.00 128.65 ? 97  GLY E CA  1 
ATOM   10026 C  C   . GLY D 1 97  ? 144.929 163.723 119.288 1.00 134.29 ? 97  GLY E C   1 
ATOM   10027 O  O   . GLY D 1 97  ? 145.509 163.500 118.222 1.00 134.45 ? 97  GLY E O   1 
ATOM   10028 N  N   . ILE D 1 98  ? 144.462 162.751 120.107 1.00 132.24 ? 98  ILE E N   1 
ATOM   10029 C  CA  . ILE D 1 98  ? 144.591 161.299 119.892 1.00 135.18 ? 98  ILE E CA  1 
ATOM   10030 C  C   . ILE D 1 98  ? 144.075 160.855 118.480 1.00 143.69 ? 98  ILE E C   1 
ATOM   10031 O  O   . ILE D 1 98  ? 144.842 160.166 117.797 1.00 144.55 ? 98  ILE E O   1 
ATOM   10032 C  CB  . ILE D 1 98  ? 143.913 160.480 121.029 1.00 140.01 ? 98  ILE E CB  1 
ATOM   10033 C  CG1 . ILE D 1 98  ? 144.368 160.968 122.424 1.00 137.30 ? 98  ILE E CG1 1 
ATOM   10034 C  CG2 . ILE D 1 98  ? 144.156 158.965 120.853 1.00 143.81 ? 98  ILE E CG2 1 
ATOM   10035 C  CD1 . ILE D 1 98  ? 143.368 160.723 123.557 1.00 145.94 ? 98  ILE E CD1 1 
ATOM   10036 N  N   . PRO D 1 99  ? 142.842 161.212 118.002 1.00 142.58 ? 99  PRO E N   1 
ATOM   10037 C  CA  . PRO D 1 99  ? 142.427 160.766 116.655 1.00 146.01 ? 99  PRO E CA  1 
ATOM   10038 C  C   . PRO D 1 99  ? 143.267 161.368 115.529 1.00 148.93 ? 99  PRO E C   1 
ATOM   10039 O  O   . PRO D 1 99  ? 143.540 160.676 114.549 1.00 151.17 ? 99  PRO E O   1 
ATOM   10040 C  CB  . PRO D 1 99  ? 140.970 161.232 116.552 1.00 149.93 ? 99  PRO E CB  1 
ATOM   10041 C  CG  . PRO D 1 99  ? 140.548 161.532 117.942 1.00 152.69 ? 99  PRO E CG  1 
ATOM   10042 C  CD  . PRO D 1 99  ? 141.772 162.010 118.635 1.00 143.79 ? 99  PRO E CD  1 
ATOM   10043 N  N   . TYR D 1 100 ? 143.688 162.641 115.679 1.00 141.95 ? 100 TYR E N   1 
ATOM   10044 C  CA  . TYR D 1 100 ? 144.501 163.352 114.697 1.00 140.51 ? 100 TYR E CA  1 
ATOM   10045 C  C   . TYR D 1 100 ? 145.920 162.794 114.682 1.00 142.22 ? 100 TYR E C   1 
ATOM   10046 O  O   . TYR D 1 100 ? 146.508 162.695 113.606 1.00 143.40 ? 100 TYR E O   1 
ATOM   10047 C  CB  . TYR D 1 100 ? 144.491 164.861 114.978 1.00 139.21 ? 100 TYR E CB  1 
ATOM   10048 C  CG  . TYR D 1 100 ? 145.399 165.688 114.092 1.00 140.50 ? 100 TYR E CG  1 
ATOM   10049 C  CD1 . TYR D 1 100 ? 145.164 165.798 112.724 1.00 145.30 ? 100 TYR E CD1 1 
ATOM   10050 C  CD2 . TYR D 1 100 ? 146.454 166.415 114.631 1.00 137.89 ? 100 TYR E CD2 1 
ATOM   10051 C  CE1 . TYR D 1 100 ? 145.982 166.582 111.910 1.00 145.33 ? 100 TYR E CE1 1 
ATOM   10052 C  CE2 . TYR D 1 100 ? 147.270 167.211 113.832 1.00 138.01 ? 100 TYR E CE2 1 
ATOM   10053 C  CZ  . TYR D 1 100 ? 147.036 167.284 112.470 1.00 149.17 ? 100 TYR E CZ  1 
ATOM   10054 O  OH  . TYR D 1 100 ? 147.843 168.073 111.689 1.00 151.60 ? 100 TYR E OH  1 
ATOM   10055 N  N   . LEU D 1 101 ? 146.457 162.396 115.859 1.00 135.99 ? 101 LEU E N   1 
ATOM   10056 C  CA  . LEU D 1 101 ? 147.788 161.789 115.961 1.00 134.92 ? 101 LEU E CA  1 
ATOM   10057 C  C   . LEU D 1 101 ? 147.760 160.415 115.295 1.00 144.07 ? 101 LEU E C   1 
ATOM   10058 O  O   . LEU D 1 101 ? 148.746 160.024 114.665 1.00 144.69 ? 101 LEU E O   1 
ATOM   10059 C  CB  . LEU D 1 101 ? 148.261 161.697 117.430 1.00 132.21 ? 101 LEU E CB  1 
ATOM   10060 C  CG  . LEU D 1 101 ? 149.644 161.072 117.721 1.00 135.67 ? 101 LEU E CG  1 
ATOM   10061 C  CD1 . LEU D 1 101 ? 150.773 161.829 117.040 1.00 133.70 ? 101 LEU E CD1 1 
ATOM   10062 C  CD2 . LEU D 1 101 ? 149.903 161.006 119.209 1.00 136.12 ? 101 LEU E CD2 1 
ATOM   10063 N  N   . TRP D 1 102 ? 146.607 159.713 115.393 1.00 144.27 ? 102 TRP E N   1 
ATOM   10064 C  CA  . TRP D 1 102 ? 146.381 158.408 114.772 1.00 149.16 ? 102 TRP E CA  1 
ATOM   10065 C  C   . TRP D 1 102 ? 146.424 158.533 113.247 1.00 156.07 ? 102 TRP E C   1 
ATOM   10066 O  O   . TRP D 1 102 ? 146.991 157.665 112.583 1.00 158.32 ? 102 TRP E O   1 
ATOM   10067 C  CB  . TRP D 1 102 ? 145.045 157.799 115.228 1.00 151.13 ? 102 TRP E CB  1 
ATOM   10068 C  CG  . TRP D 1 102 ? 144.832 156.408 114.713 1.00 157.36 ? 102 TRP E CG  1 
ATOM   10069 C  CD1 . TRP D 1 102 ? 144.112 156.042 113.616 1.00 164.78 ? 102 TRP E CD1 1 
ATOM   10070 C  CD2 . TRP D 1 102 ? 145.425 155.209 115.225 1.00 158.82 ? 102 TRP E CD2 1 
ATOM   10071 N  NE1 . TRP D 1 102 ? 144.194 154.683 113.429 1.00 168.75 ? 102 TRP E NE1 1 
ATOM   10072 C  CE2 . TRP D 1 102 ? 144.993 154.145 114.404 1.00 168.51 ? 102 TRP E CE2 1 
ATOM   10073 C  CE3 . TRP D 1 102 ? 146.261 154.923 116.318 1.00 157.72 ? 102 TRP E CE3 1 
ATOM   10074 C  CZ2 . TRP D 1 102 ? 145.383 152.821 114.630 1.00 171.22 ? 102 TRP E CZ2 1 
ATOM   10075 C  CZ3 . TRP D 1 102 ? 146.625 153.607 116.555 1.00 162.42 ? 102 TRP E CZ3 1 
ATOM   10076 C  CH2 . TRP D 1 102 ? 146.186 152.574 115.719 1.00 168.72 ? 102 TRP E CH2 1 
ATOM   10077 N  N   . ARG D 1 103 ? 145.847 159.621 112.703 1.00 152.62 ? 103 ARG E N   1 
ATOM   10078 C  CA  . ARG D 1 103 ? 145.817 159.910 111.267 1.00 155.16 ? 103 ARG E CA  1 
ATOM   10079 C  C   . ARG D 1 103 ? 147.233 160.170 110.739 1.00 157.48 ? 103 ARG E C   1 
ATOM   10080 O  O   . ARG D 1 103 ? 147.589 159.653 109.675 1.00 160.07 ? 103 ARG E O   1 
ATOM   10081 C  CB  . ARG D 1 103 ? 144.906 161.118 110.965 1.00 156.52 ? 103 ARG E CB  1 
ATOM   10082 C  CG  . ARG D 1 103 ? 143.425 160.861 111.207 1.00 175.57 ? 103 ARG E CG  1 
ATOM   10083 C  CD  . ARG D 1 103 ? 142.654 162.147 111.428 1.00 190.10 ? 103 ARG E CD  1 
ATOM   10084 N  NE  . ARG D 1 103 ? 141.312 161.867 111.935 1.00 205.72 ? 103 ARG E NE  1 
ATOM   10085 C  CZ  . ARG D 1 103 ? 140.403 162.794 112.214 1.00 220.03 ? 103 ARG E CZ  1 
ATOM   10086 N  NH1 . ARG D 1 103 ? 140.687 164.081 112.048 1.00 202.94 ? 103 ARG E NH1 1 
ATOM   10087 N  NH2 . ARG D 1 103 ? 139.206 162.446 112.664 1.00 209.90 ? 103 ARG E NH2 1 
ATOM   10088 N  N   . LEU D 1 104 ? 148.044 160.946 111.504 1.00 149.86 ? 104 LEU E N   1 
ATOM   10089 C  CA  . LEU D 1 104 ? 149.424 161.324 111.161 1.00 147.94 ? 104 LEU E CA  1 
ATOM   10090 C  C   . LEU D 1 104 ? 150.398 160.147 111.242 1.00 154.84 ? 104 LEU E C   1 
ATOM   10091 O  O   . LEU D 1 104 ? 151.448 160.182 110.590 1.00 154.84 ? 104 LEU E O   1 
ATOM   10092 C  CB  . LEU D 1 104 ? 149.932 162.468 112.053 1.00 143.02 ? 104 LEU E CB  1 
ATOM   10093 C  CG  . LEU D 1 104 ? 149.231 163.819 111.926 1.00 145.97 ? 104 LEU E CG  1 
ATOM   10094 C  CD1 . LEU D 1 104 ? 149.777 164.790 112.936 1.00 142.19 ? 104 LEU E CD1 1 
ATOM   10095 C  CD2 . LEU D 1 104 ? 149.359 164.393 110.529 1.00 149.36 ? 104 LEU E CD2 1 
ATOM   10096 N  N   . SER D 1 105 ? 150.055 159.107 112.028 1.00 153.49 ? 105 SER E N   1 
ATOM   10097 C  CA  . SER D 1 105 ? 150.879 157.904 112.165 1.00 155.45 ? 105 SER E CA  1 
ATOM   10098 C  C   . SER D 1 105 ? 150.441 156.820 111.138 1.00 166.23 ? 105 SER E C   1 
ATOM   10099 O  O   . SER D 1 105 ? 150.649 155.623 111.353 1.00 169.04 ? 105 SER E O   1 
ATOM   10100 C  CB  . SER D 1 105 ? 150.847 157.380 113.601 1.00 156.74 ? 105 SER E CB  1 
ATOM   10101 O  OG  . SER D 1 105 ? 149.565 157.475 114.196 1.00 163.66 ? 105 SER E OG  1 
ATOM   10102 N  N   . GLY D 1 106 ? 149.884 157.274 110.013 1.00 164.84 ? 106 GLY E N   1 
ATOM   10103 C  CA  . GLY D 1 106 ? 149.439 156.426 108.913 1.00 170.20 ? 106 GLY E CA  1 
ATOM   10104 C  C   . GLY D 1 106 ? 150.401 156.439 107.739 1.00 175.82 ? 106 GLY E C   1 
ATOM   10105 O  O   . GLY D 1 106 ? 151.622 156.441 107.934 1.00 173.64 ? 106 GLY E O   1 
ATOM   10106 N  N   . ARG D 1 107 ? 149.841 156.460 106.504 1.00 175.99 ? 107 ARG E N   1 
ATOM   10107 C  CA  . ARG D 1 107 ? 150.534 156.463 105.203 1.00 202.54 ? 107 ARG E CA  1 
ATOM   10108 C  C   . ARG D 1 107 ? 151.509 155.290 105.073 1.00 232.10 ? 107 ARG E C   1 
ATOM   10109 O  O   . ARG D 1 107 ? 151.225 154.328 104.362 1.00 200.38 ? 107 ARG E O   1 
ATOM   10110 C  CB  . ARG D 1 107 ? 151.266 157.791 104.949 1.00 198.73 ? 107 ARG E CB  1 
ATOM   10111 N  N   . PRO D 1 116 ? 145.941 143.071 108.846 1.00 210.77 ? 116 PRO E N   1 
ATOM   10112 C  CA  . PRO D 1 116 ? 146.179 143.249 110.285 1.00 208.37 ? 116 PRO E CA  1 
ATOM   10113 C  C   . PRO D 1 116 ? 147.556 143.846 110.583 1.00 208.05 ? 116 PRO E C   1 
ATOM   10114 O  O   . PRO D 1 116 ? 147.694 144.578 111.563 1.00 201.46 ? 116 PRO E O   1 
ATOM   10115 C  CB  . PRO D 1 116 ? 146.046 141.834 110.852 1.00 211.70 ? 116 PRO E CB  1 
ATOM   10116 C  CG  . PRO D 1 116 ? 146.332 140.932 109.709 1.00 217.71 ? 116 PRO E CG  1 
ATOM   10117 C  CD  . PRO D 1 116 ? 145.921 141.649 108.457 1.00 215.21 ? 116 PRO E CD  1 
ATOM   10118 N  N   . GLU D 1 117 ? 148.564 143.538 109.737 1.00 207.13 ? 117 GLU E N   1 
ATOM   10119 C  CA  . GLU D 1 117 ? 149.947 144.013 109.862 1.00 202.36 ? 117 GLU E CA  1 
ATOM   10120 C  C   . GLU D 1 117 ? 150.028 145.543 109.767 1.00 197.99 ? 117 GLU E C   1 
ATOM   10121 O  O   . GLU D 1 117 ? 150.795 146.152 110.514 1.00 191.94 ? 117 GLU E O   1 
ATOM   10122 C  CB  . GLU D 1 117 ? 150.835 143.368 108.782 1.00 208.70 ? 117 GLU E CB  1 
ATOM   10123 C  CG  . GLU D 1 117 ? 152.325 143.463 109.073 1.00 216.68 ? 117 GLU E CG  1 
ATOM   10124 C  CD  . GLU D 1 117 ? 153.225 143.430 107.853 1.00 235.09 ? 117 GLU E CD  1 
ATOM   10125 O  OE1 . GLU D 1 117 ? 153.195 142.417 107.117 1.00 236.22 ? 117 GLU E OE1 1 
ATOM   10126 O  OE2 . GLU D 1 117 ? 153.981 144.408 107.649 1.00 229.86 ? 117 GLU E OE2 1 
ATOM   10127 N  N   . TYR D 1 118 ? 149.231 146.149 108.860 1.00 194.36 ? 118 TYR E N   1 
ATOM   10128 C  CA  . TYR D 1 118 ? 149.172 147.595 108.625 1.00 188.02 ? 118 TYR E CA  1 
ATOM   10129 C  C   . TYR D 1 118 ? 148.626 148.354 109.845 1.00 185.17 ? 118 TYR E C   1 
ATOM   10130 O  O   . TYR D 1 118 ? 149.125 149.440 110.145 1.00 178.44 ? 118 TYR E O   1 
ATOM   10131 C  CB  . TYR D 1 118 ? 148.320 147.903 107.387 1.00 192.45 ? 118 TYR E CB  1 
ATOM   10132 N  N   . GLU D 1 119 ? 147.617 147.785 110.543 1.00 183.48 ? 119 GLU E N   1 
ATOM   10133 C  CA  . GLU D 1 119 ? 147.013 148.392 111.733 1.00 178.73 ? 119 GLU E CA  1 
ATOM   10134 C  C   . GLU D 1 119 ? 147.968 148.308 112.928 1.00 178.21 ? 119 GLU E C   1 
ATOM   10135 O  O   . GLU D 1 119 ? 148.047 149.267 113.698 1.00 172.34 ? 119 GLU E O   1 
ATOM   10136 C  CB  . GLU D 1 119 ? 145.666 147.734 112.072 1.00 184.55 ? 119 GLU E CB  1 
ATOM   10137 C  CG  . GLU D 1 119 ? 144.705 148.659 112.805 1.00 191.05 ? 119 GLU E CG  1 
ATOM   10138 C  CD  . GLU D 1 119 ? 144.197 148.154 114.142 1.00 210.79 ? 119 GLU E CD  1 
ATOM   10139 O  OE1 . GLU D 1 119 ? 143.456 147.145 114.156 1.00 212.07 ? 119 GLU E OE1 1 
ATOM   10140 O  OE2 . GLU D 1 119 ? 144.493 148.804 115.171 1.00 196.60 ? 119 GLU E OE2 1 
ATOM   10141 N  N   . ILE D 1 120 ? 148.689 147.176 113.080 1.00 177.40 ? 120 ILE E N   1 
ATOM   10142 C  CA  . ILE D 1 120 ? 149.644 146.960 114.176 1.00 174.21 ? 120 ILE E CA  1 
ATOM   10143 C  C   . ILE D 1 120 ? 150.868 147.897 113.982 1.00 171.51 ? 120 ILE E C   1 
ATOM   10144 O  O   . ILE D 1 120 ? 151.345 148.474 114.963 1.00 165.85 ? 120 ILE E O   1 
