data_3AVR
# 
_entry.id   3AVR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3AVR         
RCSB  RCSB029755   
WWPDB D_1000029755 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3AVS 
_pdbx_database_related.details        'H3-free UTX/KDM6A' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3AVR 
_pdbx_database_status.recvd_initial_deposition_date   2011-03-07 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sengoku, T.'  1 
'Yokoyama, S.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for histone H3 Lys 27 demethylation by UTX/KDM6A' 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            25 
_citation.page_first                2266 
_citation.page_last                 2277 
_citation.year                      2011 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22002947 
_citation.pdbx_database_id_DOI      10.1101/gad.172296.111 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sengoku, T.'  1 
primary 'Yokoyama, S.' 2 
# 
_cell.entry_id           3AVR 
_cell.length_a           78.905 
_cell.length_b           83.081 
_cell.length_c           95.057 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3AVR 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Lysine-specific demethylase 6A' 60264.375 1   1.14.11.- ? 'UNP residues 880-1401' ? 
2 polymer     syn 'Histone H3'                     2313.807  1   ?         ? ?                       ? 
3 non-polymer syn N-OXALYLGLYCINE                  147.086   1   ?         ? ?                       ? 
4 non-polymer syn 'ZINC ION'                       65.409    1   ?         ? ?                       ? 
5 non-polymer syn 'NICKEL (II) ION'                58.693    1   ?         ? ?                       ? 
6 non-polymer syn 1,2-ETHANEDIOL                   62.068    9   ?         ? ?                       ? 
7 non-polymer syn 'CHLORIDE ION'                   35.453    2   ?         ? ?                       ? 
8 water       nat water                            18.015    388 ?         ? ?                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Histone demethylase UTX, Ubiquitously-transcribed TPR protein on the X chromosome, Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GPGYQDPNSQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRD
AFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHT
TIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFV
RVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLM
GSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPM
VHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNS
RKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS
;
;GPGYQDPNSQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRD
AFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHT
TIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFV
RVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLM
GSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPM
VHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNS
RKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS
;
A ? 
2 'polypeptide(L)' no yes 'RKQLATKAAR(M3L)SAPATGGVKKP' RKQLATKAARKSAPATGGVKKP B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   TYR n 
1 5   GLN n 
1 6   ASP n 
1 7   PRO n 
1 8   ASN n 
1 9   SER n 
1 10  GLN n 
1 11  ILE n 
1 12  ILE n 
1 13  PRO n 
1 14  SER n 
1 15  MET n 
1 16  SER n 
1 17  VAL n 
1 18  SER n 
1 19  ILE n 
1 20  TYR n 
1 21  PRO n 
1 22  SER n 
1 23  SER n 
1 24  ALA n 
1 25  GLU n 
1 26  VAL n 
1 27  LEU n 
1 28  LYS n 
1 29  ALA n 
1 30  CYS n 
1 31  ARG n 
1 32  ASN n 
1 33  LEU n 
1 34  GLY n 
1 35  LYS n 
1 36  ASN n 
1 37  GLY n 
1 38  LEU n 
1 39  SER n 
1 40  ASN n 
1 41  SER n 
1 42  SER n 
1 43  ILE n 
1 44  LEU n 
1 45  LEU n 
1 46  ASP n 
1 47  LYS n 
1 48  CYS n 
1 49  PRO n 
1 50  PRO n 
1 51  PRO n 
1 52  ARG n 
1 53  PRO n 
1 54  PRO n 
1 55  SER n 
1 56  SER n 
1 57  PRO n 
1 58  TYR n 
1 59  PRO n 
1 60  PRO n 
1 61  LEU n 
1 62  PRO n 
1 63  LYS n 
1 64  ASP n 
1 65  LYS n 
1 66  LEU n 
1 67  ASN n 
1 68  PRO n 
1 69  PRO n 
1 70  THR n 
1 71  PRO n 
1 72  SER n 
1 73  ILE n 
1 74  TYR n 
1 75  LEU n 
1 76  GLU n 
1 77  ASN n 
1 78  LYS n 
1 79  ARG n 
1 80  ASP n 
1 81  ALA n 
1 82  PHE n 
1 83  PHE n 
1 84  PRO n 
1 85  PRO n 
1 86  LEU n 
1 87  HIS n 
1 88  GLN n 
1 89  PHE n 
1 90  CYS n 
1 91  THR n 
1 92  ASN n 
1 93  PRO n 
1 94  ASN n 
1 95  ASN n 
1 96  PRO n 
1 97  VAL n 
1 98  THR n 
1 99  VAL n 
1 100 ILE n 
1 101 ARG n 
1 102 GLY n 
1 103 LEU n 
1 104 ALA n 
1 105 GLY n 
1 106 ALA n 
1 107 LEU n 
1 108 LYS n 
1 109 LEU n 
1 110 ASP n 
1 111 LEU n 
1 112 GLY n 
1 113 LEU n 
1 114 PHE n 
1 115 SER n 
1 116 THR n 
1 117 LYS n 
1 118 THR n 
1 119 LEU n 
1 120 VAL n 
1 121 GLU n 
1 122 ALA n 
1 123 ASN n 
1 124 ASN n 
1 125 GLU n 
1 126 HIS n 
1 127 MET n 
1 128 VAL n 
1 129 GLU n 
1 130 VAL n 
1 131 ARG n 
1 132 THR n 
1 133 GLN n 
1 134 LEU n 
1 135 LEU n 
1 136 GLN n 
1 137 PRO n 
1 138 ALA n 
1 139 ASP n 
1 140 GLU n 
1 141 ASN n 
1 142 TRP n 
1 143 ASP n 
1 144 PRO n 
1 145 THR n 
1 146 GLY n 
1 147 THR n 
1 148 LYS n 
1 149 LYS n 
1 150 ILE n 
1 151 TRP n 
1 152 HIS n 
1 153 CYS n 
1 154 GLU n 
1 155 SER n 
1 156 ASN n 
1 157 ARG n 
1 158 SER n 
1 159 HIS n 
1 160 THR n 
1 161 THR n 
1 162 ILE n 
1 163 ALA n 
1 164 LYS n 
1 165 TYR n 
1 166 ALA n 
1 167 GLN n 
1 168 TYR n 
1 169 GLN n 
1 170 ALA n 
1 171 SER n 
1 172 SER n 
1 173 PHE n 
1 174 GLN n 
1 175 GLU n 
1 176 SER n 
1 177 LEU n 
1 178 ARG n 
1 179 GLU n 
1 180 GLU n 
1 181 ASN n 
1 182 GLU n 
1 183 LYS n 
1 184 ARG n 
1 185 SER n 
1 186 HIS n 
1 187 HIS n 
1 188 LYS n 
1 189 ASP n 
1 190 HIS n 
1 191 SER n 
1 192 ASP n 
1 193 SER n 
1 194 GLU n 
1 195 SER n 
1 196 THR n 
1 197 SER n 
1 198 SER n 
1 199 ASP n 
1 200 ASN n 
1 201 SER n 
1 202 GLY n 
1 203 ARG n 
1 204 ARG n 
1 205 ARG n 
1 206 LYS n 
1 207 GLY n 
1 208 PRO n 
1 209 PHE n 
1 210 LYS n 
1 211 THR n 
1 212 ILE n 
1 213 LYS n 
1 214 PHE n 
1 215 GLY n 
1 216 THR n 
1 217 ASN n 
1 218 ILE n 
1 219 ASP n 
1 220 LEU n 
1 221 SER n 
1 222 ASP n 
1 223 ASP n 
1 224 LYS n 
1 225 LYS n 
1 226 TRP n 
1 227 LYS n 
1 228 LEU n 
1 229 GLN n 
1 230 LEU n 
1 231 HIS n 
1 232 GLU n 
1 233 LEU n 
1 234 THR n 
1 235 LYS n 
1 236 LEU n 
1 237 PRO n 
1 238 ALA n 
1 239 PHE n 
1 240 VAL n 
1 241 ARG n 
1 242 VAL n 
1 243 VAL n 
1 244 SER n 
1 245 ALA n 
1 246 GLY n 
1 247 ASN n 
1 248 LEU n 
1 249 LEU n 
1 250 SER n 
1 251 HIS n 
1 252 VAL n 
1 253 GLY n 
1 254 HIS n 
1 255 THR n 
1 256 ILE n 
1 257 LEU n 
1 258 GLY n 
1 259 MET n 
1 260 ASN n 
1 261 THR n 
1 262 VAL n 
1 263 GLN n 
1 264 LEU n 
1 265 TYR n 
1 266 MET n 
1 267 LYS n 
1 268 VAL n 
1 269 PRO n 
1 270 GLY n 
1 271 SER n 
1 272 ARG n 
1 273 THR n 
1 274 PRO n 
1 275 GLY n 
1 276 HIS n 
1 277 GLN n 
1 278 GLU n 
1 279 ASN n 
1 280 ASN n 
1 281 ASN n 
1 282 PHE n 
1 283 CYS n 
1 284 SER n 
1 285 VAL n 
1 286 ASN n 
1 287 ILE n 
1 288 ASN n 
1 289 ILE n 
1 290 GLY n 
1 291 PRO n 
1 292 GLY n 
1 293 ASP n 
1 294 CYS n 
1 295 GLU n 
1 296 TRP n 
1 297 PHE n 
1 298 VAL n 
1 299 VAL n 
1 300 PRO n 
1 301 GLU n 
1 302 GLY n 
1 303 TYR n 
1 304 TRP n 
1 305 GLY n 
1 306 VAL n 
1 307 LEU n 
1 308 ASN n 
1 309 ASP n 
1 310 PHE n 
1 311 CYS n 
1 312 GLU n 
1 313 LYS n 
1 314 ASN n 
1 315 ASN n 
1 316 LEU n 
1 317 ASN n 
1 318 PHE n 
1 319 LEU n 
1 320 MET n 
1 321 GLY n 
1 322 SER n 
1 323 TRP n 
1 324 TRP n 
1 325 PRO n 
1 326 ASN n 
1 327 LEU n 
1 328 GLU n 
1 329 ASP n 
1 330 LEU n 
1 331 TYR n 
1 332 GLU n 
1 333 ALA n 
1 334 ASN n 
1 335 VAL n 
1 336 PRO n 
1 337 VAL n 
1 338 TYR n 
1 339 ARG n 
1 340 PHE n 
1 341 ILE n 
1 342 GLN n 
1 343 ARG n 
1 344 PRO n 
1 345 GLY n 
1 346 ASP n 
1 347 LEU n 
1 348 VAL n 
1 349 TRP n 
1 350 ILE n 
1 351 ASN n 
1 352 ALA n 
1 353 GLY n 
1 354 THR n 
1 355 VAL n 
1 356 HIS n 
1 357 TRP n 
1 358 VAL n 
1 359 GLN n 
1 360 ALA n 
1 361 ILE n 
1 362 GLY n 
1 363 TRP n 
1 364 CYS n 
1 365 ASN n 
1 366 ASN n 
1 367 ILE n 
1 368 ALA n 
1 369 TRP n 
1 370 ASN n 
1 371 VAL n 
1 372 GLY n 
1 373 PRO n 
1 374 LEU n 
1 375 THR n 
1 376 ALA n 
1 377 CYS n 
1 378 GLN n 
1 379 TYR n 
1 380 LYS n 
1 381 LEU n 
1 382 ALA n 
1 383 VAL n 
1 384 GLU n 
1 385 ARG n 
1 386 TYR n 
1 387 GLU n 
1 388 TRP n 
1 389 ASN n 
1 390 LYS n 
1 391 LEU n 
1 392 GLN n 
1 393 SER n 
1 394 VAL n 
1 395 LYS n 
1 396 SER n 
1 397 ILE n 
1 398 VAL n 
1 399 PRO n 
1 400 MET n 
1 401 VAL n 
1 402 HIS n 
1 403 LEU n 
1 404 SER n 
1 405 TRP n 
1 406 ASN n 
1 407 MET n 
1 408 ALA n 
1 409 ARG n 
1 410 ASN n 
1 411 ILE n 
1 412 LYS n 
1 413 VAL n 
1 414 SER n 
1 415 ASP n 
1 416 PRO n 
1 417 LYS n 
1 418 LEU n 
1 419 PHE n 
1 420 GLU n 
1 421 MET n 
1 422 ILE n 
1 423 LYS n 
1 424 TYR n 
1 425 CYS n 
1 426 LEU n 
1 427 LEU n 
1 428 ARG n 
1 429 THR n 
1 430 LEU n 
1 431 LYS n 
1 432 GLN n 
1 433 CYS n 
1 434 GLN n 
1 435 THR n 
1 436 LEU n 
1 437 ARG n 
1 438 GLU n 
1 439 ALA n 
1 440 LEU n 
1 441 ILE n 
1 442 ALA n 
1 443 ALA n 
1 444 GLY n 
1 445 LYS n 
1 446 GLU n 
1 447 ILE n 
1 448 ILE n 
1 449 TRP n 
1 450 HIS n 
1 451 GLY n 
1 452 ARG n 
1 453 THR n 
1 454 LYS n 
1 455 GLU n 
1 456 GLU n 
1 457 PRO n 
1 458 ALA n 
1 459 HIS n 
1 460 TYR n 
1 461 CYS n 
1 462 SER n 
1 463 ILE n 
1 464 CYS n 
1 465 GLU n 
1 466 VAL n 
1 467 GLU n 
1 468 VAL n 
1 469 PHE n 
1 470 ASP n 
1 471 LEU n 
1 472 LEU n 
1 473 PHE n 
1 474 VAL n 
1 475 THR n 
1 476 ASN n 
1 477 GLU n 
1 478 SER n 
1 479 ASN n 
1 480 SER n 
1 481 ARG n 
1 482 LYS n 
1 483 THR n 
1 484 TYR n 
1 485 ILE n 
1 486 VAL n 
1 487 HIS n 
1 488 CYS n 
1 489 GLN n 
1 490 ASP n 
1 491 CYS n 
1 492 ALA n 
1 493 ARG n 
1 494 LYS n 
1 495 THR n 
1 496 SER n 
1 497 GLY n 
1 498 ASN n 
1 499 LEU n 
1 500 GLU n 
1 501 ASN n 
1 502 PHE n 
1 503 VAL n 
1 504 VAL n 
1 505 LEU n 
1 506 GLU n 
1 507 GLN n 
1 508 TYR n 
1 509 LYS n 
1 510 MET n 
1 511 GLU n 
1 512 ASP n 
1 513 LEU n 
1 514 MET n 
1 515 GLN n 
1 516 VAL n 
1 517 TYR n 
1 518 ASP n 
1 519 GLN n 
1 520 PHE n 
1 521 THR n 
1 522 LEU n 
1 523 ALA n 
1 524 PRO n 
1 525 PRO n 
1 526 LEU n 
1 527 PRO n 
1 528 SER n 
1 529 ALA n 
1 530 SER n 
1 531 SER n 
2 1   ARG n 
2 2   LYS n 
2 3   GLN n 
2 4   LEU n 
2 5   ALA n 
2 6   THR n 
2 7   LYS n 
2 8   ALA n 
2 9   ALA n 
2 10  ARG n 
2 11  M3L n 
2 12  SER n 
2 13  ALA n 
2 14  PRO n 
2 15  ALA n 
2 16  THR n 
2 17  GLY n 
2 18  GLY n 
2 19  VAL n 
2 20  LYS n 
2 21  LYS n 
2 22  PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'KDM6A, UTX' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET47 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Chemical synthesis' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP KDM6A_HUMAN O15550 1 
;QIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQF
CTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQ
ASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLL
SHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLED
LYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMAR
NIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQ
DCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS
;
880 ? 
2 PDB 3AVR        3AVR   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3AVR A 10 ? 531 ? O15550 880 ? 1401 ? 880 1401 
2 2 3AVR B 1  ? 22  ? 3AVR   17  ? 38   ? 17  38   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3AVR GLY A 1 ? UNP O15550 ? ? 'EXPRESSION TAG' 871 1 
1 3AVR PRO A 2 ? UNP O15550 ? ? 'EXPRESSION TAG' 872 2 
1 3AVR GLY A 3 ? UNP O15550 ? ? 'EXPRESSION TAG' 873 3 
1 3AVR TYR A 4 ? UNP O15550 ? ? 'EXPRESSION TAG' 874 4 
1 3AVR GLN A 5 ? UNP O15550 ? ? 'EXPRESSION TAG' 875 5 
1 3AVR ASP A 6 ? UNP O15550 ? ? 'EXPRESSION TAG' 876 6 
1 3AVR PRO A 7 ? UNP O15550 ? ? 'EXPRESSION TAG' 877 7 
1 3AVR ASN A 8 ? UNP O15550 ? ? 'EXPRESSION TAG' 878 8 
1 3AVR SER A 9 ? UNP O15550 ? ? 'EXPRESSION TAG' 879 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'    ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL    'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ?                 'C9 H21 N2 O2 1' 189.275 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
NI  non-polymer         . 'NICKEL (II) ION' ?                 'Ni 2'           58.693  
OGA non-polymer         . N-OXALYLGLYCINE   ?                 'C4 H5 N O5'     147.086 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'        ?                 'Zn 2'           65.409  
# 
_exptl.entry_id          3AVR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.49 
_exptl_crystal.density_percent_sol   50.59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.1M Tris-HCl (pH 8.5), 0.2M Li2SO4, 18-20% PEG 3,350, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2010-10-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double Si(111) crystals' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     3AVR 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   58138 
_reflns.number_all                   58666 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.8 
_reflns_shell.d_res_low                   1.86 
_reflns_shell.percent_possible_all        91.4 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3AVR 
_refine.ls_number_reflns_obs                     58029 
_refine.ls_number_reflns_all                     58666 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.357 
_refine.ls_d_res_high                            1.803 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1709 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1694 
_refine.ls_R_factor_R_free                       0.1983 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.13 
_refine.ls_number_reflns_R_free                  2979 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            9.2948 
_refine.aniso_B[2][2]                            0.1240 
_refine.aniso_B[3][3]                            -4.6761 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.391 
_refine.solvent_model_param_bsol                 41.988 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.89 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3AVS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.21 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_work_R_set                   0.8734 
_refine.pdbx_overall_phase_error                 18.9600 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3920 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             388 
_refine_hist.number_atoms_total               4358 
_refine_hist.d_res_high                       1.803 
_refine_hist.d_res_low                        30.357 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.007  ? ? 4129 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.101  ? ? 5610 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 13.777 ? ? 1540 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.073  ? ? 607  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 724  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
'X-RAY DIFFRACTION' 10 1.8031 1.8675  5281 0.2771 97.00  0.3444 . . 277 . . . . 
'X-RAY DIFFRACTION' 10 1.8675 1.9423  5458 0.2204 100.00 0.2443 . . 311 . . . . 
'X-RAY DIFFRACTION' 10 1.9423 2.0306  5431 0.1881 100.00 0.2353 . . 306 . . . . 
'X-RAY DIFFRACTION' 10 2.0306 2.1377  5471 0.1685 100.00 0.2326 . . 288 . . . . 
'X-RAY DIFFRACTION' 10 2.1377 2.2716  5448 0.1551 100.00 0.1826 . . 297 . . . . 
'X-RAY DIFFRACTION' 10 2.2716 2.4469  5516 0.1520 100.00 0.1799 . . 286 . . . . 
'X-RAY DIFFRACTION' 10 2.4469 2.6930  5522 0.1592 100.00 0.1982 . . 305 . . . . 
'X-RAY DIFFRACTION' 10 2.6930 3.0823  5548 0.1682 100.00 0.2085 . . 297 . . . . 
'X-RAY DIFFRACTION' 10 3.0823 3.8822  5561 0.1734 100.00 0.2010 . . 312 . . . . 
'X-RAY DIFFRACTION' 10 3.8822 30.3610 5814 0.1581 100.00 0.1648 . . 300 . . . . 
# 
_struct.entry_id                  3AVR 
_struct.title                     
'Catalytic fragment of UTX/KDM6A bound with histone H3K27me3 peptide, N-oxyalylglycine, and Ni(II)' 
_struct.pdbx_descriptor           'Lysine-specific demethylase 6A (E.C.1.14.11.-), Histone H3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3AVR 
_struct_keywords.pdbx_keywords   'OXIDOREDUCTASE/STRUCTURAL PROTEIN' 
_struct_keywords.text            'Cupin superfamily, tri/dimethyllysine demethylase, OXIDOREDUCTASE-STRUCTURAL PROTEIN complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 7 ? 
P N N 7 ? 
Q N N 8 ? 
R N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 22  ? ARG A 31  ? SER A 892  ARG A 901  1 ? 10 
HELX_P HELX_P2  2  PRO A 62  ? LEU A 66  ? PRO A 932  LEU A 936  5 ? 5  
HELX_P HELX_P3  3  ASN A 77  ? PHE A 82  ? ASN A 947  PHE A 952  1 ? 6  
HELX_P HELX_P4  4  PHE A 83  ? ASN A 92  ? PHE A 953  ASN A 962  1 ? 10 
HELX_P HELX_P5  5  GLY A 102 ? LYS A 108 ? GLY A 972  LYS A 978  1 ? 7  
HELX_P HELX_P6  6  ASP A 110 ? PHE A 114 ? ASP A 980  PHE A 984  5 ? 5  
HELX_P HELX_P7  7  SER A 115 ? ASN A 123 ? SER A 985  ASN A 993  1 ? 9  
HELX_P HELX_P8  8  ILE A 162 ? SER A 176 ? ILE A 1032 SER A 1046 1 ? 15 
HELX_P HELX_P9  9  TRP A 226 ? LEU A 233 ? TRP A 1096 LEU A 1103 1 ? 8  
HELX_P HELX_P10 10 THR A 234 ? LEU A 236 ? THR A 1104 LEU A 1106 5 ? 3  
HELX_P HELX_P11 11 PRO A 237 ? ARG A 241 ? PRO A 1107 ARG A 1111 5 ? 5  
HELX_P HELX_P12 12 ASN A 247 ? VAL A 252 ? ASN A 1117 VAL A 1122 5 ? 6  
HELX_P HELX_P13 13 GLU A 278 ? PHE A 282 ? GLU A 1148 PHE A 1152 5 ? 5  
HELX_P HELX_P14 14 PRO A 300 ? GLY A 302 ? PRO A 1170 GLY A 1172 5 ? 3  
HELX_P HELX_P15 15 TYR A 303 ? ASN A 314 ? TYR A 1173 ASN A 1184 1 ? 12 
HELX_P HELX_P16 16 ASN A 326 ? ALA A 333 ? ASN A 1196 ALA A 1203 1 ? 8  
HELX_P HELX_P17 17 THR A 375 ? SER A 393 ? THR A 1245 SER A 1263 1 ? 19 
HELX_P HELX_P18 18 PRO A 399 ? ILE A 411 ? PRO A 1269 ILE A 1281 1 ? 13 
HELX_P HELX_P19 19 ASP A 415 ? ALA A 443 ? ASP A 1285 ALA A 1313 1 ? 29 
HELX_P HELX_P20 20 CYS A 488 ? SER A 496 ? CYS A 1358 SER A 1366 1 ? 9  
HELX_P HELX_P21 21 LYS A 509 ? GLN A 519 ? LYS A 1379 GLN A 1389 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B ARG 10  C     ? ? ? 1_555 B M3L 11 N  ? ? B ARG 26   B M3L 27   1_555 ? ? ? ? ? ? ? 1.324 ? 
covale2  covale ? ? B M3L 11  C     ? ? ? 1_555 B SER 12 N  ? ? B M3L 27   B SER 28   1_555 ? ? ? ? ? ? ? 1.329 ? 
metalc1  metalc ? ? A GLU 278 OE2   ? ? ? 1_555 E NI  .  NI ? ? A GLU 1148 A NI  1503 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc2  metalc ? ? A HIS 356 NE2   ? ? ? 1_555 E NI  .  NI ? ? A HIS 1226 A NI  1503 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc3  metalc ? ? A HIS 276 NE2   ? ? ? 1_555 E NI  .  NI ? ? A HIS 1146 A NI  1503 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc4  metalc ? ? C OGA .   O2    ? ? ? 1_555 E NI  .  NI ? ? A OGA 1501 A NI  1503 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc5  metalc ? ? C OGA .   "O2'" ? ? ? 1_555 E NI  .  NI ? ? A OGA 1501 A NI  1503 1_555 ? ? ? ? ? ? ? 2.207 ? 
metalc6  metalc ? ? A CYS 461 SG    ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 1331 A ZN  1502 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc7  metalc ? ? A CYS 488 SG    ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 1358 A ZN  1502 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc8  metalc ? ? A CYS 464 SG    ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 1334 A ZN  1502 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc9  metalc ? ? A CYS 491 SG    ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 1361 A ZN  1502 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc10 metalc ? ? E NI  .   NI    ? ? ? 1_555 Q HOH .  O  ? ? A NI  1503 A HOH 265  1_555 ? ? ? ? ? ? ? 2.355 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 58  A . ? TYR 928  A PRO 59  A ? PRO 929  A 1 0.38 
2 GLY 290 A . ? GLY 1160 A PRO 291 A ? PRO 1161 A 1 5.68 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 4 ? 
C ? 5 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 72  ? TYR A 74  ? SER A 942  TYR A 944  
A 2 VAL A 97  ? ARG A 101 ? VAL A 967  ARG A 971  
A 3 LEU A 347 ? ILE A 350 ? LEU A 1217 ILE A 1220 
A 4 CYS A 283 ? PRO A 291 ? CYS A 1153 PRO A 1161 
A 5 CYS A 364 ? VAL A 371 ? CYS A 1234 VAL A 1241 
A 6 GLN A 263 ? LYS A 267 ? GLN A 1133 LYS A 1137 
A 7 THR A 211 ? ASP A 219 ? THR A 1081 ASP A 1089 
A 8 MET A 127 ? LEU A 134 ? MET A 997  LEU A 1004 
A 9 SER A 155 ? THR A 161 ? SER A 1025 THR A 1031 
B 1 ARG A 272 ? HIS A 276 ? ARG A 1142 HIS A 1146 
B 2 VAL A 355 ? ALA A 360 ? VAL A 1225 ALA A 1230 
B 3 CYS A 294 ? VAL A 299 ? CYS A 1164 VAL A 1169 
B 4 TYR A 338 ? GLN A 342 ? TYR A 1208 GLN A 1212 
C 1 ILE A 447 ? TRP A 449 ? ILE A 1317 TRP A 1319 
C 2 VAL A 503 ? GLU A 506 ? VAL A 1373 GLU A 1376 
C 3 LEU A 471 ? ASN A 476 ? LEU A 1341 ASN A 1346 
C 4 THR A 483 ? HIS A 487 ? THR A 1353 HIS A 1357 
C 5 GLN B 3   ? LEU B 4   ? GLN B 19   LEU B 20   
D 1 HIS A 459 ? TYR A 460 ? HIS A 1329 TYR A 1330 
D 2 GLU A 467 ? VAL A 468 ? GLU A 1337 VAL A 1338 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 73  ? N ILE A 943  O ARG A 101 ? O ARG A 971  
A 2 3 N ILE A 100 ? N ILE A 970  O LEU A 347 ? O LEU A 1217 
A 3 4 O VAL A 348 ? O VAL A 1218 N ASN A 286 ? N ASN A 1156 
A 4 5 N ILE A 287 ? N ILE A 1157 O ILE A 367 ? O ILE A 1237 
A 5 6 O CYS A 364 ? O CYS A 1234 N LYS A 267 ? N LYS A 1137 
A 6 7 O LEU A 264 ? O LEU A 1134 N ILE A 218 ? N ILE A 1088 
A 7 8 O THR A 216 ? O THR A 1086 N GLU A 129 ? N GLU A 999  
A 8 9 N VAL A 130 ? N VAL A 1000 O SER A 158 ? O SER A 1028 
B 1 2 N THR A 273 ? N THR A 1143 O VAL A 358 ? O VAL A 1228 
B 2 3 O GLN A 359 ? O GLN A 1229 N GLU A 295 ? N GLU A 1165 
B 3 4 N CYS A 294 ? N CYS A 1164 O GLN A 342 ? O GLN A 1212 
C 1 2 N ILE A 448 ? N ILE A 1318 O VAL A 504 ? O VAL A 1374 
C 2 3 O LEU A 505 ? O LEU A 1375 N LEU A 472 ? N LEU A 1342 
C 3 4 N THR A 475 ? N THR A 1345 O ILE A 485 ? O ILE A 1355 
C 4 5 N TYR A 484 ? N TYR A 1354 O GLN B 3   ? O GLN B 19   
D 1 2 N HIS A 459 ? N HIS A 1329 O VAL A 468 ? O VAL A 1338 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE OGA A 1501' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1502'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NI A 1503'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE EDO A 1'    
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 2'    
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 3'    
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO A 4'    
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 5'    
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 6'    
BC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE EDO A 7'    
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 8'    
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 9'    
BC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1402'  
BC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A 1403'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 HOH Q .   ? HOH A 63   . ? 1_555 ? 
2  AC1 12 LYS A 267 ? LYS A 1137 . ? 1_555 ? 
3  AC1 12 THR A 273 ? THR A 1143 . ? 1_555 ? 
4  AC1 12 HIS A 276 ? HIS A 1146 . ? 1_555 ? 
5  AC1 12 GLU A 278 ? GLU A 1148 . ? 1_555 ? 
6  AC1 12 SER A 284 ? SER A 1154 . ? 1_555 ? 
7  AC1 12 ASN A 286 ? ASN A 1156 . ? 1_555 ? 
8  AC1 12 TRP A 296 ? TRP A 1166 . ? 1_555 ? 
9  AC1 12 HIS A 356 ? HIS A 1226 . ? 1_555 ? 
10 AC1 12 ALA A 368 ? ALA A 1238 . ? 1_555 ? 
11 AC1 12 NI  E .   ? NI  A 1503 . ? 1_555 ? 
12 AC1 12 M3L B 11  ? M3L B 27   . ? 1_555 ? 
13 AC2 4  CYS A 461 ? CYS A 1331 . ? 1_555 ? 
14 AC2 4  CYS A 464 ? CYS A 1334 . ? 1_555 ? 
15 AC2 4  CYS A 488 ? CYS A 1358 . ? 1_555 ? 
16 AC2 4  CYS A 491 ? CYS A 1361 . ? 1_555 ? 
17 AC3 5  HOH Q .   ? HOH A 265  . ? 1_555 ? 
18 AC3 5  HIS A 276 ? HIS A 1146 . ? 1_555 ? 
19 AC3 5  GLU A 278 ? GLU A 1148 . ? 1_555 ? 
20 AC3 5  HIS A 356 ? HIS A 1226 . ? 1_555 ? 
21 AC3 5  OGA C .   ? OGA A 1501 . ? 1_555 ? 
22 AC4 2  HOH Q .   ? HOH A 295  . ? 1_555 ? 
23 AC4 2  SER A 250 ? SER A 1120 . ? 1_555 ? 
24 AC5 4  HOH Q .   ? HOH A 115  . ? 1_555 ? 
25 AC5 4  HOH Q .   ? HOH A 198  . ? 1_555 ? 
26 AC5 4  GLU A 76  ? GLU A 946  . ? 3_554 ? 
27 AC5 4  MET A 421 ? MET A 1291 . ? 1_555 ? 
28 AC6 4  HOH Q .   ? HOH A 343  . ? 1_555 ? 
29 AC6 4  PRO A 62  ? PRO A 932  . ? 2_455 ? 
30 AC6 4  LYS A 63  ? LYS A 933  . ? 2_455 ? 
31 AC6 4  ASN A 334 ? ASN A 1204 . ? 2_455 ? 
32 AC7 7  HOH Q .   ? HOH A 60   . ? 3_554 ? 
33 AC7 7  HOH Q .   ? HOH A 99   . ? 3_554 ? 
34 AC7 7  HOH Q .   ? HOH A 104  . ? 1_555 ? 
35 AC7 7  ILE A 19  ? ILE A 889  . ? 1_555 ? 
36 AC7 7  TYR A 20  ? TYR A 890  . ? 1_555 ? 
37 AC7 7  PRO A 21  ? PRO A 891  . ? 1_555 ? 
38 AC7 7  THR A 70  ? THR A 940  . ? 3_554 ? 
39 AC8 5  HOH Q .   ? HOH A 55   . ? 1_555 ? 
40 AC8 5  HOH Q .   ? HOH A 210  . ? 1_555 ? 
41 AC8 5  GLN A 169 ? GLN A 1039 . ? 1_555 ? 
42 AC8 5  ALA A 170 ? ALA A 1040 . ? 1_555 ? 
43 AC8 5  TRP A 363 ? TRP A 1233 . ? 1_555 ? 
44 AC9 6  HOH Q .   ? HOH A 275  . ? 1_555 ? 
45 AC9 6  HOH Q .   ? HOH A 296  . ? 1_555 ? 
46 AC9 6  THR A 160 ? THR A 1030 . ? 1_555 ? 
47 AC9 6  LYS A 164 ? LYS A 1034 . ? 1_555 ? 
48 AC9 6  TYR A 165 ? TYR A 1035 . ? 1_555 ? 
49 AC9 6  LYS A 213 ? LYS A 1083 . ? 1_555 ? 
50 BC1 2  ALA A 238 ? ALA A 1108 . ? 1_555 ? 
51 BC1 2  ARG A 241 ? ARG A 1111 . ? 1_555 ? 
52 BC2 6  HOH Q .   ? HOH A 329  . ? 1_555 ? 
53 BC2 6  THR A 91  ? THR A 961  . ? 1_555 ? 
54 BC2 6  ASN A 351 ? ASN A 1221 . ? 1_555 ? 
55 BC2 6  ALA A 352 ? ALA A 1222 . ? 1_555 ? 
56 BC2 6  THR A 375 ? THR A 1245 . ? 1_555 ? 
57 BC2 6  CYS A 377 ? CYS A 1247 . ? 1_555 ? 
58 BC3 5  HOH Q .   ? HOH A 56   . ? 1_555 ? 
59 BC3 5  HOH Q .   ? HOH A 368  . ? 1_555 ? 
60 BC3 5  LEU A 111 ? LEU A 981  . ? 1_555 ? 
61 BC3 5  GLY A 112 ? GLY A 982  . ? 1_555 ? 
62 BC3 5  ILE A 289 ? ILE A 1159 . ? 1_555 ? 
63 BC4 1  ARG A 452 ? ARG A 1322 . ? 1_555 ? 
64 BC5 2  SER A 244 ? SER A 1114 . ? 1_555 ? 
65 BC5 2  ALA A 245 ? ALA A 1115 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3AVR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3AVR 
_atom_sites.fract_transf_matrix[1][1]   0.012673 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012036 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010520 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
NI 
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 16  ? 21.058  17.666  -23.095 1.00 75.68  ? 886  SER A N     1 
ATOM   2    C  CA    . SER A 1 16  ? 19.811  17.391  -22.388 1.00 74.43  ? 886  SER A CA    1 
ATOM   3    C  C     . SER A 1 16  ? 19.165  18.699  -21.926 1.00 68.00  ? 886  SER A C     1 
ATOM   4    O  O     . SER A 1 16  ? 19.740  19.439  -21.124 1.00 66.58  ? 886  SER A O     1 
ATOM   5    C  CB    . SER A 1 16  ? 20.077  16.476  -21.193 1.00 76.42  ? 886  SER A CB    1 
ATOM   6    O  OG    . SER A 1 16  ? 20.741  17.177  -20.154 1.00 78.95  ? 886  SER A OG    1 
ATOM   7    H  HA    . SER A 1 16  ? 19.189  16.937  -22.993 1.00 89.32  ? 886  SER A HA    1 
ATOM   8    H  HB2   . SER A 1 16  ? 19.230  16.142  -20.857 1.00 91.70  ? 886  SER A HB2   1 
ATOM   9    H  HB3   . SER A 1 16  ? 20.634  15.736  -21.480 1.00 91.70  ? 886  SER A HB3   1 
ATOM   10   H  HG    . SER A 1 16  ? 20.877  16.676  -19.520 1.00 94.74  ? 886  SER A HG    1 
ATOM   11   N  N     . VAL A 1 17  ? 17.968  18.981  -22.432 1.00 52.11  ? 887  VAL A N     1 
ATOM   12   C  CA    . VAL A 1 17  ? 17.341  20.287  -22.215 1.00 40.23  ? 887  VAL A CA    1 
ATOM   13   C  C     . VAL A 1 17  ? 16.286  20.278  -21.106 1.00 39.11  ? 887  VAL A C     1 
ATOM   14   O  O     . VAL A 1 17  ? 15.365  19.458  -21.112 1.00 35.71  ? 887  VAL A O     1 
ATOM   15   C  CB    . VAL A 1 17  ? 16.692  20.813  -23.507 1.00 36.29  ? 887  VAL A CB    1 
ATOM   16   C  CG1   . VAL A 1 17  ? 15.957  22.113  -23.229 1.00 30.09  ? 887  VAL A CG1   1 
ATOM   17   C  CG2   . VAL A 1 17  ? 17.754  21.006  -24.577 1.00 35.72  ? 887  VAL A CG2   1 
ATOM   18   H  H     . VAL A 1 17  ? 17.497  18.437  -22.903 1.00 62.54  ? 887  VAL A H     1 
ATOM   19   H  HA    . VAL A 1 17  ? 18.037  20.925  -21.953 1.00 48.27  ? 887  VAL A HA    1 
ATOM   20   H  HB    . VAL A 1 17  ? 16.042  20.156  -23.833 1.00 43.55  ? 887  VAL A HB    1 
ATOM   21   H  HG11  . VAL A 1 17  ? 15.559  22.427  -24.044 1.00 36.11  ? 887  VAL A HG11  1 
ATOM   22   H  HG12  . VAL A 1 17  ? 15.276  21.952  -22.572 1.00 36.11  ? 887  VAL A HG12  1 
ATOM   23   H  HG13  . VAL A 1 17  ? 16.584  22.761  -22.899 1.00 36.11  ? 887  VAL A HG13  1 
ATOM   24   H  HG21  . VAL A 1 17  ? 17.335  21.334  -25.376 1.00 42.86  ? 887  VAL A HG21  1 
ATOM   25   H  HG22  . VAL A 1 17  ? 18.402  21.641  -24.262 1.00 42.86  ? 887  VAL A HG22  1 
ATOM   26   H  HG23  . VAL A 1 17  ? 18.178  20.163  -24.751 1.00 42.86  ? 887  VAL A HG23  1 
ATOM   27   N  N     . SER A 1 18  ? 16.432  21.206  -20.164 1.00 26.63  ? 888  SER A N     1 
ATOM   28   C  CA    . SER A 1 18  ? 15.447  21.406  -19.108 1.00 31.97  ? 888  SER A CA    1 
ATOM   29   C  C     . SER A 1 18  ? 14.434  22.457  -19.549 1.00 31.12  ? 888  SER A C     1 
ATOM   30   O  O     . SER A 1 18  ? 14.820  23.529  -20.023 1.00 30.29  ? 888  SER A O     1 
ATOM   31   C  CB    . SER A 1 18  ? 16.142  21.865  -17.823 1.00 43.58  ? 888  SER A CB    1 
ATOM   32   O  OG    . SER A 1 18  ? 15.190  22.210  -16.831 1.00 62.21  ? 888  SER A OG    1 
ATOM   33   H  H     . SER A 1 18  ? 17.104  21.740  -20.116 1.00 31.95  ? 888  SER A H     1 
ATOM   34   H  HA    . SER A 1 18  ? 14.974  20.566  -18.930 1.00 38.36  ? 888  SER A HA    1 
ATOM   35   H  HB2   . SER A 1 18  ? 16.698  21.144  -17.490 1.00 52.29  ? 888  SER A HB2   1 
ATOM   36   H  HB3   . SER A 1 18  ? 16.689  22.642  -18.020 1.00 52.29  ? 888  SER A HB3   1 
ATOM   37   H  HG    . SER A 1 18  ? 14.431  22.102  -17.121 1.00 74.65  ? 888  SER A HG    1 
ATOM   38   N  N     . ILE A 1 19  ? 13.143  22.166  -19.407 1.00 25.20  ? 889  ILE A N     1 
ATOM   39   C  CA    . ILE A 1 19  ? 12.113  23.142  -19.778 1.00 20.08  ? 889  ILE A CA    1 
ATOM   40   C  C     . ILE A 1 19  ? 11.390  23.653  -18.525 1.00 23.86  ? 889  ILE A C     1 
ATOM   41   O  O     . ILE A 1 19  ? 10.475  24.468  -18.610 1.00 22.12  ? 889  ILE A O     1 
ATOM   42   C  CB    . ILE A 1 19  ? 11.083  22.566  -20.760 1.00 21.01  ? 889  ILE A CB    1 
ATOM   43   C  CG1   . ILE A 1 19  ? 10.343  21.366  -20.164 1.00 21.65  ? 889  ILE A CG1   1 
ATOM   44   C  CG2   . ILE A 1 19  ? 11.760  22.156  -22.088 1.00 20.38  ? 889  ILE A CG2   1 
ATOM   45   C  CD1   . ILE A 1 19  ? 9.221   20.854  -21.084 1.00 23.84  ? 889  ILE A CD1   1 
ATOM   46   H  H     . ILE A 1 19  ? 12.838  21.421  -19.104 1.00 30.24  ? 889  ILE A H     1 
ATOM   47   H  HA    . ILE A 1 19  ? 12.545  23.909  -20.210 1.00 24.10  ? 889  ILE A HA    1 
ATOM   48   H  HB    . ILE A 1 19  ? 10.431  23.257  -20.954 1.00 25.22  ? 889  ILE A HB    1 
ATOM   49   H  HG12  . ILE A 1 19  ? 10.973  20.642  -20.026 1.00 25.98  ? 889  ILE A HG12  1 
ATOM   50   H  HG13  . ILE A 1 19  ? 9.945   21.627  -19.319 1.00 25.98  ? 889  ILE A HG13  1 
ATOM   51   H  HG21  . ILE A 1 19  ? 12.426  21.490  -21.906 1.00 24.45  ? 889  ILE A HG21  1 
ATOM   52   H  HG22  . ILE A 1 19  ? 11.094  21.800  -22.681 1.00 24.45  ? 889  ILE A HG22  1 
ATOM   53   H  HG23  . ILE A 1 19  ? 12.169  22.930  -22.481 1.00 24.45  ? 889  ILE A HG23  1 
ATOM   54   H  HD11  . ILE A 1 19  ? 8.586   21.560  -21.224 1.00 28.61  ? 889  ILE A HD11  1 
ATOM   55   H  HD12  . ILE A 1 19  ? 9.603   20.585  -21.922 1.00 28.61  ? 889  ILE A HD12  1 
ATOM   56   H  HD13  . ILE A 1 19  ? 8.791   20.105  -20.664 1.00 28.61  ? 889  ILE A HD13  1 
ATOM   57   N  N     . TYR A 1 20  ? 11.804  23.167  -17.364 1.00 23.29  ? 890  TYR A N     1 
ATOM   58   C  CA    . TYR A 1 20  ? 11.149  23.550  -16.125 1.00 20.51  ? 890  TYR A CA    1 
ATOM   59   C  C     . TYR A 1 20  ? 12.076  24.394  -15.255 1.00 24.49  ? 890  TYR A C     1 
ATOM   60   O  O     . TYR A 1 20  ? 13.284  24.164  -15.231 1.00 25.59  ? 890  TYR A O     1 
ATOM   61   C  CB    . TYR A 1 20  ? 10.682  22.292  -15.378 1.00 21.72  ? 890  TYR A CB    1 
ATOM   62   C  CG    . TYR A 1 20  ? 9.596   21.541  -16.134 1.00 22.78  ? 890  TYR A CG    1 
ATOM   63   C  CD1   . TYR A 1 20  ? 8.337   22.100  -16.315 1.00 20.99  ? 890  TYR A CD1   1 
ATOM   64   C  CD2   . TYR A 1 20  ? 9.834   20.287  -16.675 1.00 21.47  ? 890  TYR A CD2   1 
ATOM   65   C  CE1   . TYR A 1 20  ? 7.333   21.423  -17.016 1.00 22.94  ? 890  TYR A CE1   1 
ATOM   66   C  CE2   . TYR A 1 20  ? 8.839   19.602  -17.385 1.00 22.26  ? 890  TYR A CE2   1 
ATOM   67   C  CZ    . TYR A 1 20  ? 7.590   20.173  -17.549 1.00 28.86  ? 890  TYR A CZ    1 
ATOM   68   O  OH    . TYR A 1 20  ? 6.593   19.496  -18.247 1.00 24.47  ? 890  TYR A OH    1 
ATOM   69   H  H     . TYR A 1 20  ? 12.459  22.618  -17.267 1.00 27.95  ? 890  TYR A H     1 
ATOM   70   H  HA    . TYR A 1 20  ? 10.358  24.089  -16.336 1.00 24.61  ? 890  TYR A HA    1 
ATOM   71   H  HB2   . TYR A 1 20  ? 11.437  21.693  -15.262 1.00 26.06  ? 890  TYR A HB2   1 
ATOM   72   H  HB3   . TYR A 1 20  ? 10.325  22.550  -14.514 1.00 26.06  ? 890  TYR A HB3   1 
ATOM   73   H  HD1   . TYR A 1 20  ? 8.157   22.941  -15.961 1.00 25.19  ? 890  TYR A HD1   1 
ATOM   74   H  HD2   . TYR A 1 20  ? 10.671  19.896  -16.572 1.00 25.76  ? 890  TYR A HD2   1 
ATOM   75   H  HE1   . TYR A 1 20  ? 6.496   21.814  -17.124 1.00 27.52  ? 890  TYR A HE1   1 
ATOM   76   H  HE2   . TYR A 1 20  ? 9.016   18.760  -17.738 1.00 26.71  ? 890  TYR A HE2   1 
ATOM   77   H  HH    . TYR A 1 20  ? 6.356   19.938  -18.896 1.00 29.36  ? 890  TYR A HH    1 
ATOM   78   N  N     . PRO A 1 21  ? 11.513  25.382  -14.537 1.00 24.65  ? 891  PRO A N     1 
ATOM   79   C  CA    . PRO A 1 21  ? 12.357  26.200  -13.656 1.00 22.84  ? 891  PRO A CA    1 
ATOM   80   C  C     . PRO A 1 21  ? 12.821  25.398  -12.442 1.00 24.44  ? 891  PRO A C     1 
ATOM   81   O  O     . PRO A 1 21  ? 12.224  24.374  -12.124 1.00 24.25  ? 891  PRO A O     1 
ATOM   82   C  CB    . PRO A 1 21  ? 11.413  27.329  -13.212 1.00 23.96  ? 891  PRO A CB    1 
ATOM   83   C  CG    . PRO A 1 21  ? 10.053  26.712  -13.247 1.00 23.50  ? 891  PRO A CG    1 
ATOM   84   C  CD    . PRO A 1 21  ? 10.093  25.771  -14.459 1.00 23.23  ? 891  PRO A CD    1 
ATOM   85   H  HA    . PRO A 1 21  ? 13.126  26.569  -14.139 1.00 27.41  ? 891  PRO A HA    1 
ATOM   86   H  HB2   . PRO A 1 21  ? 11.640  27.613  -12.312 1.00 28.75  ? 891  PRO A HB2   1 
ATOM   87   H  HB3   . PRO A 1 21  ? 11.472  28.071  -13.834 1.00 28.75  ? 891  PRO A HB3   1 
ATOM   88   H  HG2   . PRO A 1 21  ? 9.896   26.215  -12.429 1.00 28.20  ? 891  PRO A HG2   1 
ATOM   89   H  HG3   . PRO A 1 21  ? 9.382   27.402  -13.368 1.00 28.20  ? 891  PRO A HG3   1 
ATOM   90   H  HD2   . PRO A 1 21  ? 9.537   24.992  -14.301 1.00 27.88  ? 891  PRO A HD2   1 
ATOM   91   H  HD3   . PRO A 1 21  ? 9.826   26.243  -15.263 1.00 27.88  ? 891  PRO A HD3   1 
ATOM   92   N  N     . SER A 1 22  ? 13.880  25.854  -11.781 1.00 26.56  ? 892  SER A N     1 
ATOM   93   C  CA    . SER A 1 22  ? 14.333  25.219  -10.546 1.00 27.24  ? 892  SER A CA    1 
ATOM   94   C  C     . SER A 1 22  ? 13.382  25.538  -9.399  1.00 24.93  ? 892  SER A C     1 
ATOM   95   O  O     . SER A 1 22  ? 12.588  26.478  -9.480  1.00 23.53  ? 892  SER A O     1 
ATOM   96   C  CB    . SER A 1 22  ? 15.721  25.729  -10.190 1.00 32.28  ? 892  SER A CB    1 
ATOM   97   O  OG    . SER A 1 22  ? 15.649  27.111  -9.882  1.00 26.78  ? 892  SER A OG    1 
ATOM   98   H  H     . SER A 1 22  ? 14.354  26.529  -12.025 1.00 31.88  ? 892  SER A H     1 
ATOM   99   H  HA    . SER A 1 22  ? 14.372  24.247  -10.665 1.00 32.69  ? 892  SER A HA    1 
ATOM   100  H  HB2   . SER A 1 22  ? 16.051  25.246  -9.416  1.00 38.74  ? 892  SER A HB2   1 
ATOM   101  H  HB3   . SER A 1 22  ? 16.314  25.600  -10.946 1.00 38.74  ? 892  SER A HB3   1 
ATOM   102  H  HG    . SER A 1 22  ? 16.394  27.394  -9.689  1.00 32.13  ? 892  SER A HG    1 
ATOM   103  N  N     . SER A 1 23  ? 13.481  24.767  -8.320  1.00 23.86  ? 893  SER A N     1 
ATOM   104  C  CA    . SER A 1 23  ? 12.637  24.987  -7.155  1.00 23.81  ? 893  SER A CA    1 
ATOM   105  C  C     . SER A 1 23  ? 12.893  26.386  -6.592  1.00 28.55  ? 893  SER A C     1 
ATOM   106  O  O     . SER A 1 23  ? 11.971  27.062  -6.146  1.00 26.05  ? 893  SER A O     1 
ATOM   107  C  CB    . SER A 1 23  ? 12.908  23.925  -6.087  1.00 24.62  ? 893  SER A CB    1 
ATOM   108  O  OG    . SER A 1 23  ? 14.196  24.099  -5.517  1.00 26.94  ? 893  SER A OG    1 
ATOM   109  H  H     . SER A 1 23  ? 14.029  24.110  -8.239  1.00 28.63  ? 893  SER A H     1 
ATOM   110  H  HA    . SER A 1 23  ? 11.695  24.927  -7.419  1.00 28.57  ? 893  SER A HA    1 
ATOM   111  H  HB2   . SER A 1 23  ? 12.241  24.003  -5.388  1.00 29.54  ? 893  SER A HB2   1 
ATOM   112  H  HB3   . SER A 1 23  ? 12.860  23.047  -6.496  1.00 29.54  ? 893  SER A HB3   1 
ATOM   113  H  HG    . SER A 1 23  ? 14.330  23.525  -4.947  1.00 32.33  ? 893  SER A HG    1 
ATOM   114  N  N     . ALA A 1 24  ? 14.148  26.822  -6.628  1.00 26.38  ? 894  ALA A N     1 
ATOM   115  C  CA    . ALA A 1 24  ? 14.497  28.143  -6.119  1.00 35.17  ? 894  ALA A CA    1 
ATOM   116  C  C     . ALA A 1 24  ? 13.815  29.241  -6.939  1.00 33.69  ? 894  ALA A C     1 
ATOM   117  O  O     . ALA A 1 24  ? 13.332  30.232  -6.379  1.00 29.54  ? 894  ALA A O     1 
ATOM   118  C  CB    . ALA A 1 24  ? 16.009  28.336  -6.124  1.00 38.32  ? 894  ALA A CB    1 
ATOM   119  H  H     . ALA A 1 24  ? 14.812  26.375  -6.941  1.00 31.66  ? 894  ALA A H     1 
ATOM   120  H  HA    . ALA A 1 24  ? 14.186  28.220  -5.193  1.00 42.21  ? 894  ALA A HA    1 
ATOM   121  H  HB1   . ALA A 1 24  ? 16.332  28.249  -7.024  1.00 45.98  ? 894  ALA A HB1   1 
ATOM   122  H  HB2   . ALA A 1 24  ? 16.214  29.211  -5.786  1.00 45.98  ? 894  ALA A HB2   1 
ATOM   123  H  HB3   . ALA A 1 24  ? 16.411  27.666  -5.566  1.00 45.98  ? 894  ALA A HB3   1 
ATOM   124  N  N     . GLU A 1 25  ? 13.778  29.068  -8.259  1.00 28.76  ? 895  GLU A N     1 
ATOM   125  C  CA    . GLU A 1 25  ? 13.099  30.024  -9.135  1.00 30.12  ? 895  GLU A CA    1 
ATOM   126  C  C     . GLU A 1 25  ? 11.588  30.031  -8.900  1.00 27.94  ? 895  GLU A C     1 
ATOM   127  O  O     . GLU A 1 25  ? 10.951  31.083  -8.961  1.00 28.81  ? 895  GLU A O     1 
ATOM   128  C  CB    . GLU A 1 25  ? 13.398  29.716  -10.604 1.00 29.97  ? 895  GLU A CB    1 
ATOM   129  C  CG    . GLU A 1 25  ? 14.820  30.052  -10.998 1.00 38.12  ? 895  GLU A CG    1 
ATOM   130  C  CD    . GLU A 1 25  ? 15.230  29.482  -12.351 1.00 42.37  ? 895  GLU A CD    1 
ATOM   131  O  OE1   . GLU A 1 25  ? 14.566  28.550  -12.861 1.00 34.51  ? 895  GLU A OE1   1 
ATOM   132  O  OE2   . GLU A 1 25  ? 16.237  29.968  -12.904 1.00 43.47  ? 895  GLU A OE2   1 
ATOM   133  H  H     . GLU A 1 25  ? 14.138  28.405  -8.673  1.00 34.51  ? 895  GLU A H     1 
ATOM   134  H  HA    . GLU A 1 25  ? 13.437  30.924  -8.942  1.00 36.14  ? 895  GLU A HA    1 
ATOM   135  H  HB2   . GLU A 1 25  ? 13.259  28.769  -10.763 1.00 35.97  ? 895  GLU A HB2   1 
ATOM   136  H  HB3   . GLU A 1 25  ? 12.801  30.237  -11.164 1.00 35.97  ? 895  GLU A HB3   1 
ATOM   137  H  HG2   . GLU A 1 25  ? 14.913  31.016  -11.041 1.00 45.74  ? 895  GLU A HG2   1 
ATOM   138  H  HG3   . GLU A 1 25  ? 15.423  29.692  -10.329 1.00 45.74  ? 895  GLU A HG3   1 
ATOM   139  N  N     . VAL A 1 26  ? 11.012  28.857  -8.657  1.00 25.12  ? 896  VAL A N     1 
ATOM   140  C  CA    . VAL A 1 26  ? 9.585   28.768  -8.376  1.00 27.27  ? 896  VAL A CA    1 
ATOM   141  C  C     . VAL A 1 26  ? 9.278   29.545  -7.102  1.00 30.02  ? 896  VAL A C     1 
ATOM   142  O  O     . VAL A 1 26  ? 8.340   30.340  -7.043  1.00 27.26  ? 896  VAL A O     1 
ATOM   143  C  CB    . VAL A 1 26  ? 9.133   27.304  -8.212  1.00 24.45  ? 896  VAL A CB    1 
ATOM   144  C  CG1   . VAL A 1 26  ? 7.655   27.237  -7.851  1.00 31.20  ? 896  VAL A CG1   1 
ATOM   145  C  CG2   . VAL A 1 26  ? 9.394   26.536  -9.502  1.00 30.49  ? 896  VAL A CG2   1 
ATOM   146  H  H     . VAL A 1 26  ? 11.424  28.102  -8.649  1.00 30.14  ? 896  VAL A H     1 
ATOM   147  H  HA    . VAL A 1 26  ? 9.080   29.168  -9.115  1.00 32.72  ? 896  VAL A HA    1 
ATOM   148  H  HB    . VAL A 1 26  ? 9.647   26.883  -7.491  1.00 29.35  ? 896  VAL A HB    1 
ATOM   149  H  HG11  . VAL A 1 26  ? 7.399   26.317  -7.755  1.00 37.44  ? 896  VAL A HG11  1 
ATOM   150  H  HG12  . VAL A 1 26  ? 7.514   27.705  -7.025  1.00 37.44  ? 896  VAL A HG12  1 
ATOM   151  H  HG13  . VAL A 1 26  ? 7.144   27.648  -8.552  1.00 37.44  ? 896  VAL A HG13  1 
ATOM   152  H  HG21  . VAL A 1 26  ? 9.786   27.131  -10.145 1.00 36.59  ? 896  VAL A HG21  1 
ATOM   153  H  HG22  . VAL A 1 26  ? 9.995   25.810  -9.317  1.00 36.59  ? 896  VAL A HG22  1 
ATOM   154  H  HG23  . VAL A 1 26  ? 8.561   26.195  -9.836  1.00 36.59  ? 896  VAL A HG23  1 
ATOM   155  N  N     . LEU A 1 27  ? 10.086  29.315  -6.077  1.00 26.26  ? 897  LEU A N     1 
ATOM   156  C  CA    . LEU A 1 27  ? 9.862   29.951  -4.790  1.00 37.59  ? 897  LEU A CA    1 
ATOM   157  C  C     . LEU A 1 27  ? 9.981   31.472  -4.898  1.00 38.44  ? 897  LEU A C     1 
ATOM   158  O  O     . LEU A 1 27  ? 9.129   32.199  -4.388  1.00 31.46  ? 897  LEU A O     1 
ATOM   159  C  CB    . LEU A 1 27  ? 10.841  29.400  -3.757  1.00 45.81  ? 897  LEU A CB    1 
ATOM   160  C  CG    . LEU A 1 27  ? 10.671  29.946  -2.341  1.00 60.82  ? 897  LEU A CG    1 
ATOM   161  C  CD1   . LEU A 1 27  ? 9.259   29.697  -1.830  1.00 71.49  ? 897  LEU A CD1   1 
ATOM   162  C  CD2   . LEU A 1 27  ? 11.700  29.310  -1.429  1.00 61.82  ? 897  LEU A CD2   1 
ATOM   163  H  H     . LEU A 1 27  ? 10.770  28.795  -6.102  1.00 31.52  ? 897  LEU A H     1 
ATOM   164  H  HA    . LEU A 1 27  ? 8.955   29.741  -4.486  1.00 45.11  ? 897  LEU A HA    1 
ATOM   165  H  HB2   . LEU A 1 27  ? 10.732  28.437  -3.713  1.00 54.97  ? 897  LEU A HB2   1 
ATOM   166  H  HB3   . LEU A 1 27  ? 11.743  29.611  -4.045  1.00 54.97  ? 897  LEU A HB3   1 
ATOM   167  H  HG    . LEU A 1 27  ? 10.826  30.904  -2.349  1.00 72.99  ? 897  LEU A HG    1 
ATOM   168  H  HD11  . LEU A 1 27  ? 8.634   30.136  -2.412  1.00 85.78  ? 897  LEU A HD11  1 
ATOM   169  H  HD12  . LEU A 1 27  ? 9.092   28.752  -1.822  1.00 85.78  ? 897  LEU A HD12  1 
ATOM   170  H  HD13  . LEU A 1 27  ? 9.182   30.050  -0.940  1.00 85.78  ? 897  LEU A HD13  1 
ATOM   171  H  HD21  . LEU A 1 27  ? 12.579  29.520  -1.755  1.00 74.19  ? 897  LEU A HD21  1 
ATOM   172  H  HD22  . LEU A 1 27  ? 11.588  29.658  -0.542  1.00 74.19  ? 897  LEU A HD22  1 
ATOM   173  H  HD23  . LEU A 1 27  ? 11.570  28.359  -1.428  1.00 74.19  ? 897  LEU A HD23  1 
ATOM   174  N  N     . LYS A 1 28  ? 11.009  31.960  -5.586  1.00 32.95  ? 898  LYS A N     1 
ATOM   175  C  CA    . LYS A 1 28  ? 11.184  33.406  -5.692  1.00 37.28  ? 898  LYS A CA    1 
ATOM   176  C  C     . LYS A 1 28  ? 10.047  34.017  -6.512  1.00 43.95  ? 898  LYS A C     1 
ATOM   177  O  O     . LYS A 1 28  ? 9.647   35.154  -6.273  1.00 38.86  ? 898  LYS A O     1 
ATOM   178  C  CB    . LYS A 1 28  ? 12.576  33.795  -6.227  1.00 51.22  ? 898  LYS A CB    1 
ATOM   179  C  CG    . LYS A 1 28  ? 13.018  33.112  -7.508  1.00 82.71  ? 898  LYS A CG    1 
ATOM   180  C  CD    . LYS A 1 28  ? 14.392  33.616  -7.973  1.00 101.77 ? 898  LYS A CD    1 
ATOM   181  C  CE    . LYS A 1 28  ? 14.540  33.464  -9.489  1.00 77.94  ? 898  LYS A CE    1 
ATOM   182  N  NZ    . LYS A 1 28  ? 15.949  33.280  -9.936  1.00 66.59  ? 898  LYS A NZ    1 
ATOM   183  H  H     . LYS A 1 28  ? 11.605  31.490  -5.990  1.00 39.54  ? 898  LYS A H     1 
ATOM   184  H  HA    . LYS A 1 28  ? 11.115  33.781  -4.790  1.00 44.74  ? 898  LYS A HA    1 
ATOM   185  H  HB2   . LYS A 1 28  ? 12.582  34.751  -6.392  1.00 61.46  ? 898  LYS A HB2   1 
ATOM   186  H  HB3   . LYS A 1 28  ? 13.234  33.583  -5.546  1.00 61.46  ? 898  LYS A HB3   1 
ATOM   187  H  HG2   . LYS A 1 28  ? 13.080  32.156  -7.356  1.00 99.25  ? 898  LYS A HG2   1 
ATOM   188  H  HG3   . LYS A 1 28  ? 12.373  33.299  -8.208  1.00 99.25  ? 898  LYS A HG3   1 
ATOM   189  H  HD2   . LYS A 1 28  ? 14.484  34.555  -7.749  1.00 122.13 ? 898  LYS A HD2   1 
ATOM   190  H  HD3   . LYS A 1 28  ? 15.089  33.095  -7.543  1.00 122.13 ? 898  LYS A HD3   1 
ATOM   191  H  HE2   . LYS A 1 28  ? 14.034  32.688  -9.777  1.00 93.53  ? 898  LYS A HE2   1 
ATOM   192  H  HE3   . LYS A 1 28  ? 14.193  34.261  -9.919  1.00 93.53  ? 898  LYS A HE3   1 
ATOM   193  H  HZ1   . LYS A 1 28  ? 15.978  33.197  -10.822 1.00 79.90  ? 898  LYS A HZ1   1 
ATOM   194  H  HZ2   . LYS A 1 28  ? 16.438  33.984  -9.695  1.00 79.90  ? 898  LYS A HZ2   1 
ATOM   195  H  HZ3   . LYS A 1 28  ? 16.293  32.548  -9.565  1.00 79.90  ? 898  LYS A HZ3   1 
ATOM   196  N  N     . ALA A 1 29  ? 9.493   33.254  -7.452  1.00 43.94  ? 899  ALA A N     1 
ATOM   197  C  CA    . ALA A 1 29  ? 8.336   33.730  -8.203  1.00 39.67  ? 899  ALA A CA    1 
ATOM   198  C  C     . ALA A 1 29  ? 7.139   33.932  -7.275  1.00 40.74  ? 899  ALA A C     1 
ATOM   199  O  O     . ALA A 1 29  ? 6.405   34.907  -7.410  1.00 43.48  ? 899  ALA A O     1 
ATOM   200  C  CB    . ALA A 1 29  ? 7.974   32.762  -9.328  1.00 35.47  ? 899  ALA A CB    1 
ATOM   201  H  H     . ALA A 1 29  ? 9.764   32.468  -7.671  1.00 52.73  ? 899  ALA A H     1 
ATOM   202  H  HA    . ALA A 1 29  ? 8.554   34.596  -8.607  1.00 47.61  ? 899  ALA A HA    1 
ATOM   203  H  HB1   . ALA A 1 29  ? 7.211   33.105  -9.800  1.00 42.56  ? 899  ALA A HB1   1 
ATOM   204  H  HB2   . ALA A 1 29  ? 8.721   32.684  -9.925  1.00 42.56  ? 899  ALA A HB2   1 
ATOM   205  H  HB3   . ALA A 1 29  ? 7.767   31.905  -8.948  1.00 42.56  ? 899  ALA A HB3   1 
ATOM   206  N  N     . CYS A 1 30  ? 6.944   33.016  -6.328  1.00 33.08  ? 900  CYS A N     1 
ATOM   207  C  CA    . CYS A 1 30  ? 5.794   33.100  -5.429  1.00 37.43  ? 900  CYS A CA    1 
ATOM   208  C  C     . CYS A 1 30  ? 5.927   34.237  -4.423  1.00 55.51  ? 900  CYS A C     1 
ATOM   209  O  O     . CYS A 1 30  ? 4.934   34.676  -3.843  1.00 64.34  ? 900  CYS A O     1 
ATOM   210  C  CB    . CYS A 1 30  ? 5.600   31.782  -4.677  1.00 26.97  ? 900  CYS A CB    1 
ATOM   211  S  SG    . CYS A 1 30  ? 5.184   30.411  -5.760  1.00 39.58  ? 900  CYS A SG    1 
ATOM   212  H  H     . CYS A 1 30  ? 7.458   32.341  -6.186  1.00 39.70  ? 900  CYS A H     1 
ATOM   213  H  HA    . CYS A 1 30  ? 4.988   33.263  -5.962  1.00 44.92  ? 900  CYS A HA    1 
ATOM   214  H  HB2   . CYS A 1 30  ? 6.422   31.559  -4.214  1.00 32.37  ? 900  CYS A HB2   1 
ATOM   215  H  HB3   . CYS A 1 30  ? 4.878   31.887  -4.038  1.00 32.37  ? 900  CYS A HB3   1 
ATOM   216  H  HG    . CYS A 1 30  ? 6.072   30.256  -6.553  1.00 47.50  ? 900  CYS A HG    1 
ATOM   217  N  N     . ARG A 1 31  ? 7.150   34.711  -4.211  1.00 57.52  ? 901  ARG A N     1 
ATOM   218  C  CA    . ARG A 1 31  ? 7.395   35.687  -3.153  1.00 74.28  ? 901  ARG A CA    1 
ATOM   219  C  C     . ARG A 1 31  ? 6.844   37.080  -3.483  1.00 93.48  ? 901  ARG A C     1 
ATOM   220  O  O     . ARG A 1 31  ? 6.694   37.913  -2.589  1.00 99.48  ? 901  ARG A O     1 
ATOM   221  C  CB    . ARG A 1 31  ? 8.879   35.729  -2.787  1.00 74.99  ? 901  ARG A CB    1 
ATOM   222  C  CG    . ARG A 1 31  ? 9.313   34.529  -1.949  1.00 80.06  ? 901  ARG A CG    1 
ATOM   223  C  CD    . ARG A 1 31  ? 10.779  34.597  -1.570  1.00 92.29  ? 901  ARG A CD    1 
ATOM   224  N  NE    . ARG A 1 31  ? 11.084  33.725  -0.437  1.00 97.54  ? 901  ARG A NE    1 
ATOM   225  C  CZ    . ARG A 1 31  ? 11.955  32.717  -0.463  1.00 100.74 ? 901  ARG A CZ    1 
ATOM   226  N  NH1   . ARG A 1 31  ? 12.636  32.431  -1.569  1.00 98.63  ? 901  ARG A NH1   1 
ATOM   227  N  NH2   . ARG A 1 31  ? 12.155  31.991  0.633   1.00 99.11  ? 901  ARG A NH2   1 
ATOM   228  H  H     . ARG A 1 31  ? 7.849   34.487  -4.660  1.00 69.03  ? 901  ARG A H     1 
ATOM   229  H  HA    . ARG A 1 31  ? 6.918   35.381  -2.353  1.00 89.14  ? 901  ARG A HA    1 
ATOM   230  H  HB2   . ARG A 1 31  ? 9.406   35.733  -3.602  1.00 89.99  ? 901  ARG A HB2   1 
ATOM   231  H  HB3   . ARG A 1 31  ? 9.056   36.533  -2.274  1.00 89.99  ? 901  ARG A HB3   1 
ATOM   232  H  HG2   . ARG A 1 31  ? 8.791   34.506  -1.132  1.00 96.07  ? 901  ARG A HG2   1 
ATOM   233  H  HG3   . ARG A 1 31  ? 9.171   33.717  -2.460  1.00 96.07  ? 901  ARG A HG3   1 
ATOM   234  H  HD2   . ARG A 1 31  ? 11.318  34.313  -2.325  1.00 110.75 ? 901  ARG A HD2   1 
ATOM   235  H  HD3   . ARG A 1 31  ? 11.003  35.507  -1.322  1.00 110.75 ? 901  ARG A HD3   1 
ATOM   236  H  HE    . ARG A 1 31  ? 10.671  33.874  0.302   1.00 117.05 ? 901  ARG A HE    1 
ATOM   237  H  HH11  . ARG A 1 31  ? 12.514  32.896  -2.282  1.00 118.35 ? 901  ARG A HH11  1 
ATOM   238  H  HH12  . ARG A 1 31  ? 13.196  31.778  -1.573  1.00 118.35 ? 901  ARG A HH12  1 
ATOM   239  H  HH21  . ARG A 1 31  ? 11.719  32.170  1.352   1.00 118.93 ? 901  ARG A HH21  1 
ATOM   240  H  HH22  . ARG A 1 31  ? 12.716  31.340  0.620   1.00 118.93 ? 901  ARG A HH22  1 
ATOM   241  N  N     . ASN A 1 32  ? 6.530   37.324  -4.756  1.00 103.57 ? 902  ASN A N     1 
ATOM   242  C  CA    . ASN A 1 32  ? 5.679   38.460  -5.128  1.00 109.30 ? 902  ASN A CA    1 
ATOM   243  C  C     . ASN A 1 32  ? 4.272   37.974  -5.451  1.00 105.83 ? 902  ASN A C     1 
ATOM   244  O  O     . ASN A 1 32  ? 3.288   38.556  -4.997  1.00 101.73 ? 902  ASN A O     1 
ATOM   245  C  CB    . ASN A 1 32  ? 6.231   39.258  -6.320  1.00 112.07 ? 902  ASN A CB    1 
ATOM   246  C  CG    . ASN A 1 32  ? 7.141   38.439  -7.213  1.00 116.64 ? 902  ASN A CG    1 
ATOM   247  O  OD1   . ASN A 1 32  ? 8.299   38.189  -6.871  1.00 118.44 ? 902  ASN A OD1   1 
ATOM   248  N  ND2   . ASN A 1 32  ? 6.631   38.039  -8.377  1.00 113.97 ? 902  ASN A ND2   1 
ATOM   249  H  H     . ASN A 1 32  ? 6.796   36.850  -5.422  1.00 124.28 ? 902  ASN A H     1 
ATOM   250  H  HA    . ASN A 1 32  ? 5.617   39.070  -4.364  1.00 131.16 ? 902  ASN A HA    1 
ATOM   251  H  HB2   . ASN A 1 32  ? 5.488   39.573  -6.859  1.00 134.49 ? 902  ASN A HB2   1 
ATOM   252  H  HB3   . ASN A 1 32  ? 6.741   40.012  -5.985  1.00 134.49 ? 902  ASN A HB3   1 
ATOM   253  H  HD21  . ASN A 1 32  ? 7.110   37.572  -8.917  1.00 136.76 ? 902  ASN A HD21  1 
ATOM   254  H  HD22  . ASN A 1 32  ? 5.824   38.249  -8.587  1.00 136.76 ? 902  ASN A HD22  1 
ATOM   255  N  N     . ASN A 1 40  ? 6.048   42.134  -12.710 1.00 73.39  ? 910  ASN A N     1 
ATOM   256  C  CA    . ASN A 1 40  ? 7.116   41.356  -13.332 1.00 78.38  ? 910  ASN A CA    1 
ATOM   257  C  C     . ASN A 1 40  ? 6.594   40.062  -13.979 1.00 51.96  ? 910  ASN A C     1 
ATOM   258  O  O     . ASN A 1 40  ? 5.399   39.772  -13.924 1.00 34.41  ? 910  ASN A O     1 
ATOM   259  C  CB    . ASN A 1 40  ? 8.215   41.058  -12.309 1.00 84.13  ? 910  ASN A CB    1 
ATOM   260  C  CG    . ASN A 1 40  ? 7.683   40.369  -11.069 1.00 87.74  ? 910  ASN A CG    1 
ATOM   261  O  OD1   . ASN A 1 40  ? 6.782   39.534  -11.150 1.00 91.21  ? 910  ASN A OD1   1 
ATOM   262  N  ND2   . ASN A 1 40  ? 8.229   40.725  -9.911  1.00 78.90  ? 910  ASN A ND2   1 
ATOM   263  H  HA    . ASN A 1 40  ? 7.517   41.897  -14.044 1.00 94.05  ? 910  ASN A HA    1 
ATOM   264  H  HB2   . ASN A 1 40  ? 8.876   40.476  -12.716 1.00 100.96 ? 910  ASN A HB2   1 
ATOM   265  H  HB3   . ASN A 1 40  ? 8.628   41.892  -12.036 1.00 100.96 ? 910  ASN A HB3   1 
ATOM   266  H  HD21  . ASN A 1 40  ? 8.851   41.319  -9.893  1.00 94.68  ? 910  ASN A HD21  1 
ATOM   267  H  HD22  . ASN A 1 40  ? 7.960   40.362  -9.179  1.00 94.68  ? 910  ASN A HD22  1 
ATOM   268  N  N     . SER A 1 41  ? 7.493   39.283  -14.577 1.00 40.68  ? 911  SER A N     1 
ATOM   269  C  CA    . SER A 1 41  ? 7.090   38.204  -15.486 1.00 40.26  ? 911  SER A CA    1 
ATOM   270  C  C     . SER A 1 41  ? 6.552   36.951  -14.777 1.00 37.12  ? 911  SER A C     1 
ATOM   271  O  O     . SER A 1 41  ? 6.891   36.683  -13.633 1.00 32.90  ? 911  SER A O     1 
ATOM   272  C  CB    . SER A 1 41  ? 8.257   37.828  -16.414 1.00 31.78  ? 911  SER A CB    1 
ATOM   273  O  OG    . SER A 1 41  ? 9.411   37.461  -15.675 1.00 27.94  ? 911  SER A OG    1 
ATOM   274  H  H     . SER A 1 41  ? 8.344   39.357  -14.474 1.00 48.81  ? 911  SER A H     1 
ATOM   275  H  HA    . SER A 1 41  ? 6.368   38.543  -16.055 1.00 48.31  ? 911  SER A HA    1 
ATOM   276  H  HB2   . SER A 1 41  ? 7.988   37.079  -16.969 1.00 38.14  ? 911  SER A HB2   1 
ATOM   277  H  HB3   . SER A 1 41  ? 8.472   38.592  -16.973 1.00 38.14  ? 911  SER A HB3   1 
ATOM   278  H  HG    . SER A 1 41  ? 10.021  37.264  -16.186 1.00 33.53  ? 911  SER A HG    1 
ATOM   279  N  N     . SER A 1 42  ? 5.713   36.192  -15.482 1.00 32.73  ? 912  SER A N     1 
ATOM   280  C  CA    . SER A 1 42  ? 5.112   34.963  -14.959 1.00 43.52  ? 912  SER A CA    1 
ATOM   281  C  C     . SER A 1 42  ? 6.029   33.779  -15.249 1.00 41.72  ? 912  SER A C     1 
ATOM   282  O  O     . SER A 1 42  ? 6.823   33.832  -16.181 1.00 43.34  ? 912  SER A O     1 
ATOM   283  C  CB    . SER A 1 42  ? 3.770   34.720  -15.653 1.00 55.15  ? 912  SER A CB    1 
ATOM   284  O  OG    . SER A 1 42  ? 3.057   35.930  -15.852 1.00 51.54  ? 912  SER A OG    1 
ATOM   285  H  H     . SER A 1 42  ? 5.471   36.373  -16.287 1.00 39.28  ? 912  SER A H     1 
ATOM   286  H  HA    . SER A 1 42  ? 4.970   35.037  -13.992 1.00 52.23  ? 912  SER A HA    1 
ATOM   287  H  HB2   . SER A 1 42  ? 3.934   34.308  -16.516 1.00 66.18  ? 912  SER A HB2   1 
ATOM   288  H  HB3   . SER A 1 42  ? 3.235   34.128  -15.102 1.00 66.18  ? 912  SER A HB3   1 
ATOM   289  H  HG    . SER A 1 42  ? 2.342   35.776  -16.224 1.00 61.85  ? 912  SER A HG    1 
ATOM   290  N  N     . ILE A 1 43  ? 5.939   32.700  -14.478 1.00 26.46  ? 913  ILE A N     1 
ATOM   291  C  CA    . ILE A 1 43  ? 6.719   31.516  -14.853 1.00 27.07  ? 913  ILE A CA    1 
ATOM   292  C  C     . ILE A 1 43  ? 5.864   30.520  -15.621 1.00 29.39  ? 913  ILE A C     1 
ATOM   293  O  O     . ILE A 1 43  ? 6.376   29.818  -16.495 1.00 27.02  ? 913  ILE A O     1 
ATOM   294  C  CB    . ILE A 1 43  ? 7.449   30.820  -13.671 1.00 43.41  ? 913  ILE A CB    1 
ATOM   295  C  CG1   . ILE A 1 43  ? 6.461   30.201  -12.689 1.00 51.16  ? 913  ILE A CG1   1 
ATOM   296  C  CG2   . ILE A 1 43  ? 8.397   31.797  -12.979 1.00 44.30  ? 913  ILE A CG2   1 
ATOM   297  C  CD1   . ILE A 1 43  ? 7.127   29.231  -11.728 1.00 52.27  ? 913  ILE A CD1   1 
ATOM   298  H  H     . ILE A 1 43  ? 5.460   32.623  -13.768 1.00 31.75  ? 913  ILE A H     1 
ATOM   299  H  HA    . ILE A 1 43  ? 7.420   31.813  -15.471 1.00 32.49  ? 913  ILE A HA    1 
ATOM   300  H  HB    . ILE A 1 43  ? 7.986   30.101  -14.039 1.00 52.09  ? 913  ILE A HB    1 
ATOM   301  H  HG12  . ILE A 1 43  ? 6.049   30.907  -12.167 1.00 61.39  ? 913  ILE A HG12  1 
ATOM   302  H  HG13  . ILE A 1 43  ? 5.783   29.715  -13.185 1.00 61.39  ? 913  ILE A HG13  1 
ATOM   303  H  HG21  . ILE A 1 43  ? 8.836   31.345  -12.254 1.00 53.16  ? 913  ILE A HG21  1 
ATOM   304  H  HG22  . ILE A 1 43  ? 9.047   32.104  -13.615 1.00 53.16  ? 913  ILE A HG22  1 
ATOM   305  H  HG23  . ILE A 1 43  ? 7.890   32.539  -12.643 1.00 53.16  ? 913  ILE A HG23  1 
ATOM   306  H  HD11  . ILE A 1 43  ? 6.462   28.873  -11.135 1.00 62.72  ? 913  ILE A HD11  1 
ATOM   307  H  HD12  . ILE A 1 43  ? 7.533   28.522  -12.231 1.00 62.72  ? 913  ILE A HD12  1 
ATOM   308  H  HD13  . ILE A 1 43  ? 7.795   29.701  -11.224 1.00 62.72  ? 913  ILE A HD13  1 
ATOM   309  N  N     . LEU A 1 44  ? 4.571   30.449  -15.305 1.00 24.14  ? 914  LEU A N     1 
ATOM   310  C  CA    . LEU A 1 44  ? 3.653   29.673  -16.144 1.00 31.14  ? 914  LEU A CA    1 
ATOM   311  C  C     . LEU A 1 44  ? 2.183   30.116  -16.064 1.00 30.23  ? 914  LEU A C     1 
ATOM   312  O  O     . LEU A 1 44  ? 1.783   30.834  -15.158 1.00 33.52  ? 914  LEU A O     1 
ATOM   313  C  CB    . LEU A 1 44  ? 3.813   28.162  -15.912 1.00 43.86  ? 914  LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 44  ? 3.675   27.468  -14.555 1.00 51.68  ? 914  LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 44  ? 3.169   28.383  -13.465 1.00 49.91  ? 914  LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 44  ? 2.765   26.251  -14.733 1.00 52.69  ? 914  LEU A CD2   1 
ATOM   317  H  H     . LEU A 1 44  ? 4.205   30.831  -14.627 1.00 28.97  ? 914  LEU A H     1 
ATOM   318  H  HA    . LEU A 1 44  ? 3.924   29.828  -17.073 1.00 37.36  ? 914  LEU A HA    1 
ATOM   319  H  HB2   . LEU A 1 44  ? 3.166   27.727  -16.490 1.00 52.63  ? 914  LEU A HB2   1 
ATOM   320  H  HB3   . LEU A 1 44  ? 4.700   27.930  -16.230 1.00 52.63  ? 914  LEU A HB3   1 
ATOM   321  H  HG    . LEU A 1 44  ? 4.548   27.144  -14.284 1.00 62.02  ? 914  LEU A HG    1 
ATOM   322  H  HD11  . LEU A 1 44  ? 3.107   27.886  -12.645 1.00 59.89  ? 914  LEU A HD11  1 
ATOM   323  H  HD12  . LEU A 1 44  ? 3.783   29.113  -13.360 1.00 59.89  ? 914  LEU A HD12  1 
ATOM   324  H  HD13  . LEU A 1 44  ? 2.304   28.715  -13.713 1.00 59.89  ? 914  LEU A HD13  1 
ATOM   325  H  HD21  . LEU A 1 44  ? 2.670   25.806  -13.888 1.00 63.23  ? 914  LEU A HD21  1 
ATOM   326  H  HD22  . LEU A 1 44  ? 1.907   26.546  -15.047 1.00 63.23  ? 914  LEU A HD22  1 
ATOM   327  H  HD23  . LEU A 1 44  ? 3.161   25.656  -15.374 1.00 63.23  ? 914  LEU A HD23  1 
ATOM   328  N  N     . LEU A 1 45  ? 1.399   29.717  -17.061 1.00 34.52  ? 915  LEU A N     1 
ATOM   329  C  CA    . LEU A 1 45  ? 0.021   30.187  -17.206 1.00 49.48  ? 915  LEU A CA    1 
ATOM   330  C  C     . LEU A 1 45  ? -0.873  29.896  -15.986 1.00 68.62  ? 915  LEU A C     1 
ATOM   331  O  O     . LEU A 1 45  ? -1.506  30.814  -15.455 1.00 75.53  ? 915  LEU A O     1 
ATOM   332  C  CB    . LEU A 1 45  ? -0.581  29.616  -18.491 1.00 45.28  ? 915  LEU A CB    1 
ATOM   333  C  CG    . LEU A 1 45  ? -1.979  30.065  -18.917 1.00 44.12  ? 915  LEU A CG    1 
ATOM   334  C  CD1   . LEU A 1 45  ? -2.267  31.515  -18.531 1.00 41.58  ? 915  LEU A CD1   1 
ATOM   335  C  CD2   . LEU A 1 45  ? -2.116  29.862  -20.412 1.00 44.02  ? 915  LEU A CD2   1 
ATOM   336  H  H     . LEU A 1 45  ? 1.644   29.167  -17.676 1.00 41.43  ? 915  LEU A H     1 
ATOM   337  H  HA    . LEU A 1 45  ? 0.046   31.161  -17.312 1.00 59.38  ? 915  LEU A HA    1 
ATOM   338  H  HB2   . LEU A 1 45  ? 0.017   29.840  -19.221 1.00 54.34  ? 915  LEU A HB2   1 
ATOM   339  H  HB3   . LEU A 1 45  ? -0.615  28.652  -18.397 1.00 54.34  ? 915  LEU A HB3   1 
ATOM   340  H  HG    . LEU A 1 45  ? -2.637  29.504  -18.478 1.00 52.94  ? 915  LEU A HG    1 
ATOM   341  H  HD11  . LEU A 1 45  ? -3.153  31.745  -18.820 1.00 49.89  ? 915  LEU A HD11  1 
ATOM   342  H  HD12  . LEU A 1 45  ? -2.200  31.604  -17.578 1.00 49.89  ? 915  LEU A HD12  1 
ATOM   343  H  HD13  . LEU A 1 45  ? -1.625  32.086  -18.959 1.00 49.89  ? 915  LEU A HD13  1 
ATOM   344  H  HD21  . LEU A 1 45  ? -2.992  30.142  -20.686 1.00 52.82  ? 915  LEU A HD21  1 
ATOM   345  H  HD22  . LEU A 1 45  ? -1.449  30.386  -20.861 1.00 52.82  ? 915  LEU A HD22  1 
ATOM   346  H  HD23  . LEU A 1 45  ? -1.992  28.931  -20.613 1.00 52.82  ? 915  LEU A HD23  1 
ATOM   347  N  N     . ASP A 1 46  ? -0.942  28.637  -15.559 1.00 74.61  ? 916  ASP A N     1 
ATOM   348  C  CA    . ASP A 1 46  ? -1.632  28.265  -14.315 1.00 93.75  ? 916  ASP A CA    1 
ATOM   349  C  C     . ASP A 1 46  ? -3.135  28.079  -14.541 1.00 104.30 ? 916  ASP A C     1 
ATOM   350  O  O     . ASP A 1 46  ? -3.801  27.338  -13.815 1.00 104.48 ? 916  ASP A O     1 
ATOM   351  C  CB    . ASP A 1 46  ? -1.342  29.287  -13.191 1.00 95.89  ? 916  ASP A CB    1 
ATOM   352  C  CG    . ASP A 1 46  ? -2.606  29.864  -12.557 1.00 100.34 ? 916  ASP A CG    1 
ATOM   353  O  OD1   . ASP A 1 46  ? -3.625  30.047  -13.258 1.00 97.68  ? 916  ASP A OD1   1 
ATOM   354  O  OD2   . ASP A 1 46  ? -2.566  30.155  -11.342 1.00 104.91 ? 916  ASP A OD2   1 
ATOM   355  H  H     . ASP A 1 46  ? -0.593  27.969  -15.974 1.00 89.53  ? 916  ASP A H     1 
ATOM   356  H  HA    . ASP A 1 46  ? -1.278  27.402  -14.017 1.00 112.50 ? 916  ASP A HA    1 
ATOM   357  H  HB2   . ASP A 1 46  ? -0.832  28.849  -12.493 1.00 115.06 ? 916  ASP A HB2   1 
ATOM   358  H  HB3   . ASP A 1 46  ? -0.831  30.024  -13.561 1.00 115.06 ? 916  ASP A HB3   1 
ATOM   359  N  N     . LYS A 1 47  ? -3.651  28.750  -15.564 1.00 110.77 ? 917  LYS A N     1 
ATOM   360  C  CA    . LYS A 1 47  ? -5.048  28.646  -15.946 1.00 105.08 ? 917  LYS A CA    1 
ATOM   361  C  C     . LYS A 1 47  ? -5.040  27.617  -17.065 1.00 103.11 ? 917  LYS A C     1 
ATOM   362  O  O     . LYS A 1 47  ? -4.134  27.611  -17.899 1.00 109.92 ? 917  LYS A O     1 
ATOM   363  C  CB    . LYS A 1 47  ? -5.568  30.012  -16.412 1.00 95.85  ? 917  LYS A CB    1 
ATOM   364  C  CG    . LYS A 1 47  ? -7.034  30.081  -16.825 1.00 90.95  ? 917  LYS A CG    1 
ATOM   365  C  CD    . LYS A 1 47  ? -7.963  29.341  -15.875 1.00 93.87  ? 917  LYS A CD    1 
ATOM   366  C  CE    . LYS A 1 47  ? -9.323  29.110  -16.523 1.00 95.96  ? 917  LYS A CE    1 
ATOM   367  N  NZ    . LYS A 1 47  ? -9.771  30.299  -17.301 1.00 96.62  ? 917  LYS A NZ    1 
ATOM   368  H  H     . LYS A 1 47  ? -3.198  29.284  -16.064 1.00 132.93 ? 917  LYS A H     1 
ATOM   369  H  HA    . LYS A 1 47  ? -5.590  28.320  -15.198 1.00 126.10 ? 917  LYS A HA    1 
ATOM   370  H  HB2   . LYS A 1 47  ? -5.444  30.646  -15.689 1.00 115.02 ? 917  LYS A HB2   1 
ATOM   371  H  HB3   . LYS A 1 47  ? -5.041  30.292  -17.177 1.00 115.02 ? 917  LYS A HB3   1 
ATOM   372  H  HG2   . LYS A 1 47  ? -7.310  31.010  -16.849 1.00 109.14 ? 917  LYS A HG2   1 
ATOM   373  H  HG3   . LYS A 1 47  ? -7.131  29.685  -17.705 1.00 109.14 ? 917  LYS A HG3   1 
ATOM   374  H  HD2   . LYS A 1 47  ? -7.578  28.479  -15.654 1.00 112.64 ? 917  LYS A HD2   1 
ATOM   375  H  HD3   . LYS A 1 47  ? -8.092  29.871  -15.073 1.00 112.64 ? 917  LYS A HD3   1 
ATOM   376  H  HE2   . LYS A 1 47  ? -9.264  28.355  -17.129 1.00 115.15 ? 917  LYS A HE2   1 
ATOM   377  H  HE3   . LYS A 1 47  ? -9.980  28.934  -15.832 1.00 115.15 ? 917  LYS A HE3   1 
ATOM   378  H  HZ1   . LYS A 1 47  ? -9.837  31.006  -16.764 1.00 115.94 ? 917  LYS A HZ1   1 
ATOM   379  H  HZ2   . LYS A 1 47  ? -9.185  30.479  -17.946 1.00 115.94 ? 917  LYS A HZ2   1 
ATOM   380  H  HZ3   . LYS A 1 47  ? -10.566 30.140  -17.668 1.00 115.94 ? 917  LYS A HZ3   1 
ATOM   381  N  N     . CYS A 1 48  ? -6.031  26.738  -17.087 1.00 87.58  ? 918  CYS A N     1 
ATOM   382  C  CA    . CYS A 1 48  ? -5.923  25.522  -17.880 1.00 72.39  ? 918  CYS A CA    1 
ATOM   383  C  C     . CYS A 1 48  ? -7.283  25.106  -18.415 1.00 59.64  ? 918  CYS A C     1 
ATOM   384  O  O     . CYS A 1 48  ? -8.284  25.169  -17.694 1.00 64.05  ? 918  CYS A O     1 
ATOM   385  C  CB    . CYS A 1 48  ? -5.334  24.395  -17.022 1.00 72.78  ? 918  CYS A CB    1 
ATOM   386  S  SG    . CYS A 1 48  ? -3.554  24.539  -16.697 1.00 99.12  ? 918  CYS A SG    1 
ATOM   387  H  H     . CYS A 1 48  ? -6.771  26.819  -16.655 1.00 105.10 ? 918  CYS A H     1 
ATOM   388  H  HA    . CYS A 1 48  ? -5.324  25.679  -18.640 1.00 86.87  ? 918  CYS A HA    1 
ATOM   389  H  HB2   . CYS A 1 48  ? -5.789  24.389  -16.165 1.00 87.33  ? 918  CYS A HB2   1 
ATOM   390  H  HB3   . CYS A 1 48  ? -5.482  23.551  -17.476 1.00 87.33  ? 918  CYS A HB3   1 
ATOM   391  H  HG    . CYS A 1 48  ? -3.203  23.611  -16.022 1.00 118.94 ? 918  CYS A HG    1 
ATOM   392  N  N     . PRO A 1 49  ? -7.335  24.683  -19.686 1.00 54.41  ? 919  PRO A N     1 
ATOM   393  C  CA    . PRO A 1 49  ? -8.638  24.242  -20.186 1.00 62.55  ? 919  PRO A CA    1 
ATOM   394  C  C     . PRO A 1 49  ? -9.274  23.249  -19.197 1.00 59.91  ? 919  PRO A C     1 
ATOM   395  O  O     . PRO A 1 49  ? -8.599  22.316  -18.759 1.00 54.72  ? 919  PRO A O     1 
ATOM   396  C  CB    . PRO A 1 49  ? -8.298  23.583  -21.535 1.00 55.72  ? 919  PRO A CB    1 
ATOM   397  C  CG    . PRO A 1 49  ? -6.821  23.335  -21.497 1.00 48.98  ? 919  PRO A CG    1 
ATOM   398  C  CD    . PRO A 1 49  ? -6.257  24.427  -20.655 1.00 48.98  ? 919  PRO A CD    1 
ATOM   399  H  HA    . PRO A 1 49  ? -9.237  25.005  -20.327 1.00 75.06  ? 919  PRO A HA    1 
ATOM   400  H  HB2   . PRO A 1 49  ? -8.783  22.748  -21.621 1.00 66.87  ? 919  PRO A HB2   1 
ATOM   401  H  HB3   . PRO A 1 49  ? -8.525  24.188  -22.259 1.00 66.87  ? 919  PRO A HB3   1 
ATOM   402  H  HG2   . PRO A 1 49  ? -6.647  22.469  -21.097 1.00 58.78  ? 919  PRO A HG2   1 
ATOM   403  H  HG3   . PRO A 1 49  ? -6.461  23.376  -22.397 1.00 58.78  ? 919  PRO A HG3   1 
ATOM   404  H  HD2   . PRO A 1 49  ? -5.456  24.125  -20.199 1.00 58.77  ? 919  PRO A HD2   1 
ATOM   405  H  HD3   . PRO A 1 49  ? -6.088  25.217  -21.192 1.00 58.77  ? 919  PRO A HD3   1 
ATOM   406  N  N     . PRO A 1 50  ? -10.539 23.481  -18.809 1.00 64.85  ? 920  PRO A N     1 
ATOM   407  C  CA    . PRO A 1 50  ? -11.248 22.550  -17.923 1.00 63.52  ? 920  PRO A CA    1 
ATOM   408  C  C     . PRO A 1 50  ? -11.452 21.185  -18.563 1.00 50.53  ? 920  PRO A C     1 
ATOM   409  O  O     . PRO A 1 50  ? -11.846 21.108  -19.727 1.00 44.87  ? 920  PRO A O     1 
ATOM   410  C  CB    . PRO A 1 50  ? -12.610 23.221  -17.718 1.00 69.81  ? 920  PRO A CB    1 
ATOM   411  C  CG    . PRO A 1 50  ? -12.746 24.196  -18.876 1.00 75.26  ? 920  PRO A CG    1 
ATOM   412  C  CD    . PRO A 1 50  ? -11.351 24.670  -19.117 1.00 72.29  ? 920  PRO A CD    1 
ATOM   413  H  HA    . PRO A 1 50  ? -10.785 22.456  -17.064 1.00 76.22  ? 920  PRO A HA    1 
ATOM   414  H  HB2   . PRO A 1 50  ? -13.312 22.553  -17.749 1.00 83.77  ? 920  PRO A HB2   1 
ATOM   415  H  HB3   . PRO A 1 50  ? -12.619 23.692  -16.870 1.00 83.77  ? 920  PRO A HB3   1 
ATOM   416  H  HG2   . PRO A 1 50  ? -13.094 23.736  -19.655 1.00 90.31  ? 920  PRO A HG2   1 
ATOM   417  H  HG3   . PRO A 1 50  ? -13.322 24.933  -18.620 1.00 90.31  ? 920  PRO A HG3   1 
ATOM   418  H  HD2   . PRO A 1 50  ? -11.236 24.929  -20.044 1.00 86.75  ? 920  PRO A HD2   1 
ATOM   419  H  HD3   . PRO A 1 50  ? -11.131 25.397  -18.513 1.00 86.75  ? 920  PRO A HD3   1 
ATOM   420  N  N     . PRO A 1 51  ? -11.214 20.113  -17.799 1.00 46.88  ? 921  PRO A N     1 
ATOM   421  C  CA    . PRO A 1 51  ? -11.501 18.756  -18.277 1.00 42.79  ? 921  PRO A CA    1 
ATOM   422  C  C     . PRO A 1 51  ? -12.946 18.680  -18.793 1.00 46.05  ? 921  PRO A C     1 
ATOM   423  O  O     . PRO A 1 51  ? -13.808 19.387  -18.268 1.00 43.62  ? 921  PRO A O     1 
ATOM   424  C  CB    . PRO A 1 51  ? -11.313 17.900  -17.016 1.00 40.92  ? 921  PRO A CB    1 
ATOM   425  C  CG    . PRO A 1 51  ? -11.544 18.848  -15.887 1.00 37.73  ? 921  PRO A CG    1 
ATOM   426  C  CD    . PRO A 1 51  ? -10.951 20.139  -16.350 1.00 43.30  ? 921  PRO A CD    1 
ATOM   427  H  HA    . PRO A 1 51  ? -10.871 18.481  -18.975 1.00 51.35  ? 921  PRO A HA    1 
ATOM   428  H  HB2   . PRO A 1 51  ? -11.966 17.184  -17.005 1.00 49.11  ? 921  PRO A HB2   1 
ATOM   429  H  HB3   . PRO A 1 51  ? -10.410 17.546  -16.991 1.00 49.11  ? 921  PRO A HB3   1 
ATOM   430  H  HG2   . PRO A 1 51  ? -12.496 18.944  -15.728 1.00 45.27  ? 921  PRO A HG2   1 
ATOM   431  H  HG3   . PRO A 1 51  ? -11.092 18.527  -15.091 1.00 45.27  ? 921  PRO A HG3   1 
ATOM   432  H  HD2   . PRO A 1 51  ? -11.404 20.890  -15.936 1.00 51.96  ? 921  PRO A HD2   1 
ATOM   433  H  HD3   . PRO A 1 51  ? -9.996  20.157  -16.178 1.00 51.96  ? 921  PRO A HD3   1 
ATOM   434  N  N     . ARG A 1 52  ? -13.197 17.851  -19.804 1.00 40.03  ? 922  ARG A N     1 
ATOM   435  C  CA    . ARG A 1 52  ? -14.512 17.757  -20.435 1.00 34.61  ? 922  ARG A CA    1 
ATOM   436  C  C     . ARG A 1 52  ? -14.645 16.374  -21.097 1.00 42.06  ? 922  ARG A C     1 
ATOM   437  O  O     . ARG A 1 52  ? -13.629 15.732  -21.362 1.00 40.73  ? 922  ARG A O     1 
ATOM   438  C  CB    . ARG A 1 52  ? -14.656 18.847  -21.489 1.00 40.92  ? 922  ARG A CB    1 
ATOM   439  C  CG    . ARG A 1 52  ? -16.086 19.072  -21.930 1.00 62.73  ? 922  ARG A CG    1 
ATOM   440  C  CD    . ARG A 1 52  ? -16.147 20.001  -23.112 1.00 86.13  ? 922  ARG A CD    1 
ATOM   441  N  NE    . ARG A 1 52  ? -15.083 19.714  -24.068 1.00 93.05  ? 922  ARG A NE    1 
ATOM   442  C  CZ    . ARG A 1 52  ? -14.485 20.632  -24.819 1.00 91.77  ? 922  ARG A CZ    1 
ATOM   443  N  NH1   . ARG A 1 52  ? -14.842 21.908  -24.731 1.00 85.05  ? 922  ARG A NH1   1 
ATOM   444  N  NH2   . ARG A 1 52  ? -13.526 20.271  -25.662 1.00 91.46  ? 922  ARG A NH2   1 
ATOM   445  H  H     . ARG A 1 52  ? -12.612 17.324  -20.149 1.00 48.04  ? 922  ARG A H     1 
ATOM   446  H  HA    . ARG A 1 52  ? -15.218 17.862  -19.763 1.00 41.53  ? 922  ARG A HA    1 
ATOM   447  H  HB2   . ARG A 1 52  ? -14.322 19.681  -21.125 1.00 49.10  ? 922  ARG A HB2   1 
ATOM   448  H  HB3   . ARG A 1 52  ? -14.139 18.597  -22.271 1.00 49.10  ? 922  ARG A HB3   1 
ATOM   449  H  HG2   . ARG A 1 52  ? -16.480 18.224  -22.188 1.00 75.28  ? 922  ARG A HG2   1 
ATOM   450  H  HG3   . ARG A 1 52  ? -16.588 19.470  -21.202 1.00 75.28  ? 922  ARG A HG3   1 
ATOM   451  H  HD2   . ARG A 1 52  ? -16.999 19.890  -23.563 1.00 103.35 ? 922  ARG A HD2   1 
ATOM   452  H  HD3   . ARG A 1 52  ? -16.044 20.916  -22.807 1.00 103.35 ? 922  ARG A HD3   1 
ATOM   453  H  HE    . ARG A 1 52  ? -14.825 18.898  -24.150 1.00 111.66 ? 922  ARG A HE    1 
ATOM   454  H  HH11  . ARG A 1 52  ? -15.464 22.144  -24.185 1.00 102.05 ? 922  ARG A HH11  1 
ATOM   455  H  HH12  . ARG A 1 52  ? -14.452 22.499  -25.219 1.00 102.05 ? 922  ARG A HH12  1 
ATOM   456  H  HH21  . ARG A 1 52  ? -13.293 19.446  -25.721 1.00 109.75 ? 922  ARG A HH21  1 
ATOM   457  H  HH22  . ARG A 1 52  ? -13.137 20.864  -26.150 1.00 109.75 ? 922  ARG A HH22  1 
ATOM   458  N  N     . PRO A 1 53  ? -15.886 15.901  -21.354 1.00 35.98  ? 923  PRO A N     1 
ATOM   459  C  CA    . PRO A 1 53  ? -16.017 14.573  -21.975 1.00 28.26  ? 923  PRO A CA    1 
ATOM   460  C  C     . PRO A 1 53  ? -15.874 14.648  -23.487 1.00 35.13  ? 923  PRO A C     1 
