data_3AL3
# 
_entry.id   3AL3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3AL3         
RCSB  RCSB029383   
WWPDB D_1000029383 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3AL2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3AL3 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-07-22 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Leung, C.C.'  1 
'Glover, J.N.' 2 
# 
_citation.id                        primary 
_citation.title                     'Molecular basis of BACH1/FANCJ recognition by TopBP1 in DNA replication checkpoint control' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                4292 
_citation.page_last                 4301 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21127055 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.189555 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Leung, C.C.'  1 
primary 'Gong, Z.'     2 
primary 'Chen, J.'     3 
primary 'Glover, J.N.' 4 
# 
_cell.entry_id           3AL3 
_cell.length_a           78.069 
_cell.length_b           78.069 
_cell.length_c           136.766 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3AL3 
_symmetry.space_group_name_H-M             'P 62 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                180 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA topoisomerase 2-binding protein 1'     26471.287 1  ? ? 'BRCT7 and BRCT8, UNP residues 1264-1493' ? 
2 polymer     syn 'Peptide of Fanconi anemia group J protein' 1327.330  1  ? ? 'UNP residues 1129-1138'                  ? 
3 non-polymer syn 'FORMIC ACID'                               46.025    1  ? ? ?                                         ? 
4 water       nat water                                       18.015    96 ? ? ?                                         ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'DNA topoisomerase II-binding protein 1, DNA topoisomerase II-beta-binding protein 1, TopBP1' 
2 
;Protein FANCJ, ATP-dependent RNA helicase BRIP1, BRCA1-interacting protein C-terminal helicase 1, BRCA1-interacting protein 1, BRCA1-associated C-terminal helicase 1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GPLGSLKKQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNEKYLASVAAGKWVLHRSYLEACR
TAGHFVQEEDYEWGSSSILDVLTGINVQQRRLALAAMRWRKKIQQRQESGIVEGAFSGWKVILHVDQSREAGFKRLLQSG
GAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFI
;
;GPLGSLKKQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNEKYLASVAAGKWVLHRSYLEACR
TAGHFVQEEDYEWGSSSILDVLTGINVQQRRLALAAMRWRKKIQQRQESGIVEGAFSGWKVILHVDQSREAGFKRLLQSG
GAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFI
;
A ? 
2 'polypeptide(L)' no yes 'SIYF(TPO)PELYD' SIYFTPELYD B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   LEU n 
1 7   LYS n 
1 8   LYS n 
1 9   GLN n 
1 10  TYR n 
1 11  ILE n 
1 12  PHE n 
1 13  GLN n 
1 14  LEU n 
1 15  SER n 
1 16  SER n 
1 17  LEU n 
1 18  ASN n 
1 19  PRO n 
1 20  GLN n 
1 21  GLU n 
1 22  ARG n 
1 23  ILE n 
1 24  ASP n 
1 25  TYR n 
1 26  CYS n 
1 27  HIS n 
1 28  LEU n 
1 29  ILE n 
1 30  GLU n 
1 31  LYS n 
1 32  LEU n 
1 33  GLY n 
1 34  GLY n 
1 35  LEU n 
1 36  VAL n 
1 37  ILE n 
1 38  GLU n 
1 39  LYS n 
1 40  GLN n 
1 41  CYS n 
1 42  PHE n 
1 43  ASP n 
1 44  PRO n 
1 45  THR n 
1 46  CYS n 
1 47  THR n 
1 48  HIS n 
1 49  ILE n 
1 50  VAL n 
1 51  VAL n 
1 52  GLY n 
1 53  HIS n 
1 54  PRO n 
1 55  LEU n 
1 56  ARG n 
1 57  ASN n 
1 58  GLU n 
1 59  LYS n 
1 60  TYR n 
1 61  LEU n 
1 62  ALA n 
1 63  SER n 
1 64  VAL n 
1 65  ALA n 
1 66  ALA n 
1 67  GLY n 
1 68  LYS n 
1 69  TRP n 
1 70  VAL n 
1 71  LEU n 
1 72  HIS n 
1 73  ARG n 
1 74  SER n 
1 75  TYR n 
1 76  LEU n 
1 77  GLU n 
1 78  ALA n 
1 79  CYS n 
1 80  ARG n 
1 81  THR n 
1 82  ALA n 
1 83  GLY n 
1 84  HIS n 
1 85  PHE n 
1 86  VAL n 
1 87  GLN n 
1 88  GLU n 
1 89  GLU n 
1 90  ASP n 
1 91  TYR n 
1 92  GLU n 
1 93  TRP n 
1 94  GLY n 
1 95  SER n 
1 96  SER n 
1 97  SER n 
1 98  ILE n 
1 99  LEU n 
1 100 ASP n 
1 101 VAL n 
1 102 LEU n 
1 103 THR n 
1 104 GLY n 
1 105 ILE n 
1 106 ASN n 
1 107 VAL n 
1 108 GLN n 
1 109 GLN n 
1 110 ARG n 
1 111 ARG n 
1 112 LEU n 
1 113 ALA n 
1 114 LEU n 
1 115 ALA n 
1 116 ALA n 
1 117 MET n 
1 118 ARG n 
1 119 TRP n 
1 120 ARG n 
1 121 LYS n 
1 122 LYS n 
1 123 ILE n 
1 124 GLN n 
1 125 GLN n 
1 126 ARG n 
1 127 GLN n 
1 128 GLU n 
1 129 SER n 
1 130 GLY n 
1 131 ILE n 
1 132 VAL n 
1 133 GLU n 
1 134 GLY n 
1 135 ALA n 
1 136 PHE n 
1 137 SER n 
1 138 GLY n 
1 139 TRP n 
1 140 LYS n 
1 141 VAL n 
1 142 ILE n 
1 143 LEU n 
1 144 HIS n 
1 145 VAL n 
1 146 ASP n 
1 147 GLN n 
1 148 SER n 
1 149 ARG n 
1 150 GLU n 
1 151 ALA n 
1 152 GLY n 
1 153 PHE n 
1 154 LYS n 
1 155 ARG n 
1 156 LEU n 
1 157 LEU n 
1 158 GLN n 
1 159 SER n 
1 160 GLY n 
1 161 GLY n 
1 162 ALA n 
1 163 LYS n 
1 164 VAL n 
1 165 LEU n 
1 166 PRO n 
1 167 GLY n 
1 168 HIS n 
1 169 SER n 
1 170 VAL n 
1 171 PRO n 
1 172 LEU n 
1 173 PHE n 
1 174 LYS n 
1 175 GLU n 
1 176 ALA n 
1 177 THR n 
1 178 HIS n 
1 179 LEU n 
1 180 PHE n 
1 181 SER n 
1 182 ASP n 
1 183 LEU n 
1 184 ASN n 
1 185 LYS n 
1 186 LEU n 
1 187 LYS n 
1 188 PRO n 
1 189 ASP n 
1 190 ASP n 
1 191 SER n 
1 192 GLY n 
1 193 VAL n 
1 194 ASN n 
1 195 ILE n 
1 196 ALA n 
1 197 GLU n 
1 198 ALA n 
1 199 ALA n 
1 200 ALA n 
1 201 GLN n 
1 202 ASN n 
1 203 VAL n 
1 204 TYR n 
1 205 CYS n 
1 206 LEU n 
1 207 ARG n 
1 208 THR n 
1 209 GLU n 
1 210 TYR n 
1 211 ILE n 
1 212 ALA n 
1 213 ASP n 
1 214 TYR n 
1 215 LEU n 
1 216 MET n 
1 217 GLN n 
1 218 GLU n 
1 219 SER n 
1 220 PRO n 
1 221 PRO n 
1 222 HIS n 
1 223 VAL n 
1 224 GLU n 
1 225 ASN n 
1 226 TYR n 
1 227 CYS n 
1 228 LEU n 
1 229 PRO n 
1 230 GLU n 
1 231 ALA n 
1 232 ILE n 
1 233 SER n 
1 234 PHE n 
1 235 ILE n 
2 1   SER n 
2 2   ILE n 
2 3   TYR n 
2 4   PHE n 
2 5   TPO n 
2 6   PRO n 
2 7   GLU n 
2 8   LEU n 
2 9   TYR n 
2 10  ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'KIAA0259, TOPBP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 Gold' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                synthetic 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TOPB1_HUMAN Q92547 1 
;LKKQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNEKYLASVAAGKWVLHRSYLEACRTAGHF
VQEEDYEWGSSSILDVLTGINVQQRRLALAAMRWRKKIQQRQESGIVEGAFSGWKVILHVDQSREAGFKRLLQSGGAKVL
PGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFI
;
1264 ? 
2 UNP FANCJ_HUMAN Q9BX63 2 SIYFTPELYD 1129 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3AL3 A 6 ? 235 ? Q92547 1264 ? 1493 ? 1264 1493 
2 2 3AL3 B 1 ? 10  ? Q9BX63 1129 ? 1138 ? 1129 1138 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3AL3 GLY A 1 ? UNP Q92547 ? ? 'EXPRESSION TAG' 1259 1 
1 3AL3 PRO A 2 ? UNP Q92547 ? ? 'EXPRESSION TAG' 1260 2 
1 3AL3 LEU A 3 ? UNP Q92547 ? ? 'EXPRESSION TAG' 1261 3 
1 3AL3 GLY A 4 ? UNP Q92547 ? ? 'EXPRESSION TAG' 1262 4 
1 3AL3 SER A 5 ? UNP Q92547 ? ? 'EXPRESSION TAG' 1263 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                  'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'    ?                  'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE        ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3AL3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        0.507 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.16 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   43.16 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    'Sodium formate, pH 8, vapor diffusion, hanging drop, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-03-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       CLSI 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
# 
_reflns.entry_id                     3AL3 
_reflns.d_resolution_high            2.150 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   14063 
_reflns.pdbx_Rmerge_I_obs            0.060 
_reflns.pdbx_netI_over_sigmaI        28.987 
_reflns.pdbx_chi_squared             0.797 
_reflns.pdbx_redundancy              6.800 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.150 2.230  ? ? ? 0.526 ? ? 0.662 6.200 ? 1365 100.000 1  1 
2.230 2.320  ? ? ? 0.463 ? ? 0.671 6.800 ? 1370 100.000 2  1 
2.320 2.420  ? ? ? 0.374 ? ? 0.703 7.100 ? 1362 100.000 3  1 
2.420 2.550  ? ? ? 0.290 ? ? 0.710 7.100 ? 1372 100.000 4  1 
2.550 2.710  ? ? ? 0.188 ? ? 0.715 7.100 ? 1384 100.000 5  1 
2.710 2.920  ? ? ? 0.132 ? ? 0.770 7.100 ? 1384 100.000 6  1 
2.920 3.210  ? ? ? 0.081 ? ? 0.849 7.100 ? 1400 100.000 7  1 
3.210 3.680  ? ? ? 0.057 ? ? 0.939 6.900 ? 1410 100.000 8  1 
3.680 4.630  ? ? ? 0.042 ? ? 1.050 6.800 ? 1449 100.000 9  1 
4.630 50.000 ? ? ? 0.026 ? ? 0.875 6.300 ? 1567 99.300  10 1 
# 
_refine.entry_id                                 3AL3 
_refine.ls_d_res_high                            2.1500 
_refine.ls_d_res_low                             33.90 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.8600 
_refine.ls_number_reflns_obs                     14021 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: WITH TLS ADDED' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1975 
_refine.ls_R_factor_R_work                       0.1955 
_refine.ls_wR_factor_R_work                      0.1956 
_refine.ls_R_factor_R_free                       0.2364 
_refine.ls_wR_factor_R_free                      0.2364 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  699 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               47.2525 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.2700 
_refine.aniso_B[2][2]                            0.2700 
_refine.aniso_B[3][3]                            -0.4100 
_refine.aniso_B[1][2]                            0.1400 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9580 
_refine.correlation_coeff_Fo_to_Fc_free          0.9390 
_refine.overall_SU_R_Cruickshank_DPI             0.2561 
_refine.overall_SU_R_free                        0.1986 
_refine.pdbx_overall_ESU_R_Free                  0.1990 
_refine.overall_SU_ML                            0.1460 
_refine.overall_SU_B                             12.3790 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3AL2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8292 
_refine.B_iso_max                                98.780 
_refine.B_iso_min                                27.540 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1823 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             96 
_refine_hist.number_atoms_total               1922 
_refine_hist.d_res_high                       2.1500 
_refine_hist.d_res_low                        33.90 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       1915 0.009  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    2607 1.258  1.952  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 243  5.822  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 94   35.499 24.043 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 325  17.275 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 12   25.874 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         283  0.080  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   1470 0.005  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            1160 0.572  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1869 1.053  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            755  1.501  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           729  2.459  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.1510 
_refine_ls_shell.d_res_low                        2.2070 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.3000 
_refine_ls_shell.number_reflns_R_work             932 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2250 
_refine_ls_shell.R_factor_R_free                  0.2460 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             63 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                995 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3AL3 
_struct.title                     'Crystal Structure of TopBP1 BRCT7/8-BACH1 peptide complex' 
_struct.pdbx_descriptor           'DNA topoisomerase 2-binding protein 1, Peptide of Fanconi anemia group J protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3AL3 
_struct_keywords.text            'BRCT domain-phosphopeptide complex, DNA BINDING PROTEIN-PROTEIN BINDING complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 19  ? LYS A 31  ? PRO A 1277 LYS A 1289 1 ? 13 
HELX_P HELX_P2  2  GLU A 58  ? ALA A 65  ? GLU A 1316 ALA A 1323 1 ? 8  
HELX_P HELX_P3  3  SER A 74  ? ALA A 82  ? SER A 1332 ALA A 1340 1 ? 9  
HELX_P HELX_P4  4  GLU A 89  ? TYR A 91  ? GLU A 1347 TYR A 1349 1 ? 3  
HELX_P HELX_P5  5  SER A 96  ? LEU A 99  ? SER A 1354 LEU A 1357 1 ? 4  
HELX_P HELX_P6  6  VAL A 107 ? GLN A 127 ? VAL A 1365 GLN A 1385 1 ? 21 
HELX_P HELX_P7  7  GLU A 150 ? SER A 159 ? GLU A 1408 SER A 1417 1 ? 10 
HELX_P HELX_P8  8  VAL A 170 ? LEU A 172 ? VAL A 1428 LEU A 1430 1 ? 3  
HELX_P HELX_P9  9  ILE A 195 ? ALA A 200 ? ILE A 1453 ALA A 1458 1 ? 6  
HELX_P HELX_P10 10 GLU A 209 ? MET A 216 ? GLU A 1467 MET A 1474 1 ? 8  
HELX_P HELX_P11 11 VAL A 223 ? TYR A 226 ? VAL A 1481 TYR A 1484 1 ? 4  
HELX_P HELX_P12 12 PRO A 229 ? ALA A 231 ? PRO A 1487 ALA A 1489 1 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B PHE 4 C ? ? ? 1_555 B TPO 5 N ? ? B PHE 1132 B TPO 1133 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale2 covale ? ? B TPO 5 C ? ? ? 1_555 B PRO 6 N ? ? B TPO 1133 B PRO 1134 1_555 ? ? ? ? ? ? ? 1.351 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1 ? 1 ? 
2 ? 1 ? 
3 ? 1 ? 
4 ? 1 ? 
5 ? 1 ? 
6 ? 1 ? 
7 ? 1 ? 
8 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1 1 ILE A 11  ? SER A 15  ? ILE A 1269 SER A 1273 
2 1 LEU A 35  ? VAL A 36  ? LEU A 1293 VAL A 1294 
3 1 HIS A 48  ? VAL A 51  ? HIS A 1306 VAL A 1309 
4 1 TRP A 69  ? LEU A 71  ? TRP A 1327 LEU A 1329 
5 1 LYS A 140 ? HIS A 144 ? LYS A 1398 HIS A 1402 
6 1 LYS A 163 ? VAL A 164 ? LYS A 1421 VAL A 1422 
7 1 HIS A 178 ? SER A 181 ? HIS A 1436 SER A 1439 
8 1 TYR A 204 ? ARG A 207 ? TYR A 1462 ARG A 1465 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE FMT A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 HOH D .  ? HOH A 94   . ? 1_555 ? 
2 AC1 6 LEU A 17 ? LEU A 1275 . ? 1_555 ? 
3 AC1 6 ASN A 18 ? ASN A 1276 . ? 1_555 ? 
4 AC1 6 GLU A 21 ? GLU A 1279 . ? 1_555 ? 
5 AC1 6 HIS A 53 ? HIS A 1311 . ? 1_555 ? 
6 AC1 6 ARG A 73 ? ARG A 1331 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3AL3 
_atom_sites.fract_transf_matrix[1][1]   0.012809 
_atom_sites.fract_transf_matrix[1][2]   0.007395 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014791 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007312 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 8   ? -42.483 -21.406 -7.857  1.00 63.31 ? 1266 LYS A N   1 
ATOM   2    C CA  . LYS A 1 8   ? -41.116 -21.244 -7.301  1.00 60.58 ? 1266 LYS A CA  1 
ATOM   3    C C   . LYS A 1 8   ? -40.932 -19.830 -6.745  1.00 58.44 ? 1266 LYS A C   1 
ATOM   4    O O   . LYS A 1 8   ? -41.573 -18.887 -7.218  1.00 58.68 ? 1266 LYS A O   1 
ATOM   5    C CB  . LYS A 1 8   ? -40.075 -21.524 -8.394  1.00 59.51 ? 1266 LYS A CB  1 
ATOM   6    N N   . GLN A 1 9   ? -40.054 -19.692 -5.752  1.00 56.20 ? 1267 GLN A N   1 
ATOM   7    C CA  . GLN A 1 9   ? -39.693 -18.387 -5.197  1.00 53.50 ? 1267 GLN A CA  1 
ATOM   8    C C   . GLN A 1 9   ? -38.498 -17.757 -5.902  1.00 49.92 ? 1267 GLN A C   1 
ATOM   9    O O   . GLN A 1 9   ? -37.539 -18.442 -6.252  1.00 49.49 ? 1267 GLN A O   1 
ATOM   10   C CB  . GLN A 1 9   ? -39.371 -18.516 -3.718  1.00 53.95 ? 1267 GLN A CB  1 
ATOM   11   C CG  . GLN A 1 9   ? -40.586 -18.833 -2.851  1.00 57.54 ? 1267 GLN A CG  1 
ATOM   12   C CD  . GLN A 1 9   ? -40.157 -19.180 -1.459  1.00 60.01 ? 1267 GLN A CD  1 
ATOM   13   O OE1 . GLN A 1 9   ? -40.887 -18.954 -0.489  1.00 63.97 ? 1267 GLN A OE1 1 
ATOM   14   N NE2 . GLN A 1 9   ? -38.945 -19.721 -1.342  1.00 58.57 ? 1267 GLN A NE2 1 
ATOM   15   N N   . TYR A 1 10  ? -38.565 -16.445 -6.101  1.00 47.19 ? 1268 TYR A N   1 
ATOM   16   C CA  . TYR A 1 10  ? -37.507 -15.707 -6.800  1.00 43.87 ? 1268 TYR A CA  1 
ATOM   17   C C   . TYR A 1 10  ? -37.128 -14.511 -5.949  1.00 41.54 ? 1268 TYR A C   1 
ATOM   18   O O   . TYR A 1 10  ? -37.580 -13.387 -6.185  1.00 41.19 ? 1268 TYR A O   1 
ATOM   19   C CB  . TYR A 1 10  ? -37.989 -15.245 -8.171  1.00 43.95 ? 1268 TYR A CB  1 
ATOM   20   C CG  . TYR A 1 10  ? -38.103 -16.372 -9.165  1.00 45.83 ? 1268 TYR A CG  1 
ATOM   21   C CD1 . TYR A 1 10  ? -36.988 -16.796 -9.902  1.00 45.62 ? 1268 TYR A CD1 1 
ATOM   22   C CD2 . TYR A 1 10  ? -39.314 -17.027 -9.358  1.00 47.52 ? 1268 TYR A CD2 1 
ATOM   23   C CE1 . TYR A 1 10  ? -37.086 -17.852 -10.800 1.00 47.14 ? 1268 TYR A CE1 1 
ATOM   24   C CE2 . TYR A 1 10  ? -39.425 -18.072 -10.270 1.00 49.42 ? 1268 TYR A CE2 1 
ATOM   25   C CZ  . TYR A 1 10  ? -38.312 -18.474 -10.982 1.00 48.76 ? 1268 TYR A CZ  1 
ATOM   26   O OH  . TYR A 1 10  ? -38.427 -19.510 -11.873 1.00 51.71 ? 1268 TYR A OH  1 
ATOM   27   N N   . ILE A 1 11  ? -36.313 -14.779 -4.941  1.00 39.28 ? 1269 ILE A N   1 
ATOM   28   C CA  . ILE A 1 11  ? -35.926 -13.768 -3.984  1.00 37.83 ? 1269 ILE A CA  1 
ATOM   29   C C   . ILE A 1 11  ? -34.463 -13.428 -4.226  1.00 35.37 ? 1269 ILE A C   1 
ATOM   30   O O   . ILE A 1 11  ? -33.572 -14.226 -3.972  1.00 35.41 ? 1269 ILE A O   1 
ATOM   31   C CB  . ILE A 1 11  ? -36.231 -14.241 -2.542  1.00 38.37 ? 1269 ILE A CB  1 
ATOM   32   C CG1 . ILE A 1 11  ? -37.717 -14.623 -2.439  1.00 41.17 ? 1269 ILE A CG1 1 
ATOM   33   C CG2 . ILE A 1 11  ? -35.898 -13.147 -1.531  1.00 37.35 ? 1269 ILE A CG2 1 
ATOM   34   C CD1 . ILE A 1 11  ? -37.995 -15.729 -1.450  1.00 43.82 ? 1269 ILE A CD1 1 
ATOM   35   N N   . PHE A 1 12  ? -34.233 -12.236 -4.745  1.00 34.24 ? 1270 PHE A N   1 
ATOM   36   C CA  . PHE A 1 12  ? -32.903 -11.830 -5.191  1.00 32.68 ? 1270 PHE A CA  1 
ATOM   37   C C   . PHE A 1 12  ? -32.157 -10.987 -4.176  1.00 32.22 ? 1270 PHE A C   1 
ATOM   38   O O   . PHE A 1 12  ? -32.756 -10.245 -3.403  1.00 32.00 ? 1270 PHE A O   1 
ATOM   39   C CB  . PHE A 1 12  ? -33.011 -11.026 -6.489  1.00 32.16 ? 1270 PHE A CB  1 
ATOM   40   C CG  . PHE A 1 12  ? -33.320 -11.860 -7.688  1.00 32.80 ? 1270 PHE A CG  1 
ATOM   41   C CD1 . PHE A 1 12  ? -32.308 -12.235 -8.562  1.00 31.45 ? 1270 PHE A CD1 1 
ATOM   42   C CD2 . PHE A 1 12  ? -34.620 -12.292 -7.934  1.00 33.99 ? 1270 PHE A CD2 1 
ATOM   43   C CE1 . PHE A 1 12  ? -32.582 -13.022 -9.676  1.00 32.20 ? 1270 PHE A CE1 1 
ATOM   44   C CE2 . PHE A 1 12  ? -34.910 -13.072 -9.063  1.00 34.82 ? 1270 PHE A CE2 1 
ATOM   45   C CZ  . PHE A 1 12  ? -33.893 -13.439 -9.927  1.00 31.83 ? 1270 PHE A CZ  1 
ATOM   46   N N   . GLN A 1 13  ? -30.836 -11.118 -4.200  1.00 31.63 ? 1271 GLN A N   1 
ATOM   47   C CA  . GLN A 1 13  ? -29.973 -10.018 -3.794  1.00 31.56 ? 1271 GLN A CA  1 
ATOM   48   C C   . GLN A 1 13  ? -29.137 -9.610  -5.005  1.00 31.18 ? 1271 GLN A C   1 
ATOM   49   O O   . GLN A 1 13  ? -29.122 -10.307 -6.021  1.00 31.13 ? 1271 GLN A O   1 
ATOM   50   C CB  . GLN A 1 13  ? -29.106 -10.381 -2.579  1.00 31.36 ? 1271 GLN A CB  1 
ATOM   51   C CG  . GLN A 1 13  ? -29.882 -10.387 -1.262  1.00 32.34 ? 1271 GLN A CG  1 
ATOM   52   C CD  . GLN A 1 13  ? -28.967 -10.235 -0.046  1.00 34.35 ? 1271 GLN A CD  1 
ATOM   53   O OE1 . GLN A 1 13  ? -28.222 -11.153 0.299   1.00 35.82 ? 1271 GLN A OE1 1 
ATOM   54   N NE2 . GLN A 1 13  ? -29.051 -9.088  0.626   1.00 32.98 ? 1271 GLN A NE2 1 
ATOM   55   N N   . LEU A 1 14  ? -28.475 -8.465  -4.897  1.00 30.69 ? 1272 LEU A N   1 
ATOM   56   C CA  . LEU A 1 14  ? -27.671 -7.911  -5.969  1.00 30.31 ? 1272 LEU A CA  1 
ATOM   57   C C   . LEU A 1 14  ? -26.327 -7.547  -5.371  1.00 30.21 ? 1272 LEU A C   1 
ATOM   58   O O   . LEU A 1 14  ? -26.258 -7.155  -4.198  1.00 30.54 ? 1272 LEU A O   1 
ATOM   59   C CB  . LEU A 1 14  ? -28.346 -6.656  -6.534  1.00 30.74 ? 1272 LEU A CB  1 
ATOM   60   C CG  . LEU A 1 14  ? -29.765 -6.822  -7.121  1.00 30.16 ? 1272 LEU A CG  1 
ATOM   61   C CD1 . LEU A 1 14  ? -30.299 -5.460  -7.543  1.00 32.34 ? 1272 LEU A CD1 1 
ATOM   62   C CD2 . LEU A 1 14  ? -29.801 -7.789  -8.296  1.00 27.87 ? 1272 LEU A CD2 1 
ATOM   63   N N   . SER A 1 15  ? -25.263 -7.707  -6.157  1.00 29.47 ? 1273 SER A N   1 
ATOM   64   C CA  . SER A 1 15  ? -23.914 -7.449  -5.678  1.00 29.19 ? 1273 SER A CA  1 
ATOM   65   C C   . SER A 1 15  ? -23.011 -6.980  -6.813  1.00 30.43 ? 1273 SER A C   1 
ATOM   66   O O   . SER A 1 15  ? -23.183 -7.396  -7.958  1.00 30.28 ? 1273 SER A O   1 
ATOM   67   C CB  . SER A 1 15  ? -23.328 -8.685  -4.986  1.00 28.88 ? 1273 SER A CB  1 
ATOM   68   O OG  . SER A 1 15  ? -21.980 -8.493  -4.568  1.00 27.54 ? 1273 SER A OG  1 
ATOM   69   N N   . SER A 1 16  ? -22.072 -6.097  -6.463  1.00 31.21 ? 1274 SER A N   1 
ATOM   70   C CA  A SER A 1 16  ? -21.076 -5.557  -7.398  0.50 32.53 ? 1274 SER A CA  1 
ATOM   71   C CA  B SER A 1 16  ? -21.075 -5.577  -7.395  0.50 32.56 ? 1274 SER A CA  1 
ATOM   72   C C   . SER A 1 16  ? -21.711 -5.039  -8.682  1.00 33.37 ? 1274 SER A C   1 
ATOM   73   O O   . SER A 1 16  ? -21.301 -5.410  -9.788  1.00 33.74 ? 1274 SER A O   1 
ATOM   74   C CB  A SER A 1 16  ? -19.956 -6.572  -7.700  0.50 32.67 ? 1274 SER A CB  1 
ATOM   75   C CB  B SER A 1 16  ? -20.025 -6.662  -7.684  0.50 32.66 ? 1274 SER A CB  1 
ATOM   76   O OG  A SER A 1 16  ? -20.430 -7.684  -8.445  0.50 31.87 ? 1274 SER A OG  1 
ATOM   77   O OG  B SER A 1 16  ? -19.942 -7.573  -6.590  0.50 31.66 ? 1274 SER A OG  1 
ATOM   78   N N   . LEU A 1 17  ? -22.725 -4.183  -8.513  1.00 33.65 ? 1275 LEU A N   1 
ATOM   79   C CA  . LEU A 1 17  ? -23.401 -3.490  -9.600  1.00 34.56 ? 1275 LEU A CA  1 
ATOM   80   C C   . LEU A 1 17  ? -23.409 -1.982  -9.332  1.00 36.39 ? 1275 LEU A C   1 
ATOM   81   O O   . LEU A 1 17  ? -23.398 -1.547  -8.183  1.00 36.07 ? 1275 LEU A O   1 
ATOM   82   C CB  . LEU A 1 17  ? -24.845 -4.015  -9.782  1.00 33.52 ? 1275 LEU A CB  1 
ATOM   83   C CG  . LEU A 1 17  ? -24.985 -5.471  -10.281 1.00 32.73 ? 1275 LEU A CG  1 
ATOM   84   C CD1 . LEU A 1 17  ? -26.311 -6.112  -9.914  1.00 32.19 ? 1275 LEU A CD1 1 
ATOM   85   C CD2 . LEU A 1 17  ? -24.741 -5.607  -11.790 1.00 33.67 ? 1275 LEU A CD2 1 
ATOM   86   N N   . ASN A 1 18  ? -23.387 -1.201  -10.407 1.00 38.35 ? 1276 ASN A N   1 
ATOM   87   C CA  A ASN A 1 18  ? -23.548 0.252   -10.325 0.50 40.93 ? 1276 ASN A CA  1 
ATOM   88   C CA  B ASN A 1 18  ? -23.557 0.247   -10.361 0.50 41.03 ? 1276 ASN A CA  1 
ATOM   89   C C   . ASN A 1 18  ? -24.915 0.588   -9.727  1.00 41.31 ? 1276 ASN A C   1 
ATOM   90   O O   . ASN A 1 18  ? -25.880 -0.151  -9.918  1.00 40.69 ? 1276 ASN A O   1 
ATOM   91   C CB  A ASN A 1 18  ? -23.448 0.891   -11.719 0.50 42.17 ? 1276 ASN A CB  1 
ATOM   92   C CB  B ASN A 1 18  ? -23.478 0.751   -11.812 0.50 42.30 ? 1276 ASN A CB  1 
ATOM   93   C CG  A ASN A 1 18  ? -22.016 1.019   -12.223 0.50 43.74 ? 1276 ASN A CG  1 
ATOM   94   C CG  B ASN A 1 18  ? -23.769 2.222   -11.955 0.50 44.65 ? 1276 ASN A CG  1 
ATOM   95   O OD1 A ASN A 1 18  ? -21.067 0.548   -11.594 0.50 43.79 ? 1276 ASN A OD1 1 
ATOM   96   O OD1 B ASN A 1 18  ? -24.766 2.605   -12.559 0.50 46.06 ? 1276 ASN A OD1 1 
ATOM   97   N ND2 A ASN A 1 18  ? -21.860 1.669   -13.371 0.50 43.81 ? 1276 ASN A ND2 1 
ATOM   98   N ND2 B ASN A 1 18  ? -22.893 3.057   -11.416 0.50 47.78 ? 1276 ASN A ND2 1 
ATOM   99   N N   . PRO A 1 19  ? -25.018 1.713   -8.989  1.00 43.66 ? 1277 PRO A N   1 
ATOM   100  C CA  . PRO A 1 19  ? -26.329 2.087   -8.434  1.00 44.26 ? 1277 PRO A CA  1 
ATOM   101  C C   . PRO A 1 19  ? -27.480 2.110   -9.437  1.00 44.70 ? 1277 PRO A C   1 
ATOM   102  O O   . PRO A 1 19  ? -28.593 1.695   -9.101  1.00 44.44 ? 1277 PRO A O   1 
ATOM   103  C CB  . PRO A 1 19  ? -26.084 3.498   -7.923  1.00 46.65 ? 1277 PRO A CB  1 
ATOM   104  C CG  . PRO A 1 19  ? -24.677 3.470   -7.505  1.00 46.96 ? 1277 PRO A CG  1 
ATOM   105  C CD  . PRO A 1 19  ? -23.994 2.696   -8.595  1.00 45.32 ? 1277 PRO A CD  1 
ATOM   106  N N   . GLN A 1 20  ? -27.223 2.589   -10.651 1.00 45.59 ? 1278 GLN A N   1 
ATOM   107  C CA  . GLN A 1 20  ? -28.268 2.656   -11.659 1.00 45.73 ? 1278 GLN A CA  1 
ATOM   108  C C   . GLN A 1 20  ? -28.667 1.250   -12.121 1.00 43.96 ? 1278 GLN A C   1 
ATOM   109  O O   . GLN A 1 20  ? -29.860 0.990   -12.330 1.00 43.92 ? 1278 GLN A O   1 
ATOM   110  C CB  . GLN A 1 20  ? -27.872 3.580   -12.825 1.00 47.62 ? 1278 GLN A CB  1 
ATOM   111  C CG  . GLN A 1 20  ? -28.933 3.745   -13.926 0.50 48.94 ? 1278 GLN A CG  1 
ATOM   112  C CD  . GLN A 1 20  ? -30.293 4.210   -13.413 0.50 51.25 ? 1278 GLN A CD  1 
ATOM   113  O OE1 . GLN A 1 20  ? -30.387 5.098   -12.563 0.50 53.57 ? 1278 GLN A OE1 1 
ATOM   114  N NE2 . GLN A 1 20  ? -31.358 3.616   -13.944 0.50 51.34 ? 1278 GLN A NE2 1 
ATOM   115  N N   . GLU A 1 21  ? -27.694 0.346   -12.258 1.00 42.30 ? 1279 GLU A N   1 
ATOM   116  C CA  . GLU A 1 21  ? -28.000 -1.067  -12.504 1.00 41.06 ? 1279 GLU A CA  1 
ATOM   117  C C   . GLU A 1 21  ? -28.908 -1.649  -11.412 1.00 39.36 ? 1279 GLU A C   1 
ATOM   118  O O   . GLU A 1 21  ? -29.852 -2.371  -11.724 1.00 38.92 ? 1279 GLU A O   1 
ATOM   119  C CB  . GLU A 1 21  ? -26.739 -1.951  -12.642 1.00 40.51 ? 1279 GLU A CB  1 
ATOM   120  C CG  . GLU A 1 21  ? -25.913 -1.830  -13.945 1.00 44.20 ? 1279 GLU A CG  1 
ATOM   121  C CD  . GLU A 1 21  ? -26.637 -2.329  -15.203 1.00 47.37 ? 1279 GLU A CD  1 
ATOM   122  O OE1 . GLU A 1 21  ? -26.299 -3.416  -15.721 1.00 46.49 ? 1279 GLU A OE1 1 
ATOM   123  O OE2 . GLU A 1 21  ? -27.547 -1.626  -15.690 1.00 49.75 ? 1279 GLU A OE2 1 
ATOM   124  N N   . ARG A 1 22  ? -28.606 -1.355  -10.148 1.00 39.16 ? 1280 ARG A N   1 
ATOM   125  C CA  . ARG A 1 22  ? -29.354 -1.902  -9.008  1.00 38.42 ? 1280 ARG A CA  1 
ATOM   126  C C   . ARG A 1 22  ? -30.801 -1.426  -8.994  1.00 39.23 ? 1280 ARG A C   1 
ATOM   127  O O   . ARG A 1 22  ? -31.718 -2.205  -8.721  1.00 38.55 ? 1280 ARG A O   1 
ATOM   128  C CB  . ARG A 1 22  ? -28.686 -1.547  -7.680  1.00 38.45 ? 1280 ARG A CB  1 
ATOM   129  C CG  . ARG A 1 22  ? -27.410 -2.321  -7.431  1.00 38.43 ? 1280 ARG A CG  1 
ATOM   130  C CD  . ARG A 1 22  ? -26.844 -2.048  -6.055  1.00 38.31 ? 1280 ARG A CD  1 
ATOM   131  N NE  . ARG A 1 22  ? -25.387 -2.221  -6.038  1.00 37.77 ? 1280 ARG A NE  1 
ATOM   132  C CZ  . ARG A 1 22  ? -24.734 -3.136  -5.323  1.00 36.43 ? 1280 ARG A CZ  1 
ATOM   133  N NH1 . ARG A 1 22  ? -25.397 -3.991  -4.550  1.00 33.21 ? 1280 ARG A NH1 1 
ATOM   134  N NH2 . ARG A 1 22  ? -23.403 -3.187  -5.376  1.00 35.82 ? 1280 ARG A NH2 1 
ATOM   135  N N   . ILE A 1 23  ? -30.985 -0.143  -9.281  1.00 40.18 ? 1281 ILE A N   1 
ATOM   136  C CA  . ILE A 1 23  ? -32.298 0.463   -9.358  1.00 41.51 ? 1281 ILE A CA  1 
ATOM   137  C C   . ILE A 1 23  ? -33.089 -0.143  -10.530 1.00 40.75 ? 1281 ILE A C   1 
ATOM   138  O O   . ILE A 1 23  ? -34.236 -0.568  -10.346 1.00 40.75 ? 1281 ILE A O   1 
ATOM   139  C CB  . ILE A 1 23  ? -32.191 2.004   -9.454  1.00 43.08 ? 1281 ILE A CB  1 
ATOM   140  C CG1 . ILE A 1 23  ? -31.748 2.585   -8.104  1.00 45.47 ? 1281 ILE A CG1 1 
ATOM   141  C CG2 . ILE A 1 23  ? -33.525 2.617   -9.877  1.00 45.41 ? 1281 ILE A CG2 1 
ATOM   142  C CD1 . ILE A 1 23  ? -31.264 4.032   -8.173  1.00 47.08 ? 1281 ILE A CD1 1 
ATOM   143  N N   . ASP A 1 24  ? -32.459 -0.208  -11.705 1.00 40.02 ? 1282 ASP A N   1 
ATOM   144  C CA  A ASP A 1 24  ? -33.089 -0.776  -12.904 0.50 39.70 ? 1282 ASP A CA  1 
ATOM   145  C CA  B ASP A 1 24  ? -33.080 -0.775  -12.897 0.50 40.16 ? 1282 ASP A CA  1 
ATOM   146  C C   . ASP A 1 24  ? -33.515 -2.218  -12.669 1.00 38.63 ? 1282 ASP A C   1 
ATOM   147  O O   . ASP A 1 24  ? -34.585 -2.633  -13.101 1.00 39.26 ? 1282 ASP A O   1 
ATOM   148  C CB  A ASP A 1 24  ? -32.138 -0.758  -14.108 0.50 39.60 ? 1282 ASP A CB  1 
ATOM   149  C CB  B ASP A 1 24  ? -32.087 -0.712  -14.057 0.50 40.53 ? 1282 ASP A CB  1 
ATOM   150  C CG  A ASP A 1 24  ? -31.965 0.621   -14.726 0.50 40.85 ? 1282 ASP A CG  1 
ATOM   151  C CG  B ASP A 1 24  ? -32.739 -0.916  -15.399 0.50 42.43 ? 1282 ASP A CG  1 
ATOM   152  O OD1 A ASP A 1 24  ? -32.643 1.582   -14.307 0.50 41.94 ? 1282 ASP A OD1 1 
ATOM   153  O OD1 B ASP A 1 24  ? -32.682 0.030   -16.220 0.50 45.68 ? 1282 ASP A OD1 1 
ATOM   154  O OD2 A ASP A 1 24  ? -31.129 0.733   -15.645 0.50 39.81 ? 1282 ASP A OD2 1 
ATOM   155  O OD2 B ASP A 1 24  ? -33.294 -2.012  -15.643 0.50 42.98 ? 1282 ASP A OD2 1 
ATOM   156  N N   . TYR A 1 25  ? -32.668 -2.991  -12.002 1.00 37.34 ? 1283 TYR A N   1 
ATOM   157  C CA  . TYR A 1 25  ? -32.955 -4.403  -11.812 1.00 36.07 ? 1283 TYR A CA  1 
ATOM   158  C C   . TYR A 1 25  ? -33.929 -4.698  -10.682 1.00 35.99 ? 1283 TYR A C   1 
ATOM   159  O O   . TYR A 1 25  ? -34.661 -5.681  -10.748 1.00 35.93 ? 1283 TYR A O   1 
ATOM   160  C CB  . TYR A 1 25  ? -31.666 -5.221  -11.722 1.00 35.33 ? 1283 TYR A CB  1 
ATOM   161  C CG  . TYR A 1 25  ? -31.030 -5.370  -13.086 1.00 36.94 ? 1283 TYR A CG  1 
ATOM   162  C CD1 . TYR A 1 25  ? -31.822 -5.629  -14.190 1.00 37.83 ? 1283 TYR A CD1 1 
ATOM   163  C CD2 . TYR A 1 25  ? -29.645 -5.267  -13.277 1.00 38.61 ? 1283 TYR A CD2 1 
ATOM   164  C CE1 . TYR A 1 25  ? -31.286 -5.778  -15.445 1.00 40.36 ? 1283 TYR A CE1 1 
ATOM   165  C CE2 . TYR A 1 25  ? -29.087 -5.425  -14.558 1.00 39.55 ? 1283 TYR A CE2 1 
ATOM   166  C CZ  . TYR A 1 25  ? -29.929 -5.672  -15.631 1.00 41.24 ? 1283 TYR A CZ  1 
ATOM   167  O OH  . TYR A 1 25  ? -29.464 -5.829  -16.923 1.00 44.86 ? 1283 TYR A OH  1 
ATOM   168  N N   . CYS A 1 26  ? -33.921 -3.857  -9.653  1.00 36.49 ? 1284 CYS A N   1 
ATOM   169  C CA  A CYS A 1 26  ? -34.925 -3.937  -8.590  0.70 37.49 ? 1284 CYS A CA  1 
ATOM   170  C CA  B CYS A 1 26  ? -34.914 -3.926  -8.590  0.30 37.56 ? 1284 CYS A CA  1 
ATOM   171  C C   . CYS A 1 26  ? -36.304 -3.766  -9.204  1.00 38.30 ? 1284 CYS A C   1 
ATOM   172  O O   . CYS A 1 26  ? -37.214 -4.517  -8.899  1.00 39.07 ? 1284 CYS A O   1 
ATOM   173  C CB  A CYS A 1 26  ? -34.719 -2.854  -7.532  0.70 37.91 ? 1284 CYS A CB  1 
ATOM   174  C CB  B CYS A 1 26  ? -34.659 -2.823  -7.564  0.30 38.25 ? 1284 CYS A CB  1 
ATOM   175  S SG  A CYS A 1 26  ? -33.469 -3.245  -6.311  0.70 38.39 ? 1284 CYS A SG  1 
ATOM   176  S SG  B CYS A 1 26  ? -35.541 -3.018  -6.017  0.30 40.76 ? 1284 CYS A SG  1 
ATOM   177  N N   . HIS A 1 27  ? -36.437 -2.774  -10.079 1.00 38.86 ? 1285 HIS A N   1 
ATOM   178  C CA  . HIS A 1 27  ? -37.683 -2.501  -10.776 1.00 39.75 ? 1285 HIS A CA  1 
ATOM   179  C C   . HIS A 1 27  ? -38.061 -3.668  -11.684 1.00 39.08 ? 1285 HIS A C   1 
ATOM   180  O O   . HIS A 1 27  ? -39.212 -4.080  -11.697 1.00 39.26 ? 1285 HIS A O   1 
ATOM   181  C CB  . HIS A 1 27  ? -37.584 -1.188  -11.562 1.00 40.17 ? 1285 HIS A CB  1 
ATOM   182  C CG  . HIS A 1 27  ? -37.313 0.011   -10.700 1.00 42.57 ? 1285 HIS A CG  1 
ATOM   183  N ND1 . HIS A 1 27  ? -36.964 1.240   -11.220 1.00 42.98 ? 1285 HIS A ND1 1 
ATOM   184  C CD2 . HIS A 1 27  ? -37.361 0.174   -9.354  1.00 43.97 ? 1285 HIS A CD2 1 
ATOM   185  C CE1 . HIS A 1 27  ? -36.808 2.105   -10.233 1.00 45.84 ? 1285 HIS A CE1 1 
ATOM   186  N NE2 . HIS A 1 27  ? -37.028 1.479   -9.089  1.00 45.20 ? 1285 HIS A NE2 1 
ATOM   187  N N   . LEU A 1 28  ? -37.095 -4.216  -12.427 1.00 37.41 ? 1286 LEU A N   1 
ATOM   188  C CA  . LEU A 1 28  ? -37.415 -5.324  -13.325 1.00 36.78 ? 1286 LEU A CA  1 
ATOM   189  C C   . LEU A 1 28  ? -37.881 -6.544  -12.527 1.00 36.73 ? 1286 LEU A C   1 
ATOM   190  O O   . LEU A 1 28  ? -38.907 -7.146  -12.841 1.00 37.34 ? 1286 LEU A O   1 
ATOM   191  C CB  . LEU A 1 28  ? -36.226 -5.671  -14.244 1.00 35.82 ? 1286 LEU A CB  1 
ATOM   192  C CG  . LEU A 1 28  ? -36.326 -6.892  -15.175 1.00 35.68 ? 1286 LEU A CG  1 
ATOM   193  C CD1 . LEU A 1 28  ? -37.569 -6.861  -16.074 1.00 35.21 ? 1286 LEU A CD1 1 
ATOM   194  C CD2 . LEU A 1 28  ? -35.041 -7.006  -16.045 1.00 33.79 ? 1286 LEU A CD2 1 
ATOM   195  N N   . ILE A 1 29  ? -37.141 -6.893  -11.479 1.00 36.12 ? 1287 ILE A N   1 
ATOM   196  C CA  . ILE A 1 29  ? -37.461 -8.069  -10.685 1.00 36.24 ? 1287 ILE A CA  1 
ATOM   197  C C   . ILE A 1 29  ? -38.879 -7.979  -10.086 1.00 38.67 ? 1287 ILE A C   1 
ATOM   198  O O   . ILE A 1 29  ? -39.632 -8.968  -10.080 1.00 39.07 ? 1287 ILE A O   1 
ATOM   199  C CB  . ILE A 1 29  ? -36.365 -8.320  -9.627  1.00 35.21 ? 1287 ILE A CB  1 
ATOM   200  C CG1 . ILE A 1 29  ? -35.088 -8.840  -10.328 1.00 33.42 ? 1287 ILE A CG1 1 
ATOM   201  C CG2 . ILE A 1 29  ? -36.838 -9.284  -8.535  1.00 33.76 ? 1287 ILE A CG2 1 
ATOM   202  C CD1 . ILE A 1 29  ? -33.803 -8.773  -9.458  1.00 30.12 ? 1287 ILE A CD1 1 
ATOM   203  N N   . GLU A 1 30  ? -39.247 -6.788  -9.612  1.00 39.65 ? 1288 GLU A N   1 
ATOM   204  C CA  . GLU A 1 30  ? -40.556 -6.595  -9.012  1.00 42.79 ? 1288 GLU A CA  1 
ATOM   205  C C   . GLU A 1 30  ? -41.647 -6.743  -10.084 1.00 43.95 ? 1288 GLU A C   1 
ATOM   206  O O   . GLU A 1 30  ? -42.662 -7.403  -9.848  1.00 44.41 ? 1288 GLU A O   1 
ATOM   207  C CB  . GLU A 1 30  ? -40.652 -5.244  -8.291  1.00 43.45 ? 1288 GLU A CB  1 
ATOM   208  C CG  . GLU A 1 30  ? -39.728 -5.157  -7.080  1.00 46.27 ? 1288 GLU A CG  1 
ATOM   209  C CD  . GLU A 1 30  ? -39.804 -3.834  -6.328  1.00 52.12 ? 1288 GLU A CD  1 
ATOM   210  O OE1 . GLU A 1 30  ? -40.554 -2.916  -6.749  1.00 55.47 ? 1288 GLU A OE1 1 
ATOM   211  O OE2 . GLU A 1 30  ? -39.109 -3.728  -5.291  1.00 54.14 ? 1288 GLU A OE2 1 
ATOM   212  N N   . LYS A 1 31  ? -41.401 -6.135  -11.248 1.00 43.52 ? 1289 LYS A N   1 
ATOM   213  C CA  . LYS A 1 31  ? -42.286 -6.173  -12.405 1.00 45.20 ? 1289 LYS A CA  1 
ATOM   214  C C   . LYS A 1 31  ? -42.552 -7.626  -12.809 1.00 45.18 ? 1289 LYS A C   1 
ATOM   215  O O   . LYS A 1 31  ? -43.667 -7.985  -13.178 1.00 46.86 ? 1289 LYS A O   1 
ATOM   216  C CB  . LYS A 1 31  ? -41.594 -5.452  -13.559 1.00 45.07 ? 1289 LYS A CB  1 
ATOM   217  C CG  . LYS A 1 31  ? -42.418 -4.495  -14.375 1.00 49.52 ? 1289 LYS A CG  1 
ATOM   218  C CD  . LYS A 1 31  ? -42.470 -3.111  -13.753 1.00 54.12 ? 1289 LYS A CD  1 
ATOM   219  C CE  . LYS A 1 31  ? -42.090 -2.022  -14.773 1.00 55.25 ? 1289 LYS A CE  1 
ATOM   220  N NZ  . LYS A 1 31  ? -40.749 -1.433  -14.435 1.00 53.31 ? 1289 LYS A NZ  1 
ATOM   221  N N   . LEU A 1 32  ? -41.520 -8.458  -12.711 1.00 43.74 ? 1290 LEU A N   1 
ATOM   222  C CA  . LEU A 1 32  ? -41.584 -9.871  -13.084 1.00 43.52 ? 1290 LEU A CA  1 
ATOM   223  C C   . LEU A 1 32  ? -42.234 -10.727 -12.003 1.00 44.32 ? 1290 LEU A C   1 
ATOM   224  O O   . LEU A 1 32  ? -42.531 -11.896 -12.222 1.00 44.89 ? 1290 LEU A O   1 
ATOM   225  C CB  . LEU A 1 32  ? -40.182 -10.403 -13.363 1.00 41.91 ? 1290 LEU A CB  1 
ATOM   226  C CG  . LEU A 1 32  ? -39.492 -9.980  -14.665 1.00 42.39 ? 1290 LEU A CG  1 
ATOM   227  C CD1 . LEU A 1 32  ? -38.027 -10.314 -14.583 1.00 42.28 ? 1290 LEU A CD1 1 
ATOM   228  C CD2 . LEU A 1 32  ? -40.130 -10.650 -15.879 1.00 45.71 ? 1290 LEU A CD2 1 
ATOM   229  N N   . GLY A 1 33  ? -42.435 -10.144 -10.832 1.00 44.15 ? 1291 GLY A N   1 
ATOM   230  C CA  . GLY A 1 33  ? -43.081 -10.858 -9.736  1.00 46.21 ? 1291 GLY A CA  1 
ATOM   231  C C   . GLY A 1 33  ? -42.161 -11.439 -8.677  1.00 45.37 ? 1291 GLY A C   1 
ATOM   232  O O   . GLY A 1 33  ? -42.624 -12.162 -7.794  1.00 46.98 ? 1291 GLY A O   1 
ATOM   233  N N   . GLY A 1 34  ? -40.868 -11.122 -8.742  1.00 43.51 ? 1292 GLY A N   1 
ATOM   234  C CA  . GLY A 1 34  ? -39.937 -11.552 -7.704  1.00 42.29 ? 1292 GLY A CA  1 
ATOM   235  C C   . GLY A 1 34  ? -39.783 -10.513 -6.607  1.00 42.68 ? 1292 GLY A C   1 
ATOM   236  O O   . GLY A 1 34  ? -40.483 -9.494  -6.599  1.00 43.32 ? 1292 GLY A O   1 
ATOM   237  N N   . LEU A 1 35  ? -38.862 -10.772 -5.682  1.00 41.89 ? 1293 LEU A N   1 
ATOM   238  C CA  . LEU A 1 35  ? -38.515 -9.823  -4.629  1.00 42.34 ? 1293 LEU A CA  1 
ATOM   239  C C   . LEU A 1 35  ? -37.017 -9.569  -4.635  1.00 40.90 ? 1293 LEU A C   1 
ATOM   240  O O   . LEU A 1 35  ? -36.229 -10.432 -5.058  1.00 39.70 ? 1293 LEU A O   1 
ATOM   241  C CB  . LEU A 1 35  ? -38.915 -10.349 -3.246  1.00 43.21 ? 1293 LEU A CB  1 
ATOM   242  C CG  . LEU A 1 35  ? -40.352 -10.775 -2.948  1.00 46.93 ? 1293 LEU A CG  1 
ATOM   243  C CD1 . LEU A 1 35  ? -40.473 -11.047 -1.453  1.00 46.95 ? 1293 LEU A CD1 1 
ATOM   244  C CD2 . LEU A 1 35  ? -41.409 -9.755  -3.405  1.00 47.60 ? 1293 LEU A CD2 1 
ATOM   245  N N   . VAL A 1 36  ? -36.633 -8.378  -4.181  1.00 40.97 ? 1294 VAL A N   1 
ATOM   246  C CA  . VAL A 1 36  ? -35.229 -8.060  -3.953  1.00 40.02 ? 1294 VAL A CA  1 
ATOM   247  C C   . VAL A 1 36  ? -35.049 -7.681  -2.490  1.00 40.68 ? 1294 VAL A C   1 
ATOM   248  O O   . VAL A 1 36  ? -35.815 -6.890  -1.919  1.00 41.64 ? 1294 VAL A O   1 
ATOM   249  C CB  . VAL A 1 36  ? -34.697 -6.907  -4.860  1.00 40.16 ? 1294 VAL A CB  1 
ATOM   250  C CG1 . VAL A 1 36  ? -33.161 -6.766  -4.739  1.00 36.91 ? 1294 VAL A CG1 1 
ATOM   251  C CG2 . VAL A 1 36  ? -35.079 -7.128  -6.314  1.00 40.47 ? 1294 VAL A CG2 1 
ATOM   252  N N   . ILE A 1 37  ? -34.041 -8.275  -1.881  1.00 39.98 ? 1295 ILE A N   1 
ATOM   253  C CA  . ILE A 1 37  ? -33.635 -7.882  -0.543  1.00 40.84 ? 1295 ILE A CA  1 
ATOM   254  C C   . ILE A 1 37  ? -32.509 -6.865  -0.729  1.00 40.34 ? 1295 ILE A C   1 
ATOM   255  O O   . ILE A 1 37  ? -31.372 -7.225  -1.105  1.00 39.89 ? 1295 ILE A O   1 
ATOM   256  C CB  . ILE A 1 37  ? -33.165 -9.087  0.271   1.00 40.49 ? 1295 ILE A CB  1 
ATOM   257  C CG1 . ILE A 1 37  ? -34.254 -10.169 0.288   1.00 41.94 ? 1295 ILE A CG1 1 
ATOM   258  C CG2 . ILE A 1 37  ? -32.799 -8.657  1.686   1.00 40.70 ? 1295 ILE A CG2 1 
ATOM   259  C CD1 . ILE A 1 37  ? -33.799 -11.492 0.927   1.00 42.41 ? 1295 ILE A CD1 1 
ATOM   260  N N   . GLU A 1 38  ? -32.852 -5.605  -0.502  1.00 41.20 ? 1296 GLU A N   1 
ATOM   261  C CA  . GLU A 1 38  ? -31.940 -4.479  -0.647  1.00 42.31 ? 1296 GLU A CA  1 
ATOM   262  C C   . GLU A 1 38  ? -31.252 -4.213  0.681   1.00 42.76 ? 1296 GLU A C   1 
ATOM   263  O O   . GLU A 1 38  ? -31.704 -3.404  1.480   1.00 44.39 ? 1296 GLU A O   1 
ATOM   264  C CB  . GLU A 1 38  ? -32.711 -3.242  -1.103  1.00 43.77 ? 1296 GLU A CB  1 
ATOM   265  C CG  . GLU A 1 38  ? -33.447 -3.470  -2.425  1.00 46.61 ? 1296 GLU A CG  1 
ATOM   266  C CD  . GLU A 1 38  ? -34.298 -2.289  -2.830  1.00 51.07 ? 1296 GLU A CD  1 
ATOM   267  O OE1 . GLU A 1 38  ? -33.745 -1.317  -3.381  1.00 53.55 ? 1296 GLU A OE1 1 
ATOM   268  O OE2 . GLU A 1 38  ? -35.522 -2.348  -2.620  1.00 54.91 ? 1296 GLU A OE2 1 
ATOM   269  N N   . LYS A 1 39  ? -30.196 -4.970  0.938   1.00 41.65 ? 1297 LYS A N   1 
ATOM   270  C CA  . LYS A 1 39  ? -29.411 -4.817  2.146   1.00 41.97 ? 1297 LYS A CA  1 
ATOM   271  C C   . LYS A 1 39  ? -27.972 -4.823  1.695   1.00 40.89 ? 1297 LYS A C   1 
ATOM   272  O O   . LYS A 1 39  ? -27.646 -5.409  0.651   1.00 38.88 ? 1297 LYS A O   1 
ATOM   273  C CB  . LYS A 1 39  ? -29.637 -5.992  3.096   1.00 41.84 ? 1297 LYS A CB  1 
ATOM   274  C CG  . LYS A 1 39  ? -30.956 -5.967  3.852   1.00 44.86 ? 1297 LYS A CG  1 
ATOM   275  C CD  . LYS A 1 39  ? -31.144 -7.273  4.614   1.00 44.54 ? 1297 LYS A CD  1 
ATOM   276  C CE  . LYS A 1 39  ? -32.529 -7.341  5.232   1.00 47.49 ? 1297 LYS A CE  1 
ATOM   277  N NZ  . LYS A 1 39  ? -32.647 -8.476  6.180   1.00 48.11 ? 1297 LYS A NZ  1 
ATOM   278  N N   . GLN A 1 40  ? -27.126 -4.181  2.495   1.00 42.07 ? 1298 GLN A N   1 
ATOM   279  C CA  . GLN A 1 40  ? -25.688 -4.164  2.291   1.00 41.51 ? 1298 GLN A CA  1 
ATOM   280  C C   . GLN A 1 40  ? -25.117 -5.519  2.653   1.00 40.10 ? 1298 GLN A C   1 
ATOM   281  O O   . GLN A 1 40  ? -24.025 -5.890  2.197   1.00 39.60 ? 1298 GLN A O   1 
ATOM   282  C CB  . GLN A 1 40  ? -25.054 -3.118  3.210   1.00 43.66 ? 1298 GLN A CB  1 
ATOM   283  C CG  . GLN A 1 40  ? -25.376 -1.667  2.872   1.00 47.88 ? 1298 GLN A CG  1 
ATOM   284  C CD  . GLN A 1 40  ? -24.745 -0.715  3.865   1.00 52.27 ? 1298 GLN A CD  1 
ATOM   285  O OE1 . GLN A 1 40  ? -24.947 -0.838  5.076   1.00 54.71 ? 1298 GLN A OE1 1 
ATOM   286  N NE2 . GLN A 1 40  ? -23.963 0.235   3.360   1.00 53.93 ? 1298 GLN A NE2 1 
ATOM   287  N N   . CYS A 1 41  ? -25.850 -6.248  3.493   1.00 39.52 ? 1299 CYS A N   1 
ATOM   288  C CA  A CYS A 1 41  ? -25.332 -7.533  3.928   0.50 37.87 ? 1299 CYS A CA  1 
ATOM   289  C CA  B CYS A 1 41  ? -25.457 -7.546  4.046   0.50 38.90 ? 1299 CYS A CA  1 
ATOM   290  C C   . CYS A 1 41  ? -26.065 -8.703  3.289   1.00 37.34 ? 1299 CYS A C   1 
ATOM   291  O O   . CYS A 1 41  ? -27.111 -8.543  2.652   1.00 37.38 ? 1299 CYS A O   1 
ATOM   292  C CB  A CYS A 1 41  ? -25.351 -7.646  5.453   0.50 38.68 ? 1299 CYS A CB  1 
ATOM   293  C CB  B CYS A 1 41  ? -25.991 -7.686  5.471   0.50 40.11 ? 1299 CYS A CB  1 
ATOM   294  S SG  A CYS A 1 41  ? -26.999 -7.501  6.127   0.50 38.42 ? 1299 CYS A SG  1 
ATOM   295  S SG  B CYS A 1 41  ? -25.117 -6.770  6.698   0.50 44.26 ? 1299 CYS A SG  1 
ATOM   296  N N   . PHE A 1 42  ? -25.470 -9.874  3.451   1.00 35.37 ? 1300 PHE A N   1 
ATOM   297  C CA  . PHE A 1 42  ? -26.057 -11.082 2.930   1.00 35.36 ? 1300 PHE A CA  1 
ATOM   298  C C   . PHE A 1 42  ? -27.282 -11.441 3.747   1.00 36.34 ? 1300 PHE A C   1 
ATOM   299  O O   . PHE A 1 42  ? -27.306 -11.240 4.956   1.00 36.76 ? 1300 PHE A O   1 
ATOM   300  C CB  . PHE A 1 42  ? -25.056 -12.229 2.977   1.00 34.24 ? 1300 PHE A CB  1 
ATOM   301  C CG  . PHE A 1 42  ? -25.639 -13.533 2.546   1.00 35.28 ? 1300 PHE A CG  1 
ATOM   302  C CD1 . PHE A 1 42  ? -25.868 -13.787 1.197   1.00 32.40 ? 1300 PHE A CD1 1 
ATOM   303  C CD2 . PHE A 1 42  ? -25.996 -14.495 3.493   1.00 34.21 ? 1300 PHE A CD2 1 
ATOM   304  C CE1 . PHE A 1 42  ? -26.413 -14.984 0.791   1.00 33.42 ? 1300 PHE A CE1 1 
ATOM   305  C CE2 . PHE A 1 42  ? -26.544 -15.704 3.092   1.00 35.72 ? 1300 PHE A CE2 1 
ATOM   306  C CZ  . PHE A 1 42  ? -26.752 -15.949 1.736   1.00 34.61 ? 1300 PHE A CZ  1 
ATOM   307  N N   . ASP A 1 43  ? -28.299 -11.967 3.074   1.00 36.84 ? 1301 ASP A N   1 
ATOM   308  C CA  . ASP A 1 43  ? -29.516 -12.389 3.752   1.00 37.85 ? 1301 ASP A CA  1 
ATOM   309  C C   . ASP A 1 43  ? -29.852 -13.780 3.220   1.00 37.96 ? 1301 ASP A C   1 
ATOM   310  O O   . ASP A 1 43  ? -30.167 -13.925 2.039   1.00 37.57 ? 1301 ASP A O   1 
ATOM   311  C CB  . ASP A 1 43  ? -30.642 -11.376 3.490   1.00 38.60 ? 1301 ASP A CB  1 
ATOM   312  C CG  . ASP A 1 43  ? -31.920 -11.679 4.277   1.00 40.48 ? 1301 ASP A CG  1 
ATOM   313  O OD1 . ASP A 1 43  ? -32.224 -12.863 4.513   1.00 39.90 ? 1301 ASP A OD1 1 
ATOM   314  O OD2 . ASP A 1 43  ? -32.641 -10.722 4.642   1.00 41.04 ? 1301 ASP A OD2 1 
ATOM   315  N N   . PRO A 1 44  ? -29.772 -14.809 4.088   1.00 38.95 ? 1302 PRO A N   1 
ATOM   316  C CA  . PRO A 1 44  ? -30.029 -16.221 3.744   1.00 39.56 ? 1302 PRO A CA  1 
ATOM   317  C C   . PRO A 1 44  ? -31.435 -16.544 3.203   1.00 40.55 ? 1302 PRO A C   1 
ATOM   318  O O   . PRO A 1 44  ? -31.629 -17.617 2.633   1.00 41.60 ? 1302 PRO A O   1 
ATOM   319  C CB  . PRO A 1 44  ? -29.763 -16.964 5.060   1.00 40.26 ? 1302 PRO A CB  1 
ATOM   320  C CG  . PRO A 1 44  ? -29.939 -15.898 6.134   1.00 42.22 ? 1302 PRO A CG  1 
ATOM   321  C CD  . PRO A 1 44  ? -29.407 -14.645 5.509   1.00 40.06 ? 1302 PRO A CD  1 
ATOM   322  N N   . THR A 1 45  ? -32.392 -15.630 3.361   1.00 40.66 ? 1303 THR A N   1 
ATOM   323  C CA  . THR A 1 45  ? -33.730 -15.764 2.754   1.00 41.42 ? 1303 THR A CA  1 
ATOM   324  C C   . THR A 1 45  ? -33.692 -15.753 1.213   1.00 40.55 ? 1303 THR A C   1 
ATOM   325  O O   . THR A 1 45  ? -34.577 -16.326 0.566   1.00 41.23 ? 1303 THR A O   1 
ATOM   326  C CB  . THR A 1 45  ? -34.680 -14.634 3.244   1.00 42.26 ? 1303 THR A CB  1 
ATOM   327  O OG1 . THR A 1 45  ? -34.730 -14.641 4.675   1.00 43.31 ? 1303 THR A OG1 1 
ATOM   328  C CG2 . THR A 1 45  ? -36.109 -14.796 2.689   1.00 43.32 ? 1303 THR A CG2 1 
ATOM   329  N N   . CYS A 1 46  ? -32.687 -15.095 0.632   1.00 38.40 ? 1304 CYS A N   1 
ATOM   330  C CA  . CYS A 1 46  ? -32.584 -14.998 -0.829  1.00 38.16 ? 1304 CYS A CA  1 
ATOM   331  C C   . CYS A 1 46  ? -32.358 -16.362 -1.499  1.00 37.76 ? 1304 CYS A C   1 
ATOM   332  O O   . CYS A 1 46  ? -31.853 -17.307 -0.877  1.00 38.01 ? 1304 CYS A O   1 
ATOM   333  C CB  . CYS A 1 46  ? -31.525 -13.965 -1.252  1.00 36.31 ? 1304 CYS A CB  1 
ATOM   334  S SG  . CYS A 1 46  ? -29.810 -14.547 -1.278  1.00 37.67 ? 1304 CYS A SG  1 
ATOM   335  N N   . THR A 1 47  ? -32.762 -16.469 -2.761  1.00 37.58 ? 1305 THR A N   1 
ATOM   336  C CA  . THR A 1 47  ? -32.642 -17.731 -3.503  1.00 37.50 ? 1305 THR A CA  1 
ATOM   337  C C   . THR A 1 47  ? -31.738 -17.563 -4.726  1.00 36.81 ? 1305 THR A C   1 
ATOM   338  O O   . THR A 1 47  ? -31.174 -18.541 -5.232  1.00 36.65 ? 1305 THR A O   1 
ATOM   339  C CB  . THR A 1 47  ? -34.009 -18.236 -3.978  1.00 39.45 ? 1305 THR A CB  1 
ATOM   340  O OG1 . THR A 1 47  ? -34.641 -17.223 -4.776  1.00 38.26 ? 1305 THR A OG1 1 
ATOM   341  C CG2 . THR A 1 47  ? -34.906 -18.626 -2.775  1.00 40.18 ? 1305 THR A CG2 1 
ATOM   342  N N   . HIS A 1 48  ? -31.632 -16.319 -5.199  1.00 35.28 ? 1306 HIS A N   1 
ATOM   343  C CA  . HIS A 1 48  ? -30.826 -15.974 -6.362  1.00 34.22 ? 1306 HIS A CA  1 
ATOM   344  C C   . HIS A 1 48  ? -30.040 -14.740 -6.025  1.00 33.12 ? 1306 HIS A C   1 
ATOM   345  O O   . HIS A 1 48  ? -30.469 -13.938 -5.195  1.00 33.07 ? 1306 HIS A O   1 
ATOM   346  C CB  . HIS A 1 48  ? -31.692 -15.628 -7.574  1.00 33.77 ? 1306 HIS A CB  1 
ATOM   347  C CG  . HIS A 1 48  ? -32.533 -16.760 -8.080  1.00 36.82 ? 1306 HIS A CG  1 
ATOM   348  N ND1 . HIS A 1 48  ? -33.574 -17.298 -7.354  1.00 37.79 ? 1306 HIS A ND1 1 
ATOM   349  C CD2 . HIS A 1 48  ? -32.511 -17.430 -9.261  1.00 35.60 ? 1306 HIS A CD2 1 
ATOM   350  C CE1 . HIS A 1 48  ? -34.144 -18.265 -8.051  1.00 38.96 ? 1306 HIS A CE1 1 
ATOM   351  N NE2 . HIS A 1 48  ? -33.522 -18.362 -9.215  1.00 39.75 ? 1306 HIS A NE2 1 
ATOM   352  N N   . ILE A 1 49  ? -28.904 -14.569 -6.699  1.00 32.66 ? 1307 ILE A N   1 
ATOM   353  C CA  . ILE A 1 49  ? -28.159 -13.317 -6.630  1.00 32.14 ? 1307 ILE A CA  1 
ATOM   354  C C   . ILE A 1 49  ? -27.632 -13.039 -8.032  1.00 31.77 ? 1307 ILE A C   1 
ATOM   355  O O   . ILE A 1 49  ? -27.149 -13.949 -8.717  1.00 31.43 ? 1307 ILE A O   1 
ATOM   356  C CB  . ILE A 1 49  ? -26.999 -13.368 -5.596  1.00 32.01 ? 1307 ILE A CB  1 
ATOM   357  C CG1 . ILE A 1 49  ? -26.327 -11.999 -5.432  1.00 33.54 ? 1307 ILE A CG1 1 
ATOM   358  C CG2 . ILE A 1 49  ? -25.940 -14.391 -6.020  1.00 33.78 ? 1307 ILE A CG2 1 
ATOM   359  C CD1 . ILE A 1 49  ? -25.413 -11.893 -4.213  1.00 34.34 ? 1307 ILE A CD1 1 
ATOM   360  N N   . VAL A 1 50  ? -27.772 -11.792 -8.469  1.00 31.13 ? 1308 VAL A N   1 