ATOM   10145 C  CB  . ILE D 1 120 ? 150.028 145.450 114.322 1.00 183.26 ? 120 ILE E CB  1 
ATOM   10146 C  CG1 . ILE D 1 120 ? 148.785 144.606 114.716 1.00 188.48 ? 120 ILE E CG1 1 
ATOM   10147 C  CG2 . ILE D 1 120 ? 151.159 145.239 115.352 1.00 181.83 ? 120 ILE E CG2 1 
ATOM   10148 C  CD1 . ILE D 1 120 ? 148.874 143.090 114.434 1.00 203.61 ? 120 ILE E CD1 1 
ATOM   10149 N  N   . THR D 1 121 ? 151.326 148.087 112.724 1.00 168.83 ? 121 THR E N   1 
ATOM   10150 C  CA  . THR D 1 121 ? 152.449 148.977 112.396 1.00 164.46 ? 121 THR E CA  1 
ATOM   10151 C  C   . THR D 1 121 ? 152.057 150.435 112.717 1.00 162.37 ? 121 THR E C   1 
ATOM   10152 O  O   . THR D 1 121 ? 152.869 151.157 113.301 1.00 157.52 ? 121 THR E O   1 
ATOM   10153 C  CB  . THR D 1 121 ? 152.892 148.786 110.934 1.00 176.32 ? 121 THR E CB  1 
ATOM   10154 O  OG1 . THR D 1 121 ? 153.128 147.397 110.698 1.00 182.23 ? 121 THR E OG1 1 
ATOM   10155 C  CG2 . THR D 1 121 ? 154.152 149.575 110.587 1.00 171.56 ? 121 THR E CG2 1 
ATOM   10156 N  N   . GLN D 1 122 ? 150.806 150.845 112.371 1.00 159.06 ? 122 GLN E N   1 
ATOM   10157 C  CA  . GLN D 1 122 ? 150.242 152.175 112.659 1.00 153.63 ? 122 GLN E CA  1 
ATOM   10158 C  C   . GLN D 1 122 ? 150.148 152.357 114.176 1.00 153.63 ? 122 GLN E C   1 
ATOM   10159 O  O   . GLN D 1 122 ? 150.518 153.414 114.679 1.00 148.22 ? 122 GLN E O   1 
ATOM   10160 C  CB  . GLN D 1 122 ? 148.865 152.357 111.983 1.00 157.24 ? 122 GLN E CB  1 
ATOM   10161 C  CG  . GLN D 1 122 ? 148.158 153.683 112.299 1.00 160.72 ? 122 GLN E CG  1 
ATOM   10162 C  CD  . GLN D 1 122 ? 146.956 153.973 111.428 1.00 181.61 ? 122 GLN E CD  1 
ATOM   10163 O  OE1 . GLN D 1 122 ? 146.314 153.080 110.864 1.00 182.72 ? 122 GLN E OE1 1 
ATOM   10164 N  NE2 . GLN D 1 122 ? 146.604 155.241 111.323 1.00 170.99 ? 122 GLN E NE2 1 
ATOM   10165 N  N   . SER D 1 123 ? 149.709 151.303 114.899 1.00 153.04 ? 123 SER E N   1 
ATOM   10166 C  CA  . SER D 1 123 ? 149.615 151.282 116.358 1.00 150.55 ? 123 SER E CA  1 
ATOM   10167 C  C   . SER D 1 123 ? 151.002 151.415 116.993 1.00 152.17 ? 123 SER E C   1 
ATOM   10168 O  O   . SER D 1 123 ? 151.130 152.059 118.033 1.00 148.02 ? 123 SER E O   1 
ATOM   10169 C  CB  . SER D 1 123 ? 148.951 149.996 116.837 1.00 158.34 ? 123 SER E CB  1 
ATOM   10170 O  OG  . SER D 1 123 ? 147.663 149.802 116.277 1.00 169.14 ? 123 SER E OG  1 
ATOM   10171 N  N   . LEU D 1 124 ? 152.038 150.821 116.354 1.00 151.21 ? 124 LEU E N   1 
ATOM   10172 C  CA  . LEU D 1 124 ? 153.422 150.858 116.820 1.00 149.15 ? 124 LEU E CA  1 
ATOM   10173 C  C   . LEU D 1 124 ? 154.048 152.246 116.630 1.00 147.57 ? 124 LEU E C   1 
ATOM   10174 O  O   . LEU D 1 124 ? 154.636 152.770 117.575 1.00 143.73 ? 124 LEU E O   1 
ATOM   10175 C  CB  . LEU D 1 124 ? 154.253 149.784 116.096 1.00 153.96 ? 124 LEU E CB  1 
ATOM   10176 C  CG  . LEU D 1 124 ? 155.225 148.959 116.950 1.00 160.54 ? 124 LEU E CG  1 
ATOM   10177 C  CD1 . LEU D 1 124 ? 154.494 148.140 118.011 1.00 163.09 ? 124 LEU E CD1 1 
ATOM   10178 C  CD2 . LEU D 1 124 ? 156.056 148.035 116.081 1.00 168.39 ? 124 LEU E CD2 1 
ATOM   10179 N  N   . VAL D 1 125 ? 153.910 152.843 115.432 1.00 143.62 ? 125 VAL E N   1 
ATOM   10180 C  CA  . VAL D 1 125 ? 154.478 154.156 115.132 1.00 139.05 ? 125 VAL E CA  1 
ATOM   10181 C  C   . VAL D 1 125 ? 153.694 155.273 115.885 1.00 138.16 ? 125 VAL E C   1 
ATOM   10182 O  O   . VAL D 1 125 ? 154.298 156.290 116.218 1.00 133.89 ? 125 VAL E O   1 
ATOM   10183 C  CB  . VAL D 1 125 ? 154.608 154.396 113.604 1.00 145.01 ? 125 VAL E CB  1 
ATOM   10184 C  CG1 . VAL D 1 125 ? 153.254 154.526 112.917 1.00 146.59 ? 125 VAL E CG1 1 
ATOM   10185 C  CG2 . VAL D 1 125 ? 155.518 155.579 113.289 1.00 141.57 ? 125 VAL E CG2 1 
ATOM   10186 N  N   . PHE D 1 126 ? 152.394 155.055 116.211 1.00 135.65 ? 126 PHE E N   1 
ATOM   10187 C  CA  . PHE D 1 126 ? 151.583 155.998 117.003 1.00 132.16 ? 126 PHE E CA  1 
ATOM   10188 C  C   . PHE D 1 126 ? 152.080 156.003 118.455 1.00 134.05 ? 126 PHE E C   1 
ATOM   10189 O  O   . PHE D 1 126 ? 152.168 157.068 119.067 1.00 130.66 ? 126 PHE E O   1 
ATOM   10190 C  CB  . PHE D 1 126 ? 150.083 155.641 116.937 1.00 136.41 ? 126 PHE E CB  1 
ATOM   10191 C  CG  . PHE D 1 126 ? 149.187 156.210 118.019 1.00 135.64 ? 126 PHE E CG  1 
ATOM   10192 C  CD1 . PHE D 1 126 ? 148.961 155.509 119.198 1.00 139.38 ? 126 PHE E CD1 1 
ATOM   10193 C  CD2 . PHE D 1 126 ? 148.523 157.417 117.833 1.00 135.43 ? 126 PHE E CD2 1 
ATOM   10194 C  CE1 . PHE D 1 126 ? 148.116 156.022 120.188 1.00 138.77 ? 126 PHE E CE1 1 
ATOM   10195 C  CE2 . PHE D 1 126 ? 147.671 157.927 118.822 1.00 136.68 ? 126 PHE E CE2 1 
ATOM   10196 C  CZ  . PHE D 1 126 ? 147.473 157.225 119.991 1.00 135.53 ? 126 PHE E CZ  1 
ATOM   10197 N  N   . LEU D 1 127 ? 152.385 154.805 118.997 1.00 132.06 ? 127 LEU E N   1 
ATOM   10198 C  CA  . LEU D 1 127 ? 152.887 154.600 120.353 1.00 129.90 ? 127 LEU E CA  1 
ATOM   10199 C  C   . LEU D 1 127 ? 154.256 155.251 120.527 1.00 129.08 ? 127 LEU E C   1 
ATOM   10200 O  O   . LEU D 1 127 ? 154.498 155.867 121.563 1.00 125.61 ? 127 LEU E O   1 
ATOM   10201 C  CB  . LEU D 1 127 ? 152.961 153.098 120.654 1.00 134.32 ? 127 LEU E CB  1 
ATOM   10202 C  CG  . LEU D 1 127 ? 152.513 152.632 122.042 1.00 139.81 ? 127 LEU E CG  1 
ATOM   10203 C  CD1 . LEU D 1 127 ? 151.096 153.106 122.382 1.00 139.55 ? 127 LEU E CD1 1 
ATOM   10204 C  CD2 . LEU D 1 127 ? 152.561 151.128 122.133 1.00 147.15 ? 127 LEU E CD2 1 
ATOM   10205 N  N   . LEU D 1 128 ? 155.126 155.152 119.494 1.00 125.76 ? 128 LEU E N   1 
ATOM   10206 C  CA  . LEU D 1 128 ? 156.471 155.747 119.460 1.00 123.13 ? 128 LEU E CA  1 
ATOM   10207 C  C   . LEU D 1 128 ? 156.396 157.276 119.553 1.00 123.60 ? 128 LEU E C   1 
ATOM   10208 O  O   . LEU D 1 128 ? 157.166 157.876 120.302 1.00 120.71 ? 128 LEU E O   1 
ATOM   10209 C  CB  . LEU D 1 128 ? 157.225 155.344 118.176 1.00 125.21 ? 128 LEU E CB  1 
ATOM   10210 C  CG  . LEU D 1 128 ? 157.805 153.940 118.098 1.00 133.14 ? 128 LEU E CG  1 
ATOM   10211 C  CD1 . LEU D 1 128 ? 157.883 153.476 116.663 1.00 136.46 ? 128 LEU E CD1 1 
ATOM   10212 C  CD2 . LEU D 1 128 ? 159.177 153.867 118.739 1.00 134.08 ? 128 LEU E CD2 1 
ATOM   10213 N  N   . LEU D 1 129 ? 155.470 157.894 118.788 1.00 120.26 ? 129 LEU E N   1 
ATOM   10214 C  CA  . LEU D 1 129 ? 155.240 159.339 118.772 1.00 117.14 ? 129 LEU E CA  1 
ATOM   10215 C  C   . LEU D 1 129 ? 154.619 159.799 120.089 1.00 120.09 ? 129 LEU E C   1 
ATOM   10216 O  O   . LEU D 1 129 ? 155.039 160.825 120.633 1.00 118.37 ? 129 LEU E O   1 
ATOM   10217 C  CB  . LEU D 1 129 ? 154.325 159.740 117.602 1.00 118.03 ? 129 LEU E CB  1 
ATOM   10218 C  CG  . LEU D 1 129 ? 154.925 159.699 116.209 1.00 124.58 ? 129 LEU E CG  1 
ATOM   10219 C  CD1 . LEU D 1 129 ? 153.844 159.548 115.175 1.00 127.36 ? 129 LEU E CD1 1 
ATOM   10220 C  CD2 . LEU D 1 129 ? 155.722 160.948 115.921 1.00 125.17 ? 129 LEU E CD2 1 
ATOM   10221 N  N   . ALA D 1 130 ? 153.620 159.039 120.597 1.00 116.85 ? 130 ALA E N   1 
ATOM   10222 C  CA  . ALA D 1 130 ? 152.922 159.332 121.845 1.00 114.70 ? 130 ALA E CA  1 
ATOM   10223 C  C   . ALA D 1 130 ? 153.901 159.374 123.014 1.00 116.09 ? 130 ALA E C   1 
ATOM   10224 O  O   . ALA D 1 130 ? 153.890 160.350 123.762 1.00 112.75 ? 130 ALA E O   1 
ATOM   10225 C  CB  . ALA D 1 130 ? 151.836 158.300 122.098 1.00 118.40 ? 130 ALA E CB  1 
ATOM   10226 N  N   . THR D 1 131 ? 154.789 158.357 123.127 1.00 114.49 ? 131 THR E N   1 
ATOM   10227 C  CA  . THR D 1 131 ? 155.813 158.264 124.178 1.00 113.62 ? 131 THR E CA  1 
ATOM   10228 C  C   . THR D 1 131 ? 156.875 159.357 124.022 1.00 114.73 ? 131 THR E C   1 
ATOM   10229 O  O   . THR D 1 131 ? 157.425 159.808 125.030 1.00 112.98 ? 131 THR E O   1 
ATOM   10230 C  CB  . THR D 1 131 ? 156.479 156.883 124.202 1.00 124.88 ? 131 THR E CB  1 
ATOM   10231 O  OG1 . THR D 1 131 ? 156.888 156.527 122.881 1.00 126.65 ? 131 THR E OG1 1 
ATOM   10232 C  CG2 . THR D 1 131 ? 155.581 155.809 124.792 1.00 126.01 ? 131 THR E CG2 1 
ATOM   10233 N  N   . LEU D 1 132 ? 157.160 159.781 122.767 1.00 110.43 ? 132 LEU E N   1 
ATOM   10234 C  CA  . LEU D 1 132 ? 158.133 160.834 122.480 1.00 107.95 ? 132 LEU E CA  1 
ATOM   10235 C  C   . LEU D 1 132 ? 157.629 162.168 123.025 1.00 109.53 ? 132 LEU E C   1 
ATOM   10236 O  O   . LEU D 1 132 ? 158.376 162.834 123.739 1.00 108.24 ? 132 LEU E O   1 
ATOM   10237 C  CB  . LEU D 1 132 ? 158.446 160.930 120.972 1.00 108.70 ? 132 LEU E CB  1 
ATOM   10238 C  CG  . LEU D 1 132 ? 159.262 162.144 120.498 1.00 111.32 ? 132 LEU E CG  1 
ATOM   10239 C  CD1 . LEU D 1 132 ? 160.668 162.151 121.089 1.00 111.14 ? 132 LEU E CD1 1 
ATOM   10240 C  CD2 . LEU D 1 132 ? 159.307 162.210 118.991 1.00 115.15 ? 132 LEU E CD2 1 
ATOM   10241 N  N   . PHE D 1 133 ? 156.374 162.547 122.707 1.00 105.64 ? 133 PHE E N   1 
ATOM   10242 C  CA  . PHE D 1 133 ? 155.774 163.790 123.188 1.00 103.61 ? 133 PHE E CA  1 
ATOM   10243 C  C   . PHE D 1 133 ? 155.659 163.748 124.720 1.00 109.75 ? 133 PHE E C   1 
ATOM   10244 O  O   . PHE D 1 133 ? 156.046 164.714 125.378 1.00 107.74 ? 133 PHE E O   1 
ATOM   10245 C  CB  A PHE D 1 133 ? 154.392 164.020 122.523 0.50 105.53 ? 133 PHE E CB  1 
ATOM   10246 C  CB  B PHE D 1 133 ? 154.414 164.045 122.515 0.50 105.79 ? 133 PHE E CB  1 
ATOM   10247 C  CG  A PHE D 1 133 ? 153.462 165.044 123.152 0.50 105.15 ? 133 PHE E CG  1 
ATOM   10248 C  CG  B PHE D 1 133 ? 154.423 164.113 121.000 0.50 108.19 ? 133 PHE E CG  1 
ATOM   10249 C  CD1 A PHE D 1 133 ? 153.667 166.406 122.962 0.50 106.12 ? 133 PHE E CD1 1 
ATOM   10250 C  CD1 B PHE D 1 133 ? 155.482 164.703 120.317 0.50 110.56 ? 133 PHE E CD1 1 
ATOM   10251 C  CD2 A PHE D 1 133 ? 152.347 164.642 123.879 0.50 107.32 ? 133 PHE E CD2 1 
ATOM   10252 C  CD2 B PHE D 1 133 ? 153.347 163.642 120.262 0.50 112.28 ? 133 PHE E CD2 1 
ATOM   10253 C  CE1 A PHE D 1 133 ? 152.794 167.347 123.520 0.50 105.68 ? 133 PHE E CE1 1 
ATOM   10254 C  CE1 B PHE D 1 133 ? 155.481 164.779 118.922 0.50 112.78 ? 133 PHE E CE1 1 
ATOM   10255 C  CE2 A PHE D 1 133 ? 151.480 165.585 124.440 0.50 108.77 ? 133 PHE E CE2 1 
ATOM   10256 C  CE2 B PHE D 1 133 ? 153.345 163.725 118.866 0.50 116.34 ? 133 PHE E CE2 1 
ATOM   10257 C  CZ  A PHE D 1 133 ? 151.709 166.930 124.254 0.50 105.08 ? 133 PHE E CZ  1 
ATOM   10258 C  CZ  B PHE D 1 133 ? 154.411 164.293 118.206 0.50 113.71 ? 133 PHE E CZ  1 
ATOM   10259 N  N   . SER D 1 134 ? 155.219 162.598 125.278 1.00 110.30 ? 134 SER E N   1 
ATOM   10260 C  CA  . SER D 1 134 ? 155.069 162.371 126.720 1.00 111.35 ? 134 SER E CA  1 
ATOM   10261 C  C   . SER D 1 134 ? 156.376 162.612 127.474 1.00 115.81 ? 134 SER E C   1 
ATOM   10262 O  O   . SER D 1 134 ? 156.362 163.312 128.487 1.00 114.86 ? 134 SER E O   1 
ATOM   10263 C  CB  . SER D 1 134 ? 154.579 160.952 126.991 1.00 118.89 ? 134 SER E CB  1 
ATOM   10264 O  OG  . SER D 1 134 ? 153.302 160.732 126.413 1.00 132.11 ? 134 SER E OG  1 