ATOM   461  O  O     . PRO A 1 53  ? -16.470 15.531  -24.104 1.00 40.98  ? 923  PRO A O     1 
ATOM   462  C  CB    . PRO A 1 53  ? -17.446 14.144  -21.613 1.00 31.27  ? 923  PRO A CB    1 
ATOM   463  C  CG    . PRO A 1 53  ? -17.964 15.190  -20.651 1.00 38.12  ? 923  PRO A CG    1 
ATOM   464  C  CD    . PRO A 1 53  ? -17.201 16.432  -20.967 1.00 37.19  ? 923  PRO A CD    1 
ATOM   465  H  HA    . PRO A 1 53  ? -15.368 13.940  -21.602 1.00 33.91  ? 923  PRO A HA    1 
ATOM   466  H  HB2   . PRO A 1 53  ? -17.991 14.120  -22.415 1.00 37.52  ? 923  PRO A HB2   1 
ATOM   467  H  HB3   . PRO A 1 53  ? -17.426 13.272  -21.189 1.00 37.52  ? 923  PRO A HB3   1 
ATOM   468  H  HG2   . PRO A 1 53  ? -18.914 15.325  -20.796 1.00 45.75  ? 923  PRO A HG2   1 
ATOM   469  H  HG3   . PRO A 1 53  ? -17.794 14.907  -19.739 1.00 45.75  ? 923  PRO A HG3   1 
ATOM   470  H  HD2   . PRO A 1 53  ? -17.610 16.904  -21.709 1.00 44.63  ? 923  PRO A HD2   1 
ATOM   471  H  HD3   . PRO A 1 53  ? -17.123 16.995  -20.180 1.00 44.63  ? 923  PRO A HD3   1 
ATOM   472  N  N     . PRO A 1 54  ? -15.099 13.730  -24.081 1.00 33.58  ? 924  PRO A N     1 
ATOM   473  C  CA    . PRO A 1 54  ? -14.809 13.840  -25.518 1.00 35.58  ? 924  PRO A CA    1 
ATOM   474  C  C     . PRO A 1 54  ? -16.068 13.665  -26.368 1.00 34.70  ? 924  PRO A C     1 
ATOM   475  O  O     . PRO A 1 54  ? -16.995 12.963  -25.976 1.00 33.47  ? 924  PRO A O     1 
ATOM   476  C  CB    . PRO A 1 54  ? -13.815 12.701  -25.763 1.00 27.16  ? 924  PRO A CB    1 
ATOM   477  C  CG    . PRO A 1 54  ? -14.109 11.690  -24.676 1.00 25.10  ? 924  PRO A CG    1 
ATOM   478  C  CD    . PRO A 1 54  ? -14.536 12.511  -23.480 1.00 26.02  ? 924  PRO A CD    1 
ATOM   479  H  HA    . PRO A 1 54  ? -14.386 14.700  -25.722 1.00 42.69  ? 924  PRO A HA    1 
ATOM   480  H  HB2   . PRO A 1 54  ? -13.967 12.317  -26.640 1.00 32.59  ? 924  PRO A HB2   1 
ATOM   481  H  HB3   . PRO A 1 54  ? -12.908 13.035  -25.685 1.00 32.59  ? 924  PRO A HB3   1 
ATOM   482  H  HG2   . PRO A 1 54  ? -14.825 11.102  -24.961 1.00 30.12  ? 924  PRO A HG2   1 
ATOM   483  H  HG3   . PRO A 1 54  ? -13.307 11.183  -24.475 1.00 30.12  ? 924  PRO A HG3   1 
ATOM   484  H  HD2   . PRO A 1 54  ? -15.215 12.040  -22.973 1.00 31.22  ? 924  PRO A HD2   1 
ATOM   485  H  HD3   . PRO A 1 54  ? -13.768 12.730  -22.930 1.00 31.22  ? 924  PRO A HD3   1 
ATOM   486  N  N     . SER A 1 55  ? -16.114 14.314  -27.520 1.00 32.96  ? 925  SER A N     1 
ATOM   487  C  CA    . SER A 1 55  ? -17.215 14.100  -28.444 1.00 30.95  ? 925  SER A CA    1 
ATOM   488  C  C     . SER A 1 55  ? -16.995 12.748  -29.092 1.00 34.58  ? 925  SER A C     1 
ATOM   489  O  O     . SER A 1 55  ? -15.926 12.156  -28.941 1.00 31.74  ? 925  SER A O     1 
ATOM   490  C  CB    . SER A 1 55  ? -17.235 15.191  -29.510 1.00 52.49  ? 925  SER A CB    1 
ATOM   491  O  OG    . SER A 1 55  ? -16.001 15.207  -30.206 1.00 50.49  ? 925  SER A OG    1 
ATOM   492  H  H     . SER A 1 55  ? -15.525 14.880  -27.790 1.00 39.55  ? 925  SER A H     1 
ATOM   493  H  HA    . SER A 1 55  ? -18.070 14.097  -27.964 1.00 37.14  ? 925  SER A HA    1 
ATOM   494  H  HB2   . SER A 1 55  ? -17.953 15.010  -30.138 1.00 62.99  ? 925  SER A HB2   1 
ATOM   495  H  HB3   . SER A 1 55  ? -17.372 16.051  -29.084 1.00 62.99  ? 925  SER A HB3   1 
ATOM   496  H  HG    . SER A 1 55  ? -15.504 14.628  -29.908 1.00 60.59  ? 925  SER A HG    1 
ATOM   497  N  N     . SER A 1 56  ? -17.996 12.253  -29.812 1.00 40.48  ? 926  SER A N     1 
ATOM   498  C  CA    . SER A 1 56  ? -17.866 10.958  -30.473 1.00 41.04  ? 926  SER A CA    1 
ATOM   499  C  C     . SER A 1 56  ? -16.579 10.932  -31.296 1.00 32.72  ? 926  SER A C     1 
ATOM   500  O  O     . SER A 1 56  ? -16.270 11.891  -32.004 1.00 31.82  ? 926  SER A O     1 
ATOM   501  C  CB    . SER A 1 56  ? -19.068 10.695  -31.379 1.00 59.18  ? 926  SER A CB    1 
ATOM   502  O  OG    . SER A 1 56  ? -19.172 9.314   -31.673 1.00 60.78  ? 926  SER A OG    1 
ATOM   503  H  H     . SER A 1 56  ? -18.753 12.642  -29.934 1.00 48.58  ? 926  SER A H     1 
ATOM   504  H  HA    . SER A 1 56  ? -17.821 10.248  -29.799 1.00 49.25  ? 926  SER A HA    1 
ATOM   505  H  HB2   . SER A 1 56  ? -19.875 10.984  -30.926 1.00 71.01  ? 926  SER A HB2   1 
ATOM   506  H  HB3   . SER A 1 56  ? -18.955 11.188  -32.206 1.00 71.01  ? 926  SER A HB3   1 
ATOM   507  H  HG    . SER A 1 56  ? -18.567 8.902   -31.304 1.00 72.94  ? 926  SER A HG    1 
ATOM   508  N  N     . PRO A 1 57  ? -15.811 9.844   -31.187 1.00 25.99  ? 927  PRO A N     1 
ATOM   509  C  CA    . PRO A 1 57  ? -14.539 9.770   -31.899 1.00 25.70  ? 927  PRO A CA    1 
ATOM   510  C  C     . PRO A 1 57  ? -14.684 9.948   -33.397 1.00 34.26  ? 927  PRO A C     1 
ATOM   511  O  O     . PRO A 1 57  ? -15.688 9.567   -34.002 1.00 28.21  ? 927  PRO A O     1 
ATOM   512  C  CB    . PRO A 1 57  ? -14.048 8.357   -31.587 1.00 29.16  ? 927  PRO A CB    1 
ATOM   513  C  CG    . PRO A 1 57  ? -14.620 8.064   -30.242 1.00 36.25  ? 927  PRO A CG    1 
ATOM   514  C  CD    . PRO A 1 57  ? -15.964 8.746   -30.216 1.00 27.64  ? 927  PRO A CD    1 
ATOM   515  H  HA    . PRO A 1 57  ? -13.903 10.427  -31.545 1.00 30.84  ? 927  PRO A HA    1 
ATOM   516  H  HB2   . PRO A 1 57  ? -14.388 7.736   -32.250 1.00 34.99  ? 927  PRO A HB2   1 
ATOM   517  H  HB3   . PRO A 1 57  ? -13.079 8.342   -31.562 1.00 34.99  ? 927  PRO A HB3   1 
ATOM   518  H  HG2   . PRO A 1 57  ? -14.721 7.106   -30.133 1.00 43.50  ? 927  PRO A HG2   1 
ATOM   519  H  HG3   . PRO A 1 57  ? -14.039 8.427   -29.556 1.00 43.50  ? 927  PRO A HG3   1 
ATOM   520  H  HD2   . PRO A 1 57  ? -16.659 8.134   -30.504 1.00 33.16  ? 927  PRO A HD2   1 
ATOM   521  H  HD3   . PRO A 1 57  ? -16.146 9.100   -29.331 1.00 33.16  ? 927  PRO A HD3   1 
ATOM   522  N  N     . TYR A 1 58  ? -13.659 10.543  -33.979 1.00 24.92  ? 928  TYR A N     1 
ATOM   523  C  CA    . TYR A 1 58  ? -13.544 10.645  -35.421 1.00 32.03  ? 928  TYR A CA    1 
ATOM   524  C  C     . TYR A 1 58  ? -12.285 9.888   -35.829 1.00 38.83  ? 928  TYR A C     1 
ATOM   525  O  O     . TYR A 1 58  ? -11.280 9.946   -35.132 1.00 39.03  ? 928  TYR A O     1 
ATOM   526  C  CB    . TYR A 1 58  ? -13.450 12.104  -35.834 1.00 32.56  ? 928  TYR A CB    1 
ATOM   527  C  CG    . TYR A 1 58  ? -13.306 12.266  -37.323 1.00 33.44  ? 928  TYR A CG    1 
ATOM   528  C  CD1   . TYR A 1 58  ? -14.417 12.475  -38.128 1.00 32.15  ? 928  TYR A CD1   1 
ATOM   529  C  CD2   . TYR A 1 58  ? -12.061 12.179  -37.926 1.00 33.57  ? 928  TYR A CD2   1 
ATOM   530  C  CE1   . TYR A 1 58  ? -14.290 12.606  -39.499 1.00 33.00  ? 928  TYR A CE1   1 
ATOM   531  C  CE2   . TYR A 1 58  ? -11.921 12.314  -39.295 1.00 32.96  ? 928  TYR A CE2   1 
ATOM   532  C  CZ    . TYR A 1 58  ? -13.039 12.523  -40.073 1.00 35.20  ? 928  TYR A CZ    1 
ATOM   533  O  OH    . TYR A 1 58  ? -12.900 12.651  -41.429 1.00 32.37  ? 928  TYR A OH    1 
ATOM   534  H  H     . TYR A 1 58  ? -13.005 10.903  -33.553 1.00 29.90  ? 928  TYR A H     1 
ATOM   535  H  HA    . TYR A 1 58  ? -14.322 10.235  -35.854 1.00 38.43  ? 928  TYR A HA    1 
ATOM   536  H  HB2   . TYR A 1 58  ? -14.257 12.565  -35.557 1.00 39.07  ? 928  TYR A HB2   1 
ATOM   537  H  HB3   . TYR A 1 58  ? -12.675 12.505  -35.411 1.00 39.07  ? 928  TYR A HB3   1 
ATOM   538  H  HD1   . TYR A 1 58  ? -15.260 12.528  -37.739 1.00 38.58  ? 928  TYR A HD1   1 
ATOM   539  H  HD2   . TYR A 1 58  ? -11.307 12.036  -37.400 1.00 40.28  ? 928  TYR A HD2   1 
ATOM   540  H  HE1   . TYR A 1 58  ? -15.041 12.750  -40.029 1.00 39.60  ? 928  TYR A HE1   1 
ATOM   541  H  HE2   . TYR A 1 58  ? -11.080 12.257  -39.688 1.00 39.55  ? 928  TYR A HE2   1 
ATOM   542  H  HH    . TYR A 1 58  ? -12.567 11.971  -41.743 1.00 38.84  ? 928  TYR A HH    1 
ATOM   543  N  N     . PRO A 1 59  ? -12.330 9.156   -36.950 1.00 35.60  ? 929  PRO A N     1 
ATOM   544  C  CA    . PRO A 1 59  ? -13.455 8.980   -37.875 1.00 36.09  ? 929  PRO A CA    1 
ATOM   545  C  C     . PRO A 1 59  ? -14.528 8.056   -37.302 1.00 27.85  ? 929  PRO A C     1 
ATOM   546  O  O     . PRO A 1 59  ? -14.219 7.187   -36.481 1.00 26.31  ? 929  PRO A O     1 
ATOM   547  C  CB    . PRO A 1 59  ? -12.797 8.314   -39.094 1.00 37.23  ? 929  PRO A CB    1 
ATOM   548  C  CG    . PRO A 1 59  ? -11.655 7.539   -38.510 1.00 42.68  ? 929  PRO A CG    1 
ATOM   549  C  CD    . PRO A 1 59  ? -11.136 8.410   -37.389 1.00 33.05  ? 929  PRO A CD    1 
ATOM   550  H  HA    . PRO A 1 59  ? -13.846 9.842   -38.129 1.00 43.30  ? 929  PRO A HA    1 
ATOM   551  H  HB2   . PRO A 1 59  ? -13.430 7.723   -39.530 1.00 44.68  ? 929  PRO A HB2   1 
ATOM   552  H  HB3   . PRO A 1 59  ? -12.476 8.994   -39.708 1.00 44.68  ? 929  PRO A HB3   1 
ATOM   553  H  HG2   . PRO A 1 59  ? -11.975 6.690   -38.167 1.00 51.21  ? 929  PRO A HG2   1 
ATOM   554  H  HG3   . PRO A 1 59  ? -10.971 7.402   -39.185 1.00 51.21  ? 929  PRO A HG3   1 
ATOM   555  H  HD2   . PRO A 1 59  ? -10.796 7.861   -36.665 1.00 39.66  ? 929  PRO A HD2   1 
ATOM   556  H  HD3   . PRO A 1 59  ? -10.459 9.020   -37.721 1.00 39.66  ? 929  PRO A HD3   1 
ATOM   557  N  N     . PRO A 1 60  ? -15.781 8.230   -37.740 1.00 27.43  ? 930  PRO A N     1 
ATOM   558  C  CA    . PRO A 1 60  ? -16.838 7.334   -37.264 1.00 29.00  ? 930  PRO A CA    1 
ATOM   559  C  C     . PRO A 1 60  ? -16.628 5.929   -37.817 1.00 26.28  ? 930  PRO A C     1 
ATOM   560  O  O     . PRO A 1 60  ? -16.065 5.768   -38.900 1.00 26.04  ? 930  PRO A O     1 
ATOM   561  C  CB    . PRO A 1 60  ? -18.114 7.955   -37.843 1.00 26.84  ? 930  PRO A CB    1 
ATOM   562  C  CG    . PRO A 1 60  ? -17.650 8.661   -39.088 1.00 27.79  ? 930  PRO A CG    1 
ATOM   563  C  CD    . PRO A 1 60  ? -16.248 9.137   -38.806 1.00 24.83  ? 930  PRO A CD    1 
ATOM   564  H  HA    . PRO A 1 60  ? -16.880 7.316   -36.285 1.00 34.80  ? 930  PRO A HA    1 
ATOM   565  H  HB2   . PRO A 1 60  ? -18.752 7.257   -38.060 1.00 32.21  ? 930  PRO A HB2   1 
ATOM   566  H  HB3   . PRO A 1 60  ? -18.491 8.585   -37.209 1.00 32.21  ? 930  PRO A HB3   1 
ATOM   567  H  HG2   . PRO A 1 60  ? -17.655 8.040   -39.833 1.00 33.35  ? 930  PRO A HG2   1 
ATOM   568  H  HG3   . PRO A 1 60  ? -18.234 9.414   -39.270 1.00 33.35  ? 930  PRO A HG3   1 
ATOM   569  H  HD2   . PRO A 1 60  ? -15.694 9.043   -39.597 1.00 29.79  ? 930  PRO A HD2   1 
ATOM   570  H  HD3   . PRO A 1 60  ? -16.260 10.053  -38.488 1.00 29.79  ? 930  PRO A HD3   1 
ATOM   571  N  N     . LEU A 1 61  ? -17.064 4.926   -37.069 1.00 28.31  ? 931  LEU A N     1 
ATOM   572  C  CA    . LEU A 1 61  ? -16.975 3.540   -37.514 1.00 26.29  ? 931  LEU A CA    1 
ATOM   573  C  C     . LEU A 1 61  ? -18.268 3.171   -38.214 1.00 27.16  ? 931  LEU A C     1 
ATOM   574  O  O     . LEU A 1 61  ? -19.345 3.530   -37.748 1.00 25.01  ? 931  LEU A O     1 
ATOM   575  C  CB    . LEU A 1 61  ? -16.791 2.614   -36.312 1.00 22.88  ? 931  LEU A CB    1 
ATOM   576  C  CG    . LEU A 1 61  ? -15.492 2.789   -35.525 1.00 25.44  ? 931  LEU A CG    1 
ATOM   577  C  CD1   . LEU A 1 61  ? -15.475 1.852   -34.292 1.00 21.28  ? 931  LEU A CD1   1 
ATOM   578  C  CD2   . LEU A 1 61  ? -14.310 2.535   -36.431 1.00 28.21  ? 931  LEU A CD2   1 
ATOM   579  H  H     . LEU A 1 61  ? -17.419 5.021   -36.291 1.00 33.98  ? 931  LEU A H     1 
ATOM   580  H  HA    . LEU A 1 61  ? -16.224 3.426   -38.133 1.00 31.55  ? 931  LEU A HA    1 
ATOM   581  H  HB2   . LEU A 1 61  ? -17.525 2.765   -35.696 1.00 27.45  ? 931  LEU A HB2   1 
ATOM   582  H  HB3   . LEU A 1 61  ? -16.817 1.697   -36.626 1.00 27.45  ? 931  LEU A HB3   1 
ATOM   583  H  HG    . LEU A 1 61  ? -15.436 3.704   -35.207 1.00 30.52  ? 931  LEU A HG    1 
ATOM   584  H  HD11  . LEU A 1 61  ? -16.219 2.069   -33.725 1.00 25.54  ? 931  LEU A HD11  1 
ATOM   585  H  HD12  . LEU A 1 61  ? -15.544 0.942   -34.590 1.00 25.54  ? 931  LEU A HD12  1 
ATOM   586  H  HD13  . LEU A 1 61  ? -14.652 1.980   -33.815 1.00 25.54  ? 931  LEU A HD13  1 
ATOM   587  H  HD21  . LEU A 1 61  ? -14.364 1.639   -36.771 1.00 33.85  ? 931  LEU A HD21  1 
ATOM   588  H  HD22  . LEU A 1 61  ? -14.334 3.163   -37.157 1.00 33.85  ? 931  LEU A HD22  1 
ATOM   589  H  HD23  . LEU A 1 61  ? -13.501 2.648   -35.927 1.00 33.85  ? 931  LEU A HD23  1 
ATOM   590  N  N     . PRO A 1 62  ? -18.173 2.439   -39.326 1.00 23.93  ? 932  PRO A N     1 
ATOM   591  C  CA    . PRO A 1 62  ? -19.376 1.905   -39.966 1.00 26.34  ? 932  PRO A CA    1 
ATOM   592  C  C     . PRO A 1 62  ? -19.960 0.741   -39.187 1.00 26.38  ? 932  PRO A C     1 
ATOM   593  O  O     . PRO A 1 62  ? -19.300 0.190   -38.296 1.00 22.84  ? 932  PRO A O     1 
ATOM   594  C  CB    . PRO A 1 62  ? -18.854 1.413   -41.316 1.00 32.82  ? 932  PRO A CB    1 
ATOM   595  C  CG    . PRO A 1 62  ? -17.444 1.001   -41.020 1.00 29.58  ? 932  PRO A CG    1 
ATOM   596  C  CD    . PRO A 1 62  ? -16.943 2.022   -40.020 1.00 29.85  ? 932  PRO A CD    1 
ATOM   597  H  HA    . PRO A 1 62  ? -20.051 2.603   -40.096 1.00 31.61  ? 932  PRO A HA    1 
ATOM   598  H  HB2   . PRO A 1 62  ? -19.381 0.657   -41.620 1.00 39.39  ? 932  PRO A HB2   1 
ATOM   599  H  HB3   . PRO A 1 62  ? -18.876 2.136   -41.963 1.00 39.39  ? 932  PRO A HB3   1 
ATOM   600  H  HG2   . PRO A 1 62  ? -17.436 0.111   -40.635 1.00 35.50  ? 932  PRO A HG2   1 
ATOM   601  H  HG3   . PRO A 1 62  ? -16.916 1.029   -41.833 1.00 35.50  ? 932  PRO A HG3   1 
ATOM   602  H  HD2   . PRO A 1 62  ? -16.324 1.611   -39.396 1.00 35.82  ? 932  PRO A HD2   1 
ATOM   603  H  HD3   . PRO A 1 62  ? -16.540 2.776   -40.478 1.00 35.82  ? 932  PRO A HD3   1 
ATOM   604  N  N     . LYS A 1 63  ? -21.179 0.344   -39.528 1.00 25.71  ? 933  LYS A N     1 
ATOM   605  C  CA    . LYS A 1 63  ? -21.868 -0.699  -38.765 1.00 31.92  ? 933  LYS A CA    1 
ATOM   606  C  C     . LYS A 1 63  ? -21.096 -2.017  -38.732 1.00 28.55  ? 933  LYS A C     1 
ATOM   607  O  O     . LYS A 1 63  ? -21.189 -2.768  -37.760 1.00 29.85  ? 933  LYS A O     1 
ATOM   608  C  CB    . LYS A 1 63  ? -23.256 -0.953  -39.350 1.00 40.90  ? 933  LYS A CB    1 
ATOM   609  C  CG    . LYS A 1 63  ? -24.158 0.252   -39.325 1.00 33.68  ? 933  LYS A CG    1 
ATOM   610  C  CD    . LYS A 1 63  ? -24.427 0.707   -37.906 1.00 30.12  ? 933  LYS A CD    1 
ATOM   611  C  CE    . LYS A 1 63  ? -25.537 1.742   -37.862 1.00 35.87  ? 933  LYS A CE    1 
ATOM   612  N  NZ    . LYS A 1 63  ? -25.561 2.479   -36.579 1.00 36.98  ? 933  LYS A NZ    1 
ATOM   613  H  H     . LYS A 1 63  ? -21.629 0.657   -40.190 1.00 30.85  ? 933  LYS A H     1 
ATOM   614  H  HA    . LYS A 1 63  ? -21.982 -0.393  -37.841 1.00 38.31  ? 933  LYS A HA    1 
ATOM   615  H  HB2   . LYS A 1 63  ? -23.160 -1.231  -40.274 1.00 49.08  ? 933  LYS A HB2   1 
ATOM   616  H  HB3   . LYS A 1 63  ? -23.687 -1.656  -38.839 1.00 49.08  ? 933  LYS A HB3   1 
ATOM   617  H  HG2   . LYS A 1 63  ? -23.733 0.981   -39.803 1.00 40.41  ? 933  LYS A HG2   1 
ATOM   618  H  HG3   . LYS A 1 63  ? -25.006 0.027   -39.739 1.00 40.41  ? 933  LYS A HG3   1 
ATOM   619  H  HD2   . LYS A 1 63  ? -24.699 -0.055  -37.371 1.00 36.15  ? 933  LYS A HD2   1 
ATOM   620  H  HD3   . LYS A 1 63  ? -23.623 1.106   -37.538 1.00 36.15  ? 933  LYS A HD3   1 
ATOM   621  H  HE2   . LYS A 1 63  ? -25.402 2.384   -38.577 1.00 43.04  ? 933  LYS A HE2   1 
ATOM   622  H  HE3   . LYS A 1 63  ? -26.392 1.296   -37.971 1.00 43.04  ? 933  LYS A HE3   1 
ATOM   623  H  HZ1   . LYS A 1 63  ? -24.788 2.902   -36.457 1.00 44.38  ? 933  LYS A HZ1   1 
ATOM   624  H  HZ2   . LYS A 1 63  ? -26.220 3.077   -36.584 1.00 44.38  ? 933  LYS A HZ2   1 
ATOM   625  H  HZ3   . LYS A 1 63  ? -25.690 1.912   -35.905 1.00 44.38  ? 933  LYS A HZ3   1 
ATOM   626  N  N     . ASP A 1 64  ? -20.331 -2.295  -39.781 1.00 24.65  ? 934  ASP A N     1 
ATOM   627  C  CA    . ASP A 1 64  ? -19.641 -3.584  -39.888 1.00 27.75  ? 934  ASP A CA    1 
ATOM   628  C  C     . ASP A 1 64  ? -18.435 -3.656  -38.958 1.00 31.59  ? 934  ASP A C     1 
ATOM   629  O  O     . ASP A 1 64  ? -17.817 -4.709  -38.811 1.00 29.65  ? 934  ASP A O     1 
ATOM   630  C  CB    . ASP A 1 64  ? -19.206 -3.853  -41.334 1.00 31.49  ? 934  ASP A CB    1 
ATOM   631  C  CG    . ASP A 1 64  ? -18.346 -2.738  -41.905 1.00 43.44  ? 934  ASP A CG    1 
ATOM   632  O  OD1   . ASP A 1 64  ? -17.108 -2.802  -41.753 1.00 48.91  ? 934  ASP A OD1   1 
ATOM   633  O  OD2   . ASP A 1 64  ? -18.906 -1.797  -42.509 1.00 39.90  ? 934  ASP A OD2   1 
ATOM   634  H  H     . ASP A 1 64  ? -20.193 -1.762  -40.442 1.00 29.58  ? 934  ASP A H     1 
ATOM   635  H  HA    . ASP A 1 64  ? -20.262 -4.295  -39.626 1.00 33.30  ? 934  ASP A HA    1 
ATOM   636  H  HB2   . ASP A 1 64  ? -18.689 -4.674  -41.361 1.00 37.79  ? 934  ASP A HB2   1 
ATOM   637  H  HB3   . ASP A 1 64  ? -19.995 -3.939  -41.891 1.00 37.79  ? 934  ASP A HB3   1 
ATOM   638  N  N     . LYS A 1 65  ? -18.107 -2.543  -38.313 1.00 22.65  ? 935  LYS A N     1 
ATOM   639  C  CA    . LYS A 1 65  ? -16.994 -2.530  -37.368 1.00 21.57  ? 935  LYS A CA    1 
ATOM   640  C  C     . LYS A 1 65  ? -17.413 -2.318  -35.907 1.00 27.88  ? 935  LYS A C     1 
ATOM   641  O  O     . LYS A 1 65  ? -16.574 -2.002  -35.066 1.00 26.05  ? 935  LYS A O     1 
ATOM   642  C  CB    . LYS A 1 65  ? -15.993 -1.452  -37.793 1.00 28.16  ? 935  LYS A CB    1 
ATOM   643  C  CG    . LYS A 1 65  ? -15.143 -1.859  -38.986 1.00 39.11  ? 935  LYS A CG    1 
ATOM   644  C  CD    . LYS A 1 65  ? -14.329 -0.693  -39.523 1.00 45.38  ? 935  LYS A CD    1 
ATOM   645  C  CE    . LYS A 1 65  ? -13.485 -1.100  -40.730 1.00 55.71  ? 935  LYS A CE    1 
ATOM   646  N  NZ    . LYS A 1 65  ? -12.718 0.055   -41.283 1.00 61.16  ? 935  LYS A NZ    1 
ATOM   647  H  H     . LYS A 1 65  ? -18.507 -1.787  -38.403 1.00 27.18  ? 935  LYS A H     1 
ATOM   648  H  HA    . LYS A 1 65  ? -16.535 -3.395  -37.419 1.00 25.88  ? 935  LYS A HA    1 
ATOM   649  H  HB2   . LYS A 1 65  ? -16.480 -0.649  -38.034 1.00 33.79  ? 935  LYS A HB2   1 
ATOM   650  H  HB3   . LYS A 1 65  ? -15.396 -1.267  -37.051 1.00 33.79  ? 935  LYS A HB3   1 
ATOM   651  H  HG2   . LYS A 1 65  ? -14.528 -2.559  -38.716 1.00 46.94  ? 935  LYS A HG2   1 
ATOM   652  H  HG3   . LYS A 1 65  ? -15.721 -2.178  -39.697 1.00 46.94  ? 935  LYS A HG3   1 
ATOM   653  H  HD2   . LYS A 1 65  ? -14.931 0.016   -39.799 1.00 54.46  ? 935  LYS A HD2   1 
ATOM   654  H  HD3   . LYS A 1 65  ? -13.731 -0.374  -38.828 1.00 54.46  ? 935  LYS A HD3   1 
ATOM   655  H  HE2   . LYS A 1 65  ? -12.852 -1.784  -40.461 1.00 66.86  ? 935  LYS A HE2   1 
ATOM   656  H  HE3   . LYS A 1 65  ? -14.068 -1.439  -41.427 1.00 66.86  ? 935  LYS A HE3   1 
ATOM   657  H  HZ1   . LYS A 1 65  ? -12.236 -0.207  -41.983 1.00 73.40  ? 935  LYS A HZ1   1 
ATOM   658  H  HZ2   . LYS A 1 65  ? -13.279 0.696   -41.541 1.00 73.40  ? 935  LYS A HZ2   1 
ATOM   659  H  HZ3   . LYS A 1 65  ? -12.172 0.382   -40.661 1.00 73.40  ? 935  LYS A HZ3   1 
ATOM   660  N  N     . LEU A 1 66  ? -18.691 -2.522  -35.591 1.00 20.11  ? 936  LEU A N     1 
ATOM   661  C  CA    . LEU A 1 66  ? -19.185 -2.230  -34.243 1.00 18.65  ? 936  LEU A CA    1 
ATOM   662  C  C     . LEU A 1 66  ? -19.171 -3.450  -33.330 1.00 23.04  ? 936  LEU A C     1 
ATOM   663  O  O     . LEU A 1 66  ? -19.567 -3.360  -32.174 1.00 21.00  ? 936  LEU A O     1 
ATOM   664  C  CB    . LEU A 1 66  ? -20.604 -1.656  -34.294 1.00 25.06  ? 936  LEU A CB    1 
ATOM   665  C  CG    . LEU A 1 66  ? -20.744 -0.362  -35.109 1.00 21.36  ? 936  LEU A CG    1 
ATOM   666  C  CD1   . LEU A 1 66  ? -22.176 0.113   -35.087 1.00 27.52  ? 936  LEU A CD1   1 
ATOM   667  C  CD2   . LEU A 1 66  ? -19.804 0.720   -34.565 1.00 19.71  ? 936  LEU A CD2   1 
ATOM   668  H  H     . LEU A 1 66  ? -19.287 -2.825  -36.131 1.00 24.13  ? 936  LEU A H     1 
ATOM   669  H  HA    . LEU A 1 66  ? -18.605 -1.552  -33.839 1.00 22.37  ? 936  LEU A HA    1 
ATOM   670  H  HB2   . LEU A 1 66  ? -21.192 -2.318  -34.692 1.00 30.07  ? 936  LEU A HB2   1 
ATOM   671  H  HB3   . LEU A 1 66  ? -20.894 -1.465  -33.388 1.00 30.07  ? 936  LEU A HB3   1 
ATOM   672  H  HG    . LEU A 1 66  ? -20.500 -0.539  -36.031 1.00 25.64  ? 936  LEU A HG    1 
ATOM   673  H  HD11  . LEU A 1 66  ? -22.737 -0.567  -35.469 1.00 33.03  ? 936  LEU A HD11  1 
ATOM   674  H  HD12  . LEU A 1 66  ? -22.436 0.279   -34.177 1.00 33.03  ? 936  LEU A HD12  1 
ATOM   675  H  HD13  . LEU A 1 66  ? -22.245 0.921   -35.600 1.00 33.03  ? 936  LEU A HD13  1 
ATOM   676  H  HD21  . LEU A 1 66  ? -19.910 1.517   -35.089 1.00 23.65  ? 936  LEU A HD21  1 
ATOM   677  H  HD22  . LEU A 1 66  ? -20.030 0.897   -33.649 1.00 23.65  ? 936  LEU A HD22  1 
ATOM   678  H  HD23  . LEU A 1 66  ? -18.899 0.405   -34.625 1.00 23.65  ? 936  LEU A HD23  1 
ATOM   679  N  N     . ASN A 1 67  ? -18.730 -4.588  -33.855 1.00 22.88  ? 937  ASN A N     1 
ATOM   680  C  CA    . ASN A 1 67  ? -18.677 -5.809  -33.056 1.00 26.26  ? 937  ASN A CA    1 
ATOM   681  C  C     . ASN A 1 67  ? -17.322 -6.502  -33.210 1.00 26.14  ? 937  ASN A C     1 
ATOM   682  O  O     . ASN A 1 67  ? -17.244 -7.655  -33.626 1.00 24.50  ? 937  ASN A O     1 
ATOM   683  C  CB    . ASN A 1 67  ? -19.836 -6.735  -33.447 1.00 32.36  ? 937  ASN A CB    1 
ATOM   684  C  CG    . ASN A 1 67  ? -21.197 -6.168  -33.045 1.00 47.84  ? 937  ASN A CG    1 
ATOM   685  O  OD1   . ASN A 1 67  ? -21.587 -6.230  -31.879 1.00 57.46  ? 937  ASN A OD1   1 
ATOM   686  N  ND2   . ASN A 1 67  ? -21.921 -5.611  -34.011 1.00 43.71  ? 937  ASN A ND2   1 
ATOM   687  H  H     . ASN A 1 67  ? -18.458 -4.680  -34.665 1.00 27.46  ? 937  ASN A H     1 
ATOM   688  H  HA    . ASN A 1 67  ? -18.787 -5.574  -32.111 1.00 31.52  ? 937  ASN A HA    1 
ATOM   689  H  HB2   . ASN A 1 67  ? -19.833 -6.858  -34.409 1.00 38.83  ? 937  ASN A HB2   1 
ATOM   690  H  HB3   . ASN A 1 67  ? -19.722 -7.590  -33.002 1.00 38.83  ? 937  ASN A HB3   1 
ATOM   691  H  HD21  . ASN A 1 67  ? -21.617 -5.584  -34.815 1.00 52.45  ? 937  ASN A HD21  1 
ATOM   692  H  HD22  . ASN A 1 67  ? -22.694 -5.279  -33.831 1.00 52.45  ? 937  ASN A HD22  1 
ATOM   693  N  N     . PRO A 1 68  ? -16.242 -5.791  -32.862 1.00 24.19  ? 938  PRO A N     1 
ATOM   694  C  CA    . PRO A 1 68  ? -14.882 -6.276  -33.115 1.00 19.35  ? 938  PRO A CA    1 
ATOM   695  C  C     . PRO A 1 68  ? -14.504 -7.468  -32.241 1.00 17.87  ? 938  PRO A C     1 
ATOM   696  O  O     . PRO A 1 68  ? -15.024 -7.613  -31.133 1.00 19.77  ? 938  PRO A O     1 
ATOM   697  C  CB    . PRO A 1 68  ? -14.006 -5.068  -32.766 1.00 24.74  ? 938  PRO A CB    1 
ATOM   698  C  CG    . PRO A 1 68  ? -14.802 -4.333  -31.703 1.00 23.72  ? 938  PRO A CG    1 
ATOM   699  C  CD    . PRO A 1 68  ? -16.244 -4.478  -32.187 1.00 22.99  ? 938  PRO A CD    1 
ATOM   700  H  HA    . PRO A 1 68  ? -14.766 -6.507  -34.060 1.00 23.22  ? 938  PRO A HA    1 
ATOM   701  H  HB2   . PRO A 1 68  ? -13.153 -5.369  -32.415 1.00 29.69  ? 938  PRO A HB2   1 
ATOM   702  H  HB3   . PRO A 1 68  ? -13.881 -4.513  -33.552 1.00 29.69  ? 938  PRO A HB3   1 
ATOM   703  H  HG2   . PRO A 1 68  ? -14.680 -4.760  -30.841 1.00 28.46  ? 938  PRO A HG2   1 
ATOM   704  H  HG3   . PRO A 1 68  ? -14.536 -3.401  -31.673 1.00 28.46  ? 938  PRO A HG3   1 
ATOM   705  H  HD2   . PRO A 1 68  ? -16.855 -4.485  -31.434 1.00 27.59  ? 938  PRO A HD2   1 
ATOM   706  H  HD3   . PRO A 1 68  ? -16.462 -3.773  -32.817 1.00 27.59  ? 938  PRO A HD3   1 
ATOM   707  N  N     . PRO A 1 69  ? -13.600 -8.320  -32.739 1.00 19.51  ? 939  PRO A N     1 
ATOM   708  C  CA    . PRO A 1 69  ? -13.109 -9.451  -31.938 1.00 19.07  ? 939  PRO A CA    1 
ATOM   709  C  C     . PRO A 1 69  ? -12.211 -8.963  -30.818 1.00 23.89  ? 939  PRO A C     1 
ATOM   710  O  O     . PRO A 1 69  ? -11.578 -7.916  -30.953 1.00 17.94  ? 939  PRO A O     1 
ATOM   711  C  CB    . PRO A 1 69  ? -12.273 -10.248 -32.939 1.00 20.36  ? 939  PRO A CB    1 
ATOM   712  C  CG    . PRO A 1 69  ? -11.810 -9.215  -33.930 1.00 27.45  ? 939  PRO A CG    1 
ATOM   713  C  CD    . PRO A 1 69  ? -12.954 -8.254  -34.059 1.00 25.27  ? 939  PRO A CD    1 
ATOM   714  H  HA    . PRO A 1 69  ? -13.844 -9.996  -31.586 1.00 22.88  ? 939  PRO A HA    1 
ATOM   715  H  HB2   . PRO A 1 69  ? -11.518 -10.657 -32.488 1.00 24.43  ? 939  PRO A HB2   1 
ATOM   716  H  HB3   . PRO A 1 69  ? -12.825 -10.919 -33.371 1.00 24.43  ? 939  PRO A HB3   1 
ATOM   717  H  HG2   . PRO A 1 69  ? -11.021 -8.766  -33.589 1.00 32.94  ? 939  PRO A HG2   1 
ATOM   718  H  HG3   . PRO A 1 69  ? -11.622 -9.641  -34.781 1.00 32.94  ? 939  PRO A HG3   1 
ATOM   719  H  HD2   . PRO A 1 69  ? -12.625 -7.357  -34.230 1.00 30.32  ? 939  PRO A HD2   1 
ATOM   720  H  HD3   . PRO A 1 69  ? -13.566 -8.547  -34.751 1.00 30.32  ? 939  PRO A HD3   1 
ATOM   721  N  N     . THR A 1 70  ? -12.136 -9.722  -29.732 1.00 18.58  ? 940  THR A N     1 
ATOM   722  C  CA    . THR A 1 70  ? -11.369 -9.297  -28.570 1.00 16.32  ? 940  THR A CA    1 
ATOM   723  C  C     . THR A 1 70  ? -9.900  -9.691  -28.706 1.00 17.40  ? 940  THR A C     1 
ATOM   724  O  O     . THR A 1 70  ? -9.578  -10.851 -29.023 1.00 19.51  ? 940  THR A O     1 
ATOM   725  C  CB    . THR A 1 70  ? -11.953 -9.907  -27.285 1.00 27.88  ? 940  THR A CB    1 
ATOM   726  O  OG1   . THR A 1 70  ? -13.281 -9.400  -27.097 1.00 25.57  ? 940  THR A OG1   1 
ATOM   727  C  CG2   . THR A 1 70  ? -11.102 -9.536  -26.079 1.00 23.83  ? 940  THR A CG2   1 
ATOM   728  H  H     . THR A 1 70  ? -12.520 -10.487 -29.642 1.00 22.29  ? 940  THR A H     1 
ATOM   729  H  HA    . THR A 1 70  ? -11.417 -8.321  -28.494 1.00 19.59  ? 940  THR A HA    1 
ATOM   730  H  HB    . THR A 1 70  ? -11.978 -10.873 -27.363 1.00 33.46  ? 940  THR A HB    1 
ATOM   731  H  HG1   . THR A 1 70  ? -13.262 -8.583  -27.030 1.00 30.69  ? 940  THR A HG1   1 
ATOM   732  H  HG21  . THR A 1 70  ? -10.207 -9.864  -26.195 1.00 28.60  ? 940  THR A HG21  1 
ATOM   733  H  HG22  . THR A 1 70  ? -11.073 -8.581  -25.979 1.00 28.60  ? 940  THR A HG22  1 
ATOM   734  H  HG23  . THR A 1 70  ? -11.475 -9.921  -25.283 1.00 28.60  ? 940  THR A HG23  1 
ATOM   735  N  N     . PRO A 1 71  ? -9.003  -8.735  -28.464 1.00 15.14  ? 941  PRO A N     1 
ATOM   736  C  CA    . PRO A 1 71  ? -7.573  -9.036  -28.530 1.00 16.76  ? 941  PRO A CA    1 
ATOM   737  C  C     . PRO A 1 71  ? -7.267  -10.166 -27.561 1.00 17.51  ? 941  PRO A C     1 
ATOM   738  O  O     . PRO A 1 71  ? -7.674  -10.091 -26.400 1.00 20.02  ? 941  PRO A O     1 
ATOM   739  C  CB    . PRO A 1 71  ? -6.925  -7.718  -28.091 1.00 18.94  ? 941  PRO A CB    1 
ATOM   740  C  CG    . PRO A 1 71  ? -7.927  -6.665  -28.522 1.00 15.86  ? 941  PRO A CG    1 
ATOM   741  C  CD    . PRO A 1 71  ? -9.249  -7.301  -28.193 1.00 17.21  ? 941  PRO A CD    1 
ATOM   742  H  HA    . PRO A 1 71  ? -7.296  -9.272  -29.440 1.00 20.11  ? 941  PRO A HA    1 
ATOM   743  H  HB2   . PRO A 1 71  ? -6.806  -7.712  -27.129 1.00 22.72  ? 941  PRO A HB2   1 
ATOM   744  H  HB3   . PRO A 1 71  ? -6.077  -7.599  -28.547 1.00 22.72  ? 941  PRO A HB3   1 
ATOM   745  H  HG2   . PRO A 1 71  ? -7.794  -5.851  -28.012 1.00 19.03  ? 941  PRO A HG2   1 
ATOM   746  H  HG3   . PRO A 1 71  ? -7.847  -6.499  -29.475 1.00 19.03  ? 941  PRO A HG3   1 
ATOM   747  H  HD2   . PRO A 1 71  ? -9.468  -7.165  -27.258 1.00 20.65  ? 941  PRO A HD2   1 
ATOM   748  H  HD3   . PRO A 1 71  ? -9.945  -6.959  -28.776 1.00 20.65  ? 941  PRO A HD3   1 
ATOM   749  N  N     . SER A 1 72  ? -6.585  -11.201 -28.039 1.00 16.18  ? 942  SER A N     1 
ATOM   750  C  CA    . SER A 1 72  ? -6.448  -12.428 -27.261 1.00 17.63  ? 942  SER A CA    1 
ATOM   751  C  C     . SER A 1 72  ? -5.024  -12.930 -27.223 1.00 21.22  ? 942  SER A C     1 
ATOM   752  O  O     . SER A 1 72  ? -4.287  -12.826 -28.199 1.00 23.53  ? 942  SER A O     1 
ATOM   753  C  CB    . SER A 1 72  ? -7.331  -13.522 -27.856 1.00 19.48  ? 942  SER A CB    1 
ATOM   754  O  OG    . SER A 1 72  ? -8.687  -13.134 -27.848 1.00 19.47  ? 942  SER A OG    1 
ATOM   755  H  H     . SER A 1 72  ? -6.195  -11.220 -28.805 1.00 19.42  ? 942  SER A H     1 
ATOM   756  H  HA    . SER A 1 72  ? -6.741  -12.262 -26.340 1.00 21.16  ? 942  SER A HA    1 
ATOM   757  H  HB2   . SER A 1 72  ? -7.055  -13.687 -28.771 1.00 23.38  ? 942  SER A HB2   1 
ATOM   758  H  HB3   . SER A 1 72  ? -7.231  -14.330 -27.328 1.00 23.38  ? 942  SER A HB3   1 
ATOM   759  H  HG    . SER A 1 72  ? -8.762  -12.385 -27.523 1.00 23.36  ? 942  SER A HG    1 
ATOM   760  N  N     . ILE A 1 73  ? -4.654  -13.513 -26.089 1.00 20.13  ? 943  ILE A N     1 
ATOM   761  C  CA    . ILE A 1 73  ? -3.361  -14.157 -25.947 1.00 22.17  ? 943  ILE A CA    1 
ATOM   762  C  C     . ILE A 1 73  ? -3.603  -15.601 -25.554 1.00 21.34  ? 943  ILE A C     1 
ATOM   763  O  O     . ILE A 1 73  ? -4.405  -15.867 -24.664 1.00 19.41  ? 943  ILE A O     1 
ATOM   764  C  CB    . ILE A 1 73  ? -2.546  -13.438 -24.884 1.00 21.76  ? 943  ILE A CB    1 
ATOM   765  C  CG1   . ILE A 1 73  ? -2.206  -12.042 -25.420 1.00 22.15  ? 943  ILE A CG1   1 
ATOM   766  C  CG2   . ILE A 1 73  ? -1.292  -14.249 -24.534 1.00 26.05  ? 943  ILE A CG2   1 
ATOM   767  C  CD1   . ILE A 1 73  ? -1.993  -11.046 -24.368 1.00 36.78  ? 943  ILE A CD1   1 
ATOM   768  H  H     . ILE A 1 73  ? -5.141  -13.548 -25.381 1.00 24.16  ? 943  ILE A H     1 
ATOM   769  H  HA    . ILE A 1 73  ? -2.875  -14.131 -26.798 1.00 26.60  ? 943  ILE A HA    1 
ATOM   770  H  HB    . ILE A 1 73  ? -3.089  -13.342 -24.086 1.00 26.11  ? 943  ILE A HB    1 
ATOM   771  H  HG12  . ILE A 1 73  ? -1.393  -12.098 -25.946 1.00 26.58  ? 943  ILE A HG12  1 
ATOM   772  H  HG13  . ILE A 1 73  ? -2.938  -11.734 -25.977 1.00 26.58  ? 943  ILE A HG13  1 
ATOM   773  H  HG21  . ILE A 1 73  ? -1.559  -15.108 -24.200 1.00 31.26  ? 943  ILE A HG21  1 
ATOM   774  H  HG22  . ILE A 1 73  ? -0.758  -14.355 -25.324 1.00 31.26  ? 943  ILE A HG22  1 
ATOM   775  H  HG23  . ILE A 1 73  ? -0.793  -13.777 -23.862 1.00 31.26  ? 943  ILE A HG23  1 
ATOM   776  H  HD11  . ILE A 1 73  ? -1.264  -11.330 -23.813 1.00 44.14  ? 943  ILE A HD11  1 
ATOM   777  H  HD12  . ILE A 1 73  ? -1.786  -10.202 -24.776 1.00 44.14  ? 943  ILE A HD12  1 
ATOM   778  H  HD13  . ILE A 1 73  ? -2.794  -10.970 -23.844 1.00 44.14  ? 943  ILE A HD13  1 
ATOM   779  N  N     . TYR A 1 74  ? -2.949  -16.538 -26.243 1.00 16.91  ? 944  TYR A N     1 
ATOM   780  C  CA    . TYR A 1 74  ? -3.200  -17.957 -25.993 1.00 20.89  ? 944  TYR A CA    1 
ATOM   781  C  C     . TYR A 1 74  ? -1.980  -18.622 -25.342 1.00 24.07  ? 944  TYR A C     1 
ATOM   782  O  O     . TYR A 1 74  ? -1.017  -18.963 -26.024 1.00 25.30  ? 944  TYR A O     1 
ATOM   783  C  CB    . TYR A 1 74  ? -3.577  -18.644 -27.312 1.00 25.15  ? 944  TYR A CB    1 
ATOM   784  C  CG    . TYR A 1 74  ? -4.787  -18.008 -27.993 1.00 21.76  ? 944  TYR A CG    1 
ATOM   785  C  CD1   . TYR A 1 74  ? -6.089  -18.309 -27.577 1.00 20.04  ? 944  TYR A CD1   1 
ATOM   786  C  CD2   . TYR A 1 74  ? -4.627  -17.096 -29.027 1.00 21.70  ? 944  TYR A CD2   1 
ATOM   787  C  CE1   . TYR A 1 74  ? -7.192  -17.724 -28.189 1.00 21.93  ? 944  TYR A CE1   1 
ATOM   788  C  CE2   . TYR A 1 74  ? -5.720  -16.513 -29.645 1.00 23.26  ? 944  TYR A CE2   1 
ATOM   789  C  CZ    . TYR A 1 74  ? -6.995  -16.827 -29.230 1.00 21.57  ? 944  TYR A CZ    1 
ATOM   790  O  OH    . TYR A 1 74  ? -8.081  -16.238 -29.858 1.00 20.69  ? 944  TYR A OH    1 
ATOM   791  H  H     . TYR A 1 74  ? -2.363  -16.380 -26.853 1.00 20.30  ? 944  TYR A H     1 
ATOM   792  H  HA    . TYR A 1 74  ? -3.958  -18.044 -25.378 1.00 25.07  ? 944  TYR A HA    1 
ATOM   793  H  HB2   . TYR A 1 74  ? -2.826  -18.587 -27.923 1.00 30.18  ? 944  TYR A HB2   1 
ATOM   794  H  HB3   . TYR A 1 74  ? -3.789  -19.574 -27.134 1.00 30.18  ? 944  TYR A HB3   1 
ATOM   795  H  HD1   . TYR A 1 74  ? -6.218  -18.914 -26.882 1.00 24.05  ? 944  TYR A HD1   1 
ATOM   796  H  HD2   . TYR A 1 74  ? -3.770  -16.882 -29.317 1.00 26.04  ? 944  TYR A HD2   1 
ATOM   797  H  HE1   . TYR A 1 74  ? -8.053  -17.938 -27.909 1.00 26.32  ? 944  TYR A HE1   1 
ATOM   798  H  HE2   . TYR A 1 74  ? -5.593  -15.910 -30.341 1.00 27.91  ? 944  TYR A HE2   1 
ATOM   799  H  HH    . TYR A 1 74  ? -8.520  -15.808 -29.315 1.00 24.83  ? 944  TYR A HH    1 
ATOM   800  N  N     . LEU A 1 75  ? -2.018  -18.783 -24.019 1.00 18.28  ? 945  LEU A N     1 
ATOM   801  C  CA    . LEU A 1 75  ? -0.872  -19.311 -23.280 1.00 17.02  ? 945  LEU A CA    1 
ATOM   802  C  C     . LEU A 1 75  ? -0.942  -20.825 -23.242 1.00 19.97  ? 945  LEU A C     1 
ATOM   803  O  O     . LEU A 1 75  ? -2.024  -21.396 -23.140 1.00 22.28  ? 945  LEU A O     1 
ATOM   804  C  CB    . LEU A 1 75  ? -0.860  -18.785 -21.835 1.00 16.51  ? 945  LEU A CB    1 
ATOM   805  C  CG    . LEU A 1 75  ? -0.760  -17.262 -21.701 1.00 18.76  ? 945  LEU A CG    1 
ATOM   806  C  CD1   . LEU A 1 75  ? -0.621  -16.896 -20.223 1.00 23.60  ? 945  LEU A CD1   1 
ATOM   807  C  CD2   . LEU A 1 75  ? 0.416   -16.703 -22.521 1.00 23.49  ? 945  LEU A CD2   1 
ATOM   808  H  H     . LEU A 1 75  ? -2.697  -18.594 -23.526 1.00 21.94  ? 945  LEU A H     1 
ATOM   809  H  HA    . LEU A 1 75  ? -0.039  -19.043 -23.721 1.00 20.42  ? 945  LEU A HA    1 
ATOM   810  H  HB2   . LEU A 1 75  ? -1.680  -19.064 -21.398 1.00 19.81  ? 945  LEU A HB2   1 
ATOM   811  H  HB3   . LEU A 1 75  ? -0.099  -19.170 -21.373 1.00 19.81  ? 945  LEU A HB3   1 
ATOM   812  H  HG    . LEU A 1 75  ? -1.577  -16.860 -22.035 1.00 22.51  ? 945  LEU A HG    1 
ATOM   813  H  HD11  . LEU A 1 75  ? -0.558  -15.941 -20.142 1.00 28.32  ? 945  LEU A HD11  1 
ATOM   814  H  HD12  . LEU A 1 75  ? -1.392  -17.215 -19.749 1.00 28.32  ? 945  LEU A HD12  1 
ATOM   815  H  HD13  . LEU A 1 75  ? 0.173   -17.307 -19.873 1.00 28.32  ? 945  LEU A HD13  1 
ATOM   816  H  HD21  . LEU A 1 75  ? 1.232   -17.095 -22.203 1.00 28.18  ? 945  LEU A HD21  1 
ATOM   817  H  HD22  . LEU A 1 75  ? 0.284   -16.924 -23.446 1.00 28.18  ? 945  LEU A HD22  1 
ATOM   818  H  HD23  . LEU A 1 75  ? 0.446   -15.749 -22.412 1.00 28.18  ? 945  LEU A HD23  1 
ATOM   819  N  N     . GLU A 1 76  ? 0.220   -21.459 -23.315 1.00 20.04  ? 946  GLU A N     1 
ATOM   820  C  CA    . GLU A 1 76  ? 0.322   -22.915 -23.235 1.00 28.52  ? 946  GLU A CA    1 
ATOM   821  C  C     . GLU A 1 76  ? 1.321   -23.324 -22.154 1.00 36.35  ? 946  GLU A C     1 
ATOM   822  O  O     . GLU A 1 76  ? 1.063   -24.234 -21.365 1.00 37.03  ? 946  GLU A O     1 
ATOM   823  C  CB    . GLU A 1 76  ? 0.752   -23.482 -24.592 1.00 29.32  ? 946  GLU A CB    1 
ATOM   824  C  CG    . GLU A 1 76  ? -0.230  -23.144 -25.719 1.00 38.55  ? 946  GLU A CG    1 
ATOM   825  C  CD    . GLU A 1 76  ? 0.189   -23.658 -27.096 1.00 58.45  ? 946  GLU A CD    1 
ATOM   826  O  OE1   . GLU A 1 76  ? 1.328   -23.369 -27.550 1.00 43.84  ? 946  GLU A OE1   1 
ATOM   827  O  OE2   . GLU A 1 76  ? -0.646  -24.347 -27.729 1.00 38.35  ? 946  GLU A OE2   1 
ATOM   828  H  H     . GLU A 1 76  ? 0.977   -21.064 -23.413 1.00 24.05  ? 946  GLU A H     1 
ATOM   829  H  HA    . GLU A 1 76  ? -0.554  -23.291 -23.006 1.00 34.22  ? 946  GLU A HA    1 
ATOM   830  H  HB2   . GLU A 1 76  ? 1.617   -23.114 -24.829 1.00 35.18  ? 946  GLU A HB2   1 
ATOM   831  H  HB3   . GLU A 1 76  ? 0.810   -24.448 -24.526 1.00 35.18  ? 946  GLU A HB3   1 
ATOM   832  H  HG2   . GLU A 1 76  ? -1.092  -23.535 -25.508 1.00 46.26  ? 946  GLU A HG2   1 
ATOM   833  H  HG3   . GLU A 1 76  ? -0.315  -22.179 -25.778 1.00 46.26  ? 946  GLU A HG3   1 
ATOM   834  N  N     . ASN A 1 77  ? 2.456   -22.634 -22.127 1.00 29.48  ? 947  ASN A N     1 
ATOM   835  C  CA    . ASN A 1 77  ? 3.561   -22.958 -21.233 1.00 38.26  ? 947  ASN A CA    1 
ATOM   836  C  C     . ASN A 1 77  ? 3.808   -21.825 -20.242 1.00 30.38  ? 947  ASN A C     1 
ATOM   837  O  O     . ASN A 1 77  ? 3.430   -20.685 -20.486 1.00 26.11  ? 947  ASN A O     1 
ATOM   838  C  CB    . ASN A 1 77  ? 4.839   -23.180 -22.046 1.00 35.92  ? 947  ASN A CB    1 
ATOM   839  C  CG    . ASN A 1 77  ? 4.658   -24.190 -23.168 1.00 51.79  ? 947  ASN A CG    1 
ATOM   840  O  OD1   . ASN A 1 77  ? 4.406   -25.371 -22.930 1.00 46.09  ? 947  ASN A OD1   1 
ATOM   841  N  ND2   . ASN A 1 77  ? 4.809   -23.729 -24.401 1.00 41.10  ? 947  ASN A ND2   1 
ATOM   842  H  H     . ASN A 1 77  ? 2.613   -21.955 -22.632 1.00 35.38  ? 947  ASN A H     1 
ATOM   843  H  HA    . ASN A 1 77  ? 3.357   -23.776 -20.734 1.00 45.91  ? 947  ASN A HA    1 
ATOM   844  H  HB2   . ASN A 1 77  ? 5.111   -22.338 -22.442 1.00 43.11  ? 947  ASN A HB2   1 
ATOM   845  H  HB3   . ASN A 1 77  ? 5.535   -23.510 -21.456 1.00 43.11  ? 947  ASN A HB3   1 
ATOM   846  H  HD21  . ASN A 1 77  ? 4.718   -24.259 -25.072 1.00 49.32  ? 947  ASN A HD21  1 
ATOM   847  H  HD22  . ASN A 1 77  ? 5.000   -22.901 -24.530 1.00 49.32  ? 947  ASN A HD22  1 
ATOM   848  N  N     . LYS A 1 78  ? 4.465   -22.132 -19.132 1.00 29.53  ? 948  LYS A N     1 
ATOM   849  C  CA    . LYS A 1 78  ? 4.825   -21.105 -18.166 1.00 29.19  ? 948  LYS A CA    1 
ATOM   850  C  C     . LYS A 1 78  ? 5.646   -20.001 -18.836 1.00 26.98  ? 948  LYS A C     1 
ATOM   851  O  O     . LYS A 1 78  ? 5.430   -18.822 -18.586 1.00 27.93  ? 948  LYS A O     1 
ATOM   852  C  CB    . LYS A 1 78  ? 5.605   -21.729 -17.008 1.00 40.08  ? 948  LYS A CB    1 
ATOM   853  C  CG    . LYS A 1 78  ? 6.136   -20.739 -15.988 1.00 46.24  ? 948  LYS A CG    1 
ATOM   854  C  CD    . LYS A 1 78  ? 6.822   -21.480 -14.844 1.00 71.43  ? 948  LYS A CD    1 
ATOM   855  C  CE    . LYS A 1 78  ? 7.645   -20.548 -13.980 1.00 91.07  ? 948  LYS A CE    1 
ATOM   856  N  NZ    . LYS A 1 78  ? 6.775   -19.622 -13.232 1.00 99.29  ? 948  LYS A NZ    1 
ATOM   857  H  H     . LYS A 1 78  ? 4.714   -22.926 -18.915 1.00 35.43  ? 948  LYS A H     1 
ATOM   858  H  HA    . LYS A 1 78  ? 4.008   -20.702 -17.803 1.00 35.03  ? 948  LYS A HA    1 
ATOM   859  H  HB2   . LYS A 1 78  ? 5.022   -22.347 -16.541 1.00 48.10  ? 948  LYS A HB2   1 
ATOM   860  H  HB3   . LYS A 1 78  ? 6.365   -22.210 -17.372 1.00 48.10  ? 948  LYS A HB3   1 
ATOM   861  H  HG2   . LYS A 1 78  ? 6.786   -20.155 -16.411 1.00 55.49  ? 948  LYS A HG2   1 
ATOM   862  H  HG3   . LYS A 1 78  ? 5.401   -20.222 -15.624 1.00 55.49  ? 948  LYS A HG3   1 
ATOM   863  H  HD2   . LYS A 1 78  ? 6.148   -21.896 -14.284 1.00 85.71  ? 948  LYS A HD2   1 
ATOM   864  H  HD3   . LYS A 1 78  ? 7.415   -22.155 -15.211 1.00 85.71  ? 948  LYS A HD3   1 
ATOM   865  H  HE2   . LYS A 1 78  ? 8.158   -21.068 -13.343 1.00 109.28 ? 948  LYS A HE2   1 
ATOM   866  H  HE3   . LYS A 1 78  ? 8.236   -20.024 -14.544 1.00 109.28 ? 948  LYS A HE3   1 
ATOM   867  H  HZ1   . LYS A 1 78  ? 7.270   -19.080 -12.729 1.00 119.15 ? 948  LYS A HZ1   1 
ATOM   868  H  HZ2   . LYS A 1 78  ? 6.294   -19.132 -13.799 1.00 119.15 ? 948  LYS A HZ2   1 
ATOM   869  H  HZ3   . LYS A 1 78  ? 6.224   -20.081 -12.706 1.00 119.15 ? 948  LYS A HZ3   1 
ATOM   870  N  N     . ARG A 1 79  ? 6.570   -20.380 -19.711 1.00 26.19  ? 949  ARG A N     1 
ATOM   871  C  CA    . ARG A 1 79  ? 7.423   -19.396 -20.369 1.00 44.07  ? 949  ARG A CA    1 
ATOM   872  C  C     . ARG A 1 79  ? 6.600   -18.409 -21.188 1.00 38.70  ? 949  ARG A C     1 
ATOM   873  O  O     . ARG A 1 79  ? 6.979   -17.248 -21.319 1.00 29.18  ? 949  ARG A O     1 
ATOM   874  C  CB    . ARG A 1 79  ? 8.501   -20.064 -21.243 1.00 58.52  ? 949  ARG A CB    1 
ATOM   875  C  CG    . ARG A 1 79  ? 8.008   -20.922 -22.414 1.00 77.25  ? 949  ARG A CG    1 
ATOM   876  C  CD    . ARG A 1 79  ? 9.209   -21.516 -23.163 1.00 93.87  ? 949  ARG A CD    1 
ATOM   877  N  NE    . ARG A 1 79  ? 8.846   -22.382 -24.287 1.00 102.37 ? 949  ARG A NE    1 
ATOM   878  C  CZ    . ARG A 1 79  ? 8.565   -23.681 -24.183 1.00 100.76 ? 949  ARG A CZ    1 
ATOM   879  N  NH1   . ARG A 1 79  ? 8.582   -24.281 -22.996 1.00 106.41 ? 949  ARG A NH1   1 
ATOM   880  N  NH2   . ARG A 1 79  ? 8.255   -24.385 -25.269 1.00 91.39  ? 949  ARG A NH2   1 
ATOM   881  H  H     . ARG A 1 79  ? 6.723   -21.195 -19.941 1.00 31.43  ? 949  ARG A H     1 
ATOM   882  H  HA    . ARG A 1 79  ? 7.888   -18.882 -19.676 1.00 52.88  ? 949  ARG A HA    1 
ATOM   883  H  HB2   . ARG A 1 79  ? 9.063   -19.366 -21.616 1.00 70.22  ? 949  ARG A HB2   1 
ATOM   884  H  HB3   . ARG A 1 79  ? 9.039   -20.637 -20.675 1.00 70.22  ? 949  ARG A HB3   1 
ATOM   885  H  HG2   . ARG A 1 79  ? 7.462   -21.649 -22.077 1.00 92.70  ? 949  ARG A HG2   1 
ATOM   886  H  HG3   . ARG A 1 79  ? 7.501   -20.371 -23.030 1.00 92.70  ? 949  ARG A HG3   1 
ATOM   887  H  HD2   . ARG A 1 79  ? 9.749   -20.790 -23.512 1.00 112.65 ? 949  ARG A HD2   1 
ATOM   888  H  HD3   . ARG A 1 79  ? 9.734   -22.045 -22.541 1.00 112.65 ? 949  ARG A HD3   1 
ATOM   889  H  HE    . ARG A 1 79  ? 8.811   -22.027 -25.070 1.00 122.85 ? 949  ARG A HE    1 
ATOM   890  H  HH11  . ARG A 1 79  ? 8.784   -23.833 -22.291 1.00 127.69 ? 949  ARG A HH11  1 
ATOM   891  H  HH12  . ARG A 1 79  ? 8.397   -25.119 -22.936 1.00 127.69 ? 949  ARG A HH12  1 
ATOM   892  H  HH21  . ARG A 1 79  ? 8.238   -24.002 -26.039 1.00 109.67 ? 949  ARG A HH21  1 
ATOM   893  H  HH22  . ARG A 1 79  ? 8.067   -25.221 -25.201 1.00 109.67 ? 949  ARG A HH22  1 
ATOM   894  N  N     . ASP A 1 80  ? 5.473   -18.863 -21.730 1.00 27.89  ? 950  ASP A N     1 
ATOM   895  C  CA    . ASP A 1 80  ? 4.617   -17.989 -22.533 1.00 26.26  ? 950  ASP A CA    1 
ATOM   896  C  C     . ASP A 1 80  ? 4.161   -16.770 -21.738 1.00 24.99  ? 950  ASP A C     1 
ATOM   897  O  O     . ASP A 1 80  ? 4.061   -15.671 -22.279 1.00 24.43  ? 950  ASP A O     1 
ATOM   898  C  CB    . ASP A 1 80  ? 3.373   -18.732 -23.029 1.00 30.75  ? 950  ASP A CB    1 
ATOM   899  C  CG    . ASP A 1 80  ? 3.699   -19.845 -24.001 1.00 37.68  ? 950  ASP A CG    1 
ATOM   900  O  OD1   . ASP A 1 80  ? 4.819   -19.862 -24.541 1.00 39.89  ? 950  ASP A OD1   1 
ATOM   901  O  OD2   . ASP A 1 80  ? 2.820   -20.698 -24.234 1.00 28.79  ? 950  ASP A OD2   1 
ATOM   902  H  H     . ASP A 1 80  ? 5.182   -19.668 -21.650 1.00 33.47  ? 950  ASP A H     1 
ATOM   903  H  HA    . ASP A 1 80  ? 5.119   -17.676 -23.314 1.00 31.51  ? 950  ASP A HA    1 
ATOM   904  H  HB2   . ASP A 1 80  ? 2.915   -19.123 -22.269 1.00 36.89  ? 950  ASP A HB2   1 
ATOM   905  H  HB3   . ASP A 1 80  ? 2.789   -18.102 -23.480 1.00 36.89  ? 950  ASP A HB3   1 
ATOM   906  N  N     . ALA A 1 81  ? 3.854   -16.977 -20.459 1.00 25.19  ? 951  ALA A N     1 
ATOM   907  C  CA    . ALA A 1 81  ? 3.317   -15.909 -19.618 1.00 27.28  ? 951  ALA A CA    1 
ATOM   908  C  C     . ALA A 1 81  ? 4.353   -14.821 -19.340 1.00 28.34  ? 951  ALA A C     1 
ATOM   909  O  O     . ALA A 1 81  ? 3.996   -13.664 -19.109 1.00 26.09  ? 951  ALA A O     1 
ATOM   910  C  CB    . ALA A 1 81  ? 2.801   -16.485 -18.317 1.00 28.64  ? 951  ALA A CB    1 
ATOM   911  H  H     . ALA A 1 81  ? 3.948   -17.730 -20.053 1.00 30.23  ? 951  ALA A H     1 
ATOM   912  H  HA    . ALA A 1 81  ? 2.561   -15.492 -20.082 1.00 32.74  ? 951  ALA A HA    1 
ATOM   913  H  HB1   . ALA A 1 81  ? 2.107   -17.120 -18.510 1.00 34.37  ? 951  ALA A HB1   1 
ATOM   914  H  HB2   . ALA A 1 81  ? 3.524   -16.920 -17.859 1.00 34.37  ? 951  ALA A HB2   1 
ATOM   915  H  HB3   . ALA A 1 81  ? 2.452   -15.773 -17.777 1.00 34.37  ? 951  ALA A HB3   1 
ATOM   916  N  N     . PHE A 1 82  ? 5.631   -15.190 -19.381 1.00 26.74  ? 952  PHE A N     1 
ATOM   917  C  CA    . PHE A 1 82  ? 6.715   -14.255 -19.068 1.00 35.90  ? 952  PHE A CA    1 
ATOM   918  C  C     . PHE A 1 82  ? 7.380   -13.692 -20.330 1.00 40.67  ? 952  PHE A C     1 
ATOM   919  O  O     . PHE A 1 82  ? 8.426   -13.053 -20.265 1.00 40.70  ? 952  PHE A O     1 
ATOM   920  C  CB    . PHE A 1 82  ? 7.740   -14.939 -18.152 1.00 31.76  ? 952  PHE A CB    1 
ATOM   921  C  CG    . PHE A 1 82  ? 7.186   -15.281 -16.794 1.00 29.17  ? 952  PHE A CG    1 
ATOM   922  C  CD1   . PHE A 1 82  ? 7.399   -14.447 -15.705 1.00 26.53  ? 952  PHE A CD1   1 
ATOM   923  C  CD2   . PHE A 1 82  ? 6.415   -16.415 -16.617 1.00 39.83  ? 952  PHE A CD2   1 
ATOM   924  C  CE1   . PHE A 1 82  ? 6.868   -14.753 -14.467 1.00 28.92  ? 952  PHE A CE1   1 
ATOM   925  C  CE2   . PHE A 1 82  ? 5.885   -16.727 -15.378 1.00 42.61  ? 952  PHE A CE2   1 
ATOM   926  C  CZ    . PHE A 1 82  ? 6.110   -15.899 -14.303 1.00 32.19  ? 952  PHE A CZ    1 
ATOM   927  H  H     . PHE A 1 82  ? 5.901   -15.980 -19.588 1.00 32.09  ? 952  PHE A H     1 
ATOM   928  H  HA    . PHE A 1 82  ? 6.337   -13.498 -18.573 1.00 43.08  ? 952  PHE A HA    1 
ATOM   929  H  HB2   . PHE A 1 82  ? 8.036   -15.762 -18.570 1.00 38.12  ? 952  PHE A HB2   1 
ATOM   930  H  HB3   . PHE A 1 82  ? 8.495   -14.343 -18.024 1.00 38.12  ? 952  PHE A HB3   1 
ATOM   931  H  HD1   . PHE A 1 82  ? 7.908   -13.675 -15.809 1.00 31.84  ? 952  PHE A HD1   1 
ATOM   932  H  HD2   . PHE A 1 82  ? 6.259   -16.980 -17.338 1.00 47.80  ? 952  PHE A HD2   1 
ATOM   933  H  HE1   . PHE A 1 82  ? 7.025   -14.192 -13.742 1.00 34.71  ? 952  PHE A HE1   1 
ATOM   934  H  HE2   . PHE A 1 82  ? 5.375   -17.498 -15.271 1.00 51.13  ? 952  PHE A HE2   1 
ATOM   935  H  HZ    . PHE A 1 82  ? 5.755   -16.109 -13.469 1.00 38.63  ? 952  PHE A HZ    1 
ATOM   936  N  N     . PHE A 1 83  ? 6.756   -13.935 -21.477 1.00 33.58  ? 953  PHE A N     1 
ATOM   937  C  CA    . PHE A 1 83  ? 7.210   -13.376 -22.746 1.00 34.60  ? 953  PHE A CA    1 
ATOM   938  C  C     . PHE A 1 83  ? 7.041   -11.854 -22.706 1.00 33.34  ? 953  PHE A C     1 
ATOM   939  O  O     . PHE A 1 83  ? 5.924   -11.358 -22.571 1.00 33.23  ? 953  PHE A O     1 
ATOM   940  C  CB    . PHE A 1 83  ? 6.365   -13.978 -23.867 1.00 38.28  ? 953  PHE A CB    1 
ATOM   941  C  CG    . PHE A 1 83  ? 6.862   -13.679 -25.252 1.00 38.03  ? 953  PHE A CG    1 
ATOM   942  C  CD1   . PHE A 1 83  ? 8.205   -13.798 -25.572 1.00 41.94  ? 953  PHE A CD1   1 
ATOM   943  C  CD2   . PHE A 1 83  ? 5.966   -13.325 -26.251 1.00 30.98  ? 953  PHE A CD2   1 
ATOM   944  C  CE1   . PHE A 1 83  ? 8.652   -13.537 -26.864 1.00 41.21  ? 953  PHE A CE1   1 
ATOM   945  C  CE2   . PHE A 1 83  ? 6.405   -13.066 -27.539 1.00 37.83  ? 953  PHE A CE2   1 
ATOM   946  C  CZ    . PHE A 1 83  ? 7.751   -13.175 -27.844 1.00 39.73  ? 953  PHE A CZ    1 
ATOM   947  H  H     . PHE A 1 83  ? 6.056   -14.429 -21.548 1.00 40.30  ? 953  PHE A H     1 
ATOM   948  H  HA    . PHE A 1 83  ? 8.154   -13.594 -22.897 1.00 41.52  ? 953  PHE A HA    1 
ATOM   949  H  HB2   . PHE A 1 83  ? 6.352   -14.942 -23.761 1.00 45.94  ? 953  PHE A HB2   1 
ATOM   950  H  HB3   . PHE A 1 83  ? 5.463   -13.630 -23.796 1.00 45.94  ? 953  PHE A HB3   1 
ATOM   951  H  HD1   . PHE A 1 83  ? 8.816   -14.041 -24.914 1.00 50.33  ? 953  PHE A HD1   1 
ATOM   952  H  HD2   . PHE A 1 83  ? 5.061   -13.251 -26.051 1.00 37.18  ? 953  PHE A HD2   1 
ATOM   953  H  HE1   . PHE A 1 83  ? 9.557   -13.610 -27.067 1.00 49.45  ? 953  PHE A HE1   1 
ATOM   954  H  HE2   . PHE A 1 83  ? 5.797   -12.821 -28.199 1.00 45.39  ? 953  PHE A HE2   1 
ATOM   955  H  HZ    . PHE A 1 83  ? 8.048   -12.999 -28.707 1.00 47.68  ? 953  PHE A HZ    1 
ATOM   956  N  N     . PRO A 1 84  ? 8.148   -11.103 -22.813 1.00 34.39  ? 954  PRO A N     1 
ATOM   957  C  CA    . PRO A 1 84  ? 8.087   -9.641  -22.654 1.00 29.95  ? 954  PRO A CA    1 
ATOM   958  C  C     . PRO A 1 84  ? 7.057   -8.896  -23.519 1.00 35.07  ? 954  PRO A C     1 
ATOM   959  O  O     . PRO A 1 84  ? 6.385   -8.013  -22.988 1.00 35.72  ? 954  PRO A O     1 
ATOM   960  C  CB    . PRO A 1 84  ? 9.512   -9.200  -23.003 1.00 35.48  ? 954  PRO A CB    1 
ATOM   961  C  CG    . PRO A 1 84  ? 10.348  -10.356 -22.578 1.00 40.52  ? 954  PRO A CG    1 
ATOM   962  C  CD    . PRO A 1 84  ? 9.539   -11.575 -22.945 1.00 37.82  ? 954  PRO A CD    1 
ATOM   963  H  HA    . PRO A 1 84  ? 7.916   -9.423  -21.714 1.00 35.94  ? 954  PRO A HA    1 
ATOM   964  H  HB2   . PRO A 1 84  ? 9.587   -9.048  -23.958 1.00 42.57  ? 954  PRO A HB2   1 
ATOM   965  H  HB3   . PRO A 1 84  ? 9.743   -8.401  -22.503 1.00 42.57  ? 954  PRO A HB3   1 
ATOM   966  H  HG2   . PRO A 1 84  ? 11.190  -10.345 -23.060 1.00 48.62  ? 954  PRO A HG2   1 
ATOM   967  H  HG3   . PRO A 1 84  ? 10.498  -10.318 -21.621 1.00 48.62  ? 954  PRO A HG3   1 
ATOM   968  H  HD2   . PRO A 1 84  ? 9.722   -11.842 -23.859 1.00 45.38  ? 954  PRO A HD2   1 
ATOM   969  H  HD3   . PRO A 1 84  ? 9.712   -12.297 -22.321 1.00 45.38  ? 954  PRO A HD3   1 
ATOM   970  N  N     . PRO A 1 85  ? 6.939   -9.222  -24.817 1.00 32.59  ? 955  PRO A N     1 
ATOM   971  C  CA    . PRO A 1 85  ? 5.960   -8.509  -25.657 1.00 31.90  ? 955  PRO A CA    1 
ATOM   972  C  C     . PRO A 1 85  ? 4.511   -8.635  -25.188 1.00 37.68  ? 955  PRO A C     1 
ATOM   973  O  O     . PRO A 1 85  ? 3.629   -7.935  -25.688 1.00 32.45  ? 955  PRO A O     1 
ATOM   974  C  CB    . PRO A 1 85  ? 6.119   -9.180  -27.020 1.00 38.40  ? 955  PRO A CB    1 
ATOM   975  C  CG    . PRO A 1 85  ? 7.531   -9.639  -27.040 1.00 37.15  ? 955  PRO A CG    1 
ATOM   976  C  CD    . PRO A 1 85  ? 7.829   -10.077 -25.627 1.00 34.39  ? 955  PRO A CD    1 
ATOM   977  H  HA    . PRO A 1 85  ? 6.198   -7.562  -25.730 1.00 38.28  ? 955  PRO A HA    1 
ATOM   978  H  HB2   . PRO A 1 85  ? 5.510   -9.932  -27.091 1.00 46.08  ? 955  PRO A HB2   1 
ATOM   979  H  HB3   . PRO A 1 85  ? 5.955   -8.535  -27.726 1.00 46.08  ? 955  PRO A HB3   1 
ATOM   980  H  HG2   . PRO A 1 85  ? 7.624   -10.384 -27.656 1.00 44.58  ? 955  PRO A HG2   1 
ATOM   981  H  HG3   . PRO A 1 85  ? 8.110   -8.905  -27.300 1.00 44.58  ? 955  PRO A HG3   1 
ATOM   982  H  HD2   . PRO A 1 85  ? 7.602   -11.012 -25.506 1.00 41.27  ? 955  PRO A HD2   1 
ATOM   983  H  HD3   . PRO A 1 85  ? 8.758   -9.904  -25.407 1.00 41.27  ? 955  PRO A HD3   1 
ATOM   984  N  N     . LEU A 1 86  ? 4.260   -9.531  -24.248 1.00 29.19  ? 956  LEU A N     1 
ATOM   985  C  CA    . LEU A 1 86  ? 2.918   -9.723  -23.738 1.00 29.52  ? 956  LEU A CA    1 
ATOM   986  C  C     . LEU A 1 86  ? 2.479   -8.454  -23.007 1.00 25.91  ? 956  LEU A C     1 
ATOM   987  O  O     . LEU A 1 86  ? 1.360   -7.947  -23.179 1.00 23.36  ? 956  LEU A O     1 
ATOM   988  C  CB    . LEU A 1 86  ? 2.934   -10.937 -22.810 1.00 39.20  ? 956  LEU A CB    1 
ATOM   989  C  CG    . LEU A 1 86  ? 1.676   -11.336 -22.062 1.00 41.50  ? 956  LEU A CG    1 
ATOM   990  C  CD1   . LEU A 1 86  ? 0.499   -11.320 -22.973 1.00 40.43  ? 956  LEU A CD1   1 
ATOM   991  C  CD2   . LEU A 1 86  ? 1.859   -12.725 -21.474 1.00 32.96  ? 956  LEU A CD2   1 
ATOM   992  H  H     . LEU A 1 86  ? 4.852   -10.041 -23.888 1.00 35.02  ? 956  LEU A H     1 
ATOM   993  H  HA    . LEU A 1 86  ? 2.300   -9.896  -24.479 1.00 35.42  ? 956  LEU A HA    1 
ATOM   994  H  HB2   . LEU A 1 86  ? 3.193   -11.706 -23.342 1.00 47.04  ? 956  LEU A HB2   1 
ATOM   995  H  HB3   . LEU A 1 86  ? 3.615   -10.780 -22.138 1.00 47.04  ? 956  LEU A HB3   1 
ATOM   996  H  HG    . LEU A 1 86  ? 1.515   -10.711 -21.338 1.00 49.80  ? 956  LEU A HG    1 
ATOM   997  H  HD11  . LEU A 1 86  ? 0.389   -10.434 -23.326 1.00 48.52  ? 956  LEU A HD11  1 
ATOM   998  H  HD12  . LEU A 1 86  ? 0.651   -11.942 -23.689 1.00 48.52  ? 956  LEU A HD12  1 
ATOM   999  H  HD13  . LEU A 1 86  ? -0.283  -11.576 -22.478 1.00 48.52  ? 956  LEU A HD13  1 
ATOM   1000 H  HD21  . LEU A 1 86  ? 1.060   -12.972 -21.002 1.00 39.55  ? 956  LEU A HD21  1 
ATOM   1001 H  HD22  . LEU A 1 86  ? 2.024   -13.346 -22.187 1.00 39.55  ? 956  LEU A HD22  1 
ATOM   1002 H  HD23  . LEU A 1 86  ? 2.605   -12.712 -20.870 1.00 39.55  ? 956  LEU A HD23  1 
ATOM   1003 N  N     . HIS A 1 87  ? 3.391   -7.931  -22.202 1.00 25.12  ? 957  HIS A N     1 
ATOM   1004 C  CA    . HIS A 1 87  ? 3.177   -6.697  -21.475 1.00 30.20  ? 957  HIS A CA    1 
ATOM   1005 C  C     . HIS A 1 87  ? 2.816   -5.555  -22.432 1.00 27.97  ? 957  HIS A C     1 
ATOM   1006 O  O     . HIS A 1 87  ? 1.864   -4.802  -22.198 1.00 23.61  ? 957  HIS A O     1 
ATOM   1007 C  CB    . HIS A 1 87  ? 4.465   -6.370  -20.719 1.00 43.78  ? 957  HIS A CB    1 
ATOM   1008 C  CG    . HIS A 1 87  ? 4.359   -5.186  -19.816 1.00 45.59  ? 957  HIS A CG    1 
ATOM   1009 N  ND1   . HIS A 1 87  ? 5.456   -4.632  -19.193 1.00 51.31  ? 957  HIS A ND1   1 
ATOM   1010 C  CD2   . HIS A 1 87  ? 3.291   -4.452  -19.425 1.00 49.78  ? 957  HIS A CD2   1 
ATOM   1011 C  CE1   . HIS A 1 87  ? 5.069   -3.607  -18.456 1.00 52.90  ? 957  HIS A CE1   1 
ATOM   1012 N  NE2   . HIS A 1 87  ? 3.759   -3.476  -18.579 1.00 52.41  ? 957  HIS A NE2   1 
ATOM   1013 H  H     . HIS A 1 87  ? 4.162   -8.285  -22.059 1.00 30.15  ? 957  HIS A H     1 
ATOM   1014 H  HA    . HIS A 1 87  ? 2.450   -6.811  -20.828 1.00 36.24  ? 957  HIS A HA    1 
ATOM   1015 H  HB2   . HIS A 1 87  ? 4.711   -7.135  -20.176 1.00 52.53  ? 957  HIS A HB2   1 
ATOM   1016 H  HB3   . HIS A 1 87  ? 5.167   -6.187  -21.364 1.00 52.53  ? 957  HIS A HB3   1 
ATOM   1017 H  HD1   . HIS A 1 87  ? 6.266   -4.911  -19.270 1.00 61.58  ? 957  HIS A HD1   1 
ATOM   1018 H  HD2   . HIS A 1 87  ? 2.407   -4.584  -19.680 1.00 59.74  ? 957  HIS A HD2   1 
ATOM   1019 H  HE1   . HIS A 1 87  ? 5.623   -3.067  -17.939 1.00 63.48  ? 957  HIS A HE1   1 
ATOM   1020 H  HE2   . HIS A 1 87  ? 3.278   -2.876  -18.194 1.00 62.89  ? 957  HIS A HE2   1 
ATOM   1021 N  N     . GLN A 1 88  ? 3.564   -5.436  -23.524 1.00 27.96  ? 958  GLN A N     1 
ATOM   1022 C  CA    . GLN A 1 88  ? 3.346   -4.320  -24.440 1.00 31.01  ? 958  GLN A CA    1 
ATOM   1023 C  C     . GLN A 1 88  ? 2.044   -4.494  -25.232 1.00 25.87  ? 958  GLN A C     1 
ATOM   1024 O  O     . GLN A 1 88  ? 1.394   -3.518  -25.576 1.00 23.10  ? 958  GLN A O     1 
ATOM   1025 C  CB    . GLN A 1 88  ? 4.567   -4.088  -25.350 1.00 42.63  ? 958  GLN A CB    1 
ATOM   1026 C  CG    . GLN A 1 88  ? 4.976   -5.250  -26.241 1.00 68.41  ? 958  GLN A CG    1 
ATOM   1027 C  CD    . GLN A 1 88  ? 6.418   -5.116  -26.742 1.00 83.86  ? 958  GLN A CD    1 
ATOM   1028 O  OE1   . GLN A 1 88  ? 7.336   -4.864  -25.958 1.00 78.87  ? 958  GLN A OE1   1 
ATOM   1029 N  NE2   . GLN A 1 88  ? 6.616   -5.274  -28.045 1.00 86.47  ? 958  GLN A NE2   1 
ATOM   1030 H  H     . GLN A 1 88  ? 4.192   -5.977  -23.756 1.00 33.55  ? 958  GLN A H     1 
ATOM   1031 H  HA    . GLN A 1 88  ? 3.239   -3.509  -23.900 1.00 37.21  ? 958  GLN A HA    1 
ATOM   1032 H  HB2   . GLN A 1 88  ? 4.374   -3.335  -25.931 1.00 51.16  ? 958  GLN A HB2   1 
ATOM   1033 H  HB3   . GLN A 1 88  ? 5.328   -3.874  -24.789 1.00 51.16  ? 958  GLN A HB3   1 
ATOM   1034 H  HG2   . GLN A 1 88  ? 4.908   -6.076  -25.737 1.00 82.09  ? 958  GLN A HG2   1 
ATOM   1035 H  HG3   . GLN A 1 88  ? 4.390   -5.281  -27.013 1.00 82.09  ? 958  GLN A HG3   1 
ATOM   1036 H  HE21  . GLN A 1 88  ? 5.951   -5.442  -28.564 1.00 103.77 ? 958  GLN A HE21  1 
ATOM   1037 H  HE22  . GLN A 1 88  ? 7.409   -5.207  -28.371 1.00 103.77 ? 958  GLN A HE22  1 
ATOM   1038 N  N     . PHE A 1 89  ? 1.655   -5.739  -25.501 1.00 23.11  ? 959  PHE A N     1 
ATOM   1039 C  CA    . PHE A 1 89  ? 0.385   -6.018  -26.169 1.00 21.48  ? 959  PHE A CA    1 
ATOM   1040 C  C     . PHE A 1 89  ? -0.796  -5.539  -25.308 1.00 20.62  ? 959  PHE A C     1 
ATOM   1041 O  O     . PHE A 1 89  ? -1.729  -4.901  -25.808 1.00 21.26  ? 959  PHE A O     1 
ATOM   1042 C  CB    . PHE A 1 89  ? 0.264   -7.525  -26.460 1.00 24.75  ? 959  PHE A CB    1 
ATOM   1043 C  CG    . PHE A 1 89  ? -0.956  -7.912  -27.269 1.00 18.62  ? 959  PHE A CG    1 
ATOM   1044 C  CD1   . PHE A 1 89  ? -0.888  -8.016  -28.655 1.00 25.08  ? 959  PHE A CD1   1 
ATOM   1045 C  CD2   . PHE A 1 89  ? -2.166  -8.196  -26.642 1.00 20.86  ? 959  PHE A CD2   1 
ATOM   1046 C  CE1   . PHE A 1 89  ? -2.000  -8.377  -29.391 1.00 28.91  ? 959  PHE A CE1   1 
ATOM   1047 C  CE2   . PHE A 1 89  ? -3.281  -8.564  -27.374 1.00 24.77  ? 959  PHE A CE2   1 
ATOM   1048 C  CZ    . PHE A 1 89  ? -3.196  -8.657  -28.753 1.00 27.47  ? 959  PHE A CZ    1 
ATOM   1049 H  H     . PHE A 1 89  ? 2.110   -6.443  -25.305 1.00 27.73  ? 959  PHE A H     1 
ATOM   1050 H  HA    . PHE A 1 89  ? 0.357   -5.537  -27.023 1.00 25.77  ? 959  PHE A HA    1 
ATOM   1051 H  HB2   . PHE A 1 89  ? 1.048   -7.809  -26.956 1.00 29.71  ? 959  PHE A HB2   1 
ATOM   1052 H  HB3   . PHE A 1 89  ? 0.221   -8.001  -25.617 1.00 29.71  ? 959  PHE A HB3   1 
ATOM   1053 H  HD1   . PHE A 1 89  ? -0.088  -7.833  -29.091 1.00 30.10  ? 959  PHE A HD1   1 
ATOM   1054 H  HD2   . PHE A 1 89  ? -2.226  -8.137  -25.716 1.00 25.03  ? 959  PHE A HD2   1 
ATOM   1055 H  HE1   . PHE A 1 89  ? -1.943  -8.441  -30.317 1.00 34.69  ? 959  PHE A HE1   1 
ATOM   1056 H  HE2   . PHE A 1 89  ? -4.084  -8.746  -26.942 1.00 29.72  ? 959  PHE A HE2   1 
ATOM   1057 H  HZ    . PHE A 1 89  ? -3.944  -8.899  -29.250 1.00 32.96  ? 959  PHE A HZ    1 
ATOM   1058 N  N     . CYS A 1 90  ? -0.753  -5.837  -24.012 1.00 19.63  ? 960  CYS A N     1 
ATOM   1059 C  CA    . CYS A 1 90  ? -1.842  -5.472  -23.117 1.00 19.19  ? 960  CYS A CA    1 
ATOM   1060 C  C     . CYS A 1 90  ? -1.962  -3.957  -22.914 1.00 22.69  ? 960  CYS A C     1 
ATOM   1061 O  O     . CYS A 1 90  ? -3.067  -3.429  -22.825 1.00 19.13  ? 960  CYS A O     1 
ATOM   1062 C  CB    . CYS A 1 90  ? -1.647  -6.130  -21.759 1.00 17.11  ? 960  CYS A CB    1 
ATOM   1063 S  SG    . CYS A 1 90  ? -1.919  -7.922  -21.831 1.00 20.93  ? 960  CYS A SG    1 
ATOM   1064 H  H     . CYS A 1 90  ? -0.104  -6.251  -23.628 1.00 23.56  ? 960  CYS A H     1 
ATOM   1065 H  HA    . CYS A 1 90  ? -2.687  -5.795  -23.494 1.00 23.02  ? 960  CYS A HA    1 
ATOM   1066 H  HB2   . CYS A 1 90  ? -0.739  -5.974  -21.456 1.00 20.53  ? 960  CYS A HB2   1 
ATOM   1067 H  HB3   . CYS A 1 90  ? -2.280  -5.753  -21.129 1.00 20.53  ? 960  CYS A HB3   1 
ATOM   1068 H  HG    . CYS A 1 90  ? -1.753  -8.386  -20.737 1.00 25.12  ? 960  CYS A HG    1 
ATOM   1069 N  N     . THR A 1 91  ? -0.829  -3.273  -22.830 1.00 19.73  ? 961  THR A N     1 
ATOM   1070 C  CA    . THR A 1 91  ? -0.838  -1.826  -22.584 1.00 23.94  ? 961  THR A CA    1 
ATOM   1071 C  C     . THR A 1 91  ? -1.024  -0.977  -23.843 1.00 26.71  ? 961  THR A C     1 
ATOM   1072 O  O     . THR A 1 91  ? -1.279  0.224   -23.755 1.00 26.88  ? 961  THR A O     1 
ATOM   1073 C  CB    . THR A 1 91  ? 0.455   -1.372  -21.891 1.00 32.93  ? 961  THR A CB    1 
ATOM   1074 O  OG1   . THR A 1 91  ? 1.583   -1.651  -22.730 1.00 27.64  ? 961  THR A OG1   1 
ATOM   1075 C  CG2   . THR A 1 91  ? 0.615   -2.080  -20.564 1.00 25.72  ? 961  THR A CG2   1 
ATOM   1076 H  H     . THR A 1 91  ? -0.044  -3.615  -22.910 1.00 23.67  ? 961  THR A H     1 
ATOM   1077 H  HA    . THR A 1 91  ? -1.582  -1.621  -21.981 1.00 28.72  ? 961  THR A HA    1 
ATOM   1078 H  HB    . THR A 1 91  ? 0.410   -0.418  -21.723 1.00 39.51  ? 961  THR A HB    1 
ATOM   1079 H  HG1   . THR A 1 91  ? 2.274   -1.409  -22.360 1.00 33.17  ? 961  THR A HG1   1 
ATOM   1080 H  HG21  . THR A 1 91  ? -0.129  -1.877  -19.992 1.00 30.86  ? 961  THR A HG21  1 
ATOM   1081 H  HG22  . THR A 1 91  ? 0.655   -3.029  -20.701 1.00 30.86  ? 961  THR A HG22  1 
ATOM   1082 H  HG23  . THR A 1 91  ? 1.425   -1.792  -20.135 1.00 30.86  ? 961  THR A HG23  1 
ATOM   1083 N  N     . ASN A 1 92  ? -0.877  -1.589  -25.010 1.00 22.73  ? 962  ASN A N     1 
ATOM   1084 C  CA    . ASN A 1 92  ? -1.114  -0.899  -26.279 1.00 24.12  ? 962  ASN A CA    1 
ATOM   1085 C  C     . ASN A 1 92  ? -2.470  -0.178  -26.257 1.00 24.06  ? 962  ASN A C     1 
ATOM   1086 O  O     . ASN A 1 92  ? -3.496  -0.807  -26.064 1.00 22.37  ? 962  ASN A O     1 
ATOM   1087 C  CB    . ASN A 1 92  ? -1.069  -1.933  -27.416 1.00 24.14  ? 962  ASN A CB    1 
ATOM   1088 C  CG    . ASN A 1 92  ? -1.217  -1.315  -28.796 1.00 37.51  ? 962  ASN A CG    1 
ATOM   1089 O  OD1   . ASN A 1 92  ? -1.717  -0.202  -28.948 1.00 29.03  ? 962  ASN A OD1   1 
ATOM   1090 N  ND2   . ASN A 1 92  ? -0.783  -2.051  -29.817 1.00 37.90  ? 962  ASN A ND2   1 
ATOM   1091 H  H     . ASN A 1 92  ? -0.640  -2.411  -25.099 1.00 27.28  ? 962  ASN A H     1 
ATOM   1092 H  HA    . ASN A 1 92  ? -0.408  -0.236  -26.430 1.00 28.95  ? 962  ASN A HA    1 
ATOM   1093 H  HB2   . ASN A 1 92  ? -0.217  -2.396  -27.387 1.00 28.97  ? 962  ASN A HB2   1 
ATOM   1094 H  HB3   . ASN A 1 92  ? -1.793  -2.567  -27.294 1.00 28.97  ? 962  ASN A HB3   1 
ATOM   1095 H  HD21  . ASN A 1 92  ? -0.443  -2.828  -29.674 1.00 45.48  ? 962  ASN A HD21  1 
ATOM   1096 H  HD22  . ASN A 1 92  ? -0.843  -1.750  -30.621 1.00 45.48  ? 962  ASN A HD22  1 
ATOM   1097 N  N     . PRO A 1 93  ? -2.483  1.153   -26.450 1.00 28.36  ? 963  PRO A N     1 
ATOM   1098 C  CA    . PRO A 1 93  ? -3.767  1.867   -26.359 1.00 26.44  ? 963  PRO A CA    1 
ATOM   1099 C  C     . PRO A 1 93  ? -4.813  1.428   -27.374 1.00 26.78  ? 963  PRO A C     1 
ATOM   1100 O  O     . PRO A 1 93  ? -5.998  1.629   -27.137 1.00 28.26  ? 963  PRO A O     1 
ATOM   1101 C  CB    . PRO A 1 93  ? -3.383  3.332   -26.613 1.00 31.96  ? 963  PRO A CB    1 
ATOM   1102 C  CG    . PRO A 1 93  ? -1.948  3.419   -26.273 1.00 41.58  ? 963  PRO A CG    1 
ATOM   1103 C  CD    . PRO A 1 93  ? -1.341  2.077   -26.577 1.00 31.16  ? 963  PRO A CD    1 
ATOM   1104 H  HA    . PRO A 1 93  ? -4.138  1.783   -25.456 1.00 31.73  ? 963  PRO A HA    1 
ATOM   1105 H  HB2   . PRO A 1 93  ? -3.528  3.551   -27.546 1.00 38.35  ? 963  PRO A HB2   1 
ATOM   1106 H  HB3   . PRO A 1 93  ? -3.907  3.911   -26.038 1.00 38.35  ? 963  PRO A HB3   1 
ATOM   1107 H  HG2   . PRO A 1 93  ? -1.531  4.108   -26.813 1.00 49.89  ? 963  PRO A HG2   1 
ATOM   1108 H  HG3   . PRO A 1 93  ? -1.853  3.626   -25.330 1.00 49.89  ? 963  PRO A HG3   1 
ATOM   1109 H  HD2   . PRO A 1 93  ? -0.991  2.060   -27.481 1.00 37.39  ? 963  PRO A HD2   1 
ATOM   1110 H  HD3   . PRO A 1 93  ? -0.656  1.859   -25.925 1.00 37.39  ? 963  PRO A HD3   1 
ATOM   1111 N  N     . ASN A 1 94  ? -4.396  0.855   -28.496 1.00 21.78  ? 964  ASN A N     1 
ATOM   1112 C  CA    . ASN A 1 94  ? -5.359  0.374   -29.478 1.00 29.04  ? 964  ASN A CA    1 
ATOM   1113 C  C     . ASN A 1 94  ? -6.111  -0.882  -29.035 1.00 24.05  ? 964  ASN A C     1 
ATOM   1114 O  O     . ASN A 1 94  ? -7.088  -1.274  -29.672 1.00 22.73  ? 964  ASN A O     1 
ATOM   1115 C  CB    . ASN A 1 94  ? -4.667  0.128   -30.815 1.00 32.43  ? 964  ASN A CB    1 
ATOM   1116 C  CG    . ASN A 1 94  ? -4.106  1.405   -31.411 1.00 46.34  ? 964  ASN A CG    1 
ATOM   1117 O  OD1   . ASN A 1 94  ? -4.779  2.434   -31.437 1.00 44.52  ? 964  ASN A OD1   1 
ATOM   1118 N  ND2   . ASN A 1 94  ? -2.860  1.354   -31.858 1.00 40.83  ? 964  ASN A ND2   1 
ATOM   1119 H  H     . ASN A 1 94  ? -3.573  0.733   -28.712 1.00 26.13  ? 964  ASN A H     1 
ATOM   1120 H  HA    . ASN A 1 94  ? -6.027  1.077   -29.620 1.00 34.85  ? 964  ASN A HA    1 
ATOM   1121 H  HB2   . ASN A 1 94  ? -3.933  -0.492  -30.684 1.00 38.91  ? 964  ASN A HB2   1 
ATOM   1122 H  HB3   . ASN A 1 94  ? -5.309  -0.241  -31.442 1.00 38.91  ? 964  ASN A HB3   1 
ATOM   1123 H  HD21  . ASN A 1 94  ? -2.412  0.622   -31.802 1.00 49.00  ? 964  ASN A HD21  1 
ATOM   1124 H  HD22  . ASN A 1 94  ? -2.499  2.054   -32.204 1.00 49.00  ? 964  ASN A HD22  1 
ATOM   1125 N  N     . ASN A 1 95  ? -5.648  -1.512  -27.957 1.00 19.82  ? 965  ASN A N     1 
ATOM   1126 C  CA    . ASN A 1 95  ? -6.304  -2.696  -27.413 1.00 17.65  ? 965  ASN A CA    1 
ATOM   1127 C  C     . ASN A 1 95  ? -7.035  -2.346  -26.119 1.00 17.90  ? 965  ASN A C     1 
ATOM   1128 O  O     . ASN A 1 95  ? -6.401  -2.225  -25.073 1.00 17.85  ? 965  ASN A O     1 
ATOM   1129 C  CB    . ASN A 1 95  ? -5.276  -3.794  -27.128 1.00 17.78  ? 965  ASN A CB    1 
ATOM   1130 C  CG    . ASN A 1 95  ? -4.706  -4.389  -28.401 1.00 24.89  ? 965  ASN A CG    1 
ATOM   1131 O  OD1   . ASN A 1 95  ? -5.383  -4.429  -29.423 1.00 24.58  ? 965  ASN A OD1   1 
ATOM   1132 N  ND2   . ASN A 1 95  ? -3.462  -4.839  -28.349 1.00 26.94  ? 965  ASN A ND2   1 
ATOM   1133 H  H     . ASN A 1 95  ? -4.948  -1.270  -27.519 1.00 23.78  ? 965  ASN A H     1 
ATOM   1134 H  HA    . ASN A 1 95  ? -6.957  -3.037  -28.059 1.00 21.18  ? 965  ASN A HA    1 
ATOM   1135 H  HB2   . ASN A 1 95  ? -4.542  -3.418  -26.617 1.00 21.34  ? 965  ASN A HB2   1 
ATOM   1136 H  HB3   . ASN A 1 95  ? -5.702  -4.506  -26.627 1.00 21.34  ? 965  ASN A HB3   1 
ATOM   1137 H  HD21  . ASN A 1 95  ? -3.100  -5.184  -29.049 1.00 32.33  ? 965  ASN A HD21  1 
ATOM   1138 H  HD22  . ASN A 1 95  ? -3.015  -4.785  -27.616 1.00 32.33  ? 965  ASN A HD22  1 
ATOM   1139 N  N     . PRO A 1 96  ? -8.362  -2.167  -26.190 1.00 17.30  ? 966  PRO A N     1 
ATOM   1140 C  CA    . PRO A 1 96  ? -9.088  -1.704  -24.995 1.00 19.04  ? 966  PRO A CA    1 
ATOM   1141 C  C     . PRO A 1 96  ? -9.127  -2.746  -23.896 1.00 15.81  ? 966  PRO A C     1 
ATOM   1142 O  O     . PRO A 1 96  ? -9.227  -2.388  -22.724 1.00 14.75  ? 966  PRO A O     1 
ATOM   1143 C  CB    . PRO A 1 96  ? -10.507 -1.453  -25.517 1.00 20.78  ? 966  PRO A CB    1 
ATOM   1144 C  CG    . PRO A 1 96  ? -10.329 -1.228  -27.005 1.00 29.86  ? 966  PRO A CG    1 
ATOM   1145 C  CD    . PRO A 1 96  ? -9.225  -2.175  -27.387 1.00 22.51  ? 966  PRO A CD    1 
ATOM   1146 H  HA    . PRO A 1 96  ? -8.705  -0.870  -24.653 1.00 22.85  ? 966  PRO A HA    1 
ATOM   1147 H  HB2   . PRO A 1 96  ? -11.061 -2.231  -25.349 1.00 24.94  ? 966  PRO A HB2   1 
ATOM   1148 H  HB3   . PRO A 1 96  ? -10.879 -0.665  -25.091 1.00 24.94  ? 966  PRO A HB3   1 
ATOM   1149 H  HG2   . PRO A 1 96  ? -11.151 -1.446  -27.472 1.00 35.83  ? 966  PRO A HG2   1 
ATOM   1150 H  HG3   . PRO A 1 96  ? -10.070 -0.308  -27.171 1.00 35.83  ? 966  PRO A HG3   1 
ATOM   1151 H  HD2   . PRO A 1 96  ? -9.579  -3.064  -27.545 1.00 27.01  ? 966  PRO A HD2   1 
ATOM   1152 H  HD3   . PRO A 1 96  ? -8.740  -1.840  -28.158 1.00 27.01  ? 966  PRO A HD3   1 
ATOM   1153 N  N     . VAL A 1 97  ? -9.085  -4.016  -24.291 1.00 16.00  ? 967  VAL A N     1 
ATOM   1154 C  CA    . VAL A 1 97  ? -9.123  -5.139  -23.357 1.00 11.95  ? 967  VAL A CA    1 
ATOM   1155 C  C     . VAL A 1 97  ? -8.271  -6.235  -24.000 1.00 17.37  ? 967  VAL A C     1 
ATOM   1156 O  O     . VAL A 1 97  ? -8.159  -6.304  -25.228 1.00 17.07  ? 967  VAL A O     1 
ATOM   1157 C  CB    . VAL A 1 97  ? -10.580 -5.622  -23.131 1.00 14.49  ? 967  VAL A CB    1 
ATOM   1158 C  CG1   . VAL A 1 97  ? -11.242 -5.977  -24.476 1.00 15.45  ? 967  VAL A CG1   1 
ATOM   1159 C  CG2   . VAL A 1 97  ? -10.657 -6.805  -22.149 1.00 14.43  ? 967  VAL A CG2   1 
ATOM   1160 H  H     . VAL A 1 97  ? -9.032  -4.258  -25.114 1.00 19.19  ? 967  VAL A H     1 
ATOM   1161 H  HA    . VAL A 1 97  ? -8.728  -4.882  -22.497 1.00 14.34  ? 967  VAL A HA    1 
ATOM   1162 H  HB    . VAL A 1 97  ? -11.092 -4.883  -22.740 1.00 17.39  ? 967  VAL A HB    1 
ATOM   1163 H  HG11  . VAL A 1 97  ? -10.612 -5.825  -25.184 1.00 18.54  ? 967  VAL A HG11  1 
ATOM   1164 H  HG12  . VAL A 1 97  ? -11.502 -6.901  -24.461 1.00 18.54  ? 967  VAL A HG12  1 
ATOM   1165 H  HG13  . VAL A 1 97  ? -12.014 -5.421  -24.599 1.00 18.54  ? 967  VAL A HG13  1 
ATOM   1166 H  HG21  . VAL A 1 97  ? -11.576 -7.065  -22.045 1.00 17.32  ? 967  VAL A HG21  1 
ATOM   1167 H  HG22  . VAL A 1 97  ? -10.148 -7.538  -22.502 1.00 17.32  ? 967  VAL A HG22  1 
ATOM   1168 H  HG23  . VAL A 1 97  ? -10.296 -6.533  -21.302 1.00 17.32  ? 967  VAL A HG23  1 
ATOM   1169 N  N     . THR A 1 98  ? -7.660  -7.076  -23.174 1.00 14.69  ? 968  THR A N     1 
ATOM   1170 C  CA    . THR A 1 98  ? -6.966  -8.255  -23.671 1.00 14.14  ? 968  THR A CA    1 
ATOM   1171 C  C     . THR A 1 98  ? -7.414  -9.431  -22.805 1.00 16.43  ? 968  THR A C     1 
ATOM   1172 O  O     . THR A 1 98  ? -7.423  -9.323  -21.585 1.00 15.82  ? 968  THR A O     1 
ATOM   1173 C  CB    . THR A 1 98  ? -5.430  -8.098  -23.569 1.00 18.39  ? 968  THR A CB    1 
ATOM   1174 O  OG1   . THR A 1 98  ? -4.979  -7.075  -24.471 1.00 18.90  ? 968  THR A OG1   1 
ATOM   1175 C  CG2   . THR A 1 98  ? -4.729  -9.418  -23.929 1.00 16.38  ? 968  THR A CG2   1 
ATOM   1176 H  H     . THR A 1 98  ? -7.633  -6.986  -22.320 1.00 17.63  ? 968  THR A H     1 
ATOM   1177 H  HA    . THR A 1 98  ? -7.213  -8.427  -24.603 1.00 16.97  ? 968  THR A HA    1 
ATOM   1178 H  HB    . THR A 1 98  ? -5.188  -7.859  -22.661 1.00 22.07  ? 968  THR A HB    1 
ATOM   1179 H  HG1   . THR A 1 98  ? -4.165  -6.993  -24.417 1.00 22.67  ? 968  THR A HG1   1 
ATOM   1180 H  HG21  . THR A 1 98  ? -5.008  -10.112 -23.327 1.00 19.66  ? 968  THR A HG21  1 
ATOM   1181 H  HG22  . THR A 1 98  ? -4.953  -9.675  -24.826 1.00 19.66  ? 968  THR A HG22  1 
ATOM   1182 H  HG23  . THR A 1 98  ? -3.777  -9.312  -23.863 1.00 19.66  ? 968  THR A HG23  1 
ATOM   1183 N  N     . VAL A 1 99  ? -7.802  -10.546 -23.416 1.00 14.79  ? 969  VAL A N     1 
ATOM   1184 C  CA    . VAL A 1 99  ? -8.105  -11.728 -22.621 1.00 13.73  ? 969  VAL A CA    1 
ATOM   1185 C  C     . VAL A 1 99  ? -6.933  -12.688 -22.783 1.00 16.96  ? 969  VAL A C     1 
ATOM   1186 O  O     . VAL A 1 99  ? -6.531  -13.006 -23.905 1.00 15.51  ? 969  VAL A O     1 
ATOM   1187 C  CB    . VAL A 1 99  ? -9.449  -12.388 -23.027 1.00 15.99  ? 969  VAL A CB    1 
ATOM   1188 C  CG1   . VAL A 1 99  ? -9.429  -12.853 -24.493 1.00 20.10  ? 969  VAL A CG1   1 
ATOM   1189 C  CG2   . VAL A 1 99  ? -9.763  -13.564 -22.082 1.00 14.47  ? 969  VAL A CG2   1 
ATOM   1190 H  H     . VAL A 1 99  ? -7.895  -10.642 -24.266 1.00 17.75  ? 969  VAL A H     1 
ATOM   1191 H  HA    . VAL A 1 99  ? -8.163  -11.474 -21.677 1.00 16.47  ? 969  VAL A HA    1 
ATOM   1192 H  HB    . VAL A 1 99  ? -10.166 -11.727 -22.932 1.00 19.19  ? 969  VAL A HB    1 
ATOM   1193 H  HG11  . VAL A 1 99  ? -8.575  -12.640 -24.876 1.00 24.12  ? 969  VAL A HG11  1 
ATOM   1194 H  HG12  . VAL A 1 99  ? -9.575  -13.801 -24.521 1.00 24.12  ? 969  VAL A HG12  1 