ATOM   361  C CA  . VAL A 1 50  ? -27.153 -11.348 -9.709  1.00 30.75 ? 1308 VAL A CA  1 
ATOM   362  C C   . VAL A 1 50  ? -25.916 -10.541 -9.323  1.00 30.97 ? 1308 VAL A C   1 
ATOM   363  O O   . VAL A 1 50  ? -25.993 -9.637  -8.483  1.00 29.35 ? 1308 VAL A O   1 
ATOM   364  C CB  . VAL A 1 50  ? -28.127 -10.519 -10.582 1.00 31.52 ? 1308 VAL A CB  1 
ATOM   365  C CG1 . VAL A 1 50  ? -27.430 -10.009 -11.833 1.00 30.42 ? 1308 VAL A CG1 1 
ATOM   366  C CG2 . VAL A 1 50  ? -29.329 -11.371 -10.966 1.00 31.98 ? 1308 VAL A CG2 1 
ATOM   367  N N   . VAL A 1 51  ? -24.783 -10.902 -9.928  1.00 31.51 ? 1309 VAL A N   1 
ATOM   368  C CA  . VAL A 1 51  ? -23.479 -10.342 -9.575  1.00 31.98 ? 1309 VAL A CA  1 
ATOM   369  C C   . VAL A 1 51  ? -22.854 -9.715  -10.817 1.00 33.08 ? 1309 VAL A C   1 
ATOM   370  O O   . VAL A 1 51  ? -22.825 -10.337 -11.892 1.00 33.01 ? 1309 VAL A O   1 
ATOM   371  C CB  . VAL A 1 51  ? -22.561 -11.441 -8.960  1.00 32.27 ? 1309 VAL A CB  1 
ATOM   372  C CG1 . VAL A 1 51  ? -21.149 -10.949 -8.735  1.00 33.51 ? 1309 VAL A CG1 1 
ATOM   373  C CG2 . VAL A 1 51  ? -23.129 -11.934 -7.643  1.00 30.49 ? 1309 VAL A CG2 1 
ATOM   374  N N   . GLY A 1 52  ? -22.381 -8.472  -10.679 1.00 33.67 ? 1310 GLY A N   1 
ATOM   375  C CA  . GLY A 1 52  ? -21.753 -7.772  -11.807 1.00 34.72 ? 1310 GLY A CA  1 
ATOM   376  C C   . GLY A 1 52  ? -20.347 -8.290  -12.013 1.00 36.61 ? 1310 GLY A C   1 
ATOM   377  O O   . GLY A 1 52  ? -19.937 -8.574  -13.146 1.00 37.30 ? 1310 GLY A O   1 
ATOM   378  N N   . HIS A 1 53  ? -19.626 -8.442  -10.901 1.00 36.79 ? 1311 HIS A N   1 
ATOM   379  C CA  . HIS A 1 53  ? -18.238 -8.896  -10.903 1.00 39.08 ? 1311 HIS A CA  1 
ATOM   380  C C   . HIS A 1 53  ? -17.991 -9.862  -9.756  1.00 38.24 ? 1311 HIS A C   1 
ATOM   381  O O   . HIS A 1 53  ? -18.127 -9.487  -8.593  1.00 38.60 ? 1311 HIS A O   1 
ATOM   382  C CB  . HIS A 1 53  ? -17.283 -7.701  -10.803 1.00 40.36 ? 1311 HIS A CB  1 
ATOM   383  C CG  . HIS A 1 53  ? -17.512 -6.674  -11.863 1.00 43.61 ? 1311 HIS A CG  1 
ATOM   384  N ND1 . HIS A 1 53  ? -16.744 -6.601  -13.006 1.00 49.32 ? 1311 HIS A ND1 1 
ATOM   385  C CD2 . HIS A 1 53  ? -18.452 -5.705  -11.976 1.00 44.31 ? 1311 HIS A CD2 1 
ATOM   386  C CE1 . HIS A 1 53  ? -17.186 -5.613  -13.768 1.00 49.81 ? 1311 HIS A CE1 1 
ATOM   387  N NE2 . HIS A 1 53  ? -18.231 -5.063  -13.171 1.00 49.04 ? 1311 HIS A NE2 1 
ATOM   388  N N   . PRO A 1 54  ? -17.640 -11.116 -10.071 1.00 38.49 ? 1312 PRO A N   1 
ATOM   389  C CA  . PRO A 1 54  ? -17.288 -12.054 -8.996  1.00 38.04 ? 1312 PRO A CA  1 
ATOM   390  C C   . PRO A 1 54  ? -16.147 -11.514 -8.110  1.00 38.42 ? 1312 PRO A C   1 
ATOM   391  O O   . PRO A 1 54  ? -15.089 -11.169 -8.625  1.00 39.77 ? 1312 PRO A O   1 
ATOM   392  C CB  . PRO A 1 54  ? -16.856 -13.311 -9.756  1.00 39.00 ? 1312 PRO A CB  1 
ATOM   393  C CG  . PRO A 1 54  ? -17.539 -13.197 -11.110 1.00 39.61 ? 1312 PRO A CG  1 
ATOM   394  C CD  . PRO A 1 54  ? -17.569 -11.728 -11.411 1.00 39.09 ? 1312 PRO A CD  1 
ATOM   395  N N   . LEU A 1 55  ? -16.385 -11.421 -6.798  1.00 37.75 ? 1313 LEU A N   1 
ATOM   396  C CA  . LEU A 1 55  ? -15.435 -10.846 -5.826  1.00 37.70 ? 1313 LEU A CA  1 
ATOM   397  C C   . LEU A 1 55  ? -15.479 -11.666 -4.535  1.00 36.73 ? 1313 LEU A C   1 
ATOM   398  O O   . LEU A 1 55  ? -16.406 -12.454 -4.330  1.00 37.00 ? 1313 LEU A O   1 
ATOM   399  C CB  . LEU A 1 55  ? -15.758 -9.370  -5.525  1.00 37.00 ? 1313 LEU A CB  1 
ATOM   400  C CG  . LEU A 1 55  ? -15.647 -8.265  -6.598  1.00 39.87 ? 1313 LEU A CG  1 
ATOM   401  C CD1 . LEU A 1 55  ? -16.366 -6.988  -6.157  1.00 39.71 ? 1313 LEU A CD1 1 
ATOM   402  C CD2 . LEU A 1 55  ? -14.188 -7.918  -6.981  1.00 37.34 ? 1313 LEU A CD2 1 
ATOM   403  N N   . ARG A 1 56  ? -14.488 -11.489 -3.666  1.00 36.40 ? 1314 ARG A N   1 
ATOM   404  C CA  . ARG A 1 56  ? -14.450 -12.181 -2.377  1.00 35.99 ? 1314 ARG A CA  1 
ATOM   405  C C   . ARG A 1 56  ? -15.147 -11.335 -1.301  1.00 34.76 ? 1314 ARG A C   1 
ATOM   406  O O   . ARG A 1 56  ? -14.573 -11.030 -0.244  1.00 34.12 ? 1314 ARG A O   1 
ATOM   407  C CB  . ARG A 1 56  ? -13.008 -12.474 -1.971  1.00 36.73 ? 1314 ARG A CB  1 
ATOM   408  C CG  . ARG A 1 56  ? -12.540 -13.859 -2.375  1.00 40.79 ? 1314 ARG A CG  1 
ATOM   409  C CD  . ARG A 1 56  ? -11.228 -13.825 -3.090  1.00 43.97 ? 1314 ARG A CD  1 
ATOM   410  N NE  . ARG A 1 56  ? -10.079 -13.515 -2.248  1.00 49.35 ? 1314 ARG A NE  1 
ATOM   411  C CZ  . ARG A 1 56  ? -9.375  -12.384 -2.296  1.00 52.56 ? 1314 ARG A CZ  1 
ATOM   412  N NH1 . ARG A 1 56  ? -9.710  -11.406 -3.126  1.00 55.96 ? 1314 ARG A NH1 1 
ATOM   413  N NH2 . ARG A 1 56  ? -8.325  -12.227 -1.506  1.00 53.02 ? 1314 ARG A NH2 1 
ATOM   414  N N   . ASN A 1 57  ? -16.377 -10.938 -1.600  1.00 33.78 ? 1315 ASN A N   1 
ATOM   415  C CA  . ASN A 1 57  ? -17.161 -10.165 -0.655  1.00 33.18 ? 1315 ASN A CA  1 
ATOM   416  C C   . ASN A 1 57  ? -18.203 -11.054 0.000   1.00 32.46 ? 1315 ASN A C   1 
ATOM   417  O O   . ASN A 1 57  ? -18.380 -12.230 -0.383  1.00 32.49 ? 1315 ASN A O   1 
ATOM   418  C CB  . ASN A 1 57  ? -17.739 -8.888  -1.305  1.00 33.85 ? 1315 ASN A CB  1 
ATOM   419  C CG  . ASN A 1 57  ? -18.615 -9.168  -2.519  1.00 33.97 ? 1315 ASN A CG  1 
ATOM   420  O OD1 . ASN A 1 57  ? -19.115 -10.272 -2.718  1.00 35.39 ? 1315 ASN A OD1 1 
ATOM   421  N ND2 . ASN A 1 57  ? -18.833 -8.146  -3.317  1.00 36.10 ? 1315 ASN A ND2 1 
ATOM   422  N N   . GLU A 1 58  ? -18.866 -10.503 1.011   1.00 32.09 ? 1316 GLU A N   1 
ATOM   423  C CA  . GLU A 1 58  ? -19.807 -11.228 1.837   1.00 30.86 ? 1316 GLU A CA  1 
ATOM   424  C C   . GLU A 1 58  ? -20.934 -11.871 1.036   1.00 30.48 ? 1316 GLU A C   1 
ATOM   425  O O   . GLU A 1 58  ? -21.190 -13.066 1.186   1.00 30.45 ? 1316 GLU A O   1 
ATOM   426  C CB  . GLU A 1 58  ? -20.382 -10.283 2.906   1.00 30.95 ? 1316 GLU A CB  1 
ATOM   427  C CG  . GLU A 1 58  ? -21.394 -10.927 3.837   1.00 30.64 ? 1316 GLU A CG  1 
ATOM   428  C CD  . GLU A 1 58  ? -22.162 -9.922  4.693   1.00 30.62 ? 1316 GLU A CD  1 
ATOM   429  O OE1 . GLU A 1 58  ? -21.730 -8.772  4.853   1.00 33.21 ? 1316 GLU A OE1 1 
ATOM   430  O OE2 . GLU A 1 58  ? -23.211 -10.292 5.234   1.00 34.47 ? 1316 GLU A OE2 1 
ATOM   431  N N   . LYS A 1 59  ? -21.630 -11.102 0.202   1.00 31.01 ? 1317 LYS A N   1 
ATOM   432  C CA  . LYS A 1 59  ? -22.752 -11.690 -0.577  1.00 30.67 ? 1317 LYS A CA  1 
ATOM   433  C C   . LYS A 1 59  ? -22.338 -12.835 -1.506  1.00 30.63 ? 1317 LYS A C   1 
ATOM   434  O O   . LYS A 1 59  ? -23.035 -13.852 -1.624  1.00 31.23 ? 1317 LYS A O   1 
ATOM   435  C CB  . LYS A 1 59  ? -23.476 -10.613 -1.383  1.00 30.64 ? 1317 LYS A CB  1 
ATOM   436  C CG  . LYS A 1 59  ? -24.395 -9.698  -0.559  1.00 31.81 ? 1317 LYS A CG  1 
ATOM   437  C CD  . LYS A 1 59  ? -24.998 -8.604  -1.428  1.00 29.56 ? 1317 LYS A CD  1 
ATOM   438  C CE  . LYS A 1 59  ? -25.723 -7.559  -0.611  1.00 29.45 ? 1317 LYS A CE  1 
ATOM   439  N NZ  . LYS A 1 59  ? -25.962 -6.363  -1.454  1.00 28.92 ? 1317 LYS A NZ  1 
ATOM   440  N N   . TYR A 1 60  ? -21.226 -12.663 -2.204  1.00 30.79 ? 1318 TYR A N   1 
ATOM   441  C CA  . TYR A 1 60  ? -20.805 -13.671 -3.171  1.00 30.76 ? 1318 TYR A CA  1 
ATOM   442  C C   . TYR A 1 60  ? -20.428 -14.974 -2.473  1.00 31.36 ? 1318 TYR A C   1 
ATOM   443  O O   . TYR A 1 60  ? -20.979 -16.046 -2.785  1.00 31.43 ? 1318 TYR A O   1 
ATOM   444  C CB  . TYR A 1 60  ? -19.630 -13.169 -4.032  1.00 31.16 ? 1318 TYR A CB  1 
ATOM   445  C CG  . TYR A 1 60  ? -19.443 -14.046 -5.248  1.00 31.57 ? 1318 TYR A CG  1 
ATOM   446  C CD1 . TYR A 1 60  ? -20.009 -13.700 -6.470  1.00 31.72 ? 1318 TYR A CD1 1 
ATOM   447  C CD2 . TYR A 1 60  ? -18.755 -15.258 -5.158  1.00 32.18 ? 1318 TYR A CD2 1 
ATOM   448  C CE1 . TYR A 1 60  ? -19.859 -14.527 -7.597  1.00 31.95 ? 1318 TYR A CE1 1 
ATOM   449  C CE2 . TYR A 1 60  ? -18.607 -16.098 -6.280  1.00 33.97 ? 1318 TYR A CE2 1 
ATOM   450  C CZ  . TYR A 1 60  ? -19.172 -15.725 -7.484  1.00 33.18 ? 1318 TYR A CZ  1 
ATOM   451  O OH  . TYR A 1 60  ? -19.035 -16.547 -8.575  1.00 34.17 ? 1318 TYR A OH  1 
ATOM   452  N N   . LEU A 1 61  ? -19.522 -14.872 -1.505  1.00 30.81 ? 1319 LEU A N   1 
ATOM   453  C CA  . LEU A 1 61  ? -19.029 -16.055 -0.800  1.00 32.00 ? 1319 LEU A CA  1 
ATOM   454  C C   . LEU A 1 61  ? -20.119 -16.767 -0.024  1.00 32.72 ? 1319 LEU A C   1 
ATOM   455  O O   . LEU A 1 61  ? -20.160 -17.998 -0.022  1.00 33.98 ? 1319 LEU A O   1 
ATOM   456  C CB  . LEU A 1 61  ? -17.834 -15.715 0.111   1.00 31.37 ? 1319 LEU A CB  1 
ATOM   457  C CG  . LEU A 1 61  ? -16.616 -15.155 -0.655  1.00 32.40 ? 1319 LEU A CG  1 
ATOM   458  C CD1 . LEU A 1 61  ? -15.544 -14.721 0.343   1.00 30.71 ? 1319 LEU A CD1 1 
ATOM   459  C CD2 . LEU A 1 61  ? -16.060 -16.197 -1.648  1.00 32.51 ? 1319 LEU A CD2 1 
ATOM   460  N N   . ALA A 1 62  ? -20.996 -16.004 0.629   1.00 32.36 ? 1320 ALA A N   1 
ATOM   461  C CA  . ALA A 1 62  ? -22.072 -16.610 1.405   1.00 33.11 ? 1320 ALA A CA  1 
ATOM   462  C C   . ALA A 1 62  ? -23.135 -17.311 0.526   1.00 34.00 ? 1320 ALA A C   1 
ATOM   463  O O   . ALA A 1 62  ? -23.706 -18.329 0.925   1.00 34.40 ? 1320 ALA A O   1 
ATOM   464  C CB  . ALA A 1 62  ? -22.720 -15.570 2.359   1.00 32.64 ? 1320 ALA A CB  1 
ATOM   465  N N   . SER A 1 63  ? -23.421 -16.734 -0.640  1.00 33.39 ? 1321 SER A N   1 
ATOM   466  C CA  . SER A 1 63  ? -24.303 -17.362 -1.625  1.00 34.45 ? 1321 SER A CA  1 
ATOM   467  C C   . SER A 1 63  ? -23.733 -18.694 -2.110  1.00 34.91 ? 1321 SER A C   1 
ATOM   468  O O   . SER A 1 63  ? -24.464 -19.651 -2.300  1.00 35.87 ? 1321 SER A O   1 
ATOM   469  C CB  . SER A 1 63  ? -24.489 -16.438 -2.845  1.00 34.02 ? 1321 SER A CB  1 
ATOM   470  O OG  . SER A 1 63  ? -25.135 -15.236 -2.471  1.00 33.98 ? 1321 SER A OG  1 
ATOM   471  N N   . VAL A 1 64  ? -22.425 -18.741 -2.330  1.00 34.95 ? 1322 VAL A N   1 
ATOM   472  C CA  . VAL A 1 64  ? -21.771 -19.984 -2.721  1.00 35.86 ? 1322 VAL A CA  1 
ATOM   473  C C   . VAL A 1 64  ? -21.829 -21.006 -1.582  1.00 36.54 ? 1322 VAL A C   1 
ATOM   474  O O   . VAL A 1 64  ? -22.197 -22.168 -1.803  1.00 37.36 ? 1322 VAL A O   1 
ATOM   475  C CB  . VAL A 1 64  ? -20.317 -19.730 -3.159  1.00 35.94 ? 1322 VAL A CB  1 
ATOM   476  C CG1 . VAL A 1 64  ? -19.605 -21.059 -3.473  1.00 37.04 ? 1322 VAL A CG1 1 
ATOM   477  C CG2 . VAL A 1 64  ? -20.305 -18.828 -4.375  1.00 34.70 ? 1322 VAL A CG2 1 
ATOM   478  N N   . ALA A 1 65  ? -21.498 -20.563 -0.364  1.00 35.44 ? 1323 ALA A N   1 
ATOM   479  C CA  . ALA A 1 65  ? -21.508 -21.439 0.804   1.00 35.99 ? 1323 ALA A CA  1 
ATOM   480  C C   . ALA A 1 65  ? -22.865 -22.070 1.016   1.00 37.05 ? 1323 ALA A C   1 
ATOM   481  O O   . ALA A 1 65  ? -22.963 -23.156 1.597   1.00 38.50 ? 1323 ALA A O   1 
ATOM   482  C CB  . ALA A 1 65  ? -21.066 -20.679 2.063   1.00 35.87 ? 1323 ALA A CB  1 
ATOM   483  N N   . ALA A 1 66  ? -23.921 -21.406 0.544   1.00 36.76 ? 1324 ALA A N   1 
ATOM   484  C CA  . ALA A 1 66  ? -25.269 -21.963 0.695   1.00 37.83 ? 1324 ALA A CA  1 
ATOM   485  C C   . ALA A 1 66  ? -25.834 -22.508 -0.611  1.00 38.14 ? 1324 ALA A C   1 
ATOM   486  O O   . ALA A 1 66  ? -26.974 -22.954 -0.653  1.00 39.01 ? 1324 ALA A O   1 
ATOM   487  C CB  . ALA A 1 66  ? -26.232 -20.939 1.320   1.00 37.17 ? 1324 ALA A CB  1 
ATOM   488  N N   . GLY A 1 67  ? -25.042 -22.453 -1.676  1.00 37.69 ? 1325 GLY A N   1 
ATOM   489  C CA  . GLY A 1 67  ? -25.457 -23.010 -2.966  1.00 38.38 ? 1325 GLY A CA  1 
ATOM   490  C C   . GLY A 1 67  ? -26.621 -22.286 -3.620  1.00 37.83 ? 1325 GLY A C   1 
ATOM   491  O O   . GLY A 1 67  ? -27.530 -22.913 -4.134  1.00 38.93 ? 1325 GLY A O   1 
ATOM   492  N N   . LYS A 1 68  ? -26.593 -20.957 -3.609  1.00 36.30 ? 1326 LYS A N   1 
ATOM   493  C CA  . LYS A 1 68  ? -27.624 -20.181 -4.289  1.00 35.63 ? 1326 LYS A CA  1 
ATOM   494  C C   . LYS A 1 68  ? -27.331 -20.156 -5.791  1.00 35.27 ? 1326 LYS A C   1 
ATOM   495  O O   . LYS A 1 68  ? -26.223 -20.484 -6.211  1.00 33.61 ? 1326 LYS A O   1 
ATOM   496  C CB  . LYS A 1 68  ? -27.672 -18.745 -3.741  1.00 34.64 ? 1326 LYS A CB  1 
ATOM   497  C CG  . LYS A 1 68  ? -27.721 -18.612 -2.197  1.00 34.79 ? 1326 LYS A CG  1 
ATOM   498  C CD  . LYS A 1 68  ? -28.990 -19.164 -1.604  1.00 37.50 ? 1326 LYS A CD  1 
ATOM   499  C CE  . LYS A 1 68  ? -29.138 -18.751 -0.118  1.00 39.33 ? 1326 LYS A CE  1 
ATOM   500  N NZ  . LYS A 1 68  ? -30.358 -19.312 0.475   1.00 41.37 ? 1326 LYS A NZ  1 
ATOM   501  N N   . TRP A 1 69  ? -28.329 -19.780 -6.589  1.00 35.34 ? 1327 TRP A N   1 
ATOM   502  C CA  . TRP A 1 69  ? -28.086 -19.420 -7.979  1.00 35.41 ? 1327 TRP A CA  1 
ATOM   503  C C   . TRP A 1 69  ? -27.272 -18.134 -8.016  1.00 34.16 ? 1327 TRP A C   1 
ATOM   504  O O   . TRP A 1 69  ? -27.705 -17.117 -7.474  1.00 33.53 ? 1327 TRP A O   1 
ATOM   505  C CB  . TRP A 1 69  ? -29.407 -19.181 -8.702  1.00 36.53 ? 1327 TRP A CB  1 
ATOM   506  C CG  . TRP A 1 69  ? -30.209 -20.420 -8.922  1.00 39.38 ? 1327 TRP A CG  1 
ATOM   507  C CD1 . TRP A 1 69  ? -31.337 -20.799 -8.253  1.00 41.18 ? 1327 TRP A CD1 1 
ATOM   508  C CD2 . TRP A 1 69  ? -29.945 -21.447 -9.882  1.00 43.01 ? 1327 TRP A CD2 1 
ATOM   509  N NE1 . TRP A 1 69  ? -31.796 -22.006 -8.739  1.00 44.46 ? 1327 TRP A NE1 1 
ATOM   510  C CE2 . TRP A 1 69  ? -30.962 -22.423 -9.743  1.00 44.56 ? 1327 TRP A CE2 1 
ATOM   511  C CE3 . TRP A 1 69  ? -28.946 -21.641 -10.847 1.00 42.25 ? 1327 TRP A CE3 1 
ATOM   512  C CZ2 . TRP A 1 69  ? -31.015 -23.573 -10.535 1.00 46.20 ? 1327 TRP A CZ2 1 
ATOM   513  C CZ3 . TRP A 1 69  ? -29.014 -22.789 -11.649 1.00 45.15 ? 1327 TRP A CZ3 1 
ATOM   514  C CH2 . TRP A 1 69  ? -30.034 -23.735 -11.477 1.00 47.04 ? 1327 TRP A CH2 1 
ATOM   515  N N   . VAL A 1 70  ? -26.089 -18.188 -8.626  1.00 33.81 ? 1328 VAL A N   1 
ATOM   516  C CA  . VAL A 1 70  ? -25.219 -17.014 -8.759  1.00 32.50 ? 1328 VAL A CA  1 
ATOM   517  C C   . VAL A 1 70  ? -25.154 -16.648 -10.243 1.00 32.95 ? 1328 VAL A C   1 
ATOM   518  O O   . VAL A 1 70  ? -24.564 -17.368 -11.047 1.00 32.93 ? 1328 VAL A O   1 
ATOM   519  C CB  . VAL A 1 70  ? -23.807 -17.257 -8.172  1.00 32.62 ? 1328 VAL A CB  1 
ATOM   520  C CG1 . VAL A 1 70  ? -22.872 -16.062 -8.460  1.00 31.66 ? 1328 VAL A CG1 1 
ATOM   521  C CG2 . VAL A 1 70  ? -23.888 -17.515 -6.669  1.00 31.49 ? 1328 VAL A CG2 1 
ATOM   522  N N   . LEU A 1 71  ? -25.807 -15.543 -10.600 1.00 32.97 ? 1329 LEU A N   1 
ATOM   523  C CA  . LEU A 1 71  ? -26.187 -15.329 -11.986 1.00 33.62 ? 1329 LEU A CA  1 
ATOM   524  C C   . LEU A 1 71  ? -25.618 -14.053 -12.576 1.00 33.81 ? 1329 LEU A C   1 
ATOM   525  O O   . LEU A 1 71  ? -25.476 -13.038 -11.891 1.00 32.81 ? 1329 LEU A O   1 
ATOM   526  C CB  . LEU A 1 71  ? -27.708 -15.330 -12.124 1.00 34.15 ? 1329 LEU A CB  1 
ATOM   527  C CG  . LEU A 1 71  ? -28.477 -16.549 -11.604 1.00 35.17 ? 1329 LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 71  ? -29.962 -16.243 -11.667 1.00 37.28 ? 1329 LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 71  ? -28.149 -17.793 -12.399 1.00 34.44 ? 1329 LEU A CD2 1 
ATOM   530  N N   . HIS A 1 72  ? -25.280 -14.140 -13.857 1.00 33.85 ? 1330 HIS A N   1 
ATOM   531  C CA  . HIS A 1 72  ? -24.844 -13.009 -14.662 1.00 33.85 ? 1330 HIS A CA  1 
ATOM   532  C C   . HIS A 1 72  ? -26.033 -12.103 -15.032 1.00 33.76 ? 1330 HIS A C   1 
ATOM   533  O O   . HIS A 1 72  ? -27.153 -12.587 -15.195 1.00 34.21 ? 1330 HIS A O   1 
ATOM   534  C CB  . HIS A 1 72  ? -24.197 -13.556 -15.944 1.00 35.13 ? 1330 HIS A CB  1 
ATOM   535  C CG  . HIS A 1 72  ? -23.614 -12.494 -16.820 1.00 35.38 ? 1330 HIS A CG  1 
ATOM   536  N ND1 . HIS A 1 72  ? -24.285 -11.981 -17.907 1.00 36.64 ? 1330 HIS A ND1 1 
ATOM   537  C CD2 . HIS A 1 72  ? -22.442 -11.822 -16.747 1.00 35.18 ? 1330 HIS A CD2 1 
ATOM   538  C CE1 . HIS A 1 72  ? -23.545 -11.043 -18.476 1.00 36.10 ? 1330 HIS A CE1 1 
ATOM   539  N NE2 . HIS A 1 72  ? -22.424 -10.924 -17.787 1.00 35.94 ? 1330 HIS A NE2 1 
ATOM   540  N N   . ARG A 1 73  ? -25.789 -10.804 -15.214 1.00 33.85 ? 1331 ARG A N   1 
ATOM   541  C CA  . ARG A 1 73  ? -26.863 -9.841  -15.528 1.00 33.90 ? 1331 ARG A CA  1 
ATOM   542  C C   . ARG A 1 73  ? -27.667 -10.153 -16.806 1.00 34.51 ? 1331 ARG A C   1 
ATOM   543  O O   . ARG A 1 73  ? -28.840 -9.766  -16.922 1.00 34.36 ? 1331 ARG A O   1 
ATOM   544  C CB  . ARG A 1 73  ? -26.306 -8.403  -15.587 1.00 34.30 ? 1331 ARG A CB  1 
ATOM   545  C CG  . ARG A 1 73  ? -25.619 -8.024  -16.930 1.00 36.63 ? 1331 ARG A CG  1 
ATOM   546  C CD  . ARG A 1 73  ? -24.969 -6.629  -16.872 1.00 38.81 ? 1331 ARG A CD  1 
ATOM   547  N NE  . ARG A 1 73  ? -23.706 -6.674  -16.143 1.00 40.38 ? 1331 ARG A NE  1 
ATOM   548  C CZ  . ARG A 1 73  ? -23.233 -5.711  -15.355 1.00 40.05 ? 1331 ARG A CZ  1 
ATOM   549  N NH1 . ARG A 1 73  ? -23.916 -4.593  -15.145 1.00 39.56 ? 1331 ARG A NH1 1 
ATOM   550  N NH2 . ARG A 1 73  ? -22.061 -5.880  -14.764 1.00 39.69 ? 1331 ARG A NH2 1 
ATOM   551  N N   . SER A 1 74  ? -27.049 -10.822 -17.778 1.00 34.91 ? 1332 SER A N   1 
ATOM   552  C CA  . SER A 1 74  ? -27.789 -11.202 -18.991 1.00 35.42 ? 1332 SER A CA  1 
ATOM   553  C C   . SER A 1 74  ? -28.997 -12.077 -18.660 1.00 34.76 ? 1332 SER A C   1 
ATOM   554  O O   . SER A 1 74  ? -29.973 -12.098 -19.408 1.00 35.91 ? 1332 SER A O   1 
ATOM   555  C CB  . SER A 1 74  ? -26.890 -11.878 -20.040 1.00 36.10 ? 1332 SER A CB  1 
ATOM   556  O OG  . SER A 1 74  ? -26.240 -13.000 -19.477 1.00 36.44 ? 1332 SER A OG  1 
ATOM   557  N N   . TYR A 1 75  ? -28.943 -12.789 -17.540 1.00 34.87 ? 1333 TYR A N   1 
ATOM   558  C CA  . TYR A 1 75  ? -30.121 -13.503 -17.033 1.00 35.29 ? 1333 TYR A CA  1 
ATOM   559  C C   . TYR A 1 75  ? -31.360 -12.619 -17.019 1.00 35.73 ? 1333 TYR A C   1 
ATOM   560  O O   . TYR A 1 75  ? -32.404 -12.983 -17.577 1.00 36.76 ? 1333 TYR A O   1 
ATOM   561  C CB  . TYR A 1 75  ? -29.897 -14.085 -15.628 1.00 34.74 ? 1333 TYR A CB  1 
ATOM   562  C CG  . TYR A 1 75  ? -31.149 -14.754 -15.074 1.00 35.84 ? 1333 TYR A CG  1 
ATOM   563  C CD1 . TYR A 1 75  ? -31.610 -15.963 -15.608 1.00 38.24 ? 1333 TYR A CD1 1 
ATOM   564  C CD2 . TYR A 1 75  ? -31.886 -14.169 -14.044 1.00 36.14 ? 1333 TYR A CD2 1 
ATOM   565  C CE1 . TYR A 1 75  ? -32.778 -16.576 -15.139 1.00 39.57 ? 1333 TYR A CE1 1 
ATOM   566  C CE2 . TYR A 1 75  ? -33.056 -14.792 -13.543 1.00 37.08 ? 1333 TYR A CE2 1 
ATOM   567  C CZ  . TYR A 1 75  ? -33.492 -15.985 -14.101 1.00 39.41 ? 1333 TYR A CZ  1 
ATOM   568  O OH  . TYR A 1 75  ? -34.643 -16.600 -13.635 1.00 41.92 ? 1333 TYR A OH  1 
ATOM   569  N N   . LEU A 1 76  ? -31.247 -11.468 -16.360 1.00 35.19 ? 1334 LEU A N   1 
ATOM   570  C CA  . LEU A 1 76  ? -32.378 -10.569 -16.208 1.00 35.28 ? 1334 LEU A CA  1 
ATOM   571  C C   . LEU A 1 76  ? -32.805 -9.954  -17.538 1.00 36.69 ? 1334 LEU A C   1 
ATOM   572  O O   . LEU A 1 76  ? -34.001 -9.727  -17.763 1.00 36.94 ? 1334 LEU A O   1 
ATOM   573  C CB  . LEU A 1 76  ? -32.071 -9.501  -15.155 1.00 34.43 ? 1334 LEU A CB  1 
ATOM   574  C CG  . LEU A 1 76  ? -31.937 -10.034 -13.721 1.00 34.35 ? 1334 LEU A CG  1 
ATOM   575  C CD1 . LEU A 1 76  ? -31.558 -8.925  -12.736 1.00 34.89 ? 1334 LEU A CD1 1 
ATOM   576  C CD2 . LEU A 1 76  ? -33.216 -10.742 -13.264 1.00 35.13 ? 1334 LEU A CD2 1 
ATOM   577  N N   . GLU A 1 77  ? -31.839 -9.681  -18.420 1.00 37.67 ? 1335 GLU A N   1 
ATOM   578  C CA  . GLU A 1 77  ? -32.179 -9.222  -19.775 1.00 39.12 ? 1335 GLU A CA  1 
ATOM   579  C C   . GLU A 1 77  ? -32.951 -10.267 -20.591 1.00 39.87 ? 1335 GLU A C   1 
ATOM   580  O O   . GLU A 1 77  ? -33.837 -9.920  -21.380 1.00 41.74 ? 1335 GLU A O   1 
ATOM   581  C CB  . GLU A 1 77  ? -30.939 -8.754  -20.541 1.00 40.07 ? 1335 GLU A CB  1 
ATOM   582  C CG  . GLU A 1 77  ? -30.314 -7.445  -20.022 1.00 39.40 ? 1335 GLU A CG  1 
ATOM   583  C CD  . GLU A 1 77  ? -31.331 -6.358  -19.719 1.00 40.62 ? 1335 GLU A CD  1 
ATOM   584  O OE1 . GLU A 1 77  ? -32.242 -6.095  -20.536 1.00 42.37 ? 1335 GLU A OE1 1 
ATOM   585  O OE2 . GLU A 1 77  ? -31.213 -5.769  -18.634 1.00 42.04 ? 1335 GLU A OE2 1 
ATOM   586  N N   . ALA A 1 78  ? -32.622 -11.541 -20.411 1.00 39.71 ? 1336 ALA A N   1 
ATOM   587  C CA  . ALA A 1 78  ? -33.395 -12.619 -21.043 1.00 40.67 ? 1336 ALA A CA  1 
ATOM   588  C C   . ALA A 1 78  ? -34.780 -12.711 -20.410 1.00 41.10 ? 1336 ALA A C   1 
ATOM   589  O O   . ALA A 1 78  ? -35.762 -13.002 -21.096 1.00 42.30 ? 1336 ALA A O   1 
ATOM   590  C CB  . ALA A 1 78  ? -32.664 -13.938 -20.935 1.00 40.75 ? 1336 ALA A CB  1 
ATOM   591  N N   . CYS A 1 79  ? -34.861 -12.456 -19.100 1.00 40.10 ? 1337 CYS A N   1 
ATOM   592  C CA  . CYS A 1 79  ? -36.160 -12.434 -18.412 1.00 40.77 ? 1337 CYS A CA  1 
ATOM   593  C C   . CYS A 1 79  ? -37.051 -11.320 -18.959 1.00 41.57 ? 1337 CYS A C   1 
ATOM   594  O O   . CYS A 1 79  ? -38.214 -11.550 -19.259 1.00 42.45 ? 1337 CYS A O   1 
ATOM   595  C CB  . CYS A 1 79  ? -35.989 -12.282 -16.890 1.00 39.19 ? 1337 CYS A CB  1 
ATOM   596  S SG  . CYS A 1 79  ? -35.297 -13.742 -16.066 1.00 38.19 ? 1337 CYS A SG  1 
ATOM   597  N N   . ARG A 1 80  ? -36.489 -10.118 -19.070 1.00 42.05 ? 1338 ARG A N   1 
ATOM   598  C CA  . ARG A 1 80  ? -37.161 -8.933  -19.623 1.00 43.78 ? 1338 ARG A CA  1 
ATOM   599  C C   . ARG A 1 80  ? -37.761 -9.215  -21.014 1.00 45.57 ? 1338 ARG A C   1 
ATOM   600  O O   . ARG A 1 80  ? -38.898 -8.835  -21.294 1.00 47.07 ? 1338 ARG A O   1 
ATOM   601  C CB  . ARG A 1 80  ? -36.154 -7.763  -19.659 1.00 43.20 ? 1338 ARG A CB  1 
ATOM   602  C CG  . ARG A 1 80  ? -36.585 -6.480  -20.381 1.00 45.86 ? 1338 ARG A CG  1 
ATOM   603  C CD  . ARG A 1 80  ? -35.464 -5.416  -20.313 1.00 48.22 ? 1338 ARG A CD  1 
ATOM   604  N NE  . ARG A 1 80  ? -35.718 -4.459  -19.237 1.00 50.58 ? 1338 ARG A NE  1 
ATOM   605  C CZ  . ARG A 1 80  ? -34.875 -4.125  -18.268 1.00 51.66 ? 1338 ARG A CZ  1 
ATOM   606  N NH1 . ARG A 1 80  ? -33.649 -4.633  -18.199 1.00 50.82 ? 1338 ARG A NH1 1 
ATOM   607  N NH2 . ARG A 1 80  ? -35.266 -3.242  -17.359 1.00 54.67 ? 1338 ARG A NH2 1 
ATOM   608  N N   . THR A 1 81  ? -37.004 -9.914  -21.860 1.00 46.47 ? 1339 THR A N   1 
ATOM   609  C CA  . THR A 1 81  ? -37.444 -10.261 -23.216 1.00 47.94 ? 1339 THR A CA  1 
ATOM   610  C C   . THR A 1 81  ? -38.593 -11.264 -23.155 1.00 49.05 ? 1339 THR A C   1 
ATOM   611  O O   . THR A 1 81  ? -39.603 -11.122 -23.860 1.00 49.91 ? 1339 THR A O   1 
ATOM   612  C CB  . THR A 1 81  ? -36.277 -10.860 -24.036 1.00 48.17 ? 1339 THR A CB  1 
ATOM   613  O OG1 . THR A 1 81  ? -35.268 -9.860  -24.216 1.00 48.08 ? 1339 THR A OG1 1 
ATOM   614  C CG2 . THR A 1 81  ? -36.741 -11.340 -25.405 1.00 50.67 ? 1339 THR A CG2 1 
ATOM   615  N N   . ALA A 1 82  ? -38.433 -12.269 -22.299 1.00 48.46 ? 1340 ALA A N   1 
ATOM   616  C CA  . ALA A 1 82  ? -39.391 -13.354 -22.218 1.00 49.77 ? 1340 ALA A CA  1 
ATOM   617  C C   . ALA A 1 82  ? -40.689 -12.924 -21.523 1.00 50.01 ? 1340 ALA A C   1 
ATOM   618  O O   . ALA A 1 82  ? -41.760 -13.482 -21.799 1.00 51.53 ? 1340 ALA A O   1 
ATOM   619  C CB  . ALA A 1 82  ? -38.767 -14.526 -21.510 1.00 50.14 ? 1340 ALA A CB  1 
ATOM   620  N N   . GLY A 1 83  ? -40.585 -11.937 -20.631 1.00 48.29 ? 1341 GLY A N   1 
ATOM   621  C CA  . GLY A 1 83  ? -41.729 -11.446 -19.855 1.00 48.33 ? 1341 GLY A CA  1 
ATOM   622  C C   . GLY A 1 83  ? -41.987 -12.258 -18.603 1.00 48.74 ? 1341 GLY A C   1 
ATOM   623  O O   . GLY A 1 83  ? -43.054 -12.136 -17.978 1.00 49.26 ? 1341 GLY A O   1 
ATOM   624  N N   . HIS A 1 84  ? -41.014 -13.105 -18.251 1.00 48.14 ? 1342 HIS A N   1 
ATOM   625  C CA  . HIS A 1 84  ? -41.061 -13.933 -17.043 1.00 48.21 ? 1342 HIS A CA  1 
ATOM   626  C C   . HIS A 1 84  ? -39.663 -14.429 -16.682 1.00 46.75 ? 1342 HIS A C   1 
ATOM   627  O O   . HIS A 1 84  ? -38.729 -14.275 -17.475 1.00 45.70 ? 1342 HIS A O   1 
ATOM   628  C CB  . HIS A 1 84  ? -42.014 -15.128 -17.214 1.00 50.85 ? 1342 HIS A CB  1 
ATOM   629  C CG  . HIS A 1 84  ? -41.626 -16.068 -18.318 1.00 53.29 ? 1342 HIS A CG  1 
ATOM   630  N ND1 . HIS A 1 84  ? -42.209 -16.028 -19.568 1.00 56.53 ? 1342 HIS A ND1 1 
ATOM   631  C CD2 . HIS A 1 84  ? -40.736 -17.088 -18.352 1.00 54.49 ? 1342 HIS A CD2 1 
ATOM   632  C CE1 . HIS A 1 84  ? -41.688 -16.977 -20.327 1.00 57.57 ? 1342 HIS A CE1 1 
ATOM   633  N NE2 . HIS A 1 84  ? -40.791 -17.634 -19.613 1.00 57.50 ? 1342 HIS A NE2 1 
ATOM   634  N N   . PHE A 1 85  ? -39.535 -15.035 -15.499 1.00 45.76 ? 1343 PHE A N   1 
ATOM   635  C CA  . PHE A 1 85  ? -38.291 -15.673 -15.083 1.00 44.32 ? 1343 PHE A CA  1 
ATOM   636  C C   . PHE A 1 85  ? -38.000 -16.924 -15.913 1.00 45.26 ? 1343 PHE A C   1 
ATOM   637  O O   . PHE A 1 85  ? -38.764 -17.893 -15.869 1.00 47.19 ? 1343 PHE A O   1 
ATOM   638  C CB  . PHE A 1 85  ? -38.323 -16.012 -13.588 1.00 44.10 ? 1343 PHE A CB  1 
ATOM   639  C CG  . PHE A 1 85  ? -38.283 -14.800 -12.687 1.00 42.21 ? 1343 PHE A CG  1 
ATOM   640  C CD1 . PHE A 1 85  ? -37.151 -13.990 -12.636 1.00 40.49 ? 1343 PHE A CD1 1 
ATOM   641  C CD2 . PHE A 1 85  ? -39.377 -14.481 -11.876 1.00 43.92 ? 1343 PHE A CD2 1 
ATOM   642  C CE1 . PHE A 1 85  ? -37.110 -12.863 -11.809 1.00 39.23 ? 1343 PHE A CE1 1 
ATOM   643  C CE2 . PHE A 1 85  ? -39.348 -13.361 -11.032 1.00 43.40 ? 1343 PHE A CE2 1 
ATOM   644  C CZ  . PHE A 1 85  ? -38.219 -12.553 -11.000 1.00 41.54 ? 1343 PHE A CZ  1 
ATOM   645  N N   . VAL A 1 86  ? -36.906 -16.893 -16.679 1.00 43.83 ? 1344 VAL A N   1 
ATOM   646  C CA  . VAL A 1 86  ? -36.497 -18.050 -17.482 1.00 44.54 ? 1344 VAL A CA  1 
ATOM   647  C C   . VAL A 1 86  ? -35.628 -19.022 -16.676 1.00 44.72 ? 1344 VAL A C   1 
ATOM   648  O O   . VAL A 1 86  ? -35.273 -18.737 -15.528 1.00 42.87 ? 1344 VAL A O   1 
ATOM   649  C CB  . VAL A 1 86  ? -35.780 -17.640 -18.794 1.00 44.54 ? 1344 VAL A CB  1 
ATOM   650  C CG1 . VAL A 1 86  ? -36.711 -16.813 -19.684 1.00 43.33 ? 1344 VAL A CG1 1 
ATOM   651  C CG2 . VAL A 1 86  ? -34.465 -16.901 -18.512 1.00 41.79 ? 1344 VAL A CG2 1 
ATOM   652  N N   . GLN A 1 87  ? -35.307 -20.170 -17.277 1.00 46.32 ? 1345 GLN A N   1 
ATOM   653  C CA  A GLN A 1 87  ? -34.423 -21.141 -16.636 0.50 46.93 ? 1345 GLN A CA  1 
ATOM   654  C CA  B GLN A 1 87  ? -34.413 -21.157 -16.670 0.50 46.85 ? 1345 GLN A CA  1 
ATOM   655  C C   . GLN A 1 87  ? -33.062 -20.513 -16.339 1.00 44.87 ? 1345 GLN A C   1 
ATOM   656  O O   . GLN A 1 87  ? -32.492 -19.812 -17.176 1.00 44.47 ? 1345 GLN A O   1 
ATOM   657  C CB  A GLN A 1 87  ? -34.272 -22.405 -17.489 0.50 49.62 ? 1345 GLN A CB  1 
ATOM   658  C CB  B GLN A 1 87  ? -34.236 -22.360 -17.608 0.50 49.41 ? 1345 GLN A CB  1 
ATOM   659  C CG  A GLN A 1 87  ? -35.380 -23.439 -17.272 0.50 52.88 ? 1345 GLN A CG  1 
ATOM   660  C CG  B GLN A 1 87  ? -35.512 -23.192 -17.813 0.50 52.24 ? 1345 GLN A CG  1 
ATOM   661  C CD  A GLN A 1 87  ? -35.352 -24.047 -15.879 0.50 54.11 ? 1345 GLN A CD  1 
ATOM   662  C CD  B GLN A 1 87  ? -35.443 -24.127 -19.012 0.50 55.32 ? 1345 GLN A CD  1 
ATOM   663  O OE1 A GLN A 1 87  ? -34.291 -24.187 -15.275 0.50 54.58 ? 1345 GLN A OE1 1 
ATOM   664  O OE1 B GLN A 1 87  ? -34.447 -24.818 -19.225 0.50 56.94 ? 1345 GLN A OE1 1 
ATOM   665  N NE2 A GLN A 1 87  ? -36.520 -24.416 -15.366 0.50 55.06 ? 1345 GLN A NE2 1 
ATOM   666  N NE2 B GLN A 1 87  ? -36.512 -24.155 -19.798 0.50 55.95 ? 1345 GLN A NE2 1 
ATOM   667  N N   . GLU A 1 88  ? -32.559 -20.758 -15.130 1.00 43.61 ? 1346 GLU A N   1 
ATOM   668  C CA  . GLU A 1 88  ? -31.309 -20.167 -14.647 1.00 41.87 ? 1346 GLU A CA  1 
ATOM   669  C C   . GLU A 1 88  ? -30.016 -20.726 -15.259 1.00 42.93 ? 1346 GLU A C   1 
ATOM   670  O O   . GLU A 1 88  ? -29.027 -19.997 -15.382 1.00 41.89 ? 1346 GLU A O   1 
ATOM   671  C CB  . GLU A 1 88  ? -31.221 -20.275 -13.122 1.00 41.08 ? 1346 GLU A CB  1 
ATOM   672  C CG  . GLU A 1 88  ? -32.351 -19.558 -12.345 1.00 40.64 ? 1346 GLU A CG  1 
ATOM   673  C CD  . GLU A 1 88  ? -33.560 -20.440 -12.073 1.00 42.10 ? 1346 GLU A CD  1 
ATOM   674  O OE1 . GLU A 1 88  ? -33.843 -21.381 -12.838 1.00 45.77 ? 1346 GLU A OE1 1 
ATOM   675  O OE2 . GLU A 1 88  ? -34.252 -20.180 -11.079 1.00 43.81 ? 1346 GLU A OE2 1 
ATOM   676  N N   . GLU A 1 89  ? -30.029 -22.002 -15.632 1.00 45.11 ? 1347 GLU A N   1 
ATOM   677  C CA  . GLU A 1 89  ? -28.806 -22.763 -15.947 1.00 46.88 ? 1347 GLU A CA  1 
ATOM   678  C C   . GLU A 1 89  ? -27.819 -22.074 -16.892 1.00 45.98 ? 1347 GLU A C   1 
ATOM   679  O O   . GLU A 1 89  ? -26.622 -22.030 -16.609 1.00 45.33 ? 1347 GLU A O   1 
ATOM   680  C CB  . GLU A 1 89  ? -29.150 -24.158 -16.489 1.00 49.88 ? 1347 GLU A CB  1 
ATOM   681  C CG  . GLU A 1 89  ? -29.312 -25.234 -15.422 1.00 54.46 ? 1347 GLU A CG  1 
ATOM   682  C CD  . GLU A 1 89  ? -30.741 -25.376 -14.888 1.00 59.81 ? 1347 GLU A CD  1 
ATOM   683  O OE1 . GLU A 1 89  ? -31.525 -24.399 -14.921 1.00 59.97 ? 1347 GLU A OE1 1 
ATOM   684  O OE2 . GLU A 1 89  ? -31.082 -26.486 -14.423 1.00 63.97 ? 1347 GLU A OE2 1 
ATOM   685  N N   . ASP A 1 90  ? -28.322 -21.530 -17.997 1.00 46.00 ? 1348 ASP A N   1 
ATOM   686  C CA  . ASP A 1 90  ? -27.452 -20.954 -19.030 1.00 46.34 ? 1348 ASP A CA  1 
ATOM   687  C C   . ASP A 1 90  ? -26.900 -19.575 -18.664 1.00 43.74 ? 1348 ASP A C   1 
ATOM   688  O O   . ASP A 1 90  ? -26.136 -18.993 -19.436 1.00 43.48 ? 1348 ASP A O   1 
ATOM   689  C CB  . ASP A 1 90  ? -28.181 -20.891 -20.377 1.00 47.97 ? 1348 ASP A CB  1 
ATOM   690  C CG  . ASP A 1 90  ? -28.368 -22.261 -21.016 1.00 52.14 ? 1348 ASP A CG  1 
ATOM   691  O OD1 . ASP A 1 90  ? -27.745 -23.251 -20.562 1.00 52.79 ? 1348 ASP A OD1 1 
ATOM   692  O OD2 . ASP A 1 90  ? -29.140 -22.336 -21.996 1.00 54.34 ? 1348 ASP A OD2 1 
ATOM   693  N N   . TYR A 1 91  ? -27.277 -19.069 -17.484 1.00 41.12 ? 1349 TYR A N   1 
ATOM   694  C CA  . TYR A 1 91  ? -26.861 -17.738 -17.038 1.00 39.10 ? 1349 TYR A CA  1 
ATOM   695  C C   . TYR A 1 91  ? -26.060 -17.764 -15.740 1.00 38.20 ? 1349 TYR A C   1 
ATOM   696  O O   . TYR A 1 91  ? -25.692 -16.716 -15.208 1.00 36.58 ? 1349 TYR A O   1 
ATOM   697  C CB  . TYR A 1 91  ? -28.086 -16.826 -16.895 1.00 37.92 ? 1349 TYR A CB  1 
ATOM   698  C CG  . TYR A 1 91  ? -28.863 -16.751 -18.180 1.00 39.46 ? 1349 TYR A CG  1 
ATOM   699  C CD1 . TYR A 1 91  ? -28.495 -15.856 -19.177 1.00 39.51 ? 1349 TYR A CD1 1 
ATOM   700  C CD2 . TYR A 1 91  ? -29.943 -17.603 -18.410 1.00 41.12 ? 1349 TYR A CD2 1 
ATOM   701  C CE1 . TYR A 1 91  ? -29.180 -15.802 -20.363 1.00 42.56 ? 1349 TYR A CE1 1 
ATOM   702  C CE2 . TYR A 1 91  ? -30.643 -17.561 -19.601 1.00 44.22 ? 1349 TYR A CE2 1 
ATOM   703  C CZ  . TYR A 1 91  ? -30.250 -16.657 -20.575 1.00 44.81 ? 1349 TYR A CZ  1 
ATOM   704  O OH  . TYR A 1 91  ? -30.935 -16.600 -21.758 1.00 47.46 ? 1349 TYR A OH  1 
ATOM   705  N N   . GLU A 1 92  ? -25.786 -18.964 -15.242 1.00 38.66 ? 1350 GLU A N   1 
ATOM   706  C CA  . GLU A 1 92  ? -24.991 -19.119 -14.033 1.00 37.97 ? 1350 GLU A CA  1 
ATOM   707  C C   . GLU A 1 92  ? -23.564 -18.677 -14.363 1.00 38.43 ? 1350 GLU A C   1 
ATOM   708  O O   . GLU A 1 92  ? -23.041 -18.985 -15.451 1.00 39.59 ? 1350 GLU A O   1 
ATOM   709  C CB  . GLU A 1 92  ? -24.992 -20.589 -13.624 1.00 39.43 ? 1350 GLU A CB  1 
ATOM   710  C CG  . GLU A 1 92  ? -25.463 -20.865 -12.220 1.00 38.66 ? 1350 GLU A CG  1 
ATOM   711  C CD  . GLU A 1 92  ? -25.423 -22.341 -11.867 1.00 41.92 ? 1350 GLU A CD  1 
ATOM   712  O OE1 . GLU A 1 92  ? -25.482 -23.183 -12.792 1.00 41.61 ? 1350 GLU A OE1 1 
ATOM   713  O OE2 . GLU A 1 92  ? -25.327 -22.653 -10.656 1.00 42.76 ? 1350 GLU A OE2 1 
ATOM   714  N N   . TRP A 1 93  ? -22.939 -17.957 -13.439 1.00 37.44 ? 1351 TRP A N   1 
ATOM   715  C CA  . TRP A 1 93  ? -21.579 -17.445 -13.642 1.00 38.28 ? 1351 TRP A CA  1 
ATOM   716  C C   . TRP A 1 93  ? -20.579 -18.554 -13.990 1.00 40.37 ? 1351 TRP A C   1 
ATOM   717  O O   . TRP A 1 93  ? -19.673 -18.355 -14.805 1.00 41.77 ? 1351 TRP A O   1 
ATOM   718  C CB  . TRP A 1 93  ? -21.120 -16.665 -12.399 1.00 36.48 ? 1351 TRP A CB  1 
ATOM   719  C CG  . TRP A 1 93  ? -21.239 -15.162 -12.569 1.00 36.48 ? 1351 TRP A CG  1 
ATOM   720  C CD1 . TRP A 1 93  ? -22.214 -14.341 -12.058 1.00 33.52 ? 1351 TRP A CD1 1 
ATOM   721  C CD2 . TRP A 1 93  ? -20.354 -14.315 -13.331 1.00 36.28 ? 1351 TRP A CD2 1 
ATOM   722  N NE1 . TRP A 1 93  ? -21.971 -13.035 -12.441 1.00 34.65 ? 1351 TRP A NE1 1 
ATOM   723  C CE2 . TRP A 1 93  ? -20.838 -12.992 -13.214 1.00 34.93 ? 1351 TRP A CE2 1 
ATOM   724  C CE3 . TRP A 1 93  ? -19.179 -14.548 -14.067 1.00 37.09 ? 1351 TRP A CE3 1 
ATOM   725  C CZ2 . TRP A 1 93  ? -20.197 -11.898 -13.819 1.00 35.70 ? 1351 TRP A CZ2 1 
ATOM   726  C CZ3 . TRP A 1 93  ? -18.534 -13.452 -14.681 1.00 38.74 ? 1351 TRP A CZ3 1 
ATOM   727  C CH2 . TRP A 1 93  ? -19.055 -12.143 -14.552 1.00 37.29 ? 1351 TRP A CH2 1 
ATOM   728  N N   . GLY A 1 94  ? -20.743 -19.717 -13.364 1.00 41.21 ? 1352 GLY A N   1 
ATOM   729  C CA  . GLY A 1 94  ? -19.840 -20.851 -13.599 1.00 43.74 ? 1352 GLY A CA  1 
ATOM   730  C C   . GLY A 1 94  ? -20.091 -21.647 -14.871 1.00 46.48 ? 1352 GLY A C   1 
ATOM   731  O O   . GLY A 1 94  ? -19.308 -22.524 -15.214 1.00 48.53 ? 1352 GLY A O   1 
ATOM   732  N N   . SER A 1 95  ? -21.172 -21.347 -15.584 1.00 46.89 ? 1353 SER A N   1 
ATOM   733  C CA  . SER A 1 95  ? -21.512 -22.109 -16.770 1.00 49.57 ? 1353 SER A CA  1 
ATOM   734  C C   . SER A 1 95  ? -20.702 -21.658 -17.976 1.00 51.53 ? 1353 SER A C   1 
ATOM   735  O O   . SER A 1 95  ? -20.241 -20.505 -18.024 1.00 50.16 ? 1353 SER A O   1 
ATOM   736  C CB  . SER A 1 95  ? -23.002 -22.014 -17.071 1.00 49.36 ? 1353 SER A CB  1 
ATOM   737  O OG  . SER A 1 95  ? -23.315 -20.767 -17.662 1.00 50.26 ? 1353 SER A OG  1 
ATOM   738  N N   . SER A 1 96  ? -20.543 -22.578 -18.935 1.00 54.30 ? 1354 SER A N   1 
ATOM   739  C CA  . SER A 1 96  ? -19.802 -22.338 -20.167 1.00 57.37 ? 1354 SER A CA  1 
ATOM   740  C C   . SER A 1 96  ? -20.421 -21.208 -20.969 1.00 56.88 ? 1354 SER A C   1 
ATOM   741  O O   . SER A 1 96  ? -19.703 -20.401 -21.567 1.00 56.87 ? 1354 SER A O   1 
ATOM   742  C CB  . SER A 1 96  ? -19.765 -23.599 -21.048 1.00 60.60 ? 1354 SER A CB  1 
ATOM   743  O OG  . SER A 1 96  ? -19.094 -24.655 -20.391 1.00 62.69 ? 1354 SER A OG  1 
ATOM   744  N N   . SER A 1 97  ? -21.753 -21.170 -20.988 1.00 56.73 ? 1355 SER A N   1 
ATOM   745  C CA  . SER A 1 97  ? -22.494 -20.134 -21.704 1.00 57.08 ? 1355 SER A CA  1 
ATOM   746  C C   . SER A 1 97  ? -22.032 -18.738 -21.285 1.00 55.14 ? 1355 SER A C   1 
ATOM   747  O O   . SER A 1 97  ? -21.950 -17.837 -22.116 1.00 56.24 ? 1355 SER A O   1 
ATOM   748  C CB  . SER A 1 97  ? -24.000 -20.280 -21.461 1.00 56.15 ? 1355 SER A CB  1 
ATOM   749  O OG  . SER A 1 97  ? -24.485 -21.489 -22.010 1.00 61.21 ? 1355 SER A OG  1 
ATOM   750  N N   . ILE A 1 98  ? -21.723 -18.567 -20.004 1.00 53.29 ? 1356 ILE A N   1 
ATOM   751  C CA  . ILE A 1 98  ? -21.264 -17.272 -19.503 1.00 51.66 ? 1356 ILE A CA  1 
ATOM   752  C C   . ILE A 1 98  ? -19.745 -17.180 -19.598 1.00 53.51 ? 1356 ILE A C   1 
ATOM   753  O O   . ILE A 1 98  ? -19.217 -16.264 -20.228 1.00 54.21 ? 1356 ILE A O   1 
ATOM   754  C CB  . ILE A 1 98  ? -21.790 -16.968 -18.066 1.00 48.53 ? 1356 ILE A CB  1 
ATOM   755  C CG1 . ILE A 1 98  ? -23.313 -16.801 -18.063 1.00 46.30 ? 1356 ILE A CG1 1 
ATOM   756  C CG2 . ILE A 1 98  ? -21.140 -15.739 -17.483 1.00 47.26 ? 1356 ILE A CG2 1 
ATOM   757  C CD1 . ILE A 1 98  ? -23.871 -15.793 -19.099 1.00 44.06 ? 1356 ILE A CD1 1 
ATOM   758  N N   . LEU A 1 99  ? -19.053 -18.155 -19.020 1.00 55.03 ? 1357 LEU A N   1 
ATOM   759  C CA  . LEU A 1 99  ? -17.595 -18.125 -18.981 1.00 57.32 ? 1357 LEU A CA  1 
ATOM   760  C C   . LEU A 1 99  ? -16.929 -18.063 -20.355 1.00 60.89 ? 1357 LEU A C   1 
ATOM   761  O O   . LEU A 1 99  ? -15.947 -17.341 -20.515 1.00 62.18 ? 1357 LEU A O   1 
ATOM   762  C CB  . LEU A 1 99  ? -17.033 -19.278 -18.145 1.00 57.57 ? 1357 LEU A CB  1 
ATOM   763  C CG  . LEU A 1 99  ? -17.228 -19.169 -16.633 1.00 54.37 ? 1357 LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 99  ? -16.728 -20.419 -15.938 1.00 54.24 ? 1357 LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 99  ? -16.555 -17.930 -16.042 1.00 52.44 ? 1357 LEU A CD2 1 
ATOM   766  N N   . ASP A 1 100 ? -17.473 -18.773 -21.345 1.00 63.46 ? 1358 ASP A N   1 
ATOM   767  C CA  . ASP A 1 100 ? -16.875 -18.809 -22.691 1.00 67.28 ? 1358 ASP A CA  1 
ATOM   768  C C   . ASP A 1 100 ? -17.008 -17.505 -23.459 1.00 67.74 ? 1358 ASP A C   1 
ATOM   769  O O   . ASP A 1 100 ? -16.176 -17.193 -24.315 1.00 69.39 ? 1358 ASP A O   1 
ATOM   770  C CB  . ASP A 1 100 ? -17.479 -19.928 -23.542 1.00 69.48 ? 1358 ASP A CB  1 
ATOM   771  C CG  . ASP A 1 100 ? -17.147 -21.312 -23.015 1.00 71.32 ? 1358 ASP A CG  1 
ATOM   772  O OD1 . ASP A 1 100 ? -16.275 -21.441 -22.119 1.00 70.18 ? 1358 ASP A OD1 1 
ATOM   773  O OD2 . ASP A 1 100 ? -17.785 -22.268 -23.501 1.00 73.77 ? 1358 ASP A OD2 1 
ATOM   774  N N   . VAL A 1 101 ? -18.061 -16.756 -23.147 1.00 66.17 ? 1359 VAL A N   1 
ATOM   775  C CA  . VAL A 1 101 ? -18.389 -15.530 -23.867 1.00 66.80 ? 1359 VAL A CA  1 
ATOM   776  C C   . VAL A 1 101 ? -17.659 -14.328 -23.263 1.00 66.06 ? 1359 VAL A C   1 
ATOM   777  O O   . VAL A 1 101 ? -17.256 -13.412 -23.982 1.00 67.51 ? 1359 VAL A O   1 
ATOM   778  C CB  . VAL A 1 101 ? -19.927 -15.308 -23.921 1.00 65.25 ? 1359 VAL A CB  1 
ATOM   779  C CG1 . VAL A 1 101 ? -20.277 -13.925 -24.478 1.00 65.36 ? 1359 VAL A CG1 1 
ATOM   780  C CG2 . VAL A 1 101 ? -20.580 -16.409 -24.767 1.00 66.97 ? 1359 VAL A CG2 1 
ATOM   781  N N   . LEU A 1 102 ? -17.461 -14.340 -21.951 1.00 64.20 ? 1360 LEU A N   1 
ATOM   782  C CA  . LEU A 1 102 ? -16.869 -13.186 -21.295 1.00 63.48 ? 1360 LEU A CA  1 
ATOM   783  C C   . LEU A 1 102 ? -15.343 -13.114 -21.421 1.00 66.24 ? 1360 LEU A C   1 
ATOM   784  O O   . LEU A 1 102 ? -14.655 -14.133 -21.548 1.00 67.79 ? 1360 LEU A O   1 
ATOM   785  C CB  . LEU A 1 102 ? -17.325 -13.089 -19.836 1.00 60.65 ? 1360 LEU A CB  1 
ATOM   786  C CG  . LEU A 1 102 ? -18.829 -12.894 -19.595 1.00 57.50 ? 1360 LEU A CG  1 
ATOM   787  C CD1 . LEU A 1 102 ? -19.093 -12.732 -18.128 1.00 54.56 ? 1360 LEU A CD1 1 
ATOM   788  C CD2 . LEU A 1 102 ? -19.400 -11.710 -20.364 1.00 56.01 ? 1360 LEU A CD2 1 
ATOM   789  N N   . THR A 1 103 ? -14.837 -11.886 -21.419 1.00 66.97 ? 1361 THR A N   1 
ATOM   790  C CA  . THR A 1 103 ? -13.407 -11.618 -21.359 1.00 69.77 ? 1361 THR A CA  1 
ATOM   791  C C   . THR A 1 103 ? -13.111 -10.922 -20.019 1.00 68.42 ? 1361 THR A C   1 
ATOM   792  O O   . THR A 1 103 ? -14.033 -10.649 -19.238 1.00 66.27 ? 1361 THR A O   1 
ATOM   793  C CB  . THR A 1 103 ? -12.948 -10.767 -22.581 1.00 72.43 ? 1361 THR A CB  1 
ATOM   794  O OG1 . THR A 1 103 ? -13.599 -9.492  -22.552 1.00 71.76 ? 1361 THR A OG1 1 
ATOM   795  C CG2 . THR A 1 103 ? -13.298 -11.468 -23.909 1.00 73.43 ? 1361 THR A CG2 1 
ATOM   796  N N   . GLY A 1 104 ? -11.839 -10.666 -19.729 1.00 70.39 ? 1362 GLY A N   1 
ATOM   797  C CA  . GLY A 1 104 ? -11.463 -9.947  -18.504 1.00 69.63 ? 1362 GLY A CA  1 
ATOM   798  C C   . GLY A 1 104 ? -11.635 -10.739 -17.218 1.00 67.97 ? 1362 GLY A C   1 
ATOM   799  O O   . GLY A 1 104 ? -11.258 -10.284 -16.136 1.00 67.97 ? 1362 GLY A O   1 
ATOM   800  N N   . ILE A 1 105 ? -12.223 -11.924 -17.319 1.00 67.07 ? 1363 ILE A N   1 
ATOM   801  C CA  . ILE A 1 105 ? -12.307 -12.815 -16.175 1.00 64.62 ? 1363 ILE A CA  1 
ATOM   802  C C   . ILE A 1 105 ? -10.892 -13.307 -15.854 1.00 65.45 ? 1363 ILE A C   1 
ATOM   803  O O   . ILE A 1 105 ? -10.270 -14.004 -16.662 1.00 67.51 ? 1363 ILE A O   1 
ATOM   804  C CB  . ILE A 1 105 ? -13.275 -13.985 -16.450 1.00 64.19 ? 1363 ILE A CB  1 
ATOM   805  C CG1 . ILE A 1 105 ? -14.712 -13.467 -16.500 1.00 62.58 ? 1363 ILE A CG1 1 
ATOM   806  C CG2 . ILE A 1 105 ? -13.165 -15.051 -15.368 1.00 63.33 ? 1363 ILE A CG2 1 
ATOM   807  C CD1 . ILE A 1 105 ? -15.674 -14.430 -17.139 1.00 64.04 ? 1363 ILE A CD1 1 
ATOM   808  N N   . ASN A 1 106 ? -10.384 -12.911 -14.687 1.00 63.21 ? 1364 ASN A N   1 
ATOM   809  C CA  . ASN A 1 106 ? -9.087  -13.388 -14.213 1.00 63.42 ? 1364 ASN A CA  1 
ATOM   810  C C   . ASN A 1 106 ? -9.245  -14.736 -13.515 1.00 61.86 ? 1364 ASN A C   1 
ATOM   811  O O   . ASN A 1 106 ? -10.364 -15.236 -13.383 1.00 60.08 ? 1364 ASN A O   1 
ATOM   812  C CB  . ASN A 1 106 ? -8.413  -12.348 -13.310 1.00 63.22 ? 1364 ASN A CB  1 
ATOM   813  C CG  . ASN A 1 106 ? -9.236  -12.018 -12.059 1.00 60.05 ? 1364 ASN A CG  1 
ATOM   814  O OD1 . ASN A 1 106 ? -9.511  -12.882 -11.232 1.00 57.25 ? 1364 ASN A OD1 1 
ATOM   815  N ND2 . ASN A 1 106 ? -9.618  -10.753 -11.924 1.00 59.64 ? 1364 ASN A ND2 1 
ATOM   816  N N   . VAL A 1 107 ? -8.140  -15.328 -13.070 1.00 62.22 ? 1365 VAL A N   1 
ATOM   817  C CA  . VAL A 1 107 ? -8.199  -16.661 -12.463 1.00 61.44 ? 1365 VAL A CA  1 
ATOM   818  C C   . VAL A 1 107 ? -9.013  -16.718 -11.168 1.00 57.90 ? 1365 VAL A C   1 
ATOM   819  O O   . VAL A 1 107 ? -9.721  -17.690 -10.927 1.00 57.49 ? 1365 VAL A O   1 
ATOM   820  C CB  . VAL A 1 107 ? -6.805  -17.303 -12.249 1.00 63.54 ? 1365 VAL A CB  1 
ATOM   821  C CG1 . VAL A 1 107 ? -6.175  -17.677 -13.595 1.00 67.18 ? 1365 VAL A CG1 1 
ATOM   822  C CG2 . VAL A 1 107 ? -5.891  -16.388 -11.439 1.00 64.07 ? 1365 VAL A CG2 1 
ATOM   823  N N   . GLN A 1 108 ? -8.904  -15.685 -10.338 1.00 55.72 ? 1366 GLN A N   1 
ATOM   824  C CA  . GLN A 1 108 ? -9.700  -15.602 -9.115  1.00 52.80 ? 1366 GLN A CA  1 
ATOM   825  C C   . GLN A 1 108 ? -11.187 -15.661 -9.484  1.00 49.43 ? 1366 GLN A C   1 
ATOM   826  O O   . GLN A 1 108 ? -11.939 -16.472 -8.943  1.00 47.89 ? 1366 GLN A O   1 
ATOM   827  C CB  . GLN A 1 108 ? -9.369  -14.318 -8.335  1.00 52.72 ? 1366 GLN A CB  1 
ATOM   828  C CG  . GLN A 1 108 ? -10.201 -14.111 -7.064  1.00 54.67 ? 1366 GLN A CG  1 
ATOM   829  C CD  . GLN A 1 108 ? -9.678  -12.971 -6.185  1.00 59.37 ? 1366 GLN A CD  1 
ATOM   830  O OE1 . GLN A 1 108 ? -8.510  -12.970 -5.773  1.00 62.63 ? 1366 GLN A OE1 1 
ATOM   831  N NE2 . GLN A 1 108 ? -10.547 -12.004 -5.886  1.00 58.74 ? 1366 GLN A NE2 1 
ATOM   832  N N   . GLN A 1 109 ? -11.581 -14.825 -10.438 1.00 47.80 ? 1367 GLN A N   1 
ATOM   833  C CA  . GLN A 1 109 ? -12.972 -14.733 -10.852 1.00 45.65 ? 1367 GLN A CA  1 
ATOM   834  C C   . GLN A 1 109 ? -13.496 -16.025 -11.470 1.00 45.62 ? 1367 GLN A C   1 
ATOM   835  O O   . GLN A 1 109 ? -14.612 -16.456 -11.165 1.00 43.68 ? 1367 GLN A O   1 
ATOM   836  C CB  . GLN A 1 109 ? -13.169 -13.543 -11.787 1.00 46.09 ? 1367 GLN A CB  1 
ATOM   837  C CG  . GLN A 1 109 ? -12.920 -12.213 -11.078 1.00 45.55 ? 1367 GLN A CG  1 
ATOM   838  C CD  . GLN A 1 109 ? -13.309 -11.009 -11.911 1.00 46.61 ? 1367 GLN A CD  1 
ATOM   839  O OE1 . GLN A 1 109 ? -12.929 -10.896 -13.079 1.00 47.39 ? 1367 GLN A OE1 1 
ATOM   840  N NE2 . GLN A 1 109 ? -14.076 -10.094 -11.309 1.00 44.81 ? 1367 GLN A NE2 1 
ATOM   841  N N   . ARG A 1 110 ? -12.684 -16.648 -12.322 1.00 46.89 ? 1368 ARG A N   1 
ATOM   842  C CA  . ARG A 1 110 ? -13.060 -17.917 -12.937 1.00 47.62 ? 1368 ARG A CA  1 
ATOM   843  C C   . ARG A 1 110 ? -13.304 -18.975 -11.861 1.00 47.12 ? 1368 ARG A C   1 
ATOM   844  O O   . ARG A 1 110 ? -14.319 -19.674 -11.891 1.00 46.59 ? 1368 ARG A O   1 
ATOM   845  C CB  . ARG A 1 110 ? -11.992 -18.379 -13.947 0.50 49.75 ? 1368 ARG A CB  1 
ATOM   846  C CG  . ARG A 1 110 ? -12.325 -19.669 -14.694 0.50 49.70 ? 1368 ARG A CG  1 
ATOM   847  C CD  . ARG A 1 110 ? -11.228 -20.037 -15.704 0.50 50.10 ? 1368 ARG A CD  1 
ATOM   848  N NE  . ARG A 1 110 ? -10.897 -18.896 -16.554 0.50 48.26 ? 1368 ARG A NE  1 
ATOM   849  C CZ  . ARG A 1 110 ? -11.569 -18.564 -17.653 0.50 47.72 ? 1368 ARG A CZ  1 
ATOM   850  N NH1 . ARG A 1 110 ? -12.598 -19.303 -18.047 0.50 47.50 ? 1368 ARG A NH1 1 
ATOM   851  N NH2 . ARG A 1 110 ? -11.208 -17.500 -18.360 0.50 47.36 ? 1368 ARG A NH2 1 
ATOM   852  N N   . ARG A 1 111 ? -12.375 -19.081 -10.912 1.00 47.62 ? 1369 ARG A N   1 
ATOM   853  C CA  . ARG A 1 111 ? -12.521 -20.002 -9.784  1.00 47.95 ? 1369 ARG A CA  1 
ATOM   854  C C   . ARG A 1 111 ? -13.804 -19.693 -8.997  1.00 45.57 ? 1369 ARG A C   1 
ATOM   855  O O   . ARG A 1 111 ? -14.551 -20.598 -8.610  1.00 45.79 ? 1369 ARG A O   1 
ATOM   856  C CB  . ARG A 1 111 ? -11.322 -19.891 -8.830  1.00 48.55 ? 1369 ARG A CB  1 
ATOM   857  C CG  . ARG A 1 111 ? -9.957  -20.371 -9.347  1.00 53.64 ? 1369 ARG A CG  1 
ATOM   858  C CD  . ARG A 1 111 ? -8.910  -20.089 -8.253  1.00 58.04 ? 1369 ARG A CD  1 
ATOM   859  N NE  . ARG A 1 111 ? -7.666  -20.866 -8.307  1.00 63.77 ? 1369 ARG A NE  1 
ATOM   860  C CZ  . ARG A 1 111 ? -7.564  -22.161 -8.607  1.00 67.86 ? 1369 ARG A CZ  1 
ATOM   861  N NH1 . ARG A 1 111 ? -8.638  -22.890 -8.897  1.00 69.58 ? 1369 ARG A NH1 1 
ATOM   862  N NH2 . ARG A 1 111 ? -6.370  -22.738 -8.611  1.00 70.38 ? 1369 ARG A NH2 1 
ATOM   863  N N   . LEU A 1 112 ? -14.044 -18.411 -8.741  1.00 43.63 ? 1370 LEU A N   1 
ATOM   864  C CA  . LEU A 1 112 ? -15.242 -17.996 -8.016  1.00 41.47 ? 1370 LEU A CA  1 
ATOM   865  C C   . LEU A 1 112 ? -16.508 -18.382 -8.771  1.00 40.90 ? 1370 LEU A C   1 
ATOM   866  O O   . LEU A 1 112 ? -17.448 -18.890 -8.172  1.00 40.22 ? 1370 LEU A O   1 
ATOM   867  C CB  . LEU A 1 112 ? -15.210 -16.492 -7.730  1.00 40.52 ? 1370 LEU A CB  1 
ATOM   868  C CG  . LEU A 1 112 ? -14.286 -16.045 -6.593  1.00 40.37 ? 1370 LEU A CG  1 
ATOM   869  C CD1 . LEU A 1 112 ? -13.975 -14.553 -6.686  1.00 39.92 ? 1370 LEU A CD1 1 
ATOM   870  C CD2 . LEU A 1 112 ? -14.896 -16.377 -5.251  1.00 40.51 ? 1370 LEU A CD2 1 
ATOM   871  N N   . ALA A 1 113 ? -16.513 -18.146 -10.083 1.00 41.13 ? 1371 ALA A N   1 
ATOM   872  C CA  . ALA A 1 113 ? -17.654 -18.461 -10.927 1.00 41.30 ? 1371 ALA A CA  1 
ATOM   873  C C   . ALA A 1 113 ? -17.916 -19.967 -10.930 1.00 42.65 ? 1371 ALA A C   1 
ATOM   874  O O   . ALA A 1 113 ? -19.036 -20.401 -10.643 1.00 42.07 ? 1371 ALA A O   1 
ATOM   875  C CB  . ALA A 1 113 ? -17.429 -17.938 -12.354 1.00 41.57 ? 1371 ALA A CB  1 
ATOM   876  N N   . LEU A 1 114 ? -16.877 -20.750 -11.239 1.00 44.02 ? 1372 LEU A N   1 
ATOM   877  C CA  . LEU A 1 114 ? -16.964 -22.215 -11.229 1.00 45.84 ? 1372 LEU A CA  1 
ATOM   878  C C   . LEU A 1 114 ? -17.420 -22.765 -9.873  1.00 44.72 ? 1372 LEU A C   1 
ATOM   879  O O   . LEU A 1 114 ? -18.258 -23.673 -9.819  1.00 45.38 ? 1372 LEU A O   1 
ATOM   880  C CB  . LEU A 1 114 ? -15.632 -22.872 -11.666 1.00 47.90 ? 1372 LEU A CB  1 
ATOM   881  C CG  . LEU A 1 114 ? -15.132 -22.731 -13.117 1.00 50.39 ? 1372 LEU A CG  1 
ATOM   882  C CD1 . LEU A 1 114 ? -13.671 -23.188 -13.251 1.00 51.47 ? 1372 LEU A CD1 1 
ATOM   883  C CD2 . LEU A 1 114 ? -16.001 -23.508 -14.125 1.00 52.14 ? 1372 LEU A CD2 1 
ATOM   884  N N   . ALA A 1 115 ? -16.873 -22.224 -8.786  1.00 43.48 ? 1373 ALA A N   1 