ATOM   10265 N  N   . ALA D 1 135 ? 157.499 162.062 126.963 1.00 113.64 ? 135 ALA E N   1 
ATOM   10266 C  CA  . ALA D 1 135 ? 158.828 162.196 127.562 1.00 113.64 ? 135 ALA E CA  1 
ATOM   10267 C  C   . ALA D 1 135 ? 159.326 163.649 127.523 1.00 115.52 ? 135 ALA E C   1 
ATOM   10268 O  O   . ALA D 1 135 ? 159.771 164.160 128.552 1.00 114.49 ? 135 ALA E O   1 
ATOM   10269 C  CB  . ALA D 1 135 ? 159.823 161.279 126.855 1.00 116.28 ? 135 ALA E CB  1 
ATOM   10270 N  N   . LEU D 1 136 ? 159.226 164.310 126.354 1.00 111.56 ? 136 LEU E N   1 
ATOM   10271 C  CA  . LEU D 1 136 ? 159.691 165.681 126.144 1.00 110.30 ? 136 LEU E CA  1 
ATOM   10272 C  C   . LEU D 1 136 ? 158.894 166.718 126.941 1.00 113.63 ? 136 LEU E C   1 
ATOM   10273 O  O   . LEU D 1 136 ? 159.500 167.653 127.463 1.00 113.32 ? 136 LEU E O   1 
ATOM   10274 C  CB  . LEU D 1 136 ? 159.664 166.061 124.651 1.00 110.28 ? 136 LEU E CB  1 
ATOM   10275 C  CG  . LEU D 1 136 ? 160.641 165.344 123.706 1.00 116.48 ? 136 LEU E CG  1 
ATOM   10276 C  CD1 . LEU D 1 136 ? 160.307 165.658 122.266 1.00 116.86 ? 136 LEU E CD1 1 
ATOM   10277 C  CD2 . LEU D 1 136 ? 162.098 165.715 123.990 1.00 119.36 ? 136 LEU E CD2 1 
ATOM   10278 N  N   . ALA D 1 137 ? 157.558 166.566 127.034 1.00 109.84 ? 137 ALA E N   1 
ATOM   10279 C  CA  . ALA D 1 137 ? 156.685 167.516 127.741 1.00 108.77 ? 137 ALA E CA  1 
ATOM   10280 C  C   . ALA D 1 137 ? 156.869 167.490 129.258 1.00 111.31 ? 137 ALA E C   1 
ATOM   10281 O  O   . ALA D 1 137 ? 156.650 168.511 129.918 1.00 109.96 ? 137 ALA E O   1 
ATOM   10282 C  CB  . ALA D 1 137 ? 155.228 167.245 127.404 1.00 110.06 ? 137 ALA E CB  1 
ATOM   10283 N  N   . GLY D 1 138 ? 157.251 166.329 129.783 1.00 108.68 ? 138 GLY E N   1 
ATOM   10284 C  CA  . GLY D 1 138 ? 157.450 166.107 131.211 1.00 109.40 ? 138 GLY E CA  1 
ATOM   10285 C  C   . GLY D 1 138 ? 158.869 166.286 131.713 1.00 113.36 ? 138 GLY E C   1 
ATOM   10286 O  O   . GLY D 1 138 ? 159.082 166.409 132.924 1.00 114.28 ? 138 GLY E O   1 
ATOM   10287 N  N   . LEU D 1 139 ? 159.846 166.305 130.787 1.00 108.37 ? 139 LEU E N   1 
ATOM   10288 C  CA  . LEU D 1 139 ? 161.267 166.479 131.075 1.00 108.18 ? 139 LEU E CA  1 
ATOM   10289 C  C   . LEU D 1 139 ? 161.573 167.830 131.779 1.00 109.94 ? 139 LEU E C   1 
ATOM   10290 O  O   . LEU D 1 139 ? 162.354 167.772 132.727 1.00 111.31 ? 139 LEU E O   1 
ATOM   10291 C  CB  . LEU D 1 139 ? 162.094 166.329 129.789 1.00 108.47 ? 139 LEU E CB  1 
ATOM   10292 C  CG  . LEU D 1 139 ? 163.502 165.751 129.921 1.00 115.02 ? 139 LEU E CG  1 
ATOM   10293 C  CD1 . LEU D 1 139 ? 163.496 164.375 130.603 1.00 116.87 ? 139 LEU E CD1 1 
ATOM   10294 C  CD2 . LEU D 1 139 ? 164.158 165.640 128.560 1.00 117.74 ? 139 LEU E CD2 1 
ATOM   10295 N  N   . PRO D 1 140 ? 160.975 169.020 131.433 1.00 103.27 ? 140 PRO E N   1 
ATOM   10296 C  CA  . PRO D 1 140 ? 161.307 170.247 132.185 1.00 102.91 ? 140 PRO E CA  1 
ATOM   10297 C  C   . PRO D 1 140 ? 160.842 170.196 133.641 1.00 107.95 ? 140 PRO E C   1 
ATOM   10298 O  O   . PRO D 1 140 ? 161.525 170.740 134.510 1.00 108.66 ? 140 PRO E O   1 
ATOM   10299 C  CB  . PRO D 1 140 ? 160.575 171.353 131.411 1.00 103.30 ? 140 PRO E CB  1 
ATOM   10300 C  CG  . PRO D 1 140 ? 160.291 170.780 130.087 1.00 106.94 ? 140 PRO E CG  1 
ATOM   10301 C  CD  . PRO D 1 140 ? 160.026 169.336 130.347 1.00 103.15 ? 140 PRO E CD  1 
ATOM   10302 N  N   . TRP D 1 141 ? 159.701 169.525 133.906 1.00 104.90 ? 141 TRP E N   1 
ATOM   10303 C  CA  . TRP D 1 141 ? 159.134 169.358 135.247 1.00 106.16 ? 141 TRP E CA  1 
ATOM   10304 C  C   . TRP D 1 141 ? 160.047 168.474 136.085 1.00 112.30 ? 141 TRP E C   1 
ATOM   10305 O  O   . TRP D 1 141 ? 160.360 168.827 137.221 1.00 112.79 ? 141 TRP E O   1 
ATOM   10306 C  CB  . TRP D 1 141 ? 157.718 168.775 135.163 1.00 104.75 ? 141 TRP E CB  1 
ATOM   10307 C  CG  . TRP D 1 141 ? 156.767 169.678 134.443 1.00 104.76 ? 141 TRP E CG  1 
ATOM   10308 C  CD1 . TRP D 1 141 ? 156.484 169.675 133.109 1.00 106.69 ? 141 TRP E CD1 1 
ATOM   10309 C  CD2 . TRP D 1 141 ? 156.059 170.791 135.002 1.00 105.02 ? 141 TRP E CD2 1 
ATOM   10310 N  NE1 . TRP D 1 141 ? 155.616 170.696 132.807 1.00 105.87 ? 141 TRP E NE1 1 
ATOM   10311 C  CE2 . TRP D 1 141 ? 155.337 171.399 133.952 1.00 108.20 ? 141 TRP E CE2 1 
ATOM   10312 C  CE3 . TRP D 1 141 ? 155.957 171.333 136.295 1.00 107.61 ? 141 TRP E CE3 1 
ATOM   10313 C  CZ2 . TRP D 1 141 ? 154.514 172.516 134.156 1.00 107.88 ? 141 TRP E CZ2 1 
ATOM   10314 C  CZ3 . TRP D 1 141 ? 155.143 172.438 136.496 1.00 109.43 ? 141 TRP E CZ3 1 
ATOM   10315 C  CH2 . TRP D 1 141 ? 154.428 173.014 135.438 1.00 109.12 ? 141 TRP E CH2 1 
ATOM   10316 N  N   . SER D 1 142 ? 160.523 167.361 135.483 1.00 110.52 ? 142 SER E N   1 
ATOM   10317 C  CA  . SER D 1 142 ? 161.452 166.382 136.056 1.00 112.90 ? 142 SER E CA  1 
ATOM   10318 C  C   . SER D 1 142 ? 162.794 167.033 136.387 1.00 118.10 ? 142 SER E C   1 
ATOM   10319 O  O   . SER D 1 142 ? 163.374 166.745 137.435 1.00 119.35 ? 142 SER E O   1 
ATOM   10320 C  CB  . SER D 1 142 ? 161.663 165.227 135.079 1.00 117.88 ? 142 SER E CB  1 
ATOM   10321 O  OG  . SER D 1 142 ? 162.531 164.239 135.609 1.00 131.82 ? 142 SER E OG  1 
ATOM   10322 N  N   . LEU D 1 143 ? 163.277 167.911 135.485 1.00 114.46 ? 143 LEU E N   1 
ATOM   10323 C  CA  . LEU D 1 143 ? 164.519 168.663 135.619 1.00 115.94 ? 143 LEU E CA  1 
ATOM   10324 C  C   . LEU D 1 143 ? 164.402 169.652 136.776 1.00 122.30 ? 143 LEU E C   1 
ATOM   10325 O  O   . LEU D 1 143 ? 165.378 169.852 137.498 1.00 123.93 ? 143 LEU E O   1 
ATOM   10326 C  CB  . LEU D 1 143 ? 164.836 169.391 134.301 1.00 114.99 ? 143 LEU E CB  1 
ATOM   10327 C  CG  . LEU D 1 143 ? 166.217 170.018 134.184 1.00 121.82 ? 143 LEU E CG  1 
ATOM   10328 C  CD1 . LEU D 1 143 ? 167.131 169.163 133.336 1.00 123.14 ? 143 LEU E CD1 1 
ATOM   10329 C  CD2 . LEU D 1 143 ? 166.128 171.409 133.606 1.00 123.91 ? 143 LEU E CD2 1 
ATOM   10330 N  N   . TYR D 1 144 ? 163.201 170.245 136.971 1.00 119.38 ? 144 TYR E N   1 
ATOM   10331 C  CA  . TYR D 1 144 ? 162.947 171.194 138.055 1.00 121.22 ? 144 TYR E CA  1 
ATOM   10332 C  C   . TYR D 1 144 ? 162.979 170.490 139.401 1.00 127.25 ? 144 TYR E C   1 
ATOM   10333 O  O   . TYR D 1 144 ? 163.623 170.986 140.318 1.00 129.17 ? 144 TYR E O   1 
ATOM   10334 C  CB  . TYR D 1 144 ? 161.607 171.930 137.874 1.00 121.86 ? 144 TYR E CB  1 
ATOM   10335 C  CG  . TYR D 1 144 ? 161.429 173.083 138.842 1.00 126.77 ? 144 TYR E CG  1 
ATOM   10336 C  CD1 . TYR D 1 144 ? 161.944 174.346 138.557 1.00 130.07 ? 144 TYR E CD1 1 
ATOM   10337 C  CD2 . TYR D 1 144 ? 160.741 172.915 140.039 1.00 128.96 ? 144 TYR E CD2 1 
ATOM   10338 C  CE1 . TYR D 1 144 ? 161.791 175.410 139.450 1.00 133.56 ? 144 TYR E CE1 1 
ATOM   10339 C  CE2 . TYR D 1 144 ? 160.587 173.969 140.942 1.00 131.98 ? 144 TYR E CE2 1 
ATOM   10340 C  CZ  . TYR D 1 144 ? 161.108 175.217 140.639 1.00 141.94 ? 144 TYR E CZ  1 
ATOM   10341 O  OH  . TYR D 1 144 ? 160.961 176.254 141.529 1.00 147.39 ? 144 TYR E OH  1 
ATOM   10342 N  N   . ASN D 1 145 ? 162.297 169.341 139.521 1.00 123.46 ? 145 ASN E N   1 
ATOM   10343 C  CA  . ASN D 1 145 ? 162.243 168.590 140.772 1.00 125.20 ? 145 ASN E CA  1 
ATOM   10344 C  C   . ASN D 1 145 ? 163.639 168.219 141.275 1.00 130.21 ? 145 ASN E C   1 
ATOM   10345 O  O   . ASN D 1 145 ? 163.947 168.510 142.428 1.00 132.17 ? 145 ASN E O   1 
ATOM   10346 C  CB  . ASN D 1 145 ? 161.372 167.336 140.641 1.00 127.21 ? 145 ASN E CB  1 
ATOM   10347 C  CG  . ASN D 1 145 ? 161.293 166.519 141.911 1.00 156.06 ? 145 ASN E CG  1 
ATOM   10348 O  OD1 . ASN D 1 145 ? 160.696 166.927 142.914 1.00 153.42 ? 145 ASN E OD1 1 
ATOM   10349 N  ND2 . ASN D 1 145 ? 161.932 165.360 141.905 1.00 149.28 ? 145 ASN E ND2 1 
ATOM   10350 N  N   . THR D 1 146 ? 164.483 167.619 140.417 1.00 125.85 ? 146 THR E N   1 
ATOM   10351 C  CA  . THR D 1 146 ? 165.813 167.175 140.832 1.00 128.09 ? 146 THR E CA  1 
ATOM   10352 C  C   . THR D 1 146 ? 166.779 168.348 141.040 1.00 131.94 ? 146 THR E C   1 
ATOM   10353 O  O   . THR D 1 146 ? 167.488 168.355 142.046 1.00 134.64 ? 146 THR E O   1 
ATOM   10354 C  CB  . THR D 1 146 ? 166.423 166.130 139.858 1.00 137.76 ? 146 THR E CB  1 
ATOM   10355 O  OG1 . THR D 1 146 ? 166.817 166.754 138.637 1.00 137.92 ? 146 THR E OG1 1 
ATOM   10356 C  CG2 . THR D 1 146 ? 165.498 164.939 139.585 1.00 134.77 ? 146 THR E CG2 1 
ATOM   10357 N  N   . PHE D 1 147 ? 166.812 169.327 140.116 1.00 125.42 ? 147 PHE E N   1 
ATOM   10358 C  CA  . PHE D 1 147 ? 167.787 170.416 140.202 1.00 126.28 ? 147 PHE E CA  1 
ATOM   10359 C  C   . PHE D 1 147 ? 167.310 171.669 140.953 1.00 130.42 ? 147 PHE E C   1 
ATOM   10360 O  O   . PHE D 1 147 ? 168.124 172.574 141.160 1.00 132.27 ? 147 PHE E O   1 
ATOM   10361 C  CB  . PHE D 1 147 ? 168.318 170.792 138.812 1.00 126.48 ? 147 PHE E CB  1 
ATOM   10362 C  CG  . PHE D 1 147 ? 169.112 169.668 138.190 1.00 128.10 ? 147 PHE E CG  1 
ATOM   10363 C  CD1 . PHE D 1 147 ? 170.297 169.229 138.768 1.00 134.21 ? 147 PHE E CD1 1 
ATOM   10364 C  CD2 . PHE D 1 147 ? 168.656 169.023 137.047 1.00 127.92 ? 147 PHE E CD2 1 
ATOM   10365 C  CE1 . PHE D 1 147 ? 171.009 168.166 138.214 1.00 136.23 ? 147 PHE E CE1 1 
ATOM   10366 C  CE2 . PHE D 1 147 ? 169.378 167.970 136.483 1.00 131.65 ? 147 PHE E CE2 1 
ATOM   10367 C  CZ  . PHE D 1 147 ? 170.544 167.542 137.076 1.00 133.09 ? 147 PHE E CZ  1 
ATOM   10368 N  N   . VAL D 1 148 ? 166.050 171.724 141.408 1.00 125.22 ? 148 VAL E N   1 
ATOM   10369 C  CA  . VAL D 1 148 ? 165.621 172.894 142.177 1.00 126.04 ? 148 VAL E CA  1 
ATOM   10370 C  C   . VAL D 1 148 ? 165.129 172.426 143.552 1.00 131.62 ? 148 VAL E C   1 
ATOM   10371 O  O   . VAL D 1 148 ? 165.682 172.892 144.538 1.00 134.24 ? 148 VAL E O   1 
ATOM   10372 C  CB  . VAL D 1 148 ? 164.614 173.835 141.453 1.00 127.61 ? 148 VAL E CB  1 
ATOM   10373 C  CG1 . VAL D 1 148 ? 164.197 175.000 142.349 1.00 129.22 ? 148 VAL E CG1 1 
ATOM   10374 C  CG2 . VAL D 1 148 ? 165.208 174.367 140.153 1.00 126.39 ? 148 VAL E CG2 1 
ATOM   10375 N  N   . ILE D 1 149 ? 164.148 171.498 143.632 1.00 126.95 ? 149 ILE E N   1 
ATOM   10376 C  CA  . ILE D 1 149 ? 163.627 171.025 144.926 1.00 128.88 ? 149 ILE E CA  1 
ATOM   10377 C  C   . ILE D 1 149 ? 164.670 170.129 145.636 1.00 137.16 ? 149 ILE E C   1 
ATOM   10378 O  O   . ILE D 1 149 ? 165.098 170.472 146.739 1.00 140.14 ? 149 ILE E O   1 
ATOM   10379 C  CB  . ILE D 1 149 ? 162.236 170.330 144.804 1.00 129.72 ? 149 ILE E CB  1 
ATOM   10380 C  CG1 . ILE D 1 149 ? 161.169 171.322 144.344 1.00 127.98 ? 149 ILE E CG1 1 
ATOM   10381 C  CG2 . ILE D 1 149 ? 161.797 169.674 146.117 1.00 132.91 ? 149 ILE E CG2 1 
ATOM   10382 C  CD1 . ILE D 1 149 ? 160.596 170.977 143.078 1.00 131.69 ? 149 ILE E CD1 1 
ATOM   10383 N  N   . GLU D 1 150 ? 165.084 169.011 145.007 1.00 133.70 ? 150 GLU E N   1 