ATOM   1195 H  HG13  . VAL A 1 99  ? -10.126 -12.399 -24.973 1.00 24.12  ? 969  VAL A HG13  1 
ATOM   1196 H  HG21  . VAL A 1 99  ? -9.057  -13.643 -21.436 1.00 17.36  ? 969  VAL A HG21  1 
ATOM   1197 H  HG22  . VAL A 1 99  ? -10.596 -13.392 -21.637 1.00 17.36  ? 969  VAL A HG22  1 
ATOM   1198 H  HG23  . VAL A 1 99  ? -9.827  -14.370 -22.599 1.00 17.36  ? 969  VAL A HG23  1 
ATOM   1199 N  N     . ILE A 1 100 ? -6.352  -13.089 -21.659 1.00 17.24  ? 970  ILE A N     1 
ATOM   1200 C  CA    . ILE A 1 100 ? -5.204  -13.994 -21.634 1.00 16.54  ? 970  ILE A CA    1 
ATOM   1201 C  C     . ILE A 1 100 ? -5.712  -15.393 -21.293 1.00 18.64  ? 970  ILE A C     1 
ATOM   1202 O  O     . ILE A 1 100 ? -6.027  -15.695 -20.140 1.00 19.13  ? 970  ILE A O     1 
ATOM   1203 C  CB    . ILE A 1 100 ? -4.155  -13.536 -20.589 1.00 17.12  ? 970  ILE A CB    1 
ATOM   1204 C  CG1   . ILE A 1 100 ? -3.726  -12.091 -20.891 1.00 16.88  ? 970  ILE A CG1   1 
ATOM   1205 C  CG2   . ILE A 1 100 ? -2.935  -14.463 -20.611 1.00 18.36  ? 970  ILE A CG2   1 
ATOM   1206 C  CD1   . ILE A 1 100 ? -2.523  -11.602 -20.076 1.00 20.93  ? 970  ILE A CD1   1 
ATOM   1207 H  H     . ILE A 1 100 ? -6.610  -12.845 -20.876 1.00 20.69  ? 970  ILE A H     1 
ATOM   1208 H  HA    . ILE A 1 100 ? -4.780  -14.017 -22.518 1.00 19.85  ? 970  ILE A HA    1 
ATOM   1209 H  HB    . ILE A 1 100 ? -4.557  -13.567 -19.707 1.00 20.55  ? 970  ILE A HB    1 
ATOM   1210 H  HG12  . ILE A 1 100 ? -3.490  -12.028 -21.830 1.00 20.26  ? 970  ILE A HG12  1 
ATOM   1211 H  HG13  . ILE A 1 100 ? -4.471  -11.500 -20.701 1.00 20.26  ? 970  ILE A HG13  1 
ATOM   1212 H  HG21  . ILE A 1 100 ? -2.540  -14.438 -21.486 1.00 22.03  ? 970  ILE A HG21  1 
ATOM   1213 H  HG22  . ILE A 1 100 ? -2.301  -14.160 -19.957 1.00 22.03  ? 970  ILE A HG22  1 
ATOM   1214 H  HG23  . ILE A 1 100 ? -3.218  -15.356 -20.404 1.00 22.03  ? 970  ILE A HG23  1 
ATOM   1215 H  HD11  . ILE A 1 100 ? -2.741  -11.644 -19.142 1.00 25.12  ? 970  ILE A HD11  1 
ATOM   1216 H  HD12  . ILE A 1 100 ? -1.769  -12.167 -20.262 1.00 25.12  ? 970  ILE A HD12  1 
ATOM   1217 H  HD13  . ILE A 1 100 ? -2.324  -10.697 -20.326 1.00 25.12  ? 970  ILE A HD13  1 
ATOM   1218 N  N     . ARG A 1 101 ? -5.832  -16.225 -22.318 1.00 19.38  ? 971  ARG A N     1 
ATOM   1219 C  CA    . ARG A 1 101 ? -6.403  -17.557 -22.174 1.00 20.49  ? 971  ARG A CA    1 
ATOM   1220 C  C     . ARG A 1 101 ? -5.404  -18.525 -21.558 1.00 21.09  ? 971  ARG A C     1 
ATOM   1221 O  O     . ARG A 1 101 ? -4.223  -18.496 -21.884 1.00 18.36  ? 971  ARG A O     1 
ATOM   1222 C  CB    . ARG A 1 101 ? -6.840  -18.079 -23.546 1.00 16.80  ? 971  ARG A CB    1 
ATOM   1223 C  CG    . ARG A 1 101 ? -7.813  -17.143 -24.300 1.00 21.29  ? 971  ARG A CG    1 
ATOM   1224 C  CD    . ARG A 1 101 ? -9.174  -17.045 -23.591 1.00 19.92  ? 971  ARG A CD    1 
ATOM   1225 N  NE    . ARG A 1 101 ? -10.143 -16.304 -24.398 1.00 18.22  ? 971  ARG A NE    1 
ATOM   1226 C  CZ    . ARG A 1 101 ? -11.423 -16.155 -24.080 1.00 19.95  ? 971  ARG A CZ    1 
ATOM   1227 N  NH1   . ARG A 1 101 ? -11.890 -16.695 -22.962 1.00 17.68  ? 971  ARG A NH1   1 
ATOM   1228 N  NH2   . ARG A 1 101 ? -12.232 -15.475 -24.884 1.00 19.00  ? 971  ARG A NH2   1 
ATOM   1229 H  H     . ARG A 1 101 ? -5.587  -16.038 -23.120 1.00 23.26  ? 971  ARG A H     1 
ATOM   1230 H  HA    . ARG A 1 101 ? -7.191  -17.514 -21.594 1.00 24.59  ? 971  ARG A HA    1 
ATOM   1231 H  HB2   . ARG A 1 101 ? -6.052  -18.194 -24.101 1.00 20.16  ? 971  ARG A HB2   1 
ATOM   1232 H  HB3   . ARG A 1 101 ? -7.284  -18.933 -23.427 1.00 20.16  ? 971  ARG A HB3   1 
ATOM   1233 H  HG2   . ARG A 1 101 ? -7.430  -16.253 -24.345 1.00 25.55  ? 971  ARG A HG2   1 
ATOM   1234 H  HG3   . ARG A 1 101 ? -7.962  -17.490 -25.194 1.00 25.55  ? 971  ARG A HG3   1 
ATOM   1235 H  HD2   . ARG A 1 101 ? -9.522  -17.938 -23.440 1.00 23.91  ? 971  ARG A HD2   1 
ATOM   1236 H  HD3   . ARG A 1 101 ? -9.063  -16.581 -22.746 1.00 23.91  ? 971  ARG A HD3   1 
ATOM   1237 H  HE    . ARG A 1 101 ? -9.866  -15.942 -25.126 1.00 21.87  ? 971  ARG A HE    1 
ATOM   1238 H  HH11  . ARG A 1 101 ? -11.364 -17.138 -22.446 1.00 21.21  ? 971  ARG A HH11  1 
ATOM   1239 H  HH12  . ARG A 1 101 ? -12.719 -16.600 -22.752 1.00 21.21  ? 971  ARG A HH12  1 
ATOM   1240 H  HH21  . ARG A 1 101 ? -11.925 -15.125 -25.607 1.00 22.80  ? 971  ARG A HH21  1 
ATOM   1241 H  HH22  . ARG A 1 101 ? -13.060 -15.375 -24.676 1.00 22.80  ? 971  ARG A HH22  1 
ATOM   1242 N  N     . GLY A 1 102 ? -5.892  -19.396 -20.680 1.00 19.16  ? 972  GLY A N     1 
ATOM   1243 C  CA    . GLY A 1 102 ? -5.073  -20.455 -20.121 1.00 19.55  ? 972  GLY A CA    1 
ATOM   1244 C  C     . GLY A 1 102 ? -3.998  -19.971 -19.157 1.00 20.53  ? 972  GLY A C     1 
ATOM   1245 O  O     . GLY A 1 102 ? -3.001  -20.665 -18.945 1.00 22.42  ? 972  GLY A O     1 
ATOM   1246 H  H     . GLY A 1 102 ? -6.703  -19.392 -20.392 1.00 22.99  ? 972  GLY A H     1 
ATOM   1247 H  HA2   . GLY A 1 102 ? -5.643  -21.080 -19.647 1.00 23.45  ? 972  GLY A HA2   1 
ATOM   1248 H  HA3   . GLY A 1 102 ? -4.636  -20.932 -20.844 1.00 23.45  ? 972  GLY A HA3   1 
ATOM   1249 N  N     . LEU A 1 103 ? -4.198  -18.797 -18.567 1.00 18.48  ? 973  LEU A N     1 
ATOM   1250 C  CA    . LEU A 1 103 ? -3.188  -18.221 -17.674 1.00 17.63  ? 973  LEU A CA    1 
ATOM   1251 C  C     . LEU A 1 103 ? -2.963  -19.080 -16.421 1.00 17.59  ? 973  LEU A C     1 
ATOM   1252 O  O     . LEU A 1 103 ? -1.824  -19.391 -16.076 1.00 22.61  ? 973  LEU A O     1 
ATOM   1253 C  CB    . LEU A 1 103 ? -3.557  -16.792 -17.257 1.00 19.78  ? 973  LEU A CB    1 
ATOM   1254 C  CG    . LEU A 1 103 ? -2.609  -16.284 -16.159 1.00 32.95  ? 973  LEU A CG    1 
ATOM   1255 C  CD1   . LEU A 1 103 ? -1.316  -15.718 -16.737 1.00 25.67  ? 973  LEU A CD1   1 
ATOM   1256 C  CD2   . LEU A 1 103 ? -3.289  -15.284 -15.263 1.00 52.46  ? 973  LEU A CD2   1 
ATOM   1257 H  H     . LEU A 1 103 ? -4.903  -18.313 -18.664 1.00 22.18  ? 973  LEU A H     1 
ATOM   1258 H  HA    . LEU A 1 103 ? -2.336  -18.177 -18.157 1.00 21.16  ? 973  LEU A HA    1 
ATOM   1259 H  HB2   . LEU A 1 103 ? -3.481  -16.202 -18.024 1.00 23.74  ? 973  LEU A HB2   1 
ATOM   1260 H  HB3   . LEU A 1 103 ? -4.462  -16.781 -16.910 1.00 23.74  ? 973  LEU A HB3   1 
ATOM   1261 H  HG    . LEU A 1 103 ? -2.363  -17.041 -15.603 1.00 39.54  ? 973  LEU A HG    1 
ATOM   1262 H  HD11  . LEU A 1 103 ? -0.867  -16.407 -17.232 1.00 30.81  ? 973  LEU A HD11  1 
ATOM   1263 H  HD12  . LEU A 1 103 ? -1.530  -14.984 -17.318 1.00 30.81  ? 973  LEU A HD12  1 
ATOM   1264 H  HD13  . LEU A 1 103 ? -0.758  -15.415 -16.017 1.00 30.81  ? 973  LEU A HD13  1 
ATOM   1265 H  HD21  . LEU A 1 103 ? -4.047  -15.701 -14.848 1.00 62.95  ? 973  LEU A HD21  1 
ATOM   1266 H  HD22  . LEU A 1 103 ? -2.667  -14.992 -14.593 1.00 62.95  ? 973  LEU A HD22  1 
ATOM   1267 H  HD23  . LEU A 1 103 ? -3.576  -14.536 -15.792 1.00 62.95  ? 973  LEU A HD23  1 
ATOM   1268 N  N     . ALA A 1 104 ? -4.035  -19.458 -15.734 1.00 19.62  ? 974  ALA A N     1 
ATOM   1269 C  CA    . ALA A 1 104 ? -3.886  -20.253 -14.516 1.00 22.78  ? 974  ALA A CA    1 
ATOM   1270 C  C     . ALA A 1 104 ? -3.182  -21.568 -14.823 1.00 24.77  ? 974  ALA A C     1 
ATOM   1271 O  O     . ALA A 1 104 ? -2.282  -21.993 -14.092 1.00 23.15  ? 974  ALA A O     1 
ATOM   1272 C  CB    . ALA A 1 104 ? -5.243  -20.522 -13.867 1.00 24.62  ? 974  ALA A CB    1 
ATOM   1273 H  H     . ALA A 1 104 ? -4.848  -19.272 -15.945 1.00 23.54  ? 974  ALA A H     1 
ATOM   1274 H  HA    . ALA A 1 104 ? -3.336  -19.757 -13.875 1.00 27.34  ? 974  ALA A HA    1 
ATOM   1275 H  HB1   . ALA A 1 104 ? -5.653  -19.684 -13.644 1.00 29.54  ? 974  ALA A HB1   1 
ATOM   1276 H  HB2   . ALA A 1 104 ? -5.796  -21.003 -14.488 1.00 29.54  ? 974  ALA A HB2   1 
ATOM   1277 H  HB3   . ALA A 1 104 ? -5.111  -21.045 -13.073 1.00 29.54  ? 974  ALA A HB3   1 
ATOM   1278 N  N     . GLY A 1 105 ? -3.599  -22.218 -15.903 1.00 23.02  ? 975  GLY A N     1 
ATOM   1279 C  CA    . GLY A 1 105 ? -3.040  -23.510 -16.268 1.00 25.89  ? 975  GLY A CA    1 
ATOM   1280 C  C     . GLY A 1 105 ? -1.582  -23.397 -16.681 1.00 29.68  ? 975  GLY A C     1 
ATOM   1281 O  O     . GLY A 1 105 ? -0.786  -24.288 -16.404 1.00 26.91  ? 975  GLY A O     1 
ATOM   1282 H  H     . GLY A 1 105 ? -4.206  -21.931 -16.441 1.00 27.63  ? 975  GLY A H     1 
ATOM   1283 H  HA2   . GLY A 1 105 ? -3.102  -24.116 -15.514 1.00 31.06  ? 975  GLY A HA2   1 
ATOM   1284 H  HA3   . GLY A 1 105 ? -3.543  -23.884 -17.008 1.00 31.06  ? 975  GLY A HA3   1 
ATOM   1285 N  N     . ALA A 1 106 ? -1.223  -22.301 -17.345 1.00 24.52  ? 976  ALA A N     1 
ATOM   1286 C  CA    . ALA A 1 106 ? 0.164   -22.096 -17.767 1.00 28.05  ? 976  ALA A CA    1 
ATOM   1287 C  C     . ALA A 1 106 ? 1.076   -21.951 -16.555 1.00 31.14  ? 976  ALA A C     1 
ATOM   1288 O  O     . ALA A 1 106 ? 2.199   -22.453 -16.548 1.00 29.16  ? 976  ALA A O     1 
ATOM   1289 C  CB    . ALA A 1 106 ? 0.287   -20.863 -18.662 1.00 28.92  ? 976  ALA A CB    1 
ATOM   1290 H  H     . ALA A 1 106 ? -1.758  -21.663 -17.563 1.00 29.43  ? 976  ALA A H     1 
ATOM   1291 H  HA    . ALA A 1 106 ? 0.461   -22.876 -18.280 1.00 33.66  ? 976  ALA A HA    1 
ATOM   1292 H  HB1   . ALA A 1 106 ? -0.007  -20.091 -18.173 1.00 34.70  ? 976  ALA A HB1   1 
ATOM   1293 H  HB2   . ALA A 1 106 ? 1.206   -20.756 -18.921 1.00 34.70  ? 976  ALA A HB2   1 
ATOM   1294 H  HB3   . ALA A 1 106 ? -0.261  -20.986 -19.440 1.00 34.70  ? 976  ALA A HB3   1 
ATOM   1295 N  N     . LEU A 1 107 ? 0.587   -21.265 -15.527 1.00 21.82  ? 977  LEU A N     1 
ATOM   1296 C  CA    . LEU A 1 107 ? 1.399   -20.995 -14.348 1.00 24.42  ? 977  LEU A CA    1 
ATOM   1297 C  C     . LEU A 1 107 ? 1.209   -22.073 -13.282 1.00 31.72  ? 977  LEU A C     1 
ATOM   1298 O  O     . LEU A 1 107 ? 1.890   -22.066 -12.259 1.00 27.79  ? 977  LEU A O     1 
ATOM   1299 C  CB    . LEU A 1 107 ? 1.034   -19.624 -13.765 1.00 25.09  ? 977  LEU A CB    1 
ATOM   1300 C  CG    . LEU A 1 107 ? 1.335   -18.424 -14.668 1.00 32.04  ? 977  LEU A CG    1 
ATOM   1301 C  CD1   . LEU A 1 107 ? 0.845   -17.116 -14.028 1.00 27.09  ? 977  LEU A CD1   1 
ATOM   1302 C  CD2   . LEU A 1 107 ? 2.825   -18.352 -14.978 1.00 29.66  ? 977  LEU A CD2   1 
ATOM   1303 H  H     . LEU A 1 107 ? -0.210  -20.946 -15.489 1.00 26.18  ? 977  LEU A H     1 
ATOM   1304 H  HA    . LEU A 1 107 ? 2.345   -20.979 -14.603 1.00 29.30  ? 977  LEU A HA    1 
ATOM   1305 H  HB2   . LEU A 1 107 ? 0.083   -19.614 -13.575 1.00 30.11  ? 977  LEU A HB2   1 
ATOM   1306 H  HB3   . LEU A 1 107 ? 1.530   -19.499 -12.941 1.00 30.11  ? 977  LEU A HB3   1 
ATOM   1307 H  HG    . LEU A 1 107 ? 0.862   -18.538 -15.508 1.00 38.45  ? 977  LEU A HG    1 
ATOM   1308 H  HD11  . LEU A 1 107 ? 1.293   -16.993 -13.187 1.00 32.50  ? 977  LEU A HD11  1 
ATOM   1309 H  HD12  . LEU A 1 107 ? 1.048   -16.385 -14.616 1.00 32.50  ? 977  LEU A HD12  1 
ATOM   1310 H  HD13  . LEU A 1 107 ? -0.103  -17.172 -13.889 1.00 32.50  ? 977  LEU A HD13  1 
ATOM   1311 H  HD21  . LEU A 1 107 ? 3.090   -19.159 -15.425 1.00 35.60  ? 977  LEU A HD21  1 
ATOM   1312 H  HD22  . LEU A 1 107 ? 2.990   -17.594 -15.544 1.00 35.60  ? 977  LEU A HD22  1 
ATOM   1313 H  HD23  . LEU A 1 107 ? 3.310   -18.258 -14.155 1.00 35.60  ? 977  LEU A HD23  1 
ATOM   1314 N  N     . LYS A 1 108 ? 0.289   -23.000 -13.527 1.00 24.85  ? 978  LYS A N     1 
ATOM   1315 C  CA    . LYS A 1 108 ? -0.092  -23.982 -12.518 1.00 25.62  ? 978  LYS A CA    1 
ATOM   1316 C  C     . LYS A 1 108 ? -0.542  -23.300 -11.219 1.00 40.80  ? 978  LYS A C     1 
ATOM   1317 O  O     . LYS A 1 108 ? -0.167  -23.706 -10.118 1.00 31.89  ? 978  LYS A O     1 
ATOM   1318 C  CB    . LYS A 1 108 ? 1.059   -24.976 -12.291 1.00 30.04  ? 978  LYS A CB    1 
ATOM   1319 C  CG    . LYS A 1 108 ? 1.390   -25.739 -13.570 1.00 31.12  ? 978  LYS A CG    1 
ATOM   1320 C  CD    . LYS A 1 108 ? 2.376   -26.887 -13.384 1.00 63.16  ? 978  LYS A CD    1 
ATOM   1321 C  CE    . LYS A 1 108 ? 2.741   -27.488 -14.741 1.00 75.75  ? 978  LYS A CE    1 
ATOM   1322 N  NZ    . LYS A 1 108 ? 1.533   -27.900 -15.516 1.00 76.98  ? 978  LYS A NZ    1 
ATOM   1323 H  H     . LYS A 1 108 ? -0.131  -23.082 -14.273 1.00 29.82  ? 978  LYS A H     1 
ATOM   1324 H  HA    . LYS A 1 108 ? -0.856  -24.493 -12.858 1.00 30.74  ? 978  LYS A HA    1 
ATOM   1325 H  HB2   . LYS A 1 108 ? 1.851   -24.492 -12.012 1.00 36.04  ? 978  LYS A HB2   1 
ATOM   1326 H  HB3   . LYS A 1 108 ? 0.800   -25.618 -11.612 1.00 36.04  ? 978  LYS A HB3   1 
ATOM   1327 H  HG2   . LYS A 1 108 ? 0.570   -26.111 -13.930 1.00 37.35  ? 978  LYS A HG2   1 
ATOM   1328 H  HG3   . LYS A 1 108 ? 1.776   -25.120 -14.209 1.00 37.35  ? 978  LYS A HG3   1 
ATOM   1329 H  HD2   . LYS A 1 108 ? 3.185   -26.556 -12.965 1.00 75.80  ? 978  LYS A HD2   1 
ATOM   1330 H  HD3   . LYS A 1 108 ? 1.969   -27.580 -12.839 1.00 75.80  ? 978  LYS A HD3   1 
ATOM   1331 H  HE2   . LYS A 1 108 ? 3.223   -26.827 -15.262 1.00 90.90  ? 978  LYS A HE2   1 
ATOM   1332 H  HE3   . LYS A 1 108 ? 3.294   -28.272 -14.603 1.00 90.90  ? 978  LYS A HE3   1 
ATOM   1333 H  HZ1   . LYS A 1 108 ? 1.010   -27.195 -15.661 1.00 92.38  ? 978  LYS A HZ1   1 
ATOM   1334 H  HZ2   . LYS A 1 108 ? 1.778   -28.245 -16.299 1.00 92.38  ? 978  LYS A HZ2   1 
ATOM   1335 H  HZ3   . LYS A 1 108 ? 1.075   -28.512 -15.061 1.00 92.38  ? 978  LYS A HZ3   1 
ATOM   1336 N  N     . LEU A 1 109 ? -1.345  -22.247 -11.358 1.00 28.99  ? 979  LEU A N     1 
ATOM   1337 C  CA    . LEU A 1 109 ? -1.950  -21.594 -10.201 1.00 26.40  ? 979  LEU A CA    1 
ATOM   1338 C  C     . LEU A 1 109 ? -2.996  -22.497 -9.573  1.00 35.09  ? 979  LEU A C     1 
ATOM   1339 O  O     . LEU A 1 109 ? -3.814  -23.085 -10.276 1.00 39.05  ? 979  LEU A O     1 
ATOM   1340 C  CB    . LEU A 1 109 ? -2.651  -20.301 -10.603 1.00 30.91  ? 979  LEU A CB    1 
ATOM   1341 C  CG    . LEU A 1 109 ? -1.841  -19.147 -11.171 1.00 37.31  ? 979  LEU A CG    1 
ATOM   1342 C  CD1   . LEU A 1 109 ? -2.657  -17.871 -11.009 1.00 41.07  ? 979  LEU A CD1   1 
ATOM   1343 C  CD2   . LEU A 1 109 ? -0.503  -19.016 -10.475 1.00 34.89  ? 979  LEU A CD2   1 
ATOM   1344 H  H     . LEU A 1 109 ? -1.555  -21.892 -12.113 1.00 34.79  ? 979  LEU A H     1 
ATOM   1345 H  HA    . LEU A 1 109 ? -1.262  -21.390 -9.533  1.00 31.68  ? 979  LEU A HA    1 
ATOM   1346 H  HB2   . LEU A 1 109 ? -3.316  -20.526 -11.273 1.00 37.09  ? 979  LEU A HB2   1 
ATOM   1347 H  HB3   . LEU A 1 109 ? -3.105  -19.959 -9.817  1.00 37.09  ? 979  LEU A HB3   1 
ATOM   1348 H  HG    . LEU A 1 109 ? -1.684  -19.294 -12.117 1.00 44.78  ? 979  LEU A HG    1 
ATOM   1349 H  HD11  . LEU A 1 109 ? -2.156  -17.133 -11.364 1.00 49.29  ? 979  LEU A HD11  1 
ATOM   1350 H  HD12  . LEU A 1 109 ? -3.484  -17.967 -11.487 1.00 49.29  ? 979  LEU A HD12  1 
ATOM   1351 H  HD13  . LEU A 1 109 ? -2.833  -17.729 -10.076 1.00 49.29  ? 979  LEU A HD13  1 
ATOM   1352 H  HD21  . LEU A 1 109 ? -0.023  -18.279 -10.860 1.00 41.86  ? 979  LEU A HD21  1 
ATOM   1353 H  HD22  . LEU A 1 109 ? -0.652  -18.858 -9.540  1.00 41.86  ? 979  LEU A HD22  1 
ATOM   1354 H  HD23  . LEU A 1 109 ? -0.008  -19.829 -10.596 1.00 41.86  ? 979  LEU A HD23  1 
ATOM   1355 N  N     . ASP A 1 110 ? -2.991  -22.584 -8.250  1.00 32.28  ? 980  ASP A N     1 
ATOM   1356 C  CA    . ASP A 1 110 ? -4.005  -23.353 -7.543  1.00 27.74  ? 980  ASP A CA    1 
ATOM   1357 C  C     . ASP A 1 110 ? -5.217  -22.466 -7.329  1.00 30.00  ? 980  ASP A C     1 
ATOM   1358 O  O     . ASP A 1 110 ? -5.314  -21.760 -6.315  1.00 26.87  ? 980  ASP A O     1 
ATOM   1359 C  CB    . ASP A 1 110 ? -3.486  -23.843 -6.196  1.00 30.25  ? 980  ASP A CB    1 
ATOM   1360 C  CG    . ASP A 1 110 ? -4.449  -24.807 -5.524  1.00 37.35  ? 980  ASP A CG    1 
ATOM   1361 O  OD1   . ASP A 1 110 ? -5.557  -25.021 -6.069  1.00 36.73  ? 980  ASP A OD1   1 
ATOM   1362 O  OD2   . ASP A 1 110 ? -4.097  -25.355 -4.459  1.00 41.68  ? 980  ASP A OD2   1 
ATOM   1363 H  H     . ASP A 1 110 ? -2.412  -22.207 -7.738  1.00 38.73  ? 980  ASP A H     1 
ATOM   1364 H  HA    . ASP A 1 110 ? -4.270  -24.128 -8.081  1.00 33.28  ? 980  ASP A HA    1 
ATOM   1365 H  HB2   . ASP A 1 110 ? -2.642  -24.302 -6.328  1.00 36.30  ? 980  ASP A HB2   1 
ATOM   1366 H  HB3   . ASP A 1 110 ? -3.363  -23.082 -5.607  1.00 36.30  ? 980  ASP A HB3   1 
ATOM   1367 N  N     . LEU A 1 111 ? -6.127  -22.477 -8.299  1.00 29.54  ? 981  LEU A N     1 
ATOM   1368 C  CA    . LEU A 1 111 ? -7.357  -21.696 -8.196  1.00 25.74  ? 981  LEU A CA    1 
ATOM   1369 C  C     . LEU A 1 111 ? -8.204  -22.208 -7.038  1.00 27.39  ? 981  LEU A C     1 
ATOM   1370 O  O     . LEU A 1 111 ? -9.061  -21.494 -6.528  1.00 25.45  ? 981  LEU A O     1 
ATOM   1371 C  CB    . LEU A 1 111 ? -8.168  -21.776 -9.494  1.00 25.94  ? 981  LEU A CB    1 
ATOM   1372 C  CG    . LEU A 1 111 ? -7.529  -21.214 -10.765 1.00 36.50  ? 981  LEU A CG    1 
ATOM   1373 C  CD1   . LEU A 1 111 ? -8.489  -21.390 -11.943 1.00 33.28  ? 981  LEU A CD1   1 
ATOM   1374 C  CD2   . LEU A 1 111 ? -7.158  -19.748 -10.584 1.00 30.61  ? 981  LEU A CD2   1 
ATOM   1375 H  H     . LEU A 1 111 ? -6.057  -22.929 -9.027  1.00 35.45  ? 981  LEU A H     1 
ATOM   1376 H  HA    . LEU A 1 111 ? -7.134  -20.757 -8.026  1.00 30.89  ? 981  LEU A HA    1 
ATOM   1377 H  HB2   . LEU A 1 111 ? -8.367  -22.710 -9.665  1.00 31.13  ? 981  LEU A HB2   1 
ATOM   1378 H  HB3   . LEU A 1 111 ? -8.999  -21.294 -9.357  1.00 31.13  ? 981  LEU A HB3   1 
ATOM   1379 H  HG    . LEU A 1 111 ? -6.718  -21.709 -10.959 1.00 43.80  ? 981  LEU A HG    1 
ATOM   1380 H  HD11  . LEU A 1 111 ? -8.079  -21.035 -12.735 1.00 39.94  ? 981  LEU A HD11  1 
ATOM   1381 H  HD12  . LEU A 1 111 ? -8.671  -22.326 -12.060 1.00 39.94  ? 981  LEU A HD12  1 
ATOM   1382 H  HD13  . LEU A 1 111 ? -9.303  -20.918 -11.756 1.00 39.94  ? 981  LEU A HD13  1 
ATOM   1383 H  HD21  . LEU A 1 111 ? -7.953  -19.247 -10.386 1.00 36.73  ? 981  LEU A HD21  1 
ATOM   1384 H  HD22  . LEU A 1 111 ? -6.533  -19.671 -9.859  1.00 36.73  ? 981  LEU A HD22  1 
ATOM   1385 H  HD23  . LEU A 1 111 ? -6.760  -19.424 -11.396 1.00 36.73  ? 981  LEU A HD23  1 
ATOM   1386 N  N     . GLY A 1 112 ? -7.967  -23.451 -6.633  1.00 24.43  ? 982  GLY A N     1 
ATOM   1387 C  CA    . GLY A 1 112 ? -8.686  -24.035 -5.518  1.00 24.68  ? 982  GLY A CA    1 
ATOM   1388 C  C     . GLY A 1 112 ? -8.493  -23.247 -4.237  1.00 22.54  ? 982  GLY A C     1 
ATOM   1389 O  O     . GLY A 1 112 ? -9.317  -23.320 -3.331  1.00 25.73  ? 982  GLY A O     1 
ATOM   1390 H  H     . GLY A 1 112 ? -7.389  -23.977 -6.992  1.00 29.32  ? 982  GLY A H     1 
ATOM   1391 H  HA2   . GLY A 1 112 ? -9.634  -24.062 -5.723  1.00 29.62  ? 982  GLY A HA2   1 
ATOM   1392 H  HA3   . GLY A 1 112 ? -8.376  -24.942 -5.372  1.00 29.62  ? 982  GLY A HA3   1 
ATOM   1393 N  N     . LEU A 1 113 ? -7.404  -22.492 -4.153  1.00 23.93  ? 983  LEU A N     1 
ATOM   1394 C  CA    . LEU A 1 113 ? -7.178  -21.635 -2.993  1.00 25.35  ? 983  LEU A CA    1 
ATOM   1395 C  C     . LEU A 1 113 ? -8.243  -20.541 -2.878  1.00 25.46  ? 983  LEU A C     1 
ATOM   1396 O  O     . LEU A 1 113 ? -8.426  -19.961 -1.807  1.00 26.61  ? 983  LEU A O     1 
ATOM   1397 C  CB    . LEU A 1 113 ? -5.787  -21.003 -3.052  1.00 26.80  ? 983  LEU A CB    1 
ATOM   1398 C  CG    . LEU A 1 113 ? -4.634  -21.948 -2.716  1.00 30.72  ? 983  LEU A CG    1 
ATOM   1399 C  CD1   . LEU A 1 113 ? -3.315  -21.302 -3.067  1.00 29.92  ? 983  LEU A CD1   1 
ATOM   1400 C  CD2   . LEU A 1 113 ? -4.674  -22.334 -1.238  1.00 30.55  ? 983  LEU A CD2   1 
ATOM   1401 H  H     . LEU A 1 113 ? -6.784  -22.457 -4.748  1.00 28.72  ? 983  LEU A H     1 
ATOM   1402 H  HA    . LEU A 1 113 ? -7.224  -22.183 -2.182  1.00 30.42  ? 983  LEU A HA    1 
ATOM   1403 H  HB2   . LEU A 1 113 ? -5.638  -20.667 -3.950  1.00 32.16  ? 983  LEU A HB2   1 
ATOM   1404 H  HB3   . LEU A 1 113 ? -5.755  -20.267 -2.420  1.00 32.16  ? 983  LEU A HB3   1 
ATOM   1405 H  HG    . LEU A 1 113 ? -4.723  -22.758 -3.242  1.00 36.87  ? 983  LEU A HG    1 
ATOM   1406 H  HD11  . LEU A 1 113 ? -3.221  -20.491 -2.561  1.00 35.91  ? 983  LEU A HD11  1 
ATOM   1407 H  HD12  . LEU A 1 113 ? -2.603  -21.908 -2.850  1.00 35.91  ? 983  LEU A HD12  1 
ATOM   1408 H  HD13  . LEU A 1 113 ? -3.304  -21.106 -4.006  1.00 35.91  ? 983  LEU A HD13  1 
ATOM   1409 H  HD21  . LEU A 1 113 ? -5.507  -22.773 -1.052  1.00 36.66  ? 983  LEU A HD21  1 
ATOM   1410 H  HD22  . LEU A 1 113 ? -3.942  -22.927 -1.050  1.00 36.66  ? 983  LEU A HD22  1 
ATOM   1411 H  HD23  . LEU A 1 113 ? -4.596  -21.539 -0.705  1.00 36.66  ? 983  LEU A HD23  1 
ATOM   1412 N  N     . PHE A 1 114 ? -8.948  -20.274 -3.976  1.00 23.40  ? 984  PHE A N     1 
ATOM   1413 C  CA    . PHE A 1 114 ? -10.002 -19.261 -3.996  1.00 21.62  ? 984  PHE A CA    1 
ATOM   1414 C  C     . PHE A 1 114 ? -11.386 -19.869 -4.206  1.00 28.35  ? 984  PHE A C     1 
ATOM   1415 O  O     . PHE A 1 114 ? -12.342 -19.147 -4.489  1.00 20.86  ? 984  PHE A O     1 
ATOM   1416 C  CB    . PHE A 1 114 ? -9.711  -18.226 -5.101  1.00 18.86  ? 984  PHE A CB    1 
ATOM   1417 C  CG    . PHE A 1 114 ? -8.399  -17.512 -4.918  1.00 20.18  ? 984  PHE A CG    1 
ATOM   1418 C  CD1   . PHE A 1 114 ? -8.323  -16.353 -4.150  1.00 19.55  ? 984  PHE A CD1   1 
ATOM   1419 C  CD2   . PHE A 1 114 ? -7.239  -18.006 -5.496  1.00 19.67  ? 984  PHE A CD2   1 
ATOM   1420 C  CE1   . PHE A 1 114 ? -7.112  -15.693 -3.975  1.00 21.99  ? 984  PHE A CE1   1 
ATOM   1421 C  CE2   . PHE A 1 114 ? -6.027  -17.349 -5.324  1.00 19.49  ? 984  PHE A CE2   1 
ATOM   1422 C  CZ    . PHE A 1 114 ? -5.963  -16.196 -4.561  1.00 22.56  ? 984  PHE A CZ    1 
ATOM   1423 H  H     . PHE A 1 114 ? -8.834  -20.670 -4.731  1.00 28.08  ? 984  PHE A H     1 
ATOM   1424 H  HA    . PHE A 1 114 ? -10.007 -18.791 -3.136  1.00 25.94  ? 984  PHE A HA    1 
ATOM   1425 H  HB2   . PHE A 1 114 ? -9.687  -18.679 -5.958  1.00 22.63  ? 984  PHE A HB2   1 
ATOM   1426 H  HB3   . PHE A 1 114 ? -10.416 -17.559 -5.100  1.00 22.63  ? 984  PHE A HB3   1 
ATOM   1427 H  HD1   . PHE A 1 114 ? -9.093  -16.012 -3.755  1.00 23.46  ? 984  PHE A HD1   1 
ATOM   1428 H  HD2   . PHE A 1 114 ? -7.274  -18.781 -6.010  1.00 23.61  ? 984  PHE A HD2   1 
ATOM   1429 H  HE1   . PHE A 1 114 ? -7.073  -14.918 -3.462  1.00 26.39  ? 984  PHE A HE1   1 
ATOM   1430 H  HE2   . PHE A 1 114 ? -5.256  -17.688 -5.719  1.00 23.39  ? 984  PHE A HE2   1 
ATOM   1431 H  HZ    . PHE A 1 114 ? -5.151  -15.758 -4.447  1.00 27.07  ? 984  PHE A HZ    1 
ATOM   1432 N  N     . SER A 1 115 ? -11.509 -21.187 -4.054  1.00 20.89  ? 985  SER A N     1 
ATOM   1433 C  CA    . SER A 1 115 ? -12.828 -21.810 -4.121  1.00 22.79  ? 985  SER A CA    1 
ATOM   1434 C  C     . SER A 1 115 ? -13.647 -21.339 -2.931  1.00 23.95  ? 985  SER A C     1 
ATOM   1435 O  O     . SER A 1 115 ? -13.098 -20.992 -1.887  1.00 23.13  ? 985  SER A O     1 
ATOM   1436 C  CB    . SER A 1 115 ? -12.735 -23.339 -4.095  1.00 23.16  ? 985  SER A CB    1 
ATOM   1437 O  OG    . SER A 1 115 ? -12.292 -23.787 -2.823  1.00 24.60  ? 985  SER A OG    1 
ATOM   1438 H  H     . SER A 1 115 ? -10.859 -21.732 -3.913  1.00 25.07  ? 985  SER A H     1 
ATOM   1439 H  HA    . SER A 1 115 ? -13.282 -21.536 -4.945  1.00 27.34  ? 985  SER A HA    1 
ATOM   1440 H  HB2   . SER A 1 115 ? -13.612 -23.712 -4.275  1.00 27.79  ? 985  SER A HB2   1 
ATOM   1441 H  HB3   . SER A 1 115 ? -12.104 -23.630 -4.772  1.00 27.79  ? 985  SER A HB3   1 
ATOM   1442 H  HG    . SER A 1 115 ? -12.164 -23.145 -2.329  1.00 29.52  ? 985  SER A HG    1 
ATOM   1443 N  N     . THR A 1 116 ? -14.964 -21.348 -3.070  1.00 22.01  ? 986  THR A N     1 
ATOM   1444 C  CA    . THR A 1 116 ? -15.828 -20.945 -1.959  1.00 25.24  ? 986  THR A CA    1 
ATOM   1445 C  C     . THR A 1 116 ? -15.561 -21.803 -0.713  1.00 28.30  ? 986  THR A C     1 
ATOM   1446 O  O     . THR A 1 116 ? -15.491 -21.287 0.403   1.00 24.50  ? 986  THR A O     1 
ATOM   1447 C  CB    . THR A 1 116 ? -17.312 -20.996 -2.378  1.00 23.33  ? 986  THR A CB    1 
ATOM   1448 O  OG1   . THR A 1 116 ? -17.525 -20.019 -3.410  1.00 22.21  ? 986  THR A OG1   1 
ATOM   1449 C  CG2   . THR A 1 116 ? -18.237 -20.686 -1.189  1.00 22.67  ? 986  THR A CG2   1 
ATOM   1450 H  H     . THR A 1 116 ? -15.383 -21.579 -3.784  1.00 26.42  ? 986  THR A H     1 
ATOM   1451 H  HA    . THR A 1 116 ? -15.620 -20.016 -1.726  1.00 30.29  ? 986  THR A HA    1 
ATOM   1452 H  HB    . THR A 1 116 ? -17.526 -21.880 -2.716  1.00 27.99  ? 986  THR A HB    1 
ATOM   1453 H  HG1   . THR A 1 116 ? -17.049 -20.186 -4.056  1.00 26.65  ? 986  THR A HG1   1 
ATOM   1454 H  HG21  . THR A 1 116 ? -18.098 -21.330 -0.490  1.00 27.21  ? 986  THR A HG21  1 
ATOM   1455 H  HG22  . THR A 1 116 ? -18.049 -19.809 -0.847  1.00 27.21  ? 986  THR A HG22  1 
ATOM   1456 H  HG23  . THR A 1 116 ? -19.155 -20.723 -1.469  1.00 27.21  ? 986  THR A HG23  1 
ATOM   1457 N  N     . LYS A 1 117 ? -15.378 -23.103 -0.915  1.00 25.23  ? 987  LYS A N     1 
ATOM   1458 C  CA    . LYS A 1 117 ? -15.114 -24.033 0.182   1.00 26.73  ? 987  LYS A CA    1 
ATOM   1459 C  C     . LYS A 1 117 ? -13.857 -23.640 0.960   1.00 24.76  ? 987  LYS A C     1 
ATOM   1460 O  O     . LYS A 1 117 ? -13.850 -23.619 2.193   1.00 26.00  ? 987  LYS A O     1 
ATOM   1461 C  CB    . LYS A 1 117 ? -14.963 -25.450 -0.384  1.00 28.52  ? 987  LYS A CB    1 
ATOM   1462 C  CG    . LYS A 1 117 ? -14.479 -26.495 0.621   1.00 53.13  ? 987  LYS A CG    1 
ATOM   1463 C  CD    . LYS A 1 117 ? -14.172 -27.819 -0.080  1.00 69.79  ? 987  LYS A CD    1 
ATOM   1464 C  CE    . LYS A 1 117 ? -13.689 -28.890 0.889   1.00 83.35  ? 987  LYS A CE    1 
ATOM   1465 N  NZ    . LYS A 1 117 ? -14.762 -29.344 1.813   1.00 87.31  ? 987  LYS A NZ    1 
ATOM   1466 H  H     . LYS A 1 117 ? -15.401 -23.478 -1.689  1.00 30.28  ? 987  LYS A H     1 
ATOM   1467 H  HA    . LYS A 1 117 ? -15.874 -24.027 0.801   1.00 32.07  ? 987  LYS A HA    1 
ATOM   1468 H  HB2   . LYS A 1 117 ? -15.826 -25.743 -0.718  1.00 34.22  ? 987  LYS A HB2   1 
ATOM   1469 H  HB3   . LYS A 1 117 ? -14.323 -25.425 -1.112  1.00 34.22  ? 987  LYS A HB3   1 
ATOM   1470 H  HG2   . LYS A 1 117 ? -13.667 -26.180 1.049   1.00 63.75  ? 987  LYS A HG2   1 
ATOM   1471 H  HG3   . LYS A 1 117 ? -15.171 -26.652 1.283   1.00 63.75  ? 987  LYS A HG3   1 
ATOM   1472 H  HD2   . LYS A 1 117 ? -14.978 -28.144 -0.511  1.00 83.75  ? 987  LYS A HD2   1 
ATOM   1473 H  HD3   . LYS A 1 117 ? -13.477 -27.674 -0.741  1.00 83.75  ? 987  LYS A HD3   1 
ATOM   1474 H  HE2   . LYS A 1 117 ? -13.381 -29.658 0.384   1.00 100.03 ? 987  LYS A HE2   1 
ATOM   1475 H  HE3   . LYS A 1 117 ? -12.963 -28.530 1.423   1.00 100.03 ? 987  LYS A HE3   1 
ATOM   1476 H  HZ1   . LYS A 1 117 ? -15.439 -29.686 1.348   1.00 104.77 ? 987  LYS A HZ1   1 
ATOM   1477 H  HZ2   . LYS A 1 117 ? -14.445 -29.968 2.364   1.00 104.77 ? 987  LYS A HZ2   1 
ATOM   1478 H  HZ3   . LYS A 1 117 ? -15.059 -28.658 2.295   1.00 104.77 ? 987  LYS A HZ3   1 
ATOM   1479 N  N     . THR A 1 118 ? -12.788 -23.330 0.235   1.00 23.10  ? 988  THR A N     1 
ATOM   1480 C  CA    . THR A 1 118 ? -11.509 -22.999 0.858   1.00 29.01  ? 988  THR A CA    1 
ATOM   1481 C  C     . THR A 1 118 ? -11.587 -21.658 1.586   1.00 29.27  ? 988  THR A C     1 
ATOM   1482 O  O     . THR A 1 118 ? -11.006 -21.498 2.657   1.00 23.45  ? 988  THR A O     1 
ATOM   1483 C  CB    . THR A 1 118 ? -10.364 -22.939 -0.189  1.00 31.73  ? 988  THR A CB    1 
ATOM   1484 O  OG1   . THR A 1 118 ? -10.109 -24.252 -0.710  1.00 27.39  ? 988  THR A OG1   1 
ATOM   1485 C  CG2   . THR A 1 118 ? -9.087  -22.388 0.436   1.00 33.79  ? 988  THR A CG2   1 
ATOM   1486 H  H     . THR A 1 118 ? -12.776 -23.304 -0.625  1.00 27.72  ? 988  THR A H     1 
ATOM   1487 H  HA    . THR A 1 118 ? -11.285 -23.691 1.516   1.00 34.81  ? 988  THR A HA    1 
ATOM   1488 H  HB    . THR A 1 118 ? -10.625 -22.351 -0.915  1.00 38.07  ? 988  THR A HB    1 
ATOM   1489 H  HG1   . THR A 1 118 ? -9.505  -24.222 -1.264  1.00 32.87  ? 988  THR A HG1   1 
ATOM   1490 H  HG21  . THR A 1 118 ? -8.808  -22.952 1.162   1.00 40.54  ? 988  THR A HG21  1 
ATOM   1491 H  HG22  . THR A 1 118 ? -8.388  -22.356 -0.221  1.00 40.54  ? 988  THR A HG22  1 
ATOM   1492 H  HG23  . THR A 1 118 ? -9.242  -21.502 0.771   1.00 40.54  ? 988  THR A HG23  1 
ATOM   1493 N  N     . LEU A 1 119 ? -12.293 -20.694 0.998   1.00 23.80  ? 989  LEU A N     1 
ATOM   1494 C  CA    . LEU A 1 119 ? -12.376 -19.352 1.573   1.00 23.65  ? 989  LEU A CA    1 
ATOM   1495 C  C     . LEU A 1 119 ? -13.170 -19.363 2.879   1.00 27.08  ? 989  LEU A C     1 
ATOM   1496 O  O     . LEU A 1 119 ? -12.807 -18.694 3.846   1.00 28.66  ? 989  LEU A O     1 
ATOM   1497 C  CB    . LEU A 1 119 ? -13.003 -18.368 0.570   1.00 24.16  ? 989  LEU A CB    1 
ATOM   1498 C  CG    . LEU A 1 119 ? -12.190 -18.145 -0.706  1.00 31.07  ? 989  LEU A CG    1 
ATOM   1499 C  CD1   . LEU A 1 119 ? -12.995 -17.363 -1.750  1.00 34.62  ? 989  LEU A CD1   1 
ATOM   1500 C  CD2   . LEU A 1 119 ? -10.860 -17.438 -0.410  1.00 28.35  ? 989  LEU A CD2   1 
ATOM   1501 H  H     . LEU A 1 119 ? -12.733 -20.791 0.265   1.00 28.56  ? 989  LEU A H     1 
ATOM   1502 H  HA    . LEU A 1 119 ? -11.470 -19.037 1.775   1.00 28.38  ? 989  LEU A HA    1 
ATOM   1503 H  HB2   . LEU A 1 119 ? -13.873 -18.708 0.308   1.00 29.00  ? 989  LEU A HB2   1 
ATOM   1504 H  HB3   . LEU A 1 119 ? -13.108 -17.508 1.006   1.00 29.00  ? 989  LEU A HB3   1 
ATOM   1505 H  HG    . LEU A 1 119 ? -11.979 -19.010 -1.091  1.00 37.29  ? 989  LEU A HG    1 
ATOM   1506 H  HD11  . LEU A 1 119 ? -13.786 -17.861 -1.970  1.00 41.54  ? 989  LEU A HD11  1 
ATOM   1507 H  HD12  . LEU A 1 119 ? -13.236 -16.509 -1.383  1.00 41.54  ? 989  LEU A HD12  1 
ATOM   1508 H  HD13  . LEU A 1 119 ? -12.455 -17.242 -2.535  1.00 41.54  ? 989  LEU A HD13  1 
ATOM   1509 H  HD21  . LEU A 1 119 ? -10.380 -17.316 -1.233  1.00 34.02  ? 989  LEU A HD21  1 
ATOM   1510 H  HD22  . LEU A 1 119 ? -11.042 -16.585 -0.008  1.00 34.02  ? 989  LEU A HD22  1 
ATOM   1511 H  HD23  . LEU A 1 119 ? -10.345 -17.980 0.192   1.00 34.02  ? 989  LEU A HD23  1 
ATOM   1512 N  N     . VAL A 1 120 ? -14.252 -20.126 2.902   1.00 28.81  ? 990  VAL A N     1 
ATOM   1513 C  CA    . VAL A 1 120 ? -15.089 -20.233 4.088   1.00 37.34  ? 990  VAL A CA    1 
ATOM   1514 C  C     . VAL A 1 120 ? -14.320 -20.892 5.227   1.00 38.82  ? 990  VAL A C     1 
ATOM   1515 O  O     . VAL A 1 120 ? -14.385 -20.452 6.379   1.00 33.36  ? 990  VAL A O     1 
ATOM   1516 C  CB    . VAL A 1 120 ? -16.362 -21.036 3.781   1.00 35.90  ? 990  VAL A CB    1 
ATOM   1517 C  CG1   . VAL A 1 120 ? -17.045 -21.471 5.060   1.00 41.67  ? 990  VAL A CG1   1 
ATOM   1518 C  CG2   . VAL A 1 120 ? -17.306 -20.202 2.913   1.00 35.29  ? 990  VAL A CG2   1 
ATOM   1519 H  H     . VAL A 1 120 ? -14.528 -20.596 2.236   1.00 34.57  ? 990  VAL A H     1 
ATOM   1520 H  HA    . VAL A 1 120 ? -15.355 -19.335 4.377   1.00 44.81  ? 990  VAL A HA    1 
ATOM   1521 H  HB    . VAL A 1 120 ? -16.118 -21.841 3.278   1.00 43.08  ? 990  VAL A HB    1 
ATOM   1522 H  HG11  . VAL A 1 120 ? -17.835 -21.970 4.837   1.00 50.00  ? 990  VAL A HG11  1 
ATOM   1523 H  HG12  . VAL A 1 120 ? -16.441 -22.022 5.564   1.00 50.00  ? 990  VAL A HG12  1 
ATOM   1524 H  HG13  . VAL A 1 120 ? -17.281 -20.692 5.568   1.00 50.00  ? 990  VAL A HG13  1 
ATOM   1525 H  HG21  . VAL A 1 120 ? -16.901 -19.349 2.742   1.00 42.35  ? 990  VAL A HG21  1 
ATOM   1526 H  HG22  . VAL A 1 120 ? -17.459 -20.664 2.085   1.00 42.35  ? 990  VAL A HG22  1 
ATOM   1527 H  HG23  . VAL A 1 120 ? -18.137 -20.083 3.380   1.00 42.35  ? 990  VAL A HG23  1 
ATOM   1528 N  N     . GLU A 1 121 ? -13.571 -21.935 4.902   1.00 31.29  ? 991  GLU A N     1 
ATOM   1529 C  CA    . GLU A 1 121 ? -12.759 -22.603 5.907   1.00 35.29  ? 991  GLU A CA    1 
ATOM   1530 C  C     . GLU A 1 121 ? -11.704 -21.670 6.493   1.00 38.12  ? 991  GLU A C     1 
ATOM   1531 O  O     . GLU A 1 121 ? -11.379 -21.768 7.675   1.00 40.33  ? 991  GLU A O     1 
ATOM   1532 C  CB    . GLU A 1 121 ? -12.106 -23.838 5.307   1.00 34.05  ? 991  GLU A CB    1 
ATOM   1533 C  CG    . GLU A 1 121 ? -13.103 -24.954 5.089   1.00 61.69  ? 991  GLU A CG    1 
ATOM   1534 C  CD    . GLU A 1 121 ? -12.545 -26.087 4.257   1.00 77.35  ? 991  GLU A CD    1 
ATOM   1535 O  OE1   . GLU A 1 121 ? -11.382 -25.989 3.807   1.00 71.75  ? 991  GLU A OE1   1 
ATOM   1536 O  OE2   . GLU A 1 121 ? -13.277 -27.079 4.057   1.00 81.90  ? 991  GLU A OE2   1 
ATOM   1537 H  H     . GLU A 1 121 ? -13.515 -22.274 4.114   1.00 37.55  ? 991  GLU A H     1 
ATOM   1538 H  HA    . GLU A 1 121 ? -13.340 -22.896 6.639   1.00 42.35  ? 991  GLU A HA    1 
ATOM   1539 H  HB2   . GLU A 1 121 ? -11.716 -23.608 4.449   1.00 40.86  ? 991  GLU A HB2   1 
ATOM   1540 H  HB3   . GLU A 1 121 ? -11.418 -24.160 5.911   1.00 40.86  ? 991  GLU A HB3   1 
ATOM   1541 H  HG2   . GLU A 1 121 ? -13.365 -25.315 5.950   1.00 74.03  ? 991  GLU A HG2   1 
ATOM   1542 H  HG3   . GLU A 1 121 ? -13.878 -24.598 4.628   1.00 74.03  ? 991  GLU A HG3   1 
ATOM   1543 N  N     . ALA A 1 122 ? -11.190 -20.752 5.674   1.00 28.21  ? 992  ALA A N     1 
ATOM   1544 C  CA    . ALA A 1 122 ? -10.128 -19.841 6.102   1.00 28.51  ? 992  ALA A CA    1 
ATOM   1545 C  C     . ALA A 1 122 ? -10.639 -18.778 7.067   1.00 32.54  ? 992  ALA A C     1 
ATOM   1546 O  O     . ALA A 1 122 ? -10.034 -18.532 8.112   1.00 33.38  ? 992  ALA A O     1 
ATOM   1547 C  CB    . ALA A 1 122 ? -9.485  -19.171 4.880   1.00 30.83  ? 992  ALA A CB    1 
ATOM   1548 H  H     . ALA A 1 122 ? -11.442 -20.636 4.859   1.00 33.85  ? 992  ALA A H     1 
ATOM   1549 H  HA    . ALA A 1 122 ? -9.434  -20.358 6.562   1.00 34.22  ? 992  ALA A HA    1 
ATOM   1550 H  HB1   . ALA A 1 122 ? -8.791  -18.578 5.179   1.00 36.99  ? 992  ALA A HB1   1 
ATOM   1551 H  HB2   . ALA A 1 122 ? -9.114  -19.850 4.311   1.00 36.99  ? 992  ALA A HB2   1 
ATOM   1552 H  HB3   . ALA A 1 122 ? -10.157 -18.677 4.405   1.00 36.99  ? 992  ALA A HB3   1 
ATOM   1553 N  N     . ASN A 1 123 ? -11.751 -18.143 6.708   1.00 32.30  ? 993  ASN A N     1 
ATOM   1554 C  CA    . ASN A 1 123 ? -12.277 -17.013 7.467   1.00 30.29  ? 993  ASN A CA    1 
ATOM   1555 C  C     . ASN A 1 123 ? -13.795 -16.992 7.373   1.00 33.08  ? 993  ASN A C     1 
ATOM   1556 O  O     . ASN A 1 123 ? -14.375 -16.173 6.664   1.00 27.45  ? 993  ASN A O     1 
ATOM   1557 C  CB    . ASN A 1 123 ? -11.704 -15.694 6.927   1.00 30.45  ? 993  ASN A CB    1 
ATOM   1558 C  CG    . ASN A 1 123 ? -10.201 -15.600 7.088   1.00 37.43  ? 993  ASN A CG    1 
ATOM   1559 O  OD1   . ASN A 1 123 ? -9.697  -15.281 8.168   1.00 34.41  ? 993  ASN A OD1   1 
ATOM   1560 N  ND2   . ASN A 1 123 ? -9.473  -15.888 6.015   1.00 30.67  ? 993  ASN A ND2   1 
ATOM   1561 H  H     . ASN A 1 123 ? -12.225 -18.351 6.021   1.00 38.76  ? 993  ASN A H     1 
ATOM   1562 H  HA    . ASN A 1 123 ? -12.023 -17.102 8.409   1.00 36.34  ? 993  ASN A HA    1 
ATOM   1563 H  HB2   . ASN A 1 123 ? -11.909 -15.623 5.981   1.00 36.54  ? 993  ASN A HB2   1 
ATOM   1564 H  HB3   . ASN A 1 123 ? -12.105 -14.954 7.410   1.00 36.54  ? 993  ASN A HB3   1 
ATOM   1565 H  HD21  . ASN A 1 123 ? -9.860  -16.112 5.280   1.00 36.80  ? 993  ASN A HD21  1 
ATOM   1566 H  HD22  . ASN A 1 123 ? -8.615  -15.849 6.055   1.00 36.80  ? 993  ASN A HD22  1 
ATOM   1567 N  N     . ASN A 1 124 ? -14.418 -17.896 8.119   1.00 27.31  ? 994  ASN A N     1 
ATOM   1568 C  CA    . ASN A 1 124 ? -15.850 -18.149 8.067   1.00 34.64  ? 994  ASN A CA    1 
ATOM   1569 C  C     . ASN A 1 124 ? -16.709 -16.903 8.241   1.00 32.71  ? 994  ASN A C     1 
ATOM   1570 O  O     . ASN A 1 124 ? -17.794 -16.807 7.674   1.00 34.61  ? 994  ASN A O     1 
ATOM   1571 C  CB    . ASN A 1 124 ? -16.199 -19.136 9.188   1.00 55.31  ? 994  ASN A CB    1 
ATOM   1572 C  CG    . ASN A 1 124 ? -17.563 -19.776 9.010   1.00 74.21  ? 994  ASN A CG    1 
ATOM   1573 O  OD1   . ASN A 1 124 ? -17.776 -20.554 8.080   1.00 81.18  ? 994  ASN A OD1   1 
ATOM   1574 N  ND2   . ASN A 1 124 ? -18.489 -19.474 9.918   1.00 73.42  ? 994  ASN A ND2   1 
ATOM   1575 H  H     . ASN A 1 124 ? -14.012 -18.398 8.687   1.00 32.78  ? 994  ASN A H     1 
ATOM   1576 H  HA    . ASN A 1 124 ? -16.077 -18.563 7.208   1.00 41.57  ? 994  ASN A HA    1 
ATOM   1577 H  HB2   . ASN A 1 124 ? -15.536 -19.845 9.202   1.00 66.37  ? 994  ASN A HB2   1 
ATOM   1578 H  HB3   . ASN A 1 124 ? -16.197 -18.665 10.035  1.00 66.37  ? 994  ASN A HB3   1 
ATOM   1579 H  HD21  . ASN A 1 124 ? -18.299 -18.941 10.566  1.00 88.11  ? 994  ASN A HD21  1 
ATOM   1580 H  HD22  . ASN A 1 124 ? -19.277 -19.813 9.858   1.00 88.11  ? 994  ASN A HD22  1 
ATOM   1581 N  N     . GLU A 1 125 ? -16.232 -15.970 9.060   1.00 27.13  ? 995  GLU A N     1 
ATOM   1582 C  CA    . GLU A 1 125 ? -17.020 -14.806 9.462   1.00 25.79  ? 995  GLU A CA    1 
ATOM   1583 C  C     . GLU A 1 125 ? -16.682 -13.547 8.666   1.00 29.44  ? 995  GLU A C     1 
ATOM   1584 O  O     . GLU A 1 125 ? -17.148 -12.452 8.992   1.00 26.72  ? 995  GLU A O     1 
ATOM   1585 C  CB    . GLU A 1 125 ? -16.794 -14.517 10.950  1.00 31.50  ? 995  GLU A CB    1 
ATOM   1586 C  CG    . GLU A 1 125 ? -17.364 -15.582 11.850  1.00 47.42  ? 995  GLU A CG    1 
ATOM   1587 C  CD    . GLU A 1 125 ? -18.866 -15.711 11.693  1.00 67.27  ? 995  GLU A CD    1 
ATOM   1588 O  OE1   . GLU A 1 125 ? -19.318 -16.690 11.058  1.00 64.75  ? 995  GLU A OE1   1 
ATOM   1589 O  OE2   . GLU A 1 125 ? -19.595 -14.829 12.199  1.00 82.58  ? 995  GLU A OE2   1 
ATOM   1590 H  H     . GLU A 1 125 ? -15.443 -15.988 9.402   1.00 32.56  ? 995  GLU A H     1 
ATOM   1591 H  HA    . GLU A 1 125 ? -17.971 -15.002 9.330   1.00 30.95  ? 995  GLU A HA    1 
ATOM   1592 H  HB2   . GLU A 1 125 ? -15.840 -14.462 11.119  1.00 37.80  ? 995  GLU A HB2   1 
ATOM   1593 H  HB3   . GLU A 1 125 ? -17.220 -13.675 11.176  1.00 37.80  ? 995  GLU A HB3   1 
ATOM   1594 H  HG2   . GLU A 1 125 ? -16.962 -16.437 11.627  1.00 56.90  ? 995  GLU A HG2   1 
ATOM   1595 H  HG3   . GLU A 1 125 ? -17.175 -15.354 12.773  1.00 56.90  ? 995  GLU A HG3   1 
ATOM   1596 N  N     . HIS A 1 126 ? -15.877 -13.700 7.622   1.00 23.95  ? 996  HIS A N     1 
ATOM   1597 C  CA    . HIS A 1 126 ? -15.407 -12.539 6.860   1.00 22.47  ? 996  HIS A CA    1 
ATOM   1598 C  C     . HIS A 1 126 ? -16.552 -11.705 6.262   1.00 25.83  ? 996  HIS A C     1 
ATOM   1599 O  O     . HIS A 1 126 ? -17.512 -12.243 5.723   1.00 24.93  ? 996  HIS A O     1 
ATOM   1600 C  CB    . HIS A 1 126 ? -14.460 -12.991 5.741   1.00 20.61  ? 996  HIS A CB    1 
ATOM   1601 C  CG    . HIS A 1 126 ? -13.538 -11.915 5.268   1.00 23.88  ? 996  HIS A CG    1 
ATOM   1602 N  ND1   . HIS A 1 126 ? -12.518 -11.410 6.052   1.00 28.32  ? 996  HIS A ND1   1 
ATOM   1603 C  CD2   . HIS A 1 126 ? -13.488 -11.226 4.103   1.00 25.39  ? 996  HIS A CD2   1 
ATOM   1604 C  CE1   . HIS A 1 126 ? -11.875 -10.472 5.382   1.00 28.92  ? 996  HIS A CE1   1 
ATOM   1605 N  NE2   . HIS A 1 126 ? -12.444 -10.340 4.195   1.00 24.71  ? 996  HIS A NE2   1 
ATOM   1606 H  H     . HIS A 1 126 ? -15.588 -14.457 7.333   1.00 28.74  ? 996  HIS A H     1 
ATOM   1607 H  HA    . HIS A 1 126 ? -14.898 -11.956 7.462   1.00 26.96  ? 996  HIS A HA    1 
ATOM   1608 H  HB2   . HIS A 1 126 ? -13.916 -13.725 6.067   1.00 24.73  ? 996  HIS A HB2   1 
ATOM   1609 H  HB3   . HIS A 1 126 ? -14.988 -13.284 4.982   1.00 24.73  ? 996  HIS A HB3   1 
ATOM   1610 H  HD1   . HIS A 1 126 ? -12.326 -11.672 6.848   1.00 33.99  ? 996  HIS A HD1   1 
ATOM   1611 H  HD2   . HIS A 1 126 ? -14.051 -11.340 3.372   1.00 30.46  ? 996  HIS A HD2   1 
ATOM   1612 H  HE1   . HIS A 1 126 ? -11.147 -9.984  5.693   1.00 34.70  ? 996  HIS A HE1   1 
ATOM   1613 H  HE2   . HIS A 1 126 ? -12.202 -9.788  3.582   1.00 29.65  ? 996  HIS A HE2   1 
ATOM   1614 N  N     . MET A 1 127 ? -16.424 -10.386 6.355   1.00 22.40  ? 997  MET A N     1 
ATOM   1615 C  CA    . MET A 1 127 ? -17.405 -9.449  5.819   1.00 26.33  ? 997  MET A CA    1 
ATOM   1616 C  C     . MET A 1 127 ? -17.575 -9.578  4.301   1.00 23.78  ? 997  MET A C     1 
ATOM   1617 O  O     . MET A 1 127 ? -16.592 -9.569  3.560   1.00 21.80  ? 997  MET A O     1 
ATOM   1618 C  CB    . MET A 1 127 ? -16.946 -8.020  6.135   1.00 28.24  ? 997  MET A CB    1 
ATOM   1619 C  CG    . MET A 1 127 ? -17.767 -6.948  5.472   1.00 30.11  ? 997  MET A CG    1 
ATOM   1620 S  SD    . MET A 1 127 ? -19.449 -6.952  6.114   1.00 41.46  ? 997  MET A SD    1 
ATOM   1621 C  CE    . MET A 1 127 ? -19.306 -5.667  7.345   1.00 26.52  ? 997  MET A CE    1 
ATOM   1622 H  H     . MET A 1 127 ? -15.757 -9.999  6.735   1.00 26.88  ? 997  MET A H     1 
ATOM   1623 H  HA    . MET A 1 127 ? -18.269 -9.599  6.255   1.00 31.59  ? 997  MET A HA    1 
ATOM   1624 H  HB2   . MET A 1 127 ? -16.999 -7.882  7.094   1.00 33.89  ? 997  MET A HB2   1 
ATOM   1625 H  HB3   . MET A 1 127 ? -16.028 -7.915  5.839   1.00 33.89  ? 997  MET A HB3   1 
ATOM   1626 H  HG2   . MET A 1 127 ? -17.372 -6.081  5.652   1.00 36.14  ? 997  MET A HG2   1 
ATOM   1627 H  HG3   . MET A 1 127 ? -17.802 -7.113  4.517   1.00 36.14  ? 997  MET A HG3   1 
ATOM   1628 H  HE1   . MET A 1 127 ? -20.154 -5.556  7.781   1.00 31.83  ? 997  MET A HE1   1 
ATOM   1629 H  HE2   . MET A 1 127 ? -18.638 -5.922  7.986   1.00 31.83  ? 997  MET A HE2   1 
ATOM   1630 H  HE3   . MET A 1 127 ? -19.050 -4.848  6.914   1.00 31.83  ? 997  MET A HE3   1 
ATOM   1631 N  N     . VAL A 1 128 ? -18.822 -9.679  3.849   1.00 21.16  ? 998  VAL A N     1 
ATOM   1632 C  CA    . VAL A 1 128 ? -19.135 -9.681  2.415   1.00 23.46  ? 998  VAL A CA    1 
ATOM   1633 C  C     . VAL A 1 128 ? -20.204 -8.642  2.106   1.00 20.08  ? 998  VAL A C     1 
ATOM   1634 O  O     . VAL A 1 128 ? -21.328 -8.741  2.577   1.00 21.04  ? 998  VAL A O     1 
ATOM   1635 C  CB    . VAL A 1 128 ? -19.642 -11.058 1.949   1.00 20.99  ? 998  VAL A CB    1 
ATOM   1636 C  CG1   . VAL A 1 128 ? -20.129 -11.003 0.484   1.00 18.79  ? 998  VAL A CG1   1 
ATOM   1637 C  CG2   . VAL A 1 128 ? -18.550 -12.091 2.114   1.00 20.81  ? 998  VAL A CG2   1 
ATOM   1638 H  H     . VAL A 1 128 ? -19.514 -9.749  4.355   1.00 25.39  ? 998  VAL A H     1 
ATOM   1639 H  HA    . VAL A 1 128 ? -18.328 -9.458  1.905   1.00 28.15  ? 998  VAL A HA    1 
ATOM   1640 H  HB    . VAL A 1 128 ? -20.400 -11.325 2.510   1.00 25.19  ? 998  VAL A HB    1 
ATOM   1641 H  HG11  . VAL A 1 128 ? -20.016 -10.110 0.151   1.00 22.54  ? 998  VAL A HG11  1 
ATOM   1642 H  HG12  . VAL A 1 128 ? -19.609 -11.617 -0.040  1.00 22.54  ? 998  VAL A HG12  1 
ATOM   1643 H  HG13  . VAL A 1 128 ? -21.056 -11.251 0.454   1.00 22.54  ? 998  VAL A HG13  1 
ATOM   1644 H  HG21  . VAL A 1 128 ? -17.770 -11.666 2.476   1.00 24.97  ? 998  VAL A HG21  1 
ATOM   1645 H  HG22  . VAL A 1 128 ? -18.857 -12.777 2.712   1.00 24.97  ? 998  VAL A HG22  1 
ATOM   1646 H  HG23  . VAL A 1 128 ? -18.348 -12.471 1.256   1.00 24.97  ? 998  VAL A HG23  1 
ATOM   1647 N  N     . GLU A 1 129 ? -19.849 -7.643  1.313   1.00 19.11  ? 999  GLU A N     1 
ATOM   1648 C  CA    . GLU A 1 129 ? -20.827 -6.675  0.842   1.00 21.42  ? 999  GLU A CA    1 
ATOM   1649 C  C     . GLU A 1 129 ? -21.641 -7.328  -0.279  1.00 23.74  ? 999  GLU A C     1 
ATOM   1650 O  O     . GLU A 1 129 ? -21.101 -8.057  -1.105  1.00 21.70  ? 999  GLU A O     1 
ATOM   1651 C  CB    . GLU A 1 129 ? -20.120 -5.400  0.343   1.00 23.05  ? 999  GLU A CB    1 
ATOM   1652 C  CG    . GLU A 1 129 ? -21.070 -4.361  -0.246  1.00 26.79  ? 999  GLU A CG    1 
ATOM   1653 C  CD    . GLU A 1 129 ? -20.400 -3.023  -0.556  1.00 26.19  ? 999  GLU A CD    1 
ATOM   1654 O  OE1   . GLU A 1 129 ? -19.153 -2.961  -0.601  1.00 26.32  ? 999  GLU A OE1   1 
ATOM   1655 O  OE2   . GLU A 1 129 ? -21.134 -2.031  -0.765  1.00 24.09  ? 999  GLU A OE2   1 
ATOM   1656 H  H     . GLU A 1 129 ? -19.049 -7.503  1.033   1.00 22.93  ? 999  GLU A H     1 
ATOM   1657 H  HA    . GLU A 1 129 ? -21.433 -6.433  1.573   1.00 25.71  ? 999  GLU A HA    1 
ATOM   1658 H  HB2   . GLU A 1 129 ? -19.654 -4.988  1.087   1.00 27.66  ? 999  GLU A HB2   1 
ATOM   1659 H  HB3   . GLU A 1 129 ? -19.484 -5.646  -0.348  1.00 27.66  ? 999  GLU A HB3   1 
ATOM   1660 H  HG2   . GLU A 1 129 ? -21.439 -4.708  -1.073  1.00 32.14  ? 999  GLU A HG2   1 
ATOM   1661 H  HG3   . GLU A 1 129 ? -21.785 -4.195  0.389   1.00 32.14  ? 999  GLU A HG3   1 
ATOM   1662 N  N     . VAL A 1 130 ? -22.936 -7.055  -0.311  1.00 22.96  ? 1000 VAL A N     1 
ATOM   1663 C  CA    . VAL A 1 130 ? -23.850 -7.739  -1.216  1.00 26.99  ? 1000 VAL A CA    1 
ATOM   1664 C  C     . VAL A 1 130 ? -24.584 -6.727  -2.091  1.00 27.82  ? 1000 VAL A C     1 
ATOM   1665 O  O     . VAL A 1 130 ? -24.859 -5.615  -1.649  1.00 24.15  ? 1000 VAL A O     1 
ATOM   1666 C  CB    . VAL A 1 130 ? -24.882 -8.534  -0.414  1.00 28.23  ? 1000 VAL A CB    1 
ATOM   1667 C  CG1   . VAL A 1 130 ? -25.960 -9.121  -1.331  1.00 26.15  ? 1000 VAL A CG1   1 
ATOM   1668 C  CG2   . VAL A 1 130 ? -24.183 -9.629  0.402   1.00 25.13  ? 1000 VAL A CG2   1 
ATOM   1669 H  H     . VAL A 1 130 ? -23.318 -6.469  0.190   1.00 27.56  ? 1000 VAL A H     1 
ATOM   1670 H  HA    . VAL A 1 130 ? -23.351 -8.355  -1.792  1.00 32.39  ? 1000 VAL A HA    1 
ATOM   1671 H  HB    . VAL A 1 130 ? -25.324 -7.928  0.217   1.00 33.88  ? 1000 VAL A HB    1 
ATOM   1672 H  HG11  . VAL A 1 130 ? -26.589 -9.612  -0.798  1.00 31.37  ? 1000 VAL A HG11  1 
ATOM   1673 H  HG12  . VAL A 1 130 ? -26.406 -8.404  -1.788  1.00 31.37  ? 1000 VAL A HG12  1 
ATOM   1674 H  HG13  . VAL A 1 130 ? -25.543 -9.706  -1.968  1.00 31.37  ? 1000 VAL A HG13  1 
ATOM   1675 H  HG21  . VAL A 1 130 ? -23.239 -9.587  0.237   1.00 30.15  ? 1000 VAL A HG21  1 
ATOM   1676 H  HG22  . VAL A 1 130 ? -24.361 -9.485  1.334   1.00 30.15  ? 1000 VAL A HG22  1 
ATOM   1677 H  HG23  . VAL A 1 130 ? -24.525 -10.485 0.132   1.00 30.15  ? 1000 VAL A HG23  1 
ATOM   1678 N  N     . ARG A 1 131 ? -24.873 -7.109  -3.333  1.00 24.58  ? 1001 ARG A N     1 
ATOM   1679 C  CA    . ARG A 1 131 ? -25.817 -6.379  -4.161  1.00 18.36  ? 1001 ARG A CA    1 
ATOM   1680 C  C     . ARG A 1 131 ? -26.963 -7.330  -4.471  1.00 20.64  ? 1001 ARG A C     1 
ATOM   1681 O  O     . ARG A 1 131 ? -26.737 -8.450  -4.933  1.00 23.53  ? 1001 ARG A O     1 
ATOM   1682 C  CB    . ARG A 1 131 ? -25.172 -5.921  -5.479  1.00 16.72  ? 1001 ARG A CB    1 
ATOM   1683 C  CG    . ARG A 1 131 ? -24.176 -4.768  -5.322  1.00 20.55  ? 1001 ARG A CG    1 
ATOM   1684 C  CD    . ARG A 1 131 ? -24.843 -3.538  -4.707  1.00 23.56  ? 1001 ARG A CD    1 
ATOM   1685 N  NE    . ARG A 1 131 ? -23.899 -2.433  -4.535  1.00 24.14  ? 1001 ARG A NE    1 
ATOM   1686 C  CZ    . ARG A 1 131 ? -23.102 -2.293  -3.480  1.00 30.05  ? 1001 ARG A CZ    1 
ATOM   1687 N  NH1   . ARG A 1 131 ? -23.130 -3.190  -2.499  1.00 24.70  ? 1001 ARG A NH1   1 
ATOM   1688 N  NH2   . ARG A 1 131 ? -22.273 -1.261  -3.406  1.00 24.03  ? 1001 ARG A NH2   1 
ATOM   1689 H  H     . ARG A 1 131 ? -24.529 -7.795  -3.720  1.00 29.50  ? 1001 ARG A H     1 
ATOM   1690 H  HA    . ARG A 1 131 ? -26.162 -5.599  -3.679  1.00 22.03  ? 1001 ARG A HA    1 
ATOM   1691 H  HB2   . ARG A 1 131 ? -24.696 -6.671  -5.870  1.00 20.06  ? 1001 ARG A HB2   1 
ATOM   1692 H  HB3   . ARG A 1 131 ? -25.872 -5.627  -6.082  1.00 20.06  ? 1001 ARG A HB3   1 
ATOM   1693 H  HG2   . ARG A 1 131 ? -23.453 -5.046  -4.739  1.00 24.66  ? 1001 ARG A HG2   1 
ATOM   1694 H  HG3   . ARG A 1 131 ? -23.830 -4.523  -6.195  1.00 24.66  ? 1001 ARG A HG3   1 
ATOM   1695 H  HD2   . ARG A 1 131 ? -25.557 -3.238  -5.291  1.00 28.27  ? 1001 ARG A HD2   1 
ATOM   1696 H  HD3   . ARG A 1 131 ? -25.199 -3.771  -3.836  1.00 28.27  ? 1001 ARG A HD3   1 
ATOM   1697 H  HE    . ARG A 1 131 ? -23.904 -1.805  -5.123  1.00 28.96  ? 1001 ARG A HE    1 
ATOM   1698 H  HH11  . ARG A 1 131 ? -23.665 -3.861  -2.545  1.00 29.64  ? 1001 ARG A HH11  1 
ATOM   1699 H  HH12  . ARG A 1 131 ? -22.613 -3.098  -1.818  1.00 29.64  ? 1001 ARG A HH12  1 
ATOM   1700 H  HH21  . ARG A 1 131 ? -22.253 -0.679  -4.039  1.00 28.83  ? 1001 ARG A HH21  1 
ATOM   1701 H  HH22  . ARG A 1 131 ? -21.758 -1.172  -2.723  1.00 28.83  ? 1001 ARG A HH22  1 
ATOM   1702 N  N     . THR A 1 132 ? -28.186 -6.884  -4.222  1.00 18.98  ? 1002 THR A N     1 
ATOM   1703 C  CA    . THR A 1 132 ? -29.366 -7.660  -4.577  1.00 22.87  ? 1002 THR A CA    1 
ATOM   1704 C  C     . THR A 1 132 ? -29.914 -7.061  -5.862  1.00 23.00  ? 1002 THR A C     1 
ATOM   1705 O  O     . THR A 1 132 ? -30.106 -5.856  -5.957  1.00 23.27  ? 1002 THR A O     1 
ATOM   1706 C  CB    . THR A 1 132 ? -30.435 -7.612  -3.477  1.00 26.10  ? 1002 THR A CB    1 
ATOM   1707 O  OG1   . THR A 1 132 ? -29.929 -8.265  -2.307  1.00 26.26  ? 1002 THR A OG1   1 
ATOM   1708 C  CG2   . THR A 1 132 ? -31.712 -8.315  -3.936  1.00 29.73  ? 1002 THR A CG2   1 
ATOM   1709 H  H     . THR A 1 132 ? -28.361 -6.131  -3.845  1.00 22.78  ? 1002 THR A H     1 
ATOM   1710 H  HA    . THR A 1 132 ? -29.117 -8.593  -4.741  1.00 27.44  ? 1002 THR A HA    1 
ATOM   1711 H  HB    . THR A 1 132 ? -30.647 -6.689  -3.268  1.00 31.32  ? 1002 THR A HB    1 
ATOM   1712 H  HG1   . THR A 1 132 ? -29.749 -9.047  -2.478  1.00 31.51  ? 1002 THR A HG1   1 
ATOM   1713 H  HG21  . THR A 1 132 ? -32.374 -8.279  -3.241  1.00 35.68  ? 1002 THR A HG21  1 
ATOM   1714 H  HG22  . THR A 1 132 ? -32.060 -7.884  -4.720  1.00 35.68  ? 1002 THR A HG22  1 
ATOM   1715 H  HG23  . THR A 1 132 ? -31.525 -9.234  -4.141  1.00 35.68  ? 1002 THR A HG23  1 
ATOM   1716 N  N     . GLN A 1 133 ? -30.166 -7.916  -6.840  1.00 21.01  ? 1003 GLN A N     1 
ATOM   1717 C  CA    . GLN A 1 133 ? -30.446 -7.475  -8.201  1.00 19.72  ? 1003 GLN A CA    1 
ATOM   1718 C  C     . GLN A 1 133 ? -31.574 -8.326  -8.771  1.00 25.55  ? 1003 GLN A C     1 
ATOM   1719 O  O     . GLN A 1 133 ? -31.932 -9.346  -8.201  1.00 25.70  ? 1003 GLN A O     1 
ATOM   1720 C  CB    . GLN A 1 133 ? -29.184 -7.632  -9.065  1.00 20.02  ? 1003 GLN A CB    1 
ATOM   1721 C  CG    . GLN A 1 133 ? -28.013 -6.748  -8.647  1.00 20.64  ? 1003 GLN A CG    1 
ATOM   1722 C  CD    . GLN A 1 133 ? -26.719 -7.060  -9.405  1.00 24.69  ? 1003 GLN A CD    1 
ATOM   1723 O  OE1   . GLN A 1 133 ? -26.582 -8.116  -10.024 1.00 24.87  ? 1003 GLN A OE1   1 
ATOM   1724 N  NE2   . GLN A 1 133 ? -25.768 -6.140  -9.349  1.00 20.02  ? 1003 GLN A NE2   1 
ATOM   1725 H  H     . GLN A 1 133 ? -30.181 -8.770  -6.741  1.00 25.21  ? 1003 GLN A H     1 
ATOM   1726 H  HA    . GLN A 1 133 ? -30.721 -6.534  -8.202  1.00 23.67  ? 1003 GLN A HA    1 
ATOM   1727 H  HB2   . GLN A 1 133 ? -28.888 -8.555  -9.015  1.00 24.02  ? 1003 GLN A HB2   1 
ATOM   1728 H  HB3   . GLN A 1 133 ? -29.407 -7.411  -9.982  1.00 24.02  ? 1003 GLN A HB3   1 
ATOM   1729 H  HG2   . GLN A 1 133 ? -28.242 -5.821  -8.818  1.00 24.77  ? 1003 GLN A HG2   1 
ATOM   1730 H  HG3   . GLN A 1 133 ? -27.843 -6.877  -7.701  1.00 24.77  ? 1003 GLN A HG3   1 
ATOM   1731 H  HE21  . GLN A 1 133 ? -25.022 -6.267  -9.757  1.00 24.02  ? 1003 GLN A HE21  1 
ATOM   1732 H  HE22  . GLN A 1 133 ? -25.897 -5.415  -8.904  1.00 24.02  ? 1003 GLN A HE22  1 
ATOM   1733 N  N     . LEU A 1 134 ? -32.141 -7.899  -9.887  1.00 27.38  ? 1004 LEU A N     1 
ATOM   1734 C  CA    . LEU A 1 134 ? -33.087 -8.728  -10.619 1.00 30.86  ? 1004 LEU A CA    1 
ATOM   1735 C  C     . LEU A 1 134 ? -32.348 -9.554  -11.664 1.00 31.08  ? 1004 LEU A C     1 
ATOM   1736 O  O     . LEU A 1 134 ? -31.408 -9.078  -12.300 1.00 31.46  ? 1004 LEU A O     1 
ATOM   1737 C  CB    . LEU A 1 134 ? -34.125 -7.850  -11.305 1.00 32.35  ? 1004 LEU A CB    1 
ATOM   1738 C  CG    . LEU A 1 134 ? -34.986 -6.989  -10.386 1.00 38.70  ? 1004 LEU A CG    1 
ATOM   1739 C  CD1   . LEU A 1 134 ? -35.709 -5.933  -11.208 1.00 39.22  ? 1004 LEU A CD1   1 
ATOM   1740 C  CD2   . LEU A 1 134 ? -35.970 -7.851  -9.609  1.00 46.37  ? 1004 LEU A CD2   1 
ATOM   1741 H  H     . LEU A 1 134 ? -31.996 -7.130  -10.244 1.00 32.86  ? 1004 LEU A H     1 
ATOM   1742 H  HA    . LEU A 1 134 ? -33.544 -9.335  -10.001 1.00 37.04  ? 1004 LEU A HA    1 
ATOM   1743 H  HB2   . LEU A 1 134 ? -33.664 -7.251  -11.913 1.00 38.82  ? 1004 LEU A HB2   1 
ATOM   1744 H  HB3   . LEU A 1 134 ? -34.724 -8.423  -11.809 1.00 38.82  ? 1004 LEU A HB3   1 
ATOM   1745 H  HG    . LEU A 1 134 ? -34.414 -6.535  -9.748  1.00 46.45  ? 1004 LEU A HG    1 
ATOM   1746 H  HD11  . LEU A 1 134 ? -36.265 -6.370  -11.857 1.00 47.06  ? 1004 LEU A HD11  1 
ATOM   1747 H  HD12  . LEU A 1 134 ? -36.248 -5.397  -10.622 1.00 47.06  ? 1004 LEU A HD12  1 
ATOM   1748 H  HD13  . LEU A 1 134 ? -35.058 -5.383  -11.651 1.00 47.06  ? 1004 LEU A HD13  1 
ATOM   1749 H  HD21  . LEU A 1 134 ? -36.538 -8.313  -10.230 1.00 55.65  ? 1004 LEU A HD21  1 
ATOM   1750 H  HD22  . LEU A 1 134 ? -35.480 -8.484  -9.079  1.00 55.65  ? 1004 LEU A HD22  1 
ATOM   1751 H  HD23  . LEU A 1 134 ? -36.498 -7.286  -9.040  1.00 55.65  ? 1004 LEU A HD23  1 
ATOM   1752 N  N     . LEU A 1 135 ? -32.771 -10.799 -11.841 1.00 29.57  ? 1005 LEU A N     1 
ATOM   1753 C  CA    . LEU A 1 135 ? -32.162 -11.674 -12.827 1.00 29.26  ? 1005 LEU A CA    1 
ATOM   1754 C  C     . LEU A 1 135 ? -32.711 -11.304 -14.195 1.00 36.65  ? 1005 LEU A C     1 
ATOM   1755 O  O     . LEU A 1 135 ? -33.866 -11.588 -14.507 1.00 34.20  ? 1005 LEU A O     1 
ATOM   1756 C  CB    . LEU A 1 135 ? -32.479 -13.135 -12.511 1.00 33.25  ? 1005 LEU A CB    1 
ATOM   1757 C  CG    . LEU A 1 135 ? -31.932 -14.157 -13.505 1.00 37.47  ? 1005 LEU A CG    1 
ATOM   1758 C  CD1   . LEU A 1 135 ? -30.419 -14.066 -13.600 1.00 31.66  ? 1005 LEU A CD1   1 
ATOM   1759 C  CD2   . LEU A 1 135 ? -32.365 -15.564 -13.111 1.00 33.84  ? 1005 LEU A CD2   1 
ATOM   1760 H  H     . LEU A 1 135 ? -33.414 -11.162 -11.399 1.00 35.48  ? 1005 LEU A H     1 
ATOM   1761 H  HA    . LEU A 1 135 ? -31.190 -11.552 -12.829 1.00 35.11  ? 1005 LEU A HA    1 
ATOM   1762 H  HB2   . LEU A 1 135 ? -32.107 -13.348 -11.641 1.00 39.90  ? 1005 LEU A HB2   1 
ATOM   1763 H  HB3   . LEU A 1 135 ? -33.443 -13.240 -12.485 1.00 39.90  ? 1005 LEU A HB3   1 
ATOM   1764 H  HG    . LEU A 1 135 ? -32.298 -13.968 -14.384 1.00 44.97  ? 1005 LEU A HG    1 
ATOM   1765 H  HD11  . LEU A 1 135 ? -30.106 -14.719 -14.231 1.00 38.00  ? 1005 LEU A HD11  1 
ATOM   1766 H  HD12  . LEU A 1 135 ? -30.177 -13.185 -13.894 1.00 38.00  ? 1005 LEU A HD12  1 
ATOM   1767 H  HD13  . LEU A 1 135 ? -30.041 -14.239 -12.735 1.00 38.00  ? 1005 LEU A HD13  1 
ATOM   1768 H  HD21  . LEU A 1 135 ? -32.025 -15.761 -12.235 1.00 40.61  ? 1005 LEU A HD21  1 
ATOM   1769 H  HD22  . LEU A 1 135 ? -33.324 -15.607 -13.108 1.00 40.61  ? 1005 LEU A HD22  1 
ATOM   1770 H  HD23  . LEU A 1 135 ? -32.011 -16.189 -13.748 1.00 40.61  ? 1005 LEU A HD23  1 
ATOM   1771 N  N     . GLN A 1 136 ? -31.876 -10.661 -15.001 1.00 23.57  ? 1006 GLN A N     1 
ATOM   1772 C  CA    . GLN A 1 136 ? -32.290 -10.152 -16.297 1.00 23.33  ? 1006 GLN A CA    1 
ATOM   1773 C  C     . GLN A 1 136 ? -31.934 -11.145 -17.402 1.00 26.08  ? 1006 GLN A C     1 
ATOM   1774 O  O     . GLN A 1 136 ? -30.969 -11.894 -17.291 1.00 27.05  ? 1006 GLN A O     1 
ATOM   1775 C  CB    . GLN A 1 136 ? -31.593 -8.819  -16.569 1.00 24.39  ? 1006 GLN A CB    1 
ATOM   1776 C  CG    . GLN A 1 136 ? -31.968 -7.716  -15.586 1.00 25.26  ? 1006 GLN A CG    1 
ATOM   1777 C  CD    . GLN A 1 136 ? -33.320 -7.104  -15.905 1.00 29.42  ? 1006 GLN A CD    1 
ATOM   1778 O  OE1   . GLN A 1 136 ? -33.844 -7.279  -17.006 1.00 27.61  ? 1006 GLN A OE1   1 
ATOM   1779 N  NE2   . GLN A 1 136 ? -33.891 -6.378  -14.946 1.00 32.44  ? 1006 GLN A NE2   1 
ATOM   1780 H  H     . GLN A 1 136 ? -31.050 -10.505 -14.816 1.00 28.29  ? 1006 GLN A H     1 
ATOM   1781 H  HA    . GLN A 1 136 ? -33.260 -10.008 -16.302 1.00 27.99  ? 1006 GLN A HA    1 
ATOM   1782 H  HB2   . GLN A 1 136 ? -30.634 -8.952  -16.515 1.00 29.26  ? 1006 GLN A HB2   1 
ATOM   1783 H  HB3   . GLN A 1 136 ? -31.833 -8.517  -17.459 1.00 29.26  ? 1006 GLN A HB3   1 
ATOM   1784 H  HG2   . GLN A 1 136 ? -32.007 -8.087  -14.691 1.00 30.31  ? 1006 GLN A HG2   1 
ATOM   1785 H  HG3   . GLN A 1 136 ? -31.300 -7.013  -15.628 1.00 30.31  ? 1006 GLN A HG3   1 
ATOM   1786 H  HE21  . GLN A 1 136 ? -33.493 -6.275  -14.191 1.00 38.93  ? 1006 GLN A HE21  1 
ATOM   1787 H  HE22  . GLN A 1 136 ? -34.657 -6.012  -15.083 1.00 38.93  ? 1006 GLN A HE22  1 
ATOM   1788 N  N     . PRO A 1 137 ? -32.706 -11.132 -18.491 1.00 26.86  ? 1007 PRO A N     1 
ATOM   1789 C  CA    . PRO A 1 137 ? -32.441 -12.045 -19.608 1.00 32.95  ? 1007 PRO A CA    1 
ATOM   1790 C  C     . PRO A 1 137 ? -31.254 -11.610 -20.463 1.00 28.50  ? 1007 PRO A C     1 
ATOM   1791 O  O     . PRO A 1 137 ? -31.118 -10.426 -20.774 1.00 26.51  ? 1007 PRO A O     1 
ATOM   1792 C  CB    . PRO A 1 137 ? -33.738 -11.986 -20.422 1.00 33.72  ? 1007 PRO A CB    1 
ATOM   1793 C  CG    . PRO A 1 137 ? -34.297 -10.626 -20.143 1.00 37.54  ? 1007 PRO A CG    1 
ATOM   1794 C  CD    . PRO A 1 137 ? -33.872 -10.263 -18.732 1.00 27.65  ? 1007 PRO A CD    1 
ATOM   1795 H  HA    . PRO A 1 137 ? -32.298 -12.958 -19.282 1.00 39.54  ? 1007 PRO A HA    1 
ATOM   1796 H  HB2   . PRO A 1 137 ? -33.538 -12.090 -21.365 1.00 40.46  ? 1007 PRO A HB2   1 
ATOM   1797 H  HB3   . PRO A 1 137 ? -34.347 -12.678 -20.120 1.00 40.46  ? 1007 PRO A HB3   1 
ATOM   1798 H  HG2   . PRO A 1 137 ? -33.934 -9.991  -20.779 1.00 45.05  ? 1007 PRO A HG2   1 
ATOM   1799 H  HG3   . PRO A 1 137 ? -35.264 -10.655 -20.208 1.00 45.05  ? 1007 PRO A HG3   1 
ATOM   1800 H  HD2   . PRO A 1 137 ? -33.613 -9.330  -18.686 1.00 33.18  ? 1007 PRO A HD2   1 
ATOM   1801 H  HD3   . PRO A 1 137 ? -34.581 -10.467 -18.102 1.00 33.18  ? 1007 PRO A HD3   1 
ATOM   1802 N  N     . ALA A 1 138 ? -30.408 -12.571 -20.821 1.00 23.57  ? 1008 ALA A N     1 
ATOM   1803 C  CA    . ALA A 1 138 ? -29.299 -12.346 -21.744 1.00 27.74  ? 1008 ALA A CA    1 
ATOM   1804 C  C     . ALA A 1 138 ? -28.509 -11.071 -21.423 1.00 25.35  ? 1008 ALA A C     1 
ATOM   1805 O  O     . ALA A 1 138 ? -28.030 -10.900 -20.300 1.00 26.28  ? 1008 ALA A O     1 
ATOM   1806 C  CB    . ALA A 1 138 ? -29.811 -12.324 -23.178 1.00 28.93  ? 1008 ALA A CB    1 
ATOM   1807 H  H     . ALA A 1 138 ? -30.457 -13.381 -20.537 1.00 28.28  ? 1008 ALA A H     1 
ATOM   1808 H  HA    . ALA A 1 138 ? -28.677 -13.100 -21.667 1.00 33.29  ? 1008 ALA A HA    1 
ATOM   1809 H  HB1   . ALA A 1 138 ? -30.224 -13.168 -23.375 1.00 34.72  ? 1008 ALA A HB1   1 
ATOM   1810 H  HB2   . ALA A 1 138 ? -30.452 -11.616 -23.270 1.00 34.72  ? 1008 ALA A HB2   1 
ATOM   1811 H  HB3   . ALA A 1 138 ? -29.071 -12.175 -23.772 1.00 34.72  ? 1008 ALA A HB3   1 
ATOM   1812 N  N     . ASP A 1 139 ? -28.369 -10.186 -22.408 1.00 22.77  ? 1009 ASP A N     1 
ATOM   1813 C  CA    . ASP A 1 139 ? -27.537 -8.990  -22.268 1.00 21.92  ? 1009 ASP A CA    1 
ATOM   1814 C  C     . ASP A 1 139 ? -28.391 -7.739  -22.082 1.00 25.82  ? 1009 ASP A C     1 
ATOM   1815 O  O     . ASP A 1 139 ? -27.916 -6.616  -22.266 1.00 29.70  ? 1009 ASP A O     1 
ATOM   1816 C  CB    . ASP A 1 139 ? -26.645 -8.828  -23.506 1.00 26.28  ? 1009 ASP A CB    1 
ATOM   1817 C  CG    . ASP A 1 139 ? -27.428 -8.901  -24.816 1.00 38.45  ? 1009 ASP A CG    1 
ATOM   1818 O  OD1   . ASP A 1 139 ? -28.641 -8.627  -24.816 1.00 31.36  ? 1009 ASP A OD1   1 
ATOM   1819 O  OD2   . ASP A 1 139 ? -26.830 -9.235  -25.856 1.00 40.83  ? 1009 ASP A OD2   1 
ATOM   1820 H  H     . ASP A 1 139 ? -28.749 -10.256 -23.177 1.00 27.33  ? 1009 ASP A H     1 
ATOM   1821 H  HA    . ASP A 1 139 ? -26.960 -9.087  -21.482 1.00 26.30  ? 1009 ASP A HA    1 
ATOM   1822 H  HB2   . ASP A 1 139 ? -26.205 -7.965  -23.467 1.00 31.53  ? 1009 ASP A HB2   1 
ATOM   1823 H  HB3   . ASP A 1 139 ? -25.983 -9.538  -23.512 1.00 31.53  ? 1009 ASP A HB3   1 
ATOM   1824 N  N     . GLU A 1 140 ? -29.647 -7.950  -21.708 1.00 23.49  ? 1010 GLU A N     1 
ATOM   1825 C  CA    . GLU A 1 140 ? -30.645 -6.886  -21.665 1.00 22.65  ? 1010 GLU A CA    1 
ATOM   1826 C  C     . GLU A 1 140 ? -30.913 -6.459  -20.241 1.00 25.78  ? 1010 GLU A C     1 
ATOM   1827 O  O     . GLU A 1 140 ? -30.541 -7.143  -19.289 1.00 26.61  ? 1010 GLU A O     1 
ATOM   1828 C  CB    . GLU A 1 140 ? -31.961 -7.378  -22.273 1.00 24.66  ? 1010 GLU A CB    1 
ATOM   1829 C  CG    . GLU A 1 140 ? -31.826 -7.804  -23.733 1.00 29.41  ? 1010 GLU A CG    1 
ATOM   1830 C  CD    . GLU A 1 140 ? -33.022 -8.588  -24.249 1.00 33.59  ? 1010 GLU A CD    1 
ATOM   1831 O  OE1   . GLU A 1 140 ? -33.989 -8.795  -23.488 1.00 29.43  ? 1010 GLU A OE1   1 
ATOM   1832 O  OE2   . GLU A 1 140 ? -32.984 -8.996  -25.429 1.00 41.29  ? 1010 GLU A OE2   1 
ATOM   1833 H  H     . GLU A 1 140 ? -29.953 -8.717  -21.469 1.00 28.18  ? 1010 GLU A H     1 
ATOM   1834 H  HA    . GLU A 1 140 ? -30.329 -6.111  -22.176 1.00 27.17  ? 1010 GLU A HA    1 
ATOM   1835 H  HB2   . GLU A 1 140 ? -32.274 -8.143  -21.767 1.00 29.59  ? 1010 GLU A HB2   1 
ATOM   1836 H  HB3   . GLU A 1 140 ? -32.614 -6.662  -22.230 1.00 29.59  ? 1010 GLU A HB3   1 
ATOM   1837 H  HG2   . GLU A 1 140 ? -31.731 -7.011  -24.284 1.00 35.29  ? 1010 GLU A HG2   1 
ATOM   1838 H  HG3   . GLU A 1 140 ? -31.040 -8.365  -23.825 1.00 35.29  ? 1010 GLU A HG3   1 
ATOM   1839 N  N     . ASN A 1 141 ? -31.588 -5.329  -20.102 1.00 25.71  ? 1011 ASN A N     1 
ATOM   1840 C  CA    . ASN A 1 141 ? -31.991 -4.849  -18.795 1.00 22.22  ? 1011 ASN A CA    1 
ATOM   1841 C  C     . ASN A 1 141 ? -33.355 -4.194  -18.932 1.00 24.83  ? 1011 ASN A C     1 
ATOM   1842 O  O     . ASN A 1 141 ? -33.506 -3.205  -19.644 1.00 26.40  ? 1011 ASN A O     1 
ATOM   1843 C  CB    . ASN A 1 141 ? -30.954 -3.871  -18.236 1.00 22.91  ? 1011 ASN A CB    1 
ATOM   1844 C  CG    . ASN A 1 141 ? -31.290 -3.414  -16.836 1.00 27.89  ? 1011 ASN A CG    1 
ATOM   1845 O  OD1   . ASN A 1 141 ? -31.197 -4.180  -15.874 1.00 26.90  ? 1011 ASN A OD1   1 
ATOM   1846 N  ND2   . ASN A 1 141 ? -31.691 -2.159  -16.710 1.00 25.90  ? 1011 ASN A ND2   1 
ATOM   1847 H  H     . ASN A 1 141 ? -31.826 -4.821  -20.753 1.00 30.86  ? 1011 ASN A H     1 
ATOM   1848 H  HA    . ASN A 1 141 ? -32.070 -5.606  -18.178 1.00 26.66  ? 1011 ASN A HA    1 
ATOM   1849 H  HB2   . ASN A 1 141 ? -30.088 -4.307  -18.210 1.00 27.49  ? 1011 ASN A HB2   1 
ATOM   1850 H  HB3   . ASN A 1 141 ? -30.916 -3.088  -18.807 1.00 27.49  ? 1011 ASN A HB3   1 
ATOM   1851 H  HD21  . ASN A 1 141 ? -31.748 -1.654  -17.404 1.00 31.08  ? 1011 ASN A HD21  1 
ATOM   1852 H  HD22  . ASN A 1 141 ? -31.894 -1.849  -15.934 1.00 31.08  ? 1011 ASN A HD22  1 
ATOM   1853 N  N     . TRP A 1 142 ? -34.340 -4.768  -18.248 1.00 30.06  ? 1012 TRP A N     1 
ATOM   1854 C  CA    . TRP A 1 142 ? -35.727 -4.336  -18.342 1.00 30.22  ? 1012 TRP A CA    1 
ATOM   1855 C  C     . TRP A 1 142 ? -36.183 -3.703  -17.039 1.00 33.09  ? 1012 TRP A C     1 
ATOM   1856 O  O     . TRP A 1 142 ? -35.673 -4.031  -15.968 1.00 29.12  ? 1012 TRP A O     1 
ATOM   1857 C  CB    . TRP A 1 142 ? -36.612 -5.544  -18.635 1.00 31.65  ? 1012 TRP A CB    1 
ATOM   1858 C  CG    . TRP A 1 142 ? -36.379 -6.141  -19.966 1.00 35.05  ? 1012 TRP A CG    1 
ATOM   1859 C  CD1   . TRP A 1 142 ? -35.371 -6.980  -20.320 1.00 31.41  ? 1012 TRP A CD1   1 
ATOM   1860 C  CD2   . TRP A 1 142 ? -37.178 -5.950  -21.140 1.00 31.88  ? 1012 TRP A CD2   1 
ATOM   1861 N  NE1   . TRP A 1 142 ? -35.492 -7.327  -21.642 1.00 36.45  ? 1012 TRP A NE1   1 
ATOM   1862 C  CE2   . TRP A 1 142 ? -36.590 -6.702  -22.169 1.00 33.41  ? 1012 TRP A CE2   1 
ATOM   1863 C  CE3   . TRP A 1 142 ? -38.333 -5.212  -21.417 1.00 41.14  ? 1012 TRP A CE3   1 
ATOM   1864 C  CZ2   . TRP A 1 142 ? -37.118 -6.745  -23.457 1.00 37.53  ? 1012 TRP A CZ2   1 
ATOM   1865 C  CZ3   . TRP A 1 142 ? -38.856 -5.253  -22.694 1.00 36.23  ? 1012 TRP A CZ3   1 
ATOM   1866 C  CH2   . TRP A 1 142 ? -38.249 -6.014  -23.699 1.00 43.56  ? 1012 TRP A CH2   1 
ATOM   1867 H  H     . TRP A 1 142 ? -34.225 -5.427  -17.709 1.00 36.07  ? 1012 TRP A H     1 
ATOM   1868 H  HA    . TRP A 1 142 ? -35.827 -3.684  -19.066 1.00 36.26  ? 1012 TRP A HA    1 
ATOM   1869 H  HB2   . TRP A 1 142 ? -36.439 -6.227  -17.969 1.00 37.98  ? 1012 TRP A HB2   1 
ATOM   1870 H  HB3   . TRP A 1 142 ? -37.541 -5.269  -18.592 1.00 37.98  ? 1012 TRP A HB3   1 
ATOM   1871 H  HD1   . TRP A 1 142 ? -34.699 -7.277  -19.750 1.00 37.69  ? 1012 TRP A HD1   1 
ATOM   1872 H  HE1   . TRP A 1 142 ? -34.958 -7.846  -22.073 1.00 43.74  ? 1012 TRP A HE1   1 
ATOM   1873 H  HE3   . TRP A 1 142 ? -38.741 -4.703  -20.753 1.00 49.37  ? 1012 TRP A HE3   1 
ATOM   1874 H  HZ2   . TRP A 1 142 ? -36.717 -7.251  -24.127 1.00 45.04  ? 1012 TRP A HZ2   1 
ATOM   1875 H  HZ3   . TRP A 1 142 ? -39.623 -4.765  -22.890 1.00 43.48  ? 1012 TRP A HZ3   1 
ATOM   1876 H  HH2   . TRP A 1 142 ? -38.622 -6.022  -24.551 1.00 52.27  ? 1012 TRP A HH2   1 
ATOM   1877 N  N     . ASP A 1 143 ? -37.160 -2.807  -17.123 1.00 30.17  ? 1013 ASP A N     1 
ATOM   1878 C  CA    . ASP A 1 143 ? -37.740 -2.245  -15.921 1.00 31.76  ? 1013 ASP A CA    1 
ATOM   1879 C  C     . ASP A 1 143 ? -38.411 -3.397  -15.184 1.00 40.68  ? 1013 ASP A C     1 
ATOM   1880 O  O     . ASP A 1 143 ? -38.682 -4.438  -15.783 1.00 40.26  ? 1013 ASP A O     1 
ATOM   1881 C  CB    . ASP A 1 143 ? -38.749 -1.159  -16.270 1.00 44.21  ? 1013 ASP A CB    1 
ATOM   1882 C  CG    . ASP A 1 143 ? -40.108 -1.720  -16.591 1.00 46.72  ? 1013 ASP A CG    1 
ATOM   1883 O  OD1   . ASP A 1 143 ? -40.967 -1.736  -15.685 1.00 51.03  ? 1013 ASP A OD1   1 
ATOM   1884 O  OD2   . ASP A 1 143 ? -40.315 -2.144  -17.743 1.00 48.91  ? 1013 ASP A OD2   1 
ATOM   1885 H  H     . ASP A 1 143 ? -37.498 -2.513  -17.857 1.00 36.21  ? 1013 ASP A H     1 
ATOM   1886 H  HA    . ASP A 1 143 ? -37.038 -1.864  -15.353 1.00 38.11  ? 1013 ASP A HA    1 
ATOM   1887 H  HB2   . ASP A 1 143 ? -38.842 -0.559  -15.514 1.00 53.06  ? 1013 ASP A HB2   1 
ATOM   1888 H  HB3   . ASP A 1 143 ? -38.433 -0.671  -17.046 1.00 53.06  ? 1013 ASP A HB3   1 
ATOM   1889 N  N     . PRO A 1 144 ? -38.675 -3.225  -13.882 1.00 50.02  ? 1014 PRO A N     1 
ATOM   1890 C  CA    . PRO A 1 144 ? -39.172 -4.335  -13.055 1.00 53.62  ? 1014 PRO A CA    1 
ATOM   1891 C  C     . PRO A 1 144 ? -40.456 -4.982  -13.583 1.00 55.09  ? 1014 PRO A C     1 
ATOM   1892 O  O     . PRO A 1 144 ? -40.657 -6.180  -13.374 1.00 56.17  ? 1014 PRO A O     1 
ATOM   1893 C  CB    . PRO A 1 144 ? -39.413 -3.675  -11.693 1.00 54.52  ? 1014 PRO A CB    1 
ATOM   1894 C  CG    . PRO A 1 144 ? -38.486 -2.496  -11.680 1.00 49.23  ? 1014 PRO A CG    1 
ATOM   1895 C  CD    . PRO A 1 144 ? -38.481 -1.995  -13.096 1.00 43.46  ? 1014 PRO A CD    1 
ATOM   1896 H  HA    . PRO A 1 144 ? -38.480 -5.023  -12.962 1.00 64.35  ? 1014 PRO A HA    1 
ATOM   1897 H  HB2   . PRO A 1 144 ? -40.337 -3.389  -11.625 1.00 65.43  ? 1014 PRO A HB2   1 
ATOM   1898 H  HB3   . PRO A 1 144 ? -39.190 -4.297  -10.982 1.00 65.43  ? 1014 PRO A HB3   1 
ATOM   1899 H  HG2   . PRO A 1 144 ? -38.827 -1.818  -11.076 1.00 59.08  ? 1014 PRO A HG2   1 
ATOM   1900 H  HG3   . PRO A 1 144 ? -37.598 -2.781  -11.413 1.00 59.08  ? 1014 PRO A HG3   1 
ATOM   1901 H  HD2   . PRO A 1 144 ? -39.217 -1.380  -13.241 1.00 52.15  ? 1014 PRO A HD2   1 
ATOM   1902 H  HD3   . PRO A 1 144 ? -37.627 -1.587  -13.308 1.00 52.15  ? 1014 PRO A HD3   1 
ATOM   1903 N  N     . THR A 1 145 ? -41.303 -4.208  -14.255 1.00 46.11  ? 1015 THR A N     1 
ATOM   1904 C  CA    . THR A 1 145 ? -42.550 -4.733  -14.803 1.00 48.95  ? 1015 THR A CA    1 
ATOM   1905 C  C     . THR A 1 145 ? -42.337 -5.496  -16.110 1.00 54.51  ? 1015 THR A C     1 
ATOM   1906 O  O     . THR A 1 145 ? -43.276 -6.071  -16.659 1.00 58.31  ? 1015 THR A O     1 
ATOM   1907 C  CB    . THR A 1 145 ? -43.566 -3.606  -15.063 1.00 51.60  ? 1015 THR A CB    1 
ATOM   1908 O  OG1   . THR A 1 145 ? -43.111 -2.787  -16.149 1.00 49.88  ? 1015 THR A OG1   1 
ATOM   1909 C  CG2   . THR A 1 145 ? -43.748 -2.752  -13.818 1.00 50.39  ? 1015 THR A CG2   1 
ATOM   1910 H  H     . THR A 1 145 ? -41.178 -3.371  -14.409 1.00 55.33  ? 1015 THR A H     1 
ATOM   1911 H  HA    . THR A 1 145 ? -42.946 -5.351  -14.154 1.00 58.74  ? 1015 THR A HA    1 
ATOM   1912 H  HB    . THR A 1 145 ? -44.424 -3.995  -15.294 1.00 61.91  ? 1015 THR A HB    1 
ATOM   1913 H  HG1   . THR A 1 145 ? -43.650 -2.185  -16.290 1.00 59.85  ? 1015 THR A HG1   1 
ATOM   1914 H  HG21  . THR A 1 145 ? -42.910 -2.357  -13.565 1.00 60.46  ? 1015 THR A HG21  1 
ATOM   1915 H  HG22  . THR A 1 145 ? -44.382 -2.052  -13.990 1.00 60.46  ? 1015 THR A HG22  1 
ATOM   1916 H  HG23  . THR A 1 145 ? -44.069 -3.293  -13.093 1.00 60.46  ? 1015 THR A HG23  1 
ATOM   1917 N  N     . GLY A 1 146 ? -41.104 -5.497  -16.607 1.00 44.47  ? 1016 GLY A N     1 
ATOM   1918 C  CA    . GLY A 1 146 ? -40.769 -6.217  -17.823 1.00 38.58  ? 1016 GLY A CA    1 
ATOM   1919 C  C     . GLY A 1 146 ? -41.414 -5.596  -19.047 1.00 43.54  ? 1016 GLY A C     1 
ATOM   1920 O  O     . GLY A 1 146 ? -41.679 -6.271  -20.041 1.00 43.43  ? 1016 GLY A O     1 
ATOM   1921 H  H     . GLY A 1 146 ? -40.439 -5.083  -16.252 1.00 53.36  ? 1016 GLY A H     1 
ATOM   1922 H  HA2   . GLY A 1 146 ? -39.807 -6.215  -17.947 1.00 46.30  ? 1016 GLY A HA2   1 
ATOM   1923 H  HA3   . GLY A 1 146 ? -41.069 -7.136  -17.750 1.00 46.30  ? 1016 GLY A HA3   1 
ATOM   1924 N  N     . THR A 1 147 ? -41.658 -4.293  -18.976 1.00 40.66  ? 1017 THR A N     1 
ATOM   1925 C  CA    . THR A 1 147 ? -42.333 -3.579  -20.052 1.00 48.88  ? 1017 THR A CA    1 
ATOM   1926 C  C     . THR A 1 147 ? -41.375 -3.025  -21.107 1.00 49.58  ? 1017 THR A C     1 
ATOM   1927 O  O     . THR A 1 147 ? -41.624 -3.154  -22.306 1.00 42.70  ? 1017 THR A O     1 
ATOM   1928 C  CB    . THR A 1 147 ? -43.147 -2.402  -19.490 1.00 56.40  ? 1017 THR A CB    1 