ATOM   885  C CA  . ALA A 1 115 ? -17.271 -22.662 -7.437  1.00 43.20 ? 1373 ALA A CA  1 
ATOM   886  C C   . ALA A 1 115 ? -18.764 -22.427 -7.185  1.00 42.63 ? 1373 ALA A C   1 
ATOM   887  O O   . ALA A 1 115 ? -19.446 -23.260 -6.571  1.00 43.28 ? 1373 ALA A O   1 
ATOM   888  C CB  . ALA A 1 115 ? -16.442 -21.956 -6.367  1.00 41.55 ? 1373 ALA A CB  1 
ATOM   889  N N   . ALA A 1 116 ? -19.259 -21.291 -7.662  1.00 41.70 ? 1374 ALA A N   1 
ATOM   890  C CA  . ALA A 1 116 ? -20.666 -20.942 -7.495  1.00 41.93 ? 1374 ALA A CA  1 
ATOM   891  C C   . ALA A 1 116 ? -21.562 -22.018 -8.111  1.00 43.35 ? 1374 ALA A C   1 
ATOM   892  O O   . ALA A 1 116 ? -22.488 -22.513 -7.458  1.00 44.01 ? 1374 ALA A O   1 
ATOM   893  C CB  . ALA A 1 116 ? -20.954 -19.560 -8.087  1.00 40.09 ? 1374 ALA A CB  1 
ATOM   894  N N   . MET A 1 117 ? -21.249 -22.417 -9.340  1.00 45.14 ? 1375 MET A N   1 
ATOM   895  C CA  . MET A 1 117 ? -21.990 -23.484 -10.015 1.00 46.96 ? 1375 MET A CA  1 
ATOM   896  C C   . MET A 1 117 ? -21.874 -24.842 -9.305  1.00 48.52 ? 1375 MET A C   1 
ATOM   897  O O   . MET A 1 117 ? -22.873 -25.562 -9.126  1.00 49.20 ? 1375 MET A O   1 
ATOM   898  C CB  . MET A 1 117 ? -21.548 -23.609 -11.473 1.00 48.68 ? 1375 MET A CB  1 
ATOM   899  C CG  . MET A 1 117 ? -22.224 -24.753 -12.214 1.00 51.43 ? 1375 MET A CG  1 
ATOM   900  S SD  . MET A 1 117 ? -21.793 -24.841 -13.963 1.00 57.70 ? 1375 MET A SD  1 
ATOM   901  C CE  . MET A 1 117 ? -20.127 -25.499 -13.879 1.00 57.50 ? 1375 MET A CE  1 
ATOM   902  N N   . ARG A 1 118 ? -20.650 -25.178 -8.909  1.00 48.60 ? 1376 ARG A N   1 
ATOM   903  C CA  . ARG A 1 118 ? -20.347 -26.449 -8.264  1.00 50.11 ? 1376 ARG A CA  1 
ATOM   904  C C   . ARG A 1 118 ? -21.088 -26.603 -6.938  1.00 48.81 ? 1376 ARG A C   1 
ATOM   905  O O   . ARG A 1 118 ? -21.683 -27.649 -6.666  1.00 49.84 ? 1376 ARG A O   1 
ATOM   906  C CB  . ARG A 1 118 ? -18.839 -26.550 -8.034  1.00 50.84 ? 1376 ARG A CB  1 
ATOM   907  C CG  . ARG A 1 118 ? -18.236 -27.920 -8.332  1.00 56.18 ? 1376 ARG A CG  1 
ATOM   908  C CD  . ARG A 1 118 ? -16.709 -27.884 -8.287  1.00 59.10 ? 1376 ARG A CD  1 
ATOM   909  N NE  . ARG A 1 118 ? -16.187 -27.144 -7.132  1.00 57.59 ? 1376 ARG A NE  1 
ATOM   910  C CZ  . ARG A 1 118 ? -15.489 -26.013 -7.215  1.00 56.84 ? 1376 ARG A CZ  1 
ATOM   911  N NH1 . ARG A 1 118 ? -15.210 -25.485 -8.403  1.00 56.19 ? 1376 ARG A NH1 1 
ATOM   912  N NH2 . ARG A 1 118 ? -15.057 -25.415 -6.109  1.00 55.78 ? 1376 ARG A NH2 1 
ATOM   913  N N   . TRP A 1 119 ? -21.054 -25.561 -6.109  1.00 46.05 ? 1377 TRP A N   1 
ATOM   914  C CA  . TRP A 1 119 ? -21.728 -25.625 -4.824  1.00 44.95 ? 1377 TRP A CA  1 
ATOM   915  C C   . TRP A 1 119 ? -23.247 -25.582 -4.989  1.00 45.25 ? 1377 TRP A C   1 
ATOM   916  O O   . TRP A 1 119 ? -23.960 -26.208 -4.210  1.00 45.71 ? 1377 TRP A O   1 
ATOM   917  C CB  . TRP A 1 119 ? -21.217 -24.538 -3.872  1.00 43.03 ? 1377 TRP A CB  1 
ATOM   918  C CG  . TRP A 1 119 ? -19.869 -24.877 -3.240  1.00 43.08 ? 1377 TRP A CG  1 
ATOM   919  C CD1 . TRP A 1 119 ? -18.652 -24.351 -3.571  1.00 42.99 ? 1377 TRP A CD1 1 
ATOM   920  C CD2 . TRP A 1 119 ? -19.621 -25.823 -2.187  1.00 44.34 ? 1377 TRP A CD2 1 
ATOM   921  N NE1 . TRP A 1 119 ? -17.665 -24.900 -2.782  1.00 44.14 ? 1377 TRP A NE1 1 
ATOM   922  C CE2 . TRP A 1 119 ? -18.232 -25.807 -1.928  1.00 43.77 ? 1377 TRP A CE2 1 
ATOM   923  C CE3 . TRP A 1 119 ? -20.443 -26.669 -1.424  1.00 45.70 ? 1377 TRP A CE3 1 
ATOM   924  C CZ2 . TRP A 1 119 ? -17.642 -26.601 -0.936  1.00 44.80 ? 1377 TRP A CZ2 1 
ATOM   925  C CZ3 . TRP A 1 119 ? -19.856 -27.473 -0.450  1.00 45.80 ? 1377 TRP A CZ3 1 
ATOM   926  C CH2 . TRP A 1 119 ? -18.468 -27.423 -0.208  1.00 45.34 ? 1377 TRP A CH2 1 
ATOM   927  N N   . ARG A 1 120 ? -23.735 -24.866 -6.005  1.00 44.94 ? 1378 ARG A N   1 
ATOM   928  C CA  . ARG A 1 120 ? -25.168 -24.841 -6.311  1.00 45.65 ? 1378 ARG A CA  1 
ATOM   929  C C   . ARG A 1 120 ? -25.654 -26.263 -6.595  1.00 48.80 ? 1378 ARG A C   1 
ATOM   930  O O   . ARG A 1 120 ? -26.655 -26.713 -6.018  1.00 49.44 ? 1378 ARG A O   1 
ATOM   931  C CB  . ARG A 1 120 ? -25.470 -23.914 -7.495  1.00 44.73 ? 1378 ARG A CB  1 
ATOM   932  C CG  . ARG A 1 120 ? -26.958 -23.635 -7.740  1.00 44.55 ? 1378 ARG A CG  1 
ATOM   933  C CD  . ARG A 1 120 ? -27.612 -24.669 -8.686  1.00 46.72 ? 1378 ARG A CD  1 
ATOM   934  N NE  . ARG A 1 120 ? -26.956 -24.735 -9.996  1.00 46.16 ? 1378 ARG A NE  1 
ATOM   935  C CZ  . ARG A 1 120 ? -27.203 -25.667 -10.911 1.00 48.15 ? 1378 ARG A CZ  1 
ATOM   936  N NH1 . ARG A 1 120 ? -28.088 -26.616 -10.655 1.00 50.21 ? 1378 ARG A NH1 1 
ATOM   937  N NH2 . ARG A 1 120 ? -26.566 -25.663 -12.080 1.00 47.34 ? 1378 ARG A NH2 1 
ATOM   938  N N   . LYS A 1 121 ? -24.923 -26.966 -7.458  1.00 50.53 ? 1379 LYS A N   1 
ATOM   939  C CA  . LYS A 1 121 ? -25.245 -28.353 -7.800  1.00 54.53 ? 1379 LYS A CA  1 
ATOM   940  C C   . LYS A 1 121 ? -25.208 -29.284 -6.592  1.00 56.33 ? 1379 LYS A C   1 
ATOM   941  O O   . LYS A 1 121 ? -26.163 -30.021 -6.359  1.00 57.72 ? 1379 LYS A O   1 
ATOM   942  C CB  . LYS A 1 121 ? -24.339 -28.871 -8.922  1.00 55.56 ? 1379 LYS A CB  1 
ATOM   943  C CG  . LYS A 1 121 ? -24.704 -28.278 -10.272 1.00 56.04 ? 1379 LYS A CG  1 
ATOM   944  C CD  . LYS A 1 121 ? -23.810 -28.790 -11.392 1.00 59.05 ? 1379 LYS A CD  1 
ATOM   945  C CE  . LYS A 1 121 ? -24.103 -28.051 -12.687 1.00 59.00 ? 1379 LYS A CE  1 
ATOM   946  N NZ  . LYS A 1 121 ? -23.309 -28.583 -13.821 1.00 63.40 ? 1379 LYS A NZ  1 
ATOM   947  N N   . LYS A 1 122 ? -24.117 -29.226 -5.826  1.00 56.69 ? 1380 LYS A N   1 
ATOM   948  C CA  . LYS A 1 122 ? -23.924 -30.090 -4.662  1.00 59.26 ? 1380 LYS A CA  1 
ATOM   949  C C   . LYS A 1 122 ? -25.056 -29.953 -3.641  1.00 59.87 ? 1380 LYS A C   1 
ATOM   950  O O   . LYS A 1 122 ? -25.637 -30.949 -3.207  1.00 61.84 ? 1380 LYS A O   1 
ATOM   951  C CB  . LYS A 1 122 ? -22.587 -29.785 -3.983  1.00 58.01 ? 1380 LYS A CB  1 
ATOM   952  C CG  . LYS A 1 122 ? -21.366 -30.246 -4.751  1.00 60.79 ? 1380 LYS A CG  1 
ATOM   953  C CD  . LYS A 1 122 ? -20.077 -29.869 -4.035  1.00 60.93 ? 1380 LYS A CD  1 
ATOM   954  C CE  . LYS A 1 122 ? -18.921 -30.723 -4.548  1.00 65.39 ? 1380 LYS A CE  1 
ATOM   955  N NZ  . LYS A 1 122 ? -17.711 -30.521 -3.708  1.00 66.01 ? 1380 LYS A NZ  1 
ATOM   956  N N   . ILE A 1 123 ? -25.368 -28.712 -3.277  1.00 58.53 ? 1381 ILE A N   1 
ATOM   957  C CA  . ILE A 1 123 ? -26.316 -28.428 -2.209  1.00 59.45 ? 1381 ILE A CA  1 
ATOM   958  C C   . ILE A 1 123 ? -27.761 -28.728 -2.603  1.00 62.28 ? 1381 ILE A C   1 
ATOM   959  O O   . ILE A 1 123 ? -28.536 -29.239 -1.788  1.00 63.63 ? 1381 ILE A O   1 
ATOM   960  C CB  . ILE A 1 123 ? -26.108 -26.988 -1.668  1.00 56.50 ? 1381 ILE A CB  1 
ATOM   961  C CG1 . ILE A 1 123 ? -24.868 -26.975 -0.767  1.00 55.33 ? 1381 ILE A CG1 1 
ATOM   962  C CG2 . ILE A 1 123 ? -27.315 -26.502 -0.889  1.00 56.37 ? 1381 ILE A CG2 1 
ATOM   963  C CD1 . ILE A 1 123 ? -24.086 -25.687 -0.780  1.00 52.90 ? 1381 ILE A CD1 1 
ATOM   964  N N   . GLN A 1 124 ? -28.103 -28.458 -3.861  1.00 64.02 ? 1382 GLN A N   1 
ATOM   965  C CA  . GLN A 1 124 ? -29.454 -28.705 -4.363  1.00 67.13 ? 1382 GLN A CA  1 
ATOM   966  C C   . GLN A 1 124 ? -29.803 -30.191 -4.469  1.00 71.57 ? 1382 GLN A C   1 
ATOM   967  O O   . GLN A 1 124 ? -30.984 -30.552 -4.480  1.00 73.86 ? 1382 GLN A O   1 
ATOM   968  C CB  . GLN A 1 124 ? -29.688 -27.994 -5.697  1.00 66.26 ? 1382 GLN A CB  1 
ATOM   969  C CG  . GLN A 1 124 ? -29.779 -26.460 -5.583  1.00 64.15 ? 1382 GLN A CG  1 
ATOM   970  C CD  . GLN A 1 124 ? -30.521 -25.828 -6.756  1.00 64.64 ? 1382 GLN A CD  1 
ATOM   971  O OE1 . GLN A 1 124 ? -30.780 -26.478 -7.775  1.00 65.93 ? 1382 GLN A OE1 1 
ATOM   972  N NE2 . GLN A 1 124 ? -30.876 -24.559 -6.612  1.00 63.06 ? 1382 GLN A NE2 1 
ATOM   973  N N   . GLN A 1 125 ? -28.786 -31.046 -4.547  1.00 73.51 ? 1383 GLN A N   1 
ATOM   974  C CA  A GLN A 1 125 ? -29.011 -32.487 -4.570  0.50 77.52 ? 1383 GLN A CA  1 
ATOM   975  C CA  B GLN A 1 125 ? -29.002 -32.492 -4.575  0.50 77.62 ? 1383 GLN A CA  1 
ATOM   976  C C   . GLN A 1 125 ? -29.234 -33.035 -3.162  1.00 78.95 ? 1383 GLN A C   1 
ATOM   977  O O   . GLN A 1 125 ? -29.811 -34.106 -2.989  1.00 82.00 ? 1383 GLN A O   1 
ATOM   978  C CB  A GLN A 1 125 ? -27.861 -33.210 -5.270  0.50 78.64 ? 1383 GLN A CB  1 
ATOM   979  C CB  B GLN A 1 125 ? -27.842 -33.216 -5.276  0.50 78.80 ? 1383 GLN A CB  1 
ATOM   980  C CG  A GLN A 1 125 ? -27.841 -32.994 -6.772  0.50 78.63 ? 1383 GLN A CG  1 
ATOM   981  C CG  B GLN A 1 125 ? -26.680 -33.621 -4.378  0.50 78.59 ? 1383 GLN A CG  1 
ATOM   982  C CD  A GLN A 1 125 ? -27.255 -34.171 -7.514  0.50 80.71 ? 1383 GLN A CD  1 
ATOM   983  C CD  B GLN A 1 125 ? -25.374 -33.738 -5.135  0.50 78.85 ? 1383 GLN A CD  1 
ATOM   984  O OE1 A GLN A 1 125 ? -26.498 -34.958 -6.949  0.50 81.51 ? 1383 GLN A OE1 1 
ATOM   985  O OE1 B GLN A 1 125 ? -25.356 -33.764 -6.368  0.50 79.94 ? 1383 GLN A OE1 1 
ATOM   986  N NE2 A GLN A 1 125 ? -27.601 -34.299 -8.787  0.50 81.82 ? 1383 GLN A NE2 1 
ATOM   987  N NE2 B GLN A 1 125 ? -24.270 -33.804 -4.400  0.50 77.86 ? 1383 GLN A NE2 1 
ATOM   988  N N   . ARG A 1 126 ? -28.783 -32.282 -2.161  1.00 77.47 ? 1384 ARG A N   1 
ATOM   989  C CA  . ARG A 1 126 ? -28.985 -32.640 -0.758  1.00 79.56 ? 1384 ARG A CA  1 
ATOM   990  C C   . ARG A 1 126 ? -30.320 -32.137 -0.205  1.00 80.45 ? 1384 ARG A C   1 
ATOM   991  O O   . ARG A 1 126 ? -30.932 -32.810 0.633   1.00 82.66 ? 1384 ARG A O   1 
ATOM   992  C CB  . ARG A 1 126 ? -27.824 -32.154 0.106   1.00 77.25 ? 1384 ARG A CB  1 
ATOM   993  C CG  . ARG A 1 126 ? -26.702 -33.178 0.258   1.00 79.39 ? 1384 ARG A CG  1 
ATOM   994  C CD  . ARG A 1 126 ? -25.578 -32.948 -0.742  1.00 78.49 ? 1384 ARG A CD  1 
ATOM   995  N NE  . ARG A 1 126 ? -24.281 -32.935 -0.070  1.00 77.54 ? 1384 ARG A NE  1 
ATOM   996  C CZ  . ARG A 1 126 ? -23.795 -31.899 0.607   1.00 74.58 ? 1384 ARG A CZ  1 
ATOM   997  N NH1 . ARG A 1 126 ? -24.491 -30.775 0.705   1.00 73.19 ? 1384 ARG A NH1 1 
ATOM   998  N NH2 . ARG A 1 126 ? -22.609 -31.986 1.191   1.00 74.90 ? 1384 ARG A NH2 1 
ATOM   999  N N   . GLN A 1 127 ? -30.752 -30.963 -0.675  1.00 79.27 ? 1385 GLN A N   1 
ATOM   1000 C CA  . GLN A 1 127 ? -32.093 -30.421 -0.410  1.00 80.65 ? 1385 GLN A CA  1 
ATOM   1001 C C   . GLN A 1 127 ? -33.197 -31.420 -0.774  1.00 84.56 ? 1385 GLN A C   1 
ATOM   1002 O O   . GLN A 1 127 ? -34.035 -31.760 0.065   1.00 86.64 ? 1385 GLN A O   1 
ATOM   1003 C CB  . GLN A 1 127 ? -32.321 -29.115 -1.187  1.00 78.39 ? 1385 GLN A CB  1 
ATOM   1004 C CG  . GLN A 1 127 ? -31.562 -27.897 -0.660  1.00 76.32 ? 1385 GLN A CG  1 
ATOM   1005 C CD  . GLN A 1 127 ? -31.695 -26.658 -1.556  1.00 75.65 ? 1385 GLN A CD  1 
ATOM   1006 O OE1 . GLN A 1 127 ? -32.252 -26.716 -2.654  1.00 77.03 ? 1385 GLN A OE1 1 
ATOM   1007 N NE2 . GLN A 1 127 ? -31.172 -25.531 -1.084  1.00 73.59 ? 1385 GLN A NE2 1 
ATOM   1008 N N   . GLU A 1 128 ? -33.183 -31.891 -2.021  1.00 86.14 ? 1386 GLU A N   1 
ATOM   1009 C CA  . GLU A 1 128 ? -34.175 -32.856 -2.516  1.00 90.33 ? 1386 GLU A CA  1 
ATOM   1010 C C   . GLU A 1 128 ? -34.043 -34.226 -1.849  1.00 93.52 ? 1386 GLU A C   1 
ATOM   1011 O O   . GLU A 1 128 ? -34.953 -35.052 -1.916  1.00 96.88 ? 1386 GLU A O   1 
ATOM   1012 C CB  . GLU A 1 128 ? -34.066 -33.003 -4.035  1.00 90.89 ? 1386 GLU A CB  1 
ATOM   1013 C CG  . GLU A 1 128 ? -34.163 -31.682 -4.792  1.00 89.01 ? 1386 GLU A CG  1 
ATOM   1014 C CD  . GLU A 1 128 ? -33.690 -31.787 -6.229  1.00 89.97 ? 1386 GLU A CD  1 
ATOM   1015 O OE1 . GLU A 1 128 ? -33.550 -32.922 -6.739  1.00 93.05 ? 1386 GLU A OE1 1 
ATOM   1016 O OE2 . GLU A 1 128 ? -33.462 -30.725 -6.849  1.00 87.40 ? 1386 GLU A OE2 1 
ATOM   1017 N N   . SER A 1 129 ? -32.897 -34.453 -1.217  1.00 92.78 ? 1387 SER A N   1 
ATOM   1018 C CA  . SER A 1 129 ? -32.637 -35.662 -0.450  1.00 95.71 ? 1387 SER A CA  1 
ATOM   1019 C C   . SER A 1 129 ? -33.149 -35.476 0.982   1.00 95.95 ? 1387 SER A C   1 
ATOM   1020 O O   . SER A 1 129 ? -33.321 -36.444 1.726   1.00 98.78 ? 1387 SER A O   1 
ATOM   1021 C CB  . SER A 1 129 ? -31.136 -35.958 -0.460  1.00 94.69 ? 1387 SER A CB  1 
ATOM   1022 O OG  . SER A 1 129 ? -30.883 -37.347 -0.417  1.00 98.64 ? 1387 SER A OG  1 
ATOM   1023 N N   . GLY A 1 130 ? -33.389 -34.219 1.356   1.00 93.26 ? 1388 GLY A N   1 
ATOM   1024 C CA  . GLY A 1 130 ? -33.966 -33.884 2.653   1.00 93.39 ? 1388 GLY A CA  1 
ATOM   1025 C C   . GLY A 1 130 ? -32.958 -33.641 3.761   1.00 91.49 ? 1388 GLY A C   1 
ATOM   1026 O O   . GLY A 1 130 ? -33.255 -33.889 4.931   1.00 92.83 ? 1388 GLY A O   1 
ATOM   1027 N N   . ILE A 1 131 ? -31.761 -33.179 3.399   1.00 88.33 ? 1389 ILE A N   1 
ATOM   1028 C CA  . ILE A 1 131 ? -30.787 -32.723 4.397   1.00 86.05 ? 1389 ILE A CA  1 
ATOM   1029 C C   . ILE A 1 131 ? -30.331 -31.285 4.135   1.00 82.16 ? 1389 ILE A C   1 
ATOM   1030 O O   . ILE A 1 131 ? -30.126 -30.877 2.984   1.00 80.74 ? 1389 ILE A O   1 
ATOM   1031 C CB  . ILE A 1 131 ? -29.563 -33.691 4.591   1.00 86.78 ? 1389 ILE A CB  1 
ATOM   1032 C CG1 . ILE A 1 131 ? -28.556 -33.593 3.435   1.00 85.18 ? 1389 ILE A CG1 1 
ATOM   1033 C CG2 . ILE A 1 131 ? -30.027 -35.138 4.840   1.00 90.57 ? 1389 ILE A CG2 1 
ATOM   1034 C CD1 . ILE A 1 131 ? -27.121 -33.972 3.816   1.00 84.16 ? 1389 ILE A CD1 1 
ATOM   1035 N N   . VAL A 1 132 ? -30.212 -30.521 5.219   1.00 80.40 ? 1390 VAL A N   1 
ATOM   1036 C CA  . VAL A 1 132 ? -29.722 -29.146 5.183   1.00 76.78 ? 1390 VAL A CA  1 
ATOM   1037 C C   . VAL A 1 132 ? -28.231 -29.162 5.537   1.00 74.74 ? 1390 VAL A C   1 
ATOM   1038 O O   . VAL A 1 132 ? -27.855 -29.564 6.645   1.00 75.68 ? 1390 VAL A O   1 
ATOM   1039 C CB  . VAL A 1 132 ? -30.556 -28.201 6.124   1.00 76.74 ? 1390 VAL A CB  1 
ATOM   1040 C CG1 . VAL A 1 132 ? -30.824 -28.847 7.493   1.00 79.14 ? 1390 VAL A CG1 1 
ATOM   1041 C CG2 . VAL A 1 132 ? -29.895 -26.826 6.278   1.00 73.79 ? 1390 VAL A CG2 1 
ATOM   1042 N N   . GLU A 1 133 ? -27.391 -28.747 4.589   1.00 71.80 ? 1391 GLU A N   1 
ATOM   1043 C CA  . GLU A 1 133 ? -25.939 -28.873 4.733   1.00 69.58 ? 1391 GLU A CA  1 
ATOM   1044 C C   . GLU A 1 133 ? -25.155 -27.977 3.769   1.00 66.16 ? 1391 GLU A C   1 
ATOM   1045 O O   . GLU A 1 133 ? -24.934 -28.343 2.609   1.00 66.78 ? 1391 GLU A O   1 
ATOM   1046 C CB  . GLU A 1 133 ? -25.524 -30.340 4.550   1.00 72.03 ? 1391 GLU A CB  1 
ATOM   1047 C CG  . GLU A 1 133 ? -24.021 -30.601 4.641   1.00 72.97 ? 1391 GLU A CG  1 
ATOM   1048 C CD  . GLU A 1 133 ? -23.686 -31.906 5.346   1.00 77.08 ? 1391 GLU A CD  1 
ATOM   1049 O OE1 . GLU A 1 133 ? -22.527 -32.359 5.231   1.00 78.04 ? 1391 GLU A OE1 1 
ATOM   1050 O OE2 . GLU A 1 133 ? -24.572 -32.474 6.022   1.00 79.71 ? 1391 GLU A OE2 1 
ATOM   1051 N N   . GLY A 1 134 ? -24.726 -26.813 4.253   1.00 62.41 ? 1392 GLY A N   1 
ATOM   1052 C CA  . GLY A 1 134 ? -23.842 -25.937 3.483   1.00 58.15 ? 1392 GLY A CA  1 
ATOM   1053 C C   . GLY A 1 134 ? -22.378 -26.368 3.489   1.00 56.39 ? 1392 GLY A C   1 
ATOM   1054 O O   . GLY A 1 134 ? -22.017 -27.406 4.055   1.00 57.31 ? 1392 GLY A O   1 
ATOM   1055 N N   . ALA A 1 135 ? -21.535 -25.551 2.859   1.00 53.66 ? 1393 ALA A N   1 
ATOM   1056 C CA  . ALA A 1 135 ? -20.087 -25.801 2.754   1.00 52.47 ? 1393 ALA A CA  1 
ATOM   1057 C C   . ALA A 1 135 ? -19.326 -25.939 4.083   1.00 51.46 ? 1393 ALA A C   1 
ATOM   1058 O O   . ALA A 1 135 ? -18.336 -26.670 4.151   1.00 51.86 ? 1393 ALA A O   1 
ATOM   1059 C CB  . ALA A 1 135 ? -19.434 -24.711 1.903   1.00 51.19 ? 1393 ALA A CB  1 
ATOM   1060 N N   . PHE A 1 136 ? -19.778 -25.233 5.123   1.00 49.52 ? 1394 PHE A N   1 
ATOM   1061 C CA  . PHE A 1 136 ? -19.081 -25.234 6.417   1.00 48.37 ? 1394 PHE A CA  1 
ATOM   1062 C C   . PHE A 1 136 ? -19.815 -26.049 7.482   1.00 49.73 ? 1394 PHE A C   1 
ATOM   1063 O O   . PHE A 1 136 ? -19.710 -25.779 8.685   1.00 48.95 ? 1394 PHE A O   1 
ATOM   1064 C CB  . PHE A 1 136 ? -18.855 -23.806 6.922   1.00 46.15 ? 1394 PHE A CB  1 
ATOM   1065 C CG  . PHE A 1 136 ? -18.266 -22.880 5.900   1.00 44.38 ? 1394 PHE A CG  1 
ATOM   1066 C CD1 . PHE A 1 136 ? -17.064 -23.185 5.263   1.00 42.02 ? 1394 PHE A CD1 1 
ATOM   1067 C CD2 . PHE A 1 136 ? -18.914 -21.692 5.582   1.00 40.90 ? 1394 PHE A CD2 1 
ATOM   1068 C CE1 . PHE A 1 136 ? -16.524 -22.317 4.327   1.00 40.39 ? 1394 PHE A CE1 1 
ATOM   1069 C CE2 . PHE A 1 136 ? -18.378 -20.823 4.648   1.00 40.02 ? 1394 PHE A CE2 1 
ATOM   1070 C CZ  . PHE A 1 136 ? -17.184 -21.137 4.015   1.00 38.59 ? 1394 PHE A CZ  1 
ATOM   1071 N N   . SER A 1 137 ? -20.549 -27.060 7.029   1.00 51.14 ? 1395 SER A N   1 
ATOM   1072 C CA  . SER A 1 137 ? -21.299 -27.925 7.923   1.00 52.97 ? 1395 SER A CA  1 
ATOM   1073 C C   . SER A 1 137 ? -20.328 -28.664 8.840   1.00 53.38 ? 1395 SER A C   1 
ATOM   1074 O O   . SER A 1 137 ? -19.324 -29.191 8.374   1.00 53.94 ? 1395 SER A O   1 
ATOM   1075 C CB  . SER A 1 137 ? -22.113 -28.913 7.097   1.00 54.69 ? 1395 SER A CB  1 
ATOM   1076 O OG  . SER A 1 137 ? -23.389 -29.095 7.670   1.00 57.44 ? 1395 SER A OG  1 
ATOM   1077 N N   . GLY A 1 138 ? -20.613 -28.676 10.140  1.00 53.47 ? 1396 GLY A N   1 
ATOM   1078 C CA  . GLY A 1 138 ? -19.720 -29.279 11.128  1.00 53.19 ? 1396 GLY A CA  1 
ATOM   1079 C C   . GLY A 1 138 ? -18.644 -28.367 11.707  1.00 51.51 ? 1396 GLY A C   1 
ATOM   1080 O O   . GLY A 1 138 ? -17.974 -28.742 12.671  1.00 52.28 ? 1396 GLY A O   1 
ATOM   1081 N N   . TRP A 1 139 ? -18.464 -27.177 11.133  1.00 48.81 ? 1397 TRP A N   1 
ATOM   1082 C CA  . TRP A 1 139 ? -17.477 -26.221 11.646  1.00 47.02 ? 1397 TRP A CA  1 
ATOM   1083 C C   . TRP A 1 139 ? -17.992 -25.470 12.873  1.00 46.53 ? 1397 TRP A C   1 
ATOM   1084 O O   . TRP A 1 139 ? -19.114 -24.960 12.873  1.00 46.40 ? 1397 TRP A O   1 
ATOM   1085 C CB  . TRP A 1 139 ? -17.112 -25.187 10.579  1.00 45.51 ? 1397 TRP A CB  1 
ATOM   1086 C CG  . TRP A 1 139 ? -16.278 -25.675 9.432   1.00 45.59 ? 1397 TRP A CG  1 
ATOM   1087 C CD1 . TRP A 1 139 ? -16.163 -26.957 8.964   1.00 47.90 ? 1397 TRP A CD1 1 
ATOM   1088 C CD2 . TRP A 1 139 ? -15.481 -24.862 8.568   1.00 44.17 ? 1397 TRP A CD2 1 
ATOM   1089 N NE1 . TRP A 1 139 ? -15.319 -26.992 7.873   1.00 46.76 ? 1397 TRP A NE1 1 
ATOM   1090 C CE2 . TRP A 1 139 ? -14.886 -25.720 7.613   1.00 46.11 ? 1397 TRP A CE2 1 
ATOM   1091 C CE3 . TRP A 1 139 ? -15.208 -23.489 8.505   1.00 43.34 ? 1397 TRP A CE3 1 
ATOM   1092 C CZ2 . TRP A 1 139 ? -14.036 -25.245 6.611   1.00 44.73 ? 1397 TRP A CZ2 1 
ATOM   1093 C CZ3 . TRP A 1 139 ? -14.352 -23.026 7.519   1.00 42.22 ? 1397 TRP A CZ3 1 
ATOM   1094 C CH2 . TRP A 1 139 ? -13.781 -23.899 6.588   1.00 43.09 ? 1397 TRP A CH2 1 
ATOM   1095 N N   . LYS A 1 140 ? -17.163 -25.394 13.908  1.00 45.85 ? 1398 LYS A N   1 
ATOM   1096 C CA  . LYS A 1 140 ? -17.471 -24.601 15.092  1.00 45.65 ? 1398 LYS A CA  1 
ATOM   1097 C C   . LYS A 1 140 ? -16.367 -23.556 15.269  1.00 43.68 ? 1398 LYS A C   1 
ATOM   1098 O O   . LYS A 1 140 ? -15.244 -23.880 15.638  1.00 43.92 ? 1398 LYS A O   1 
ATOM   1099 C CB  . LYS A 1 140 ? -17.588 -25.508 16.324  1.00 47.74 ? 1398 LYS A CB  1 
ATOM   1100 C CG  . LYS A 1 140 ? -18.862 -26.350 16.359  1.00 50.85 ? 1398 LYS A CG  1 
ATOM   1101 C CD  . LYS A 1 140 ? -18.703 -27.521 17.308  1.00 56.49 ? 1398 LYS A CD  1 
ATOM   1102 C CE  . LYS A 1 140 ? -19.985 -27.775 18.085  1.00 60.27 ? 1398 LYS A CE  1 
ATOM   1103 N NZ  . LYS A 1 140 ? -19.738 -28.628 19.288  1.00 63.82 ? 1398 LYS A NZ  1 
ATOM   1104 N N   . VAL A 1 141 ? -16.695 -22.298 15.003  1.00 41.87 ? 1399 VAL A N   1 
ATOM   1105 C CA  . VAL A 1 141 ? -15.672 -21.309 14.688  1.00 39.21 ? 1399 VAL A CA  1 
ATOM   1106 C C   . VAL A 1 141 ? -15.550 -20.193 15.708  1.00 39.16 ? 1399 VAL A C   1 
ATOM   1107 O O   . VAL A 1 141 ? -16.553 -19.598 16.134  1.00 38.96 ? 1399 VAL A O   1 
ATOM   1108 C CB  . VAL A 1 141 ? -15.933 -20.682 13.290  1.00 38.53 ? 1399 VAL A CB  1 
ATOM   1109 C CG1 . VAL A 1 141 ? -14.973 -19.523 12.999  1.00 36.73 ? 1399 VAL A CG1 1 
ATOM   1110 C CG2 . VAL A 1 141 ? -15.870 -21.754 12.199  1.00 37.19 ? 1399 VAL A CG2 1 
ATOM   1111 N N   . ILE A 1 142 ? -14.300 -19.930 16.082  1.00 38.46 ? 1400 ILE A N   1 
ATOM   1112 C CA  . ILE A 1 142 ? -13.920 -18.732 16.807  1.00 39.20 ? 1400 ILE A CA  1 
ATOM   1113 C C   . ILE A 1 142 ? -13.333 -17.729 15.805  1.00 38.79 ? 1400 ILE A C   1 
ATOM   1114 O O   . ILE A 1 142 ? -12.432 -18.057 15.024  1.00 38.08 ? 1400 ILE A O   1 
ATOM   1115 C CB  . ILE A 1 142 ? -12.918 -19.037 17.950  1.00 39.94 ? 1400 ILE A CB  1 
ATOM   1116 C CG1 . ILE A 1 142 ? -13.628 -19.779 19.087  1.00 41.62 ? 1400 ILE A CG1 1 
ATOM   1117 C CG2 . ILE A 1 142 ? -12.299 -17.739 18.493  1.00 39.75 ? 1400 ILE A CG2 1 
ATOM   1118 C CD1 . ILE A 1 142 ? -12.688 -20.450 20.071  1.00 41.89 ? 1400 ILE A CD1 1 
ATOM   1119 N N   . LEU A 1 143 ? -13.861 -16.508 15.842  1.00 39.07 ? 1401 LEU A N   1 
ATOM   1120 C CA  . LEU A 1 143 ? -13.454 -15.454 14.927  1.00 39.33 ? 1401 LEU A CA  1 
ATOM   1121 C C   . LEU A 1 143 ? -12.627 -14.441 15.705  1.00 39.86 ? 1401 LEU A C   1 
ATOM   1122 O O   . LEU A 1 143 ? -13.049 -13.973 16.760  1.00 40.03 ? 1401 LEU A O   1 
ATOM   1123 C CB  . LEU A 1 143 ? -14.706 -14.776 14.386  1.00 39.47 ? 1401 LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 143 ? -15.072 -14.691 12.911  1.00 41.10 ? 1401 LEU A CG  1 
ATOM   1125 C CD1 . LEU A 1 143 ? -14.639 -15.896 12.127  1.00 39.75 ? 1401 LEU A CD1 1 
ATOM   1126 C CD2 . LEU A 1 143 ? -16.586 -14.441 12.791  1.00 42.32 ? 1401 LEU A CD2 1 
ATOM   1127 N N   . HIS A 1 144 ? -11.436 -14.143 15.207  1.00 39.82 ? 1402 HIS A N   1 
ATOM   1128 C CA  . HIS A 1 144 ? -10.643 -13.025 15.717  1.00 41.61 ? 1402 HIS A CA  1 
ATOM   1129 C C   . HIS A 1 144 ? -10.222 -12.179 14.529  1.00 41.52 ? 1402 HIS A C   1 
ATOM   1130 O O   . HIS A 1 144 ? -9.080  -12.262 14.071  1.00 42.60 ? 1402 HIS A O   1 
ATOM   1131 C CB  . HIS A 1 144 ? -9.401  -13.517 16.467  1.00 42.42 ? 1402 HIS A CB  1 
ATOM   1132 C CG  . HIS A 1 144 ? -8.539  -12.412 17.010  1.00 44.28 ? 1402 HIS A CG  1 
ATOM   1133 N ND1 . HIS A 1 144 ? -9.027  -11.421 17.836  1.00 47.26 ? 1402 HIS A ND1 1 
ATOM   1134 C CD2 . HIS A 1 144 ? -7.217  -12.160 16.865  1.00 45.28 ? 1402 HIS A CD2 1 
ATOM   1135 C CE1 . HIS A 1 144 ? -8.047  -10.597 18.166  1.00 48.51 ? 1402 HIS A CE1 1 
ATOM   1136 N NE2 . HIS A 1 144 ? -6.936  -11.028 17.596  1.00 49.51 ? 1402 HIS A NE2 1 
ATOM   1137 N N   . VAL A 1 145 ? -11.149 -11.394 13.999  1.00 41.38 ? 1403 VAL A N   1 
ATOM   1138 C CA  . VAL A 1 145 ? -10.869 -10.673 12.766  1.00 41.22 ? 1403 VAL A CA  1 
ATOM   1139 C C   . VAL A 1 145 ? -11.127 -9.189  12.941  1.00 42.89 ? 1403 VAL A C   1 
ATOM   1140 O O   . VAL A 1 145 ? -11.813 -8.771  13.883  1.00 43.14 ? 1403 VAL A O   1 
ATOM   1141 C CB  . VAL A 1 145 ? -11.631 -11.248 11.532  1.00 40.27 ? 1403 VAL A CB  1 
ATOM   1142 C CG1 . VAL A 1 145 ? -11.448 -12.763 11.421  1.00 37.89 ? 1403 VAL A CG1 1 
ATOM   1143 C CG2 . VAL A 1 145 ? -13.100 -10.880 11.557  1.00 40.24 ? 1403 VAL A CG2 1 
ATOM   1144 N N   . ASP A 1 146 ? -10.537 -8.396  12.050  1.00 43.68 ? 1404 ASP A N   1 
ATOM   1145 C CA  . ASP A 1 146 ? -10.725 -6.947  12.069  1.00 45.80 ? 1404 ASP A CA  1 
ATOM   1146 C C   . ASP A 1 146 ? -12.202 -6.581  12.256  1.00 45.31 ? 1404 ASP A C   1 
ATOM   1147 O O   . ASP A 1 146 ? -13.069 -7.139  11.579  1.00 43.68 ? 1404 ASP A O   1 
ATOM   1148 C CB  . ASP A 1 146 ? -10.201 -6.344  10.768  1.00 46.50 ? 1404 ASP A CB  1 
ATOM   1149 C CG  . ASP A 1 146 ? -9.889  -4.883  10.913  1.00 50.48 ? 1404 ASP A CG  1 
ATOM   1150 O OD1 . ASP A 1 146 ? -8.798  -4.562  11.431  1.00 53.78 ? 1404 ASP A OD1 1 
ATOM   1151 O OD2 . ASP A 1 146 ? -10.755 -4.062  10.546  1.00 52.72 ? 1404 ASP A OD2 1 
ATOM   1152 N N   . GLN A 1 147 ? -12.488 -5.667  13.182  1.00 47.01 ? 1405 GLN A N   1 
ATOM   1153 C CA  . GLN A 1 147 ? -13.872 -5.236  13.429  1.00 47.74 ? 1405 GLN A CA  1 
ATOM   1154 C C   . GLN A 1 147 ? -14.578 -4.716  12.169  1.00 47.10 ? 1405 GLN A C   1 
ATOM   1155 O O   . GLN A 1 147 ? -15.804 -4.840  12.045  1.00 46.23 ? 1405 GLN A O   1 
ATOM   1156 C CB  . GLN A 1 147 ? -13.945 -4.169  14.528  1.00 50.16 ? 1405 GLN A CB  1 
ATOM   1157 C CG  . GLN A 1 147 ? -14.955 -4.476  15.631  0.50 51.22 ? 1405 GLN A CG  1 
ATOM   1158 C CD  . GLN A 1 147 ? -16.322 -4.875  15.104  0.50 50.88 ? 1405 GLN A CD  1 
ATOM   1159 O OE1 . GLN A 1 147 ? -17.094 -4.035  14.635  0.50 50.89 ? 1405 GLN A OE1 1 
ATOM   1160 N NE2 . GLN A 1 147 ? -16.630 -6.164  15.187  0.50 49.13 ? 1405 GLN A NE2 1 
ATOM   1161 N N   . SER A 1 148 ? -13.817 -4.143  11.236  1.00 47.21 ? 1406 SER A N   1 
ATOM   1162 C CA  . SER A 1 148 ? -14.404 -3.695  9.966   1.00 47.67 ? 1406 SER A CA  1 
ATOM   1163 C C   . SER A 1 148 ? -15.062 -4.847  9.195   1.00 44.95 ? 1406 SER A C   1 
ATOM   1164 O O   . SER A 1 148 ? -15.906 -4.614  8.343   1.00 45.21 ? 1406 SER A O   1 
ATOM   1165 C CB  . SER A 1 148 ? -13.357 -3.001  9.077   1.00 48.47 ? 1406 SER A CB  1 
ATOM   1166 O OG  . SER A 1 148 ? -12.389 -3.939  8.633   1.00 48.67 ? 1406 SER A OG  1 
ATOM   1167 N N   . ARG A 1 149 ? -14.690 -6.080  9.525   1.00 43.39 ? 1407 ARG A N   1 
ATOM   1168 C CA  . ARG A 1 149 ? -15.003 -7.260  8.720   1.00 41.78 ? 1407 ARG A CA  1 
ATOM   1169 C C   . ARG A 1 149 ? -15.697 -8.397  9.454   1.00 40.27 ? 1407 ARG A C   1 
ATOM   1170 O O   . ARG A 1 149 ? -16.180 -9.328  8.815   1.00 38.79 ? 1407 ARG A O   1 
ATOM   1171 C CB  . ARG A 1 149 ? -13.701 -7.868  8.204   1.00 41.57 ? 1407 ARG A CB  1 
ATOM   1172 C CG  . ARG A 1 149 ? -13.179 -7.285  6.942   1.00 43.94 ? 1407 ARG A CG  1 
ATOM   1173 C CD  . ARG A 1 149 ? -11.753 -7.752  6.809   1.00 47.70 ? 1407 ARG A CD  1 
ATOM   1174 N NE  . ARG A 1 149 ? -11.105 -7.063  5.711   1.00 51.28 ? 1407 ARG A NE  1 
ATOM   1175 C CZ  . ARG A 1 149 ? -9.792  -6.921  5.578   1.00 54.12 ? 1407 ARG A CZ  1 
ATOM   1176 N NH1 . ARG A 1 149 ? -8.950  -7.416  6.485   1.00 53.87 ? 1407 ARG A NH1 1 
ATOM   1177 N NH2 . ARG A 1 149 ? -9.330  -6.270  4.526   1.00 55.57 ? 1407 ARG A NH2 1 
ATOM   1178 N N   . GLU A 1 150 ? -15.704 -8.353  10.781  1.00 40.62 ? 1408 GLU A N   1 
ATOM   1179 C CA  . GLU A 1 150 ? -16.120 -9.518  11.566  1.00 40.34 ? 1408 GLU A CA  1 
ATOM   1180 C C   . GLU A 1 150 ? -17.539 -9.985  11.302  1.00 39.04 ? 1408 GLU A C   1 
ATOM   1181 O O   . GLU A 1 150 ? -17.776 -11.180 11.136  1.00 38.01 ? 1408 GLU A O   1 
ATOM   1182 C CB  . GLU A 1 150 ? -15.913 -9.296  13.071  1.00 42.17 ? 1408 GLU A CB  1 
ATOM   1183 C CG  . GLU A 1 150 ? -15.933 -10.614 13.865  1.00 44.13 ? 1408 GLU A CG  1 
ATOM   1184 C CD  . GLU A 1 150 ? -15.333 -10.464 15.249  1.00 50.50 ? 1408 GLU A CD  1 
ATOM   1185 O OE1 . GLU A 1 150 ? -15.951 -9.724  16.058  1.00 53.70 ? 1408 GLU A OE1 1 
ATOM   1186 O OE2 . GLU A 1 150 ? -14.242 -11.055 15.506  1.00 50.42 ? 1408 GLU A OE2 1 
ATOM   1187 N N   . ALA A 1 151 ? -18.483 -9.050  11.285  1.00 39.01 ? 1409 ALA A N   1 
ATOM   1188 C CA  . ALA A 1 151 ? -19.879 -9.409  11.066  1.00 38.90 ? 1409 ALA A CA  1 
ATOM   1189 C C   . ALA A 1 151 ? -20.101 -10.038 9.674   1.00 36.92 ? 1409 ALA A C   1 
ATOM   1190 O O   . ALA A 1 151 ? -20.947 -10.918 9.506   1.00 36.89 ? 1409 ALA A O   1 
ATOM   1191 C CB  . ALA A 1 151 ? -20.799 -8.189  11.305  1.00 39.99 ? 1409 ALA A CB  1 
ATOM   1192 N N   . GLY A 1 152 ? -19.322 -9.602  8.690   1.00 36.01 ? 1410 GLY A N   1 
ATOM   1193 C CA  . GLY A 1 152 ? -19.379 -10.164 7.344   1.00 34.28 ? 1410 GLY A CA  1 
ATOM   1194 C C   . GLY A 1 152 ? -18.939 -11.620 7.300   1.00 33.97 ? 1410 GLY A C   1 
ATOM   1195 O O   . GLY A 1 152 ? -19.585 -12.445 6.658   1.00 32.52 ? 1410 GLY A O   1 
ATOM   1196 N N   . PHE A 1 153 ? -17.835 -11.927 7.987   1.00 34.00 ? 1411 PHE A N   1 
ATOM   1197 C CA  . PHE A 1 153 ? -17.355 -13.296 8.121   1.00 34.19 ? 1411 PHE A CA  1 
ATOM   1198 C C   . PHE A 1 153 ? -18.310 -14.172 8.884   1.00 34.62 ? 1411 PHE A C   1 
ATOM   1199 O O   . PHE A 1 153 ? -18.475 -15.341 8.553   1.00 34.46 ? 1411 PHE A O   1 
ATOM   1200 C CB  . PHE A 1 153 ? -15.980 -13.347 8.795   1.00 34.57 ? 1411 PHE A CB  1 
ATOM   1201 C CG  . PHE A 1 153 ? -14.845 -13.162 7.830   1.00 34.68 ? 1411 PHE A CG  1 
ATOM   1202 C CD1 . PHE A 1 153 ? -14.595 -14.116 6.851   1.00 34.60 ? 1411 PHE A CD1 1 
ATOM   1203 C CD2 . PHE A 1 153 ? -14.049 -12.030 7.882   1.00 36.30 ? 1411 PHE A CD2 1 
ATOM   1204 C CE1 . PHE A 1 153 ? -13.552 -13.947 5.941   1.00 34.37 ? 1411 PHE A CE1 1 
ATOM   1205 C CE2 . PHE A 1 153 ? -13.007 -11.855 6.981   1.00 37.03 ? 1411 PHE A CE2 1 
ATOM   1206 C CZ  . PHE A 1 153 ? -12.772 -12.820 5.999   1.00 34.84 ? 1411 PHE A CZ  1 
ATOM   1207 N N   . LYS A 1 154 ? -18.920 -13.610 9.921   1.00 35.81 ? 1412 LYS A N   1 
ATOM   1208 C CA  . LYS A 1 154 ? -19.840 -14.373 10.733  1.00 37.62 ? 1412 LYS A CA  1 
ATOM   1209 C C   . LYS A 1 154 ? -21.042 -14.813 9.875   1.00 37.51 ? 1412 LYS A C   1 
ATOM   1210 O O   . LYS A 1 154 ? -21.382 -15.991 9.860   1.00 37.63 ? 1412 LYS A O   1 
ATOM   1211 C CB  . LYS A 1 154 ? -20.263 -13.568 11.964  1.00 38.92 ? 1412 LYS A CB  1 
ATOM   1212 C CG  . LYS A 1 154 ? -21.300 -14.283 12.800  1.00 43.69 ? 1412 LYS A CG  1 
ATOM   1213 C CD  . LYS A 1 154 ? -21.841 -13.419 13.944  1.00 49.41 ? 1412 LYS A CD  1 
ATOM   1214 C CE  . LYS A 1 154 ? -21.266 -13.882 15.265  1.00 52.86 ? 1412 LYS A CE  1 
ATOM   1215 N NZ  . LYS A 1 154 ? -22.289 -13.783 16.357  1.00 56.94 ? 1412 LYS A NZ  1 
ATOM   1216 N N   . ARG A 1 155 ? -21.644 -13.876 9.140   1.00 37.40 ? 1413 ARG A N   1 
ATOM   1217 C CA  . ARG A 1 155 ? -22.736 -14.209 8.221   1.00 38.20 ? 1413 ARG A CA  1 
ATOM   1218 C C   . ARG A 1 155 ? -22.321 -15.191 7.136   1.00 37.91 ? 1413 ARG A C   1 
ATOM   1219 O O   . ARG A 1 155 ? -23.056 -16.138 6.832   1.00 39.43 ? 1413 ARG A O   1 
ATOM   1220 C CB  . ARG A 1 155 ? -23.381 -12.952 7.632   1.00 38.01 ? 1413 ARG A CB  1 
ATOM   1221 C CG  . ARG A 1 155 ? -24.324 -12.246 8.623   1.00 39.26 ? 1413 ARG A CG  1 
ATOM   1222 C CD  . ARG A 1 155 ? -24.995 -11.033 8.021   1.00 39.85 ? 1413 ARG A CD  1 
ATOM   1223 N NE  . ARG A 1 155 ? -24.126 -9.855  7.991   1.00 41.38 ? 1413 ARG A NE  1 
ATOM   1224 C CZ  . ARG A 1 155 ? -24.065 -8.943  8.963   1.00 43.50 ? 1413 ARG A CZ  1 
ATOM   1225 N NH1 . ARG A 1 155 ? -24.812 -9.057  10.055  1.00 45.13 ? 1413 ARG A NH1 1 
ATOM   1226 N NH2 . ARG A 1 155 ? -23.261 -7.898  8.843   1.00 44.26 ? 1413 ARG A NH2 1 
ATOM   1227 N N   . LEU A 1 156 ? -21.133 -14.989 6.576   1.00 37.15 ? 1414 LEU A N   1 
ATOM   1228 C CA  . LEU A 1 156 ? -20.595 -15.922 5.595   1.00 36.77 ? 1414 LEU A CA  1 
ATOM   1229 C C   . LEU A 1 156 ? -20.540 -17.339 6.181   1.00 36.59 ? 1414 LEU A C   1 
ATOM   1230 O O   . LEU A 1 156 ? -21.046 -18.289 5.576   1.00 36.65 ? 1414 LEU A O   1 
ATOM   1231 C CB  . LEU A 1 156 ? -19.205 -15.458 5.121   1.00 36.25 ? 1414 LEU A CB  1 
ATOM   1232 C CG  . LEU A 1 156 ? -18.226 -16.482 4.512   1.00 37.16 ? 1414 LEU A CG  1 
ATOM   1233 C CD1 . LEU A 1 156 ? -18.838 -17.266 3.343   1.00 37.51 ? 1414 LEU A CD1 1 
ATOM   1234 C CD2 . LEU A 1 156 ? -16.959 -15.748 4.057   1.00 35.95 ? 1414 LEU A CD2 1 
ATOM   1235 N N   . LEU A 1 157 ? -19.917 -17.474 7.350   1.00 36.17 ? 1415 LEU A N   1 
ATOM   1236 C CA  . LEU A 1 157 ? -19.744 -18.786 7.972   1.00 36.93 ? 1415 LEU A CA  1 
ATOM   1237 C C   . LEU A 1 157 ? -21.082 -19.438 8.311   1.00 38.32 ? 1415 LEU A C   1 
ATOM   1238 O O   . LEU A 1 157 ? -21.278 -20.624 8.041   1.00 38.12 ? 1415 LEU A O   1 
ATOM   1239 C CB  . LEU A 1 157 ? -18.850 -18.692 9.214   1.00 37.07 ? 1415 LEU A CB  1 
ATOM   1240 C CG  . LEU A 1 157 ? -17.374 -18.437 8.846   1.00 37.24 ? 1415 LEU A CG  1 
ATOM   1241 C CD1 . LEU A 1 157 ? -16.617 -17.745 9.961   1.00 34.56 ? 1415 LEU A CD1 1 
ATOM   1242 C CD2 . LEU A 1 157 ? -16.680 -19.736 8.415   1.00 36.12 ? 1415 LEU A CD2 1 
ATOM   1243 N N   . GLN A 1 158 ? -21.998 -18.648 8.877   1.00 38.81 ? 1416 GLN A N   1 
ATOM   1244 C CA  . GLN A 1 158 ? -23.341 -19.134 9.213   1.00 40.99 ? 1416 GLN A CA  1 
ATOM   1245 C C   . GLN A 1 158 ? -24.104 -19.572 7.966   1.00 41.53 ? 1416 GLN A C   1 
ATOM   1246 O O   . GLN A 1 158 ? -24.802 -20.586 7.991   1.00 42.36 ? 1416 GLN A O   1 
ATOM   1247 C CB  . GLN A 1 158 ? -24.141 -18.052 9.940   1.00 41.50 ? 1416 GLN A CB  1 
ATOM   1248 C CG  . GLN A 1 158 ? -23.650 -17.779 11.354  1.00 42.70 ? 1416 GLN A CG  1 
ATOM   1249 C CD  . GLN A 1 158 ? -24.346 -16.595 12.007  1.00 44.33 ? 1416 GLN A CD  1 
ATOM   1250 O OE1 . GLN A 1 158 ? -24.864 -15.708 11.333  1.00 45.62 ? 1416 GLN A OE1 1 
ATOM   1251 N NE2 . GLN A 1 158 ? -24.352 -16.578 13.330  1.00 44.30 ? 1416 GLN A NE2 1 
ATOM   1252 N N   . SER A 1 159 ? -23.936 -18.827 6.871   1.00 40.81 ? 1417 SER A N   1 
ATOM   1253 C CA  . SER A 1 159 ? -24.623 -19.165 5.623   1.00 41.51 ? 1417 SER A CA  1 
ATOM   1254 C C   . SER A 1 159 ? -24.310 -20.596 5.179   1.00 42.07 ? 1417 SER A C   1 
ATOM   1255 O O   . SER A 1 159 ? -25.203 -21.320 4.728   1.00 43.52 ? 1417 SER A O   1 
ATOM   1256 C CB  . SER A 1 159 ? -24.289 -18.170 4.511   1.00 40.12 ? 1417 SER A CB  1 
ATOM   1257 O OG  . SER A 1 159 ? -24.972 -18.534 3.323   1.00 40.56 ? 1417 SER A OG  1 
ATOM   1258 N N   . GLY A 1 160 ? -23.054 -21.009 5.340   1.00 41.67 ? 1418 GLY A N   1 
ATOM   1259 C CA  . GLY A 1 160 ? -22.634 -22.377 5.010   1.00 42.12 ? 1418 GLY A CA  1 
ATOM   1260 C C   . GLY A 1 160 ? -22.843 -23.406 6.110   1.00 43.81 ? 1418 GLY A C   1 
ATOM   1261 O O   . GLY A 1 160 ? -22.334 -24.529 6.023   1.00 44.40 ? 1418 GLY A O   1 
ATOM   1262 N N   . GLY A 1 161 ? -23.587 -23.037 7.152   1.00 44.20 ? 1419 GLY A N   1 
ATOM   1263 C CA  . GLY A 1 161 ? -23.956 -23.996 8.193   1.00 45.96 ? 1419 GLY A CA  1 
ATOM   1264 C C   . GLY A 1 161 ? -22.936 -24.150 9.308   1.00 46.15 ? 1419 GLY A C   1 
ATOM   1265 O O   . GLY A 1 161 ? -22.987 -25.112 10.057  1.00 47.82 ? 1419 GLY A O   1 
ATOM   1266 N N   . ALA A 1 162 ? -21.996 -23.216 9.422   1.00 44.67 ? 1420 ALA A N   1 
ATOM   1267 C CA  . ALA A 1 162 ? -21.092 -23.221 10.565  1.00 44.86 ? 1420 ALA A CA  1 
ATOM   1268 C C   . ALA A 1 162 ? -21.750 -22.606 11.800  1.00 45.71 ? 1420 ALA A C   1 
ATOM   1269 O O   . ALA A 1 162 ? -22.599 -21.718 11.689  1.00 45.86 ? 1420 ALA A O   1 
ATOM   1270 C CB  . ALA A 1 162 ? -19.805 -22.484 10.243  1.00 43.37 ? 1420 ALA A CB  1 
ATOM   1271 N N   . LYS A 1 163 ? -21.344 -23.089 12.970  1.00 46.35 ? 1421 LYS A N   1 
ATOM   1272 C CA  . LYS A 1 163 ? -21.639 -22.439 14.240  1.00 47.45 ? 1421 LYS A CA  1 
ATOM   1273 C C   . LYS A 1 163 ? -20.520 -21.423 14.535  1.00 46.12 ? 1421 LYS A C   1 
ATOM   1274 O O   . LYS A 1 163 ? -19.333 -21.777 14.562  1.00 45.22 ? 1421 LYS A O   1 
ATOM   1275 C CB  . LYS A 1 163 ? -21.753 -23.514 15.338  1.00 49.62 ? 1421 LYS A CB  1 
ATOM   1276 C CG  . LYS A 1 163 ? -22.283 -23.065 16.708  1.00 52.82 ? 1421 LYS A CG  1 
ATOM   1277 C CD  . LYS A 1 163 ? -23.055 -24.209 17.379  1.00 58.98 ? 1421 LYS A CD  1 
ATOM   1278 C CE  . LYS A 1 163 ? -22.681 -24.446 18.848  1.00 62.02 ? 1421 LYS A CE  1 
ATOM   1279 N NZ  . LYS A 1 163 ? -22.874 -23.281 19.752  1.00 61.94 ? 1421 LYS A NZ  1 
ATOM   1280 N N   . VAL A 1 164 ? -20.883 -20.150 14.693  1.00 45.62 ? 1422 VAL A N   1 
ATOM   1281 C CA  . VAL A 1 164 ? -19.909 -19.152 15.160  1.00 44.27 ? 1422 VAL A CA  1 
ATOM   1282 C C   . VAL A 1 164 ? -20.075 -18.994 16.664  1.00 46.08 ? 1422 VAL A C   1 
ATOM   1283 O O   . VAL A 1 164 ? -21.129 -18.566 17.141  1.00 46.67 ? 1422 VAL A O   1 
ATOM   1284 C CB  . VAL A 1 164 ? -19.995 -17.790 14.401  1.00 43.32 ? 1422 VAL A CB  1 
ATOM   1285 C CG1 . VAL A 1 164 ? -18.986 -16.777 14.965  1.00 41.54 ? 1422 VAL A CG1 1 
ATOM   1286 C CG2 . VAL A 1 164 ? -19.736 -17.990 12.883  1.00 40.25 ? 1422 VAL A CG2 1 
ATOM   1287 N N   . LEU A 1 165 ? -19.034 -19.372 17.398  1.00 46.63 ? 1423 LEU A N   1 
ATOM   1288 C CA  . LEU A 1 165 ? -19.062 -19.370 18.856  1.00 48.87 ? 1423 LEU A CA  1 
ATOM   1289 C C   . LEU A 1 165 ? -18.981 -17.944 19.388  1.00 49.94 ? 1423 LEU A C   1 
ATOM   1290 O O   . LEU A 1 165 ? -18.351 -17.097 18.755  1.00 48.66 ? 1423 LEU A O   1 
ATOM   1291 C CB  . LEU A 1 165 ? -17.906 -20.202 19.419  1.00 48.91 ? 1423 LEU A CB  1 
ATOM   1292 C CG  . LEU A 1 165 ? -17.868 -21.703 19.117  1.00 49.55 ? 1423 LEU A CG  1 
ATOM   1293 C CD1 . LEU A 1 165 ? -16.512 -22.281 19.499  1.00 48.07 ? 1423 LEU A CD1 1 
ATOM   1294 C CD2 . LEU A 1 165 ? -18.997 -22.428 19.854  1.00 51.27 ? 1423 LEU A CD2 1 
ATOM   1295 N N   . PRO A 1 166 ? -19.619 -17.673 20.549  1.00 52.43 ? 1424 PRO A N   1 
ATOM   1296 C CA  . PRO A 1 166 ? -19.588 -16.311 21.075  1.00 53.81 ? 1424 PRO A CA  1 
ATOM   1297 C C   . PRO A 1 166 ? -18.289 -16.035 21.826  1.00 54.32 ? 1424 PRO A C   1 
ATOM   1298 O O   . PRO A 1 166 ? -18.086 -16.552 22.926  1.00 56.24 ? 1424 PRO A O   1 
ATOM   1299 C CB  . PRO A 1 166 ? -20.789 -16.268 22.043  1.00 56.39 ? 1424 PRO A CB  1 
ATOM   1300 C CG  . PRO A 1 166 ? -21.005 -17.697 22.478  1.00 56.80 ? 1424 PRO A CG  1 
ATOM   1301 C CD  . PRO A 1 166 ? -20.350 -18.603 21.437  1.00 54.32 ? 1424 PRO A CD  1 
ATOM   1302 N N   . GLY A 1 167 ? -17.418 -15.220 21.245  1.00 53.31 ? 1425 GLY A N   1 
ATOM   1303 C CA  . GLY A 1 167 ? -16.200 -14.814 21.937  1.00 53.35 ? 1425 GLY A CA  1 
ATOM   1304 C C   . GLY A 1 167 ? -14.990 -15.638 21.551  1.00 51.66 ? 1425 GLY A C   1 
ATOM   1305 O O   . GLY A 1 167 ? -15.032 -16.436 20.612  1.00 50.87 ? 1425 GLY A O   1 
ATOM   1306 N N   . HIS A 1 168 ? -13.903 -15.433 22.282  1.00 51.88 ? 1426 HIS A N   1 
ATOM   1307 C CA  . HIS A 1 168 ? -12.639 -16.079 21.991  1.00 51.19 ? 1426 HIS A CA  1 
ATOM   1308 C C   . HIS A 1 168 ? -11.959 -16.547 23.277  1.00 51.68 ? 1426 HIS A C   1 
ATOM   1309 O O   . HIS A 1 168 ? -10.750 -16.743 23.297  1.00 51.77 ? 1426 HIS A O   1 
ATOM   1310 C CB  . HIS A 1 168 ? -11.726 -15.118 21.215  1.00 50.84 ? 1426 HIS A CB  1 
ATOM   1311 C CG  . HIS A 1 168 ? -11.581 -13.773 21.862  1.00 53.62 ? 1426 HIS A CG  1 
ATOM   1312 N ND1 . HIS A 1 168 ? -12.248 -12.653 21.410  1.00 55.43 ? 1426 HIS A ND1 1 
ATOM   1313 C CD2 . HIS A 1 168 ? -10.868 -13.375 22.942  1.00 56.10 ? 1426 HIS A CD2 1 
ATOM   1314 C CE1 . HIS A 1 168 ? -11.943 -11.622 22.176  1.00 56.80 ? 1426 HIS A CE1 1 
ATOM   1315 N NE2 . HIS A 1 168 ? -11.109 -12.033 23.115  1.00 57.85 ? 1426 HIS A NE2 1 
ATOM   1316 N N   . SER A 1 169 ? -12.733 -16.715 24.348  1.00 52.87 ? 1427 SER A N   1 
ATOM   1317 C CA  . SER A 1 169 ? -12.191 -17.159 25.643  1.00 54.05 ? 1427 SER A CA  1 
ATOM   1318 C C   . SER A 1 169 ? -11.642 -18.577 25.539  1.00 52.73 ? 1427 SER A C   1 
ATOM   1319 O O   . SER A 1 169 ? -12.209 -19.407 24.820  1.00 51.79 ? 1427 SER A O   1 
ATOM   1320 C CB  . SER A 1 169 ? -13.259 -17.119 26.733  1.00 55.94 ? 1427 SER A CB  1 
ATOM   1321 O OG  . SER A 1 169 ? -13.618 -15.791 27.049  1.00 59.26 ? 1427 SER A OG  1 
ATOM   1322 N N   . VAL A 1 170 ? -10.556 -18.845 26.265  1.00 52.69 ? 1428 VAL A N   1 
ATOM   1323 C CA  . VAL A 1 170 ? -9.897  -20.160 26.240  1.00 51.86 ? 1428 VAL A CA  1 
ATOM   1324 C C   . VAL A 1 170 ? -10.868 -21.339 26.486  1.00 51.95 ? 1428 VAL A C   1 
ATOM   1325 O O   . VAL A 1 170 ? -10.771 -22.350 25.784  1.00 51.43 ? 1428 VAL A O   1 
ATOM   1326 C CB  . VAL A 1 170 ? -8.650  -20.214 27.181  1.00 53.10 ? 1428 VAL A CB  1 
ATOM   1327 C CG1 . VAL A 1 170 ? -8.033  -21.622 27.219  1.00 52.74 ? 1428 VAL A CG1 1 
ATOM   1328 C CG2 . VAL A 1 170 ? -7.595  -19.188 26.749  1.00 52.27 ? 1428 VAL A CG2 1 
ATOM   1329 N N   . PRO A 1 171 ? -11.825 -21.204 27.435  1.00 52.59 ? 1429 PRO A N   1 
ATOM   1330 C CA  . PRO A 1 171 ? -12.806 -22.276 27.655  1.00 53.09 ? 1429 PRO A CA  1 
ATOM   1331 C C   . PRO A 1 171 ? -13.577 -22.733 26.408  1.00 51.49 ? 1429 PRO A C   1 
ATOM   1332 O O   . PRO A 1 171 ? -14.060 -23.871 26.370  1.00 51.90 ? 1429 PRO A O   1 
ATOM   1333 C CB  . PRO A 1 171 ? -13.783 -21.656 28.672  1.00 54.80 ? 1429 PRO A CB  1 
ATOM   1334 C CG  . PRO A 1 171 ? -12.957 -20.691 29.429  1.00 55.21 ? 1429 PRO A CG  1 
ATOM   1335 C CD  . PRO A 1 171 ? -12.005 -20.112 28.418  1.00 54.30 ? 1429 PRO A CD  1 
ATOM   1336 N N   . LEU A 1 172 ? -13.698 -21.856 25.413  1.00 49.32 ? 1430 LEU A N   1 
ATOM   1337 C CA  . LEU A 1 172 ? -14.415 -22.182 24.176  1.00 48.09 ? 1430 LEU A CA  1 
ATOM   1338 C C   . LEU A 1 172 ? -13.595 -23.045 23.201  1.00 46.43 ? 1430 LEU A C   1 
ATOM   1339 O O   . LEU A 1 172 ? -14.162 -23.610 22.264  1.00 45.74 ? 1430 LEU A O   1 
ATOM   1340 C CB  . LEU A 1 172 ? -14.886 -20.910 23.447  1.00 47.10 ? 1430 LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 172 ? -16.015 -20.002 23.950  1.00 48.94 ? 1430 LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 172 ? -15.883 -19.620 25.405  1.00 52.86 ? 1430 LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 172 ? -15.968 -18.734 23.103  1.00 50.62 ? 1430 LEU A CD2 1 
ATOM   1344 N N   . PHE A 1 173 ? -12.286 -23.146 23.422  1.00 45.52 ? 1431 PHE A N   1 
ATOM   1345 C CA  . PHE A 1 173 ? -11.395 -23.817 22.463  1.00 45.11 ? 1431 PHE A CA  1 
ATOM   1346 C C   . PHE A 1 173 ? -11.710 -25.314 22.325  1.00 45.72 ? 1431 PHE A C   1 
ATOM   1347 O O   . PHE A 1 173 ? -11.549 -25.884 21.246  1.00 44.86 ? 1431 PHE A O   1 
ATOM   1348 C CB  . PHE A 1 173 ? -9.910  -23.639 22.822  1.00 44.70 ? 1431 PHE A CB  1 
ATOM   1349 C CG  . PHE A 1 173 ? -9.411  -22.211 22.776  1.00 44.49 ? 1431 PHE A CG  1 
ATOM   1350 C CD1 . PHE A 1 173 ? -10.097 -21.222 22.084  1.00 44.00 ? 1431 PHE A CD1 1 
ATOM   1351 C CD2 . PHE A 1 173 ? -8.207  -21.874 23.392  1.00 44.54 ? 1431 PHE A CD2 1 
ATOM   1352 C CE1 . PHE A 1 173 ? -9.624  -19.909 22.039  1.00 44.09 ? 1431 PHE A CE1 1 
ATOM   1353 C CE2 . PHE A 1 173 ? -7.718  -20.576 23.342  1.00 45.57 ? 1431 PHE A CE2 1 
ATOM   1354 C CZ  . PHE A 1 173 ? -8.435  -19.584 22.670  1.00 45.37 ? 1431 PHE A CZ  1 
ATOM   1355 N N   . LYS A 1 174 ? -12.168 -25.938 23.409  1.00 46.78 ? 1432 LYS A N   1 
ATOM   1356 C CA  . LYS A 1 174 ? -12.520 -27.358 23.386  1.00 48.13 ? 1432 LYS A CA  1 
ATOM   1357 C C   . LYS A 1 174 ? -13.735 -27.671 22.508  1.00 48.93 ? 1432 LYS A C   1 
ATOM   1358 O O   . LYS A 1 174 ? -13.889 -28.799 22.049  1.00 49.84 ? 1432 LYS A O   1 
ATOM   1359 C CB  . LYS A 1 174 ? -12.726 -27.905 24.812  1.00 50.19 ? 1432 LYS A CB  1 
ATOM   1360 C CG  . LYS A 1 174 ? -14.077 -27.607 25.458  1.00 49.40 ? 1432 LYS A CG  1 
ATOM   1361 C CD  . LYS A 1 174 ? -14.164 -28.178 26.866  1.00 50.65 ? 1432 LYS A CD  1 
ATOM   1362 C CE  . LYS A 1 174 ? -13.355 -27.372 27.881  1.00 49.35 ? 1432 LYS A CE  1 
ATOM   1363 N NZ  . LYS A 1 174 ? -13.944 -26.015 28.115  1.00 46.80 ? 1432 LYS A NZ  1 
ATOM   1364 N N   . GLU A 1 175 ? -14.596 -26.675 22.297  1.00 49.08 ? 1433 GLU A N   1 
ATOM   1365 C CA  . GLU A 1 175 ? -15.755 -26.797 21.416  1.00 49.64 ? 1433 GLU A CA  1 
ATOM   1366 C C   . GLU A 1 175 ? -15.423 -26.396 19.973  1.00 48.27 ? 1433 GLU A C   1 
ATOM   1367 O O   . GLU A 1 175 ? -16.140 -26.762 19.044  1.00 48.35 ? 1433 GLU A O   1 
ATOM   1368 C CB  . GLU A 1 175 ? -16.908 -25.926 21.938  1.00 50.77 ? 1433 GLU A CB  1 
ATOM   1369 C CG  . GLU A 1 175 ? -18.299 -26.355 21.446  0.50 52.41 ? 1433 GLU A CG  1 
ATOM   1370 C CD  . GLU A 1 175 ? -19.415 -25.391 21.829  0.50 53.67 ? 1433 GLU A CD  1 
ATOM   1371 O OE1 . GLU A 1 175 ? -20.382 -25.261 21.045  0.50 53.34 ? 1433 GLU A OE1 1 
ATOM   1372 O OE2 . GLU A 1 175 ? -19.333 -24.767 22.908  0.50 54.78 ? 1433 GLU A OE2 1 
ATOM   1373 N N   . ALA A 1 176 ? -14.340 -25.647 19.793  1.00 46.89 ? 1434 ALA A N   1 
ATOM   1374 C CA  . ALA A 1 176 ? -13.987 -25.092 18.488  1.00 45.77 ? 1434 ALA A CA  1 
ATOM   1375 C C   . ALA A 1 176 ? -13.225 -26.093 17.628  1.00 45.91 ? 1434 ALA A C   1 
ATOM   1376 O O   . ALA A 1 176 ? -12.395 -26.857 18.127  1.00 46.79 ? 1434 ALA A O   1 
ATOM   1377 C CB  . ALA A 1 176 ? -13.163 -23.831 18.662  1.00 45.05 ? 1434 ALA A CB  1 
ATOM   1378 N N   . THR A 1 177 ? -13.518 -26.085 16.334  1.00 45.48 ? 1435 THR A N   1 
ATOM   1379 C CA  . THR A 1 177 ? -12.730 -26.833 15.357  1.00 45.50 ? 1435 THR A CA  1 
ATOM   1380 C C   . THR A 1 177 ? -11.770 -25.893 14.618  1.00 44.04 ? 1435 THR A C   1 
ATOM   1381 O O   . THR A 1 177 ? -10.670 -26.302 14.231  1.00 44.66 ? 1435 THR A O   1 
ATOM   1382 C CB  . THR A 1 177 ? -13.627 -27.557 14.324  1.00 45.96 ? 1435 THR A CB  1 
ATOM   1383 O OG1 . THR A 1 177 ? -14.486 -26.602 13.689  1.00 44.93 ? 1435 THR A OG1 1 
ATOM   1384 C CG2 . THR A 1 177 ? -14.474 -28.637 14.991  1.00 48.71 ? 1435 THR A CG2 1 
ATOM   1385 N N   . HIS A 1 178 ? -12.187 -24.639 14.439  1.00 42.56 ? 1436 HIS A N   1 
ATOM   1386 C CA  . HIS A 1 178 ? -11.413 -23.640 13.689  1.00 41.45 ? 1436 HIS A CA  1 
ATOM   1387 C C   . HIS A 1 178 ? -11.332 -22.307 14.422  1.00 40.67 ? 1436 HIS A C   1 
ATOM   1388 O O   . HIS A 1 178 ? -12.280 -21.872 15.051  1.00 40.78 ? 1436 HIS A O   1 
ATOM   1389 C CB  . HIS A 1 178 ? -12.049 -23.366 12.322  1.00 40.54 ? 1436 HIS A CB  1 
ATOM   1390 C CG  . HIS A 1 178 ? -12.101 -24.556 11.418  1.00 42.09 ? 1436 HIS A CG  1 
ATOM   1391 N ND1 . HIS A 1 178 ? -13.036 -25.559 11.562  1.00 45.26 ? 1436 HIS A ND1 1 
ATOM   1392 C CD2 . HIS A 1 178 ? -11.356 -24.887 10.337  1.00 41.58 ? 1436 HIS A CD2 1 
ATOM   1393 C CE1 . HIS A 1 178 ? -12.844 -26.471 10.623  1.00 46.20 ? 1436 HIS A CE1 1 
ATOM   1394 N NE2 . HIS A 1 178 ? -11.836 -26.081 9.862   1.00 44.01 ? 1436 HIS A NE2 1 
ATOM   1395 N N   . LEU A 1 179 ? -10.187 -21.657 14.323  1.00 40.43 ? 1437 LEU A N   1 
ATOM   1396 C CA  . LEU A 1 179 ? -10.032 -20.295 14.801  1.00 39.80 ? 1437 LEU A CA  1 
ATOM   1397 C C   . LEU A 1 179 ? -9.411  -19.543 13.630  1.00 39.18 ? 1437 LEU A C   1 
ATOM   1398 O O   . LEU A 1 179 ? -8.353  -19.930 13.141  1.00 40.39 ? 1437 LEU A O   1 
ATOM   1399 C CB  . LEU A 1 179 ? -9.142  -20.248 16.045  1.00 40.15 ? 1437 LEU A CB  1 
ATOM   1400 C CG  . LEU A 1 179 ? -8.937  -18.915 16.778  1.00 42.16 ? 1437 LEU A CG  1 
ATOM   1401 C CD1 . LEU A 1 179 ? -8.437  -19.155 18.202  1.00 42.35 ? 1437 LEU A CD1 1 
ATOM   1402 C CD2 . LEU A 1 179 ? -7.984  -17.967 16.032  1.00 42.52 ? 1437 LEU A CD2 1 
ATOM   1403 N N   . PHE A 1 180 ? -10.103 -18.514 13.148  1.00 38.03 ? 1438 PHE A N   1 
ATOM   1404 C CA  . PHE A 1 180 ? -9.632  -17.719 12.023  1.00 37.09 ? 1438 PHE A CA  1 
ATOM   1405 C C   . PHE A 1 180 ? -9.239  -16.329 12.483  1.00 37.46 ? 1438 PHE A C   1 
ATOM   1406 O O   . PHE A 1 180 ? -9.908  -15.730 13.330  1.00 37.19 ? 1438 PHE A O   1 
ATOM   1407 C CB  . PHE A 1 180 ? -10.715 -17.592 10.935  1.00 35.97 ? 1438 PHE A CB  1 
ATOM   1408 C CG  . PHE A 1 180 ? -11.097 -18.892 10.298  1.00 35.88 ? 1438 PHE A CG  1 
ATOM   1409 C CD1 . PHE A 1 180 ? -10.270 -19.488 9.354   1.00 34.44 ? 1438 PHE A CD1 1 