ATOM   10384 C  CA  . GLU D 1 150 ? 166.049 168.075 145.596 1.00 136.57 ? 150 GLU E CA  1 
ATOM   10385 C  C   . GLU D 1 150 ? 167.425 168.720 145.788 1.00 143.94 ? 150 GLU E C   1 
ATOM   10386 O  O   . GLU D 1 150 ? 168.159 168.309 146.683 1.00 147.26 ? 150 GLU E O   1 
ATOM   10387 C  CB  . GLU D 1 150 ? 166.176 166.787 144.761 1.00 136.69 ? 150 GLU E CB  1 
ATOM   10388 C  CG  . GLU D 1 150 ? 164.891 165.979 144.618 1.00 145.97 ? 150 GLU E CG  1 
ATOM   10389 C  CD  . GLU D 1 150 ? 164.176 165.574 145.892 1.00 169.89 ? 150 GLU E CD  1 
ATOM   10390 O  OE1 . GLU D 1 150 ? 164.851 165.075 146.821 1.00 179.38 ? 150 GLU E OE1 1 
ATOM   10391 O  OE2 . GLU D 1 150 ? 162.934 165.730 145.949 1.00 155.53 ? 150 GLU E OE2 1 
ATOM   10392 N  N   . GLU D 1 151 ? 167.761 169.740 144.981 1.00 139.69 ? 151 GLU E N   1 
ATOM   10393 C  CA  . GLU D 1 151 ? 169.045 170.424 145.094 1.00 142.48 ? 151 GLU E CA  1 
ATOM   10394 C  C   . GLU D 1 151 ? 169.023 171.475 146.210 1.00 149.51 ? 151 GLU E C   1 
ATOM   10395 O  O   . GLU D 1 151 ? 170.015 171.590 146.928 1.00 152.83 ? 151 GLU E O   1 
ATOM   10396 C  CB  . GLU D 1 151 ? 169.458 171.055 143.758 1.00 142.02 ? 151 GLU E CB  1 
ATOM   10397 C  CG  . GLU D 1 151 ? 170.960 171.214 143.583 1.00 157.30 ? 151 GLU E CG  1 
ATOM   10398 C  CD  . GLU D 1 151 ? 171.767 169.930 143.656 1.00 185.95 ? 151 GLU E CD  1 
ATOM   10399 O  OE1 . GLU D 1 151 ? 171.746 169.157 142.671 1.00 181.37 ? 151 GLU E OE1 1 
ATOM   10400 O  OE2 . GLU D 1 151 ? 172.414 169.693 144.702 1.00 186.42 ? 151 GLU E OE2 1 
ATOM   10401 N  N   . LYS D 1 152 ? 167.905 172.228 146.362 1.00 145.20 ? 152 LYS E N   1 
ATOM   10402 C  CA  . LYS D 1 152 ? 167.737 173.264 147.397 1.00 148.29 ? 152 LYS E CA  1 
ATOM   10403 C  C   . LYS D 1 152 ? 167.805 172.655 148.797 1.00 156.93 ? 152 LYS E C   1 
ATOM   10404 O  O   . LYS D 1 152 ? 168.405 173.251 149.694 1.00 160.79 ? 152 LYS E O   1 
ATOM   10405 C  CB  . LYS D 1 152 ? 166.395 174.011 147.222 1.00 148.51 ? 152 LYS E CB  1 
ATOM   10406 C  CG  . LYS D 1 152 ? 166.234 175.275 148.065 1.00 164.22 ? 152 LYS E CG  1 
ATOM   10407 N  N   . HIS D 1 153 ? 167.203 171.465 148.972 1.00 152.96 ? 153 HIS E N   1 
ATOM   10408 C  CA  . HIS D 1 153 ? 167.145 170.772 150.255 1.00 156.33 ? 153 HIS E CA  1 
ATOM   10409 C  C   . HIS D 1 153 ? 168.260 169.703 150.382 1.00 162.98 ? 153 HIS E C   1 
ATOM   10410 O  O   . HIS D 1 153 ? 168.163 168.790 151.208 1.00 164.70 ? 153 HIS E O   1 
ATOM   10411 C  CB  . HIS D 1 153 ? 165.740 170.191 150.464 1.00 155.32 ? 153 HIS E CB  1 
ATOM   10412 C  CG  . HIS D 1 153 ? 164.670 171.241 150.373 1.00 157.19 ? 153 HIS E CG  1 
ATOM   10413 N  ND1 . HIS D 1 153 ? 164.432 172.122 151.414 1.00 161.99 ? 153 HIS E ND1 1 
ATOM   10414 C  CD2 . HIS D 1 153 ? 163.845 171.551 149.345 1.00 155.01 ? 153 HIS E CD2 1 
ATOM   10415 C  CE1 . HIS D 1 153 ? 163.470 172.926 150.992 1.00 159.28 ? 153 HIS E CE1 1 
ATOM   10416 N  NE2 . HIS D 1 153 ? 163.080 172.615 149.756 1.00 155.41 ? 153 HIS E NE2 1 
ATOM   10417 N  N   . GLY D 1 154 ? 169.324 169.891 149.593 1.00 159.89 ? 154 GLY E N   1 
ATOM   10418 C  CA  . GLY D 1 154 ? 170.556 169.104 149.564 1.00 162.10 ? 154 GLY E CA  1 
ATOM   10419 C  C   . GLY D 1 154 ? 170.480 167.597 149.426 1.00 165.22 ? 154 GLY E C   1 
ATOM   10420 O  O   . GLY D 1 154 ? 171.376 166.900 149.910 1.00 168.26 ? 154 GLY E O   1 
ATOM   10421 N  N   . PHE D 1 155 ? 169.442 167.078 148.756 1.00 157.77 ? 155 PHE E N   1 
ATOM   10422 C  CA  . PHE D 1 155 ? 169.296 165.639 148.548 1.00 157.22 ? 155 PHE E CA  1 
ATOM   10423 C  C   . PHE D 1 155 ? 170.025 165.197 147.288 1.00 159.64 ? 155 PHE E C   1 
ATOM   10424 O  O   . PHE D 1 155 ? 170.802 164.246 147.351 1.00 161.66 ? 155 PHE E O   1 
ATOM   10425 C  CB  . PHE D 1 155 ? 167.818 165.222 148.479 1.00 156.45 ? 155 PHE E CB  1 
ATOM   10426 C  CG  . PHE D 1 155 ? 167.125 165.131 149.816 1.00 160.69 ? 155 PHE E CG  1 
ATOM   10427 C  CD1 . PHE D 1 155 ? 167.332 164.039 150.652 1.00 167.24 ? 155 PHE E CD1 1 
ATOM   10428 C  CD2 . PHE D 1 155 ? 166.242 166.122 150.229 1.00 162.40 ? 155 PHE E CD2 1 
ATOM   10429 C  CE1 . PHE D 1 155 ? 166.675 163.946 151.880 1.00 170.77 ? 155 PHE E CE1 1 
ATOM   10430 C  CE2 . PHE D 1 155 ? 165.595 166.034 151.461 1.00 167.83 ? 155 PHE E CE2 1 
ATOM   10431 C  CZ  . PHE D 1 155 ? 165.809 164.943 152.275 1.00 169.21 ? 155 PHE E CZ  1 
ATOM   10432 N  N   . ASN D 1 156 ? 169.793 165.902 146.157 1.00 152.82 ? 156 ASN E N   1 
ATOM   10433 C  CA  . ASN D 1 156 ? 170.357 165.599 144.838 1.00 150.91 ? 156 ASN E CA  1 
ATOM   10434 C  C   . ASN D 1 156 ? 171.882 165.618 144.818 1.00 157.63 ? 156 ASN E C   1 
ATOM   10435 O  O   . ASN D 1 156 ? 172.516 166.504 145.395 1.00 159.38 ? 156 ASN E O   1 
ATOM   10436 C  CB  . ASN D 1 156 ? 169.822 166.557 143.772 1.00 146.98 ? 156 ASN E CB  1 
ATOM   10437 C  CG  . ASN D 1 156 ? 170.032 166.063 142.360 1.00 159.11 ? 156 ASN E CG  1 
ATOM   10438 O  OD1 . ASN D 1 156 ? 169.429 165.076 141.920 1.00 152.40 ? 156 ASN E OD1 1 
ATOM   10439 N  ND2 . ASN D 1 156 ? 170.894 166.743 141.620 1.00 146.79 ? 156 ASN E ND2 1 
ATOM   10440 N  N   . GLN D 1 157 ? 172.449 164.606 144.143 1.00 154.58 ? 157 GLN E N   1 
ATOM   10441 C  CA  . GLN D 1 157 ? 173.882 164.384 143.943 1.00 157.53 ? 157 GLN E CA  1 
ATOM   10442 C  C   . GLN D 1 157 ? 174.178 164.265 142.434 1.00 159.29 ? 157 GLN E C   1 
ATOM   10443 O  O   . GLN D 1 157 ? 175.340 164.162 142.029 1.00 160.96 ? 157 GLN E O   1 
ATOM   10444 C  CB  . GLN D 1 157 ? 174.345 163.117 144.698 1.00 162.57 ? 157 GLN E CB  1 
ATOM   10445 C  CG  . GLN D 1 157 ? 173.902 163.015 146.168 1.00 180.76 ? 157 GLN E CG  1 
ATOM   10446 C  CD  . GLN D 1 157 ? 174.468 164.097 147.057 1.00 205.80 ? 157 GLN E CD  1 
ATOM   10447 O  OE1 . GLN D 1 157 ? 175.683 164.315 147.128 1.00 205.67 ? 157 GLN E OE1 1 
ATOM   10448 N  NE2 . GLN D 1 157 ? 173.595 164.778 147.782 1.00 197.65 ? 157 GLN E NE2 1 
ATOM   10449 N  N   . GLN D 1 158 ? 173.105 164.288 141.613 1.00 151.82 ? 158 GLN E N   1 
ATOM   10450 C  CA  . GLN D 1 158 ? 173.141 164.195 140.155 1.00 149.16 ? 158 GLN E CA  1 
ATOM   10451 C  C   . GLN D 1 158 ? 173.701 165.446 139.501 1.00 152.39 ? 158 GLN E C   1 
ATOM   10452 O  O   . GLN D 1 158 ? 173.495 166.560 139.992 1.00 151.75 ? 158 GLN E O   1 
ATOM   10453 C  CB  . GLN D 1 158 ? 171.725 163.973 139.596 1.00 146.48 ? 158 GLN E CB  1 
ATOM   10454 C  CG  . GLN D 1 158 ? 171.212 162.551 139.661 1.00 159.52 ? 158 GLN E CG  1 
ATOM   10455 C  CD  . GLN D 1 158 ? 169.934 162.428 138.871 1.00 176.71 ? 158 GLN E CD  1 
ATOM   10456 O  OE1 . GLN D 1 158 ? 169.946 162.180 137.661 1.00 170.24 ? 158 GLN E OE1 1 
ATOM   10457 N  NE2 . GLN D 1 158 ? 168.802 162.630 139.532 1.00 170.08 ? 158 GLN E NE2 1 
ATOM   10458 N  N   . THR D 1 159 ? 174.360 165.254 138.353 1.00 148.49 ? 159 THR E N   1 
ATOM   10459 C  CA  . THR D 1 159 ? 174.860 166.327 137.499 1.00 147.32 ? 159 THR E CA  1 
ATOM   10460 C  C   . THR D 1 159 ? 173.890 166.413 136.315 1.00 145.29 ? 159 THR E C   1 
ATOM   10461 O  O   . THR D 1 159 ? 173.139 165.460 136.083 1.00 142.98 ? 159 THR E O   1 
ATOM   10462 C  CB  . THR D 1 159 ? 176.340 166.115 137.110 1.00 161.17 ? 159 THR E CB  1 
ATOM   10463 O  OG1 . THR D 1 159 ? 176.716 167.099 136.143 1.00 163.23 ? 159 THR E OG1 1 
ATOM   10464 C  CG2 . THR D 1 159 ? 176.635 164.714 136.575 1.00 160.26 ? 159 THR E CG2 1 
ATOM   10465 N  N   . LEU D 1 160 ? 173.881 167.544 135.583 1.00 139.93 ? 160 LEU E N   1 
ATOM   10466 C  CA  . LEU D 1 160 ? 172.975 167.727 134.440 1.00 136.32 ? 160 LEU E CA  1 
ATOM   10467 C  C   . LEU D 1 160 ? 173.233 166.684 133.348 1.00 140.03 ? 160 LEU E C   1 
ATOM   10468 O  O   . LEU D 1 160 ? 172.290 166.253 132.679 1.00 137.46 ? 160 LEU E O   1 
ATOM   10469 C  CB  . LEU D 1 160 ? 173.075 169.141 133.860 1.00 135.67 ? 160 LEU E CB  1 
ATOM   10470 C  CG  . LEU D 1 160 ? 171.813 169.640 133.163 1.00 136.72 ? 160 LEU E CG  1 
ATOM   10471 C  CD1 . LEU D 1 160 ? 171.460 171.032 133.627 1.00 136.79 ? 160 LEU E CD1 1 
ATOM   10472 C  CD2 . LEU D 1 160 ? 171.943 169.570 131.643 1.00 137.60 ? 160 LEU E CD2 1 
ATOM   10473 N  N   . GLY D 1 161 ? 174.495 166.286 133.207 1.00 139.37 ? 161 GLY E N   1 
ATOM   10474 C  CA  . GLY D 1 161 ? 174.931 165.284 132.246 1.00 140.41 ? 161 GLY E CA  1 
ATOM   10475 C  C   . GLY D 1 161 ? 174.379 163.911 132.556 1.00 144.76 ? 161 GLY E C   1 
ATOM   10476 O  O   . GLY D 1 161 ? 173.859 163.243 131.659 1.00 143.01 ? 161 GLY E O   1 
ATOM   10477 N  N   . PHE D 1 162 ? 174.471 163.495 133.841 1.00 143.73 ? 162 PHE E N   1 
ATOM   10478 C  CA  . PHE D 1 162 ? 173.971 162.204 134.322 1.00 144.60 ? 162 PHE E CA  1 
ATOM   10479 C  C   . PHE D 1 162 ? 172.463 162.128 134.149 1.00 145.62 ? 162 PHE E C   1 
ATOM   10480 O  O   . PHE D 1 162 ? 171.962 161.095 133.711 1.00 145.08 ? 162 PHE E O   1 
ATOM   10481 C  CB  . PHE D 1 162 ? 174.356 161.958 135.792 1.00 149.15 ? 162 PHE E CB  1 
ATOM   10482 C  CG  . PHE D 1 162 ? 173.925 160.615 136.332 1.00 152.34 ? 162 PHE E CG  1 
ATOM   10483 C  CD1 . PHE D 1 162 ? 174.721 159.491 136.161 1.00 158.34 ? 162 PHE E CD1 1 
ATOM   10484 C  CD2 . PHE D 1 162 ? 172.719 160.473 137.008 1.00 154.16 ? 162 PHE E CD2 1 
ATOM   10485 C  CE1 . PHE D 1 162 ? 174.319 158.247 136.656 1.00 163.10 ? 162 PHE E CE1 1 
ATOM   10486 C  CE2 . PHE D 1 162 ? 172.313 159.227 137.496 1.00 156.98 ? 162 PHE E CE2 1 
ATOM   10487 C  CZ  . PHE D 1 162 ? 173.118 158.123 137.321 1.00 159.51 ? 162 PHE E CZ  1 
ATOM   10488 N  N   . PHE D 1 163 ? 171.750 163.220 134.490 1.00 140.32 ? 163 PHE E N   1 
ATOM   10489 C  CA  . PHE D 1 163 ? 170.297 163.328 134.363 1.00 137.27 ? 163 PHE E CA  1 
ATOM   10490 C  C   . PHE D 1 163 ? 169.879 163.137 132.899 1.00 139.88 ? 163 PHE E C   1 
ATOM   10491 O  O   . PHE D 1 163 ? 168.978 162.341 132.621 1.00 138.96 ? 163 PHE E O   1 
ATOM   10492 C  CB  . PHE D 1 163 ? 169.805 164.689 134.902 1.00 137.20 ? 163 PHE E CB  1 
ATOM   10493 C  CG  . PHE D 1 163 ? 168.306 164.873 134.883 1.00 135.68 ? 163 PHE E CG  1 
ATOM   10494 C  CD1 . PHE D 1 163 ? 167.516 164.375 135.912 1.00 139.10 ? 163 PHE E CD1 1 
ATOM   10495 C  CD2 . PHE D 1 163 ? 167.685 165.540 133.836 1.00 134.83 ? 163 PHE E CD2 1 
ATOM   10496 C  CE1 . PHE D 1 163 ? 166.130 164.529 135.886 1.00 137.78 ? 163 PHE E CE1 1 
ATOM   10497 C  CE2 . PHE D 1 163 ? 166.297 165.687 133.808 1.00 135.48 ? 163 PHE E CE2 1 
ATOM   10498 C  CZ  . PHE D 1 163 ? 165.531 165.188 134.836 1.00 134.06 ? 163 PHE E CZ  1 
ATOM   10499 N  N   . MET D 1 164 ? 170.559 163.844 131.974 1.00 136.13 ? 164 MET E N   1 
ATOM   10500 C  CA  . MET D 1 164 ? 170.297 163.786 130.539 1.00 134.70 ? 164 MET E CA  1 
ATOM   10501 C  C   . MET D 1 164 ? 170.616 162.411 129.957 1.00 138.83 ? 164 MET E C   1 
ATOM   10502 O  O   . MET D 1 164 ? 169.764 161.840 129.276 1.00 136.68 ? 164 MET E O   1 
ATOM   10503 C  CB  . MET D 1 164 ? 171.081 164.877 129.790 1.00 137.53 ? 164 MET E CB  1 