ATOM   1929 O  OG1   . THR A 1 147 ? -44.115 -2.892  -18.554 1.00 55.22  ? 1017 THR A OG1   1 
ATOM   1930 C  CG2   . THR A 1 147 ? -43.847 -1.654  -20.617 1.00 59.99  ? 1017 THR A CG2   1 
ATOM   1931 H  H     . THR A 1 147 ? -41.441 -3.796  -18.309 1.00 48.79  ? 1017 THR A H     1 
ATOM   1932 H  HA    . THR A 1 147 ? -42.954 -4.190  -20.499 1.00 58.65  ? 1017 THR A HA    1 
ATOM   1933 H  HB    . THR A 1 147 ? -42.549 -1.785  -19.040 1.00 67.68  ? 1017 THR A HB    1 
ATOM   1934 H  HG1   . THR A 1 147 ? -43.739 -3.277  -17.937 1.00 66.27  ? 1017 THR A HG1   1 
ATOM   1935 H  HG21  . THR A 1 147 ? -43.198 -1.312  -21.236 1.00 71.99  ? 1017 THR A HG21  1 
ATOM   1936 H  HG22  . THR A 1 147 ? -44.442 -2.246  -21.083 1.00 71.99  ? 1017 THR A HG22  1 
ATOM   1937 H  HG23  . THR A 1 147 ? -44.353 -0.921  -20.259 1.00 71.99  ? 1017 THR A HG23  1 
ATOM   1938 N  N     . LYS A 1 148 ? -40.289 -2.401  -20.657 1.00 41.36  ? 1018 LYS A N     1 
ATOM   1939 C  CA    . LYS A 1 148 ? -39.363 -1.717  -21.554 1.00 34.42  ? 1018 LYS A CA    1 
ATOM   1940 C  C     . LYS A 1 148 ? -37.926 -1.879  -21.071 1.00 31.12  ? 1018 LYS A C     1 
ATOM   1941 O  O     . LYS A 1 148 ? -37.680 -2.009  -19.873 1.00 32.38  ? 1018 LYS A O     1 
ATOM   1942 C  CB    . LYS A 1 148 ? -39.706 -0.227  -21.637 1.00 46.67  ? 1018 LYS A CB    1 
ATOM   1943 C  CG    . LYS A 1 148 ? -39.676 0.518   -20.297 1.00 56.13  ? 1018 LYS A CG    1 
ATOM   1944 C  CD    . LYS A 1 148 ? -40.028 1.998   -20.482 1.00 68.02  ? 1018 LYS A CD    1 
ATOM   1945 C  CE    . LYS A 1 148 ? -39.627 2.877   -19.290 1.00 73.68  ? 1018 LYS A CE    1 
ATOM   1946 N  NZ    . LYS A 1 148 ? -39.855 2.268   -17.947 1.00 76.68  ? 1018 LYS A NZ    1 
ATOM   1947 H  H     . LYS A 1 148 ? -40.066 -2.359  -19.827 1.00 49.63  ? 1018 LYS A H     1 
ATOM   1948 H  HA    . LYS A 1 148 ? -39.434 -2.103  -22.452 1.00 41.30  ? 1018 LYS A HA    1 
ATOM   1949 H  HB2   . LYS A 1 148 ? -39.067 0.205   -22.226 1.00 56.00  ? 1018 LYS A HB2   1 
ATOM   1950 H  HB3   . LYS A 1 148 ? -40.599 -0.135  -22.003 1.00 56.00  ? 1018 LYS A HB3   1 
ATOM   1951 H  HG2   . LYS A 1 148 ? -40.325 0.122   -19.695 1.00 67.35  ? 1018 LYS A HG2   1 
ATOM   1952 H  HG3   . LYS A 1 148 ? -38.785 0.461   -19.918 1.00 67.35  ? 1018 LYS A HG3   1 
ATOM   1953 H  HD2   . LYS A 1 148 ? -39.569 2.334   -21.267 1.00 81.63  ? 1018 LYS A HD2   1 
ATOM   1954 H  HD3   . LYS A 1 148 ? -40.988 2.079   -20.602 1.00 81.63  ? 1018 LYS A HD3   1 
ATOM   1955 H  HE2   . LYS A 1 148 ? -38.682 3.080   -19.362 1.00 88.41  ? 1018 LYS A HE2   1 
ATOM   1956 H  HE3   . LYS A 1 148 ? -40.140 3.700   -19.329 1.00 88.41  ? 1018 LYS A HE3   1 
ATOM   1957 H  HZ1   . LYS A 1 148 ? -40.719 2.082   -17.840 1.00 92.01  ? 1018 LYS A HZ1   1 
ATOM   1958 H  HZ2   . LYS A 1 148 ? -39.386 1.516   -17.871 1.00 92.01  ? 1018 LYS A HZ2   1 
ATOM   1959 H  HZ3   . LYS A 1 148 ? -39.600 2.834   -17.309 1.00 92.01  ? 1018 LYS A HZ3   1 
ATOM   1960 N  N     . LYS A 1 149 ? -36.978 -1.870  -22.002 1.00 33.20  ? 1019 LYS A N     1 
ATOM   1961 C  CA    . LYS A 1 149 ? -35.573 -1.891  -21.630 1.00 35.28  ? 1019 LYS A CA    1 
ATOM   1962 C  C     . LYS A 1 149 ? -35.205 -0.512  -21.101 1.00 32.42  ? 1019 LYS A C     1 
ATOM   1963 O  O     . LYS A 1 149 ? -35.633 0.502   -21.649 1.00 33.99  ? 1019 LYS A O     1 
ATOM   1964 C  CB    . LYS A 1 149 ? -34.686 -2.256  -22.824 1.00 29.54  ? 1019 LYS A CB    1 
ATOM   1965 C  CG    . LYS A 1 149 ? -35.013 -3.587  -23.465 1.00 35.53  ? 1019 LYS A CG    1 
ATOM   1966 C  CD    . LYS A 1 149 ? -34.245 -3.755  -24.775 1.00 48.00  ? 1019 LYS A CD    1 
ATOM   1967 C  CE    . LYS A 1 149 ? -34.406 -5.150  -25.351 1.00 54.52  ? 1019 LYS A CE    1 
ATOM   1968 N  NZ    . LYS A 1 149 ? -33.729 -5.290  -26.670 1.00 65.14  ? 1019 LYS A NZ    1 
ATOM   1969 H  H     . LYS A 1 149 ? -37.122 -1.852  -22.850 1.00 39.84  ? 1019 LYS A H     1 
ATOM   1970 H  HA    . LYS A 1 149 ? -35.429 -2.550  -20.918 1.00 42.34  ? 1019 LYS A HA    1 
ATOM   1971 H  HB2   . LYS A 1 149 ? -34.784 -1.571  -23.504 1.00 35.45  ? 1019 LYS A HB2   1 
ATOM   1972 H  HB3   . LYS A 1 149 ? -33.763 -2.291  -22.527 1.00 35.45  ? 1019 LYS A HB3   1 
ATOM   1973 H  HG2   . LYS A 1 149 ? -34.757 -4.306  -22.865 1.00 42.63  ? 1019 LYS A HG2   1 
ATOM   1974 H  HG3   . LYS A 1 149 ? -35.963 -3.628  -23.658 1.00 42.63  ? 1019 LYS A HG3   1 
ATOM   1975 H  HD2   . LYS A 1 149 ? -34.582 -3.119  -25.426 1.00 57.60  ? 1019 LYS A HD2   1 
ATOM   1976 H  HD3   . LYS A 1 149 ? -33.301 -3.601  -24.614 1.00 57.60  ? 1019 LYS A HD3   1 
ATOM   1977 H  HE2   . LYS A 1 149 ? -34.014 -5.794  -24.740 1.00 65.42  ? 1019 LYS A HE2   1 
ATOM   1978 H  HE3   . LYS A 1 149 ? -35.350 -5.337  -25.474 1.00 65.42  ? 1019 LYS A HE3   1 
ATOM   1979 H  HZ1   . LYS A 1 149 ? -32.858 -5.128  -26.584 1.00 78.16  ? 1019 LYS A HZ1   1 
ATOM   1980 H  HZ2   . LYS A 1 149 ? -33.840 -6.116  -26.982 1.00 78.16  ? 1019 LYS A HZ2   1 
ATOM   1981 H  HZ3   . LYS A 1 149 ? -34.075 -4.712  -27.252 1.00 78.16  ? 1019 LYS A HZ3   1 
ATOM   1982 N  N     . ILE A 1 150 ? -34.421 -0.481  -20.030 1.00 27.48  ? 1020 ILE A N     1 
ATOM   1983 C  CA    . ILE A 1 150 ? -33.965 0.770   -19.438 1.00 22.29  ? 1020 ILE A CA    1 
ATOM   1984 C  C     . ILE A 1 150 ? -32.484 0.661   -19.066 1.00 27.41  ? 1020 ILE A C     1 
ATOM   1985 O  O     . ILE A 1 150 ? -31.946 -0.436  -18.976 1.00 25.77  ? 1020 ILE A O     1 
ATOM   1986 C  CB    . ILE A 1 150 ? -34.771 1.094   -18.177 1.00 31.01  ? 1020 ILE A CB    1 
ATOM   1987 C  CG1   . ILE A 1 150 ? -34.658 -0.048  -17.168 1.00 26.94  ? 1020 ILE A CG1   1 
ATOM   1988 C  CG2   . ILE A 1 150 ? -36.236 1.334   -18.527 1.00 39.77  ? 1020 ILE A CG2   1 
ATOM   1989 C  CD1   . ILE A 1 150 ? -35.234 0.301   -15.798 1.00 36.00  ? 1020 ILE A CD1   1 
ATOM   1990 H  H     . ILE A 1 150 ? -34.134 -1.182  -19.622 1.00 32.98  ? 1020 ILE A H     1 
ATOM   1991 H  HA    . ILE A 1 150 ? -34.076 1.501   -20.081 1.00 26.75  ? 1020 ILE A HA    1 
ATOM   1992 H  HB    . ILE A 1 150 ? -34.411 1.901   -17.777 1.00 37.21  ? 1020 ILE A HB    1 
ATOM   1993 H  HG12  . ILE A 1 150 ? -35.141 -0.818  -17.508 1.00 32.33  ? 1020 ILE A HG12  1 
ATOM   1994 H  HG13  . ILE A 1 150 ? -33.721 -0.272  -17.050 1.00 32.33  ? 1020 ILE A HG13  1 
ATOM   1995 H  HG21  . ILE A 1 150 ? -36.295 2.072   -19.138 1.00 47.73  ? 1020 ILE A HG21  1 
ATOM   1996 H  HG22  . ILE A 1 150 ? -36.593 0.541   -18.935 1.00 47.73  ? 1020 ILE A HG22  1 
ATOM   1997 H  HG23  . ILE A 1 150 ? -36.720 1.535   -17.722 1.00 47.73  ? 1020 ILE A HG23  1 
ATOM   1998 H  HD11  . ILE A 1 150 ? -35.132 -0.454  -15.214 1.00 43.21  ? 1020 ILE A HD11  1 
ATOM   1999 H  HD12  . ILE A 1 150 ? -34.759 1.057   -15.443 1.00 43.21  ? 1020 ILE A HD12  1 
ATOM   2000 H  HD13  . ILE A 1 150 ? -36.165 0.516   -15.896 1.00 43.21  ? 1020 ILE A HD13  1 
ATOM   2001 N  N     . TRP A 1 151 ? -31.826 1.793   -18.849 1.00 22.48  ? 1021 TRP A N     1 
ATOM   2002 C  CA    . TRP A 1 151 ? -30.413 1.779   -18.470 1.00 25.07  ? 1021 TRP A CA    1 
ATOM   2003 C  C     . TRP A 1 151 ? -30.238 1.585   -16.961 1.00 24.38  ? 1021 TRP A C     1 
ATOM   2004 O  O     . TRP A 1 151 ? -29.233 1.035   -16.513 1.00 22.82  ? 1021 TRP A O     1 
ATOM   2005 C  CB    . TRP A 1 151 ? -29.728 3.076   -18.917 1.00 26.37  ? 1021 TRP A CB    1 
ATOM   2006 C  CG    . TRP A 1 151 ? -29.331 3.071   -20.375 1.00 25.82  ? 1021 TRP A CG    1 
ATOM   2007 C  CD1   . TRP A 1 151 ? -30.154 2.880   -21.455 1.00 31.96  ? 1021 TRP A CD1   1 
ATOM   2008 C  CD2   . TRP A 1 151 ? -28.015 3.278   -20.906 1.00 23.24  ? 1021 TRP A CD2   1 
ATOM   2009 N  NE1   . TRP A 1 151 ? -29.426 2.946   -22.620 1.00 24.20  ? 1021 TRP A NE1   1 
ATOM   2010 C  CE2   . TRP A 1 151 ? -28.113 3.191   -22.314 1.00 25.92  ? 1021 TRP A CE2   1 
ATOM   2011 C  CE3   . TRP A 1 151 ? -26.762 3.525   -20.326 1.00 19.78  ? 1021 TRP A CE3   1 
ATOM   2012 C  CZ2   . TRP A 1 151 ? -27.005 3.340   -23.151 1.00 25.21  ? 1021 TRP A CZ2   1 
ATOM   2013 C  CZ3   . TRP A 1 151 ? -25.662 3.670   -21.158 1.00 21.13  ? 1021 TRP A CZ3   1 
ATOM   2014 C  CH2   . TRP A 1 151 ? -25.792 3.578   -22.558 1.00 22.32  ? 1021 TRP A CH2   1 
ATOM   2015 H  H     . TRP A 1 151 ? -32.169 2.579   -18.914 1.00 26.97  ? 1021 TRP A H     1 
ATOM   2016 H  HA    . TRP A 1 151 ? -29.969 1.032   -18.923 1.00 30.09  ? 1021 TRP A HA    1 
ATOM   2017 H  HB2   . TRP A 1 151 ? -30.338 3.817   -18.777 1.00 31.65  ? 1021 TRP A HB2   1 
ATOM   2018 H  HB3   . TRP A 1 151 ? -28.925 3.206   -18.390 1.00 31.65  ? 1021 TRP A HB3   1 
ATOM   2019 H  HD1   . TRP A 1 151 ? -31.069 2.723   -21.407 1.00 38.35  ? 1021 TRP A HD1   1 
ATOM   2020 H  HE1   . TRP A 1 151 ? -29.744 2.853   -23.413 1.00 29.04  ? 1021 TRP A HE1   1 
ATOM   2021 H  HE3   . TRP A 1 151 ? -26.670 3.583   -19.403 1.00 23.73  ? 1021 TRP A HE3   1 
ATOM   2022 H  HZ2   . TRP A 1 151 ? -27.087 3.280   -24.075 1.00 30.26  ? 1021 TRP A HZ2   1 
ATOM   2023 H  HZ3   . TRP A 1 151 ? -24.826 3.834   -20.786 1.00 25.35  ? 1021 TRP A HZ3   1 
ATOM   2024 H  HH2   . TRP A 1 151 ? -25.038 3.683   -23.093 1.00 26.78  ? 1021 TRP A HH2   1 
ATOM   2025 N  N     . HIS A 1 152 ? -31.213 2.027   -16.172 1.00 24.42  ? 1022 HIS A N     1 
ATOM   2026 C  CA    . HIS A 1 152 ? -31.071 1.951   -14.721 1.00 25.89  ? 1022 HIS A CA    1 
ATOM   2027 C  C     . HIS A 1 152 ? -30.974 0.501   -14.262 1.00 25.07  ? 1022 HIS A C     1 
ATOM   2028 O  O     . HIS A 1 152 ? -31.843 -0.312  -14.558 1.00 26.53  ? 1022 HIS A O     1 
ATOM   2029 C  CB    . HIS A 1 152 ? -32.240 2.630   -14.011 1.00 28.95  ? 1022 HIS A CB    1 
ATOM   2030 C  CG    . HIS A 1 152 ? -32.202 2.481   -12.522 1.00 37.72  ? 1022 HIS A CG    1 
ATOM   2031 N  ND1   . HIS A 1 152 ? -32.910 1.504   -11.853 1.00 43.70  ? 1022 HIS A ND1   1 
ATOM   2032 C  CD2   . HIS A 1 152 ? -31.525 3.170   -11.572 1.00 38.90  ? 1022 HIS A CD2   1 
ATOM   2033 C  CE1   . HIS A 1 152 ? -32.681 1.606   -10.557 1.00 49.24  ? 1022 HIS A CE1   1 
ATOM   2034 N  NE2   . HIS A 1 152 ? -31.842 2.609   -10.359 1.00 49.53  ? 1022 HIS A NE2   1 
ATOM   2035 H  H     . HIS A 1 152 ? -31.953 2.368   -16.445 1.00 29.30  ? 1022 HIS A H     1 
ATOM   2036 H  HA    . HIS A 1 152 ? -30.247 2.410   -14.455 1.00 31.07  ? 1022 HIS A HA    1 
ATOM   2037 H  HB2   . HIS A 1 152 ? -32.223 3.578   -14.215 1.00 34.74  ? 1022 HIS A HB2   1 
ATOM   2038 H  HB3   . HIS A 1 152 ? -33.069 2.239   -14.328 1.00 34.74  ? 1022 HIS A HB3   1 
ATOM   2039 H  HD1   . HIS A 1 152 ? -33.426 0.923   -12.222 1.00 52.44  ? 1022 HIS A HD1   1 
ATOM   2040 H  HD2   . HIS A 1 152 ? -30.956 3.891   -11.714 1.00 46.68  ? 1022 HIS A HD2   1 
ATOM   2041 H  HE1   . HIS A 1 152 ? -33.045 1.064   -9.896  1.00 59.09  ? 1022 HIS A HE1   1 
ATOM   2042 H  HE2   . HIS A 1 152 ? -31.544 2.868   -9.595  1.00 59.43  ? 1022 HIS A HE2   1 
ATOM   2043 N  N     . CYS A 1 153 ? -29.924 0.202   -13.511 1.00 23.23  ? 1023 CYS A N     1 
ATOM   2044 C  CA    . CYS A 1 153 ? -29.637 -1.158  -13.065 1.00 24.69  ? 1023 CYS A CA    1 
ATOM   2045 C  C     . CYS A 1 153 ? -29.878 -1.256  -11.560 1.00 24.91  ? 1023 CYS A C     1 
ATOM   2046 O  O     . CYS A 1 153 ? -29.100 -0.730  -10.758 1.00 24.80  ? 1023 CYS A O     1 
ATOM   2047 C  CB    . CYS A 1 153 ? -28.183 -1.523  -13.418 1.00 23.27  ? 1023 CYS A CB    1 
ATOM   2048 S  SG    . CYS A 1 153 ? -27.619 -3.139  -12.768 1.00 28.47  ? 1023 CYS A SG    1 
ATOM   2049 H  H     . CYS A 1 153 ? -29.349 0.782   -13.240 1.00 27.88  ? 1023 CYS A H     1 
ATOM   2050 H  HA    . CYS A 1 153 ? -30.236 -1.787  -13.519 1.00 29.63  ? 1023 CYS A HA    1 
ATOM   2051 H  HB2   . CYS A 1 153 ? -28.096 -1.549  -14.384 1.00 27.93  ? 1023 CYS A HB2   1 
ATOM   2052 H  HB3   . CYS A 1 153 ? -27.596 -0.840  -13.056 1.00 27.93  ? 1023 CYS A HB3   1 
ATOM   2053 H  HG    . CYS A 1 153 ? -28.318 -4.006  -13.216 1.00 34.17  ? 1023 CYS A HG    1 
ATOM   2054 N  N     A GLU A 1 154 ? -30.959 -1.926  -11.173 0.53 25.64  ? 1024 GLU A N     1 
ATOM   2055 N  N     B GLU A 1 154 ? -30.975 -1.911  -11.189 0.47 25.75  ? 1024 GLU A N     1 
ATOM   2056 C  CA    A GLU A 1 154 ? -31.328 -2.036  -9.764  0.53 23.99  ? 1024 GLU A CA    1 
ATOM   2057 C  CA    B GLU A 1 154 ? -31.319 -2.106  -9.788  0.47 24.52  ? 1024 GLU A CA    1 
ATOM   2058 C  C     A GLU A 1 154 ? -30.357 -2.949  -9.016  0.53 23.48  ? 1024 GLU A C     1 
ATOM   2059 C  C     B GLU A 1 154 ? -30.226 -2.911  -9.107  0.47 22.56  ? 1024 GLU A C     1 
ATOM   2060 O  O     A GLU A 1 154 ? -30.227 -4.123  -9.336  0.53 22.34  ? 1024 GLU A O     1 
ATOM   2061 O  O     B GLU A 1 154 ? -29.864 -3.984  -9.574  0.47 25.01  ? 1024 GLU A O     1 
ATOM   2062 C  CB    A GLU A 1 154 ? -32.761 -2.559  -9.623  0.53 31.04  ? 1024 GLU A CB    1 
ATOM   2063 C  CB    B GLU A 1 154 ? -32.652 -2.848  -9.656  0.47 31.14  ? 1024 GLU A CB    1 
ATOM   2064 C  CG    A GLU A 1 154 ? -33.338 -2.398  -8.222  0.53 34.36  ? 1024 GLU A CG    1 
ATOM   2065 C  CG    B GLU A 1 154 ? -33.093 -3.047  -8.208  0.47 35.05  ? 1024 GLU A CG    1 
ATOM   2066 C  CD    A GLU A 1 154 ? -33.691 -0.960  -7.895  0.53 39.05  ? 1024 GLU A CD    1 
ATOM   2067 C  CD    B GLU A 1 154 ? -34.379 -3.850  -8.084  0.47 42.73  ? 1024 GLU A CD    1 
ATOM   2068 O  OE1   A GLU A 1 154 ? -34.464 -0.342  -8.660  0.53 38.79  ? 1024 GLU A OE1   1 
ATOM   2069 O  OE1   B GLU A 1 154 ? -35.364 -3.511  -8.774  0.47 51.19  ? 1024 GLU A OE1   1 
ATOM   2070 O  OE2   A GLU A 1 154 ? -33.193 -0.446  -6.873  0.53 47.49  ? 1024 GLU A OE2   1 
ATOM   2071 O  OE2   B GLU A 1 154 ? -34.404 -4.817  -7.292  0.47 42.07  ? 1024 GLU A OE2   1 
ATOM   2072 H  H     A GLU A 1 154 ? -31.499 -2.328  -11.709 0.53 30.77  ? 1024 GLU A H     1 
ATOM   2073 H  H     B GLU A 1 154 ? -31.540 -2.255  -11.738 0.47 30.90  ? 1024 GLU A H     1 
ATOM   2074 H  HA    A GLU A 1 154 ? -31.287 -1.148  -9.353  0.53 28.79  ? 1024 GLU A HA    1 
ATOM   2075 H  HA    B GLU A 1 154 ? -31.397 -1.238  -9.341  0.47 29.42  ? 1024 GLU A HA    1 
ATOM   2076 H  HB2   A GLU A 1 154 ? -33.333 -2.073  -10.238 0.53 37.25  ? 1024 GLU A HB2   1 
ATOM   2077 H  HB2   B GLU A 1 154 ? -33.342 -2.339  -10.111 0.47 37.36  ? 1024 GLU A HB2   1 
ATOM   2078 H  HB3   A GLU A 1 154 ? -32.772 -3.504  -9.841  0.53 37.25  ? 1024 GLU A HB3   1 
ATOM   2079 H  HB3   B GLU A 1 154 ? -32.566 -3.724  -10.064 0.47 37.36  ? 1024 GLU A HB3   1 
ATOM   2080 H  HG2   A GLU A 1 154 ? -34.147 -2.928  -8.150  0.53 41.23  ? 1024 GLU A HG2   1 
ATOM   2081 H  HG2   B GLU A 1 154 ? -32.396 -3.521  -7.729  0.47 42.06  ? 1024 GLU A HG2   1 
ATOM   2082 H  HG3   A GLU A 1 154 ? -32.684 -2.701  -7.573  0.53 41.23  ? 1024 GLU A HG3   1 
ATOM   2083 H  HG3   B GLU A 1 154 ? -33.242 -2.178  -7.802  0.47 42.06  ? 1024 GLU A HG3   1 
ATOM   2084 N  N     . SER A 1 155 ? -29.697 -2.401  -8.001  1.00 21.63  ? 1025 SER A N     1 
ATOM   2085 C  CA    . SER A 1 155 ? -28.594 -3.078  -7.337  1.00 22.17  ? 1025 SER A CA    1 
ATOM   2086 C  C     . SER A 1 155 ? -28.464 -2.559  -5.911  1.00 26.23  ? 1025 SER A C     1 
ATOM   2087 O  O     . SER A 1 155 ? -27.747 -1.594  -5.664  1.00 24.53  ? 1025 SER A O     1 
ATOM   2088 C  CB    . SER A 1 155 ? -27.315 -2.805  -8.141  1.00 26.04  ? 1025 SER A CB    1 
ATOM   2089 O  OG    . SER A 1 155 ? -26.253 -3.656  -7.765  1.00 23.40  ? 1025 SER A OG    1 
ATOM   2090 H  H     A SER A 1 155 ? -29.874 -1.625  -7.675  0.50 25.96  ? 1025 SER A H     1 
ATOM   2091 H  H     B SER A 1 155 ? -29.955 -1.674  -7.620  0.50 25.96  ? 1025 SER A H     1 
ATOM   2092 H  HA    . SER A 1 155 ? -28.758 -4.044  -7.313  1.00 26.60  ? 1025 SER A HA    1 
ATOM   2093 H  HB2   . SER A 1 155 ? -27.504 -2.941  -9.082  1.00 31.25  ? 1025 SER A HB2   1 
ATOM   2094 H  HB3   . SER A 1 155 ? -27.044 -1.886  -7.991  1.00 31.25  ? 1025 SER A HB3   1 
ATOM   2095 H  HG    . SER A 1 155 ? -25.586 -3.485  -8.211  1.00 28.08  ? 1025 SER A HG    1 
ATOM   2096 N  N     . ASN A 1 156 ? -29.168 -3.199  -4.980  1.00 23.99  ? 1026 ASN A N     1 
ATOM   2097 C  CA    . ASN A 1 156 ? -29.306 -2.680  -3.613  1.00 29.19  ? 1026 ASN A CA    1 
ATOM   2098 C  C     . ASN A 1 156 ? -28.280 -3.278  -2.652  1.00 27.63  ? 1026 ASN A C     1 
ATOM   2099 O  O     . ASN A 1 156 ? -27.990 -4.470  -2.711  1.00 26.80  ? 1026 ASN A O     1 
ATOM   2100 C  CB    . ASN A 1 156 ? -30.730 -2.942  -3.113  1.00 33.33  ? 1026 ASN A CB    1 
ATOM   2101 C  CG    . ASN A 1 156 ? -31.789 -2.319  -4.022  1.00 45.32  ? 1026 ASN A CG    1 
ATOM   2102 O  OD1   . ASN A 1 156 ? -31.640 -1.185  -4.475  1.00 41.84  ? 1026 ASN A OD1   1 
ATOM   2103 N  ND2   . ASN A 1 156 ? -32.850 -3.066  -4.303  1.00 43.10  ? 1026 ASN A ND2   1 
ATOM   2104 H  H     . ASN A 1 156 ? -29.579 -3.942  -5.112  1.00 28.79  ? 1026 ASN A H     1 
ATOM   2105 H  HA    . ASN A 1 156 ? -29.169 -1.710  -3.629  1.00 35.03  ? 1026 ASN A HA    1 
ATOM   2106 H  HB2   . ASN A 1 156 ? -30.885 -3.899  -3.082  1.00 40.00  ? 1026 ASN A HB2   1 
ATOM   2107 H  HB3   . ASN A 1 156 ? -30.830 -2.560  -2.227  1.00 40.00  ? 1026 ASN A HB3   1 
ATOM   2108 H  HD21  . ASN A 1 156 ? -32.915 -3.860  -3.978  1.00 51.72  ? 1026 ASN A HD21  1 
ATOM   2109 H  HD22  . ASN A 1 156 ? -33.471 -2.757  -4.811  1.00 51.72  ? 1026 ASN A HD22  1 
ATOM   2110 N  N     . ARG A 1 157 ? -27.751 -2.444  -1.759  1.00 24.88  ? 1027 ARG A N     1 
ATOM   2111 C  CA    . ARG A 1 157 ? -26.638 -2.817  -0.880  1.00 31.32  ? 1027 ARG A CA    1 
ATOM   2112 C  C     . ARG A 1 157 ? -27.082 -3.472  0.428   1.00 30.91  ? 1027 ARG A C     1 
ATOM   2113 O  O     . ARG A 1 157 ? -28.049 -3.040  1.062   1.00 27.13  ? 1027 ARG A O     1 
ATOM   2114 C  CB    . ARG A 1 157 ? -25.801 -1.573  -0.548  1.00 37.05  ? 1027 ARG A CB    1 
ATOM   2115 C  CG    . ARG A 1 157 ? -24.532 -1.860  0.262   1.00 38.60  ? 1027 ARG A CG    1 
ATOM   2116 C  CD    . ARG A 1 157 ? -23.658 -0.607  0.459   1.00 41.85  ? 1027 ARG A CD    1 
ATOM   2117 N  NE    . ARG A 1 157 ? -24.046 0.156   1.646   1.00 73.45  ? 1027 ARG A NE    1 
ATOM   2118 C  CZ    . ARG A 1 157 ? -23.215 0.551   2.613   1.00 67.20  ? 1027 ARG A CZ    1 
ATOM   2119 N  NH1   . ARG A 1 157 ? -21.915 0.274   2.566   1.00 46.54  ? 1027 ARG A NH1   1 
ATOM   2120 N  NH2   . ARG A 1 157 ? -23.690 1.235   3.643   1.00 75.87  ? 1027 ARG A NH2   1 
ATOM   2121 H  H     . ARG A 1 157 ? -28.024 -1.637  -1.640  1.00 29.85  ? 1027 ARG A H     1 
ATOM   2122 H  HA    . ARG A 1 157 ? -26.060 -3.452  -1.353  1.00 37.58  ? 1027 ARG A HA    1 
ATOM   2123 H  HB2   . ARG A 1 157 ? -25.531 -1.150  -1.378  1.00 44.46  ? 1027 ARG A HB2   1 
ATOM   2124 H  HB3   . ARG A 1 157 ? -26.348 -0.960  -0.032  1.00 44.46  ? 1027 ARG A HB3   1 
ATOM   2125 H  HG2   . ARG A 1 157 ? -24.784 -2.190  1.139   1.00 46.32  ? 1027 ARG A HG2   1 
ATOM   2126 H  HG3   . ARG A 1 157 ? -24.002 -2.525  -0.204  1.00 46.32  ? 1027 ARG A HG3   1 
ATOM   2127 H  HD2   . ARG A 1 157 ? -22.732 -0.879  0.564   1.00 50.22  ? 1027 ARG A HD2   1 
ATOM   2128 H  HD3   . ARG A 1 157 ? -23.751 -0.030  -0.315  1.00 50.22  ? 1027 ARG A HD3   1 
ATOM   2129 H  HE    . ARG A 1 157 ? -24.876 0.366   1.727   1.00 88.14  ? 1027 ARG A HE    1 
ATOM   2130 H  HH11  . ARG A 1 157 ? -21.594 -0.171  1.903   1.00 55.84  ? 1027 ARG A HH11  1 
ATOM   2131 H  HH12  . ARG A 1 157 ? -21.396 0.538   3.198   1.00 55.84  ? 1027 ARG A HH12  1 
ATOM   2132 H  HH21  . ARG A 1 157 ? -24.528 1.422   3.686   1.00 91.05  ? 1027 ARG A HH21  1 
ATOM   2133 H  HH22  . ARG A 1 157 ? -23.160 1.495   4.269   1.00 91.05  ? 1027 ARG A HH22  1 
ATOM   2134 N  N     . SER A 1 158 ? -26.359 -4.513  0.834   1.00 26.78  ? 1028 SER A N     1 
ATOM   2135 C  CA    . SER A 1 158 ? -26.506 -5.088  2.173   1.00 30.54  ? 1028 SER A CA    1 
ATOM   2136 C  C     . SER A 1 158 ? -25.189 -5.764  2.531   1.00 30.47  ? 1028 SER A C     1 
ATOM   2137 O  O     . SER A 1 158 ? -24.243 -5.728  1.749   1.00 26.44  ? 1028 SER A O     1 
ATOM   2138 C  CB    . SER A 1 158 ? -27.663 -6.090  2.216   1.00 27.15  ? 1028 SER A CB    1 
ATOM   2139 O  OG    . SER A 1 158 ? -27.393 -7.204  1.381   1.00 29.95  ? 1028 SER A OG    1 
ATOM   2140 H  H     . SER A 1 158 ? -25.770 -4.909  0.349   1.00 32.13  ? 1028 SER A H     1 
ATOM   2141 H  HA    . SER A 1 158 ? -26.681 -4.376  2.823   1.00 36.65  ? 1028 SER A HA    1 
ATOM   2142 H  HB2   . SER A 1 158 ? -27.780 -6.399  3.128   1.00 32.57  ? 1028 SER A HB2   1 
ATOM   2143 H  HB3   . SER A 1 158 ? -28.472 -5.653  1.908   1.00 32.57  ? 1028 SER A HB3   1 
ATOM   2144 H  HG    . SER A 1 158 ? -28.018 -7.735  1.411   1.00 35.94  ? 1028 SER A HG    1 
ATOM   2145 N  N     . HIS A 1 159 ? -25.119 -6.386  3.698   1.00 23.72  ? 1029 HIS A N     1 
ATOM   2146 C  CA    . HIS A 1 159 ? -23.890 -7.041  4.114   1.00 25.82  ? 1029 HIS A CA    1 
ATOM   2147 C  C     . HIS A 1 159 ? -24.180 -8.383  4.773   1.00 28.74  ? 1029 HIS A C     1 
ATOM   2148 O  O     . HIS A 1 159 ? -25.170 -8.545  5.480   1.00 26.18  ? 1029 HIS A O     1 
ATOM   2149 C  CB    . HIS A 1 159 ? -23.103 -6.138  5.072   1.00 26.88  ? 1029 HIS A CB    1 
ATOM   2150 C  CG    . HIS A 1 159 ? -22.592 -4.890  4.424   1.00 24.26  ? 1029 HIS A CG    1 
ATOM   2151 N  ND1   . HIS A 1 159 ? -23.371 -3.766  4.266   1.00 25.59  ? 1029 HIS A ND1   1 
ATOM   2152 C  CD2   . HIS A 1 159 ? -21.394 -4.606  3.863   1.00 25.71  ? 1029 HIS A CD2   1 
ATOM   2153 C  CE1   . HIS A 1 159 ? -22.669 -2.833  3.643   1.00 26.72  ? 1029 HIS A CE1   1 
ATOM   2154 N  NE2   . HIS A 1 159 ? -21.470 -3.320  3.386   1.00 28.17  ? 1029 HIS A NE2   1 
ATOM   2155 H  H     . HIS A 1 159 ? -25.764 -6.443  4.264   1.00 28.46  ? 1029 HIS A H     1 
ATOM   2156 H  HA    . HIS A 1 159 ? -23.333 -7.205  3.324   1.00 30.98  ? 1029 HIS A HA    1 
ATOM   2157 H  HB2   . HIS A 1 159 ? -23.683 -5.878  5.805   1.00 32.25  ? 1029 HIS A HB2   1 
ATOM   2158 H  HB3   . HIS A 1 159 ? -22.341 -6.631  5.413   1.00 32.25  ? 1029 HIS A HB3   1 
ATOM   2159 H  HD1   . HIS A 1 159 ? -24.185 -3.682  4.532   1.00 30.71  ? 1029 HIS A HD1   1 
ATOM   2160 H  HD2   . HIS A 1 159 ? -20.659 -5.174  3.809   1.00 30.85  ? 1029 HIS A HD2   1 
ATOM   2161 H  HE1   . HIS A 1 159 ? -22.968 -1.980  3.425   1.00 32.07  ? 1029 HIS A HE1   1 
ATOM   2162 H  HE2   . HIS A 1 159 ? -20.834 -2.896  2.992   1.00 33.81  ? 1029 HIS A HE2   1 
ATOM   2163 N  N     . THR A 1 160 ? -23.291 -9.339  4.548   1.00 23.28  ? 1030 THR A N     1 
ATOM   2164 C  CA    . THR A 1 160 ? -23.456 -10.676 5.090   1.00 25.57  ? 1030 THR A CA    1 
ATOM   2165 C  C     . THR A 1 160 ? -22.072 -11.212 5.458   1.00 23.89  ? 1030 THR A C     1 
ATOM   2166 O  O     . THR A 1 160 ? -21.104 -10.446 5.509   1.00 24.33  ? 1030 THR A O     1 
ATOM   2167 C  CB    . THR A 1 160 ? -24.160 -11.588 4.062   1.00 27.77  ? 1030 THR A CB    1 
ATOM   2168 O  OG1   . THR A 1 160 ? -24.448 -12.864 4.652   1.00 27.35  ? 1030 THR A OG1   1 
ATOM   2169 C  CG2   . THR A 1 160 ? -23.290 -11.762 2.826   1.00 28.92  ? 1030 THR A CG2   1 
ATOM   2170 H  H     . THR A 1 160 ? -22.576 -9.237  4.080   1.00 27.94  ? 1030 THR A H     1 
ATOM   2171 H  HA    . THR A 1 160 ? -24.003 -10.637 5.902   1.00 30.68  ? 1030 THR A HA    1 
ATOM   2172 H  HB    . THR A 1 160 ? -24.992 -11.172 3.787   1.00 33.32  ? 1030 THR A HB    1 
ATOM   2173 H  HG1   . THR A 1 160 ? -24.938 -12.769 5.302   1.00 32.82  ? 1030 THR A HG1   1 
ATOM   2174 H  HG21  . THR A 1 160 ? -23.732 -12.330 2.191   1.00 34.71  ? 1030 THR A HG21  1 
ATOM   2175 H  HG22  . THR A 1 160 ? -23.124 -10.909 2.420   1.00 34.71  ? 1030 THR A HG22  1 
ATOM   2176 H  HG23  . THR A 1 160 ? -22.451 -12.160 3.070   1.00 34.71  ? 1030 THR A HG23  1 
ATOM   2177 N  N     . THR A 1 161 ? -21.982 -12.502 5.757   1.00 25.77  ? 1031 THR A N     1 
ATOM   2178 C  CA    . THR A 1 161 ? -20.694 -13.140 6.015   1.00 24.94  ? 1031 THR A CA    1 
ATOM   2179 C  C     . THR A 1 161 ? -20.366 -14.081 4.868   1.00 26.29  ? 1031 THR A C     1 
ATOM   2180 O  O     . THR A 1 161 ? -21.248 -14.488 4.116   1.00 23.54  ? 1031 THR A O     1 
ATOM   2181 C  CB    . THR A 1 161 ? -20.693 -13.958 7.315   1.00 28.76  ? 1031 THR A CB    1 
ATOM   2182 O  OG1   . THR A 1 161 ? -21.599 -15.059 7.195   1.00 27.92  ? 1031 THR A OG1   1 
ATOM   2183 C  CG2   . THR A 1 161 ? -21.089 -13.095 8.520   1.00 31.65  ? 1031 THR A CG2   1 
ATOM   2184 H  H     . THR A 1 161 ? -22.655 -13.034 5.818   1.00 30.92  ? 1031 THR A H     1 
ATOM   2185 H  HA    . THR A 1 161 ? -19.993 -12.458 6.072   1.00 29.93  ? 1031 THR A HA    1 
ATOM   2186 H  HB    . THR A 1 161 ? -19.799 -14.300 7.473   1.00 34.51  ? 1031 THR A HB    1 
ATOM   2187 H  HG1   . THR A 1 161 ? -22.358 -14.784 7.052   1.00 33.50  ? 1031 THR A HG1   1 
ATOM   2188 H  HG21  . THR A 1 161 ? -21.082 -13.626 9.320   1.00 37.97  ? 1031 THR A HG21  1 
ATOM   2189 H  HG22  . THR A 1 161 ? -20.469 -12.369 8.622   1.00 37.97  ? 1031 THR A HG22  1 
ATOM   2190 H  HG23  . THR A 1 161 ? -21.971 -12.737 8.391   1.00 37.97  ? 1031 THR A HG23  1 
ATOM   2191 N  N     . ILE A 1 162 ? -19.099 -14.442 4.738   1.00 21.14  ? 1032 ILE A N     1 
ATOM   2192 C  CA    . ILE A 1 162 ? -18.703 -15.319 3.643   1.00 22.50  ? 1032 ILE A CA    1 
ATOM   2193 C  C     . ILE A 1 162 ? -19.357 -16.695 3.831   1.00 23.99  ? 1032 ILE A C     1 
ATOM   2194 O  O     . ILE A 1 162 ? -19.767 -17.330 2.858   1.00 25.16  ? 1032 ILE A O     1 
ATOM   2195 C  CB    . ILE A 1 162 ? -17.160 -15.393 3.513   1.00 28.07  ? 1032 ILE A CB    1 
ATOM   2196 C  CG1   . ILE A 1 162 ? -16.764 -16.096 2.220   1.00 39.66  ? 1032 ILE A CG1   1 
ATOM   2197 C  CG2   . ILE A 1 162 ? -16.534 -16.087 4.733   1.00 29.71  ? 1032 ILE A CG2   1 
ATOM   2198 C  CD1   . ILE A 1 162 ? -15.360 -15.748 1.757   1.00 34.40  ? 1032 ILE A CD1   1 
ATOM   2199 H  H     . ILE A 1 162 ? -18.458 -14.200 5.258   1.00 25.37  ? 1032 ILE A H     1 
ATOM   2200 H  HA    . ILE A 1 162 ? -19.048 -14.943 2.807   1.00 26.99  ? 1032 ILE A HA    1 
ATOM   2201 H  HB    . ILE A 1 162 ? -16.819 -14.486 3.477   1.00 33.68  ? 1032 ILE A HB    1 
ATOM   2202 H  HG12  . ILE A 1 162 ? -16.803 -17.055 2.359   1.00 47.59  ? 1032 ILE A HG12  1 
ATOM   2203 H  HG13  . ILE A 1 162 ? -17.382 -15.837 1.519   1.00 47.59  ? 1032 ILE A HG13  1 
ATOM   2204 H  HG21  . ILE A 1 162 ? -16.883 -16.979 4.798   1.00 35.65  ? 1032 ILE A HG21  1 
ATOM   2205 H  HG22  . ILE A 1 162 ? -15.581 -16.116 4.620   1.00 35.65  ? 1032 ILE A HG22  1 
ATOM   2206 H  HG23  . ILE A 1 162 ? -16.755 -15.590 5.523   1.00 35.65  ? 1032 ILE A HG23  1 
ATOM   2207 H  HD11  . ILE A 1 162 ? -15.307 -14.801 1.607   1.00 41.28  ? 1032 ILE A HD11  1 
ATOM   2208 H  HD12  . ILE A 1 162 ? -14.734 -16.007 2.438   1.00 41.28  ? 1032 ILE A HD12  1 
ATOM   2209 H  HD13  . ILE A 1 162 ? -15.174 -16.221 0.943   1.00 41.28  ? 1032 ILE A HD13  1 
ATOM   2210 N  N     . ALA A 1 163 ? -19.495 -17.142 5.078   1.00 25.79  ? 1033 ALA A N     1 
ATOM   2211 C  CA    . ALA A 1 163 ? -20.175 -18.408 5.359   1.00 26.17  ? 1033 ALA A CA    1 
ATOM   2212 C  C     . ALA A 1 163 ? -21.618 -18.385 4.856   1.00 27.05  ? 1033 ALA A C     1 
ATOM   2213 O  O     . ALA A 1 163 ? -22.101 -19.355 4.275   1.00 27.61  ? 1033 ALA A O     1 
ATOM   2214 C  CB    . ALA A 1 163 ? -20.144 -18.719 6.869   1.00 32.51  ? 1033 ALA A CB    1 
ATOM   2215 H  H     . ALA A 1 163 ? -19.206 -16.734 5.778   1.00 30.95  ? 1033 ALA A H     1 
ATOM   2216 H  HA    . ALA A 1 163 ? -19.705 -19.130 4.893   1.00 31.40  ? 1033 ALA A HA    1 
ATOM   2217 H  HB1   . ALA A 1 163 ? -20.595 -19.551 7.026   1.00 39.01  ? 1033 ALA A HB1   1 
ATOM   2218 H  HB2   . ALA A 1 163 ? -19.231 -18.782 7.157   1.00 39.01  ? 1033 ALA A HB2   1 
ATOM   2219 H  HB3   . ALA A 1 163 ? -20.589 -18.011 7.342   1.00 39.01  ? 1033 ALA A HB3   1 
ATOM   2220 N  N     . LYS A 1 164 ? -22.317 -17.279 5.081   1.00 24.28  ? 1034 LYS A N     1 
ATOM   2221 C  CA    . LYS A 1 164 ? -23.715 -17.209 4.674   1.00 24.84  ? 1034 LYS A CA    1 
ATOM   2222 C  C     . LYS A 1 164 ? -23.860 -17.024 3.166   1.00 24.27  ? 1034 LYS A C     1 
ATOM   2223 O  O     . LYS A 1 164 ? -24.728 -17.636 2.548   1.00 27.65  ? 1034 LYS A O     1 
ATOM   2224 C  CB    . LYS A 1 164 ? -24.439 -16.095 5.420   1.00 30.18  ? 1034 LYS A CB    1 
ATOM   2225 C  CG    . LYS A 1 164 ? -24.640 -16.409 6.902   1.00 37.02  ? 1034 LYS A CG    1 
ATOM   2226 C  CD    . LYS A 1 164 ? -26.072 -16.179 7.313   1.00 45.02  ? 1034 LYS A CD    1 
ATOM   2227 C  CE    . LYS A 1 164 ? -26.257 -16.360 8.807   1.00 57.06  ? 1034 LYS A CE    1 
ATOM   2228 N  NZ    . LYS A 1 164 ? -27.641 -16.019 9.224   1.00 71.33  ? 1034 LYS A NZ    1 
ATOM   2229 H  H     . LYS A 1 164 ? -22.014 -16.569 5.461   1.00 29.14  ? 1034 LYS A H     1 
ATOM   2230 H  HA    . LYS A 1 164 ? -24.151 -18.055 4.910   1.00 29.81  ? 1034 LYS A HA    1 
ATOM   2231 H  HB2   . LYS A 1 164 ? -23.917 -15.280 5.354   1.00 36.22  ? 1034 LYS A HB2   1 
ATOM   2232 H  HB3   . LYS A 1 164 ? -25.313 -15.963 5.020   1.00 36.22  ? 1034 LYS A HB3   1 
ATOM   2233 H  HG2   . LYS A 1 164 ? -24.421 -17.339 7.067   1.00 44.43  ? 1034 LYS A HG2   1 
ATOM   2234 H  HG3   . LYS A 1 164 ? -24.073 -15.829 7.434   1.00 44.43  ? 1034 LYS A HG3   1 
ATOM   2235 H  HD2   . LYS A 1 164 ? -26.330 -15.272 7.082   1.00 54.03  ? 1034 LYS A HD2   1 
ATOM   2236 H  HD3   . LYS A 1 164 ? -26.643 -16.816 6.856   1.00 54.03  ? 1034 LYS A HD3   1 
ATOM   2237 H  HE2   . LYS A 1 164 ? -26.087 -17.286 9.041   1.00 68.47  ? 1034 LYS A HE2   1 
ATOM   2238 H  HE3   . LYS A 1 164 ? -25.643 -15.775 9.279   1.00 68.47  ? 1034 LYS A HE3   1 
ATOM   2239 H  HZ1   . LYS A 1 164 ? -27.819 -15.171 9.021   1.00 85.60  ? 1034 LYS A HZ1   1 
ATOM   2240 H  HZ2   . LYS A 1 164 ? -28.223 -16.545 8.804   1.00 85.60  ? 1034 LYS A HZ2   1 
ATOM   2241 H  HZ3   . LYS A 1 164 ? -27.730 -16.131 10.102  1.00 85.60  ? 1034 LYS A HZ3   1 
ATOM   2242 N  N     . TYR A 1 165 ? -23.018 -16.193 2.559   1.00 24.16  ? 1035 TYR A N     1 
ATOM   2243 C  CA    . TYR A 1 165 ? -23.118 -16.041 1.118   1.00 24.42  ? 1035 TYR A CA    1 
ATOM   2244 C  C     . TYR A 1 165 ? -22.770 -17.388 0.476   1.00 25.83  ? 1035 TYR A C     1 
ATOM   2245 O  O     . TYR A 1 165 ? -23.424 -17.809 -0.475  1.00 23.39  ? 1035 TYR A O     1 
ATOM   2246 C  CB    . TYR A 1 165 ? -22.250 -14.904 0.542   1.00 23.35  ? 1035 TYR A CB    1 
ATOM   2247 C  CG    . TYR A 1 165 ? -22.602 -14.732 -0.905  1.00 21.58  ? 1035 TYR A CG    1 
ATOM   2248 C  CD1   . TYR A 1 165 ? -23.738 -14.021 -1.289  1.00 23.83  ? 1035 TYR A CD1   1 
ATOM   2249 C  CD2   . TYR A 1 165 ? -21.875 -15.386 -1.885  1.00 16.61  ? 1035 TYR A CD2   1 
ATOM   2250 C  CE1   . TYR A 1 165 ? -24.100 -13.923 -2.631  1.00 27.00  ? 1035 TYR A CE1   1 
ATOM   2251 C  CE2   . TYR A 1 165 ? -22.227 -15.300 -3.209  1.00 17.81  ? 1035 TYR A CE2   1 
ATOM   2252 C  CZ    . TYR A 1 165 ? -23.332 -14.569 -3.579  1.00 26.52  ? 1035 TYR A CZ    1 
ATOM   2253 O  OH    . TYR A 1 165 ? -23.650 -14.514 -4.913  1.00 21.56  ? 1035 TYR A OH    1 
ATOM   2254 H  H     . TYR A 1 165 ? -22.406 -15.725 2.941   1.00 28.99  ? 1035 TYR A H     1 
ATOM   2255 H  HA    . TYR A 1 165 ? -24.050 -15.840 0.893   1.00 29.31  ? 1035 TYR A HA    1 
ATOM   2256 H  HB2   . TYR A 1 165 ? -22.436 -14.076 1.012   1.00 28.02  ? 1035 TYR A HB2   1 
ATOM   2257 H  HB3   . TYR A 1 165 ? -21.311 -15.138 0.611   1.00 28.02  ? 1035 TYR A HB3   1 
ATOM   2258 H  HD1   . TYR A 1 165 ? -24.252 -13.592 -0.642  1.00 28.60  ? 1035 TYR A HD1   1 
ATOM   2259 H  HD2   . TYR A 1 165 ? -21.130 -15.886 -1.642  1.00 19.93  ? 1035 TYR A HD2   1 
ATOM   2260 H  HE1   . TYR A 1 165 ? -24.849 -13.432 -2.884  1.00 32.40  ? 1035 TYR A HE1   1 
ATOM   2261 H  HE2   . TYR A 1 165 ? -21.716 -15.731 -3.855  1.00 21.37  ? 1035 TYR A HE2   1 
ATOM   2262 H  HH    . TYR A 1 165 ? -23.786 -15.269 -5.200  1.00 25.87  ? 1035 TYR A HH    1 
ATOM   2263 N  N     . ALA A 1 166 ? -21.783 -18.091 1.033   1.00 24.24  ? 1036 ALA A N     1 
ATOM   2264 C  CA    . ALA A 1 166 ? -21.404 -19.408 0.513   1.00 25.65  ? 1036 ALA A CA    1 
ATOM   2265 C  C     . ALA A 1 166 ? -22.577 -20.384 0.497   1.00 25.21  ? 1036 ALA A C     1 
ATOM   2266 O  O     . ALA A 1 166 ? -22.730 -21.143 -0.460  1.00 25.26  ? 1036 ALA A O     1 
ATOM   2267 C  CB    . ALA A 1 166 ? -20.238 -20.000 1.308   1.00 24.79  ? 1036 ALA A CB    1 
ATOM   2268 H  H     . ALA A 1 166 ? -21.320 -17.830 1.709   1.00 29.09  ? 1036 ALA A H     1 
ATOM   2269 H  HA    . ALA A 1 166 ? -21.102 -19.298 -0.413  1.00 30.78  ? 1036 ALA A HA    1 
ATOM   2270 H  HB1   . ALA A 1 166 ? -20.501 -20.093 2.226   1.00 29.75  ? 1036 ALA A HB1   1 
ATOM   2271 H  HB2   . ALA A 1 166 ? -20.015 -20.860 0.942   1.00 29.75  ? 1036 ALA A HB2   1 
ATOM   2272 H  HB3   . ALA A 1 166 ? -19.483 -19.411 1.241   1.00 29.75  ? 1036 ALA A HB3   1 
ATOM   2273 N  N     . GLN A 1 167 ? -23.399 -20.383 1.548   1.00 26.84  ? 1037 GLN A N     1 
ATOM   2274 C  CA    . GLN A 1 167 ? -24.549 -21.298 1.601   1.00 29.64  ? 1037 GLN A CA    1 
ATOM   2275 C  C     . GLN A 1 167 ? -25.537 -20.954 0.520   1.00 31.75  ? 1037 GLN A C     1 
ATOM   2276 O  O     . GLN A 1 167 ? -26.170 -21.828 -0.068  1.00 25.81  ? 1037 GLN A O     1 
ATOM   2277 C  CB    . GLN A 1 167 ? -25.301 -21.183 2.927   1.00 32.25  ? 1037 GLN A CB    1 
ATOM   2278 C  CG    . GLN A 1 167 ? -24.626 -21.801 4.112   1.00 65.85  ? 1037 GLN A CG    1 
ATOM   2279 C  CD    . GLN A 1 167 ? -25.240 -21.294 5.399   1.00 97.44  ? 1037 GLN A CD    1 
ATOM   2280 O  OE1   . GLN A 1 167 ? -26.387 -20.841 5.413   1.00 103.09 ? 1037 GLN A OE1   1 
ATOM   2281 N  NE2   . GLN A 1 167 ? -24.482 -21.353 6.481   1.00 102.69 ? 1037 GLN A NE2   1 
ATOM   2282 H  H     . GLN A 1 167 ? -23.317 -19.872 2.235   1.00 32.21  ? 1037 GLN A H     1 
ATOM   2283 H  HA    . GLN A 1 167 ? -24.251 -22.223 1.480   1.00 35.57  ? 1037 GLN A HA    1 
ATOM   2284 H  HB2   . GLN A 1 167 ? -25.430 -20.242 3.125   1.00 38.70  ? 1037 GLN A HB2   1 
ATOM   2285 H  HB3   . GLN A 1 167 ? -26.164 -21.613 2.828   1.00 38.70  ? 1037 GLN A HB3   1 
ATOM   2286 H  HG2   . GLN A 1 167 ? -24.734 -22.764 4.078   1.00 79.01  ? 1037 GLN A HG2   1 
ATOM   2287 H  HG3   . GLN A 1 167 ? -23.685 -21.565 4.107   1.00 79.01  ? 1037 GLN A HG3   1 
ATOM   2288 H  HE21  . GLN A 1 167 ? -23.683 -21.668 6.429   1.00 123.23 ? 1037 GLN A HE21  1 
ATOM   2289 H  HE22  . GLN A 1 167 ? -24.788 -21.077 7.235   1.00 123.23 ? 1037 GLN A HE22  1 
ATOM   2290 N  N     . TYR A 1 168 ? -25.701 -19.658 0.297   1.00 27.47  ? 1038 TYR A N     1 
ATOM   2291 C  CA    . TYR A 1 168 ? -26.597 -19.173 -0.735  1.00 28.75  ? 1038 TYR A CA    1 
ATOM   2292 C  C     . TYR A 1 168 ? -26.113 -19.585 -2.128  1.00 29.22  ? 1038 TYR A C     1 
ATOM   2293 O  O     . TYR A 1 168 ? -26.887 -20.089 -2.944  1.00 23.77  ? 1038 TYR A O     1 
ATOM   2294 C  CB    . TYR A 1 168 ? -26.714 -17.651 -0.638  1.00 26.85  ? 1038 TYR A CB    1 
ATOM   2295 C  CG    . TYR A 1 168 ? -27.364 -17.048 -1.853  1.00 28.05  ? 1038 TYR A CG    1 
ATOM   2296 C  CD1   . TYR A 1 168 ? -28.732 -17.170 -2.057  1.00 38.80  ? 1038 TYR A CD1   1 
ATOM   2297 C  CD2   . TYR A 1 168 ? -26.609 -16.392 -2.819  1.00 28.73  ? 1038 TYR A CD2   1 
ATOM   2298 C  CE1   . TYR A 1 168 ? -29.334 -16.638 -3.169  1.00 34.19  ? 1038 TYR A CE1   1 
ATOM   2299 C  CE2   . TYR A 1 168 ? -27.206 -15.856 -3.937  1.00 28.73  ? 1038 TYR A CE2   1 
ATOM   2300 C  CZ    . TYR A 1 168 ? -28.567 -15.982 -4.104  1.00 31.02  ? 1038 TYR A CZ    1 
ATOM   2301 O  OH    . TYR A 1 168 ? -29.163 -15.449 -5.216  1.00 28.32  ? 1038 TYR A OH    1 
ATOM   2302 H  H     . TYR A 1 168 ? -25.299 -19.036 0.734   1.00 32.96  ? 1038 TYR A H     1 
ATOM   2303 H  HA    . TYR A 1 168 ? -27.488 -19.558 -0.595  1.00 34.50  ? 1038 TYR A HA    1 
ATOM   2304 H  HB2   . TYR A 1 168 ? -27.253 -17.423 0.136   1.00 32.22  ? 1038 TYR A HB2   1 
ATOM   2305 H  HB3   . TYR A 1 168 ? -25.827 -17.270 -0.550  1.00 32.22  ? 1038 TYR A HB3   1 
ATOM   2306 H  HD1   . TYR A 1 168 ? -29.251 -17.612 -1.424  1.00 46.56  ? 1038 TYR A HD1   1 
ATOM   2307 H  HD2   . TYR A 1 168 ? -25.690 -16.306 -2.703  1.00 34.48  ? 1038 TYR A HD2   1 
ATOM   2308 H  HE1   . TYR A 1 168 ? -30.253 -16.719 -3.289  1.00 41.02  ? 1038 TYR A HE1   1 
ATOM   2309 H  HE2   . TYR A 1 168 ? -26.695 -15.411 -4.574  1.00 34.47  ? 1038 TYR A HE2   1 
ATOM   2310 H  HH    . TYR A 1 168 ? -28.848 -15.788 -5.893  1.00 33.98  ? 1038 TYR A HH    1 
ATOM   2311 N  N     . GLN A 1 169 ? -24.825 -19.385 -2.399  1.00 20.07  ? 1039 GLN A N     1 
ATOM   2312 C  CA    . GLN A 1 169 ? -24.254 -19.724 -3.701  1.00 22.61  ? 1039 GLN A CA    1 
ATOM   2313 C  C     . GLN A 1 169 ? -24.326 -21.230 -3.959  1.00 28.48  ? 1039 GLN A C     1 
ATOM   2314 O  O     . GLN A 1 169 ? -24.738 -21.670 -5.035  1.00 25.33  ? 1039 GLN A O     1 
ATOM   2315 C  CB    . GLN A 1 169 ? -22.803 -19.257 -3.754  1.00 19.99  ? 1039 GLN A CB    1 
ATOM   2316 C  CG    . GLN A 1 169 ? -22.117 -19.416 -5.103  1.00 20.61  ? 1039 GLN A CG    1 
ATOM   2317 C  CD    . GLN A 1 169 ? -20.635 -19.125 -4.992  1.00 25.62  ? 1039 GLN A CD    1 
ATOM   2318 O  OE1   . GLN A 1 169 ? -19.950 -19.697 -4.142  1.00 23.01  ? 1039 GLN A OE1   1 
ATOM   2319 N  NE2   . GLN A 1 169 ? -20.131 -18.214 -5.834  1.00 20.09  ? 1039 GLN A NE2   1 
ATOM   2320 H  H     . GLN A 1 169 ? -24.259 -19.052 -1.844  1.00 24.08  ? 1039 GLN A H     1 
ATOM   2321 H  HA    . GLN A 1 169 ? -24.754 -19.264 -4.407  1.00 27.13  ? 1039 GLN A HA    1 
ATOM   2322 H  HB2   . GLN A 1 169 ? -22.774 -18.315 -3.522  1.00 23.99  ? 1039 GLN A HB2   1 
ATOM   2323 H  HB3   . GLN A 1 169 ? -22.292 -19.766 -3.106  1.00 23.99  ? 1039 GLN A HB3   1 
ATOM   2324 H  HG2   . GLN A 1 169 ? -22.227 -20.328 -5.415  1.00 24.74  ? 1039 GLN A HG2   1 
ATOM   2325 H  HG3   . GLN A 1 169 ? -22.504 -18.792 -5.737  1.00 24.74  ? 1039 GLN A HG3   1 
ATOM   2326 H  HE21  . GLN A 1 169 ? -19.294 -18.019 -5.806  1.00 24.10  ? 1039 GLN A HE21  1 
ATOM   2327 H  HE22  . GLN A 1 169 ? -20.645 -17.825 -6.403  1.00 24.10  ? 1039 GLN A HE22  1 
ATOM   2328 N  N     . ALA A 1 170 ? -23.928 -22.007 -2.957  1.00 26.86  ? 1040 ALA A N     1 
ATOM   2329 C  CA    . ALA A 1 170 ? -23.849 -23.458 -3.077  1.00 35.06  ? 1040 ALA A CA    1 
ATOM   2330 C  C     . ALA A 1 170 ? -25.230 -24.070 -3.250  1.00 38.64  ? 1040 ALA A C     1 
ATOM   2331 O  O     . ALA A 1 170 ? -25.411 -24.962 -4.073  1.00 34.70  ? 1040 ALA A O     1 
ATOM   2332 C  CB    . ALA A 1 170 ? -23.149 -24.061 -1.853  1.00 40.22  ? 1040 ALA A CB    1 
ATOM   2333 H  H     . ALA A 1 170 ? -23.695 -21.712 -2.184  1.00 32.23  ? 1040 ALA A H     1 
ATOM   2334 H  HA    . ALA A 1 170 ? -23.318 -23.683 -3.870  1.00 42.07  ? 1040 ALA A HA    1 
ATOM   2335 H  HB1   . ALA A 1 170 ? -23.650 -23.837 -1.066  1.00 48.26  ? 1040 ALA A HB1   1 
ATOM   2336 H  HB2   . ALA A 1 170 ? -23.109 -25.015 -1.955  1.00 48.26  ? 1040 ALA A HB2   1 
ATOM   2337 H  HB3   . ALA A 1 170 ? -22.262 -23.700 -1.792  1.00 48.26  ? 1040 ALA A HB3   1 
ATOM   2338 N  N     . SER A 1 171 ? -26.200 -23.594 -2.475  1.00 40.64  ? 1041 SER A N     1 
ATOM   2339 C  CA    . SER A 1 171 ? -27.564 -24.110 -2.563  1.00 60.51  ? 1041 SER A CA    1 
ATOM   2340 C  C     . SER A 1 171 ? -28.226 -23.666 -3.867  1.00 54.66  ? 1041 SER A C     1 
ATOM   2341 O  O     . SER A 1 171 ? -29.031 -24.392 -4.438  1.00 48.72  ? 1041 SER A O     1 
ATOM   2342 C  CB    . SER A 1 171 ? -28.399 -23.663 -1.357  1.00 62.93  ? 1041 SER A CB    1 
ATOM   2343 O  OG    . SER A 1 171 ? -28.763 -22.298 -1.446  1.00 70.07  ? 1041 SER A OG    1 
ATOM   2344 H  H     . SER A 1 171 ? -26.095 -22.973 -1.890  1.00 48.77  ? 1041 SER A H     1 
ATOM   2345 H  HA    . SER A 1 171 ? -27.533 -25.090 -2.560  1.00 72.61  ? 1041 SER A HA    1 
ATOM   2346 H  HB2   . SER A 1 171 ? -29.206 -24.200 -1.320  1.00 75.51  ? 1041 SER A HB2   1 
ATOM   2347 H  HB3   . SER A 1 171 ? -27.878 -23.796 -0.550  1.00 75.51  ? 1041 SER A HB3   1 
ATOM   2348 H  HG    . SER A 1 171 ? -28.462 -21.972 -2.136  1.00 84.09  ? 1041 SER A HG    1 
ATOM   2349 N  N     . SER A 1 172 ? -27.887 -22.464 -4.318  1.00 45.95  ? 1042 SER A N     1 
ATOM   2350 C  CA    . SER A 1 172 ? -28.312 -21.960 -5.621  1.00 46.16  ? 1042 SER A CA    1 
ATOM   2351 C  C     . SER A 1 172 ? -27.937 -22.946 -6.721  1.00 47.30  ? 1042 SER A C     1 
ATOM   2352 O  O     . SER A 1 172 ? -28.758 -23.331 -7.551  1.00 48.05  ? 1042 SER A O     1 
ATOM   2353 C  CB    . SER A 1 172 ? -27.617 -20.627 -5.900  1.00 41.14  ? 1042 SER A CB    1 
ATOM   2354 O  OG    . SER A 1 172 ? -28.061 -20.065 -7.121  1.00 53.66  ? 1042 SER A OG    1 
ATOM   2355 H  H     . SER A 1 172 ? -27.399 -21.909 -3.878  1.00 55.14  ? 1042 SER A H     1 
ATOM   2356 H  HA    . SER A 1 172 ? -29.282 -21.824 -5.630  1.00 55.40  ? 1042 SER A HA    1 
ATOM   2357 H  HB2   . SER A 1 172 ? -27.817 -20.010 -5.179  1.00 49.37  ? 1042 SER A HB2   1 
ATOM   2358 H  HB3   . SER A 1 172 ? -26.660 -20.776 -5.952  1.00 49.37  ? 1042 SER A HB3   1 
ATOM   2359 H  HG    . SER A 1 172 ? -28.618 -20.556 -7.469  1.00 64.39  ? 1042 SER A HG    1 
ATOM   2360 N  N     . PHE A 1 173 ? -26.668 -23.338 -6.700  1.00 30.48  ? 1043 PHE A N     1 
ATOM   2361 C  CA    . PHE A 1 173 ? -26.066 -24.239 -7.679  1.00 33.69  ? 1043 PHE A CA    1 
ATOM   2362 C  C     . PHE A 1 173 ? -26.764 -25.609 -7.625  1.00 53.70  ? 1043 PHE A C     1 
ATOM   2363 O  O     . PHE A 1 173 ? -26.554 -26.450 -8.498  1.00 43.51  ? 1043 PHE A O     1 
ATOM   2364 C  CB    . PHE A 1 173 ? -24.568 -24.350 -7.354  1.00 37.88  ? 1043 PHE A CB    1 
ATOM   2365 C  CG    . PHE A 1 173 ? -23.787 -25.278 -8.245  1.00 64.04  ? 1043 PHE A CG    1 
ATOM   2366 C  CD1   . PHE A 1 173 ? -22.736 -24.786 -9.009  1.00 77.42  ? 1043 PHE A CD1   1 
ATOM   2367 C  CD2   . PHE A 1 173 ? -24.053 -26.636 -8.280  1.00 75.55  ? 1043 PHE A CD2   1 
ATOM   2368 C  CE1   . PHE A 1 173 ? -21.990 -25.626 -9.818  1.00 82.44  ? 1043 PHE A CE1   1 
ATOM   2369 C  CE2   . PHE A 1 173 ? -23.314 -27.483 -9.092  1.00 85.23  ? 1043 PHE A CE2   1 
ATOM   2370 C  CZ    . PHE A 1 173 ? -22.278 -26.976 -9.857  1.00 86.40  ? 1043 PHE A CZ    1 
ATOM   2371 H  H     . PHE A 1 173 ? -26.109 -23.082 -6.099  1.00 36.57  ? 1043 PHE A H     1 
ATOM   2372 H  HA    . PHE A 1 173 ? -26.168 -23.867 -8.580  1.00 40.43  ? 1043 PHE A HA    1 
ATOM   2373 H  HB2   . PHE A 1 173 ? -24.171 -23.468 -7.431  1.00 45.46  ? 1043 PHE A HB2   1 
ATOM   2374 H  HB3   . PHE A 1 173 ? -24.473 -24.670 -6.444  1.00 45.46  ? 1043 PHE A HB3   1 
ATOM   2375 H  HD1   . PHE A 1 173 ? -22.539 -23.878 -8.987  1.00 92.90  ? 1043 PHE A HD1   1 
ATOM   2376 H  HD2   . PHE A 1 173 ? -24.749 -26.981 -7.769  1.00 90.66  ? 1043 PHE A HD2   1 
ATOM   2377 H  HE1   . PHE A 1 173 ? -21.296 -25.282 -10.333 1.00 98.93  ? 1043 PHE A HE1   1 
ATOM   2378 H  HE2   . PHE A 1 173 ? -23.509 -28.392 -9.115  1.00 102.28 ? 1043 PHE A HE2   1 
ATOM   2379 H  HZ    . PHE A 1 173 ? -21.780 -27.543 -10.401 1.00 103.68 ? 1043 PHE A HZ    1 
ATOM   2380 N  N     . GLN A 1 174 ? -27.624 -25.817 -6.625  1.00 59.78  ? 1044 GLN A N     1 
ATOM   2381 C  CA    . GLN A 1 174 ? -28.359 -27.087 -6.486  1.00 67.45  ? 1044 GLN A CA    1 
ATOM   2382 C  C     . GLN A 1 174 ? -29.810 -26.946 -6.961  1.00 76.01  ? 1044 GLN A C     1 
ATOM   2383 O  O     . GLN A 1 174 ? -30.306 -27.761 -7.735  1.00 85.85  ? 1044 GLN A O     1 
ATOM   2384 C  CB    . GLN A 1 174 ? -28.329 -27.604 -5.037  1.00 78.76  ? 1044 GLN A CB    1 
ATOM   2385 C  CG    . GLN A 1 174 ? -27.182 -28.580 -4.704  1.00 87.06  ? 1044 GLN A CG    1 
ATOM   2386 C  CD    . GLN A 1 174 ? -25.822 -28.073 -5.167  1.00 91.52  ? 1044 GLN A CD    1 
ATOM   2387 O  OE1   . GLN A 1 174 ? -25.725 -27.024 -5.792  1.00 105.28 ? 1044 GLN A OE1   1 
ATOM   2388 N  NE2   . GLN A 1 174 ? -24.764 -28.813 -4.856  1.00 78.50  ? 1044 GLN A NE2   1 
ATOM   2389 H  H     . GLN A 1 174 ? -27.803 -25.241 -6.012  1.00 71.73  ? 1044 GLN A H     1 
ATOM   2390 H  HA    . GLN A 1 174 ? -27.926 -27.762 -7.050  1.00 80.94  ? 1044 GLN A HA    1 
ATOM   2391 H  HB2   . GLN A 1 174 ? -28.245 -26.842 -4.441  1.00 94.51  ? 1044 GLN A HB2   1 
ATOM   2392 H  HB3   . GLN A 1 174 ? -29.164 -28.064 -4.858  1.00 94.51  ? 1044 GLN A HB3   1 
ATOM   2393 H  HG2   . GLN A 1 174 ? -27.143 -28.707 -3.744  1.00 104.47 ? 1044 GLN A HG2   1 
ATOM   2394 H  HG3   . GLN A 1 174 ? -27.351 -29.428 -5.145  1.00 104.47 ? 1044 GLN A HG3   1 
ATOM   2395 H  HE21  . GLN A 1 174 ? -24.865 -29.543 -4.413  1.00 94.19  ? 1044 GLN A HE21  1 
ATOM   2396 H  HE22  . GLN A 1 174 ? -23.978 -28.562 -5.099  1.00 94.19  ? 1044 GLN A HE22  1 
ATOM   2397 N  N     . GLU A 1 175 ? -30.472 -25.896 -6.490  1.00 79.20  ? 1045 GLU A N     1 
ATOM   2398 C  CA    . GLU A 1 175 ? -31.823 -25.528 -6.918  1.00 99.83  ? 1045 GLU A CA    1 
ATOM   2399 C  C     . GLU A 1 175 ? -32.004 -25.482 -8.444  1.00 110.36 ? 1045 GLU A C     1 
ATOM   2400 O  O     . GLU A 1 175 ? -32.971 -26.030 -8.979  1.00 109.50 ? 1045 GLU A O     1 
ATOM   2401 C  CB    . GLU A 1 175 ? -32.165 -24.163 -6.316  1.00 107.57 ? 1045 GLU A CB    1 
ATOM   2402 C  CG    . GLU A 1 175 ? -33.452 -23.527 -6.813  1.00 114.54 ? 1045 GLU A CG    1 
ATOM   2403 C  CD    . GLU A 1 175 ? -33.606 -22.105 -6.312  1.00 118.46 ? 1045 GLU A CD    1 
ATOM   2404 O  OE1   . GLU A 1 175 ? -32.589 -21.382 -6.249  1.00 115.50 ? 1045 GLU A OE1   1 
ATOM   2405 O  OE2   . GLU A 1 175 ? -34.739 -21.711 -5.974  1.00 121.45 ? 1045 GLU A OE2   1 
ATOM   2406 H  H     . GLU A 1 175 ? -30.150 -25.360 -5.900  1.00 95.04  ? 1045 GLU A H     1 
ATOM   2407 H  HA    . GLU A 1 175 ? -32.458 -26.184 -6.560  1.00 119.80 ? 1045 GLU A HA    1 
ATOM   2408 H  HB2   . GLU A 1 175 ? -32.244 -24.264 -5.355  1.00 129.09 ? 1045 GLU A HB2   1 
ATOM   2409 H  HB3   . GLU A 1 175 ? -31.442 -23.550 -6.519  1.00 129.09 ? 1045 GLU A HB3   1 
ATOM   2410 H  HG2   . GLU A 1 175 ? -33.445 -23.508 -7.782  1.00 137.45 ? 1045 GLU A HG2   1 
ATOM   2411 H  HG3   . GLU A 1 175 ? -34.207 -24.044 -6.493  1.00 137.45 ? 1045 GLU A HG3   1 
ATOM   2412 N  N     . SER A 1 176 ? -31.078 -24.826 -9.141  1.00 115.12 ? 1046 SER A N     1 
ATOM   2413 C  CA    . SER A 1 176 ? -31.156 -24.684 -10.595 1.00 112.07 ? 1046 SER A CA    1 
ATOM   2414 C  C     . SER A 1 176 ? -31.213 -26.061 -11.263 1.00 114.84 ? 1046 SER A C     1 
ATOM   2415 O  O     . SER A 1 176 ? -31.898 -26.264 -12.269 1.00 126.27 ? 1046 SER A O     1 
ATOM   2416 C  CB    . SER A 1 176 ? -29.926 -23.936 -11.120 1.00 96.38  ? 1046 SER A CB    1 
ATOM   2417 O  OG    . SER A 1 176 ? -28.804 -24.804 -11.158 1.00 87.47  ? 1046 SER A OG    1 
ATOM   2418 H  H     . SER A 1 176 ? -30.388 -24.449 -8.791  1.00 138.14 ? 1046 SER A H     1 
ATOM   2419 H  HA    . SER A 1 176 ? -31.961 -24.180 -10.838 1.00 134.49 ? 1046 SER A HA    1 
ATOM   2420 H  HB2   . SER A 1 176 ? -30.108 -23.613 -12.016 1.00 115.66 ? 1046 SER A HB2   1 
ATOM   2421 H  HB3   . SER A 1 176 ? -29.731 -23.191 -10.530 1.00 115.66 ? 1046 SER A HB3   1 
ATOM   2422 H  HG    . SER A 1 176 ? -28.148 -24.401 -11.439 1.00 104.97 ? 1046 SER A HG    1 
ATOM   2423 N  N     . LEU A 1 177 ? -30.513 -27.003 -10.641 1.00 82.25  ? 1047 LEU A N     1 
ATOM   2424 C  CA    . LEU A 1 177 ? -30.155 -28.297 -11.213 1.00 76.18  ? 1047 LEU A CA    1 
ATOM   2425 C  C     . LEU A 1 177 ? -30.964 -29.388 -10.519 1.00 88.55  ? 1047 LEU A C     1 
ATOM   2426 O  O     . LEU A 1 177 ? -31.588 -30.230 -11.166 1.00 87.69  ? 1047 LEU A O     1 
ATOM   2427 C  CB    . LEU A 1 177 ? -28.644 -28.511 -11.010 1.00 59.55  ? 1047 LEU A CB    1 
ATOM   2428 C  CG    . LEU A 1 177 ? -27.957 -29.884 -10.984 1.00 60.23  ? 1047 LEU A CG    1 
ATOM   2429 C  CD1   . LEU A 1 177 ? -26.557 -29.652 -10.410 1.00 52.45  ? 1047 LEU A CD1   1 
ATOM   2430 C  CD2   . LEU A 1 177 ? -28.702 -30.953 -10.174 1.00 64.38  ? 1047 LEU A CD2   1 
ATOM   2431 H  H     . LEU A 1 177 ? -30.217 -26.908 -9.839  1.00 98.71  ? 1047 LEU A H     1 
ATOM   2432 H  HA    . LEU A 1 177 ? -30.356 -28.309 -12.173 1.00 91.41  ? 1047 LEU A HA    1 
ATOM   2433 H  HB2   . LEU A 1 177 ? -28.200 -28.014 -11.715 1.00 71.46  ? 1047 LEU A HB2   1 
ATOM   2434 H  HB3   . LEU A 1 177 ? -28.419 -28.094 -10.164 1.00 71.46  ? 1047 LEU A HB3   1 
ATOM   2435 H  HG    . LEU A 1 177 ? -27.860 -30.208 -11.893 1.00 72.27  ? 1047 LEU A HG    1 
ATOM   2436 H  HD11  . LEU A 1 177 ? -26.639 -29.286 -9.527  1.00 62.94  ? 1047 LEU A HD11  1 
ATOM   2437 H  HD12  . LEU A 1 177 ? -26.090 -30.490 -10.376 1.00 62.94  ? 1047 LEU A HD12  1 
ATOM   2438 H  HD13  . LEU A 1 177 ? -26.086 -29.037 -10.978 1.00 62.94  ? 1047 LEU A HD13  1 
ATOM   2439 H  HD21  . LEU A 1 177 ? -29.575 -31.079 -10.553 1.00 77.25  ? 1047 LEU A HD21  1 
ATOM   2440 H  HD22  . LEU A 1 177 ? -28.207 -31.774 -10.210 1.00 77.25  ? 1047 LEU A HD22  1 
ATOM   2441 H  HD23  . LEU A 1 177 ? -28.780 -30.657 -9.264  1.00 77.25  ? 1047 LEU A HD23  1 
ATOM   2442 N  N     . PRO A 1 208 ? -41.682 -9.959  -13.688 1.00 82.66  ? 1078 PRO A N     1 
ATOM   2443 C  CA    . PRO A 1 208 ? -41.533 -11.406 -13.860 1.00 83.85  ? 1078 PRO A CA    1 
ATOM   2444 C  C     . PRO A 1 208 ? -40.109 -11.868 -13.568 1.00 79.84  ? 1078 PRO A C     1 
ATOM   2445 O  O     . PRO A 1 208 ? -39.709 -12.945 -14.020 1.00 85.39  ? 1078 PRO A O     1 
ATOM   2446 C  CB    . PRO A 1 208 ? -41.850 -11.611 -15.344 1.00 81.45  ? 1078 PRO A CB    1 
ATOM   2447 C  CG    . PRO A 1 208 ? -41.437 -10.340 -15.992 1.00 73.87  ? 1078 PRO A CG    1 
ATOM   2448 C  CD    . PRO A 1 208 ? -41.661 -9.245  -14.977 1.00 72.12  ? 1078 PRO A CD    1 
ATOM   2449 H  HA    . PRO A 1 208 ? -42.173 -11.899 -13.305 1.00 100.62 ? 1078 PRO A HA    1 
ATOM   2450 H  HB2   . PRO A 1 208 ? -41.336 -12.357 -15.690 1.00 97.74  ? 1078 PRO A HB2   1 
ATOM   2451 H  HB3   . PRO A 1 208 ? -42.801 -11.763 -15.459 1.00 97.74  ? 1078 PRO A HB3   1 
ATOM   2452 H  HG2   . PRO A 1 208 ? -40.499 -10.391 -16.233 1.00 88.65  ? 1078 PRO A HG2   1 
ATOM   2453 H  HG3   . PRO A 1 208 ? -41.982 -10.188 -16.780 1.00 88.65  ? 1078 PRO A HG3   1 
ATOM   2454 H  HD2   . PRO A 1 208 ? -40.928 -8.610  -14.999 1.00 86.54  ? 1078 PRO A HD2   1 
ATOM   2455 H  HD3   . PRO A 1 208 ? -42.513 -8.808  -15.135 1.00 86.54  ? 1078 PRO A HD3   1 
ATOM   2456 N  N     . PHE A 1 209 ? -39.348 -11.062 -12.832 1.00 62.65  ? 1079 PHE A N     1 
ATOM   2457 C  CA    . PHE A 1 209 ? -37.948 -11.395 -12.599 1.00 50.42  ? 1079 PHE A CA    1 
ATOM   2458 C  C     . PHE A 1 209 ? -37.653 -11.906 -11.193 1.00 44.04  ? 1079 PHE A C     1 
ATOM   2459 O  O     . PHE A 1 209 ? -38.211 -11.452 -10.192 1.00 41.34  ? 1079 PHE A O     1 
ATOM   2460 C  CB    . PHE A 1 209 ? -37.016 -10.220 -12.909 1.00 49.21  ? 1079 PHE A CB    1 
ATOM   2461 C  CG    . PHE A 1 209 ? -37.195 -9.646  -14.280 1.00 38.15  ? 1079 PHE A CG    1 
ATOM   2462 C  CD1   . PHE A 1 209 ? -36.909 -10.400 -15.407 1.00 41.51  ? 1079 PHE A CD1   1 
ATOM   2463 C  CD2   . PHE A 1 209 ? -37.637 -8.347  -14.440 1.00 45.44  ? 1079 PHE A CD2   1 
ATOM   2464 C  CE1   . PHE A 1 209 ? -37.072 -9.866  -16.672 1.00 48.69  ? 1079 PHE A CE1   1 
ATOM   2465 C  CE2   . PHE A 1 209 ? -37.803 -7.808  -15.697 1.00 42.68  ? 1079 PHE A CE2   1 
ATOM   2466 C  CZ    . PHE A 1 209 ? -37.516 -8.568  -16.817 1.00 45.71  ? 1079 PHE A CZ    1 
ATOM   2467 H  H     . PHE A 1 209 ? -39.612 -10.331 -12.463 1.00 75.17  ? 1079 PHE A H     1 
ATOM   2468 H  HA    . PHE A 1 209 ? -37.708 -12.117 -13.217 1.00 60.50  ? 1079 PHE A HA    1 
ATOM   2469 H  HB2   . PHE A 1 209 ? -37.184 -9.512  -12.268 1.00 59.05  ? 1079 PHE A HB2   1 
ATOM   2470 H  HB3   . PHE A 1 209 ? -36.098 -10.522 -12.832 1.00 59.05  ? 1079 PHE A HB3   1 
ATOM   2471 H  HD1   . PHE A 1 209 ? -36.609 -11.275 -15.312 1.00 49.81  ? 1079 PHE A HD1   1 
ATOM   2472 H  HD2   . PHE A 1 209 ? -37.831 -7.832  -13.691 1.00 54.53  ? 1079 PHE A HD2   1 
ATOM   2473 H  HE1   . PHE A 1 209 ? -36.879 -10.380 -17.423 1.00 58.43  ? 1079 PHE A HE1   1 
ATOM   2474 H  HE2   . PHE A 1 209 ? -38.103 -6.933  -15.793 1.00 51.22  ? 1079 PHE A HE2   1 
ATOM   2475 H  HZ    . PHE A 1 209 ? -37.627 -8.206  -17.666 1.00 54.85  ? 1079 PHE A HZ    1 
ATOM   2476 N  N     . LYS A 1 210 ? -36.741 -12.863 -11.156 1.00 44.47  ? 1080 LYS A N     1 
ATOM   2477 C  CA    . LYS A 1 210 ? -36.251 -13.433 -9.924  1.00 42.38  ? 1080 LYS A CA    1 
ATOM   2478 C  C     . LYS A 1 210 ? -35.249 -12.459 -9.311  1.00 39.15  ? 1080 LYS A C     1 
ATOM   2479 O  O     . LYS A 1 210 ? -34.659 -11.658 -10.023 1.00 39.96  ? 1080 LYS A O     1 
ATOM   2480 C  CB    . LYS A 1 210 ? -35.573 -14.751 -10.255 1.00 43.32  ? 1080 LYS A CB    1 
ATOM   2481 C  CG    . LYS A 1 210 ? -34.938 -15.444 -9.087  1.00 64.88  ? 1080 LYS A CG    1 
ATOM   2482 C  CD    . LYS A 1 210 ? -34.367 -16.777 -9.522  1.00 73.23  ? 1080 LYS A CD    1 
ATOM   2483 C  CE    . LYS A 1 210 ? -33.843 -17.541 -8.332  1.00 75.45  ? 1080 LYS A CE    1 
ATOM   2484 N  NZ    . LYS A 1 210 ? -34.979 -18.167 -7.608  1.00 75.44  ? 1080 LYS A NZ    1 
ATOM   2485 H  H     . LYS A 1 210 ? -36.381 -13.206 -11.858 1.00 53.36  ? 1080 LYS A H     1 
ATOM   2486 H  HA    . LYS A 1 210 ? -36.988 -13.588 -9.297  1.00 50.86  ? 1080 LYS A HA    1 
ATOM   2487 H  HB2   . LYS A 1 210 ? -36.235 -15.354 -10.628 1.00 51.98  ? 1080 LYS A HB2   1 
ATOM   2488 H  HB3   . LYS A 1 210 ? -34.878 -14.585 -10.910 1.00 51.98  ? 1080 LYS A HB3   1 
ATOM   2489 H  HG2   . LYS A 1 210 ? -34.216 -14.898 -8.739  1.00 77.86  ? 1080 LYS A HG2   1 
ATOM   2490 H  HG3   . LYS A 1 210 ? -35.605 -15.603 -8.401  1.00 77.86  ? 1080 LYS A HG3   1 
ATOM   2491 H  HD2   . LYS A 1 210 ? -35.064 -17.305 -9.943  1.00 87.87  ? 1080 LYS A HD2   1 
ATOM   2492 H  HD3   . LYS A 1 210 ? -33.634 -16.629 -10.139 1.00 87.87  ? 1080 LYS A HD3   1 
ATOM   2493 H  HE2   . LYS A 1 210 ? -33.243 -18.242 -8.632  1.00 90.54  ? 1080 LYS A HE2   1 
ATOM   2494 H  HE3   . LYS A 1 210 ? -33.387 -16.934 -7.729  1.00 90.54  ? 1080 LYS A HE3   1 
ATOM   2495 H  HZ1   . LYS A 1 210 ? -34.678 -18.620 -6.904  1.00 90.52  ? 1080 LYS A HZ1   1 
ATOM   2496 H  HZ2   . LYS A 1 210 ? -35.544 -17.538 -7.328  1.00 90.52  ? 1080 LYS A HZ2   1 
ATOM   2497 H  HZ3   . LYS A 1 210 ? -35.413 -18.726 -8.148  1.00 90.52  ? 1080 LYS A HZ3   1 
ATOM   2498 N  N     . THR A 1 211 ? -35.071 -12.499 -7.996  1.00 31.53  ? 1081 THR A N     1 
ATOM   2499 C  CA    . THR A 1 211 ? -34.014 -11.712 -7.368  1.00 37.59  ? 1081 THR A CA    1 
ATOM   2500 C  C     . THR A 1 211 ? -32.809 -12.606 -7.109  1.00 34.86  ? 1081 THR A C     1 
ATOM   2501 O  O     . THR A 1 211 ? -32.963 -13.769 -6.747  1.00 26.41  ? 1081 THR A O     1 
ATOM   2502 C  CB    . THR A 1 211 ? -34.455 -11.111 -6.028  1.00 45.39  ? 1081 THR A CB    1 
ATOM   2503 O  OG1   . THR A 1 211 ? -34.769 -12.167 -5.121  1.00 52.21  ? 1081 THR A OG1   1 
ATOM   2504 C  CG2   . THR A 1 211 ? -35.664 -10.228 -6.205  1.00 58.04  ? 1081 THR A CG2   1 
ATOM   2505 H  H     . THR A 1 211 ? -35.541 -12.967 -7.449  1.00 37.84  ? 1081 THR A H     1 
ATOM   2506 H  HA    . THR A 1 211 ? -33.744 -10.985 -7.966  1.00 45.11  ? 1081 THR A HA    1 
ATOM   2507 H  HB    . THR A 1 211 ? -33.735 -10.574 -5.662  1.00 54.47  ? 1081 THR A HB    1 
ATOM   2508 H  HG1   . THR A 1 211 ? -34.109 -12.640 -5.002  1.00 62.65  ? 1081 THR A HG1   1 
ATOM   2509 H  HG21  . THR A 1 211 ? -36.393 -10.740 -6.564  1.00 69.65  ? 1081 THR A HG21  1 
ATOM   2510 H  HG22  . THR A 1 211 ? -35.928 -9.860  -5.359  1.00 69.65  ? 1081 THR A HG22  1 
ATOM   2511 H  HG23  . THR A 1 211 ? -35.460 -9.510  -6.809  1.00 69.65  ? 1081 THR A HG23  1 
ATOM   2512 N  N     . ILE A 1 212 ? -31.612 -12.059 -7.298  1.00 26.35  ? 1082 ILE A N     1 
ATOM   2513 C  CA    . ILE A 1 212 ? -30.382 -12.786 -7.017  1.00 24.45  ? 1082 ILE A CA    1 
ATOM   2514 C  C     . ILE A 1 212 ? -29.492 -11.919 -6.146  1.00 27.13  ? 1082 ILE A C     1 
ATOM   2515 O  O     . ILE A 1 212 ? -29.690 -10.713 -6.068  1.00 24.39  ? 1082 ILE A O     1 
ATOM   2516 C  CB    . ILE A 1 212 ? -29.627 -13.117 -8.306  1.00 23.14  ? 1082 ILE A CB    1 
ATOM   2517 C  CG1   . ILE A 1 212 ? -29.469 -11.847 -9.147  1.00 23.34  ? 1082 ILE A CG1   1 
ATOM   2518 C  CG2   . ILE A 1 212 ? -30.367 -14.210 -9.088  1.00 24.55  ? 1082 ILE A CG2   1 
ATOM   2519 C  CD1   . ILE A 1 212 ? -28.476 -11.973 -10.272 1.00 34.93  ? 1082 ILE A CD1   1 
ATOM   2520 H  H     . ILE A 1 212 ? -31.486 -11.261 -7.591  1.00 31.62  ? 1082 ILE A H     1 
ATOM   2521 H  HA    . ILE A 1 212 ? -30.584 -13.618 -6.540  1.00 29.34  ? 1082 ILE A HA    1 
ATOM   2522 H  HB    . ILE A 1 212 ? -28.745 -13.446 -8.073  1.00 27.77  ? 1082 ILE A HB    1 
ATOM   2523 H  HG12  . ILE A 1 212 ? -30.329 -11.622 -9.535  1.00 28.00  ? 1082 ILE A HG12  1 
ATOM   2524 H  HG13  . ILE A 1 212 ? -29.172 -11.127 -8.569  1.00 28.00  ? 1082 ILE A HG13  1 
ATOM   2525 H  HG21  . ILE A 1 212 ? -31.247 -13.896 -9.307  1.00 29.46  ? 1082 ILE A HG21  1 
ATOM   2526 H  HG22  . ILE A 1 212 ? -29.879 -14.403 -9.892  1.00 29.46  ? 1082 ILE A HG22  1 
ATOM   2527 H  HG23  . ILE A 1 212 ? -30.426 -14.998 -8.543  1.00 29.46  ? 1082 ILE A HG23  1 
ATOM   2528 H  HD11  . ILE A 1 212 ? -28.761 -12.675 -10.863 1.00 41.91  ? 1082 ILE A HD11  1 
ATOM   2529 H  HD12  . ILE A 1 212 ? -28.436 -11.141 -10.748 1.00 41.91  ? 1082 ILE A HD12  1 
ATOM   2530 H  HD13  . ILE A 1 212 ? -27.614 -12.184 -9.905  1.00 41.91  ? 1082 ILE A HD13  1 
ATOM   2531 N  N     . LYS A 1 213 ? -28.517 -12.535 -5.494  1.00 21.13  ? 1083 LYS A N     1 
ATOM   2532 C  CA    . LYS A 1 213 ? -27.592 -11.803 -4.641  1.00 20.99  ? 1083 LYS A CA    1 
ATOM   2533 C  C     . LYS A 1 213 ? -26.152 -12.054 -5.081  1.00 25.04  ? 1083 LYS A C     1 
ATOM   2534 O  O     . LYS A 1 213 ? -25.798 -13.175 -5.459  1.00 23.76  ? 1083 LYS A O     1 
ATOM   2535 C  CB    . LYS A 1 213 ? -27.778 -12.212 -3.193  1.00 23.84  ? 1083 LYS A CB    1 
ATOM   2536 C  CG    . LYS A 1 213 ? -29.177 -11.912 -2.681  1.00 29.47  ? 1083 LYS A CG    1 
ATOM   2537 C  CD    . LYS A 1 213 ? -29.337 -12.220 -1.208  1.00 36.88  ? 1083 LYS A CD    1 
ATOM   2538 C  CE    . LYS A 1 213 ? -29.634 -13.695 -0.969  1.00 54.96  ? 1083 LYS A CE    1 
ATOM   2539 N  NZ    . LYS A 1 213 ? -30.499 -13.925 0.236   1.00 63.29  ? 1083 LYS A NZ    1 
ATOM   2540 H  H     . LYS A 1 213 ? -28.368 -13.381 -5.529  1.00 25.36  ? 1083 LYS A H     1 
ATOM   2541 H  HA    . LYS A 1 213 ? -27.774 -10.842 -4.715  1.00 25.19  ? 1083 LYS A HA    1 
ATOM   2542 H  HB2   . LYS A 1 213 ? -27.626 -13.167 -3.111  1.00 28.61  ? 1083 LYS A HB2   1 
ATOM   2543 H  HB3   . LYS A 1 213 ? -27.145 -11.726 -2.641  1.00 28.61  ? 1083 LYS A HB3   1 
ATOM   2544 H  HG2   . LYS A 1 213 ? -29.367 -10.970 -2.813  1.00 35.37  ? 1083 LYS A HG2   1 
ATOM   2545 H  HG3   . LYS A 1 213 ? -29.817 -12.451 -3.172  1.00 35.37  ? 1083 LYS A HG3   1 
ATOM   2546 H  HD2   . LYS A 1 213 ? -28.514 -11.998 -0.744  1.00 44.26  ? 1083 LYS A HD2   1 
ATOM   2547 H  HD3   . LYS A 1 213 ? -30.074 -11.701 -0.851  1.00 44.26  ? 1083 LYS A HD3   1 
ATOM   2548 H  HE2   . LYS A 1 213 ? -30.096 -14.053 -1.742  1.00 65.95  ? 1083 LYS A HE2   1 
ATOM   2549 H  HE3   . LYS A 1 213 ? -28.798 -14.168 -0.832  1.00 65.95  ? 1083 LYS A HE3   1 
ATOM   2550 H  HZ1   . LYS A 1 213 ? -30.096 -13.611 0.964   1.00 75.95  ? 1083 LYS A HZ1   1 
ATOM   2551 H  HZ2   . LYS A 1 213 ? -31.279 -13.507 0.135   1.00 75.95  ? 1083 LYS A HZ2   1 
ATOM   2552 H  HZ3   . LYS A 1 213 ? -30.649 -14.796 0.341   1.00 75.95  ? 1083 LYS A HZ3   1 
ATOM   2553 N  N     . PHE A 1 214 ? -25.331 -11.008 -4.974  1.00 24.78  ? 1084 PHE A N     1 
ATOM   2554 C  CA    . PHE A 1 214 ? -23.997 -10.960 -5.571  1.00 19.86  ? 1084 PHE A CA    1 
ATOM   2555 C  C     . PHE A 1 214 ? -23.043 -10.495 -4.466  1.00 22.57  ? 1084 PHE A C     1 
ATOM   2556 O  O     . PHE A 1 214 ? -23.204 -9.395  -3.934  1.00 22.33  ? 1084 PHE A O     1 
ATOM   2557 C  CB    . PHE A 1 214 ? -24.068 -9.982  -6.763  1.00 17.87  ? 1084 PHE A CB    1 
ATOM   2558 C  CG    . PHE A 1 214 ? -22.730 -9.631  -7.432  1.00 19.08  ? 1084 PHE A CG    1 
ATOM   2559 C  CD1   . PHE A 1 214 ? -21.575 -10.372 -7.227  1.00 19.57  ? 1084 PHE A CD1   1 
ATOM   2560 C  CD2   . PHE A 1 214 ? -22.657 -8.532  -8.297  1.00 18.05  ? 1084 PHE A CD2   1 
ATOM   2561 C  CE1   . PHE A 1 214 ? -20.378 -10.016 -7.871  1.00 18.16  ? 1084 PHE A CE1   1 
ATOM   2562 C  CE2   . PHE A 1 214 ? -21.469 -8.193  -8.927  1.00 21.00  ? 1084 PHE A CE2   1 
ATOM   2563 C  CZ    . PHE A 1 214 ? -20.340 -8.928  -8.717  1.00 20.01  ? 1084 PHE A CZ    1 
ATOM   2564 H  H     . PHE A 1 214 ? -25.533 -10.291 -4.546  1.00 29.73  ? 1084 PHE A H     1 
ATOM   2565 H  HA    . PHE A 1 214 ? -23.728 -11.848 -5.887  1.00 23.84  ? 1084 PHE A HA    1 
ATOM   2566 H  HB2   . PHE A 1 214 ? -24.637 -10.374 -7.445  1.00 21.44  ? 1084 PHE A HB2   1 
ATOM   2567 H  HB3   . PHE A 1 214 ? -24.462 -9.152  -6.454  1.00 21.44  ? 1084 PHE A HB3   1 
ATOM   2568 H  HD1   . PHE A 1 214 ? -21.594 -11.109 -6.660  1.00 23.49  ? 1084 PHE A HD1   1 
ATOM   2569 H  HD2   . PHE A 1 214 ? -23.419 -8.023  -8.454  1.00 21.66  ? 1084 PHE A HD2   1 
ATOM   2570 H  HE1   . PHE A 1 214 ? -19.608 -10.517 -7.727  1.00 21.80  ? 1084 PHE A HE1   1 
ATOM   2571 H  HE2   . PHE A 1 214 ? -21.442 -7.458  -9.497  1.00 25.20  ? 1084 PHE A HE2   1 
ATOM   2572 H  HZ    . PHE A 1 214 ? -19.546 -8.693  -9.139  1.00 24.01  ? 1084 PHE A HZ    1 
ATOM   2573 N  N     . GLY A 1 215 ? -22.095 -11.344 -4.070  1.00 18.28  ? 1085 GLY A N     1 
ATOM   2574 C  CA    . GLY A 1 215 ? -21.069 -10.937 -3.120  1.00 19.43  ? 1085 GLY A CA    1 
ATOM   2575 C  C     . GLY A 1 215 ? -19.974 -10.177 -3.844  1.00 21.23  ? 1085 GLY A C     1 
ATOM   2576 O  O     . GLY A 1 215 ? -19.322 -10.735 -4.727  1.00 19.85  ? 1085 GLY A O     1 
ATOM   2577 H  H     . GLY A 1 215 ? -22.026 -12.159 -4.337  1.00 21.93  ? 1085 GLY A H     1 
ATOM   2578 H  HA2   . GLY A 1 215 ? -21.455 -10.364 -2.439  1.00 23.31  ? 1085 GLY A HA2   1 
ATOM   2579 H  HA3   . GLY A 1 215 ? -20.683 -11.718 -2.694  1.00 23.31  ? 1085 GLY A HA3   1 
ATOM   2580 N  N     . THR A 1 216 ? -19.761 -8.912  -3.486  1.00 19.69  ? 1086 THR A N     1 
ATOM   2581 C  CA    . THR A 1 216 ? -18.927 -8.032  -4.306  1.00 16.91  ? 1086 THR A CA    1 
ATOM   2582 C  C     . THR A 1 216 ? -17.876 -7.245  -3.505  1.00 17.71  ? 1086 THR A C     1 
ATOM   2583 O  O     . THR A 1 216 ? -18.096 -6.903  -2.351  1.00 22.20  ? 1086 THR A O     1 
ATOM   2584 C  CB    . THR A 1 216 ? -19.822 -7.057  -5.124  1.00 18.93  ? 1086 THR A CB    1 
ATOM   2585 O  OG1   . THR A 1 216 ? -19.030 -6.312  -6.061  1.00 22.67  ? 1086 THR A OG1   1 
ATOM   2586 C  CG2   . THR A 1 216 ? -20.576 -6.094  -4.222  1.00 19.76  ? 1086 THR A CG2   1 
ATOM   2587 H  H     . THR A 1 216 ? -20.083 -8.541  -2.780  1.00 23.62  ? 1086 THR A H     1 
ATOM   2588 H  HA    . THR A 1 216 ? -18.440 -8.588  -4.951  1.00 20.30  ? 1086 THR A HA    1 
ATOM   2589 H  HB    . THR A 1 216 ? -20.479 -7.575  -5.616  1.00 22.72  ? 1086 THR A HB    1 
ATOM   2590 H  HG1   . THR A 1 216 ? -19.508 -5.801  -6.488  1.00 27.20  ? 1086 THR A HG1   1 
ATOM   2591 H  HG21  . THR A 1 216 ? -21.119 -5.505  -4.752  1.00 23.71  ? 1086 THR A HG21  1 
ATOM   2592 H  HG22  . THR A 1 216 ? -21.142 -6.583  -3.620  1.00 23.71  ? 1086 THR A HG22  1 
ATOM   2593 H  HG23  . THR A 1 216 ? -19.955 -5.569  -3.711  1.00 23.71  ? 1086 THR A HG23  1 
ATOM   2594 N  N     . ASN A 1 217 ? -16.735 -6.968  -4.134  1.00 20.05  ? 1087 ASN A N     1 
ATOM   2595 C  CA    . ASN A 1 217 ? -15.665 -6.183  -3.513  1.00 20.09  ? 1087 ASN A CA    1 
ATOM   2596 C  C     . ASN A 1 217 ? -15.311 -6.701  -2.116  1.00 22.70  ? 1087 ASN A C     1 
ATOM   2597 O  O     . ASN A 1 217 ? -15.187 -5.937  -1.158  1.00 21.41  ? 1087 ASN A O     1 
ATOM   2598 C  CB    . ASN A 1 217 ? -16.067 -4.704  -3.461  1.00 20.72  ? 1087 ASN A CB    1 
ATOM   2599 C  CG    . ASN A 1 217 ? -16.583 -4.201  -4.805  1.00 21.06  ? 1087 ASN A CG    1 
ATOM   2600 O  OD1   . ASN A 1 217 ? -17.791 -4.148  -5.045  1.00 20.85  ? 1087 ASN A OD1   1 
ATOM   2601 N  ND2   . ASN A 1 217 ? -15.667 -3.865  -5.701  1.00 21.44  ? 1087 ASN A ND2   1 
ATOM   2602 H  H     . ASN A 1 217 ? -16.552 -7.227  -4.933  1.00 24.06  ? 1087 ASN A H     1 
ATOM   2603 H  HA    . ASN A 1 217 ? -14.861 -6.254  -4.069  1.00 24.11  ? 1087 ASN A HA    1 
ATOM   2604 H  HB2   . ASN A 1 217 ? -16.772 -4.588  -2.804  1.00 24.86  ? 1087 ASN A HB2   1 
ATOM   2605 H  HB3   . ASN A 1 217 ? -15.293 -4.172  -3.216  1.00 24.86  ? 1087 ASN A HB3   1 
ATOM   2606 H  HD21  . ASN A 1 217 ? -15.908 -3.576  -6.475  1.00 25.72  ? 1087 ASN A HD21  1 
ATOM   2607 H  HD22  . ASN A 1 217 ? -14.832 -3.936  -5.510  1.00 25.72  ? 1087 ASN A HD22  1 
ATOM   2608 N  N     . ILE A 1 218 ? -15.142 -8.013  -2.016  1.00 16.68  ? 1088 ILE A N     1 
ATOM   2609 C  CA    . ILE A 1 218 ? -14.776 -8.646  -0.757  1.00 17.38  ? 1088 ILE A CA    1 
ATOM   2610 C  C     . ILE A 1 218 ? -13.274 -8.474  -0.570  1.00 19.04  ? 1088 ILE A C     1 
ATOM   2611 O  O     . ILE A 1 218 ? -12.482 -8.849  -1.428  1.00 18.35  ? 1088 ILE A O     1 
ATOM   2612 C  CB    . ILE A 1 218 ? -15.150 -10.134 -0.763  1.00 15.83  ? 1088 ILE A CB    1 
ATOM   2613 C  CG1   . ILE A 1 218 ? -16.650 -10.287 -1.051  1.00 21.97  ? 1088 ILE A CG1   1 
ATOM   2614 C  CG2   . ILE A 1 218 ? -14.797 -10.759 0.579   1.00 17.04  ? 1088 ILE A CG2   1 
ATOM   2615 C  CD1   . ILE A 1 218 ? -17.091 -11.692 -1.540  1.00 20.74  ? 1088 ILE A CD1   1 
ATOM   2616 H  H     . ILE A 1 218 ? -15.234 -8.565  -2.669  1.00 20.02  ? 1088 ILE A H     1 
ATOM   2617 H  HA    . ILE A 1 218 ? -15.240 -8.205  -0.016  1.00 20.85  ? 1088 ILE A HA    1 
ATOM   2618 H  HB    . ILE A 1 218 ? -14.647 -10.583 -1.461  1.00 18.99  ? 1088 ILE A HB    1 
ATOM   2619 H  HG12  . ILE A 1 218 ? -17.140 -10.095 -0.236  1.00 26.37  ? 1088 ILE A HG12  1 
ATOM   2620 H  HG13  . ILE A 1 218 ? -16.898 -9.648  -1.737  1.00 26.37  ? 1088 ILE A HG13  1 
ATOM   2621 H  HG21  . ILE A 1 218 ? -15.035 -11.689 0.563   1.00 20.44  ? 1088 ILE A HG21  1 
ATOM   2622 H  HG22  . ILE A 1 218 ? -13.853 -10.665 0.729   1.00 20.44  ? 1088 ILE A HG22  1 
ATOM   2623 H  HG23  . ILE A 1 218 ? -15.285 -10.307 1.272   1.00 20.44  ? 1088 ILE A HG23  1 
ATOM   2624 H  HD11  . ILE A 1 218 ? -16.630 -11.897 -2.357  1.00 24.89  ? 1088 ILE A HD11  1 
ATOM   2625 H  HD12  . ILE A 1 218 ? -16.870 -12.340 -0.867  1.00 24.89  ? 1088 ILE A HD12  1 
ATOM   2626 H  HD13  . ILE A 1 218 ? -18.039 -11.686 -1.691  1.00 24.89  ? 1088 ILE A HD13  1 
ATOM   2627 N  N     . ASP A 1 219 ? -12.871 -7.887  0.550   1.00 20.98  ? 1089 ASP A N     1 
ATOM   2628 C  CA    . ASP A 1 219 ? -11.488 -7.462  0.690   1.00 20.36  ? 1089 ASP A CA    1 
ATOM   2629 C  C     . ASP A 1 219 ? -10.565 -8.556  1.227   1.00 22.53  ? 1089 ASP A C     1 
ATOM   2630 O  O     . ASP A 1 219 ? -10.647 -8.956  2.384   1.00 25.09  ? 1089 ASP A O     1 
ATOM   2631 C  CB    . ASP A 1 219 ? -11.425 -6.183  1.546   1.00 21.85  ? 1089 ASP A CB    1 
ATOM   2632 C  CG    . ASP A 1 219 ? -11.966 -4.958  0.789   1.00 29.17  ? 1089 ASP A CG    1 
ATOM   2633 O  OD1   . ASP A 1 219 ? -11.420 -4.636  -0.289  1.00 23.65  ? 1089 ASP A OD1   1 
ATOM   2634 O  OD2   . ASP A 1 219 ? -12.952 -4.336  1.245   1.00 26.51  ? 1089 ASP A OD2   1 
ATOM   2635 H  H     . ASP A 1 219 ? -13.370 -7.726  1.232   1.00 25.18  ? 1089 ASP A H     1 
ATOM   2636 H  HA    . ASP A 1 219 ? -11.156 -7.224  -0.201  1.00 24.43  ? 1089 ASP A HA    1 
ATOM   2637 H  HB2   . ASP A 1 219 ? -11.962 -6.307  2.344   1.00 26.22  ? 1089 ASP A HB2   1 
ATOM   2638 H  HB3   . ASP A 1 219 ? -10.502 -6.007  1.787   1.00 26.22  ? 1089 ASP A HB3   1 
ATOM   2639 N  N     . LEU A 1 220 ? -9.677  -9.026  0.358   1.00 18.82  ? 1090 LEU A N     1 
ATOM   2640 C  CA    . LEU A 1 220 ? -8.647  -9.991  0.727   1.00 20.94  ? 1090 LEU A CA    1 
ATOM   2641 C  C     . LEU A 1 220 ? -7.333  -9.262  1.026   1.00 23.96  ? 1090 LEU A C     1 
ATOM   2642 O  O     . LEU A 1 220 ? -6.259  -9.677  0.590   1.00 25.38  ? 1090 LEU A O     1 
ATOM   2643 C  CB    . LEU A 1 220 ? -8.441  -10.992 -0.416  1.00 23.58  ? 1090 LEU A CB    1 
ATOM   2644 C  CG    . LEU A 1 220 ? -9.203  -12.320 -0.357  1.00 34.73  ? 1090 LEU A CG    1 
ATOM   2645 C  CD1   . LEU A 1 220 ? -10.634 -12.164 0.146   1.00 26.85  ? 1090 LEU A CD1   1 
ATOM   2646 C  CD2   . LEU A 1 220 ? -9.165  -13.013 -1.724  1.00 25.39  ? 1090 LEU A CD2   1 
ATOM   2647 H  H     . LEU A 1 220 ? -9.651  -8.796  -0.470  1.00 22.59  ? 1090 LEU A H     1 
ATOM   2648 H  HA    . LEU A 1 220 ? -8.925  -10.481 1.529   1.00 25.13  ? 1090 LEU A HA    1 
ATOM   2649 H  HB2   . LEU A 1 220 ? -8.698  -10.556 -1.243  1.00 28.30  ? 1090 LEU A HB2   1 
ATOM   2650 H  HB3   . LEU A 1 220 ? -7.497  -11.211 -0.453  1.00 28.30  ? 1090 LEU A HB3   1 
ATOM   2651 H  HG    . LEU A 1 220 ? -8.745  -12.901 0.269   1.00 41.67  ? 1090 LEU A HG    1 
ATOM   2652 H  HD11  . LEU A 1 220 ? -11.056 -13.027 0.159   1.00 32.23  ? 1090 LEU A HD11  1 
ATOM   2653 H  HD12  . LEU A 1 220 ? -10.615 -11.795 1.032   1.00 32.23  ? 1090 LEU A HD12  1 
ATOM   2654 H  HD13  . LEU A 1 220 ? -11.110 -11.576 -0.445  1.00 32.23  ? 1090 LEU A HD13  1 
ATOM   2655 H  HD21  . LEU A 1 220 ? -9.574  -12.439 -2.376  1.00 30.47  ? 1090 LEU A HD21  1 
ATOM   2656 H  HD22  . LEU A 1 220 ? -8.251  -13.181 -1.963  1.00 30.47  ? 1090 LEU A HD22  1 
ATOM   2657 H  HD23  . LEU A 1 220 ? -9.647  -13.841 -1.668  1.00 30.47  ? 1090 LEU A HD23  1 
ATOM   2658 N  N     . SER A 1 221 ? -7.419  -8.169  1.772   1.00 21.58  ? 1091 SER A N     1 
ATOM   2659 C  CA    . SER A 1 221 ? -6.254  -7.320  2.018   1.00 20.74  ? 1091 SER A CA    1 
ATOM   2660 C  C     . SER A 1 221 ? -5.364  -7.783  3.183   1.00 26.20  ? 1091 SER A C     1 
ATOM   2661 O  O     . SER A 1 221 ? -4.191  -7.420  3.253   1.00 28.14  ? 1091 SER A O     1 
ATOM   2662 C  CB    . SER A 1 221 ? -6.719  -5.892  2.302   1.00 27.17  ? 1091 SER A CB    1 
ATOM   2663 O  OG    . SER A 1 221 ? -7.598  -5.871  3.414   1.00 25.85  ? 1091 SER A OG    1 