ATOM   1410 C CD2 . PHE A 1 180 ? -12.305 -19.506 10.618  1.00 34.41 ? 1438 PHE A CD2 1 
ATOM   1411 C CE1 . PHE A 1 180 ? -10.614 -20.693 8.768   1.00 35.25 ? 1438 PHE A CE1 1 
ATOM   1412 C CE2 . PHE A 1 180 ? -12.676 -20.695 10.031  1.00 33.48 ? 1438 PHE A CE2 1 
ATOM   1413 C CZ  . PHE A 1 180 ? -11.826 -21.303 9.097   1.00 35.12 ? 1438 PHE A CZ  1 
ATOM   1414 N N   . SER A 1 181 ? -8.169  -15.813 11.896  1.00 38.43 ? 1439 SER A N   1 
ATOM   1415 C CA  . SER A 1 181 ? -7.709  -14.460 12.163  1.00 40.27 ? 1439 SER A CA  1 
ATOM   1416 C C   . SER A 1 181 ? -7.151  -13.815 10.897  1.00 42.11 ? 1439 SER A C   1 
ATOM   1417 O O   . SER A 1 181 ? -6.609  -14.498 10.020  1.00 41.99 ? 1439 SER A O   1 
ATOM   1418 C CB  . SER A 1 181 ? -6.640  -14.460 13.257  1.00 40.59 ? 1439 SER A CB  1 
ATOM   1419 O OG  . SER A 1 181 ? -6.265  -13.141 13.597  1.00 40.18 ? 1439 SER A OG  1 
ATOM   1420 N N   . ASP A 1 182 ? -7.267  -12.495 10.817  1.00 44.49 ? 1440 ASP A N   1 
ATOM   1421 C CA  . ASP A 1 182 ? -6.591  -11.755 9.760   1.00 47.49 ? 1440 ASP A CA  1 
ATOM   1422 C C   . ASP A 1 182 ? -5.723  -10.634 10.324  1.00 50.20 ? 1440 ASP A C   1 
ATOM   1423 O O   . ASP A 1 182 ? -5.390  -9.683  9.628   1.00 51.62 ? 1440 ASP A O   1 
ATOM   1424 C CB  . ASP A 1 182 ? -7.591  -11.266 8.692   1.00 46.99 ? 1440 ASP A CB  1 
ATOM   1425 C CG  . ASP A 1 182 ? -8.581  -10.190 9.198   1.00 48.21 ? 1440 ASP A CG  1 
ATOM   1426 O OD1 . ASP A 1 182 ? -9.431  -9.778  8.374   1.00 49.33 ? 1440 ASP A OD1 1 
ATOM   1427 O OD2 . ASP A 1 182 ? -8.535  -9.735  10.365  1.00 49.11 ? 1440 ASP A OD2 1 
ATOM   1428 N N   . LEU A 1 183 ? -5.333  -10.760 11.588  1.00 52.42 ? 1441 LEU A N   1 
ATOM   1429 C CA  . LEU A 1 183 ? -4.676  -9.643  12.279  1.00 55.29 ? 1441 LEU A CA  1 
ATOM   1430 C C   . LEU A 1 183 ? -3.157  -9.771  12.408  1.00 57.15 ? 1441 LEU A C   1 
ATOM   1431 O O   . LEU A 1 183 ? -2.651  -10.702 13.038  1.00 57.66 ? 1441 LEU A O   1 
ATOM   1432 C CB  . LEU A 1 183 ? -5.341  -9.396  13.641  1.00 55.58 ? 1441 LEU A CB  1 
ATOM   1433 C CG  . LEU A 1 183 ? -6.722  -8.717  13.561  1.00 56.14 ? 1441 LEU A CG  1 
ATOM   1434 C CD1 . LEU A 1 183 ? -7.586  -9.083  14.766  1.00 57.09 ? 1441 LEU A CD1 1 
ATOM   1435 C CD2 . LEU A 1 183 ? -6.612  -7.189  13.409  1.00 56.91 ? 1441 LEU A CD2 1 
ATOM   1436 N N   . GLY A 1 192 ? -5.770  -9.838  22.120  1.00 63.14 ? 1450 GLY A N   1 
ATOM   1437 C CA  . GLY A 1 192 ? -6.365  -10.369 23.346  1.00 63.40 ? 1450 GLY A CA  1 
ATOM   1438 C C   . GLY A 1 192 ? -6.788  -11.826 23.201  1.00 61.45 ? 1450 GLY A C   1 
ATOM   1439 O O   . GLY A 1 192 ? -7.470  -12.381 24.068  1.00 62.18 ? 1450 GLY A O   1 
ATOM   1440 N N   . VAL A 1 193 ? -6.391  -12.456 22.102  1.00 58.94 ? 1451 VAL A N   1 
ATOM   1441 C CA  . VAL A 1 193 ? -6.755  -13.849 21.886  1.00 56.46 ? 1451 VAL A CA  1 
ATOM   1442 C C   . VAL A 1 193 ? -5.528  -14.740 22.077  1.00 55.21 ? 1451 VAL A C   1 
ATOM   1443 O O   . VAL A 1 193 ? -4.478  -14.510 21.466  1.00 55.24 ? 1451 VAL A O   1 
ATOM   1444 C CB  . VAL A 1 193 ? -7.418  -14.057 20.506  1.00 55.22 ? 1451 VAL A CB  1 
ATOM   1445 C CG1 . VAL A 1 193 ? -6.412  -13.820 19.392  1.00 56.09 ? 1451 VAL A CG1 1 
ATOM   1446 C CG2 . VAL A 1 193 ? -8.033  -15.441 20.394  1.00 53.96 ? 1451 VAL A CG2 1 
ATOM   1447 N N   . ASN A 1 194 ? -5.661  -15.741 22.942  1.00 53.41 ? 1452 ASN A N   1 
ATOM   1448 C CA  . ASN A 1 194 ? -4.559  -16.663 23.182  1.00 51.76 ? 1452 ASN A CA  1 
ATOM   1449 C C   . ASN A 1 194 ? -4.531  -17.793 22.151  1.00 49.99 ? 1452 ASN A C   1 
ATOM   1450 O O   . ASN A 1 194 ? -5.005  -18.911 22.405  1.00 49.77 ? 1452 ASN A O   1 
ATOM   1451 C CB  . ASN A 1 194 ? -4.594  -17.206 24.615  1.00 52.24 ? 1452 ASN A CB  1 
ATOM   1452 C CG  . ASN A 1 194 ? -3.247  -17.745 25.064  1.00 50.41 ? 1452 ASN A CG  1 
ATOM   1453 O OD1 . ASN A 1 194 ? -2.439  -18.189 24.246  1.00 44.79 ? 1452 ASN A OD1 1 
ATOM   1454 N ND2 . ASN A 1 194 ? -2.998  -17.707 26.375  1.00 48.99 ? 1452 ASN A ND2 1 
ATOM   1455 N N   . ILE A 1 195 ? -3.957  -17.480 20.994  1.00 48.48 ? 1453 ILE A N   1 
ATOM   1456 C CA  . ILE A 1 195 ? -3.913  -18.377 19.840  1.00 46.63 ? 1453 ILE A CA  1 
ATOM   1457 C C   . ILE A 1 195 ? -3.125  -19.657 20.080  1.00 45.89 ? 1453 ILE A C   1 
ATOM   1458 O O   . ILE A 1 195 ? -3.541  -20.731 19.637  1.00 45.30 ? 1453 ILE A O   1 
ATOM   1459 C CB  . ILE A 1 195 ? -3.244  -17.694 18.617  1.00 46.52 ? 1453 ILE A CB  1 
ATOM   1460 C CG1 . ILE A 1 195 ? -3.831  -16.295 18.352  1.00 48.14 ? 1453 ILE A CG1 1 
ATOM   1461 C CG2 . ILE A 1 195 ? -3.288  -18.619 17.392  1.00 45.25 ? 1453 ILE A CG2 1 
ATOM   1462 C CD1 . ILE A 1 195 ? -5.032  -16.238 17.407  1.00 48.11 ? 1453 ILE A CD1 1 
ATOM   1463 N N   . ALA A 1 196 ? -1.966  -19.526 20.721  1.00 45.55 ? 1454 ALA A N   1 
ATOM   1464 C CA  . ALA A 1 196 ? -1.070  -20.658 20.954  1.00 45.66 ? 1454 ALA A CA  1 
ATOM   1465 C C   . ALA A 1 196 ? -1.754  -21.700 21.847  1.00 45.22 ? 1454 ALA A C   1 
ATOM   1466 O O   . ALA A 1 196 ? -1.523  -22.901 21.725  1.00 45.16 ? 1454 ALA A O   1 
ATOM   1467 C CB  . ALA A 1 196 ? 0.226   -20.179 21.590  1.00 46.36 ? 1454 ALA A CB  1 
ATOM   1468 N N   . GLU A 1 197 ? -2.596  -21.204 22.746  1.00 44.85 ? 1455 GLU A N   1 
ATOM   1469 C CA  . GLU A 1 197 ? -3.382  -22.022 23.662  1.00 44.94 ? 1455 GLU A CA  1 
ATOM   1470 C C   . GLU A 1 197 ? -4.391  -22.869 22.858  1.00 43.62 ? 1455 GLU A C   1 
ATOM   1471 O O   . GLU A 1 197 ? -4.524  -24.078 23.072  1.00 44.31 ? 1455 GLU A O   1 
ATOM   1472 C CB  . GLU A 1 197 ? -4.041  -21.079 24.680  1.00 45.08 ? 1455 GLU A CB  1 
ATOM   1473 C CG  . GLU A 1 197 ? -4.689  -21.695 25.884  1.00 47.82 ? 1455 GLU A CG  1 
ATOM   1474 C CD  . GLU A 1 197 ? -3.761  -22.478 26.793  1.00 47.87 ? 1455 GLU A CD  1 
ATOM   1475 O OE1 . GLU A 1 197 ? -2.664  -22.010 27.183  1.00 50.05 ? 1455 GLU A OE1 1 
ATOM   1476 O OE2 . GLU A 1 197 ? -4.180  -23.577 27.171  1.00 49.52 ? 1455 GLU A OE2 1 
ATOM   1477 N N   . ALA A 1 198 ? -5.055  -22.244 21.893  1.00 42.29 ? 1456 ALA A N   1 
ATOM   1478 C CA  . ALA A 1 198 ? -5.959  -22.967 21.007  1.00 41.81 ? 1456 ALA A CA  1 
ATOM   1479 C C   . ALA A 1 198 ? -5.203  -24.008 20.179  1.00 41.96 ? 1456 ALA A C   1 
ATOM   1480 O O   . ALA A 1 198 ? -5.631  -25.160 20.095  1.00 43.13 ? 1456 ALA A O   1 
ATOM   1481 C CB  . ALA A 1 198 ? -6.706  -22.000 20.106  1.00 40.51 ? 1456 ALA A CB  1 
ATOM   1482 N N   . ALA A 1 199 ? -4.073  -23.606 19.599  1.00 41.11 ? 1457 ALA A N   1 
ATOM   1483 C CA  . ALA A 1 199 ? -3.233  -24.496 18.806  1.00 41.85 ? 1457 ALA A CA  1 
ATOM   1484 C C   . ALA A 1 199 ? -2.750  -25.692 19.627  1.00 43.04 ? 1457 ALA A C   1 
ATOM   1485 O O   . ALA A 1 199 ? -2.709  -26.814 19.121  1.00 43.42 ? 1457 ALA A O   1 
ATOM   1486 C CB  . ALA A 1 199 ? -2.042  -23.741 18.242  1.00 41.79 ? 1457 ALA A CB  1 
ATOM   1487 N N   . ALA A 1 200 ? -2.397  -25.446 20.890  1.00 43.53 ? 1458 ALA A N   1 
ATOM   1488 C CA  . ALA A 1 200 ? -1.954  -26.515 21.779  1.00 45.28 ? 1458 ALA A CA  1 
ATOM   1489 C C   . ALA A 1 200 ? -3.055  -27.572 21.965  1.00 45.52 ? 1458 ALA A C   1 
ATOM   1490 O O   . ALA A 1 200 ? -2.766  -28.703 22.305  1.00 46.14 ? 1458 ALA A O   1 
ATOM   1491 C CB  . ALA A 1 200 ? -1.494  -25.940 23.127  1.00 45.58 ? 1458 ALA A CB  1 
ATOM   1492 N N   . GLN A 1 201 ? -4.303  -27.194 21.689  1.00 45.31 ? 1459 GLN A N   1 
ATOM   1493 C CA  . GLN A 1 201 ? -5.452  -28.105 21.779  1.00 46.76 ? 1459 GLN A CA  1 
ATOM   1494 C C   . GLN A 1 201 ? -5.917  -28.629 20.426  1.00 46.44 ? 1459 GLN A C   1 
ATOM   1495 O O   . GLN A 1 201 ? -7.013  -29.195 20.332  1.00 46.81 ? 1459 GLN A O   1 
ATOM   1496 C CB  . GLN A 1 201 ? -6.655  -27.395 22.399  1.00 46.26 ? 1459 GLN A CB  1 
ATOM   1497 C CG  . GLN A 1 201 ? -6.610  -27.230 23.864  1.00 47.63 ? 1459 GLN A CG  1 
ATOM   1498 C CD  . GLN A 1 201 ? -7.882  -26.585 24.402  1.00 47.66 ? 1459 GLN A CD  1 
ATOM   1499 O OE1 . GLN A 1 201 ? -7.817  -25.772 25.319  1.00 49.76 ? 1459 GLN A OE1 1 
ATOM   1500 N NE2 . GLN A 1 201 ? -9.041  -26.958 23.845  1.00 43.44 ? 1459 GLN A NE2 1 
ATOM   1501 N N   . ASN A 1 202 ? -5.106  -28.419 19.391  1.00 46.32 ? 1460 ASN A N   1 
ATOM   1502 C CA  . ASN A 1 202 ? -5.400  -28.908 18.036  1.00 46.43 ? 1460 ASN A CA  1 
ATOM   1503 C C   . ASN A 1 202 ? -6.609  -28.279 17.335  1.00 44.74 ? 1460 ASN A C   1 
ATOM   1504 O O   . ASN A 1 202 ? -7.207  -28.894 16.451  1.00 45.28 ? 1460 ASN A O   1 
ATOM   1505 C CB  . ASN A 1 202 ? -5.476  -30.439 18.021  1.00 48.15 ? 1460 ASN A CB  1 
ATOM   1506 C CG  . ASN A 1 202 ? -4.178  -31.064 18.420  1.00 50.89 ? 1460 ASN A CG  1 
ATOM   1507 O OD1 . ASN A 1 202 ? -3.132  -30.700 17.891  1.00 51.72 ? 1460 ASN A OD1 1 
ATOM   1508 N ND2 . ASN A 1 202 ? -4.221  -31.984 19.384  1.00 52.19 ? 1460 ASN A ND2 1 
ATOM   1509 N N   . VAL A 1 203 ? -6.967  -27.065 17.747  1.00 43.10 ? 1461 VAL A N   1 
ATOM   1510 C CA  . VAL A 1 203 ? -7.885  -26.216 16.994  1.00 41.56 ? 1461 VAL A CA  1 
ATOM   1511 C C   . VAL A 1 203 ? -7.120  -25.766 15.739  1.00 41.27 ? 1461 VAL A C   1 
ATOM   1512 O O   . VAL A 1 203 ? -5.938  -25.446 15.830  1.00 40.85 ? 1461 VAL A O   1 
ATOM   1513 C CB  . VAL A 1 203 ? -8.336  -24.980 17.852  1.00 40.96 ? 1461 VAL A CB  1 
ATOM   1514 C CG1 . VAL A 1 203 ? -9.183  -23.998 17.030  1.00 37.90 ? 1461 VAL A CG1 1 
ATOM   1515 C CG2 . VAL A 1 203 ? -9.098  -25.436 19.121  1.00 40.71 ? 1461 VAL A CG2 1 
ATOM   1516 N N   . TYR A 1 204 ? -7.763  -25.789 14.569  1.00 41.55 ? 1462 TYR A N   1 
ATOM   1517 C CA  . TYR A 1 204 ? -7.133  -25.239 13.351  1.00 41.24 ? 1462 TYR A CA  1 
ATOM   1518 C C   . TYR A 1 204 ? -7.054  -23.725 13.471  1.00 39.82 ? 1462 TYR A C   1 
ATOM   1519 O O   . TYR A 1 204 ? -8.081  -23.043 13.461  1.00 39.32 ? 1462 TYR A O   1 
ATOM   1520 C CB  . TYR A 1 204 ? -7.898  -25.610 12.073  1.00 41.41 ? 1462 TYR A CB  1 
ATOM   1521 C CG  . TYR A 1 204 ? -7.913  -27.097 11.776  1.00 44.71 ? 1462 TYR A CG  1 
ATOM   1522 C CD1 . TYR A 1 204 ? -6.727  -27.802 11.574  1.00 47.81 ? 1462 TYR A CD1 1 
ATOM   1523 C CD2 . TYR A 1 204 ? -9.121  -27.798 11.702  1.00 47.54 ? 1462 TYR A CD2 1 
ATOM   1524 C CE1 . TYR A 1 204 ? -6.738  -29.175 11.316  1.00 51.62 ? 1462 TYR A CE1 1 
ATOM   1525 C CE2 . TYR A 1 204 ? -9.149  -29.169 11.439  1.00 50.06 ? 1462 TYR A CE2 1 
ATOM   1526 C CZ  . TYR A 1 204 ? -7.954  -29.846 11.247  1.00 52.62 ? 1462 TYR A CZ  1 
ATOM   1527 O OH  . TYR A 1 204 ? -7.969  -31.194 10.990  1.00 57.20 ? 1462 TYR A OH  1 
ATOM   1528 N N   . CYS A 1 205 ? -5.835  -23.218 13.629  1.00 39.47 ? 1463 CYS A N   1 
ATOM   1529 C CA  . CYS A 1 205 ? -5.608  -21.790 13.794  1.00 39.44 ? 1463 CYS A CA  1 
ATOM   1530 C C   . CYS A 1 205 ? -5.099  -21.233 12.474  1.00 38.63 ? 1463 CYS A C   1 
ATOM   1531 O O   . CYS A 1 205 ? -3.921  -21.359 12.176  1.00 38.35 ? 1463 CYS A O   1 
ATOM   1532 C CB  . CYS A 1 205 ? -4.599  -21.521 14.912  1.00 40.34 ? 1463 CYS A CB  1 
ATOM   1533 S SG  . CYS A 1 205 ? -5.151  -22.047 16.558  1.00 42.52 ? 1463 CYS A SG  1 
ATOM   1534 N N   . LEU A 1 206 ? -6.000  -20.591 11.729  1.00 37.19 ? 1464 LEU A N   1 
ATOM   1535 C CA  . LEU A 1 206 ? -5.819  -20.328 10.301  1.00 37.51 ? 1464 LEU A CA  1 
ATOM   1536 C C   . LEU A 1 206 ? -6.113  -18.893 9.882   1.00 36.74 ? 1464 LEU A C   1 
ATOM   1537 O O   . LEU A 1 206 ? -6.965  -18.213 10.479  1.00 35.22 ? 1464 LEU A O   1 
ATOM   1538 C CB  . LEU A 1 206 ? -6.716  -21.277 9.478   1.00 36.99 ? 1464 LEU A CB  1 
ATOM   1539 C CG  . LEU A 1 206 ? -6.645  -22.782 9.773   1.00 38.44 ? 1464 LEU A CG  1 
ATOM   1540 C CD1 . LEU A 1 206 ? -7.641  -23.545 8.896   1.00 37.24 ? 1464 LEU A CD1 1 
ATOM   1541 C CD2 . LEU A 1 206 ? -5.226  -23.352 9.599   1.00 38.36 ? 1464 LEU A CD2 1 
ATOM   1542 N N   . ARG A 1 207 ? -5.402  -18.445 8.850   1.00 37.35 ? 1465 ARG A N   1 
ATOM   1543 C CA  . ARG A 1 207 ? -5.670  -17.165 8.185   1.00 37.80 ? 1465 ARG A CA  1 
ATOM   1544 C C   . ARG A 1 207 ? -7.064  -17.204 7.558   1.00 36.20 ? 1465 ARG A C   1 
ATOM   1545 O O   . ARG A 1 207 ? -7.496  -18.261 7.091   1.00 35.82 ? 1465 ARG A O   1 
ATOM   1546 C CB  . ARG A 1 207 ? -4.637  -16.927 7.079   1.00 39.60 ? 1465 ARG A CB  1 
ATOM   1547 C CG  . ARG A 1 207 ? -3.394  -16.196 7.546   1.00 43.40 ? 1465 ARG A CG  1 
ATOM   1548 C CD  . ARG A 1 207 ? -2.240  -16.292 6.545   1.00 49.87 ? 1465 ARG A CD  1 
ATOM   1549 N NE  . ARG A 1 207 ? -2.629  -16.616 5.165   1.00 53.45 ? 1465 ARG A NE  1 
ATOM   1550 C CZ  . ARG A 1 207 ? -2.121  -17.624 4.448   1.00 56.12 ? 1465 ARG A CZ  1 
ATOM   1551 N NH1 . ARG A 1 207 ? -1.199  -18.432 4.953   1.00 58.19 ? 1465 ARG A NH1 1 
ATOM   1552 N NH2 . ARG A 1 207 ? -2.524  -17.819 3.203   1.00 58.72 ? 1465 ARG A NH2 1 
ATOM   1553 N N   . THR A 1 208 ? -7.755  -16.066 7.526   1.00 35.43 ? 1466 THR A N   1 
ATOM   1554 C CA  . THR A 1 208 ? -9.101  -16.007 6.898   1.00 34.62 ? 1466 THR A CA  1 
ATOM   1555 C C   . THR A 1 208 ? -9.178  -16.453 5.431   1.00 35.19 ? 1466 THR A C   1 
ATOM   1556 O O   . THR A 1 208 ? -10.253 -16.846 4.965   1.00 35.52 ? 1466 THR A O   1 
ATOM   1557 C CB  . THR A 1 208 ? -9.740  -14.621 6.981   1.00 33.61 ? 1466 THR A CB  1 
ATOM   1558 O OG1 . THR A 1 208 ? -8.796  -13.630 6.574   1.00 33.73 ? 1466 THR A OG1 1 
ATOM   1559 C CG2 . THR A 1 208 ? -10.225 -14.323 8.392   1.00 33.20 ? 1466 THR A CG2 1 
ATOM   1560 N N   . GLU A 1 209 ? -8.054  -16.388 4.726   1.00 36.11 ? 1467 GLU A N   1 
ATOM   1561 C CA  . GLU A 1 209 ? -7.960  -16.779 3.322   1.00 37.65 ? 1467 GLU A CA  1 
ATOM   1562 C C   . GLU A 1 209 ? -8.381  -18.215 3.085   1.00 37.68 ? 1467 GLU A C   1 
ATOM   1563 O O   . GLU A 1 209 ? -8.861  -18.552 1.999   1.00 37.76 ? 1467 GLU A O   1 
ATOM   1564 C CB  . GLU A 1 209 ? -6.532  -16.589 2.807   1.00 39.65 ? 1467 GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 209 ? -6.172  -15.129 2.449   1.00 43.01 ? 1467 GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 209 ? -5.755  -14.270 3.659   1.00 46.84 ? 1467 GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 209 ? -5.764  -14.767 4.817   1.00 45.43 ? 1467 GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 209 ? -5.425  -13.075 3.437   1.00 48.50 ? 1467 GLU A OE2 1 
ATOM   1569 N N   . TYR A 1 210 ? -8.178  -19.063 4.094   1.00 37.37 ? 1468 TYR A N   1 
ATOM   1570 C CA  . TYR A 1 210 ? -8.619  -20.433 4.018   1.00 37.23 ? 1468 TYR A CA  1 
ATOM   1571 C C   . TYR A 1 210 ? -10.121 -20.522 3.728   1.00 36.91 ? 1468 TYR A C   1 
ATOM   1572 O O   . TYR A 1 210 ? -10.559 -21.436 3.027   1.00 37.82 ? 1468 TYR A O   1 
ATOM   1573 C CB  . TYR A 1 210 ? -8.261  -21.181 5.307   1.00 37.47 ? 1468 TYR A CB  1 
ATOM   1574 C CG  . TYR A 1 210 ? -8.677  -22.649 5.328   1.00 38.05 ? 1468 TYR A CG  1 
ATOM   1575 C CD1 . TYR A 1 210 ? -7.931  -23.619 4.660   1.00 41.06 ? 1468 TYR A CD1 1 
ATOM   1576 C CD2 . TYR A 1 210 ? -9.815  -23.059 6.017   1.00 39.76 ? 1468 TYR A CD2 1 
ATOM   1577 C CE1 . TYR A 1 210 ? -8.303  -24.972 4.671   1.00 42.44 ? 1468 TYR A CE1 1 
ATOM   1578 C CE2 . TYR A 1 210 ? -10.199 -24.410 6.046   1.00 41.97 ? 1468 TYR A CE2 1 
ATOM   1579 C CZ  . TYR A 1 210 ? -9.436  -25.355 5.367   1.00 43.88 ? 1468 TYR A CZ  1 
ATOM   1580 O OH  . TYR A 1 210 ? -9.808  -26.679 5.403   1.00 45.70 ? 1468 TYR A OH  1 
ATOM   1581 N N   . ILE A 1 211 ? -10.911 -19.601 4.278   1.00 36.13 ? 1469 ILE A N   1 
ATOM   1582 C CA  . ILE A 1 211 ? -12.365 -19.693 4.131   1.00 35.70 ? 1469 ILE A CA  1 
ATOM   1583 C C   . ILE A 1 211 ? -12.727 -19.608 2.654   1.00 36.13 ? 1469 ILE A C   1 
ATOM   1584 O O   . ILE A 1 211 ? -13.407 -20.497 2.136   1.00 36.91 ? 1469 ILE A O   1 
ATOM   1585 C CB  . ILE A 1 211 ? -13.111 -18.659 4.987   1.00 35.02 ? 1469 ILE A CB  1 
ATOM   1586 C CG1 . ILE A 1 211 ? -12.873 -18.957 6.475   1.00 34.02 ? 1469 ILE A CG1 1 
ATOM   1587 C CG2 . ILE A 1 211 ? -14.616 -18.637 4.643   1.00 35.81 ? 1469 ILE A CG2 1 
ATOM   1588 C CD1 . ILE A 1 211 ? -13.165 -17.794 7.376   1.00 32.73 ? 1469 ILE A CD1 1 
ATOM   1589 N N   . ALA A 1 212 ? -12.217 -18.579 1.984   1.00 35.83 ? 1470 ALA A N   1 
ATOM   1590 C CA  . ALA A 1 212 ? -12.458 -18.361 0.555   1.00 36.97 ? 1470 ALA A CA  1 
ATOM   1591 C C   . ALA A 1 212 ? -11.838 -19.439 -0.361  1.00 38.63 ? 1470 ALA A C   1 
ATOM   1592 O O   . ALA A 1 212 ? -12.477 -19.894 -1.307  1.00 38.97 ? 1470 ALA A O   1 
ATOM   1593 C CB  . ALA A 1 212 ? -11.971 -16.966 0.155   1.00 35.90 ? 1470 ALA A CB  1 
ATOM   1594 N N   . ASP A 1 213 ? -10.594 -19.834 -0.091  1.00 39.75 ? 1471 ASP A N   1 
ATOM   1595 C CA  . ASP A 1 213 ? -9.934  -20.879 -0.880  1.00 42.32 ? 1471 ASP A CA  1 
ATOM   1596 C C   . ASP A 1 213 ? -10.613 -22.231 -0.688  1.00 43.59 ? 1471 ASP A C   1 
ATOM   1597 O O   . ASP A 1 213 ? -10.673 -23.042 -1.619  1.00 44.20 ? 1471 ASP A O   1 
ATOM   1598 C CB  . ASP A 1 213 ? -8.464  -20.992 -0.499  1.00 43.18 ? 1471 ASP A CB  1 
ATOM   1599 C CG  . ASP A 1 213 ? -7.662  -19.778 -0.920  1.00 44.69 ? 1471 ASP A CG  1 
ATOM   1600 O OD1 . ASP A 1 213 ? -8.248  -18.865 -1.560  1.00 43.30 ? 1471 ASP A OD1 1 
ATOM   1601 O OD2 . ASP A 1 213 ? -6.449  -19.749 -0.613  1.00 42.91 ? 1471 ASP A OD2 1 
ATOM   1602 N N   . TYR A 1 214 ? -11.138 -22.458 0.515   1.00 43.38 ? 1472 TYR A N   1 
ATOM   1603 C CA  . TYR A 1 214 ? -11.913 -23.662 0.777   1.00 45.64 ? 1472 TYR A CA  1 
ATOM   1604 C C   . TYR A 1 214 ? -13.131 -23.755 -0.146  1.00 46.58 ? 1472 TYR A C   1 
ATOM   1605 O O   . TYR A 1 214 ? -13.478 -24.838 -0.604  1.00 47.53 ? 1472 TYR A O   1 
ATOM   1606 C CB  . TYR A 1 214 ? -12.344 -23.727 2.236   1.00 44.89 ? 1472 TYR A CB  1 
ATOM   1607 C CG  . TYR A 1 214 ? -13.022 -25.011 2.600   1.00 46.51 ? 1472 TYR A CG  1 
ATOM   1608 C CD1 . TYR A 1 214 ? -12.270 -26.121 2.962   1.00 48.44 ? 1472 TYR A CD1 1 
ATOM   1609 C CD2 . TYR A 1 214 ? -14.414 -25.124 2.584   1.00 46.94 ? 1472 TYR A CD2 1 
ATOM   1610 C CE1 . TYR A 1 214 ? -12.867 -27.307 3.298   1.00 51.18 ? 1472 TYR A CE1 1 
ATOM   1611 C CE2 . TYR A 1 214 ? -15.027 -26.334 2.921   1.00 50.43 ? 1472 TYR A CE2 1 
ATOM   1612 C CZ  . TYR A 1 214 ? -14.236 -27.413 3.272   1.00 51.53 ? 1472 TYR A CZ  1 
ATOM   1613 O OH  . TYR A 1 214 ? -14.789 -28.621 3.612   1.00 56.76 ? 1472 TYR A OH  1 
ATOM   1614 N N   . LEU A 1 215 ? -13.759 -22.617 -0.426  1.00 46.88 ? 1473 LEU A N   1 
ATOM   1615 C CA  . LEU A 1 215 ? -14.876 -22.561 -1.371  1.00 48.62 ? 1473 LEU A CA  1 
ATOM   1616 C C   . LEU A 1 215 ? -14.453 -22.527 -2.843  1.00 50.65 ? 1473 LEU A C   1 
ATOM   1617 O O   . LEU A 1 215 ? -15.104 -23.141 -3.686  1.00 51.91 ? 1473 LEU A O   1 
ATOM   1618 C CB  . LEU A 1 215 ? -15.747 -21.331 -1.097  1.00 46.61 ? 1473 LEU A CB  1 
ATOM   1619 C CG  . LEU A 1 215 ? -16.655 -21.239 0.125   1.00 45.91 ? 1473 LEU A CG  1 
ATOM   1620 C CD1 . LEU A 1 215 ? -17.257 -19.836 0.181   1.00 44.00 ? 1473 LEU A CD1 1 
ATOM   1621 C CD2 . LEU A 1 215 ? -17.754 -22.286 0.096   1.00 44.71 ? 1473 LEU A CD2 1 
ATOM   1622 N N   . MET A 1 216 ? -13.375 -21.802 -3.132  1.00 51.85 ? 1474 MET A N   1 
ATOM   1623 C CA  A MET A 1 216 ? -12.910 -21.529 -4.496  0.50 53.75 ? 1474 MET A CA  1 
ATOM   1624 C CA  B MET A 1 216 ? -12.959 -21.549 -4.514  0.50 53.63 ? 1474 MET A CA  1 
ATOM   1625 C C   . MET A 1 216 ? -12.281 -22.744 -5.180  1.00 56.50 ? 1474 MET A C   1 
ATOM   1626 O O   . MET A 1 216 ? -12.202 -22.817 -6.416  1.00 57.37 ? 1474 MET A O   1 
ATOM   1627 C CB  A MET A 1 216 ? -11.872 -20.403 -4.455  0.50 53.68 ? 1474 MET A CB  1 
ATOM   1628 C CB  B MET A 1 216 ? -12.047 -20.322 -4.583  0.50 53.35 ? 1474 MET A CB  1 
ATOM   1629 C CG  A MET A 1 216 ? -12.019 -19.368 -5.548  0.50 54.58 ? 1474 MET A CG  1 
ATOM   1630 C CG  B MET A 1 216 ? -12.767 -19.014 -4.296  0.50 52.13 ? 1474 MET A CG  1 
ATOM   1631 S SD  A MET A 1 216 ? -10.603 -18.259 -5.651  0.50 57.72 ? 1474 MET A SD  1 
ATOM   1632 S SD  B MET A 1 216 ? -11.644 -17.655 -3.936  0.50 52.27 ? 1474 MET A SD  1 
ATOM   1633 C CE  A MET A 1 216 ? -10.437 -17.763 -3.934  0.50 56.58 ? 1474 MET A CE  1 
ATOM   1634 C CE  B MET A 1 216 ? -10.855 -17.450 -5.532  0.50 54.66 ? 1474 MET A CE  1 
ATOM   1635 N N   . GLN A 1 217 ? -11.808 -23.686 -4.372  1.00 58.07 ? 1475 GLN A N   1 
ATOM   1636 C CA  . GLN A 1 217 ? -11.044 -24.807 -4.907  1.00 61.54 ? 1475 GLN A CA  1 
ATOM   1637 C C   . GLN A 1 217 ? -11.694 -26.169 -4.698  1.00 63.12 ? 1475 GLN A C   1 
ATOM   1638 O O   . GLN A 1 217 ? -12.083 -26.529 -3.581  1.00 62.28 ? 1475 GLN A O   1 
ATOM   1639 C CB  . GLN A 1 217 ? -9.630  -24.787 -4.333  1.00 62.30 ? 1475 GLN A CB  1 
ATOM   1640 C CG  . GLN A 1 217 ? -8.799  -23.608 -4.825  1.00 64.00 ? 1475 GLN A CG  1 
ATOM   1641 C CD  . GLN A 1 217 ? -7.524  -23.408 -4.036  1.00 66.70 ? 1475 GLN A CD  1 
ATOM   1642 O OE1 . GLN A 1 217 ? -7.106  -24.279 -3.273  1.00 68.66 ? 1475 GLN A OE1 1 
ATOM   1643 N NE2 . GLN A 1 217 ? -6.892  -22.257 -4.220  1.00 66.66 ? 1475 GLN A NE2 1 
ATOM   1644 N N   . GLU A 1 218 ? -11.816 -26.898 -5.806  1.00 66.28 ? 1476 GLU A N   1 
ATOM   1645 C CA  . GLU A 1 218 ? -12.144 -28.327 -5.824  1.00 69.01 ? 1476 GLU A CA  1 
ATOM   1646 C C   . GLU A 1 218 ? -11.348 -29.078 -4.755  1.00 70.00 ? 1476 GLU A C   1 
ATOM   1647 O O   . GLU A 1 218 ? -11.923 -29.701 -3.860  1.00 69.89 ? 1476 GLU A O   1 
ATOM   1648 C CB  . GLU A 1 218 ? -11.832 -28.909 -7.206  1.00 71.92 ? 1476 GLU A CB  1 
ATOM   1649 C CG  . GLU A 1 218 ? -12.956 -28.821 -8.234  1.00 73.30 ? 1476 GLU A CG  1 
ATOM   1650 C CD  . GLU A 1 218 ? -13.936 -29.989 -8.141  1.00 75.41 ? 1476 GLU A CD  1 
ATOM   1651 O OE1 . GLU A 1 218 ? -14.388 -30.299 -7.017  1.00 75.72 ? 1476 GLU A OE1 1 
ATOM   1652 O OE2 . GLU A 1 218 ? -14.267 -30.587 -9.185  1.00 75.19 ? 1476 GLU A OE2 1 
ATOM   1653 N N   . SER A 1 219 ? -10.024 -28.999 -4.852  1.00 71.39 ? 1477 SER A N   1 
ATOM   1654 C CA  . SER A 1 219 ? -9.132  -29.559 -3.842  1.00 72.59 ? 1477 SER A CA  1 
ATOM   1655 C C   . SER A 1 219 ? -8.288  -28.428 -3.276  1.00 71.01 ? 1477 SER A C   1 
ATOM   1656 O O   . SER A 1 219 ? -7.263  -28.069 -3.865  1.00 72.34 ? 1477 SER A O   1 
ATOM   1657 C CB  . SER A 1 219 ? -8.222  -30.633 -4.445  1.00 75.90 ? 1477 SER A CB  1 
ATOM   1658 O OG  . SER A 1 219 ? -8.958  -31.530 -5.255  1.00 78.79 ? 1477 SER A OG  1 
ATOM   1659 N N   . PRO A 1 220 ? -8.720  -27.851 -2.143  1.00 68.88 ? 1478 PRO A N   1 
ATOM   1660 C CA  . PRO A 1 220 ? -7.932  -26.784 -1.508  1.00 67.62 ? 1478 PRO A CA  1 
ATOM   1661 C C   . PRO A 1 220 ? -6.606  -27.317 -0.950  1.00 68.97 ? 1478 PRO A C   1 
ATOM   1662 O O   . PRO A 1 220 ? -6.519  -28.519 -0.649  1.00 70.31 ? 1478 PRO A O   1 
ATOM   1663 C CB  . PRO A 1 220 ? -8.840  -26.284 -0.373  1.00 65.32 ? 1478 PRO A CB  1 
ATOM   1664 C CG  . PRO A 1 220 ? -9.811  -27.392 -0.126  1.00 66.22 ? 1478 PRO A CG  1 
ATOM   1665 C CD  . PRO A 1 220 ? -9.986  -28.114 -1.436  1.00 67.80 ? 1478 PRO A CD  1 
ATOM   1666 N N   . PRO A 1 221 ? -5.575  -26.442 -0.822  1.00 68.23 ? 1479 PRO A N   1 
ATOM   1667 C CA  . PRO A 1 221 ? -4.331  -26.909 -0.202  1.00 68.71 ? 1479 PRO A CA  1 
ATOM   1668 C C   . PRO A 1 221 ? -4.556  -27.318 1.252   1.00 66.71 ? 1479 PRO A C   1 
ATOM   1669 O O   . PRO A 1 221 ? -5.591  -26.991 1.855   1.00 64.07 ? 1479 PRO A O   1 
ATOM   1670 C CB  . PRO A 1 221 ? -3.398  -25.689 -0.276  1.00 68.33 ? 1479 PRO A CB  1 
ATOM   1671 C CG  . PRO A 1 221 ? -4.010  -24.778 -1.283  1.00 68.27 ? 1479 PRO A CG  1 
ATOM   1672 C CD  . PRO A 1 221 ? -5.488  -25.020 -1.209  1.00 66.97 ? 1479 PRO A CD  1 
ATOM   1673 N N   . HIS A 1 222 ? -3.585  -28.052 1.785   1.00 67.54 ? 1480 HIS A N   1 
ATOM   1674 C CA  . HIS A 1 222 ? -3.596  -28.478 3.174   1.00 65.97 ? 1480 HIS A CA  1 
ATOM   1675 C C   . HIS A 1 222 ? -3.697  -27.277 4.123   1.00 62.47 ? 1480 HIS A C   1 
ATOM   1676 O O   . HIS A 1 222 ? -3.137  -26.209 3.852   1.00 61.86 ? 1480 HIS A O   1 
ATOM   1677 C CB  . HIS A 1 222 ? -2.332  -29.285 3.463   1.00 68.54 ? 1480 HIS A CB  1 
ATOM   1678 C CG  . HIS A 1 222 ? -2.457  -30.193 4.645   1.00 69.84 ? 1480 HIS A CG  1 
ATOM   1679 N ND1 . HIS A 1 222 ? -2.456  -31.567 4.530   1.00 73.04 ? 1480 HIS A ND1 1 
ATOM   1680 C CD2 . HIS A 1 222 ? -2.602  -29.924 5.965   1.00 68.59 ? 1480 HIS A CD2 1 
ATOM   1681 C CE1 . HIS A 1 222 ? -2.581  -32.105 5.731   1.00 74.17 ? 1480 HIS A CE1 1 
ATOM   1682 N NE2 . HIS A 1 222 ? -2.681  -31.128 6.618   1.00 71.79 ? 1480 HIS A NE2 1 
ATOM   1683 N N   . VAL A 1 223 ? -4.419  -27.464 5.223   1.00 59.94 ? 1481 VAL A N   1 
ATOM   1684 C CA  . VAL A 1 223 ? -4.585  -26.445 6.267   1.00 56.73 ? 1481 VAL A CA  1 
ATOM   1685 C C   . VAL A 1 223 ? -3.253  -25.922 6.813   1.00 55.89 ? 1481 VAL A C   1 
ATOM   1686 O O   . VAL A 1 223 ? -3.143  -24.761 7.197   1.00 54.25 ? 1481 VAL A O   1 
ATOM   1687 C CB  . VAL A 1 223 ? -5.459  -26.958 7.450   1.00 56.27 ? 1481 VAL A CB  1 
ATOM   1688 C CG1 . VAL A 1 223 ? -6.867  -27.299 6.974   1.00 56.27 ? 1481 VAL A CG1 1 
ATOM   1689 C CG2 . VAL A 1 223 ? -4.817  -28.169 8.132   1.00 57.47 ? 1481 VAL A CG2 1 
ATOM   1690 N N   . GLU A 1 224 ? -2.244  -26.786 6.838   1.00 56.63 ? 1482 GLU A N   1 
ATOM   1691 C CA  . GLU A 1 224 ? -0.894  -26.393 7.247   1.00 56.56 ? 1482 GLU A CA  1 
ATOM   1692 C C   . GLU A 1 224 ? -0.383  -25.170 6.477   1.00 55.33 ? 1482 GLU A C   1 
ATOM   1693 O O   . GLU A 1 224 ? 0.435   -24.412 6.989   1.00 55.41 ? 1482 GLU A O   1 
ATOM   1694 C CB  . GLU A 1 224 ? 0.081   -27.574 7.116   1.00 59.16 ? 1482 GLU A CB  1 
ATOM   1695 C CG  . GLU A 1 224 ? -0.217  -28.714 8.083   0.50 59.55 ? 1482 GLU A CG  1 
ATOM   1696 C CD  . GLU A 1 224 ? 0.726   -29.896 7.944   0.50 62.55 ? 1482 GLU A CD  1 
ATOM   1697 O OE1 . GLU A 1 224 ? 1.217   -30.167 6.825   0.50 64.38 ? 1482 GLU A OE1 1 
ATOM   1698 O OE2 . GLU A 1 224 ? 0.967   -30.567 8.967   0.50 63.12 ? 1482 GLU A OE2 1 
ATOM   1699 N N   . ASN A 1 225 ? -0.890  -24.964 5.265   1.00 54.12 ? 1483 ASN A N   1 
ATOM   1700 C CA  . ASN A 1 225 ? -0.487  -23.818 4.447   1.00 53.24 ? 1483 ASN A CA  1 
ATOM   1701 C C   . ASN A 1 225 ? -1.073  -22.476 4.923   1.00 50.53 ? 1483 ASN A C   1 
ATOM   1702 O O   . ASN A 1 225 ? -0.649  -21.417 4.466   1.00 50.17 ? 1483 ASN A O   1 
ATOM   1703 C CB  . ASN A 1 225 ? -0.817  -24.073 2.971   1.00 54.15 ? 1483 ASN A CB  1 
ATOM   1704 C CG  . ASN A 1 225 ? -0.022  -25.243 2.380   1.00 57.99 ? 1483 ASN A CG  1 
ATOM   1705 O OD1 . ASN A 1 225 ? -0.503  -25.949 1.494   1.00 60.63 ? 1483 ASN A OD1 1 
ATOM   1706 N ND2 . ASN A 1 225 ? 1.197   -25.445 2.867   1.00 58.82 ? 1483 ASN A ND2 1 
ATOM   1707 N N   . TYR A 1 226 ? -2.015  -22.529 5.866   1.00 47.51 ? 1484 TYR A N   1 
ATOM   1708 C CA  . TYR A 1 226 ? -2.737  -21.330 6.310   1.00 45.03 ? 1484 TYR A CA  1 
ATOM   1709 C C   . TYR A 1 226 ? -2.576  -21.052 7.802   1.00 44.17 ? 1484 TYR A C   1 
ATOM   1710 O O   . TYR A 1 226 ? -3.287  -20.218 8.357   1.00 42.94 ? 1484 TYR A O   1 
ATOM   1711 C CB  . TYR A 1 226 ? -4.226  -21.466 5.982   1.00 42.84 ? 1484 TYR A CB  1 
ATOM   1712 C CG  . TYR A 1 226 ? -4.520  -21.573 4.501   1.00 42.71 ? 1484 TYR A CG  1 
ATOM   1713 C CD1 . TYR A 1 226 ? -4.962  -20.464 3.783   1.00 39.60 ? 1484 TYR A CD1 1 
ATOM   1714 C CD2 . TYR A 1 226 ? -4.346  -22.782 3.819   1.00 41.77 ? 1484 TYR A CD2 1 
ATOM   1715 C CE1 . TYR A 1 226 ? -5.241  -20.554 2.424   1.00 40.42 ? 1484 TYR A CE1 1 
ATOM   1716 C CE2 . TYR A 1 226 ? -4.605  -22.881 2.445   1.00 43.17 ? 1484 TYR A CE2 1 
ATOM   1717 C CZ  . TYR A 1 226 ? -5.060  -21.764 1.763   1.00 41.98 ? 1484 TYR A CZ  1 
ATOM   1718 O OH  . TYR A 1 226 ? -5.326  -21.851 0.419   1.00 41.45 ? 1484 TYR A OH  1 
ATOM   1719 N N   . CYS A 1 227 ? -1.635  -21.750 8.425   1.00 44.86 ? 1485 CYS A N   1 
ATOM   1720 C CA  A CYS A 1 227 ? -1.394  -21.667 9.858   0.50 44.44 ? 1485 CYS A CA  1 
ATOM   1721 C CA  B CYS A 1 227 ? -1.422  -21.658 9.870   0.50 44.81 ? 1485 CYS A CA  1 
ATOM   1722 C C   . CYS A 1 227 ? -1.004  -20.257 10.315  1.00 44.34 ? 1485 CYS A C   1 
ATOM   1723 O O   . CYS A 1 227 ? -0.121  -19.635 9.732   1.00 45.47 ? 1485 CYS A O   1 
ATOM   1724 C CB  A CYS A 1 227 ? -0.290  -22.660 10.216  0.50 45.93 ? 1485 CYS A CB  1 
ATOM   1725 C CB  B CYS A 1 227 ? -0.393  -22.695 10.345  0.50 46.25 ? 1485 CYS A CB  1 
ATOM   1726 S SG  A CYS A 1 227 ? -0.032  -22.906 11.962  0.50 44.83 ? 1485 CYS A SG  1 
ATOM   1727 S SG  B CYS A 1 227 ? -1.010  -24.402 10.531  0.50 47.94 ? 1485 CYS A SG  1 
ATOM   1728 N N   . LEU A 1 228 ? -1.661  -19.758 11.357  1.00 43.16 ? 1486 LEU A N   1 
ATOM   1729 C CA  . LEU A 1 228 ? -1.269  -18.486 11.976  1.00 43.46 ? 1486 LEU A CA  1 
ATOM   1730 C C   . LEU A 1 228 ? 0.097   -18.623 12.647  1.00 45.74 ? 1486 LEU A C   1 
ATOM   1731 O O   . LEU A 1 228 ? 0.512   -19.735 12.961  1.00 45.05 ? 1486 LEU A O   1 
ATOM   1732 C CB  . LEU A 1 228 ? -2.311  -18.042 13.003  1.00 41.58 ? 1486 LEU A CB  1 
ATOM   1733 C CG  . LEU A 1 228 ? -3.683  -17.671 12.439  1.00 38.79 ? 1486 LEU A CG  1 
ATOM   1734 C CD1 . LEU A 1 228 ? -4.655  -17.603 13.598  1.00 35.18 ? 1486 LEU A CD1 1 
ATOM   1735 C CD2 . LEU A 1 228 ? -3.662  -16.337 11.615  1.00 35.31 ? 1486 LEU A CD2 1 
ATOM   1736 N N   . PRO A 1 229 ? 0.807   -17.492 12.842  1.00 48.49 ? 1487 PRO A N   1 
ATOM   1737 C CA  . PRO A 1 229 ? 2.164   -17.504 13.394  1.00 51.13 ? 1487 PRO A CA  1 
ATOM   1738 C C   . PRO A 1 229 ? 2.334   -18.273 14.693  1.00 52.23 ? 1487 PRO A C   1 
ATOM   1739 O O   . PRO A 1 229 ? 3.250   -19.093 14.782  1.00 53.53 ? 1487 PRO A O   1 
ATOM   1740 C CB  . PRO A 1 229 ? 2.458   -16.014 13.597  1.00 52.36 ? 1487 PRO A CB  1 
ATOM   1741 C CG  . PRO A 1 229 ? 1.752   -15.372 12.470  1.00 50.56 ? 1487 PRO A CG  1 
ATOM   1742 C CD  . PRO A 1 229 ? 0.458   -16.147 12.334  1.00 48.24 ? 1487 PRO A CD  1 
ATOM   1743 N N   . GLU A 1 230 ? 1.462   -18.036 15.677  1.00 52.58 ? 1488 GLU A N   1 
ATOM   1744 C CA  . GLU A 1 230 ? 1.556   -18.700 16.998  1.00 53.99 ? 1488 GLU A CA  1 
ATOM   1745 C C   . GLU A 1 230 ? 1.271   -20.204 16.958  1.00 53.49 ? 1488 GLU A C   1 
ATOM   1746 O O   . GLU A 1 230 ? 1.585   -20.930 17.910  1.00 54.12 ? 1488 GLU A O   1 
ATOM   1747 C CB  . GLU A 1 230 ? 0.613   -18.047 18.026  1.00 53.98 ? 1488 GLU A CB  1 
ATOM   1748 C CG  . GLU A 1 230 ? 0.716   -16.527 18.148  1.00 56.10 ? 1488 GLU A CG  1 
ATOM   1749 C CD  . GLU A 1 230 ? -0.167  -15.797 17.165  0.50 56.90 ? 1488 GLU A CD  1 
ATOM   1750 O OE1 . GLU A 1 230 ? -0.091  -16.080 15.949  0.50 57.41 ? 1488 GLU A OE1 1 
ATOM   1751 O OE2 . GLU A 1 230 ? -0.933  -14.921 17.613  0.50 59.09 ? 1488 GLU A OE2 1 
ATOM   1752 N N   . ALA A 1 231 ? 0.666   -20.660 15.863  1.00 53.04 ? 1489 ALA A N   1 
ATOM   1753 C CA  . ALA A 1 231 ? 0.326   -22.074 15.679  1.00 53.28 ? 1489 ALA A CA  1 
ATOM   1754 C C   . ALA A 1 231 ? 1.379   -22.887 14.904  1.00 55.13 ? 1489 ALA A C   1 
ATOM   1755 O O   . ALA A 1 231 ? 1.263   -24.114 14.799  1.00 54.82 ? 1489 ALA A O   1 
ATOM   1756 C CB  . ALA A 1 231 ? -1.043  -22.194 15.014  1.00 51.61 ? 1489 ALA A CB  1 
ATOM   1757 N N   . ILE A 1 232 ? 2.395   -22.205 14.364  1.00 56.77 ? 1490 ILE A N   1 
ATOM   1758 C CA  . ILE A 1 232 ? 3.464   -22.866 13.589  1.00 59.33 ? 1490 ILE A CA  1 
ATOM   1759 C C   . ILE A 1 232 ? 4.344   -23.775 14.462  1.00 61.14 ? 1490 ILE A C   1 
ATOM   1760 O O   . ILE A 1 232 ? 4.866   -23.339 15.490  1.00 61.65 ? 1490 ILE A O   1 
ATOM   1761 C CB  . ILE A 1 232 ? 4.367   -21.835 12.844  1.00 60.20 ? 1490 ILE A CB  1 
ATOM   1762 C CG1 . ILE A 1 232 ? 3.531   -20.829 12.038  1.00 59.96 ? 1490 ILE A CG1 1 
ATOM   1763 C CG2 . ILE A 1 232 ? 5.400   -22.542 11.962  1.00 62.50 ? 1490 ILE A CG2 1 
ATOM   1764 C CD1 . ILE A 1 232 ? 3.130   -21.267 10.645  1.00 61.17 ? 1490 ILE A CD1 1 
ATOM   1765 N N   . SER A 1 233 ? 4.496   -25.027 14.026  1.00 62.82 ? 1491 SER A N   1 
ATOM   1766 C CA  . SER A 1 233 ? 5.277   -26.081 14.697  1.00 65.22 ? 1491 SER A CA  1 
ATOM   1767 C C   . SER A 1 233 ? 5.280   -26.059 16.234  1.00 65.23 ? 1491 SER A C   1 
ATOM   1768 O O   . SER A 1 233 ? 4.262   -25.770 16.872  1.00 64.35 ? 1491 SER A O   1 
ATOM   1769 C CB  . SER A 1 233 ? 6.713   -26.151 14.139  1.00 67.72 ? 1491 SER A CB  1 
ATOM   1770 O OG  . SER A 1 233 ? 7.669   -25.607 15.039  1.00 68.88 ? 1491 SER A OG  1 
ATOM   1771 N N   . SER B 2 1   ? -15.054 -0.286  -8.263  1.00 42.24 ? 1129 SER B N   1 
ATOM   1772 C CA  . SER B 2 1   ? -16.087 0.790   -8.038  1.00 41.91 ? 1129 SER B CA  1 
ATOM   1773 C C   . SER B 2 1   ? -16.416 1.039   -6.566  1.00 41.16 ? 1129 SER B C   1 
ATOM   1774 O O   . SER B 2 1   ? -16.557 0.093   -5.791  1.00 40.45 ? 1129 SER B O   1 
ATOM   1775 C CB  . SER B 2 1   ? -17.368 0.512   -8.825  1.00 39.99 ? 1129 SER B CB  1 
ATOM   1776 O OG  . SER B 2 1   ? -18.423 1.386   -8.430  1.00 40.21 ? 1129 SER B OG  1 
ATOM   1777 N N   . ILE B 2 2   ? -16.530 2.317   -6.197  1.00 41.52 ? 1130 ILE B N   1 
ATOM   1778 C CA  . ILE B 2 2   ? -16.951 2.701   -4.842  1.00 41.94 ? 1130 ILE B CA  1 
ATOM   1779 C C   . ILE B 2 2   ? -18.325 2.139   -4.452  1.00 39.81 ? 1130 ILE B C   1 
ATOM   1780 O O   . ILE B 2 2   ? -18.662 2.076   -3.266  1.00 40.74 ? 1130 ILE B O   1 
ATOM   1781 C CB  . ILE B 2 2   ? -16.982 4.248   -4.622  1.00 43.84 ? 1130 ILE B CB  1 
ATOM   1782 C CG1 . ILE B 2 2   ? -17.902 4.931   -5.642  1.00 43.91 ? 1130 ILE B CG1 1 
ATOM   1783 C CG2 . ILE B 2 2   ? -15.581 4.834   -4.645  1.00 46.91 ? 1130 ILE B CG2 1 
ATOM   1784 C CD1 . ILE B 2 2   ? -18.208 6.419   -5.345  1.00 47.48 ? 1130 ILE B CD1 1 
ATOM   1785 N N   . TYR B 2 3   ? -19.109 1.749   -5.452  1.00 37.08 ? 1131 TYR B N   1 
ATOM   1786 C CA  . TYR B 2 3   ? -20.442 1.232   -5.244  1.00 36.25 ? 1131 TYR B CA  1 
ATOM   1787 C C   . TYR B 2 3   ? -20.475 -0.311  -5.193  1.00 35.24 ? 1131 TYR B C   1 
ATOM   1788 O O   . TYR B 2 3   ? -21.552 -0.888  -5.053  1.00 35.49 ? 1131 TYR B O   1 
ATOM   1789 C CB  . TYR B 2 3   ? -21.386 1.751   -6.340  1.00 36.11 ? 1131 TYR B CB  1 
ATOM   1790 C CG  . TYR B 2 3   ? -21.436 3.271   -6.502  1.00 38.68 ? 1131 TYR B CG  1 
ATOM   1791 C CD1 . TYR B 2 3   ? -21.811 4.093   -5.433  1.00 40.93 ? 1131 TYR B CD1 1 
ATOM   1792 C CD2 . TYR B 2 3   ? -21.137 3.883   -7.733  1.00 38.76 ? 1131 TYR B CD2 1 
ATOM   1793 C CE1 . TYR B 2 3   ? -21.881 5.492   -5.573  1.00 43.69 ? 1131 TYR B CE1 1 
ATOM   1794 C CE2 . TYR B 2 3   ? -21.216 5.296   -7.895  1.00 41.07 ? 1131 TYR B CE2 1 
ATOM   1795 C CZ  . TYR B 2 3   ? -21.589 6.086   -6.793  1.00 44.03 ? 1131 TYR B CZ  1 
ATOM   1796 O OH  . TYR B 2 3   ? -21.672 7.465   -6.885  1.00 44.29 ? 1131 TYR B OH  1 
ATOM   1797 N N   . PHE B 2 4   ? -19.321 -0.976  -5.344  1.00 34.54 ? 1132 PHE B N   1 
ATOM   1798 C CA  . PHE B 2 4   ? -19.255 -2.436  -5.183  1.00 33.33 ? 1132 PHE B CA  1 
ATOM   1799 C C   . PHE B 2 4   ? -18.878 -2.708  -3.723  1.00 33.51 ? 1132 PHE B C   1 
ATOM   1800 O O   . PHE B 2 4   ? -17.967 -2.082  -3.192  1.00 35.05 ? 1132 PHE B O   1 
ATOM   1801 C CB  . PHE B 2 4   ? -18.215 -3.102  -6.110  1.00 33.56 ? 1132 PHE B CB  1 
ATOM   1802 C CG  . PHE B 2 4   ? -18.430 -2.889  -7.609  1.00 31.81 ? 1132 PHE B CG  1 
ATOM   1803 C CD1 . PHE B 2 4   ? -19.611 -2.328  -8.129  1.00 31.47 ? 1132 PHE B CD1 1 
ATOM   1804 C CD2 . PHE B 2 4   ? -17.437 -3.301  -8.504  1.00 32.17 ? 1132 PHE B CD2 1 
ATOM   1805 C CE1 . PHE B 2 4   ? -19.785 -2.160  -9.512  1.00 32.00 ? 1132 PHE B CE1 1 
ATOM   1806 C CE2 . PHE B 2 4   ? -17.584 -3.119  -9.905  1.00 34.85 ? 1132 PHE B CE2 1 
ATOM   1807 C CZ  . PHE B 2 4   ? -18.753 -2.550  -10.411 1.00 33.20 ? 1132 PHE B CZ  1 
HETATM 1808 N N   . TPO B 2 5   ? -19.569 -3.632  -3.070  1.00 32.90 ? 1133 TPO B N   1 
HETATM 1809 C CA  . TPO B 2 5   ? -19.294 -3.932  -1.673  1.00 32.83 ? 1133 TPO B CA  1 
HETATM 1810 C CB  . TPO B 2 5   ? -20.220 -5.033  -1.164  1.00 32.81 ? 1133 TPO B CB  1 
HETATM 1811 C CG2 . TPO B 2 5   ? -20.101 -5.224  0.350   1.00 32.41 ? 1133 TPO B CG2 1 
HETATM 1812 O OG1 . TPO B 2 5   ? -21.561 -4.679  -1.494  1.00 31.90 ? 1133 TPO B OG1 1 
HETATM 1813 P P   . TPO B 2 5   ? -22.428 -5.442  -2.636  1.00 31.69 ? 1133 TPO B P   1 
HETATM 1814 O O1P . TPO B 2 5   ? -23.830 -5.027  -2.334  1.00 32.07 ? 1133 TPO B O1P 1 
HETATM 1815 O O2P . TPO B 2 5   ? -21.892 -4.901  -3.931  1.00 30.05 ? 1133 TPO B O2P 1 
HETATM 1816 O O3P . TPO B 2 5   ? -22.179 -6.912  -2.389  1.00 29.93 ? 1133 TPO B O3P 1 
HETATM 1817 C C   . TPO B 2 5   ? -17.855 -4.369  -1.537  1.00 33.11 ? 1133 TPO B C   1 
HETATM 1818 O O   . TPO B 2 5   ? -17.416 -5.269  -2.263  1.00 32.92 ? 1133 TPO B O   1 
ATOM   1819 N N   . PRO B 2 6   ? -17.091 -3.728  -0.625  1.00 33.95 ? 1134 PRO B N   1 
ATOM   1820 C CA  . PRO B 2 6   ? -15.704 -4.157  -0.415  1.00 35.53 ? 1134 PRO B CA  1 
ATOM   1821 C C   . PRO B 2 6   ? -15.583 -5.655  -0.124  1.00 35.75 ? 1134 PRO B C   1 
ATOM   1822 O O   . PRO B 2 6   ? -16.479 -6.252  0.492   1.00 35.43 ? 1134 PRO B O   1 
ATOM   1823 C CB  . PRO B 2 6   ? -15.248 -3.329  0.794   1.00 37.42 ? 1134 PRO B CB  1 
ATOM   1824 C CG  . PRO B 2 6   ? -16.068 -2.059  0.712   1.00 37.14 ? 1134 PRO B CG  1 
ATOM   1825 C CD  . PRO B 2 6   ? -17.421 -2.512  0.141   1.00 34.93 ? 1134 PRO B CD  1 
ATOM   1826 N N   . GLU B 2 7   ? -14.492 -6.249  -0.609  1.00 36.49 ? 1135 GLU B N   1 
ATOM   1827 C CA  . GLU B 2 7   ? -14.121 -7.621  -0.292  1.00 36.97 ? 1135 GLU B CA  1 
ATOM   1828 C C   . GLU B 2 7   ? -13.851 -7.795  1.212   1.00 36.92 ? 1135 GLU B C   1 
ATOM   1829 O O   . GLU B 2 7   ? -13.634 -6.820  1.928   1.00 37.28 ? 1135 GLU B O   1 
ATOM   1830 C CB  . GLU B 2 7   ? -12.858 -8.018  -1.079  1.00 38.80 ? 1135 GLU B CB  1 
ATOM   1831 C CG  . GLU B 2 7   ? -13.028 -8.140  -2.599  1.00 41.88 ? 1135 GLU B CG  1 
ATOM   1832 C CD  . GLU B 2 7   ? -11.981 -9.049  -3.228  1.00 48.27 ? 1135 GLU B CD  1 
ATOM   1833 O OE1 . GLU B 2 7   ? -10.788 -8.966  -2.848  1.00 53.26 ? 1135 GLU B OE1 1 
ATOM   1834 O OE2 . GLU B 2 7   ? -12.346 -9.878  -4.084  1.00 48.70 ? 1135 GLU B OE2 1 
ATOM   1835 N N   . LEU B 2 8   ? -13.815 -9.043  1.666   1.00 36.58 ? 1136 LEU B N   1 
ATOM   1836 C CA  . LEU B 2 8   ? -13.502 -9.375  3.061   1.00 37.08 ? 1136 LEU B CA  1 
ATOM   1837 C C   . LEU B 2 8   ? -11.995 -9.575  3.276   1.00 38.96 ? 1136 LEU B C   1 
ATOM   1838 O O   . LEU B 2 8   ? -11.567 -10.057 4.327   1.00 39.98 ? 1136 LEU B O   1 
ATOM   1839 C CB  . LEU B 2 8   ? -14.289 -10.623 3.485   1.00 36.44 ? 1136 LEU B CB  1 
ATOM   1840 C CG  . LEU B 2 8   ? -15.805 -10.482 3.695   1.00 35.80 ? 1136 LEU B CG  1 
ATOM   1841 C CD1 . LEU B 2 8   ? -16.452 -11.843 3.753   1.00 34.91 ? 1136 LEU B CD1 1 
ATOM   1842 C CD2 . LEU B 2 8   ? -16.154 -9.661  4.961   1.00 35.95 ? 1136 LEU B CD2 1 
ATOM   1843 N N   . TYR B 2 9   ? -11.208 -9.176  2.275   1.00 40.14 ? 1137 TYR B N   1 
ATOM   1844 C CA  . TYR B 2 9   ? -9.758  -9.368  2.224   1.00 43.66 ? 1137 TYR B CA  1 
ATOM   1845 C C   . TYR B 2 9   ? -9.030  -8.149  1.669   1.00 46.44 ? 1137 TYR B C   1 
ATOM   1846 O O   . TYR B 2 9   ? -9.588  -7.416  0.856   1.00 45.67 ? 1137 TYR B O   1 
ATOM   1847 C CB  . TYR B 2 9   ? -9.429  -10.573 1.335   1.00 43.70 ? 1137 TYR B CB  1 
ATOM   1848 C CG  . TYR B 2 9   ? -10.065 -11.857 1.826   1.00 41.24 ? 1137 TYR B CG  1 
ATOM   1849 C CD1 . TYR B 2 9   ? -9.442  -12.624 2.802   1.00 40.86 ? 1137 TYR B CD1 1 
ATOM   1850 C CD2 . TYR B 2 9   ? -11.306 -12.285 1.333   1.00 37.02 ? 1137 TYR B CD2 1 
ATOM   1851 C CE1 . TYR B 2 9   ? -10.018 -13.796 3.275   1.00 38.96 ? 1137 TYR B CE1 1 
ATOM   1852 C CE2 . TYR B 2 9   ? -11.895 -13.466 1.801   1.00 36.27 ? 1137 TYR B CE2 1 
ATOM   1853 C CZ  . TYR B 2 9   ? -11.241 -14.212 2.773   1.00 36.28 ? 1137 TYR B CZ  1 
ATOM   1854 O OH  . TYR B 2 9   ? -11.788 -15.381 3.245   1.00 36.18 ? 1137 TYR B OH  1 
ATOM   1855 N N   . ASP B 2 10  ? -7.787  -7.952  2.103   1.00 50.87 ? 1138 ASP B N   1 
ATOM   1856 C CA  . ASP B 2 10  ? -6.853  -7.010  1.470   1.00 55.24 ? 1138 ASP B CA  1 
ATOM   1857 C C   . ASP B 2 10  ? -6.470  -7.509  0.080   1.00 56.34 ? 1138 ASP B C   1 
ATOM   1858 O O   . ASP B 2 10  ? -7.015  -7.053  -0.923  1.00 55.91 ? 1138 ASP B O   1 
ATOM   1859 C CB  . ASP B 2 10  ? -5.565  -6.858  2.297   1.00 59.55 ? 1138 ASP B CB  1 
ATOM   1860 C CG  . ASP B 2 10  ? -5.814  -6.312  3.700   1.00 61.14 ? 1138 ASP B CG  1 
ATOM   1861 O OD1 . ASP B 2 10  ? -6.911  -5.785  3.978   1.00 59.36 ? 1138 ASP B OD1 1 
ATOM   1862 O OD2 . ASP B 2 10  ? -4.893  -6.397  4.535   1.00 66.98 ? 1138 ASP B OD2 1 
HETATM 1863 C C   . FMT C 3 .   ? -21.830 -3.030  -12.877 1.00 55.68 ? 1    FMT A C   1 
HETATM 1864 O O1  . FMT C 3 .   ? -22.713 -2.180  -13.000 1.00 55.11 ? 1    FMT A O1  1 
HETATM 1865 O O2  . FMT C 3 .   ? -20.986 -3.276  -13.739 1.00 56.40 ? 1    FMT A O2  1 
HETATM 1866 O O   . HOH D 4 .   ? -28.368 -4.197  -3.565  1.00 45.30 ? 3    HOH A O   1 
HETATM 1867 O O   . HOH D 4 .   ? -29.096 -6.875  -2.568  1.00 34.87 ? 4    HOH A O   1 
HETATM 1868 O O   . HOH D 4 .   ? -9.556  -11.027 5.956   1.00 34.84 ? 5    HOH A O   1 
HETATM 1869 O O   . HOH D 4 .   ? -11.356 -27.947 20.199  1.00 42.37 ? 6    HOH A O   1 
HETATM 1870 O O   . HOH D 4 .   ? -9.629  -28.631 21.723  1.00 47.74 ? 7    HOH A O   1 
HETATM 1871 O O   . HOH D 4 .   ? -24.676 -20.896 -9.150  1.00 38.73 ? 8    HOH A O   1 
HETATM 1872 O O   . HOH D 4 .   ? -22.596 -20.025 -10.990 1.00 43.08 ? 9    HOH A O   1 
HETATM 1873 O O   . HOH D 4 .   ? -23.432 -9.703  -14.292 1.00 34.21 ? 10   HOH A O   1 
HETATM 1874 O O   . HOH D 4 .   ? -5.421  -17.045 -0.592  1.00 62.18 ? 11   HOH A O   1 
HETATM 1875 O O   . HOH D 4 .   ? -29.415 -11.691 -22.108 1.00 39.52 ? 12   HOH A O   1 
HETATM 1876 O O   . HOH D 4 .   ? -13.985 -7.693  15.885  1.00 68.34 ? 13   HOH A O   1 
HETATM 1877 O O   . HOH D 4 .   ? -29.608 -26.350 1.469   1.00 63.73 ? 14   HOH A O   1 
HETATM 1878 O O   . HOH D 4 .   ? -5.107  -25.194 25.345  1.00 41.19 ? 15   HOH A O   1 
HETATM 1879 O O   . HOH D 4 .   ? -43.085 -8.246  -7.182  1.00 44.40 ? 16   HOH A O   1 
HETATM 1880 O O   . HOH D 4 .   ? -14.471 -13.532 24.467  1.00 59.86 ? 17   HOH A O   1 
HETATM 1881 O O   . HOH D 4 .   ? -3.097  -22.576 30.061  1.00 42.87 ? 18   HOH A O   1 
HETATM 1882 O O   . HOH D 4 .   ? -23.563 -21.401 -5.148  1.00 41.56 ? 19   HOH A O   1 
HETATM 1883 O O   . HOH D 4 .   ? -11.150 -25.087 25.915  1.00 47.34 ? 20   HOH A O   1 
HETATM 1884 O O   . HOH D 4 .   ? -26.220 -17.240 -21.804 1.00 45.06 ? 21   HOH A O   1 
HETATM 1885 O O   . HOH D 4 .   ? -16.163 -27.650 -3.984  1.00 60.21 ? 22   HOH A O   1 
HETATM 1886 O O   . HOH D 4 .   ? -27.760 -20.693 4.859   1.00 70.35 ? 23   HOH A O   1 
HETATM 1887 O O   . HOH D 4 .   ? -25.199 -23.890 -15.314 1.00 48.25 ? 24   HOH A O   1 
HETATM 1888 O O   . HOH D 4 .   ? -15.701 -26.868 -11.258 1.00 61.57 ? 25   HOH A O   1 
HETATM 1889 O O   . HOH D 4 .   ? -24.877 -13.012 12.297  1.00 57.64 ? 26   HOH A O   1 
HETATM 1890 O O   . HOH D 4 .   ? -34.253 -7.918  -22.968 1.00 59.29 ? 27   HOH A O   1 
HETATM 1891 O O   . HOH D 4 .   ? -42.007 -16.138 -13.921 1.00 54.19 ? 29   HOH A O   1 
HETATM 1892 O O   . HOH D 4 .   ? 0.272   -17.005 9.046   1.00 70.65 ? 30   HOH A O   1 
HETATM 1893 O O   . HOH D 4 .   ? -44.488 -14.416 -20.134 1.00 71.31 ? 31   HOH A O   1 
HETATM 1894 O O   . HOH D 4 .   ? -19.205 -10.061 -5.961  1.00 46.51 ? 32   HOH A O   1 
HETATM 1895 O O   . HOH D 4 .   ? -16.475 -9.405  -20.413 1.00 54.07 ? 33   HOH A O   1 
HETATM 1896 O O   . HOH D 4 .   ? -30.218 -23.024 -1.810  1.00 59.69 ? 34   HOH A O   1 
HETATM 1897 O O   . HOH D 4 .   ? -38.906 -6.554  -3.822  1.00 47.92 ? 35   HOH A O   1 
HETATM 1898 O O   . HOH D 4 .   ? -15.071 -30.106 10.883  1.00 59.77 ? 36   HOH A O   1 
HETATM 1899 O O   . HOH D 4 .   ? -32.866 -13.113 7.302   1.00 51.94 ? 37   HOH A O   1 
HETATM 1900 O O   . HOH D 4 .   ? -9.518  -33.791 10.747  1.00 82.84 ? 38   HOH A O   1 
HETATM 1901 O O   . HOH D 4 .   ? -10.241 -4.744  14.697  1.00 64.88 ? 39   HOH A O   1 
HETATM 1902 O O   . HOH D 4 .   ? -17.706 -6.393  11.922  1.00 54.66 ? 40   HOH A O   1 
HETATM 1903 O O   . HOH D 4 .   ? -22.129 -7.356  2.030   1.00 45.88 ? 41   HOH A O   1 
HETATM 1904 O O   . HOH D 4 .   ? -11.329 -1.784  12.036  1.00 70.22 ? 42   HOH A O   1 
HETATM 1905 O O   . HOH D 4 .   ? -13.623 -23.545 -8.641  1.00 55.69 ? 43   HOH A O   1 
HETATM 1906 O O   . HOH D 4 .   ? -23.656 -19.340 14.679  1.00 51.99 ? 44   HOH A O   1 
HETATM 1907 O O   . HOH D 4 .   ? -31.401 -21.142 -4.214  1.00 46.31 ? 45   HOH A O   1 
HETATM 1908 O O   . HOH D 4 .   ? -25.785 -24.181 -19.085 1.00 60.81 ? 46   HOH A O   1 
HETATM 1909 O O   . HOH D 4 .   ? -12.164 -11.498 -8.013  1.00 53.61 ? 47   HOH A O   1 
HETATM 1910 O O   . HOH D 4 .   ? -41.312 -14.858 -6.108  1.00 54.92 ? 48   HOH A O   1 
HETATM 1911 O O   . HOH D 4 .   ? -34.886 -0.072  -17.312 1.00 56.36 ? 49   HOH A O   1 
HETATM 1912 O O   . HOH D 4 .   ? -0.903  -16.955 21.867  1.00 63.13 ? 50   HOH A O   1 
HETATM 1913 O O   . HOH D 4 .   ? -6.526  -17.370 -2.776  1.00 71.73 ? 51   HOH A O   1 
HETATM 1914 O O   . HOH D 4 .   ? -3.395  -24.777 12.982  1.00 46.10 ? 52   HOH A O   1 
HETATM 1915 O O   . HOH D 4 .   ? -13.756 -29.465 6.429   1.00 54.13 ? 53   HOH A O   1 
HETATM 1916 O O   . HOH D 4 .   ? -18.356 -24.462 -16.851 1.00 54.75 ? 54   HOH A O   1 
HETATM 1917 O O   . HOH D 4 .   ? -10.558 -1.235  14.454  1.00 74.98 ? 55   HOH A O   1 
HETATM 1918 O O   . HOH D 4 .   ? -36.600 -20.785 -13.492 1.00 61.21 ? 56   HOH A O   1 
HETATM 1919 O O   . HOH D 4 .   ? -37.756 -7.027  0.059   1.00 70.26 ? 57   HOH A O   1 
HETATM 1920 O O   . HOH D 4 .   ? -22.953 -3.714  1.097   1.00 56.83 ? 58   HOH A O   1 
HETATM 1921 O O   . HOH D 4 .   ? -21.700 -15.921 17.707  1.00 70.36 ? 59   HOH A O   1 
HETATM 1922 O O   . HOH D 4 .   ? -7.035  -34.701 10.968  1.00 67.84 ? 60   HOH A O   1 
HETATM 1923 O O   . HOH D 4 .   ? -14.247 -20.913 -20.388 1.00 68.96 ? 61   HOH A O   1 
HETATM 1924 O O   . HOH D 4 .   ? -42.399 -13.812 -14.101 1.00 55.15 ? 62   HOH A O   1 
HETATM 1925 O O   . HOH D 4 .   ? -19.585 -31.336 18.183  1.00 82.74 ? 64   HOH A O   1 
HETATM 1926 O O   . HOH D 4 .   ? -45.572 -12.723 -13.509 1.00 78.79 ? 65   HOH A O   1 
HETATM 1927 O O   . HOH D 4 .   ? -15.669 -8.864  -14.216 1.00 52.62 ? 66   HOH A O   1 
HETATM 1928 O O   . HOH D 4 .   ? -18.858 -30.331 14.682  1.00 58.81 ? 67   HOH A O   1 
HETATM 1929 O O   . HOH D 4 .   ? -35.205 -4.820  0.650   1.00 54.13 ? 68   HOH A O   1 
HETATM 1930 O O   . HOH D 4 .   ? -8.141  -16.108 24.235  1.00 46.11 ? 69   HOH A O   1 
HETATM 1931 O O   . HOH D 4 .   ? -21.233 -26.567 12.630  1.00 62.31 ? 70   HOH A O   1 
HETATM 1932 O O   . HOH D 4 .   ? -21.860 -31.310 16.832  1.00 67.42 ? 71   HOH A O   1 
HETATM 1933 O O   . HOH D 4 .   ? -16.224 -30.767 8.483   1.00 68.80 ? 72   HOH A O   1 