ATOM   10504 C  CG  . MET D 1 164 ? 170.378 166.227 129.750 1.00 139.14 ? 164 MET E CG  1 
ATOM   10505 S  SD  . MET D 1 164 ? 168.631 166.180 129.258 1.00 140.60 ? 164 MET E SD  1 
ATOM   10506 C  CE  . MET D 1 164 ? 168.740 165.530 127.555 1.00 137.70 ? 164 MET E CE  1 
ATOM   10507 N  N   . LYS D 1 165 ? 171.823 161.872 130.242 1.00 138.52 ? 165 LYS E N   1 
ATOM   10508 C  CA  . LYS D 1 165 ? 172.264 160.561 129.758 1.00 141.10 ? 165 LYS E CA  1 
ATOM   10509 C  C   . LYS D 1 165 ? 171.331 159.455 130.238 1.00 145.42 ? 165 LYS E C   1 
ATOM   10510 O  O   . LYS D 1 165 ? 171.046 158.537 129.471 1.00 146.36 ? 165 LYS E O   1 
ATOM   10511 C  CB  . LYS D 1 165 ? 173.706 160.259 130.192 1.00 147.31 ? 165 LYS E CB  1 
ATOM   10512 N  N   . ASP D 1 166 ? 170.834 159.564 131.485 1.00 141.07 ? 166 ASP E N   1 
ATOM   10513 C  CA  . ASP D 1 166 ? 169.917 158.595 132.082 1.00 141.19 ? 166 ASP E CA  1 
ATOM   10514 C  C   . ASP D 1 166 ? 168.525 158.671 131.448 1.00 139.81 ? 166 ASP E C   1 
ATOM   10515 O  O   . ASP D 1 166 ? 167.900 157.628 131.251 1.00 140.49 ? 166 ASP E O   1 
ATOM   10516 C  CB  . ASP D 1 166 ? 169.817 158.802 133.598 1.00 144.09 ? 166 ASP E CB  1 
ATOM   10517 C  CG  . ASP D 1 166 ? 169.909 157.511 134.385 1.00 161.61 ? 166 ASP E CG  1 
ATOM   10518 O  OD1 . ASP D 1 166 ? 171.034 156.963 134.504 1.00 165.67 ? 166 ASP E OD1 1 
ATOM   10519 O  OD2 . ASP D 1 166 ? 168.858 157.047 134.887 1.00 168.26 ? 166 ASP E OD2 1 
ATOM   10520 N  N   . ALA D 1 167 ? 168.044 159.894 131.131 1.00 131.30 ? 167 ALA E N   1 
ATOM   10521 C  CA  . ALA D 1 167 ? 166.734 160.124 130.510 1.00 127.81 ? 167 ALA E CA  1 
ATOM   10522 C  C   . ALA D 1 167 ? 166.644 159.432 129.148 1.00 130.02 ? 167 ALA E C   1 
ATOM   10523 O  O   . ALA D 1 167 ? 165.637 158.786 128.865 1.00 129.22 ? 167 ALA E O   1 
ATOM   10524 C  CB  . ALA D 1 167 ? 166.469 161.619 130.364 1.00 125.81 ? 167 ALA E CB  1 
ATOM   10525 N  N   . ILE D 1 168 ? 167.714 159.539 128.330 1.00 126.39 ? 168 ILE E N   1 
ATOM   10526 C  CA  . ILE D 1 168 ? 167.807 158.915 127.005 1.00 126.81 ? 168 ILE E CA  1 
ATOM   10527 C  C   . ILE D 1 168 ? 167.931 157.394 127.185 1.00 132.56 ? 168 ILE E C   1 
ATOM   10528 O  O   . ILE D 1 168 ? 167.187 156.650 126.546 1.00 132.41 ? 168 ILE E O   1 
ATOM   10529 C  CB  . ILE D 1 168 ? 168.972 159.508 126.154 1.00 130.53 ? 168 ILE E CB  1 
ATOM   10530 C  CG1 . ILE D 1 168 ? 168.902 161.054 126.102 1.00 128.36 ? 168 ILE E CG1 1 
ATOM   10531 C  CG2 . ILE D 1 168 ? 168.974 158.913 124.737 1.00 132.53 ? 168 ILE E CG2 1 
ATOM   10532 C  CD1 . ILE D 1 168 ? 170.226 161.758 125.938 1.00 139.72 ? 168 ILE E CD1 1 
ATOM   10533 N  N   . LYS D 1 169 ? 168.847 156.948 128.077 1.00 130.84 ? 169 LYS E N   1 
ATOM   10534 C  CA  . LYS D 1 169 ? 169.099 155.547 128.422 1.00 133.95 ? 169 LYS E CA  1 
ATOM   10535 C  C   . LYS D 1 169 ? 167.797 154.829 128.777 1.00 138.12 ? 169 LYS E C   1 
ATOM   10536 O  O   . LYS D 1 169 ? 167.521 153.769 128.219 1.00 140.19 ? 169 LYS E O   1 
ATOM   10537 C  CB  . LYS D 1 169 ? 170.074 155.462 129.604 1.00 138.15 ? 169 LYS E CB  1 
ATOM   10538 C  CG  . LYS D 1 169 ? 171.350 154.684 129.319 1.00 160.70 ? 169 LYS E CG  1 
ATOM   10539 C  CD  . LYS D 1 169 ? 172.050 154.253 130.613 1.00 176.53 ? 169 LYS E CD  1 
ATOM   10540 C  CE  . LYS D 1 169 ? 172.868 155.351 131.255 1.00 189.41 ? 169 LYS E CE  1 
ATOM   10541 N  NZ  . LYS D 1 169 ? 173.080 155.096 132.702 1.00 202.21 ? 169 LYS E NZ  1 
ATOM   10542 N  N   . LYS D 1 170 ? 166.985 155.435 129.674 1.00 132.52 ? 170 LYS E N   1 
ATOM   10543 C  CA  . LYS D 1 170 ? 165.693 154.915 130.123 1.00 132.20 ? 170 LYS E CA  1 
ATOM   10544 C  C   . LYS D 1 170 ? 164.680 154.900 128.977 1.00 134.74 ? 170 LYS E C   1 
ATOM   10545 O  O   . LYS D 1 170 ? 164.070 153.859 128.744 1.00 136.12 ? 170 LYS E O   1 
ATOM   10546 C  CB  . LYS D 1 170 ? 165.158 155.724 131.315 1.00 132.53 ? 170 LYS E CB  1 
ATOM   10547 N  N   . PHE D 1 171 ? 164.536 156.024 128.239 1.00 128.81 ? 171 PHE E N   1 
ATOM   10548 C  CA  . PHE D 1 171 ? 163.612 156.154 127.105 1.00 127.87 ? 171 PHE E CA  1 
ATOM   10549 C  C   . PHE D 1 171 ? 163.882 155.087 126.035 1.00 133.62 ? 171 PHE E C   1 
ATOM   10550 O  O   . PHE D 1 171 ? 162.925 154.498 125.535 1.00 133.87 ? 171 PHE E O   1 
ATOM   10551 C  CB  . PHE D 1 171 ? 163.691 157.565 126.490 1.00 127.05 ? 171 PHE E CB  1 
ATOM   10552 C  CG  . PHE D 1 171 ? 162.785 157.817 125.307 1.00 128.24 ? 171 PHE E CG  1 
ATOM   10553 C  CD1 . PHE D 1 171 ? 161.424 158.045 125.487 1.00 130.62 ? 171 PHE E CD1 1 
ATOM   10554 C  CD2 . PHE D 1 171 ? 163.298 157.864 124.015 1.00 131.23 ? 171 PHE E CD2 1 
ATOM   10555 C  CE1 . PHE D 1 171 ? 160.589 158.291 124.392 1.00 131.14 ? 171 PHE E CE1 1 
ATOM   10556 C  CE2 . PHE D 1 171 ? 162.463 158.108 122.922 1.00 133.66 ? 171 PHE E CE2 1 
ATOM   10557 C  CZ  . PHE D 1 171 ? 161.115 158.317 123.116 1.00 130.67 ? 171 PHE E CZ  1 
ATOM   10558 N  N   . VAL D 1 172 ? 165.175 154.828 125.709 1.00 131.40 ? 172 VAL E N   1 
ATOM   10559 C  CA  . VAL D 1 172 ? 165.604 153.829 124.715 1.00 134.03 ? 172 VAL E CA  1 
ATOM   10560 C  C   . VAL D 1 172 ? 165.163 152.421 125.169 1.00 142.01 ? 172 VAL E C   1 
ATOM   10561 O  O   . VAL D 1 172 ? 164.487 151.721 124.411 1.00 143.33 ? 172 VAL E O   1 
ATOM   10562 C  CB  . VAL D 1 172 ? 167.131 153.915 124.437 1.00 138.37 ? 172 VAL E CB  1 
ATOM   10563 C  CG1 . VAL D 1 172 ? 167.642 152.675 123.708 1.00 142.48 ? 172 VAL E CG1 1 
ATOM   10564 C  CG2 . VAL D 1 172 ? 167.470 155.173 123.644 1.00 135.38 ? 172 VAL E CG2 1 
ATOM   10565 N  N   . VAL D 1 173 ? 165.499 152.047 126.420 1.00 140.36 ? 173 VAL E N   1 
ATOM   10566 C  CA  . VAL D 1 173 ? 165.163 150.757 127.034 1.00 144.23 ? 173 VAL E CA  1 
ATOM   10567 C  C   . VAL D 1 173 ? 163.618 150.583 127.109 1.00 148.66 ? 173 VAL E C   1 
ATOM   10568 O  O   . VAL D 1 173 ? 163.128 149.479 126.860 1.00 151.36 ? 173 VAL E O   1 
ATOM   10569 C  CB  . VAL D 1 173 ? 165.867 150.610 128.413 1.00 149.06 ? 173 VAL E CB  1 
ATOM   10570 C  CG1 . VAL D 1 173 ? 165.299 149.456 129.237 1.00 152.14 ? 173 VAL E CG1 1 
ATOM   10571 C  CG2 . VAL D 1 173 ? 167.374 150.439 128.236 1.00 151.10 ? 173 VAL E CG2 1 
ATOM   10572 N  N   . THR D 1 174 ? 162.867 151.677 127.381 1.00 142.61 ? 174 THR E N   1 
ATOM   10573 C  CA  . THR D 1 174 ? 161.397 151.679 127.456 1.00 142.42 ? 174 THR E CA  1 
ATOM   10574 C  C   . THR D 1 174 ? 160.789 151.212 126.128 1.00 148.33 ? 174 THR E C   1 
ATOM   10575 O  O   . THR D 1 174 ? 159.951 150.316 126.145 1.00 150.54 ? 174 THR E O   1 
ATOM   10576 C  CB  . THR D 1 174 ? 160.865 153.076 127.853 1.00 151.22 ? 174 THR E CB  1 
ATOM   10577 O  OG1 . THR D 1 174 ? 161.465 153.470 129.086 1.00 155.12 ? 174 THR E OG1 1 
ATOM   10578 C  CG2 . THR D 1 174 ? 159.340 153.122 127.992 1.00 148.67 ? 174 THR E CG2 1 
ATOM   10579 N  N   . GLN D 1 175 ? 161.225 151.797 124.992 1.00 144.37 ? 175 GLN E N   1 
ATOM   10580 C  CA  . GLN D 1 175 ? 160.721 151.463 123.653 1.00 146.30 ? 175 GLN E CA  1 
ATOM   10581 C  C   . GLN D 1 175 ? 161.069 150.013 123.262 1.00 157.17 ? 175 GLN E C   1 
ATOM   10582 O  O   . GLN D 1 175 ? 160.233 149.326 122.667 1.00 159.69 ? 175 GLN E O   1 
ATOM   10583 C  CB  . GLN D 1 175 ? 161.252 152.450 122.590 1.00 145.17 ? 175 GLN E CB  1 
ATOM   10584 C  CG  . GLN D 1 175 ? 161.111 153.941 122.929 1.00 149.38 ? 175 GLN E CG  1 
ATOM   10585 C  CD  . GLN D 1 175 ? 159.696 154.464 122.900 1.00 162.83 ? 175 GLN E CD  1 
ATOM   10586 O  OE1 . GLN D 1 175 ? 159.238 155.020 121.901 1.00 155.12 ? 175 GLN E OE1 1 
ATOM   10587 N  NE2 . GLN D 1 175 ? 158.996 154.361 124.021 1.00 156.33 ? 175 GLN E NE2 1 
ATOM   10588 N  N   . CYS D 1 176 ? 162.281 149.542 123.638 1.00 156.28 ? 176 CYS E N   1 
ATOM   10589 C  CA  . CYS D 1 176 ? 162.773 148.183 123.368 1.00 161.71 ? 176 CYS E CA  1 
ATOM   10590 C  C   . CYS D 1 176 ? 161.941 147.112 124.103 1.00 169.84 ? 176 CYS E C   1 
ATOM   10591 O  O   . CYS D 1 176 ? 162.019 145.935 123.747 1.00 174.68 ? 176 CYS E O   1 
ATOM   10592 C  CB  . CYS D 1 176 ? 164.252 148.068 123.720 1.00 163.02 ? 176 CYS E CB  1 
ATOM   10593 S  SG  . CYS D 1 176 ? 165.343 149.033 122.647 1.00 165.02 ? 176 CYS E SG  1 
ATOM   10594 N  N   . ILE D 1 177 ? 161.162 147.515 125.122 1.00 164.40 ? 177 ILE E N   1 
ATOM   10595 C  CA  . ILE D 1 177 ? 160.283 146.623 125.882 1.00 167.28 ? 177 ILE E CA  1 
ATOM   10596 C  C   . ILE D 1 177 ? 158.849 146.822 125.367 1.00 170.45 ? 177 ILE E C   1 
ATOM   10597 O  O   . ILE D 1 177 ? 158.151 145.843 125.115 1.00 174.35 ? 177 ILE E O   1 
ATOM   10598 C  CB  . ILE D 1 177 ? 160.418 146.857 127.422 1.00 169.01 ? 177 ILE E CB  1 
ATOM   10599 C  CG1 . ILE D 1 177 ? 161.840 146.503 127.915 1.00 171.16 ? 177 ILE E CG1 1 
ATOM   10600 C  CG2 . ILE D 1 177 ? 159.348 146.082 128.222 1.00 172.63 ? 177 ILE E CG2 1 
ATOM   10601 C  CD1 . ILE D 1 177 ? 162.251 147.120 129.263 1.00 176.10 ? 177 ILE E CD1 1 
ATOM   10602 N  N   . LEU D 1 178 ? 158.438 148.093 125.184 1.00 161.90 ? 178 LEU E N   1 
ATOM   10603 C  CA  . LEU D 1 178 ? 157.109 148.503 124.734 1.00 160.43 ? 178 LEU E CA  1 
ATOM   10604 C  C   . LEU D 1 178 ? 156.758 147.928 123.355 1.00 167.04 ? 178 LEU E C   1 
ATOM   10605 O  O   . LEU D 1 178 ? 155.792 147.172 123.265 1.00 169.98 ? 178 LEU E O   1 
ATOM   10606 C  CB  . LEU D 1 178 ? 157.011 150.043 124.719 1.00 154.89 ? 178 LEU E CB  1 
ATOM   10607 C  CG  . LEU D 1 178 ? 155.663 150.671 124.350 1.00 158.09 ? 178 LEU E CG  1 
ATOM   10608 C  CD1 . LEU D 1 178 ? 154.697 150.648 125.526 1.00 158.25 ? 178 LEU E CD1 1 
ATOM   10609 C  CD2 . LEU D 1 178 ? 155.852 152.092 123.880 1.00 155.91 ? 178 LEU E CD2 1 
ATOM   10610 N  N   . LEU D 1 179 ? 157.541 148.279 122.303 1.00 162.55 ? 179 LEU E N   1 
ATOM   10611 C  CA  . LEU D 1 179 ? 157.326 147.875 120.907 1.00 165.17 ? 179 LEU E CA  1 
ATOM   10612 C  C   . LEU D 1 179 ? 157.099 146.345 120.723 1.00 175.25 ? 179 LEU E C   1 
ATOM   10613 O  O   . LEU D 1 179 ? 156.075 146.008 120.127 1.00 177.31 ? 179 LEU E O   1 
ATOM   10614 C  CB  . LEU D 1 179 ? 158.465 148.357 119.997 1.00 164.06 ? 179 LEU E CB  1 
ATOM   10615 N  N   . PRO D 1 180 ? 157.946 145.401 121.224 1.00 174.61 ? 180 PRO E N   1 
ATOM   10616 C  CA  . PRO D 1 180 ? 157.656 143.974 120.992 1.00 180.89 ? 180 PRO E CA  1 
ATOM   10617 C  C   . PRO D 1 180 ? 156.430 143.470 121.760 1.00 186.17 ? 180 PRO E C   1 
ATOM   10618 O  O   . PRO D 1 180 ? 155.629 142.741 121.181 1.00 190.06 ? 180 PRO E O   1 
ATOM   10619 C  CB  . PRO D 1 180 ? 158.937 143.263 121.454 1.00 185.23 ? 180 PRO E CB  1 
ATOM   10620 C  CG  . PRO D 1 180 ? 159.975 144.334 121.551 1.00 184.81 ? 180 PRO E CG  1 
ATOM   10621 C  CD  . PRO D 1 180 ? 159.222 145.558 121.948 1.00 174.61 ? 180 PRO E CD  1 
ATOM   10622 N  N   . VAL D 1 181 ? 156.269 143.877 123.039 1.00 179.66 ? 181 VAL E N   1 