ATOM   2664 H  H     . SER A 1 221 ? -8.141  -7.894  2.151   1.00 25.89  ? 1091 SER A H     1 
ATOM   2665 H  HA    . SER A 1 221 ? -5.702  -7.301  1.208   1.00 24.88  ? 1091 SER A HA    1 
ATOM   2666 H  HB2   . SER A 1 221 ? -5.945  -5.340  2.499   1.00 32.60  ? 1091 SER A HB2   1 
ATOM   2667 H  HB3   . SER A 1 221 ? -7.184  -5.548  1.523   1.00 32.60  ? 1091 SER A HB3   1 
ATOM   2668 H  HG    . SER A 1 221 ? -7.844  -5.103  3.562   1.00 31.01  ? 1091 SER A HG    1 
ATOM   2669 N  N     . ASP A 1 222 ? -5.916  -8.571  4.099   1.00 23.07  ? 1092 ASP A N     1 
ATOM   2670 C  CA    . ASP A 1 222 ? -5.191  -8.938  5.324   1.00 25.71  ? 1092 ASP A CA    1 
ATOM   2671 C  C     . ASP A 1 222 ? -4.292  -10.147 5.087   1.00 32.86  ? 1092 ASP A C     1 
ATOM   2672 O  O     . ASP A 1 222 ? -4.777  -11.266 4.940   1.00 29.32  ? 1092 ASP A O     1 
ATOM   2673 C  CB    . ASP A 1 222 ? -6.180  -9.244  6.452   1.00 31.14  ? 1092 ASP A CB    1 
ATOM   2674 C  CG    . ASP A 1 222 ? -5.502  -9.383  7.814   1.00 41.76  ? 1092 ASP A CG    1 
ATOM   2675 O  OD1   . ASP A 1 222 ? -4.321  -9.787  7.869   1.00 37.58  ? 1092 ASP A OD1   1 
ATOM   2676 O  OD2   . ASP A 1 222 ? -6.162  -9.092  8.830   1.00 37.59  ? 1092 ASP A OD2   1 
ATOM   2677 H  H     . ASP A 1 222 ? -6.706  -8.908  4.042   1.00 27.69  ? 1092 ASP A H     1 
ATOM   2678 H  HA    . ASP A 1 222 ? -4.627  -8.187  5.604   1.00 30.85  ? 1092 ASP A HA    1 
ATOM   2679 H  HB2   . ASP A 1 222 ? -6.825  -8.522  6.511   1.00 37.37  ? 1092 ASP A HB2   1 
ATOM   2680 H  HB3   . ASP A 1 222 ? -6.634  -10.079 6.257   1.00 37.37  ? 1092 ASP A HB3   1 
ATOM   2681 N  N     . ASP A 1 223 ? -2.983  -9.923  5.057   1.00 34.09  ? 1093 ASP A N     1 
ATOM   2682 C  CA    . ASP A 1 223 ? -2.042  -10.998 4.749   1.00 34.95  ? 1093 ASP A CA    1 
ATOM   2683 C  C     . ASP A 1 223 ? -2.013  -12.091 5.824   1.00 35.67  ? 1093 ASP A C     1 
ATOM   2684 O  O     . ASP A 1 223 ? -1.610  -13.218 5.558   1.00 42.03  ? 1093 ASP A O     1 
ATOM   2685 C  CB    . ASP A 1 223 ? -0.632  -10.451 4.544   1.00 47.70  ? 1093 ASP A CB    1 
ATOM   2686 C  CG    . ASP A 1 223 ? 0.355   -11.544 4.179   1.00 71.01  ? 1093 ASP A CG    1 
ATOM   2687 O  OD1   . ASP A 1 223 ? 0.216   -12.119 3.077   1.00 70.53  ? 1093 ASP A OD1   1 
ATOM   2688 O  OD2   . ASP A 1 223 ? 1.257   -11.838 4.993   1.00 74.24  ? 1093 ASP A OD2   1 
ATOM   2689 H  H     . ASP A 1 223 ? -2.613  -9.162  5.211   1.00 40.91  ? 1093 ASP A H     1 
ATOM   2690 H  HA    . ASP A 1 223 ? -2.319  -11.420 3.909   1.00 41.94  ? 1093 ASP A HA    1 
ATOM   2691 H  HB2   . ASP A 1 223 ? -0.644  -9.802  3.823   1.00 57.24  ? 1093 ASP A HB2   1 
ATOM   2692 H  HB3   . ASP A 1 223 ? -0.329  -10.034 5.365   1.00 57.24  ? 1093 ASP A HB3   1 
ATOM   2693 N  N     . LYS A 1 224 ? -2.425  -11.753 7.038   1.00 30.91  ? 1094 LYS A N     1 
ATOM   2694 C  CA    . LYS A 1 224 ? -2.543  -12.760 8.083   1.00 46.52  ? 1094 LYS A CA    1 
ATOM   2695 C  C     . LYS A 1 224 ? -3.691  -13.717 7.766   1.00 48.25  ? 1094 LYS A C     1 
ATOM   2696 O  O     . LYS A 1 224 ? -3.563  -14.921 7.950   1.00 55.88  ? 1094 LYS A O     1 
ATOM   2697 C  CB    . LYS A 1 224 ? -2.739  -12.097 9.450   1.00 47.88  ? 1094 LYS A CB    1 
ATOM   2698 C  CG    . LYS A 1 224 ? -1.584  -11.177 9.843   1.00 64.94  ? 1094 LYS A CG    1 
ATOM   2699 C  CD    . LYS A 1 224 ? -1.842  -10.433 11.153  1.00 84.47  ? 1094 LYS A CD    1 
ATOM   2700 C  CE    . LYS A 1 224 ? -2.823  -9.280  10.982  1.00 87.82  ? 1094 LYS A CE    1 
ATOM   2701 N  NZ    . LYS A 1 224 ? -2.473  -8.362  9.859   1.00 79.83  ? 1094 LYS A NZ    1 
ATOM   2702 H  H     . LYS A 1 224 ? -2.641  -10.957 7.282   1.00 37.09  ? 1094 LYS A H     1 
ATOM   2703 H  HA    . LYS A 1 224 ? -1.715  -13.282 8.116   1.00 55.82  ? 1094 LYS A HA    1 
ATOM   2704 H  HB2   . LYS A 1 224 ? -3.550  -11.566 9.429   1.00 57.45  ? 1094 LYS A HB2   1 
ATOM   2705 H  HB3   . LYS A 1 224 ? -2.813  -12.788 10.127  1.00 57.45  ? 1094 LYS A HB3   1 
ATOM   2706 H  HG2   . LYS A 1 224 ? -0.779  -11.708 9.953   1.00 77.93  ? 1094 LYS A HG2   1 
ATOM   2707 H  HG3   . LYS A 1 224 ? -1.453  -10.517 9.144   1.00 77.93  ? 1094 LYS A HG3   1 
ATOM   2708 H  HD2   . LYS A 1 224 ? -2.214  -11.051 11.801  1.00 101.36 ? 1094 LYS A HD2   1 
ATOM   2709 H  HD3   . LYS A 1 224 ? -1.005  -10.070 11.482  1.00 101.36 ? 1094 LYS A HD3   1 
ATOM   2710 H  HE2   . LYS A 1 224 ? -3.705  -9.642  10.806  1.00 105.38 ? 1094 LYS A HE2   1 
ATOM   2711 H  HE3   . LYS A 1 224 ? -2.839  -8.757  11.799  1.00 105.38 ? 1094 LYS A HE3   1 
ATOM   2712 H  HZ1   . LYS A 1 224 ? -2.461  -8.812  9.091   1.00 95.79  ? 1094 LYS A HZ1   1 
ATOM   2713 H  HZ2   . LYS A 1 224 ? -3.075  -7.709  9.801   1.00 95.79  ? 1094 LYS A HZ2   1 
ATOM   2714 H  HZ3   . LYS A 1 224 ? -1.670  -8.004  9.997   1.00 95.79  ? 1094 LYS A HZ3   1 
ATOM   2715 N  N     . LYS A 1 225 ? -4.801  -13.183 7.265   1.00 28.69  ? 1095 LYS A N     1 
ATOM   2716 C  CA    . LYS A 1 225 ? -6.003  -13.984 7.052   1.00 28.98  ? 1095 LYS A CA    1 
ATOM   2717 C  C     . LYS A 1 225 ? -5.964  -14.760 5.746   1.00 30.28  ? 1095 LYS A C     1 
ATOM   2718 O  O     . LYS A 1 225 ? -6.627  -15.783 5.610   1.00 27.01  ? 1095 LYS A O     1 
ATOM   2719 C  CB    . LYS A 1 225 ? -7.252  -13.094 7.066   1.00 34.35  ? 1095 LYS A CB    1 
ATOM   2720 C  CG    . LYS A 1 225 ? -7.661  -12.601 8.448   1.00 34.70  ? 1095 LYS A CG    1 
ATOM   2721 C  CD    . LYS A 1 225 ? -8.719  -11.496 8.382   1.00 32.78  ? 1095 LYS A CD    1 
ATOM   2722 C  CE    . LYS A 1 225 ? -9.154  -11.059 9.790   1.00 39.58  ? 1095 LYS A CE    1 
ATOM   2723 N  NZ    . LYS A 1 225 ? -10.164 -9.955  9.767   1.00 37.84  ? 1095 LYS A NZ    1 
ATOM   2724 H  H     . LYS A 1 225 ? -4.884  -12.357 7.040   1.00 34.43  ? 1095 LYS A H     1 
ATOM   2725 H  HA    . LYS A 1 225 ? -6.086  -14.631 7.784   1.00 34.78  ? 1095 LYS A HA    1 
ATOM   2726 H  HB2   . LYS A 1 225 ? -7.084  -12.315 6.514   1.00 41.22  ? 1095 LYS A HB2   1 
ATOM   2727 H  HB3   . LYS A 1 225 ? -7.996  -13.598 6.702   1.00 41.22  ? 1095 LYS A HB3   1 
ATOM   2728 H  HG2   . LYS A 1 225 ? -8.030  -13.342 8.953   1.00 41.64  ? 1095 LYS A HG2   1 
ATOM   2729 H  HG3   . LYS A 1 225 ? -6.881  -12.245 8.902   1.00 41.64  ? 1095 LYS A HG3   1 
ATOM   2730 H  HD2   . LYS A 1 225 ? -8.349  -10.725 7.924   1.00 39.34  ? 1095 LYS A HD2   1 
ATOM   2731 H  HD3   . LYS A 1 225 ? -9.499  -11.826 7.909   1.00 39.34  ? 1095 LYS A HD3   1 
ATOM   2732 H  HE2   . LYS A 1 225 ? -9.550  -11.818 10.248  1.00 47.50  ? 1095 LYS A HE2   1 
ATOM   2733 H  HE3   . LYS A 1 225 ? -8.377  -10.745 10.278  1.00 47.50  ? 1095 LYS A HE3   1 
ATOM   2734 H  HZ1   . LYS A 1 225 ? -9.825  -9.242  9.358   1.00 45.41  ? 1095 LYS A HZ1   1 
ATOM   2735 H  HZ2   . LYS A 1 225 ? -10.893 -10.220 9.330   1.00 45.41  ? 1095 LYS A HZ2   1 
ATOM   2736 H  HZ3   . LYS A 1 225 ? -10.390 -9.732  10.599  1.00 45.41  ? 1095 LYS A HZ3   1 
ATOM   2737 N  N     . TRP A 1 226 ? -5.193  -14.273 4.780   1.00 25.61  ? 1096 TRP A N     1 
ATOM   2738 C  CA    . TRP A 1 226 ? -5.228  -14.845 3.439   1.00 25.65  ? 1096 TRP A CA    1 
ATOM   2739 C  C     . TRP A 1 226 ? -3.828  -15.160 2.938   1.00 28.41  ? 1096 TRP A C     1 
ATOM   2740 O  O     . TRP A 1 226 ? -3.542  -15.016 1.758   1.00 22.94  ? 1096 TRP A O     1 
ATOM   2741 C  CB    . TRP A 1 226 ? -5.905  -13.865 2.485   1.00 26.47  ? 1096 TRP A CB    1 
ATOM   2742 C  CG    . TRP A 1 226 ? -7.254  -13.405 2.963   1.00 25.48  ? 1096 TRP A CG    1 
ATOM   2743 C  CD1   . TRP A 1 226 ? -7.577  -12.170 3.460   1.00 24.04  ? 1096 TRP A CD1   1 
ATOM   2744 C  CD2   . TRP A 1 226 ? -8.458  -14.179 2.999   1.00 21.55  ? 1096 TRP A CD2   1 
ATOM   2745 N  NE1   . TRP A 1 226 ? -8.914  -12.127 3.794   1.00 24.41  ? 1096 TRP A NE1   1 
ATOM   2746 C  CE2   . TRP A 1 226 ? -9.476  -13.348 3.523   1.00 23.84  ? 1096 TRP A CE2   1 
ATOM   2747 C  CE3   . TRP A 1 226 ? -8.779  -15.491 2.629   1.00 23.89  ? 1096 TRP A CE3   1 
ATOM   2748 C  CZ2   . TRP A 1 226 ? -10.787 -13.784 3.678   1.00 23.11  ? 1096 TRP A CZ2   1 
ATOM   2749 C  CZ3   . TRP A 1 226 ? -10.082 -15.927 2.795   1.00 24.81  ? 1096 TRP A CZ3   1 
ATOM   2750 C  CH2   . TRP A 1 226 ? -11.071 -15.076 3.313   1.00 27.12  ? 1096 TRP A CH2   1 
ATOM   2751 H  H     . TRP A 1 226 ? -4.645  -13.617 4.874   1.00 30.74  ? 1096 TRP A H     1 
ATOM   2752 H  HA    . TRP A 1 226 ? -5.747  -15.676 3.451   1.00 30.79  ? 1096 TRP A HA    1 
ATOM   2753 H  HB2   . TRP A 1 226 ? -5.341  -13.082 2.387   1.00 31.77  ? 1096 TRP A HB2   1 
ATOM   2754 H  HB3   . TRP A 1 226 ? -6.025  -14.296 1.625   1.00 31.77  ? 1096 TRP A HB3   1 
ATOM   2755 H  HD1   . TRP A 1 226 ? -6.981  -11.462 3.556   1.00 28.85  ? 1096 TRP A HD1   1 
ATOM   2756 H  HE1   . TRP A 1 226 ? -9.326  -11.447 4.122   1.00 29.30  ? 1096 TRP A HE1   1 
ATOM   2757 H  HE3   . TRP A 1 226 ? -8.130  -16.058 2.281   1.00 28.67  ? 1096 TRP A HE3   1 
ATOM   2758 H  HZ2   . TRP A 1 226 ? -11.443 -13.226 4.028   1.00 27.73  ? 1096 TRP A HZ2   1 
ATOM   2759 H  HZ3   . TRP A 1 226 ? -10.308 -16.796 2.554   1.00 29.78  ? 1096 TRP A HZ3   1 
ATOM   2760 H  HH2   . TRP A 1 226 ? -11.938 -15.397 3.415   1.00 32.55  ? 1096 TRP A HH2   1 
ATOM   2761 N  N     . LYS A 1 227 ? -2.958  -15.601 3.840   1.00 29.04  ? 1097 LYS A N     1 
ATOM   2762 C  CA    . LYS A 1 227 ? -1.546  -15.760 3.511   1.00 29.94  ? 1097 LYS A CA    1 
ATOM   2763 C  C     . LYS A 1 227 ? -1.326  -16.605 2.261   1.00 25.99  ? 1097 LYS A C     1 
ATOM   2764 O  O     . LYS A 1 227 ? -0.547  -16.230 1.391   1.00 26.57  ? 1097 LYS A O     1 
ATOM   2765 C  CB    . LYS A 1 227 ? -0.780  -16.384 4.694   1.00 34.45  ? 1097 LYS A CB    1 
ATOM   2766 C  CG    . LYS A 1 227 ? 0.713   -16.560 4.432   1.00 58.65  ? 1097 LYS A CG    1 
ATOM   2767 C  CD    . LYS A 1 227 ? 1.448   -17.187 5.619   1.00 84.50  ? 1097 LYS A CD    1 
ATOM   2768 C  CE    . LYS A 1 227 ? 1.212   -18.691 5.712   1.00 104.41 ? 1097 LYS A CE    1 
ATOM   2769 N  NZ    . LYS A 1 227 ? 1.946   -19.301 6.861   1.00 111.02 ? 1097 LYS A NZ    1 
ATOM   2770 H  H     . LYS A 1 227 ? -3.159  -15.816 4.648   1.00 34.85  ? 1097 LYS A H     1 
ATOM   2771 H  HA    . LYS A 1 227 ? -1.163  -14.874 3.342   1.00 35.93  ? 1097 LYS A HA    1 
ATOM   2772 H  HB2   . LYS A 1 227 ? -0.880  -15.811 5.470   1.00 41.34  ? 1097 LYS A HB2   1 
ATOM   2773 H  HB3   . LYS A 1 227 ? -1.154  -17.260 4.882   1.00 41.34  ? 1097 LYS A HB3   1 
ATOM   2774 H  HG2   . LYS A 1 227 ? 0.834   -17.140 3.664   1.00 70.39  ? 1097 LYS A HG2   1 
ATOM   2775 H  HG3   . LYS A 1 227 ? 1.109   -15.692 4.258   1.00 70.39  ? 1097 LYS A HG3   1 
ATOM   2776 H  HD2   . LYS A 1 227 ? 2.401   -17.036 5.519   1.00 101.40 ? 1097 LYS A HD2   1 
ATOM   2777 H  HD3   . LYS A 1 227 ? 1.130   -16.780 6.440   1.00 101.40 ? 1097 LYS A HD3   1 
ATOM   2778 H  HE2   . LYS A 1 227 ? 0.265   -18.859 5.836   1.00 125.29 ? 1097 LYS A HE2   1 
ATOM   2779 H  HE3   . LYS A 1 227 ? 1.523   -19.114 4.896   1.00 125.29 ? 1097 LYS A HE3   1 
ATOM   2780 H  HZ1   . LYS A 1 227 ? 1.675   -18.933 7.624   1.00 133.23 ? 1097 LYS A HZ1   1 
ATOM   2781 H  HZ2   . LYS A 1 227 ? 1.791   -20.177 6.890   1.00 133.23 ? 1097 LYS A HZ2   1 
ATOM   2782 H  HZ3   . LYS A 1 227 ? 2.821   -19.166 6.769   1.00 133.23 ? 1097 LYS A HZ3   1 
ATOM   2783 N  N     . LEU A 1 228 ? -1.977  -17.762 2.185   1.00 26.07  ? 1098 LEU A N     1 
ATOM   2784 C  CA    . LEU A 1 228 ? -1.724  -18.686 1.089   1.00 30.38  ? 1098 LEU A CA    1 
ATOM   2785 C  C     . LEU A 1 228 ? -2.327  -18.155 -0.202  1.00 27.94  ? 1098 LEU A C     1 
ATOM   2786 O  O     . LEU A 1 228 ? -1.732  -18.290 -1.272  1.00 25.98  ? 1098 LEU A O     1 
ATOM   2787 C  CB    . LEU A 1 228 ? -2.301  -20.064 1.394   1.00 34.26  ? 1098 LEU A CB    1 
ATOM   2788 C  CG    . LEU A 1 228 ? -1.639  -20.778 2.573   1.00 50.84  ? 1098 LEU A CG    1 
ATOM   2789 C  CD1   . LEU A 1 228 ? -2.327  -22.107 2.838   1.00 49.94  ? 1098 LEU A CD1   1 
ATOM   2790 C  CD2   . LEU A 1 228 ? -0.153  -20.975 2.308   1.00 47.15  ? 1098 LEU A CD2   1 
ATOM   2791 H  H     . LEU A 1 228 ? -2.566  -18.032 2.751   1.00 31.29  ? 1098 LEU A H     1 
ATOM   2792 H  HA    . LEU A 1 228 ? -0.757  -18.779 0.961   1.00 36.46  ? 1098 LEU A HA    1 
ATOM   2793 H  HB2   . LEU A 1 228 ? -3.244  -19.968 1.599   1.00 41.11  ? 1098 LEU A HB2   1 
ATOM   2794 H  HB3   . LEU A 1 228 ? -2.193  -20.626 0.611   1.00 41.11  ? 1098 LEU A HB3   1 
ATOM   2795 H  HG    . LEU A 1 228 ? -1.732  -20.228 3.366   1.00 61.01  ? 1098 LEU A HG    1 
ATOM   2796 H  HD11  . LEU A 1 228 ? -2.257  -22.657 2.054   1.00 59.93  ? 1098 LEU A HD11  1 
ATOM   2797 H  HD12  . LEU A 1 228 ? -1.897  -22.538 3.581   1.00 59.93  ? 1098 LEU A HD12  1 
ATOM   2798 H  HD13  . LEU A 1 228 ? -3.251  -21.944 3.043   1.00 59.93  ? 1098 LEU A HD13  1 
ATOM   2799 H  HD21  . LEU A 1 228 ? 0.259   -20.117 2.187   1.00 56.58  ? 1098 LEU A HD21  1 
ATOM   2800 H  HD22  . LEU A 1 228 ? 0.241   -21.424 3.060   1.00 56.58  ? 1098 LEU A HD22  1 
ATOM   2801 H  HD23  . LEU A 1 228 ? -0.044  -21.506 1.516   1.00 56.58  ? 1098 LEU A HD23  1 
ATOM   2802 N  N     . GLN A 1 229 ? -3.509  -17.556 -0.100  1.00 25.71  ? 1099 GLN A N     1 
ATOM   2803 C  CA    . GLN A 1 229 ? -4.152  -16.957 -1.270  1.00 25.95  ? 1099 GLN A CA    1 
ATOM   2804 C  C     . GLN A 1 229 ? -3.230  -15.925 -1.910  1.00 25.46  ? 1099 GLN A C     1 
ATOM   2805 O  O     . GLN A 1 229 ? -3.011  -15.928 -3.128  1.00 25.38  ? 1099 GLN A O     1 
ATOM   2806 C  CB    . GLN A 1 229 ? -5.470  -16.294 -0.870  1.00 22.41  ? 1099 GLN A CB    1 
ATOM   2807 C  CG    . GLN A 1 229 ? -6.630  -17.265 -0.608  1.00 23.84  ? 1099 GLN A CG    1 
ATOM   2808 C  CD    . GLN A 1 229 ? -6.458  -18.120 0.650   1.00 29.35  ? 1099 GLN A CD    1 
ATOM   2809 O  OE1   . GLN A 1 229 ? -5.852  -17.701 1.641   1.00 23.19  ? 1099 GLN A OE1   1 
ATOM   2810 N  NE2   . GLN A 1 229 ? -7.008  -19.326 0.616   1.00 27.54  ? 1099 GLN A NE2   1 
ATOM   2811 H  H     . GLN A 1 229 ? -3.958  -17.481 0.629   1.00 30.86  ? 1099 GLN A H     1 
ATOM   2812 H  HA    . GLN A 1 229 ? -4.343  -17.655 -1.931  1.00 31.14  ? 1099 GLN A HA    1 
ATOM   2813 H  HB2   . GLN A 1 229 ? -5.326  -15.785 -0.057  1.00 26.90  ? 1099 GLN A HB2   1 
ATOM   2814 H  HB3   . GLN A 1 229 ? -5.744  -15.696 -1.583  1.00 26.90  ? 1099 GLN A HB3   1 
ATOM   2815 H  HG2   . GLN A 1 229 ? -7.448  -16.754 -0.509  1.00 28.61  ? 1099 GLN A HG2   1 
ATOM   2816 H  HG3   . GLN A 1 229 ? -6.709  -17.866 -1.365  1.00 28.61  ? 1099 GLN A HG3   1 
ATOM   2817 H  HE21  . GLN A 1 229 ? -6.942  -19.849 1.296   1.00 33.05  ? 1099 GLN A HE21  1 
ATOM   2818 H  HE22  . GLN A 1 229 ? -7.431  -19.586 -0.087  1.00 33.05  ? 1099 GLN A HE22  1 
ATOM   2819 N  N     . LEU A 1 230 ? -2.695  -15.028 -1.093  1.00 21.09  ? 1100 LEU A N     1 
ATOM   2820 C  CA    . LEU A 1 230 ? -1.932  -13.915 -1.626  1.00 25.45  ? 1100 LEU A CA    1 
ATOM   2821 C  C     . LEU A 1 230 ? -0.573  -14.386 -2.115  1.00 32.73  ? 1100 LEU A C     1 
ATOM   2822 O  O     . LEU A 1 230 ? -0.044  -13.838 -3.082  1.00 25.55  ? 1100 LEU A O     1 
ATOM   2823 C  CB    . LEU A 1 230 ? -1.788  -12.790 -0.593  1.00 29.00  ? 1100 LEU A CB    1 
ATOM   2824 C  CG    . LEU A 1 230 ? -3.120  -12.171 -0.145  1.00 27.98  ? 1100 LEU A CG    1 
ATOM   2825 C  CD1   . LEU A 1 230 ? -2.887  -11.078 0.877   1.00 29.95  ? 1100 LEU A CD1   1 
ATOM   2826 C  CD2   . LEU A 1 230 ? -3.896  -11.620 -1.333  1.00 25.15  ? 1100 LEU A CD2   1 
ATOM   2827 H  H     . LEU A 1 230 ? -2.759  -15.041 -0.236  1.00 25.31  ? 1100 LEU A H     1 
ATOM   2828 H  HA    . LEU A 1 230 ? -2.412  -13.548 -2.397  1.00 30.54  ? 1100 LEU A HA    1 
ATOM   2829 H  HB2   . LEU A 1 230 ? -1.348  -13.146 0.195   1.00 34.80  ? 1100 LEU A HB2   1 
ATOM   2830 H  HB3   . LEU A 1 230 ? -1.248  -12.082 -0.977  1.00 34.80  ? 1100 LEU A HB3   1 
ATOM   2831 H  HG    . LEU A 1 230 ? -3.662  -12.859 0.272   1.00 33.57  ? 1100 LEU A HG    1 
ATOM   2832 H  HD11  . LEU A 1 230 ? -3.734  -10.710 1.138   1.00 35.94  ? 1100 LEU A HD11  1 
ATOM   2833 H  HD12  . LEU A 1 230 ? -2.443  -11.455 1.640   1.00 35.94  ? 1100 LEU A HD12  1 
ATOM   2834 H  HD13  . LEU A 1 230 ? -2.339  -10.395 0.484   1.00 35.94  ? 1100 LEU A HD13  1 
ATOM   2835 H  HD21  . LEU A 1 230 ? -4.720  -11.242 -1.019  1.00 30.18  ? 1100 LEU A HD21  1 
ATOM   2836 H  HD22  . LEU A 1 230 ? -3.368  -10.944 -1.765  1.00 30.18  ? 1100 LEU A HD22  1 
ATOM   2837 H  HD23  . LEU A 1 230 ? -4.077  -12.336 -1.947  1.00 30.18  ? 1100 LEU A HD23  1 
ATOM   2838 N  N     . HIS A 1 231 ? -0.004  -15.400 -1.463  1.00 29.77  ? 1101 HIS A N     1 
ATOM   2839 C  CA    . HIS A 1 231 ? 1.290   -15.903 -1.904  1.00 32.64  ? 1101 HIS A CA    1 
ATOM   2840 C  C     . HIS A 1 231 ? 1.154   -16.515 -3.286  1.00 25.49  ? 1101 HIS A C     1 
ATOM   2841 O  O     . HIS A 1 231 ? 2.055   -16.406 -4.109  1.00 28.92  ? 1101 HIS A O     1 
ATOM   2842 C  CB    . HIS A 1 231 ? 1.893   -16.932 -0.941  1.00 37.19  ? 1101 HIS A CB    1 
ATOM   2843 C  CG    . HIS A 1 231 ? 3.170   -17.529 -1.448  1.00 45.61  ? 1101 HIS A CG    1 
ATOM   2844 N  ND1   . HIS A 1 231 ? 3.234   -18.793 -1.994  1.00 55.88  ? 1101 HIS A ND1   1 
ATOM   2845 C  CD2   . HIS A 1 231 ? 4.422   -17.020 -1.531  1.00 48.07  ? 1101 HIS A CD2   1 
ATOM   2846 C  CE1   . HIS A 1 231 ? 4.476   -19.045 -2.373  1.00 59.62  ? 1101 HIS A CE1   1 
ATOM   2847 N  NE2   . HIS A 1 231 ? 5.215   -17.984 -2.105  1.00 61.23  ? 1101 HIS A NE2   1 
ATOM   2848 H  H     . HIS A 1 231 ? -0.338  -15.803 -0.781  1.00 35.72  ? 1101 HIS A H     1 
ATOM   2849 H  HA    . HIS A 1 231 ? 1.915   -15.151 -1.968  1.00 39.16  ? 1101 HIS A HA    1 
ATOM   2850 H  HB2   . HIS A 1 231 ? 2.080   -16.499 -0.093  1.00 44.62  ? 1101 HIS A HB2   1 
ATOM   2851 H  HB3   . HIS A 1 231 ? 1.257   -17.653 -0.812  1.00 44.62  ? 1101 HIS A HB3   1 
ATOM   2852 H  HD1   . HIS A 1 231 ? 2.572   -19.337 -2.068  1.00 67.05  ? 1101 HIS A HD1   1 
ATOM   2853 H  HD2   . HIS A 1 231 ? 4.696   -16.178 -1.247  1.00 57.68  ? 1101 HIS A HD2   1 
ATOM   2854 H  HE1   . HIS A 1 231 ? 4.777   -19.834 -2.763  1.00 71.54  ? 1101 HIS A HE1   1 
ATOM   2855 H  HE2   . HIS A 1 231 ? 6.057   -17.910 -2.260  1.00 73.48  ? 1101 HIS A HE2   1 
ATOM   2856 N  N     . GLU A 1 232 ? 0.017   -17.147 -3.547  1.00 22.80  ? 1102 GLU A N     1 
ATOM   2857 C  CA    . GLU A 1 232 ? -0.187  -17.793 -4.833  1.00 25.61  ? 1102 GLU A CA    1 
ATOM   2858 C  C     . GLU A 1 232 ? -0.088  -16.751 -5.952  1.00 29.88  ? 1102 GLU A C     1 
ATOM   2859 O  O     . GLU A 1 232 ? 0.402   -17.036 -7.044  1.00 25.45  ? 1102 GLU A O     1 
ATOM   2860 C  CB    . GLU A 1 232 ? -1.543  -18.505 -4.859  1.00 24.60  ? 1102 GLU A CB    1 
ATOM   2861 C  CG    . GLU A 1 232 ? -1.726  -19.476 -6.018  1.00 30.61  ? 1102 GLU A CG    1 
ATOM   2862 C  CD    . GLU A 1 232 ? -0.796  -20.693 -5.960  1.00 33.54  ? 1102 GLU A CD    1 
ATOM   2863 O  OE1   . GLU A 1 232 ? -0.044  -20.857 -4.980  1.00 30.01  ? 1102 GLU A OE1   1 
ATOM   2864 O  OE2   . GLU A 1 232 ? -0.818  -21.489 -6.918  1.00 32.37  ? 1102 GLU A OE2   1 
ATOM   2865 H  H     . GLU A 1 232 ? -0.645  -17.214 -3.002  1.00 27.37  ? 1102 GLU A H     1 
ATOM   2866 H  HA    . GLU A 1 232 ? 0.514   -18.463 -4.973  1.00 30.73  ? 1102 GLU A HA    1 
ATOM   2867 H  HB2   . GLU A 1 232 ? -1.645  -19.007 -4.035  1.00 29.52  ? 1102 GLU A HB2   1 
ATOM   2868 H  HB3   . GLU A 1 232 ? -2.243  -17.836 -4.922  1.00 29.52  ? 1102 GLU A HB3   1 
ATOM   2869 H  HG2   . GLU A 1 232 ? -2.640  -19.801 -6.011  1.00 36.74  ? 1102 GLU A HG2   1 
ATOM   2870 H  HG3   . GLU A 1 232 ? -1.550  -19.008 -6.849  1.00 36.74  ? 1102 GLU A HG3   1 
ATOM   2871 N  N     . LEU A 1 233 ? -0.531  -15.533 -5.668  1.00 22.50  ? 1103 LEU A N     1 
ATOM   2872 C  CA    . LEU A 1 233 ? -0.576  -14.500 -6.698  1.00 24.40  ? 1103 LEU A CA    1 
ATOM   2873 C  C     . LEU A 1 233 ? 0.811   -13.929 -7.012  1.00 29.39  ? 1103 LEU A C     1 
ATOM   2874 O  O     . LEU A 1 233 ? 0.971   -13.178 -7.969  1.00 23.10  ? 1103 LEU A O     1 
ATOM   2875 C  CB    . LEU A 1 233 ? -1.549  -13.383 -6.291  1.00 27.66  ? 1103 LEU A CB    1 
ATOM   2876 C  CG    . LEU A 1 233 ? -2.987  -13.869 -6.059  1.00 23.99  ? 1103 LEU A CG    1 
ATOM   2877 C  CD1   . LEU A 1 233 ? -3.899  -12.707 -5.701  1.00 19.91  ? 1103 LEU A CD1   1 
ATOM   2878 C  CD2   . LEU A 1 233 ? -3.547  -14.616 -7.294  1.00 21.79  ? 1103 LEU A CD2   1 
ATOM   2879 H  H     . LEU A 1 233 ? -0.809  -15.279 -4.895  1.00 27.00  ? 1103 LEU A H     1 
ATOM   2880 H  HA    . LEU A 1 233 ? -0.920  -14.901 -7.523  1.00 29.28  ? 1103 LEU A HA    1 
ATOM   2881 H  HB2   . LEU A 1 233 ? -1.235  -12.980 -5.466  1.00 33.19  ? 1103 LEU A HB2   1 
ATOM   2882 H  HB3   . LEU A 1 233 ? -1.571  -12.716 -6.994  1.00 33.19  ? 1103 LEU A HB3   1 
ATOM   2883 H  HG    . LEU A 1 233 ? -2.991  -14.488 -5.312  1.00 28.79  ? 1103 LEU A HG    1 
ATOM   2884 H  HD11  . LEU A 1 233 ? -4.789  -13.040 -5.562  1.00 23.89  ? 1103 LEU A HD11  1 
ATOM   2885 H  HD12  . LEU A 1 233 ? -3.576  -12.292 -4.898  1.00 23.89  ? 1103 LEU A HD12  1 
ATOM   2886 H  HD13  . LEU A 1 233 ? -3.895  -12.073 -6.422  1.00 23.89  ? 1103 LEU A HD13  1 
ATOM   2887 H  HD21  . LEU A 1 233 ? -4.444  -14.901 -7.106  1.00 26.15  ? 1103 LEU A HD21  1 
ATOM   2888 H  HD22  . LEU A 1 233 ? -3.543  -14.021 -8.047  1.00 26.15  ? 1103 LEU A HD22  1 
ATOM   2889 H  HD23  . LEU A 1 233 ? -2.992  -15.378 -7.476  1.00 26.15  ? 1103 LEU A HD23  1 
ATOM   2890 N  N     . THR A 1 234 ? 1.818   -14.281 -6.218  1.00 23.08  ? 1104 THR A N     1 
ATOM   2891 C  CA    . THR A 1 234 ? 3.162   -13.802 -6.506  1.00 27.15  ? 1104 THR A CA    1 
ATOM   2892 C  C     . THR A 1 234 ? 3.790   -14.614 -7.642  1.00 26.39  ? 1104 THR A C     1 
ATOM   2893 O  O     . THR A 1 234 ? 4.850   -14.257 -8.144  1.00 29.63  ? 1104 THR A O     1 
ATOM   2894 C  CB    . THR A 1 234 ? 4.066   -13.816 -5.259  1.00 36.32  ? 1104 THR A CB    1 
ATOM   2895 O  OG1   . THR A 1 234 ? 4.299   -15.165 -4.846  1.00 35.79  ? 1104 THR A OG1   1 
ATOM   2896 C  CG2   . THR A 1 234 ? 3.415   -13.028 -4.123  1.00 42.79  ? 1104 THR A CG2   1 
ATOM   2897 H  H     . THR A 1 234 ? 1.752   -14.783 -5.523  1.00 27.70  ? 1104 THR A H     1 
ATOM   2898 H  HA    . THR A 1 234 ? 3.099   -12.873 -6.811  1.00 32.58  ? 1104 THR A HA    1 
ATOM   2899 H  HB    . THR A 1 234 ? 4.913   -13.396 -5.473  1.00 43.59  ? 1104 THR A HB    1 
ATOM   2900 H  HG1   . THR A 1 234 ? 4.667   -15.583 -5.447  1.00 42.95  ? 1104 THR A HG1   1 
ATOM   2901 H  HG21  . THR A 1 234 ? 3.276   -12.117 -4.393  1.00 51.34  ? 1104 THR A HG21  1 
ATOM   2902 H  HG22  . THR A 1 234 ? 2.568   -13.419 -3.895  1.00 51.34  ? 1104 THR A HG22  1 
ATOM   2903 H  HG23  . THR A 1 234 ? 3.982   -13.040 -3.348  1.00 51.34  ? 1104 THR A HG23  1 
ATOM   2904 N  N     . LYS A 1 235 ? 3.111   -15.685 -8.056  1.00 25.62  ? 1105 LYS A N     1 
ATOM   2905 C  CA    . LYS A 1 235 ? 3.531   -16.493 -9.207  1.00 26.34  ? 1105 LYS A CA    1 
ATOM   2906 C  C     . LYS A 1 235 ? 3.268   -15.777 -10.545 1.00 32.21  ? 1105 LYS A C     1 
ATOM   2907 O  O     . LYS A 1 235 ? 3.786   -16.171 -11.593 1.00 24.74  ? 1105 LYS A O     1 
ATOM   2908 C  CB    . LYS A 1 235 ? 2.780   -17.832 -9.213  1.00 24.51  ? 1105 LYS A CB    1 
ATOM   2909 C  CG    . LYS A 1 235 ? 3.127   -18.792 -8.066  1.00 34.65  ? 1105 LYS A CG    1 
ATOM   2910 C  CD    . LYS A 1 235 ? 2.271   -20.056 -8.163  1.00 40.33  ? 1105 LYS A CD    1 
ATOM   2911 C  CE    . LYS A 1 235 ? 2.680   -21.139 -7.165  1.00 53.19  ? 1105 LYS A CE    1 
ATOM   2912 N  NZ    . LYS A 1 235 ? 2.025   -22.446 -7.502  1.00 44.27  ? 1105 LYS A NZ    1 
ATOM   2913 H  H     . LYS A 1 235 ? 2.391   -15.970 -7.682  1.00 30.74  ? 1105 LYS A H     1 
ATOM   2914 H  HA    . LYS A 1 235 ? 4.491   -16.678 -9.140  1.00 31.61  ? 1105 LYS A HA    1 
ATOM   2915 H  HB2   . LYS A 1 235 ? 1.829   -17.650 -9.162  1.00 29.41  ? 1105 LYS A HB2   1 
ATOM   2916 H  HB3   . LYS A 1 235 ? 2.977   -18.290 -10.045 1.00 29.41  ? 1105 LYS A HB3   1 
ATOM   2917 H  HG2   . LYS A 1 235 ? 4.061   -19.047 -8.127  1.00 41.58  ? 1105 LYS A HG2   1 
ATOM   2918 H  HG3   . LYS A 1 235 ? 2.946   -18.361 -7.216  1.00 41.58  ? 1105 LYS A HG3   1 
ATOM   2919 H  HD2   . LYS A 1 235 ? 1.346   -19.823 -7.987  1.00 48.39  ? 1105 LYS A HD2   1 
ATOM   2920 H  HD3   . LYS A 1 235 ? 2.355   -20.425 -9.056  1.00 48.39  ? 1105 LYS A HD3   1 
ATOM   2921 H  HE2   . LYS A 1 235 ? 3.642   -21.261 -7.198  1.00 63.83  ? 1105 LYS A HE2   1 
ATOM   2922 H  HE3   . LYS A 1 235 ? 2.402   -20.877 -6.273  1.00 63.83  ? 1105 LYS A HE3   1 
ATOM   2923 H  HZ1   . LYS A 1 235 ? 2.270   -23.069 -6.915  1.00 53.12  ? 1105 LYS A HZ1   1 
ATOM   2924 H  HZ2   . LYS A 1 235 ? 1.139   -22.357 -7.477  1.00 53.12  ? 1105 LYS A HZ2   1 
ATOM   2925 H  HZ3   . LYS A 1 235 ? 2.266   -22.706 -8.318  1.00 53.12  ? 1105 LYS A HZ3   1 
ATOM   2926 N  N     . LEU A 1 236 ? 2.447   -14.737 -10.514 1.00 19.23  ? 1106 LEU A N     1 
ATOM   2927 C  CA    . LEU A 1 236 ? 2.094   -14.009 -11.733 1.00 20.56  ? 1106 LEU A CA    1 
ATOM   2928 C  C     . LEU A 1 236 ? 3.289   -13.218 -12.282 1.00 21.69  ? 1106 LEU A C     1 
ATOM   2929 O  O     . LEU A 1 236 ? 4.165   -12.798 -11.521 1.00 23.22  ? 1106 LEU A O     1 
ATOM   2930 C  CB    . LEU A 1 236 ? 0.941   -13.041 -11.435 1.00 21.41  ? 1106 LEU A CB    1 
ATOM   2931 C  CG    . LEU A 1 236 ? -0.416  -13.675 -11.097 1.00 20.72  ? 1106 LEU A CG    1 
ATOM   2932 C  CD1   . LEU A 1 236 ? -1.375  -12.605 -10.560 1.00 22.92  ? 1106 LEU A CD1   1 
ATOM   2933 C  CD2   . LEU A 1 236 ? -1.011  -14.385 -12.319 1.00 20.57  ? 1106 LEU A CD2   1 
ATOM   2934 H  H     . LEU A 1 236 ? 2.079   -14.429 -9.801  1.00 23.08  ? 1106 LEU A H     1 
ATOM   2935 H  HA    . LEU A 1 236 ? 1.798   -14.644 -12.419 1.00 24.68  ? 1106 LEU A HA    1 
ATOM   2936 H  HB2   . LEU A 1 236 ? 1.196   -12.489 -10.680 1.00 25.69  ? 1106 LEU A HB2   1 
ATOM   2937 H  HB3   . LEU A 1 236 ? 0.809   -12.478 -12.214 1.00 25.69  ? 1106 LEU A HB3   1 
ATOM   2938 H  HG    . LEU A 1 236 ? -0.288  -14.338 -10.400 1.00 24.86  ? 1106 LEU A HG    1 
ATOM   2939 H  HD11  . LEU A 1 236 ? -0.997  -12.217 -9.767  1.00 27.50  ? 1106 LEU A HD11  1 
ATOM   2940 H  HD12  . LEU A 1 236 ? -1.496  -11.930 -11.230 1.00 27.50  ? 1106 LEU A HD12  1 
ATOM   2941 H  HD13  . LEU A 1 236 ? -2.217  -13.017 -10.353 1.00 27.50  ? 1106 LEU A HD13  1 
ATOM   2942 H  HD21  . LEU A 1 236 ? -0.408  -15.074 -12.604 1.00 24.68  ? 1106 LEU A HD21  1 
ATOM   2943 H  HD22  . LEU A 1 236 ? -1.856  -14.769 -12.075 1.00 24.68  ? 1106 LEU A HD22  1 
ATOM   2944 H  HD23  . LEU A 1 236 ? -1.134  -13.744 -13.023 1.00 24.68  ? 1106 LEU A HD23  1 
ATOM   2945 N  N     . PRO A 1 237 ? 3.321   -12.997 -13.605 1.00 21.26  ? 1107 PRO A N     1 
ATOM   2946 C  CA    . PRO A 1 237 ? 4.324   -12.098 -14.196 1.00 24.14  ? 1107 PRO A CA    1 
ATOM   2947 C  C     . PRO A 1 237 ? 4.194   -10.686 -13.633 1.00 24.45  ? 1107 PRO A C     1 
ATOM   2948 O  O     . PRO A 1 237 ? 3.082   -10.271 -13.310 1.00 18.32  ? 1107 PRO A O     1 
ATOM   2949 C  CB    . PRO A 1 237 ? 3.973   -12.093 -15.689 1.00 25.26  ? 1107 PRO A CB    1 
ATOM   2950 C  CG    . PRO A 1 237 ? 3.029   -13.235 -15.896 1.00 29.60  ? 1107 PRO A CG    1 
ATOM   2951 C  CD    . PRO A 1 237 ? 2.349   -13.485 -14.599 1.00 21.67  ? 1107 PRO A CD    1 
ATOM   2952 H  HA    . PRO A 1 237 ? 5.233   -12.439 -14.061 1.00 28.97  ? 1107 PRO A HA    1 
ATOM   2953 H  HB2   . PRO A 1 237 ? 3.547   -11.252 -15.919 1.00 30.31  ? 1107 PRO A HB2   1 
ATOM   2954 H  HB3   . PRO A 1 237 ? 4.780   -12.219 -16.212 1.00 30.31  ? 1107 PRO A HB3   1 
ATOM   2955 H  HG2   . PRO A 1 237 ? 2.379   -12.995 -16.575 1.00 35.52  ? 1107 PRO A HG2   1 
ATOM   2956 H  HG3   . PRO A 1 237 ? 3.529   -14.019 -16.171 1.00 35.52  ? 1107 PRO A HG3   1 
ATOM   2957 H  HD2   . PRO A 1 237 ? 1.525   -12.976 -14.544 1.00 26.00  ? 1107 PRO A HD2   1 
ATOM   2958 H  HD3   . PRO A 1 237 ? 2.190   -14.434 -14.478 1.00 26.00  ? 1107 PRO A HD3   1 
ATOM   2959 N  N     . ALA A 1 238 ? 5.305   -9.964  -13.542 1.00 25.31  ? 1108 ALA A N     1 
ATOM   2960 C  CA    . ALA A 1 238 ? 5.350   -8.689  -12.831 1.00 22.46  ? 1108 ALA A CA    1 
ATOM   2961 C  C     . ALA A 1 238 ? 4.270   -7.707  -13.284 1.00 21.92  ? 1108 ALA A C     1 
ATOM   2962 O  O     . ALA A 1 238 ? 3.724   -6.962  -12.459 1.00 22.51  ? 1108 ALA A O     1 
ATOM   2963 C  CB    . ALA A 1 238 ? 6.733   -8.057  -12.992 1.00 23.92  ? 1108 ALA A CB    1 
ATOM   2964 H  H     . ALA A 1 238 ? 6.058   -10.194 -13.888 1.00 30.37  ? 1108 ALA A H     1 
ATOM   2965 H  HA    . ALA A 1 238 ? 5.212   -8.860  -11.876 1.00 26.95  ? 1108 ALA A HA    1 
ATOM   2966 H  HB1   . ALA A 1 238 ? 6.750   -7.221  -12.521 1.00 28.70  ? 1108 ALA A HB1   1 
ATOM   2967 H  HB2   . ALA A 1 238 ? 7.392   -8.652  -12.628 1.00 28.70  ? 1108 ALA A HB2   1 
ATOM   2968 H  HB3   . ALA A 1 238 ? 6.903   -7.911  -13.925 1.00 28.70  ? 1108 ALA A HB3   1 
ATOM   2969 N  N     . PHE A 1 239 ? 3.964   -7.685  -14.582 1.00 20.69  ? 1109 PHE A N     1 
ATOM   2970 C  CA    . PHE A 1 239 ? 3.100   -6.629  -15.113 1.00 19.89  ? 1109 PHE A CA    1 
ATOM   2971 C  C     . PHE A 1 239 ? 1.641   -6.778  -14.685 1.00 22.03  ? 1109 PHE A C     1 
ATOM   2972 O  O     . PHE A 1 239 ? 0.873   -5.832  -14.820 1.00 22.13  ? 1109 PHE A O     1 
ATOM   2973 C  CB    . PHE A 1 239 ? 3.217   -6.496  -16.645 1.00 24.68  ? 1109 PHE A CB    1 
ATOM   2974 C  CG    . PHE A 1 239 ? 2.346   -7.455  -17.433 1.00 21.98  ? 1109 PHE A CG    1 
ATOM   2975 C  CD1   . PHE A 1 239 ? 1.131   -7.034  -17.959 1.00 18.54  ? 1109 PHE A CD1   1 
ATOM   2976 C  CD2   . PHE A 1 239 ? 2.762   -8.753  -17.686 1.00 23.73  ? 1109 PHE A CD2   1 
ATOM   2977 C  CE1   . PHE A 1 239 ? 0.334   -7.901  -18.699 1.00 24.07  ? 1109 PHE A CE1   1 
ATOM   2978 C  CE2   . PHE A 1 239 ? 1.969   -9.626  -18.427 1.00 26.69  ? 1109 PHE A CE2   1 
ATOM   2979 C  CZ    . PHE A 1 239 ? 0.756   -9.195  -18.939 1.00 24.31  ? 1109 PHE A CZ    1 
ATOM   2980 H  H     . PHE A 1 239 ? 4.236   -8.256  -15.164 1.00 24.83  ? 1109 PHE A H     1 
ATOM   2981 H  HA    . PHE A 1 239 ? 3.413   -5.779  -14.737 1.00 23.86  ? 1109 PHE A HA    1 
ATOM   2982 H  HB2   . PHE A 1 239 ? 2.964   -5.594  -16.898 1.00 29.61  ? 1109 PHE A HB2   1 
ATOM   2983 H  HB3   . PHE A 1 239 ? 4.139   -6.660  -16.900 1.00 29.61  ? 1109 PHE A HB3   1 
ATOM   2984 H  HD1   . PHE A 1 239 ? 0.841   -6.164  -17.805 1.00 22.25  ? 1109 PHE A HD1   1 
ATOM   2985 H  HD2   . PHE A 1 239 ? 3.577   -9.047  -17.348 1.00 28.48  ? 1109 PHE A HD2   1 
ATOM   2986 H  HE1   . PHE A 1 239 ? -0.480  -7.608  -19.039 1.00 28.89  ? 1109 PHE A HE1   1 
ATOM   2987 H  HE2   . PHE A 1 239 ? 2.257   -10.497 -18.583 1.00 32.02  ? 1109 PHE A HE2   1 
ATOM   2988 H  HZ    . PHE A 1 239 ? 0.222   -9.777  -19.430 1.00 29.18  ? 1109 PHE A HZ    1 
ATOM   2989 N  N     . VAL A 1 240 ? 1.256   -7.932  -14.141 1.00 17.69  ? 1110 VAL A N     1 
ATOM   2990 C  CA    . VAL A 1 240 ? -0.110  -8.056  -13.613 1.00 17.41  ? 1110 VAL A CA    1 
ATOM   2991 C  C     . VAL A 1 240 ? -0.155  -8.251  -12.098 1.00 21.05  ? 1110 VAL A C     1 
ATOM   2992 O  O     . VAL A 1 240 ? -1.238  -8.379  -11.533 1.00 18.59  ? 1110 VAL A O     1 
ATOM   2993 C  CB    . VAL A 1 240 ? -0.930  -9.200  -14.269 1.00 16.84  ? 1110 VAL A CB    1 
ATOM   2994 C  CG1   . VAL A 1 240 ? -1.186  -8.907  -15.752 1.00 17.84  ? 1110 VAL A CG1   1 
ATOM   2995 C  CG2   . VAL A 1 240 ? -0.249  -10.547 -14.067 1.00 17.31  ? 1110 VAL A CG2   1 
ATOM   2996 H  H     . VAL A 1 240 ? 1.743   -8.637  -14.065 1.00 21.23  ? 1110 VAL A H     1 
ATOM   2997 H  HA    . VAL A 1 240 ? -0.582  -7.220  -13.806 1.00 20.89  ? 1110 VAL A HA    1 
ATOM   2998 H  HB    . VAL A 1 240 ? -1.803  -9.245  -13.826 1.00 20.20  ? 1110 VAL A HB    1 
ATOM   2999 H  HG11  . VAL A 1 240 ? -1.693  -9.629  -16.129 1.00 21.41  ? 1110 VAL A HG11  1 
ATOM   3000 H  HG12  . VAL A 1 240 ? -1.677  -8.086  -15.827 1.00 21.41  ? 1110 VAL A HG12  1 
ATOM   3001 H  HG13  . VAL A 1 240 ? -0.343  -8.828  -16.204 1.00 21.41  ? 1110 VAL A HG13  1 
ATOM   3002 H  HG21  . VAL A 1 240 ? 0.560   -10.416 -13.568 1.00 20.77  ? 1110 VAL A HG21  1 
ATOM   3003 H  HG22  . VAL A 1 240 ? -0.842  -11.127 -13.583 1.00 20.77  ? 1110 VAL A HG22  1 
ATOM   3004 H  HG23  . VAL A 1 240 ? -0.048  -10.927 -14.925 1.00 20.77  ? 1110 VAL A HG23  1 
ATOM   3005 N  N     . ARG A 1 241 ? 1.005   -8.281  -11.447 1.00 16.49  ? 1111 ARG A N     1 
ATOM   3006 C  CA    . ARG A 1 241 ? 1.056   -8.464  -10.001 1.00 17.96  ? 1111 ARG A CA    1 
ATOM   3007 C  C     . ARG A 1 241 ? 0.439   -7.291  -9.234  1.00 22.70  ? 1111 ARG A C     1 
ATOM   3008 O  O     . ARG A 1 241 ? 0.493   -6.142  -9.676  1.00 21.53  ? 1111 ARG A O     1 
ATOM   3009 C  CB    . ARG A 1 241 ? 2.496   -8.675  -9.526  1.00 20.17  ? 1111 ARG A CB    1 
ATOM   3010 C  CG    . ARG A 1 241 ? 3.072   -10.021 -9.963  1.00 23.97  ? 1111 ARG A CG    1 
ATOM   3011 C  CD    . ARG A 1 241 ? 4.190   -10.523 -9.034  1.00 31.20  ? 1111 ARG A CD    1 
ATOM   3012 N  NE    . ARG A 1 241 ? 5.444   -9.786  -9.176  1.00 45.27  ? 1111 ARG A NE    1 
ATOM   3013 C  CZ    . ARG A 1 241 ? 6.518   -10.226 -9.835  1.00 53.62  ? 1111 ARG A CZ    1 
ATOM   3014 N  NH1   . ARG A 1 241 ? 6.512   -11.411 -10.445 1.00 40.41  ? 1111 ARG A NH1   1 
ATOM   3015 N  NH2   . ARG A 1 241 ? 7.612   -9.472  -9.891  1.00 42.29  ? 1111 ARG A NH2   1 
ATOM   3016 H  H     . ARG A 1 241 ? 1.775   -8.198  -11.820 1.00 19.79  ? 1111 ARG A H     1 
ATOM   3017 H  HA    . ARG A 1 241 ? 0.546   -9.269  -9.771  1.00 21.55  ? 1111 ARG A HA    1 
ATOM   3018 H  HB2   . ARG A 1 241 ? 3.056   -7.975  -9.895  1.00 24.20  ? 1111 ARG A HB2   1 
ATOM   3019 H  HB3   . ARG A 1 241 ? 2.517   -8.640  -8.557  1.00 24.20  ? 1111 ARG A HB3   1 
ATOM   3020 H  HG2   . ARG A 1 241 ? 2.363   -10.683 -9.963  1.00 28.76  ? 1111 ARG A HG2   1 
ATOM   3021 H  HG3   . ARG A 1 241 ? 3.442   -9.932  -10.855 1.00 28.76  ? 1111 ARG A HG3   1 
ATOM   3022 H  HD2   . ARG A 1 241 ? 3.896   -10.435 -8.114  1.00 37.44  ? 1111 ARG A HD2   1 
ATOM   3023 H  HD3   . ARG A 1 241 ? 4.369   -11.455 -9.235  1.00 37.44  ? 1111 ARG A HD3   1 
ATOM   3024 H  HE    . ARG A 1 241 ? 5.493   -9.011  -8.807  1.00 54.33  ? 1111 ARG A HE    1 
ATOM   3025 H  HH11  . ARG A 1 241 ? 5.810   -11.907 -10.412 1.00 48.49  ? 1111 ARG A HH11  1 
ATOM   3026 H  HH12  . ARG A 1 241 ? 7.211   -11.681 -10.867 1.00 48.49  ? 1111 ARG A HH12  1 
ATOM   3027 H  HH21  . ARG A 1 241 ? 7.626   -8.704  -9.504  1.00 50.75  ? 1111 ARG A HH21  1 
ATOM   3028 H  HH22  . ARG A 1 241 ? 8.304   -9.750  -10.319 1.00 50.75  ? 1111 ARG A HH22  1 
ATOM   3029 N  N     . VAL A 1 242 ? -0.130  -7.611  -8.073  1.00 20.24  ? 1112 VAL A N     1 
ATOM   3030 C  CA    . VAL A 1 242 ? -0.753  -6.624  -7.197  1.00 18.12  ? 1112 VAL A CA    1 
ATOM   3031 C  C     . VAL A 1 242 ? 0.295   -5.615  -6.739  1.00 21.42  ? 1112 VAL A C     1 
ATOM   3032 O  O     . VAL A 1 242 ? 0.010   -4.424  -6.599  1.00 21.10  ? 1112 VAL A O     1 
ATOM   3033 C  CB    . VAL A 1 242 ? -1.358  -7.302  -5.942  1.00 26.30  ? 1112 VAL A CB    1 
ATOM   3034 C  CG1   . VAL A 1 242 ? -2.090  -6.275  -5.084  1.00 33.70  ? 1112 VAL A CG1   1 
ATOM   3035 C  CG2   . VAL A 1 242 ? -2.307  -8.423  -6.344  1.00 29.10  ? 1112 VAL A CG2   1 
ATOM   3036 H  H     . VAL A 1 242 ? -0.167  -8.413  -7.765  1.00 24.29  ? 1112 VAL A H     1 
ATOM   3037 H  HA    . VAL A 1 242 ? -1.464  -6.150  -7.677  1.00 21.75  ? 1112 VAL A HA    1 
ATOM   3038 H  HB    . VAL A 1 242 ? -0.636  -7.691  -5.406  1.00 31.56  ? 1112 VAL A HB    1 
ATOM   3039 H  HG11  . VAL A 1 242 ? -2.024  -5.414  -5.503  1.00 40.44  ? 1112 VAL A HG11  1 
ATOM   3040 H  HG12  . VAL A 1 242 ? -3.012  -6.533  -5.008  1.00 40.44  ? 1112 VAL A HG12  1 
ATOM   3041 H  HG13  . VAL A 1 242 ? -1.684  -6.249  -4.215  1.00 40.44  ? 1112 VAL A HG13  1 
ATOM   3042 H  HG21  . VAL A 1 242 ? -2.668  -8.826  -5.551  1.00 34.92  ? 1112 VAL A HG21  1 
ATOM   3043 H  HG22  . VAL A 1 242 ? -3.017  -8.055  -6.876  1.00 34.92  ? 1112 VAL A HG22  1 
ATOM   3044 H  HG23  . VAL A 1 242 ? -1.821  -9.077  -6.852  1.00 34.92  ? 1112 VAL A HG23  1 
ATOM   3045 N  N     . VAL A 1 243 ? 1.508   -6.105  -6.503  1.00 19.11  ? 1113 VAL A N     1 
ATOM   3046 C  CA    . VAL A 1 243 ? 2.611   -5.264  -6.052  1.00 22.72  ? 1113 VAL A CA    1 
ATOM   3047 C  C     . VAL A 1 243 ? 3.821   -5.471  -6.950  1.00 25.07  ? 1113 VAL A C     1 
ATOM   3048 O  O     . VAL A 1 243 ? 4.236   -6.600  -7.163  1.00 24.89  ? 1113 VAL A O     1 
ATOM   3049 C  CB    . VAL A 1 243 ? 3.043   -5.629  -4.618  1.00 28.24  ? 1113 VAL A CB    1 
ATOM   3050 C  CG1   . VAL A 1 243 ? 4.184   -4.722  -4.156  1.00 29.94  ? 1113 VAL A CG1   1 
ATOM   3051 C  CG2   . VAL A 1 243 ? 1.858   -5.566  -3.655  1.00 32.33  ? 1113 VAL A CG2   1 
ATOM   3052 H  H     . VAL A 1 243 ? 1.720   -6.933  -6.598  1.00 22.93  ? 1113 VAL A H     1 
ATOM   3053 H  HA    . VAL A 1 243 ? 2.348   -4.320  -6.078  1.00 27.27  ? 1113 VAL A HA    1 
ATOM   3054 H  HB    . VAL A 1 243 ? 3.378   -6.551  -4.617  1.00 33.89  ? 1113 VAL A HB    1 
ATOM   3055 H  HG11  . VAL A 1 243 ? 4.397   -4.106  -4.861  1.00 35.93  ? 1113 VAL A HG11  1 
ATOM   3056 H  HG12  . VAL A 1 243 ? 3.902   -4.241  -3.374  1.00 35.93  ? 1113 VAL A HG12  1 
ATOM   3057 H  HG13  . VAL A 1 243 ? 4.949   -5.263  -3.951  1.00 35.93  ? 1113 VAL A HG13  1 
ATOM   3058 H  HG21  . VAL A 1 243 ? 2.160   -5.798  -2.774  1.00 38.80  ? 1113 VAL A HG21  1 
ATOM   3059 H  HG22  . VAL A 1 243 ? 1.503   -4.674  -3.656  1.00 38.80  ? 1113 VAL A HG22  1 
ATOM   3060 H  HG23  . VAL A 1 243 ? 1.186   -6.187  -3.946  1.00 38.80  ? 1113 VAL A HG23  1 
ATOM   3061 N  N     . SER A 1 244 ? 4.378   -4.390  -7.488  1.00 21.96  ? 1114 SER A N     1 
ATOM   3062 C  CA    . SER A 1 244 ? 5.650   -4.461  -8.214  1.00 26.79  ? 1114 SER A CA    1 
ATOM   3063 C  C     . SER A 1 244 ? 6.213   -3.067  -8.414  1.00 24.85  ? 1114 SER A C     1 
ATOM   3064 O  O     . SER A 1 244 ? 5.473   -2.084  -8.382  1.00 21.65  ? 1114 SER A O     1 
ATOM   3065 C  CB    . SER A 1 244 ? 5.507   -5.147  -9.574  1.00 28.84  ? 1114 SER A CB    1 
ATOM   3066 O  OG    . SER A 1 244 ? 4.893   -4.300  -10.519 1.00 35.82  ? 1114 SER A OG    1 
ATOM   3067 H  H     . SER A 1 244 ? 4.040   -3.599  -7.449  1.00 26.35  ? 1114 SER A H     1 
ATOM   3068 H  HA    . SER A 1 244 ? 6.293   -4.974  -7.681  1.00 32.14  ? 1114 SER A HA    1 
ATOM   3069 H  HB2   . SER A 1 244 ? 6.389   -5.390  -9.897  1.00 34.61  ? 1114 SER A HB2   1 
ATOM   3070 H  HB3   . SER A 1 244 ? 4.964   -5.943  -9.467  1.00 34.61  ? 1114 SER A HB3   1 
ATOM   3071 H  HG    . SER A 1 244 ? 4.826   -4.686  -11.239 1.00 42.98  ? 1114 SER A HG    1 
ATOM   3072 N  N     . ALA A 1 245 ? 7.521   -2.984  -8.624  1.00 29.31  ? 1115 ALA A N     1 
ATOM   3073 C  CA    . ALA A 1 245 ? 8.187   -1.690  -8.772  1.00 28.78  ? 1115 ALA A CA    1 
ATOM   3074 C  C     . ALA A 1 245 ? 7.632   -0.925  -9.969  1.00 27.56  ? 1115 ALA A C     1 
ATOM   3075 O  O     . ALA A 1 245 ? 7.646   0.305   -9.990  1.00 26.12  ? 1115 ALA A O     1 
ATOM   3076 C  CB    . ALA A 1 245 ? 9.686   -1.888  -8.922  1.00 37.06  ? 1115 ALA A CB    1 
ATOM   3077 H  H     . ALA A 1 245 ? 8.049   -3.661  -8.685  1.00 35.17  ? 1115 ALA A H     1 
ATOM   3078 H  HA    . ALA A 1 245 ? 8.029   -1.154  -7.967  1.00 34.53  ? 1115 ALA A HA    1 
ATOM   3079 H  HB1   . ALA A 1 245 ? 10.106  -1.030  -9.018  1.00 44.47  ? 1115 ALA A HB1   1 
ATOM   3080 H  HB2   . ALA A 1 245 ? 10.022  -2.332  -8.140  1.00 44.47  ? 1115 ALA A HB2   1 
ATOM   3081 H  HB3   . ALA A 1 245 ? 9.854   -2.424  -9.701  1.00 44.47  ? 1115 ALA A HB3   1 
ATOM   3082 N  N     . GLY A 1 246 ? 7.131   -1.647  -10.963 1.00 24.06  ? 1116 GLY A N     1 
ATOM   3083 C  CA    . GLY A 1 246 ? 6.613   -1.013  -12.165 1.00 23.41  ? 1116 GLY A CA    1 
ATOM   3084 C  C     . GLY A 1 246 ? 5.128   -0.690  -12.131 1.00 25.06  ? 1116 GLY A C     1 
ATOM   3085 O  O     . GLY A 1 246 ? 4.548   -0.267  -13.129 1.00 27.86  ? 1116 GLY A O     1 
ATOM   3086 H  H     . GLY A 1 246 ? 7.080   -2.506  -10.965 1.00 28.88  ? 1116 GLY A H     1 
ATOM   3087 H  HA2   . GLY A 1 246 ? 7.094   -0.184  -12.315 1.00 28.09  ? 1116 GLY A HA2   1 
ATOM   3088 H  HA3   . GLY A 1 246 ? 6.774   -1.596  -12.923 1.00 28.09  ? 1116 GLY A HA3   1 
ATOM   3089 N  N     . ASN A 1 247 ? 4.511   -0.880  -10.974 1.00 20.68  ? 1117 ASN A N     1 
ATOM   3090 C  CA    . ASN A 1 247 ? 3.096   -0.588  -10.791 1.00 18.16  ? 1117 ASN A CA    1 
ATOM   3091 C  C     . ASN A 1 247 ? 2.950   0.742   -10.042 1.00 18.24  ? 1117 ASN A C     1 
ATOM   3092 O  O     . ASN A 1 247 ? 3.363   0.847   -8.894  1.00 18.58  ? 1117 ASN A O     1 
ATOM   3093 C  CB    . ASN A 1 247 ? 2.465   -1.743  -9.989  1.00 14.96  ? 1117 ASN A CB    1 
ATOM   3094 C  CG    . ASN A 1 247 ? 0.995   -1.543  -9.723  1.00 20.95  ? 1117 ASN A CG    1 
ATOM   3095 O  OD1   . ASN A 1 247 ? 0.413   -0.513  -10.068 1.00 18.04  ? 1117 ASN A OD1   1 
ATOM   3096 N  ND2   . ASN A 1 247 ? 0.373   -2.544  -9.105  1.00 21.06  ? 1117 ASN A ND2   1 
ATOM   3097 H  H     . ASN A 1 247 ? 4.896   -1.182  -10.267 1.00 24.81  ? 1117 ASN A H     1 
ATOM   3098 H  HA    . ASN A 1 247 ? 2.650   -0.518  -11.661 1.00 21.79  ? 1117 ASN A HA    1 
ATOM   3099 H  HB2   . ASN A 1 247 ? 2.569   -2.567  -10.489 1.00 17.95  ? 1117 ASN A HB2   1 
ATOM   3100 H  HB3   . ASN A 1 247 ? 2.916   -1.815  -9.133  1.00 17.95  ? 1117 ASN A HB3   1 
ATOM   3101 H  HD21  . ASN A 1 247 ? -0.466  -2.485  -8.928  1.00 25.27  ? 1117 ASN A HD21  1 
ATOM   3102 H  HD22  . ASN A 1 247 ? 0.811   -3.250  -8.883  1.00 25.27  ? 1117 ASN A HD22  1 
ATOM   3103 N  N     . LEU A 1 248 ? 2.396   1.773   -10.686 1.00 19.63  ? 1118 LEU A N     1 
ATOM   3104 C  CA    . LEU A 1 248 ? 2.278   3.076   -10.021 1.00 16.72  ? 1118 LEU A CA    1 
ATOM   3105 C  C     . LEU A 1 248 ? 1.550   2.948   -8.689  1.00 19.92  ? 1118 LEU A C     1 
ATOM   3106 O  O     . LEU A 1 248 ? 1.850   3.679   -7.744  1.00 18.74  ? 1118 LEU A O     1 
ATOM   3107 C  CB    . LEU A 1 248 ? 1.536   4.107   -10.888 1.00 16.42  ? 1118 LEU A CB    1 
ATOM   3108 C  CG    . LEU A 1 248 ? 2.117   4.426   -12.271 1.00 20.26  ? 1118 LEU A CG    1 
ATOM   3109 C  CD1   . LEU A 1 248 ? 1.297   5.538   -12.919 1.00 23.03  ? 1118 LEU A CD1   1 
ATOM   3110 C  CD2   . LEU A 1 248 ? 3.577   4.811   -12.172 1.00 27.29  ? 1118 LEU A CD2   1 
ATOM   3111 H  H     . LEU A 1 248 ? 2.087   1.747   -11.488 1.00 23.55  ? 1118 LEU A H     1 
ATOM   3112 H  HA    . LEU A 1 248 ? 3.177   3.424   -9.842  1.00 20.06  ? 1118 LEU A HA    1 
ATOM   3113 H  HB2   . LEU A 1 248 ? 0.632   3.784   -11.029 1.00 19.71  ? 1118 LEU A HB2   1 
ATOM   3114 H  HB3   . LEU A 1 248 ? 1.501   4.942   -10.396 1.00 19.71  ? 1118 LEU A HB3   1 
ATOM   3115 H  HG    . LEU A 1 248 ? 2.051   3.637   -12.832 1.00 24.32  ? 1118 LEU A HG    1 
ATOM   3116 H  HD11  . LEU A 1 248 ? 1.336   6.319   -12.363 1.00 27.63  ? 1118 LEU A HD11  1 
ATOM   3117 H  HD12  . LEU A 1 248 ? 1.666   5.733   -13.784 1.00 27.63  ? 1118 LEU A HD12  1 
ATOM   3118 H  HD13  . LEU A 1 248 ? 0.388   5.244   -13.009 1.00 27.63  ? 1118 LEU A HD13  1 
ATOM   3119 H  HD21  . LEU A 1 248 ? 3.909   5.004   -13.052 1.00 32.74  ? 1118 LEU A HD21  1 
ATOM   3120 H  HD22  . LEU A 1 248 ? 3.658   5.588   -11.614 1.00 32.74  ? 1118 LEU A HD22  1 
ATOM   3121 H  HD23  . LEU A 1 248 ? 4.068   4.080   -11.789 1.00 32.74  ? 1118 LEU A HD23  1 
ATOM   3122 N  N     . LEU A 1 249 ? 0.591   2.029   -8.596  1.00 14.97  ? 1119 LEU A N     1 
ATOM   3123 C  CA    . LEU A 1 249 ? -0.195  1.916   -7.358  1.00 14.39  ? 1119 LEU A CA    1 
ATOM   3124 C  C     . LEU A 1 249 ? 0.627   1.353   -6.189  1.00 19.67  ? 1119 LEU A C     1 
ATOM   3125 O  O     . LEU A 1 249 ? 0.234   1.489   -5.032  1.00 19.27  ? 1119 LEU A O     1 
ATOM   3126 C  CB    . LEU A 1 249 ? -1.459  1.076   -7.587  1.00 15.49  ? 1119 LEU A CB    1 
ATOM   3127 C  CG    . LEU A 1 249 ? -2.403  1.675   -8.641  1.00 19.84  ? 1119 LEU A CG    1 
ATOM   3128 C  CD1   . LEU A 1 249 ? -3.520  0.690   -8.973  1.00 18.13  ? 1119 LEU A CD1   1 
ATOM   3129 C  CD2   . LEU A 1 249 ? -2.992  3.016   -8.184  1.00 17.88  ? 1119 LEU A CD2   1 
ATOM   3130 H  H     . LEU A 1 249 ? 0.376   1.471   -9.214  1.00 17.97  ? 1119 LEU A H     1 
ATOM   3131 H  HA    . LEU A 1 249 ? -0.488  2.815   -7.099  1.00 17.26  ? 1119 LEU A HA    1 
ATOM   3132 H  HB2   . LEU A 1 249 ? -1.198  0.192   -7.888  1.00 18.59  ? 1119 LEU A HB2   1 
ATOM   3133 H  HB3   . LEU A 1 249 ? -1.948  1.010   -6.752  1.00 18.59  ? 1119 LEU A HB3   1 
ATOM   3134 H  HG    . LEU A 1 249 ? -1.899  1.836   -9.454  1.00 23.81  ? 1119 LEU A HG    1 
ATOM   3135 H  HD11  . LEU A 1 249 ? -3.131  -0.117  -9.318  1.00 21.76  ? 1119 LEU A HD11  1 
ATOM   3136 H  HD12  . LEU A 1 249 ? -4.016  0.500   -8.174  1.00 21.76  ? 1119 LEU A HD12  1 
ATOM   3137 H  HD13  . LEU A 1 249 ? -4.097  1.084   -9.632  1.00 21.76  ? 1119 LEU A HD13  1 
ATOM   3138 H  HD21  . LEU A 1 249 ? -3.573  3.351   -8.871  1.00 21.45  ? 1119 LEU A HD21  1 
ATOM   3139 H  HD22  . LEU A 1 249 ? -3.487  2.879   -7.374  1.00 21.45  ? 1119 LEU A HD22  1 
ATOM   3140 H  HD23  . LEU A 1 249 ? -2.275  3.635   -8.030  1.00 21.45  ? 1119 LEU A HD23  1 
ATOM   3141 N  N     . SER A 1 250 ? 1.766   0.737   -6.492  1.00 17.43  ? 1120 SER A N     1 
ATOM   3142 C  CA    . SER A 1 250 ? 2.684   0.270   -5.454  1.00 17.00  ? 1120 SER A CA    1 
ATOM   3143 C  C     . SER A 1 250 ? 3.518   1.425   -4.890  1.00 22.77  ? 1120 SER A C     1 
ATOM   3144 O  O     . SER A 1 250 ? 4.243   1.251   -3.908  1.00 23.20  ? 1120 SER A O     1 
ATOM   3145 C  CB    . SER A 1 250 ? 3.608   -0.817  -6.026  1.00 21.33  ? 1120 SER A CB    1 
ATOM   3146 O  OG    . SER A 1 250 ? 2.849   -1.913  -6.528  1.00 19.12  ? 1120 SER A OG    1 
ATOM   3147 H  H     . SER A 1 250 ? 2.032   0.575   -7.294  1.00 20.92  ? 1120 SER A H     1 
ATOM   3148 H  HA    . SER A 1 250 ? 2.167   -0.122  -4.719  1.00 20.40  ? 1120 SER A HA    1 
ATOM   3149 H  HB2   . SER A 1 250 ? 4.132   -0.438  -6.749  1.00 25.59  ? 1120 SER A HB2   1 
ATOM   3150 H  HB3   . SER A 1 250 ? 4.195   -1.135  -5.322  1.00 25.59  ? 1120 SER A HB3   1 
ATOM   3151 H  HG    . SER A 1 250 ? 2.048   -1.771  -6.423  1.00 22.95  ? 1120 SER A HG    1 
ATOM   3152 N  N     . HIS A 1 251 ? 3.406   2.602   -5.512  1.00 19.95  ? 1121 HIS A N     1 
ATOM   3153 C  CA    . HIS A 1 251 ? 4.123   3.800   -5.062  1.00 19.40  ? 1121 HIS A CA    1 
ATOM   3154 C  C     . HIS A 1 251 ? 3.224   4.778   -4.317  1.00 24.89  ? 1121 HIS A C     1 
ATOM   3155 O  O     . HIS A 1 251 ? 3.672   5.851   -3.902  1.00 21.83  ? 1121 HIS A O     1 
ATOM   3156 C  CB    . HIS A 1 251 ? 4.770   4.514   -6.259  1.00 16.42  ? 1121 HIS A CB    1 
ATOM   3157 C  CG    . HIS A 1 251 ? 5.849   3.713   -6.898  1.00 21.08  ? 1121 HIS A CG    1 
ATOM   3158 N  ND1   . HIS A 1 251 ? 7.171   3.808   -6.516  1.00 23.15  ? 1121 HIS A ND1   1 
ATOM   3159 C  CD2   . HIS A 1 251 ? 5.802   2.764   -7.859  1.00 22.02  ? 1121 HIS A CD2   1 
ATOM   3160 C  CE1   . HIS A 1 251 ? 7.894   2.961   -7.226  1.00 26.87  ? 1121 HIS A CE1   1 
ATOM   3161 N  NE2   . HIS A 1 251 ? 7.087   2.317   -8.049  1.00 23.76  ? 1121 HIS A NE2   1 
ATOM   3162 H  H     . HIS A 1 251 ? 2.914   2.735   -6.205  1.00 23.94  ? 1121 HIS A H     1 
ATOM   3163 H  HA    . HIS A 1 251 ? 4.840   3.528   -4.452  1.00 23.28  ? 1121 HIS A HA    1 
ATOM   3164 H  HB2   . HIS A 1 251 ? 4.089   4.687   -6.928  1.00 19.71  ? 1121 HIS A HB2   1 
ATOM   3165 H  HB3   . HIS A 1 251 ? 5.157   5.350   -5.956  1.00 19.71  ? 1121 HIS A HB3   1 
ATOM   3166 H  HD1   . HIS A 1 251 ? 7.476   4.337   -5.910  1.00 27.78  ? 1121 HIS A HD1   1 
ATOM   3167 H  HD2   . HIS A 1 251 ? 5.042   2.472   -8.310  1.00 26.43  ? 1121 HIS A HD2   1 
ATOM   3168 H  HE1   . HIS A 1 251 ? 8.814   2.845   -7.163  1.00 32.25  ? 1121 HIS A HE1   1 
ATOM   3169 H  HE2   . HIS A 1 251 ? 7.328   1.718   -8.617  1.00 28.52  ? 1121 HIS A HE2   1 
ATOM   3170 N  N     . VAL A 1 252 ? 1.956   4.416   -4.146  1.00 17.41  ? 1122 VAL A N     1 
ATOM   3171 C  CA    . VAL A 1 252 ? 1.044   5.251   -3.368  1.00 18.79  ? 1122 VAL A CA    1 
ATOM   3172 C  C     . VAL A 1 252 ? 1.534   5.356   -1.919  1.00 27.20  ? 1122 VAL A C     1 
ATOM   3173 O  O     . VAL A 1 252 ? 1.485   6.429   -1.318  1.00 23.17  ? 1122 VAL A O     1 
ATOM   3174 C  CB    . VAL A 1 252 ? -0.398  4.713   -3.426  1.00 20.04  ? 1122 VAL A CB    1 
ATOM   3175 C  CG1   . VAL A 1 252 ? -1.308  5.469   -2.456  1.00 23.45  ? 1122 VAL A CG1   1 
ATOM   3176 C  CG2   . VAL A 1 252 ? -0.928  4.817   -4.864  1.00 17.29  ? 1122 VAL A CG2   1 
ATOM   3177 H  H     . VAL A 1 252 ? 1.601   3.701   -4.466  1.00 20.89  ? 1122 VAL A H     1 
ATOM   3178 H  HA    . VAL A 1 252 ? 1.041   6.154   -3.748  1.00 22.55  ? 1122 VAL A HA    1 
ATOM   3179 H  HB    . VAL A 1 252 ? -0.398  3.767   -3.169  1.00 24.05  ? 1122 VAL A HB    1 
ATOM   3180 H  HG11  . VAL A 1 252 ? -2.196  5.110   -2.518  1.00 28.14  ? 1122 VAL A HG11  1 
ATOM   3181 H  HG12  . VAL A 1 252 ? -0.971  5.360   -1.564  1.00 28.14  ? 1122 VAL A HG12  1 
ATOM   3182 H  HG13  . VAL A 1 252 ? -1.313  6.399   -2.694  1.00 28.14  ? 1122 VAL A HG13  1 
ATOM   3183 H  HG21  . VAL A 1 252 ? -0.245  5.196   -5.422  1.00 20.75  ? 1122 VAL A HG21  1 
ATOM   3184 H  HG22  . VAL A 1 252 ? -1.156  3.938   -5.176  1.00 20.75  ? 1122 VAL A HG22  1 
ATOM   3185 H  HG23  . VAL A 1 252 ? -1.706  5.379   -4.870  1.00 20.75  ? 1122 VAL A HG23  1 
ATOM   3186 N  N     . GLY A 1 253 ? 2.025   4.250   -1.369  1.00 25.83  ? 1123 GLY A N     1 
ATOM   3187 C  CA    . GLY A 1 253 ? 2.598   4.265   -0.028  1.00 29.24  ? 1123 GLY A CA    1 
ATOM   3188 C  C     . GLY A 1 253 ? 1.611   3.885   1.064   1.00 29.09  ? 1123 GLY A C     1 
ATOM   3189 O  O     . GLY A 1 253 ? 1.973   3.816   2.237   1.00 26.58  ? 1123 GLY A O     1 
ATOM   3190 H  H     . GLY A 1 253 ? 2.038   3.479   -1.750  1.00 31.00  ? 1123 GLY A H     1 
ATOM   3191 H  HA2   . GLY A 1 253 ? 3.342   3.645   0.007   1.00 35.09  ? 1123 GLY A HA2   1 
ATOM   3192 H  HA3   . GLY A 1 253 ? 2.935   5.155   0.164   1.00 35.09  ? 1123 GLY A HA3   1 
ATOM   3193 N  N     . HIS A 1 254 ? 0.359   3.652   0.679   1.00 23.14  ? 1124 HIS A N     1 
ATOM   3194 C  CA    . HIS A 1 254 ? -0.683  3.243   1.616   1.00 25.33  ? 1124 HIS A CA    1 
ATOM   3195 C  C     . HIS A 1 254 ? -1.745  2.446   0.873   1.00 27.19  ? 1124 HIS A C     1 
ATOM   3196 O  O     . HIS A 1 254 ? -1.780  2.438   -0.355  1.00 22.13  ? 1124 HIS A O     1 
ATOM   3197 C  CB    . HIS A 1 254 ? -1.320  4.454   2.329   1.00 25.96  ? 1124 HIS A CB    1 
ATOM   3198 C  CG    . HIS A 1 254 ? -1.960  5.451   1.407   1.00 28.27  ? 1124 HIS A CG    1 
ATOM   3199 N  ND1   . HIS A 1 254 ? -1.284  6.547   0.910   1.00 24.93  ? 1124 HIS A ND1   1 
ATOM   3200 C  CD2   . HIS A 1 254 ? -3.223  5.542   0.919   1.00 24.31  ? 1124 HIS A CD2   1 
ATOM   3201 C  CE1   . HIS A 1 254 ? -2.094  7.258   0.148   1.00 25.60  ? 1124 HIS A CE1   1 
ATOM   3202 N  NE2   . HIS A 1 254 ? -3.280  6.672   0.137   1.00 25.75  ? 1124 HIS A NE2   1 
ATOM   3203 H  H     . HIS A 1 254 ? 0.085   3.725   -0.133  1.00 27.77  ? 1124 HIS A H     1 
ATOM   3204 H  HA    . HIS A 1 254 ? -0.288  2.662   2.300   1.00 30.39  ? 1124 HIS A HA    1 
ATOM   3205 H  HB2   . HIS A 1 254 ? -2.005  4.132   2.935   1.00 31.15  ? 1124 HIS A HB2   1 
ATOM   3206 H  HB3   . HIS A 1 254 ? -0.630  4.917   2.830   1.00 31.15  ? 1124 HIS A HB3   1 
ATOM   3207 H  HD1   . HIS A 1 254 ? -0.460  6.735   1.068   1.00 29.91  ? 1124 HIS A HD1   1 
ATOM   3208 H  HD2   . HIS A 1 254 ? -3.920  4.948   1.081   1.00 29.17  ? 1124 HIS A HD2   1 
ATOM   3209 H  HE1   . HIS A 1 254 ? -1.870  8.039   -0.305  1.00 30.72  ? 1124 HIS A HE1   1 
ATOM   3210 H  HE2   . HIS A 1 254 ? -3.972  6.948   -0.293  1.00 30.90  ? 1124 HIS A HE2   1 
ATOM   3211 N  N     . THR A 1 255 ? -2.618  1.783   1.623   1.00 23.94  ? 1125 THR A N     1 
ATOM   3212 C  CA    . THR A 1 255 ? -3.616  0.896   1.021   1.00 18.01  ? 1125 THR A CA    1 
ATOM   3213 C  C     . THR A 1 255 ? -4.773  1.660   0.410   1.00 18.99  ? 1125 THR A C     1 
ATOM   3214 O  O     . THR A 1 255 ? -5.332  2.575   1.020   1.00 21.90  ? 1125 THR A O     1 
ATOM   3215 C  CB    . THR A 1 255 ? -4.214  -0.058  2.087   1.00 25.72  ? 1125 THR A CB    1 
ATOM   3216 O  OG1   . THR A 1 255 ? -3.185  -0.921  2.580   1.00 27.34  ? 1125 THR A OG1   1 
ATOM   3217 C  CG2   . THR A 1 255 ? -5.336  -0.906  1.492   1.00 21.37  ? 1125 THR A CG2   1 
ATOM   3218 H  H     . THR A 1 255 ? -2.655  1.826   2.481   1.00 28.73  ? 1125 THR A H     1 
ATOM   3219 H  HA    . THR A 1 255 ? -3.195  0.356   0.320   1.00 21.61  ? 1125 THR A HA    1 
ATOM   3220 H  HB    . THR A 1 255 ? -4.578  0.462   2.820   1.00 30.86  ? 1125 THR A HB    1 
ATOM   3221 H  HG1   . THR A 1 255 ? -2.872  -1.364  1.965   1.00 32.80  ? 1125 THR A HG1   1 
ATOM   3222 H  HG21  . THR A 1 255 ? -6.037  -0.338  1.164   1.00 25.64  ? 1125 THR A HG21  1 
ATOM   3223 H  HG22  . THR A 1 255 ? -4.997  -1.434  0.765   1.00 25.64  ? 1125 THR A HG22  1 
ATOM   3224 H  HG23  . THR A 1 255 ? -5.696  -1.491  2.162   1.00 25.64  ? 1125 THR A HG23  1 
ATOM   3225 N  N     . ILE A 1 256 ? -5.126  1.276   -0.809  1.00 18.34  ? 1126 ILE A N     1 
ATOM   3226 C  CA    . ILE A 1 256 ? -6.380  1.680   -1.410  1.00 15.14  ? 1126 ILE A CA    1 
ATOM   3227 C  C     . ILE A 1 256 ? -7.093  0.355   -1.690  1.00 17.87  ? 1126 ILE A C     1 
ATOM   3228 O  O     . ILE A 1 256 ? -6.715  -0.366  -2.609  1.00 18.15  ? 1126 ILE A O     1 
ATOM   3229 C  CB    . ILE A 1 256 ? -6.143  2.440   -2.734  1.00 19.00  ? 1126 ILE A CB    1 
ATOM   3230 C  CG1   . ILE A 1 256 ? -5.261  3.676   -2.499  1.00 18.48  ? 1126 ILE A CG1   1 
ATOM   3231 C  CG2   . ILE A 1 256 ? -7.478  2.858   -3.364  1.00 17.25  ? 1126 ILE A CG2   1 
ATOM   3232 C  CD1   . ILE A 1 256 ? -4.788  4.348   -3.807  1.00 21.26  ? 1126 ILE A CD1   1 
ATOM   3233 H  H     . ILE A 1 256 ? -4.645  0.774   -1.314  1.00 22.01  ? 1126 ILE A H     1 
ATOM   3234 H  HA    . ILE A 1 256 ? -6.911  2.227   -0.794  1.00 18.17  ? 1126 ILE A HA    1 
ATOM   3235 H  HB    . ILE A 1 256 ? -5.685  1.847   -3.350  1.00 22.80  ? 1126 ILE A HB    1 
ATOM   3236 H  HG12  . ILE A 1 256 ? -5.767  4.332   -1.994  1.00 22.18  ? 1126 ILE A HG12  1 
ATOM   3237 H  HG13  . ILE A 1 256 ? -4.474  3.410   -1.999  1.00 22.18  ? 1126 ILE A HG13  1 
ATOM   3238 H  HG21  . ILE A 1 256 ? -7.303  3.327   -4.183  1.00 20.69  ? 1126 ILE A HG21  1 
ATOM   3239 H  HG22  . ILE A 1 256 ? -7.999  2.072   -3.541  1.00 20.69  ? 1126 ILE A HG22  1 
ATOM   3240 H  HG23  . ILE A 1 256 ? -7.946  3.431   -2.752  1.00 20.69  ? 1126 ILE A HG23  1 
ATOM   3241 H  HD11  . ILE A 1 256 ? -4.275  3.715   -4.315  1.00 25.51  ? 1126 ILE A HD11  1 
ATOM   3242 H  HD12  . ILE A 1 256 ? -5.556  4.628   -4.310  1.00 25.51  ? 1126 ILE A HD12  1 
ATOM   3243 H  HD13  . ILE A 1 256 ? -4.245  5.109   -3.588  1.00 25.51  ? 1126 ILE A HD13  1 
ATOM   3244 N  N     . LEU A 1 257 ? -8.097  0.030   -0.887  1.00 18.00  ? 1127 LEU A N     1 
ATOM   3245 C  CA    . LEU A 1 257 ? -8.690  -1.309  -0.903  1.00 17.65  ? 1127 LEU A CA    1 
ATOM   3246 C  C     . LEU A 1 257 ? -9.282  -1.645  -2.262  1.00 18.44  ? 1127 LEU A C     1 
ATOM   3247 O  O     . LEU A 1 257 ? -10.093 -0.893  -2.787  1.00 19.69  ? 1127 LEU A O     1 
ATOM   3248 C  CB    . LEU A 1 257 ? -9.778  -1.410  0.165   1.00 22.24  ? 1127 LEU A CB    1 
ATOM   3249 C  CG    . LEU A 1 257 ? -9.242  -1.437  1.596   1.00 23.08  ? 1127 LEU A CG    1 
ATOM   3250 C  CD1   . LEU A 1 257 ? -10.372 -1.257  2.624   1.00 27.10  ? 1127 LEU A CD1   1 
ATOM   3251 C  CD2   . LEU A 1 257 ? -8.485  -2.742  1.852   1.00 23.30  ? 1127 LEU A CD2   1 
ATOM   3252 H  H     . LEU A 1 257 ? -8.457  0.566   -0.319  1.00 21.60  ? 1127 LEU A H     1 
ATOM   3253 H  HA    . LEU A 1 257 ? -7.997  -1.972  -0.698  1.00 21.18  ? 1127 LEU A HA    1 
ATOM   3254 H  HB2   . LEU A 1 257 ? -10.367 -0.643  0.084   1.00 26.69  ? 1127 LEU A HB2   1 
ATOM   3255 H  HB3   . LEU A 1 257 ? -10.282 -2.226  0.023   1.00 26.69  ? 1127 LEU A HB3   1 
ATOM   3256 H  HG    . LEU A 1 257 ? -8.617  -0.704  1.710   1.00 27.70  ? 1127 LEU A HG    1 
ATOM   3257 H  HD11  . LEU A 1 257 ? -9.996  -1.280  3.508   1.00 32.52  ? 1127 LEU A HD11  1 
ATOM   3258 H  HD12  . LEU A 1 257 ? -10.801 -0.412  2.472   1.00 32.52  ? 1127 LEU A HD12  1 
ATOM   3259 H  HD13  . LEU A 1 257 ? -11.006 -1.970  2.519   1.00 32.52  ? 1127 LEU A HD13  1 
ATOM   3260 H  HD21  . LEU A 1 257 ? -8.156  -2.741  2.754   1.00 27.96  ? 1127 LEU A HD21  1 
ATOM   3261 H  HD22  . LEU A 1 257 ? -9.084  -3.481  1.722   1.00 27.96  ? 1127 LEU A HD22  1 
ATOM   3262 H  HD23  . LEU A 1 257 ? -7.751  -2.803  1.235   1.00 27.96  ? 1127 LEU A HD23  1 
ATOM   3263 N  N     . GLY A 1 258 ? -8.888  -2.776  -2.832  1.00 17.86  ? 1128 GLY A N     1 
ATOM   3264 C  CA    . GLY A 1 258 ? -9.417  -3.177  -4.126  1.00 19.92  ? 1128 GLY A CA    1 
ATOM   3265 C  C     . GLY A 1 258 ? -8.578  -2.679  -5.290  1.00 19.86  ? 1128 GLY A C     1 
ATOM   3266 O  O     . GLY A 1 258 ? -8.702  -3.182  -6.414  1.00 17.32  ? 1128 GLY A O     1 
ATOM   3267 H  H     . GLY A 1 258 ? -8.321  -3.325  -2.492  1.00 21.43  ? 1128 GLY A H     1 
ATOM   3268 H  HA2   . GLY A 1 258 ? -9.458  -4.145  -4.171  1.00 23.91  ? 1128 GLY A HA2   1 
ATOM   3269 H  HA3   . GLY A 1 258 ? -10.317 -2.828  -4.227  1.00 23.91  ? 1128 GLY A HA3   1 
ATOM   3270 N  N     . MET A 1 259 ? -7.712  -1.700  -5.042  1.00 15.63  ? 1129 MET A N     1 
ATOM   3271 C  CA    . MET A 1 259 ? -6.853  -1.203  -6.117  1.00 13.69  ? 1129 MET A CA    1 
ATOM   3272 C  C     . MET A 1 259 ? -5.454  -1.778  -5.969  1.00 16.41  ? 1129 MET A C     1 
ATOM   3273 O  O     . MET A 1 259 ? -4.989  -2.486  -6.857  1.00 18.38  ? 1129 MET A O     1 
ATOM   3274 C  CB    . MET A 1 259 ? -6.825  0.329   -6.167  1.00 15.37  ? 1129 MET A CB    1 
ATOM   3275 C  CG    . MET A 1 259 ? -8.187  0.949   -6.420  1.00 15.69  ? 1129 MET A CG    1 
ATOM   3276 S  SD    . MET A 1 259 ? -8.052  2.651   -7.033  1.00 16.81  ? 1129 MET A SD    1 
ATOM   3277 C  CE    . MET A 1 259 ? -7.370  2.398   -8.694  1.00 17.57  ? 1129 MET A CE    1 
ATOM   3278 H  H     . MET A 1 259 ? -7.602  -1.314  -4.282  1.00 18.76  ? 1129 MET A H     1 
ATOM   3279 H  HA    . MET A 1 259 ? -7.222  -1.512  -6.971  1.00 16.42  ? 1129 MET A HA    1 
ATOM   3280 H  HB2   . MET A 1 259 ? -6.498  0.664   -5.317  1.00 18.45  ? 1129 MET A HB2   1 
ATOM   3281 H  HB3   . MET A 1 259 ? -6.232  0.609   -6.882  1.00 18.45  ? 1129 MET A HB3   1 
ATOM   3282 H  HG2   . MET A 1 259 ? -8.657  0.424   -7.086  1.00 18.83  ? 1129 MET A HG2   1 
ATOM   3283 H  HG3   . MET A 1 259 ? -8.689  0.965   -5.590  1.00 18.83  ? 1129 MET A HG3   1 
ATOM   3284 H  HE1   . MET A 1 259 ? -7.256  3.252   -9.117  1.00 21.08  ? 1129 MET A HE1   1 
ATOM   3285 H  HE2   . MET A 1 259 ? -6.522  1.954   -8.619  1.00 21.08  ? 1129 MET A HE2   1 
ATOM   3286 H  HE3   . MET A 1 259 ? -7.979  1.859   -9.203  1.00 21.08  ? 1129 MET A HE3   1 
ATOM   3287 N  N     . ASN A 1 260 ? -4.785  -1.499  -4.854  1.00 16.13  ? 1130 ASN A N     1 
ATOM   3288 C  CA    . ASN A 1 260 ? -3.502  -2.140  -4.595  1.00 17.99  ? 1130 ASN A CA    1 
ATOM   3289 C  C     . ASN A 1 260 ? -3.611  -3.222  -3.519  1.00 20.23  ? 1130 ASN A C     1 
ATOM   3290 O  O     . ASN A 1 260 ? -2.613  -3.592  -2.903  1.00 21.17  ? 1130 ASN A O     1 
ATOM   3291 C  CB    . ASN A 1 260 ? -2.399  -1.115  -4.278  1.00 18.93  ? 1130 ASN A CB    1 
ATOM   3292 C  CG    . ASN A 1 260 ? -2.709  -0.266  -3.049  1.00 19.35  ? 1130 ASN A CG    1 
ATOM   3293 O  OD1   . ASN A 1 260 ? -3.521  -0.646  -2.201  1.00 17.82  ? 1130 ASN A OD1   1 
ATOM   3294 N  ND2   . ASN A 1 260 ? -2.051  0.897   -2.950  1.00 18.80  ? 1130 ASN A ND2   1 
ATOM   3295 H  H     . ASN A 1 260 ? -5.047  -0.954  -4.243  1.00 19.35  ? 1130 ASN A H     1 
ATOM   3296 H  HA    . ASN A 1 260 ? -3.229  -2.594  -5.419  1.00 21.58  ? 1130 ASN A HA    1 
ATOM   3297 H  HB2   . ASN A 1 260 ? -1.568  -1.587  -4.113  1.00 22.72  ? 1130 ASN A HB2   1 
ATOM   3298 H  HB3   . ASN A 1 260 ? -2.296  -0.518  -5.035  1.00 22.72  ? 1130 ASN A HB3   1 
ATOM   3299 H  HD21  . ASN A 1 260 ? -2.190  1.413   -2.276  1.00 22.55  ? 1130 ASN A HD21  1 
ATOM   3300 H  HD22  . ASN A 1 260 ? -1.491  1.127   -3.560  1.00 22.55  ? 1130 ASN A HD22  1 
ATOM   3301 N  N     . THR A 1 261 ? -4.835  -3.710  -3.303  1.00 18.18  ? 1131 THR A N     1 
ATOM   3302 C  CA    . THR A 1 261 ? -5.082  -4.965  -2.580  1.00 17.72  ? 1131 THR A CA    1 
ATOM   3303 C  C     . THR A 1 261 ? -6.148  -5.759  -3.348  1.00 19.25  ? 1131 THR A C     1 
ATOM   3304 O  O     . THR A 1 261 ? -6.924  -5.196  -4.112  1.00 19.55  ? 1131 THR A O     1 
ATOM   3305 C  CB    . THR A 1 261 ? -5.593  -4.758  -1.133  1.00 20.59  ? 1131 THR A CB    1 
ATOM   3306 O  OG1   . THR A 1 261 ? -6.839  -4.050  -1.164  1.00 19.82  ? 1131 THR A OG1   1 
ATOM   3307 C  CG2   . THR A 1 261 ? -4.575  -3.973  -0.284  1.00 24.35  ? 1131 THR A CG2   1 
ATOM   3308 H  H     . THR A 1 261 ? -5.555  -3.325  -3.571  1.00 21.82  ? 1131 THR A H     1 
ATOM   3309 H  HA    . THR A 1 261 ? -4.258  -5.495  -2.549  1.00 21.26  ? 1131 THR A HA    1 
ATOM   3310 H  HB    . THR A 1 261 ? -5.730  -5.624  -0.718  1.00 24.71  ? 1131 THR A HB    1 
ATOM   3311 H  HG1   . THR A 1 261 ? -6.737  -3.319  -1.521  1.00 23.79  ? 1131 THR A HG1   1 
ATOM   3312 H  HG21  . THR A 1 261 ? -4.419  -3.110  -0.673  1.00 29.22  ? 1131 THR A HG21  1 
ATOM   3313 H  HG22  . THR A 1 261 ? -4.912  -3.857  0.608   1.00 29.22  ? 1131 THR A HG22  1 
ATOM   3314 H  HG23  . THR A 1 261 ? -3.743  -4.452  -0.243  1.00 29.22  ? 1131 THR A HG23  1 
ATOM   3315 N  N     . VAL A 1 262 ? -6.181  -7.067  -3.131  1.00 16.12  ? 1132 VAL A N     1 
ATOM   3316 C  CA    . VAL A 1 262 ? -7.038  -7.937  -3.913  1.00 15.82  ? 1132 VAL A CA    1 
ATOM   3317 C  C     . VAL A 1 262 ? -8.480  -7.880  -3.438  1.00 16.28  ? 1132 VAL A C     1 
ATOM   3318 O  O     . VAL A 1 262 ? -8.749  -7.888  -2.233  1.00 20.10  ? 1132 VAL A O     1 
ATOM   3319 C  CB    . VAL A 1 262 ? -6.568  -9.387  -3.796  1.00 17.06  ? 1132 VAL A CB    1 
ATOM   3320 C  CG1   . VAL A 1 262 ? -7.548  -10.313 -4.509  1.00 16.94  ? 1132 VAL A CG1   1 
ATOM   3321 C  CG2   . VAL A 1 262 ? -5.167  -9.508  -4.362  1.00 19.72  ? 1132 VAL A CG2   1 
ATOM   3322 H  H     . VAL A 1 262 ? -5.715  -7.474  -2.534  1.00 19.34  ? 1132 VAL A H     1 
ATOM   3323 H  HA    . VAL A 1 262 ? -7.006  -7.672  -4.855  1.00 18.99  ? 1132 VAL A HA    1 
ATOM   3324 H  HB    . VAL A 1 262 ? -6.539  -9.641  -2.850  1.00 20.47  ? 1132 VAL A HB    1 
ATOM   3325 H  HG11  . VAL A 1 262 ? -7.238  -11.218 -4.426  1.00 20.33  ? 1132 VAL A HG11  1 
ATOM   3326 H  HG12  . VAL A 1 262 ? -8.413  -10.224 -4.103  1.00 20.33  ? 1132 VAL A HG12  1 
ATOM   3327 H  HG13  . VAL A 1 262 ? -7.593  -10.065 -5.435  1.00 20.33  ? 1132 VAL A HG13  1 
ATOM   3328 H  HG21  . VAL A 1 262 ? -4.880  -8.645  -4.671  1.00 23.67  ? 1132 VAL A HG21  1 
ATOM   3329 H  HG22  . VAL A 1 262 ? -4.578  -9.822  -3.672  1.00 23.67  ? 1132 VAL A HG22  1 
ATOM   3330 H  HG23  . VAL A 1 262 ? -5.178  -10.131 -5.092  1.00 23.67  ? 1132 VAL A HG23  1 
ATOM   3331 N  N     . GLN A 1 263 ? -9.408  -7.826  -4.389  1.00 14.49  ? 1133 GLN A N     1 
ATOM   3332 C  CA    . GLN A 1 263 ? -10.819 -8.002  -4.077  1.00 14.81  ? 1133 GLN A CA    1 
ATOM   3333 C  C     . GLN A 1 263 ? -11.369 -9.273  -4.705  1.00 19.06  ? 1133 GLN A C     1 
ATOM   3334 O  O     . GLN A 1 263 ? -10.966 -9.682  -5.795  1.00 18.93  ? 1133 GLN A O     1 
ATOM   3335 C  CB    . GLN A 1 263 ? -11.647 -6.778  -4.485  1.00 17.00  ? 1133 GLN A CB    1 
ATOM   3336 C  CG    . GLN A 1 263 ? -11.740 -5.744  -3.354  1.00 19.14  ? 1133 GLN A CG    1 
ATOM   3337 C  CD    . GLN A 1 263 ? -12.480 -4.477  -3.757  1.00 18.59  ? 1133 GLN A CD    1 
ATOM   3338 O  OE1   . GLN A 1 263 ? -12.907 -4.328  -4.901  1.00 21.44  ? 1133 GLN A OE1   1 
ATOM   3339 N  NE2   . GLN A 1 263 ? -12.638 -3.556  -2.807  1.00 17.48  ? 1133 GLN A NE2   1 
ATOM   3340 H  H     . GLN A 1 263 ? -9.246  -7.688  -5.222  1.00 17.39  ? 1133 GLN A H     1 
ATOM   3341 H  HA    . GLN A 1 263 ? -10.906 -8.099  -3.105  1.00 17.77  ? 1133 GLN A HA    1 
ATOM   3342 H  HB2   . GLN A 1 263 ? -11.230 -6.352  -5.251  1.00 20.40  ? 1133 GLN A HB2   1 
ATOM   3343 H  HB3   . GLN A 1 263 ? -12.547 -7.063  -4.709  1.00 20.40  ? 1133 GLN A HB3   1 
ATOM   3344 H  HG2   . GLN A 1 263 ? -12.212 -6.140  -2.605  1.00 22.97  ? 1133 GLN A HG2   1 
ATOM   3345 H  HG3   . GLN A 1 263 ? -10.843 -5.493  -3.084  1.00 22.97  ? 1133 GLN A HG3   1 
ATOM   3346 H  HE21  . GLN A 1 263 ? -13.049 -2.821  -2.984  1.00 20.98  ? 1133 GLN A HE21  1 
ATOM   3347 H  HE22  . GLN A 1 263 ? -12.328 -3.696  -2.017  1.00 20.98  ? 1133 GLN A HE22  1 
ATOM   3348 N  N     . LEU A 1 264 ? -12.274 -9.908  -3.973  1.00 16.96  ? 1134 LEU A N     1 
ATOM   3349 C  CA    . LEU A 1 264 ? -12.913 -11.135 -4.399  1.00 17.20  ? 1134 LEU A CA    1 
ATOM   3350 C  C     . LEU A 1 264 ? -14.378 -10.863 -4.722  1.00 17.52  ? 1134 LEU A C     1 
ATOM   3351 O  O     . LEU A 1 264 ? -15.013 -10.006 -4.110  1.00 18.79  ? 1134 LEU A O     1 
ATOM   3352 C  CB    . LEU A 1 264 ? -12.812 -12.158 -3.249  1.00 17.77  ? 1134 LEU A CB    1 
ATOM   3353 C  CG    . LEU A 1 264 ? -13.736 -13.369 -3.260  1.00 19.25  ? 1134 LEU A CG    1 
ATOM   3354 C  CD1   . LEU A 1 264 ? -13.184 -14.413 -4.202  1.00 18.01  ? 1134 LEU A CD1   1 
ATOM   3355 C  CD2   . LEU A 1 264 ? -13.865 -13.951 -1.830  1.00 21.98  ? 1134 LEU A CD2   1 
ATOM   3356 H  H     . LEU A 1 264 ? -12.539 -9.635  -3.202  1.00 20.35  ? 1134 LEU A H     1 
ATOM   3357 H  HA    . LEU A 1 264 ? -12.466 -11.495 -5.193  1.00 20.64  ? 1134 LEU A HA    1 
ATOM   3358 H  HB2   . LEU A 1 264 ? -11.904 -12.499 -3.237  1.00 21.32  ? 1134 LEU A HB2   1 
ATOM   3359 H  HB3   . LEU A 1 264 ? -12.981 -11.686 -2.419  1.00 21.32  ? 1134 LEU A HB3   1 
ATOM   3360 H  HG    . LEU A 1 264 ? -14.617 -13.106 -3.570  1.00 23.10  ? 1134 LEU A HG    1 
ATOM   3361 H  HD11  . LEU A 1 264 ? -12.311 -14.674 -3.901  1.00 21.61  ? 1134 LEU A HD11  1 
ATOM   3362 H  HD12  . LEU A 1 264 ? -13.771 -15.173 -4.204  1.00 21.61  ? 1134 LEU A HD12  1 
ATOM   3363 H  HD13  . LEU A 1 264 ? -13.129 -14.039 -5.084  1.00 21.61  ? 1134 LEU A HD13  1 
ATOM   3364 H  HD21  . LEU A 1 264 ? -14.228 -13.277 -1.250  1.00 26.38  ? 1134 LEU A HD21  1 
ATOM   3365 H  HD22  . LEU A 1 264 ? -14.449 -14.712 -1.854  1.00 26.38  ? 1134 LEU A HD22  1 
ATOM   3366 H  HD23  . LEU A 1 264 ? -12.995 -14.215 -1.521  1.00 26.38  ? 1134 LEU A HD23  1 
ATOM   3367 N  N     . TYR A 1 265 ? -14.905 -11.599 -5.694  1.00 14.99  ? 1135 TYR A N     1 
ATOM   3368 C  CA    . TYR A 1 265 ? -16.310 -11.547 -6.068  1.00 13.50  ? 1135 TYR A CA    1 
ATOM   3369 C  C     . TYR A 1 265 ? -16.838 -12.972 -5.985  1.00 18.65  ? 1135 TYR A C     1 
ATOM   3370 O  O     . TYR A 1 265 ? -16.193 -13.902 -6.460  1.00 18.79  ? 1135 TYR A O     1 
ATOM   3371 C  CB    . TYR A 1 265 ? -16.466 -11.041 -7.514  1.00 13.57  ? 1135 TYR A CB    1 
ATOM   3372 C  CG    . TYR A 1 265 ? -15.981 -9.609  -7.709  1.00 15.29  ? 1135 TYR A CG    1 
ATOM   3373 C  CD1   . TYR A 1 265 ? -16.847 -8.528  -7.563  1.00 17.44  ? 1135 TYR A CD1   1 
ATOM   3374 C  CD2   . TYR A 1 265 ? -14.655 -9.345  -8.025  1.00 22.35  ? 1135 TYR A CD2   1 
ATOM   3375 C  CE1   . TYR A 1 265 ? -16.400 -7.211  -7.743  1.00 18.45  ? 1135 TYR A CE1   1 
ATOM   3376 C  CE2   . TYR A 1 265 ? -14.200 -8.044  -8.197  1.00 30.87  ? 1135 TYR A CE2   1 
ATOM   3377 C  CZ    . TYR A 1 265 ? -15.070 -6.981  -8.062  1.00 26.76  ? 1135 TYR A CZ    1 
ATOM   3378 O  OH    . TYR A 1 265 ? -14.584 -5.692  -8.243  1.00 25.53  ? 1135 TYR A OH    1 
ATOM   3379 H  H     . TYR A 1 265 ? -14.450 -12.155 -6.167  1.00 17.99  ? 1135 TYR A H     1 
ATOM   3380 H  HA    . TYR A 1 265 ? -16.813 -10.969 -5.456  1.00 16.20  ? 1135 TYR A HA    1 
ATOM   3381 H  HB2   . TYR A 1 265 ? -15.952 -11.613 -8.104  1.00 16.29  ? 1135 TYR A HB2   1 
ATOM   3382 H  HB3   . TYR A 1 265 ? -17.405 -11.073 -7.758  1.00 16.29  ? 1135 TYR A HB3   1 
ATOM   3383 H  HD1   . TYR A 1 265 ? -17.740 -8.683  -7.353  1.00 20.92  ? 1135 TYR A HD1   1 
ATOM   3384 H  HD2   . TYR A 1 265 ? -14.060 -10.053 -8.121  1.00 26.82  ? 1135 TYR A HD2   1 
ATOM   3385 H  HE1   . TYR A 1 265 ? -16.989 -6.498  -7.646  1.00 22.14  ? 1135 TYR A HE1   1 
ATOM   3386 H  HE2   . TYR A 1 265 ? -13.309 -7.889  -8.413  1.00 37.04  ? 1135 TYR A HE2   1 
ATOM   3387 H  HH    . TYR A 1 265 ? -14.687 -5.255  -7.557  1.00 30.64  ? 1135 TYR A HH    1 
ATOM   3388 N  N     . MET A 1 266 ? -18.006 -13.149 -5.391  1.00 15.91  ? 1136 MET A N     1 
ATOM   3389 C  CA    . MET A 1 266 ? -18.637 -14.465 -5.343  1.00 15.80  ? 1136 MET A CA    1 
ATOM   3390 C  C     . MET A 1 266 ? -19.982 -14.319 -6.017  1.00 18.83  ? 1136 MET A C     1 
ATOM   3391 O  O     . MET A 1 266 ? -20.802 -13.507 -5.603  1.00 18.49  ? 1136 MET A O     1 
ATOM   3392 C  CB    . MET A 1 266 ? -18.793 -14.942 -3.891  1.00 15.55  ? 1136 MET A CB    1 
ATOM   3393 C  CG    . MET A 1 266 ? -17.469 -15.036 -3.139  1.00 22.20  ? 1136 MET A CG    1 
ATOM   3394 S  SD    . MET A 1 266 ? -17.633 -15.385 -1.375  1.00 21.15  ? 1136 MET A SD    1 
ATOM   3395 C  CE    . MET A 1 266 ? -18.217 -17.093 -1.419  1.00 18.22  ? 1136 MET A CE    1 
ATOM   3396 H  H     . MET A 1 266 ? -18.457 -12.526 -5.006  1.00 19.09  ? 1136 MET A H     1 
ATOM   3397 H  HA    . MET A 1 266 ? -18.089 -15.115 -5.831  1.00 18.96  ? 1136 MET A HA    1 