HETATM 1934 O O   . HOH D 4 .   ? -3.695  -17.045 1.121   1.00 63.43 ? 73   HOH A O   1 
HETATM 1935 O O   . HOH D 4 .   ? -6.755  -32.809 12.849  1.00 73.03 ? 74   HOH A O   1 
HETATM 1936 O O   . HOH D 4 .   ? -23.626 -32.641 18.273  1.00 78.43 ? 75   HOH A O   1 
HETATM 1937 O O   . HOH D 4 .   ? -20.978 -31.782 14.355  1.00 70.92 ? 76   HOH A O   1 
HETATM 1938 O O   . HOH D 4 .   ? -16.976 -11.674 23.292  1.00 64.28 ? 77   HOH A O   1 
HETATM 1939 O O   . HOH D 4 .   ? -25.947 -14.773 -21.429 1.00 42.29 ? 78   HOH A O   1 
HETATM 1940 O O   . HOH D 4 .   ? -27.971 -18.832 7.532   1.00 59.24 ? 79   HOH A O   1 
HETATM 1941 O O   . HOH D 4 .   ? -16.089 -16.204 17.660  1.00 46.44 ? 80   HOH A O   1 
HETATM 1942 O O   . HOH D 4 .   ? -11.030 -27.675 7.626   1.00 58.22 ? 81   HOH A O   1 
HETATM 1943 O O   . HOH D 4 .   ? -9.575  -29.220 18.587  1.00 56.72 ? 82   HOH A O   1 
HETATM 1944 O O   . HOH D 4 .   ? -9.746  -28.829 14.866  1.00 56.32 ? 83   HOH A O   1 
HETATM 1945 O O   . HOH D 4 .   ? -20.459 -25.482 -18.260 1.00 75.83 ? 84   HOH A O   1 
HETATM 1946 O O   . HOH D 4 .   ? -12.074 -5.585  3.738   1.00 50.81 ? 85   HOH A O   1 
HETATM 1947 O O   . HOH D 4 .   ? -17.527 -9.080  -17.749 1.00 51.55 ? 86   HOH A O   1 
HETATM 1948 O O   . HOH D 4 .   ? -4.584  -19.023 -4.028  1.00 76.06 ? 87   HOH A O   1 
HETATM 1949 O O   . HOH D 4 .   ? -31.039 -21.391 -18.924 1.00 62.38 ? 89   HOH A O   1 
HETATM 1950 O O   . HOH D 4 .   ? -27.255 -4.653  -17.878 1.00 55.57 ? 90   HOH A O   1 
HETATM 1951 O O   . HOH D 4 .   ? -13.840 -22.338 -18.087 1.00 60.56 ? 91   HOH A O   1 
HETATM 1952 O O   . HOH D 4 .   ? 2.220   -26.856 15.666  1.00 62.33 ? 92   HOH A O   1 
HETATM 1953 O O   . HOH D 4 .   ? -27.626 -27.761 -13.873 1.00 70.95 ? 93   HOH A O   1 
HETATM 1954 O O   . HOH D 4 .   ? -19.434 -2.326  -15.487 1.00 69.69 ? 94   HOH A O   1 
HETATM 1955 O O   . HOH D 4 .   ? -36.709 -20.794 -5.510  1.00 59.49 ? 95   HOH A O   1 
HETATM 1956 O O   . HOH D 4 .   ? -35.160 -12.034 5.204   1.00 63.84 ? 96   HOH A O   1 
HETATM 1957 O O   . HOH E 4 .   ? -21.128 -8.387  -0.363  1.00 31.19 ? 1    HOH B O   1 
HETATM 1958 O O   . HOH E 4 .   ? -18.181 -7.858  1.954   1.00 31.11 ? 2    HOH B O   1 
HETATM 1959 O O   . HOH E 4 .   ? -12.471 -4.710  -2.151  1.00 49.99 ? 28   HOH B O   1 
HETATM 1960 O O   . HOH E 4 .   ? -6.894  -10.169 4.394   1.00 61.48 ? 63   HOH B O   1 
HETATM 1961 O O   . HOH E 4 .   ? -15.582 -1.492  -3.625  1.00 43.37 ? 88   HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LYS A 8   ? 0.6952 0.9397 0.7704 -0.3008 -0.0224 0.1013  1266 LYS A N   
2    C CA  . LYS A 8   ? 0.6795 0.8844 0.7376 -0.2767 -0.0081 0.0824  1266 LYS A CA  
3    C C   . LYS A 8   ? 0.6360 0.8836 0.7008 -0.2427 0.0160  0.0740  1266 LYS A C   
4    O O   . LYS A 8   ? 0.6240 0.9085 0.6969 -0.2317 0.0208  0.0714  1266 LYS A O   
5    C CB  . LYS A 8   ? 0.7015 0.8297 0.7298 -0.2697 -0.0156 0.0542  1266 LYS A CB  
6    N N   . GLN A 9   ? 0.6124 0.8510 0.6719 -0.2257 0.0288  0.0692  1267 GLN A N   
7    C CA  . GLN A 9   ? 0.5698 0.8334 0.6295 -0.1922 0.0473  0.0578  1267 GLN A CA  
8    C C   . GLN A 9   ? 0.5480 0.7602 0.5883 -0.1724 0.0515  0.0306  1267 GLN A C   
9    O O   . GLN A 9   ? 0.5660 0.7236 0.5905 -0.1774 0.0467  0.0205  1267 GLN A O   
10   C CB  . GLN A 9   ? 0.5677 0.8509 0.6310 -0.1838 0.0573  0.0677  1267 GLN A CB  
11   C CG  . GLN A 9   ? 0.5820 0.9370 0.6672 -0.1962 0.0577  0.0978  1267 GLN A CG  
12   C CD  . GLN A 9   ? 0.6089 0.9765 0.6944 -0.1913 0.0656  0.1084  1267 GLN A CD  
13   O OE1 . GLN A 9   ? 0.6317 1.0680 0.7308 -0.1844 0.0737  0.1272  1267 GLN A OE1 
14   N NE2 . GLN A 9   ? 0.6172 0.9216 0.6867 -0.1924 0.0638  0.0965  1267 GLN A NE2 
15   N N   . TYR A 10  ? 0.5065 0.7384 0.5480 -0.1494 0.0591  0.0204  1268 TYR A N   
16   C CA  . TYR A 10  ? 0.4826 0.6747 0.5094 -0.1326 0.0616  -0.0002 1268 TYR A CA  
17   C C   . TYR A 10  ? 0.4481 0.6548 0.4751 -0.1049 0.0709  -0.0064 1268 TYR A C   
18   O O   . TYR A 10  ? 0.4354 0.6638 0.4656 -0.0891 0.0712  -0.0106 1268 TYR A O   
19   C CB  . TYR A 10  ? 0.4835 0.6765 0.5096 -0.1353 0.0550  -0.0061 1268 TYR A CB  
20   C CG  . TYR A 10  ? 0.5197 0.6837 0.5377 -0.1589 0.0428  -0.0061 1268 TYR A CG  
21   C CD1 . TYR A 10  ? 0.5410 0.6532 0.5389 -0.1575 0.0400  -0.0206 1268 TYR A CD1 
22   C CD2 . TYR A 10  ? 0.5290 0.7181 0.5581 -0.1815 0.0324  0.0088  1268 TYR A CD2 
23   C CE1 . TYR A 10  ? 0.5751 0.6559 0.5598 -0.1748 0.0262  -0.0237 1268 TYR A CE1 
24   C CE2 . TYR A 10  ? 0.5682 0.7232 0.5863 -0.2033 0.0164  0.0075  1268 TYR A CE2 
25   C CZ  . TYR A 10  ? 0.5867 0.6852 0.5806 -0.1981 0.0131  -0.0105 1268 TYR A CZ  
26   O OH  . TYR A 10  ? 0.6420 0.7029 0.6198 -0.2153 -0.0049 -0.0147 1268 TYR A OH  
27   N N   . ILE A 11  ? 0.4261 0.6182 0.4481 -0.0990 0.0763  -0.0069 1269 ILE A N   
28   C CA  . ILE A 11  ? 0.4056 0.6071 0.4246 -0.0735 0.0822  -0.0127 1269 ILE A CA  
29   C C   . ILE A 11  ? 0.3946 0.5477 0.4014 -0.0655 0.0817  -0.0261 1269 ILE A C   
30   O O   . ILE A 11  ? 0.4065 0.5313 0.4075 -0.0726 0.0835  -0.0263 1269 ILE A O   
31   C CB  . ILE A 11  ? 0.4005 0.6332 0.4241 -0.0714 0.0882  -0.0004 1269 ILE A CB  
32   C CG1 . ILE A 11  ? 0.4116 0.7016 0.4509 -0.0828 0.0880  0.0180  1269 ILE A CG1 
33   C CG2 . ILE A 11  ? 0.3869 0.6290 0.4030 -0.0413 0.0921  -0.0089 1269 ILE A CG2 
34   C CD1 . ILE A 11  ? 0.4346 0.7485 0.4815 -0.0985 0.0903  0.0381  1269 ILE A CD1 
35   N N   . PHE A 12  ? 0.3839 0.5294 0.3876 -0.0511 0.0780  -0.0353 1270 PHE A N   
36   C CA  . PHE A 12  ? 0.3798 0.4866 0.3753 -0.0470 0.0754  -0.0435 1270 PHE A CA  
37   C C   . PHE A 12  ? 0.3790 0.4756 0.3696 -0.0286 0.0737  -0.0480 1270 PHE A C   
38   O O   . PHE A 12  ? 0.3698 0.4862 0.3596 -0.0119 0.0716  -0.0498 1270 PHE A O   
39   C CB  . PHE A 12  ? 0.3744 0.4769 0.3703 -0.0464 0.0689  -0.0473 1270 PHE A CB  
40   C CG  . PHE A 12  ? 0.3836 0.4835 0.3790 -0.0641 0.0685  -0.0459 1270 PHE A CG  
41   C CD1 . PHE A 12  ? 0.3784 0.4512 0.3654 -0.0696 0.0683  -0.0495 1270 PHE A CD1 
42   C CD2 . PHE A 12  ? 0.3874 0.5142 0.3897 -0.0743 0.0672  -0.0404 1270 PHE A CD2 
43   C CE1 . PHE A 12  ? 0.3917 0.4589 0.3730 -0.0823 0.0660  -0.0510 1270 PHE A CE1 
44   C CE2 . PHE A 12  ? 0.4016 0.5207 0.4006 -0.0911 0.0632  -0.0403 1270 PHE A CE2 
45   C CZ  . PHE A 12  ? 0.3786 0.4654 0.3651 -0.0938 0.0622  -0.0472 1270 PHE A CZ  
46   N N   . GLN A 13  ? 0.3833 0.4493 0.3690 -0.0304 0.0735  -0.0500 1271 GLN A N   
47   C CA  . GLN A 13  ? 0.3899 0.4378 0.3713 -0.0167 0.0655  -0.0539 1271 GLN A CA  
48   C C   . GLN A 13  ? 0.3907 0.4204 0.3734 -0.0233 0.0601  -0.0525 1271 GLN A C   
49   O O   . GLN A 13  ? 0.3894 0.4201 0.3730 -0.0353 0.0649  -0.0507 1271 GLN A O   
50   C CB  . GLN A 13  ? 0.3929 0.4288 0.3697 -0.0122 0.0684  -0.0537 1271 GLN A CB  
51   C CG  . GLN A 13  ? 0.3989 0.4574 0.3724 0.0002  0.0711  -0.0545 1271 GLN A CG  
52   C CD  . GLN A 13  ? 0.4321 0.4754 0.3976 0.0107  0.0688  -0.0567 1271 GLN A CD  
53   O OE1 . GLN A 13  ? 0.4539 0.4870 0.4199 0.0016  0.0753  -0.0523 1271 GLN A OE1 
54   N NE2 . GLN A 13  ? 0.4189 0.4589 0.3752 0.0312  0.0579  -0.0641 1271 GLN A NE2 
55   N N   . LEU A 14  ? 0.3901 0.4044 0.3716 -0.0152 0.0482  -0.0523 1272 LEU A N   
56   C CA  . LEU A 14  ? 0.3876 0.3914 0.3727 -0.0220 0.0410  -0.0461 1272 LEU A CA  
57   C C   . LEU A 14  ? 0.3926 0.3775 0.3777 -0.0207 0.0339  -0.0412 1272 LEU A C   
58   O O   . LEU A 14  ? 0.4021 0.3761 0.3822 -0.0103 0.0273  -0.0455 1272 LEU A O   
59   C CB  . LEU A 14  ? 0.3922 0.3970 0.3787 -0.0166 0.0271  -0.0462 1272 LEU A CB  
60   C CG  . LEU A 14  ? 0.3768 0.4042 0.3648 -0.0164 0.0316  -0.0500 1272 LEU A CG  
61   C CD1 . LEU A 14  ? 0.4055 0.4296 0.3936 -0.0075 0.0153  -0.0502 1272 LEU A CD1 
62   C CD2 . LEU A 14  ? 0.3436 0.3816 0.3338 -0.0318 0.0420  -0.0469 1272 LEU A CD2 
63   N N   . SER A 15  ? 0.3817 0.3662 0.3717 -0.0303 0.0351  -0.0316 1273 SER A N   
64   C CA  . SER A 15  ? 0.3808 0.3542 0.3741 -0.0318 0.0287  -0.0229 1273 SER A CA  
65   C C   . SER A 15  ? 0.3905 0.3729 0.3926 -0.0415 0.0228  -0.0072 1273 SER A C   
66   O O   . SER A 15  ? 0.3826 0.3825 0.3853 -0.0459 0.0315  -0.0050 1273 SER A O   
67   C CB  . SER A 15  ? 0.3777 0.3513 0.3680 -0.0312 0.0429  -0.0253 1273 SER A CB  
68   O OG  . SER A 15  ? 0.3612 0.3288 0.3561 -0.0329 0.0373  -0.0155 1273 SER A OG  
69   N N   . SER A 16  ? 0.4018 0.3736 0.4101 -0.0450 0.0063  0.0047  1274 SER A N   
70   C CA  A SER A 16  ? 0.4097 0.3963 0.4300 -0.0567 -0.0019 0.0261  1274 SER A CA  
71   C CA  B SER A 16  ? 0.4100 0.3967 0.4302 -0.0566 -0.0016 0.0259  1274 SER A CA  
72   C C   . SER A 16  ? 0.4152 0.4146 0.4381 -0.0615 -0.0055 0.0313  1274 SER A C   
73   O O   . SER A 16  ? 0.4089 0.4367 0.4361 -0.0669 0.0040  0.0418  1274 SER A O   
74   C CB  A SER A 16  ? 0.4017 0.4131 0.4264 -0.0588 0.0144  0.0350  1274 SER A CB  
75   C CB  B SER A 16  ? 0.4021 0.4132 0.4257 -0.0580 0.0159  0.0333  1274 SER A CB  
76   O OG  A SER A 16  ? 0.3891 0.4162 0.4055 -0.0539 0.0346  0.0248  1274 SER A OG  
77   O OG  B SER A 16  ? 0.3958 0.3950 0.4121 -0.0501 0.0265  0.0208  1274 SER A OG  
78   N N   . LEU A 17  ? 0.4267 0.4066 0.4452 -0.0571 -0.0195 0.0232  1275 LEU A N   
79   C CA  . LEU A 17  ? 0.4351 0.4219 0.4560 -0.0610 -0.0275 0.0284  1275 LEU A CA  
80   C C   . LEU A 17  ? 0.4673 0.4251 0.4901 -0.0625 -0.0587 0.0362  1275 LEU A C   
81   O O   . LEU A 17  ? 0.4755 0.4034 0.4914 -0.0540 -0.0724 0.0277  1275 LEU A O   
82   C CB  . LEU A 17  ? 0.4231 0.4153 0.4350 -0.0519 -0.0145 0.0094  1275 LEU A CB  
83   C CG  . LEU A 17  ? 0.4069 0.4218 0.4148 -0.0529 0.0104  0.0024  1275 LEU A CG  
84   C CD1 . LEU A 17  ? 0.4026 0.4176 0.4028 -0.0458 0.0202  -0.0152 1275 LEU A CD1 
85   C CD2 . LEU A 17  ? 0.4096 0.4498 0.4198 -0.0608 0.0154  0.0132  1275 LEU A CD2 
86   N N   . ASN A 18  ? 0.4870 0.4523 0.5175 -0.0729 -0.0716 0.0529  1276 ASN A N   
87   C CA  A ASN A 18  ? 0.5305 0.4633 0.5611 -0.0747 -0.1050 0.0606  1276 ASN A CA  
88   C CA  B ASN A 18  ? 0.5314 0.4651 0.5622 -0.0749 -0.1047 0.0608  1276 ASN A CA  
89   C C   . ASN A 18  ? 0.5487 0.4568 0.5640 -0.0539 -0.1104 0.0357  1276 ASN A C   
90   O O   . ASN A 18  ? 0.5356 0.4639 0.5461 -0.0447 -0.0888 0.0205  1276 ASN A O   
91   C CB  A ASN A 18  ? 0.5363 0.4877 0.5782 -0.0899 -0.1150 0.0838  1276 ASN A CB  
92   C CB  B ASN A 18  ? 0.5361 0.4926 0.5781 -0.0898 -0.1111 0.0832  1276 ASN A CB  
93   C CG  A ASN A 18  ? 0.5425 0.5180 0.6014 -0.1108 -0.1206 0.1158  1276 ASN A CG  
94   C CG  B ASN A 18  ? 0.5772 0.4998 0.6194 -0.0931 -0.1469 0.0931  1276 ASN A CG  
95   O OD1 A ASN A 18  ? 0.5399 0.5208 0.6030 -0.1137 -0.1149 0.1201  1276 ASN A OD1 
96   O OD1 B ASN A 18  ? 0.5969 0.5182 0.6349 -0.0873 -0.1505 0.0875  1276 ASN A OD1 
97   N ND2 A ASN A 18  ? 0.5333 0.5280 0.6030 -0.1253 -0.1320 0.1405  1276 ASN A ND2 
98   N ND2 B ASN A 18  ? 0.6253 0.5183 0.6718 -0.1030 -0.1761 0.1086  1276 ASN A ND2 
99   N N   . PRO A 19  ? 0.5959 0.4606 0.6022 -0.0450 -0.1411 0.0317  1277 PRO A N   
100  C CA  . PRO A 19  ? 0.6152 0.4618 0.6046 -0.0198 -0.1466 0.0080  1277 PRO A CA  
101  C C   . PRO A 19  ? 0.6127 0.4818 0.6039 -0.0160 -0.1380 0.0049  1277 PRO A C   
102  O O   . PRO A 19  ? 0.6075 0.4905 0.5905 0.0019  -0.1235 -0.0139 1277 PRO A O   
103  C CB  . PRO A 19  ? 0.6666 0.4597 0.6459 -0.0138 -0.1885 0.0100  1277 PRO A CB  
104  C CG  . PRO A 19  ? 0.6718 0.4535 0.6587 -0.0312 -0.1979 0.0258  1277 PRO A CG  
105  C CD  . PRO A 19  ? 0.6279 0.4572 0.6366 -0.0555 -0.1746 0.0479  1277 PRO A CD  
106  N N   . GLN A 20  ? 0.6176 0.4943 0.6203 -0.0334 -0.1474 0.0254  1278 GLN A N   
107  C CA  . GLN A 20  ? 0.6119 0.5095 0.6161 -0.0310 -0.1412 0.0241  1278 GLN A CA  
108  C C   . GLN A 20  ? 0.5730 0.5160 0.5811 -0.0343 -0.1046 0.0171  1278 GLN A C   
109  O O   . GLN A 20  ? 0.5683 0.5275 0.5726 -0.0237 -0.0944 0.0044  1278 GLN A O   
110  C CB  . GLN A 20  ? 0.6334 0.5277 0.6480 -0.0490 -0.1628 0.0498  1278 GLN A CB  
111  C CG  . GLN A 20  ? 0.6429 0.5578 0.6588 -0.0469 -0.1592 0.0500  1278 GLN A CG  
112  C CD  . GLN A 20  ? 0.6824 0.5800 0.6849 -0.0202 -0.1673 0.0276  1278 GLN A CD  
113  O OE1 . GLN A 20  ? 0.7298 0.5849 0.7205 -0.0040 -0.1932 0.0192  1278 GLN A OE1 
114  N NE2 . GLN A 20  ? 0.6718 0.6037 0.6749 -0.0142 -0.1467 0.0181  1278 GLN A NE2 
115  N N   . GLU A 21  ? 0.5433 0.5055 0.5580 -0.0478 -0.0871 0.0252  1279 GLU A N   
116  C CA  . GLU A 21  ? 0.5175 0.5115 0.5311 -0.0486 -0.0564 0.0154  1279 GLU A CA  
117  C C   . GLU A 21  ? 0.4997 0.4909 0.5045 -0.0324 -0.0454 -0.0064 1279 GLU A C   
118  O O   . GLU A 21  ? 0.4875 0.5006 0.4907 -0.0304 -0.0301 -0.0153 1279 GLU A O   
119  C CB  . GLU A 21  ? 0.5037 0.5134 0.5220 -0.0601 -0.0416 0.0251  1279 GLU A CB  
120  C CG  . GLU A 21  ? 0.5390 0.5742 0.5659 -0.0751 -0.0418 0.0477  1279 GLU A CG  
121  C CD  . GLU A 21  ? 0.5711 0.6344 0.5943 -0.0766 -0.0287 0.0452  1279 GLU A CD  
122  O OE1 . GLU A 21  ? 0.5537 0.6403 0.5722 -0.0777 -0.0094 0.0428  1279 GLU A OE1 
123  O OE2 . GLU A 21  ? 0.6021 0.6626 0.6254 -0.0754 -0.0396 0.0450  1279 GLU A OE2 
124  N N   . ARG A 22  ? 0.5071 0.4743 0.5063 -0.0220 -0.0540 -0.0132 1280 ARG A N   
125  C CA  . ARG A 22  ? 0.4994 0.4701 0.4901 -0.0058 -0.0432 -0.0309 1280 ARG A CA  
126  C C   . ARG A 22  ? 0.5084 0.4880 0.4940 0.0109  -0.0476 -0.0415 1280 ARG A C   
127  O O   . ARG A 22  ? 0.4910 0.4973 0.4761 0.0165  -0.0308 -0.0499 1280 ARG A O   
128  C CB  . ARG A 22  ? 0.5117 0.4545 0.4945 0.0041  -0.0545 -0.0357 1280 ARG A CB  
129  C CG  . ARG A 22  ? 0.5097 0.4526 0.4978 -0.0093 -0.0444 -0.0278 1280 ARG A CG  
130  C CD  . ARG A 22  ? 0.5196 0.4369 0.4990 0.0008  -0.0549 -0.0336 1280 ARG A CD  
131  N NE  . ARG A 22  ? 0.5125 0.4228 0.4998 -0.0144 -0.0573 -0.0194 1280 ARG A NE  
132  C CZ  . ARG A 22  ? 0.4937 0.4093 0.4810 -0.0159 -0.0432 -0.0209 1280 ARG A CZ  
133  N NH1 . ARG A 22  ? 0.4518 0.3782 0.4317 -0.0052 -0.0260 -0.0348 1280 ARG A NH1 
134  N NH2 . ARG A 22  ? 0.4840 0.3970 0.4798 -0.0288 -0.0471 -0.0059 1280 ARG A NH2 
135  N N   . ILE A 23  ? 0.5287 0.4868 0.5112 0.0185  -0.0718 -0.0390 1281 ILE A N   
136  C CA  . ILE A 23  ? 0.5447 0.5104 0.5218 0.0375  -0.0791 -0.0481 1281 ILE A CA  
137  C C   . ILE A 23  ? 0.5194 0.5221 0.5066 0.0257  -0.0631 -0.0434 1281 ILE A C   
138  O O   . ILE A 23  ? 0.5095 0.5418 0.4967 0.0359  -0.0515 -0.0516 1281 ILE A O   
139  C CB  . ILE A 23  ? 0.5807 0.5060 0.5501 0.0480  -0.1133 -0.0458 1281 ILE A CB  
140  C CG1 . ILE A 23  ? 0.6291 0.5163 0.5823 0.0669  -0.1316 -0.0566 1281 ILE A CG1 
141  C CG2 . ILE A 23  ? 0.6077 0.5443 0.5734 0.0660  -0.1206 -0.0523 1281 ILE A CG2 
142  C CD1 . ILE A 23  ? 0.6702 0.5038 0.6146 0.0706  -0.1714 -0.0514 1281 ILE A CD1 
143  N N   . ASP A 24  ? 0.5068 0.5113 0.5024 0.0044  -0.0630 -0.0290 1282 ASP A N   
144  C CA  A ASP A 24  ? 0.4901 0.5260 0.4922 -0.0072 -0.0503 -0.0249 1282 ASP A CA  
145  C CA  B ASP A 24  ? 0.4961 0.5317 0.4981 -0.0072 -0.0503 -0.0249 1282 ASP A CA  
146  C C   . ASP A 24  ? 0.4673 0.5303 0.4702 -0.0120 -0.0257 -0.0326 1282 ASP A C   
147  O O   . ASP A 24  ? 0.4657 0.5549 0.4711 -0.0126 -0.0183 -0.0357 1282 ASP A O   
148  C CB  A ASP A 24  ? 0.4864 0.5237 0.4943 -0.0276 -0.0517 -0.0081 1282 ASP A CB  
149  C CB  B ASP A 24  ? 0.4988 0.5342 0.5066 -0.0273 -0.0527 -0.0079 1282 ASP A CB  
150  C CG  A ASP A 24  ? 0.5074 0.5266 0.5178 -0.0289 -0.0773 0.0053  1282 ASP A CG  
151  C CG  B ASP A 24  ? 0.5132 0.5748 0.5240 -0.0359 -0.0473 -0.0030 1282 ASP A CG  
152  O OD1 A ASP A 24  ? 0.5292 0.5293 0.5349 -0.0126 -0.0956 -0.0005 1282 ASP A OD1 
153  O OD1 B ASP A 24  ? 0.5548 0.6121 0.5687 -0.0398 -0.0634 0.0093  1282 ASP A OD1 
154  O OD2 A ASP A 24  ? 0.4902 0.5157 0.5066 -0.0457 -0.0799 0.0231  1282 ASP A OD2 
155  O OD2 B ASP A 24  ? 0.5128 0.5977 0.5223 -0.0399 -0.0294 -0.0106 1282 ASP A OD2 
156  N N   . TYR A 25  ? 0.4539 0.5097 0.4551 -0.0170 -0.0153 -0.0342 1283 TYR A N   
157  C CA  . TYR A 25  ? 0.4314 0.5062 0.4326 -0.0241 0.0044  -0.0394 1283 TYR A CA  
158  C C   . TYR A 25  ? 0.4256 0.5156 0.4261 -0.0115 0.0100  -0.0480 1283 TYR A C   
159  O O   . TYR A 25  ? 0.4160 0.5296 0.4195 -0.0190 0.0216  -0.0490 1283 TYR A O   
160  C CB  . TYR A 25  ? 0.4264 0.4899 0.4257 -0.0347 0.0136  -0.0363 1283 TYR A CB  
161  C CG  . TYR A 25  ? 0.4452 0.5134 0.4447 -0.0473 0.0148  -0.0275 1283 TYR A CG  
162  C CD1 . TYR A 25  ? 0.4509 0.5370 0.4494 -0.0532 0.0172  -0.0278 1283 TYR A CD1 
163  C CD2 . TYR A 25  ? 0.4690 0.5287 0.4692 -0.0524 0.0136  -0.0178 1283 TYR A CD2 
164  C CE1 . TYR A 25  ? 0.4812 0.5755 0.4766 -0.0617 0.0186  -0.0206 1283 TYR A CE1 
165  C CE2 . TYR A 25  ? 0.4765 0.5505 0.4758 -0.0609 0.0163  -0.0084 1283 TYR A CE2 
166  C CZ  . TYR A 25  ? 0.4935 0.5840 0.4890 -0.0644 0.0189  -0.0108 1283 TYR A CZ  
167  O OH  . TYR A 25  ? 0.5350 0.6429 0.5262 -0.0699 0.0216  -0.0028 1283 TYR A OH  
168  N N   . CYS A 26  ? 0.4377 0.5153 0.4333 0.0073  0.0001  -0.0531 1284 CYS A N   
169  C CA  A CYS A 26  ? 0.4435 0.5439 0.4367 0.0251  0.0043  -0.0604 1284 CYS A CA  
170  C CA  B CYS A 26  ? 0.4445 0.5445 0.4377 0.0252  0.0041  -0.0604 1284 CYS A CA  
171  C C   . CYS A 26  ? 0.4407 0.5745 0.4398 0.0294  0.0043  -0.0595 1284 CYS A C   
172  O O   . CYS A 26  ? 0.4364 0.6067 0.4411 0.0281  0.0158  -0.0581 1284 CYS A O   
173  C CB  A CYS A 26  ? 0.4601 0.5385 0.4418 0.0505  -0.0107 -0.0685 1284 CYS A CB  
174  C CB  B CYS A 26  ? 0.4651 0.5414 0.4466 0.0500  -0.0114 -0.0683 1284 CYS A CB  
175  S SG  A CYS A 26  ? 0.4770 0.5302 0.4513 0.0506  -0.0080 -0.0712 1284 CYS A SG  
176  S SG  B CYS A 26  ? 0.4895 0.5959 0.4634 0.0762  -0.0039 -0.0775 1284 CYS A SG  
177  N N   . HIS A 27  ? 0.4516 0.5742 0.4505 0.0329  -0.0099 -0.0578 1285 HIS A N   
178  C CA  . HIS A 27  ? 0.4510 0.6035 0.4556 0.0372  -0.0120 -0.0561 1285 HIS A CA  
179  C C   . HIS A 27  ? 0.4310 0.6088 0.4450 0.0121  0.0014  -0.0493 1285 HIS A C   
180  O O   . HIS A 27  ? 0.4180 0.6343 0.4393 0.0122  0.0072  -0.0473 1285 HIS A O   
181  C CB  . HIS A 27  ? 0.4654 0.5938 0.4669 0.0443  -0.0324 -0.0543 1285 HIS A CB  
182  C CG  . HIS A 27  ? 0.5107 0.6067 0.4997 0.0702  -0.0520 -0.0620 1285 HIS A CG  
183  N ND1 . HIS A 27  ? 0.5295 0.5898 0.5135 0.0750  -0.0761 -0.0590 1285 HIS A ND1 
184  C CD2 . HIS A 27  ? 0.5334 0.6253 0.5116 0.0933  -0.0534 -0.0728 1285 HIS A CD2 
185  C CE1 . HIS A 27  ? 0.5807 0.6107 0.5501 0.1000  -0.0939 -0.0689 1285 HIS A CE1 
186  N NE2 . HIS A 27  ? 0.5678 0.6171 0.5323 0.1128  -0.0797 -0.0784 1285 HIS A NE2 
187  N N   . LEU A 28  ? 0.4169 0.5745 0.4298 -0.0083 0.0049  -0.0455 1286 LEU A N   
188  C CA  . LEU A 28  ? 0.4025 0.5764 0.4186 -0.0294 0.0140  -0.0420 1286 LEU A CA  
189  C C   . LEU A 28  ? 0.3944 0.5874 0.4137 -0.0364 0.0258  -0.0425 1286 LEU A C   
190  O O   . LEU A 28  ? 0.3904 0.6121 0.4162 -0.0460 0.0281  -0.0386 1286 LEU A O   
191  C CB  . LEU A 28  ? 0.4002 0.5506 0.4101 -0.0442 0.0152  -0.0395 1286 LEU A CB  
192  C CG  . LEU A 28  ? 0.3976 0.5546 0.4034 -0.0626 0.0222  -0.0396 1286 LEU A CG  
193  C CD1 . LEU A 28  ? 0.3818 0.5641 0.3916 -0.0682 0.0176  -0.0375 1286 LEU A CD1 
194  C CD2 . LEU A 28  ? 0.3829 0.5212 0.3795 -0.0688 0.0231  -0.0375 1286 LEU A CD2 
195  N N   . ILE A 29  ? 0.3928 0.5709 0.4084 -0.0329 0.0314  -0.0451 1287 ILE A N   
196  C CA  . ILE A 29  ? 0.3882 0.5817 0.4069 -0.0414 0.0413  -0.0428 1287 ILE A CA  
197  C C   . ILE A 29  ? 0.4001 0.6404 0.4288 -0.0330 0.0426  -0.0378 1287 ILE A C   
198  O O   . ILE A 29  ? 0.3936 0.6603 0.4303 -0.0490 0.0467  -0.0296 1287 ILE A O   
199  C CB  . ILE A 29  ? 0.3852 0.5547 0.3977 -0.0366 0.0462  -0.0460 1287 ILE A CB  
200  C CG1 . ILE A 29  ? 0.3764 0.5117 0.3814 -0.0494 0.0476  -0.0475 1287 ILE A CG1 
201  C CG2 . ILE A 29  ? 0.3582 0.5494 0.3749 -0.0405 0.0547  -0.0414 1287 ILE A CG2 
202  C CD1 . ILE A 29  ? 0.3450 0.4544 0.3447 -0.0427 0.0497  -0.0498 1287 ILE A CD1 
203  N N   . GLU A 30  ? 0.4091 0.6606 0.4368 -0.0075 0.0372  -0.0416 1288 GLU A N   
204  C CA  . GLU A 30  ? 0.4289 0.7320 0.4647 0.0070  0.0392  -0.0370 1288 GLU A CA  
205  C C   . GLU A 30  ? 0.4293 0.7640 0.4765 -0.0054 0.0364  -0.0291 1288 GLU A C   
206  O O   . GLU A 30  ? 0.4152 0.7971 0.4748 -0.0135 0.0413  -0.0178 1288 GLU A O   
207  C CB  . GLU A 30  ? 0.4407 0.7430 0.4672 0.0429  0.0315  -0.0464 1288 GLU A CB  
208  C CG  . GLU A 30  ? 0.4888 0.7659 0.5033 0.0560  0.0329  -0.0537 1288 GLU A CG  
209  C CD  . GLU A 30  ? 0.5705 0.8393 0.5705 0.0937  0.0210  -0.0656 1288 GLU A CD  
210  O OE1 . GLU A 30  ? 0.6096 0.8895 0.6082 0.1122  0.0109  -0.0688 1288 GLU A OE1 
211  O OE2 . GLU A 30  ? 0.6066 0.8554 0.5947 0.1062  0.0202  -0.0724 1288 GLU A OE2 
212  N N   . LYS A 31  ? 0.4333 0.7434 0.4767 -0.0082 0.0276  -0.0329 1289 LYS A N   
213  C CA  . LYS A 31  ? 0.4444 0.7770 0.4959 -0.0199 0.0230  -0.0269 1289 LYS A CA  
214  C C   . LYS A 31  ? 0.4387 0.7814 0.4962 -0.0510 0.0275  -0.0187 1289 LYS A C   
215  O O   . LYS A 31  ? 0.4433 0.8248 0.5124 -0.0616 0.0253  -0.0091 1289 LYS A O   
216  C CB  . LYS A 31  ? 0.4579 0.7531 0.5012 -0.0217 0.0137  -0.0317 1289 LYS A CB  
217  C CG  . LYS A 31  ? 0.5072 0.8197 0.5545 -0.0118 0.0035  -0.0296 1289 LYS A CG  
218  C CD  . LYS A 31  ? 0.5695 0.8748 0.6118 0.0204  -0.0059 -0.0356 1289 LYS A CD  
219  C CE  . LYS A 31  ? 0.5958 0.8708 0.6326 0.0238  -0.0211 -0.0358 1289 LYS A CE  
220  N NZ  . LYS A 31  ? 0.5916 0.8162 0.6175 0.0285  -0.0287 -0.0400 1289 LYS A NZ  
221  N N   . LEU A 32  ? 0.4356 0.7418 0.4843 -0.0651 0.0315  -0.0223 1290 LEU A N   
222  C CA  . LEU A 32  ? 0.4349 0.7352 0.4833 -0.0930 0.0316  -0.0174 1290 LEU A CA  
223  C C   . LEU A 32  ? 0.4306 0.7630 0.4904 -0.1016 0.0360  -0.0056 1290 LEU A C   
224  O O   . LEU A 32  ? 0.4372 0.7689 0.4993 -0.1266 0.0318  0.0021  1290 LEU A O   
225  C CB  . LEU A 32  ? 0.4371 0.6857 0.4694 -0.0998 0.0333  -0.0265 1290 LEU A CB  
226  C CG  . LEU A 32  ? 0.4562 0.6776 0.4765 -0.0997 0.0287  -0.0338 1290 LEU A CG  
227  C CD1 . LEU A 32  ? 0.4724 0.6546 0.4794 -0.0984 0.0333  -0.0407 1290 LEU A CD1 
228  C CD2 . LEU A 32  ? 0.4982 0.7236 0.5147 -0.1181 0.0210  -0.0325 1290 LEU A CD2 
229  N N   . GLY A 33  ? 0.4175 0.7770 0.4828 -0.0804 0.0425  -0.0035 1291 GLY A N   
230  C CA  . GLY A 33  ? 0.4257 0.8268 0.5030 -0.0860 0.0479  0.0110  1291 GLY A CA  
231  C C   . GLY A 33  ? 0.4253 0.8027 0.4956 -0.0862 0.0548  0.0094  1291 GLY A C   
232  O O   . GLY A 33  ? 0.4315 0.8417 0.5116 -0.0947 0.0586  0.0241  1291 GLY A O   
233  N N   . GLY A 34  ? 0.4245 0.7493 0.4794 -0.0775 0.0560  -0.0056 1292 GLY A N   
234  C CA  . GLY A 34  ? 0.4187 0.7213 0.4665 -0.0745 0.0623  -0.0078 1292 GLY A CA  
235  C C   . GLY A 34  ? 0.4206 0.7363 0.4646 -0.0434 0.0666  -0.0136 1292 GLY A C   
236  O O   . GLY A 34  ? 0.4187 0.7624 0.4648 -0.0224 0.0642  -0.0159 1292 GLY A O   
237  N N   . LEU A 35  ? 0.4207 0.7140 0.4568 -0.0388 0.0713  -0.0170 1293 LEU A N   
238  C CA  . LEU A 35  ? 0.4292 0.7232 0.4563 -0.0090 0.0726  -0.0254 1293 LEU A CA  
239  C C   . LEU A 35  ? 0.4343 0.6709 0.4487 -0.0067 0.0696  -0.0370 1293 LEU A C   
240  O O   . LEU A 35  ? 0.4296 0.6359 0.4428 -0.0268 0.0715  -0.0358 1293 LEU A O   
241  C CB  . LEU A 35  ? 0.4259 0.7597 0.4562 -0.0032 0.0810  -0.0153 1293 LEU A CB  
242  C CG  . LEU A 35  ? 0.4442 0.8486 0.4903 -0.0073 0.0856  0.0029  1293 LEU A CG  
243  C CD1 . LEU A 35  ? 0.4323 0.8741 0.4773 0.0053  0.0942  0.0115  1293 LEU A CD1 
244  C CD2 . LEU A 35  ? 0.4385 0.8809 0.4888 0.0126  0.0819  0.0008  1293 LEU A CD2 
245  N N   . VAL A 36  ? 0.4435 0.6655 0.4475 0.0187  0.0630  -0.0476 1294 VAL A N   
246  C CA  . VAL A 36  ? 0.4509 0.6250 0.4446 0.0216  0.0583  -0.0553 1294 VAL A CA  
247  C C   . VAL A 36  ? 0.4614 0.6396 0.4445 0.0448  0.0579  -0.0605 1294 VAL A C   
248  O O   . VAL A 36  ? 0.4676 0.6700 0.4444 0.0707  0.0536  -0.0656 1294 VAL A O   
249  C CB  . VAL A 36  ? 0.4653 0.6060 0.4545 0.0268  0.0444  -0.0619 1294 VAL A CB  
250  C CG1 . VAL A 36  ? 0.4408 0.5375 0.4238 0.0225  0.0394  -0.0641 1294 VAL A CG1 
251  C CG2 . VAL A 36  ? 0.4649 0.6102 0.4625 0.0089  0.0444  -0.0572 1294 VAL A CG2 
252  N N   . ILE A 37  ? 0.4611 0.6172 0.4405 0.0375  0.0619  -0.0598 1295 ILE A N   
253  C CA  . ILE A 37  ? 0.4779 0.6291 0.4444 0.0586  0.0593  -0.0660 1295 ILE A CA  
254  C C   . ILE A 37  ? 0.4917 0.5926 0.4484 0.0655  0.0433  -0.0752 1295 ILE A C   
255  O O   . ILE A 37  ? 0.4951 0.5655 0.4551 0.0482  0.0432  -0.0720 1295 ILE A O   
256  C CB  . ILE A 37  ? 0.4712 0.6273 0.4397 0.0461  0.0710  -0.0581 1295 ILE A CB  
257  C CG1 . ILE A 37  ? 0.4697 0.6725 0.4511 0.0316  0.0830  -0.0439 1295 ILE A CG1 
258  C CG2 . ILE A 37  ? 0.4794 0.6342 0.4329 0.0696  0.0681  -0.0646 1295 ILE A CG2 
259  C CD1 . ILE A 37  ? 0.4748 0.6769 0.4596 0.0138  0.0918  -0.0330 1295 ILE A CD1 
260  N N   . GLU A 38  ? 0.5089 0.6028 0.4537 0.0909  0.0283  -0.0854 1296 GLU A N   
261  C CA  . GLU A 38  ? 0.5426 0.5873 0.4775 0.0977  0.0069  -0.0924 1296 GLU A CA  
262  C C   . GLU A 38  ? 0.5606 0.5850 0.4788 0.1144  -0.0010 -0.1001 1296 GLU A C   
263  O O   . GLU A 38  ? 0.5878 0.6112 0.4874 0.1446  -0.0129 -0.1123 1296 GLU A O   
264  C CB  . GLU A 38  ? 0.5650 0.6053 0.4928 0.1174  -0.0099 -0.0999 1296 GLU A CB  
265  C CG  . GLU A 38  ? 0.5880 0.6509 0.5319 0.1016  -0.0027 -0.0920 1296 GLU A CG  
266  C CD  . GLU A 38  ? 0.6469 0.7094 0.5842 0.1229  -0.0188 -0.0989 1296 GLU A CD  
267  O OE1 . GLU A 38  ? 0.6935 0.7145 0.6264 0.1225  -0.0398 -0.1000 1296 GLU A OE1 
268  O OE2 . GLU A 38  ? 0.6810 0.7868 0.6184 0.1394  -0.0113 -0.1011 1296 GLU A OE2 
269  N N   . LYS A 39  ? 0.5494 0.5602 0.4727 0.0965  0.0059  -0.0936 1297 LYS A N   
270  C CA  . LYS A 39  ? 0.5651 0.5553 0.4740 0.1081  -0.0016 -0.0992 1297 LYS A CA  
271  C C   . LYS A 39  ? 0.5611 0.5144 0.4779 0.0864  -0.0094 -0.0915 1297 LYS A C   
272  O O   . LYS A 39  ? 0.5288 0.4861 0.4622 0.0630  0.0003  -0.0808 1297 LYS A O   
273  C CB  . LYS A 39  ? 0.5516 0.5763 0.4615 0.1077  0.0190  -0.0951 1297 LYS A CB  
274  C CG  . LYS A 39  ? 0.5775 0.6484 0.4784 0.1323  0.0263  -0.0996 1297 LYS A CG  
275  C CD  . LYS A 39  ? 0.5586 0.6675 0.4660 0.1233  0.0470  -0.0885 1297 LYS A CD  
276  C CE  . LYS A 39  ? 0.5772 0.7463 0.4810 0.1439  0.0565  -0.0867 1297 LYS A CE  
277  N NZ  . LYS A 39  ? 0.5712 0.7777 0.4790 0.1371  0.0728  -0.0735 1297 LYS A NZ  
278  N N   . GLN A 40  ? 0.5916 0.5118 0.4951 0.0957  -0.0276 -0.0964 1298 GLN A N   
279  C CA  . GLN A 40  ? 0.5915 0.4825 0.5030 0.0764  -0.0365 -0.0865 1298 GLN A CA  
280  C C   . GLN A 40  ? 0.5647 0.4737 0.4852 0.0629  -0.0143 -0.0787 1298 GLN A C   
281  O O   . GLN A 40  ? 0.5571 0.4572 0.4900 0.0439  -0.0125 -0.0673 1298 GLN A O   
282  C CB  . GLN A 40  ? 0.6384 0.4891 0.5310 0.0912  -0.0652 -0.0943 1298 GLN A CB  
283  C CG  . GLN A 40  ? 0.7069 0.5244 0.5876 0.1039  -0.0957 -0.1015 1298 GLN A CG  
284  C CD  . GLN A 40  ? 0.7855 0.5566 0.6437 0.1188  -0.1279 -0.1107 1298 GLN A CD  
285  O OE1 . GLN A 40  ? 0.8225 0.5958 0.6602 0.1415  -0.1271 -0.1243 1298 GLN A OE1 
286  N NE2 . GLN A 40  ? 0.8196 0.5487 0.6807 0.1053  -0.1583 -0.1019 1298 GLN A NE2 
287  N N   . CYS A 41  ? 0.5502 0.4869 0.4644 0.0738  0.0014  -0.0835 1299 CYS A N   
288  C CA  A CYS A 41  ? 0.5229 0.4721 0.4439 0.0616  0.0194  -0.0756 1299 CYS A CA  
289  C CA  B CYS A 41  ? 0.5353 0.4875 0.4549 0.0639  0.0201  -0.0765 1299 CYS A CA  
290  C C   . CYS A 41  ? 0.5017 0.4813 0.4355 0.0477  0.0410  -0.0686 1299 CYS A C   
291  O O   . CYS A 41  ? 0.4950 0.4929 0.4322 0.0490  0.0438  -0.0701 1299 CYS A O   
292  C CB  A CYS A 41  ? 0.5364 0.4915 0.4414 0.0793  0.0193  -0.0815 1299 CYS A CB  
293  C CB  B CYS A 41  ? 0.5499 0.5205 0.4536 0.0846  0.0236  -0.0833 1299 CYS A CB  
294  S SG  A CYS A 41  ? 0.5237 0.5200 0.4159 0.1047  0.0261  -0.0899 1299 CYS A SG  
295  S SG  B CYS A 41  ? 0.6208 0.5580 0.5027 0.1037  0.0011  -0.0933 1299 CYS A SG  
296  N N   . PHE A 42  ? 0.4740 0.4555 0.4142 0.0342  0.0535  -0.0607 1300 PHE A N   
297  C CA  . PHE A 42  ? 0.4643 0.4653 0.4138 0.0197  0.0694  -0.0538 1300 PHE A CA  
298  C C   . PHE A 42  ? 0.4662 0.5021 0.4125 0.0274  0.0772  -0.0525 1300 PHE A C   
299  O O   . PHE A 42  ? 0.4718 0.5168 0.4079 0.0424  0.0759  -0.0547 1300 PHE A O   
300  C CB  . PHE A 42  ? 0.4530 0.4412 0.4066 0.0066  0.0772  -0.0466 1300 PHE A CB  
301  C CG  . PHE A 42  ? 0.4607 0.4599 0.4199 -0.0078 0.0886  -0.0404 1300 PHE A CG  
302  C CD1 . PHE A 42  ? 0.4237 0.4192 0.3881 -0.0188 0.0899  -0.0405 1300 PHE A CD1 
303  C CD2 . PHE A 42  ? 0.4431 0.4557 0.4010 -0.0109 0.0957  -0.0334 1300 PHE A CD2 
304  C CE1 . PHE A 42  ? 0.4348 0.4335 0.4014 -0.0324 0.0957  -0.0358 1300 PHE A CE1 
305  C CE2 . PHE A 42  ? 0.4591 0.4762 0.4218 -0.0271 0.1012  -0.0257 1300 PHE A CE2 
306  C CZ  . PHE A 42  ? 0.4472 0.4545 0.4133 -0.0377 0.1001  -0.0279 1300 PHE A CZ  
307  N N   . ASP A 43  ? 0.4620 0.5207 0.4169 0.0171  0.0844  -0.0474 1301 ASP A N   
308  C CA  . ASP A 43  ? 0.4600 0.5616 0.4163 0.0205  0.0920  -0.0405 1301 ASP A CA  
309  C C   . ASP A 43  ? 0.4554 0.5634 0.4232 -0.0049 0.0998  -0.0277 1301 ASP A C   
310  O O   . ASP A 43  ? 0.4503 0.5523 0.4246 -0.0173 0.0985  -0.0279 1301 ASP A O   
311  C CB  . ASP A 43  ? 0.4612 0.5892 0.4160 0.0364  0.0878  -0.0462 1301 ASP A CB  
312  C CG  . ASP A 43  ? 0.4655 0.6503 0.4222 0.0444  0.0960  -0.0371 1301 ASP A CG  
313  O OD1 . ASP A 43  ? 0.4479 0.6537 0.4143 0.0260  0.1047  -0.0215 1301 ASP A OD1 
314  O OD2 . ASP A 43  ? 0.4668 0.6771 0.4153 0.0698  0.0923  -0.0442 1301 ASP A OD2 
315  N N   . PRO A 44  ? 0.4646 0.5817 0.4333 -0.0129 0.1055  -0.0164 1302 PRO A N   
316  C CA  . PRO A 44  ? 0.4703 0.5853 0.4473 -0.0381 0.1081  -0.0029 1302 PRO A CA  
317  C C   . PRO A 44  ? 0.4676 0.6171 0.4558 -0.0515 0.1081  0.0077  1302 PRO A C   
318  O O   . PRO A 44  ? 0.4834 0.6203 0.4769 -0.0744 0.1048  0.0166  1302 PRO A O   
319  C CB  . PRO A 44  ? 0.4768 0.6014 0.4515 -0.0392 0.1120  0.0086  1302 PRO A CB  
320  C CG  . PRO A 44  ? 0.4945 0.6486 0.4609 -0.0128 0.1140  0.0032  1302 PRO A CG  
321  C CD  . PRO A 44  ? 0.4785 0.6056 0.4380 0.0025  0.1073  -0.0157 1302 PRO A CD  
322  N N   . THR A 45  ? 0.4545 0.6453 0.4450 -0.0368 0.1096  0.0067  1303 THR A N   
323  C CA  . THR A 45  ? 0.4474 0.6760 0.4502 -0.0477 0.1090  0.0169  1303 THR A CA  
324  C C   . THR A 45  ? 0.4461 0.6435 0.4512 -0.0606 0.1027  0.0087  1303 THR A C   
325  O O   . THR A 45  ? 0.4459 0.6594 0.4609 -0.0795 0.0994  0.0191  1303 THR A O   
326  C CB  . THR A 45  ? 0.4407 0.7216 0.4431 -0.0218 0.1119  0.0148  1303 THR A CB  
327  O OG1 . THR A 45  ? 0.4448 0.7589 0.4417 -0.0064 0.1179  0.0216  1303 THR A OG1 
328  C CG2 . THR A 45  ? 0.4327 0.7626 0.4505 -0.0328 0.1120  0.0287  1303 THR A CG2 
329  N N   . CYS A 46  ? 0.4355 0.5918 0.4315 -0.0508 0.1000  -0.0080 1304 CYS A N   
330  C CA  . CYS A 46  ? 0.4407 0.5722 0.4370 -0.0598 0.0949  -0.0155 1304 CYS A CA  
331  C C   . CYS A 46  ? 0.4451 0.5488 0.4406 -0.0834 0.0915  -0.0108 1304 CYS A C   
332  O O   . CYS A 46  ? 0.4546 0.5424 0.4472 -0.0910 0.0922  -0.0048 1304 CYS A O   
333  C CB  . CYS A 46  ? 0.4302 0.5310 0.4185 -0.0450 0.0919  -0.0301 1304 CYS A CB  
334  S SG  . CYS A 46  ? 0.4655 0.5198 0.4458 -0.0482 0.0925  -0.0343 1304 CYS A SG  
335  N N   . THR A 47  ? 0.4451 0.5413 0.4412 -0.0938 0.0861  -0.0138 1305 THR A N   
336  C CA  . THR A 47  ? 0.4563 0.5216 0.4468 -0.1135 0.0790  -0.0123 1305 THR A CA  
337  C C   . THR A 47  ? 0.4634 0.4931 0.4417 -0.1079 0.0768  -0.0272 1305 THR A C   
338  O O   . THR A 47  ? 0.4772 0.4717 0.4436 -0.1146 0.0717  -0.0314 1305 THR A O   
339  C CB  . THR A 47  ? 0.4704 0.5587 0.4697 -0.1334 0.0711  -0.0009 1305 THR A CB  
340  O OG1 . THR A 47  ? 0.4461 0.5570 0.4503 -0.1265 0.0713  -0.0062 1305 THR A OG1 
341  C CG2 . THR A 47  ? 0.4607 0.5918 0.4740 -0.1425 0.0726  0.0197  1305 THR A CG2 
342  N N   . HIS A 48  ? 0.4398 0.4806 0.4201 -0.0946 0.0794  -0.0343 1306 HIS A N   
343  C CA  . HIS A 48  ? 0.4363 0.4558 0.4078 -0.0888 0.0781  -0.0444 1306 HIS A CA  
344  C C   . HIS A 48  ? 0.4205 0.4432 0.3946 -0.0723 0.0815  -0.0473 1306 HIS A C   
345  O O   . HIS A 48  ? 0.4110 0.4534 0.3921 -0.0640 0.0821  -0.0449 1306 HIS A O   
346  C CB  . HIS A 48  ? 0.4261 0.4578 0.3989 -0.0945 0.0729  -0.0464 1306 HIS A CB  
347  C CG  . HIS A 48  ? 0.4678 0.4940 0.4371 -0.1129 0.0650  -0.0435 1306 HIS A CG  
348  N ND1 . HIS A 48  ? 0.4698 0.5164 0.4495 -0.1266 0.0620  -0.0313 1306 HIS A ND1 
349  C CD2 . HIS A 48  ? 0.4643 0.4678 0.4203 -0.1203 0.0570  -0.0501 1306 HIS A CD2 
350  C CE1 . HIS A 48  ? 0.4909 0.5239 0.4654 -0.1447 0.0506  -0.0292 1306 HIS A CE1 
351  N NE2 . HIS A 48  ? 0.5161 0.5199 0.4741 -0.1399 0.0469  -0.0425 1306 HIS A NE2 
352  N N   . ILE A 49  ? 0.4228 0.4277 0.3905 -0.0669 0.0818  -0.0516 1307 ILE A N   
353  C CA  . ILE A 49  ? 0.4139 0.4213 0.3857 -0.0557 0.0805  -0.0510 1307 ILE A CA  
354  C C   . ILE A 49  ? 0.4112 0.4166 0.3793 -0.0559 0.0786  -0.0519 1307 ILE A C   
355  O O   . ILE A 49  ? 0.4136 0.4085 0.3718 -0.0578 0.0813  -0.0549 1307 ILE A O   
356  C CB  . ILE A 49  ? 0.4167 0.4116 0.3877 -0.0488 0.0830  -0.0492 1307 ILE A CB  
357  C CG1 . ILE A 49  ? 0.4343 0.4296 0.4103 -0.0403 0.0765  -0.0465 1307 ILE A CG1 
358  C CG2 . ILE A 49  ? 0.4476 0.4256 0.4103 -0.0497 0.0873  -0.0501 1307 ILE A CG2 
359  C CD1 . ILE A 49  ? 0.4478 0.4329 0.4238 -0.0338 0.0758  -0.0444 1307 ILE A CD1 
360  N N   . VAL A 50  ? 0.3974 0.4134 0.3718 -0.0527 0.0728  -0.0490 1308 VAL A N   
361  C CA  . VAL A 50  ? 0.3916 0.4118 0.3646 -0.0528 0.0705  -0.0453 1308 VAL A CA  
362  C C   . VAL A 50  ? 0.3934 0.4107 0.3725 -0.0480 0.0667  -0.0368 1308 VAL A C   
363  O O   . VAL A 50  ? 0.3725 0.3849 0.3576 -0.0443 0.0588  -0.0348 1308 VAL A O   
364  C CB  . VAL A 50  ? 0.3956 0.4296 0.3724 -0.0554 0.0638  -0.0443 1308 VAL A CB  
365  C CG1 . VAL A 50  ? 0.3789 0.4217 0.3550 -0.0561 0.0611  -0.0372 1308 VAL A CG1 
366  C CG2 . VAL A 50  ? 0.4011 0.4403 0.3733 -0.0625 0.0659  -0.0507 1308 VAL A CG2 
367  N N   . VAL A 51  ? 0.3999 0.4212 0.3761 -0.0470 0.0709  -0.0316 1309 VAL A N   
368  C CA  . VAL A 51  ? 0.4025 0.4262 0.3863 -0.0450 0.0675  -0.0199 1309 VAL A CA  
369  C C   . VAL A 51  ? 0.4076 0.4532 0.3958 -0.0475 0.0641  -0.0065 1309 VAL A C   
370  O O   . VAL A 51  ? 0.4051 0.4647 0.3843 -0.0451 0.0715  -0.0086 1309 VAL A O   
371  C CB  . VAL A 51  ? 0.4104 0.4271 0.3886 -0.0397 0.0769  -0.0221 1309 VAL A CB  
372  C CG1 . VAL A 51  ? 0.4197 0.4461 0.4072 -0.0384 0.0738  -0.0076 1309 VAL A CG1 
373  C CG2 . VAL A 51  ? 0.3947 0.3930 0.3706 -0.0390 0.0785  -0.0310 1309 VAL A CG2 
374  N N   . GLY A 52  ? 0.4100 0.4585 0.4107 -0.0522 0.0509  0.0079  1310 GLY A N   
375  C CA  . GLY A 52  ? 0.4121 0.4863 0.4206 -0.0578 0.0454  0.0267  1310 GLY A CA  
376  C C   . GLY A 52  ? 0.4272 0.5254 0.4382 -0.0548 0.0536  0.0391  1310 GLY A C   
377  O O   . GLY A 52  ? 0.4268 0.5560 0.4344 -0.0518 0.0609  0.0466  1310 GLY A O   
378  N N   . HIS A 53  ? 0.4318 0.5184 0.4473 -0.0535 0.0526  0.0407  1311 HIS A N   
379  C CA  . HIS A 53  ? 0.4512 0.5622 0.4713 -0.0495 0.0595  0.0538  1311 HIS A CA  
380  C C   . HIS A 53  ? 0.4500 0.5399 0.4631 -0.0412 0.0677  0.0405  1311 HIS A C   
381  O O   . HIS A 53  ? 0.4616 0.5262 0.4787 -0.0449 0.0590  0.0373  1311 HIS A O   
382  C CB  . HIS A 53  ? 0.4553 0.5822 0.4957 -0.0622 0.0427  0.0816  1311 HIS A CB  
383  C CG  . HIS A 53  ? 0.4874 0.6329 0.5364 -0.0731 0.0312  0.0985  1311 HIS A CG  
384  N ND1 . HIS A 53  ? 0.5408 0.7360 0.5969 -0.0749 0.0355  0.1209  1311 HIS A ND1 
385  C CD2 . HIS A 53  ? 0.5033 0.6266 0.5537 -0.0811 0.0155  0.0968  1311 HIS A CD2 
386  C CE1 . HIS A 53  ? 0.5425 0.7444 0.6055 -0.0864 0.0222  0.1340  1311 HIS A CE1 
387  N NE2 . HIS A 53  ? 0.5493 0.7053 0.6085 -0.0899 0.0095  0.1187  1311 HIS A NE2 
388  N N   . PRO A 54  ? 0.4545 0.5530 0.4548 -0.0283 0.0830  0.0319  1312 PRO A N   
389  C CA  . PRO A 54  ? 0.4574 0.5361 0.4517 -0.0207 0.0894  0.0222  1312 PRO A CA  
390  C C   . PRO A 54  ? 0.4541 0.5408 0.4646 -0.0247 0.0824  0.0392  1312 PRO A C   
391  O O   . PRO A 54  ? 0.4557 0.5780 0.4773 -0.0251 0.0815  0.0595  1312 PRO A O   
392  C CB  . PRO A 54  ? 0.4709 0.5621 0.4485 -0.0040 0.1029  0.0145  1312 PRO A CB  
393  C CG  . PRO A 54  ? 0.4773 0.5815 0.4459 -0.0034 0.1040  0.0106  1312 PRO A CG  
394  C CD  . PRO A 54  ? 0.4578 0.5815 0.4457 -0.0181 0.0931  0.0296  1312 PRO A CD  
395  N N   . LEU A 55  ? 0.4552 0.5122 0.4667 -0.0280 0.0766  0.0325  1313 LEU A N   
396  C CA  . LEU A 55  ? 0.4503 0.5071 0.4748 -0.0331 0.0661  0.0464  1313 LEU A CA  
397  C C   . LEU A 55  ? 0.4495 0.4806 0.4655 -0.0265 0.0712  0.0333  1313 LEU A C   
398  O O   . LEU A 55  ? 0.4638 0.4754 0.4664 -0.0216 0.0794  0.0157  1313 LEU A O   
399  C CB  . LEU A 55  ? 0.4428 0.4860 0.4769 -0.0462 0.0446  0.0543  1313 LEU A CB  
400  C CG  . LEU A 55  ? 0.4683 0.5319 0.5144 -0.0576 0.0321  0.0730  1313 LEU A CG  
401  C CD1 . LEU A 55  ? 0.4764 0.5087 0.5236 -0.0659 0.0092  0.0712  1313 LEU A CD1 
402  C CD2 . LEU A 55  ? 0.4174 0.5195 0.4819 -0.0653 0.0266  0.1027  1313 LEU A CD2 
403  N N   . ARG A 56  ? 0.4418 0.4746 0.4664 -0.0277 0.0650  0.0441  1314 ARG A N   
404  C CA  . ARG A 56  ? 0.4465 0.4571 0.4638 -0.0220 0.0684  0.0343  1314 ARG A CA  
405  C C   . ARG A 56  ? 0.4410 0.4240 0.4557 -0.0270 0.0540  0.0275  1314 ARG A C   
406  O O   . ARG A 56  ? 0.4353 0.4086 0.4524 -0.0279 0.0443  0.0318  1314 ARG A O   
407  C CB  . ARG A 56  ? 0.4469 0.4753 0.4733 -0.0188 0.0690  0.0489  1314 ARG A CB  
408  C CG  . ARG A 56  ? 0.4970 0.5377 0.5151 -0.0038 0.0866  0.0445  1314 ARG A CG  
409  C CD  . ARG A 56  ? 0.5187 0.6031 0.5489 0.0010  0.0894  0.0644  1314 ARG A CD  
410  N NE  . ARG A 56  ? 0.5773 0.6751 0.6223 -0.0026 0.0815  0.0817  1314 ARG A NE  
411  C CZ  . ARG A 56  ? 0.6036 0.7247 0.6688 -0.0171 0.0664  0.1053  1314 ARG A CZ  
412  N NH1 . ARG A 56  ? 0.6402 0.7724 0.7133 -0.0293 0.0571  0.1148  1314 ARG A NH1 
413  N NH2 . ARG A 56  ? 0.6012 0.7339 0.6792 -0.0208 0.0583  0.1210  1314 ARG A NH2 
414  N N   . ASN A 57  ? 0.4342 0.4065 0.4426 -0.0283 0.0519  0.0167  1315 ASN A N   
415  C CA  . ASN A 57  ? 0.4362 0.3860 0.4383 -0.0271 0.0393  0.0077  1315 ASN A CA  
416  C C   . ASN A 57  ? 0.4340 0.3756 0.4236 -0.0199 0.0518  -0.0079 1315 ASN A C   
417  O O   . ASN A 57  ? 0.4336 0.3809 0.4198 -0.0190 0.0671  -0.0115 1315 ASN A O   
418  C CB  . ASN A 57  ? 0.4451 0.3908 0.4500 -0.0320 0.0238  0.0095  1315 ASN A CB  
419  C CG  . ASN A 57  ? 0.4427 0.4013 0.4465 -0.0332 0.0346  0.0049  1315 ASN A CG  
420  O OD1 . ASN A 57  ? 0.4612 0.4249 0.4586 -0.0296 0.0514  -0.0040 1315 ASN A OD1 
421  N ND2 . ASN A 57  ? 0.4671 0.4280 0.4764 -0.0390 0.0221  0.0114  1315 ASN A ND2 
422  N N   . GLU A 58  ? 0.4364 0.3649 0.4179 -0.0141 0.0432  -0.0162 1316 GLU A N   
423  C CA  . GLU A 58  ? 0.4241 0.3527 0.3956 -0.0075 0.0532  -0.0265 1316 GLU A CA  
424  C C   . GLU A 58  ? 0.4159 0.3555 0.3865 -0.0108 0.0651  -0.0315 1316 GLU A C   
425  O O   . GLU A 58  ? 0.4155 0.3579 0.3835 -0.0131 0.0771  -0.0324 1316 GLU A O   
426  C CB  . GLU A 58  ? 0.4316 0.3514 0.3928 0.0033  0.0401  -0.0345 1316 GLU A CB  
427  C CG  . GLU A 58  ? 0.4272 0.3580 0.3787 0.0116  0.0504  -0.0418 1316 GLU A CG  
428  C CD  . GLU A 58  ? 0.4318 0.3615 0.3698 0.0283  0.0386  -0.0519 1316 GLU A CD  
429  O OE1 . GLU A 58  ? 0.4731 0.3827 0.4057 0.0345  0.0189  -0.0550 1316 GLU A OE1 
430  O OE2 . GLU A 58  ? 0.4760 0.4259 0.4077 0.0363  0.0475  -0.0561 1316 GLU A OE2 
431  N N   . LYS A 59  ? 0.4205 0.3643 0.3931 -0.0120 0.0596  -0.0339 1317 LYS A N   
432  C CA  . LYS A 59  ? 0.4126 0.3680 0.3847 -0.0163 0.0692  -0.0381 1317 LYS A CA  
433  C C   . LYS A 59  ? 0.4115 0.3676 0.3846 -0.0237 0.0797  -0.0355 1317 LYS A C   
434  O O   . LYS A 59  ? 0.4201 0.3772 0.3890 -0.0278 0.0874  -0.0387 1317 LYS A O   
435  C CB  . LYS A 59  ? 0.4098 0.3699 0.3842 -0.0157 0.0604  -0.0402 1317 LYS A CB  
436  C CG  . LYS A 59  ? 0.4263 0.3877 0.3946 -0.0036 0.0512  -0.0474 1317 LYS A CG  
437  C CD  . LYS A 59  ? 0.3970 0.3590 0.3671 -0.0018 0.0403  -0.0490 1317 LYS A CD  
438  C CE  . LYS A 59  ? 0.4001 0.3581 0.3605 0.0156  0.0273  -0.0577 1317 LYS A CE  
439  N NZ  . LYS A 59  ? 0.3962 0.3445 0.3579 0.0172  0.0112  -0.0576 1317 LYS A NZ  
440  N N   . TYR A 60  ? 0.4120 0.3686 0.3894 -0.0247 0.0782  -0.0290 1318 TYR A N   
441  C CA  . TYR A 60  ? 0.4118 0.3710 0.3858 -0.0257 0.0872  -0.0287 1318 TYR A CA  
442  C C   . TYR A 60  ? 0.4257 0.3729 0.3928 -0.0228 0.0945  -0.0309 1318 TYR A C   
443  O O   . TYR A 60  ? 0.4326 0.3707 0.3909 -0.0248 0.0991  -0.0368 1318 TYR A O   
444  C CB  . TYR A 60  ? 0.4101 0.3831 0.3908 -0.0246 0.0849  -0.0184 1318 TYR A CB  
445  C CG  . TYR A 60  ? 0.4153 0.3959 0.3881 -0.0209 0.0935  -0.0210 1318 TYR A CG  
446  C CD1 . TYR A 60  ? 0.4140 0.4058 0.3854 -0.0237 0.0926  -0.0222 1318 TYR A CD1 
447  C CD2 . TYR A 60  ? 0.4282 0.4025 0.3920 -0.0125 0.1011  -0.0239 1318 TYR A CD2 
448  C CE1 . TYR A 60  ? 0.4189 0.4166 0.3783 -0.0173 0.0991  -0.0269 1318 TYR A CE1 
449  C CE2 . TYR A 60  ? 0.4544 0.4314 0.4050 -0.0043 0.1066  -0.0297 1318 TYR A CE2 
450  C CZ  . TYR A 60  ? 0.4413 0.4301 0.3890 -0.0065 0.1056  -0.0317 1318 TYR A CZ  
451  O OH  . TYR A 60  ? 0.4591 0.4495 0.3897 0.0041  0.1095  -0.0394 1318 TYR A OH  
452  N N   . LEU A 61  ? 0.4185 0.3629 0.3889 -0.0189 0.0929  -0.0255 1319 LEU A N   
453  C CA  . LEU A 61  ? 0.4396 0.3722 0.4039 -0.0152 0.0987  -0.0258 1319 LEU A CA  
454  C C   . LEU A 61  ? 0.4540 0.3768 0.4123 -0.0199 0.1006  -0.0301 1319 LEU A C   
455  O O   . LEU A 61  ? 0.4772 0.3859 0.4278 -0.0210 0.1039  -0.0317 1319 LEU A O   
456  C CB  . LEU A 61  ? 0.4290 0.3635 0.3993 -0.0107 0.0955  -0.0177 1319 LEU A CB  
457  C CG  . LEU A 61  ? 0.4333 0.3848 0.4127 -0.0083 0.0931  -0.0076 1319 LEU A CG  
458  C CD1 . LEU A 61  ? 0.4085 0.3624 0.3957 -0.0072 0.0865  0.0022  1319 LEU A CD1 
459  C CD2 . LEU A 61  ? 0.4349 0.3923 0.4079 0.0000  0.1024  -0.0086 1319 LEU A CD2 
460  N N   . ALA A 62  ? 0.4456 0.3769 0.4068 -0.0219 0.0971  -0.0310 1320 ALA A N   
461  C CA  . ALA A 62  ? 0.4553 0.3894 0.4133 -0.0265 0.0995  -0.0309 1320 ALA A CA  
462  C C   . ALA A 62  ? 0.4672 0.4013 0.4232 -0.0365 0.1009  -0.0328 1320 ALA A C   
463  O O   . ALA A 62  ? 0.4745 0.4045 0.4278 -0.0445 0.1017  -0.0288 1320 ALA A O   
464  C CB  . ALA A 62  ? 0.4436 0.3936 0.4027 -0.0206 0.0957  -0.0317 1320 ALA A CB  
465  N N   . SER A 63  ? 0.4572 0.3963 0.4149 -0.0374 0.0990  -0.0372 1321 SER A N   
466  C CA  . SER A 63  ? 0.4727 0.4093 0.4269 -0.0467 0.0982  -0.0400 1321 SER A CA  
467  C C   . SER A 63  ? 0.4908 0.4015 0.4339 -0.0481 0.0978  -0.0424 1321 SER A C   
468  O O   . SER A 63  ? 0.5088 0.4074 0.4463 -0.0583 0.0937  -0.0423 1321 SER A O   
469  C CB  . SER A 63  ? 0.4631 0.4096 0.4199 -0.0453 0.0961  -0.0441 1321 SER A CB  
470  O OG  . SER A 63  ? 0.4538 0.4189 0.4181 -0.0425 0.0933  -0.0433 1321 SER A OG  
471  N N   . VAL A 64  ? 0.4953 0.3978 0.4346 -0.0371 0.1002  -0.0440 1322 VAL A N   
472  C CA  . VAL A 64  ? 0.5199 0.3971 0.4452 -0.0318 0.0992  -0.0481 1322 VAL A CA  
473  C C   . VAL A 64  ? 0.5360 0.3942 0.4581 -0.0367 0.0969  -0.0434 1322 VAL A C   
474  O O   . VAL A 64  ? 0.5591 0.3908 0.4695 -0.0423 0.0898  -0.0456 1322 VAL A O   
475  C CB  . VAL A 64  ? 0.5194 0.4029 0.4432 -0.0160 0.1036  -0.0484 1322 VAL A CB  
476  C CG1 . VAL A 64  ? 0.5478 0.4057 0.4538 -0.0043 0.1023  -0.0545 1322 VAL A CG1 
477  C CG2 . VAL A 64  ? 0.4956 0.4002 0.4224 -0.0134 0.1046  -0.0498 1322 VAL A CG2 
478  N N   . ALA A 65  ? 0.5149 0.3852 0.4463 -0.0352 0.1005  -0.0361 1323 ALA A N   
479  C CA  . ALA A 65  ? 0.5267 0.3845 0.4562 -0.0396 0.0989  -0.0289 1323 ALA A CA  
480  C C   . ALA A 65  ? 0.5404 0.3967 0.4703 -0.0569 0.0933  -0.0230 1323 ALA A C   
481  O O   . ALA A 65  ? 0.5667 0.4042 0.4919 -0.0646 0.0878  -0.0158 1323 ALA A O   
482  C CB  . ALA A 65  ? 0.5160 0.3923 0.4544 -0.0346 0.1030  -0.0226 1323 ALA A CB  
483  N N   . ALA A 66  ? 0.5275 0.4052 0.4639 -0.0642 0.0933  -0.0237 1324 ALA A N   
484  C CA  . ALA A 66  ? 0.5374 0.4225 0.4773 -0.0824 0.0874  -0.0147 1324 ALA A CA  
485  C C   . ALA A 66  ? 0.5503 0.4162 0.4826 -0.0917 0.0784  -0.0206 1324 ALA A C   
486  O O   . ALA A 66  ? 0.5578 0.4301 0.4942 -0.1095 0.0708  -0.0119 1324 ALA A O   
487  C CB  . ALA A 66  ? 0.5099 0.4394 0.4630 -0.0836 0.0928  -0.0082 1324 ALA A CB  
488  N N   . GLY A 67  ? 0.5549 0.4012 0.4759 -0.0794 0.0783  -0.0342 1325 GLY A N   
489  C CA  . GLY A 67  ? 0.5752 0.3994 0.4833 -0.0842 0.0684  -0.0427 1325 GLY A CA  
490  C C   . GLY A 67  ? 0.5564 0.4072 0.4735 -0.0942 0.0677  -0.0421 1325 GLY A C   
491  O O   . GLY A 67  ? 0.5753 0.4152 0.4883 -0.1093 0.0561  -0.0405 1325 GLY A O   
492  N N   . LYS A 68  ? 0.5220 0.4061 0.4510 -0.0859 0.0778  -0.0429 1326 LYS A N   
493  C CA  . LYS A 68  ? 0.5026 0.4118 0.4393 -0.0919 0.0771  -0.0432 1326 LYS A CA  
494  C C   . LYS A 68  ? 0.5068 0.4021 0.4309 -0.0862 0.0738  -0.0552 1326 LYS A C   
495  O O   . LYS A 68  ? 0.4968 0.3721 0.4079 -0.0732 0.0751  -0.0629 1326 LYS A O   
496  C CB  . LYS A 68  ? 0.4741 0.4173 0.4247 -0.0826 0.0855  -0.0408 1326 LYS A CB  
497  C CG  . LYS A 68  ? 0.4679 0.4270 0.4266 -0.0806 0.0900  -0.0318 1326 LYS A CG  
498  C CD  . LYS A 68  ? 0.4929 0.4727 0.4591 -0.0955 0.0871  -0.0194 1326 LYS A CD  
499  C CE  . LYS A 68  ? 0.5041 0.5126 0.4774 -0.0885 0.0933  -0.0108 1326 LYS A CE  
500  N NZ  . LYS A 68  ? 0.5166 0.5560 0.4990 -0.1029 0.0916  0.0055  1326 LYS A NZ  
501  N N   . TRP A 69  ? 0.5018 0.4118 0.4291 -0.0943 0.0697  -0.0560 1327 TRP A N   
502  C CA  . TRP A 69  ? 0.5067 0.4147 0.4240 -0.0868 0.0687  -0.0659 1327 TRP A CA  
503  C C   . TRP A 69  ? 0.4807 0.4104 0.4066 -0.0725 0.0784  -0.0654 1327 TRP A C   
504  O O   . TRP A 69  ? 0.4596 0.4135 0.4008 -0.0732 0.0814  -0.0595 1327 TRP A O   
505  C CB  . TRP A 69  ? 0.5142 0.4377 0.4360 -0.0997 0.0619  -0.0647 1327 TRP A CB  
506  C CG  . TRP A 69  ? 0.5611 0.4614 0.4737 -0.1168 0.0475  -0.0639 1327 TRP A CG  
507  C CD1 . TRP A 69  ? 0.5755 0.4883 0.5009 -0.1365 0.0410  -0.0507 1327 TRP A CD1 
508  C CD2 . TRP A 69  ? 0.6287 0.4892 0.5161 -0.1160 0.0351  -0.0756 1327 TRP A CD2 
509  N NE1 . TRP A 69  ? 0.6324 0.5126 0.5443 -0.1521 0.0231  -0.0514 1327 TRP A NE1 
510  C CE2 . TRP A 69  ? 0.6544 0.4979 0.5406 -0.1385 0.0182  -0.0688 1327 TRP A CE2 
511  C CE3 . TRP A 69  ? 0.6337 0.4732 0.4982 -0.0969 0.0353  -0.0907 1327 TRP A CE3 
512  C CZ2 . TRP A 69  ? 0.6993 0.4960 0.5598 -0.1431 -0.0015 -0.0788 1327 TRP A CZ2 
513  C CZ3 . TRP A 69  ? 0.6938 0.4911 0.5306 -0.0971 0.0182  -0.1026 1327 TRP A CZ3 
514  C CH2 . TRP A 69  ? 0.7272 0.4989 0.5611 -0.1203 -0.0013 -0.0977 1327 TRP A CH2 