ATOM   10623 C  CA  . VAL D 1 181 ? 155.155 143.474 123.911 1.00 181.19 ? 181 VAL E CA  1 
ATOM   10624 C  C   . VAL D 1 181 ? 153.815 143.989 123.344 1.00 184.21 ? 181 VAL E C   1 
ATOM   10625 O  O   . VAL D 1 181 ? 152.853 143.218 123.284 1.00 188.26 ? 181 VAL E O   1 
ATOM   10626 C  CB  . VAL D 1 181 ? 155.386 143.928 125.385 1.00 181.74 ? 181 VAL E CB  1 
ATOM   10627 C  CG1 . VAL D 1 181 ? 154.114 143.836 126.227 1.00 182.21 ? 181 VAL E CG1 1 
ATOM   10628 C  CG2 . VAL D 1 181 ? 156.506 143.119 126.033 1.00 184.31 ? 181 VAL E CG2 1 
ATOM   10629 N  N   . SER D 1 182 ? 153.767 145.267 122.910 1.00 175.33 ? 182 SER E N   1 
ATOM   10630 C  CA  . SER D 1 182 ? 152.564 145.899 122.356 1.00 173.71 ? 182 SER E CA  1 
ATOM   10631 C  C   . SER D 1 182 ? 152.147 145.266 121.023 1.00 181.01 ? 182 SER E C   1 
ATOM   10632 O  O   . SER D 1 182 ? 150.967 144.953 120.858 1.00 183.51 ? 182 SER E O   1 
ATOM   10633 C  CB  . SER D 1 182 ? 152.770 147.400 122.176 1.00 171.20 ? 182 SER E CB  1 
ATOM   10634 O  OG  . SER D 1 182 ? 153.174 148.017 123.388 1.00 176.56 ? 182 SER E OG  1 
ATOM   10635 N  N   . SER D 1 183 ? 153.110 145.057 120.095 1.00 177.42 ? 183 SER E N   1 
ATOM   10636 C  CA  . SER D 1 183 ? 152.880 144.460 118.774 1.00 181.25 ? 183 SER E CA  1 
ATOM   10637 C  C   . SER D 1 183 ? 152.279 143.051 118.871 1.00 190.16 ? 183 SER E C   1 
ATOM   10638 O  O   . SER D 1 183 ? 151.356 142.739 118.116 1.00 193.33 ? 183 SER E O   1 
ATOM   10639 C  CB  . SER D 1 183 ? 154.177 144.410 117.974 1.00 185.37 ? 183 SER E CB  1 
ATOM   10640 O  OG  . SER D 1 183 ? 155.195 143.724 118.683 1.00 196.31 ? 183 SER E OG  1 
ATOM   10641 N  N   . LEU D 1 184 ? 152.790 142.216 119.802 1.00 187.38 ? 184 LEU E N   1 
ATOM   10642 C  CA  . LEU D 1 184 ? 152.308 140.850 120.013 1.00 193.65 ? 184 LEU E CA  1 
ATOM   10643 C  C   . LEU D 1 184 ? 150.909 140.840 120.629 1.00 198.08 ? 184 LEU E C   1 
ATOM   10644 O  O   . LEU D 1 184 ? 150.085 140.022 120.222 1.00 203.59 ? 184 LEU E O   1 
ATOM   10645 C  CB  . LEU D 1 184 ? 153.268 140.045 120.902 1.00 195.58 ? 184 LEU E CB  1 
ATOM   10646 C  CG  . LEU D 1 184 ? 154.644 139.696 120.341 1.00 201.46 ? 184 LEU E CG  1 
ATOM   10647 C  CD1 . LEU D 1 184 ? 155.592 139.319 121.457 1.00 201.51 ? 184 LEU E CD1 1 
ATOM   10648 C  CD2 . LEU D 1 184 ? 154.567 138.571 119.324 1.00 207.37 ? 184 LEU E CD2 1 
ATOM   10649 N  N   . LEU D 1 185 ? 150.641 141.743 121.601 1.00 189.06 ? 185 LEU E N   1 
ATOM   10650 C  CA  . LEU D 1 185 ? 149.349 141.865 122.290 1.00 189.22 ? 185 LEU E CA  1 
ATOM   10651 C  C   . LEU D 1 185 ? 148.220 142.213 121.306 1.00 194.53 ? 185 LEU E C   1 
ATOM   10652 O  O   . LEU D 1 185 ? 147.114 141.686 121.442 1.00 198.47 ? 185 LEU E O   1 
ATOM   10653 C  CB  . LEU D 1 185 ? 149.431 142.917 123.415 1.00 182.82 ? 185 LEU E CB  1 
ATOM   10654 C  CG  . LEU D 1 185 ? 148.207 143.062 124.340 1.00 187.80 ? 185 LEU E CG  1 
ATOM   10655 C  CD1 . LEU D 1 185 ? 148.062 141.869 125.278 1.00 193.32 ? 185 LEU E CD1 1 
ATOM   10656 C  CD2 . LEU D 1 185 ? 148.280 144.345 125.143 1.00 183.41 ? 185 LEU E CD2 1 
ATOM   10657 N  N   . LEU D 1 186 ? 148.508 143.081 120.316 1.00 187.78 ? 186 LEU E N   1 
ATOM   10658 C  CA  . LEU D 1 186 ? 147.557 143.493 119.277 1.00 188.52 ? 186 LEU E CA  1 
ATOM   10659 C  C   . LEU D 1 186 ? 147.262 142.342 118.311 1.00 200.22 ? 186 LEU E C   1 
ATOM   10660 O  O   . LEU D 1 186 ? 146.132 142.218 117.833 1.00 202.90 ? 186 LEU E O   1 
ATOM   10661 C  CB  . LEU D 1 186 ? 148.094 144.704 118.495 1.00 182.95 ? 186 LEU E CB  1 
ATOM   10662 C  CG  . LEU D 1 186 ? 148.172 146.021 119.252 1.00 180.06 ? 186 LEU E CG  1 
ATOM   10663 C  CD1 . LEU D 1 186 ? 149.309 146.861 118.734 1.00 175.71 ? 186 LEU E CD1 1 
ATOM   10664 C  CD2 . LEU D 1 186 ? 146.867 146.780 119.171 1.00 180.62 ? 186 LEU E CD2 1 
ATOM   10665 N  N   . TYR D 1 187 ? 148.284 141.509 118.026 1.00 200.20 ? 187 TYR E N   1 
ATOM   10666 C  CA  . TYR D 1 187 ? 148.189 140.348 117.144 1.00 206.58 ? 187 TYR E CA  1 
ATOM   10667 C  C   . TYR D 1 187 ? 147.231 139.303 117.732 1.00 212.19 ? 187 TYR E C   1 
ATOM   10668 O  O   . TYR D 1 187 ? 146.374 138.802 117.011 1.00 214.52 ? 187 TYR E O   1 
ATOM   10669 C  CB  . TYR D 1 187 ? 149.579 139.738 116.899 1.00 207.72 ? 187 TYR E CB  1 
ATOM   10670 N  N   . ILE D 1 188 ? 147.343 139.027 119.046 1.00 209.68 ? 188 ILE E N   1 
ATOM   10671 C  CA  . ILE D 1 188 ? 146.521 138.062 119.788 1.00 212.12 ? 188 ILE E CA  1 
ATOM   10672 C  C   . ILE D 1 188 ? 145.031 138.483 119.786 1.00 215.94 ? 188 ILE E C   1 
ATOM   10673 O  O   . ILE D 1 188 ? 144.165 137.627 119.593 1.00 218.43 ? 188 ILE E O   1 
ATOM   10674 C  CB  . ILE D 1 188 ? 147.088 137.892 121.229 1.00 213.16 ? 188 ILE E CB  1 
ATOM   10675 C  CG1 . ILE D 1 188 ? 148.425 137.117 121.195 1.00 213.89 ? 188 ILE E CG1 1 
ATOM   10676 C  CG2 . ILE D 1 188 ? 146.084 137.215 122.175 1.00 215.66 ? 188 ILE E CG2 1 
ATOM   10677 C  CD1 . ILE D 1 188 ? 149.368 137.396 122.335 1.00 216.61 ? 188 ILE E CD1 1 
ATOM   10678 N  N   . ILE D 1 189 ? 144.742 139.785 119.984 1.00 211.76 ? 189 ILE E N   1 
ATOM   10679 C  CA  . ILE D 1 189 ? 143.374 140.313 120.008 1.00 212.28 ? 189 ILE E CA  1 
ATOM   10680 C  C   . ILE D 1 189 ? 142.735 140.260 118.605 1.00 217.22 ? 189 ILE E C   1 
ATOM   10681 O  O   . ILE D 1 189 ? 141.593 139.813 118.481 1.00 219.13 ? 189 ILE E O   1 
ATOM   10682 C  CB  . ILE D 1 189 ? 143.343 141.748 120.589 1.00 211.09 ? 189 ILE E CB  1 
ATOM   10683 N  N   . LYS D 1 190 ? 143.481 140.687 117.561 1.00 214.63 ? 190 LYS E N   1 
ATOM   10684 C  CA  . LYS D 1 190 ? 143.017 140.720 116.170 1.00 216.30 ? 190 LYS E CA  1 
ATOM   10685 C  C   . LYS D 1 190 ? 142.869 139.313 115.553 1.00 223.65 ? 190 LYS E C   1 
ATOM   10686 O  O   . LYS D 1 190 ? 141.856 139.054 114.899 1.00 225.73 ? 190 LYS E O   1 
ATOM   10687 C  CB  . LYS D 1 190 ? 143.957 141.575 115.306 1.00 215.85 ? 190 LYS E CB  1 
ATOM   10688 N  N   . ILE D 1 191 ? 143.863 138.417 115.750 1.00 222.80 ? 191 ILE E N   1 
ATOM   10689 C  CA  . ILE D 1 191 ? 143.849 137.060 115.183 1.00 226.62 ? 191 ILE E CA  1 
ATOM   10690 C  C   . ILE D 1 191 ? 142.932 136.133 116.006 1.00 232.50 ? 191 ILE E C   1 
ATOM   10691 O  O   . ILE D 1 191 ? 142.011 135.543 115.439 1.00 235.11 ? 191 ILE E O   1 
ATOM   10692 C  CB  . ILE D 1 191 ? 145.294 136.480 115.025 1.00 228.71 ? 191 ILE E CB  1 
ATOM   10693 C  CG1 . ILE D 1 191 ? 146.166 137.305 114.027 1.00 227.17 ? 191 ILE E CG1 1 
ATOM   10694 C  CG2 . ILE D 1 191 ? 145.308 134.974 114.699 1.00 233.24 ? 191 ILE E CG2 1 
ATOM   10695 C  CD1 . ILE D 1 191 ? 145.703 137.396 112.512 1.00 233.93 ? 191 ILE E CD1 1 
ATOM   10696 N  N   . GLY D 1 192 ? 143.202 136.011 117.307 1.00 229.94 ? 192 GLY E N   1 
ATOM   10697 C  CA  . GLY D 1 192 ? 142.446 135.159 118.220 1.00 232.57 ? 192 GLY E CA  1 
ATOM   10698 C  C   . GLY D 1 192 ? 140.999 135.564 118.421 1.00 236.93 ? 192 GLY E C   1 
ATOM   10699 O  O   . GLY D 1 192 ? 140.628 136.717 118.189 1.00 234.66 ? 192 GLY E O   1 
ATOM   10700 N  N   . GLY D 1 193 ? 140.191 134.601 118.851 1.00 238.50 ? 193 GLY E N   1 
ATOM   10701 C  CA  . GLY D 1 193 ? 138.767 134.792 119.098 1.00 240.11 ? 193 GLY E CA  1 
ATOM   10702 C  C   . GLY D 1 193 ? 137.960 133.505 119.075 1.00 243.61 ? 193 GLY E C   1 
ATOM   10703 O  O   . GLY D 1 193 ? 138.465 132.476 118.618 1.00 243.63 ? 193 GLY E O   1 
ATOM   10704 N  N   . ASP D 1 194 ? 136.694 133.520 119.562 1.00 242.56 ? 194 ASP E N   1 
ATOM   10705 C  CA  . ASP D 1 194 ? 135.987 134.673 120.141 1.00 242.43 ? 194 ASP E CA  1 
ATOM   10706 C  C   . ASP D 1 194 ? 136.371 134.883 121.619 1.00 243.70 ? 194 ASP E C   1 
ATOM   10707 O  O   . ASP D 1 194 ? 135.967 135.878 122.227 1.00 243.40 ? 194 ASP E O   1 
ATOM   10708 C  CB  . ASP D 1 194 ? 134.467 134.485 120.003 1.00 242.96 ? 194 ASP E CB  1 
ATOM   10709 N  N   . TYR D 1 195 ? 137.176 133.956 122.174 1.00 242.70 ? 195 TYR E N   1 
ATOM   10710 C  CA  . TYR D 1 195 ? 137.659 133.988 123.550 1.00 242.57 ? 195 TYR E CA  1 
ATOM   10711 C  C   . TYR D 1 195 ? 139.110 134.528 123.590 1.00 243.27 ? 195 TYR E C   1 
ATOM   10712 O  O   . TYR D 1 195 ? 139.969 133.974 124.285 1.00 242.78 ? 195 TYR E O   1 
ATOM   10713 C  CB  . TYR D 1 195 ? 137.544 132.582 124.164 1.00 242.96 ? 195 TYR E CB  1 
ATOM   10714 N  N   . PHE D 1 196 ? 139.357 135.641 122.851 1.00 238.09 ? 196 PHE E N   1 
ATOM   10715 C  CA  . PHE D 1 196 ? 140.654 136.321 122.728 1.00 234.47 ? 196 PHE E CA  1 
ATOM   10716 C  C   . PHE D 1 196 ? 141.131 136.936 124.056 1.00 234.48 ? 196 PHE E C   1 
ATOM   10717 O  O   . PHE D 1 196 ? 142.342 137.082 124.244 1.00 232.12 ? 196 PHE E O   1 
ATOM   10718 C  CB  . PHE D 1 196 ? 140.603 137.410 121.641 1.00 233.57 ? 196 PHE E CB  1 
ATOM   10719 N  N   . PHE D 1 197 ? 140.184 137.274 124.977 1.00 232.54 ? 197 PHE E N   1 
ATOM   10720 C  CA  . PHE D 1 197 ? 140.450 137.889 126.287 1.00 230.40 ? 197 PHE E CA  1 
ATOM   10721 C  C   . PHE D 1 197 ? 141.138 136.926 127.285 1.00 233.79 ? 197 PHE E C   1 
ATOM   10722 O  O   . PHE D 1 197 ? 141.492 137.352 128.387 1.00 231.86 ? 197 PHE E O   1 
ATOM   10723 C  CB  . PHE D 1 197 ? 139.162 138.476 126.906 1.00 232.21 ? 197 PHE E CB  1 
ATOM   10724 C  CG  . PHE D 1 197 ? 138.119 137.506 127.416 1.00 237.12 ? 197 PHE E CG  1 
ATOM   10725 C  CD1 . PHE D 1 197 ? 137.114 137.037 126.579 1.00 241.89 ? 197 PHE E CD1 1 
ATOM   10726 C  CD2 . PHE D 1 197 ? 138.100 137.117 128.752 1.00 239.59 ? 197 PHE E CD2 1 
ATOM   10727 C  CE1 . PHE D 1 197 ? 136.129 136.167 127.058 1.00 244.62 ? 197 PHE E CE1 1 
ATOM   10728 C  CE2 . PHE D 1 197 ? 137.119 136.242 129.230 1.00 244.84 ? 197 PHE E CE2 1 
ATOM   10729 C  CZ  . PHE D 1 197 ? 136.137 135.777 128.381 1.00 244.23 ? 197 PHE E CZ  1 
ATOM   10730 N  N   . ILE D 1 198 ? 141.317 135.648 126.905 1.00 234.14 ? 198 ILE E N   1 
ATOM   10731 C  CA  . ILE D 1 198 ? 141.986 134.644 127.735 1.00 235.23 ? 198 ILE E CA  1 
ATOM   10732 C  C   . ILE D 1 198 ? 143.451 134.552 127.292 1.00 235.85 ? 198 ILE E C   1 
ATOM   10733 O  O   . ILE D 1 198 ? 144.337 134.591 128.148 1.00 234.13 ? 198 ILE E O   1 
ATOM   10734 C  CB  . ILE D 1 198 ? 141.247 133.272 127.708 1.00 241.71 ? 198 ILE E CB  1 
ATOM   10735 C  CG1 . ILE D 1 198 ? 139.879 133.377 128.402 1.00 243.32 ? 198 ILE E CG1 1 
ATOM   10736 C  CG2 . ILE D 1 198 ? 142.069 132.154 128.360 1.00 243.60 ? 198 ILE E CG2 1 
ATOM   10737 C  CD1 . ILE D 1 198 ? 138.745 133.369 127.488 1.00 245.58 ? 198 ILE E CD1 1 
ATOM   10738 N  N   . TYR D 1 199 ? 143.705 134.464 125.964 1.00 233.53 ? 199 TYR E N   1 
ATOM   10739 C  CA  . TYR D 1 199 ? 145.067 134.390 125.426 1.00 231.92 ? 199 TYR E CA  1 
ATOM   10740 C  C   . TYR D 1 199 ? 145.827 135.702 125.662 1.00 230.67 ? 199 TYR E C   1 
ATOM   10741 O  O   . TYR D 1 199 ? 147.021 135.654 125.957 1.00 228.88 ? 199 TYR E O   1 
ATOM   10742 C  CB  . TYR D 1 199 ? 145.099 134.028 123.927 1.00 233.92 ? 199 TYR E CB  1 