ATOM   3398 H  HB2   . MET A 1 266 ? -19.363 -14.317 -3.415  1.00 18.66  ? 1136 MET A HB2   1 
ATOM   3399 H  HB3   . MET A 1 266 ? -19.199 -15.823 -3.892  1.00 18.66  ? 1136 MET A HB3   1 
ATOM   3400 H  HG2   . MET A 1 266 ? -16.939 -15.747 -3.531  1.00 26.64  ? 1136 MET A HG2   1 
ATOM   3401 H  HG3   . MET A 1 266 ? -17.000 -14.191 -3.229  1.00 26.64  ? 1136 MET A HG3   1 
ATOM   3402 H  HE1   . MET A 1 266 ? -17.560 -17.635 -1.861  1.00 21.86  ? 1136 MET A HE1   1 
ATOM   3403 H  HE2   . MET A 1 266 ? -18.345 -17.402 -0.519  1.00 21.86  ? 1136 MET A HE2   1 
ATOM   3404 H  HE3   . MET A 1 266 ? -19.047 -17.126 -1.899  1.00 21.86  ? 1136 MET A HE3   1 
ATOM   3405 N  N     . LYS A 1 267 ? -20.202 -15.095 -7.070  1.00 15.96  ? 1137 LYS A N     1 
ATOM   3406 C  CA    . LYS A 1 267 ? -21.318 -14.833 -7.969  1.00 17.13  ? 1137 LYS A CA    1 
ATOM   3407 C  C     . LYS A 1 267 ? -22.244 -16.024 -8.176  1.00 19.22  ? 1137 LYS A C     1 
ATOM   3408 O  O     . LYS A 1 267 ? -21.828 -17.183 -8.090  1.00 19.80  ? 1137 LYS A O     1 
ATOM   3409 C  CB    . LYS A 1 267 ? -20.772 -14.433 -9.346  1.00 16.07  ? 1137 LYS A CB    1 
ATOM   3410 C  CG    . LYS A 1 267 ? -19.822 -13.231 -9.311  1.00 20.32  ? 1137 LYS A CG    1 
ATOM   3411 C  CD    . LYS A 1 267 ? -19.348 -12.859 -10.726 1.00 17.33  ? 1137 LYS A CD    1 
ATOM   3412 C  CE    . LYS A 1 267 ? -18.238 -11.790 -10.710 1.00 17.97  ? 1137 LYS A CE    1 
ATOM   3413 N  NZ    . LYS A 1 267 ? -17.783 -11.467 -12.111 1.00 16.73  ? 1137 LYS A NZ    1 
ATOM   3414 H  H     . LYS A 1 267 ? -19.724 -15.777 -7.285  1.00 19.15  ? 1137 LYS A H     1 
ATOM   3415 H  HA    . LYS A 1 267 ? -21.848 -14.087 -7.618  1.00 20.56  ? 1137 LYS A HA    1 
ATOM   3416 H  HB2   . LYS A 1 267 ? -20.285 -15.185 -9.719  1.00 19.28  ? 1137 LYS A HB2   1 
ATOM   3417 H  HB3   . LYS A 1 267 ? -21.517 -14.205 -9.923  1.00 19.28  ? 1137 LYS A HB3   1 
ATOM   3418 H  HG2   . LYS A 1 267 ? -20.285 -12.467 -8.933  1.00 24.38  ? 1137 LYS A HG2   1 
ATOM   3419 H  HG3   . LYS A 1 267 ? -19.043 -13.452 -8.776  1.00 24.38  ? 1137 LYS A HG3   1 
ATOM   3420 H  HD2   . LYS A 1 267 ? -18.997 -13.651 -11.162 1.00 20.80  ? 1137 LYS A HD2   1 
ATOM   3421 H  HD3   . LYS A 1 267 ? -20.098 -12.506 -11.230 1.00 20.80  ? 1137 LYS A HD3   1 
ATOM   3422 H  HE2   . LYS A 1 267 ? -18.579 -10.978 -10.304 1.00 21.57  ? 1137 LYS A HE2   1 
ATOM   3423 H  HE3   . LYS A 1 267 ? -17.477 -12.124 -10.210 1.00 21.57  ? 1137 LYS A HE3   1 
ATOM   3424 H  HZ1   . LYS A 1 267 ? -17.142 -10.850 -12.087 1.00 20.07  ? 1137 LYS A HZ1   1 
ATOM   3425 H  HZ2   . LYS A 1 267 ? -17.464 -12.200 -12.503 1.00 20.07  ? 1137 LYS A HZ2   1 
ATOM   3426 H  HZ3   . LYS A 1 267 ? -18.466 -11.157 -12.589 1.00 20.07  ? 1137 LYS A HZ3   1 
ATOM   3427 N  N     . VAL A 1 268 ? -23.501 -15.702 -8.476  1.00 15.81  ? 1138 VAL A N     1 
ATOM   3428 C  CA    . VAL A 1 268 ? -24.453 -16.636 -9.057  1.00 16.77  ? 1138 VAL A CA    1 
ATOM   3429 C  C     . VAL A 1 268 ? -24.822 -16.109 -10.452 1.00 18.09  ? 1138 VAL A C     1 
ATOM   3430 O  O     . VAL A 1 268 ? -24.552 -14.950 -10.774 1.00 19.34  ? 1138 VAL A O     1 
ATOM   3431 C  CB    . VAL A 1 268 ? -25.726 -16.774 -8.173  1.00 24.11  ? 1138 VAL A CB    1 
ATOM   3432 C  CG1   . VAL A 1 268 ? -25.349 -17.264 -6.777  1.00 23.11  ? 1138 VAL A CG1   1 
ATOM   3433 C  CG2   . VAL A 1 268 ? -26.488 -15.442 -8.092  1.00 24.15  ? 1138 VAL A CG2   1 
ATOM   3434 H  H     . VAL A 1 268 ? -23.833 -14.920 -8.345  1.00 18.97  ? 1138 VAL A H     1 
ATOM   3435 H  HA    . VAL A 1 268 ? -24.037 -17.519 -9.152  1.00 20.12  ? 1138 VAL A HA    1 
ATOM   3436 H  HB    . VAL A 1 268 ? -26.323 -17.439 -8.575  1.00 28.94  ? 1138 VAL A HB    1 
ATOM   3437 H  HG11  . VAL A 1 268 ? -24.397 -17.386 -6.736  1.00 27.73  ? 1138 VAL A HG11  1 
ATOM   3438 H  HG12  . VAL A 1 268 ? -25.624 -16.608 -6.131  1.00 27.73  ? 1138 VAL A HG12  1 
ATOM   3439 H  HG13  . VAL A 1 268 ? -25.794 -18.097 -6.608  1.00 27.73  ? 1138 VAL A HG13  1 
ATOM   3440 H  HG21  . VAL A 1 268 ? -26.020 -14.783 -8.610  1.00 28.98  ? 1138 VAL A HG21  1 
ATOM   3441 H  HG22  . VAL A 1 268 ? -27.373 -15.566 -8.443  1.00 28.98  ? 1138 VAL A HG22  1 
ATOM   3442 H  HG23  . VAL A 1 268 ? -26.535 -15.165 -7.174  1.00 28.98  ? 1138 VAL A HG23  1 
ATOM   3443 N  N     . PRO A 1 269 ? -25.424 -16.957 -11.293 1.00 19.06  ? 1139 PRO A N     1 
ATOM   3444 C  CA    . PRO A 1 269 ? -25.747 -16.487 -12.642 1.00 18.87  ? 1139 PRO A CA    1 
ATOM   3445 C  C     . PRO A 1 269 ? -26.598 -15.231 -12.627 1.00 23.67  ? 1139 PRO A C     1 
ATOM   3446 O  O     . PRO A 1 269 ? -27.570 -15.167 -11.877 1.00 22.84  ? 1139 PRO A O     1 
ATOM   3447 C  CB    . PRO A 1 269 ? -26.539 -17.659 -13.234 1.00 24.00  ? 1139 PRO A CB    1 
ATOM   3448 C  CG    . PRO A 1 269 ? -25.965 -18.855 -12.573 1.00 19.95  ? 1139 PRO A CG    1 
ATOM   3449 C  CD    . PRO A 1 269 ? -25.692 -18.398 -11.137 1.00 17.52  ? 1139 PRO A CD    1 
ATOM   3450 H  HA    . PRO A 1 269 ? -24.933 -16.335 -13.165 1.00 22.65  ? 1139 PRO A HA    1 
ATOM   3451 H  HB2   . PRO A 1 269 ? -27.481 -17.563 -13.020 1.00 28.80  ? 1139 PRO A HB2   1 
ATOM   3452 H  HB3   . PRO A 1 269 ? -26.405 -17.697 -14.194 1.00 28.80  ? 1139 PRO A HB3   1 
ATOM   3453 H  HG2   . PRO A 1 269 ? -26.609 -19.580 -12.588 1.00 23.95  ? 1139 PRO A HG2   1 
ATOM   3454 H  HG3   . PRO A 1 269 ? -25.142 -19.113 -13.016 1.00 23.95  ? 1139 PRO A HG3   1 
ATOM   3455 H  HD2   . PRO A 1 269 ? -26.474 -18.539 -10.582 1.00 21.03  ? 1139 PRO A HD2   1 
ATOM   3456 H  HD3   . PRO A 1 269 ? -24.913 -18.852 -10.780 1.00 21.03  ? 1139 PRO A HD3   1 
ATOM   3457 N  N     . GLY A 1 270 ? -26.243 -14.253 -13.456 1.00 21.32  ? 1140 GLY A N     1 
ATOM   3458 C  CA    . GLY A 1 270 ? -26.995 -13.016 -13.534 1.00 22.50  ? 1140 GLY A CA    1 
ATOM   3459 C  C     . GLY A 1 270 ? -26.392 -11.902 -12.695 1.00 23.52  ? 1140 GLY A C     1 
ATOM   3460 O  O     . GLY A 1 270 ? -26.838 -10.760 -12.787 1.00 25.54  ? 1140 GLY A O     1 
ATOM   3461 H  H     . GLY A 1 270 ? -25.566 -14.286 -13.985 1.00 25.58  ? 1140 GLY A H     1 
ATOM   3462 H  HA2   . GLY A 1 270 ? -27.031 -12.719 -14.456 1.00 26.99  ? 1140 GLY A HA2   1 
ATOM   3463 H  HA3   . GLY A 1 270 ? -27.902 -13.172 -13.227 1.00 26.99  ? 1140 GLY A HA3   1 
ATOM   3464 N  N     . SER A 1 271 ? -25.382 -12.217 -11.879 1.00 18.10  ? 1141 SER A N     1 
ATOM   3465 C  CA    . SER A 1 271 ? -24.760 -11.211 -11.008 1.00 18.48  ? 1141 SER A CA    1 
ATOM   3466 C  C     . SER A 1 271 ? -24.013 -10.196 -11.864 1.00 21.48  ? 1141 SER A C     1 
ATOM   3467 O  O     . SER A 1 271 ? -23.087 -10.560 -12.580 1.00 17.80  ? 1141 SER A O     1 
ATOM   3468 C  CB    . SER A 1 271 ? -23.756 -11.847 -10.041 1.00 20.44  ? 1141 SER A CB    1 
ATOM   3469 O  OG    . SER A 1 271 ? -24.388 -12.725 -9.123  1.00 19.23  ? 1141 SER A OG    1 
ATOM   3470 H  H     . SER A 1 271 ? -25.039 -13.002 -11.811 1.00 21.72  ? 1141 SER A H     1 
ATOM   3471 H  HA    . SER A 1 271 ? -25.449 -10.745 -10.490 1.00 22.17  ? 1141 SER A HA    1 
ATOM   3472 H  HB2   . SER A 1 271 ? -23.103 -12.349 -10.554 1.00 24.53  ? 1141 SER A HB2   1 
ATOM   3473 H  HB3   . SER A 1 271 ? -23.311 -11.142 -9.545  1.00 24.53  ? 1141 SER A HB3   1 
ATOM   3474 H  HG    . SER A 1 271 ? -23.830 -13.051 -8.618  1.00 23.07  ? 1141 SER A HG    1 
ATOM   3475 N  N     . ARG A 1 272 ? -24.377 -8.924  -11.757 1.00 17.49  ? 1142 ARG A N     1 
ATOM   3476 C  CA    . ARG A 1 272 ? -23.820 -7.913  -12.656 1.00 20.11  ? 1142 ARG A CA    1 
ATOM   3477 C  C     . ARG A 1 272 ? -22.976 -6.852  -11.975 1.00 17.51  ? 1142 ARG A C     1 
ATOM   3478 O  O     . ARG A 1 272 ? -23.323 -6.363  -10.899 1.00 17.85  ? 1142 ARG A O     1 
ATOM   3479 C  CB    . ARG A 1 272 ? -24.959 -7.220  -13.410 1.00 18.11  ? 1142 ARG A CB    1 
ATOM   3480 C  CG    . ARG A 1 272 ? -25.525 -8.096  -14.516 1.00 18.89  ? 1142 ARG A CG    1 
ATOM   3481 C  CD    . ARG A 1 272 ? -26.733 -7.488  -15.205 1.00 19.51  ? 1142 ARG A CD    1 
ATOM   3482 N  NE    . ARG A 1 272 ? -27.053 -8.253  -16.414 1.00 18.70  ? 1142 ARG A NE    1 
ATOM   3483 C  CZ    . ARG A 1 272 ? -28.003 -7.934  -17.287 1.00 20.65  ? 1142 ARG A CZ    1 
ATOM   3484 N  NH1   . ARG A 1 272 ? -28.755 -6.863  -17.090 1.00 20.21  ? 1142 ARG A NH1   1 
ATOM   3485 N  NH2   . ARG A 1 272 ? -28.201 -8.702  -18.350 1.00 20.36  ? 1142 ARG A NH2   1 
ATOM   3486 H  H     . ARG A 1 272 ? -24.938 -8.620  -11.180 1.00 20.99  ? 1142 ARG A H     1 
ATOM   3487 H  HA    . ARG A 1 272 ? -23.255 -8.362  -13.318 1.00 24.13  ? 1142 ARG A HA    1 
ATOM   3488 H  HB2   . ARG A 1 272 ? -25.676 -7.018  -12.788 1.00 21.74  ? 1142 ARG A HB2   1 
ATOM   3489 H  HB3   . ARG A 1 272 ? -24.625 -6.404  -13.812 1.00 21.74  ? 1142 ARG A HB3   1 
ATOM   3490 H  HG2   . ARG A 1 272 ? -24.839 -8.238  -15.187 1.00 22.67  ? 1142 ARG A HG2   1 
ATOM   3491 H  HG3   . ARG A 1 272 ? -25.796 -8.947  -14.136 1.00 22.67  ? 1142 ARG A HG3   1 
ATOM   3492 H  HD2   . ARG A 1 272 ? -27.498 -7.517  -14.609 1.00 23.42  ? 1142 ARG A HD2   1 
ATOM   3493 H  HD3   . ARG A 1 272 ? -26.536 -6.573  -15.461 1.00 23.42  ? 1142 ARG A HD3   1 
ATOM   3494 H  HE    . ARG A 1 272 ? -26.591 -8.961  -16.570 1.00 22.44  ? 1142 ARG A HE    1 
ATOM   3495 H  HH11  . ARG A 1 272 ? -28.625 -6.367  -16.399 1.00 24.26  ? 1142 ARG A HH11  1 
ATOM   3496 H  HH12  . ARG A 1 272 ? -29.371 -6.660  -17.654 1.00 24.26  ? 1142 ARG A HH12  1 
ATOM   3497 H  HH21  . ARG A 1 272 ? -27.713 -9.399  -18.474 1.00 24.43  ? 1142 ARG A HH21  1 
ATOM   3498 H  HH22  . ARG A 1 272 ? -28.817 -8.502  -18.916 1.00 24.43  ? 1142 ARG A HH22  1 
ATOM   3499 N  N     . THR A 1 273 ? -21.861 -6.498  -12.616 1.00 15.52  ? 1143 THR A N     1 
ATOM   3500 C  CA    . THR A 1 273 ? -21.173 -5.260  -12.298 1.00 16.75  ? 1143 THR A CA    1 
ATOM   3501 C  C     . THR A 1 273 ? -21.513 -4.288  -13.423 1.00 17.25  ? 1143 THR A C     1 
ATOM   3502 O  O     . THR A 1 273 ? -21.145 -4.504  -14.571 1.00 16.02  ? 1143 THR A O     1 
ATOM   3503 C  CB    . THR A 1 273 ? -19.656 -5.461  -12.180 1.00 19.68  ? 1143 THR A CB    1 
ATOM   3504 O  OG1   . THR A 1 273 ? -19.393 -6.410  -11.137 1.00 18.85  ? 1143 THR A OG1   1 
ATOM   3505 C  CG2   . THR A 1 273 ? -18.964 -4.140  -11.835 1.00 17.07  ? 1143 THR A CG2   1 
ATOM   3506 H  H     . THR A 1 273 ? -21.488 -6.960  -13.238 1.00 18.63  ? 1143 THR A H     1 
ATOM   3507 H  HA    . THR A 1 273 ? -21.512 -4.898  -11.452 1.00 20.09  ? 1143 THR A HA    1 
ATOM   3508 H  HB    . THR A 1 273 ? -19.301 -5.790  -13.021 1.00 23.61  ? 1143 THR A HB    1 
ATOM   3509 H  HG1   . THR A 1 273 ? -18.586 -6.528  -11.062 1.00 22.62  ? 1143 THR A HG1   1 
ATOM   3510 H  HG21  . THR A 1 273 ? -19.135 -3.491  -12.521 1.00 20.49  ? 1143 THR A HG21  1 
ATOM   3511 H  HG22  . THR A 1 273 ? -19.295 -3.806  -10.998 1.00 20.49  ? 1143 THR A HG22  1 
ATOM   3512 H  HG23  . THR A 1 273 ? -18.016 -4.276  -11.764 1.00 20.49  ? 1143 THR A HG23  1 
ATOM   3513 N  N     . PRO A 1 274 ? -22.258 -3.227  -13.103 1.00 17.92  ? 1144 PRO A N     1 
ATOM   3514 C  CA    . PRO A 1 274 ? -22.730 -2.319  -14.157 1.00 16.49  ? 1144 PRO A CA    1 
ATOM   3515 C  C     . PRO A 1 274 ? -21.622 -1.438  -14.739 1.00 16.41  ? 1144 PRO A C     1 
ATOM   3516 O  O     . PRO A 1 274 ? -20.470 -1.510  -14.309 1.00 18.55  ? 1144 PRO A O     1 
ATOM   3517 C  CB    . PRO A 1 274 ? -23.797 -1.479  -13.435 1.00 16.22  ? 1144 PRO A CB    1 
ATOM   3518 C  CG    . PRO A 1 274 ? -23.377 -1.489  -12.013 1.00 20.75  ? 1144 PRO A CG    1 
ATOM   3519 C  CD    . PRO A 1 274 ? -22.776 -2.852  -11.775 1.00 17.92  ? 1144 PRO A CD    1 
ATOM   3520 H  HA    . PRO A 1 274 ? -23.154 -2.828  -14.880 1.00 19.79  ? 1144 PRO A HA    1 
ATOM   3521 H  HB2   . PRO A 1 274 ? -23.798 -0.576  -13.788 1.00 19.47  ? 1144 PRO A HB2   1 
ATOM   3522 H  HB3   . PRO A 1 274 ? -24.668 -1.893  -13.541 1.00 19.47  ? 1144 PRO A HB3   1 
ATOM   3523 H  HG2   . PRO A 1 274 ? -22.717 -0.794  -11.864 1.00 24.90  ? 1144 PRO A HG2   1 
ATOM   3524 H  HG3   . PRO A 1 274 ? -24.151 -1.353  -11.445 1.00 24.90  ? 1144 PRO A HG3   1 
ATOM   3525 H  HD2   . PRO A 1 274 ? -22.052 -2.795  -11.133 1.00 21.51  ? 1144 PRO A HD2   1 
ATOM   3526 H  HD3   . PRO A 1 274 ? -23.459 -3.478  -11.489 1.00 21.51  ? 1144 PRO A HD3   1 
ATOM   3527 N  N     . GLY A 1 275 ? -21.982 -0.616  -15.719 1.00 16.11  ? 1145 GLY A N     1 
ATOM   3528 C  CA    . GLY A 1 275 ? -21.011 0.118   -16.517 1.00 18.93  ? 1145 GLY A CA    1 
ATOM   3529 C  C     . GLY A 1 275 ? -20.122 1.027   -15.689 1.00 21.58  ? 1145 GLY A C     1 
ATOM   3530 O  O     . GLY A 1 275 ? -20.586 1.749   -14.807 1.00 19.07  ? 1145 GLY A O     1 
ATOM   3531 H  H     . GLY A 1 275 ? -22.798 -0.464  -15.944 1.00 19.33  ? 1145 GLY A H     1 
ATOM   3532 H  HA2   . GLY A 1 275 ? -20.446 -0.511  -16.993 1.00 22.71  ? 1145 GLY A HA2   1 
ATOM   3533 H  HA3   . GLY A 1 275 ? -21.479 0.662   -17.170 1.00 22.71  ? 1145 GLY A HA3   1 
ATOM   3534 N  N     . HIS A 1 276 ? -18.828 1.003   -15.981 1.00 17.20  ? 1146 HIS A N     1 
ATOM   3535 C  CA    . HIS A 1 276 ? -17.909 1.916   -15.317 1.00 18.70  ? 1146 HIS A CA    1 
ATOM   3536 C  C     . HIS A 1 276 ? -16.570 2.008   -16.019 1.00 20.62  ? 1146 HIS A C     1 
ATOM   3537 O  O     . HIS A 1 276 ? -16.214 1.161   -16.848 1.00 18.30  ? 1146 HIS A O     1 
ATOM   3538 C  CB    . HIS A 1 276 ? -17.644 1.423   -13.911 1.00 21.25  ? 1146 HIS A CB    1 
ATOM   3539 C  CG    . HIS A 1 276 ? -17.062 0.053   -13.880 1.00 22.12  ? 1146 HIS A CG    1 
ATOM   3540 N  ND1   . HIS A 1 276 ? -17.793 -1.066  -14.224 1.00 27.99  ? 1146 HIS A ND1   1 
ATOM   3541 C  CD2   . HIS A 1 276 ? -15.817 -0.388  -13.587 1.00 26.84  ? 1146 HIS A CD2   1 
ATOM   3542 C  CE1   . HIS A 1 276 ? -17.028 -2.137  -14.128 1.00 27.50  ? 1146 HIS A CE1   1 
ATOM   3543 N  NE2   . HIS A 1 276 ? -15.828 -1.754  -13.731 1.00 30.85  ? 1146 HIS A NE2   1 
ATOM   3544 H  H     . HIS A 1 276 ? -18.460 0.475   -16.552 1.00 20.64  ? 1146 HIS A H     1 
ATOM   3545 H  HA    . HIS A 1 276 ? -18.305 2.811   -15.270 1.00 22.45  ? 1146 HIS A HA    1 
ATOM   3546 H  HB2   . HIS A 1 276 ? -17.018 2.025   -13.478 1.00 25.50  ? 1146 HIS A HB2   1 
ATOM   3547 H  HB3   . HIS A 1 276 ? -18.480 1.405   -13.420 1.00 25.50  ? 1146 HIS A HB3   1 
ATOM   3548 H  HD1   . HIS A 1 276 ? -18.619 -1.066  -14.461 1.00 33.59  ? 1146 HIS A HD1   1 
ATOM   3549 H  HD2   . HIS A 1 276 ? -15.096 0.133   -13.317 1.00 32.21  ? 1146 HIS A HD2   1 
ATOM   3550 H  HE1   . HIS A 1 276 ? -17.293 -3.012  -14.297 1.00 33.00  ? 1146 HIS A HE1   1 
ATOM   3551 N  N     . GLN A 1 277 ? -15.832 3.046   -15.653 1.00 18.09  ? 1147 GLN A N     1 
ATOM   3552 C  CA    . GLN A 1 277 ? -14.388 3.065   -15.817 1.00 17.84  ? 1147 GLN A CA    1 
ATOM   3553 C  C     . GLN A 1 277 ? -13.784 2.831   -14.429 1.00 16.55  ? 1147 GLN A C     1 
ATOM   3554 O  O     . GLN A 1 277 ? -14.394 3.184   -13.419 1.00 16.50  ? 1147 GLN A O     1 
ATOM   3555 C  CB    . GLN A 1 277 ? -13.942 4.419   -16.373 1.00 15.60  ? 1147 GLN A CB    1 
ATOM   3556 C  CG    . GLN A 1 277 ? -14.308 4.589   -17.847 1.00 17.68  ? 1147 GLN A CG    1 
ATOM   3557 C  CD    . GLN A 1 277 ? -14.096 6.012   -18.330 1.00 14.65  ? 1147 GLN A CD    1 
ATOM   3558 O  OE1   . GLN A 1 277 ? -14.689 6.944   -17.800 1.00 21.78  ? 1147 GLN A OE1   1 
ATOM   3559 N  NE2   . GLN A 1 277 ? -13.253 6.180   -19.339 1.00 16.79  ? 1147 GLN A NE2   1 
ATOM   3560 H  H     . GLN A 1 277 ? -16.150 3.764   -15.302 1.00 21.71  ? 1147 GLN A H     1 
ATOM   3561 H  HA    . GLN A 1 277 ? -14.102 2.351   -16.424 1.00 21.40  ? 1147 GLN A HA    1 
ATOM   3562 H  HB2   . GLN A 1 277 ? -14.375 5.126   -15.871 1.00 18.72  ? 1147 GLN A HB2   1 
ATOM   3563 H  HB3   . GLN A 1 277 ? -12.978 4.494   -16.291 1.00 18.72  ? 1147 GLN A HB3   1 
ATOM   3564 H  HG2   . GLN A 1 277 ? -13.751 4.003   -18.382 1.00 21.22  ? 1147 GLN A HG2   1 
ATOM   3565 H  HG3   . GLN A 1 277 ? -15.243 4.365   -17.970 1.00 21.22  ? 1147 GLN A HG3   1 
ATOM   3566 H  HE21  . GLN A 1 277 ? -12.857 5.500   -19.686 1.00 20.14  ? 1147 GLN A HE21  1 
ATOM   3567 H  HE22  . GLN A 1 277 ? -13.102 6.968   -19.647 1.00 20.14  ? 1147 GLN A HE22  1 
ATOM   3568 N  N     . GLU A 1 278 ? -12.598 2.241   -14.366 1.00 15.73  ? 1148 GLU A N     1 
ATOM   3569 C  CA    . GLU A 1 278 ? -11.924 2.060   -13.073 1.00 15.68  ? 1148 GLU A CA    1 
ATOM   3570 C  C     . GLU A 1 278 ? -11.652 3.409   -12.400 1.00 20.98  ? 1148 GLU A C     1 
ATOM   3571 O  O     . GLU A 1 278 ? -11.616 4.449   -13.052 1.00 16.24  ? 1148 GLU A O     1 
ATOM   3572 C  CB    . GLU A 1 278 ? -10.584 1.356   -13.256 1.00 16.52  ? 1148 GLU A CB    1 
ATOM   3573 C  CG    . GLU A 1 278 ? -10.680 -0.025  -13.848 1.00 16.55  ? 1148 GLU A CG    1 
ATOM   3574 C  CD    . GLU A 1 278 ? -11.594 -0.909  -13.032 1.00 19.76  ? 1148 GLU A CD    1 
ATOM   3575 O  OE1   . GLU A 1 278 ? -11.410 -1.038  -11.804 1.00 19.34  ? 1148 GLU A OE1   1 
ATOM   3576 O  OE2   . GLU A 1 278 ? -12.518 -1.443  -13.629 1.00 23.47  ? 1148 GLU A OE2   1 
ATOM   3577 H  H     . GLU A 1 278 ? -12.163 1.938   -15.043 1.00 18.88  ? 1148 GLU A H     1 
ATOM   3578 H  HA    . GLU A 1 278 ? -12.486 1.519   -12.480 1.00 18.82  ? 1148 GLU A HA    1 
ATOM   3579 H  HB2   . GLU A 1 278 ? -10.030 1.891   -13.846 1.00 19.83  ? 1148 GLU A HB2   1 
ATOM   3580 H  HB3   . GLU A 1 278 ? -10.155 1.275   -12.389 1.00 19.83  ? 1148 GLU A HB3   1 
ATOM   3581 H  HG2   . GLU A 1 278 ? -11.038 0.036   -14.747 1.00 19.86  ? 1148 GLU A HG2   1 
ATOM   3582 H  HG3   . GLU A 1 278 ? -9.799  -0.430  -13.864 1.00 19.86  ? 1148 GLU A HG3   1 
ATOM   3583 N  N     . ASN A 1 279 ? -11.439 3.377   -11.089 1.00 16.58  ? 1149 ASN A N     1 
ATOM   3584 C  CA    . ASN A 1 279 ? -11.049 4.578   -10.345 1.00 14.54  ? 1149 ASN A CA    1 
ATOM   3585 C  C     . ASN A 1 279 ? -9.799  5.190   -10.955 1.00 15.19  ? 1149 ASN A C     1 
ATOM   3586 O  O     . ASN A 1 279 ? -8.811  4.500   -11.172 1.00 14.29  ? 1149 ASN A O     1 
ATOM   3587 C  CB    . ASN A 1 279 ? -10.837 4.213   -8.864  1.00 15.34  ? 1149 ASN A CB    1 
ATOM   3588 C  CG    . ASN A 1 279 ? -12.134 3.835   -8.178  1.00 22.19  ? 1149 ASN A CG    1 
ATOM   3589 O  OD1   . ASN A 1 279 ? -12.450 2.651   -7.996  1.00 25.95  ? 1149 ASN A OD1   1 
ATOM   3590 N  ND2   . ASN A 1 279 ? -12.918 4.836   -7.841  1.00 15.63  ? 1149 ASN A ND2   1 
ATOM   3591 H  H     . ASN A 1 279 ? -11.513 2.671   -10.602 1.00 19.90  ? 1149 ASN A H     1 
ATOM   3592 H  HA    . ASN A 1 279 ? -11.771 5.239   -10.398 1.00 17.45  ? 1149 ASN A HA    1 
ATOM   3593 H  HB2   . ASN A 1 279 ? -10.233 3.456   -8.806  1.00 18.41  ? 1149 ASN A HB2   1 
ATOM   3594 H  HB3   . ASN A 1 279 ? -10.461 4.977   -8.398  1.00 18.41  ? 1149 ASN A HB3   1 
ATOM   3595 H  HD21  . ASN A 1 279 ? -12.681 5.645   -8.013  1.00 18.75  ? 1149 ASN A HD21  1 
ATOM   3596 H  HD22  . ASN A 1 279 ? -13.668 4.682   -7.449  1.00 18.75  ? 1149 ASN A HD22  1 
ATOM   3597 N  N     . ASN A 1 280 ? -9.881  6.480   -11.272 1.00 12.85  ? 1150 ASN A N     1 
ATOM   3598 C  CA    . ASN A 1 280 ? -8.797  7.216   -11.892 1.00 14.80  ? 1150 ASN A CA    1 
ATOM   3599 C  C     . ASN A 1 280 ? -8.229  6.536   -13.142 1.00 16.66  ? 1150 ASN A C     1 
ATOM   3600 O  O     . ASN A 1 280 ? -7.061  6.703   -13.473 1.00 15.75  ? 1150 ASN A O     1 
ATOM   3601 C  CB    . ASN A 1 280 ? -7.728  7.549   -10.849 1.00 16.19  ? 1150 ASN A CB    1 
ATOM   3602 C  CG    . ASN A 1 280 ? -8.221  8.589   -9.848  1.00 18.90  ? 1150 ASN A CG    1 
ATOM   3603 O  OD1   . ASN A 1 280 ? -8.588  8.260   -8.721  1.00 15.67  ? 1150 ASN A OD1   1 
ATOM   3604 N  ND2   . ASN A 1 280 ? -8.293  9.847   -10.287 1.00 15.80  ? 1150 ASN A ND2   1 
ATOM   3605 H  H     . ASN A 1 280 ? -10.580 6.960   -11.130 1.00 15.42  ? 1150 ASN A H     1 
ATOM   3606 H  HA    . ASN A 1 280 ? -9.164  8.074   -12.192 1.00 17.76  ? 1150 ASN A HA    1 
ATOM   3607 H  HB2   . ASN A 1 280 ? -7.496  6.744   -10.361 1.00 19.43  ? 1150 ASN A HB2   1 
ATOM   3608 H  HB3   . ASN A 1 280 ? -6.945  7.906   -11.297 1.00 19.43  ? 1150 ASN A HB3   1 
ATOM   3609 H  HD21  . ASN A 1 280 ? -8.565  10.471  -9.761  1.00 18.97  ? 1150 ASN A HD21  1 
ATOM   3610 H  HD22  . ASN A 1 280 ? -8.068  10.034  -11.095 1.00 18.97  ? 1150 ASN A HD22  1 
ATOM   3611 N  N     . ASN A 1 281 ? -9.092  5.795   -13.843 1.00 13.93  ? 1151 ASN A N     1 
ATOM   3612 C  CA    . ASN A 1 281 ? -8.733  5.159   -15.118 1.00 12.43  ? 1151 ASN A CA    1 
ATOM   3613 C  C     . ASN A 1 281 ? -7.537  4.195   -15.039 1.00 13.81  ? 1151 ASN A C     1 
ATOM   3614 O  O     . ASN A 1 281 ? -6.838  3.992   -16.027 1.00 15.33  ? 1151 ASN A O     1 
ATOM   3615 C  CB    . ASN A 1 281 ? -8.470  6.243   -16.177 1.00 13.59  ? 1151 ASN A CB    1 
ATOM   3616 C  CG    . ASN A 1 281 ? -9.757  6.835   -16.755 1.00 21.29  ? 1151 ASN A CG    1 
ATOM   3617 O  OD1   . ASN A 1 281 ? -10.814 6.200   -16.741 1.00 21.94  ? 1151 ASN A OD1   1 
ATOM   3618 N  ND2   . ASN A 1 281 ? -9.665  8.054   -17.273 1.00 20.13  ? 1151 ASN A ND2   1 
ATOM   3619 H  H     . ASN A 1 281 ? -9.903  5.644   -13.600 1.00 16.71  ? 1151 ASN A H     1 
ATOM   3620 H  HA    . ASN A 1 281 ? -9.503  4.636   -15.424 1.00 14.92  ? 1151 ASN A HA    1 
ATOM   3621 H  HB2   . ASN A 1 281 ? -7.963  6.964   -15.772 1.00 16.30  ? 1151 ASN A HB2   1 
ATOM   3622 H  HB3   . ASN A 1 281 ? -7.965  5.853   -16.909 1.00 16.30  ? 1151 ASN A HB3   1 
ATOM   3623 H  HD21  . ASN A 1 281 ? -8.910  8.466   -17.272 1.00 24.16  ? 1151 ASN A HD21  1 
ATOM   3624 H  HD22  . ASN A 1 281 ? -10.360 8.431   -17.610 1.00 24.16  ? 1151 ASN A HD22  1 
ATOM   3625 N  N     . PHE A 1 282 ? -7.289  3.593   -13.875 1.00 14.59  ? 1152 PHE A N     1 
ATOM   3626 C  CA    . PHE A 1 282 ? -6.227  2.585   -13.779 1.00 14.38  ? 1152 PHE A CA    1 
ATOM   3627 C  C     . PHE A 1 282 ? -6.628  1.259   -14.436 1.00 17.04  ? 1152 PHE A C     1 
ATOM   3628 O  O     . PHE A 1 282 ? -7.804  0.918   -14.491 1.00 15.81  ? 1152 PHE A O     1 
ATOM   3629 C  CB    . PHE A 1 282 ? -5.796  2.383   -12.315 1.00 14.11  ? 1152 PHE A CB    1 
ATOM   3630 C  CG    . PHE A 1 282 ? -4.845  3.452   -11.863 1.00 15.15  ? 1152 PHE A CG    1 
ATOM   3631 C  CD1   . PHE A 1 282 ? -3.487  3.303   -12.046 1.00 18.01  ? 1152 PHE A CD1   1 
ATOM   3632 C  CD2   . PHE A 1 282 ? -5.324  4.646   -11.365 1.00 18.24  ? 1152 PHE A CD2   1 
ATOM   3633 C  CE1   . PHE A 1 282 ? -2.605  4.318   -11.682 1.00 20.53  ? 1152 PHE A CE1   1 
ATOM   3634 C  CE2   . PHE A 1 282 ? -4.459  5.665   -11.012 1.00 17.28  ? 1152 PHE A CE2   1 
ATOM   3635 C  CZ    . PHE A 1 282 ? -3.101  5.502   -11.168 1.00 14.76  ? 1152 PHE A CZ    1 
ATOM   3636 H  H     . PHE A 1 282 ? -7.710  3.744   -13.140 1.00 17.51  ? 1152 PHE A H     1 
ATOM   3637 H  HA    . PHE A 1 282 ? -5.446  2.921   -14.265 1.00 17.25  ? 1152 PHE A HA    1 
ATOM   3638 H  HB2   . PHE A 1 282 ? -6.580  2.413   -11.745 1.00 16.94  ? 1152 PHE A HB2   1 
ATOM   3639 H  HB3   . PHE A 1 282 ? -5.351  1.526   -12.229 1.00 16.94  ? 1152 PHE A HB3   1 
ATOM   3640 H  HD1   . PHE A 1 282 ? -3.155  2.509   -12.398 1.00 21.62  ? 1152 PHE A HD1   1 
ATOM   3641 H  HD2   . PHE A 1 282 ? -6.240  4.767   -11.263 1.00 21.89  ? 1152 PHE A HD2   1 
ATOM   3642 H  HE1   . PHE A 1 282 ? -1.688  4.203   -11.790 1.00 24.64  ? 1152 PHE A HE1   1 
ATOM   3643 H  HE2   . PHE A 1 282 ? -4.794  6.456   -10.657 1.00 20.73  ? 1152 PHE A HE2   1 
ATOM   3644 H  HZ    . PHE A 1 282 ? -2.518  6.181   -10.914 1.00 17.71  ? 1152 PHE A HZ    1 
ATOM   3645 N  N     . CYS A 1 283 ? -5.647  0.549   -14.982 1.00 15.43  ? 1153 CYS A N     1 
ATOM   3646 C  CA    . CYS A 1 283 ? -5.910  -0.756  -15.592 1.00 13.93  ? 1153 CYS A CA    1 
ATOM   3647 C  C     . CYS A 1 283 ? -6.431  -1.690  -14.528 1.00 15.50  ? 1153 CYS A C     1 
ATOM   3648 O  O     . CYS A 1 283 ? -6.170  -1.486  -13.346 1.00 16.54  ? 1153 CYS A O     1 
ATOM   3649 C  CB    . CYS A 1 283 ? -4.634  -1.318  -16.223 1.00 13.82  ? 1153 CYS A CB    1 
ATOM   3650 S  SG    . CYS A 1 283 ? -3.982  -0.254  -17.574 1.00 17.38  ? 1153 CYS A SG    1 
ATOM   3651 H  H     . CYS A 1 283 ? -4.823  0.795   -15.013 1.00 18.52  ? 1153 CYS A H     1 
ATOM   3652 H  HA    . CYS A 1 283 ? -6.591  -0.663  -16.291 1.00 16.71  ? 1153 CYS A HA    1 
ATOM   3653 H  HB2   . CYS A 1 283 ? -3.949  -1.389  -15.540 1.00 16.58  ? 1153 CYS A HB2   1 
ATOM   3654 H  HB3   . CYS A 1 283 ? -4.824  -2.193  -16.595 1.00 16.58  ? 1153 CYS A HB3   1 
ATOM   3655 H  HG    . CYS A 1 283 ? -3.732  0.832   -17.129 1.00 20.86  ? 1153 CYS A HG    1 
ATOM   3656 N  N     A SER A 1 284 ? -7.171  -2.719  -14.927 0.37 14.92  ? 1154 SER A N     1 
ATOM   3657 N  N     B SER A 1 284 ? -7.170  -2.711  -14.951 0.63 14.54  ? 1154 SER A N     1 
ATOM   3658 C  CA    A SER A 1 284 ? -7.662  -3.695  -13.964 0.37 12.74  ? 1154 SER A CA    1 
ATOM   3659 C  CA    B SER A 1 284 ? -7.690  -3.710  -14.032 0.63 14.47  ? 1154 SER A CA    1 
ATOM   3660 C  C     A SER A 1 284 ? -7.349  -5.114  -14.448 0.37 15.59  ? 1154 SER A C     1 
ATOM   3661 C  C     B SER A 1 284 ? -7.218  -5.100  -14.471 0.63 16.08  ? 1154 SER A C     1 
ATOM   3662 O  O     A SER A 1 284 ? -7.370  -5.394  -15.642 0.37 15.54  ? 1154 SER A O     1 
ATOM   3663 O  O     B SER A 1 284 ? -7.008  -5.347  -15.659 0.63 13.39  ? 1154 SER A O     1 
ATOM   3664 C  CB    A SER A 1 284 ? -9.163  -3.502  -13.717 0.37 15.38  ? 1154 SER A CB    1 
ATOM   3665 C  CB    B SER A 1 284 ? -9.221  -3.647  -13.995 0.63 17.51  ? 1154 SER A CB    1 
ATOM   3666 O  OG    A SER A 1 284 ? -9.936  -4.084  -14.746 0.37 15.69  ? 1154 SER A OG    1 
ATOM   3667 O  OG    B SER A 1 284 ? -9.743  -4.532  -13.020 0.63 19.45  ? 1154 SER A OG    1 
ATOM   3668 H  H     A SER A 1 284 ? -7.400  -2.873  -15.742 0.37 17.91  ? 1154 SER A H     1 
ATOM   3669 H  H     B SER A 1 284 ? -7.385  -2.846  -15.773 0.63 17.45  ? 1154 SER A H     1 
ATOM   3670 H  HA    A SER A 1 284 ? -7.198  -3.560  -13.112 0.37 15.29  ? 1154 SER A HA    1 
ATOM   3671 H  HA    B SER A 1 284 ? -7.349  -3.536  -13.130 0.63 17.37  ? 1154 SER A HA    1 
ATOM   3672 H  HB2   A SER A 1 284 ? -9.398  -3.920  -12.874 0.37 18.45  ? 1154 SER A HB2   1 
ATOM   3673 H  HB2   B SER A 1 284 ? -9.493  -2.742  -13.776 0.63 21.01  ? 1154 SER A HB2   1 
ATOM   3674 H  HB3   A SER A 1 284 ? -9.355  -2.552  -13.679 0.37 18.45  ? 1154 SER A HB3   1 
ATOM   3675 H  HB3   B SER A 1 284 ? -9.568  -3.896  -14.865 0.63 21.01  ? 1154 SER A HB3   1 
ATOM   3676 H  HG    A SER A 1 284 ? -10.734 -3.970  -14.596 0.37 18.83  ? 1154 SER A HG    1 
ATOM   3677 H  HG    B SER A 1 284 ? -9.131  -4.927  -12.644 0.63 23.34  ? 1154 SER A HG    1 
ATOM   3678 N  N     . VAL A 1 285 ? -7.032  -5.986  -13.496 1.00 13.82  ? 1155 VAL A N     1 
ATOM   3679 C  CA    . VAL A 1 285 ? -6.654  -7.371  -13.755 1.00 17.06  ? 1155 VAL A CA    1 
ATOM   3680 C  C     . VAL A 1 285 ? -7.715  -8.220  -13.065 1.00 14.67  ? 1155 VAL A C     1 
ATOM   3681 O  O     . VAL A 1 285 ? -8.044  -7.970  -11.907 1.00 14.91  ? 1155 VAL A O     1 
ATOM   3682 C  CB    . VAL A 1 285 ? -5.271  -7.680  -13.122 1.00 17.49  ? 1155 VAL A CB    1 
ATOM   3683 C  CG1   . VAL A 1 285 ? -4.941  -9.165  -13.224 1.00 18.63  ? 1155 VAL A CG1   1 
ATOM   3684 C  CG2   . VAL A 1 285 ? -4.175  -6.823  -13.784 1.00 19.00  ? 1155 VAL A CG2   1 
ATOM   3685 H  H     A VAL A 1 285 ? -7.029  -5.789  -12.659 0.50 16.58  ? 1155 VAL A H     1 
ATOM   3686 H  H     B VAL A 1 285 ? -7.120  -5.804  -12.660 0.50 16.58  ? 1155 VAL A H     1 
ATOM   3687 H  HA    . VAL A 1 285 ? -6.638  -7.562  -14.716 1.00 20.47  ? 1155 VAL A HA    1 
ATOM   3688 H  HB    . VAL A 1 285 ? -5.300  -7.446  -12.171 1.00 20.99  ? 1155 VAL A HB    1 
ATOM   3689 H  HG11  . VAL A 1 285 ? -4.082  -9.322  -12.825 1.00 22.35  ? 1155 VAL A HG11  1 
ATOM   3690 H  HG12  . VAL A 1 285 ? -5.615  -9.667  -12.761 1.00 22.35  ? 1155 VAL A HG12  1 
ATOM   3691 H  HG13  . VAL A 1 285 ? -4.923  -9.417  -14.150 1.00 22.35  ? 1155 VAL A HG13  1 
ATOM   3692 H  HG21  . VAL A 1 285 ? -3.330  -7.030  -13.378 1.00 22.81  ? 1155 VAL A HG21  1 
ATOM   3693 H  HG22  . VAL A 1 285 ? -4.146  -7.024  -14.722 1.00 22.81  ? 1155 VAL A HG22  1 
ATOM   3694 H  HG23  . VAL A 1 285 ? -4.383  -5.895  -13.653 1.00 22.81  ? 1155 VAL A HG23  1 
ATOM   3695 N  N     . ASN A 1 286 ? -8.262  -9.214  -13.760 1.00 15.51  ? 1156 ASN A N     1 
ATOM   3696 C  CA    . ASN A 1 286 ? -9.347  -10.019 -13.190 1.00 15.70  ? 1156 ASN A CA    1 
ATOM   3697 C  C     . ASN A 1 286 ? -9.134  -11.477 -13.582 1.00 13.91  ? 1156 ASN A C     1 
ATOM   3698 O  O     . ASN A 1 286 ? -8.983  -11.791 -14.763 1.00 14.81  ? 1156 ASN A O     1 
ATOM   3699 C  CB    . ASN A 1 286 ? -10.701 -9.504  -13.722 1.00 15.49  ? 1156 ASN A CB    1 
ATOM   3700 C  CG    . ASN A 1 286 ? -11.892 -10.281 -13.182 1.00 17.38  ? 1156 ASN A CG    1 
ATOM   3701 O  OD1   . ASN A 1 286 ? -11.955 -11.518 -13.286 1.00 15.06  ? 1156 ASN A OD1   1 
ATOM   3702 N  ND2   . ASN A 1 286 ? -12.861 -9.555  -12.618 1.00 16.30  ? 1156 ASN A ND2   1 
ATOM   3703 H  H     . ASN A 1 286 ? -8.028  -9.442  -14.555 1.00 18.61  ? 1156 ASN A H     1 
ATOM   3704 H  HA    . ASN A 1 286 ? -9.340  -9.948  -12.212 1.00 18.85  ? 1156 ASN A HA    1 
ATOM   3705 H  HB2   . ASN A 1 286 ? -10.808 -8.576  -13.463 1.00 18.59  ? 1156 ASN A HB2   1 
ATOM   3706 H  HB3   . ASN A 1 286 ? -10.709 -9.581  -14.689 1.00 18.59  ? 1156 ASN A HB3   1 
ATOM   3707 H  HD21  . ASN A 1 286 ? -13.557 -9.943  -12.296 1.00 19.56  ? 1156 ASN A HD21  1 
ATOM   3708 H  HD22  . ASN A 1 286 ? -12.788 -8.699  -12.577 1.00 19.56  ? 1156 ASN A HD22  1 
ATOM   3709 N  N     . ILE A 1 287 ? -9.104  -12.371 -12.602 1.00 13.34  ? 1157 ILE A N     1 
ATOM   3710 C  CA    . ILE A 1 287 ? -8.971  -13.789 -12.903 1.00 16.14  ? 1157 ILE A CA    1 
ATOM   3711 C  C     . ILE A 1 287 ? -10.237 -14.501 -12.452 1.00 15.67  ? 1157 ILE A C     1 
ATOM   3712 O  O     . ILE A 1 287 ? -10.666 -14.356 -11.303 1.00 16.32  ? 1157 ILE A O     1 
ATOM   3713 C  CB    . ILE A 1 287 ? -7.743  -14.401 -12.189 1.00 15.86  ? 1157 ILE A CB    1 
ATOM   3714 C  CG1   . ILE A 1 287 ? -6.448  -13.740 -12.684 1.00 14.80  ? 1157 ILE A CG1   1 
ATOM   3715 C  CG2   . ILE A 1 287 ? -7.672  -15.911 -12.448 1.00 17.57  ? 1157 ILE A CG2   1 
ATOM   3716 C  CD1   . ILE A 1 287 ? -5.185  -14.180 -11.885 1.00 17.46  ? 1157 ILE A CD1   1 
ATOM   3717 H  H     . ILE A 1 287 ? -9.159  -12.186 -11.764 1.00 16.00  ? 1157 ILE A H     1 
ATOM   3718 H  HA    . ILE A 1 287 ? -8.867  -13.914 -13.870 1.00 19.37  ? 1157 ILE A HA    1 
ATOM   3719 H  HB    . ILE A 1 287 ? -7.827  -14.251 -11.235 1.00 19.03  ? 1157 ILE A HB    1 
ATOM   3720 H  HG12  . ILE A 1 287 ? -6.310  -13.978 -13.614 1.00 17.76  ? 1157 ILE A HG12  1 
ATOM   3721 H  HG13  . ILE A 1 287 ? -6.535  -12.778 -12.599 1.00 17.76  ? 1157 ILE A HG13  1 
ATOM   3722 H  HG21  . ILE A 1 287 ? -6.904  -16.270 -11.997 1.00 21.09  ? 1157 ILE A HG21  1 
ATOM   3723 H  HG22  . ILE A 1 287 ? -8.471  -16.324 -12.113 1.00 21.09  ? 1157 ILE A HG22  1 
ATOM   3724 H  HG23  . ILE A 1 287 ? -7.597  -16.063 -13.393 1.00 21.09  ? 1157 ILE A HG23  1 
ATOM   3725 H  HD11  . ILE A 1 287 ? -5.079  -15.130 -11.968 1.00 20.96  ? 1157 ILE A HD11  1 
ATOM   3726 H  HD12  . ILE A 1 287 ? -4.417  -13.731 -12.245 1.00 20.96  ? 1157 ILE A HD12  1 
ATOM   3727 H  HD13  . ILE A 1 287 ? -5.302  -13.942 -10.962 1.00 20.96  ? 1157 ILE A HD13  1 
ATOM   3728 N  N     . ASN A 1 288 ? -10.846 -15.255 -13.360 1.00 15.44  ? 1158 ASN A N     1 
ATOM   3729 C  CA    . ASN A 1 288 ? -12.033 -16.037 -13.035 1.00 15.43  ? 1158 ASN A CA    1 
ATOM   3730 C  C     . ASN A 1 288 ? -11.602 -17.349 -12.371 1.00 14.91  ? 1158 ASN A C     1 
ATOM   3731 O  O     . ASN A 1 288 ? -10.835 -18.118 -12.945 1.00 15.83  ? 1158 ASN A O     1 
ATOM   3732 C  CB    . ASN A 1 288 ? -12.862 -16.283 -14.308 1.00 18.98  ? 1158 ASN A CB    1 
ATOM   3733 C  CG    . ASN A 1 288 ? -14.118 -17.111 -14.050 1.00 23.24  ? 1158 ASN A CG    1 
ATOM   3734 O  OD1   . ASN A 1 288 ? -14.398 -17.488 -12.919 1.00 22.21  ? 1158 ASN A OD1   1 
ATOM   3735 N  ND2   . ASN A 1 288 ? -14.891 -17.375 -15.103 1.00 20.11  ? 1158 ASN A ND2   1 
ATOM   3736 H  H     . ASN A 1 288 ? -10.589 -15.331 -14.178 1.00 18.52  ? 1158 ASN A H     1 
ATOM   3737 H  HA    . ASN A 1 288 ? -12.586 -15.538 -12.399 1.00 18.51  ? 1158 ASN A HA    1 
ATOM   3738 H  HB2   . ASN A 1 288 ? -13.138 -15.428 -14.674 1.00 22.78  ? 1158 ASN A HB2   1 
ATOM   3739 H  HB3   . ASN A 1 288 ? -12.317 -16.760 -14.953 1.00 22.78  ? 1158 ASN A HB3   1 
ATOM   3740 H  HD21  . ASN A 1 288 ? -15.608 -17.838 -15.005 1.00 24.13  ? 1158 ASN A HD21  1 
ATOM   3741 H  HD22  . ASN A 1 288 ? -14.671 -17.082 -15.882 1.00 24.13  ? 1158 ASN A HD22  1 
ATOM   3742 N  N     . ILE A 1 289 ? -12.063 -17.565 -11.140 1.00 14.93  ? 1159 ILE A N     1 
ATOM   3743 C  CA    . ILE A 1 289 ? -11.748 -18.778 -10.363 1.00 14.37  ? 1159 ILE A CA    1 
ATOM   3744 C  C     . ILE A 1 289 ? -12.575 -19.970 -10.816 1.00 18.85  ? 1159 ILE A C     1 
ATOM   3745 O  O     . ILE A 1 289 ? -12.133 -21.126 -10.716 1.00 19.98  ? 1159 ILE A O     1 
ATOM   3746 C  CB    . ILE A 1 289 ? -12.045 -18.546 -8.860  1.00 15.38  ? 1159 ILE A CB    1 
ATOM   3747 C  CG1   . ILE A 1 289 ? -11.283 -17.318 -8.337  1.00 16.75  ? 1159 ILE A CG1   1 
ATOM   3748 C  CG2   . ILE A 1 289 ? -11.718 -19.803 -8.018  1.00 17.16  ? 1159 ILE A CG2   1 
ATOM   3749 C  CD1   . ILE A 1 289 ? -9.798  -17.354 -8.597  1.00 18.46  ? 1159 ILE A CD1   1 
ATOM   3750 H  H     . ILE A 1 289 ? -12.572 -17.014 -10.719 1.00 17.92  ? 1159 ILE A H     1 
ATOM   3751 H  HA    . ILE A 1 289 ? -10.798 -18.997 -10.465 1.00 17.24  ? 1159 ILE A HA    1 
ATOM   3752 H  HB    . ILE A 1 289 ? -12.994 -18.367 -8.769  1.00 18.46  ? 1159 ILE A HB    1 
ATOM   3753 H  HG12  . ILE A 1 289 ? -11.638 -16.525 -8.768  1.00 20.10  ? 1159 ILE A HG12  1 
ATOM   3754 H  HG13  . ILE A 1 289 ? -11.413 -17.256 -7.378  1.00 20.10  ? 1159 ILE A HG13  1 
ATOM   3755 H  HG21  . ILE A 1 289 ? -12.255 -20.535 -8.329  1.00 20.59  ? 1159 ILE A HG21  1 
ATOM   3756 H  HG22  . ILE A 1 289 ? -10.787 -20.014 -8.119  1.00 20.59  ? 1159 ILE A HG22  1 
ATOM   3757 H  HG23  . ILE A 1 289 ? -11.915 -19.621 -7.096  1.00 20.59  ? 1159 ILE A HG23  1 
ATOM   3758 H  HD11  . ILE A 1 289 ? -9.400  -16.556 -8.242  1.00 22.15  ? 1159 ILE A HD11  1 
ATOM   3759 H  HD12  . ILE A 1 289 ? -9.424  -18.126 -8.167  1.00 22.15  ? 1159 ILE A HD12  1 
ATOM   3760 H  HD13  . ILE A 1 289 ? -9.648  -17.402 -9.544  1.00 22.15  ? 1159 ILE A HD13  1 
ATOM   3761 N  N     . GLY A 1 290 ? -13.783 -19.693 -11.298 1.00 17.61  ? 1160 GLY A N     1 
ATOM   3762 C  CA    . GLY A 1 290 ? -14.690 -20.737 -11.736 1.00 19.17  ? 1160 GLY A CA    1 
ATOM   3763 C  C     . GLY A 1 290 ? -15.631 -21.138 -10.612 1.00 20.09  ? 1160 GLY A C     1 
ATOM   3764 O  O     . GLY A 1 290 ? -15.668 -20.495 -9.547  1.00 19.10  ? 1160 GLY A O     1 
ATOM   3765 H  H     . GLY A 1 290 ? -14.100 -18.898 -11.380 1.00 21.14  ? 1160 GLY A H     1 
ATOM   3766 H  HA2   . GLY A 1 290 ? -15.217 -20.421 -12.487 1.00 23.00  ? 1160 GLY A HA2   1 
ATOM   3767 H  HA3   . GLY A 1 290 ? -14.185 -21.517 -12.015 1.00 23.00  ? 1160 GLY A HA3   1 
ATOM   3768 N  N     . PRO A 1 291 ? -16.385 -22.220 -10.813 1.00 19.11  ? 1161 PRO A N     1 
ATOM   3769 C  CA    . PRO A 1 291 ? -16.338 -23.146 -11.949 1.00 19.09  ? 1161 PRO A CA    1 
ATOM   3770 C  C     . PRO A 1 291 ? -17.032 -22.633 -13.207 1.00 21.80  ? 1161 PRO A C     1 
ATOM   3771 O  O     . PRO A 1 291 ? -16.803 -23.201 -14.275 1.00 22.38  ? 1161 PRO A O     1 
ATOM   3772 C  CB    . PRO A 1 291 ? -17.081 -24.376 -11.408 1.00 25.65  ? 1161 PRO A CB    1 
ATOM   3773 C  CG    . PRO A 1 291 ? -18.075 -23.803 -10.435 1.00 22.29  ? 1161 PRO A CG    1 
ATOM   3774 C  CD    . PRO A 1 291 ? -17.342 -22.660 -9.777  1.00 23.50  ? 1161 PRO A CD    1 
ATOM   3775 H  HA    . PRO A 1 291 ? -15.412 -23.388 -12.159 1.00 22.91  ? 1161 PRO A HA    1 
ATOM   3776 H  HB2   . PRO A 1 291 ? -17.532 -24.835 -12.134 1.00 30.78  ? 1161 PRO A HB2   1 
ATOM   3777 H  HB3   . PRO A 1 291 ? -16.456 -24.966 -10.958 1.00 30.78  ? 1161 PRO A HB3   1 
ATOM   3778 H  HG2   . PRO A 1 291 ? -18.856 -23.483 -10.912 1.00 26.75  ? 1161 PRO A HG2   1 
ATOM   3779 H  HG3   . PRO A 1 291 ? -18.320 -24.477 -9.781  1.00 26.75  ? 1161 PRO A HG3   1 
ATOM   3780 H  HD2   . PRO A 1 291 ? -17.959 -21.944 -9.561  1.00 28.20  ? 1161 PRO A HD2   1 
ATOM   3781 H  HD3   . PRO A 1 291 ? -16.868 -22.971 -8.990  1.00 28.20  ? 1161 PRO A HD3   1 
ATOM   3782 N  N     . GLY A 1 292 ? -17.847 -21.584 -13.090 1.00 19.78  ? 1162 GLY A N     1 
ATOM   3783 C  CA    . GLY A 1 292 ? -18.634 -21.084 -14.211 1.00 20.62  ? 1162 GLY A CA    1 
ATOM   3784 C  C     . GLY A 1 292 ? -17.946 -19.954 -14.970 1.00 22.17  ? 1162 GLY A C     1 
ATOM   3785 O  O     . GLY A 1 292 ? -16.818 -19.583 -14.647 1.00 18.72  ? 1162 GLY A O     1 
ATOM   3786 H  H     . GLY A 1 292 ? -17.962 -21.141 -12.361 1.00 23.73  ? 1162 GLY A H     1 
ATOM   3787 H  HA2   . GLY A 1 292 ? -18.803 -21.809 -14.833 1.00 24.74  ? 1162 GLY A HA2   1 
ATOM   3788 H  HA3   . GLY A 1 292 ? -19.486 -20.757 -13.884 1.00 24.74  ? 1162 GLY A HA3   1 
ATOM   3789 N  N     . ASP A 1 293 ? -18.624 -19.409 -15.983 1.00 17.67  ? 1163 ASP A N     1 
ATOM   3790 C  CA    . ASP A 1 293 ? -18.029 -18.395 -16.851 1.00 17.44  ? 1163 ASP A CA    1 
ATOM   3791 C  C     . ASP A 1 293 ? -18.611 -17.016 -16.578 1.00 15.90  ? 1163 ASP A C     1 
ATOM   3792 O  O     . ASP A 1 293 ? -19.723 -16.904 -16.080 1.00 16.87  ? 1163 ASP A O     1 
ATOM   3793 C  CB    . ASP A 1 293 ? -18.316 -18.712 -18.328 1.00 20.49  ? 1163 ASP A CB    1 
ATOM   3794 C  CG    . ASP A 1 293 ? -17.758 -20.062 -18.779 1.00 27.24  ? 1163 ASP A CG    1 
ATOM   3795 O  OD1   . ASP A 1 293 ? -16.663 -20.459 -18.351 1.00 23.03  ? 1163 ASP A OD1   1 
ATOM   3796 O  OD2   . ASP A 1 293 ? -18.420 -20.715 -19.602 1.00 26.15  ? 1163 ASP A OD2   1 
ATOM   3797 H  H     . ASP A 1 293 ? -19.435 -19.612 -16.187 1.00 21.21  ? 1163 ASP A H     1 
ATOM   3798 H  HA    . ASP A 1 293 ? -17.059 -18.365 -16.714 1.00 20.93  ? 1163 ASP A HA    1 
ATOM   3799 H  HB2   . ASP A 1 293 ? -19.276 -18.726 -18.465 1.00 24.59  ? 1163 ASP A HB2   1 
ATOM   3800 H  HB3   . ASP A 1 293 ? -17.913 -18.024 -18.881 1.00 24.59  ? 1163 ASP A HB3   1 
ATOM   3801 N  N     . CYS A 1 294 ? -17.872 -15.972 -16.971 1.00 15.14  ? 1164 CYS A N     1 
ATOM   3802 C  CA    . CYS A 1 294 ? -18.354 -14.592 -16.931 1.00 14.16  ? 1164 CYS A CA    1 
ATOM   3803 C  C     . CYS A 1 294 ? -18.396 -14.013 -18.330 1.00 19.96  ? 1164 CYS A C     1 
ATOM   3804 O  O     . CYS A 1 294 ? -17.554 -14.345 -19.153 1.00 18.66  ? 1164 CYS A O     1 
ATOM   3805 C  CB    . CYS A 1 294 ? -17.410 -13.717 -16.122 1.00 19.65  ? 1164 CYS A CB    1 
ATOM   3806 S  SG    . CYS A 1 294 ? -17.483 -14.042 -14.365 1.00 22.78  ? 1164 CYS A SG    1 
ATOM   3807 H  H     . CYS A 1 294 ? -17.069 -16.044 -17.272 1.00 18.17  ? 1164 CYS A H     1 
ATOM   3808 H  HA    . CYS A 1 294 ? -19.250 -14.554 -16.537 1.00 16.99  ? 1164 CYS A HA    1 
ATOM   3809 H  HB2   . CYS A 1 294 ? -16.501 -13.877 -16.418 1.00 23.58  ? 1164 CYS A HB2   1 
ATOM   3810 H  HB3   . CYS A 1 294 ? -17.645 -12.786 -16.263 1.00 23.58  ? 1164 CYS A HB3   1 
ATOM   3811 H  HG    . CYS A 1 294 ? -17.184 -15.187 -14.167 1.00 27.33  ? 1164 CYS A HG    1 
ATOM   3812 N  N     . GLU A 1 295 ? -19.362 -13.134 -18.590 1.00 15.90  ? 1165 GLU A N     1 
ATOM   3813 C  CA    . GLU A 1 295 ? -19.454 -12.457 -19.879 1.00 13.15  ? 1165 GLU A CA    1 
ATOM   3814 C  C     . GLU A 1 295 ? -19.122 -10.984 -19.728 1.00 17.63  ? 1165 GLU A C     1 
ATOM   3815 O  O     . GLU A 1 295 ? -19.664 -10.304 -18.854 1.00 17.18  ? 1165 GLU A O     1 
ATOM   3816 C  CB    . GLU A 1 295 ? -20.855 -12.614 -20.461 1.00 18.13  ? 1165 GLU A CB    1 
ATOM   3817 C  CG    . GLU A 1 295 ? -21.009 -12.020 -21.836 1.00 21.44  ? 1165 GLU A CG    1 
ATOM   3818 C  CD    . GLU A 1 295 ? -22.384 -12.272 -22.425 1.00 28.36  ? 1165 GLU A CD    1 
ATOM   3819 O  OE1   . GLU A 1 295 ? -23.372 -12.311 -21.662 1.00 24.17  ? 1165 GLU A OE1   1 
ATOM   3820 O  OE2   . GLU A 1 295 ? -22.475 -12.441 -23.655 1.00 25.37  ? 1165 GLU A OE2   1 
ATOM   3821 H  H     . GLU A 1 295 ? -19.978 -12.912 -18.033 1.00 19.08  ? 1165 GLU A H     1 
ATOM   3822 H  HA    . GLU A 1 295 ? -18.813 -12.857 -20.503 1.00 15.78  ? 1165 GLU A HA    1 
ATOM   3823 H  HB2   . GLU A 1 295 ? -21.065 -13.560 -20.521 1.00 21.76  ? 1165 GLU A HB2   1 
ATOM   3824 H  HB3   . GLU A 1 295 ? -21.489 -12.173 -19.874 1.00 21.76  ? 1165 GLU A HB3   1 
ATOM   3825 H  HG2   . GLU A 1 295 ? -20.875 -11.060 -21.784 1.00 25.73  ? 1165 GLU A HG2   1 
ATOM   3826 H  HG3   . GLU A 1 295 ? -20.351 -12.416 -22.429 1.00 25.73  ? 1165 GLU A HG3   1 
ATOM   3827 N  N     . TRP A 1 296 ? -18.254 -10.488 -20.605 1.00 14.23  ? 1166 TRP A N     1 
ATOM   3828 C  CA    . TRP A 1 296 ? -17.725 -9.124  -20.497 1.00 16.59  ? 1166 TRP A CA    1 
ATOM   3829 C  C     . TRP A 1 296 ? -18.165 -8.287  -21.700 1.00 17.98  ? 1166 TRP A C     1 
ATOM   3830 O  O     . TRP A 1 296 ? -18.237 -8.795  -22.827 1.00 17.48  ? 1166 TRP A O     1 
ATOM   3831 C  CB    . TRP A 1 296 ? -16.190 -9.143  -20.470 1.00 13.56  ? 1166 TRP A CB    1 
ATOM   3832 C  CG    . TRP A 1 296 ? -15.605 -9.670  -19.185 1.00 15.25  ? 1166 TRP A CG    1 
ATOM   3833 C  CD1   . TRP A 1 296 ? -15.639 -10.955 -18.737 1.00 16.15  ? 1166 TRP A CD1   1 
ATOM   3834 C  CD2   . TRP A 1 296 ? -14.887 -8.917  -18.197 1.00 15.88  ? 1166 TRP A CD2   1 
ATOM   3835 N  NE1   . TRP A 1 296 ? -14.997 -11.051 -17.521 1.00 14.26  ? 1166 TRP A NE1   1 
ATOM   3836 C  CE2   . TRP A 1 296 ? -14.525 -9.816  -17.168 1.00 18.12  ? 1166 TRP A CE2   1 
ATOM   3837 C  CE3   . TRP A 1 296 ? -14.526 -7.573  -18.078 1.00 16.17  ? 1166 TRP A CE3   1 
ATOM   3838 C  CZ2   . TRP A 1 296 ? -13.810 -9.415  -16.033 1.00 18.92  ? 1166 TRP A CZ2   1 
ATOM   3839 C  CZ3   . TRP A 1 296 ? -13.812 -7.172  -16.946 1.00 18.75  ? 1166 TRP A CZ3   1 
ATOM   3840 C  CH2   . TRP A 1 296 ? -13.461 -8.094  -15.941 1.00 18.88  ? 1166 TRP A CH2   1 
ATOM   3841 H  H     . TRP A 1 296 ? -17.949 -10.925 -21.280 1.00 17.07  ? 1166 TRP A H     1 
ATOM   3842 H  HA    . TRP A 1 296 ? -18.054 -8.700  -19.677 1.00 19.91  ? 1166 TRP A HA    1 
ATOM   3843 H  HB2   . TRP A 1 296 ? -15.873 -9.707  -21.193 1.00 16.27  ? 1166 TRP A HB2   1 
ATOM   3844 H  HB3   . TRP A 1 296 ? -15.865 -8.237  -20.594 1.00 16.27  ? 1166 TRP A HB3   1 
ATOM   3845 H  HD1   . TRP A 1 296 ? -16.045 -11.664 -19.182 1.00 19.38  ? 1166 TRP A HD1   1 
ATOM   3846 H  HE1   . TRP A 1 296 ? -14.902 -11.772 -17.062 1.00 17.12  ? 1166 TRP A HE1   1 
ATOM   3847 H  HE3   . TRP A 1 296 ? -14.752 -6.960  -18.740 1.00 19.40  ? 1166 TRP A HE3   1 
ATOM   3848 H  HZ2   . TRP A 1 296 ? -13.579 -10.022 -15.368 1.00 22.71  ? 1166 TRP A HZ2   1 
ATOM   3849 H  HZ3   . TRP A 1 296 ? -13.563 -6.280  -16.856 1.00 22.50  ? 1166 TRP A HZ3   1 
ATOM   3850 H  HH2   . TRP A 1 296 ? -12.988 -7.798  -15.197 1.00 22.65  ? 1166 TRP A HH2   1 
ATOM   3851 N  N     . PHE A 1 297 ? -18.426 -7.008  -21.438 1.00 13.57  ? 1167 PHE A N     1 
ATOM   3852 C  CA    . PHE A 1 297 ? -18.828 -6.038  -22.454 1.00 16.73  ? 1167 PHE A CA    1 
ATOM   3853 C  C     . PHE A 1 297 ? -17.878 -4.859  -22.318 1.00 17.36  ? 1167 PHE A C     1 
ATOM   3854 O  O     . PHE A 1 297 ? -17.714 -4.314  -21.219 1.00 15.45  ? 1167 PHE A O     1 
ATOM   3855 C  CB    . PHE A 1 297 ? -20.261 -5.566  -22.200 1.00 16.29  ? 1167 PHE A CB    1 
ATOM   3856 C  CG    . PHE A 1 297 ? -21.277 -6.684  -22.195 1.00 17.74  ? 1167 PHE A CG    1 
ATOM   3857 C  CD1   . PHE A 1 297 ? -21.968 -7.022  -23.352 1.00 23.39  ? 1167 PHE A CD1   1 
ATOM   3858 C  CD2   . PHE A 1 297 ? -21.518 -7.408  -21.043 1.00 18.50  ? 1167 PHE A CD2   1 
ATOM   3859 C  CE1   . PHE A 1 297 ? -22.894 -8.064  -23.342 1.00 21.72  ? 1167 PHE A CE1   1 
ATOM   3860 C  CE2   . PHE A 1 297 ? -22.446 -8.441  -21.024 1.00 19.78  ? 1167 PHE A CE2   1 
ATOM   3861 C  CZ    . PHE A 1 297 ? -23.130 -8.767  -22.174 1.00 21.25  ? 1167 PHE A CZ    1 
ATOM   3862 H  H     . PHE A 1 297 ? -18.374 -6.667  -20.650 1.00 16.28  ? 1167 PHE A H     1 
ATOM   3863 H  HA    . PHE A 1 297 ? -18.757 -6.423  -23.353 1.00 20.08  ? 1167 PHE A HA    1 
ATOM   3864 H  HB2   . PHE A 1 297 ? -20.298 -5.128  -21.335 1.00 19.55  ? 1167 PHE A HB2   1 
ATOM   3865 H  HB3   . PHE A 1 297 ? -20.513 -4.940  -22.897 1.00 19.55  ? 1167 PHE A HB3   1 
ATOM   3866 H  HD1   . PHE A 1 297 ? -21.812 -6.550  -24.138 1.00 28.07  ? 1167 PHE A HD1   1 
ATOM   3867 H  HD2   . PHE A 1 297 ? -21.061 -7.191  -20.263 1.00 22.20  ? 1167 PHE A HD2   1 
ATOM   3868 H  HE1   . PHE A 1 297 ? -23.358 -8.282  -24.118 1.00 26.07  ? 1167 PHE A HE1   1 
ATOM   3869 H  HE2   . PHE A 1 297 ? -22.600 -8.916  -20.240 1.00 23.73  ? 1167 PHE A HE2   1 
ATOM   3870 H  HZ    . PHE A 1 297 ? -23.749 -9.461  -22.166 1.00 25.50  ? 1167 PHE A HZ    1 
ATOM   3871 N  N     . VAL A 1 298 ? -17.265 -4.447  -23.422 1.00 13.59  ? 1168 VAL A N     1 
ATOM   3872 C  CA    . VAL A 1 298 ? -16.179 -3.486  -23.348 1.00 14.44  ? 1168 VAL A CA    1 
ATOM   3873 C  C     . VAL A 1 298 ? -16.320 -2.440  -24.447 1.00 15.78  ? 1168 VAL A C     1 
ATOM   3874 O  O     . VAL A 1 298 ? -16.602 -2.773  -25.598 1.00 15.85  ? 1168 VAL A O     1 
ATOM   3875 C  CB    . VAL A 1 298 ? -14.799 -4.195  -23.473 1.00 20.33  ? 1168 VAL A CB    1 
ATOM   3876 C  CG1   . VAL A 1 298 ? -13.706 -3.210  -23.894 1.00 19.20  ? 1168 VAL A CG1   1 
ATOM   3877 C  CG2   . VAL A 1 298 ? -14.418 -4.881  -22.155 1.00 17.29  ? 1168 VAL A CG2   1 
ATOM   3878 H  H     . VAL A 1 298 ? -17.459 -4.707  -24.219 1.00 16.30  ? 1168 VAL A H     1 
ATOM   3879 H  HA    . VAL A 1 298 ? -16.211 -3.028  -22.483 1.00 17.32  ? 1168 VAL A HA    1 
ATOM   3880 H  HB    . VAL A 1 298 ? -14.860 -4.888  -24.164 1.00 24.40  ? 1168 VAL A HB    1 
ATOM   3881 H  HG11  . VAL A 1 298 ? -12.871 -3.680  -23.960 1.00 23.03  ? 1168 VAL A HG11  1 
ATOM   3882 H  HG12  . VAL A 1 298 ? -13.938 -2.832  -24.745 1.00 23.03  ? 1168 VAL A HG12  1 
ATOM   3883 H  HG13  . VAL A 1 298 ? -13.640 -2.516  -23.233 1.00 23.03  ? 1168 VAL A HG13  1 
ATOM   3884 H  HG21  . VAL A 1 298 ? -13.565 -5.309  -22.261 1.00 20.75  ? 1168 VAL A HG21  1 
ATOM   3885 H  HG22  . VAL A 1 298 ? -14.368 -4.219  -21.461 1.00 20.75  ? 1168 VAL A HG22  1 
ATOM   3886 H  HG23  . VAL A 1 298 ? -15.087 -5.534  -21.938 1.00 20.75  ? 1168 VAL A HG23  1 
ATOM   3887 N  N     . VAL A 1 299 ? -16.105 -1.179  -24.083 1.00 14.59  ? 1169 VAL A N     1 
ATOM   3888 C  CA    . VAL A 1 299 ? -16.177 -0.068  -25.037 1.00 17.10  ? 1169 VAL A CA    1 
ATOM   3889 C  C     . VAL A 1 299 ? -14.894 0.738   -24.893 1.00 16.60  ? 1169 VAL A C     1 
ATOM   3890 O  O     . VAL A 1 299 ? -14.440 0.979   -23.774 1.00 15.09  ? 1169 VAL A O     1 
ATOM   3891 C  CB    . VAL A 1 299 ? -17.420 0.818   -24.757 1.00 19.40  ? 1169 VAL A CB    1 
ATOM   3892 C  CG1   . VAL A 1 299 ? -17.315 2.185   -25.483 1.00 17.40  ? 1169 VAL A CG1   1 
ATOM   3893 C  CG2   . VAL A 1 299 ? -18.702 0.081   -25.167 1.00 18.39  ? 1169 VAL A CG2   1 
ATOM   3894 H  H     . VAL A 1 299 ? -15.912 -0.935  -23.281 1.00 17.50  ? 1169 VAL A H     1 
ATOM   3895 H  HA    . VAL A 1 299 ? -16.234 -0.416  -25.952 1.00 20.52  ? 1169 VAL A HA    1 
ATOM   3896 H  HB    . VAL A 1 299 ? -17.471 0.994   -23.794 1.00 23.27  ? 1169 VAL A HB    1 
ATOM   3897 H  HG11  . VAL A 1 299 ? -16.489 2.216   -25.971 1.00 20.88  ? 1169 VAL A HG11  1 
ATOM   3898 H  HG12  . VAL A 1 299 ? -18.056 2.276   -26.086 1.00 20.88  ? 1169 VAL A HG12  1 
ATOM   3899 H  HG13  . VAL A 1 299 ? -17.336 2.888   -24.829 1.00 20.88  ? 1169 VAL A HG13  1 
ATOM   3900 H  HG21  . VAL A 1 299 ? -18.468 -0.783  -25.514 1.00 22.07  ? 1169 VAL A HG21  1 
ATOM   3901 H  HG22  . VAL A 1 299 ? -19.265 -0.017  -24.396 1.00 22.07  ? 1169 VAL A HG22  1 
ATOM   3902 H  HG23  . VAL A 1 299 ? -19.155 0.594   -25.840 1.00 22.07  ? 1169 VAL A HG23  1 
ATOM   3903 N  N     . PRO A 1 300 ? -14.288 1.155   -26.011 1.00 17.10  ? 1170 PRO A N     1 
ATOM   3904 C  CA    . PRO A 1 300 ? -12.995 1.839   -25.882 1.00 15.32  ? 1170 PRO A CA    1 
ATOM   3905 C  C     . PRO A 1 300 ? -13.077 3.159   -25.127 1.00 14.27  ? 1170 PRO A C     1 
ATOM   3906 O  O     . PRO A 1 300 ? -14.109 3.823   -25.144 1.00 18.17  ? 1170 PRO A O     1 
ATOM   3907 C  CB    . PRO A 1 300 ? -12.575 2.090   -27.334 1.00 16.37  ? 1170 PRO A CB    1 
ATOM   3908 C  CG    . PRO A 1 300 ? -13.320 1.027   -28.134 1.00 19.99  ? 1170 PRO A CG    1 
ATOM   3909 C  CD    . PRO A 1 300 ? -14.644 0.899   -27.421 1.00 15.82  ? 1170 PRO A CD    1 
ATOM   3910 H  HA    . PRO A 1 300 ? -12.339 1.254   -25.449 1.00 18.39  ? 1170 PRO A HA    1 
ATOM   3911 H  HB2   . PRO A 1 300 ? -12.847 2.981   -27.606 1.00 19.64  ? 1170 PRO A HB2   1 
ATOM   3912 H  HB3   . PRO A 1 300 ? -11.615 1.979   -27.423 1.00 19.64  ? 1170 PRO A HB3   1 
ATOM   3913 H  HG2   . PRO A 1 300 ? -13.446 1.329   -29.048 1.00 23.99  ? 1170 PRO A HG2   1 
ATOM   3914 H  HG3   . PRO A 1 300 ? -12.831 0.190   -28.109 1.00 23.99  ? 1170 PRO A HG3   1 
ATOM   3915 H  HD2   . PRO A 1 300 ? -15.268 1.570   -27.741 1.00 18.98  ? 1170 PRO A HD2   1 
ATOM   3916 H  HD3   . PRO A 1 300 ? -15.000 0.003   -27.524 1.00 18.98  ? 1170 PRO A HD3   1 
ATOM   3917 N  N     . GLU A 1 301 ? -11.978 3.518   -24.473 1.00 16.46  ? 1171 GLU A N     1 
ATOM   3918 C  CA    . GLU A 1 301 ? -11.892 4.736   -23.670 1.00 17.23  ? 1171 GLU A CA    1 
ATOM   3919 C  C     . GLU A 1 301 ? -12.394 5.962   -24.433 1.00 19.29  ? 1171 GLU A C     1 
ATOM   3920 O  O     . GLU A 1 301 ? -13.036 6.853   -23.860 1.00 16.19  ? 1171 GLU A O     1 
ATOM   3921 C  CB    . GLU A 1 301 ? -10.440 4.951   -23.237 1.00 16.99  ? 1171 GLU A CB    1 
ATOM   3922 C  CG    . GLU A 1 301 ? -10.228 6.109   -22.257 1.00 16.61  ? 1171 GLU A CG    1 
ATOM   3923 C  CD    . GLU A 1 301 ? -10.097 7.453   -22.963 1.00 25.37  ? 1171 GLU A CD    1 
ATOM   3924 O  OE1   . GLU A 1 301 ? -9.642  7.476   -24.127 1.00 25.96  ? 1171 GLU A OE1   1 
ATOM   3925 O  OE2   . GLU A 1 301 ? -10.445 8.482   -22.353 1.00 24.09  ? 1171 GLU A OE2   1 
ATOM   3926 H  H     . GLU A 1 301 ? -11.249 3.061   -24.479 1.00 19.75  ? 1171 GLU A H     1 
ATOM   3927 H  HA    . GLU A 1 301 ? -12.440 4.631   -22.864 1.00 20.67  ? 1171 GLU A HA    1 
ATOM   3928 H  HB2   . GLU A 1 301 ? -10.122 4.142   -22.807 1.00 20.39  ? 1171 GLU A HB2   1 
ATOM   3929 H  HB3   . GLU A 1 301 ? -9.905  5.133   -24.026 1.00 20.39  ? 1171 GLU A HB3   1 
ATOM   3930 H  HG2   . GLU A 1 301 ? -10.988 6.158   -21.656 1.00 19.93  ? 1171 GLU A HG2   1 
ATOM   3931 H  HG3   . GLU A 1 301 ? -9.414  5.954   -21.753 1.00 19.93  ? 1171 GLU A HG3   1 
ATOM   3932 N  N     . GLY A 1 302 ? -12.116 6.003   -25.728 1.00 18.11  ? 1172 GLY A N     1 
ATOM   3933 C  CA    . GLY A 1 302 ? -12.427 7.183   -26.527 1.00 19.79  ? 1172 GLY A CA    1 
ATOM   3934 C  C     . GLY A 1 302 ? -13.915 7.452   -26.646 1.00 21.98  ? 1172 GLY A C     1 
ATOM   3935 O  O     . GLY A 1 302 ? -14.332 8.556   -26.996 1.00 19.36  ? 1172 GLY A O     1 
ATOM   3936 H  H     . GLY A 1 302 ? -11.748 5.363   -26.170 1.00 21.74  ? 1172 GLY A H     1 
ATOM   3937 H  HA2   . GLY A 1 302 ? -12.008 7.960   -26.126 1.00 23.75  ? 1172 GLY A HA2   1 
ATOM   3938 H  HA3   . GLY A 1 302 ? -12.067 7.069   -27.420 1.00 23.75  ? 1172 GLY A HA3   1 
ATOM   3939 N  N     . TYR A 1 303 ? -14.730 6.448   -26.352 1.00 19.63  ? 1173 TYR A N     1 
ATOM   3940 C  CA    . TYR A 1 303 ? -16.179 6.612   -26.411 1.00 19.71  ? 1173 TYR A CA    1 
ATOM   3941 C  C     . TYR A 1 303 ? -16.809 6.961   -25.069 1.00 17.98  ? 1173 TYR A C     1 
ATOM   3942 O  O     . TYR A 1 303 ? -18.031 6.950   -24.951 1.00 18.11  ? 1173 TYR A O     1 
ATOM   3943 C  CB    . TYR A 1 303 ? -16.837 5.338   -26.965 1.00 16.32  ? 1173 TYR A CB    1 
ATOM   3944 C  CG    . TYR A 1 303 ? -16.563 5.164   -28.447 1.00 20.56  ? 1173 TYR A CG    1 
ATOM   3945 C  CD1   . TYR A 1 303 ? -17.469 5.620   -29.398 1.00 18.97  ? 1173 TYR A CD1   1 
ATOM   3946 C  CD2   . TYR A 1 303 ? -15.383 4.579   -28.890 1.00 15.74  ? 1173 TYR A CD2   1 
ATOM   3947 C  CE1   . TYR A 1 303 ? -17.211 5.474   -30.768 1.00 16.20  ? 1173 TYR A CE1   1 
ATOM   3948 C  CE2   . TYR A 1 303 ? -15.121 4.429   -30.250 1.00 19.97  ? 1173 TYR A CE2   1 
ATOM   3949 C  CZ    . TYR A 1 303 ? -16.040 4.888   -31.173 1.00 23.32  ? 1173 TYR A CZ    1 
ATOM   3950 O  OH    . TYR A 1 303 ? -15.785 4.757   -32.512 1.00 23.77  ? 1173 TYR A OH    1 
ATOM   3951 H  H     . TYR A 1 303 ? -14.471 5.662   -26.116 1.00 23.55  ? 1173 TYR A H     1 
ATOM   3952 H  HA    . TYR A 1 303 ? -16.383 7.343   -27.031 1.00 23.65  ? 1173 TYR A HA    1 
ATOM   3953 H  HB2   . TYR A 1 303 ? -16.480 4.566   -26.498 1.00 19.59  ? 1173 TYR A HB2   1 
ATOM   3954 H  HB3   . TYR A 1 303 ? -17.797 5.393   -26.838 1.00 19.59  ? 1173 TYR A HB3   1 
ATOM   3955 H  HD1   . TYR A 1 303 ? -18.262 6.020   -29.121 1.00 22.76  ? 1173 TYR A HD1   1 
ATOM   3956 H  HD2   . TYR A 1 303 ? -14.763 4.273   -28.268 1.00 18.89  ? 1173 TYR A HD2   1 
ATOM   3957 H  HE1   . TYR A 1 303 ? -17.824 5.780   -31.397 1.00 19.44  ? 1173 TYR A HE1   1 
ATOM   3958 H  HE2   . TYR A 1 303 ? -14.328 4.035   -30.534 1.00 23.96  ? 1173 TYR A HE2   1 
ATOM   3959 H  HH    . TYR A 1 303 ? -15.772 5.495   -32.868 1.00 28.52  ? 1173 TYR A HH    1 
ATOM   3960 N  N     . TRP A 1 304 ? -16.011 7.272   -24.053 1.00 15.42  ? 1174 TRP A N     1 
ATOM   3961 C  CA    . TRP A 1 304 ? -16.609 7.462   -22.737 1.00 16.05  ? 1174 TRP A CA    1 
ATOM   3962 C  C     . TRP A 1 304 ? -17.519 8.695   -22.695 1.00 18.62  ? 1174 TRP A C     1 
ATOM   3963 O  O     . TRP A 1 304 ? -18.491 8.728   -21.943 1.00 18.46  ? 1174 TRP A O     1 
ATOM   3964 C  CB    . TRP A 1 304 ? -15.546 7.486   -21.623 1.00 19.18  ? 1174 TRP A CB    1 
ATOM   3965 C  CG    . TRP A 1 304 ? -14.834 8.790   -21.417 1.00 16.64  ? 1174 TRP A CG    1 
ATOM   3966 C  CD1   . TRP A 1 304 ? -13.668 9.192   -21.993 1.00 17.68  ? 1174 TRP A CD1   1 
ATOM   3967 C  CD2   . TRP A 1 304 ? -15.235 9.854   -20.534 1.00 18.72  ? 1174 TRP A CD2   1 
ATOM   3968 N  NE1   . TRP A 1 304 ? -13.316 10.444  -21.529 1.00 20.56  ? 1174 TRP A NE1   1 
ATOM   3969 C  CE2   . TRP A 1 304 ? -14.262 10.868  -20.633 1.00 20.44  ? 1174 TRP A CE2   1 
ATOM   3970 C  CE3   . TRP A 1 304 ? -16.321 10.042  -19.681 1.00 17.30  ? 1174 TRP A CE3   1 
ATOM   3971 C  CZ2   . TRP A 1 304 ? -14.348 12.066  -19.909 1.00 24.28  ? 1174 TRP A CZ2   1 
ATOM   3972 C  CZ3   . TRP A 1 304 ? -16.406 11.237  -18.958 1.00 22.60  ? 1174 TRP A CZ3   1 
ATOM   3973 C  CH2   . TRP A 1 304 ? -15.423 12.226  -19.080 1.00 21.01  ? 1174 TRP A CH2   1 
ATOM   3974 H  H     . TRP A 1 304 ? -15.158 7.374   -24.093 1.00 18.50  ? 1174 TRP A H     1 
ATOM   3975 H  HA    . TRP A 1 304 ? -17.181 6.687   -22.559 1.00 19.26  ? 1174 TRP A HA    1 
ATOM   3976 H  HB2   . TRP A 1 304 ? -15.978 7.258   -20.785 1.00 23.02  ? 1174 TRP A HB2   1 
ATOM   3977 H  HB3   . TRP A 1 304 ? -14.873 6.819   -21.830 1.00 23.02  ? 1174 TRP A HB3   1 
ATOM   3978 H  HD1   . TRP A 1 304 ? -13.175 8.691   -22.603 1.00 21.21  ? 1174 TRP A HD1   1 
ATOM   3979 H  HE1   . TRP A 1 304 ? -12.617 10.886  -21.765 1.00 24.67  ? 1174 TRP A HE1   1 
ATOM   3980 H  HE3   . TRP A 1 304 ? -16.975 9.387   -19.593 1.00 20.75  ? 1174 TRP A HE3   1 
ATOM   3981 H  HZ2   . TRP A 1 304 ? -13.699 12.727  -19.992 1.00 29.13  ? 1174 TRP A HZ2   1 
ATOM   3982 H  HZ3   . TRP A 1 304 ? -17.124 11.373  -18.383 1.00 27.12  ? 1174 TRP A HZ3   1 
ATOM   3983 H  HH2   . TRP A 1 304 ? -15.505 13.011  -18.587 1.00 25.22  ? 1174 TRP A HH2   1 
ATOM   3984 N  N     . GLY A 1 305 ? -17.222 9.690   -23.520 1.00 19.39  ? 1175 GLY A N     1 
ATOM   3985 C  CA    . GLY A 1 305 ? -18.066 10.867  -23.615 1.00 24.45  ? 1175 GLY A CA    1 
ATOM   3986 C  C     . GLY A 1 305 ? -19.447 10.535  -24.154 1.00 23.82  ? 1175 GLY A C     1 
ATOM   3987 O  O     . GLY A 1 305 ? -20.453 11.054  -23.673 1.00 24.05  ? 1175 GLY A O     1 
ATOM   3988 H  H     . GLY A 1 305 ? -16.535 9.706   -24.037 1.00 23.27  ? 1175 GLY A H     1 
ATOM   3989 H  HA2   . GLY A 1 305 ? -18.165 11.267  -22.736 1.00 29.34  ? 1175 GLY A HA2   1 
ATOM   3990 H  HA3   . GLY A 1 305 ? -17.652 11.516  -24.205 1.00 29.34  ? 1175 GLY A HA3   1 
ATOM   3991 N  N     . VAL A 1 306 ? -19.494 9.659   -25.154 1.00 17.56  ? 1176 VAL A N     1 
ATOM   3992 C  CA    . VAL A 1 306 ? -20.753 9.206   -25.717 1.00 19.30  ? 1176 VAL A CA    1 
ATOM   3993 C  C     . VAL A 1 306 ? -21.569 8.445   -24.669 1.00 22.05  ? 1176 VAL A C     1 
ATOM   3994 O  O     . VAL A 1 306 ? -22.774 8.656   -24.543 1.00 19.62  ? 1176 VAL A O     1 
ATOM   3995 C  CB    . VAL A 1 306 ? -20.518 8.296   -26.961 1.00 17.34  ? 1176 VAL A CB    1 
ATOM   3996 C  CG1   . VAL A 1 306 ? -21.842 7.750   -27.487 1.00 23.76  ? 1176 VAL A CG1   1 
ATOM   3997 C  CG2   . VAL A 1 306 ? -19.793 9.062   -28.060 1.00 24.17  ? 1176 VAL A CG2   1 
ATOM   3998 H  H     . VAL A 1 306 ? -18.800 9.312   -25.525 1.00 21.07  ? 1176 VAL A H     1 
ATOM   3999 H  HA    . VAL A 1 306 ? -21.275 9.984   -26.004 1.00 23.16  ? 1176 VAL A HA    1 
ATOM   4000 H  HB    . VAL A 1 306 ? -19.957 7.535   -26.700 1.00 20.81  ? 1176 VAL A HB    1 
ATOM   4001 H  HG11  . VAL A 1 306 ? -21.669 7.195   -28.251 1.00 28.51  ? 1176 VAL A HG11  1 
ATOM   4002 H  HG12  . VAL A 1 306 ? -22.264 7.235   -26.796 1.00 28.51  ? 1176 VAL A HG12  1 
ATOM   4003 H  HG13  . VAL A 1 306 ? -22.405 8.486   -27.738 1.00 28.51  ? 1176 VAL A HG13  1 
ATOM   4004 H  HG21  . VAL A 1 306 ? -19.661 8.480   -28.812 1.00 29.01  ? 1176 VAL A HG21  1 
ATOM   4005 H  HG22  . VAL A 1 306 ? -20.328 9.817   -28.319 1.00 29.01  ? 1176 VAL A HG22  1 
ATOM   4006 H  HG23  . VAL A 1 306 ? -18.945 9.362   -27.725 1.00 29.01  ? 1176 VAL A HG23  1 
ATOM   4007 N  N     . LEU A 1 307 ? -20.922 7.558   -23.913 1.00 19.81  ? 1177 LEU A N     1 
ATOM   4008 C  CA    . LEU A 1 307 ? -21.627 6.840   -22.847 1.00 20.51  ? 1177 LEU A CA    1 
ATOM   4009 C  C     . LEU A 1 307 ? -22.095 7.805   -21.758 1.00 21.65  ? 1177 LEU A C     1 
ATOM   4010 O  O     . LEU A 1 307 ? -23.177 7.649   -21.190 1.00 22.24  ? 1177 LEU A O     1 
ATOM   4011 C  CB    . LEU A 1 307 ? -20.734 5.760   -22.231 1.00 17.90  ? 1177 LEU A CB    1 
ATOM   4012 C  CG    . LEU A 1 307 ? -20.903 4.370   -22.874 1.00 26.08  ? 1177 LEU A CG    1 
ATOM   4013 C  CD1   . LEU A 1 307 ? -20.991 4.428   -24.385 1.00 34.82  ? 1177 LEU A CD1   1 
ATOM   4014 C  CD2   . LEU A 1 307 ? -19.769 3.471   -22.458 1.00 35.48  ? 1177 LEU A CD2   1 
ATOM   4015 H  H     . LEU A 1 307 ? -20.090 7.355   -23.994 1.00 23.77  ? 1177 LEU A H     1 
ATOM   4016 H  HA    . LEU A 1 307 ? -22.418 6.402   -23.225 1.00 24.61  ? 1177 LEU A HA    1 
ATOM   4017 H  HB2   . LEU A 1 307 ? -19.806 6.024   -22.335 1.00 21.48  ? 1177 LEU A HB2   1 
ATOM   4018 H  HB3   . LEU A 1 307 ? -20.948 5.678   -21.288 1.00 21.48  ? 1177 LEU A HB3   1 
ATOM   4019 H  HG    . LEU A 1 307 ? -21.726 3.976   -22.547 1.00 31.29  ? 1177 LEU A HG    1 
ATOM   4020 H  HD11  . LEU A 1 307 ? -21.748 4.964   -24.633 1.00 41.79  ? 1177 LEU A HD11  1 
ATOM   4021 H  HD12  . LEU A 1 307 ? -20.185 4.818   -24.730 1.00 41.79  ? 1177 LEU A HD12  1 
ATOM   4022 H  HD13  . LEU A 1 307 ? -21.095 3.536   -24.725 1.00 41.79  ? 1177 LEU A HD13  1 
ATOM   4023 H  HD21  . LEU A 1 307 ? -19.888 2.610   -22.866 1.00 42.58  ? 1177 LEU A HD21  1 
ATOM   4024 H  HD22  . LEU A 1 307 ? -18.940 3.859   -22.747 1.00 42.58  ? 1177 LEU A HD22  1 
ATOM   4025 H  HD23  . LEU A 1 307 ? -19.775 3.384   -21.502 1.00 42.58  ? 1177 LEU A HD23  1 
ATOM   4026 N  N     . ASN A 1 308 ? -21.274 8.799   -21.453 1.00 19.41  ? 1178 ASN A N     1 
ATOM   4027 C  CA    . ASN A 1 308 ? -21.664 9.811   -20.475 1.00 23.72  ? 1178 ASN A CA    1 
ATOM   4028 C  C     . ASN A 1 308 ? -22.965 10.481  -20.905 1.00 27.64  ? 1178 ASN A C     1 
ATOM   4029 O  O     . ASN A 1 308 ? -23.881 10.669  -20.102 1.00 24.70  ? 1178 ASN A O     1 
ATOM   4030 C  CB    . ASN A 1 308 ? -20.562 10.858  -20.317 1.00 23.28  ? 1178 ASN A CB    1 
ATOM   4031 C  CG    . ASN A 1 308 ? -20.947 11.969  -19.372 1.00 29.87  ? 1178 ASN A CG    1 
ATOM   4032 O  OD1   . ASN A 1 308 ? -21.057 11.764  -18.162 1.00 28.93  ? 1178 ASN A OD1   1 
ATOM   4033 N  ND2   . ASN A 1 308 ? -21.136 13.165  -19.916 1.00 29.39  ? 1178 ASN A ND2   1 
ATOM   4034 H  H     . ASN A 1 308 ? -20.493 8.913   -21.794 1.00 23.29  ? 1178 ASN A H     1 
ATOM   4035 H  HA    . ASN A 1 308 ? -21.810 9.383   -19.605 1.00 28.47  ? 1178 ASN A HA    1 
ATOM   4036 H  HB2   . ASN A 1 308 ? -19.765 10.428  -19.968 1.00 27.94  ? 1178 ASN A HB2   1 
ATOM   4037 H  HB3   . ASN A 1 308 ? -20.374 11.252  -21.184 1.00 27.94  ? 1178 ASN A HB3   1 
ATOM   4038 H  HD21  . ASN A 1 308 ? -21.357 13.832  -19.422 1.00 35.27  ? 1178 ASN A HD21  1 
ATOM   4039 H  HD22  . ASN A 1 308 ? -21.037 13.272  -20.764 1.00 35.27  ? 1178 ASN A HD22  1 
ATOM   4040 N  N     . ASP A 1 309 ? -23.050 10.830  -22.183 1.00 23.54  ? 1179 ASP A N     1 
ATOM   4041 C  CA    . ASP A 1 309 ? -24.258 11.462  -22.714 1.00 25.92  ? 1179 ASP A CA    1 
ATOM   4042 C  C     . ASP A 1 309 ? -25.464 10.531  -22.638 1.00 25.99  ? 1179 ASP A C     1 
ATOM   4043 O  O     . ASP A 1 309 ? -26.563 10.967  -22.315 1.00 27.97  ? 1179 ASP A O     1 
ATOM   4044 C  CB    . ASP A 1 309 ? -24.036 11.920  -24.154 1.00 36.31  ? 1179 ASP A CB    1 
ATOM   4045 C  CG    . ASP A 1 309 ? -23.062 13.074  -24.247 1.00 64.47  ? 1179 ASP A CG    1 
ATOM   4046 O  OD1   . ASP A 1 309 ? -22.901 13.794  -23.238 1.00 65.75  ? 1179 ASP A OD1   1 
ATOM   4047 O  OD2   . ASP A 1 309 ? -22.462 13.265  -25.325 1.00 74.71  ? 1179 ASP A OD2   1 
ATOM   4048 H  H     . ASP A 1 309 ? -22.426 10.714  -22.764 1.00 28.25  ? 1179 ASP A H     1 
ATOM   4049 H  HA    . ASP A 1 309 ? -24.460 12.256  -22.176 1.00 31.10  ? 1179 ASP A HA    1 
ATOM   4050 H  HB2   . ASP A 1 309 ? -23.678 11.181  -24.670 1.00 43.58  ? 1179 ASP A HB2   1 
ATOM   4051 H  HB3   . ASP A 1 309 ? -24.882 12.209  -24.529 1.00 43.58  ? 1179 ASP A HB3   1 
ATOM   4052 N  N     . PHE A 1 310 ? -25.267 9.251   -22.933 1.00 21.06  ? 1180 PHE A N     1 
ATOM   4053 C  CA    . PHE A 1 310 ? -26.350 8.283   -22.786 1.00 27.35  ? 1180 PHE A CA    1 
ATOM   4054 C  C     . PHE A 1 310 ? -26.846 8.271   -21.339 1.00 27.23  ? 1180 PHE A C     1 
ATOM   4055 O  O     . PHE A 1 310 ? -28.052 8.272   -21.084 1.00 28.45  ? 1180 PHE A O     1 
ATOM   4056 C  CB    . PHE A 1 310 ? -25.898 6.874   -23.189 1.00 25.28  ? 1180 PHE A CB    1 
ATOM   4057 C  CG    . PHE A 1 310 ? -26.118 6.554   -24.653 1.00 26.49  ? 1180 PHE A CG    1 
ATOM   4058 C  CD1   . PHE A 1 310 ? -27.389 6.601   -25.207 1.00 30.62  ? 1180 PHE A CD1   1 
ATOM   4059 C  CD2   . PHE A 1 310 ? -25.053 6.187   -25.463 1.00 22.70  ? 1180 PHE A CD2   1 
ATOM   4060 C  CE1   . PHE A 1 310 ? -27.593 6.294   -26.551 1.00 38.82  ? 1180 PHE A CE1   1 
ATOM   4061 C  CE2   . PHE A 1 310 ? -25.251 5.874   -26.806 1.00 28.99  ? 1180 PHE A CE2   1 
ATOM   4062 C  CZ    . PHE A 1 310 ? -26.524 5.931   -27.347 1.00 32.40  ? 1180 PHE A CZ    1 
ATOM   4063 H  H     . PHE A 1 310 ? -24.526 8.919   -23.217 1.00 25.28  ? 1180 PHE A H     1 
ATOM   4064 H  HA    . PHE A 1 310 ? -27.097 8.544   -23.364 1.00 32.82  ? 1180 PHE A HA    1 
ATOM   4065 H  HB2   . PHE A 1 310 ? -24.949 6.786   -23.006 1.00 30.33  ? 1180 PHE A HB2   1 
ATOM   4066 H  HB3   . PHE A 1 310 ? -26.394 6.225   -22.666 1.00 30.33  ? 1180 PHE A HB3   1 
ATOM   4067 H  HD1   . PHE A 1 310 ? -28.113 6.843   -24.676 1.00 36.74  ? 1180 PHE A HD1   1 
ATOM   4068 H  HD2   . PHE A 1 310 ? -24.196 6.145   -25.103 1.00 27.25  ? 1180 PHE A HD2   1 
ATOM   4069 H  HE1   . PHE A 1 310 ? -28.449 6.332   -26.912 1.00 46.59  ? 1180 PHE A HE1   1 
ATOM   4070 H  HE2   . PHE A 1 310 ? -24.529 5.633   -27.340 1.00 34.79  ? 1180 PHE A HE2   1 
ATOM   4071 H  HZ    . PHE A 1 310 ? -26.659 5.728   -28.244 1.00 38.88  ? 1180 PHE A HZ    1 
ATOM   4072 N  N     . CYS A 1 311 ? -25.919 8.259   -20.385 1.00 21.99  ? 1181 CYS A N     1 
ATOM   4073 C  CA    . CYS A 1 311 ? -26.317 8.237   -18.987 1.00 25.07  ? 1181 CYS A CA    1 
ATOM   4074 C  C     . CYS A 1 311 ? -27.179 9.453   -18.680 1.00 31.20  ? 1181 CYS A C     1 
ATOM   4075 O  O     . CYS A 1 311 ? -28.299 9.310   -18.191 1.00 29.42  ? 1181 CYS A O     1 
ATOM   4076 C  CB    . CYS A 1 311 ? -25.094 8.178   -18.067 1.00 23.62  ? 1181 CYS A CB    1 
ATOM   4077 S  SG    . CYS A 1 311 ? -24.317 6.551   -18.090 1.00 24.36  ? 1181 CYS A SG    1 
ATOM   4078 H  H     . CYS A 1 311 ? -25.070 8.264   -20.519 1.00 26.39  ? 1181 CYS A H     1 
ATOM   4079 H  HA    . CYS A 1 311 ? -26.856 7.435   -18.822 1.00 30.08  ? 1181 CYS A HA    1 
ATOM   4080 H  HB2   . CYS A 1 311 ? -24.440 8.831   -18.364 1.00 28.34  ? 1181 CYS A HB2   1 
ATOM   4081 H  HB3   . CYS A 1 311 ? -25.370 8.370   -17.157 1.00 28.34  ? 1181 CYS A HB3   1 
ATOM   4082 H  HG    . CYS A 1 311 ? -23.965 6.302   -19.210 1.00 29.24  ? 1181 CYS A HG    1 
ATOM   4083 N  N     . GLU A 1 312 ? -26.666 10.640  -18.989 1.00 30.53  ? 1182 GLU A N     1 
ATOM   4084 C  CA    . GLU A 1 312 ? -27.386 11.884  -18.719 1.00 29.51  ? 1182 GLU A CA    1 
ATOM   4085 C  C     . GLU A 1 312 ? -28.774 11.876  -19.339 1.00 40.35  ? 1182 GLU A C     1 
ATOM   4086 O  O     . GLU A 1 312 ? -29.752 12.293  -18.710 1.00 34.35  ? 1182 GLU A O     1 
ATOM   4087 C  CB    . GLU A 1 312 ? -26.596 13.082  -19.246 1.00 36.60  ? 1182 GLU A CB    1 
ATOM   4088 C  CG    . GLU A 1 312 ? -25.361 13.397  -18.424 1.00 47.00  ? 1182 GLU A CG    1 
ATOM   4089 C  CD    . GLU A 1 312 ? -25.699 13.740  -16.979 1.00 60.65  ? 1182 GLU A CD    1 
ATOM   4090 O  OE1   . GLU A 1 312 ? -24.826 13.568  -16.101 1.00 44.60  ? 1182 GLU A OE1   1 
ATOM   4091 O  OE2   . GLU A 1 312 ? -26.840 14.182  -16.723 1.00 62.13  ? 1182 GLU A OE2   1 
ATOM   4092 H  H     . GLU A 1 312 ? -25.898 10.754  -19.358 1.00 36.64  ? 1182 GLU A H     1 
ATOM   4093 H  HA    . GLU A 1 312 ? -27.487 11.990  -17.750 1.00 35.41  ? 1182 GLU A HA    1 
ATOM   4094 H  HB2   . GLU A 1 312 ? -26.310 12.894  -20.154 1.00 43.92  ? 1182 GLU A HB2   1 
ATOM   4095 H  HB3   . GLU A 1 312 ? -27.169 13.864  -19.235 1.00 43.92  ? 1182 GLU A HB3   1 
ATOM   4096 H  HG2   . GLU A 1 312 ? -24.776 12.624  -18.421 1.00 56.40  ? 1182 GLU A HG2   1 
ATOM   4097 H  HG3   . GLU A 1 312 ? -24.905 14.159  -18.816 1.00 56.40  ? 1182 GLU A HG3   1 
ATOM   4098 N  N     . LYS A 1 313 ? -28.854 11.403  -20.577 1.00 35.81  ? 1183 LYS A N     1 
ATOM   4099 C  CA    . LYS A 1 313 ? -30.117 11.376  -21.300 1.00 41.83  ? 1183 LYS A CA    1 
ATOM   4100 C  C     . LYS A 1 313 ? -31.089 10.410  -20.630 1.00 40.83  ? 1183 LYS A C     1 
ATOM   4101 O  O     . LYS A 1 313 ? -32.299 10.567  -20.747 1.00 37.56  ? 1183 LYS A O     1 
ATOM   4102 C  CB    . LYS A 1 313 ? -29.893 11.011  -22.776 1.00 51.66  ? 1183 LYS A CB    1 
ATOM   4103 C  CG    . LYS A 1 313 ? -29.291 12.152  -23.603 1.00 70.18  ? 1183 LYS A CG    1 
ATOM   4104 C  CD    . LYS A 1 313 ? -29.429 11.920  -25.106 1.00 85.84  ? 1183 LYS A CD    1 
ATOM   4105 C  CE    . LYS A 1 313 ? -28.929 13.122  -25.903 1.00 88.47  ? 1183 LYS A CE    1 
ATOM   4106 N  NZ    . LYS A 1 313 ? -29.748 14.345  -25.672 1.00 90.00  ? 1183 LYS A NZ    1 
ATOM   4107 H  H     . LYS A 1 313 ? -28.188 11.091  -21.022 1.00 42.97  ? 1183 LYS A H     1 
ATOM   4108 H  HA    . LYS A 1 313 ? -30.516 12.271  -21.271 1.00 50.20  ? 1183 LYS A HA    1 
ATOM   4109 H  HB2   . LYS A 1 313 ? -29.285 10.256  -22.824 1.00 61.99  ? 1183 LYS A HB2   1 
ATOM   4110 H  HB3   . LYS A 1 313 ? -30.746 10.774  -23.173 1.00 61.99  ? 1183 LYS A HB3   1 
ATOM   4111 H  HG2   . LYS A 1 313 ? -29.749 12.978  -23.382 1.00 84.22  ? 1183 LYS A HG2   1 
ATOM   4112 H  HG3   . LYS A 1 313 ? -28.347 12.229  -23.395 1.00 84.22  ? 1183 LYS A HG3   1 
ATOM   4113 H  HD2   . LYS A 1 313 ? -28.902 11.146  -25.361 1.00 103.01 ? 1183 LYS A HD2   1 
ATOM   4114 H  HD3   . LYS A 1 313 ? -30.363 11.778  -25.324 1.00 103.01 ? 1183 LYS A HD3   1 
ATOM   4115 H  HE2   . LYS A 1 313 ? -28.016 13.318  -25.641 1.00 106.16 ? 1183 LYS A HE2   1 
ATOM   4116 H  HE3   . LYS A 1 313 ? -28.965 12.911  -26.849 1.00 106.16 ? 1183 LYS A HE3   1 
ATOM   4117 H  HZ1   . LYS A 1 313 ? -29.426 15.022  -26.153 1.00 108.00 ? 1183 LYS A HZ1   1 
ATOM   4118 H  HZ2   . LYS A 1 313 ? -30.592 14.196  -25.912 1.00 108.00 ? 1183 LYS A HZ2   1 
ATOM   4119 H  HZ3   . LYS A 1 313 ? -29.726 14.567  -24.810 1.00 108.00 ? 1183 LYS A HZ3   1 
ATOM   4120 N  N     . ASN A 1 314 ? -30.562 9.421   -19.914 1.00 30.52  ? 1184 ASN A N     1 
ATOM   4121 C  CA    . ASN A 1 314 ? -31.408 8.494   -19.181 1.00 30.00  ? 1184 ASN A CA    1 
ATOM   4122 C  C     . ASN A 1 314 ? -31.478 8.834   -17.688 1.00 38.68  ? 1184 ASN A C     1 
ATOM   4123 O  O     . ASN A 1 314 ? -31.821 7.982   -16.866 1.00 32.81  ? 1184 ASN A O     1 
ATOM   4124 C  CB    . ASN A 1 314 ? -30.935 7.042   -19.390 1.00 29.37  ? 1184 ASN A CB    1 
ATOM   4125 C  CG    . ASN A 1 314 ? -31.319 6.487   -20.764 1.00 39.81  ? 1184 ASN A CG    1 
ATOM   4126 O  OD1   . ASN A 1 314 ? -32.423 5.977   -20.952 1.00 41.39  ? 1184 ASN A OD1   1 
ATOM   4127 N  ND2   . ASN A 1 314 ? -30.400 6.565   -21.719 1.00 29.82  ? 1184 ASN A ND2   1 
ATOM   4128 H  H     . ASN A 1 314 ? -29.719 9.268   -19.838 1.00 36.63  ? 1184 ASN A H     1 
ATOM   4129 H  HA    . ASN A 1 314 ? -32.318 8.559   -19.538 1.00 35.99  ? 1184 ASN A HA    1 
ATOM   4130 H  HB2   . ASN A 1 314 ? -29.968 7.010   -19.314 1.00 35.25  ? 1184 ASN A HB2   1 
ATOM   4131 H  HB3   . ASN A 1 314 ? -31.340 6.477   -18.714 1.00 35.25  ? 1184 ASN A HB3   1 