515  N N   . VAL A 70  ? 0.4825 0.4043 0.3978 -0.0589 0.0817  -0.0706 1328 VAL A N   
516  C CA  . VAL A 70  ? 0.4556 0.3990 0.3802 -0.0487 0.0879  -0.0659 1328 VAL A CA  
517  C C   . VAL A 70  ? 0.4597 0.4151 0.3769 -0.0443 0.0868  -0.0691 1328 VAL A C   
518  O O   . VAL A 70  ? 0.4683 0.4147 0.3679 -0.0346 0.0871  -0.0759 1328 VAL A O   
519  C CB  . VAL A 70  ? 0.4595 0.3970 0.3826 -0.0371 0.0933  -0.0633 1328 VAL A CB  
520  C CG1 . VAL A 70  ? 0.4355 0.3978 0.3694 -0.0301 0.0963  -0.0547 1328 VAL A CG1 
521  C CG2 . VAL A 70  ? 0.4458 0.3743 0.3763 -0.0414 0.0940  -0.0592 1328 VAL A CG2 
522  N N   . LEU A 71  ? 0.4492 0.4252 0.3781 -0.0497 0.0848  -0.0644 1329 LEU A N   
523  C CA  . LEU A 71  ? 0.4563 0.4430 0.3779 -0.0500 0.0818  -0.0674 1329 LEU A CA  
524  C C   . LEU A 71  ? 0.4468 0.4595 0.3782 -0.0457 0.0828  -0.0574 1329 LEU A C   
525  O O   . LEU A 71  ? 0.4261 0.4467 0.3736 -0.0476 0.0811  -0.0485 1329 LEU A O   
526  C CB  . LEU A 71  ? 0.4615 0.4494 0.3863 -0.0629 0.0754  -0.0698 1329 LEU A CB  
527  C CG  . LEU A 71  ? 0.4836 0.4502 0.4021 -0.0731 0.0705  -0.0744 1329 LEU A CG  
528  C CD1 . LEU A 71  ? 0.5017 0.4839 0.4306 -0.0866 0.0648  -0.0709 1329 LEU A CD1 
529  C CD2 . LEU A 71  ? 0.4918 0.4309 0.3856 -0.0697 0.0651  -0.0853 1329 LEU A CD2 
530  N N   . HIS A 72  ? 0.4471 0.4719 0.3668 -0.0397 0.0835  -0.0585 1330 HIS A N   
531  C CA  . HIS A 72  ? 0.4345 0.4886 0.3627 -0.0383 0.0828  -0.0459 1330 HIS A CA  
532  C C   . HIS A 72  ? 0.4278 0.4894 0.3653 -0.0486 0.0753  -0.0434 1330 HIS A C   
533  O O   . HIS A 72  ? 0.4389 0.4905 0.3702 -0.0543 0.0723  -0.0533 1330 HIS A O   
534  C CB  . HIS A 72  ? 0.4520 0.5216 0.3611 -0.0260 0.0870  -0.0485 1330 HIS A CB  
535  C CG  . HIS A 72  ? 0.4395 0.5471 0.3575 -0.0249 0.0870  -0.0312 1330 HIS A CG  
536  N ND1 . HIS A 72  ? 0.4509 0.5747 0.3663 -0.0290 0.0826  -0.0289 1330 HIS A ND1 
537  C CD2 . HIS A 72  ? 0.4235 0.5580 0.3549 -0.0226 0.0892  -0.0123 1330 HIS A CD2 
538  C CE1 . HIS A 72  ? 0.4287 0.5877 0.3552 -0.0292 0.0823  -0.0086 1330 HIS A CE1 
539  N NE2 . HIS A 72  ? 0.4205 0.5874 0.3577 -0.0263 0.0856  0.0026  1330 HIS A NE2 
540  N N   . ARG A 73  ? 0.4181 0.4975 0.3704 -0.0514 0.0702  -0.0290 1331 ARG A N   
541  C CA  . ARG A 73  ? 0.4140 0.4988 0.3750 -0.0585 0.0613  -0.0261 1331 ARG A CA  
542  C C   . ARG A 73  ? 0.4221 0.5173 0.3715 -0.0604 0.0604  -0.0319 1331 ARG A C   
543  O O   . ARG A 73  ? 0.4185 0.5143 0.3725 -0.0661 0.0544  -0.0344 1331 ARG A O   
544  C CB  . ARG A 73  ? 0.4101 0.5066 0.3865 -0.0611 0.0519  -0.0079 1331 ARG A CB  
545  C CG  . ARG A 73  ? 0.4300 0.5561 0.4053 -0.0618 0.0514  0.0069  1331 ARG A CG  
546  C CD  . ARG A 73  ? 0.4488 0.5838 0.4419 -0.0686 0.0383  0.0297  1331 ARG A CD  
547  N NE  . ARG A 73  ? 0.4661 0.6018 0.4663 -0.0679 0.0397  0.0395  1331 ARG A NE  
548  C CZ  . ARG A 73  ? 0.4613 0.5846 0.4758 -0.0740 0.0258  0.0523  1331 ARG A CZ  
549  N NH1 . ARG A 73  ? 0.4589 0.5638 0.4803 -0.0791 0.0082  0.0552  1331 ARG A NH1 
550  N NH2 . ARG A 73  ? 0.4533 0.5809 0.4738 -0.0740 0.0276  0.0616  1331 ARG A NH2 
551  N N   . SER A 74  ? 0.4293 0.5348 0.3624 -0.0539 0.0657  -0.0340 1332 SER A N   
552  C CA  . SER A 74  ? 0.4387 0.5508 0.3562 -0.0542 0.0633  -0.0418 1332 SER A CA  
553  C C   . SER A 74  ? 0.4407 0.5287 0.3511 -0.0611 0.0595  -0.0572 1332 SER A C   
554  O O   . SER A 74  ? 0.4556 0.5478 0.3608 -0.0669 0.0534  -0.0613 1332 SER A O   
555  C CB  . SER A 74  ? 0.4499 0.5764 0.3452 -0.0408 0.0691  -0.0446 1332 SER A CB  
556  O OG  . SER A 74  ? 0.4654 0.5716 0.3475 -0.0311 0.0746  -0.0556 1332 SER A OG  
557  N N   . TYR A 75  ? 0.4493 0.5148 0.3608 -0.0622 0.0619  -0.0633 1333 TYR A N   
558  C CA  . TYR A 75  ? 0.4603 0.5087 0.3715 -0.0728 0.0568  -0.0714 1333 TYR A CA  
559  C C   . TYR A 75  ? 0.4547 0.5202 0.3825 -0.0819 0.0512  -0.0656 1333 TYR A C   
560  O O   . TYR A 75  ? 0.4687 0.5360 0.3920 -0.0905 0.0444  -0.0696 1333 TYR A O   
561  C CB  . TYR A 75  ? 0.4577 0.4874 0.3745 -0.0742 0.0602  -0.0725 1333 TYR A CB  
562  C CG  . TYR A 75  ? 0.4734 0.4944 0.3938 -0.0878 0.0542  -0.0750 1333 TYR A CG  
563  C CD1 . TYR A 75  ? 0.5167 0.5167 0.4193 -0.0953 0.0455  -0.0836 1333 TYR A CD1 
564  C CD2 . TYR A 75  ? 0.4656 0.5012 0.4060 -0.0928 0.0550  -0.0674 1333 TYR A CD2 
565  C CE1 . TYR A 75  ? 0.5328 0.5289 0.4416 -0.1122 0.0372  -0.0809 1333 TYR A CE1 
566  C CE2 . TYR A 75  ? 0.4744 0.5133 0.4208 -0.1062 0.0500  -0.0651 1333 TYR A CE2 
567  C CZ  . TYR A 75  ? 0.5149 0.5351 0.4474 -0.1181 0.0408  -0.0699 1333 TYR A CZ  
568  O OH  . TYR A 75  ? 0.5416 0.5683 0.4827 -0.1353 0.0332  -0.0629 1333 TYR A OH  
569  N N   . LEU A 76  ? 0.4381 0.5148 0.3839 -0.0790 0.0522  -0.0564 1334 LEU A N   
570  C CA  . LEU A 76  ? 0.4293 0.5214 0.3895 -0.0821 0.0463  -0.0519 1334 LEU A CA  
571  C C   . LEU A 76  ? 0.4425 0.5510 0.4006 -0.0838 0.0403  -0.0485 1334 LEU A C   
572  O O   . LEU A 76  ? 0.4393 0.5606 0.4033 -0.0887 0.0348  -0.0484 1334 LEU A O   
573  C CB  . LEU A 76  ? 0.4138 0.5061 0.3880 -0.0745 0.0454  -0.0457 1334 LEU A CB  
574  C CG  . LEU A 76  ? 0.4155 0.4968 0.3926 -0.0723 0.0506  -0.0488 1334 LEU A CG  
575  C CD1 . LEU A 76  ? 0.4206 0.4984 0.4067 -0.0622 0.0469  -0.0447 1334 LEU A CD1 
576  C CD2 . LEU A 76  ? 0.4212 0.5121 0.4014 -0.0793 0.0510  -0.0517 1334 LEU A CD2 
577  N N   . GLU A 77  ? 0.4558 0.5689 0.4064 -0.0797 0.0415  -0.0439 1335 GLU A N   
578  C CA  . GLU A 77  ? 0.4697 0.6008 0.4156 -0.0814 0.0362  -0.0398 1335 GLU A CA  
579  C C   . GLU A 77  ? 0.4855 0.6145 0.4146 -0.0868 0.0339  -0.0512 1335 GLU A C   
580  O O   . GLU A 77  ? 0.5045 0.6473 0.4340 -0.0915 0.0271  -0.0497 1335 GLU A O   
581  C CB  . GLU A 77  ? 0.4787 0.6233 0.4204 -0.0759 0.0384  -0.0290 1335 GLU A CB  
582  C CG  . GLU A 77  ? 0.4628 0.6111 0.4230 -0.0754 0.0335  -0.0125 1335 GLU A CG  
583  C CD  . GLU A 77  ? 0.4740 0.6205 0.4486 -0.0777 0.0221  -0.0087 1335 GLU A CD  
584  O OE1 . GLU A 77  ? 0.4926 0.6511 0.4660 -0.0806 0.0168  -0.0085 1335 GLU A OE1 
585  O OE2 . GLU A 77  ? 0.4933 0.6254 0.4785 -0.0747 0.0176  -0.0067 1335 GLU A OE2 
586  N N   . ALA A 78  ? 0.4957 0.6044 0.4086 -0.0860 0.0369  -0.0626 1336 ALA A N   
587  C CA  . ALA A 78  ? 0.5179 0.6145 0.4128 -0.0928 0.0294  -0.0743 1336 ALA A CA  
588  C C   . ALA A 78  ? 0.5174 0.6161 0.4280 -0.1071 0.0229  -0.0726 1336 ALA A C   
589  O O   . ALA A 78  ? 0.5327 0.6359 0.4384 -0.1166 0.0132  -0.0750 1336 ALA A O   
590  C CB  . ALA A 78  ? 0.5362 0.6037 0.4083 -0.0870 0.0305  -0.0869 1336 ALA A CB  
591  N N   . CYS A 79  ? 0.4982 0.5979 0.4273 -0.1079 0.0277  -0.0671 1337 CYS A N   
592  C CA  . CYS A 79  ? 0.4962 0.6102 0.4426 -0.1183 0.0235  -0.0620 1337 CYS A CA  
593  C C   . CYS A 79  ? 0.4923 0.6356 0.4514 -0.1176 0.0190  -0.0551 1337 CYS A C   
594  O O   . CYS A 79  ? 0.4968 0.6554 0.4607 -0.1281 0.0116  -0.0529 1337 CYS A O   
595  C CB  . CYS A 79  ? 0.4710 0.5856 0.4322 -0.1143 0.0307  -0.0576 1337 CYS A CB  
596  S SG  . CYS A 79  ? 0.4728 0.5554 0.4227 -0.1191 0.0335  -0.0631 1337 CYS A SG  
597  N N   . ARG A 80  ? 0.4941 0.6444 0.4590 -0.1058 0.0216  -0.0503 1338 ARG A N   
598  C CA  . ARG A 80  ? 0.5053 0.6778 0.4803 -0.1023 0.0155  -0.0433 1338 ARG A CA  
599  C C   . ARG A 80  ? 0.5281 0.7105 0.4929 -0.1107 0.0084  -0.0447 1338 ARG A C   
600  O O   . ARG A 80  ? 0.5367 0.7405 0.5110 -0.1143 0.0018  -0.0407 1338 ARG A O   
601  C CB  . ARG A 80  ? 0.4984 0.6664 0.4765 -0.0912 0.0156  -0.0366 1338 ARG A CB  
602  C CG  . ARG A 80  ? 0.5246 0.7077 0.5099 -0.0874 0.0062  -0.0278 1338 ARG A CG  
603  C CD  . ARG A 80  ? 0.5568 0.7298 0.5455 -0.0805 0.0026  -0.0180 1338 ARG A CD  
604  N NE  . ARG A 80  ? 0.5855 0.7502 0.5858 -0.0700 -0.0042 -0.0164 1338 ARG A NE  
605  C CZ  . ARG A 80  ? 0.6048 0.7504 0.6075 -0.0639 -0.0048 -0.0154 1338 ARG A CZ  
606  N NH1 . ARG A 80  ? 0.5991 0.7348 0.5969 -0.0682 0.0022  -0.0134 1338 ARG A NH1 
607  N NH2 . ARG A 80  ? 0.6438 0.7806 0.6526 -0.0513 -0.0139 -0.0167 1338 ARG A NH2 
608  N N   . THR A 81  ? 0.5511 0.7194 0.4950 -0.1118 0.0093  -0.0511 1339 THR A N   
609  C CA  . THR A 81  ? 0.5731 0.7473 0.5011 -0.1173 0.0015  -0.0549 1339 THR A CA  
610  C C   . THR A 81  ? 0.5890 0.7594 0.5151 -0.1321 -0.0073 -0.0602 1339 THR A C   
611  O O   . THR A 81  ? 0.5935 0.7811 0.5218 -0.1400 -0.0167 -0.0576 1339 THR A O   
612  C CB  . THR A 81  ? 0.5895 0.7499 0.4907 -0.1096 0.0048  -0.0625 1339 THR A CB  
613  O OG1 . THR A 81  ? 0.5822 0.7559 0.4886 -0.0992 0.0114  -0.0520 1339 THR A OG1 
614  C CG2 . THR A 81  ? 0.6276 0.7911 0.5066 -0.1126 -0.0046 -0.0697 1339 THR A CG2 
615  N N   . ALA A 82  ? 0.5897 0.7385 0.5129 -0.1374 -0.0061 -0.0653 1340 ALA A N   
616  C CA  . ALA A 82  ? 0.6098 0.7506 0.5304 -0.1552 -0.0179 -0.0674 1340 ALA A CA  
617  C C   . ALA A 82  ? 0.5919 0.7669 0.5414 -0.1649 -0.0200 -0.0540 1340 ALA A C   
618  O O   . ALA A 82  ? 0.6067 0.7915 0.5595 -0.1821 -0.0326 -0.0499 1340 ALA A O   
619  C CB  . ALA A 82  ? 0.6301 0.7360 0.5388 -0.1580 -0.0178 -0.0745 1340 ALA A CB  
620  N N   . GLY A 83  ? 0.5569 0.7515 0.5261 -0.1528 -0.0092 -0.0469 1341 GLY A N   
621  C CA  . GLY A 83  ? 0.5363 0.7688 0.5310 -0.1543 -0.0090 -0.0351 1341 GLY A CA  
622  C C   . GLY A 83  ? 0.5371 0.7727 0.5419 -0.1631 -0.0065 -0.0295 1341 GLY A C   
623  O O   . GLY A 83  ? 0.5239 0.7984 0.5490 -0.1671 -0.0073 -0.0174 1341 GLY A O   
624  N N   . HIS A 84  ? 0.5467 0.7452 0.5371 -0.1652 -0.0038 -0.0368 1342 HIS A N   
625  C CA  . HIS A 84  ? 0.5462 0.7418 0.5438 -0.1737 -0.0016 -0.0309 1342 HIS A CA  
626  C C   . HIS A 84  ? 0.5474 0.7005 0.5281 -0.1663 0.0047  -0.0412 1342 HIS A C   
627  O O   . HIS A 84  ? 0.5482 0.6770 0.5110 -0.1564 0.0063  -0.0523 1342 HIS A O   
628  C CB  . HIS A 84  ? 0.5786 0.7757 0.5777 -0.2007 -0.0172 -0.0227 1342 HIS A CB  
629  C CG  . HIS A 84  ? 0.6339 0.7853 0.6054 -0.2109 -0.0314 -0.0351 1342 HIS A CG  
630  N ND1 . HIS A 84  ? 0.6770 0.8310 0.6399 -0.2180 -0.0439 -0.0383 1342 HIS A ND1 
631  C CD2 . HIS A 84  ? 0.6736 0.7749 0.6216 -0.2125 -0.0364 -0.0463 1342 HIS A CD2 
632  C CE1 . HIS A 84  ? 0.7157 0.8225 0.6489 -0.2225 -0.0564 -0.0521 1342 HIS A CE1 
633  N NE2 . HIS A 84  ? 0.7292 0.8028 0.6525 -0.2182 -0.0523 -0.0575 1342 HIS A NE2 
634  N N   . PHE A 85  ? 0.5342 0.6833 0.5212 -0.1706 0.0083  -0.0358 1343 PHE A N   
635  C CA  . PHE A 85  ? 0.5342 0.6435 0.5060 -0.1653 0.0127  -0.0442 1343 PHE A CA  
636  C C   . PHE A 85  ? 0.5686 0.6351 0.5157 -0.1764 -0.0006 -0.0538 1343 PHE A C   
637  O O   . PHE A 85  ? 0.5955 0.6547 0.5427 -0.1973 -0.0150 -0.0475 1343 PHE A O   
638  C CB  . PHE A 85  ? 0.5240 0.6424 0.5090 -0.1678 0.0187  -0.0344 1343 PHE A CB  
639  C CG  . PHE A 85  ? 0.4845 0.6341 0.4850 -0.1492 0.0316  -0.0304 1343 PHE A CG  
640  C CD1 . PHE A 85  ? 0.4704 0.6039 0.4642 -0.1298 0.0399  -0.0395 1343 PHE A CD1 
641  C CD2 . PHE A 85  ? 0.4840 0.6801 0.5046 -0.1503 0.0336  -0.0170 1343 PHE A CD2 
642  C CE1 . PHE A 85  ? 0.4441 0.5979 0.4484 -0.1123 0.0468  -0.0374 1343 PHE A CE1 
643  C CE2 . PHE A 85  ? 0.4662 0.6872 0.4956 -0.1283 0.0430  -0.0165 1343 PHE A CE2 
644  C CZ  . PHE A 85  ? 0.4544 0.6494 0.4743 -0.1097 0.0480  -0.0278 1343 PHE A CZ  
645  N N   . VAL A 86  ? 0.5668 0.6062 0.4920 -0.1617 0.0022  -0.0680 1344 VAL A N   
646  C CA  . VAL A 86  ? 0.6004 0.5963 0.4956 -0.1642 -0.0107 -0.0812 1344 VAL A CA  
647  C C   . VAL A 86  ? 0.6186 0.5777 0.5026 -0.1613 -0.0104 -0.0854 1344 VAL A C   
648  O O   . VAL A 86  ? 0.5861 0.5563 0.4864 -0.1575 0.0015  -0.0777 1344 VAL A O   
649  C CB  . VAL A 86  ? 0.6092 0.6003 0.4825 -0.1467 -0.0084 -0.0941 1344 VAL A CB  
650  C CG1 . VAL A 86  ? 0.5804 0.6035 0.4622 -0.1518 -0.0121 -0.0896 1344 VAL A CG1 
651  C CG2 . VAL A 86  ? 0.5713 0.5699 0.4465 -0.1254 0.0095  -0.0951 1344 VAL A CG2 
652  N N   . GLN A 87  ? 0.6640 0.5775 0.5182 -0.1616 -0.0255 -0.0984 1345 GLN A N   
653  C CA  A GLN A 87  ? 0.6903 0.5634 0.5295 -0.1557 -0.0276 -0.1044 1345 GLN A CA  
654  C CA  B GLN A 87  ? 0.6899 0.5621 0.5282 -0.1554 -0.0279 -0.1048 1345 GLN A CA  
655  C C   . GLN A 87  ? 0.6610 0.5435 0.5003 -0.1304 -0.0065 -0.1086 1345 GLN A C   
656  O O   . GLN A 87  ? 0.6531 0.5516 0.4847 -0.1134 0.0022  -0.1149 1345 GLN A O   
657  C CB  A GLN A 87  ? 0.7554 0.5733 0.5564 -0.1544 -0.0503 -0.1212 1345 GLN A CB  
658  C CB  B GLN A 87  ? 0.7532 0.5716 0.5523 -0.1526 -0.0499 -0.1226 1345 GLN A CB  
659  C CG  A GLN A 87  ? 0.8058 0.5964 0.6069 -0.1846 -0.0769 -0.1132 1345 GLN A CG  
660  C CG  B GLN A 87  ? 0.7968 0.5943 0.5936 -0.1819 -0.0775 -0.1171 1345 GLN A CG  
661  C CD  A GLN A 87  ? 0.8197 0.5995 0.6366 -0.1982 -0.0781 -0.0989 1345 GLN A CD  
662  C CD  B GLN A 87  ? 0.8676 0.6127 0.6214 -0.1764 -0.1025 -0.1379 1345 GLN A CD  
663  O OE1 A GLN A 87  ? 0.8323 0.5978 0.6436 -0.1811 -0.0667 -0.1037 1345 GLN A OE1 
664  O OE1 B GLN A 87  ? 0.9133 0.6154 0.6346 -0.1547 -0.1069 -0.1558 1345 GLN A OE1 
665  N NE2 A GLN A 87  ? 0.8212 0.6121 0.6586 -0.2295 -0.0924 -0.0789 1345 GLN A NE2 
666  N NE2 B GLN A 87  ? 0.8750 0.6240 0.6268 -0.1941 -0.1203 -0.1361 1345 GLN A NE2 
667  N N   . GLU A 88  ? 0.6439 0.5197 0.4932 -0.1296 0.0005  -0.1025 1346 GLU A N   
668  C CA  . GLU A 88  ? 0.6168 0.5034 0.4705 -0.1094 0.0188  -0.1029 1346 GLU A CA  
669  C C   . GLU A 88  ? 0.6488 0.5089 0.4734 -0.0863 0.0199  -0.1178 1346 GLU A C   
670  O O   . GLU A 88  ? 0.6273 0.5093 0.4549 -0.0687 0.0344  -0.1172 1346 GLU A O   
671  C CB  . GLU A 88  ? 0.5996 0.4886 0.4723 -0.1158 0.0250  -0.0915 1346 GLU A CB  
672  C CG  . GLU A 88  ? 0.5716 0.4987 0.4738 -0.1311 0.0284  -0.0757 1346 GLU A CG  
673  C CD  . GLU A 88  ? 0.5902 0.5119 0.4972 -0.1559 0.0130  -0.0663 1346 GLU A CD  
674  O OE1 . GLU A 88  ? 0.6539 0.5432 0.5419 -0.1654 -0.0045 -0.0728 1346 GLU A OE1 
675  O OE2 . GLU A 88  ? 0.5942 0.5464 0.5238 -0.1660 0.0170  -0.0510 1346 GLU A OE2 
676  N N   . GLU A 89  ? 0.7009 0.5155 0.4972 -0.0857 0.0029  -0.1301 1347 GLU A N   
677  C CA  . GLU A 89  ? 0.7437 0.5278 0.5095 -0.0602 0.0020  -0.1452 1347 GLU A CA  
678  C C   . GLU A 89  ? 0.7260 0.5400 0.4811 -0.0334 0.0160  -0.1515 1347 GLU A C   
679  O O   . GLU A 89  ? 0.7158 0.5377 0.4686 -0.0135 0.0281  -0.1516 1347 GLU A O   
680  C CB  . GLU A 89  ? 0.8129 0.5388 0.5433 -0.0616 -0.0242 -0.1609 1347 GLU A CB  
681  C CG  . GLU A 89  ? 0.8854 0.5677 0.6158 -0.0760 -0.0385 -0.1564 1347 GLU A CG  
682  C CD  . GLU A 89  ? 0.9451 0.6289 0.6984 -0.1133 -0.0521 -0.1396 1347 GLU A CD  
683  O OE1 . GLU A 89  ? 0.9226 0.6534 0.7027 -0.1269 -0.0426 -0.1275 1347 GLU A OE1 
684  O OE2 . GLU A 89  ? 1.0157 0.6547 0.7602 -0.1290 -0.0737 -0.1368 1347 GLU A OE2 
685  N N   . ASP A 90  ? 0.7208 0.5559 0.4711 -0.0339 0.0141  -0.1539 1348 ASP A N   
686  C CA  . ASP A 90  ? 0.7186 0.5857 0.4562 -0.0095 0.0252  -0.1576 1348 ASP A CA  
687  C C   . ASP A 90  ? 0.6575 0.5763 0.4280 -0.0095 0.0450  -0.1386 1348 ASP A C   
688  O O   . ASP A 90  ? 0.6442 0.5974 0.4103 0.0070  0.0545  -0.1352 1348 ASP A O   
689  C CB  . ASP A 90  ? 0.7443 0.6154 0.4629 -0.0100 0.0146  -0.1663 1348 ASP A CB  
690  C CG  . ASP A 90  ? 0.8295 0.6471 0.5044 -0.0005 -0.0073 -0.1890 1348 ASP A CG  
691  O OD1 . ASP A 90  ? 0.8572 0.6357 0.5126 0.0123  -0.0134 -0.1994 1348 ASP A OD1 
692  O OD2 . ASP A 90  ? 0.8646 0.6769 0.5230 -0.0052 -0.0207 -0.1969 1348 ASP A OD2 
693  N N   . TYR A 91  ? 0.6121 0.5362 0.4139 -0.0275 0.0493  -0.1254 1349 TYR A N   
694  C CA  . TYR A 91  ? 0.5636 0.5269 0.3949 -0.0293 0.0625  -0.1084 1349 TYR A CA  
695  C C   . TYR A 91  ? 0.5491 0.5077 0.3944 -0.0268 0.0703  -0.1016 1349 TYR A C   
696  O O   . TYR A 91  ? 0.5126 0.4960 0.3810 -0.0292 0.0777  -0.0880 1349 TYR A O   
697  C CB  . TYR A 91  ? 0.5356 0.5153 0.3900 -0.0490 0.0593  -0.0993 1349 TYR A CB  
698  C CG  . TYR A 91  ? 0.5567 0.5437 0.3988 -0.0520 0.0513  -0.1046 1349 TYR A CG  
699  C CD1 . TYR A 91  ? 0.5464 0.5660 0.3885 -0.0438 0.0559  -0.0986 1349 TYR A CD1 
700  C CD2 . TYR A 91  ? 0.5901 0.5518 0.4201 -0.0643 0.0375  -0.1138 1349 TYR A CD2 
701  C CE1 . TYR A 91  ? 0.5868 0.6142 0.4160 -0.0456 0.0485  -0.1034 1349 TYR A CE1 
702  C CE2 . TYR A 91  ? 0.6319 0.5991 0.4491 -0.0672 0.0285  -0.1191 1349 TYR A CE2 
703  C CZ  . TYR A 91  ? 0.6287 0.6289 0.4447 -0.0566 0.0350  -0.1149 1349 TYR A CZ  
704  O OH  . TYR A 91  ? 0.6644 0.6719 0.4668 -0.0588 0.0261  -0.1198 1349 TYR A OH  
705  N N   . GLU A 92  ? 0.5717 0.4955 0.4014 -0.0220 0.0663  -0.1110 1350 GLU A N   
706  C CA  . GLU A 92  ? 0.5616 0.4792 0.4018 -0.0185 0.0729  -0.1052 1350 GLU A CA  
707  C C   . GLU A 92  ? 0.5582 0.5040 0.3978 0.0017  0.0841  -0.0999 1350 GLU A C   
708  O O   . GLU A 92  ? 0.5773 0.5316 0.3952 0.0197  0.0849  -0.1071 1350 GLU A O   
709  C CB  . GLU A 92  ? 0.6024 0.4738 0.4219 -0.0163 0.0634  -0.1166 1350 GLU A CB  
710  C CG  . GLU A 92  ? 0.5923 0.4481 0.4285 -0.0333 0.0612  -0.1088 1350 GLU A CG  
711  C CD  . GLU A 92  ? 0.6567 0.4639 0.4721 -0.0328 0.0487  -0.1173 1350 GLU A CD  
712  O OE1 . GLU A 92  ? 0.6724 0.4497 0.4587 -0.0246 0.0361  -0.1318 1350 GLU A OE1 
713  O OE2 . GLU A 92  ? 0.6670 0.4640 0.4936 -0.0401 0.0496  -0.1095 1350 GLU A OE2 
714  N N   . TRP A 93  ? 0.5322 0.4955 0.3947 -0.0006 0.0917  -0.0863 1351 TRP A N   
715  C CA  . TRP A 93  ? 0.5300 0.5261 0.3980 0.0139  0.1007  -0.0755 1351 TRP A CA  
716  C C   . TRP A 93  ? 0.5672 0.5561 0.4103 0.0385  0.1038  -0.0852 1351 TRP A C   
717  O O   . TRP A 93  ? 0.5753 0.5991 0.4123 0.0560  0.1103  -0.0800 1351 TRP A O   
718  C CB  . TRP A 93  ? 0.4955 0.5005 0.3900 0.0053  0.1038  -0.0608 1351 TRP A CB  
719  C CG  . TRP A 93  ? 0.4783 0.5127 0.3950 -0.0057 0.1021  -0.0452 1351 TRP A CG  
720  C CD1 . TRP A 93  ? 0.4379 0.4663 0.3693 -0.0209 0.0960  -0.0425 1351 TRP A CD1 
721  C CD2 . TRP A 93  ? 0.4596 0.5339 0.3849 -0.0013 0.1043  -0.0289 1351 TRP A CD2 
722  N NE1 . TRP A 93  ? 0.4385 0.4926 0.3853 -0.0258 0.0922  -0.0275 1351 TRP A NE1 
723  C CE2 . TRP A 93  ? 0.4330 0.5160 0.3780 -0.0165 0.0967  -0.0171 1351 TRP A CE2 
724  C CE3 . TRP A 93  ? 0.4614 0.5678 0.3798 0.0148  0.1111  -0.0215 1351 TRP A CE3 
725  C CZ2 . TRP A 93  ? 0.4264 0.5443 0.3856 -0.0201 0.0933  0.0036  1351 TRP A CZ2 
726  C CZ3 . TRP A 93  ? 0.4619 0.6132 0.3966 0.0112  0.1105  0.0012  1351 TRP A CZ3 
727  C CH2 . TRP A 93  ? 0.4358 0.5897 0.3912 -0.0082 0.1005  0.0143  1351 TRP A CH2 
728  N N   . GLY A 94  ? 0.5971 0.5429 0.4256 0.0409  0.0983  -0.0978 1352 GLY A N   
729  C CA  . GLY A 94  ? 0.6435 0.5734 0.4448 0.0673  0.0982  -0.1095 1352 GLY A CA  
730  C C   . GLY A 94  ? 0.6961 0.6091 0.4608 0.0848  0.0901  -0.1287 1352 GLY A C   
731  O O   . GLY A 94  ? 0.7347 0.6369 0.4721 0.1128  0.0890  -0.1406 1352 GLY A O   
732  N N   . SER A 95  ? 0.7030 0.6134 0.4649 0.0708  0.0831  -0.1327 1353 SER A N   
733  C CA  . SER A 95  ? 0.7564 0.6456 0.4812 0.0858  0.0721  -0.1524 1353 SER A CA  
734  C C   . SER A 95  ? 0.7688 0.7080 0.4811 0.1115  0.0822  -0.1509 1353 SER A C   
735  O O   . SER A 95  ? 0.7241 0.7177 0.4638 0.1066  0.0954  -0.1302 1353 SER A O   
736  C CB  . SER A 95  ? 0.7600 0.6287 0.4866 0.0600  0.0592  -0.1561 1353 SER A CB  
737  O OG  . SER A 95  ? 0.7493 0.6647 0.4954 0.0505  0.0673  -0.1436 1353 SER A OG  
738  N N   . SER A 96  ? 0.8243 0.7445 0.4941 0.1389  0.0738  -0.1721 1354 SER A N   
739  C CA  . SER A 96  ? 0.8533 0.8229 0.5034 0.1691  0.0825  -0.1732 1354 SER A CA  
740  C C   . SER A 96  ? 0.8276 0.8393 0.4941 0.1520  0.0864  -0.1603 1354 SER A C   
741  O O   . SER A 96  ? 0.8026 0.8787 0.4792 0.1625  0.1000  -0.1435 1354 SER A O   
742  C CB  . SER A 96  ? 0.9259 0.8562 0.5204 0.2026  0.0679  -0.2035 1354 SER A CB  
743  O OG  . SER A 96  ? 0.9717 0.8626 0.5474 0.2234  0.0628  -0.2158 1354 SER A OG  
744  N N   . SER A 97  ? 0.8360 0.8134 0.5057 0.1253  0.0734  -0.1661 1355 SER A N   
745  C CA  . SER A 97  ? 0.8244 0.8348 0.5094 0.1075  0.0746  -0.1550 1355 SER A CA  
746  C C   . SER A 97  ? 0.7671 0.8321 0.4955 0.0931  0.0896  -0.1254 1355 SER A C   
747  O O   . SER A 97  ? 0.7626 0.8753 0.4990 0.0927  0.0950  -0.1116 1355 SER A O   
748  C CB  . SER A 97  ? 0.8252 0.7923 0.5156 0.0776  0.0589  -0.1618 1355 SER A CB  
749  O OG  . SER A 97  ? 0.9198 0.8362 0.5695 0.0874  0.0402  -0.1869 1355 SER A OG  
750  N N   . ILE A 98  ? 0.7380 0.7937 0.4927 0.0811  0.0940  -0.1152 1356 ILE A N   
751  C CA  . ILE A 98  ? 0.6906 0.7881 0.4840 0.0670  0.1033  -0.0884 1356 ILE A CA  
752  C C   . ILE A 98  ? 0.6985 0.8407 0.4938 0.0886  0.1153  -0.0750 1356 ILE A C   
753  O O   . ILE A 98  ? 0.6845 0.8818 0.4932 0.0894  0.1214  -0.0542 1356 ILE A O   
754  C CB  . ILE A 98  ? 0.6513 0.7198 0.4725 0.0423  0.1002  -0.0831 1356 ILE A CB  
755  C CG1 . ILE A 98  ? 0.6299 0.6735 0.4556 0.0205  0.0900  -0.0895 1356 ILE A CG1 
756  C CG2 . ILE A 98  ? 0.6125 0.7156 0.4675 0.0323  0.1061  -0.0583 1356 ILE A CG2 
757  C CD1 . ILE A 98  ? 0.5887 0.6641 0.4210 0.0128  0.0882  -0.0807 1356 ILE A CD1 
758  N N   . LEU A 99  ? 0.7293 0.8505 0.5108 0.1064  0.1175  -0.0854 1357 LEU A N   
759  C CA  . LEU A 99  ? 0.7419 0.9083 0.5274 0.1276  0.1291  -0.0716 1357 LEU A CA  
760  C C   . LEU A 99  ? 0.7742 0.9985 0.5408 0.1545  0.1365  -0.0669 1357 LEU A C   
761  O O   . LEU A 99  ? 0.7626 1.0503 0.5495 0.1581  0.1463  -0.0405 1357 LEU A O   
762  C CB  . LEU A 99  ? 0.7622 0.8922 0.5329 0.1448  0.1290  -0.0859 1357 LEU A CB  
763  C CG  . LEU A 99  ? 0.7244 0.8202 0.5211 0.1213  0.1263  -0.0806 1357 LEU A CG  
764  C CD1 . LEU A 99  ? 0.7419 0.7991 0.5195 0.1397  0.1244  -0.0956 1357 LEU A CD1 
765  C CD2 . LEU A 99  ? 0.6720 0.8121 0.5082 0.1054  0.1330  -0.0511 1357 LEU A CD2 
766  N N   . ASP A 100 ? 0.8256 1.0314 0.5540 0.1721  0.1306  -0.0902 1358 ASP A N   
767  C CA  . ASP A 100 ? 0.8634 1.1255 0.5671 0.2029  0.1376  -0.0887 1358 ASP A CA  
768  C C   . ASP A 100 ? 0.8413 1.1639 0.5685 0.1858  0.1420  -0.0618 1358 ASP A C   
769  O O   . ASP A 100 ? 0.8397 1.2333 0.5632 0.2057  0.1521  -0.0451 1358 ASP A O   
770  C CB  . ASP A 100 ? 0.9231 1.1419 0.5748 0.2274  0.1264  -0.1238 1358 ASP A CB  
771  C CG  . ASP A 100 ? 0.9756 1.1384 0.5956 0.2528  0.1194  -0.1504 1358 ASP A CG  
772  O OD1 . ASP A 100 ? 0.9533 1.1236 0.5894 0.2582  0.1271  -0.1409 1358 ASP A OD1 
773  O OD2 . ASP A 100 ? 1.0388 1.1467 0.6171 0.2663  0.1036  -0.1804 1358 ASP A OD2 
774  N N   . VAL A 101 ? 0.8221 1.1186 0.5733 0.1500  0.1338  -0.0563 1359 VAL A N   
775  C CA  . VAL A 101 ? 0.8086 1.1492 0.5802 0.1313  0.1336  -0.0331 1359 VAL A CA  
776  C C   . VAL A 101 ? 0.7700 1.1530 0.5867 0.1106  0.1376  0.0037  1359 VAL A C   
777  O O   . VAL A 101 ? 0.7632 1.2069 0.5950 0.1057  0.1403  0.0317  1359 VAL A O   
778  C CB  . VAL A 101 ? 0.8046 1.0974 0.5770 0.1063  0.1208  -0.0461 1359 VAL A CB  
779  C CG1 . VAL A 101 ? 0.7840 1.1168 0.5825 0.0844  0.1187  -0.0199 1359 VAL A CG1 
780  C CG2 . VAL A 101 ? 0.8526 1.1126 0.5791 0.1259  0.1136  -0.0782 1359 VAL A CG2 
781  N N   . LEU A 102 ? 0.7503 1.1015 0.5872 0.0980  0.1362  0.0052  1360 LEU A N   
782  C CA  . LEU A 102 ? 0.7182 1.0976 0.5959 0.0758  0.1348  0.0378  1360 LEU A CA  
783  C C   . LEU A 102 ? 0.7279 1.1736 0.6152 0.0913  0.1448  0.0631  1360 LEU A C   
784  O O   . LEU A 102 ? 0.7514 1.2086 0.6154 0.1220  0.1545  0.0507  1360 LEU A O   
785  C CB  . LEU A 102 ? 0.6957 1.0173 0.5913 0.0553  0.1275  0.0306  1360 LEU A CB  
786  C CG  . LEU A 102 ? 0.6732 0.9428 0.5685 0.0361  0.1172  0.0141  1360 LEU A CG  
787  C CD1 . LEU A 102 ? 0.6440 0.8713 0.5574 0.0202  0.1118  0.0114  1360 LEU A CD1 
788  C CD2 . LEU A 102 ? 0.6420 0.9350 0.5510 0.0193  0.1098  0.0308  1360 LEU A CD2 
789  N N   . THR A 103 ? 0.7108 1.2011 0.6325 0.0700  0.1405  0.1001  1361 THR A N   
790  C CA  . THR A 103 ? 0.7176 1.2743 0.6588 0.0755  0.1466  0.1323  1361 THR A CA  
791  C C   . THR A 103 ? 0.6977 1.2289 0.6731 0.0482  0.1357  0.1485  1361 THR A C   
792  O O   . THR A 103 ? 0.6902 1.1568 0.6707 0.0291  0.1248  0.1335  1361 THR A O   
793  C CB  . THR A 103 ? 0.7199 1.3592 0.6728 0.0721  0.1477  0.1683  1361 THR A CB  
794  O OG1 . THR A 103 ? 0.7076 1.3322 0.6864 0.0362  0.1310  0.1874  1361 THR A OG1 
795  C CG2 . THR A 103 ? 0.7376 1.4005 0.6518 0.1019  0.1578  0.1492  1361 THR A CG2 
796  N N   . GLY A 104 ? 0.6981 1.2809 0.6955 0.0478  0.1378  0.1784  1362 GLY A N   
797  C CA  . GLY A 104 ? 0.6850 1.2465 0.7140 0.0215  0.1244  0.1962  1362 GLY A CA  
798  C C   . GLY A 104 ? 0.6885 1.1857 0.7084 0.0276  0.1259  0.1671  1362 GLY A C   
799  O O   . GLY A 104 ? 0.6873 1.1662 0.7289 0.0105  0.1157  0.1785  1362 GLY A O   
800  N N   . ILE A 105 ? 0.7003 1.1606 0.6872 0.0511  0.1363  0.1302  1363 ILE A N   
801  C CA  . ILE A 105 ? 0.6910 1.0965 0.6675 0.0588  0.1384  0.1053  1363 ILE A CA  
802  C C   . ILE A 105 ? 0.6855 1.1337 0.6676 0.0772  0.1474  0.1192  1363 ILE A C   
803  O O   . ILE A 105 ? 0.7028 1.1955 0.6668 0.1071  0.1600  0.1180  1363 ILE A O   
804  C CB  . ILE A 105 ? 0.7145 1.0701 0.6541 0.0772  0.1434  0.0658  1363 ILE A CB  
805  C CG1 . ILE A 105 ? 0.7087 1.0204 0.6485 0.0553  0.1332  0.0540  1363 ILE A CG1 
806  C CG2 . ILE A 105 ? 0.7235 1.0315 0.6513 0.0883  0.1458  0.0444  1363 ILE A CG2 
807  C CD1 . ILE A 105 ? 0.7497 1.0277 0.6557 0.0694  0.1353  0.0228  1363 ILE A CD1 
808  N N   . ASN A 106 ? 0.6528 1.0898 0.6589 0.0609  0.1400  0.1327  1364 ASN A N   
809  C CA  . ASN A 106 ? 0.6411 1.1138 0.6547 0.0764  0.1471  0.1456  1364 ASN A CA  
810  C C   . ASN A 106 ? 0.6474 1.0679 0.6348 0.0988  0.1543  0.1119  1364 ASN A C   
811  O O   . ASN A 106 ? 0.6526 1.0112 0.6189 0.0984  0.1522  0.0819  1364 ASN A O   
812  C CB  . ASN A 106 ? 0.6218 1.1074 0.6726 0.0478  0.1332  0.1772  1364 ASN A CB  
813  C CG  . ASN A 106 ? 0.6062 1.0146 0.6609 0.0258  0.1193  0.1610  1364 ASN A CG  
814  O OD1 . ASN A 106 ? 0.5915 0.9526 0.6308 0.0362  0.1237  0.1355  1364 ASN A OD1 
815  N ND2 . ASN A 106 ? 0.5981 0.9953 0.6725 -0.0034 0.1012  0.1770  1364 ASN A ND2 
816  N N   . VAL A 107 ? 0.6428 1.0890 0.6323 0.1175  0.1613  0.1186  1365 VAL A N   
817  C CA  . VAL A 107 ? 0.6578 1.0555 0.6210 0.1410  0.1665  0.0885  1365 VAL A CA  
818  C C   . VAL A 107 ? 0.6374 0.9588 0.6033 0.1194  0.1567  0.0721  1365 VAL A C   
819  O O   . VAL A 107 ? 0.6596 0.9247 0.5998 0.1293  0.1570  0.0429  1365 VAL A O   
820  C CB  . VAL A 107 ? 0.6688 1.1122 0.6331 0.1688  0.1758  0.0995  1365 VAL A CB  
821  C CG1 . VAL A 107 ? 0.6978 1.2099 0.6448 0.2038  0.1884  0.1044  1365 VAL A CG1 
822  C CG2 . VAL A 107 ? 0.6496 1.1304 0.6541 0.1455  0.1697  0.1349  1365 VAL A CG2 
823  N N   . GLN A 108 ? 0.6002 0.9209 0.5959 0.0904  0.1465  0.0918  1366 GLN A N   
824  C CA  . GLN A 108 ? 0.5840 0.8403 0.5819 0.0714  0.1371  0.0779  1366 GLN A CA  
825  C C   . GLN A 108 ? 0.5619 0.7733 0.5428 0.0639  0.1344  0.0548  1366 GLN A C   
826  O O   . GLN A 108 ? 0.5653 0.7254 0.5289 0.0668  0.1345  0.0314  1366 GLN A O   
827  C CB  . GLN A 108 ? 0.5699 0.8344 0.5988 0.0435  0.1231  0.1024  1366 GLN A CB  
828  C CG  . GLN A 108 ? 0.6149 0.8183 0.6438 0.0270  0.1128  0.0881  1366 GLN A CG  
829  C CD  . GLN A 108 ? 0.6648 0.8719 0.7188 0.0054  0.0962  0.1099  1366 GLN A CD  
830  O OE1 . GLN A 108 ? 0.6917 0.9279 0.7599 0.0069  0.0948  0.1286  1366 GLN A OE1 
831  N NE2 . GLN A 108 ? 0.6658 0.8421 0.7239 -0.0134 0.0818  0.1071  1366 GLN A NE2 
832  N N   . GLN A 109 ? 0.5314 0.7664 0.5183 0.0539  0.1313  0.0640  1367 GLN A N   
833  C CA  . GLN A 109 ? 0.5199 0.7202 0.4943 0.0453  0.1277  0.0460  1367 GLN A CA  
834  C C   . GLN A 109 ? 0.5382 0.7151 0.4799 0.0664  0.1352  0.0192  1367 GLN A C   
835  O O   . GLN A 109 ? 0.5339 0.6623 0.4633 0.0598  0.1312  -0.0008 1367 GLN A O   
836  C CB  . GLN A 109 ? 0.5096 0.7437 0.4978 0.0312  0.1219  0.0642  1367 GLN A CB  
837  C CG  . GLN A 109 ? 0.4919 0.7295 0.5091 0.0063  0.1072  0.0873  1367 GLN A CG  
838  C CD  . GLN A 109 ? 0.4947 0.7521 0.5242 -0.0103 0.0969  0.1039  1367 GLN A CD  
839  O OE1 . GLN A 109 ? 0.4883 0.7939 0.5182 -0.0046 0.1021  0.1181  1367 GLN A OE1 
840  N NE2 . GLN A 109 ? 0.4810 0.7021 0.5194 -0.0293 0.0813  0.1026  1367 GLN A NE2 
841  N N   . ARG A 110 ? 0.5474 0.7596 0.4744 0.0924  0.1442  0.0197  1368 ARG A N   
842  C CA  . ARG A 110 ? 0.5777 0.7630 0.4684 0.1166  0.1474  -0.0072 1368 ARG A CA  
843  C C   . ARG A 110 ? 0.5954 0.7215 0.4735 0.1198  0.1440  -0.0262 1368 ARG A C   
844  O O   . ARG A 110 ? 0.6122 0.6880 0.4700 0.1175  0.1376  -0.0478 1368 ARG A O   
845  C CB  . ARG A 110 ? 0.5925 0.8305 0.4671 0.1504  0.1574  -0.0032 1368 ARG A CB  
846  C CG  . ARG A 110 ? 0.6168 0.8240 0.4474 0.1804  0.1571  -0.0336 1368 ARG A CG  
847  C CD  . ARG A 110 ? 0.6079 0.8753 0.4203 0.2194  0.1675  -0.0297 1368 ARG A CD  
848  N NE  . ARG A 110 ? 0.5529 0.8947 0.3860 0.2116  0.1736  -0.0020 1368 ARG A NE  
849  C CZ  . ARG A 110 ? 0.5459 0.8998 0.3673 0.2099  0.1723  -0.0057 1368 ARG A CZ  
850  N NH1 . ARG A 110 ? 0.5734 0.8697 0.3617 0.2160  0.1647  -0.0370 1368 ARG A NH1 
851  N NH2 . ARG A 110 ? 0.5108 0.9346 0.3538 0.2007  0.1768  0.0236  1368 ARG A NH2 
852  N N   . ARG A 111 ? 0.5948 0.7286 0.4860 0.1233  0.1466  -0.0157 1369 ARG A N   
853  C CA  . ARG A 111 ? 0.6191 0.7008 0.5018 0.1242  0.1428  -0.0291 1369 ARG A CA  
854  C C   . ARG A 111 ? 0.6009 0.6384 0.4921 0.0950  0.1345  -0.0350 1369 ARG A C   
855  O O   . ARG A 111 ? 0.6256 0.6138 0.5002 0.0933  0.1289  -0.0518 1369 ARG A O   
856  C CB  . ARG A 111 ? 0.6128 0.7173 0.5144 0.1278  0.1464  -0.0122 1369 ARG A CB  
857  C CG  . ARG A 111 ? 0.6643 0.8152 0.5587 0.1602  0.1553  -0.0050 1369 ARG A CG  
858  C CD  . ARG A 111 ? 0.7043 0.8771 0.6237 0.1557  0.1565  0.0150  1369 ARG A CD  
859  N NE  . ARG A 111 ? 0.7695 0.9725 0.6806 0.1884  0.1639  0.0183  1369 ARG A NE  
860  C CZ  . ARG A 111 ? 0.8413 1.0180 0.7188 0.2208  0.1655  -0.0038 1369 ARG A CZ  
861  N NH1 . ARG A 111 ? 0.8931 1.0091 0.7416 0.2227  0.1585  -0.0306 1369 ARG A NH1 
862  N NH2 . ARG A 111 ? 0.8638 1.0742 0.7359 0.2523  0.1720  0.0013  1369 ARG A NH2 
863  N N   . LEU A 112 ? 0.5613 0.6182 0.4781 0.0727  0.1321  -0.0196 1370 LEU A N   
864  C CA  . LEU A 112 ? 0.5422 0.5666 0.4668 0.0494  0.1250  -0.0244 1370 LEU A CA  
865  C C   . LEU A 112 ? 0.5487 0.5492 0.4561 0.0456  0.1216  -0.0408 1370 LEU A C   
866  O O   . LEU A 112 ? 0.5542 0.5180 0.4559 0.0358  0.1168  -0.0510 1370 LEU A O   
867  C CB  . LEU A 112 ? 0.5136 0.5615 0.4644 0.0312  0.1201  -0.0064 1370 LEU A CB  
868  C CG  . LEU A 112 ? 0.5030 0.5590 0.4718 0.0269  0.1174  0.0081  1370 LEU A CG  
869  C CD1 . LEU A 112 ? 0.4806 0.5639 0.4721 0.0121  0.1085  0.0285  1370 LEU A CD1 
870  C CD2 . LEU A 112 ? 0.5184 0.5354 0.4851 0.0196  0.1139  -0.0013 1370 LEU A CD2 
871  N N   . ALA A 113 ? 0.5459 0.5710 0.4457 0.0529  0.1236  -0.0411 1371 ALA A N   
872  C CA  . ALA A 113 ? 0.5602 0.5660 0.4429 0.0497  0.1190  -0.0558 1371 ALA A CA  
873  C C   . ALA A 113 ? 0.6016 0.5633 0.4556 0.0617  0.1146  -0.0759 1371 ALA A C   
874  O O   . ALA A 113 ? 0.6082 0.5336 0.4567 0.0475  0.1063  -0.0853 1371 ALA A O   
875  C CB  . ALA A 113 ? 0.5518 0.5974 0.4300 0.0584  0.1222  -0.0510 1371 ALA A CB  
876  N N   . LEU A 114 ? 0.6235 0.5892 0.4595 0.0881  0.1182  -0.0810 1372 LEU A N   
877  C CA  . LEU A 114 ? 0.6731 0.5903 0.4781 0.1034  0.1102  -0.1007 1372 LEU A CA  
878  C C   . LEU A 114 ? 0.6711 0.5451 0.4827 0.0868  0.1034  -0.1012 1372 LEU A C   
879  O O   . LEU A 114 ? 0.7012 0.5276 0.4953 0.0802  0.0907  -0.1136 1372 LEU A O   
880  C CB  . LEU A 114 ? 0.7004 0.6339 0.4855 0.1397  0.1157  -0.1050 1372 LEU A CB  
881  C CG  . LEU A 114 ? 0.7242 0.6992 0.4913 0.1656  0.1214  -0.1082 1372 LEU A CG  
882  C CD1 . LEU A 114 ? 0.7307 0.7379 0.4870 0.2018  0.1301  -0.1058 1372 LEU A CD1 
883  C CD2 . LEU A 114 ? 0.7718 0.7076 0.5017 0.1747  0.1090  -0.1326 1372 LEU A CD2 
884  N N   . ALA A 115 ? 0.6414 0.5328 0.4778 0.0792  0.1100  -0.0861 1373 ALA A N   
885  C CA  . ALA A 115 ? 0.6463 0.5048 0.4901 0.0640  0.1050  -0.0839 1373 ALA A CA  
886  C C   . ALA A 115 ? 0.6420 0.4843 0.4934 0.0372  0.0981  -0.0843 1373 ALA A C   
887  O O   . ALA A 115 ? 0.6644 0.4705 0.5095 0.0262  0.0890  -0.0875 1373 ALA A O   
888  C CB  . ALA A 115 ? 0.6085 0.4931 0.4769 0.0609  0.1127  -0.0677 1373 ALA A CB  
889  N N   . ALA A 116 ? 0.6155 0.4876 0.4813 0.0268  0.1015  -0.0790 1374 ALA A N   
890  C CA  . ALA A 116 ? 0.6173 0.4839 0.4919 0.0045  0.0961  -0.0783 1374 ALA A CA  
891  C C   . ALA A 116 ? 0.6543 0.4855 0.5073 0.0001  0.0843  -0.0907 1374 ALA A C   
892  O O   . ALA A 116 ? 0.6689 0.4790 0.5243 -0.0171 0.0763  -0.0886 1374 ALA A O   
893  C CB  . ALA A 116 ? 0.5769 0.4794 0.4670 -0.0012 0.1000  -0.0719 1374 ALA A CB  
894  N N   . MET A 117 ? 0.6863 0.5118 0.5169 0.0162  0.0815  -0.1024 1375 MET A N   
895  C CA  . MET A 117 ? 0.7316 0.5165 0.5361 0.0145  0.0659  -0.1165 1375 MET A CA  
896  C C   . MET A 117 ? 0.7735 0.5081 0.5620 0.0156  0.0536  -0.1213 1375 MET A C   
897  O O   . MET A 117 ? 0.7955 0.4955 0.5782 -0.0031 0.0376  -0.1223 1375 MET A O   
898  C CB  . MET A 117 ? 0.7601 0.5503 0.5391 0.0374  0.0652  -0.1300 1375 MET A CB  
899  C CG  . MET A 117 ? 0.8224 0.5632 0.5684 0.0390  0.0451  -0.1476 1375 MET A CG  
900  S SD  . MET A 117 ? 0.9100 0.6607 0.6214 0.0693  0.0438  -0.1655 1375 MET A SD  
901  C CE  . MET A 117 ? 0.9147 0.6649 0.6051 0.1097  0.0507  -0.1729 1375 MET A CE  
902  N N   . ARG A 118 ? 0.7771 0.5095 0.5599 0.0366  0.0595  -0.1221 1376 ARG A N   
903  C CA  . ARG A 118 ? 0.8179 0.5020 0.5839 0.0423  0.0475  -0.1266 1376 ARG A CA  
904  C C   . ARG A 118 ? 0.7985 0.4709 0.5848 0.0137  0.0430  -0.1118 1376 ARG A C   
905  O O   . ARG A 118 ? 0.8310 0.4576 0.6050 0.0015  0.0245  -0.1128 1376 ARG A O   
906  C CB  . ARG A 118 ? 0.8241 0.5216 0.5858 0.0713  0.0583  -0.1271 1376 ARG A CB  
907  C CG  . ARG A 118 ? 0.9205 0.5687 0.6454 0.0979  0.0443  -0.1436 1376 ARG A CG  
908  C CD  . ARG A 118 ? 0.9491 0.6252 0.6710 0.1311  0.0577  -0.1434 1376 ARG A CD  
909  N NE  . ARG A 118 ? 0.9065 0.6188 0.6627 0.1199  0.0725  -0.1235 1376 ARG A NE  
910  C CZ  . ARG A 118 ? 0.8694 0.6417 0.6484 0.1240  0.0900  -0.1112 1376 ARG A CZ  
911  N NH1 . ARG A 118 ? 0.8510 0.6597 0.6243 0.1387  0.0969  -0.1144 1376 ARG A NH1 
912  N NH2 . ARG A 118 ? 0.8390 0.6347 0.6456 0.1128  0.0985  -0.0945 1376 ARG A NH2 
913  N N   . TRP A 119 ? 0.7396 0.4540 0.5560 0.0034  0.0580  -0.0970 1377 TRP A N   
914  C CA  . TRP A 119 ? 0.7200 0.4332 0.5547 -0.0196 0.0560  -0.0824 1377 TRP A CA  
915  C C   . TRP A 119 ? 0.7212 0.4351 0.5628 -0.0456 0.0468  -0.0776 1377 TRP A C   
916  O O   . TRP A 119 ? 0.7304 0.4293 0.5769 -0.0652 0.0369  -0.0668 1377 TRP A O   
917  C CB  . TRP A 119 ? 0.6735 0.4282 0.5331 -0.0188 0.0724  -0.0707 1377 TRP A CB  
918  C CG  . TRP A 119 ? 0.6770 0.4262 0.5336 -0.0009 0.0774  -0.0692 1377 TRP A CG  
919  C CD1 . TRP A 119 ? 0.6674 0.4403 0.5256 0.0196  0.0877  -0.0708 1377 TRP A CD1 
920  C CD2 . TRP A 119 ? 0.7034 0.4249 0.5563 -0.0029 0.0713  -0.0635 1377 TRP A CD2 
921  N NE1 . TRP A 119 ? 0.6861 0.4489 0.5420 0.0315  0.0889  -0.0672 1377 TRP A NE1 
922  C CE2 . TRP A 119 ? 0.6940 0.4232 0.5457 0.0185  0.0790  -0.0637 1377 TRP A CE2 
923  C CE3 . TRP A 119 ? 0.7298 0.4245 0.5818 -0.0223 0.0593  -0.0553 1377 TRP A CE3 
924  C CZ2 . TRP A 119 ? 0.7154 0.4231 0.5637 0.0229  0.0755  -0.0582 1377 TRP A CZ2 
925  C CZ3 . TRP A 119 ? 0.7398 0.4121 0.5881 -0.0191 0.0551  -0.0488 1377 TRP A CZ3 
926  C CH2 . TRP A 119 ? 0.7329 0.4106 0.5789 0.0041  0.0635  -0.0513 1377 TRP A CH2 
927  N N   . ARG A 120 ? 0.7100 0.4445 0.5527 -0.0464 0.0493  -0.0833 1378 ARG A N   
928  C CA  . ARG A 120 ? 0.7160 0.4537 0.5645 -0.0696 0.0396  -0.0791 1378 ARG A CA  
929  C C   . ARG A 120 ? 0.7808 0.4656 0.6077 -0.0800 0.0161  -0.0832 1378 ARG A C   
930  O O   . ARG A 120 ? 0.7873 0.4670 0.6241 -0.1056 0.0047  -0.0693 1378 ARG A O   
931  C CB  . ARG A 120 ? 0.6954 0.4594 0.5446 -0.0652 0.0447  -0.0864 1378 ARG A CB  
932  C CG  . ARG A 120 ? 0.6841 0.4636 0.5449 -0.0882 0.0377  -0.0798 1378 ARG A CG  
933  C CD  . ARG A 120 ? 0.7322 0.4724 0.5705 -0.0974 0.0163  -0.0884 1378 ARG A CD  
934  N NE  . ARG A 120 ? 0.7387 0.4639 0.5512 -0.0756 0.0147  -0.1073 1378 ARG A NE  
935  C CZ  . ARG A 120 ? 0.7875 0.4707 0.5712 -0.0743 -0.0050 -0.1206 1378 ARG A CZ  
936  N NH1 . ARG A 120 ? 0.8268 0.4750 0.6060 -0.0973 -0.0271 -0.1154 1378 ARG A NH1 
937  N NH2 . ARG A 120 ? 0.7879 0.4647 0.5461 -0.0498 -0.0045 -0.1382 1378 ARG A NH2 
938  N N   . LYS A 121 ? 0.8254 0.4722 0.6221 -0.0594 0.0073  -0.1009 1379 LYS A N   
939  C CA  . LYS A 121 ? 0.9061 0.4906 0.6752 -0.0647 -0.0200 -0.1085 1379 LYS A CA  
940  C C   . LYS A 121 ? 0.9382 0.4916 0.7103 -0.0775 -0.0313 -0.0954 1379 LYS A C   
941  O O   . LYS A 121 ? 0.9647 0.4911 0.7371 -0.1045 -0.0528 -0.0848 1379 LYS A O   
942  C CB  . LYS A 121 ? 0.9427 0.4940 0.6742 -0.0317 -0.0265 -0.1331 1379 LYS A CB  
943  C CG  . LYS A 121 ? 0.9456 0.5161 0.6676 -0.0253 -0.0246 -0.1450 1379 LYS A CG  
944  C CD  . LYS A 121 ? 1.0056 0.5504 0.6875 0.0112  -0.0303 -0.1694 1379 LYS A CD  
945  C CE  . LYS A 121 ? 0.9968 0.5724 0.6721 0.0184  -0.0246 -0.1784 1379 LYS A CE  
946  N NZ  . LYS A 121 ? 1.0736 0.6288 0.7062 0.0564  -0.0308 -0.2022 1379 LYS A NZ  
947  N N   . LYS A 122 ? 0.9392 0.4994 0.7151 -0.0600 -0.0177 -0.0938 1380 LYS A N   
948  C CA  . LYS A 122 ? 0.9806 0.5126 0.7583 -0.0687 -0.0271 -0.0812 1380 LYS A CA  
949  C C   . LYS A 122 ? 0.9700 0.5280 0.7766 -0.1042 -0.0286 -0.0553 1380 LYS A C   
950  O O   . LYS A 122 ? 1.0076 0.5310 0.8109 -0.1262 -0.0507 -0.0427 1380 LYS A O   
951  C CB  . LYS A 122 ? 0.9572 0.5069 0.7397 -0.0444 -0.0081 -0.0818 1380 LYS A CB  
952  C CG  . LYS A 122 ? 1.0115 0.5337 0.7642 -0.0077 -0.0096 -0.1029 1380 LYS A CG  
953  C CD  . LYS A 122 ? 1.0010 0.5503 0.7637 0.0133  0.0095  -0.0992 1380 LYS A CD  
954  C CE  . LYS A 122 ? 1.0800 0.5939 0.8106 0.0494  0.0025  -0.1166 1380 LYS A CE  
955  N NZ  . LYS A 122 ? 1.0759 0.6139 0.8181 0.0665  0.0180  -0.1093 1380 LYS A NZ  
956  N N   . ILE A 123 ? 0.9232 0.5434 0.7570 -0.1087 -0.0066 -0.0466 1381 ILE A N   
957  C CA  . ILE A 123 ? 0.9131 0.5714 0.7741 -0.1342 -0.0030 -0.0226 1381 ILE A CA  
958  C C   . ILE A 123 ? 0.9461 0.6068 0.8131 -0.1636 -0.0198 -0.0114 1381 ILE A C   
959  O O   . ILE A 123 ? 0.9560 0.6247 0.8366 -0.1893 -0.0298 0.0118  1381 ILE A O   
960  C CB  . ILE A 123 ? 0.8481 0.5674 0.7312 -0.1237 0.0234  -0.0199 1381 ILE A CB  
961  C CG1 . ILE A 123 ? 0.8343 0.5511 0.7168 -0.1060 0.0341  -0.0199 1381 ILE A CG1 
962  C CG2 . ILE A 123 ? 0.8222 0.5899 0.7297 -0.1449 0.0276  0.0004  1381 ILE A CG2 
963  C CD1 . ILE A 123 ? 0.7890 0.5410 0.6799 -0.0856 0.0542  -0.0279 1381 ILE A CD1 
964  N N   . GLN A 124 ? 0.9732 0.6287 0.8302 -0.1605 -0.0242 -0.0260 1382 GLN A N   
965  C CA  . GLN A 124 ? 1.0099 0.6684 0.8723 -0.1880 -0.0415 -0.0163 1382 GLN A CA  
966  C C   . GLN A 124 ? 1.0928 0.6887 0.9376 -0.2086 -0.0754 -0.0102 1382 GLN A C   
967  O O   . GLN A 124 ? 1.1161 0.7182 0.9720 -0.2400 -0.0931 0.0082  1382 GLN A O   
968  C CB  . GLN A 124 ? 0.9978 0.6670 0.8528 -0.1782 -0.0377 -0.0340 1382 GLN A CB  
969  C CG  . GLN A 124 ? 0.9415 0.6764 0.8194 -0.1680 -0.0105 -0.0330 1382 GLN A CG  
970  C CD  . GLN A 124 ? 0.9414 0.6949 0.8197 -0.1707 -0.0118 -0.0405 1382 GLN A CD  
971  O OE1 . GLN A 124 ? 0.9768 0.6934 0.8347 -0.1754 -0.0307 -0.0506 1382 GLN A OE1 
972  N NE2 . GLN A 124 ? 0.8960 0.7044 0.7955 -0.1669 0.0062  -0.0360 1382 GLN A NE2 
973  N N   . GLN A 125 ? 1.1465 0.6824 0.9639 -0.1909 -0.0865 -0.0244 1383 GLN A N   
974  C CA  A GLN A 125 ? 1.2275 0.6934 1.0245 -0.2081 -0.1228 -0.0195 1383 GLN A CA  
975  C CA  B GLN A 125 ? 1.2289 0.6943 1.0256 -0.2078 -0.1229 -0.0197 1383 GLN A CA  
976  C C   . GLN A 125 ? 1.2368 0.7091 1.0535 -0.2319 -0.1285 0.0109  1383 GLN A C   
977  O O   . GLN A 125 ? 1.2911 0.7214 1.1029 -0.2597 -0.1605 0.0273  1383 GLN A O   
978  C CB  A GLN A 125 ? 1.2788 0.6749 1.0341 -0.1752 -0.1351 -0.0488 1383 GLN A CB  
979  C CB  B GLN A 125 ? 1.2812 0.6767 1.0361 -0.1746 -0.1351 -0.0492 1383 GLN A CB  
980  C CG  A GLN A 125 ? 1.2928 0.6727 1.0221 -0.1563 -0.1395 -0.0764 1383 GLN A CG  
981  C CG  B GLN A 125 ? 1.2866 0.6633 1.0358 -0.1551 -0.1283 -0.0493 1383 GLN A CG  
982  C CD  A GLN A 125 ? 1.3636 0.6576 1.0453 -0.1355 -0.1696 -0.1005 1383 GLN A CD  
983  C CD  B GLN A 125 ? 1.3116 0.6569 1.0275 -0.1103 -0.1233 -0.0807 1383 GLN A CD  
984  O OE1 A GLN A 125 ? 1.3930 0.6440 1.0598 -0.1233 -0.1792 -0.1022 1383 GLN A OE1 
985  O OE1 B GLN A 125 ? 1.3409 0.6652 1.0311 -0.0940 -0.1312 -0.1033 1383 GLN A OE1 
986  N NE2 A GLN A 125 ? 1.3954 0.6627 1.0505 -0.1291 -0.1859 -0.1203 1383 GLN A NE2 
987  N NE2 B GLN A 125 ? 1.2984 0.6453 1.0144 -0.0888 -0.1098 -0.0812 1383 GLN A NE2 
988  N N   . ARG A 126 ? 1.1931 0.7185 1.0316 -0.2218 -0.0991 0.0196  1384 ARG A N   
989  C CA  . ARG A 126 ? 1.2062 0.7517 1.0649 -0.2416 -0.0995 0.0495  1384 ARG A CA  
990  C C   . ARG A 126 ? 1.1825 0.7989 1.0751 -0.2718 -0.0936 0.0794  1384 ARG A C   
991  O O   . ARG A 126 ? 1.2032 0.8275 1.1099 -0.3009 -0.1080 0.1105  1384 ARG A O   
992  C CB  . ARG A 126 ? 1.1691 0.7347 1.0314 -0.2146 -0.0736 0.0443  1384 ARG A CB  
993  C CG  . ARG A 126 ? 1.2274 0.7252 1.0639 -0.1983 -0.0878 0.0343  1384 ARG A CG  
994  C CD  . ARG A 126 ? 1.2339 0.7038 1.0444 -0.1595 -0.0798 -0.0001 1384 ARG A CD  
995  N NE  . ARG A 126 ? 1.2241 0.6915 1.0305 -0.1334 -0.0656 -0.0054 1384 ARG A NE  
996  C CZ  . ARG A 126 ? 1.1609 0.6852 0.9876 -0.1220 -0.0367 -0.0021 1384 ARG A CZ  
997  N NH1 . ARG A 126 ? 1.1151 0.7002 0.9653 -0.1316 -0.0190 0.0047  1384 ARG A NH1 
998  N NH2 . ARG A 126 ? 1.1685 0.6868 0.9906 -0.1000 -0.0275 -0.0058 1384 ARG A NH2 
999  N N   . GLN A 127 ? 1.1455 0.8153 1.0508 -0.2637 -0.0732 0.0713  1385 GLN A N   
1000 C CA  . GLN A 127 ? 1.1303 0.8693 1.0647 -0.2872 -0.0684 0.0954  1385 GLN A CA  
1001 C C   . GLN A 127 ? 1.1859 0.9037 1.1231 -0.3260 -0.1019 0.1169  1385 GLN A C   
1002 O O   . GLN A 127 ? 1.1918 0.9483 1.1519 -0.3550 -0.1091 0.1520  1385 GLN A O   
1003 C CB  . GLN A 127 ? 1.0861 0.8663 1.0258 -0.2695 -0.0479 0.0771  1385 GLN A CB  
1004 C CG  . GLN A 127 ? 1.0447 0.8645 0.9906 -0.2386 -0.0162 0.0649  1385 GLN A CG  
1005 C CD  . GLN A 127 ? 1.0262 0.8739 0.9740 -0.2214 -0.0013 0.0462  1385 GLN A CD  
1006 O OE1 . GLN A 127 ? 1.0495 0.8854 0.9917 -0.2294 -0.0125 0.0393  1385 GLN A OE1 
1007 N NE2 . GLN A 127 ? 0.9864 0.8687 0.9409 -0.1982 0.0218  0.0385  1385 GLN A NE2 
1008 N N   . GLU A 128 ? 1.2340 0.8919 1.1470 -0.3265 -0.1238 0.0969  1386 GLU A N   
1009 C CA  . GLU A 128 ? 1.2985 0.9240 1.2094 -0.3634 -0.1615 0.1139  1386 GLU A CA  
1010 C C   . GLU A 128 ? 1.3600 0.9299 1.2634 -0.3866 -0.1926 0.1346  1386 GLU A C   
1011 O O   . GLU A 128 ? 1.4063 0.9589 1.3157 -0.4252 -0.2260 0.1601  1386 GLU A O   
1012 C CB  . GLU A 128 ? 1.3349 0.9032 1.2151 -0.3524 -0.1782 0.0824  1386 GLU A CB  
1013 C CG  . GLU A 128 ? 1.2926 0.9108 1.1785 -0.3303 -0.1503 0.0626  1386 GLU A CG  
1014 C CD  . GLU A 128 ? 1.3356 0.8971 1.1857 -0.3090 -0.1611 0.0271  1386 GLU A CD  
1015 O OE1 . GLU A 128 ? 1.4106 0.8941 1.2307 -0.3150 -0.1951 0.0183  1386 GLU A OE1 
1016 O OE2 . GLU A 128 ? 1.2918 0.8867 1.1422 -0.2852 -0.1370 0.0084  1386 GLU A OE2 
1017 N N   . SER A 129 ? 1.3644 0.9059 1.2550 -0.3636 -0.1831 0.1248  1387 SER A N   
1018 C CA  . SER A 129 ? 1.4203 0.9118 1.3043 -0.3811 -0.2092 0.1446  1387 SER A CA  
1019 C C   . SER A 129 ? 1.3856 0.9536 1.3064 -0.4028 -0.1948 0.1856  1387 SER A C   
1020 O O   . SER A 129 ? 1.4267 0.9739 1.3525 -0.4299 -0.2184 0.2155  1387 SER A O   
1021 C CB  . SER A 129 ? 1.4383 0.8684 1.2910 -0.3426 -0.2045 0.1142  1387 SER A CB  
1022 O OG  . SER A 129 ? 1.5255 0.8680 1.3541 -0.3545 -0.2443 0.1188  1387 SER A OG  
1023 N N   . GLY A 130 ? 1.3141 0.9705 1.2587 -0.3893 -0.1573 0.1870  1388 GLY A N   
1024 C CA  . GLY A 130 ? 1.2765 1.0180 1.2540 -0.4040 -0.1405 0.2233  1388 GLY A CA  
1025 C C   . GLY A 130 ? 1.2484 1.0031 1.2247 -0.3793 -0.1172 0.2206  1388 GLY A C   
1026 O O   . GLY A 130 ? 1.2447 1.0427 1.2396 -0.3956 -0.1151 0.2540  1388 GLY A O   
1027 N N   . ILE A 131 ? 1.2270 0.9472 1.1819 -0.3410 -0.1007 0.1829  1389 ILE A N   
1028 C CA  . ILE A 131 ? 1.1910 0.9318 1.1463 -0.3148 -0.0756 0.1777  1389 ILE A CA  
1029 C C   . ILE A 131 ? 1.1286 0.9084 1.0845 -0.2801 -0.0429 0.1498  1389 ILE A C   
1030 O O   . ILE A 131 ? 1.1226 0.8789 1.0660 -0.2655 -0.0413 0.1226  1389 ILE A O   
1031 C CB  . ILE A 131 ? 1.2344 0.8970 1.1655 -0.3032 -0.0897 0.1675  1389 ILE A CB  
1032 C CG1 . ILE A 131 ? 1.2439 0.8463 1.1460 -0.2714 -0.0894 0.1259  1389 ILE A CG1 
1033 C CG2 . ILE A 131 ? 1.2992 0.9141 1.2277 -0.3391 -0.1276 0.1961  1389 ILE A CG2 
1034 C CD1 . ILE A 131 ? 1.2520 0.8103 1.1352 -0.2440 -0.0862 0.1109  1389 ILE A CD1 
1035 N N   . VAL A 132 ? 1.0816 0.9215 1.0515 -0.2680 -0.0190 0.1583  1390 VAL A N   
1036 C CA  . VAL A 132 ? 1.0244 0.8982 0.9946 -0.2360 0.0084  0.1349  1390 VAL A CA  
1037 C C   . VAL A 132 ? 1.0159 0.8529 0.9707 -0.2104 0.0161  0.1173  1390 VAL A C   
1038 O O   . VAL A 132 ? 1.0256 0.8675 0.9823 -0.2116 0.0173  0.1323  1390 VAL A O   
1039 C CB  . VAL A 132 ? 0.9875 0.9495 0.9787 -0.2345 0.0272  0.1523  1390 VAL A CB  
1040 C CG1 . VAL A 132 ? 1.0038 0.9975 1.0056 -0.2502 0.0246  0.1856  1390 VAL A CG1 
1041 C CG2 . VAL A 132 ? 0.9436 0.9290 0.9310 -0.2000 0.0508  0.1282  1390 VAL A CG2 
1042 N N   . GLU A 133 ? 0.9945 0.7985 0.9347 -0.1879 0.0210  0.0877  1391 GLU A N   
1043 C CA  . GLU A 133 ? 0.9833 0.7511 0.9090 -0.1642 0.0257  0.0718  1391 GLU A CA  
1044 C C   . GLU A 133 ? 0.9447 0.7069 0.8620 -0.1382 0.0376  0.0438  1391 GLU A C   
1045 O O   . GLU A 133 ? 0.9706 0.6939 0.8728 -0.1332 0.0282  0.0280  1391 GLU A O   
1046 C CB  . GLU A 133 ? 1.0428 0.7428 0.9511 -0.1719 0.0023  0.0740  1391 GLU A CB  
1047 C CG  . GLU A 133 ? 1.0726 0.7350 0.9647 -0.1454 0.0055  0.0582  1391 GLU A CG  
1048 C CD  . GLU A 133 ? 1.1423 0.7607 1.0254 -0.1541 -0.0128 0.0726  1391 GLU A CD  
1049 O OE1 . GLU A 133 ? 1.1738 0.7512 1.0398 -0.1323 -0.0157 0.0589  1391 GLU A OE1 
1050 O OE2 . GLU A 133 ? 1.1690 0.7967 1.0628 -0.1824 -0.0249 0.0995  1391 GLU A OE2 
1051 N N   . GLY A 134 ? 0.8816 0.6824 0.8073 -0.1216 0.0564  0.0387  1392 GLY A N   
1052 C CA  . GLY A 134 ? 0.8300 0.6288 0.7506 -0.0989 0.0665  0.0174  1392 GLY A CA  
1053 C C   . GLY A 134 ? 0.8228 0.5886 0.7309 -0.0801 0.0668  0.0082  1392 GLY A C   
1054 O O   . GLY A 134 ? 0.8465 0.5835 0.7475 -0.0828 0.0581  0.0157  1392 GLY A O   
1055 N N   . ALA A 135 ? 0.7863 0.5595 0.6929 -0.0610 0.0760  -0.0060 1393 ALA A N   
1056 C CA  . ALA A 135 ? 0.7805 0.5349 0.6779 -0.0403 0.0783  -0.0137 1393 ALA A CA  
1057 C C   . ALA A 135 ? 0.7648 0.5235 0.6667 -0.0355 0.0819  -0.0037 1393 ALA A C   
1058 O O   . ALA A 135 ? 0.7816 0.5151 0.6737 -0.0227 0.0788  -0.0059 1393 ALA A O   