ATOM   10743 C  CG  . TYR D 1 199 ? 143.945 133.195 123.413 1.00 238.61 ? 199 TYR E CG  1 
ATOM   10744 C  CD1 . TYR D 1 199 ? 143.783 131.871 123.809 1.00 243.42 ? 199 TYR E CD1 1 
ATOM   10745 C  CD2 . TYR D 1 199 ? 143.073 133.698 122.455 1.00 239.32 ? 199 TYR E CD2 1 
ATOM   10746 C  CE1 . TYR D 1 199 ? 142.735 131.092 123.318 1.00 244.56 ? 199 TYR E CE1 1 
ATOM   10747 C  CE2 . TYR D 1 199 ? 142.027 132.928 121.951 1.00 243.51 ? 199 TYR E CE2 1 
ATOM   10748 C  CZ  . TYR D 1 199 ? 141.861 131.624 122.385 1.00 246.68 ? 199 TYR E CZ  1 
ATOM   10749 O  OH  . TYR D 1 199 ? 140.830 130.863 121.889 1.00 247.05 ? 199 TYR E OH  1 
ATOM   10750 N  N   . ALA D 1 200 ? 145.135 136.863 125.546 1.00 227.00 ? 200 ALA E N   1 
ATOM   10751 C  CA  . ALA D 1 200 ? 145.711 138.198 125.769 1.00 223.39 ? 200 ALA E CA  1 
ATOM   10752 C  C   . ALA D 1 200 ? 146.030 138.423 127.248 1.00 225.13 ? 200 ALA E C   1 
ATOM   10753 O  O   . ALA D 1 200 ? 147.002 139.113 127.563 1.00 222.25 ? 200 ALA E O   1 
ATOM   10754 C  CB  . ALA D 1 200 ? 144.763 139.276 125.267 1.00 222.83 ? 200 ALA E CB  1 
ATOM   10755 N  N   . TRP D 1 201 ? 145.213 137.834 128.150 1.00 225.09 ? 201 TRP E N   1 
ATOM   10756 C  CA  . TRP D 1 201 ? 145.412 137.905 129.597 1.00 224.48 ? 201 TRP E CA  1 
ATOM   10757 C  C   . TRP D 1 201 ? 146.563 136.978 130.003 1.00 227.26 ? 201 TRP E C   1 
ATOM   10758 O  O   . TRP D 1 201 ? 147.376 137.353 130.850 1.00 225.13 ? 201 TRP E O   1 
ATOM   10759 C  CB  . TRP D 1 201 ? 144.116 137.552 130.344 1.00 226.15 ? 201 TRP E CB  1 
ATOM   10760 C  CG  . TRP D 1 201 ? 144.302 137.234 131.796 1.00 227.35 ? 201 TRP E CG  1 
ATOM   10761 C  CD1 . TRP D 1 201 ? 144.608 138.108 132.796 1.00 227.12 ? 201 TRP E CD1 1 
ATOM   10762 C  CD2 . TRP D 1 201 ? 144.216 135.941 132.404 1.00 230.29 ? 201 TRP E CD2 1 
ATOM   10763 N  NE1 . TRP D 1 201 ? 144.705 137.442 133.994 1.00 228.20 ? 201 TRP E NE1 1 
ATOM   10764 C  CE2 . TRP D 1 201 ? 144.468 136.109 133.783 1.00 232.35 ? 201 TRP E CE2 1 
ATOM   10765 C  CE3 . TRP D 1 201 ? 143.941 134.651 131.918 1.00 234.47 ? 201 TRP E CE3 1 
ATOM   10766 C  CZ2 . TRP D 1 201 ? 144.447 135.038 134.684 1.00 234.49 ? 201 TRP E CZ2 1 
ATOM   10767 C  CZ3 . TRP D 1 201 ? 143.921 133.591 132.811 1.00 238.08 ? 201 TRP E CZ3 1 
ATOM   10768 C  CH2 . TRP D 1 201 ? 144.174 133.788 134.176 1.00 237.82 ? 201 TRP E CH2 1 
ATOM   10769 N  N   . LEU D 1 202 ? 146.635 135.777 129.387 1.00 227.33 ? 202 LEU E N   1 
ATOM   10770 C  CA  . LEU D 1 202 ? 147.690 134.796 129.640 1.00 228.03 ? 202 LEU E CA  1 
ATOM   10771 C  C   . LEU D 1 202 ? 149.031 135.287 129.092 1.00 227.79 ? 202 LEU E C   1 
ATOM   10772 O  O   . LEU D 1 202 ? 150.066 134.950 129.664 1.00 227.06 ? 202 LEU E O   1 
ATOM   10773 C  CB  . LEU D 1 202 ? 147.336 133.433 129.037 1.00 231.74 ? 202 LEU E CB  1 
ATOM   10774 N  N   . PHE D 1 203 ? 149.014 136.090 127.999 1.00 223.72 ? 203 PHE E N   1 
ATOM   10775 C  CA  . PHE D 1 203 ? 150.218 136.678 127.402 1.00 221.13 ? 203 PHE E CA  1 
ATOM   10776 C  C   . PHE D 1 203 ? 150.808 137.711 128.357 1.00 220.52 ? 203 PHE E C   1 
ATOM   10777 O  O   . PHE D 1 203 ? 152.015 137.685 128.597 1.00 219.12 ? 203 PHE E O   1 
ATOM   10778 C  CB  . PHE D 1 203 ? 149.924 137.307 126.024 1.00 221.60 ? 203 PHE E CB  1 
ATOM   10779 C  CG  . PHE D 1 203 ? 151.040 138.156 125.453 1.00 219.97 ? 203 PHE E CG  1 
ATOM   10780 C  CD1 . PHE D 1 203 ? 152.187 137.568 124.932 1.00 222.40 ? 203 PHE E CD1 1 
ATOM   10781 C  CD2 . PHE D 1 203 ? 150.935 139.540 125.421 1.00 218.65 ? 203 PHE E CD2 1 
ATOM   10782 C  CE1 . PHE D 1 203 ? 153.218 138.353 124.408 1.00 220.83 ? 203 PHE E CE1 1 
ATOM   10783 C  CE2 . PHE D 1 203 ? 151.965 140.324 124.894 1.00 218.39 ? 203 PHE E CE2 1 
ATOM   10784 C  CZ  . PHE D 1 203 ? 153.101 139.725 124.395 1.00 217.63 ? 203 PHE E CZ  1 
ATOM   10785 N  N   . THR D 1 204 ? 149.953 138.601 128.914 1.00 217.01 ? 204 THR E N   1 
ATOM   10786 C  CA  . THR D 1 204 ? 150.351 139.629 129.881 1.00 214.35 ? 204 THR E CA  1 
ATOM   10787 C  C   . THR D 1 204 ? 150.828 138.966 131.179 1.00 217.51 ? 204 THR E C   1 
ATOM   10788 O  O   . THR D 1 204 ? 151.735 139.489 131.821 1.00 215.42 ? 204 THR E O   1 
ATOM   10789 C  CB  . THR D 1 204 ? 149.218 140.639 130.144 1.00 218.89 ? 204 THR E CB  1 
ATOM   10790 O  OG1 . THR D 1 204 ? 148.033 139.953 130.550 1.00 221.67 ? 204 THR E OG1 1 
ATOM   10791 C  CG2 . THR D 1 204 ? 148.927 141.526 128.943 1.00 215.68 ? 204 THR E CG2 1 
ATOM   10792 N  N   . LEU D 1 205 ? 150.242 137.798 131.533 1.00 217.87 ? 205 LEU E N   1 
ATOM   10793 C  CA  . LEU D 1 205 ? 150.597 136.998 132.709 1.00 218.90 ? 205 LEU E CA  1 
ATOM   10794 C  C   . LEU D 1 205 ? 152.040 136.472 132.583 1.00 220.91 ? 205 LEU E C   1 
ATOM   10795 O  O   . LEU D 1 205 ? 152.787 136.505 133.563 1.00 219.85 ? 205 LEU E O   1 
ATOM   10796 C  CB  . LEU D 1 205 ? 149.600 135.832 132.862 1.00 222.43 ? 205 LEU E CB  1 
ATOM   10797 C  CG  . LEU D 1 205 ? 149.551 135.132 134.215 1.00 227.20 ? 205 LEU E CG  1 
ATOM   10798 C  CD1 . LEU D 1 205 ? 148.127 134.830 134.610 1.00 229.66 ? 205 LEU E CD1 1 
ATOM   10799 C  CD2 . LEU D 1 205 ? 150.359 133.847 134.200 1.00 231.01 ? 205 LEU E CD2 1 
ATOM   10800 N  N   . VAL D 1 206 ? 152.421 136.002 131.373 1.00 219.03 ? 206 VAL E N   1 
ATOM   10801 C  CA  . VAL D 1 206 ? 153.760 135.483 131.068 1.00 218.70 ? 206 VAL E CA  1 
ATOM   10802 C  C   . VAL D 1 206 ? 154.751 136.653 131.021 1.00 218.35 ? 206 VAL E C   1 
ATOM   10803 O  O   . VAL D 1 206 ? 155.776 136.598 131.697 1.00 217.37 ? 206 VAL E O   1 
ATOM   10804 C  CB  . VAL D 1 206 ? 153.781 134.643 129.759 1.00 223.03 ? 206 VAL E CB  1 
ATOM   10805 C  CG1 . VAL D 1 206 ? 155.206 134.303 129.328 1.00 222.55 ? 206 VAL E CG1 1 
ATOM   10806 C  CG2 . VAL D 1 206 ? 152.957 133.369 129.913 1.00 226.36 ? 206 VAL E CG2 1 
ATOM   10807 N  N   . VAL D 1 207 ? 154.421 137.717 130.253 1.00 214.55 ? 207 VAL E N   1 
ATOM   10808 C  CA  . VAL D 1 207 ? 155.226 138.934 130.080 1.00 211.72 ? 207 VAL E CA  1 
ATOM   10809 C  C   . VAL D 1 207 ? 155.521 139.581 131.455 1.00 213.05 ? 207 VAL E C   1 
ATOM   10810 O  O   . VAL D 1 207 ? 156.648 140.032 131.667 1.00 211.29 ? 207 VAL E O   1 
ATOM   10811 C  CB  . VAL D 1 207 ? 154.547 139.913 129.077 1.00 213.20 ? 207 VAL E CB  1 
ATOM   10812 C  CG1 . VAL D 1 207 ? 155.063 141.346 129.206 1.00 207.76 ? 207 VAL E CG1 1 
ATOM   10813 C  CG2 . VAL D 1 207 ? 154.719 139.419 127.646 1.00 214.24 ? 207 VAL E CG2 1 
ATOM   10814 N  N   . SER D 1 208 ? 154.540 139.568 132.391 1.00 211.52 ? 208 SER E N   1 
ATOM   10815 C  CA  . SER D 1 208 ? 154.700 140.118 133.742 1.00 210.27 ? 208 SER E CA  1 
ATOM   10816 C  C   . SER D 1 208 ? 155.782 139.359 134.523 1.00 213.11 ? 208 SER E C   1 
ATOM   10817 O  O   . SER D 1 208 ? 156.760 139.972 134.949 1.00 211.16 ? 208 SER E O   1 
ATOM   10818 C  CB  . SER D 1 208 ? 153.378 140.091 134.509 1.00 213.94 ? 208 SER E CB  1 
ATOM   10819 O  OG  . SER D 1 208 ? 152.412 140.936 133.907 1.00 219.63 ? 208 SER E OG  1 
ATOM   10820 N  N   . LEU D 1 209 ? 155.628 138.027 134.660 1.00 213.08 ? 209 LEU E N   1 
ATOM   10821 C  CA  . LEU D 1 209 ? 156.552 137.155 135.392 1.00 213.90 ? 209 LEU E CA  1 
ATOM   10822 C  C   . LEU D 1 209 ? 157.959 137.105 134.764 1.00 215.27 ? 209 LEU E C   1 
ATOM   10823 O  O   . LEU D 1 209 ? 158.937 136.957 135.502 1.00 214.84 ? 209 LEU E O   1 
ATOM   10824 C  CB  . LEU D 1 209 ? 155.972 135.737 135.505 1.00 217.18 ? 209 LEU E CB  1 
ATOM   10825 C  CG  . LEU D 1 209 ? 154.668 135.607 136.308 1.00 221.70 ? 209 LEU E CG  1 
ATOM   10826 C  CD1 . LEU D 1 209 ? 153.971 134.303 136.002 1.00 225.21 ? 209 LEU E CD1 1 
ATOM   10827 C  CD2 . LEU D 1 209 ? 154.913 135.738 137.806 1.00 223.09 ? 209 LEU E CD2 1 
ATOM   10828 N  N   . VAL D 1 210 ? 158.063 137.242 133.422 1.00 212.19 ? 210 VAL E N   1 
ATOM   10829 C  CA  . VAL D 1 210 ? 159.344 137.236 132.702 1.00 211.19 ? 210 VAL E CA  1 
ATOM   10830 C  C   . VAL D 1 210 ? 160.099 138.544 133.005 1.00 210.93 ? 210 VAL E C   1 
ATOM   10831 O  O   . VAL D 1 210 ? 161.253 138.487 133.431 1.00 210.22 ? 210 VAL E O   1 
ATOM   10832 C  CB  . VAL D 1 210 ? 159.171 136.989 131.175 1.00 214.33 ? 210 VAL E CB  1 
ATOM   10833 C  CG1 . VAL D 1 210 ? 160.451 137.303 130.401 1.00 213.12 ? 210 VAL E CG1 1 
ATOM   10834 C  CG2 . VAL D 1 210 ? 158.729 135.555 130.902 1.00 217.31 ? 210 VAL E CG2 1 
ATOM   10835 N  N   . LEU D 1 211 ? 159.433 139.705 132.829 1.00 206.96 ? 211 LEU E N   1 
ATOM   10836 C  CA  . LEU D 1 211 ? 160.012 141.030 133.079 1.00 203.10 ? 211 LEU E CA  1 
ATOM   10837 C  C   . LEU D 1 211 ? 160.378 141.247 134.556 1.00 207.11 ? 211 LEU E C   1 
ATOM   10838 O  O   . LEU D 1 211 ? 161.292 142.021 134.833 1.00 203.89 ? 211 LEU E O   1 
ATOM   10839 C  CB  . LEU D 1 211 ? 159.064 142.149 132.615 1.00 197.61 ? 211 LEU E CB  1 
ATOM   10840 C  CG  . LEU D 1 211 ? 159.018 142.452 131.117 1.00 200.43 ? 211 LEU E CG  1 
ATOM   10841 C  CD1 . LEU D 1 211 ? 157.793 143.259 130.783 1.00 196.91 ? 211 LEU E CD1 1 
ATOM   10842 C  CD2 . LEU D 1 211 ? 160.260 143.208 130.656 1.00 199.52 ? 211 LEU E CD2 1 
ATOM   10843 N  N   . VAL D 1 212 ? 159.681 140.566 135.494 1.00 206.59 ? 212 VAL E N   1 
ATOM   10844 C  CA  . VAL D 1 212 ? 159.940 140.662 136.935 1.00 206.54 ? 212 VAL E CA  1 
ATOM   10845 C  C   . VAL D 1 212 ? 161.316 140.033 137.247 1.00 210.67 ? 212 VAL E C   1 
ATOM   10846 O  O   . VAL D 1 212 ? 162.106 140.637 137.976 1.00 209.11 ? 212 VAL E O   1 
ATOM   10847 C  CB  . VAL D 1 212 ? 158.776 140.034 137.761 1.00 210.66 ? 212 VAL E CB  1 
ATOM   10848 C  CG1 . VAL D 1 212 ? 159.235 139.534 139.128 1.00 211.34 ? 212 VAL E CG1 1 
ATOM   10849 C  CG2 . VAL D 1 212 ? 157.628 141.026 137.920 1.00 209.52 ? 212 VAL E CG2 1 
ATOM   10850 N  N   . THR D 1 213 ? 161.609 138.856 136.655 1.00 211.26 ? 213 THR E N   1 
ATOM   10851 C  CA  . THR D 1 213 ? 162.863 138.118 136.851 1.00 212.51 ? 213 THR E CA  1 
ATOM   10852 C  C   . THR D 1 213 ? 164.032 138.781 136.087 1.00 214.77 ? 213 THR E C   1 
ATOM   10853 O  O   . THR D 1 213 ? 165.153 138.791 136.600 1.00 214.46 ? 213 THR E O   1 
ATOM   10854 C  CB  . THR D 1 213 ? 162.694 136.636 136.437 1.00 219.69 ? 213 THR E CB  1 
ATOM   10855 O  OG1 . THR D 1 213 ? 161.407 136.159 136.840 1.00 220.48 ? 213 THR E OG1 1 
ATOM   10856 C  CG2 . THR D 1 213 ? 163.776 135.730 137.018 1.00 219.69 ? 213 THR E CG2 1 
ATOM   10857 N  N   . ILE D 1 214 ? 163.775 139.326 134.879 1.00 212.15 ? 214 ILE E N   1 
ATOM   10858 C  CA  . ILE D 1 214 ? 164.802 139.946 134.033 1.00 211.08 ? 214 ILE E CA  1 
ATOM   10859 C  C   . ILE D 1 214 ? 165.278 141.305 134.598 1.00 212.40 ? 214 ILE E C   1 
ATOM   10860 O  O   . ILE D 1 214 ? 166.489 141.514 134.681 1.00 211.72 ? 214 ILE E O   1 
ATOM   10861 C  CB  . ILE D 1 214 ? 164.305 140.074 132.555 1.00 212.99 ? 214 ILE E CB  1 