ATOM   4132 H  HD21  . ASN A 1 314 ? -30.572 6.265   -22.507 1.00 35.78  ? 1184 ASN A HD21  1 
ATOM   4133 H  HD22  . ASN A 1 314 ? -29.633 6.914   -21.550 1.00 35.78  ? 1184 ASN A HD22  1 
ATOM   4134 N  N     A ASN A 1 315 ? -31.162 10.082  -17.345 0.49 36.44  ? 1185 ASN A N     1 
ATOM   4135 N  N     B ASN A 1 315 ? -31.123 10.074  -17.362 0.51 36.46  ? 1185 ASN A N     1 
ATOM   4136 C  CA    A ASN A 1 315 ? -31.233 10.567  -15.963 0.49 38.90  ? 1185 ASN A CA    1 
ATOM   4137 C  CA    B ASN A 1 315 ? -31.204 10.573  -15.997 0.51 38.38  ? 1185 ASN A CA    1 
ATOM   4138 C  C     A ASN A 1 315 ? -30.359 9.777   -14.986 0.49 38.31  ? 1185 ASN A C     1 
ATOM   4139 C  C     B ASN A 1 315 ? -30.392 9.719   -15.027 0.51 38.38  ? 1185 ASN A C     1 
ATOM   4140 O  O     A ASN A 1 315 ? -30.754 9.527   -13.845 0.49 34.22  ? 1185 ASN A O     1 
ATOM   4141 O  O     B ASN A 1 315 ? -30.858 9.368   -13.940 0.51 36.87  ? 1185 ASN A O     1 
ATOM   4142 C  CB    A ASN A 1 315 ? -32.682 10.557  -15.465 0.49 42.33  ? 1185 ASN A CB    1 
ATOM   4143 C  CB    B ASN A 1 315 ? -32.669 10.661  -15.570 0.51 42.74  ? 1185 ASN A CB    1 
ATOM   4144 C  CG    A ASN A 1 315 ? -32.855 11.319  -14.160 0.49 47.00  ? 1185 ASN A CG    1 
ATOM   4145 C  CG    B ASN A 1 315 ? -33.483 11.545  -16.495 0.51 52.67  ? 1185 ASN A CG    1 
ATOM   4146 O  OD1   A ASN A 1 315 ? -32.227 12.357  -13.946 0.49 50.25  ? 1185 ASN A OD1   1 
ATOM   4147 O  OD1   B ASN A 1 315 ? -33.214 12.740  -16.616 0.51 56.44  ? 1185 ASN A OD1   1 
ATOM   4148 N  ND2   A ASN A 1 315 ? -33.704 10.801  -13.279 0.49 43.45  ? 1185 ASN A ND2   1 
ATOM   4149 N  ND2   B ASN A 1 315 ? -34.479 10.963  -17.155 0.51 58.55  ? 1185 ASN A ND2   1 
ATOM   4150 H  H     A ASN A 1 315 ? -30.899 10.680  -17.905 0.49 43.73  ? 1185 ASN A H     1 
ATOM   4151 H  H     B ASN A 1 315 ? -30.828 10.653  -17.924 0.51 43.75  ? 1185 ASN A H     1 
ATOM   4152 H  HA    A ASN A 1 315 ? -30.924 11.497  -15.946 0.49 46.68  ? 1185 ASN A HA    1 
ATOM   4153 H  HA    B ASN A 1 315 ? -30.834 11.480  -15.974 0.51 46.05  ? 1185 ASN A HA    1 
ATOM   4154 H  HB2   A ASN A 1 315 ? -33.249 10.972  -16.133 0.49 50.80  ? 1185 ASN A HB2   1 
ATOM   4155 H  HB2   B ASN A 1 315 ? -33.057 9.772   -15.583 0.51 51.29  ? 1185 ASN A HB2   1 
ATOM   4156 H  HB3   A ASN A 1 315 ? -32.959 9.639   -15.316 0.49 50.80  ? 1185 ASN A HB3   1 
ATOM   4157 H  HB3   B ASN A 1 315 ? -32.717 11.033  -14.676 0.51 51.29  ? 1185 ASN A HB3   1 
ATOM   4158 H  HD21  A ASN A 1 315 ? -34.122 10.071  -13.461 0.49 52.14  ? 1185 ASN A HD21  1 
ATOM   4159 H  HD21  B ASN A 1 315 ? -34.635 10.125  -17.047 0.51 70.26  ? 1185 ASN A HD21  1 
ATOM   4160 H  HD22  A ASN A 1 315 ? -33.836 11.195  -12.526 0.49 52.14  ? 1185 ASN A HD22  1 
ATOM   4161 H  HD22  B ASN A 1 315 ? -34.968 11.426  -17.691 0.51 70.26  ? 1185 ASN A HD22  1 
ATOM   4162 N  N     . LEU A 1 316 ? -29.166 9.405   -15.433 1.00 31.78  ? 1186 LEU A N     1 
ATOM   4163 C  CA    . LEU A 1 316 ? -28.261 8.595   -14.634 1.00 26.04  ? 1186 LEU A CA    1 
ATOM   4164 C  C     . LEU A 1 316 ? -26.910 9.280   -14.568 1.00 31.13  ? 1186 LEU A C     1 
ATOM   4165 O  O     . LEU A 1 316 ? -26.532 10.012  -15.486 1.00 30.15  ? 1186 LEU A O     1 
ATOM   4166 C  CB    . LEU A 1 316 ? -28.099 7.203   -15.253 1.00 25.98  ? 1186 LEU A CB    1 
ATOM   4167 C  CG    . LEU A 1 316 ? -29.325 6.302   -15.133 1.00 30.49  ? 1186 LEU A CG    1 
ATOM   4168 C  CD1   . LEU A 1 316 ? -29.257 5.163   -16.137 1.00 30.83  ? 1186 LEU A CD1   1 
ATOM   4169 C  CD2   . LEU A 1 316 ? -29.450 5.773   -13.709 1.00 35.66  ? 1186 LEU A CD2   1 
ATOM   4170 H  H     A LEU A 1 316 ? -28.854 9.613   -16.207 0.50 38.13  ? 1186 LEU A H     1 
ATOM   4171 H  H     B LEU A 1 316 ? -28.830 9.656   -16.184 0.50 38.13  ? 1186 LEU A H     1 
ATOM   4172 H  HA    . LEU A 1 316 ? -28.613 8.499   -13.725 1.00 31.25  ? 1186 LEU A HA    1 
ATOM   4173 H  HB2   . LEU A 1 316 ? -27.902 7.305   -16.197 1.00 31.17  ? 1186 LEU A HB2   1 
ATOM   4174 H  HB3   . LEU A 1 316 ? -27.361 6.753   -14.813 1.00 31.17  ? 1186 LEU A HB3   1 
ATOM   4175 H  HG    . LEU A 1 316 ? -30.119 6.825   -15.328 1.00 36.59  ? 1186 LEU A HG    1 
ATOM   4176 H  HD11  . LEU A 1 316 ? -29.223 5.529   -17.024 1.00 37.00  ? 1186 LEU A HD11  1 
ATOM   4177 H  HD12  . LEU A 1 316 ? -28.468 4.643   -15.967 1.00 37.00  ? 1186 LEU A HD12  1 
ATOM   4178 H  HD13  . LEU A 1 316 ? -30.039 4.614   -16.039 1.00 37.00  ? 1186 LEU A HD13  1 
ATOM   4179 H  HD21  . LEU A 1 316 ? -28.662 5.269   -13.493 1.00 42.79  ? 1186 LEU A HD21  1 
ATOM   4180 H  HD22  . LEU A 1 316 ? -29.540 6.515   -13.107 1.00 42.79  ? 1186 LEU A HD22  1 
ATOM   4181 H  HD23  . LEU A 1 316 ? -30.225 5.209   -13.653 1.00 42.79  ? 1186 LEU A HD23  1 
ATOM   4182 N  N     . ASN A 1 317 ? -26.180 9.035   -13.486 1.00 26.03  ? 1187 ASN A N     1 
ATOM   4183 C  CA    . ASN A 1 317 ? -24.860 9.613   -13.321 1.00 25.02  ? 1187 ASN A CA    1 
ATOM   4184 C  C     . ASN A 1 317 ? -23.817 8.665   -13.866 1.00 25.03  ? 1187 ASN A C     1 
ATOM   4185 O  O     . ASN A 1 317 ? -23.712 7.521   -13.421 1.00 24.04  ? 1187 ASN A O     1 
ATOM   4186 C  CB    . ASN A 1 317 ? -24.541 9.898   -11.858 1.00 27.73  ? 1187 ASN A CB    1 
ATOM   4187 C  CG    . ASN A 1 317 ? -23.274 10.709  -11.709 1.00 38.16  ? 1187 ASN A CG    1 
ATOM   4188 O  OD1   . ASN A 1 317 ? -22.186 10.165  -11.498 1.00 28.05  ? 1187 ASN A OD1   1 
ATOM   4189 N  ND2   . ASN A 1 317 ? -23.400 12.021  -11.872 1.00 39.08  ? 1187 ASN A ND2   1 
ATOM   4190 H  H     . ASN A 1 317 ? -26.430 8.534   -12.833 1.00 31.24  ? 1187 ASN A H     1 
ATOM   4191 H  HA    . ASN A 1 317 ? -24.807 10.455  -13.820 1.00 30.02  ? 1187 ASN A HA    1 
ATOM   4192 H  HB2   . ASN A 1 317 ? -25.271 10.400  -11.463 1.00 33.28  ? 1187 ASN A HB2   1 
ATOM   4193 H  HB3   . ASN A 1 317 ? -24.420 9.058   -11.388 1.00 33.28  ? 1187 ASN A HB3   1 
ATOM   4194 H  HD21  . ASN A 1 317 ? -24.170 12.360  -12.051 1.00 46.90  ? 1187 ASN A HD21  1 
ATOM   4195 H  HD22  . ASN A 1 317 ? -22.712 12.532  -11.798 1.00 46.90  ? 1187 ASN A HD22  1 
ATOM   4196 N  N     . PHE A 1 318 ? -23.041 9.137   -14.831 1.00 20.79  ? 1188 PHE A N     1 
ATOM   4197 C  CA    . PHE A 1 318 ? -22.045 8.286   -15.457 1.00 16.63  ? 1188 PHE A CA    1 
ATOM   4198 C  C     . PHE A 1 318 ? -21.039 7.767   -14.419 1.00 20.67  ? 1188 PHE A C     1 
ATOM   4199 O  O     . PHE A 1 318 ? -20.769 6.572   -14.359 1.00 19.35  ? 1188 PHE A O     1 
ATOM   4200 C  CB    . PHE A 1 318 ? -21.317 9.041   -16.575 1.00 19.70  ? 1188 PHE A CB    1 
ATOM   4201 C  CG    . PHE A 1 318 ? -20.179 8.256   -17.194 1.00 20.51  ? 1188 PHE A CG    1 
ATOM   4202 C  CD1   . PHE A 1 318 ? -20.428 7.265   -18.132 1.00 20.20  ? 1188 PHE A CD1   1 
ATOM   4203 C  CD2   . PHE A 1 318 ? -18.866 8.500   -16.817 1.00 22.51  ? 1188 PHE A CD2   1 
ATOM   4204 C  CE1   . PHE A 1 318 ? -19.391 6.536   -18.689 1.00 20.74  ? 1188 PHE A CE1   1 
ATOM   4205 C  CE2   . PHE A 1 318 ? -17.818 7.779   -17.369 1.00 24.93  ? 1188 PHE A CE2   1 
ATOM   4206 C  CZ    . PHE A 1 318 ? -18.079 6.790   -18.304 1.00 20.76  ? 1188 PHE A CZ    1 
ATOM   4207 H  H     . PHE A 1 318 ? -23.072 9.939   -15.139 1.00 24.95  ? 1188 PHE A H     1 
ATOM   4208 H  HA    . PHE A 1 318 ? -22.493 7.512   -15.857 1.00 19.96  ? 1188 PHE A HA    1 
ATOM   4209 H  HB2   . PHE A 1 318 ? -21.952 9.248   -17.278 1.00 23.64  ? 1188 PHE A HB2   1 
ATOM   4210 H  HB3   . PHE A 1 318 ? -20.948 9.861   -16.211 1.00 23.64  ? 1188 PHE A HB3   1 
ATOM   4211 H  HD1   . PHE A 1 318 ? -21.304 7.088   -18.390 1.00 24.24  ? 1188 PHE A HD1   1 
ATOM   4212 H  HD2   . PHE A 1 318 ? -18.685 9.159   -16.186 1.00 27.01  ? 1188 PHE A HD2   1 
ATOM   4213 H  HE1   . PHE A 1 318 ? -19.571 5.877   -19.319 1.00 24.89  ? 1188 PHE A HE1   1 
ATOM   4214 H  HE2   . PHE A 1 318 ? -16.943 7.954   -17.108 1.00 29.92  ? 1188 PHE A HE2   1 
ATOM   4215 H  HZ    . PHE A 1 318 ? -17.379 6.307   -18.680 1.00 24.91  ? 1188 PHE A HZ    1 
ATOM   4216 N  N     . LEU A 1 319 ? -20.477 8.659   -13.605 1.00 17.55  ? 1189 LEU A N     1 
ATOM   4217 C  CA    . LEU A 1 319 ? -19.371 8.274   -12.724 1.00 22.68  ? 1189 LEU A CA    1 
ATOM   4218 C  C     . LEU A 1 319 ? -19.796 7.454   -11.498 1.00 26.18  ? 1189 LEU A C     1 
ATOM   4219 O  O     . LEU A 1 319 ? -19.046 6.584   -11.049 1.00 27.45  ? 1189 LEU A O     1 
ATOM   4220 C  CB    . LEU A 1 319 ? -18.620 9.515   -12.229 1.00 17.41  ? 1189 LEU A CB    1 
ATOM   4221 C  CG    . LEU A 1 319 ? -17.869 10.333  -13.285 1.00 16.35  ? 1189 LEU A CG    1 
ATOM   4222 C  CD1   . LEU A 1 319 ? -17.439 11.674  -12.669 1.00 17.09  ? 1189 LEU A CD1   1 
ATOM   4223 C  CD2   . LEU A 1 319 ? -16.669 9.543   -13.822 1.00 21.09  ? 1189 LEU A CD2   1 
ATOM   4224 H  H     . LEU A 1 319 ? -20.713 9.484   -13.542 1.00 21.06  ? 1189 LEU A H     1 
ATOM   4225 H  HA    . LEU A 1 319 ? -18.739 7.730   -13.238 1.00 27.22  ? 1189 LEU A HA    1 
ATOM   4226 H  HB2   . LEU A 1 319 ? -19.261 10.110  -11.809 1.00 20.89  ? 1189 LEU A HB2   1 
ATOM   4227 H  HB3   . LEU A 1 319 ? -17.968 9.231   -11.569 1.00 20.89  ? 1189 LEU A HB3   1 
ATOM   4228 H  HG    . LEU A 1 319 ? -18.465 10.518  -14.027 1.00 19.62  ? 1189 LEU A HG    1 
ATOM   4229 H  HD11  . LEU A 1 319 ? -16.969 12.186  -13.331 1.00 20.51  ? 1189 LEU A HD11  1 
ATOM   4230 H  HD12  . LEU A 1 319 ? -18.222 12.151  -12.382 1.00 20.51  ? 1189 LEU A HD12  1 
ATOM   4231 H  HD13  . LEU A 1 319 ? -16.866 11.504  -11.918 1.00 20.51  ? 1189 LEU A HD13  1 
ATOM   4232 H  HD21  . LEU A 1 319 ? -16.075 9.345   -13.094 1.00 25.30  ? 1189 LEU A HD21  1 
ATOM   4233 H  HD22  . LEU A 1 319 ? -16.984 8.728   -14.219 1.00 25.30  ? 1189 LEU A HD22  1 
ATOM   4234 H  HD23  . LEU A 1 319 ? -16.215 10.074  -14.480 1.00 25.30  ? 1189 LEU A HD23  1 
ATOM   4235 N  N     . MET A 1 320 ? -20.982 7.734   -10.967 1.00 26.32  ? 1190 MET A N     1 
ATOM   4236 C  CA    . MET A 1 320 ? -21.404 7.187   -9.667  1.00 31.62  ? 1190 MET A CA    1 
ATOM   4237 C  C     . MET A 1 320 ? -22.662 6.339   -9.765  1.00 29.38  ? 1190 MET A C     1 
ATOM   4238 O  O     . MET A 1 320 ? -23.057 5.701   -8.788  1.00 27.77  ? 1190 MET A O     1 
ATOM   4239 C  CB    . MET A 1 320 ? -21.706 8.324   -8.675  1.00 31.97  ? 1190 MET A CB    1 
ATOM   4240 C  CG    . MET A 1 320 ? -20.534 9.215   -8.340  1.00 41.31  ? 1190 MET A CG    1 
ATOM   4241 S  SD    . MET A 1 320 ? -19.079 8.275   -7.842  1.00 64.09  ? 1190 MET A SD    1 
ATOM   4242 C  CE    . MET A 1 320 ? -19.207 8.393   -6.058  1.00 88.47  ? 1190 MET A CE    1 
ATOM   4243 H  H     . MET A 1 320 ? -21.569 8.242   -11.337 1.00 31.58  ? 1190 MET A H     1 
ATOM   4244 H  HA    . MET A 1 320 ? -20.677 6.644   -9.297  1.00 37.94  ? 1190 MET A HA    1 
ATOM   4245 H  HB2   . MET A 1 320 ? -22.400 8.886   -9.053  1.00 38.36  ? 1190 MET A HB2   1 
ATOM   4246 H  HB3   . MET A 1 320 ? -22.021 7.933   -7.845  1.00 38.36  ? 1190 MET A HB3   1 
ATOM   4247 H  HG2   . MET A 1 320 ? -20.301 9.740   -9.121  1.00 49.58  ? 1190 MET A HG2   1 
ATOM   4248 H  HG3   . MET A 1 320 ? -20.780 9.800   -7.606  1.00 49.58  ? 1190 MET A HG3   1 
ATOM   4249 H  HE1   . MET A 1 320 ? -19.178 9.318   -5.803  1.00 106.17 ? 1190 MET A HE1   1 
ATOM   4250 H  HE2   . MET A 1 320 ? -20.038 8.002   -5.778  1.00 106.17 ? 1190 MET A HE2   1 
ATOM   4251 H  HE3   . MET A 1 320 ? -18.472 7.921   -5.660  1.00 106.17 ? 1190 MET A HE3   1 
ATOM   4252 N  N     . GLY A 1 321 ? -23.303 6.356   -10.926 1.00 22.72  ? 1191 GLY A N     1 
ATOM   4253 C  CA    . GLY A 1 321 ? -24.614 5.752   -11.085 1.00 25.22  ? 1191 GLY A CA    1 
ATOM   4254 C  C     . GLY A 1 321 ? -24.525 4.267   -11.377 1.00 21.94  ? 1191 GLY A C     1 
ATOM   4255 O  O     . GLY A 1 321 ? -23.436 3.731   -11.576 1.00 20.84  ? 1191 GLY A O     1 
ATOM   4256 H  H     . GLY A 1 321 ? -22.995 6.715   -11.644 1.00 27.27  ? 1191 GLY A H     1 
ATOM   4257 H  HA2   . GLY A 1 321 ? -25.129 5.876   -10.272 1.00 30.26  ? 1191 GLY A HA2   1 
ATOM   4258 H  HA3   . GLY A 1 321 ? -25.084 6.183   -11.816 1.00 30.26  ? 1191 GLY A HA3   1 
ATOM   4259 N  N     . SER A 1 322 ? -25.681 3.610   -11.419 1.00 20.55  ? 1192 SER A N     1 
ATOM   4260 C  CA    . SER A 1 322 ? -25.752 2.171   -11.679 1.00 20.61  ? 1192 SER A CA    1 
ATOM   4261 C  C     . SER A 1 322 ? -26.500 1.975   -12.989 1.00 20.98  ? 1192 SER A C     1 
ATOM   4262 O  O     . SER A 1 322 ? -27.724 2.128   -13.052 1.00 20.79  ? 1192 SER A O     1 
ATOM   4263 C  CB    . SER A 1 322 ? -26.460 1.443   -10.525 1.00 23.83  ? 1192 SER A CB    1 
ATOM   4264 O  OG    . SER A 1 322 ? -26.480 0.029   -10.733 1.00 26.11  ? 1192 SER A OG    1 
ATOM   4265 H  H     . SER A 1 322 ? -26.448 3.978   -11.298 1.00 24.67  ? 1192 SER A H     1 
ATOM   4266 H  HA    . SER A 1 322 ? -24.848 1.806   -11.774 1.00 24.73  ? 1192 SER A HA    1 
ATOM   4267 H  HB2   . SER A 1 322 ? -25.989 1.631   -9.698  1.00 28.60  ? 1192 SER A HB2   1 
ATOM   4268 H  HB3   . SER A 1 322 ? -27.374 1.764   -10.465 1.00 28.60  ? 1192 SER A HB3   1 
ATOM   4269 H  HG    . SER A 1 322 ? -26.862 -0.341  -10.109 1.00 31.34  ? 1192 SER A HG    1 
ATOM   4270 N  N     . TRP A 1 323 ? -25.763 1.665   -14.049 1.00 18.22  ? 1193 TRP A N     1 
ATOM   4271 C  CA    . TRP A 1 323 ? -26.351 1.657   -15.383 1.00 21.36  ? 1193 TRP A CA    1 
ATOM   4272 C  C     . TRP A 1 323 ? -25.812 0.512   -16.224 1.00 22.96  ? 1193 TRP A C     1 
ATOM   4273 O  O     . TRP A 1 323 ? -24.619 0.225   -16.201 1.00 22.63  ? 1193 TRP A O     1 
ATOM   4274 C  CB    . TRP A 1 323 ? -26.108 2.992   -16.101 1.00 17.78  ? 1193 TRP A CB    1 
ATOM   4275 C  CG    . TRP A 1 323 ? -24.703 3.535   -15.995 1.00 18.89  ? 1193 TRP A CG    1 
ATOM   4276 C  CD1   . TRP A 1 323 ? -24.208 4.357   -15.013 1.00 22.42  ? 1193 TRP A CD1   1 
ATOM   4277 C  CD2   . TRP A 1 323 ? -23.620 3.319   -16.915 1.00 19.44  ? 1193 TRP A CD2   1 
ATOM   4278 N  NE1   . TRP A 1 323 ? -22.887 4.648   -15.266 1.00 21.97  ? 1193 TRP A NE1   1 
ATOM   4279 C  CE2   . TRP A 1 323 ? -22.504 4.024   -16.424 1.00 20.75  ? 1193 TRP A CE2   1 
ATOM   4280 C  CE3   . TRP A 1 323 ? -23.483 2.585   -18.100 1.00 17.49  ? 1193 TRP A CE3   1 
ATOM   4281 C  CZ2   . TRP A 1 323 ? -21.266 4.018   -17.077 1.00 19.49  ? 1193 TRP A CZ2   1 
ATOM   4282 C  CZ3   . TRP A 1 323 ? -22.248 2.585   -18.752 1.00 19.86  ? 1193 TRP A CZ3   1 
ATOM   4283 C  CH2   . TRP A 1 323 ? -21.163 3.297   -18.237 1.00 18.00  ? 1193 TRP A CH2   1 
ATOM   4284 H  H     . TRP A 1 323 ? -24.929 1.458   -14.024 1.00 21.86  ? 1193 TRP A H     1 
ATOM   4285 H  HA    . TRP A 1 323 ? -27.320 1.535   -15.299 1.00 25.64  ? 1193 TRP A HA    1 
ATOM   4286 H  HB2   . TRP A 1 323 ? -26.305 2.874   -17.044 1.00 21.33  ? 1193 TRP A HB2   1 
ATOM   4287 H  HB3   . TRP A 1 323 ? -26.707 3.656   -15.725 1.00 21.33  ? 1193 TRP A HB3   1 
ATOM   4288 H  HD1   . TRP A 1 323 ? -24.694 4.669   -14.283 1.00 26.90  ? 1193 TRP A HD1   1 
ATOM   4289 H  HE1   . TRP A 1 323 ? -22.383 5.144   -14.776 1.00 26.37  ? 1193 TRP A HE1   1 
ATOM   4290 H  HE3   . TRP A 1 323 ? -24.202 2.108   -18.448 1.00 20.98  ? 1193 TRP A HE3   1 
ATOM   4291 H  HZ2   . TRP A 1 323 ? -20.541 4.493   -16.739 1.00 23.38  ? 1193 TRP A HZ2   1 
ATOM   4292 H  HZ3   . TRP A 1 323 ? -22.146 2.103   -19.540 1.00 23.83  ? 1193 TRP A HZ3   1 
ATOM   4293 H  HH2   . TRP A 1 323 ? -20.351 3.280   -18.690 1.00 21.60  ? 1193 TRP A HH2   1 
ATOM   4294 N  N     . TRP A 1 324 ? -26.721 -0.131  -16.950 1.00 18.79  ? 1194 TRP A N     1 
ATOM   4295 C  CA    . TRP A 1 324 ? -26.421 -1.279  -17.798 1.00 17.86  ? 1194 TRP A CA    1 
ATOM   4296 C  C     . TRP A 1 324 ? -26.806 -0.914  -19.228 1.00 20.70  ? 1194 TRP A C     1 
ATOM   4297 O  O     . TRP A 1 324 ? -27.990 -0.857  -19.546 1.00 21.07  ? 1194 TRP A O     1 
ATOM   4298 C  CB    . TRP A 1 324 ? -27.245 -2.487  -17.347 1.00 18.18  ? 1194 TRP A CB    1 
ATOM   4299 C  CG    . TRP A 1 324 ? -26.901 -3.744  -18.096 1.00 20.10  ? 1194 TRP A CG    1 
ATOM   4300 C  CD1   . TRP A 1 324 ? -27.513 -4.219  -19.231 1.00 23.04  ? 1194 TRP A CD1   1 
ATOM   4301 C  CD2   . TRP A 1 324 ? -25.852 -4.678  -17.785 1.00 17.11  ? 1194 TRP A CD2   1 
ATOM   4302 N  NE1   . TRP A 1 324 ? -26.910 -5.390  -19.636 1.00 23.11  ? 1194 TRP A NE1   1 
ATOM   4303 C  CE2   . TRP A 1 324 ? -25.892 -5.694  -18.770 1.00 20.21  ? 1194 TRP A CE2   1 
ATOM   4304 C  CE3   . TRP A 1 324 ? -24.880 -4.748  -16.778 1.00 18.78  ? 1194 TRP A CE3   1 
ATOM   4305 C  CZ2   . TRP A 1 324 ? -25.001 -6.772  -18.774 1.00 20.28  ? 1194 TRP A CZ2   1 
ATOM   4306 C  CZ3   . TRP A 1 324 ? -23.999 -5.822  -16.774 1.00 15.40  ? 1194 TRP A CZ3   1 
ATOM   4307 C  CH2   . TRP A 1 324 ? -24.067 -6.823  -17.770 1.00 18.63  ? 1194 TRP A CH2   1 
ATOM   4308 H  H     . TRP A 1 324 ? -27.552 0.090   -16.968 1.00 22.55  ? 1194 TRP A H     1 
ATOM   4309 H  HA    . TRP A 1 324 ? -25.466 -1.497  -17.759 1.00 21.43  ? 1194 TRP A HA    1 
ATOM   4310 H  HB2   . TRP A 1 324 ? -27.081 -2.646  -16.404 1.00 21.81  ? 1194 TRP A HB2   1 
ATOM   4311 H  HB3   . TRP A 1 324 ? -28.185 -2.299  -17.492 1.00 21.81  ? 1194 TRP A HB3   1 
ATOM   4312 H  HD1   . TRP A 1 324 ? -28.231 -3.812  -19.660 1.00 27.65  ? 1194 TRP A HD1   1 
ATOM   4313 H  HE1   . TRP A 1 324 ? -27.139 -5.858  -20.320 1.00 27.74  ? 1194 TRP A HE1   1 
ATOM   4314 H  HE3   . TRP A 1 324 ? -24.832 -4.094  -16.119 1.00 22.53  ? 1194 TRP A HE3   1 
ATOM   4315 H  HZ2   . TRP A 1 324 ? -25.045 -7.433  -19.426 1.00 24.33  ? 1194 TRP A HZ2   1 
ATOM   4316 H  HZ3   . TRP A 1 324 ? -23.353 -5.882  -16.108 1.00 18.47  ? 1194 TRP A HZ3   1 
ATOM   4317 H  HH2   . TRP A 1 324 ? -23.464 -7.531  -17.747 1.00 22.36  ? 1194 TRP A HH2   1 
ATOM   4318 N  N     . PRO A 1 325 ? -25.814 -0.666  -20.096 1.00 22.14  ? 1195 PRO A N     1 
ATOM   4319 C  CA    . PRO A 1 325 ? -26.146 -0.129  -21.420 1.00 19.57  ? 1195 PRO A CA    1 
ATOM   4320 C  C     . PRO A 1 325 ? -27.082 -1.018  -22.225 1.00 21.31  ? 1195 PRO A C     1 
ATOM   4321 O  O     . PRO A 1 325 ? -26.986 -2.243  -22.179 1.00 21.15  ? 1195 PRO A O     1 
ATOM   4322 C  CB    . PRO A 1 325 ? -24.781 -0.031  -22.111 1.00 18.46  ? 1195 PRO A CB    1 
ATOM   4323 C  CG    . PRO A 1 325 ? -23.801 0.143   -20.966 1.00 19.20  ? 1195 PRO A CG    1 
ATOM   4324 C  CD    . PRO A 1 325 ? -24.358 -0.741  -19.880 1.00 21.53  ? 1195 PRO A CD    1 
ATOM   4325 H  HA    . PRO A 1 325 ? -26.536 0.767   -21.338 1.00 23.48  ? 1195 PRO A HA    1 
ATOM   4326 H  HB2   . PRO A 1 325 ? -24.600 -0.849  -22.601 1.00 22.16  ? 1195 PRO A HB2   1 
ATOM   4327 H  HB3   . PRO A 1 325 ? -24.765 0.738   -22.701 1.00 22.16  ? 1195 PRO A HB3   1 
ATOM   4328 H  HG2   . PRO A 1 325 ? -22.919 -0.155  -21.238 1.00 23.04  ? 1195 PRO A HG2   1 
ATOM   4329 H  HG3   . PRO A 1 325 ? -23.783 1.071   -20.684 1.00 23.04  ? 1195 PRO A HG3   1 
ATOM   4330 H  HD2   . PRO A 1 325 ? -24.046 -1.652  -19.992 1.00 25.83  ? 1195 PRO A HD2   1 
ATOM   4331 H  HD3   . PRO A 1 325 ? -24.126 -0.390  -19.006 1.00 25.83  ? 1195 PRO A HD3   1 
ATOM   4332 N  N     . ASN A 1 326 ? -27.984 -0.376  -22.957 1.00 23.27  ? 1196 ASN A N     1 
ATOM   4333 C  CA    . ASN A 1 326 ? -28.792 -1.049  -23.965 1.00 21.43  ? 1196 ASN A CA    1 
ATOM   4334 C  C     . ASN A 1 326 ? -27.951 -1.139  -25.236 1.00 19.82  ? 1196 ASN A C     1 
ATOM   4335 O  O     . ASN A 1 326 ? -27.619 -0.127  -25.856 1.00 22.71  ? 1196 ASN A O     1 
ATOM   4336 C  CB    . ASN A 1 326 ? -30.069 -0.246  -24.202 1.00 27.60  ? 1196 ASN A CB    1 
ATOM   4337 C  CG    . ASN A 1 326 ? -31.003 -0.896  -25.207 1.00 35.72  ? 1196 ASN A CG    1 
ATOM   4338 O  OD1   . ASN A 1 326 ? -30.623 -1.802  -25.944 1.00 31.82  ? 1196 ASN A OD1   1 
ATOM   4339 N  ND2   . ASN A 1 326 ? -32.238 -0.416  -25.245 1.00 35.05  ? 1196 ASN A ND2   1 
ATOM   4340 H  H     . ASN A 1 326 ? -28.149 0.465   -22.886 1.00 27.92  ? 1196 ASN A H     1 
ATOM   4341 H  HA    . ASN A 1 326 ? -29.026 -1.952  -23.666 1.00 25.71  ? 1196 ASN A HA    1 
ATOM   4342 H  HB2   . ASN A 1 326 ? -30.547 -0.160  -23.362 1.00 33.12  ? 1196 ASN A HB2   1 
ATOM   4343 H  HB3   . ASN A 1 326 ? -29.832 0.632   -24.539 1.00 33.12  ? 1196 ASN A HB3   1 
ATOM   4344 H  HD21  . ASN A 1 326 ? -32.466 0.225   -24.719 1.00 42.06  ? 1196 ASN A HD21  1 
ATOM   4345 H  HD22  . ASN A 1 326 ? -32.810 -0.746  -25.795 1.00 42.06  ? 1196 ASN A HD22  1 
ATOM   4346 N  N     . LEU A 1 327 ? -27.564 -2.351  -25.603 1.00 21.53  ? 1197 LEU A N     1 
ATOM   4347 C  CA    . LEU A 1 327 ? -26.677 -2.546  -26.741 1.00 22.00  ? 1197 LEU A CA    1 
ATOM   4348 C  C     . LEU A 1 327 ? -27.280 -2.001  -28.029 1.00 28.02  ? 1197 LEU A C     1 
ATOM   4349 O  O     . LEU A 1 327 ? -26.554 -1.622  -28.950 1.00 25.32  ? 1197 LEU A O     1 
ATOM   4350 C  CB    . LEU A 1 327 ? -26.358 -4.035  -26.918 1.00 23.38  ? 1197 LEU A CB    1 
ATOM   4351 C  CG    . LEU A 1 327 ? -25.489 -4.626  -25.809 1.00 21.51  ? 1197 LEU A CG    1 
ATOM   4352 C  CD1   . LEU A 1 327 ? -25.197 -6.088  -26.118 1.00 28.05  ? 1197 LEU A CD1   1 
ATOM   4353 C  CD2   . LEU A 1 327 ? -24.182 -3.822  -25.634 1.00 20.74  ? 1197 LEU A CD2   1 
ATOM   4354 H  H     . LEU A 1 327 ? -27.801 -3.079  -25.211 1.00 25.84  ? 1197 LEU A H     1 
ATOM   4355 H  HA    . LEU A 1 327 ? -25.835 -2.073  -26.575 1.00 26.40  ? 1197 LEU A HA    1 
ATOM   4356 H  HB2   . LEU A 1 327 ? -27.191 -4.531  -26.937 1.00 28.06  ? 1197 LEU A HB2   1 
ATOM   4357 H  HB3   . LEU A 1 327 ? -25.887 -4.154  -27.758 1.00 28.06  ? 1197 LEU A HB3   1 
ATOM   4358 H  HG    . LEU A 1 327 ? -25.977 -4.589  -24.972 1.00 25.82  ? 1197 LEU A HG    1 
ATOM   4359 H  HD11  . LEU A 1 327 ? -26.027 -6.568  -26.170 1.00 33.67  ? 1197 LEU A HD11  1 
ATOM   4360 H  HD12  . LEU A 1 327 ? -24.734 -6.144  -26.957 1.00 33.67  ? 1197 LEU A HD12  1 
ATOM   4361 H  HD13  . LEU A 1 327 ? -24.651 -6.453  -25.418 1.00 33.67  ? 1197 LEU A HD13  1 
ATOM   4362 H  HD21  . LEU A 1 327 ? -23.663 -4.220  -24.932 1.00 24.89  ? 1197 LEU A HD21  1 
ATOM   4363 H  HD22  . LEU A 1 327 ? -23.690 -3.843  -26.458 1.00 24.89  ? 1197 LEU A HD22  1 
ATOM   4364 H  HD23  . LEU A 1 327 ? -24.402 -2.916  -25.406 1.00 24.89  ? 1197 LEU A HD23  1 
ATOM   4365 N  N     . GLU A 1 328 ? -28.603 -1.967  -28.105 1.00 27.97  ? 1198 GLU A N     1 
ATOM   4366 C  CA    . GLU A 1 328 ? -29.249 -1.465  -29.316 1.00 27.83  ? 1198 GLU A CA    1 
ATOM   4367 C  C     . GLU A 1 328 ? -29.046 0.047   -29.439 1.00 28.84  ? 1198 GLU A C     1 
ATOM   4368 O  O     . GLU A 1 328 ? -28.892 0.564   -30.544 1.00 27.99  ? 1198 GLU A O     1 
ATOM   4369 C  CB    . GLU A 1 328 ? -30.734 -1.838  -29.336 1.00 38.40  ? 1198 GLU A CB    1 
ATOM   4370 C  CG    . GLU A 1 328 ? -30.964 -3.346  -29.391 1.00 52.21  ? 1198 GLU A CG    1 
ATOM   4371 C  CD    . GLU A 1 328 ? -32.434 -3.724  -29.405 1.00 75.55  ? 1198 GLU A CD    1 
ATOM   4372 O  OE1   . GLU A 1 328 ? -33.285 -2.872  -29.067 1.00 83.54  ? 1198 GLU A OE1   1 
ATOM   4373 O  OE2   . GLU A 1 328 ? -32.738 -4.881  -29.759 1.00 79.99  ? 1198 GLU A OE2   1 
ATOM   4374 H  H     . GLU A 1 328 ? -29.142 -2.222  -27.485 1.00 33.57  ? 1198 GLU A H     1 
ATOM   4375 H  HA    . GLU A 1 328 ? -28.827 -1.886  -30.093 1.00 33.40  ? 1198 GLU A HA    1 
ATOM   4376 H  HB2   . GLU A 1 328 ? -31.156 -1.499  -28.532 1.00 46.08  ? 1198 GLU A HB2   1 
ATOM   4377 H  HB3   . GLU A 1 328 ? -31.147 -1.443  -30.120 1.00 46.08  ? 1198 GLU A HB3   1 
ATOM   4378 H  HG2   . GLU A 1 328 ? -30.557 -3.698  -30.198 1.00 62.66  ? 1198 GLU A HG2   1 
ATOM   4379 H  HG3   . GLU A 1 328 ? -30.559 -3.755  -28.610 1.00 62.66  ? 1198 GLU A HG3   1 
ATOM   4380 N  N     . ASP A 1 329 ? -29.043 0.751   -28.308 1.00 25.00  ? 1199 ASP A N     1 
ATOM   4381 C  CA    . ASP A 1 329 ? -28.718 2.183   -28.298 1.00 26.04  ? 1199 ASP A CA    1 
ATOM   4382 C  C     . ASP A 1 329 ? -27.287 2.425   -28.759 1.00 27.30  ? 1199 ASP A C     1 
ATOM   4383 O  O     . ASP A 1 329 ? -27.018 3.353   -29.532 1.00 22.82  ? 1199 ASP A O     1 
ATOM   4384 C  CB    . ASP A 1 329 ? -28.877 2.785   -26.897 1.00 24.22  ? 1199 ASP A CB    1 
ATOM   4385 C  CG    . ASP A 1 329 ? -30.329 2.959   -26.486 1.00 34.77  ? 1199 ASP A CG    1 
ATOM   4386 O  OD1   . ASP A 1 329 ? -31.218 2.909   -27.353 1.00 34.34  ? 1199 ASP A OD1   1 
ATOM   4387 O  OD2   . ASP A 1 329 ? -30.581 3.169   -25.285 1.00 28.75  ? 1199 ASP A OD2   1 
ATOM   4388 H  H     . ASP A 1 329 ? -29.225 0.426   -27.533 1.00 30.00  ? 1199 ASP A H     1 
ATOM   4389 H  HA    . ASP A 1 329 ? -29.322 2.657   -28.907 1.00 31.25  ? 1199 ASP A HA    1 
ATOM   4390 H  HB2   . ASP A 1 329 ? -28.451 2.199   -26.252 1.00 29.06  ? 1199 ASP A HB2   1 
ATOM   4391 H  HB3   . ASP A 1 329 ? -28.454 3.658   -26.879 1.00 29.06  ? 1199 ASP A HB3   1 
ATOM   4392 N  N     . LEU A 1 330 ? -26.362 1.598   -28.275 1.00 23.59  ? 1200 LEU A N     1 
ATOM   4393 C  CA    . LEU A 1 330 ? -24.954 1.764   -28.620 1.00 24.31  ? 1200 LEU A CA    1 
ATOM   4394 C  C     . LEU A 1 330 ? -24.748 1.518   -30.111 1.00 23.64  ? 1200 LEU A C     1 
ATOM   4395 O  O     . LEU A 1 330 ? -24.013 2.243   -30.780 1.00 23.11  ? 1200 LEU A O     1 
ATOM   4396 C  CB    . LEU A 1 330 ? -24.070 0.814   -27.803 1.00 24.99  ? 1200 LEU A CB    1 
ATOM   4397 C  CG    . LEU A 1 330 ? -24.075 1.072   -26.292 1.00 25.33  ? 1200 LEU A CG    1 
ATOM   4398 C  CD1   . LEU A 1 330 ? -23.015 0.194   -25.588 1.00 19.96  ? 1200 LEU A CD1   1 
ATOM   4399 C  CD2   . LEU A 1 330 ? -23.849 2.549   -25.982 1.00 24.07  ? 1200 LEU A CD2   1 
ATOM   4400 H  H     . LEU A 1 330 ? -26.523 0.937   -27.749 1.00 28.31  ? 1200 LEU A H     1 
ATOM   4401 H  HA    . LEU A 1 330 ? -24.680 2.683   -28.420 1.00 29.17  ? 1200 LEU A HA    1 
ATOM   4402 H  HB2   . LEU A 1 330 ? -24.377 -0.095  -27.947 1.00 29.99  ? 1200 LEU A HB2   1 
ATOM   4403 H  HB3   . LEU A 1 330 ? -23.155 0.900   -28.113 1.00 29.99  ? 1200 LEU A HB3   1 
ATOM   4404 H  HG    . LEU A 1 330 ? -24.943 0.826   -25.938 1.00 30.39  ? 1200 LEU A HG    1 
ATOM   4405 H  HD11  . LEU A 1 330 ? -23.217 -0.730  -25.751 1.00 23.95  ? 1200 LEU A HD11  1 
ATOM   4406 H  HD12  . LEU A 1 330 ? -22.148 0.408   -25.942 1.00 23.95  ? 1200 LEU A HD12  1 
ATOM   4407 H  HD13  . LEU A 1 330 ? -23.037 0.374   -24.645 1.00 23.95  ? 1200 LEU A HD13  1 
ATOM   4408 H  HD21  . LEU A 1 330 ? -22.999 2.816   -26.340 1.00 28.88  ? 1200 LEU A HD21  1 
ATOM   4409 H  HD22  . LEU A 1 330 ? -24.552 3.063   -26.387 1.00 28.88  ? 1200 LEU A HD22  1 
ATOM   4410 H  HD23  . LEU A 1 330 ? -23.858 2.673   -25.030 1.00 28.88  ? 1200 LEU A HD23  1 
ATOM   4411 N  N     . TYR A 1 331 ? -25.406 0.495   -30.631 1.00 20.97  ? 1201 TYR A N     1 
ATOM   4412 C  CA    . TYR A 1 331 ? -25.243 0.138   -32.032 1.00 26.27  ? 1201 TYR A CA    1 
ATOM   4413 C  C     . TYR A 1 331 ? -25.726 1.281   -32.919 1.00 31.39  ? 1201 TYR A C     1 
ATOM   4414 O  O     . TYR A 1 331 ? -25.088 1.623   -33.918 1.00 26.39  ? 1201 TYR A O     1 
ATOM   4415 C  CB    . TYR A 1 331 ? -26.020 -1.136  -32.344 1.00 26.56  ? 1201 TYR A CB    1 
ATOM   4416 C  CG    . TYR A 1 331 ? -25.876 -1.596  -33.781 1.00 34.95  ? 1201 TYR A CG    1 
ATOM   4417 C  CD1   . TYR A 1 331 ? -24.780 -2.352  -34.178 1.00 41.48  ? 1201 TYR A CD1   1 
ATOM   4418 C  CD2   . TYR A 1 331 ? -26.836 -1.280  -34.732 1.00 42.25  ? 1201 TYR A CD2   1 
ATOM   4419 C  CE1   . TYR A 1 331 ? -24.642 -2.778  -35.486 1.00 49.07  ? 1201 TYR A CE1   1 
ATOM   4420 C  CE2   . TYR A 1 331 ? -26.708 -1.704  -36.049 1.00 44.44  ? 1201 TYR A CE2   1 
ATOM   4421 C  CZ    . TYR A 1 331 ? -25.611 -2.452  -36.416 1.00 45.07  ? 1201 TYR A CZ    1 
ATOM   4422 O  OH    . TYR A 1 331 ? -25.475 -2.881  -37.716 1.00 50.78  ? 1201 TYR A OH    1 
ATOM   4423 H  H     . TYR A 1 331 ? -25.952 -0.008  -30.196 1.00 25.17  ? 1201 TYR A H     1 
ATOM   4424 H  HA    . TYR A 1 331 ? -24.295 -0.023  -32.220 1.00 31.52  ? 1201 TYR A HA    1 
ATOM   4425 H  HB2   . TYR A 1 331 ? -25.698 -1.848  -31.770 1.00 31.88  ? 1201 TYR A HB2   1 
ATOM   4426 H  HB3   . TYR A 1 331 ? -26.962 -0.978  -32.176 1.00 31.88  ? 1201 TYR A HB3   1 
ATOM   4427 H  HD1   . TYR A 1 331 ? -24.128 -2.574  -33.554 1.00 49.78  ? 1201 TYR A HD1   1 
ATOM   4428 H  HD2   . TYR A 1 331 ? -27.577 -0.776  -34.483 1.00 50.70  ? 1201 TYR A HD2   1 
ATOM   4429 H  HE1   . TYR A 1 331 ? -23.904 -3.284  -35.738 1.00 58.89  ? 1201 TYR A HE1   1 
ATOM   4430 H  HE2   . TYR A 1 331 ? -27.358 -1.486  -36.677 1.00 53.33  ? 1201 TYR A HE2   1 
ATOM   4431 H  HH    . TYR A 1 331 ? -25.447 -3.700  -37.740 1.00 60.94  ? 1201 TYR A HH    1 
ATOM   4432 N  N     . GLU A 1 332 ? -26.844 1.887   -32.540 1.00 30.78  ? 1202 GLU A N     1 
ATOM   4433 C  CA    . GLU A 1 332 ? -27.403 2.971   -33.342 1.00 33.37  ? 1202 GLU A CA    1 
ATOM   4434 C  C     . GLU A 1 332 ? -26.505 4.192   -33.295 1.00 37.09  ? 1202 GLU A C     1 
ATOM   4435 O  O     . GLU A 1 332 ? -26.438 4.953   -34.257 1.00 36.16  ? 1202 GLU A O     1 
ATOM   4436 C  CB    . GLU A 1 332 ? -28.820 3.316   -32.889 1.00 42.63  ? 1202 GLU A CB    1 
ATOM   4437 C  CG    . GLU A 1 332 ? -29.805 2.209   -33.204 1.00 79.84  ? 1202 GLU A CG    1 
ATOM   4438 C  CD    . GLU A 1 332 ? -29.858 1.909   -34.690 1.00 109.97 ? 1202 GLU A CD    1 
ATOM   4439 O  OE1   . GLU A 1 332 ? -29.743 2.860   -35.495 1.00 117.33 ? 1202 GLU A OE1   1 
ATOM   4440 O  OE2   . GLU A 1 332 ? -30.001 0.724   -35.053 1.00 121.26 ? 1202 GLU A OE2   1 
ATOM   4441 H  H     . GLU A 1 332 ? -27.295 1.695   -31.833 1.00 36.94  ? 1202 GLU A H     1 
ATOM   4442 H  HA    . GLU A 1 332 ? -27.454 2.675   -34.275 1.00 40.04  ? 1202 GLU A HA    1 
ATOM   4443 H  HB2   . GLU A 1 332 ? -28.822 3.458   -31.929 1.00 51.15  ? 1202 GLU A HB2   1 
ATOM   4444 H  HB3   . GLU A 1 332 ? -29.113 4.120   -33.346 1.00 51.15  ? 1202 GLU A HB3   1 
ATOM   4445 H  HG2   . GLU A 1 332 ? -29.535 1.400   -32.741 1.00 95.80  ? 1202 GLU A HG2   1 
ATOM   4446 H  HG3   . GLU A 1 332 ? -30.691 2.479   -32.917 1.00 95.80  ? 1202 GLU A HG3   1 
ATOM   4447 N  N     . ALA A 1 333 ? -25.793 4.361   -32.185 1.00 28.27  ? 1203 ALA A N     1 
ATOM   4448 C  CA    . ALA A 1 333 ? -24.882 5.488   -32.043 1.00 26.93  ? 1203 ALA A CA    1 
ATOM   4449 C  C     . ALA A 1 333 ? -23.490 5.147   -32.577 1.00 22.88  ? 1203 ALA A C     1 
ATOM   4450 O  O     . ALA A 1 333 ? -22.553 5.932   -32.418 1.00 24.13  ? 1203 ALA A O     1 
ATOM   4451 C  CB    . ALA A 1 333 ? -24.815 5.948   -30.571 1.00 27.49  ? 1203 ALA A CB    1 
ATOM   4452 H  H     . ALA A 1 333 ? -25.820 3.839   -31.503 1.00 33.92  ? 1203 ALA A H     1 
ATOM   4453 H  HA    . ALA A 1 333 ? -25.226 6.237   -32.572 1.00 32.32  ? 1203 ALA A HA    1 
ATOM   4454 H  HB1   . ALA A 1 333 ? -24.502 5.219   -30.030 1.00 32.99  ? 1203 ALA A HB1   1 
ATOM   4455 H  HB2   . ALA A 1 333 ? -24.209 6.689   -30.503 1.00 32.99  ? 1203 ALA A HB2   1 
ATOM   4456 H  HB3   . ALA A 1 333 ? -25.692 6.214   -30.287 1.00 32.99  ? 1203 ALA A HB3   1 
ATOM   4457 N  N     . ASN A 1 334 ? -23.358 3.988   -33.224 1.00 20.55  ? 1204 ASN A N     1 
ATOM   4458 C  CA    . ASN A 1 334 ? -22.082 3.579   -33.816 1.00 21.31  ? 1204 ASN A CA    1 
ATOM   4459 C  C     . ASN A 1 334 ? -20.947 3.512   -32.780 1.00 21.00  ? 1204 ASN A C     1 
ATOM   4460 O  O     . ASN A 1 334 ? -19.801 3.907   -33.052 1.00 20.83  ? 1204 ASN A O     1 
ATOM   4461 C  CB    . ASN A 1 334 ? -21.704 4.515   -34.962 1.00 31.83  ? 1204 ASN A CB    1 
ATOM   4462 C  CG    . ASN A 1 334 ? -22.640 4.365   -36.160 1.00 39.02  ? 1204 ASN A CG    1 
ATOM   4463 O  OD1   . ASN A 1 334 ? -23.785 4.791   -36.101 1.00 36.46  ? 1204 ASN A OD1   1 
ATOM   4464 N  ND2   . ASN A 1 334 ? -22.156 3.761   -37.242 1.00 51.48  ? 1204 ASN A ND2   1 
ATOM   4465 H  H     . ASN A 1 334 ? -23.993 3.419   -33.335 1.00 24.66  ? 1204 ASN A H     1 
ATOM   4466 H  HA    . ASN A 1 334 ? -22.189 2.681   -34.193 1.00 25.58  ? 1204 ASN A HA    1 
ATOM   4467 H  HB2   . ASN A 1 334 ? -21.754 5.433   -34.652 1.00 38.20  ? 1204 ASN A HB2   1 
ATOM   4468 H  HB3   . ASN A 1 334 ? -20.802 4.311   -35.255 1.00 38.20  ? 1204 ASN A HB3   1 
ATOM   4469 H  HD21  . ASN A 1 334 ? -21.346 3.473   -37.248 1.00 61.78  ? 1204 ASN A HD21  1 
ATOM   4470 H  HD22  . ASN A 1 334 ? -22.654 3.658   -37.936 1.00 61.78  ? 1204 ASN A HD22  1 
ATOM   4471 N  N     . VAL A 1 335 ? -21.287 3.018   -31.595 1.00 19.81  ? 1205 VAL A N     1 
ATOM   4472 C  CA    . VAL A 1 335 ? -20.301 2.722   -30.556 1.00 18.17  ? 1205 VAL A CA    1 
ATOM   4473 C  C     . VAL A 1 335 ? -19.891 1.250   -30.658 1.00 20.12  ? 1205 VAL A C     1 
ATOM   4474 O  O     . VAL A 1 335 ? -20.744 0.374   -30.606 1.00 19.31  ? 1205 VAL A O     1 
ATOM   4475 C  CB    . VAL A 1 335 ? -20.895 2.946   -29.151 1.00 20.70  ? 1205 VAL A CB    1 
ATOM   4476 C  CG1   . VAL A 1 335 ? -19.866 2.589   -28.067 1.00 21.13  ? 1205 VAL A CG1   1 
ATOM   4477 C  CG2   . VAL A 1 335 ? -21.360 4.389   -28.981 1.00 19.44  ? 1205 VAL A CG2   1 
ATOM   4478 H  H     . VAL A 1 335 ? -22.096 2.843   -31.362 1.00 23.78  ? 1205 VAL A H     1 
ATOM   4479 H  HA    . VAL A 1 335 ? -19.508 3.287   -30.667 1.00 21.81  ? 1205 VAL A HA    1 
ATOM   4480 H  HB    . VAL A 1 335 ? -21.672 2.361   -29.036 1.00 24.84  ? 1205 VAL A HB    1 
ATOM   4481 H  HG11  . VAL A 1 335 ? -20.258 2.737   -27.203 1.00 25.35  ? 1205 VAL A HG11  1 
ATOM   4482 H  HG12  . VAL A 1 335 ? -19.620 1.666   -28.161 1.00 25.35  ? 1205 VAL A HG12  1 
ATOM   4483 H  HG13  . VAL A 1 335 ? -19.092 3.146   -28.175 1.00 25.35  ? 1205 VAL A HG13  1 
ATOM   4484 H  HG21  . VAL A 1 335 ? -21.186 4.871   -29.793 1.00 23.33  ? 1205 VAL A HG21  1 
ATOM   4485 H  HG22  . VAL A 1 335 ? -22.301 4.393   -28.792 1.00 23.33  ? 1205 VAL A HG22  1 
ATOM   4486 H  HG23  . VAL A 1 335 ? -20.878 4.789   -28.253 1.00 23.33  ? 1205 VAL A HG23  1 
ATOM   4487 N  N     . PRO A 1 336 ? -18.589 0.970   -30.820 1.00 18.43  ? 1206 PRO A N     1 
ATOM   4488 C  CA    . PRO A 1 336 ? -18.172 -0.431  -30.941 1.00 16.26  ? 1206 PRO A CA    1 
ATOM   4489 C  C     . PRO A 1 336 ? -18.182 -1.113  -29.573 1.00 16.30  ? 1206 PRO A C     1 
ATOM   4490 O  O     . PRO A 1 336 ? -17.822 -0.476  -28.583 1.00 16.79  ? 1206 PRO A O     1 
ATOM   4491 C  CB    . PRO A 1 336 ? -16.746 -0.329  -31.485 1.00 17.16  ? 1206 PRO A CB    1 
ATOM   4492 C  CG    . PRO A 1 336 ? -16.245 1.001   -30.984 1.00 16.75  ? 1206 PRO A CG    1 
ATOM   4493 C  CD    . PRO A 1 336 ? -17.457 1.904   -30.966 1.00 20.22  ? 1206 PRO A CD    1 
ATOM   4494 H  HA    . PRO A 1 336 ? -18.743 -0.919  -31.570 1.00 19.52  ? 1206 PRO A HA    1 
ATOM   4495 H  HB2   . PRO A 1 336 ? -16.208 -1.056  -31.134 1.00 20.59  ? 1206 PRO A HB2   1 
ATOM   4496 H  HB3   . PRO A 1 336 ? -16.763 -0.349  -32.455 1.00 20.59  ? 1206 PRO A HB3   1 
ATOM   4497 H  HG2   . PRO A 1 336 ? -15.882 0.897   -30.091 1.00 20.10  ? 1206 PRO A HG2   1 
ATOM   4498 H  HG3   . PRO A 1 336 ? -15.571 1.345   -31.591 1.00 20.10  ? 1206 PRO A HG3   1 
ATOM   4499 H  HD2   . PRO A 1 336 ? -17.417 2.507   -30.206 1.00 24.26  ? 1206 PRO A HD2   1 
ATOM   4500 H  HD3   . PRO A 1 336 ? -17.528 2.391   -31.802 1.00 24.26  ? 1206 PRO A HD3   1 
ATOM   4501 N  N     . VAL A 1 337 ? -18.621 -2.366  -29.528 1.00 18.75  ? 1207 VAL A N     1 
ATOM   4502 C  CA    . VAL A 1 337 ? -18.671 -3.127  -28.276 1.00 18.85  ? 1207 VAL A CA    1 
ATOM   4503 C  C     . VAL A 1 337 ? -17.932 -4.443  -28.470 1.00 19.78  ? 1207 VAL A C     1 
ATOM   4504 O  O     . VAL A 1 337 ? -18.268 -5.227  -29.363 1.00 18.01  ? 1207 VAL A O     1 
ATOM   4505 C  CB    . VAL A 1 337 ? -20.124 -3.416  -27.843 1.00 22.29  ? 1207 VAL A CB    1 
ATOM   4506 C  CG1   . VAL A 1 337 ? -20.143 -4.258  -26.566 1.00 19.68  ? 1207 VAL A CG1   1 
ATOM   4507 C  CG2   . VAL A 1 337 ? -20.903 -2.096  -27.649 1.00 20.40  ? 1207 VAL A CG2   1 
ATOM   4508 H  H     . VAL A 1 337 ? -18.898 -2.805  -30.213 1.00 22.50  ? 1207 VAL A H     1 
ATOM   4509 H  HA    . VAL A 1 337 ? -18.228 -2.620  -27.564 1.00 22.62  ? 1207 VAL A HA    1 
ATOM   4510 H  HB    . VAL A 1 337 ? -20.570 -3.929  -28.550 1.00 26.75  ? 1207 VAL A HB    1 
ATOM   4511 H  HG11  . VAL A 1 337 ? -21.054 -4.426  -26.316 1.00 23.62  ? 1207 VAL A HG11  1 
ATOM   4512 H  HG12  . VAL A 1 337 ? -19.691 -5.089  -26.732 1.00 23.62  ? 1207 VAL A HG12  1 
ATOM   4513 H  HG13  . VAL A 1 337 ? -19.695 -3.776  -25.867 1.00 23.62  ? 1207 VAL A HG13  1 
ATOM   4514 H  HG21  . VAL A 1 337 ? -21.802 -2.301  -27.381 1.00 24.48  ? 1207 VAL A HG21  1 
ATOM   4515 H  HG22  . VAL A 1 337 ? -20.469 -1.574  -26.970 1.00 24.48  ? 1207 VAL A HG22  1 
ATOM   4516 H  HG23  . VAL A 1 337 ? -20.911 -1.613  -28.479 1.00 24.48  ? 1207 VAL A HG23  1 
ATOM   4517 N  N     . TYR A 1 338 ? -16.901 -4.651  -27.654 1.00 13.71  ? 1208 TYR A N     1 
ATOM   4518 C  CA    . TYR A 1 338 ? -16.166 -5.907  -27.592 1.00 14.09  ? 1208 TYR A CA    1 
ATOM   4519 C  C     . TYR A 1 338 ? -16.916 -6.763  -26.593 1.00 15.97  ? 1208 TYR A C     1 
ATOM   4520 O  O     . TYR A 1 338 ? -17.311 -6.282  -25.540 1.00 19.24  ? 1208 TYR A O     1 
ATOM   4521 C  CB    . TYR A 1 338 ? -14.746 -5.665  -27.065 1.00 14.81  ? 1208 TYR A CB    1 
ATOM   4522 C  CG    . TYR A 1 338 ? -13.865 -4.873  -27.998 1.00 17.48  ? 1208 TYR A CG    1 
ATOM   4523 C  CD1   . TYR A 1 338 ? -12.915 -5.507  -28.790 1.00 20.81  ? 1208 TYR A CD1   1 
ATOM   4524 C  CD2   . TYR A 1 338 ? -13.994 -3.489  -28.101 1.00 18.63  ? 1208 TYR A CD2   1 
ATOM   4525 C  CE1   . TYR A 1 338 ? -12.103 -4.790  -29.650 1.00 19.75  ? 1208 TYR A CE1   1 
ATOM   4526 C  CE2   . TYR A 1 338 ? -13.189 -2.764  -28.953 1.00 16.78  ? 1208 TYR A CE2   1 
ATOM   4527 C  CZ    . TYR A 1 338 ? -12.248 -3.418  -29.726 1.00 22.19  ? 1208 TYR A CZ    1 
ATOM   4528 O  OH    . TYR A 1 338 ? -11.452 -2.691  -30.574 1.00 23.24  ? 1208 TYR A OH    1 
ATOM   4529 H  H     . TYR A 1 338 ? -16.601 -4.057  -27.109 1.00 16.45  ? 1208 TYR A H     1 
ATOM   4530 H  HA    . TYR A 1 338 ? -16.137 -6.348  -28.467 1.00 16.91  ? 1208 TYR A HA    1 
ATOM   4531 H  HB2   . TYR A 1 338 ? -14.804 -5.177  -26.228 1.00 17.77  ? 1208 TYR A HB2   1 
ATOM   4532 H  HB3   . TYR A 1 338 ? -14.320 -6.523  -26.914 1.00 17.77  ? 1208 TYR A HB3   1 
ATOM   4533 H  HD1   . TYR A 1 338 ? -12.817 -6.431  -28.735 1.00 24.98  ? 1208 TYR A HD1   1 
ATOM   4534 H  HD2   . TYR A 1 338 ? -14.625 -3.048  -27.579 1.00 22.36  ? 1208 TYR A HD2   1 
ATOM   4535 H  HE1   . TYR A 1 338 ? -11.468 -5.225  -30.172 1.00 23.70  ? 1208 TYR A HE1   1 
ATOM   4536 H  HE2   . TYR A 1 338 ? -13.281 -1.840  -29.011 1.00 20.14  ? 1208 TYR A HE2   1 
ATOM   4537 H  HH    . TYR A 1 338 ? -11.565 -2.941  -31.347 1.00 27.88  ? 1208 TYR A HH    1 
ATOM   4538 N  N     . ARG A 1 339 ? -17.093 -8.032  -26.913 1.00 16.81  ? 1209 ARG A N     1 
ATOM   4539 C  CA    . ARG A 1 339 ? -17.912 -8.896  -26.101 1.00 19.30  ? 1209 ARG A CA    1 
ATOM   4540 C  C     . ARG A 1 339 ? -17.274 -10.271 -26.097 1.00 20.60  ? 1209 ARG A C     1 
ATOM   4541 O  O     . ARG A 1 339 ? -16.949 -10.805 -27.155 1.00 18.98  ? 1209 ARG A O     1 
ATOM   4542 C  CB    . ARG A 1 339 ? -19.301 -8.946  -26.723 1.00 30.53  ? 1209 ARG A CB    1 
ATOM   4543 C  CG    . ARG A 1 339 ? -20.263 -9.843  -26.034 1.00 52.44  ? 1209 ARG A CG    1 
ATOM   4544 C  CD    . ARG A 1 339 ? -21.609 -9.723  -26.695 1.00 48.10  ? 1209 ARG A CD    1 
ATOM   4545 N  NE    . ARG A 1 339 ? -22.607 -10.484 -25.968 1.00 42.89  ? 1209 ARG A NE    1 
ATOM   4546 C  CZ    . ARG A 1 339 ? -23.909 -10.274 -26.063 1.00 36.05  ? 1209 ARG A CZ    1 
ATOM   4547 N  NH1   . ARG A 1 339 ? -24.365 -9.320  -26.865 1.00 26.48  ? 1209 ARG A NH1   1 
ATOM   4548 N  NH2   . ARG A 1 339 ? -24.742 -11.016 -25.350 1.00 37.07  ? 1209 ARG A NH2   1 
ATOM   4549 H  H     . ARG A 1 339 ? -16.747 -8.416  -27.600 1.00 20.18  ? 1209 ARG A H     1 
ATOM   4550 H  HA    . ARG A 1 339 ? -17.972 -8.556  -25.184 1.00 23.15  ? 1209 ARG A HA    1 
ATOM   4551 H  HB2   . ARG A 1 339 ? -19.676 -8.052  -26.713 1.00 36.64  ? 1209 ARG A HB2   1 
ATOM   4552 H  HB3   . ARG A 1 339 ? -19.218 -9.254  -27.639 1.00 36.64  ? 1209 ARG A HB3   1 
ATOM   4553 H  HG2   . ARG A 1 339 ? -19.962 -10.763 -26.105 1.00 62.93  ? 1209 ARG A HG2   1 
ATOM   4554 H  HG3   . ARG A 1 339 ? -20.348 -9.580  -25.104 1.00 62.93  ? 1209 ARG A HG3   1 
ATOM   4555 H  HD2   . ARG A 1 339 ? -21.882 -8.792  -26.707 1.00 57.72  ? 1209 ARG A HD2   1 
ATOM   4556 H  HD3   . ARG A 1 339 ? -21.557 -10.072 -27.599 1.00 57.72  ? 1209 ARG A HD3   1 
ATOM   4557 H  HE    . ARG A 1 339 ? -22.332 -11.052 -25.383 1.00 51.47  ? 1209 ARG A HE    1 
ATOM   4558 H  HH11  . ARG A 1 339 ? -23.814 -8.842  -27.321 1.00 31.78  ? 1209 ARG A HH11  1 
ATOM   4559 H  HH12  . ARG A 1 339 ? -25.211 -9.181  -26.930 1.00 31.78  ? 1209 ARG A HH12  1 
ATOM   4560 H  HH21  . ARG A 1 339 ? -24.435 -11.631 -24.834 1.00 44.48  ? 1209 ARG A HH21  1 
ATOM   4561 H  HH22  . ARG A 1 339 ? -25.590 -10.887 -25.409 1.00 44.48  ? 1209 ARG A HH22  1 
ATOM   4562 N  N     . PHE A 1 340 ? -17.076 -10.855 -24.926 1.00 15.60  ? 1210 PHE A N     1 
ATOM   4563 C  CA    . PHE A 1 340 ? -16.409 -12.159 -24.880 1.00 15.23  ? 1210 PHE A CA    1 
ATOM   4564 C  C     . PHE A 1 340 ? -16.717 -12.875 -23.586 1.00 15.41  ? 1210 PHE A C     1 
ATOM   4565 O  O     . PHE A 1 340 ? -17.254 -12.280 -22.660 1.00 14.94  ? 1210 PHE A O     1 
ATOM   4566 C  CB    . PHE A 1 340 ? -14.897 -11.995 -25.028 1.00 13.21  ? 1210 PHE A CB    1 
ATOM   4567 C  CG    . PHE A 1 340 ? -14.249 -11.250 -23.881 1.00 17.38  ? 1210 PHE A CG    1 
ATOM   4568 C  CD1   . PHE A 1 340 ? -13.704 -11.940 -22.811 1.00 18.87  ? 1210 PHE A CD1   1 
ATOM   4569 C  CD2   . PHE A 1 340 ? -14.176 -9.869  -23.886 1.00 16.22  ? 1210 PHE A CD2   1 
ATOM   4570 C  CE1   . PHE A 1 340 ? -13.108 -11.250 -21.747 1.00 19.08  ? 1210 PHE A CE1   1 
ATOM   4571 C  CE2   . PHE A 1 340 ? -13.580 -9.172  -22.830 1.00 18.16  ? 1210 PHE A CE2   1 
ATOM   4572 C  CZ    . PHE A 1 340 ? -13.046 -9.868  -21.761 1.00 14.26  ? 1210 PHE A CZ    1 
ATOM   4573 H  H     . PHE A 1 340 ? -17.307 -10.534 -24.162 1.00 18.72  ? 1210 PHE A H     1 
ATOM   4574 H  HA    . PHE A 1 340 ? -16.731 -12.713 -25.621 1.00 18.28  ? 1210 PHE A HA    1 
ATOM   4575 H  HB2   . PHE A 1 340 ? -14.491 -12.874 -25.078 1.00 15.85  ? 1210 PHE A HB2   1 
ATOM   4576 H  HB3   . PHE A 1 340 ? -14.715 -11.501 -25.842 1.00 15.85  ? 1210 PHE A HB3   1 
ATOM   4577 H  HD1   . PHE A 1 340 ? -13.745 -12.868 -22.792 1.00 22.65  ? 1210 PHE A HD1   1 
ATOM   4578 H  HD2   . PHE A 1 340 ? -14.537 -9.395  -24.600 1.00 19.46  ? 1210 PHE A HD2   1 
ATOM   4579 H  HE1   . PHE A 1 340 ? -12.747 -11.723 -21.032 1.00 22.89  ? 1210 PHE A HE1   1 
ATOM   4580 H  HE2   . PHE A 1 340 ? -13.542 -8.243  -22.847 1.00 21.79  ? 1210 PHE A HE2   1 
ATOM   4581 H  HZ    . PHE A 1 340 ? -12.646 -9.411  -21.058 1.00 17.11  ? 1210 PHE A HZ    1 
ATOM   4582 N  N     . ILE A 1 341 ? -16.373 -14.156 -23.533 1.00 13.37  ? 1211 ILE A N     1 
ATOM   4583 C  CA    . ILE A 1 341 ? -16.627 -14.963 -22.353 1.00 14.96  ? 1211 ILE A CA    1 
ATOM   4584 C  C     . ILE A 1 341 ? -15.291 -15.271 -21.696 1.00 18.99  ? 1211 ILE A C     1 
ATOM   4585 O  O     . ILE A 1 341 ? -14.367 -15.702 -22.363 1.00 17.72  ? 1211 ILE A O     1 
ATOM   4586 C  CB    . ILE A 1 341 ? -17.298 -16.299 -22.732 1.00 16.06  ? 1211 ILE A CB    1 
ATOM   4587 C  CG1   . ILE A 1 341 ? -18.689 -16.057 -23.332 1.00 25.60  ? 1211 ILE A CG1   1 
ATOM   4588 C  CG2   . ILE A 1 341 ? -17.390 -17.207 -21.501 1.00 16.24  ? 1211 ILE A CG2   1 
ATOM   4589 C  CD1   . ILE A 1 341 ? -19.653 -15.334 -22.414 1.00 25.47  ? 1211 ILE A CD1   1 
ATOM   4590 H  H     . ILE A 1 341 ? -15.988 -14.582 -24.174 1.00 16.04  ? 1211 ILE A H     1 
ATOM   4591 H  HA    . ILE A 1 341 ? -17.198 -14.477 -21.722 1.00 17.95  ? 1211 ILE A HA    1 
ATOM   4592 H  HB    . ILE A 1 341 ? -16.749 -16.740 -23.399 1.00 19.27  ? 1211 ILE A HB    1 
ATOM   4593 H  HG12  . ILE A 1 341 ? -18.591 -15.522 -24.136 1.00 30.72  ? 1211 ILE A HG12  1 
ATOM   4594 H  HG13  . ILE A 1 341 ? -19.083 -16.914 -23.556 1.00 30.72  ? 1211 ILE A HG13  1 
ATOM   4595 H  HG21  . ILE A 1 341 ? -17.912 -16.767 -20.827 1.00 19.48  ? 1211 ILE A HG21  1 
ATOM   4596 H  HG22  . ILE A 1 341 ? -17.809 -18.033 -21.754 1.00 19.48  ? 1211 ILE A HG22  1 
ATOM   4597 H  HG23  . ILE A 1 341 ? -16.504 -17.376 -21.172 1.00 19.48  ? 1211 ILE A HG23  1 
ATOM   4598 H  HD11  . ILE A 1 341 ? -19.287 -14.474 -22.192 1.00 30.57  ? 1211 ILE A HD11  1 
ATOM   4599 H  HD12  . ILE A 1 341 ? -20.492 -15.225 -22.867 1.00 30.57  ? 1211 ILE A HD12  1 
ATOM   4600 H  HD13  . ILE A 1 341 ? -19.775 -15.854 -21.617 1.00 30.57  ? 1211 ILE A HD13  1 
ATOM   4601 N  N     . GLN A 1 342 ? -15.196 -15.031 -20.392 1.00 14.78  ? 1212 GLN A N     1 
ATOM   4602 C  CA    . GLN A 1 342 ? -14.009 -15.347 -19.603 1.00 12.52  ? 1212 GLN A CA    1 
ATOM   4603 C  C     . GLN A 1 342 ? -14.255 -16.657 -18.882 1.00 16.19  ? 1212 GLN A C     1 
ATOM   4604 O  O     . GLN A 1 342 ? -15.184 -16.758 -18.075 1.00 16.99  ? 1212 GLN A O     1 
ATOM   4605 C  CB    . GLN A 1 342 ? -13.781 -14.240 -18.551 1.00 15.42  ? 1212 GLN A CB    1 
ATOM   4606 C  CG    . GLN A 1 342 ? -12.598 -14.473 -17.602 1.00 14.86  ? 1212 GLN A CG    1 
ATOM   4607 C  CD    . GLN A 1 342 ? -12.672 -13.547 -16.388 1.00 15.79  ? 1212 GLN A CD    1 
ATOM   4608 O  OE1   . GLN A 1 342 ? -13.762 -13.139 -15.985 1.00 14.62  ? 1212 GLN A OE1   1 
ATOM   4609 N  NE2   . GLN A 1 342 ? -11.524 -13.223 -15.802 1.00 15.36  ? 1212 GLN A NE2   1 
ATOM   4610 H  H     . GLN A 1 342 ? -15.826 -14.675 -19.928 1.00 17.73  ? 1212 GLN A H     1 
ATOM   4611 H  HA    . GLN A 1 342 ? -13.219 -15.427 -20.178 1.00 15.02  ? 1212 GLN A HA    1 
ATOM   4612 H  HB2   . GLN A 1 342 ? -13.622 -13.403 -19.014 1.00 18.51  ? 1212 GLN A HB2   1 
ATOM   4613 H  HB3   . GLN A 1 342 ? -14.580 -14.163 -18.006 1.00 18.51  ? 1212 GLN A HB3   1 
ATOM   4614 H  HG2   . GLN A 1 342 ? -12.614 -15.390 -17.288 1.00 17.83  ? 1212 GLN A HG2   1 
ATOM   4615 H  HG3   . GLN A 1 342 ? -11.769 -14.293 -18.073 1.00 17.83  ? 1212 GLN A HG3   1 
ATOM   4616 H  HE21  . GLN A 1 342 ? -11.522 -12.704 -15.116 1.00 18.44  ? 1212 GLN A HE21  1 
ATOM   4617 H  HE22  . GLN A 1 342 ? -10.782 -13.531 -16.109 1.00 18.44  ? 1212 GLN A HE22  1 
ATOM   4618 N  N     . ARG A 1 343 ? -13.432 -17.656 -19.166 1.00 14.54  ? 1213 ARG A N     1 
ATOM   4619 C  CA    . ARG A 1 343 ? -13.605 -18.979 -18.556 1.00 13.49  ? 1213 ARG A CA    1 
ATOM   4620 C  C     . ARG A 1 343 ? -12.742 -19.053 -17.303 1.00 16.97  ? 1213 ARG A C     1 
ATOM   4621 O  O     . ARG A 1 343 ? -11.911 -18.193 -17.061 1.00 14.63  ? 1213 ARG A O     1 
ATOM   4622 C  CB    . ARG A 1 343 ? -13.166 -20.080 -19.537 1.00 12.62  ? 1213 ARG A CB    1 
ATOM   4623 C  CG    . ARG A 1 343 ? -13.761 -19.951 -20.956 1.00 12.91  ? 1213 ARG A CG    1 
ATOM   4624 C  CD    . ARG A 1 343 ? -12.944 -20.766 -21.987 1.00 18.55  ? 1213 ARG A CD    1 
ATOM   4625 N  NE    . ARG A 1 343 ? -11.539 -20.390 -21.924 1.00 19.18  ? 1213 ARG A NE    1 
ATOM   4626 C  CZ    . ARG A 1 343 ? -10.536 -21.097 -22.440 1.00 22.80  ? 1213 ARG A CZ    1 
ATOM   4627 N  NH1   . ARG A 1 343 ? -10.755 -22.244 -23.083 1.00 15.87  ? 1213 ARG A NH1   1 
ATOM   4628 N  NH2   . ARG A 1 343 ? -9.300  -20.652 -22.302 1.00 16.52  ? 1213 ARG A NH2   1 
ATOM   4629 H  H     . ARG A 1 343 ? -12.764 -17.601 -19.705 1.00 17.45  ? 1213 ARG A H     1 
ATOM   4630 H  HA    . ARG A 1 343 ? -14.543 -19.120 -18.311 1.00 16.19  ? 1213 ARG A HA    1 
ATOM   4631 H  HB2   . ARG A 1 343 ? -12.200 -20.054 -19.620 1.00 15.15  ? 1213 ARG A HB2   1 
ATOM   4632 H  HB3   . ARG A 1 343 ? -13.440 -20.939 -19.181 1.00 15.15  ? 1213 ARG A HB3   1 
ATOM   4633 H  HG2   . ARG A 1 343 ? -14.670 -20.287 -20.954 1.00 15.49  ? 1213 ARG A HG2   1 
ATOM   4634 H  HG3   . ARG A 1 343 ? -13.747 -19.019 -21.226 1.00 15.49  ? 1213 ARG A HG3   1 
ATOM   4635 H  HD2   . ARG A 1 343 ? -13.020 -21.712 -21.786 1.00 22.26  ? 1213 ARG A HD2   1 
ATOM   4636 H  HD3   . ARG A 1 343 ? -13.272 -20.581 -22.881 1.00 22.26  ? 1213 ARG A HD3   1 
ATOM   4637 H  HE    . ARG A 1 343 ? -11.342 -19.656 -21.522 1.00 23.02  ? 1213 ARG A HE    1 
ATOM   4638 H  HH11  . ARG A 1 343 ? -11.557 -22.540 -23.172 1.00 19.04  ? 1213 ARG A HH11  1 
ATOM   4639 H  HH12  . ARG A 1 343 ? -10.094 -22.686 -23.410 1.00 19.04  ? 1213 ARG A HH12  1 
ATOM   4640 H  HH21  . ARG A 1 343 ? -9.153  -19.912 -21.890 1.00 19.83  ? 1213 ARG A HH21  1 
ATOM   4641 H  HH22  . ARG A 1 343 ? -8.644  -21.097 -22.635 1.00 19.83  ? 1213 ARG A HH22  1 
ATOM   4642 N  N     . PRO A 1 344 ? -12.921 -20.102 -16.504 1.00 15.36  ? 1214 PRO A N     1 
ATOM   4643 C  CA    . PRO A 1 344 ? -12.039 -20.222 -15.341 1.00 17.37  ? 1214 PRO A CA    1 
ATOM   4644 C  C     . PRO A 1 344 ? -10.576 -20.311 -15.755 1.00 16.67  ? 1214 PRO A C     1 
ATOM   4645 O  O     . PRO A 1 344 ? -10.245 -21.027 -16.706 1.00 20.19  ? 1214 PRO A O     1 
ATOM   4646 C  CB    . PRO A 1 344 ? -12.511 -21.531 -14.682 1.00 20.13  ? 1214 PRO A CB    1 
ATOM   4647 C  CG    . PRO A 1 344 ? -13.964 -21.647 -15.081 1.00 18.09  ? 1214 PRO A CG    1 
ATOM   4648 C  CD    . PRO A 1 344 ? -13.989 -21.113 -16.514 1.00 17.30  ? 1214 PRO A CD    1 
ATOM   4649 H  HA    . PRO A 1 344 ? -12.168 -19.471 -14.725 1.00 20.84  ? 1214 PRO A HA    1 
ATOM   4650 H  HB2   . PRO A 1 344 ? -11.997 -22.278 -15.026 1.00 24.16  ? 1214 PRO A HB2   1 
ATOM   4651 H  HB3   . PRO A 1 344 ? -12.422 -21.465 -13.718 1.00 24.16  ? 1214 PRO A HB3   1 
ATOM   4652 H  HG2   . PRO A 1 344 ? -14.241 -22.576 -15.051 1.00 21.71  ? 1214 PRO A HG2   1 
ATOM   4653 H  HG3   . PRO A 1 344 ? -14.512 -21.101 -14.497 1.00 21.71  ? 1214 PRO A HG3   1 
ATOM   4654 H  HD2   . PRO A 1 344 ? -13.781 -21.821 -17.144 1.00 20.76  ? 1214 PRO A HD2   1 
ATOM   4655 H  HD3   . PRO A 1 344 ? -14.846 -20.701 -16.708 1.00 20.76  ? 1214 PRO A HD3   1 
ATOM   4656 N  N     . GLY A 1 345 ? -9.709  -19.576 -15.065 1.00 16.71  ? 1215 GLY A N     1 
ATOM   4657 C  CA    . GLY A 1 345 ? -8.290  -19.602 -15.356 1.00 17.55  ? 1215 GLY A CA    1 
ATOM   4658 C  C     . GLY A 1 345 ? -7.872  -18.568 -16.380 1.00 18.79  ? 1215 GLY A C     1 
ATOM   4659 O  O     . GLY A 1 345 ? -6.680  -18.359 -16.587 1.00 19.03  ? 1215 GLY A O     1 
ATOM   4660 H  H     . GLY A 1 345 ? -9.925  -19.051 -14.419 1.00 20.06  ? 1215 GLY A H     1 
ATOM   4661 H  HA2   . GLY A 1 345 ? -7.792  -19.440 -14.540 1.00 21.06  ? 1215 GLY A HA2   1 
ATOM   4662 H  HA3   . GLY A 1 345 ? -8.048  -20.479 -15.693 1.00 21.06  ? 1215 GLY A HA3   1 
ATOM   4663 N  N     . ASP A 1 346 ? -8.846  -17.926 -17.024 1.00 14.21  ? 1216 ASP A N     1 
ATOM   4664 C  CA    . ASP A 1 346 ? -8.549  -16.846 -17.983 1.00 13.49  ? 1216 ASP A CA    1 
ATOM   4665 C  C     . ASP A 1 346 ? -8.384  -15.523 -17.230 1.00 19.13  ? 1216 ASP A C     1 
ATOM   4666 O  O     . ASP A 1 346 ? -9.185  -15.209 -16.362 1.00 17.05  ? 1216 ASP A O     1 
ATOM   4667 C  CB    . ASP A 1 346 ? -9.689  -16.650 -18.972 1.00 16.70  ? 1216 ASP A CB    1 
ATOM   4668 C  CG    . ASP A 1 346 ? -9.829  -17.798 -19.978 1.00 18.50  ? 1216 ASP A CG    1 
ATOM   4669 O  OD1   . ASP A 1 346 ? -8.893  -18.606 -20.167 1.00 17.34  ? 1216 ASP A OD1   1 
ATOM   4670 O  OD2   . ASP A 1 346 ? -10.904 -17.862 -20.589 1.00 16.08  ? 1216 ASP A OD2   1 
ATOM   4671 H  H     . ASP A 1 346 ? -9.685  -18.092 -16.928 1.00 17.05  ? 1216 ASP A H     1 
ATOM   4672 H  HA    . ASP A 1 346 ? -7.724  -17.044 -18.474 1.00 16.19  ? 1216 ASP A HA    1 
ATOM   4673 H  HB2   . ASP A 1 346 ? -10.522 -16.582 -18.480 1.00 20.04  ? 1216 ASP A HB2   1 
ATOM   4674 H  HB3   . ASP A 1 346 ? -9.534  -15.833 -19.472 1.00 20.04  ? 1216 ASP A HB3   1 
ATOM   4675 N  N     . LEU A 1 347 ? -7.378  -14.733 -17.595 1.00 14.05  ? 1217 LEU A N     1 
ATOM   4676 C  CA    . LEU A 1 347 ? -7.195  -13.414 -16.992 1.00 13.53  ? 1217 LEU A CA    1 
ATOM   4677 C  C     . LEU A 1 347 ? -7.666  -12.329 -17.961 1.00 14.40  ? 1217 LEU A C     1 
ATOM   4678 O  O     . LEU A 1 347 ? -7.326  -12.363 -19.135 1.00 16.68  ? 1217 LEU A O     1 
ATOM   4679 C  CB    . LEU A 1 347 ? -5.726  -13.196 -16.633 1.00 15.11  ? 1217 LEU A CB    1 
ATOM   4680 C  CG    . LEU A 1 347 ? -5.338  -11.854 -15.983 1.00 16.52  ? 1217 LEU A CG    1 
ATOM   4681 C  CD1   . LEU A 1 347 ? -4.092  -12.064 -15.137 1.00 16.12  ? 1217 LEU A CD1   1 
ATOM   4682 C  CD2   . LEU A 1 347 ? -5.078  -10.769 -17.041 1.00 18.13  ? 1217 LEU A CD2   1 
ATOM   4683 H  H     . LEU A 1 347 ? -6.789  -14.935 -18.188 1.00 16.86  ? 1217 LEU A H     1 
ATOM   4684 H  HA    . LEU A 1 347 ? -7.728  -13.352 -16.172 1.00 16.24  ? 1217 LEU A HA    1 
ATOM   4685 H  HB2   . LEU A 1 347 ? -5.463  -13.896 -16.015 1.00 18.13  ? 1217 LEU A HB2   1 
ATOM   4686 H  HB3   . LEU A 1 347 ? -5.204  -13.278 -17.446 1.00 18.13  ? 1217 LEU A HB3   1 
ATOM   4687 H  HG    . LEU A 1 347 ? -6.056  -11.555 -15.404 1.00 19.82  ? 1217 LEU A HG    1 
ATOM   4688 H  HD11  . LEU A 1 347 ? -4.281  -12.717 -14.459 1.00 19.34  ? 1217 LEU A HD11  1 
ATOM   4689 H  HD12  . LEU A 1 347 ? -3.380  -12.376 -15.702 1.00 19.34  ? 1217 LEU A HD12  1 
ATOM   4690 H  HD13  . LEU A 1 347 ? -3.846  -11.230 -14.731 1.00 19.34  ? 1217 LEU A HD13  1 
ATOM   4691 H  HD21  . LEU A 1 347 ? -4.360  -11.055 -17.611 1.00 21.76  ? 1217 LEU A HD21  1 
ATOM   4692 H  HD22  . LEU A 1 347 ? -5.877  -10.641 -17.559 1.00 21.76  ? 1217 LEU A HD22  1 
ATOM   4693 H  HD23  . LEU A 1 347 ? -4.840  -9.952  -16.598 1.00 21.76  ? 1217 LEU A HD23  1 
ATOM   4694 N  N     . VAL A 1 348 ? -8.453  -11.380 -17.462 1.00 13.30  ? 1218 VAL A N     1 
ATOM   4695 C  CA    . VAL A 1 348 ? -8.879  -10.232 -18.254 1.00 13.78  ? 1218 VAL A CA    1 
ATOM   4696 C  C     . VAL A 1 348 ? -8.092  -8.992  -17.843 1.00 16.42  ? 1218 VAL A C     1 
ATOM   4697 O  O     . VAL A 1 348 ? -8.037  -8.634  -16.663 1.00 15.51  ? 1218 VAL A O     1 
ATOM   4698 C  CB    . VAL A 1 348 ? -10.390 -9.968  -18.095 1.00 15.36  ? 1218 VAL A CB    1 
ATOM   4699 C  CG1   . VAL A 1 348 ? -10.795 -8.637  -18.777 1.00 13.88  ? 1218 VAL A CG1   1 
ATOM   4700 C  CG2   . VAL A 1 348 ? -11.189 -11.161 -18.656 1.00 18.64  ? 1218 VAL A CG2   1 
ATOM   4701 H  H     . VAL A 1 348 ? -8.757  -11.379 -16.658 1.00 15.96  ? 1218 VAL A H     1 
ATOM   4702 H  HA    . VAL A 1 348 ? -8.698  -10.409 -19.200 1.00 16.53  ? 1218 VAL A HA    1 
ATOM   4703 H  HB    . VAL A 1 348 ? -10.598 -9.891  -17.141 1.00 18.43  ? 1218 VAL A HB    1 
ATOM   4704 H  HG11  . VAL A 1 348 ? -10.015 -8.236  -19.167 1.00 16.66  ? 1218 VAL A HG11  1 
ATOM   4705 H  HG12  . VAL A 1 348 ? -11.445 -8.820  -19.459 1.00 16.66  ? 1218 VAL A HG12  1 
ATOM   4706 H  HG13  . VAL A 1 348 ? -11.170 -8.050  -18.117 1.00 16.66  ? 1218 VAL A HG13  1 
ATOM   4707 H  HG21  . VAL A 1 348 ? -10.575 -11.821 -18.987 1.00 22.37  ? 1218 VAL A HG21  1 
ATOM   4708 H  HG22  . VAL A 1 348 ? -11.725 -11.536 -17.952 1.00 22.37  ? 1218 VAL A HG22  1 
ATOM   4709 H  HG23  . VAL A 1 348 ? -11.753 -10.852 -19.368 1.00 22.37  ? 1218 VAL A HG23  1 
ATOM   4710 N  N     . TRP A 1 349 ? -7.470  -8.356  -18.829 1.00 14.57  ? 1219 TRP A N     1 
ATOM   4711 C  CA    . TRP A 1 349 ? -6.785  -7.083  -18.633 1.00 14.38  ? 1219 TRP A CA    1 
ATOM   4712 C  C     . TRP A 1 349 ? -7.638  -5.977  -19.234 1.00 14.99  ? 1219 TRP A C     1 
ATOM   4713 O  O     . TRP A 1 349 ? -7.837  -5.939  -20.446 1.00 15.26  ? 1219 TRP A O     1 
ATOM   4714 C  CB    . TRP A 1 349 ? -5.430  -7.123  -19.335 1.00 12.35  ? 1219 TRP A CB    1 
ATOM   4715 C  CG    . TRP A 1 349 ? -4.709  -5.800  -19.364 1.00 17.84  ? 1219 TRP A CG    1 
ATOM   4716 C  CD1   . TRP A 1 349 ? -4.938  -4.759  -20.224 1.00 18.18  ? 1219 TRP A CD1   1 
ATOM   4717 C  CD2   . TRP A 1 349 ? -3.645  -5.379  -18.506 1.00 17.56  ? 1219 TRP A CD2   1 
ATOM   4718 N  NE1   . TRP A 1 349 ? -4.090  -3.717  -19.943 1.00 18.48  ? 1219 TRP A NE1   1 
ATOM   4719 C  CE2   . TRP A 1 349 ? -3.281  -4.071  -18.899 1.00 17.97  ? 1219 TRP A CE2   1 
ATOM   4720 C  CE3   . TRP A 1 349 ? -2.964  -5.978  -17.446 1.00 17.52  ? 1219 TRP A CE3   1 
ATOM   4721 C  CZ2   . TRP A 1 349 ? -2.265  -3.355  -18.271 1.00 19.35  ? 1219 TRP A CZ2   1 
ATOM   4722 C  CZ3   . TRP A 1 349 ? -1.956  -5.264  -16.822 1.00 21.99  ? 1219 TRP A CZ3   1 
ATOM   4723 C  CH2   . TRP A 1 349 ? -1.613  -3.971  -17.239 1.00 17.18  ? 1219 TRP A CH2   1 
ATOM   4724 H  H     . TRP A 1 349 ? -7.430  -8.647  -19.637 1.00 17.48  ? 1219 TRP A H     1 
ATOM   4725 H  HA    . TRP A 1 349 ? -6.652  -6.910  -17.678 1.00 17.25  ? 1219 TRP A HA    1 
ATOM   4726 H  HB2   . TRP A 1 349 ? -4.860  -7.759  -18.875 1.00 14.82  ? 1219 TRP A HB2   1 
ATOM   4727 H  HB3   . TRP A 1 349 ? -5.564  -7.407  -20.253 1.00 14.82  ? 1219 TRP A HB3   1 
ATOM   4728 H  HD1   . TRP A 1 349 ? -5.585  -4.754  -20.892 1.00 21.82  ? 1219 TRP A HD1   1 
ATOM   4729 H  HE1   . TRP A 1 349 ? -4.064  -2.968  -20.364 1.00 22.18  ? 1219 TRP A HE1   1 
ATOM   4730 H  HE3   . TRP A 1 349 ? -3.181  -6.838  -17.167 1.00 21.03  ? 1219 TRP A HE3   1 
ATOM   4731 H  HZ2   . TRP A 1 349 ? -2.039  -2.495  -18.542 1.00 23.22  ? 1219 TRP A HZ2   1 
ATOM   4732 H  HZ3   . TRP A 1 349 ? -1.494  -5.652  -16.115 1.00 26.39  ? 1219 TRP A HZ3   1 
ATOM   4733 H  HH2   . TRP A 1 349 ? -0.934  -3.516  -16.795 1.00 20.62  ? 1219 TRP A HH2   1 
ATOM   4734 N  N     . ILE A 1 350 ? -8.135  -5.076  -18.390 1.00 16.37  ? 1220 ILE A N     1 
ATOM   4735 C  CA    . ILE A 1 350 ? -8.887  -3.912  -18.850 1.00 14.99  ? 1220 ILE A CA    1 
ATOM   4736 C  C     . ILE A 1 350 ? -7.904  -2.757  -18.980 1.00 16.96  ? 1220 ILE A C     1 
ATOM   4737 O  O     . ILE A 1 350 ? -7.313  -2.333  -17.987 1.00 13.28  ? 1220 ILE A O     1 
ATOM   4738 C  CB    . ILE A 1 350 ? -9.994  -3.534  -17.832 1.00 14.74  ? 1220 ILE A CB    1 
ATOM   4739 C  CG1   . ILE A 1 350 ? -11.050 -4.643  -17.762 1.00 16.14  ? 1220 ILE A CG1   1 
ATOM   4740 C  CG2   . ILE A 1 350 ? -10.639 -2.180  -18.187 1.00 15.23  ? 1220 ILE A CG2   1 
ATOM   4741 C  CD1   . ILE A 1 350 ? -11.824 -4.848  -19.070 1.00 20.09  ? 1220 ILE A CD1   1 
ATOM   4742 H  H     . ILE A 1 350 ? -8.049  -5.118  -17.536 1.00 19.65  ? 1220 ILE A H     1 
ATOM   4743 H  HA    . ILE A 1 350 ? -9.295  -4.092  -19.723 1.00 17.99  ? 1220 ILE A HA    1 
ATOM   4744 H  HB    . ILE A 1 350 ? -9.584  -3.453  -16.957 1.00 17.69  ? 1220 ILE A HB    1 
ATOM   4745 H  HG12  . ILE A 1 350 ? -10.610 -5.479  -17.544 1.00 19.37  ? 1220 ILE A HG12  1 
ATOM   4746 H  HG13  . ILE A 1 350 ? -11.692 -4.419  -17.070 1.00 19.37  ? 1220 ILE A HG13  1 
ATOM   4747 H  HG21  . ILE A 1 350 ? -9.961  -1.499  -18.176 1.00 18.28  ? 1220 ILE A HG21  1 
ATOM   4748 H  HG22  . ILE A 1 350 ? -11.029 -2.240  -19.062 1.00 18.28  ? 1220 ILE A HG22  1 
ATOM   4749 H  HG23  . ILE A 1 350 ? -11.317 -1.977  -17.539 1.00 18.28  ? 1220 ILE A HG23  1 
ATOM   4750 H  HD11  . ILE A 1 350 ? -12.463 -5.554  -18.947 1.00 24.11  ? 1220 ILE A HD11  1 
ATOM   4751 H  HD12  . ILE A 1 350 ? -12.277 -4.032  -19.296 1.00 24.11  ? 1220 ILE A HD12  1 
ATOM   4752 H  HD13  . ILE A 1 350 ? -11.206 -5.083  -19.765 1.00 24.11  ? 1220 ILE A HD13  1 
ATOM   4753 N  N     . ASN A 1 351 ? -7.703  -2.261  -20.196 1.00 14.79  ? 1221 ASN A N     1 
ATOM   4754 C  CA    . ASN A 1 351 ? -6.747  -1.179  -20.401 1.00 15.50  ? 1221 ASN A CA    1 
ATOM   4755 C  C     . ASN A 1 351 ? -7.234  0.147   -19.803 1.00 14.44  ? 1221 ASN A C     1 
ATOM   4756 O  O     . ASN A 1 351 ? -8.387  0.286   -19.404 1.00 15.93  ? 1221 ASN A O     1 
ATOM   4757 C  CB    . ASN A 1 351 ? -6.446  -1.001  -21.901 1.00 16.96  ? 1221 ASN A CB    1 
ATOM   4758 C  CG    . ASN A 1 351 ? -5.009  -0.593  -22.165 1.00 24.45  ? 1221 ASN A CG    1 
ATOM   4759 O  OD1   . ASN A 1 351 ? -4.222  -0.371  -21.230 1.00 22.53  ? 1221 ASN A OD1   1 
ATOM   4760 N  ND2   . ASN A 1 351 ? -4.647  -0.513  -23.442 1.00 20.36  ? 1221 ASN A ND2   1 
ATOM   4761 H  H     . ASN A 1 351 ? -8.101  -2.528  -20.910 1.00 17.75  ? 1221 ASN A H     1 
ATOM   4762 H  HA    . ASN A 1 351 ? -5.907  -1.415  -19.955 1.00 18.60  ? 1221 ASN A HA    1 
ATOM   4763 H  HB2   . ASN A 1 351 ? -6.609  -1.842  -22.358 1.00 20.35  ? 1221 ASN A HB2   1 
ATOM   4764 H  HB3   . ASN A 1 351 ? -7.025  -0.311  -22.260 1.00 20.35  ? 1221 ASN A HB3   1 
ATOM   4765 H  HD21  . ASN A 1 351 ? -5.216  -0.688  -24.063 1.00 24.43  ? 1221 ASN A HD21  1 
ATOM   4766 H  HD22  . ASN A 1 351 ? -3.843  -0.286  -23.648 1.00 24.43  ? 1221 ASN A HD22  1 
ATOM   4767 N  N     . ALA A 1 352 ? -6.351  1.138   -19.771 1.00 16.57  ? 1222 ALA A N     1 
ATOM   4768 C  CA    . ALA A 1 352 ? -6.621  2.360   -19.018 1.00 15.21  ? 1222 ALA A CA    1 
ATOM   4769 C  C     . ALA A 1 352 ? -7.827  3.098   -19.578 1.00 15.95  ? 1222 ALA A C     1 
ATOM   4770 O  O     . ALA A 1 352 ? -7.856  3.439   -20.763 1.00 16.27  ? 1222 ALA A O     1 
ATOM   4771 C  CB    . ALA A 1 352 ? -5.392  3.274   -19.045 1.00 15.53  ? 1222 ALA A CB    1 
ATOM   4772 H  H     . ALA A 1 352 ? -5.592  1.131   -20.174 1.00 19.88  ? 1222 ALA A H     1 
ATOM   4773 H  HA    . ALA A 1 352 ? -6.810  2.128   -18.085 1.00 18.25  ? 1222 ALA A HA    1 
ATOM   4774 H  HB1   . ALA A 1 352 ? -5.190  3.498   -19.957 1.00 18.64  ? 1222 ALA A HB1   1 
ATOM   4775 H  HB2   . ALA A 1 352 ? -5.585  4.072   -18.547 1.00 18.64  ? 1222 ALA A HB2   1 
ATOM   4776 H  HB3   . ALA A 1 352 ? -4.650  2.811   -18.649 1.00 18.64  ? 1222 ALA A HB3   1 
ATOM   4777 N  N     . GLY A 1 353 ? -8.819  3.352   -18.729 1.00 14.79  ? 1223 GLY A N     1 
ATOM   4778 C  CA    . GLY A 1 353 ? -9.980  4.127   -19.139 1.00 17.97  ? 1223 GLY A CA    1 
ATOM   4779 C  C     . GLY A 1 353 ? -11.007 3.366   -19.950 1.00 19.89  ? 1223 GLY A C     1 
ATOM   4780 O  O     . GLY A 1 353 ? -12.004 3.928   -20.369 1.00 17.03  ? 1223 GLY A O     1 
ATOM   4781 H  H     . GLY A 1 353 ? -8.842  3.086   -17.912 1.00 17.75  ? 1223 GLY A H     1 
ATOM   4782 H  HA2   . GLY A 1 353 ? -10.422 4.473   -18.347 1.00 21.57  ? 1223 GLY A HA2   1 
ATOM   4783 H  HA3   . GLY A 1 353 ? -9.682  4.883   -19.669 1.00 21.57  ? 1223 GLY A HA3   1 
ATOM   4784 N  N     . THR A 1 354 ? -10.774 2.083   -20.187 1.00 14.35  ? 1224 THR A N     1 
ATOM   4785 C  CA    . THR A 1 354 ? -11.746 1.269   -20.929 1.00 16.30  ? 1224 THR A CA    1 
ATOM   4786 C  C     . THR A 1 354 ? -13.068 1.151   -20.171 1.00 15.58  ? 1224 THR A C     1 
ATOM   4787 O  O     . THR A 1 354 ? -13.087 0.843   -18.978 1.00 17.90  ? 1224 THR A O     1 
ATOM   4788 C  CB    . THR A 1 354 ? -11.158 -0.135  -21.238 1.00 18.35  ? 1224 THR A CB    1 
ATOM   4789 O  OG1   . THR A 1 354 ? -10.085 0.023   -22.170 1.00 15.47  ? 1224 THR A OG1   1 
ATOM   4790 C  CG2   . THR A 1 354 ? -12.197 -1.082  -21.852 1.00 17.14  ? 1224 THR A CG2   1 
ATOM   4791 H  H     . THR A 1 354 ? -10.070 1.657   -19.936 1.00 17.22  ? 1224 THR A H     1 
ATOM   4792 H  HA    . THR A 1 354 ? -11.933 1.707   -21.786 1.00 19.55  ? 1224 THR A HA    1 
ATOM   4793 H  HB    . THR A 1 354 ? -10.822 -0.534  -20.420 1.00 22.02  ? 1224 THR A HB    1 
ATOM   4794 H  HG1   . THR A 1 354 ? -10.363 0.366   -22.861 1.00 18.56  ? 1224 THR A HG1   1 
ATOM   4795 H  HG21  . THR A 1 354 ? -12.528 -0.716  -22.675 1.00 20.57  ? 1224 THR A HG21  1 
ATOM   4796 H  HG22  . THR A 1 354 ? -11.798 -1.937  -22.028 1.00 20.57  ? 1224 THR A HG22  1 
ATOM   4797 H  HG23  . THR A 1 354 ? -12.932 -1.200  -21.245 1.00 20.57  ? 1224 THR A HG23  1 
ATOM   4798 N  N     . VAL A 1 355 ? -14.182 1.409   -20.857 1.00 15.34  ? 1225 VAL A N     1 
ATOM   4799 C  CA    . VAL A 1 355 ? -15.494 1.341   -20.210 1.00 14.89  ? 1225 VAL A CA    1 
ATOM   4800 C  C     . VAL A 1 355 ? -15.962 -0.107  -20.269 1.00 17.83  ? 1225 VAL A C     1 
ATOM   4801 O  O     . VAL A 1 355 ? -15.838 -0.746  -21.304 1.00 16.82  ? 1225 VAL A O     1 
ATOM   4802 C  CB    . VAL A 1 355 ? -16.533 2.230   -20.935 1.00 17.73  ? 1225 VAL A CB    1 
ATOM   4803 C  CG1   . VAL A 1 355 ? -17.820 2.287   -20.138 1.00 19.34  ? 1225 VAL A CG1   1 
ATOM   4804 C  CG2   . VAL A 1 355 ? -15.970 3.645   -21.151 1.00 16.26  ? 1225 VAL A CG2   1 
ATOM   4805 H  H     . VAL A 1 355 ? -14.206 1.623   -21.689 1.00 18.40  ? 1225 VAL A H     1 
ATOM   4806 H  HA    . VAL A 1 355 ? -15.426 1.621   -19.274 1.00 17.87  ? 1225 VAL A HA    1 
ATOM   4807 H  HB    . VAL A 1 355 ? -16.733 1.842   -21.813 1.00 21.27  ? 1225 VAL A HB    1 
ATOM   4808 H  HG11  . VAL A 1 355 ? -18.451 2.842   -20.603 1.00 23.21  ? 1225 VAL A HG11  1 
ATOM   4809 H  HG12  . VAL A 1 355 ? -18.171 1.398   -20.047 1.00 23.21  ? 1225 VAL A HG12  1 
ATOM   4810 H  HG13  . VAL A 1 355 ? -17.634 2.657   -19.271 1.00 23.21  ? 1225 VAL A HG13  1 
ATOM   4811 H  HG21  . VAL A 1 355 ? -16.629 4.178   -21.602 1.00 19.51  ? 1225 VAL A HG21  1 
ATOM   4812 H  HG22  . VAL A 1 355 ? -15.762 4.032   -20.298 1.00 19.51  ? 1225 VAL A HG22  1 
ATOM   4813 H  HG23  . VAL A 1 355 ? -15.174 3.586   -21.686 1.00 19.51  ? 1225 VAL A HG23  1 
ATOM   4814 N  N     . HIS A 1 356 ? -16.480 -0.656  -19.177 1.00 13.29  ? 1226 HIS A N     1 
ATOM   4815 C  CA    . HIS A 1 356 ? -16.911 -2.047  -19.231 1.00 14.17  ? 1226 HIS A CA    1 
ATOM   4816 C  C     . HIS A 1 356 ? -17.982 -2.402  -18.221 1.00 14.84  ? 1226 HIS A C     1 
ATOM   4817 O  O     . HIS A 1 356 ? -18.213 -1.695  -17.242 1.00 15.78  ? 1226 HIS A O     1 
ATOM   4818 C  CB    . HIS A 1 356 ? -15.706 -2.981  -19.061 1.00 16.89  ? 1226 HIS A CB    1 
ATOM   4819 C  CG    . HIS A 1 356 ? -14.980 -2.782  -17.769 1.00 16.28  ? 1226 HIS A CG    1 
ATOM   4820 N  ND1   . HIS A 1 356 ? -14.248 -1.644  -17.498 1.00 15.98  ? 1226 HIS A ND1   1 
ATOM   4821 C  CD2   . HIS A 1 356 ? -14.886 -3.565  -16.669 1.00 19.65  ? 1226 HIS A CD2   1 
ATOM   4822 C  CE1   . HIS A 1 356 ? -13.725 -1.740  -16.287 1.00 20.82  ? 1226 HIS A CE1   1 
ATOM   4823 N  NE2   . HIS A 1 356 ? -14.087 -2.900  -15.772 1.00 17.97  ? 1226 HIS A NE2   1 
ATOM   4824 H  H     . HIS A 1 356 ? -16.590 -0.263  -18.420 1.00 15.94  ? 1226 HIS A H     1 
ATOM   4825 H  HA    . HIS A 1 356 ? -17.285 -2.215  -20.121 1.00 17.00  ? 1226 HIS A HA    1 
ATOM   4826 H  HB2   . HIS A 1 356 ? -16.015 -3.900  -19.090 1.00 20.27  ? 1226 HIS A HB2   1 
ATOM   4827 H  HB3   . HIS A 1 356 ? -15.079 -2.821  -19.783 1.00 20.27  ? 1226 HIS A HB3   1 
ATOM   4828 H  HD1   . HIS A 1 356 ? -14.145 -0.978  -18.033 1.00 19.18  ? 1226 HIS A HD1   1 
ATOM   4829 H  HD2   . HIS A 1 356 ? -15.271 -4.403  -16.552 1.00 23.58  ? 1226 HIS A HD2   1 
ATOM   4830 H  HE1   . HIS A 1 356 ? -13.185 -1.106  -15.874 1.00 24.99  ? 1226 HIS A HE1   1 
ATOM   4831 N  N     . TRP A 1 357 ? -18.647 -3.515  -18.489 1.00 12.84  ? 1227 TRP A N     1 
ATOM   4832 C  CA    . TRP A 1 357 ? -19.630 -4.055  -17.576 1.00 14.71  ? 1227 TRP A CA    1 
ATOM   4833 C  C     . TRP A 1 357 ? -19.592 -5.574  -17.726 1.00 16.03  ? 1227 TRP A C     1 
ATOM   4834 O  O     . TRP A 1 357 ? -19.110 -6.094  -18.737 1.00 16.66  ? 1227 TRP A O     1 
ATOM   4835 C  CB    . TRP A 1 357 ? -21.025 -3.430  -17.791 1.00 14.19  ? 1227 TRP A CB    1 
ATOM   4836 C  CG    . TRP A 1 357 ? -21.593 -3.453  -19.214 1.00 15.75  ? 1227 TRP A CG    1 
ATOM   4837 C  CD1   . TRP A 1 357 ? -22.574 -4.289  -19.688 1.00 13.87  ? 1227 TRP A CD1   1 
ATOM   4838 C  CD2   . TRP A 1 357 ? -21.245 -2.585  -20.318 1.00 15.62  ? 1227 TRP A CD2   1 
ATOM   4839 N  NE1   . TRP A 1 357 ? -22.847 -3.999  -20.998 1.00 15.23  ? 1227 TRP A NE1   1 
ATOM   4840 C  CE2   . TRP A 1 357 ? -22.054 -2.957  -21.409 1.00 15.90  ? 1227 TRP A CE2   1 
ATOM   4841 C  CE3   . TRP A 1 357 ? -20.336 -1.532  -20.481 1.00 17.26  ? 1227 TRP A CE3   1 
ATOM   4842 C  CZ2   . TRP A 1 357 ? -21.972 -2.329  -22.670 1.00 17.84  ? 1227 TRP A CZ2   1 
ATOM   4843 C  CZ3   . TRP A 1 357 ? -20.259 -0.896  -21.740 1.00 19.70  ? 1227 TRP A CZ3   1 
ATOM   4844 C  CH2   . TRP A 1 357 ? -21.073 -1.305  -22.812 1.00 20.11  ? 1227 TRP A CH2   1 
ATOM   4845 H  H     . TRP A 1 357 ? -18.544 -3.980  -19.205 1.00 15.41  ? 1227 TRP A H     1 
ATOM   4846 H  HA    . TRP A 1 357 ? -19.352 -3.843  -16.660 1.00 17.65  ? 1227 TRP A HA    1 
ATOM   4847 H  HB2   . TRP A 1 357 ? -21.656 -3.901  -17.225 1.00 17.03  ? 1227 TRP A HB2   1 
ATOM   4848 H  HB3   . TRP A 1 357 ? -20.984 -2.500  -17.516 1.00 17.03  ? 1227 TRP A HB3   1 
ATOM   4849 H  HD1   . TRP A 1 357 ? -22.997 -4.951  -19.190 1.00 16.65  ? 1227 TRP A HD1   1 
ATOM   4850 H  HE1   . TRP A 1 357 ? -23.425 -4.407  -21.487 1.00 18.27  ? 1227 TRP A HE1   1 
ATOM   4851 H  HE3   . TRP A 1 357 ? -19.795 -1.258  -19.776 1.00 20.72  ? 1227 TRP A HE3   1 
ATOM   4852 H  HZ2   . TRP A 1 357 ? -22.511 -2.599  -23.378 1.00 21.41  ? 1227 TRP A HZ2   1 
ATOM   4853 H  HZ3   . TRP A 1 357 ? -19.658 -0.197  -21.863 1.00 23.64  ? 1227 TRP A HZ3   1 
ATOM   4854 H  HH2   . TRP A 1 357 ? -21.003 -0.869  -23.630 1.00 24.13  ? 1227 TRP A HH2   1 
ATOM   4855 N  N     . VAL A 1 358 ? -20.054 -6.288  -16.707 1.00 12.74  ? 1228 VAL A N     1 
ATOM   4856 C  CA    . VAL A 1 358 ? -19.795 -7.726  -16.618 1.00 13.92  ? 1228 VAL A CA    1 
ATOM   4857 C  C     . VAL A 1 358 ? -20.980 -8.438  -15.970 1.00 17.00  ? 1228 VAL A C     1 
ATOM   4858 O  O     . VAL A 1 358 ? -21.632 -7.890  -15.081 1.00 18.56  ? 1228 VAL A O     1 
ATOM   4859 C  CB    . VAL A 1 358 ? -18.569 -7.996  -15.713 1.00 20.48  ? 1228 VAL A CB    1 
ATOM   4860 C  CG1   . VAL A 1 358 ? -18.160 -9.489  -15.773 1.00 15.91  ? 1228 VAL A CG1   1 
ATOM   4861 C  CG2   . VAL A 1 358 ? -17.398 -7.068  -16.083 1.00 20.06  ? 1228 VAL A CG2   1 
ATOM   4862 H  H     . VAL A 1 358 ? -20.518 -5.970  -16.056 1.00 15.29  ? 1228 VAL A H     1 
ATOM   4863 H  HA    . VAL A 1 358 ? -19.634 -8.103  -17.508 1.00 16.70  ? 1228 VAL A HA    1 
ATOM   4864 H  HB    . VAL A 1 358 ? -18.819 -7.798  -14.787 1.00 24.58  ? 1228 VAL A HB    1 
ATOM   4865 H  HG11  . VAL A 1 358 ? -17.400 -9.628  -15.204 1.00 19.09  ? 1228 VAL A HG11  1 