1059 C CB  . ALA A 135 ? 0.7559 0.5324 0.6567 -0.0250 0.0879  -0.0245 1393 ALA A CB  
1060 N N   . PHE A 136 ? 0.7250 0.5165 0.6399 -0.0430 0.0879  0.0063  1394 PHE A N   
1061 C CA  . PHE A 136 ? 0.7066 0.5062 0.6247 -0.0377 0.0913  0.0152  1394 PHE A CA  
1062 C C   . PHE A 136 ? 0.7237 0.5229 0.6428 -0.0536 0.0858  0.0323  1394 PHE A C   
1063 O O   . PHE A 136 ? 0.7048 0.5263 0.6286 -0.0528 0.0901  0.0421  1394 PHE A O   
1064 C CB  . PHE A 136 ? 0.6633 0.4989 0.5910 -0.0301 0.0999  0.0133  1394 PHE A CB  
1065 C CG  . PHE A 136 ? 0.6381 0.4798 0.5684 -0.0195 0.1031  0.0017  1394 PHE A CG  
1066 C CD1 . PHE A 136 ? 0.6142 0.4416 0.5405 -0.0066 0.1034  -0.0031 1394 PHE A CD1 
1067 C CD2 . PHE A 136 ? 0.5839 0.4491 0.5208 -0.0215 0.1052  -0.0026 1394 PHE A CD2 
1068 C CE1 . PHE A 136 ? 0.5874 0.4290 0.5182 0.0014  0.1063  -0.0092 1394 PHE A CE1 
1069 C CE2 . PHE A 136 ? 0.5695 0.4411 0.5100 -0.0143 0.1061  -0.0098 1394 PHE A CE2 
1070 C CZ  . PHE A 136 ? 0.5551 0.4173 0.4935 -0.0042 0.1070  -0.0117 1394 PHE A CZ  
1071 N N   . SER A 137 ? 0.7518 0.5257 0.6656 -0.0687 0.0744  0.0373  1395 SER A N   
1072 C CA  . SER A 137 ? 0.7740 0.5480 0.6906 -0.0884 0.0659  0.0584  1395 SER A CA  
1073 C C   . SER A 137 ? 0.7881 0.5410 0.6990 -0.0819 0.0626  0.0662  1395 SER A C   
1074 O O   . SER A 137 ? 0.8117 0.5264 0.7110 -0.0677 0.0578  0.0555  1395 SER A O   
1075 C CB  . SER A 137 ? 0.8089 0.5496 0.7194 -0.1068 0.0490  0.0618  1395 SER A CB  
1076 O OG  . SER A 137 ? 0.8298 0.6000 0.7523 -0.1315 0.0446  0.0840  1395 SER A OG  
1077 N N   . GLY A 138 ? 0.7771 0.5589 0.6953 -0.0899 0.0655  0.0849  1396 GLY A N   
1078 C CA  . GLY A 138 ? 0.7796 0.5476 0.6937 -0.0839 0.0631  0.0941  1396 GLY A CA  
1079 C C   . GLY A 138 ? 0.7511 0.5396 0.6662 -0.0624 0.0758  0.0851  1396 GLY A C   
1080 O O   . GLY A 138 ? 0.7625 0.5483 0.6756 -0.0579 0.0750  0.0943  1396 GLY A O   
1081 N N   . TRP A 139 ? 0.7095 0.5172 0.6280 -0.0504 0.0853  0.0686  1397 TRP A N   
1082 C CA  . TRP A 139 ? 0.6802 0.5059 0.6005 -0.0331 0.0931  0.0615  1397 TRP A CA  
1083 C C   . TRP A 139 ? 0.6591 0.5262 0.5824 -0.0338 0.0984  0.0697  1397 TRP A C   
1084 O O   . TRP A 139 ? 0.6471 0.5424 0.5736 -0.0403 0.1013  0.0712  1397 TRP A O   
1085 C CB  . TRP A 139 ? 0.6586 0.4889 0.5817 -0.0224 0.0977  0.0440  1397 TRP A CB  
1086 C CG  . TRP A 139 ? 0.6711 0.4716 0.5895 -0.0131 0.0952  0.0341  1397 TRP A CG  
1087 C CD1 . TRP A 139 ? 0.7161 0.4791 0.6245 -0.0136 0.0873  0.0344  1397 TRP A CD1 
1088 C CD2 . TRP A 139 ? 0.6494 0.4575 0.5711 -0.0001 0.0994  0.0227  1397 TRP A CD2 
1089 N NE1 . TRP A 139 ? 0.7080 0.4573 0.6111 0.0023  0.0879  0.0216  1397 TRP A NE1 
1090 C CE2 . TRP A 139 ? 0.6860 0.4668 0.5990 0.0095  0.0964  0.0163  1397 TRP A CE2 
1091 C CE3 . TRP A 139 ? 0.6271 0.4621 0.5574 0.0042  0.1033  0.0185  1397 TRP A CE3 
1092 C CZ2 . TRP A 139 ? 0.6653 0.4547 0.5796 0.0240  0.1003  0.0078  1397 TRP A CZ2 
1093 C CZ3 . TRP A 139 ? 0.6102 0.4496 0.5441 0.0143  0.1050  0.0124  1397 TRP A CZ3 
1094 C CH2 . TRP A 139 ? 0.6297 0.4511 0.5565 0.0243  0.1050  0.0080  1397 TRP A CH2 
1095 N N   . LYS A 140 ? 0.6496 0.5220 0.5703 -0.0248 0.0990  0.0741  1398 LYS A N   
1096 C CA  . LYS A 140 ? 0.6355 0.5451 0.5538 -0.0195 0.1027  0.0781  1398 LYS A CA  
1097 C C   . LYS A 140 ? 0.6113 0.5208 0.5276 -0.0030 0.1021  0.0654  1398 LYS A C   
1098 O O   . LYS A 140 ? 0.6194 0.5144 0.5349 0.0028  0.0995  0.0680  1398 LYS A O   
1099 C CB  . LYS A 140 ? 0.6601 0.5787 0.5752 -0.0260 0.1011  0.0985  1398 LYS A CB  
1100 C CG  . LYS A 140 ? 0.6939 0.6249 0.6131 -0.0459 0.0993  0.1169  1398 LYS A CG  
1101 C CD  . LYS A 140 ? 0.7678 0.6931 0.6854 -0.0559 0.0937  0.1399  1398 LYS A CD  
1102 C CE  . LYS A 140 ? 0.7988 0.7705 0.7204 -0.0707 0.0951  0.1638  1398 LYS A CE  
1103 N NZ  . LYS A 140 ? 0.8422 0.8210 0.7616 -0.0770 0.0911  0.1879  1398 LYS A NZ  
1104 N N   . VAL A 141 ? 0.5833 0.5084 0.4991 0.0036  0.1025  0.0530  1399 VAL A N   
1105 C CA  . VAL A 141 ? 0.5520 0.4683 0.4693 0.0138  0.0977  0.0415  1399 VAL A CA  
1106 C C   . VAL A 141 ? 0.5493 0.4812 0.4572 0.0255  0.0915  0.0362  1399 VAL A C   
1107 O O   . VAL A 141 ? 0.5425 0.4957 0.4419 0.0305  0.0919  0.0322  1399 VAL A O   
1108 C CB  . VAL A 141 ? 0.5430 0.4537 0.4670 0.0117  0.0978  0.0304  1399 VAL A CB  
1109 C CG1 . VAL A 141 ? 0.5205 0.4274 0.4477 0.0191  0.0902  0.0227  1399 VAL A CG1 
1110 C CG2 . VAL A 141 ? 0.5310 0.4217 0.4603 0.0039  0.1014  0.0324  1399 VAL A CG2 
1111 N N   . ILE A 142 ? 0.5439 0.4652 0.4520 0.0311  0.0844  0.0363  1400 ILE A N   
1112 C CA  . ILE A 142 ? 0.5554 0.4799 0.4540 0.0416  0.0726  0.0287  1400 ILE A CA  
1113 C C   . ILE A 142 ? 0.5515 0.4632 0.4589 0.0403  0.0633  0.0211  1400 ILE A C   
1114 O O   . ILE A 142 ? 0.5406 0.4440 0.4620 0.0347  0.0644  0.0265  1400 ILE A O   
1115 C CB  . ILE A 142 ? 0.5670 0.4897 0.4604 0.0463  0.0672  0.0363  1400 ILE A CB  
1116 C CG1 . ILE A 142 ? 0.5860 0.5274 0.4678 0.0488  0.0741  0.0448  1400 ILE A CG1 
1117 C CG2 . ILE A 142 ? 0.5697 0.4867 0.4539 0.0553  0.0495  0.0277  1400 ILE A CG2 
1118 C CD1 . ILE A 142 ? 0.5911 0.5300 0.4704 0.0504  0.0718  0.0561  1400 ILE A CD1 
1119 N N   . LEU A 143 ? 0.5580 0.4701 0.4563 0.0467  0.0532  0.0096  1401 LEU A N   
1120 C CA  . LEU A 143 ? 0.5629 0.4626 0.4689 0.0436  0.0412  0.0044  1401 LEU A CA  
1121 C C   . LEU A 143 ? 0.5767 0.4635 0.4740 0.0492  0.0193  0.0017  1401 LEU A C   
1122 O O   . LEU A 143 ? 0.5860 0.4721 0.4625 0.0619  0.0108  -0.0068 1401 LEU A O   
1123 C CB  . LEU A 143 ? 0.5652 0.4688 0.4655 0.0470  0.0415  -0.0067 1401 LEU A CB  
1124 C CG  . LEU A 143 ? 0.5815 0.4844 0.4956 0.0379  0.0471  -0.0076 1401 LEU A CG  
1125 C CD1 . LEU A 143 ? 0.5590 0.4636 0.4877 0.0277  0.0614  0.0020  1401 LEU A CD1 
1126 C CD2 . LEU A 143 ? 0.5955 0.5112 0.5011 0.0435  0.0525  -0.0166 1401 LEU A CD2 
1127 N N   . HIS A 144 ? 0.5738 0.4528 0.4861 0.0401  0.0092  0.0104  1402 HIS A N   
1128 C CA  . HIS A 144 ? 0.6035 0.4665 0.5107 0.0403  -0.0172 0.0100  1402 HIS A CA  
1129 C C   . HIS A 144 ? 0.5988 0.4557 0.5227 0.0282  -0.0293 0.0155  1402 HIS A C   
1130 O O   . HIS A 144 ? 0.6032 0.4682 0.5470 0.0169  -0.0331 0.0315  1402 HIS A O   
1131 C CB  . HIS A 144 ? 0.6110 0.4771 0.5235 0.0378  -0.0213 0.0225  1402 HIS A CB  
1132 C CG  . HIS A 144 ? 0.6419 0.4904 0.5498 0.0350  -0.0519 0.0243  1402 HIS A CG  
1133 N ND1 . HIS A 144 ? 0.6962 0.5221 0.5774 0.0462  -0.0735 0.0087  1402 HIS A ND1 
1134 C CD2 . HIS A 144 ? 0.6481 0.4984 0.5737 0.0226  -0.0665 0.0406  1402 HIS A CD2 
1135 C CE1 . HIS A 144 ? 0.7179 0.5256 0.5993 0.0392  -0.1027 0.0144  1402 HIS A CE1 
1136 N NE2 . HIS A 144 ? 0.7153 0.5401 0.6256 0.0231  -0.0987 0.0356  1402 HIS A NE2 
1137 N N   . VAL A 145 ? 0.6025 0.4500 0.5194 0.0306  -0.0349 0.0045  1403 VAL A N   
1138 C CA  . VAL A 145 ? 0.5957 0.4407 0.5296 0.0179  -0.0443 0.0118  1403 VAL A CA  
1139 C C   . VAL A 145 ? 0.6313 0.4470 0.5511 0.0202  -0.0752 0.0028  1403 VAL A C   
1140 O O   . VAL A 145 ? 0.6489 0.4479 0.5422 0.0368  -0.0848 -0.0142 1403 VAL A O   
1141 C CB  . VAL A 145 ? 0.5746 0.4363 0.5192 0.0149  -0.0211 0.0110  1403 VAL A CB  
1142 C CG1 . VAL A 145 ? 0.5351 0.4165 0.4878 0.0152  0.0051  0.0171  1403 VAL A CG1 
1143 C CG2 . VAL A 145 ? 0.5819 0.4373 0.5096 0.0256  -0.0186 -0.0063 1403 VAL A CG2 
1144 N N   . ASP A 146 ? 0.6377 0.4477 0.5740 0.0047  -0.0925 0.0153  1404 ASP A N   
1145 C CA  . ASP A 146 ? 0.6801 0.4556 0.6044 0.0041  -0.1268 0.0092  1404 ASP A CA  
1146 C C   . ASP A 146 ? 0.6872 0.4484 0.5858 0.0246  -0.1246 -0.0153 1404 ASP A C   
1147 O O   . ASP A 146 ? 0.6578 0.4401 0.5616 0.0277  -0.0992 -0.0195 1404 ASP A O   
1148 C CB  . ASP A 146 ? 0.6787 0.4598 0.6283 -0.0172 -0.1377 0.0287  1404 ASP A CB  
1149 C CG  . ASP A 146 ? 0.7448 0.4862 0.6870 -0.0253 -0.1819 0.0316  1404 ASP A CG  
1150 O OD1 . ASP A 146 ? 0.7877 0.5200 0.7356 -0.0372 -0.2054 0.0458  1404 ASP A OD1 
1151 O OD2 . ASP A 146 ? 0.7855 0.5026 0.7150 -0.0193 -0.1950 0.0195  1404 ASP A OD2 
1152 N N   . GLN A 147 ? 0.7299 0.4567 0.5995 0.0401  -0.1521 -0.0317 1405 GLN A N   
1153 C CA  . GLN A 147 ? 0.7513 0.4685 0.5939 0.0648  -0.1520 -0.0555 1405 GLN A CA  
1154 C C   . GLN A 147 ? 0.7403 0.4563 0.5929 0.0597  -0.1516 -0.0556 1405 GLN A C   
1155 O O   . GLN A 147 ? 0.7283 0.4577 0.5703 0.0762  -0.1359 -0.0696 1405 GLN A O   
1156 C CB  . GLN A 147 ? 0.8082 0.4828 0.6145 0.0855  -0.1882 -0.0741 1405 GLN A CB  
1157 C CG  . GLN A 147 ? 0.8281 0.5159 0.6022 0.1185  -0.1753 -0.0962 1405 GLN A CG  
1158 C CD  . GLN A 147 ? 0.8122 0.5332 0.5878 0.1303  -0.1466 -0.1037 1405 GLN A CD  
1159 O OE1 . GLN A 147 ? 0.8210 0.5268 0.5859 0.1418  -0.1589 -0.1154 1405 GLN A OE1 
1160 N NE2 . GLN A 147 ? 0.7707 0.5364 0.5596 0.1269  -0.1103 -0.0958 1405 GLN A NE2 
1161 N N   . SER A 148 ? 0.7383 0.4429 0.6123 0.0366  -0.1689 -0.0379 1406 SER A N   
1162 C CA  . SER A 148 ? 0.7395 0.4464 0.6252 0.0294  -0.1678 -0.0348 1406 SER A CA  
1163 C C   . SER A 148 ? 0.6850 0.4359 0.5866 0.0279  -0.1260 -0.0329 1406 SER A C   
1164 O O   . SER A 148 ? 0.6857 0.4419 0.5898 0.0294  -0.1202 -0.0369 1406 SER A O   
1165 C CB  . SER A 148 ? 0.7449 0.4419 0.6548 0.0014  -0.1915 -0.0099 1406 SER A CB  
1166 O OG  . SER A 148 ? 0.7248 0.4606 0.6636 -0.0171 -0.1699 0.0124  1406 SER A OG  
1167 N N   . ARG A 149 ? 0.6531 0.4320 0.5634 0.0255  -0.0999 -0.0272 1407 ARG A N   
1168 C CA  . ARG A 149 ? 0.6153 0.4296 0.5425 0.0194  -0.0655 -0.0213 1407 ARG A CA  
1169 C C   . ARG A 149 ? 0.5931 0.4267 0.5103 0.0320  -0.0399 -0.0308 1407 ARG A C   
1170 O O   . ARG A 149 ? 0.5636 0.4196 0.4904 0.0280  -0.0156 -0.0286 1407 ARG A O   
1171 C CB  . ARG A 149 ? 0.5985 0.4307 0.5501 0.0014  -0.0584 0.0000  1407 ARG A CB  
1172 C CG  . ARG A 149 ? 0.6197 0.4582 0.5914 -0.0155 -0.0676 0.0166  1407 ARG A CG  
1173 C CD  . ARG A 149 ? 0.6535 0.5131 0.6455 -0.0283 -0.0653 0.0384  1407 ARG A CD  
1174 N NE  . ARG A 149 ? 0.6878 0.5599 0.7006 -0.0457 -0.0781 0.0595  1407 ARG A NE  
1175 C CZ  . ARG A 149 ? 0.7111 0.6014 0.7436 -0.0601 -0.0886 0.0840  1407 ARG A CZ  
1176 N NH1 . ARG A 149 ? 0.7060 0.6009 0.7399 -0.0585 -0.0884 0.0890  1407 ARG A NH1 
1177 N NH2 . ARG A 149 ? 0.7171 0.6251 0.7691 -0.0765 -0.0998 0.1057  1407 ARG A NH2 
1178 N N   . GLU A 150 ? 0.6067 0.4318 0.5046 0.0460  -0.0469 -0.0395 1408 GLU A N   
1179 C CA  . GLU A 150 ? 0.5977 0.4453 0.4894 0.0540  -0.0238 -0.0418 1408 GLU A CA  
1180 C C   . GLU A 150 ? 0.5748 0.4454 0.4629 0.0613  -0.0042 -0.0489 1408 GLU A C   
1181 O O   . GLU A 150 ? 0.5516 0.4432 0.4493 0.0543  0.0181  -0.0419 1408 GLU A O   
1182 C CB  . GLU A 150 ? 0.6317 0.4697 0.5007 0.0697  -0.0361 -0.0495 1408 GLU A CB  
1183 C CG  . GLU A 150 ? 0.6486 0.5111 0.5171 0.0716  -0.0138 -0.0440 1408 GLU A CG  
1184 C CD  . GLU A 150 ? 0.7384 0.5916 0.5887 0.0826  -0.0269 -0.0469 1408 GLU A CD  
1185 O OE1 . GLU A 150 ? 0.7898 0.6371 0.6135 0.1038  -0.0398 -0.0622 1408 GLU A OE1 
1186 O OE2 . GLU A 150 ? 0.7340 0.5863 0.5951 0.0721  -0.0254 -0.0346 1408 GLU A OE2 
1187 N N   . ALA A 151 ? 0.5807 0.4466 0.4546 0.0756  -0.0146 -0.0620 1409 ALA A N   
1188 C CA  . ALA A 151 ? 0.5708 0.4648 0.4425 0.0831  0.0025  -0.0670 1409 ALA A CA  
1189 C C   . ALA A 151 ? 0.5343 0.4396 0.4287 0.0639  0.0184  -0.0579 1409 ALA A C   
1190 O O   . ALA A 151 ? 0.5236 0.4548 0.4229 0.0608  0.0374  -0.0548 1409 ALA A O   
1191 C CB  . ALA A 151 ? 0.5939 0.4813 0.4443 0.1064  -0.0137 -0.0838 1409 ALA A CB  
1192 N N   . GLY A 152 ? 0.5244 0.4117 0.4320 0.0504  0.0091  -0.0521 1410 GLY A N   
1193 C CA  . GLY A 152 ? 0.4930 0.3904 0.4190 0.0345  0.0224  -0.0442 1410 GLY A CA  
1194 C C   . GLY A 152 ? 0.4819 0.3911 0.4174 0.0246  0.0418  -0.0349 1410 GLY A C   
1195 O O   . GLY A 152 ? 0.4574 0.3796 0.3984 0.0184  0.0567  -0.0335 1410 GLY A O   
1196 N N   . PHE A 153 ? 0.4846 0.3865 0.4207 0.0236  0.0390  -0.0287 1411 PHE A N   
1197 C CA  . PHE A 153 ? 0.4828 0.3915 0.4246 0.0179  0.0544  -0.0207 1411 PHE A CA  
1198 C C   . PHE A 153 ? 0.4868 0.4083 0.4202 0.0217  0.0666  -0.0225 1411 PHE A C   
1199 O O   . PHE A 153 ? 0.4817 0.4074 0.4201 0.0141  0.0793  -0.0171 1411 PHE A O   
1200 C CB  . PHE A 153 ? 0.4896 0.3901 0.4336 0.0178  0.0472  -0.0131 1411 PHE A CB  
1201 C CG  . PHE A 153 ? 0.4857 0.3863 0.4454 0.0090  0.0431  -0.0028 1411 PHE A CG  
1202 C CD1 . PHE A 153 ? 0.4786 0.3886 0.4474 0.0045  0.0577  0.0023  1411 PHE A CD1 
1203 C CD2 . PHE A 153 ? 0.5075 0.4001 0.4716 0.0058  0.0229  0.0025  1411 PHE A CD2 
1204 C CE1 . PHE A 153 ? 0.4677 0.3877 0.4503 -0.0001 0.0556  0.0132  1411 PHE A CE1 
1205 C CE2 . PHE A 153 ? 0.5076 0.4103 0.4890 -0.0036 0.0194  0.0169  1411 PHE A CE2 
1206 C CZ  . PHE A 153 ? 0.4708 0.3914 0.4616 -0.0053 0.0376  0.0223  1411 PHE A CZ  
1207 N N   . LYS A 154 ? 0.5041 0.4324 0.4238 0.0342  0.0610  -0.0289 1412 LYS A N   
1208 C CA  . LYS A 154 ? 0.5219 0.4725 0.4347 0.0379  0.0722  -0.0265 1412 LYS A CA  
1209 C C   . LYS A 154 ? 0.5125 0.4800 0.4325 0.0300  0.0827  -0.0251 1412 LYS A C   
1210 O O   . LYS A 154 ? 0.5094 0.4857 0.4346 0.0193  0.0934  -0.0156 1412 LYS A O   
1211 C CB  . LYS A 154 ? 0.5414 0.5022 0.4352 0.0577  0.0638  -0.0346 1412 LYS A CB  
1212 C CG  . LYS A 154 ? 0.5921 0.5882 0.4798 0.0626  0.0763  -0.0288 1412 LYS A CG  
1213 C CD  . LYS A 154 ? 0.6659 0.6799 0.5312 0.0882  0.0689  -0.0387 1412 LYS A CD  
1214 C CE  . LYS A 154 ? 0.7114 0.7311 0.5658 0.0944  0.0693  -0.0332 1412 LYS A CE  
1215 N NZ  . LYS A 154 ? 0.7547 0.8175 0.5913 0.1152  0.0741  -0.0338 1412 LYS A NZ  
1216 N N   . ARG A 155 ? 0.5107 0.4795 0.4308 0.0339  0.0772  -0.0333 1413 ARG A N   
1217 C CA  . ARG A 155 ? 0.5129 0.4974 0.4409 0.0255  0.0853  -0.0319 1413 ARG A CA  
1218 C C   . ARG A 155 ? 0.5100 0.4806 0.4496 0.0079  0.0919  -0.0258 1413 ARG A C   
1219 O O   . ARG A 155 ? 0.5246 0.5050 0.4684 -0.0028 0.0996  -0.0197 1413 ARG A O   
1220 C CB  . ARG A 155 ? 0.5107 0.4974 0.4360 0.0347  0.0766  -0.0421 1413 ARG A CB  
1221 C CG  . ARG A 155 ? 0.5234 0.5340 0.4342 0.0560  0.0732  -0.0490 1413 ARG A CG  
1222 C CD  . ARG A 155 ? 0.5326 0.5423 0.4391 0.0677  0.0629  -0.0599 1413 ARG A CD  
1223 N NE  . ARG A 155 ? 0.5668 0.5405 0.4650 0.0760  0.0427  -0.0692 1413 ARG A NE  
1224 C CZ  . ARG A 155 ? 0.6037 0.5673 0.4815 0.0984  0.0274  -0.0803 1413 ARG A CZ  
1225 N NH1 . ARG A 155 ? 0.6198 0.6124 0.4824 0.1183  0.0328  -0.0844 1413 ARG A NH1 
1226 N NH2 . ARG A 155 ? 0.6283 0.5534 0.4997 0.1015  0.0047  -0.0865 1413 ARG A NH2 
1227 N N   . LEU A 156 ? 0.5062 0.4551 0.4499 0.0057  0.0872  -0.0265 1414 LEU A N   
1228 C CA  . LEU A 156 ? 0.5032 0.4402 0.4535 -0.0047 0.0930  -0.0225 1414 LEU A CA  
1229 C C   . LEU A 156 ? 0.5030 0.4361 0.4510 -0.0101 0.1001  -0.0152 1414 LEU A C   
1230 O O   . LEU A 156 ? 0.5051 0.4336 0.4538 -0.0195 0.1040  -0.0130 1414 LEU A O   
1231 C CB  . LEU A 156 ? 0.4989 0.4239 0.4542 -0.0030 0.0874  -0.0210 1414 LEU A CB  
1232 C CG  . LEU A 156 ? 0.5123 0.4285 0.4709 -0.0057 0.0935  -0.0161 1414 LEU A CG  
1233 C CD1 . LEU A 156 ? 0.5184 0.4313 0.4754 -0.0113 0.0996  -0.0193 1414 LEU A CD1 
1234 C CD2 . LEU A 156 ? 0.4936 0.4120 0.4601 -0.0034 0.0873  -0.0111 1414 LEU A CD2 
1235 N N   . LEU A 157 ? 0.4994 0.4312 0.4435 -0.0046 0.0990  -0.0111 1415 LEU A N   
1236 C CA  . LEU A 157 ? 0.5119 0.4374 0.4538 -0.0095 0.1036  -0.0023 1415 LEU A CA  
1237 C C   . LEU A 157 ? 0.5242 0.4661 0.4654 -0.0185 0.1072  0.0046  1415 LEU A C   
1238 O O   . LEU A 157 ? 0.5256 0.4552 0.4674 -0.0299 0.1080  0.0116  1415 LEU A O   
1239 C CB  . LEU A 157 ? 0.5153 0.4399 0.4532 -0.0014 0.1010  0.0014  1415 LEU A CB  
1240 C CG  . LEU A 157 ? 0.5210 0.4307 0.4631 0.0031  0.0970  0.0005  1415 LEU A CG  
1241 C CD1 . LEU A 157 ? 0.4874 0.3993 0.4261 0.0113  0.0896  0.0016  1415 LEU A CD1 
1242 C CD2 . LEU A 157 ? 0.5120 0.4051 0.4553 0.0006  0.1015  0.0054  1415 LEU A CD2 
1243 N N   . GLN A 158 ? 0.5216 0.4919 0.4608 -0.0127 0.1075  0.0035  1416 GLN A N   
1244 C CA  . GLN A 158 ? 0.5389 0.5382 0.4802 -0.0207 0.1114  0.0137  1416 GLN A CA  
1245 C C   . GLN A 158 ? 0.5448 0.5398 0.4933 -0.0353 0.1112  0.0144  1416 GLN A C   
1246 O O   . GLN A 158 ? 0.5519 0.5529 0.5044 -0.0510 0.1110  0.0274  1416 GLN A O   
1247 C CB  . GLN A 158 ? 0.5350 0.5707 0.4710 -0.0053 0.1121  0.0100  1416 GLN A CB  
1248 C CG  . GLN A 158 ? 0.5506 0.5961 0.4756 0.0094  0.1112  0.0108  1416 GLN A CG  
1249 C CD  . GLN A 158 ? 0.5650 0.6408 0.4784 0.0314  0.1090  0.0021  1416 GLN A CD  
1250 O OE1 . GLN A 158 ? 0.5805 0.6591 0.4937 0.0386  0.1056  -0.0085 1416 GLN A OE1 
1251 N NE2 . GLN A 158 ? 0.5610 0.6593 0.4627 0.0446  0.1101  0.0060  1416 GLN A NE2 
1252 N N   . SER A 159 ? 0.5391 0.5224 0.4889 -0.0315 0.1091  0.0019  1417 SER A N   
1253 C CA  . SER A 159 ? 0.5480 0.5265 0.5024 -0.0438 0.1080  0.0007  1417 SER A CA  
1254 C C   . SER A 159 ? 0.5658 0.5142 0.5182 -0.0575 0.1051  0.0061  1417 SER A C   
1255 O O   . SER A 159 ? 0.5833 0.5319 0.5380 -0.0728 0.1013  0.0127  1417 SER A O   
1256 C CB  . SER A 159 ? 0.5332 0.5026 0.4883 -0.0368 0.1059  -0.0122 1417 SER A CB  
1257 O OG  . SER A 159 ? 0.5392 0.5049 0.4968 -0.0479 0.1045  -0.0136 1417 SER A OG  
1258 N N   . GLY A 160 ? 0.5714 0.4932 0.5185 -0.0514 0.1046  0.0039  1418 GLY A N   
1259 C CA  . GLY A 160 ? 0.5907 0.4782 0.5315 -0.0588 0.0996  0.0069  1418 GLY A CA  
1260 C C   . GLY A 160 ? 0.6131 0.4981 0.5533 -0.0687 0.0965  0.0226  1418 GLY A C   
1261 O O   . GLY A 160 ? 0.6345 0.4850 0.5673 -0.0722 0.0898  0.0252  1418 GLY A O   
1262 N N   . GLY A 161 ? 0.6037 0.5257 0.5500 -0.0716 0.1003  0.0336  1419 GLY A N   
1263 C CA  . GLY A 161 ? 0.6231 0.5523 0.5708 -0.0840 0.0972  0.0534  1419 GLY A CA  
1264 C C   . GLY A 161 ? 0.6287 0.5527 0.5718 -0.0737 0.0996  0.0571  1419 GLY A C   
1265 O O   . GLY A 161 ? 0.6514 0.5712 0.5941 -0.0840 0.0952  0.0736  1419 GLY A O   
1266 N N   . ALA A 162 ? 0.6112 0.5347 0.5513 -0.0551 0.1045  0.0437  1420 ALA A N   
1267 C CA  . ALA A 162 ? 0.6147 0.5388 0.5508 -0.0453 0.1061  0.0476  1420 ALA A CA  
1268 C C   . ALA A 162 ? 0.6111 0.5789 0.5465 -0.0401 0.1104  0.0552  1420 ALA A C   
1269 O O   . ALA A 162 ? 0.6028 0.5999 0.5395 -0.0354 0.1133  0.0503  1420 ALA A O   
1270 C CB  . ALA A 162 ? 0.6017 0.5101 0.5358 -0.0296 0.1066  0.0334  1420 ALA A CB  
1271 N N   . LYS A 163 ? 0.6187 0.5918 0.5503 -0.0386 0.1105  0.0668  1421 LYS A N   
1272 C CA  . LYS A 163 ? 0.6214 0.6341 0.5471 -0.0268 0.1143  0.0708  1421 LYS A CA  
1273 C C   . LYS A 163 ? 0.6116 0.6116 0.5291 -0.0072 0.1121  0.0544  1421 LYS A C   
1274 O O   . LYS A 163 ? 0.6099 0.5809 0.5271 -0.0059 0.1090  0.0533  1421 LYS A O   
1275 C CB  . LYS A 163 ? 0.6447 0.6706 0.5700 -0.0365 0.1141  0.0939  1421 LYS A CB  
1276 C CG  . LYS A 163 ? 0.6703 0.7482 0.5883 -0.0251 0.1191  0.1030  1421 LYS A CG  
1277 C CD  . LYS A 163 ? 0.7365 0.8434 0.6610 -0.0441 0.1195  0.1334  1421 LYS A CD  
1278 C CE  . LYS A 163 ? 0.7700 0.9007 0.6857 -0.0365 0.1212  0.1472  1421 LYS A CE  
1279 N NZ  . LYS A 163 ? 0.7594 0.9336 0.6604 -0.0096 0.1270  0.1370  1421 LYS A NZ  
1280 N N   . VAL A 164 ? 0.6008 0.6208 0.5118 0.0079  0.1114  0.0420  1422 VAL A N   
1281 C CA  . VAL A 164 ? 0.5910 0.5987 0.4922 0.0248  0.1044  0.0289  1422 VAL A CA  
1282 C C   . VAL A 164 ? 0.6094 0.6451 0.4961 0.0383  0.1043  0.0335  1422 VAL A C   
1283 O O   . VAL A 164 ? 0.6072 0.6800 0.4858 0.0486  0.1074  0.0333  1422 VAL A O   
1284 C CB  . VAL A 164 ? 0.5823 0.5822 0.4815 0.0345  0.0977  0.0109  1422 VAL A CB  
1285 C CG1 . VAL A 164 ? 0.5688 0.5520 0.4573 0.0490  0.0851  0.0003  1422 VAL A CG1 
1286 C CG2 . VAL A 164 ? 0.5468 0.5224 0.4600 0.0215  0.0985  0.0081  1422 VAL A CG2 
1287 N N   . LEU A 165 ? 0.6224 0.6439 0.5052 0.0398  0.1011  0.0382  1423 LEU A N   
1288 C CA  . LEU A 165 ? 0.6473 0.6942 0.5152 0.0520  0.1008  0.0441  1423 LEU A CA  
1289 C C   . LEU A 165 ? 0.6664 0.7164 0.5147 0.0760  0.0905  0.0251  1423 LEU A C   
1290 O O   . LEU A 165 ? 0.6601 0.6794 0.5091 0.0789  0.0799  0.0107  1423 LEU A O   
1291 C CB  . LEU A 165 ? 0.6538 0.6810 0.5235 0.0461  0.0988  0.0546  1423 LEU A CB  
1292 C CG  . LEU A 165 ? 0.6608 0.6775 0.5444 0.0258  0.1045  0.0735  1423 LEU A CG  
1293 C CD1 . LEU A 165 ? 0.6507 0.6405 0.5352 0.0252  0.1001  0.0785  1423 LEU A CD1 
1294 C CD2 . LEU A 165 ? 0.6696 0.7262 0.5522 0.0184  0.1112  0.0938  1423 LEU A CD2 
1295 N N   . PRO A 166 ? 0.6917 0.7791 0.5210 0.0940  0.0917  0.0258  1424 PRO A N   
1296 C CA  . PRO A 166 ? 0.7182 0.8030 0.5230 0.1211  0.0783  0.0046  1424 PRO A CA  
1297 C C   . PRO A 166 ? 0.7385 0.7941 0.5312 0.1275  0.0642  -0.0008 1424 PRO A C   
1298 O O   . PRO A 166 ? 0.7600 0.8343 0.5425 0.1326  0.0669  0.0087  1424 PRO A O   
1299 C CB  . PRO A 166 ? 0.7375 0.8803 0.5248 0.1408  0.0865  0.0088  1424 PRO A CB  
1300 C CG  . PRO A 166 ? 0.7277 0.9014 0.5290 0.1219  0.1012  0.0372  1424 PRO A CG  
1301 C CD  . PRO A 166 ? 0.7006 0.8344 0.5288 0.0913  0.1034  0.0469  1424 PRO A CD  
1302 N N   . GLY A 167 ? 0.7394 0.7523 0.5338 0.1261  0.0482  -0.0139 1425 GLY A N   
1303 C CA  . GLY A 167 ? 0.7526 0.7384 0.5358 0.1314  0.0308  -0.0187 1425 GLY A CA  
1304 C C   . GLY A 167 ? 0.7302 0.6957 0.5367 0.1095  0.0333  -0.0042 1425 GLY A C   
1305 O O   . GLY A 167 ? 0.7128 0.6775 0.5422 0.0919  0.0465  0.0061  1425 GLY A O   
1306 N N   . HIS A 168 ? 0.7410 0.6900 0.5398 0.1128  0.0192  -0.0042 1426 HIS A N   
1307 C CA  . HIS A 168 ? 0.7309 0.6636 0.5503 0.0962  0.0191  0.0089  1426 HIS A CA  
1308 C C   . HIS A 168 ? 0.7389 0.6776 0.5472 0.1016  0.0155  0.0168  1426 HIS A C   
1309 O O   . HIS A 168 ? 0.7411 0.6651 0.5605 0.0935  0.0083  0.0247  1426 HIS A O   
1310 C CB  . HIS A 168 ? 0.7331 0.6360 0.5624 0.0894  0.0004  0.0033  1426 HIS A CB  
1311 C CG  . HIS A 168 ? 0.7826 0.6666 0.5879 0.1034  -0.0263 -0.0121 1426 HIS A CG  
1312 N ND1 . HIS A 168 ? 0.8138 0.6841 0.6081 0.1116  -0.0390 -0.0280 1426 HIS A ND1 
1313 C CD2 . HIS A 168 ? 0.8238 0.6964 0.6112 0.1119  -0.0456 -0.0150 1426 HIS A CD2 
1314 C CE1 . HIS A 168 ? 0.8473 0.6945 0.6164 0.1252  -0.0665 -0.0408 1426 HIS A CE1 
1315 N NE2 . HIS A 168 ? 0.8618 0.7102 0.6260 0.1252  -0.0712 -0.0335 1426 HIS A NE2 
1316 N N   . SER A 169 ? 0.7523 0.7174 0.5390 0.1161  0.0207  0.0162  1427 SER A N   
1317 C CA  . SER A 169 ? 0.7684 0.7436 0.5416 0.1227  0.0176  0.0243  1427 SER A CA  
1318 C C   . SER A 169 ? 0.7432 0.7216 0.5387 0.1053  0.0316  0.0464  1427 SER A C   
1319 O O   . SER A 169 ? 0.7233 0.7088 0.5356 0.0931  0.0474  0.0562  1427 SER A O   
1320 C CB  . SER A 169 ? 0.7889 0.8017 0.5348 0.1427  0.0232  0.0217  1427 SER A CB  
1321 O OG  . SER A 169 ? 0.8426 0.8487 0.5602 0.1658  0.0063  -0.0013 1427 SER A OG  
1322 N N   . VAL A 170 ? 0.7457 0.7164 0.5396 0.1053  0.0234  0.0539  1428 VAL A N   
1323 C CA  . VAL A 170 ? 0.7296 0.6989 0.5420 0.0924  0.0332  0.0740  1428 VAL A CA  
1324 C C   . VAL A 170 ? 0.7220 0.7154 0.5361 0.0867  0.0510  0.0901  1428 VAL A C   
1325 O O   . VAL A 170 ? 0.7128 0.6952 0.5461 0.0729  0.0599  0.1020  1428 VAL A O   
1326 C CB  . VAL A 170 ? 0.7490 0.7120 0.5562 0.0960  0.0205  0.0801  1428 VAL A CB  
1327 C CG1 . VAL A 170 ? 0.7392 0.7012 0.5633 0.0861  0.0303  0.1010  1428 VAL A CG1 
1328 C CG2 . VAL A 170 ? 0.7445 0.6836 0.5579 0.0947  0.0010  0.0705  1428 VAL A CG2 
1329 N N   . PRO A 171 ? 0.7259 0.7527 0.5194 0.0977  0.0546  0.0912  1429 PRO A N   
1330 C CA  . PRO A 171 ? 0.7210 0.7771 0.5189 0.0888  0.0696  0.1113  1429 PRO A CA  
1331 C C   . PRO A 171 ? 0.6962 0.7463 0.5138 0.0729  0.0796  0.1147  1429 PRO A C   
1332 O O   . PRO A 171 ? 0.6950 0.7539 0.5231 0.0580  0.0876  0.1353  1429 PRO A O   
1333 C CB  . PRO A 171 ? 0.7365 0.8374 0.5082 0.1079  0.0710  0.1073  1429 PRO A CB  
1334 C CG  . PRO A 171 ? 0.7532 0.8419 0.5025 0.1269  0.0546  0.0903  1429 PRO A CG  
1335 C CD  . PRO A 171 ? 0.7527 0.7941 0.5162 0.1199  0.0432  0.0760  1429 PRO A CD  
1336 N N   . LEU A 172 ? 0.6727 0.7066 0.4945 0.0752  0.0769  0.0957  1430 LEU A N   
1337 C CA  . LEU A 172 ? 0.6536 0.6810 0.4923 0.0615  0.0850  0.0965  1430 LEU A CA  
1338 C C   . LEU A 172 ? 0.6384 0.6284 0.4970 0.0468  0.0853  0.1019  1430 LEU A C   
1339 O O   . LEU A 172 ? 0.6286 0.6103 0.4990 0.0344  0.0910  0.1055  1430 LEU A O   
1340 C CB  . LEU A 172 ? 0.6431 0.6683 0.4780 0.0703  0.0816  0.0748  1430 LEU A CB  
1341 C CG  . LEU A 172 ? 0.6611 0.7213 0.4770 0.0875  0.0821  0.0649  1430 LEU A CG  
1342 C CD1 . LEU A 172 ? 0.7118 0.7944 0.5022 0.1074  0.0762  0.0632  1430 LEU A CD1 
1343 C CD2 . LEU A 172 ? 0.6905 0.7282 0.5044 0.0953  0.0725  0.0419  1430 LEU A CD2 
1344 N N   . PHE A 173 ? 0.6330 0.6026 0.4938 0.0501  0.0784  0.1023  1431 PHE A N   
1345 C CA  . PHE A 173 ? 0.6328 0.5711 0.5100 0.0430  0.0783  0.1046  1431 PHE A CA  
1346 C C   . PHE A 173 ? 0.6421 0.5694 0.5253 0.0312  0.0833  0.1216  1431 PHE A C   
1347 O O   . PHE A 173 ? 0.6364 0.5385 0.5294 0.0258  0.0844  0.1199  1431 PHE A O   
1348 C CB  . PHE A 173 ? 0.6306 0.5577 0.5101 0.0503  0.0697  0.1046  1431 PHE A CB  
1349 C CG  . PHE A 173 ? 0.6285 0.5568 0.5049 0.0579  0.0591  0.0900  1431 PHE A CG  
1350 C CD1 . PHE A 173 ? 0.6223 0.5519 0.4974 0.0583  0.0578  0.0756  1431 PHE A CD1 
1351 C CD2 . PHE A 173 ? 0.6303 0.5557 0.5060 0.0632  0.0476  0.0921  1431 PHE A CD2 
1352 C CE1 . PHE A 173 ? 0.6265 0.5507 0.4980 0.0637  0.0435  0.0637  1431 PHE A CE1 
1353 C CE2 . PHE A 173 ? 0.6454 0.5671 0.5187 0.0668  0.0330  0.0811  1431 PHE A CE2 
1354 C CZ  . PHE A 173 ? 0.6447 0.5637 0.5152 0.0668  0.0299  0.0669  1431 PHE A CZ  
1355 N N   . LYS A 174 ? 0.6520 0.5975 0.5278 0.0274  0.0844  0.1385  1432 LYS A N   
1356 C CA  . LYS A 174 ? 0.6717 0.6043 0.5525 0.0132  0.0845  0.1584  1432 LYS A CA  
1357 C C   . LYS A 174 ? 0.6802 0.6119 0.5670 -0.0011 0.0878  0.1604  1432 LYS A C   
1358 O O   . LYS A 174 ? 0.6990 0.6036 0.5910 -0.0138 0.0834  0.1717  1432 LYS A O   
1359 C CB  . LYS A 174 ? 0.6922 0.6501 0.5646 0.0105  0.0836  0.1802  1432 LYS A CB  
1360 C CG  . LYS A 174 ? 0.6681 0.6747 0.5340 0.0065  0.0895  0.1900  1432 LYS A CG  
1361 C CD  . LYS A 174 ? 0.6767 0.7134 0.5343 0.0049  0.0888  0.2142  1432 LYS A CD  
1362 C CE  . LYS A 174 ? 0.6605 0.7120 0.5025 0.0254  0.0867  0.2042  1432 LYS A CE  
1363 N NZ  . LYS A 174 ? 0.6217 0.7070 0.4492 0.0423  0.0901  0.1854  1432 LYS A NZ  
1364 N N   . GLU A 175 ? 0.6735 0.6329 0.5584 0.0015  0.0932  0.1496  1433 GLU A N   
1365 C CA  . GLU A 175 ? 0.6769 0.6404 0.5687 -0.0110 0.0962  0.1501  1433 GLU A CA  
1366 C C   . GLU A 175 ? 0.6676 0.6002 0.5659 -0.0085 0.0958  0.1295  1433 GLU A C   
1367 O O   . GLU A 175 ? 0.6702 0.5922 0.5745 -0.0201 0.0958  0.1296  1433 GLU A O   
1368 C CB  . GLU A 175 ? 0.6759 0.6910 0.5618 -0.0065 0.1027  0.1499  1433 GLU A CB  
1369 C CG  . GLU A 175 ? 0.6871 0.7222 0.5817 -0.0239 0.1056  0.1626  1433 GLU A CG  
1370 C CD  . GLU A 175 ? 0.6864 0.7773 0.5754 -0.0143 0.1130  0.1600  1433 GLU A CD  
1371 O OE1 . GLU A 175 ? 0.6756 0.7782 0.5726 -0.0227 0.1156  0.1592  1433 GLU A OE1 
1372 O OE2 . GLU A 175 ? 0.6943 0.8176 0.5693 0.0033  0.1155  0.1581  1433 GLU A OE2 
1373 N N   . ALA A 176 ? 0.6544 0.5754 0.5518 0.0055  0.0943  0.1140  1434 ALA A N   
1374 C CA  . ALA A 176 ? 0.6443 0.5465 0.5482 0.0091  0.0944  0.0967  1434 ALA A CA  
1375 C C   . ALA A 176 ? 0.6565 0.5219 0.5656 0.0078  0.0918  0.0975  1434 ALA A C   
1376 O O   . ALA A 176 ? 0.6731 0.5239 0.5807 0.0114  0.0882  0.1062  1434 ALA A O   
1377 C CB  . ALA A 176 ? 0.6333 0.5426 0.5356 0.0224  0.0912  0.0837  1434 ALA A CB  
1378 N N   . THR A 177 ? 0.6546 0.5055 0.5677 0.0050  0.0930  0.0876  1435 THR A N   
1379 C CA  . THR A 177 ? 0.6654 0.4838 0.5796 0.0106  0.0903  0.0830  1435 THR A CA  
1380 C C   . THR A 177 ? 0.6423 0.4680 0.5628 0.0233  0.0927  0.0705  1435 THR A C   
1381 O O   . THR A 177 ? 0.6537 0.4673 0.5757 0.0349  0.0916  0.0696  1435 THR A O   
1382 C CB  . THR A 177 ? 0.6797 0.4752 0.5913 0.0004  0.0877  0.0806  1435 THR A CB  
1383 O OG1 . THR A 177 ? 0.6587 0.4739 0.5745 -0.0045 0.0925  0.0713  1435 THR A OG1 
1384 C CG2 . THR A 177 ? 0.7192 0.5046 0.6269 -0.0157 0.0811  0.0982  1435 THR A CG2 
1385 N N   . HIS A 178 ? 0.6151 0.4625 0.5393 0.0216  0.0948  0.0625  1436 HIS A N   
1386 C CA  . HIS A 178 ? 0.5954 0.4519 0.5276 0.0289  0.0944  0.0541  1436 HIS A CA  
1387 C C   . HIS A 178 ? 0.5785 0.4550 0.5115 0.0298  0.0896  0.0520  1436 HIS A C   
1388 O O   . HIS A 178 ? 0.5788 0.4656 0.5048 0.0266  0.0891  0.0500  1436 HIS A O   
1389 C CB  . HIS A 178 ? 0.5839 0.4378 0.5186 0.0255  0.0975  0.0443  1436 HIS A CB  
1390 C CG  . HIS A 178 ? 0.6132 0.4427 0.5432 0.0271  0.0989  0.0425  1436 HIS A CG  
1391 N ND1 . HIS A 178 ? 0.6623 0.4726 0.5845 0.0175  0.0969  0.0462  1436 HIS A ND1 
1392 C CD2 . HIS A 178 ? 0.6094 0.4306 0.5396 0.0381  0.1001  0.0374  1436 HIS A CD2 
1393 C CE1 . HIS A 178 ? 0.6856 0.4686 0.6011 0.0227  0.0943  0.0414  1436 HIS A CE1 
1394 N NE2 . HIS A 178 ? 0.6540 0.4449 0.5730 0.0375  0.0974  0.0347  1436 HIS A NE2 
1395 N N   . LEU A 179 ? 0.5707 0.4538 0.5115 0.0352  0.0842  0.0530  1437 LEU A N   
1396 C CA  . LEU A 179 ? 0.5592 0.4530 0.4998 0.0351  0.0740  0.0497  1437 LEU A CA  
1397 C C   . LEU A 179 ? 0.5450 0.4446 0.4990 0.0336  0.0703  0.0488  1437 LEU A C   
1398 O O   . LEU A 179 ? 0.5548 0.4603 0.5194 0.0372  0.0719  0.0566  1437 LEU A O   
1399 C CB  . LEU A 179 ? 0.5635 0.4605 0.5011 0.0395  0.0659  0.0572  1437 LEU A CB  
1400 C CG  . LEU A 179 ? 0.5899 0.4904 0.5217 0.0406  0.0500  0.0532  1437 LEU A CG  
1401 C CD1 . LEU A 179 ? 0.5950 0.4971 0.5171 0.0457  0.0440  0.0590  1437 LEU A CD1 
1402 C CD2 . LEU A 179 ? 0.5884 0.4920 0.5349 0.0364  0.0382  0.0563  1437 LEU A CD2 
1403 N N   . PHE A 180 ? 0.5302 0.4311 0.4836 0.0294  0.0656  0.0407  1438 PHE A N   
1404 C CA  . PHE A 180 ? 0.5114 0.4198 0.4778 0.0255  0.0606  0.0423  1438 PHE A CA  
1405 C C   . PHE A 180 ? 0.5159 0.4239 0.4834 0.0219  0.0410  0.0435  1438 PHE A C   
1406 O O   . PHE A 180 ? 0.5207 0.4187 0.4736 0.0244  0.0323  0.0346  1438 PHE A O   
1407 C CB  . PHE A 180 ? 0.4982 0.4048 0.4635 0.0222  0.0675  0.0333  1438 PHE A CB  
1408 C CG  . PHE A 180 ? 0.4995 0.4010 0.4625 0.0242  0.0820  0.0315  1438 PHE A CG  
1409 C CD1 . PHE A 180 ? 0.4770 0.3839 0.4474 0.0293  0.0877  0.0361  1438 PHE A CD1 
1410 C CD2 . PHE A 180 ? 0.4876 0.3800 0.4399 0.0218  0.0881  0.0259  1438 PHE A CD2 
1411 C CE1 . PHE A 180 ? 0.4939 0.3881 0.4572 0.0337  0.0969  0.0319  1438 PHE A CE1 
1412 C CE2 . PHE A 180 ? 0.4806 0.3616 0.4295 0.0211  0.0963  0.0251  1438 PHE A CE2 
1413 C CZ  . PHE A 180 ? 0.5016 0.3787 0.4540 0.0279  0.0996  0.0263  1438 PHE A CZ  
1414 N N   . SER A 181 ? 0.5188 0.4388 0.5026 0.0165  0.0324  0.0552  1439 SER A N   
1415 C CA  . SER A 181 ? 0.5423 0.4582 0.5295 0.0090  0.0085  0.0597  1439 SER A CA  
1416 C C   . SER A 181 ? 0.5532 0.4861 0.5604 -0.0011 0.0027  0.0722  1439 SER A C   
1417 O O   . SER A 181 ? 0.5392 0.4962 0.5600 0.0005  0.0169  0.0819  1439 SER A O   
1418 C CB  . SER A 181 ? 0.5456 0.4626 0.5340 0.0090  -0.0037 0.0696  1439 SER A CB  
1419 O OG  . SER A 181 ? 0.5444 0.4497 0.5325 0.0005  -0.0318 0.0729  1439 SER A OG  
1420 N N   . ASP A 182 ? 0.5874 0.5083 0.5947 -0.0102 -0.0195 0.0727  1440 ASP A N   
1421 C CA  . ASP A 182 ? 0.6121 0.5517 0.6406 -0.0237 -0.0303 0.0906  1440 ASP A CA  
1422 C C   . ASP A 182 ? 0.6470 0.5781 0.6822 -0.0371 -0.0630 0.1047  1440 ASP A C   
1423 O O   . ASP A 182 ? 0.6584 0.5950 0.7078 -0.0520 -0.0813 0.1193  1440 ASP A O   
1424 C CB  . ASP A 182 ? 0.6079 0.5427 0.6347 -0.0262 -0.0273 0.0824  1440 ASP A CB  
1425 C CG  . ASP A 182 ? 0.6419 0.5400 0.6497 -0.0255 -0.0470 0.0660  1440 ASP A CG  
1426 O OD1 . ASP A 182 ? 0.6581 0.5519 0.6641 -0.0265 -0.0452 0.0591  1440 ASP A OD1 
1427 O OD2 . ASP A 182 ? 0.6664 0.5402 0.6594 -0.0219 -0.0651 0.0591  1440 ASP A OD2 
1428 N N   . LEU A 183 ? 0.6830 0.6005 0.7081 -0.0330 -0.0725 0.1022  1441 LEU A N   
1429 C CA  . LEU A 183 ? 0.7260 0.6241 0.7505 -0.0450 -0.1088 0.1110  1441 LEU A CA  
1430 C C   . LEU A 183 ? 0.7312 0.6597 0.7801 -0.0571 -0.1179 0.1391  1441 LEU A C   
1431 O O   . LEU A 183 ? 0.7327 0.6758 0.7820 -0.0483 -0.1043 0.1411  1441 LEU A O   
1432 C CB  . LEU A 183 ? 0.7538 0.6120 0.7458 -0.0320 -0.1210 0.0876  1441 LEU A CB  
1433 C CG  . LEU A 183 ? 0.7792 0.6061 0.7476 -0.0224 -0.1262 0.0639  1441 LEU A CG  
1434 C CD1 . LEU A 183 ? 0.8074 0.6174 0.7444 -0.0009 -0.1189 0.0401  1441 LEU A CD1 
1435 C CD2 . LEU A 183 ? 0.8010 0.5953 0.7658 -0.0339 -0.1663 0.0665  1441 LEU A CD2 
1436 N N   . GLY A 192 ? 0.9356 0.6993 0.7640 0.0535  -0.1734 0.0130  1450 GLY A N   
1437 C CA  . GLY A 192 ? 0.9465 0.7173 0.7450 0.0760  -0.1624 -0.0004 1450 GLY A CA  
1438 C C   . GLY A 192 ? 0.9045 0.7132 0.7171 0.0778  -0.1209 0.0078  1450 GLY A C   
1439 O O   . GLY A 192 ? 0.9159 0.7387 0.7077 0.0943  -0.1069 0.0004  1450 GLY A O   
1440 N N   . VAL A 193 ? 0.8556 0.6813 0.7023 0.0613  -0.1029 0.0242  1451 VAL A N   
1441 C CA  . VAL A 193 ? 0.8112 0.6639 0.6698 0.0623  -0.0685 0.0317  1451 VAL A CA  
1442 C C   . VAL A 193 ? 0.7842 0.6512 0.6624 0.0543  -0.0630 0.0514  1451 VAL A C   
1443 O O   . VAL A 193 ? 0.7757 0.6458 0.6771 0.0415  -0.0724 0.0652  1451 VAL A O   
1444 C CB  . VAL A 193 ? 0.7873 0.6473 0.6633 0.0556  -0.0501 0.0315  1451 VAL A CB  
1445 C CG1 . VAL A 193 ? 0.7876 0.6503 0.6931 0.0391  -0.0560 0.0461  1451 VAL A CG1 
1446 C CG2 . VAL A 193 ? 0.7632 0.6428 0.6439 0.0581  -0.0197 0.0358  1451 VAL A CG2 
1447 N N   . ASN A 194 ? 0.7603 0.6394 0.6295 0.0626  -0.0486 0.0545  1452 ASN A N   
1448 C CA  . ASN A 194 ? 0.7298 0.6214 0.6153 0.0582  -0.0431 0.0725  1452 ASN A CA  
1449 C C   . ASN A 194 ? 0.6957 0.5998 0.6037 0.0539  -0.0184 0.0824  1452 ASN A C   
1450 O O   . ASN A 194 ? 0.6926 0.6019 0.5965 0.0585  -0.0003 0.0851  1452 ASN A O   
1451 C CB  . ASN A 194 ? 0.7412 0.6375 0.6061 0.0686  -0.0425 0.0733  1452 ASN A CB  
1452 C CG  . ASN A 194 ? 0.7109 0.6151 0.5892 0.0648  -0.0476 0.0906  1452 ASN A CG  
1453 O OD1 . ASN A 194 ? 0.6278 0.5413 0.5327 0.0574  -0.0414 0.1040  1452 ASN A OD1 
1454 N ND2 . ASN A 194 ? 0.6997 0.6034 0.5583 0.0721  -0.0591 0.0904  1452 ASN A ND2 
1455 N N   . ILE A 195 ? 0.6675 0.5762 0.5981 0.0452  -0.0202 0.0887  1453 ILE A N   
1456 C CA  . ILE A 195 ? 0.6346 0.5537 0.5833 0.0443  0.0000  0.0949  1453 ILE A CA  
1457 C C   . ILE A 195 ? 0.6191 0.5483 0.5762 0.0502  0.0110  0.1080  1453 ILE A C   
1458 O O   . ILE A 195 ? 0.6126 0.5386 0.5698 0.0551  0.0285  0.1074  1453 ILE A O   
1459 C CB  . ILE A 195 ? 0.6217 0.5524 0.5931 0.0355  -0.0062 0.1024  1453 ILE A CB  
1460 C CG1 . ILE A 195 ? 0.6489 0.5660 0.6139 0.0280  -0.0230 0.0921  1453 ILE A CG1 
1461 C CG2 . ILE A 195 ? 0.5976 0.5396 0.5821 0.0393  0.0150  0.1054  1453 ILE A CG2 
1462 C CD1 . ILE A 195 ? 0.6518 0.5628 0.6131 0.0285  -0.0100 0.0795  1453 ILE A CD1 
1463 N N   . ALA A 196 ? 0.6090 0.5483 0.5731 0.0498  -0.0014 0.1201  1454 ALA A N   
1464 C CA  . ALA A 196 ? 0.6035 0.5544 0.5767 0.0575  0.0065  0.1338  1454 ALA A CA  
1465 C C   . ALA A 196 ? 0.6088 0.5457 0.5634 0.0645  0.0167  0.1306  1454 ALA A C   
1466 O O   . ALA A 196 ? 0.6075 0.5429 0.5653 0.0720  0.0282  0.1373  1454 ALA A O   
1467 C CB  . ALA A 196 ? 0.6037 0.5705 0.5873 0.0542  -0.0116 0.1481  1454 ALA A CB  
1468 N N   . GLU A 197 ? 0.6142 0.5417 0.5481 0.0630  0.0107  0.1212  1455 GLU A N   
1469 C CA  . GLU A 197 ? 0.6232 0.5453 0.5390 0.0674  0.0191  0.1208  1455 GLU A CA  
1470 C C   . GLU A 197 ? 0.6091 0.5227 0.5255 0.0660  0.0365  0.1176  1455 GLU A C   
1471 O O   . GLU A 197 ? 0.6206 0.5277 0.5350 0.0679  0.0450  0.1261  1455 GLU A O   
1472 C CB  . GLU A 197 ? 0.6326 0.5547 0.5254 0.0692  0.0077  0.1104  1455 GLU A CB  
1473 C CG  . GLU A 197 ? 0.6720 0.6001 0.5446 0.0748  0.0128  0.1134  1455 GLU A CG  
1474 C CD  . GLU A 197 ? 0.6709 0.6036 0.5442 0.0779  0.0100  0.1286  1455 GLU A CD  
1475 O OE1 . GLU A 197 ? 0.6966 0.6311 0.5737 0.0788  -0.0048 0.1323  1455 GLU A OE1 
1476 O OE2 . GLU A 197 ? 0.6923 0.6272 0.5619 0.0783  0.0212  0.1385  1455 GLU A OE2 
1477 N N   . ALA A 198 ? 0.5922 0.5031 0.5116 0.0618  0.0393  0.1066  1456 ALA A N   
1478 C CA  . ALA A 198 ? 0.5885 0.4906 0.5094 0.0591  0.0531  0.1033  1456 ALA A CA  
1479 C C   . ALA A 198 ? 0.5888 0.4829 0.5224 0.0635  0.0596  0.1104  1456 ALA A C   
1480 O O   . ALA A 198 ? 0.6101 0.4893 0.5392 0.0641  0.0665  0.1140  1456 ALA A O   
1481 C CB  . ALA A 198 ? 0.5714 0.4739 0.4937 0.0545  0.0533  0.0903  1456 ALA A CB  
1482 N N   . ALA A 199 ? 0.5693 0.4746 0.5179 0.0675  0.0555  0.1135  1457 ALA A N   
1483 C CA  . ALA A 199 ? 0.5752 0.4805 0.5342 0.0778  0.0615  0.1194  1457 ALA A CA  
1484 C C   . ALA A 199 ? 0.5954 0.4908 0.5490 0.0862  0.0617  0.1296  1457 ALA A C   
1485 O O   . ALA A 199 ? 0.6070 0.4850 0.5577 0.0954  0.0671  0.1302  1457 ALA A O   
1486 C CB  . ALA A 199 ? 0.5593 0.4914 0.5369 0.0805  0.0561  0.1258  1457 ALA A CB  
1487 N N   . ALA A 200 ? 0.6002 0.5034 0.5501 0.0840  0.0537  0.1371  1458 ALA A N   
1488 C CA  . ALA A 200 ? 0.6269 0.5220 0.5714 0.0909  0.0526  0.1485  1458 ALA A CA  
1489 C C   . ALA A 200 ? 0.6434 0.5124 0.5738 0.0870  0.0579  0.1487  1458 ALA A C   
1490 O O   . ALA A 200 ? 0.6579 0.5108 0.5843 0.0931  0.0568  0.1581  1458 ALA A O   
1491 C CB  . ALA A 200 ? 0.6270 0.5369 0.5677 0.0879  0.0421  0.1556  1458 ALA A CB  
1492 N N   . GLN A 201 ? 0.6441 0.5093 0.5681 0.0762  0.0619  0.1399  1459 GLN A N   
1493 C CA  . GLN A 201 ? 0.6723 0.5182 0.5860 0.0681  0.0652  0.1432  1459 GLN A CA  
1494 C C   . GLN A 201 ? 0.6753 0.4985 0.5906 0.0679  0.0693  0.1350  1459 GLN A C   
1495 O O   . GLN A 201 ? 0.6873 0.4953 0.5957 0.0572  0.0700  0.1369  1459 GLN A O   
1496 C CB  . GLN A 201 ? 0.6633 0.5261 0.5683 0.0569  0.0669  0.1408  1459 GLN A CB  
1497 C CG  . GLN A 201 ? 0.6777 0.5587 0.5731 0.0570  0.0628  0.1501  1459 GLN A CG  
1498 C CD  . GLN A 201 ? 0.6746 0.5774 0.5586 0.0509  0.0656  0.1469  1459 GLN A CD  
1499 O OE1 . GLN A 201 ? 0.6979 0.6208 0.5716 0.0564  0.0612  0.1440  1459 GLN A OE1 
1500 N NE2 . GLN A 201 ? 0.6221 0.5220 0.5064 0.0412  0.0717  0.1476  1459 GLN A NE2 
1501 N N   . ASN A 202 ? 0.6705 0.4949 0.5945 0.0794  0.0711  0.1272  1460 ASN A N   
1502 C CA  . ASN A 202 ? 0.6792 0.4829 0.6017 0.0840  0.0742  0.1174  1460 ASN A CA  
1503 C C   . ASN A 202 ? 0.6576 0.4631 0.5792 0.0710  0.0784  0.1068  1460 ASN A C   
1504 O O   . ASN A 202 ? 0.6742 0.4561 0.5901 0.0699  0.0788  0.1006  1460 ASN A O   
1505 C CB  . ASN A 202 ? 0.7179 0.4823 0.6290 0.0892  0.0686  0.1225  1460 ASN A CB  
1506 C CG  . ASN A 202 ? 0.7533 0.5149 0.6653 0.1076  0.0646  0.1303  1460 ASN A CG  
1507 O OD1 . ASN A 202 ? 0.7540 0.5361 0.6748 0.1238  0.0678  0.1270  1460 ASN A OD1 
1508 N ND2 . ASN A 202 ? 0.7792 0.5203 0.6833 0.1048  0.0572  0.1432  1460 ASN A ND2 
1509 N N   . VAL A 203 ? 0.6269 0.4581 0.5525 0.0625  0.0796  0.1043  1461 VAL A N   
1510 C CA  . VAL A 203 ? 0.6043 0.4431 0.5314 0.0543  0.0832  0.0931  1461 VAL A CA  
1511 C C   . VAL A 203 ? 0.5950 0.4407 0.5322 0.0633  0.0853  0.0858  1461 VAL A C   
1512 O O   . VAL A 203 ? 0.5813 0.4430 0.5275 0.0719  0.0829  0.0908  1461 VAL A O   
1513 C CB  . VAL A 203 ? 0.5894 0.4517 0.5149 0.0479  0.0808  0.0913  1461 VAL A CB  
1514 C CG1 . VAL A 203 ? 0.5476 0.4174 0.4749 0.0424  0.0829  0.0791  1461 VAL A CG1 
1515 C CG2 . VAL A 203 ? 0.5888 0.4546 0.5031 0.0420  0.0804  0.1004  1461 VAL A CG2 
1516 N N   . TYR A 204 ? 0.6016 0.4390 0.5378 0.0613  0.0893  0.0762  1462 TYR A N   
1517 C CA  . TYR A 204 ? 0.5898 0.4416 0.5353 0.0693  0.0920  0.0707  1462 TYR A CA  
1518 C C   . TYR A 204 ? 0.5597 0.4376 0.5155 0.0614  0.0886  0.0706  1462 TYR A C   
1519 O O   . TYR A 204 ? 0.5545 0.4321 0.5072 0.0510  0.0880  0.0639  1462 TYR A O   
1520 C CB  . TYR A 204 ? 0.5993 0.4354 0.5386 0.0694  0.0959  0.0599  1462 TYR A CB  
1521 C CG  . TYR A 204 ? 0.6569 0.4590 0.5827 0.0789  0.0942  0.0579  1462 TYR A CG  
1522 C CD1 . TYR A 204 ? 0.6979 0.4970 0.6216 0.0999  0.0936  0.0601  1462 TYR A CD1 
1523 C CD2 . TYR A 204 ? 0.7065 0.4787 0.6209 0.0674  0.0908  0.0547  1462 TYR A CD2 
1524 C CE1 . TYR A 204 ? 0.7647 0.5247 0.6717 0.1117  0.0882  0.0562  1462 TYR A CE1 
1525 C CE2 . TYR A 204 ? 0.7567 0.4889 0.6563 0.0745  0.0837  0.0532  1462 TYR A CE2 
1526 C CZ  . TYR A 204 ? 0.7940 0.5168 0.6883 0.0979  0.0817  0.0525  1462 TYR A CZ  
1527 O OH  . TYR A 204 ? 0.8737 0.5501 0.7495 0.1081  0.0712  0.0490  1462 TYR A OH  
1528 N N   . CYS A 205 ? 0.5441 0.4436 0.5118 0.0665  0.0842  0.0792  1463 CYS A N   
1529 C CA  . CYS A 205 ? 0.5343 0.4528 0.5114 0.0576  0.0751  0.0815  1463 CYS A CA  
1530 C C   . CYS A 205 ? 0.5121 0.4520 0.5034 0.0587  0.0763  0.0840  1463 CYS A C   
1531 O O   . CYS A 205 ? 0.4967 0.4599 0.5004 0.0666  0.0762  0.0954  1463 CYS A O   
1532 C CB  . CYS A 205 ? 0.5403 0.4698 0.5223 0.0582  0.0651  0.0928  1463 CYS A CB  
1533 S SG  . CYS A 205 ? 0.5799 0.4913 0.5442 0.0574  0.0629  0.0920  1463 CYS A SG  
1534 N N   . LEU A 206 ? 0.4955 0.4320 0.4854 0.0510  0.0771  0.0750  1464 LEU A N   
1535 C CA  . LEU A 206 ? 0.4906 0.4446 0.4897 0.0529  0.0815  0.0756  1464 LEU A CA  
1536 C C   . LEU A 206 ? 0.4748 0.4387 0.4823 0.0395  0.0719  0.0764  1464 LEU A C   
1537 O O   . LEU A 206 ? 0.4638 0.4109 0.4634 0.0309  0.0642  0.0684  1464 LEU A O   
1538 C CB  . LEU A 206 ? 0.4948 0.4295 0.4809 0.0591  0.0930  0.0627  1464 LEU A CB  
1539 C CG  . LEU A 206 ? 0.5248 0.4373 0.4981 0.0715  0.0987  0.0600  1464 LEU A CG  
1540 C CD1 . LEU A 206 ? 0.5226 0.4105 0.4819 0.0735  0.1041  0.0471  1464 LEU A CD1 
1541 C CD2 . LEU A 206 ? 0.5155 0.4469 0.4950 0.0897  0.1009  0.0696  1464 LEU A CD2 
1542 N N   . ARG A 207 ? 0.4677 0.4608 0.4905 0.0394  0.0714  0.0869  1465 ARG A N   
1543 C CA  . ARG A 207 ? 0.4671 0.4698 0.4991 0.0261  0.0616  0.0900  1465 ARG A CA  
1544 C C   . ARG A 207 ? 0.4580 0.4403 0.4771 0.0248  0.0689  0.0727  1465 ARG A C   
1545 O O   . ARG A 207 ? 0.4594 0.4331 0.4684 0.0346  0.0827  0.0633  1465 ARG A O   
1546 C CB  . ARG A 207 ? 0.4691 0.5151 0.5205 0.0275  0.0630  0.1082  1465 ARG A CB  
1547 C CG  . ARG A 207 ? 0.5013 0.5747 0.5728 0.0182  0.0473  0.1314  1465 ARG A CG  
1548 C CD  . ARG A 207 ? 0.5578 0.6870 0.6499 0.0239  0.0529  0.1536  1465 ARG A CD  
1549 N NE  . ARG A 207 ? 0.5989 0.7445 0.6874 0.0340  0.0680  0.1481  1465 ARG A NE  
1550 C CZ  . ARG A 207 ? 0.6244 0.7975 0.7101 0.0568  0.0850  0.1487  1465 ARG A CZ  
1551 N NH1 . ARG A 207 ? 0.6450 0.8334 0.7325 0.0727  0.0899  0.1551  1465 ARG A NH1 
1552 N NH2 . ARG A 207 ? 0.6554 0.8410 0.7346 0.0662  0.0961  0.1422  1465 ARG A NH2 
1553 N N   . THR A 208 ? 0.4514 0.4244 0.4702 0.0132  0.0575  0.0687  1466 THR A N   
1554 C CA  . THR A 208 ? 0.4493 0.4079 0.4579 0.0117  0.0636  0.0538  1466 THR A CA  
1555 C C   . THR A 208 ? 0.4506 0.4244 0.4621 0.0161  0.0757  0.0533  1466 THR A C   
1556 O O   . THR A 208 ? 0.4630 0.4228 0.4637 0.0172  0.0835  0.0401  1466 THR A O   
1557 C CB  . THR A 208 ? 0.4401 0.3885 0.4481 0.0016  0.0476  0.0503  1466 THR A CB  
1558 O OG1 . THR A 208 ? 0.4304 0.3960 0.4550 -0.0076 0.0325  0.0671  1466 THR A OG1 
1559 C CG2 . THR A 208 ? 0.4471 0.3732 0.4412 0.0032  0.0382  0.0413  1466 THR A CG2 
1560 N N   . GLU A 209 ? 0.4468 0.4525 0.4724 0.0191  0.0766  0.0684  1467 GLU A N   
1561 C CA  . GLU A 209 ? 0.4589 0.4863 0.4853 0.0273  0.0878  0.0692  1467 GLU A CA  
1562 C C   . GLU A 209 ? 0.4716 0.4802 0.4796 0.0429  0.1019  0.0537  1467 GLU A C   
1563 O O   . GLU A 209 ? 0.4751 0.4846 0.4748 0.0488  0.1090  0.0455  1467 GLU A O   
1564 C CB  . GLU A 209 ? 0.4624 0.5369 0.5070 0.0316  0.0875  0.0913  1467 GLU A CB  
1565 C CG  . GLU A 209 ? 0.4897 0.5895 0.5547 0.0131  0.0719  0.1110  1467 GLU A CG  
1566 C CD  . GLU A 209 ? 0.5391 0.6269 0.6135 -0.0019 0.0515  0.1211  1467 GLU A CD  
1567 O OE1 . GLU A 209 ? 0.5326 0.5959 0.5975 0.0026  0.0511  0.1124  1467 GLU A OE1 
1568 O OE2 . GLU A 209 ? 0.5504 0.6517 0.6405 -0.0189 0.0334  0.1384  1467 GLU A OE2 
1569 N N   . TYR A 210 ? 0.4765 0.4662 0.4771 0.0493  0.1034  0.0506  1468 TYR A N   
1570 C CA  . TYR A 210 ? 0.4900 0.4525 0.4719 0.0613  0.1114  0.0374  1468 TYR A CA  
1571 C C   . TYR A 210 ? 0.4990 0.4343 0.4690 0.0519  0.1119  0.0228  1468 TYR A C   
1572 O O   . TYR A 210 ? 0.5211 0.4391 0.4766 0.0597  0.1161  0.0123  1468 TYR A O   
1573 C CB  . TYR A 210 ? 0.5005 0.4450 0.4780 0.0651  0.1098  0.0393  1468 TYR A CB  
1574 C CG  . TYR A 210 ? 0.5258 0.4360 0.4838 0.0755  0.1136  0.0283  1468 TYR A CG  
1575 C CD1 . TYR A 210 ? 0.5669 0.4774 0.5156 0.0976  0.1177  0.0258  1468 TYR A CD1 
1576 C CD2 . TYR A 210 ? 0.5614 0.4397 0.5095 0.0639  0.1109  0.0217  1468 TYR A CD2 
1577 C CE1 . TYR A 210 ? 0.6049 0.4747 0.5327 0.1073  0.1159  0.0151  1468 TYR A CE1 
1578 C CE2 . TYR A 210 ? 0.6066 0.4501 0.5379 0.0694  0.1098  0.0152  1468 TYR A CE2 
1579 C CZ  . TYR A 210 ? 0.6374 0.4720 0.5576 0.0907  0.1107  0.0111  1468 TYR A CZ  
1580 O OH  . TYR A 210 ? 0.6812 0.4729 0.5821 0.0962  0.1047  0.0041  1468 TYR A OH  
1581 N N   . ILE A 211 ? 0.4892 0.4200 0.4636 0.0365  0.1059  0.0219  1469 ILE A N   
1582 C CA  . ILE A 211 ? 0.4932 0.4047 0.4583 0.0280  0.1066  0.0105  1469 ILE A CA  
1583 C C   . ILE A 211 ? 0.4971 0.4155 0.4599 0.0295  0.1100  0.0048  1469 ILE A C   
1584 O O   . ILE A 211 ? 0.5178 0.4171 0.4675 0.0316  0.1129  -0.0048 1469 ILE A O   
1585 C CB  . ILE A 211 ? 0.4836 0.3948 0.4522 0.0167  0.0997  0.0100  1469 ILE A CB  
1586 C CG1 . ILE A 211 ? 0.4746 0.3777 0.4400 0.0176  0.0971  0.0138  1469 ILE A CG1 
1587 C CG2 . ILE A 211 ? 0.4986 0.4012 0.4604 0.0093  0.1013  0.0004  1469 ILE A CG2 
1588 C CD1 . ILE A 211 ? 0.4566 0.3635 0.4233 0.0132  0.0876  0.0138  1469 ILE A CD1 
1589 N N   . ALA A 212 ? 0.4804 0.4256 0.4553 0.0280  0.1078  0.0123  1470 ALA A N   
1590 C CA  . ALA A 212 ? 0.4906 0.4494 0.4644 0.0298  0.1109  0.0096  1470 ALA A CA  
1591 C C   . ALA A 212 ? 0.5137 0.4778 0.4762 0.0483  0.1188  0.0060  1470 ALA A C   
1592 O O   . ALA A 212 ? 0.5255 0.4801 0.4748 0.0524  0.1213  -0.0050 1470 ALA A O   
1593 C CB  . ALA A 212 ? 0.4613 0.4501 0.4527 0.0219  0.1042  0.0233  1470 ALA A CB  
1594 N N   . ASP A 213 ? 0.5214 0.5013 0.4874 0.0616  0.1214  0.0147  1471 ASP A N   
1595 C CA  . ASP A 213 ? 0.5567 0.5426 0.5086 0.0855  0.1281  0.0098  1471 ASP A CA  
1596 C C   . ASP A 213 ? 0.5970 0.5340 0.5250 0.0926  0.1267  -0.0076 1471 ASP A C   
1597 O O   . ASP A 213 ? 0.6152 0.5408 0.5231 0.1095  0.1279  -0.0196 1471 ASP A O   
1598 C CB  . ASP A 213 ? 0.5539 0.5706 0.5160 0.0993  0.1307  0.0245  1471 ASP A CB  
1599 C CG  . ASP A 213 ? 0.5470 0.6178 0.5331 0.0928  0.1299  0.0458  1471 ASP A CG  
1600 O OD1 . ASP A 213 ? 0.5239 0.6046 0.5167 0.0787  0.1270  0.0481  1471 ASP A OD1 
1601 O OD2 . ASP A 213 ? 0.5092 0.6131 0.5080 0.1008  0.1307  0.0621  1471 ASP A OD2 