ATOM   10862 C  CG1 . ILE D 1 214 ? 164.113 138.690 131.871 1.00 215.73 ? 214 ILE E CG1 1 
ATOM   10863 C  CG2 . ILE D 1 214 ? 165.183 141.006 131.701 1.00 211.78 ? 214 ILE E CG2 1 
ATOM   10864 C  CD1 . ILE D 1 214 ? 165.375 137.734 131.767 1.00 222.78 ? 214 ILE E CD1 1 
ATOM   10865 N  N   . TYR D 1 215 ? 164.334 142.209 134.967 1.00 209.63 ? 215 TYR E N   1 
ATOM   10866 C  CA  . TYR D 1 215 ? 164.557 143.589 135.441 1.00 206.90 ? 215 TYR E CA  1 
ATOM   10867 C  C   . TYR D 1 215 ? 165.808 143.785 136.326 1.00 210.68 ? 215 TYR E C   1 
ATOM   10868 O  O   . TYR D 1 215 ? 166.776 144.379 135.852 1.00 209.67 ? 215 TYR E O   1 
ATOM   10869 C  CB  . TYR D 1 215 ? 163.324 144.142 136.178 1.00 205.37 ? 215 TYR E CB  1 
ATOM   10870 N  N   . ALA D 1 216 ? 165.787 143.293 137.584 1.00 209.42 ? 216 ALA E N   1 
ATOM   10871 C  CA  . ALA D 1 216 ? 166.865 143.445 138.572 1.00 209.38 ? 216 ALA E CA  1 
ATOM   10872 C  C   . ALA D 1 216 ? 168.208 142.839 138.133 1.00 212.76 ? 216 ALA E C   1 
ATOM   10873 O  O   . ALA D 1 216 ? 169.256 143.297 138.595 1.00 212.23 ? 216 ALA E O   1 
ATOM   10874 C  CB  . ALA D 1 216 ? 166.443 142.829 139.894 1.00 210.98 ? 216 ALA E CB  1 
ATOM   10875 N  N   . ASP D 1 217 ? 168.178 141.824 137.254 1.00 211.53 ? 217 ASP E N   1 
ATOM   10876 C  CA  . ASP D 1 217 ? 169.375 141.135 136.778 1.00 212.36 ? 217 ASP E CA  1 
ATOM   10877 C  C   . ASP D 1 217 ? 169.969 141.724 135.489 1.00 213.77 ? 217 ASP E C   1 
ATOM   10878 O  O   . ASP D 1 217 ? 171.178 141.597 135.287 1.00 213.76 ? 217 ASP E O   1 
ATOM   10879 C  CB  . ASP D 1 217 ? 169.072 139.647 136.551 1.00 215.71 ? 217 ASP E CB  1 
ATOM   10880 C  CG  . ASP D 1 217 ? 169.460 138.758 137.712 1.00 224.03 ? 217 ASP E CG  1 
ATOM   10881 O  OD1 . ASP D 1 217 ? 170.677 138.565 137.933 1.00 224.89 ? 217 ASP E OD1 1 
ATOM   10882 O  OD2 . ASP D 1 217 ? 168.549 138.233 138.386 1.00 228.76 ? 217 ASP E OD2 1 
ATOM   10883 N  N   . TYR D 1 218 ? 169.142 142.335 134.610 1.00 210.41 ? 218 TYR E N   1 
ATOM   10884 C  CA  . TYR D 1 218 ? 169.637 142.844 133.328 1.00 209.66 ? 218 TYR E CA  1 
ATOM   10885 C  C   . TYR D 1 218 ? 169.275 144.312 133.047 1.00 210.13 ? 218 TYR E C   1 
ATOM   10886 O  O   . TYR D 1 218 ? 170.160 145.067 132.643 1.00 209.20 ? 218 TYR E O   1 
ATOM   10887 C  CB  . TYR D 1 218 ? 169.134 141.962 132.171 1.00 211.70 ? 218 TYR E CB  1 
ATOM   10888 C  CG  . TYR D 1 218 ? 169.512 140.502 132.307 1.00 215.16 ? 218 TYR E CG  1 
ATOM   10889 C  CD1 . TYR D 1 218 ? 170.759 140.043 131.891 1.00 217.46 ? 218 TYR E CD1 1 
ATOM   10890 C  CD2 . TYR D 1 218 ? 168.623 139.578 132.851 1.00 216.95 ? 218 TYR E CD2 1 
ATOM   10891 C  CE1 . TYR D 1 218 ? 171.117 138.702 132.023 1.00 220.05 ? 218 TYR E CE1 1 
ATOM   10892 C  CE2 . TYR D 1 218 ? 168.971 138.235 132.991 1.00 219.69 ? 218 TYR E CE2 1 
ATOM   10893 C  CZ  . TYR D 1 218 ? 170.219 137.800 132.572 1.00 225.19 ? 218 TYR E CZ  1 
ATOM   10894 O  OH  . TYR D 1 218 ? 170.568 136.477 132.697 1.00 227.54 ? 218 TYR E OH  1 
ATOM   10895 N  N   . ILE D 1 219 ? 167.998 144.711 133.232 1.00 205.24 ? 219 ILE E N   1 
ATOM   10896 C  CA  . ILE D 1 219 ? 167.522 146.073 132.943 1.00 198.92 ? 219 ILE E CA  1 
ATOM   10897 C  C   . ILE D 1 219 ? 168.032 147.087 133.991 1.00 200.16 ? 219 ILE E C   1 
ATOM   10898 O  O   . ILE D 1 219 ? 168.640 148.087 133.606 1.00 196.81 ? 219 ILE E O   1 
ATOM   10899 C  CB  . ILE D 1 219 ? 165.969 146.125 132.805 1.00 200.06 ? 219 ILE E CB  1 
ATOM   10900 C  CG1 . ILE D 1 219 ? 165.470 145.176 131.687 1.00 203.42 ? 219 ILE E CG1 1 
ATOM   10901 C  CG2 . ILE D 1 219 ? 165.476 147.564 132.559 1.00 194.88 ? 219 ILE E CG2 1 
ATOM   10902 C  CD1 . ILE D 1 219 ? 164.010 144.696 131.829 1.00 212.09 ? 219 ILE E CD1 1 
ATOM   10903 N  N   . ALA D 1 220 ? 167.765 146.839 135.293 1.00 198.12 ? 220 ALA E N   1 
ATOM   10904 C  CA  . ALA D 1 220 ? 168.127 147.714 136.417 1.00 196.12 ? 220 ALA E CA  1 
ATOM   10905 C  C   . ALA D 1 220 ? 169.645 148.053 136.512 1.00 200.80 ? 220 ALA E C   1 
ATOM   10906 O  O   . ALA D 1 220 ? 169.937 149.232 136.734 1.00 197.46 ? 220 ALA E O   1 
ATOM   10907 C  CB  . ALA D 1 220 ? 167.649 147.114 137.730 1.00 199.56 ? 220 ALA E CB  1 
ATOM   10908 N  N   . PRO D 1 221 ? 170.622 147.117 136.327 1.00 201.28 ? 221 PRO E N   1 
ATOM   10909 C  CA  . PRO D 1 221 ? 172.040 147.510 136.452 1.00 202.25 ? 221 PRO E CA  1 
ATOM   10910 C  C   . PRO D 1 221 ? 172.548 148.474 135.366 1.00 203.19 ? 221 PRO E C   1 
ATOM   10911 O  O   . PRO D 1 221 ? 173.644 149.016 135.524 1.00 203.20 ? 221 PRO E O   1 
ATOM   10912 C  CB  . PRO D 1 221 ? 172.787 146.174 136.372 1.00 207.48 ? 221 PRO E CB  1 
ATOM   10913 C  CG  . PRO D 1 221 ? 171.770 145.137 136.685 1.00 211.17 ? 221 PRO E CG  1 
ATOM   10914 C  CD  . PRO D 1 221 ? 170.514 145.664 136.089 1.00 207.11 ? 221 PRO E CD  1 
ATOM   10915 N  N   . LEU D 1 222 ? 171.766 148.702 134.286 1.00 197.23 ? 222 LEU E N   1 
ATOM   10916 C  CA  . LEU D 1 222 ? 172.130 149.612 133.188 1.00 194.29 ? 222 LEU E CA  1 
ATOM   10917 C  C   . LEU D 1 222 ? 172.050 151.085 133.604 1.00 194.23 ? 222 LEU E C   1 
ATOM   10918 O  O   . LEU D 1 222 ? 172.754 151.919 133.029 1.00 192.40 ? 222 LEU E O   1 
ATOM   10919 C  CB  . LEU D 1 222 ? 171.223 149.396 131.960 1.00 192.82 ? 222 LEU E CB  1 
ATOM   10920 C  CG  . LEU D 1 222 ? 171.241 148.023 131.290 1.00 202.08 ? 222 LEU E CG  1 
ATOM   10921 C  CD1 . LEU D 1 222 ? 169.979 147.804 130.481 1.00 200.79 ? 222 LEU E CD1 1 
ATOM   10922 C  CD2 . LEU D 1 222 ? 172.468 147.844 130.408 1.00 207.44 ? 222 LEU E CD2 1 
ATOM   10923 N  N   . PHE D 1 223 ? 171.178 151.403 134.576 1.00 189.30 ? 223 PHE E N   1 
ATOM   10924 C  CA  . PHE D 1 223 ? 170.950 152.766 135.055 1.00 185.53 ? 223 PHE E CA  1 
ATOM   10925 C  C   . PHE D 1 223 ? 171.683 153.055 136.367 1.00 192.14 ? 223 PHE E C   1 
ATOM   10926 O  O   . PHE D 1 223 ? 172.148 154.180 136.561 1.00 189.79 ? 223 PHE E O   1 
ATOM   10927 C  CB  . PHE D 1 223 ? 169.443 153.024 135.225 1.00 184.24 ? 223 PHE E CB  1 
ATOM   10928 C  CG  . PHE D 1 223 ? 168.588 152.542 134.074 1.00 185.04 ? 223 PHE E CG  1 
ATOM   10929 C  CD1 . PHE D 1 223 ? 168.684 153.132 132.819 1.00 185.87 ? 223 PHE E CD1 1 
ATOM   10930 C  CD2 . PHE D 1 223 ? 167.682 151.503 134.247 1.00 189.22 ? 223 PHE E CD2 1 
ATOM   10931 C  CE1 . PHE D 1 223 ? 167.909 152.675 131.754 1.00 186.50 ? 223 PHE E CE1 1 
ATOM   10932 C  CE2 . PHE D 1 223 ? 166.893 151.057 133.183 1.00 191.82 ? 223 PHE E CE2 1 
ATOM   10933 C  CZ  . PHE D 1 223 ? 167.010 151.648 131.945 1.00 187.64 ? 223 PHE E CZ  1 
ATOM   10934 N  N   . ASP D 1 224 ? 171.783 152.051 137.263 1.00 193.66 ? 224 ASP E N   1 
ATOM   10935 C  CA  . ASP D 1 224 ? 172.445 152.186 138.563 1.00 196.45 ? 224 ASP E CA  1 
ATOM   10936 C  C   . ASP D 1 224 ? 173.520 151.116 138.771 1.00 206.06 ? 224 ASP E C   1 
ATOM   10937 O  O   . ASP D 1 224 ? 173.336 149.971 138.356 1.00 208.17 ? 224 ASP E O   1 
ATOM   10938 C  CB  . ASP D 1 224 ? 171.413 152.120 139.696 1.00 198.30 ? 224 ASP E CB  1 
ATOM   10939 C  CG  . ASP D 1 224 ? 170.501 153.328 139.743 1.00 207.36 ? 224 ASP E CG  1 
ATOM   10940 O  OD1 . ASP D 1 224 ? 170.947 154.389 140.232 1.00 207.49 ? 224 ASP E OD1 1 
ATOM   10941 O  OD2 . ASP D 1 224 ? 169.343 153.215 139.287 1.00 212.06 ? 224 ASP E OD2 1 
ATOM   10942 N  N   . LYS D 1 225 ? 174.638 151.491 139.424 1.00 204.97 ? 225 LYS E N   1 
ATOM   10943 C  CA  . LYS D 1 225 ? 175.763 150.591 139.695 1.00 209.40 ? 225 LYS E CA  1 
ATOM   10944 C  C   . LYS D 1 225 ? 175.414 149.594 140.803 1.00 212.56 ? 225 LYS E C   1 
ATOM   10945 O  O   . LYS D 1 225 ? 175.235 149.980 141.961 1.00 212.26 ? 225 LYS E O   1 
ATOM   10946 C  CB  . LYS D 1 225 ? 177.031 151.383 140.057 1.00 211.70 ? 225 LYS E CB  1 
ATOM   10947 N  N   . PHE D 1 226 ? 175.291 148.313 140.424 1.00 211.03 ? 226 PHE E N   1 
ATOM   10948 C  CA  . PHE D 1 226 ? 174.975 147.201 141.322 1.00 211.98 ? 226 PHE E CA  1 
ATOM   10949 C  C   . PHE D 1 226 ? 176.248 146.438 141.679 1.00 216.77 ? 226 PHE E C   1 
ATOM   10950 O  O   . PHE D 1 226 ? 176.962 145.971 140.785 1.00 217.03 ? 226 PHE E O   1 
ATOM   10951 C  CB  . PHE D 1 226 ? 173.958 146.248 140.666 1.00 213.04 ? 226 PHE E CB  1 
ATOM   10952 C  CG  . PHE D 1 226 ? 172.493 146.561 140.849 1.00 212.79 ? 226 PHE E CG  1 
ATOM   10953 C  CD1 . PHE D 1 226 ? 171.915 147.657 140.219 1.00 213.00 ? 226 PHE E CD1 1 
ATOM   10954 C  CD2 . PHE D 1 226 ? 171.669 145.705 141.567 1.00 214.65 ? 226 PHE E CD2 1 
ATOM   10955 C  CE1 . PHE D 1 226 ? 170.552 147.924 140.356 1.00 212.69 ? 226 PHE E CE1 1 
ATOM   10956 C  CE2 . PHE D 1 226 ? 170.304 145.967 141.696 1.00 215.65 ? 226 PHE E CE2 1 
ATOM   10957 C  CZ  . PHE D 1 226 ? 169.756 147.077 141.093 1.00 212.80 ? 226 PHE E CZ  1 
ATOM   10958 N  N   . THR D 1 227 ? 176.540 146.331 142.984 1.00 215.72 ? 227 THR E N   1 
ATOM   10959 C  CA  . THR D 1 227 ? 177.713 145.618 143.501 1.00 217.36 ? 227 THR E CA  1 
ATOM   10960 C  C   . THR D 1 227 ? 177.314 144.751 144.702 1.00 221.09 ? 227 THR E C   1 
ATOM   10961 O  O   . THR D 1 227 ? 176.530 145.214 145.535 1.00 220.30 ? 227 THR E O   1 
ATOM   10962 C  CB  . THR D 1 227 ? 178.852 146.588 143.877 1.00 223.35 ? 227 THR E CB  1 
ATOM   10963 O  OG1 . THR D 1 227 ? 178.335 147.669 144.656 1.00 222.46 ? 227 THR E OG1 1 
ATOM   10964 C  CG2 . THR D 1 227 ? 179.615 147.109 142.661 1.00 221.94 ? 227 THR E CG2 1 
ATOM   10965 N  N   . PRO D 1 228 ? 177.830 143.502 144.823 1.00 220.39 ? 228 PRO E N   1 
ATOM   10966 C  CA  . PRO D 1 228 ? 177.471 142.673 145.986 1.00 221.50 ? 228 PRO E CA  1 
ATOM   10967 C  C   . PRO D 1 228 ? 178.059 143.234 147.282 1.00 224.79 ? 228 PRO E C   1 
ATOM   10968 O  O   . PRO D 1 228 ? 179.122 143.860 147.255 1.00 224.62 ? 228 PRO E O   1 
ATOM   10969 C  CB  . PRO D 1 228 ? 178.062 141.297 145.647 1.00 224.36 ? 228 PRO E CB  1 
ATOM   10970 C  CG  . PRO D 1 228 ? 178.418 141.357 144.187 1.00 226.77 ? 228 PRO E CG  1 
ATOM   10971 C  CD  . PRO D 1 228 ? 178.762 142.785 143.932 1.00 222.36 ? 228 PRO E CD  1 
ATOM   10972 N  N   . LEU D 1 229 ? 177.346 143.032 148.406 1.00 223.13 ? 229 LEU E N   1 
ATOM   10973 C  CA  . LEU D 1 229 ? 177.716 143.510 149.741 1.00 223.79 ? 229 LEU E CA  1 
ATOM   10974 C  C   . LEU D 1 229 ? 179.089 142.969 150.167 1.00 228.85 ? 229 LEU E C   1 
ATOM   10975 O  O   . LEU D 1 229 ? 179.309 141.757 150.090 1.00 229.88 ? 229 LEU E O   1 
ATOM   10976 C  CB  . LEU D 1 229 ? 176.640 143.109 150.766 1.00 224.16 ? 229 LEU E CB  1 
ATOM   10977 C  CG  . LEU D 1 229 ? 176.643 143.861 152.095 1.00 227.51 ? 229 LEU E CG  1 
ATOM   10978 C  CD1 . LEU D 1 229 ? 175.813 145.129 152.011 1.00 225.94 ? 229 LEU E CD1 1 
ATOM   10979 C  CD2 . LEU D 1 229 ? 176.102 142.992 153.197 1.00 230.46 ? 229 LEU E CD2 1 
ATOM   10980 N  N   . PRO D 1 230 ? 180.032 143.851 150.588 1.00 227.38 ? 230 PRO E N   1 
ATOM   10981 C  CA  . PRO D 1 230 ? 181.365 143.368 150.9