1602 N N   . TYR A 214 ? 0.6037 0.5117 0.5326 0.0794  0.1221  -0.0081 1472 TYR A N   
1603 C CA  . TYR A 214 ? 0.6542 0.5158 0.5638 0.0791  0.1174  -0.0198 1472 TYR A CA  
1604 C C   . TYR A 214 ? 0.6757 0.5201 0.5740 0.0709  0.1144  -0.0316 1472 TYR A C   
1605 O O   . TYR A 214 ? 0.7061 0.5163 0.5834 0.0783  0.1086  -0.0430 1472 TYR A O   
1606 C CB  . TYR A 214 ? 0.6483 0.4930 0.5640 0.0634  0.1136  -0.0138 1472 TYR A CB  
1607 C CG  . TYR A 214 ? 0.6892 0.4899 0.5882 0.0605  0.1066  -0.0197 1472 TYR A CG  
1608 C CD1 . TYR A 214 ? 0.7252 0.5027 0.6125 0.0757  0.1030  -0.0198 1472 TYR A CD1 
1609 C CD2 . TYR A 214 ? 0.7016 0.4846 0.5972 0.0417  0.1017  -0.0230 1472 TYR A CD2 
1610 C CE1 . TYR A 214 ? 0.7800 0.5125 0.6518 0.0708  0.0926  -0.0227 1472 TYR A CE1 
1611 C CE2 . TYR A 214 ? 0.7636 0.5066 0.6457 0.0351  0.0919  -0.0239 1472 TYR A CE2 
1612 C CZ  . TYR A 214 ? 0.7908 0.5062 0.6607 0.0491  0.0864  -0.0237 1472 TYR A CZ  
1613 O OH  . TYR A 214 ? 0.8764 0.5474 0.7325 0.0411  0.0728  -0.0224 1472 TYR A OH  
1614 N N   . LEU A 215 ? 0.6679 0.5338 0.5793 0.0560  0.1159  -0.0288 1473 LEU A N   
1615 C CA  . LEU A 215 ? 0.6956 0.5526 0.5991 0.0482  0.1135  -0.0383 1473 LEU A CA  
1616 C C   . LEU A 215 ? 0.7189 0.5928 0.6128 0.0642  0.1167  -0.0444 1473 LEU A C   
1617 O O   . LEU A 215 ? 0.7482 0.6003 0.6237 0.0672  0.1123  -0.0569 1473 LEU A O   
1618 C CB  . LEU A 215 ? 0.6588 0.5330 0.5788 0.0286  0.1132  -0.0333 1473 LEU A CB  
1619 C CG  . LEU A 215 ? 0.6516 0.5150 0.5775 0.0126  0.1100  -0.0301 1473 LEU A CG  
1620 C CD1 . LEU A 215 ? 0.6153 0.5015 0.5548 0.0023  0.1095  -0.0270 1473 LEU A CD1 
1621 C CD2 . LEU A 215 ? 0.6503 0.4845 0.5638 0.0035  0.1047  -0.0357 1473 LEU A CD2 
1622 N N   . MET A 216 ? 0.7163 0.6311 0.6225 0.0739  0.1230  -0.0338 1474 MET A N   
1623 C CA  A MET A 216 ? 0.7311 0.6780 0.6328 0.0883  0.1277  -0.0339 1474 MET A CA  
1624 C CA  B MET A 216 ? 0.7303 0.6758 0.6313 0.0880  0.1275  -0.0346 1474 MET A CA  
1625 C C   . MET A 216 ? 0.7779 0.7153 0.6535 0.1181  0.1291  -0.0456 1474 MET A C   
1626 O O   . MET A 216 ? 0.7879 0.7419 0.6496 0.1335  0.1315  -0.0521 1474 MET A O   
1627 C CB  A MET A 216 ? 0.7048 0.7035 0.6311 0.0869  0.1320  -0.0132 1474 MET A CB  
1628 C CB  B MET A 216 ? 0.7010 0.6991 0.6268 0.0850  0.1317  -0.0143 1474 MET A CB  
1629 C CG  A MET A 216 ? 0.7010 0.7360 0.6365 0.0809  0.1332  -0.0054 1474 MET A CG  
1630 C CG  B MET A 216 ? 0.6770 0.6811 0.6222 0.0595  0.1265  -0.0063 1474 MET A CG  
1631 S SD  A MET A 216 ? 0.7100 0.8094 0.6734 0.0801  0.1349  0.0238  1474 MET A SD  
1632 S SD  B MET A 216 ? 0.6540 0.7032 0.6286 0.0506  0.1232  0.0198  1474 MET A SD  
1633 C CE  A MET A 216 ? 0.6961 0.7757 0.6780 0.0616  0.1264  0.0327  1474 MET A CE  
1634 C CE  B MET A 216 ? 0.6657 0.7695 0.6416 0.0649  0.1300  0.0311  1474 MET A CE  
1635 N N   . GLN A 217 ? 0.8093 0.7204 0.6764 0.1287  0.1266  -0.0486 1475 GLN A N   
1636 C CA  . GLN A 217 ? 0.8651 0.7667 0.7062 0.1622  0.1263  -0.0596 1475 GLN A CA  
1637 C C   . GLN A 217 ? 0.9174 0.7506 0.7300 0.1664  0.1131  -0.0779 1475 GLN A C   
1638 O O   . GLN A 217 ? 0.9161 0.7160 0.7341 0.1497  0.1067  -0.0747 1475 GLN A O   
1639 C CB  . GLN A 217 ? 0.8590 0.7953 0.7126 0.1787  0.1333  -0.0455 1475 GLN A CB  
1640 C CG  . GLN A 217 ? 0.8484 0.8569 0.7263 0.1793  0.1434  -0.0254 1475 GLN A CG  
1641 C CD  . GLN A 217 ? 0.8638 0.9085 0.7619 0.1856  0.1477  -0.0062 1475 GLN A CD  
1642 O OE1 . GLN A 217 ? 0.8998 0.9192 0.7895 0.1978  0.1454  -0.0103 1475 GLN A OE1 
1643 N NE2 . GLN A 217 ? 0.8343 0.9384 0.7599 0.1759  0.1521  0.0166  1475 GLN A NE2 
1644 N N   . GLU A 218 ? 0.9747 0.7878 0.7559 0.1887  0.1071  -0.0961 1476 GLU A N   
1645 C CA  . GLU A 218 ? 1.0434 0.7882 0.7903 0.2015  0.0900  -0.1149 1476 GLU A CA  
1646 C C   . GLU A 218 ? 1.0632 0.7875 0.8090 0.2130  0.0870  -0.1105 1476 GLU A C   
1647 O O   . GLU A 218 ? 1.0786 0.7539 0.8229 0.1948  0.0747  -0.1095 1476 GLU A O   
1648 C CB  . GLU A 218 ? 1.0940 0.8343 0.8042 0.2381  0.0859  -0.1349 1476 GLU A CB  
1649 C CG  . GLU A 218 ? 1.1229 0.8447 0.8175 0.2273  0.0774  -0.1480 1476 GLU A CG  
1650 C CD  . GLU A 218 ? 1.1867 0.8249 0.8533 0.2179  0.0519  -0.1643 1476 GLU A CD  
1651 O OE1 . GLU A 218 ? 1.1972 0.8025 0.8771 0.1922  0.0440  -0.1551 1476 GLU A OE1 
1652 O OE2 . GLU A 218 ? 1.2065 0.8127 0.8375 0.2350  0.0382  -0.1849 1476 GLU A OE2 
1653 N N   . SER A 219 ? 1.0658 0.8326 0.8138 0.2427  0.0980  -0.1053 1477 SER A N   
1654 C CA  . SER A 219 ? 1.0827 0.8417 0.8337 0.2552  0.0975  -0.0984 1477 SER A CA  
1655 C C   . SER A 219 ? 1.0268 0.8553 0.8159 0.2465  0.1143  -0.0743 1477 SER A C   
1656 O O   . SER A 219 ? 1.0230 0.9088 0.8168 0.2707  0.1256  -0.0676 1477 SER A O   
1657 C CB  . SER A 219 ? 1.1408 0.8863 0.8567 0.3040  0.0924  -0.1143 1477 SER A CB  
1658 O OG  . SER A 219 ? 1.2108 0.8954 0.8872 0.3156  0.0746  -0.1389 1477 SER A OG  
1659 N N   . PRO A 220 ? 0.9919 0.8176 0.8076 0.2124  0.1146  -0.0603 1478 PRO A N   
1660 C CA  . PRO A 220 ? 0.9458 0.8281 0.7953 0.2024  0.1255  -0.0381 1478 PRO A CA  
1661 C C   . PRO A 220 ? 0.9572 0.8554 0.8076 0.2274  0.1281  -0.0303 1478 PRO A C   
1662 O O   . PRO A 220 ? 0.9973 0.8491 0.8248 0.2445  0.1195  -0.0416 1478 PRO A O   
1663 C CB  . PRO A 220 ? 0.9178 0.7789 0.7850 0.1653  0.1212  -0.0308 1478 PRO A CB  
1664 C CG  . PRO A 220 ? 0.9586 0.7542 0.8032 0.1595  0.1089  -0.0445 1478 PRO A CG  
1665 C CD  . PRO A 220 ? 0.9957 0.7697 0.8106 0.1817  0.1037  -0.0633 1478 PRO A CD  
1666 N N   . PRO A 221 ? 0.9174 0.8803 0.7945 0.2289  0.1376  -0.0100 1479 PRO A N   
1667 C CA  . PRO A 221 ? 0.9155 0.8980 0.7969 0.2504  0.1397  -0.0001 1479 PRO A CA  
1668 C C   . PRO A 221 ? 0.9036 0.8422 0.7886 0.2337  0.1318  0.0022  1479 PRO A C   
1669 O O   . PRO A 221 ? 0.8788 0.7863 0.7692 0.2029  0.1267  0.0010  1479 PRO A O   
1670 C CB  . PRO A 221 ? 0.8734 0.9342 0.7885 0.2434  0.1483  0.0258  1479 PRO A CB  
1671 C CG  . PRO A 221 ? 0.8629 0.9469 0.7838 0.2292  0.1514  0.0264  1479 PRO A CG  
1672 C CD  . PRO A 221 ? 0.8737 0.8925 0.7782 0.2100  0.1441  0.0068  1479 PRO A CD  
1673 N N   . HIS A 222 ? 0.9150 0.8549 0.7960 0.2566  0.1310  0.0062  1480 HIS A N   
1674 C CA  . HIS A 222 ? 0.9052 0.8111 0.7899 0.2445  0.1240  0.0114  1480 HIS A CA  
1675 C C   . HIS A 222 ? 0.8422 0.7737 0.7576 0.2103  0.1253  0.0293  1480 HIS A C   
1676 O O   . HIS A 222 ? 0.8083 0.7952 0.7467 0.2042  0.1309  0.0438  1480 HIS A O   
1677 C CB  . HIS A 222 ? 0.9357 0.8536 0.8146 0.2779  0.1243  0.0158  1480 HIS A CB  
1678 C CG  . HIS A 222 ? 0.9731 0.8378 0.8427 0.2745  0.1138  0.0147  1480 HIS A CG  
1679 N ND1 . HIS A 222 ? 1.0421 0.8525 0.8803 0.3004  0.1033  -0.0003 1480 HIS A ND1 
1680 C CD2 . HIS A 222 ? 0.9546 0.8109 0.8404 0.2485  0.1105  0.0274  1480 HIS A CD2 
1681 C CE1 . HIS A 222 ? 1.0689 0.8417 0.9072 0.2882  0.0943  0.0056  1480 HIS A CE1 
1682 N NE2 . HIS A 222 ? 1.0196 0.8219 0.8862 0.2572  0.0997  0.0223  1480 HIS A NE2 
1683 N N   . VAL A 223 ? 0.8239 0.7149 0.7384 0.1887  0.1183  0.0288  1481 VAL A N   
1684 C CA  . VAL A 223 ? 0.7709 0.6773 0.7073 0.1605  0.1170  0.0420  1481 VAL A CA  
1685 C C   . VAL A 223 ? 0.7377 0.6906 0.6953 0.1656  0.1183  0.0609  1481 VAL A C   
1686 O O   . VAL A 223 ? 0.7011 0.6812 0.6787 0.1460  0.1161  0.0726  1481 VAL A O   
1687 C CB  . VAL A 223 ? 0.7833 0.6433 0.7113 0.1432  0.1098  0.0397  1481 VAL A CB  
1688 C CG1 . VAL A 223 ? 0.8011 0.6228 0.7138 0.1312  0.1067  0.0262  1481 VAL A CG1 
1689 C CG2 . VAL A 223 ? 0.8103 0.6458 0.7272 0.1604  0.1051  0.0421  1481 VAL A CG2 
1690 N N   . GLU A 224 ? 0.7463 0.7067 0.6985 0.1925  0.1197  0.0639  1482 GLU A N   
1691 C CA  . GLU A 224 ? 0.7214 0.7327 0.6947 0.2000  0.1210  0.0838  1482 GLU A CA  
1692 C C   . GLU A 224 ? 0.6773 0.7506 0.6741 0.1929  0.1247  0.0984  1482 GLU A C   
1693 O O   . GLU A 224 ? 0.6571 0.7705 0.6778 0.1827  0.1209  0.1188  1482 GLU A O   
1694 C CB  . GLU A 224 ? 0.7570 0.7721 0.7183 0.2368  0.1233  0.0829  1482 GLU A CB  
1695 C CG  . GLU A 224 ? 0.7880 0.7439 0.7305 0.2409  0.1157  0.0750  1482 GLU A CG  
1696 C CD  . GLU A 224 ? 0.8321 0.7849 0.7596 0.2802  0.1152  0.0725  1482 GLU A CD  
1697 O OE1 . GLU A 224 ? 0.8500 0.8275 0.7683 0.3106  0.1210  0.0663  1482 GLU A OE1 
1698 O OE2 . GLU A 224 ? 0.8497 0.7756 0.7729 0.2826  0.1084  0.0765  1482 GLU A OE2 
1699 N N   . ASN A 225 ? 0.6619 0.7419 0.6521 0.1961  0.1299  0.0895  1483 ASN A N   
1700 C CA  . ASN A 225 ? 0.6240 0.7628 0.6361 0.1877  0.1324  0.1054  1483 ASN A CA  
1701 C C   . ASN A 225 ? 0.5851 0.7202 0.6146 0.1504  0.1230  0.1131  1483 ASN A C   
1702 O O   . ASN A 225 ? 0.5582 0.7387 0.6093 0.1380  0.1199  0.1311  1483 ASN A O   
1703 C CB  . ASN A 225 ? 0.6372 0.7861 0.6341 0.2058  0.1409  0.0935  1483 ASN A CB  
1704 C CG  . ASN A 225 ? 0.6869 0.8508 0.6656 0.2491  0.1485  0.0873  1483 ASN A CG  
1705 O OD1 . ASN A 225 ? 0.7373 0.8773 0.6890 0.2698  0.1517  0.0670  1483 ASN A OD1 
1706 N ND2 . ASN A 225 ? 0.6800 0.8829 0.6718 0.2644  0.1499  0.1041  1483 ASN A ND2 
1707 N N   . TYR A 226 ? 0.5676 0.6502 0.5871 0.1338  0.1169  0.1010  1484 TYR A N   
1708 C CA  . TYR A 226 ? 0.5369 0.6085 0.5654 0.1043  0.1072  0.1026  1484 TYR A CA  
1709 C C   . TYR A 226 ? 0.5296 0.5857 0.5628 0.0913  0.0965  0.1084  1484 TYR A C   
1710 O O   . TYR A 226 ? 0.5204 0.5575 0.5534 0.0719  0.0873  0.1049  1484 TYR A O   
1711 C CB  . TYR A 226 ? 0.5292 0.5587 0.5397 0.0969  0.1095  0.0818  1484 TYR A CB  
1712 C CG  . TYR A 226 ? 0.5255 0.5673 0.5299 0.1066  0.1174  0.0748  1484 TYR A CG  
1713 C CD1 . TYR A 226 ? 0.4772 0.5358 0.4913 0.0913  0.1147  0.0781  1484 TYR A CD1 
1714 C CD2 . TYR A 226 ? 0.5220 0.5565 0.5084 0.1325  0.1257  0.0643  1484 TYR A CD2 
1715 C CE1 . TYR A 226 ? 0.4853 0.5574 0.4929 0.1003  0.1219  0.0722  1484 TYR A CE1 
1716 C CE2 . TYR A 226 ? 0.5390 0.5850 0.5161 0.1439  0.1318  0.0563  1484 TYR A CE2 
1717 C CZ  . TYR A 226 ? 0.5132 0.5800 0.5017 0.1269  0.1308  0.0608  1484 TYR A CZ  
1718 O OH  . TYR A 226 ? 0.5053 0.5856 0.4839 0.1381  0.1368  0.0536  1484 TYR A OH  
1719 N N   . CYS A 227 ? 0.5346 0.5999 0.5698 0.1046  0.0974  0.1167  1485 CYS A N   
1720 C CA  A CYS A 227 ? 0.5334 0.5849 0.5703 0.0959  0.0879  0.1221  1485 CYS A CA  
1721 C CA  B CYS A 227 ? 0.5383 0.5890 0.5750 0.0955  0.0878  0.1218  1485 CYS A CA  
1722 C C   . CYS A 227 ? 0.5192 0.5909 0.5745 0.0743  0.0720  0.1369  1485 CYS A C   
1723 O O   . CYS A 227 ? 0.5121 0.6276 0.5880 0.0712  0.0677  0.1553  1485 CYS A O   
1724 C CB  A CYS A 227 ? 0.5467 0.6130 0.5851 0.1167  0.0918  0.1310  1485 CYS A CB  
1725 C CB  B CYS A 227 ? 0.5534 0.6139 0.5899 0.1156  0.0913  0.1295  1485 CYS A CB  
1726 S SG  A CYS A 227 ? 0.5409 0.5861 0.5763 0.1108  0.0823  0.1357  1485 CYS A SG  
1727 S SG  B CYS A 227 ? 0.6011 0.6109 0.6094 0.1352  0.0996  0.1111  1485 CYS A SG  
1728 N N   . LEU A 228 ? 0.5175 0.5581 0.5640 0.0601  0.0613  0.1297  1486 LEU A N   
1729 C CA  . LEU A 228 ? 0.5150 0.5632 0.5729 0.0420  0.0409  0.1410  1486 LEU A CA  
1730 C C   . LEU A 228 ? 0.5300 0.6053 0.6024 0.0444  0.0332  0.1608  1486 LEU A C   
1731 O O   . LEU A 228 ? 0.5220 0.5995 0.5901 0.0608  0.0438  0.1612  1486 LEU A O   
1732 C CB  . LEU A 228 ? 0.5111 0.5188 0.5499 0.0333  0.0316  0.1253  1486 LEU A CB  
1733 C CG  . LEU A 228 ? 0.4871 0.4728 0.5138 0.0290  0.0357  0.1079  1486 LEU A CG  
1734 C CD1 . LEU A 228 ? 0.4590 0.4133 0.4644 0.0282  0.0315  0.0933  1486 LEU A CD1 
1735 C CD2 . LEU A 228 ? 0.4350 0.4321 0.4743 0.0151  0.0223  0.1141  1486 LEU A CD2 
1736 N N   . PRO A 229 ? 0.5525 0.6475 0.6422 0.0273  0.0125  0.1785  1487 PRO A N   
1737 C CA  . PRO A 229 ? 0.5691 0.6968 0.6768 0.0261  0.0025  0.2014  1487 PRO A CA  
1738 C C   . PRO A 229 ? 0.5941 0.7017 0.6885 0.0355  0.0030  0.1960  1487 PRO A C   
1739 O O   . PRO A 229 ? 0.5984 0.7334 0.7021 0.0494  0.0110  0.2081  1487 PRO A O   
1740 C CB  . PRO A 229 ? 0.5797 0.7096 0.7001 0.0003  -0.0267 0.2154  1487 PRO A CB  
1741 C CG  . PRO A 229 ? 0.5566 0.6852 0.6790 -0.0073 -0.0251 0.2109  1487 PRO A CG  
1742 C CD  . PRO A 229 ? 0.5479 0.6404 0.6445 0.0077  -0.0038 0.1816  1487 PRO A CD  
1743 N N   . GLU A 230 ? 0.6207 0.6843 0.6928 0.0302  -0.0048 0.1788  1488 GLU A N   
1744 C CA  . GLU A 230 ? 0.6492 0.6949 0.7070 0.0377  -0.0056 0.1749  1488 GLU A CA  
1745 C C   . GLU A 230 ? 0.6495 0.6864 0.6963 0.0575  0.0172  0.1668  1488 GLU A C   
1746 O O   . GLU A 230 ? 0.6621 0.6924 0.7018 0.0653  0.0179  0.1692  1488 GLU A O   
1747 C CB  . GLU A 230 ? 0.6702 0.6767 0.7040 0.0302  -0.0190 0.1582  1488 GLU A CB  
1748 C CG  . GLU A 230 ? 0.6985 0.6979 0.7349 0.0127  -0.0470 0.1610  1488 GLU A CG  
1749 C CD  . GLU A 230 ? 0.7127 0.7013 0.7477 0.0060  -0.0468 0.1508  1488 GLU A CD  
1750 O OE1 . GLU A 230 ? 0.7065 0.7177 0.7571 0.0073  -0.0321 0.1568  1488 GLU A OE1 
1751 O OE2 . GLU A 230 ? 0.7569 0.7148 0.7734 0.0015  -0.0624 0.1364  1488 GLU A OE2 
1752 N N   . ALA A 231 ? 0.6457 0.6795 0.6899 0.0648  0.0333  0.1574  1489 ALA A N   
1753 C CA  . ALA A 231 ? 0.6584 0.6758 0.6899 0.0825  0.0507  0.1487  1489 ALA A CA  
1754 C C   . ALA A 231 ? 0.6679 0.7155 0.7112 0.1025  0.0603  0.1592  1489 ALA A C   
1755 O O   . ALA A 231 ? 0.6742 0.7038 0.7049 0.1204  0.0706  0.1524  1489 ALA A O   
1756 C CB  . ALA A 231 ? 0.6512 0.6412 0.6682 0.0802  0.0599  0.1304  1489 ALA A CB  
1757 N N   . ILE A 232 ? 0.6653 0.7596 0.7319 0.1005  0.0555  0.1769  1490 ILE A N   
1758 C CA  . ILE A 232 ? 0.6795 0.8160 0.7586 0.1228  0.0652  0.1892  1490 ILE A CA  
1759 C C   . ILE A 232 ? 0.7008 0.8424 0.7796 0.1391  0.0649  0.1979  1490 ILE A C   
1760 O O   . ILE A 232 ? 0.7019 0.8510 0.7895 0.1270  0.0519  0.2101  1490 ILE A O   
1761 C CB  . ILE A 232 ? 0.6607 0.8577 0.7689 0.1137  0.0590  0.2122  1490 ILE A CB  
1762 C CG1 . ILE A 232 ? 0.6592 0.8501 0.7687 0.0952  0.0561  0.2060  1490 ILE A CG1 
1763 C CG2 . ILE A 232 ? 0.6682 0.9185 0.7876 0.1414  0.0718  0.2249  1490 ILE A CG2 
1764 C CD1 . ILE A 232 ? 0.6737 0.8737 0.7767 0.1113  0.0729  0.1963  1490 ILE A CD1 
1765 N N   . SER A 233 ? 0.7283 0.8633 0.7951 0.1674  0.0773  0.1907  1491 SER A N   
1766 C CA  . SER A 233 ? 0.7601 0.8948 0.8231 0.1889  0.0779  0.1966  1491 SER A CA  
1767 C C   . SER A 233 ? 0.7690 0.8805 0.8288 0.1746  0.0665  0.2013  1491 SER A C   
1768 O O   . SER A 233 ? 0.7754 0.8474 0.8219 0.1555  0.0618  0.1903  1491 SER A O   
1769 C CB  . SER A 233 ? 0.7619 0.9644 0.8465 0.2102  0.0815  0.2171  1491 SER A CB  
1770 O OG  . SER A 233 ? 0.7576 0.9952 0.8640 0.1981  0.0698  0.2400  1491 SER A OG  
1771 N N   . SER B 1   ? 0.4288 0.5818 0.5941 -0.0625 0.0045  0.0585  1129 SER B N   
1772 C CA  . SER B 1   ? 0.4429 0.5573 0.5919 -0.0776 -0.0095 0.0435  1129 SER B CA  
1773 C C   . SER B 1   ? 0.4537 0.5289 0.5812 -0.0838 -0.0278 0.0295  1129 SER B C   
1774 O O   . SER B 1   ? 0.4515 0.5194 0.5658 -0.0734 -0.0231 0.0189  1129 SER B O   
1775 C CB  . SER B 1   ? 0.4328 0.5294 0.5571 -0.0674 0.0044  0.0277  1129 SER B CB  
1776 O OG  . SER B 1   ? 0.4505 0.5171 0.5599 -0.0731 -0.0039 0.0175  1129 SER B OG  
1777 N N   . ILE B 2   ? 0.4744 0.5151 0.5881 -0.0979 -0.0489 0.0303  1130 ILE B N   
1778 C CA  . ILE B 2   ? 0.5140 0.4964 0.5830 -0.0952 -0.0656 0.0159  1130 ILE B CA  
1779 C C   . ILE B 2   ? 0.5022 0.4676 0.5425 -0.0704 -0.0437 -0.0018 1130 ILE B C   
1780 O O   . ILE B 2   ? 0.5390 0.4664 0.5421 -0.0577 -0.0475 -0.0108 1130 ILE B O   
1781 C CB  . ILE B 2   ? 0.5694 0.4926 0.6038 -0.1083 -0.0929 0.0182  1130 ILE B CB  
1782 C CG1 . ILE B 2   ? 0.5724 0.4929 0.6028 -0.1009 -0.0776 0.0167  1130 ILE B CG1 
1783 C CG2 . ILE B 2   ? 0.5961 0.5282 0.6579 -0.1419 -0.1270 0.0428  1130 ILE B CG2 
1784 C CD1 . ILE B 2   ? 0.6618 0.5046 0.6373 -0.1033 -0.0999 0.0148  1130 ILE B CD1 
1785 N N   . TYR B 3   ? 0.4525 0.4466 0.5097 -0.0639 -0.0231 -0.0019 1131 TYR B N   
1786 C CA  . TYR B 3   ? 0.4459 0.4394 0.4921 -0.0477 -0.0064 -0.0070 1131 TYR B CA  
1787 C C   . TYR B 3   ? 0.4210 0.4378 0.4800 -0.0462 0.0033  -0.0088 1131 TYR B C   
1788 O O   . TYR B 3   ? 0.4222 0.4451 0.4809 -0.0399 0.0128  -0.0061 1131 TYR B O   
1789 C CB  . TYR B 3   ? 0.4368 0.4432 0.4920 -0.0468 0.0016  -0.0013 1131 TYR B CB  
1790 C CG  . TYR B 3   ? 0.4855 0.4621 0.5218 -0.0458 -0.0067 0.0012  1131 TYR B CG  
1791 C CD1 . TYR B 3   ? 0.5466 0.4717 0.5368 -0.0283 -0.0109 -0.0018 1131 TYR B CD1 
1792 C CD2 . TYR B 3   ? 0.4764 0.4663 0.5298 -0.0583 -0.0099 0.0076  1131 TYR B CD2 
1793 C CE1 . TYR B 3   ? 0.6086 0.4869 0.5644 -0.0247 -0.0214 -0.0003 1131 TYR B CE1 
1794 C CE2 . TYR B 3   ? 0.5246 0.4795 0.5562 -0.0587 -0.0195 0.0113  1131 TYR B CE2 
1795 C CZ  . TYR B 3   ? 0.5996 0.4939 0.5793 -0.0423 -0.0267 0.0063  1131 TYR B CZ  
1796 O OH  . TYR B 3   ? 0.6344 0.4739 0.5745 -0.0395 -0.0390 0.0087  1131 TYR B OH  
1797 N N   . PHE B 4   ? 0.4037 0.4343 0.4740 -0.0513 0.0005  -0.0084 1132 PHE B N   
1798 C CA  . PHE B 4   ? 0.3880 0.4236 0.4548 -0.0456 0.0082  -0.0113 1132 PHE B CA  
1799 C C   . PHE B 4   ? 0.3986 0.4205 0.4541 -0.0396 0.0033  -0.0149 1132 PHE B C   
1800 O O   . PHE B 4   ? 0.4193 0.4367 0.4757 -0.0437 -0.0102 -0.0125 1132 PHE B O   
1801 C CB  . PHE B 4   ? 0.3832 0.4358 0.4559 -0.0422 0.0135  -0.0060 1132 PHE B CB  
1802 C CG  . PHE B 4   ? 0.3600 0.4177 0.4306 -0.0426 0.0189  -0.0020 1132 PHE B CG  
1803 C CD1 . PHE B 4   ? 0.3589 0.4092 0.4275 -0.0507 0.0159  -0.0042 1132 PHE B CD1 
1804 C CD2 . PHE B 4   ? 0.3616 0.4323 0.4282 -0.0295 0.0290  0.0075  1132 PHE B CD2 
1805 C CE1 . PHE B 4   ? 0.3684 0.4186 0.4289 -0.0508 0.0181  -0.0008 1132 PHE B CE1 
1806 C CE2 . PHE B 4   ? 0.4015 0.4690 0.4537 -0.0240 0.0356  0.0118  1132 PHE B CE2 
1807 C CZ  . PHE B 4   ? 0.3866 0.4407 0.4342 -0.0370 0.0278  0.0056  1132 PHE B CZ  
1808 N N   . TPO B 5   ? 0.3977 0.4109 0.4415 -0.0324 0.0107  -0.0175 1133 TPO B N   
1809 C CA  . TPO B 5   ? 0.4079 0.4047 0.4345 -0.0230 0.0082  -0.0205 1133 TPO B CA  
1810 C CB  . TPO B 5   ? 0.4109 0.4048 0.4309 -0.0167 0.0197  -0.0171 1133 TPO B CB  
1811 C CG2 . TPO B 5   ? 0.4203 0.3946 0.4164 -0.0018 0.0206  -0.0184 1133 TPO B CG2 
1812 O OG1 . TPO B 5   ? 0.3929 0.3969 0.4220 -0.0175 0.0272  -0.0068 1133 TPO B OG1 
1813 P P   . TPO B 5   ? 0.3788 0.3983 0.4266 -0.0346 0.0261  0.0034  1133 TPO B P   
1814 O O1P . TPO B 5   ? 0.3707 0.4124 0.4353 -0.0303 0.0345  0.0245  1133 TPO B O1P 
1815 O O2P . TPO B 5   ? 0.3566 0.3776 0.4075 -0.0426 0.0197  -0.0042 1133 TPO B O2P 
1816 O O3P . TPO B 5   ? 0.3659 0.3696 0.4017 -0.0393 0.0232  0.0027  1133 TPO B O3P 
1817 C C   . TPO B 5   ? 0.4058 0.4124 0.4397 -0.0243 0.0002  -0.0196 1133 TPO B C   
1818 O O   . TPO B 5   ? 0.3957 0.4174 0.4375 -0.0217 0.0079  -0.0168 1133 TPO B O   
1819 N N   . PRO B 6   ? 0.4232 0.4175 0.4489 -0.0263 -0.0173 -0.0188 1134 PRO B N   
1820 C CA  . PRO B 6   ? 0.4298 0.4469 0.4733 -0.0287 -0.0275 -0.0090 1134 PRO B CA  
1821 C C   . PRO B 6   ? 0.4328 0.4553 0.4701 -0.0132 -0.0126 -0.0106 1134 PRO B C   
1822 O O   . PRO B 6   ? 0.4452 0.4427 0.4581 -0.0050 -0.0035 -0.0197 1134 PRO B O   
1823 C CB  . PRO B 6   ? 0.4720 0.4568 0.4927 -0.0361 -0.0563 -0.0090 1134 PRO B CB  
1824 C CG  . PRO B 6   ? 0.4907 0.4360 0.4842 -0.0400 -0.0631 -0.0163 1134 PRO B CG  
1825 C CD  . PRO B 6   ? 0.4599 0.4133 0.4539 -0.0262 -0.0323 -0.0231 1134 PRO B CD  
1826 N N   . GLU B 7   ? 0.4238 0.4799 0.4824 -0.0066 -0.0084 0.0027  1135 GLU B N   
1827 C CA  . GLU B 7   ? 0.4349 0.4897 0.4800 0.0125  0.0035  0.0038  1135 GLU B CA  
1828 C C   . GLU B 7   ? 0.4431 0.4838 0.4756 0.0142  -0.0102 0.0017  1135 GLU B C   
1829 O O   . GLU B 7   ? 0.4500 0.4833 0.4831 0.0009  -0.0334 0.0030  1135 GLU B O   
1830 C CB  . GLU B 7   ? 0.4354 0.5345 0.5043 0.0283  0.0134  0.0263  1135 GLU B CB  
1831 C CG  . GLU B 7   ? 0.4758 0.5774 0.5377 0.0389  0.0324  0.0290  1135 GLU B CG  
1832 C CD  . GLU B 7   ? 0.5516 0.6755 0.6066 0.0742  0.0538  0.0495  1135 GLU B CD  
1833 O OE1 . GLU B 7   ? 0.5834 0.7626 0.6777 0.0829  0.0523  0.0774  1135 GLU B OE1 
1834 O OE2 . GLU B 7   ? 0.5877 0.6699 0.5924 0.0958  0.0709  0.0408  1135 GLU B OE2 
1835 N N   . LEU B 8   ? 0.4501 0.4778 0.4619 0.0314  0.0011  -0.0008 1136 LEU B N   
1836 C CA  . LEU B 8   ? 0.4664 0.4804 0.4620 0.0375  -0.0095 -0.0014 1136 LEU B CA  
1837 C C   . LEU B 8   ? 0.4671 0.5234 0.4897 0.0446  -0.0201 0.0202  1136 LEU B C   
1838 O O   . LEU B 8   ? 0.4863 0.5360 0.4964 0.0528  -0.0288 0.0230  1136 LEU B O   
1839 C CB  . LEU B 8   ? 0.4815 0.4603 0.4427 0.0508  0.0074  -0.0110 1136 LEU B CB  
1840 C CG  . LEU B 8   ? 0.4892 0.4383 0.4327 0.0432  0.0146  -0.0203 1136 LEU B CG  
1841 C CD1 . LEU B 8   ? 0.4935 0.4171 0.4156 0.0486  0.0279  -0.0196 1136 LEU B CD1 
1842 C CD2 . LEU B 8   ? 0.5041 0.4340 0.4278 0.0455  0.0051  -0.0236 1136 LEU B CD2 
1843 N N   . TYR B 9   ? 0.4521 0.5576 0.5154 0.0424  -0.0189 0.0406  1137 TYR B N   
1844 C CA  . TYR B 9   ? 0.4616 0.6300 0.5671 0.0524  -0.0232 0.0749  1137 TYR B CA  
1845 C C   . TYR B 9   ? 0.4599 0.6827 0.6217 0.0285  -0.0429 0.1032  1137 TYR B C   
1846 O O   . TYR B 9   ? 0.4523 0.6664 0.6165 0.0155  -0.0394 0.0953  1137 TYR B O   
1847 C CB  . TYR B 9   ? 0.4613 0.6432 0.5557 0.0912  0.0130  0.0846  1137 TYR B CB  
1848 C CG  . TYR B 9   ? 0.4700 0.5911 0.5055 0.1115  0.0278  0.0614  1137 TYR B CG  
1849 C CD1 . TYR B 9   ? 0.4661 0.5917 0.4946 0.1285  0.0252  0.0703  1137 TYR B CD1 
1850 C CD2 . TYR B 9   ? 0.4527 0.5119 0.4418 0.1096  0.0400  0.0346  1137 TYR B CD2 
1851 C CE1 . TYR B 9   ? 0.4801 0.5465 0.4537 0.1450  0.0373  0.0518  1137 TYR B CE1 
1852 C CE2 . TYR B 9   ? 0.4791 0.4812 0.4176 0.1210  0.0478  0.0198  1137 TYR B CE2 
1853 C CZ  . TYR B 9   ? 0.4816 0.4857 0.4112 0.1394  0.0477  0.0276  1137 TYR B CZ  
1854 O OH  . TYR B 9   ? 0.5167 0.4620 0.3956 0.1496  0.0545  0.0160  1137 TYR B OH  
1855 N N   . ASP B 10  ? 0.4804 0.7618 0.6903 0.0208  -0.0656 0.1407  1138 ASP B N   
1856 C CA  . ASP B 10  ? 0.4882 0.8427 0.7680 -0.0007 -0.0828 0.1846  1138 ASP B CA  
1857 C C   . ASP B 10  ? 0.4738 0.8861 0.7805 0.0343  -0.0380 0.2097  1138 ASP B C   
1858 O O   . ASP B 10  ? 0.4747 0.8750 0.7745 0.0324  -0.0227 0.1998  1138 ASP B O   
1859 C CB  . ASP B 10  ? 0.5049 0.9196 0.8379 -0.0179 -0.1205 0.2296  1138 ASP B CB  
1860 C CG  . ASP B 10  ? 0.5622 0.9069 0.8538 -0.0512 -0.1720 0.2075  1138 ASP B CG  
1861 O OD1 . ASP B 10  ? 0.5896 0.8470 0.8187 -0.0623 -0.1789 0.1640  1138 ASP B OD1 
1862 O OD2 . ASP B 10  ? 0.6171 0.9931 0.9346 -0.0633 -0.2062 0.2372  1138 ASP B OD2 
1866 O O   . HOH D .   ? 0.6000 0.5585 0.5626 0.0298  -0.0125 -0.0635 3    HOH A O   
1867 O O   . HOH D .   ? 0.4498 0.4587 0.4163 0.0221  0.0306  -0.0650 4    HOH A O   
1868 O O   . HOH D .   ? 0.4498 0.3956 0.4783 -0.0277 -0.0046 0.0691  5    HOH A O   
1869 O O   . HOH D .   ? 0.6195 0.4705 0.5197 0.0156  0.0817  0.1318  6    HOH A O   
1870 O O   . HOH D .   ? 0.6904 0.5365 0.5868 0.0285  0.0744  0.1480  7    HOH A O   
1871 O O   . HOH D .   ? 0.5829 0.4360 0.4524 -0.0409 0.0729  -0.0887 8    HOH A O   
1872 O O   . HOH D .   ? 0.6294 0.5226 0.4846 -0.0022 0.0871  -0.0939 9    HOH A O   
1873 O O   . HOH D .   ? 0.4101 0.5053 0.3845 -0.0488 0.0683  -0.0008 10   HOH A O   
1874 O O   . HOH D .   ? 0.7109 0.8887 0.7629 0.0618  0.1118  0.1100  11   HOH A O   
1875 O O   . HOH D .   ? 0.4957 0.6312 0.3746 -0.0546 0.0523  -0.0559 12   HOH A O   
1876 O O   . HOH D .   ? 1.0001 0.7743 0.8222 0.0902  -0.1022 -0.0609 13   HOH A O   
1877 O O   . HOH D .   ? 0.8659 0.7359 0.8197 -0.1877 0.0313  0.0563  14   HOH A O   
1878 O O   . HOH D .   ? 0.5872 0.5012 0.4763 0.0693  0.0452  0.1431  15   HOH A O   
1879 O O   . HOH D .   ? 0.3919 0.8372 0.4577 0.0021  0.0587  -0.0050 16   HOH A O   
1880 O O   . HOH D .   ? 0.8646 0.8167 0.5930 0.1655  -0.0138 -0.0372 17   HOH A O   
1881 O O   . HOH D .   ? 0.6143 0.5682 0.4463 0.0928  -0.0106 0.1411  18   HOH A O   
1882 O O   . HOH D .   ? 0.6126 0.4560 0.5103 -0.0455 0.0832  -0.0650 19   HOH A O   
1883 O O   . HOH D .   ? 0.6558 0.6369 0.5059 0.0497  0.0750  0.1421  20   HOH A O   
1884 O O   . HOH D .   ? 0.6370 0.6729 0.4018 0.0154  0.0613  -0.1219 21   HOH A O   
1885 O O   . HOH D .   ? 0.9384 0.6199 0.7291 0.0862  0.0695  -0.0962 22   HOH A O   
1886 O O   . HOH D .   ? 0.8935 0.9156 0.8636 -0.0854 0.1030  0.0272  23   HOH A O   
1887 O O   . HOH D .   ? 0.7836 0.5392 0.5105 0.0084  0.0216  -0.1628 24   HOH A O   
1888 O O   . HOH D .   ? 0.9598 0.7261 0.6532 0.1854  0.0770  -0.1591 25   HOH A O   
1889 O O   . HOH D .   ? 0.7454 0.8208 0.6236 0.0903  0.0836  -0.0407 26   HOH A O   
1890 O O   . HOH D .   ? 0.7103 0.8918 0.6506 -0.0911 0.0163  -0.0298 27   HOH A O   
1891 O O   . HOH D .   ? 0.6026 0.8250 0.6313 -0.2086 -0.0031 0.0027  29   HOH A O   
1892 O O   . HOH D .   ? 0.8053 0.9624 0.9165 0.0303  0.0376  0.1847  30   HOH A O   
1893 O O   . HOH D .   ? 0.8176 1.0700 0.8218 -0.2226 -0.0474 -0.0152 31   HOH A O   
1894 O O   . HOH D .   ? 0.5855 0.5911 0.5904 -0.0384 0.0581  0.0087  32   HOH A O   
1895 O O   . HOH D .   ? 0.5516 0.9757 0.5270 -0.0001 0.1062  0.1225  33   HOH A O   
1896 O O   . HOH D .   ? 0.7981 0.7167 0.7529 -0.1518 0.0536  0.0056  34   HOH A O   
1897 O O   . HOH D .   ? 0.5065 0.8040 0.5100 0.0691  0.0547  -0.0521 35   HOH A O   
1898 O O   . HOH D .   ? 0.8983 0.5853 0.7871 -0.0139 0.0634  0.0633  36   HOH A O   
1899 O O   . HOH D .   ? 0.5782 0.8642 0.5308 0.0566  0.1162  -0.0072 37   HOH A O   
1900 O O   . HOH D .   ? 1.2507 0.8090 1.0875 0.0942  0.0365  0.0475  38   HOH A O   
1901 O O   . HOH D .   ? 0.9744 0.6545 0.8362 0.0252  -0.2116 -0.0164 39   HOH A O   
1902 O O   . HOH D .   ? 0.8132 0.6075 0.6560 0.0929  -0.0794 -0.0790 40   HOH A O   
1903 O O   . HOH D .   ? 0.6295 0.5328 0.5809 0.0177  0.0043  -0.0484 41   HOH A O   
1904 O O   . HOH D .   ? 1.0621 0.6746 0.9312 0.0050  -0.2721 -0.0135 42   HOH A O   
1905 O O   . HOH D .   ? 0.7928 0.7151 0.6080 0.1464  0.1229  -0.0837 43   HOH A O   
1906 O O   . HOH D .   ? 0.6543 0.7555 0.5655 0.0137  0.1197  0.0458  44   HOH A O   
1907 O O   . HOH D .   ? 0.6146 0.5706 0.5743 -0.1447 0.0563  -0.0138 45   HOH A O   
1908 O O   . HOH D .   ? 0.9698 0.7217 0.6190 0.0428  -0.0010 -0.2019 46   HOH A O   
1909 O O   . HOH D .   ? 0.6024 0.7868 0.6476 -0.0165 0.0854  0.0971  47   HOH A O   
1910 O O   . HOH D .   ? 0.5490 0.9134 0.6240 -0.1345 0.0620  0.0412  48   HOH A O   
1911 O O   . HOH D .   ? 0.6770 0.7726 0.6915 -0.0333 -0.0588 0.0009  49   HOH A O   
1912 O O   . HOH D .   ? 0.8364 0.7670 0.7952 0.0335  -0.0575 0.1230  50   HOH A O   
1913 O O   . HOH D .   ? 0.8367 1.0228 0.8660 0.0762  0.1259  0.0915  51   HOH A O   
1914 O O   . HOH D .   ? 0.6178 0.5376 0.5959 0.1016  0.0896  0.0943  52   HOH A O   
1916 O O   . HOH D .   ? 0.8520 0.7206 0.5073 0.1798  0.0767  -0.1799 54   HOH A O   
1917 O O   . HOH D .   ? 1.1584 0.7120 0.9784 0.0258  -0.3196 -0.0337 55   HOH A O   
1918 O O   . HOH D .   ? 0.8175 0.7708 0.7372 -0.2023 -0.0201 -0.0508 56   HOH A O   
1919 O O   . HOH D .   ? 0.7954 1.1047 0.7692 0.1099  0.0677  -0.0586 57   HOH A O   
1920 O O   . HOH D .   ? 0.7912 0.6396 0.7286 0.0329  -0.0594 -0.0563 58   HOH A O   
1921 O O   . HOH D .   ? 0.9136 1.0015 0.7583 0.0958  0.0916  -0.0020 59   HOH A O   
1922 O O   . HOH D .   ? 1.0676 0.6174 0.8925 0.1502  0.0346  0.0446  60   HOH A O   
1923 O O   . HOH D .   ? 0.8987 1.1305 0.5910 0.2585  0.1491  -0.1003 61   HOH A O   
1924 O O   . HOH D .   ? 0.5921 0.8677 0.6355 -0.1724 0.0116  -0.0010 62   HOH A O   
1925 O O   . HOH D .   ? 1.1153 0.9902 1.0382 -0.1140 0.0597  0.2109  64   HOH A O   
1926 O O   . HOH D .   ? 0.8240 1.2499 0.9194 -0.1693 0.0102  0.0356  65   HOH A O   
1927 O O   . HOH D .   ? 0.5689 0.8291 0.6010 -0.0402 0.0759  0.1119  66   HOH A O   
1928 O O   . HOH D .   ? 0.8406 0.6377 0.7562 -0.0882 0.0619  0.1420  67   HOH A O   
1929 O O   . HOH D .   ? 0.6510 0.8237 0.5818 0.1442  0.0300  -0.0946 68   HOH A O   
1930 O O   . HOH D .   ? 0.6786 0.5734 0.5000 0.0895  -0.0281 0.0326  69   HOH A O   
1931 O O   . HOH D .   ? 0.8445 0.7452 0.7778 -0.0785 0.0916  0.0999  70   HOH A O   
1932 O O   . HOH D .   ? 0.9075 0.8083 0.8457 -0.1475 0.0540  0.2205  71   HOH A O   
1933 O O   . HOH D .   ? 1.0351 0.6719 0.9069 -0.0208 0.0485  0.0423  72   HOH A O   
1934 O O   . HOH D .   ? 0.7119 0.9113 0.7868 0.0595  0.1017  0.1355  73   HOH A O   
1935 O O   . HOH D .   ? 1.0885 0.7304 0.9558 0.1221  0.0571  0.0700  74   HOH A O   
1936 O O   . HOH D .   ? 1.0188 0.9850 0.9760 -0.1969 0.0392  0.2917  75   HOH A O   
1937 O O   . HOH D .   ? 0.9936 0.7834 0.9175 -0.1374 0.0385  0.1775  76   HOH A O   
1938 O O   . HOH D .   ? 0.9249 0.8875 0.6299 0.1990  -0.0182 -0.0723 77   HOH A O   
1939 O O   . HOH D .   ? 0.5604 0.6631 0.3832 -0.0034 0.0740  -0.0818 78   HOH A O   
1940 O O   . HOH D .   ? 0.7288 0.8284 0.6934 -0.0450 0.1160  0.0288  79   HOH A O   
1941 O O   . HOH D .   ? 0.6497 0.6023 0.5124 0.0701  0.0583  0.0000  80   HOH A O   
1945 O O   . HOH D .   ? 1.1645 0.9489 0.7676 0.1670  0.0394  -0.2150 84   HOH A O   
1946 O O   . HOH D .   ? 0.6802 0.5482 0.7021 -0.0592 -0.0946 0.0662  85   HOH A O   
1947 O O   . HOH D .   ? 0.5527 0.8590 0.5470 -0.0265 0.0882  0.0973  86   HOH A O   
1948 O O   . HOH D .   ? 0.8693 1.1358 0.8847 0.1360  0.1490  0.0993  87   HOH A O   
1949 O O   . HOH D .   ? 0.9253 0.7605 0.6840 -0.0776 -0.0129 -0.1503 89   HOH A O   
1950 O O   . HOH D .   ? 0.6596 0.7897 0.6618 -0.0779 0.0117  0.0340  90   HOH A O   
1951 O O   . HOH D .   ? 0.8237 0.9588 0.5182 0.2580  0.1407  -0.1172 91   HOH A O   
1952 O O   . HOH D .   ? 0.7856 0.7860 0.7964 0.1633  0.0775  0.1554  92   HOH A O   
1953 O O   . HOH D .   ? 1.1449 0.7158 0.8349 -0.0539 -0.0606 -0.1684 93   HOH A O   
1954 O O   . HOH D .   ? 0.8000 0.9717 0.8761 -0.1192 -0.0319 0.1585  94   HOH A O   
1955 O O   . HOH D .   ? 0.7191 0.8108 0.7301 -0.2064 0.0312  0.0317  95   HOH A O   
1956 O O   . HOH D .   ? 0.7053 1.0428 0.6775 0.0593  0.1125  -0.0090 96   HOH A O   
1957 O O   . HOH E .   ? 0.4270 0.3528 0.4051 -0.0114 0.0233  -0.0275 1    HOH B O   
1958 O O   . HOH E .   ? 0.4365 0.3302 0.4153 -0.0121 -0.0044 -0.0114 2    HOH B O   
1959 O O   . HOH E .   ? 0.5356 0.6851 0.6786 -0.0255 -0.0230 0.0517  28   HOH B O   
1960 O O   . HOH E .   ? 0.7445 0.7661 0.8253 -0.0535 -0.0223 0.1289  63   HOH B O   
1961 O O   . HOH E .   ? 0.4939 0.5568 0.5969 -0.0625 -0.0325 0.0143  88   HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1259 ?    ?   ?   A . n 
A 1 2   PRO 2   1260 ?    ?   ?   A . n 
A 1 3   LEU 3   1261 ?    ?   ?   A . n 
A 1 4   GLY 4   1262 ?    ?   ?   A . n 
A 1 5   SER 5   1263 ?    ?   ?   A . n 
A 1 6   LEU 6   1264 ?    ?   ?   A . n 
A 1 7   LYS 7   1265 ?    ?   ?   A . n 
A 1 8   LYS 8   1266 1266 LYS LYS A . n 
A 1 9   GLN 9   1267 1267 GLN GLN A . n 
A 1 10  TYR 10  1268 1268 TYR TYR A . n 
A 1 11  ILE 11  1269 1269 ILE ILE A . n 
A 1 12  PHE 12  1270 1270 PHE PHE A . n 
A 1 13  GLN 13  1271 1271 GLN GLN A . n 
A 1 14  LEU 14  1272 1272 LEU LEU A . n 
A 1 15  SER 15  1273 1273 SER SER A . n 
A 1 16  SER 16  1274 1274 SER SER A . n 
A 1 17  LEU 17  1275 1275 LEU LEU A . n 
A 1 18  ASN 18  1276 1276 ASN ASN A . n 
A 1 19  PRO 19  1277 1277 PRO PRO A . n 
A 1 20  GLN 20  1278 1278 GLN GLN A . n 
A 1 21  GLU 21  1279 1279 GLU GLU A . n 
A 1 22  ARG 22  1280 1280 ARG ARG A . n 
A 1 23  ILE 23  1281 1281 ILE ILE A . n 
A 1 24  ASP 24  1282 1282 ASP ASP A . n 
A 1 25  TYR 25  1283 1283 TYR TYR A . n 
A 1 26  CYS 26  1284 1284 CYS CYS A . n 
A 1 27  HIS 27  1285 1285 HIS HIS A . n 
A 1 28  LEU 28  1286 1286 LEU LEU A . n 
A 1 29  ILE 29  1287 1287 ILE ILE A . n 
A 1 30  GLU 30  1288 1288 GLU GLU A . n 
A 1 31  LYS 31  1289 1289 LYS LYS A . n 
A 1 32  LEU 32  1290 1290 LEU LEU A . n 
A 1 33  GLY 33  1291 1291 GLY GLY A . n 
A 1 34  GLY 34  1292 1292 GLY GLY A . n 
A 1 35  LEU 35  1293 1293 LEU LEU A . n 
A 1 36  VAL 36  1294 1294 VAL VAL A . n 
A 1 37  ILE 37  1295 1295 ILE ILE A . n 
A 1 38  GLU 38  1296 1296 GLU GLU A . n 
A 1 39  LYS 39  1297 1297 LYS LYS A . n 
A 1 40  GLN 40  1298 1298 GLN GLN A . n 
A 1 41  CYS 41  1299 1299 CYS CYS A . n 
A 1 42  PHE 42  1300 1300 PHE PHE A . n 
A 1 43  ASP 43  1301 1301 ASP ASP A . n 
A 1 44  PRO 44  1302 1302 PRO PRO A . n 
A 1 45  THR 45  1303 1303 THR THR A . n 
A 1 46  CYS 46  1304 1304 CYS CYS A . n 
A 1 47  THR 47  1305 1305 THR THR A . n 
A 1 48  HIS 48  1306 1306 HIS HIS A . n 
A 1 49  ILE 49  1307 1307 ILE ILE A . n 
A 1 50  VAL 50  1308 1308 VAL VAL A . n 
A 1 51  VAL 51  1309 1309 VAL VAL A . n 
A 1 52  GLY 52  1310 1310 GLY GLY A . n 
A 1 53  HIS 53  1311 1311 HIS HIS A . n 
A 1 54  PRO 54  1312 1312 PRO PRO A . n 
A 1 55  LEU 55  1313 1313 LEU LEU A . n 
A 1 56  ARG 56  1314 1314 ARG ARG A . n 
A 1 57  ASN 57  1315 1315 ASN ASN A . n 
A 1 58  GLU 58  1316 1316 GLU GLU A . n 
A 1 59  LYS 59  1317 1317 LYS LYS A . n 
A 1 60  TYR 60  1318 1318 TYR TYR A . n 
A 1 61  LEU 61  1319 1319 LEU LEU A . n 
A 1 62  ALA 62  1320 1320 ALA ALA A . n 
A 1 63  SER 63  1321 1321 SER SER A . n 
A 1 64  VAL 64  1322 1322 VAL VAL A . n 
A 1 65  ALA 65  1323 1323 ALA ALA A . n 
A 1 66  ALA 66  1324 1324 ALA ALA A . n 
A 1 67  GLY 67  1325 1325 GLY GLY A . n 
A 1 68  LYS 68  1326 1326 LYS LYS A . n 
A 1 69  TRP 69  1327 1327 TRP TRP A . n 
A 1 70  VAL 70  1328 1328 VAL VAL A . n 
A 1 71  LEU 71  1329 1329 LEU LEU A . n 
A 1 72  HIS 72  1330 1330 HIS HIS A . n 
A 1 73  ARG 73  1331 1331 ARG ARG A . n 
A 1 74  SER 74  1332 1332 SER SER A . n 
A 1 75  TYR 75  1333 1333 TYR TYR A . n 
A 1 76  LEU 76  1334 1334 LEU LEU A . n 
A 1 77  GLU 77  1335 1335 GLU GLU A . n 
A 1 78  ALA 78  1336 1336 ALA ALA A . n 
A 1 79  CYS 79  1337 1337 CYS CYS A . n 
A 1 80  ARG 80  1338 1338 ARG ARG A . n 
A 1 81  THR 81  1339 1339 THR THR A . n 
A 1 82  ALA 82  1340 1340 ALA ALA A . n 
A 1 83  GLY 83  1341 1341 GLY GLY A . n 
A 1 84  HIS 84  1342 1342 HIS HIS A . n 
A 1 85  PHE 85  1343 1343 PHE PHE A . n 
A 1 86  VAL 86  1344 1344 VAL VAL A . n 
A 1 87  GLN 87  1345 1345 GLN GLN A . n 
A 1 88  GLU 88  1346 1346 GLU GLU A . n 
A 1 89  GLU 89  1347 1347 GLU GLU A . n 
A 1 90  ASP 90  1348 1348 ASP ASP A . n 
A 1 91  TYR 91  1349 1349 TYR TYR A . n 
A 1 92  GLU 92  1350 1350 GLU GLU A . n 
A 1 93  TRP 93  1351 1351 TRP TRP A . n 
A 1 94  GLY 94  1352 1352 GLY GLY A . n 
A 1 95  SER 95  1353 1353 SER SER A . n 
A 1 96  SER 96  1354 1354 SER SER A . n 
A 1 97  SER 97  1355 1355 SER SER A . n 
A 1 98  ILE 98  1356 1356 ILE ILE A . n 
A 1 99  LEU 99  1357 1357 LEU LEU A . n 
A 1 100 ASP 100 1358 1358 ASP ASP A . n 
A 1 101 VAL 101 1359 1359 VAL VAL A . n 
A 1 102 LEU 102 1360 1360 LEU LEU A . n 
A 1 103 THR 103 1361 1361 THR THR A . n 
A 1 104 GLY 104 1362 1362 GLY GLY A . n 
A 1 105 ILE 105 1363 1363 ILE ILE A . n 
A 1 106 ASN 106 1364 1364 ASN ASN A . n 
A 1 107 VAL 107 1365 1365 VAL VAL A . n 
A 1 108 GLN 108 1366 1366 GLN GLN A . n 
A 1 109 GLN 109 1367 1367 GLN GLN A . n 
A 1 110 ARG 110 1368 1368 ARG ARG A . n 
A 1 111 ARG 111 1369 1369 ARG ARG A . n 
A 1 112 LEU 112 1370 1370 LEU LEU A . n 
A 1 113 ALA 113 1371 1371 ALA ALA A . n 
A 1 114 LEU 114 1372 1372 LEU LEU A . n 
A 1 115 ALA 115 1373 1373 ALA ALA A . n 
A 1 116 ALA 116 1374 1374 ALA ALA A . n 
A 1 117 MET 117 1375 1375 MET MET A . n 
A 1 118 ARG 118 1376 1376 ARG ARG A . n 
A 1 119 TRP 119 1377 1377 TRP TRP A . n 
A 1 120 ARG 120 1378 1378 ARG ARG A . n 
A 1 121 LYS 121 1379 1379 LYS LYS A . n 
A 1 122 LYS 122 1380 1380 LYS LYS A . n 
A 1 123 ILE 123 1381 1381 ILE ILE A . n 
A 1 124 GLN 124 1382 1382 GLN GLN A . n 
A 1 125 GLN 125 1383 1383 GLN GLN A . n 
A 1 126 ARG 126 1384 1384 ARG ARG A . n 
A 1 127 GLN 127 1385 1385 GLN GLN A . n 
A 1 128 GLU 128 1386 1386 GLU GLU A . n 
A 1 129 SER 129 1387 1387 SER SER A . n 
A 1 130 GLY 130 1388 1388 GLY GLY A . n 
A 1 131 ILE 131 1389 1389 ILE ILE A . n 
A 1 132 VAL 132 1390 1390 VAL VAL A . n 
A 1 133 GLU 133 1391 1391 GLU GLU A . n 
A 1 134 GLY 134 1392 1392 GLY GLY A . n 
A 1 135 ALA 135 1393 1393 ALA ALA A . n 
A 1 136 PHE 136 1394 1394 PHE PHE A . n 
A 1 137 SER 137 1395 1395 SER SER A . n 
A 1 138 GLY 138 1396 1396 GLY GLY A . n 
A 1 139 TRP 139 1397 1397 TRP TRP A . n 
A 1 140 LYS 140 1398 1398 LYS LYS A . n 
A 1 141 VAL 141 1399 1399 VAL VAL A . n 
A 1 142 ILE 142 1400 1400 ILE ILE A . n 
A 1 143 LEU 143 1401 1401 LEU LEU A . n 
A 1 144 HIS 144 1402 1402 HIS HIS A . n 
A 1 145 VAL 145 1403 1403 VAL VAL A . n 
A 1 146 ASP 146 1404 1404 ASP ASP A . n 
A 1 147 GLN 147 1405 1405 GLN GLN A . n 
A 1 148 SER 148 1406 1406 SER SER A . n 
A 1 149 ARG 149 1407 1407 ARG ARG A . n 
A 1 150 GLU 150 1408 1408 GLU GLU A . n 
A 1 151 ALA 151 1409 1409 ALA ALA A . n 
A 1 152 GLY 152 1410 1410 GLY GLY A . n 
A 1 153 PHE 153 1411 1411 PHE PHE A . n 
A 1 154 LYS 154 1412 1412 LYS LYS A . n 
A 1 155 ARG 155 1413 1413 ARG ARG A . n 
A 1 156 LEU 156 1414 1414 LEU LEU A . n 
A 1 157 LEU 157 1415 1415 LEU LEU A . n 
A 1 158 GLN 158 1416 1416 GLN GLN A . n 
A 1 159 SER 159 1417 1417 SER SER A . n 
A 1 160 GLY 160 1418 1418 GLY GLY A . n 
A 1 161 GLY 161 1419 1419 GLY GLY A . n 
A 1 162 ALA 162 1420 1420 ALA ALA A . n 
A 1 163 LYS 163 1421 1421 LYS LYS A . n 
A 1 164 VAL 164 1422 1422 VAL VAL A . n 
A 1 165 LEU 165 1423 1423 LEU LEU A . n 
A 1 166 PRO 166 1424 1424 PRO PRO A . n 
A 1 167 GLY 167 1425 1425 GLY GLY A . n 
A 1 168 HIS 168 1426 1426 HIS HIS A . n 
A 1 169 SER 169 1427 1427 SER SER A . n 
A 1 170 VAL 170 1428 1428 VAL VAL A . n 
A 1 171 PRO 171 1429 1429 PRO PRO A . n 
A 1 172 LEU 172 1430 1430 LEU LEU A . n 
A 1 173 PHE 173 1431 1431 PHE PHE A . n 
A 1 174 LYS 174 1432 1432 LYS LYS A . n 
A 1 175 GLU 175 1433 1433 GLU GLU A . n 
A 1 176 ALA 176 1434 1434 ALA ALA A . n 
A 1 177 THR 177 1435 1435 THR THR A . n 
A 1 178 HIS 178 1436 1436 HIS HIS A . n 
A 1 179 LEU 179 1437 1437 LEU LEU A . n 
A 1 180 PHE 180 1438 1438 PHE PHE A . n 
A 1 181 SER 181 1439 1439 SER SER A . n 
A 1 182 ASP 182 1440 1440 ASP ASP A . n 
A 1 183 LEU 183 1441 1441 LEU LEU A . n 
A 1 184 ASN 184 1442 ?    ?   ?   A . n 
A 1 185 LYS 185 1443 ?    ?   ?   A . n 
A 1 186 LEU 186 1444 ?    ?   ?   A . n 
A 1 187 LYS 187 1445 ?    ?   ?   A . n 
A 1 188 PRO 188 1446 ?    ?   ?   A . n 
A 1 189 ASP 189 1447 ?    ?   ?   A . n 
A 1 190 ASP 190 1448 ?    ?   ?   A . n 
A 1 191 SER 191 1449 ?    ?   ?   A . n 
A 1 192 GLY 192 1450 1450 GLY GLY A . n 
A 1 193 VAL 193 1451 1451 VAL VAL A . n 
A 1 194 ASN 194 1452 1452 ASN ASN A . n 
A 1 195 ILE 195 1453 1453 ILE ILE A . n 
A 1 196 ALA 196 1454 1454 ALA ALA A . n 
A 1 197 GLU 197 1455 1455 GLU GLU A . n 
A 1 198 ALA 198 1456 1456 ALA ALA A . n 
A 1 199 ALA 199 1457 1457 ALA ALA A . n 
A 1 200 ALA 200 1458 1458 ALA ALA A . n 
A 1 201 GLN 201 1459 1459 GLN GLN A . n 
A 1 202 ASN 202 1460 1460 ASN ASN A . n 
A 1 203 VAL 203 1461 1461 VAL VAL A . n 
A 1 204 TYR 204 1462 1462 TYR TYR A . n 
A 1 205 CYS 205 1463 1463 CYS CYS A . n 
A 1 206 LEU 206 1464 1464 LEU LEU A . n 
A 1 207 ARG 207 1465 1465 ARG ARG A . n 
A 1 208 THR 208 1466 1466 THR THR A . n 
A 1 209 GLU 209 1467 1467 GLU GLU A . n 
A 1 210 TYR 210 1468 1468 TYR TYR A . n 
A 1 211 ILE 211 1469 1469 ILE ILE A . n 
A 1 212 ALA 212 1470 1470 ALA ALA A . n 
A 1 213 ASP 213 1471 1471 ASP ASP A . n 
A 1 214 TYR 214 1472 1472 TYR TYR A . n 
A 1 215 LEU 215 1473 1473 LEU LEU A . n 
A 1 216 MET 216 1474 1474 MET MET A . n 
A 1 217 GLN 217 1475 1475 GLN GLN A . n 
A 1 218 GLU 218 1476 1476 GLU GLU A . n 
A 1 219 SER 219 1477 1477 SER SER A . n 
A 1 220 PRO 220 1478 1478 PRO PRO A . n 
A 1 221 PRO 221 1479 1479 PRO PRO A . n 
A 1 222 HIS 222 1480 1480 HIS HIS A . n 
A 1 223 VAL 223 1481 1481 VAL VAL A . n 
A 1 224 GLU 224 1482 1482 GLU GLU A . n 
A 1 225 ASN 225 1483 1483 ASN ASN A . n 
A 1 226 TYR 226 1484 1484 TYR TYR A . n 
A 1 227 CYS 227 1485 1485 CYS CYS A . n 
A 1 228 LEU 228 1486 1486 LEU LEU A . n 
A 1 229 PRO 229 1487 1487 PRO PRO A . n 
A 1 230 GLU 230 1488 1488 GLU GLU A . n 
A 1 231 ALA 231 1489 1489 ALA ALA A . n 
A 1 232 ILE 232 1490 1490 ILE ILE A . n 
A 1 233 SER 233 1491 1491 SER SER A . n 
A 1 234 PHE 234 1492 ?    ?   ?   A . n 
A 1 235 ILE 235 1493 ?    ?   ?   A . n 
B 2 1   SER 1   1129 1129 SER SER B . n 
B 2 2   ILE 2   1130 1130 ILE ILE B . n 
B 2 3   TYR 3   1131 1131 TYR TYR B . n 
B 2 4   PHE 4   1132 1132 PHE PHE B . n 
B 2 5   TPO 5   1133 1133 TPO TPO B . n 
B 2 6   PRO 6   1134 1134 PRO PRO B . n 
B 2 7   GLU 7   1135 1135 GLU GLU B . n 
B 2 8   LEU 8   1136 1136 LEU LEU B . n 
B 2 9   TYR 9   1137 1137 TYR TYR B . n 
B 2 10  ASP 10  1138 1138 ASP ASP B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 FMT 1  1  1  FMT FMT A . 
D 4 HOH 1  3  3  HOH HOH A . 
D 4 HOH 2  4  4  HOH HOH A . 
D 4 HOH 3  5  5  HOH HOH A . 
D 4 HOH 4  6  6  HOH HOH A . 
D 4 HOH 5  7  7  HOH HOH A . 
D 4 HOH 6  8  8  HOH HOH A . 
D 4 HOH 7  9  9  HOH HOH A . 
D 4 HOH 8  10 10 HOH HOH A . 
D 4 HOH 9  11 11 HOH HOH A . 
D 4 HOH 10 12 12 HOH HOH A . 
D 4 HOH 11 13 13 HOH HOH A . 
D 4 HOH 12 14 14 HOH HOH A . 
D 4 HOH 13 15 15 HOH HOH A . 
D 4 HOH 14 16 16 HOH HOH A . 
D 4 HOH 15 17 17 HOH HOH A . 
D 4 HOH 16 18 18 HOH HOH A . 
D 4 HOH 17 19 19 HOH HOH A . 
D 4 HOH 18 20 20 HOH HOH A . 
D 4 HOH 19 21 21 HOH HOH A . 
D 4 HOH 20 22 22 HOH HOH A . 
D 4 HOH 21 23 23 HOH HOH A . 
D 4 HOH 22 24 24 HOH HOH A . 
D 4 HOH 23 25 25 HOH HOH A . 
D 4 HOH 24 26 26 HOH HOH A . 
D 4 HOH 25 27 27 HOH HOH A . 
D 4 HOH 26 29 29 HOH HOH A . 
D 4 HOH 27 30 30 HOH HOH A . 
D 4 HOH 28 31 31 HOH HOH A . 
D 4 HOH 29 32 32 HOH HOH A . 
D 4 HOH 30 33 33 HOH HOH A . 
D 4 HOH 31 34 34 HOH HOH A . 
D 4 HOH 32 35 35 HOH HOH A . 
D 4 HOH 33 36 36 HOH HOH A . 
D 4 HOH 34 37 37 HOH HOH A . 
D 4 HOH 35 38 38 HOH HOH A . 
D 4 HOH 36 39 39 HOH HOH A . 
D 4 HOH 37 40 40 HOH HOH A . 
D 4 HOH 38 41 41 HOH HOH A . 
D 4 HOH 39 42 42 HOH HOH A . 
D 4 HOH 40 43 43 HOH HOH A . 
D 4 HOH 41 44 44 HOH HOH A . 
D 4 HOH 42 45 45 HOH HOH A . 
D 4 HOH 43 46 46 HOH HOH A . 
D 4 HOH 44 47 47 HOH HOH A . 
D 4 HOH 45 48 48 HOH HOH A . 
D 4 HOH 46 49 49 HOH HOH A . 
D 4 HOH 47 50 50 HOH HOH A . 
D 4 HOH 48 51 51 HOH HOH A . 
D 4 HOH 49 52 52 HOH HOH A . 
D 4 HOH 50 53 53 HOH HOH A . 
D 4 HOH 51 54 54 HOH HOH A . 
D 4 HOH 52 55 55 HOH HOH A . 
D 4 HOH 53 56 56 HOH HOH A . 
D 4 HOH 54 57 57 HOH HOH A . 
D 4 HOH 55 58 58 HOH HOH A . 
D 4 HOH 56 59 59 HOH HOH A . 
D 4 HOH 57 60 60 HOH HOH A . 
D 4 HOH 58 61 61 HOH HOH A . 
D 4 HOH 59 62 62 HOH HOH A . 
D 4 HOH 60 64 64 HOH HOH A . 
D 4 HOH 61 65 65 HOH HOH A . 
D 4 HOH 62 66 66 HOH HOH A . 
D 4 HOH 63 67 67 HOH HOH A . 
D 4 HOH 64 68 68 HOH HOH A . 
D 4 HOH 65 69 69 HOH HOH A . 
D 4 HOH 66 70 70 HOH HOH A . 
D 4 HOH 67 71 71 HOH HOH A . 
D 4 HOH 68 72 72 HOH HOH A . 
D 4 HOH 69 73 73 HOH HOH A . 
D 4 HOH 70 74 74 HOH HOH A . 
D 4 HOH 71 75 75 HOH HOH A . 
D 4 HOH 72 76 76 HOH HOH A . 
D 4 HOH 73 77 77 HOH HOH A . 
D 4 HOH 74 78 78 HOH HOH A . 
D 4 HOH 75 79 79 HOH HOH A . 
D 4 HOH 76 80 80 HOH HOH A . 
D 4 HOH 77 81 81 HOH HOH A . 
D 4 HOH 78 82 82 HOH HOH A . 
D 4 HOH 79 83 83 HOH HOH A . 
D 4 HOH 80 84 84 HOH HOH A . 
D 4 HOH 81 85 85 HOH HOH A . 
D 4 HOH 82 86 86 HOH HOH A . 
D 4 HOH 83 87 87 HOH HOH A . 
D 4 HOH 84 89 89 HOH HOH A . 
D 4 HOH 85 90 90 HOH HOH A . 
D 4 HOH 86 91 91 HOH HOH A . 
D 4 HOH 87 92 92 HOH HOH A . 
D 4 HOH 88 93 93 HOH HOH A . 
D 4 HOH 89 94 94 HOH HOH A . 
D 4 HOH 90 95 95 HOH HOH A . 
D 4 HOH 91 96 96 HOH HOH A . 
E 4 HOH 1  1  1  HOH HOH B . 
E 4 HOH 2  2  2  HOH HOH B . 
E 4 HOH 3  28 28 HOH HOH B . 
E 4 HOH 4  63 63 HOH HOH B . 
E 4 HOH 5  88 88 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    TPO 
_pdbx_struct_mod_residue.label_seq_id     5 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     TPO 
_pdbx_struct_mod_residue.auth_seq_id      1133 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   THR 
_pdbx_struct_mod_residue.details          PHOSPHOTHREONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1350  ? 
1 MORE         -10   ? 
1 'SSA (A^2)'  11400 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-12-01 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2011-11-30 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -20.3815 -17.1593 -0.4357 0.1398 0.0594 0.0951 -0.0218 0.1020  -0.0324 2.8124 1.2020 4.0167 
-0.9245 2.4141 -1.4828 -0.0553 -0.0483 0.1036 0.0767 -0.1425 -0.0254 -0.0386 0.3240  -0.0393 
'X-RAY DIFFRACTION' 2 ? refined -15.6655 -4.1494  -2.1742 0.1123 0.1641 0.1846 -0.0316 -0.0124 -0.0010 1.7930 6.5409 8.4023 
-2.3772 1.8673 -5.8162 -0.2276 -0.2176 0.4452 0.1230 0.2503  -0.5114 0.3582  -0.0847 0.6383  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 1266 A 1491 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 1129 B 1138 ? . . . . ? 
# 
_pdbx_phasing_MR.entry_id                     3AL3 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     46.590 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           33.900 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        33.900 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .     ?                          program 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 PHASER      2.1.4 'Wed Jun 24 14:00:05 2009' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
3 REFMAC      .     ?                          program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.10  'June 10, 2010'            package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 HKL-2000    .     ?                          ?       ?                    ?                           'data collection' ? ? ? 
6 DENZO       .     ?                          ?       ?                    ?                           'data reduction'  ? ? ? 
7 HKL-2000    .     ?                          ?       ?                    ?                           'data scaling'    ? ? ? 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
650 
;HELIX 
DETERMINATION METHOD: AUTHOR DETERMINED
;
700 
;SHEET 
DETERMINATION METHOD: AUTHOR DETERMINED
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 1314 ? ? -90.69  52.92 
2 1 GLU A 1391 ? ? -162.39 97.21 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 1266 ? CG ? A LYS 8 CG 
2 1 Y 1 A LYS 1266 ? CD ? A LYS 8 CD 
3 1 Y 1 A LYS 1266 ? CE ? A LYS 8 CE 
4 1 Y 1 A LYS 1266 ? NZ ? A LYS 8 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1259 ? A GLY 1   
2  1 Y 1 A PRO 1260 ? A PRO 2   
3  1 Y 1 A LEU 1261 ? A LEU 3   
4  1 Y 1 A GLY 1262 ? A GLY 4   
5  1 Y 1 A SER 1263 ? A SER 5   
6  1 Y 1 A LEU 1264 ? A LEU 6   
7  1 Y 1 A LYS 1265 ? A LYS 7   
8  1 Y 1 A ASN 1442 ? A ASN 184 
9  1 Y 1 A LYS 1443 ? A LYS 185 
10 1 Y 1 A LEU 1444 ? A LEU 186 
11 1 Y 1 A LYS 1445 ? A LYS 187 
12 1 Y 1 A PRO 1446 ? A PRO 188 
13 1 Y 1 A ASP 1447 ? A ASP 189 
14 1 Y 1 A ASP 1448 ? A ASP 190 
15 1 Y 1 A SER 1449 ? A SER 191 
16 1 Y 1 A PHE 1492 ? A PHE 234 
17 1 Y 1 A ILE 1493 ? A ILE 235 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'FORMIC ACID' FMT 
4 water         HOH 
#