ATOM   4866 H  HG12  . VAL A 1 358 ? -18.897 -10.027 -15.472 1.00 19.09  ? 1228 VAL A HG12  1 
ATOM   4867 H  HG13  . VAL A 1 358 ? -17.938 -9.716  -16.679 1.00 19.09  ? 1228 VAL A HG13  1 
ATOM   4868 H  HG21  . VAL A 1 358 ? -16.655 -7.259  -15.507 1.00 24.07  ? 1228 VAL A HG21  1 
ATOM   4869 H  HG22  . VAL A 1 358 ? -17.152 -7.226  -16.998 1.00 24.07  ? 1228 VAL A HG22  1 
ATOM   4870 H  HG23  . VAL A 1 358 ? -17.675 -6.156  -15.970 1.00 24.07  ? 1228 VAL A HG23  1 
ATOM   4871 N  N     . GLN A 1 359 ? -21.258 -9.656  -16.409 1.00 14.48  ? 1229 GLN A N     1 
ATOM   4872 C  CA    . GLN A 1 359 ? -22.218 -10.487 -15.692 1.00 14.49  ? 1229 GLN A CA    1 
ATOM   4873 C  C     . GLN A 1 359 ? -21.739 -11.921 -15.616 1.00 18.64  ? 1229 GLN A C     1 
ATOM   4874 O  O     . GLN A 1 359 ? -21.111 -12.431 -16.535 1.00 19.01  ? 1229 GLN A O     1 
ATOM   4875 C  CB    . GLN A 1 359 ? -23.587 -10.450 -16.362 1.00 17.06  ? 1229 GLN A CB    1 
ATOM   4876 C  CG    . GLN A 1 359 ? -23.612 -11.087 -17.740 1.00 20.45  ? 1229 GLN A CG    1 
ATOM   4877 C  CD    . GLN A 1 359 ? -24.976 -10.988 -18.395 1.00 24.95  ? 1229 GLN A CD    1 
ATOM   4878 O  OE1   . GLN A 1 359 ? -25.964 -10.641 -17.748 1.00 24.06  ? 1229 GLN A OE1   1 
ATOM   4879 N  NE2   . GLN A 1 359 ? -25.033 -11.272 -19.692 1.00 20.90  ? 1229 GLN A NE2   1 
ATOM   4880 H  H     . GLN A 1 359 ? -20.913 -10.022 -17.106 1.00 17.38  ? 1229 GLN A H     1 
ATOM   4881 H  HA    . GLN A 1 359 ? -22.317 -10.149 -14.777 1.00 17.39  ? 1229 GLN A HA    1 
ATOM   4882 H  HB2   . GLN A 1 359 ? -24.221 -10.926 -15.804 1.00 20.47  ? 1229 GLN A HB2   1 
ATOM   4883 H  HB3   . GLN A 1 359 ? -23.863 -9.525  -16.458 1.00 20.47  ? 1229 GLN A HB3   1 
ATOM   4884 H  HG2   . GLN A 1 359 ? -22.970 -10.635 -18.311 1.00 24.54  ? 1229 GLN A HG2   1 
ATOM   4885 H  HG3   . GLN A 1 359 ? -23.383 -12.026 -17.660 1.00 24.54  ? 1229 GLN A HG3   1 
ATOM   4886 H  HE21  . GLN A 1 359 ? -24.319 -11.498 -20.114 1.00 25.08  ? 1229 GLN A HE21  1 
ATOM   4887 H  HE22  . GLN A 1 359 ? -25.784 -11.231 -20.109 1.00 25.08  ? 1229 GLN A HE22  1 
ATOM   4888 N  N     . ALA A 1 360 ? -22.052 -12.579 -14.509 1.00 15.43  ? 1230 ALA A N     1 
ATOM   4889 C  CA    . ALA A 1 360 ? -21.820 -14.013 -14.408 1.00 14.05  ? 1230 ALA A CA    1 
ATOM   4890 C  C     . ALA A 1 360 ? -22.821 -14.763 -15.276 1.00 18.11  ? 1230 ALA A C     1 
ATOM   4891 O  O     . ALA A 1 360 ? -24.011 -14.470 -15.259 1.00 20.23  ? 1230 ALA A O     1 
ATOM   4892 C  CB    . ALA A 1 360 ? -21.966 -14.455 -12.945 1.00 16.51  ? 1230 ALA A CB    1 
ATOM   4893 H  H     . ALA A 1 360 ? -22.398 -12.222 -13.807 1.00 18.51  ? 1230 ALA A H     1 
ATOM   4894 H  HA    . ALA A 1 360 ? -20.913 -14.225 -14.714 1.00 16.86  ? 1230 ALA A HA    1 
ATOM   4895 H  HB1   . ALA A 1 360 ? -22.854 -14.249 -12.644 1.00 19.82  ? 1230 ALA A HB1   1 
ATOM   4896 H  HB2   . ALA A 1 360 ? -21.811 -15.400 -12.888 1.00 19.82  ? 1230 ALA A HB2   1 
ATOM   4897 H  HB3   . ALA A 1 360 ? -21.322 -13.984 -12.411 1.00 19.82  ? 1230 ALA A HB3   1 
ATOM   4898 N  N     . ILE A 1 361 ? -22.317 -15.713 -16.056 1.00 14.67  ? 1231 ILE A N     1 
ATOM   4899 C  CA    . ILE A 1 361 ? -23.156 -16.676 -16.749 1.00 18.99  ? 1231 ILE A CA    1 
ATOM   4900 C  C     . ILE A 1 361 ? -23.373 -17.942 -15.925 1.00 25.61  ? 1231 ILE A C     1 
ATOM   4901 O  O     . ILE A 1 361 ? -24.436 -18.544 -15.983 1.00 33.05  ? 1231 ILE A O     1 
ATOM   4902 C  CB    . ILE A 1 361 ? -22.511 -17.100 -18.081 1.00 22.74  ? 1231 ILE A CB    1 
ATOM   4903 C  CG1   . ILE A 1 361 ? -22.262 -15.877 -18.958 1.00 33.82  ? 1231 ILE A CG1   1 
ATOM   4904 C  CG2   . ILE A 1 361 ? -23.396 -18.125 -18.795 1.00 29.02  ? 1231 ILE A CG2   1 
ATOM   4905 C  CD1   . ILE A 1 361 ? -23.459 -14.956 -19.063 1.00 30.20  ? 1231 ILE A CD1   1 
ATOM   4906 H  H     . ILE A 1 361 ? -21.476 -15.820 -16.201 1.00 17.61  ? 1231 ILE A H     1 
ATOM   4907 H  HA    . ILE A 1 361 ? -24.029 -16.274 -16.939 1.00 22.78  ? 1231 ILE A HA    1 
ATOM   4908 H  HB    . ILE A 1 361 ? -21.656 -17.517 -17.887 1.00 27.29  ? 1231 ILE A HB    1 
ATOM   4909 H  HG12  . ILE A 1 361 ? -21.526 -15.367 -18.585 1.00 40.58  ? 1231 ILE A HG12  1 
ATOM   4910 H  HG13  . ILE A 1 361 ? -22.035 -16.174 -19.854 1.00 40.58  ? 1231 ILE A HG13  1 
ATOM   4911 H  HG21  . ILE A 1 361 ? -22.978 -18.377 -19.621 1.00 34.83  ? 1231 ILE A HG21  1 
ATOM   4912 H  HG22  . ILE A 1 361 ? -23.499 -18.896 -18.231 1.00 34.83  ? 1231 ILE A HG22  1 
ATOM   4913 H  HG23  . ILE A 1 361 ? -24.254 -17.730 -18.968 1.00 34.83  ? 1231 ILE A HG23  1 
ATOM   4914 H  HD11  . ILE A 1 361 ? -23.690 -14.643 -18.186 1.00 36.25  ? 1231 ILE A HD11  1 
ATOM   4915 H  HD12  . ILE A 1 361 ? -23.232 -14.213 -19.627 1.00 36.25  ? 1231 ILE A HD12  1 
ATOM   4916 H  HD13  . ILE A 1 361 ? -24.194 -15.442 -19.442 1.00 36.25  ? 1231 ILE A HD13  1 
ATOM   4917 N  N     . GLY A 1 362 ? -22.363 -18.349 -15.165 1.00 23.92  ? 1232 GLY A N     1 
ATOM   4918 C  CA    . GLY A 1 362 ? -22.495 -19.513 -14.308 1.00 19.69  ? 1232 GLY A CA    1 
ATOM   4919 C  C     . GLY A 1 362 ? -22.301 -19.140 -12.850 1.00 24.36  ? 1232 GLY A C     1 
ATOM   4920 O  O     . GLY A 1 362 ? -22.396 -17.966 -12.472 1.00 21.98  ? 1232 GLY A O     1 
ATOM   4921 H  H     . GLY A 1 362 ? -21.593 -17.968 -15.130 1.00 28.70  ? 1232 GLY A H     1 
ATOM   4922 H  HA2   . GLY A 1 362 ? -23.378 -19.901 -14.415 1.00 23.63  ? 1232 GLY A HA2   1 
ATOM   4923 H  HA3   . GLY A 1 362 ? -21.831 -20.177 -14.551 1.00 23.63  ? 1232 GLY A HA3   1 
ATOM   4924 N  N     . TRP A 1 363 ? -22.051 -20.140 -12.013 1.00 18.67  ? 1233 TRP A N     1 
ATOM   4925 C  CA    . TRP A 1 363 ? -21.661 -19.882 -10.624 1.00 18.93  ? 1233 TRP A CA    1 
ATOM   4926 C  C     . TRP A 1 363 ? -20.149 -19.772 -10.592 1.00 21.95  ? 1233 TRP A C     1 
ATOM   4927 O  O     . TRP A 1 363 ? -19.468 -20.683 -11.040 1.00 19.23  ? 1233 TRP A O     1 
ATOM   4928 C  CB    . TRP A 1 363 ? -22.091 -21.043 -9.723  1.00 19.88  ? 1233 TRP A CB    1 
ATOM   4929 C  CG    . TRP A 1 363 ? -23.559 -21.082 -9.495  1.00 22.63  ? 1233 TRP A CG    1 
ATOM   4930 C  CD1   . TRP A 1 363 ? -24.227 -20.627 -8.395  1.00 25.18  ? 1233 TRP A CD1   1 
ATOM   4931 C  CD2   . TRP A 1 363 ? -24.557 -21.579 -10.395 1.00 22.45  ? 1233 TRP A CD2   1 
ATOM   4932 N  NE1   . TRP A 1 363 ? -25.576 -20.818 -8.553  1.00 24.14  ? 1233 TRP A NE1   1 
ATOM   4933 C  CE2   . TRP A 1 363 ? -25.805 -21.406 -9.768  1.00 28.26  ? 1233 TRP A CE2   1 
ATOM   4934 C  CE3   . TRP A 1 363 ? -24.515 -22.163 -11.666 1.00 28.38  ? 1233 TRP A CE3   1 
ATOM   4935 C  CZ2   . TRP A 1 363 ? -27.000 -21.789 -10.368 1.00 42.02  ? 1233 TRP A CZ2   1 
ATOM   4936 C  CZ3   . TRP A 1 363 ? -25.702 -22.543 -12.258 1.00 35.66  ? 1233 TRP A CZ3   1 
ATOM   4937 C  CH2   . TRP A 1 363 ? -26.928 -22.353 -11.610 1.00 33.82  ? 1233 TRP A CH2   1 
ATOM   4938 H  H     . TRP A 1 363 ? -22.099 -20.974 -12.219 1.00 22.41  ? 1233 TRP A H     1 
ATOM   4939 H  HA    . TRP A 1 363 ? -22.060 -19.047 -10.302 1.00 22.72  ? 1233 TRP A HA    1 
ATOM   4940 H  HB2   . TRP A 1 363 ? -21.831 -21.879 -10.139 1.00 23.85  ? 1233 TRP A HB2   1 
ATOM   4941 H  HB3   . TRP A 1 363 ? -21.657 -20.952 -8.861  1.00 23.85  ? 1233 TRP A HB3   1 
ATOM   4942 H  HD1   . TRP A 1 363 ? -23.827 -20.244 -7.648  1.00 30.22  ? 1233 TRP A HD1   1 
ATOM   4943 H  HE1   . TRP A 1 363 ? -26.180 -20.609 -7.978  1.00 28.97  ? 1233 TRP A HE1   1 
ATOM   4944 H  HE3   . TRP A 1 363 ? -23.704 -22.292 -12.102 1.00 34.05  ? 1233 TRP A HE3   1 
ATOM   4945 H  HZ2   . TRP A 1 363 ? -27.817 -21.664 -9.941  1.00 50.43  ? 1233 TRP A HZ2   1 
ATOM   4946 H  HZ3   . TRP A 1 363 ? -25.687 -22.932 -13.103 1.00 42.79  ? 1233 TRP A HZ3   1 
ATOM   4947 H  HH2   . TRP A 1 363 ? -27.711 -22.621 -12.034 1.00 40.59  ? 1233 TRP A HH2   1 
ATOM   4948 N  N     . CYS A 1 364 ? -19.605 -18.680 -10.066 1.00 20.49  ? 1234 CYS A N     1 
ATOM   4949 C  CA    . CYS A 1 364 ? -18.157 -18.546 -10.064 1.00 21.56  ? 1234 CYS A CA    1 
ATOM   4950 C  C     . CYS A 1 364 ? -17.681 -17.503 -9.074  1.00 20.42  ? 1234 CYS A C     1 
ATOM   4951 O  O     . CYS A 1 364 ? -18.462 -16.686 -8.595  1.00 19.80  ? 1234 CYS A O     1 
ATOM   4952 C  CB    . CYS A 1 364 ? -17.668 -18.172 -11.470 1.00 19.56  ? 1234 CYS A CB    1 
ATOM   4953 S  SG    . CYS A 1 364 ? -18.217 -16.533 -12.015 1.00 22.95  ? 1234 CYS A SG    1 
ATOM   4954 H  H     . CYS A 1 364 ? -20.037 -18.024 -9.715  1.00 24.59  ? 1234 CYS A H     1 
ATOM   4955 H  HA    . CYS A 1 364 ? -17.755 -19.405 -9.819  1.00 25.87  ? 1234 CYS A HA    1 
ATOM   4956 H  HB2   . CYS A 1 364 ? -16.698 -18.178 -11.476 1.00 23.47  ? 1234 CYS A HB2   1 
ATOM   4957 H  HB3   . CYS A 1 364 ? -18.005 -18.825 -12.103 1.00 23.47  ? 1234 CYS A HB3   1 
ATOM   4958 H  HG    . CYS A 1 364 ? -17.798 -15.707 -11.252 1.00 27.54  ? 1234 CYS A HG    1 
ATOM   4959 N  N     . ASN A 1 365 ? -16.395 -17.556 -8.752  1.00 16.49  ? 1235 ASN A N     1 
ATOM   4960 C  CA    . ASN A 1 365 ? -15.747 -16.483 -8.020  1.00 15.92  ? 1235 ASN A CA    1 
ATOM   4961 C  C     . ASN A 1 365 ? -14.770 -15.798 -8.965  1.00 16.01  ? 1235 ASN A C     1 
ATOM   4962 O  O     . ASN A 1 365 ? -14.301 -16.419 -9.917  1.00 16.55  ? 1235 ASN A O     1 
ATOM   4963 C  CB    . ASN A 1 365 ? -14.988 -17.029 -6.816  1.00 13.13  ? 1235 ASN A CB    1 
ATOM   4964 C  CG    . ASN A 1 365 ? -15.901 -17.718 -5.815  1.00 18.93  ? 1235 ASN A CG    1 
ATOM   4965 O  OD1   . ASN A 1 365 ? -17.123 -17.601 -5.892  1.00 19.02  ? 1235 ASN A OD1   1 
ATOM   4966 N  ND2   . ASN A 1 365 ? -15.302 -18.416 -4.851  1.00 19.15  ? 1235 ASN A ND2   1 
ATOM   4967 H  H     . ASN A 1 365 ? -15.872 -18.209 -8.950  1.00 19.78  ? 1235 ASN A H     1 
ATOM   4968 H  HA    . ASN A 1 365 ? -16.412 -15.831 -7.714  1.00 19.10  ? 1235 ASN A HA    1 
ATOM   4969 H  HB2   . ASN A 1 365 ? -14.334 -17.677 -7.122  1.00 15.76  ? 1235 ASN A HB2   1 
ATOM   4970 H  HB3   . ASN A 1 365 ? -14.543 -16.296 -6.363  1.00 15.76  ? 1235 ASN A HB3   1 
ATOM   4971 H  HD21  . ASN A 1 365 ? -15.774 -18.824 -4.260  1.00 22.98  ? 1235 ASN A HD21  1 
ATOM   4972 H  HD22  . ASN A 1 365 ? -14.444 -18.458 -4.821  1.00 22.98  ? 1235 ASN A HD22  1 
ATOM   4973 N  N     . ASN A 1 366 ? -14.467 -14.527 -8.715  1.00 15.58  ? 1236 ASN A N     1 
ATOM   4974 C  CA    . ASN A 1 366 ? -13.411 -13.832 -9.463  1.00 15.10  ? 1236 ASN A CA    1 
ATOM   4975 C  C     . ASN A 1 366 ? -12.527 -13.134 -8.453  1.00 15.41  ? 1236 ASN A C     1 
ATOM   4976 O  O     . ASN A 1 366 ? -13.003 -12.749 -7.381  1.00 15.64  ? 1236 ASN A O     1 
ATOM   4977 C  CB    . ASN A 1 366 ? -13.985 -12.757 -10.410 1.00 15.58  ? 1236 ASN A CB    1 
ATOM   4978 C  CG    . ASN A 1 366 ? -14.841 -13.338 -11.520 1.00 17.75  ? 1236 ASN A CG    1 
ATOM   4979 O  OD1   . ASN A 1 366 ? -15.932 -13.849 -11.271 1.00 21.07  ? 1236 ASN A OD1   1 
ATOM   4980 N  ND2   . ASN A 1 366 ? -14.359 -13.237 -12.765 1.00 15.39  ? 1236 ASN A ND2   1 
ATOM   4981 H  H     . ASN A 1 366 ? -14.854 -14.042 -8.119  1.00 18.69  ? 1236 ASN A H     1 
ATOM   4982 H  HA    . ASN A 1 366 ? -12.877 -14.472 -9.979  1.00 18.12  ? 1236 ASN A HA    1 
ATOM   4983 H  HB2   . ASN A 1 366 ? -14.537 -12.147 -9.895  1.00 18.70  ? 1236 ASN A HB2   1 
ATOM   4984 H  HB3   . ASN A 1 366 ? -13.251 -12.274 -10.820 1.00 18.70  ? 1236 ASN A HB3   1 
ATOM   4985 H  HD21  . ASN A 1 366 ? -13.600 -12.857 -12.902 1.00 18.47  ? 1236 ASN A HD21  1 
ATOM   4986 H  HD22  . ASN A 1 366 ? -14.809 -13.551 -13.427 1.00 18.47  ? 1236 ASN A HD22  1 
ATOM   4987 N  N     . ILE A 1 367 ? -11.259 -12.933 -8.788  1.00 14.00  ? 1237 ILE A N     1 
ATOM   4988 C  CA    . ILE A 1 367 ? -10.419 -12.033 -7.997  1.00 15.02  ? 1237 ILE A CA    1 
ATOM   4989 C  C     . ILE A 1 367 ? -9.875  -10.949 -8.909  1.00 15.52  ? 1237 ILE A C     1 
ATOM   4990 O  O     . ILE A 1 367 ? -9.677  -11.173 -10.101 1.00 16.53  ? 1237 ILE A O     1 
ATOM   4991 C  CB    . ILE A 1 367 ? -9.263  -12.784 -7.333  1.00 15.88  ? 1237 ILE A CB    1 
ATOM   4992 C  CG1   . ILE A 1 367 ? -8.466  -13.566 -8.384  1.00 16.49  ? 1237 ILE A CG1   1 
ATOM   4993 C  CG2   . ILE A 1 367 ? -9.800  -13.743 -6.259  1.00 15.96  ? 1237 ILE A CG2   1 
ATOM   4994 C  CD1   . ILE A 1 367 ? -7.237  -14.298 -7.779  1.00 18.38  ? 1237 ILE A CD1   1 
ATOM   4995 H  H     . ILE A 1 367 ? -10.862 -13.298 -9.458  1.00 16.80  ? 1237 ILE A H     1 
ATOM   4996 H  HA    . ILE A 1 367 ? -10.959 -11.610 -7.297  1.00 18.02  ? 1237 ILE A HA    1 
ATOM   4997 H  HB    . ILE A 1 367 ? -8.674  -12.139 -6.910  1.00 19.06  ? 1237 ILE A HB    1 
ATOM   4998 H  HG12  . ILE A 1 367 ? -9.043  -14.232 -8.789  1.00 19.78  ? 1237 ILE A HG12  1 
ATOM   4999 H  HG13  . ILE A 1 367 ? -8.145  -12.949 -9.061  1.00 19.78  ? 1237 ILE A HG13  1 
ATOM   5000 H  HG21  . ILE A 1 367 ? -10.394 -14.374 -6.673  1.00 19.15  ? 1237 ILE A HG21  1 
ATOM   5001 H  HG22  . ILE A 1 367 ? -9.062  -14.204 -5.855  1.00 19.15  ? 1237 ILE A HG22  1 
ATOM   5002 H  HG23  . ILE A 1 367 ? -10.273 -13.235 -5.595  1.00 19.15  ? 1237 ILE A HG23  1 
ATOM   5003 H  HD11  . ILE A 1 367 ? -6.652  -13.649 -7.381  1.00 22.05  ? 1237 ILE A HD11  1 
ATOM   5004 H  HD12  . ILE A 1 367 ? -7.540  -14.918 -7.112  1.00 22.05  ? 1237 ILE A HD12  1 
ATOM   5005 H  HD13  . ILE A 1 367 ? -6.777  -14.768 -8.478  1.00 22.05  ? 1237 ILE A HD13  1 
ATOM   5006 N  N     . ALA A 1 368 ? -9.641  -9.758  -8.369  1.00 14.25  ? 1238 ALA A N     1 
ATOM   5007 C  CA    . ALA A 1 368 ? -9.278  -8.645  -9.237  1.00 12.96  ? 1238 ALA A CA    1 
ATOM   5008 C  C     . ALA A 1 368 ? -8.665  -7.501  -8.435  1.00 14.63  ? 1238 ALA A C     1 
ATOM   5009 O  O     . ALA A 1 368 ? -8.868  -7.396  -7.226  1.00 14.55  ? 1238 ALA A O     1 
ATOM   5010 C  CB    . ALA A 1 368 ? -10.521 -8.146  -10.009 1.00 12.35  ? 1238 ALA A CB    1 
ATOM   5011 H  H     . ALA A 1 368 ? -9.683  -9.571  -7.531  1.00 17.10  ? 1238 ALA A H     1 
ATOM   5012 H  HA    . ALA A 1 368 ? -8.615  -8.949  -9.891  1.00 15.56  ? 1238 ALA A HA    1 
ATOM   5013 H  HB1   . ALA A 1 368 ? -10.264 -7.414  -10.575 1.00 14.82  ? 1238 ALA A HB1   1 
ATOM   5014 H  HB2   . ALA A 1 368 ? -10.867 -8.865  -10.541 1.00 14.82  ? 1238 ALA A HB2   1 
ATOM   5015 H  HB3   . ALA A 1 368 ? -11.184 -7.855  -9.378  1.00 14.82  ? 1238 ALA A HB3   1 
ATOM   5016 N  N     . TRP A 1 369 ? -7.899  -6.664  -9.123  1.00 13.11  ? 1239 TRP A N     1 
ATOM   5017 C  CA    . TRP A 1 369 ? -7.246  -5.521  -8.504  1.00 15.92  ? 1239 TRP A CA    1 
ATOM   5018 C  C     . TRP A 1 369 ? -6.868  -4.578  -9.640  1.00 20.01  ? 1239 TRP A C     1 
ATOM   5019 O  O     . TRP A 1 369 ? -7.115  -4.874  -10.805 1.00 16.26  ? 1239 TRP A O     1 
ATOM   5020 C  CB    . TRP A 1 369 ? -6.002  -5.971  -7.726  1.00 14.06  ? 1239 TRP A CB    1 
ATOM   5021 C  CG    . TRP A 1 369 ? -5.025  -6.822  -8.541  1.00 13.55  ? 1239 TRP A CG    1 
ATOM   5022 C  CD1   . TRP A 1 369 ? -3.947  -6.381  -9.262  1.00 13.92  ? 1239 TRP A CD1   1 
ATOM   5023 C  CD2   . TRP A 1 369 ? -5.049  -8.255  -8.691  1.00 16.91  ? 1239 TRP A CD2   1 
ATOM   5024 N  NE1   . TRP A 1 369 ? -3.303  -7.454  -9.864  1.00 14.88  ? 1239 TRP A NE1   1 
ATOM   5025 C  CE2   . TRP A 1 369 ? -3.960  -8.612  -9.521  1.00 14.80  ? 1239 TRP A CE2   1 
ATOM   5026 C  CE3   . TRP A 1 369 ? -5.887  -9.265  -8.206  1.00 13.95  ? 1239 TRP A CE3   1 
ATOM   5027 C  CZ2   . TRP A 1 369 ? -3.694  -9.937  -9.880  1.00 19.75  ? 1239 TRP A CZ2   1 
ATOM   5028 C  CZ3   . TRP A 1 369 ? -5.622  -10.585 -8.564  1.00 18.72  ? 1239 TRP A CZ3   1 
ATOM   5029 C  CH2   . TRP A 1 369 ? -4.530  -10.905 -9.387  1.00 20.68  ? 1239 TRP A CH2   1 
ATOM   5030 H  H     . TRP A 1 369 ? -7.740  -6.740  -9.965  1.00 15.74  ? 1239 TRP A H     1 
ATOM   5031 H  HA    . TRP A 1 369 ? -7.863  -5.065  -7.895  1.00 19.10  ? 1239 TRP A HA    1 
ATOM   5032 H  HB2   . TRP A 1 369 ? -5.525  -5.184  -7.421  1.00 16.88  ? 1239 TRP A HB2   1 
ATOM   5033 H  HB3   . TRP A 1 369 ? -6.287  -6.498  -6.963  1.00 16.88  ? 1239 TRP A HB3   1 
ATOM   5034 H  HD1   . TRP A 1 369 ? -3.689  -5.491  -9.343  1.00 16.70  ? 1239 TRP A HD1   1 
ATOM   5035 H  HE1   . TRP A 1 369 ? -2.604  -7.403  -10.361 1.00 17.85  ? 1239 TRP A HE1   1 
ATOM   5036 H  HE3   . TRP A 1 369 ? -6.611  -9.059  -7.659  1.00 16.74  ? 1239 TRP A HE3   1 
ATOM   5037 H  HZ2   . TRP A 1 369 ? -2.974  -10.154 -10.426 1.00 23.69  ? 1239 TRP A HZ2   1 
ATOM   5038 H  HZ3   . TRP A 1 369 ? -6.171  -11.265 -8.246  1.00 22.46  ? 1239 TRP A HZ3   1 
ATOM   5039 H  HH2   . TRP A 1 369 ? -4.375  -11.795 -9.610  1.00 24.82  ? 1239 TRP A HH2   1 
ATOM   5040 N  N     . ASN A 1 370 ? -6.293  -3.432  -9.316  1.00 14.06  ? 1240 ASN A N     1 
ATOM   5041 C  CA    . ASN A 1 370 ? -5.853  -2.518  -10.359 1.00 17.02  ? 1240 ASN A CA    1 
ATOM   5042 C  C     . ASN A 1 370 ? -4.348  -2.563  -10.487 1.00 15.79  ? 1240 ASN A C     1 
ATOM   5043 O  O     . ASN A 1 370 ? -3.662  -2.989  -9.572  1.00 15.74  ? 1240 ASN A O     1 
ATOM   5044 C  CB    . ASN A 1 370 ? -6.305  -1.092  -10.027 1.00 14.00  ? 1240 ASN A CB    1 
ATOM   5045 C  CG    . ASN A 1 370 ? -7.812  -0.909  -10.175 1.00 15.05  ? 1240 ASN A CG    1 
ATOM   5046 O  OD1   . ASN A 1 370 ? -8.523  -0.728  -9.192  1.00 15.61  ? 1240 ASN A OD1   1 
ATOM   5047 N  ND2   . ASN A 1 370 ? -8.301  -0.943  -11.417 1.00 19.58  ? 1240 ASN A ND2   1 
ATOM   5048 H  H     . ASN A 1 370 ? -6.147  -3.161  -8.513  1.00 16.87  ? 1240 ASN A H     1 
ATOM   5049 H  HA    . ASN A 1 370 ? -6.248  -2.781  -11.217 1.00 20.42  ? 1240 ASN A HA    1 
ATOM   5050 H  HB2   . ASN A 1 370 ? -6.066  -0.890  -9.109  1.00 16.81  ? 1240 ASN A HB2   1 
ATOM   5051 H  HB3   . ASN A 1 370 ? -5.866  -0.472  -10.630 1.00 16.81  ? 1240 ASN A HB3   1 
ATOM   5052 H  HD21  . ASN A 1 370 ? -7.772  -1.063  -12.084 1.00 23.49  ? 1240 ASN A HD21  1 
ATOM   5053 H  HD22  . ASN A 1 370 ? -9.145  -0.844  -11.550 1.00 23.49  ? 1240 ASN A HD22  1 
ATOM   5054 N  N     . VAL A 1 371 ? -3.834  -2.132  -11.634 1.00 14.45  ? 1241 VAL A N     1 
ATOM   5055 C  CA    . VAL A 1 371 ? -2.404  -1.920  -11.789 1.00 13.12  ? 1241 VAL A CA    1 
ATOM   5056 C  C     . VAL A 1 371 ? -2.236  -0.646  -12.622 1.00 15.61  ? 1241 VAL A C     1 
ATOM   5057 O  O     . VAL A 1 371 ? -3.127  -0.273  -13.377 1.00 14.33  ? 1241 VAL A O     1 
ATOM   5058 C  CB    . VAL A 1 371 ? -1.677  -3.096  -12.504 1.00 17.16  ? 1241 VAL A CB    1 
ATOM   5059 C  CG1   . VAL A 1 371 ? -1.864  -4.425  -11.736 1.00 14.65  ? 1241 VAL A CG1   1 
ATOM   5060 C  CG2   . VAL A 1 371 ? -2.159  -3.254  -13.924 1.00 22.18  ? 1241 VAL A CG2   1 
ATOM   5061 H  H     . VAL A 1 371 ? -4.294  -1.956  -12.338 1.00 17.34  ? 1241 VAL A H     1 
ATOM   5062 H  HA    . VAL A 1 371 ? -1.992  -1.780  -10.911 1.00 15.75  ? 1241 VAL A HA    1 
ATOM   5063 H  HB    . VAL A 1 371 ? -0.717  -2.901  -12.534 1.00 20.59  ? 1241 VAL A HB    1 
ATOM   5064 H  HG11  . VAL A 1 371 ? -1.403  -5.124  -12.205 1.00 17.59  ? 1241 VAL A HG11  1 
ATOM   5065 H  HG12  . VAL A 1 371 ? -1.500  -4.329  -10.852 1.00 17.59  ? 1241 VAL A HG12  1 
ATOM   5066 H  HG13  . VAL A 1 371 ? -2.801  -4.627  -11.684 1.00 17.59  ? 1241 VAL A HG13  1 
ATOM   5067 H  HG21  . VAL A 1 371 ? -1.691  -3.986  -14.333 1.00 26.62  ? 1241 VAL A HG21  1 
ATOM   5068 H  HG22  . VAL A 1 371 ? -3.102  -3.432  -13.916 1.00 26.62  ? 1241 VAL A HG22  1 
ATOM   5069 H  HG23  . VAL A 1 371 ? -1.983  -2.442  -14.406 1.00 26.62  ? 1241 VAL A HG23  1 
ATOM   5070 N  N     . GLY A 1 372 ? -1.096  0.018   -12.482 1.00 13.75  ? 1242 GLY A N     1 
ATOM   5071 C  CA    . GLY A 1 372 ? -0.843  1.231   -13.241 1.00 15.56  ? 1242 GLY A CA    1 
ATOM   5072 C  C     . GLY A 1 372 ? 0.496   1.126   -13.927 1.00 18.72  ? 1242 GLY A C     1 
ATOM   5073 O  O     . GLY A 1 372 ? 1.531   1.299   -13.294 1.00 19.46  ? 1242 GLY A O     1 
ATOM   5074 H  H     . GLY A 1 372 ? -0.456  -0.212  -11.957 1.00 16.50  ? 1242 GLY A H     1 
ATOM   5075 H  HA2   . GLY A 1 372 ? -1.534  1.355   -13.911 1.00 18.68  ? 1242 GLY A HA2   1 
ATOM   5076 H  HA3   . GLY A 1 372 ? -0.836  1.999   -12.648 1.00 18.68  ? 1242 GLY A HA3   1 
ATOM   5077 N  N     . PRO A 1 373 ? 0.490   0.796   -15.226 1.00 18.61  ? 1243 PRO A N     1 
ATOM   5078 C  CA    . PRO A 1 373 ? 1.749   0.738   -15.963 1.00 18.56  ? 1243 PRO A CA    1 
ATOM   5079 C  C     . PRO A 1 373 ? 2.455   2.074   -15.935 1.00 23.22  ? 1243 PRO A C     1 
ATOM   5080 O  O     . PRO A 1 373 ? 1.800   3.121   -15.865 1.00 17.61  ? 1243 PRO A O     1 
ATOM   5081 C  CB    . PRO A 1 373 ? 1.303   0.409   -17.392 1.00 23.41  ? 1243 PRO A CB    1 
ATOM   5082 C  CG    . PRO A 1 373 ? 0.001   -0.343  -17.219 1.00 25.38  ? 1243 PRO A CG    1 
ATOM   5083 C  CD    . PRO A 1 373 ? -0.655  0.325   -16.025 1.00 16.40  ? 1243 PRO A CD    1 
ATOM   5084 H  HA    . PRO A 1 373 ? 2.334   0.032   -15.617 1.00 22.27  ? 1243 PRO A HA    1 
ATOM   5085 H  HB2   . PRO A 1 373 ? 1.164   1.229   -17.890 1.00 28.09  ? 1243 PRO A HB2   1 
ATOM   5086 H  HB3   . PRO A 1 373 ? 1.969   -0.149  -17.824 1.00 28.09  ? 1243 PRO A HB3   1 
ATOM   5087 H  HG2   . PRO A 1 373 ? -0.546  -0.244  -18.014 1.00 30.46  ? 1243 PRO A HG2   1 
ATOM   5088 H  HG3   . PRO A 1 373 ? 0.181   -1.279  -17.037 1.00 30.46  ? 1243 PRO A HG3   1 
ATOM   5089 H  HD2   . PRO A 1 373 ? -1.198  1.075   -16.312 1.00 19.68  ? 1243 PRO A HD2   1 
ATOM   5090 H  HD3   . PRO A 1 373 ? -1.176  -0.320  -15.521 1.00 19.68  ? 1243 PRO A HD3   1 
ATOM   5091 N  N     . LEU A 1 374 ? 3.780   2.029   -15.997 1.00 18.44  ? 1244 LEU A N     1 
ATOM   5092 C  CA    . LEU A 1 374 ? 4.599   3.236   -15.988 1.00 20.49  ? 1244 LEU A CA    1 
ATOM   5093 C  C     . LEU A 1 374 ? 4.659   3.778   -17.416 1.00 22.62  ? 1244 LEU A C     1 
ATOM   5094 O  O     . LEU A 1 374 ? 5.669   3.634   -18.117 1.00 20.43  ? 1244 LEU A O     1 
ATOM   5095 C  CB    . LEU A 1 374 ? 5.995   2.908   -15.452 1.00 19.48  ? 1244 LEU A CB    1 
ATOM   5096 C  CG    . LEU A 1 374 ? 7.006   4.055   -15.297 1.00 27.94  ? 1244 LEU A CG    1 
ATOM   5097 C  CD1   . LEU A 1 374 ? 6.505   5.074   -14.284 1.00 24.52  ? 1244 LEU A CD1   1 
ATOM   5098 C  CD2   . LEU A 1 374 ? 8.366   3.503   -14.872 1.00 31.30  ? 1244 LEU A CD2   1 
ATOM   5099 H  H     . LEU A 1 374 ? 4.235   1.301   -16.046 1.00 22.13  ? 1244 LEU A H     1 
ATOM   5100 H  HA    . LEU A 1 374 ? 4.189   3.912   -15.409 1.00 24.59  ? 1244 LEU A HA    1 
ATOM   5101 H  HB2   . LEU A 1 374 ? 5.890   2.506   -14.576 1.00 23.38  ? 1244 LEU A HB2   1 
ATOM   5102 H  HB3   . LEU A 1 374 ? 6.397   2.258   -16.050 1.00 23.38  ? 1244 LEU A HB3   1 
ATOM   5103 H  HG    . LEU A 1 374 ? 7.114   4.503   -16.150 1.00 33.52  ? 1244 LEU A HG    1 
ATOM   5104 H  HD11  . LEU A 1 374 ? 6.387   4.639   -13.436 1.00 29.42  ? 1244 LEU A HD11  1 
ATOM   5105 H  HD12  . LEU A 1 374 ? 7.152   5.779   -14.205 1.00 29.42  ? 1244 LEU A HD12  1 
ATOM   5106 H  HD13  . LEU A 1 374 ? 5.667   5.430   -14.589 1.00 29.42  ? 1244 LEU A HD13  1 
ATOM   5107 H  HD21  . LEU A 1 374 ? 8.678   2.891   -15.544 1.00 37.55  ? 1244 LEU A HD21  1 
ATOM   5108 H  HD22  . LEU A 1 374 ? 8.984   4.231   -14.780 1.00 37.55  ? 1244 LEU A HD22  1 
ATOM   5109 H  HD23  . LEU A 1 374 ? 8.269   3.046   -14.033 1.00 37.55  ? 1244 LEU A HD23  1 
ATOM   5110 N  N     . THR A 1 375 ? 3.556   4.379   -17.853 1.00 20.13  ? 1245 THR A N     1 
ATOM   5111 C  CA    . THR A 1 375 ? 3.464   4.899   -19.214 1.00 19.81  ? 1245 THR A CA    1 
ATOM   5112 C  C     . THR A 1 375 ? 2.810   6.260   -19.215 1.00 20.51  ? 1245 THR A C     1 
ATOM   5113 O  O     . THR A 1 375 ? 2.022   6.596   -18.333 1.00 18.09  ? 1245 THR A O     1 
ATOM   5114 C  CB    . THR A 1 375 ? 2.630   3.991   -20.125 1.00 20.59  ? 1245 THR A CB    1 
ATOM   5115 O  OG1   . THR A 1 375 ? 1.277   3.946   -19.647 1.00 17.09  ? 1245 THR A OG1   1 
ATOM   5116 C  CG2   . THR A 1 375 ? 3.224   2.578   -20.164 1.00 24.31  ? 1245 THR A CG2   1 
ATOM   5117 H  H     . THR A 1 375 ? 2.846   4.498   -17.382 1.00 24.16  ? 1245 THR A H     1 
ATOM   5118 H  HA    . THR A 1 375 ? 4.363   4.984   -19.595 1.00 23.77  ? 1245 THR A HA    1 
ATOM   5119 H  HB    . THR A 1 375 ? 2.639   4.348   -21.027 1.00 24.71  ? 1245 THR A HB    1 
ATOM   5120 H  HG1   . THR A 1 375 ? 1.260   3.650   -18.882 1.00 20.51  ? 1245 THR A HG1   1 
ATOM   5121 H  HG21  . THR A 1 375 ? 3.234   2.202   -19.281 1.00 29.17  ? 1245 THR A HG21  1 
ATOM   5122 H  HG22  . THR A 1 375 ? 2.697   2.016   -20.737 1.00 29.17  ? 1245 THR A HG22  1 
ATOM   5123 H  HG23  . THR A 1 375 ? 4.123   2.610   -20.500 1.00 29.17  ? 1245 THR A HG23  1 
ATOM   5124 N  N     . ALA A 1 376 ? 3.145   7.041   -20.223 1.00 17.26  ? 1246 ALA A N     1 
ATOM   5125 C  CA    . ALA A 1 376 ? 2.528   8.341   -20.398 1.00 22.73  ? 1246 ALA A CA    1 
ATOM   5126 C  C     . ALA A 1 376 ? 1.011   8.186   -20.518 1.00 19.47  ? 1246 ALA A C     1 
ATOM   5127 O  O     . ALA A 1 376 ? 0.264   8.962   -19.938 1.00 19.11  ? 1246 ALA A O     1 
ATOM   5128 C  CB    . ALA A 1 376 ? 3.106   9.025   -21.641 1.00 22.07  ? 1246 ALA A CB    1 
ATOM   5129 H  H     . ALA A 1 376 ? 3.728   6.843   -20.823 1.00 20.71  ? 1246 ALA A H     1 
ATOM   5130 H  HA    . ALA A 1 376 ? 2.721   8.901   -19.617 1.00 27.28  ? 1246 ALA A HA    1 
ATOM   5131 H  HB1   . ALA A 1 376 ? 2.927   8.478   -22.410 1.00 26.49  ? 1246 ALA A HB1   1 
ATOM   5132 H  HB2   . ALA A 1 376 ? 2.690   9.884   -21.747 1.00 26.49  ? 1246 ALA A HB2   1 
ATOM   5133 H  HB3   . ALA A 1 376 ? 4.053   9.131   -21.528 1.00 26.49  ? 1246 ALA A HB3   1 
ATOM   5134 N  N     A CYS A 1 377 ? 0.554   7.178   -21.260 0.45 18.20  ? 1247 CYS A N     1 
ATOM   5135 N  N     B CYS A 1 377 ? 0.558   7.178   -21.260 0.55 18.09  ? 1247 CYS A N     1 
ATOM   5136 C  CA    A CYS A 1 377 ? -0.882  7.003   -21.467 0.45 17.36  ? 1247 CYS A CA    1 
ATOM   5137 C  CA    B CYS A 1 377 ? -0.876  6.990   -21.457 0.55 17.27  ? 1247 CYS A CA    1 
ATOM   5138 C  C     A CYS A 1 377 ? -1.624  6.767   -20.145 0.45 14.64  ? 1247 CYS A C     1 
ATOM   5139 C  C     B CYS A 1 377 ? -1.607  6.786   -20.131 0.55 14.47  ? 1247 CYS A C     1 
ATOM   5140 O  O     A CYS A 1 377 ? -2.680  7.344   -19.922 0.45 17.32  ? 1247 CYS A O     1 
ATOM   5141 O  O     B CYS A 1 377 ? -2.641  7.395   -19.895 0.55 17.12  ? 1247 CYS A O     1 
ATOM   5142 C  CB    A CYS A 1 377 ? -1.176  5.858   -22.438 0.45 23.86  ? 1247 CYS A CB    1 
ATOM   5143 C  CB    B CYS A 1 377 ? -1.153  5.805   -22.374 0.55 23.35  ? 1247 CYS A CB    1 
ATOM   5144 S  SG    A CYS A 1 377 ? -2.951  5.601   -22.739 0.45 27.30  ? 1247 CYS A SG    1 
ATOM   5145 S  SG    B CYS A 1 377 ? -0.429  5.990   -24.004 0.55 37.56  ? 1247 CYS A SG    1 
ATOM   5146 H  H     A CYS A 1 377 ? 1.047   6.590   -21.649 0.45 21.84  ? 1247 CYS A H     1 
ATOM   5147 H  H     B CYS A 1 377 ? 1.053   6.597   -21.655 0.55 21.70  ? 1247 CYS A H     1 
ATOM   5148 H  HA    A CYS A 1 377 ? -1.241  7.825   -21.863 0.45 20.83  ? 1247 CYS A HA    1 
ATOM   5149 H  HA    B CYS A 1 377 ? -1.245  7.792   -21.883 0.55 20.73  ? 1247 CYS A HA    1 
ATOM   5150 H  HB2   A CYS A 1 377 ? -0.755  6.053   -23.290 0.45 28.63  ? 1247 CYS A HB2   1 
ATOM   5151 H  HB2   B CYS A 1 377 ? -0.783  5.003   -21.972 0.55 28.02  ? 1247 CYS A HB2   1 
ATOM   5152 H  HB3   A CYS A 1 377 ? -0.814  5.036   -22.072 0.45 28.63  ? 1247 CYS A HB3   1 
ATOM   5153 H  HB3   B CYS A 1 377 ? -2.112  5.708   -22.482 0.55 28.02  ? 1247 CYS A HB3   1 
ATOM   5154 H  HG    A CYS A 1 377 ? -3.089  4.690   -23.507 0.45 32.76  ? 1247 CYS A HG    1 
ATOM   5155 H  HG    B CYS A 1 377 ? -0.692  5.020   -24.660 0.55 45.08  ? 1247 CYS A HG    1 
ATOM   5156 N  N     . GLN A 1 378 ? -1.084  5.908   -19.284 1.00 13.63  ? 1248 GLN A N     1 
ATOM   5157 C  CA    . GLN A 1 378 ? -1.737  5.624   -17.994 1.00 13.27  ? 1248 GLN A CA    1 
ATOM   5158 C  C     . GLN A 1 378 ? -1.736  6.873   -17.111 1.00 16.10  ? 1248 GLN A C     1 
ATOM   5159 O  O     . GLN A 1 378 ? -2.737  7.213   -16.480 1.00 13.36  ? 1248 GLN A O     1 
ATOM   5160 C  CB    . GLN A 1 378 ? -1.035  4.493   -17.235 1.00 14.66  ? 1248 GLN A CB    1 
ATOM   5161 C  CG    . GLN A 1 378 ? -1.571  4.292   -15.801 1.00 13.34  ? 1248 GLN A CG    1 
ATOM   5162 C  CD    . GLN A 1 378 ? -3.027  3.779   -15.770 1.00 18.02  ? 1248 GLN A CD    1 
ATOM   5163 O  OE1   . GLN A 1 378 ? -3.277  2.579   -15.598 1.00 17.28  ? 1248 GLN A OE1   1 
ATOM   5164 N  NE2   . GLN A 1 378 ? -3.981  4.687   -15.934 1.00 16.03  ? 1248 GLN A NE2   1 
ATOM   5165 H  H     A GLN A 1 378 ? -0.350  5.478   -19.414 0.50 16.36  ? 1248 GLN A H     1 
ATOM   5166 H  H     B GLN A 1 378 ? -0.361  5.463   -19.423 0.50 16.36  ? 1248 GLN A H     1 
ATOM   5167 H  HA    . GLN A 1 378 ? -2.667  5.359   -18.152 1.00 15.93  ? 1248 GLN A HA    1 
ATOM   5168 H  HB2   . GLN A 1 378 ? -1.163  3.663   -17.720 1.00 17.59  ? 1248 GLN A HB2   1 
ATOM   5169 H  HB3   . GLN A 1 378 ? -0.088  4.696   -17.173 1.00 17.59  ? 1248 GLN A HB3   1 
ATOM   5170 H  HG2   . GLN A 1 378 ? -1.015  3.642   -15.344 1.00 16.01  ? 1248 GLN A HG2   1 
ATOM   5171 H  HG3   . GLN A 1 378 ? -1.543  5.141   -15.332 1.00 16.01  ? 1248 GLN A HG3   1 
ATOM   5172 H  HE21  . GLN A 1 378 ? -4.807  4.449   -15.924 1.00 19.24  ? 1248 GLN A HE21  1 
ATOM   5173 H  HE22  . GLN A 1 378 ? -3.773  5.514   -16.049 1.00 19.24  ? 1248 GLN A HE22  1 
ATOM   5174 N  N     . TYR A 1 379 ? -0.597  7.548   -17.048 1.00 16.64  ? 1249 TYR A N     1 
ATOM   5175 C  CA    . TYR A 1 379 ? -0.481  8.711   -16.170 1.00 15.76  ? 1249 TYR A CA    1 
ATOM   5176 C  C     . TYR A 1 379 ? -1.403  9.820   -16.677 1.00 15.22  ? 1249 TYR A C     1 
ATOM   5177 O  O     . TYR A 1 379 ? -2.122  10.463  -15.901 1.00 14.72  ? 1249 TYR A O     1 
ATOM   5178 C  CB    . TYR A 1 379 ? 0.973   9.206   -16.085 1.00 15.15  ? 1249 TYR A CB    1 
ATOM   5179 C  CG    . TYR A 1 379 ? 1.151   10.339  -15.088 1.00 18.89  ? 1249 TYR A CG    1 
ATOM   5180 C  CD1   . TYR A 1 379 ? 1.170   10.094  -13.713 1.00 20.41  ? 1249 TYR A CD1   1 
ATOM   5181 C  CD2   . TYR A 1 379 ? 1.279   11.657  -15.521 1.00 17.75  ? 1249 TYR A CD2   1 
ATOM   5182 C  CE1   . TYR A 1 379 ? 1.324   11.139  -12.793 1.00 14.51  ? 1249 TYR A CE1   1 
ATOM   5183 C  CE2   . TYR A 1 379 ? 1.441   12.702  -14.614 1.00 17.12  ? 1249 TYR A CE2   1 
ATOM   5184 C  CZ    . TYR A 1 379 ? 1.467   12.439  -13.258 1.00 15.40  ? 1249 TYR A CZ    1 
ATOM   5185 O  OH    . TYR A 1 379 ? 1.624   13.502  -12.382 1.00 15.24  ? 1249 TYR A OH    1 
ATOM   5186 H  H     . TYR A 1 379 ? 0.115   7.361   -17.494 1.00 19.97  ? 1249 TYR A H     1 
ATOM   5187 H  HA    . TYR A 1 379 ? -0.771  8.462   -15.267 1.00 18.92  ? 1249 TYR A HA    1 
ATOM   5188 H  HB2   . TYR A 1 379 ? 1.542   8.471   -15.808 1.00 18.19  ? 1249 TYR A HB2   1 
ATOM   5189 H  HB3   . TYR A 1 379 ? 1.248   9.529   -16.958 1.00 18.19  ? 1249 TYR A HB3   1 
ATOM   5190 H  HD1   . TYR A 1 379 ? 1.080   9.222   -13.403 1.00 24.49  ? 1249 TYR A HD1   1 
ATOM   5191 H  HD2   . TYR A 1 379 ? 1.270   11.841  -16.433 1.00 21.30  ? 1249 TYR A HD2   1 
ATOM   5192 H  HE1   . TYR A 1 379 ? 1.343   10.962  -11.880 1.00 17.41  ? 1249 TYR A HE1   1 
ATOM   5193 H  HE2   . TYR A 1 379 ? 1.532   13.575  -14.921 1.00 20.54  ? 1249 TYR A HE2   1 
ATOM   5194 H  HH    . TYR A 1 379 ? 2.298   13.394  -11.927 1.00 18.29  ? 1249 TYR A HH    1 
ATOM   5195 N  N     . LYS A 1 380 ? -1.425  10.024  -17.991 1.00 13.83  ? 1250 LYS A N     1 
ATOM   5196 C  CA    . LYS A 1 380 ? -2.269  11.084  -18.561 1.00 13.65  ? 1250 LYS A CA    1 
ATOM   5197 C  C     . LYS A 1 380 ? -3.734  10.836  -18.209 1.00 17.58  ? 1250 LYS A C     1 
ATOM   5198 O  O     . LYS A 1 380 ? -4.435  11.745  -17.768 1.00 14.76  ? 1250 LYS A O     1 
ATOM   5199 C  CB    . LYS A 1 380 ? -2.097  11.146  -20.084 1.00 14.52  ? 1250 LYS A CB    1 
ATOM   5200 C  CG    . LYS A 1 380 ? -2.980  12.180  -20.764 1.00 23.40  ? 1250 LYS A CG    1 
ATOM   5201 C  CD    . LYS A 1 380 ? -2.642  12.260  -22.265 1.00 29.10  ? 1250 LYS A CD    1 
ATOM   5202 C  CE    . LYS A 1 380 ? -3.515  13.271  -22.994 1.00 33.91  ? 1250 LYS A CE    1 
ATOM   5203 N  NZ    . LYS A 1 380 ? -3.100  13.387  -24.418 1.00 45.11  ? 1250 LYS A NZ    1 
ATOM   5204 H  H     . LYS A 1 380 ? -0.973  9.575   -18.569 1.00 16.60  ? 1250 LYS A H     1 
ATOM   5205 H  HA    . LYS A 1 380 ? -2.003  11.949  -18.184 1.00 16.38  ? 1250 LYS A HA    1 
ATOM   5206 H  HB2   . LYS A 1 380 ? -1.174  11.368  -20.285 1.00 17.43  ? 1250 LYS A HB2   1 
ATOM   5207 H  HB3   . LYS A 1 380 ? -2.315  10.279  -20.459 1.00 17.43  ? 1250 LYS A HB3   1 
ATOM   5208 H  HG2   . LYS A 1 380 ? -3.911  11.923  -20.671 1.00 28.08  ? 1250 LYS A HG2   1 
ATOM   5209 H  HG3   . LYS A 1 380 ? -2.826  13.051  -20.366 1.00 28.08  ? 1250 LYS A HG3   1 
ATOM   5210 H  HD2   . LYS A 1 380 ? -1.716  12.531  -22.368 1.00 34.92  ? 1250 LYS A HD2   1 
ATOM   5211 H  HD3   . LYS A 1 380 ? -2.783  11.391  -22.670 1.00 34.92  ? 1250 LYS A HD3   1 
ATOM   5212 H  HE2   . LYS A 1 380 ? -4.440  12.979  -22.966 1.00 40.69  ? 1250 LYS A HE2   1 
ATOM   5213 H  HE3   . LYS A 1 380 ? -3.422  14.141  -22.575 1.00 40.69  ? 1250 LYS A HE3   1 
ATOM   5214 H  HZ1   . LYS A 1 380 ? -3.178  12.598  -24.823 1.00 54.13  ? 1250 LYS A HZ1   1 
ATOM   5215 H  HZ2   . LYS A 1 380 ? -3.615  13.979  -24.838 1.00 54.13  ? 1250 LYS A HZ2   1 
ATOM   5216 H  HZ3   . LYS A 1 380 ? -2.253  13.654  -24.467 1.00 54.13  ? 1250 LYS A HZ3   1 
ATOM   5217 N  N     . LEU A 1 381 ? -4.203  9.601   -18.414 1.00 15.91  ? 1251 LEU A N     1 
ATOM   5218 C  CA    . LEU A 1 381 ? -5.613  9.291   -18.208 1.00 16.34  ? 1251 LEU A CA    1 
ATOM   5219 C  C     . LEU A 1 381 ? -5.975  9.377   -16.723 1.00 16.18  ? 1251 LEU A C     1 
ATOM   5220 O  O     . LEU A 1 381 ? -7.100  9.742   -16.376 1.00 15.66  ? 1251 LEU A O     1 
ATOM   5221 C  CB    . LEU A 1 381 ? -5.944  7.903   -18.746 1.00 13.19  ? 1251 LEU A CB    1 
ATOM   5222 C  CG    . LEU A 1 381 ? -6.086  7.837   -20.271 1.00 16.83  ? 1251 LEU A CG    1 
ATOM   5223 C  CD1   . LEU A 1 381 ? -6.121  6.386   -20.749 1.00 20.78  ? 1251 LEU A CD1   1 
ATOM   5224 C  CD2   . LEU A 1 381 ? -7.347  8.594   -20.678 1.00 23.60  ? 1251 LEU A CD2   1 
ATOM   5225 H  H     . LEU A 1 381 ? -3.726  8.933   -18.670 1.00 19.10  ? 1251 LEU A H     1 
ATOM   5226 H  HA    . LEU A 1 381 ? -6.159  9.944   -18.693 1.00 19.61  ? 1251 LEU A HA    1 
ATOM   5227 H  HB2   . LEU A 1 381 ? -5.235  7.293   -18.489 1.00 15.83  ? 1251 LEU A HB2   1 
ATOM   5228 H  HB3   . LEU A 1 381 ? -6.784  7.612   -18.359 1.00 15.83  ? 1251 LEU A HB3   1 
ATOM   5229 H  HG    . LEU A 1 381 ? -5.324  8.273   -20.682 1.00 20.19  ? 1251 LEU A HG    1 
ATOM   5230 H  HD11  . LEU A 1 381 ? -6.211  6.375   -21.705 1.00 24.93  ? 1251 LEU A HD11  1 
ATOM   5231 H  HD12  . LEU A 1 381 ? -5.305  5.953   -20.491 1.00 24.93  ? 1251 LEU A HD12  1 
ATOM   5232 H  HD13  . LEU A 1 381 ? -6.870  5.943   -20.344 1.00 24.93  ? 1251 LEU A HD13  1 
ATOM   5233 H  HD21  . LEU A 1 381 ? -7.268  9.508   -20.393 1.00 28.31  ? 1251 LEU A HD21  1 
ATOM   5234 H  HD22  . LEU A 1 381 ? -7.441  8.555   -21.632 1.00 28.31  ? 1251 LEU A HD22  1 
ATOM   5235 H  HD23  . LEU A 1 381 ? -8.107  8.184   -20.257 1.00 28.31  ? 1251 LEU A HD23  1 
ATOM   5236 N  N     . ALA A 1 382 ? -5.031  9.042   -15.849 1.00 14.57  ? 1252 ALA A N     1 
ATOM   5237 C  CA    . ALA A 1 382 ? -5.302  9.101   -14.405 1.00 13.44  ? 1252 ALA A CA    1 
ATOM   5238 C  C     . ALA A 1 382 ? -5.433  10.557  -13.968 1.00 16.16  ? 1252 ALA A C     1 
ATOM   5239 O  O     . ALA A 1 382 ? -6.287  10.900  -13.145 1.00 16.59  ? 1252 ALA A O     1 
ATOM   5240 C  CB    . ALA A 1 382 ? -4.194  8.406   -13.592 1.00 14.64  ? 1252 ALA A CB    1 
ATOM   5241 H  H     . ALA A 1 382 ? -4.238  8.781   -16.055 1.00 17.48  ? 1252 ALA A H     1 
ATOM   5242 H  HA    . ALA A 1 382 ? -6.150  8.647   -14.218 1.00 16.13  ? 1252 ALA A HA    1 
ATOM   5243 H  HB1   . ALA A 1 382 ? -4.143  7.485   -13.858 1.00 17.57  ? 1252 ALA A HB1   1 
ATOM   5244 H  HB2   . ALA A 1 382 ? -3.358  8.844   -13.766 1.00 17.57  ? 1252 ALA A HB2   1 
ATOM   5245 H  HB3   . ALA A 1 382 ? -4.408  8.466   -12.658 1.00 17.57  ? 1252 ALA A HB3   1 
ATOM   5246 N  N     . VAL A 1 383 ? -4.569  11.413  -14.501 1.00 14.91  ? 1253 VAL A N     1 
ATOM   5247 C  CA    . VAL A 1 383 ? -4.616  12.827  -14.149 1.00 15.24  ? 1253 VAL A CA    1 
ATOM   5248 C  C     . VAL A 1 383 ? -5.880  13.466  -14.731 1.00 15.29  ? 1253 VAL A C     1 
ATOM   5249 O  O     . VAL A 1 383 ? -6.543  14.256  -14.062 1.00 17.38  ? 1253 VAL A O     1 
ATOM   5250 C  CB    . VAL A 1 383 ? -3.349  13.566  -14.648 1.00 17.69  ? 1253 VAL A CB    1 
ATOM   5251 C  CG1   . VAL A 1 383 ? -3.528  15.088  -14.561 1.00 21.33  ? 1253 VAL A CG1   1 
ATOM   5252 C  CG2   . VAL A 1 383 ? -2.142  13.101  -13.838 1.00 17.12  ? 1253 VAL A CG2   1 
ATOM   5253 H  H     . VAL A 1 383 ? -3.952  11.204  -15.063 1.00 17.90  ? 1253 VAL A H     1 
ATOM   5254 H  HA    . VAL A 1 383 ? -4.654  12.913  -13.173 1.00 18.29  ? 1253 VAL A HA    1 
ATOM   5255 H  HB    . VAL A 1 383 ? -3.193  13.332  -15.586 1.00 21.23  ? 1253 VAL A HB    1 
ATOM   5256 H  HG11  . VAL A 1 383 ? -4.401  15.280  -14.211 1.00 25.59  ? 1253 VAL A HG11  1 
ATOM   5257 H  HG12  . VAL A 1 383 ? -2.854  15.448  -13.980 1.00 25.59  ? 1253 VAL A HG12  1 
ATOM   5258 H  HG13  . VAL A 1 383 ? -3.438  15.463  -15.440 1.00 25.59  ? 1253 VAL A HG13  1 
ATOM   5259 H  HG21  . VAL A 1 383 ? -2.430  12.451  -13.194 1.00 20.54  ? 1253 VAL A HG21  1 
ATOM   5260 H  HG22  . VAL A 1 383 ? -1.498  12.710  -14.434 1.00 20.54  ? 1253 VAL A HG22  1 
ATOM   5261 H  HG23  . VAL A 1 383 ? -1.757  13.858  -13.390 1.00 20.54  ? 1253 VAL A HG23  1 
ATOM   5262 N  N     . GLU A 1 384 ? -6.208  13.142  -15.982 1.00 15.80  ? 1254 GLU A N     1 
ATOM   5263 C  CA    . GLU A 1 384 ? -7.424  13.685  -16.583 1.00 15.55  ? 1254 GLU A CA    1 
ATOM   5264 C  C     . GLU A 1 384 ? -8.639  13.367  -15.712 1.00 23.03  ? 1254 GLU A C     1 
ATOM   5265 O  O     . GLU A 1 384 ? -9.461  14.235  -15.444 1.00 18.99  ? 1254 GLU A O     1 
ATOM   5266 C  CB    . GLU A 1 384 ? -7.643  13.115  -17.979 1.00 17.80  ? 1254 GLU A CB    1 
ATOM   5267 C  CG    . GLU A 1 384 ? -6.695  13.690  -19.015 1.00 24.87  ? 1254 GLU A CG    1 
ATOM   5268 C  CD    . GLU A 1 384 ? -6.929  13.107  -20.402 1.00 31.98  ? 1254 GLU A CD    1 
ATOM   5269 O  OE1   . GLU A 1 384 ? -7.778  12.188  -20.549 1.00 31.88  ? 1254 GLU A OE1   1 
ATOM   5270 O  OE2   . GLU A 1 384 ? -6.263  13.581  -21.342 1.00 34.61  ? 1254 GLU A OE2   1 
ATOM   5271 H  H     . GLU A 1 384 ? -5.754  12.621  -16.494 1.00 18.96  ? 1254 GLU A H     1 
ATOM   5272 H  HA    . GLU A 1 384 ? -7.343  14.659  -16.656 1.00 18.66  ? 1254 GLU A HA    1 
ATOM   5273 H  HB2   . GLU A 1 384 ? -7.508  12.155  -17.952 1.00 21.36  ? 1254 GLU A HB2   1 
ATOM   5274 H  HB3   . GLU A 1 384 ? -8.549  13.314  -18.262 1.00 21.36  ? 1254 GLU A HB3   1 
ATOM   5275 H  HG2   . GLU A 1 384 ? -6.826  14.649  -19.066 1.00 29.85  ? 1254 GLU A HG2   1 
ATOM   5276 H  HG3   . GLU A 1 384 ? -5.783  13.491  -18.755 1.00 29.85  ? 1254 GLU A HG3   1 
ATOM   5277 N  N     . ARG A 1 385 ? -8.759  12.115  -15.281 1.00 17.13  ? 1255 ARG A N     1 
ATOM   5278 C  CA    . ARG A 1 385 ? -9.941  11.709  -14.530 1.00 15.12  ? 1255 ARG A CA    1 
ATOM   5279 C  C     . ARG A 1 385 ? -9.926  12.381  -13.158 1.00 16.93  ? 1255 ARG A C     1 
ATOM   5280 O  O     . ARG A 1 385 ? -10.971 12.769  -12.649 1.00 19.14  ? 1255 ARG A O     1 
ATOM   5281 C  CB    . ARG A 1 385 ? -10.010 10.178  -14.409 1.00 15.10  ? 1255 ARG A CB    1 
ATOM   5282 C  CG    . ARG A 1 385 ? -11.185 9.636   -13.566 1.00 15.14  ? 1255 ARG A CG    1 
ATOM   5283 C  CD    . ARG A 1 385 ? -12.538 10.260  -13.941 1.00 20.23  ? 1255 ARG A CD    1 
ATOM   5284 N  NE    . ARG A 1 385 ? -12.809 10.317  -15.389 1.00 15.89  ? 1255 ARG A NE    1 
ATOM   5285 C  CZ    . ARG A 1 385 ? -13.385 9.352   -16.103 1.00 18.56  ? 1255 ARG A CZ    1 
ATOM   5286 N  NH1   . ARG A 1 385 ? -13.742 8.200   -15.525 1.00 16.39  ? 1255 ARG A NH1   1 
ATOM   5287 N  NH2   . ARG A 1 385 ? -13.595 9.540   -17.411 1.00 17.06  ? 1255 ARG A NH2   1 
ATOM   5288 H  H     . ARG A 1 385 ? -8.180  11.491  -15.407 1.00 20.56  ? 1255 ARG A H     1 
ATOM   5289 H  HA    . ARG A 1 385 ? -10.742 12.012  -15.007 1.00 18.14  ? 1255 ARG A HA    1 
ATOM   5290 H  HB2   . ARG A 1 385 ? -10.092 9.803   -15.299 1.00 18.12  ? 1255 ARG A HB2   1 
ATOM   5291 H  HB3   . ARG A 1 385 ? -9.188  9.865   -13.999 1.00 18.12  ? 1255 ARG A HB3   1 
ATOM   5292 H  HG2   . ARG A 1 385 ? -11.251 8.677   -13.699 1.00 18.16  ? 1255 ARG A HG2   1 
ATOM   5293 H  HG3   . ARG A 1 385 ? -11.016 9.829   -12.631 1.00 18.16  ? 1255 ARG A HG3   1 
ATOM   5294 H  HD2   . ARG A 1 385 ? -13.245 9.737   -13.531 1.00 24.28  ? 1255 ARG A HD2   1 
ATOM   5295 H  HD3   . ARG A 1 385 ? -12.566 11.168  -13.601 1.00 24.28  ? 1255 ARG A HD3   1 
ATOM   5296 H  HE    . ARG A 1 385 ? -12.575 11.032  -15.807 1.00 19.07  ? 1255 ARG A HE    1 
ATOM   5297 H  HH11  . ARG A 1 385 ? -13.611 8.082   -14.684 1.00 19.66  ? 1255 ARG A HH11  1 
ATOM   5298 H  HH12  . ARG A 1 385 ? -14.109 7.579   -15.994 1.00 19.66  ? 1255 ARG A HH12  1 
ATOM   5299 H  HH21  . ARG A 1 385 ? -13.358 10.278  -17.783 1.00 20.48  ? 1255 ARG A HH21  1 
ATOM   5300 H  HH22  . ARG A 1 385 ? -13.955 8.917   -17.883 1.00 20.48  ? 1255 ARG A HH22  1 
ATOM   5301 N  N     . TYR A 1 386 ? -8.736  12.535  -12.572 1.00 16.56  ? 1256 TYR A N     1 
ATOM   5302 C  CA    . TYR A 1 386 ? -8.586  13.247  -11.304 1.00 17.32  ? 1256 TYR A CA    1 
ATOM   5303 C  C     . TYR A 1 386 ? -9.140  14.667  -11.435 1.00 16.90  ? 1256 TYR A C     1 
ATOM   5304 O  O     . TYR A 1 386 ? -9.836  15.166  -10.542 1.00 19.86  ? 1256 TYR A O     1 
ATOM   5305 C  CB    . TYR A 1 386 ? -7.098  13.282  -10.931 1.00 18.36  ? 1256 TYR A CB    1 
ATOM   5306 C  CG    . TYR A 1 386 ? -6.711  13.978  -9.634  1.00 20.15  ? 1256 TYR A CG    1 
ATOM   5307 C  CD1   . TYR A 1 386 ? -6.699  13.282  -8.429  1.00 15.44  ? 1256 TYR A CD1   1 
ATOM   5308 C  CD2   . TYR A 1 386 ? -6.253  15.290  -9.635  1.00 19.04  ? 1256 TYR A CD2   1 
ATOM   5309 C  CE1   . TYR A 1 386 ? -6.301  13.891  -7.241  1.00 18.55  ? 1256 TYR A CE1   1 
ATOM   5310 C  CE2   . TYR A 1 386 ? -5.850  15.913  -8.451  1.00 23.43  ? 1256 TYR A CE2   1 
ATOM   5311 C  CZ    . TYR A 1 386 ? -5.879  15.204  -7.259  1.00 16.77  ? 1256 TYR A CZ    1 
ATOM   5312 O  OH    . TYR A 1 386 ? -5.477  15.806  -6.085  1.00 18.02  ? 1256 TYR A OH    1 
ATOM   5313 H  H     . TYR A 1 386 ? -7.997  12.235  -12.893 1.00 19.87  ? 1256 TYR A H     1 
ATOM   5314 H  HA    . TYR A 1 386 ? -9.078  12.778  -10.599 1.00 20.78  ? 1256 TYR A HA    1 
ATOM   5315 H  HB2   . TYR A 1 386 ? -6.784  12.367  -10.866 1.00 22.03  ? 1256 TYR A HB2   1 
ATOM   5316 H  HB3   . TYR A 1 386 ? -6.621  13.731  -11.647 1.00 22.03  ? 1256 TYR A HB3   1 
ATOM   5317 H  HD1   . TYR A 1 386 ? -6.985  12.397  -8.412  1.00 18.52  ? 1256 TYR A HD1   1 
ATOM   5318 H  HD2   . TYR A 1 386 ? -6.235  15.768  -10.433 1.00 22.85  ? 1256 TYR A HD2   1 
ATOM   5319 H  HE1   . TYR A 1 386 ? -6.317  13.415  -6.442  1.00 22.25  ? 1256 TYR A HE1   1 
ATOM   5320 H  HE2   . TYR A 1 386 ? -5.564  16.798  -8.462  1.00 28.11  ? 1256 TYR A HE2   1 
ATOM   5321 H  HH    . TYR A 1 386 ? -4.841  15.399  -5.764  1.00 21.62  ? 1256 TYR A HH    1 
ATOM   5322 N  N     . GLU A 1 387 ? -8.833  15.326  -12.545 1.00 17.53  ? 1257 GLU A N     1 
ATOM   5323 C  CA    . GLU A 1 387 ? -9.289  16.700  -12.733 1.00 17.80  ? 1257 GLU A CA    1 
ATOM   5324 C  C     . GLU A 1 387 ? -10.794 16.739  -13.014 1.00 21.22  ? 1257 GLU A C     1 
ATOM   5325 O  O     . GLU A 1 387 ? -11.503 17.616  -12.528 1.00 20.47  ? 1257 GLU A O     1 
ATOM   5326 C  CB    . GLU A 1 387 ? -8.499  17.384  -13.859 1.00 17.54  ? 1257 GLU A CB    1 
ATOM   5327 C  CG    . GLU A 1 387 ? -7.031  17.644  -13.504 1.00 22.08  ? 1257 GLU A CG    1 
ATOM   5328 C  CD    . GLU A 1 387 ? -6.858  18.524  -12.260 1.00 38.61  ? 1257 GLU A CD    1 
ATOM   5329 O  OE1   . GLU A 1 387 ? -7.737  19.373  -11.983 1.00 36.88  ? 1257 GLU A OE1   1 
ATOM   5330 O  OE2   . GLU A 1 387 ? -5.841  18.362  -11.548 1.00 35.84  ? 1257 GLU A OE2   1 
ATOM   5331 H  H     . GLU A 1 387 ? -8.369  15.008  -13.196 1.00 21.03  ? 1257 GLU A H     1 
ATOM   5332 H  HA    . GLU A 1 387 ? -9.127  17.201  -11.907 1.00 21.35  ? 1257 GLU A HA    1 
ATOM   5333 H  HB2   . GLU A 1 387 ? -8.519  16.817  -14.645 1.00 21.05  ? 1257 GLU A HB2   1 
ATOM   5334 H  HB3   . GLU A 1 387 ? -8.912  18.238  -14.058 1.00 21.05  ? 1257 GLU A HB3   1 
ATOM   5335 H  HG2   . GLU A 1 387 ? -6.594  16.795  -13.333 1.00 26.50  ? 1257 GLU A HG2   1 
ATOM   5336 H  HG3   . GLU A 1 387 ? -6.602  18.093  -14.249 1.00 26.50  ? 1257 GLU A HG3   1 
ATOM   5337 N  N     . TRP A 1 388 ? -11.284 15.786  -13.800 1.00 18.11  ? 1258 TRP A N     1 
ATOM   5338 C  CA    . TRP A 1 388 ? -12.711 15.725  -14.114 1.00 16.83  ? 1258 TRP A CA    1 
ATOM   5339 C  C     . TRP A 1 388 ? -13.503 15.418  -12.840 1.00 17.12  ? 1258 TRP A C     1 
ATOM   5340 O  O     . TRP A 1 388 ? -14.560 16.000  -12.599 1.00 22.85  ? 1258 TRP A O     1 
ATOM   5341 C  CB    . TRP A 1 388 ? -12.958 14.653  -15.191 1.00 16.23  ? 1258 TRP A CB    1 
ATOM   5342 C  CG    . TRP A 1 388 ? -14.404 14.427  -15.554 1.00 20.17  ? 1258 TRP A CG    1 
ATOM   5343 C  CD1   . TRP A 1 388 ? -15.124 13.275  -15.376 1.00 18.03  ? 1258 TRP A CD1   1 
ATOM   5344 C  CD2   . TRP A 1 388 ? -15.292 15.360  -16.178 1.00 19.96  ? 1258 TRP A CD2   1 
ATOM   5345 N  NE1   . TRP A 1 388 ? -16.411 13.441  -15.843 1.00 18.05  ? 1258 TRP A NE1   1 
ATOM   5346 C  CE2   . TRP A 1 388 ? -16.538 14.712  -16.340 1.00 21.96  ? 1258 TRP A CE2   1 
ATOM   5347 C  CE3   . TRP A 1 388 ? -15.161 16.687  -16.606 1.00 29.78  ? 1258 TRP A CE3   1 
ATOM   5348 C  CZ2   . TRP A 1 388 ? -17.636 15.342  -16.915 1.00 29.46  ? 1258 TRP A CZ2   1 
ATOM   5349 C  CZ3   . TRP A 1 388 ? -16.255 17.309  -17.176 1.00 32.64  ? 1258 TRP A CZ3   1 
ATOM   5350 C  CH2   . TRP A 1 388 ? -17.475 16.638  -17.327 1.00 34.37  ? 1258 TRP A CH2   1 
ATOM   5351 H  H     . TRP A 1 388 ? -10.814 15.163  -14.163 1.00 21.73  ? 1258 TRP A H     1 
ATOM   5352 H  HA    . TRP A 1 388 ? -13.007 16.592  -14.463 1.00 20.20  ? 1258 TRP A HA    1 
ATOM   5353 H  HB2   . TRP A 1 388 ? -12.492 14.917  -16.000 1.00 19.48  ? 1258 TRP A HB2   1 
ATOM   5354 H  HB3   . TRP A 1 388 ? -12.602 13.809  -14.873 1.00 19.48  ? 1258 TRP A HB3   1 
ATOM   5355 H  HD1   . TRP A 1 388 ? -14.793 12.494  -14.995 1.00 21.64  ? 1258 TRP A HD1   1 
ATOM   5356 H  HE1   . TRP A 1 388 ? -17.031 12.845  -15.828 1.00 21.66  ? 1258 TRP A HE1   1 
ATOM   5357 H  HE3   . TRP A 1 388 ? -14.354 17.139  -16.513 1.00 35.73  ? 1258 TRP A HE3   1 
ATOM   5358 H  HZ2   . TRP A 1 388 ? -18.449 14.902  -17.012 1.00 35.35  ? 1258 TRP A HZ2   1 
ATOM   5359 H  HZ3   . TRP A 1 388 ? -16.179 18.189  -17.467 1.00 39.16  ? 1258 TRP A HZ3   1 
ATOM   5360 H  HH2   . TRP A 1 388 ? -18.194 17.085  -17.712 1.00 41.25  ? 1258 TRP A HH2   1 
ATOM   5361 N  N     . ASN A 1 389 ? -12.967 14.530  -12.004 1.00 14.81  ? 1259 ASN A N     1 
ATOM   5362 C  CA    . ASN A 1 389 ? -13.589 14.193  -10.721 1.00 19.14  ? 1259 ASN A CA    1 
ATOM   5363 C  C     . ASN A 1 389 ? -13.777 15.443  -9.856  1.00 22.23  ? 1259 ASN A C     1 
ATOM   5364 O  O     . ASN A 1 389 ? -14.835 15.651  -9.263  1.00 22.32  ? 1259 ASN A O     1 
ATOM   5365 C  CB    . ASN A 1 389 ? -12.739 13.171  -9.947  1.00 19.08  ? 1259 ASN A CB    1 
ATOM   5366 C  CG    . ASN A 1 389 ? -12.965 11.729  -10.406 1.00 17.18  ? 1259 ASN A CG    1 
ATOM   5367 O  OD1   . ASN A 1 389 ? -13.927 11.428  -11.101 1.00 19.71  ? 1259 ASN A OD1   1 
ATOM   5368 N  ND2   . ASN A 1 389 ? -12.087 10.830  -9.978  1.00 17.46  ? 1259 ASN A ND2   1 
ATOM   5369 H  H     . ASN A 1 389 ? -12.236 14.104  -12.157 1.00 17.78  ? 1259 ASN A H     1 
ATOM   5370 H  HA    . ASN A 1 389 ? -14.471 13.798  -10.884 1.00 22.97  ? 1259 ASN A HA    1 
ATOM   5371 H  HB2   . ASN A 1 389 ? -11.800 13.381  -10.075 1.00 22.90  ? 1259 ASN A HB2   1 
ATOM   5372 H  HB3   . ASN A 1 389 ? -12.963 13.223  -9.005  1.00 22.90  ? 1259 ASN A HB3   1 
ATOM   5373 H  HD21  . ASN A 1 389 ? -12.169 10.005  -10.208 1.00 20.95  ? 1259 ASN A HD21  1 
ATOM   5374 H  HD22  . ASN A 1 389 ? -11.435 11.072  -9.472  1.00 20.95  ? 1259 ASN A HD22  1 
ATOM   5375 N  N     . LYS A 1 390 ? -12.744 16.273  -9.781  1.00 21.75  ? 1260 LYS A N     1 
ATOM   5376 C  CA    . LYS A 1 390 ? -12.850 17.531  -9.036  1.00 25.86  ? 1260 LYS A CA    1 
ATOM   5377 C  C     . LYS A 1 390 ? -14.050 18.339  -9.519  1.00 30.86  ? 1260 LYS A C     1 
ATOM   5378 O  O     . LYS A 1 390 ? -14.835 18.855  -8.724  1.00 25.28  ? 1260 LYS A O     1 
ATOM   5379 C  CB    . LYS A 1 390 ? -11.610 18.396  -9.229  1.00 25.67  ? 1260 LYS A CB    1 
ATOM   5380 C  CG    . LYS A 1 390 ? -10.354 17.952  -8.529  1.00 33.31  ? 1260 LYS A CG    1 
ATOM   5381 C  CD    . LYS A 1 390 ? -9.428  19.166  -8.350  1.00 40.43  ? 1260 LYS A CD    1 
ATOM   5382 C  CE    . LYS A 1 390 ? -8.076  18.771  -7.778  1.00 44.76  ? 1260 LYS A CE    1 
ATOM   5383 N  NZ    . LYS A 1 390 ? -7.256  19.970  -7.427  1.00 57.26  ? 1260 LYS A NZ    1 
ATOM   5384 H  H     . LYS A 1 390 ? -11.978 16.138  -10.146 1.00 26.10  ? 1260 LYS A H     1 
ATOM   5385 H  HA    . LYS A 1 390 ? -12.960 17.343  -8.080  1.00 31.03  ? 1260 LYS A HA    1 
ATOM   5386 H  HB2   . LYS A 1 390 ? -11.411 18.431  -10.178 1.00 30.80  ? 1260 LYS A HB2   1 
ATOM   5387 H  HB3   . LYS A 1 390 ? -11.813 19.290  -8.912  1.00 30.80  ? 1260 LYS A HB3   1 
ATOM   5388 H  HG2   . LYS A 1 390 ? -10.575 17.596  -7.654  1.00 39.97  ? 1260 LYS A HG2   1 
ATOM   5389 H  HG3   . LYS A 1 390 ? -9.896  17.287  -9.066  1.00 39.97  ? 1260 LYS A HG3   1 
ATOM   5390 H  HD2   . LYS A 1 390 ? -9.281  19.584  -9.212  1.00 48.51  ? 1260 LYS A HD2   1 
ATOM   5391 H  HD3   . LYS A 1 390 ? -9.843  19.795  -7.739  1.00 48.51  ? 1260 LYS A HD3   1 
ATOM   5392 H  HE2   . LYS A 1 390 ? -8.210  18.248  -6.972  1.00 53.71  ? 1260 LYS A HE2   1 
ATOM   5393 H  HE3   . LYS A 1 390 ? -7.589  18.252  -8.437  1.00 53.71  ? 1260 LYS A HE3   1 
ATOM   5394 H  HZ1   . LYS A 1 390 ? -6.471  19.715  -7.095  1.00 68.71  ? 1260 LYS A HZ1   1 
ATOM   5395 H  HZ2   . LYS A 1 390 ? -7.116  20.466  -8.153  1.00 68.71  ? 1260 LYS A HZ2   1 
ATOM   5396 H  HZ3   . LYS A 1 390 ? -7.682  20.462  -6.819  1.00 68.71  ? 1260 LYS A HZ3   1 
ATOM   5397 N  N     . LEU A 1 391 ? -14.188 18.460  -10.833 1.00 27.65  ? 1261 LEU A N     1 
ATOM   5398 C  CA    . LEU A 1 391 ? -15.256 19.272  -11.389 1.00 27.38  ? 1261 LEU A CA    1 
ATOM   5399 C  C     . LEU A 1 391 ? -16.607 18.667  -11.055 1.00 33.11  ? 1261 LEU A C     1 
ATOM   5400 O  O     . LEU A 1 391 ? -17.591 19.385  -10.894 1.00 29.60  ? 1261 LEU A O     1 
ATOM   5401 C  CB    . LEU A 1 391 ? -15.108 19.390  -12.899 1.00 29.63  ? 1261 LEU A CB    1 
ATOM   5402 C  CG    . LEU A 1 391 ? -15.463 20.752  -13.467 1.00 54.01  ? 1261 LEU A CG    1 
ATOM   5403 C  CD1   . LEU A 1 391 ? -14.448 21.790  -12.994 1.00 55.57  ? 1261 LEU A CD1   1 
ATOM   5404 C  CD2   . LEU A 1 391 ? -15.506 20.659  -14.981 1.00 51.75  ? 1261 LEU A CD2   1 
ATOM   5405 H  H     . LEU A 1 391 ? -13.681 18.085  -11.418 1.00 33.18  ? 1261 LEU A H     1 
ATOM   5406 H  HA    . LEU A 1 391 ? -15.215 20.172  -11.003 1.00 32.85  ? 1261 LEU A HA    1 
ATOM   5407 H  HB2   . LEU A 1 391 ? -14.186 19.205  -13.135 1.00 35.56  ? 1261 LEU A HB2   1 
ATOM   5408 H  HB3   . LEU A 1 391 ? -15.690 18.737  -13.319 1.00 35.56  ? 1261 LEU A HB3   1 
ATOM   5409 H  HG    . LEU A 1 391 ? -16.341 21.015  -13.151 1.00 64.82  ? 1261 LEU A HG    1 
ATOM   5410 H  HD11  . LEU A 1 391 ? -13.574 21.533  -13.296 1.00 66.68  ? 1261 LEU A HD11  1 
ATOM   5411 H  HD12  . LEU A 1 391 ? -14.684 22.646  -13.359 1.00 66.68  ? 1261 LEU A HD12  1 
ATOM   5412 H  HD13  . LEU A 1 391 ? -14.465 21.828  -12.034 1.00 66.68  ? 1261 LEU A HD13  1 
ATOM   5413 H  HD21  . LEU A 1 391 ? -16.171 20.014  -15.234 1.00 62.10  ? 1261 LEU A HD21  1 
ATOM   5414 H  HD22  . LEU A 1 391 ? -15.731 21.520  -15.340 1.00 62.10  ? 1261 LEU A HD22  1 
ATOM   5415 H  HD23  . LEU A 1 391 ? -14.644 20.384  -15.301 1.00 62.10  ? 1261 LEU A HD23  1 
ATOM   5416 N  N     . GLN A 1 392 ? -16.649 17.344  -10.937 1.00 25.60  ? 1262 GLN A N     1 
ATOM   5417 C  CA    . GLN A 1 392 ? -17.899 16.638  -10.675 1.00 26.82  ? 1262 GLN A CA    1 
ATOM   5418 C  C     . GLN A 1 392 ? -18.165 16.394  -9.186  1.00 25.78  ? 1262 GLN A C     1 
ATOM   5419 O  O     . GLN A 1 392 ? -19.151 15.754  -8.837  1.00 34.69  ? 1262 GLN A O     1 
ATOM   5420 C  CB    . GLN A 1 392 ? -17.889 15.297  -11.414 1.00 26.24  ? 1262 GLN A CB    1 
ATOM   5421 C  CG    . GLN A 1 392 ? -17.793 15.466  -12.916 1.00 27.79  ? 1262 GLN A CG    1 
ATOM   5422 C  CD    . GLN A 1 392 ? -18.848 16.426  -13.434 1.00 38.94  ? 1262 GLN A CD    1 
ATOM   5423 O  OE1   . GLN A 1 392 ? -20.018 16.315  -13.085 1.00 37.71  ? 1262 GLN A OE1   1 
ATOM   5424 N  NE2   . GLN A 1 392 ? -18.435 17.386  -14.253 1.00 28.26  ? 1262 GLN A NE2   1 
ATOM   5425 H  H     . GLN A 1 392 ? -15.963 16.829  -11.005 1.00 30.72  ? 1262 GLN A H     1 
ATOM   5426 H  HA    . GLN A 1 392 ? -18.642 17.170  -11.029 1.00 32.18  ? 1262 GLN A HA    1 
ATOM   5427 H  HB2   . GLN A 1 392 ? -17.125 14.778  -11.120 1.00 31.48  ? 1262 GLN A HB2   1 
ATOM   5428 H  HB3   . GLN A 1 392 ? -18.711 14.820  -11.216 1.00 31.48  ? 1262 GLN A HB3   1 
ATOM   5429 H  HG2   . GLN A 1 392 ? -16.920 15.822  -13.143 1.00 33.35  ? 1262 GLN A HG2   1 
ATOM   5430 H  HG3   . GLN A 1 392 ? -17.927 14.606  -13.345 1.00 33.35  ? 1262 GLN A HG3   1 
ATOM   5431 H  HE21  . GLN A 1 392 ? -17.603 17.442  -14.466 1.00 33.92  ? 1262 GLN A HE21  1 
ATOM   5432 H  HE22  . GLN A 1 392 ? -18.998 17.953  -14.571 1.00 33.92  ? 1262 GLN A HE22  1 
ATOM   5433 N  N     . SER A 1 393 ? -17.282 16.886  -8.322  1.00 23.34  ? 1263 SER A N     1 
ATOM   5434 C  CA    . SER A 1 393 ? -17.364 16.614  -6.884  1.00 38.21  ? 1263 SER A CA    1 
ATOM   5435 C  C     . SER A 1 393 ? -17.360 15.117  -6.559  1.00 37.35  ? 1263 SER A C     1 
ATOM   5436 O  O     . SER A 1 393 ? -18.060 14.671  -5.654  1.00 39.19  ? 1263 SER A O     1 
ATOM   5437 C  CB    . SER A 1 393 ? -18.617 17.262  -6.290  1.00 44.67  ? 1263 SER A CB    1 
ATOM   5438 O  OG    . SER A 1 393 ? -18.663 18.636  -6.622  1.00 43.02  ? 1263 SER A OG    1 
ATOM   5439 H  H     . SER A 1 393 ? -16.619 17.386  -8.544  1.00 28.01  ? 1263 SER A H     1 
ATOM   5440 H  HA    . SER A 1 393 ? -16.585 17.015  -6.445  1.00 45.85  ? 1263 SER A HA    1 
ATOM   5441 H  HB2   . SER A 1 393 ? -19.403 16.822  -6.650  1.00 53.61  ? 1263 SER A HB2   1 
ATOM   5442 H  HB3   . SER A 1 393 ? -18.596 17.169  -5.325  1.00 53.61  ? 1263 SER A HB3   1 
ATOM   5443 H  HG    . SER A 1 393 ? -18.009 18.838  -7.073  1.00 51.62  ? 1263 SER A HG    1 
ATOM   5444 N  N     . VAL A 1 394 ? -16.567 14.350  -7.297  1.00 24.58  ? 1264 VAL A N     1 
ATOM   5445 C  CA    . VAL A 1 394 ? -16.438 12.913  -7.071  1.00 23.56  ? 1264 VAL A CA    1 
ATOM   5446 C  C     . VAL A 1 394 ? -15.054 12.629  -6.511  1.00 21.69  ? 1264 VAL A C     1 
ATOM   5447 O  O     . VAL A 1 394 ? -14.062 13.160  -6.995  1.00 21.52  ? 1264 VAL A O     1 
ATOM   5448 C  CB    . VAL A 1 394 ? -16.644 12.132  -8.395  1.00 25.17  ? 1264 VAL A CB    1 
ATOM   5449 C  CG1   . VAL A 1 394 ? -16.247 10.662  -8.238  1.00 24.81  ? 1264 VAL A CG1   1 
ATOM   5450 C  CG2   . VAL A 1 394 ? -18.102 12.274  -8.864  1.00 28.95  ? 1264 VAL A CG2   1 
ATOM   5451 H  H     . VAL A 1 394 ? -16.085 14.642  -7.946  1.00 29.49  ? 1264 VAL A H     1 
ATOM   5452 H  HA    . VAL A 1 394 ? -17.110 12.617  -6.421  1.00 28.27  ? 1264 VAL A HA    1 
ATOM   5453 H  HB    . VAL A 1 394 ? -16.069 12.525  -9.084  1.00 30.21  ? 1264 VAL A HB    1 
ATOM   5454 H  HG11  . VAL A 1 394 ? -15.945 10.515  -7.338  1.00 29.78  ? 1264 VAL A HG11  1 
ATOM   5455 H  HG12  . VAL A 1 394 ? -17.011 10.111  -8.422  1.00 29.78  ? 1264 VAL A HG12  1 
ATOM   5456 H  HG13  . VAL A 1 394 ? -15.541 10.462  -8.857  1.00 29.78  ? 1264 VAL A HG13  1 
ATOM   5457 H  HG21  . VAL A 1 394 ? -18.580 12.819  -8.236  1.00 34.74  ? 1264 VAL A HG21  1 
ATOM   5458 H  HG22  . VAL A 1 394 ? -18.111 12.687  -9.731  1.00 34.74  ? 1264 VAL A HG22  1 
ATOM   5459 H  HG23  . VAL A 1 394 ? -18.500 11.402  -8.912  1.00 34.74  ? 1264 VAL A HG23  1 
ATOM   5460 N  N     . LYS A 1 395 ? -14.974 11.800  -5.482  1.00 18.51  ? 1265 LYS A N     1 
ATOM   5461 C  CA    . LYS A 1 395 ? -13.690 11.550  -4.846  1.00 18.01  ? 1265 LYS A CA    1 
ATOM   5462 C  C     . LYS A 1 395 ? -12.777 10.699  -5.726  1.00 22.20  ? 1265 LYS A C     1 
ATOM   5463 O  O     . LYS A 1 395 ? -13.187 9.643   -6.200  1.00 22.65  ? 1265 LYS A O     1 
ATOM   5464 C  CB    . LYS A 1 395 ? -13.897 10.841  -3.512  1.00 25.06  ? 1265 LYS A CB    1 
ATOM   5465 C  CG    . LYS A 1 395 ? -12.595 10.485  -2.815  1.00 25.78  ? 1265 LYS A CG    1 
ATOM   5466 C  CD    . LYS A 1 395 ? -12.844 9.948   -1.403  1.00 28.93  ? 1265 LYS A CD    1 
ATOM   5467 C  CE    . LYS A 1 395 ? -11.534 9.557   -0.727  1.00 28.89  ? 1265 LYS A CE    1 
ATOM   5468 N  NZ    . LYS A 1 395 ? -11.701 9.138   0.708   1.00 26.28  ? 1265 LYS A NZ    1 
ATOM   5469 H  H     . LYS A 1 395 ? -15.637 11.374  -5.137  1.00 22.21  ? 1265 LYS A H     1 
ATOM   5470 H  HA    . LYS A 1 395 ? -13.243 12.405  -4.674  1.00 21.61  ? 1265 LYS A HA    1 
ATOM   5471 H  HB2   . LYS A 1 395 ? -14.402 11.423  -2.922  1.00 30.07  ? 1265 LYS A HB2   1 
ATOM   5472 H  HB3   . LYS A 1 395 ? -14.388 10.019  -3.666  1.00 30.07  ? 1265 LYS A HB3   1 
ATOM   5473 H  HG2   . LYS A 1 395 ? -12.137 9.799   -3.325  1.00 30.94  ? 1265 LYS A HG2   1 
ATOM   5474 H  HG3   . LYS A 1 395 ? -12.042 11.278  -2.745  1.00 30.94  ? 1265 LYS A HG3   1 
ATOM   5475 H  HD2   . LYS A 1 395 ? -13.271 10.636  -0.868  1.00 34.71  ? 1265 LYS A HD2   1 
ATOM   5476 H  HD3   . LYS A 1 395 ? -13.409 9.161   -1.453  1.00 34.71  ? 1265 LYS A HD3   1 
ATOM   5477 H  HE2   . LYS A 1 395 ? -11.141 8.813   -1.210  1.00 34.67  ? 1265 LYS A HE2   1 
ATOM   5478 H  HE3   . LYS A 1 395 ? -10.932 10.317  -0.747  1.00 34.67  ? 1265 LYS A HE3   1 
ATOM   5479 H  HZ1   . LYS A 1 395 ? -10.911 8.921   1.055   1.00 31.53  ? 1265 LYS A HZ1   1 
ATOM   5480 H  HZ2   . LYS A 1 395 ? -12.051 9.806   1.181   1.00 31.53  ? 1265 LYS A HZ2   1 
ATOM   5481 H  HZ3   . LYS A 1 395 ? -12.242 8.433   0.758   1.00 31.53  ? 1265 LYS A HZ3   1 
ATOM   5482 N  N     . SER A 1 396 ? -11.541 11.151  -5.933  1.00 18.52  ? 1266 SER A N     1 
ATOM   5483 C  CA    . SER A 1 396 ? -10.508 10.314  -6.551  1.00 17.90  ? 1266 SER A CA    1 
ATOM   5484 C  C     . SER A 1 396 ? -9.852  9.465   -5.469  1.00 18.55  ? 1266 SER A C     1 
ATOM   5485 O  O     . SER A 1 396 ? -9.168  10.010  -4.592  1.00 21.10  ? 1266 SER A O     1 
ATOM   5486 C  CB    . SER A 1 396 ? -9.417  11.185  -7.194  1.00 19.50  ? 1266 SER A CB    1 
ATOM   5487 O  OG    . SER A 1 396 ? -9.877  11.866  -8.354  1.00 17.90  ? 1266 SER A OG    1 
ATOM   5488 H  H     . SER A 1 396 ? -11.272 11.941  -5.724  1.00 22.22  ? 1266 SER A H     1 
ATOM   5489 H  HA    . SER A 1 396 ? -10.903 9.729   -7.231  1.00 21.48  ? 1266 SER A HA    1 
ATOM   5490 H  HB2   . SER A 1 396 ? -9.122  11.842  -6.545  1.00 23.41  ? 1266 SER A HB2   1 
ATOM   5491 H  HB3   . SER A 1 396 ? -8.673  10.615  -7.444  1.00 23.41  ? 1266 SER A HB3   1 
ATOM   5492 H  HG    . SER A 1 396 ? -9.272  12.320  -8.671  1.00 21.48  ? 1266 SER A HG    1 
ATOM   5493 N  N     . ILE A 1 397 ? -10.039 8.146   -5.490  1.00 17.83  ? 1267 ILE A N     1 
ATOM   5494 C  CA    . ILE A 1 397 ? -9.470  7.333   -4.403  1.00 19.00  ? 1267 ILE A CA    1 
ATOM   5495 C  C     . ILE A 1 397 ? -7.982  7.058   -4.630  1.00 19.70  ? 1267 ILE A C     1 
ATOM   5496 O  O     . ILE A 1 397 ? -7.294  6.563   -3.731  1.00 21.43  ? 1267 ILE A O     1 
ATOM   5497 C  CB    . ILE A 1 397 ? -10.238 6.005   -4.131  1.00 20.36  ? 1267 ILE A CB    1 
ATOM   5498 C  CG1   . ILE A 1 397 ? -10.246 5.097   -5.358  1.00 18.06  ? 1267 ILE A CG1   1 
ATOM   5499 C  CG2   . ILE A 1 397 ? -11.674 6.300   -3.633  1.00 22.67  ? 1267 ILE A CG2   1 
ATOM   5500 C  CD1   . ILE A 1 397 ? -10.772 3.688   -5.039  1.00 20.42  ? 1267 ILE A CD1   1 
ATOM   5501 H  H     . ILE A 1 397 ? -10.470 7.709   -6.092  1.00 21.40  ? 1267 ILE A H     1 
ATOM   5502 H  HA    . ILE A 1 397 ? -9.533  7.861   -3.580  1.00 22.79  ? 1267 ILE A HA    1 
ATOM   5503 H  HB    . ILE A 1 397 ? -9.771  5.535   -3.421  1.00 24.43  ? 1267 ILE A HB    1 
ATOM   5504 H  HG12  . ILE A 1 397 ? -10.820 5.486   -6.036  1.00 21.68  ? 1267 ILE A HG12  1 
ATOM   5505 H  HG13  . ILE A 1 397 ? -9.341  5.011   -5.695  1.00 21.68  ? 1267 ILE A HG13  1 
ATOM   5506 H  HG21  . ILE A 1 397 ? -12.126 5.469   -3.472  1.00 27.21  ? 1267 ILE A HG21  1 
ATOM   5507 H  HG22  . ILE A 1 397 ? -11.624 6.809   -2.820  1.00 27.21  ? 1267 ILE A HG22  1 
ATOM   5508 H  HG23  . ILE A 1 397 ? -12.140 6.802   -4.305  1.00 27.21  ? 1267 ILE A HG23  1 
ATOM   5509 H  HD11  . ILE A 1 397 ? -11.671 3.757   -4.709  1.00 24.50  ? 1267 ILE A HD11  1 
ATOM   5510 H  HD12  . ILE A 1 397 ? -10.756 3.160   -5.840  1.00 24.50  ? 1267 ILE A HD12  1 
ATOM   5511 H  HD13  . ILE A 1 397 ? -10.208 3.288   -4.372  1.00 24.50  ? 1267 ILE A HD13  1 
ATOM   5512 N  N     . VAL A 1 398 ? -7.485  7.376   -5.824  1.00 17.72  ? 1268 VAL A N     1 
ATOM   5513 C  CA    . VAL A 1 398 ? -6.047  7.473   -6.015  1.00 14.99  ? 1268 VAL A CA    1 
ATOM   5514 C  C     . VAL A 1 398 ? -5.665  8.951   -5.874  1.00 17.97  ? 1268 VAL A C     1 
ATOM   5515 O  O     . VAL A 1 398 ? -6.057  9.782   -6.702  1.00 18.80  ? 1268 VAL A O     1 
ATOM   5516 C  CB    . VAL A 1 398 ? -5.571  6.992   -7.405  1.00 16.07  ? 1268 VAL A CB    1 
ATOM   5517 C  CG1   . VAL A 1 398 ? -4.054  6.972   -7.413  1.00 14.34  ? 1268 VAL A CG1   1 
ATOM   5518 C  CG2   . VAL A 1 398 ? -6.122  5.587   -7.727  1.00 16.34  ? 1268 VAL A CG2   1 
ATOM   5519 H  H     . VAL A 1 398 ? -7.954  7.538   -6.527  1.00 21.26  ? 1268 VAL A H     1 
ATOM   5520 H  HA    . VAL A 1 398 ? -5.582  6.957   -5.323  1.00 17.99  ? 1268 VAL A HA    1 
ATOM   5521 H  HB    . VAL A 1 398 ? -5.880  7.616   -8.094  1.00 19.28  ? 1268 VAL A HB    1 
ATOM   5522 H  HG11  . VAL A 1 398 ? -3.733  7.262   -6.556  1.00 17.20  ? 1268 VAL A HG11  1 
ATOM   5523 H  HG12  . VAL A 1 398 ? -3.754  6.077   -7.589  1.00 17.20  ? 1268 VAL A HG12  1 
ATOM   5524 H  HG13  . VAL A 1 398 ? -3.738  7.565   -8.099  1.00 17.20  ? 1268 VAL A HG13  1 
ATOM   5525 H  HG21  . VAL A 1 398 ? -5.808  5.321   -8.595  1.00 19.61  ? 1268 VAL A HG21  1 
ATOM   5526 H  HG22  . VAL A 1 398 ? -5.811  4.969   -7.062  1.00 19.61  ? 1268 VAL A HG22  1 
ATOM   5527 H  HG23  . VAL A 1 398 ? -7.081  5.620   -7.722  1.00 19.61  ? 1268 VAL A HG23  1 
ATOM   5528 N  N     . PRO A 1 399 ? -4.910  9.281   -4.821  1.00 20.44  ? 1269 PRO A N     1 
ATOM   5529 C  CA    . PRO A 1 399 ? -4.527  10.674  -4.554  1.00 15.97  ? 1269 PRO A CA    1 
ATOM   5530 C  C     . PRO A 1 399 ? -3.389  11.055  -5.486  1.00 14.96  ? 1269 PRO A C     1 
ATOM   5531 O  O     . PRO A 1 399 ? -2.215  10.852  -5.158  1.00 19.01  ? 1269 PRO A O     1 
ATOM   5532 C  CB    . PRO A 1 399 ? -4.082  10.634  -3.093  1.00 15.86  ? 1269 PRO A CB    1 
ATOM   5533 C  CG    . PRO A 1 399 ? -3.526  9.230   -2.911  1.00 21.97  ? 1269 PRO A CG    1 
ATOM   5534 C  CD    . PRO A 1 399 ? -4.303  8.337   -3.863  1.00 23.09  ? 1269 PRO A CD    1 
ATOM   5535 H  HA    . PRO A 1 399 ? -5.286  11.283  -4.667  1.00 19.17  ? 1269 PRO A HA    1 
ATOM   5536 H  HB2   . PRO A 1 399 ? -3.395  11.301  -2.939  1.00 19.03  ? 1269 PRO A HB2   1 
ATOM   5537 H  HB3   . PRO A 1 399 ? -4.845  10.782  -2.512  1.00 19.03  ? 1269 PRO A HB3   1 
ATOM   5538 H  HG2   . PRO A 1 399 ? -2.582  9.225   -3.134  1.00 26.36  ? 1269 PRO A HG2   1 
ATOM   5539 H  HG3   . PRO A 1 399 ? -3.660  8.946   -1.993  1.00 26.36  ? 1269 PRO A HG3   1 
ATOM   5540 H  HD2   . PRO A 1 399 ? -3.701  7.731   -4.323  1.00 27.71  ? 1269 PRO A HD2   1 
ATOM   5541 H  HD3   . PRO A 1 399 ? -4.994  7.854   -3.383  1.00 27.71  ? 1269 PRO A HD3   1 
ATOM   5542 N  N     . MET A 1 400 ? -3.734  11.572  -6.659  1.00 16.68  ? 1270 MET A N     1 
ATOM   5543 C  CA    . MET A 1 400 ? -2.749  11.716  -7.729  1.00 16.42  ? 1270 MET A CA    1 
ATOM   5544 C  C     . MET A 1 400 ? -1.623  12.706  -7.396  1.00 18.49  ? 1270 MET A C     1 
ATOM   5545 O  O     . MET A 1 400 ? -0.533  12.598  -7.943  1.00 16.94  ? 1270 MET A O     1 
ATOM   5546 C  CB    . MET A 1 400 ? -3.417  12.114  -9.052  1.00 16.32  ? 1270 MET A CB    1 
ATOM   5547 C  CG    . MET A 1 400 ? -4.217  10.990  -9.718  1.00 17.21  ? 1270 MET A CG    1 
ATOM   5548 S  SD    . MET A 1 400 ? -3.258  9.476   -9.986  1.00 16.28  ? 1270 MET A SD    1 
ATOM   5549 C  CE    . MET A 1 400 ? -1.926  10.023  -11.045 1.00 19.26  ? 1270 MET A CE    1 
ATOM   5550 H  H     . MET A 1 400 ? -4.524  11.845  -6.861  1.00 20.02  ? 1270 MET A H     1 
ATOM   5551 H  HA    . MET A 1 400 ? -2.339  10.837  -7.873  1.00 19.71  ? 1270 MET A HA    1 
ATOM   5552 H  HB2   . MET A 1 400 ? -4.027  12.850  -8.884  1.00 19.59  ? 1270 MET A HB2   1 
ATOM   5553 H  HB3   . MET A 1 400 ? -2.730  12.395  -9.676  1.00 19.59  ? 1270 MET A HB3   1 
ATOM   5554 H  HG2   . MET A 1 400 ? -4.973  10.766  -9.152  1.00 20.65  ? 1270 MET A HG2   1 
ATOM   5555 H  HG3   . MET A 1 400 ? -4.533  11.299  -10.581 1.00 20.65  ? 1270 MET A HG3   1 
ATOM   5556 H  HE1   . MET A 1 400 ? -1.358  9.275   -11.242 1.00 23.11  ? 1270 MET A HE1   1 
ATOM   5557 H  HE2   . MET A 1 400 ? -2.298  10.376  -11.857 1.00 23.11  ? 1270 MET A HE2   1 
ATOM   5558 H  HE3   . MET A 1 400 ? -1.426  10.704  -10.590 1.00 23.11  ? 1270 MET A HE3   1 
ATOM   5559 N  N     . VAL A 1 401 ? -1.864  13.676  -6.526  1.00 18.32  ? 1271 VAL A N     1 
ATOM   5560 C  CA    . VAL A 1 401 ? -0.770  14.578  -6.165  1.00 18.92  ? 1271 VAL A CA    1 
ATOM   5561 C  C     . VAL A 1 401 ? 0.228   13.839  -5.260  1.00 17.60  ? 1271 VAL A C     1 
ATOM   5562 O  O     . VAL A 1 401 ? 1.413   13.756  -5.570  1.00 17.72  ? 1271 VAL A O     1 
ATOM   5563 C  CB    . VAL A 1 401 ? -1.269  15.889  -5.515  1.00 16.84  ? 1271 VAL A CB    1 
ATOM   5564 C  CG1   . VAL A 1 401 ? -0.079  16.763  -5.091  1.00 17.69  ? 1271 VAL A CG1   1 
ATOM   5565 C  CG2   . VAL A 1 401 ? -2.176  16.651  -6.510  1.00 19.32  ? 1271 VAL A CG2   1 
ATOM   5566 H  H     . VAL A 1 401 ? -2.617  13.833  -6.141  1.00 21.99  ? 1271 VAL A H     1 
ATOM   5567 H  HA    . VAL A 1 401 ? -0.292  14.824  -6.985  1.00 22.71  ? 1271 VAL A HA    1 
ATOM   5568 H  HB    . VAL A 1 401 ? -1.797  15.676  -4.717  1.00 20.21  ? 1271 VAL A HB    1 
ATOM   5569 H  HG11  . VAL A 1 401 ? 0.737   16.312  -5.319  1.00 21.23  ? 1271 VAL A HG11  1 
ATOM   5570 H  HG12  . VAL A 1 401 ? -0.129  17.603  -5.553  1.00 21.23  ? 1271 VAL A HG12  1 
ATOM   5571 H  HG13  . VAL A 1 401 ? -0.120  16.908  -4.143  1.00 21.23  ? 1271 VAL A HG13  1 
ATOM   5572 H  HG21  . VAL A 1 401 ? -2.237  16.147  -7.325  1.00 23.18  ? 1271 VAL A HG21  1 
ATOM   5573 H  HG22  . VAL A 1 401 ? -3.047  16.754  -6.121  1.00 23.18  ? 1271 VAL A HG22  1 
ATOM   5574 H  HG23  . VAL A 1 401 ? -1.791  17.513  -6.686  1.00 23.18  ? 1271 VAL A HG23  1 
ATOM   5575 N  N     . HIS A 1 402 ? -0.266  13.304  -4.153  1.00 17.01  ? 1272 HIS A N     1 
ATOM   5576 C  CA    . HIS A 1 402 ? 0.522   12.471  -3.245  1.00 17.52  ? 1272 HIS A CA    1 
ATOM   5577 C  C     . HIS A 1 402 ? 1.327   11.438  -4.039  1.00 21.66  ? 1272 HIS A C     1 
ATOM   5578 O  O     . HIS A 1 402 ? 2.541   11.306  -3.862  1.00 19.37  ? 1272 HIS A O     1 
ATOM   5579 C  CB    . HIS A 1 402 ? -0.434  11.779  -2.271  1.00 20.00  ? 1272 HIS A CB    1 
ATOM   5580 C  CG    . HIS A 1 402 ? 0.209   10.757  -1.381  1.00 30.93  ? 1272 HIS A CG    1 
ATOM   5581 N  ND1   . HIS A 1 402 ? 0.720   11.067  -0.139  1.00 37.11  ? 1272 HIS A ND1   1 
ATOM   5582 C  CD2   . HIS A 1 402 ? 0.382   9.420   -1.535  1.00 23.17  ? 1272 HIS A CD2   1 
ATOM   5583 C  CE1   . HIS A 1 402 ? 1.199   9.973   0.426   1.00 35.34  ? 1272 HIS A CE1   1 
ATOM   5584 N  NE2   . HIS A 1 402 ? 1.005   8.960   -0.397  1.00 26.52  ? 1272 HIS A NE2   1 
ATOM   5585 H  H     . HIS A 1 402 ? -1.080  13.411  -3.896  1.00 20.41  ? 1272 HIS A H     1 
ATOM   5586 H  HA    . HIS A 1 402 ? 1.143   13.031  -2.734  1.00 21.02  ? 1272 HIS A HA    1 
ATOM   5587 H  HB2   . HIS A 1 402 ? -0.837  12.453  -1.701  1.00 24.00  ? 1272 HIS A HB2   1 
ATOM   5588 H  HB3   . HIS A 1 402 ? -1.125  11.330  -2.782  1.00 24.00  ? 1272 HIS A HB3   1 
ATOM   5589 H  HD1   . HIS A 1 402 ? 0.733   11.852  0.210   1.00 44.54  ? 1272 HIS A HD1   1 
ATOM   5590 H  HD2   . HIS A 1 402 ? 0.132   8.912   -2.273  1.00 27.80  ? 1272 HIS A HD2   1 
ATOM   5591 H  HE1   . HIS A 1 402 ? 1.603   9.925   1.262   1.00 42.40  ? 1272 HIS A HE1   1 
ATOM   5592 H  HE2   . HIS A 1 402 ? 1.235   8.144   -0.249  1.00 31.82  ? 1272 HIS A HE2   1 
ATOM   5593 N  N     . LEU A 1 403 ? 0.652   10.737  -4.943  1.00 18.79  ? 1273 LEU A N     1 
ATOM   5594 C  CA    . LEU A 1 403 ? 1.295   9.692   -5.748  1.00 15.91  ? 1273 LEU A CA    1 
ATOM   5595 C  C     . LEU A 1 403 ? 2.390   10.240  -6.656  1.00 15.71  ? 1273 LEU A C     1 
ATOM   5596 O  O     . LEU A 1 403 ? 3.449   9.629   -6.792  1.00 16.56  ? 1273 LEU A O     1 
ATOM   5597 C  CB    . LEU A 1 403 ? 0.252   8.931   -6.577  1.00 17.23  ? 1273 LEU A CB    1 
ATOM   5598 C  CG    . LEU A 1 403 ? 0.818   7.951   -7.617  1.00 17.06  ? 1273 LEU A CG    1 
ATOM   5599 C  CD1   . LEU A 1 403 ? 1.689   6.894   -6.937  1.00 16.86  ? 1273 LEU A CD1   1 
ATOM   5600 C  CD2   . LEU A 1 403 ? -0.326  7.282   -8.405  1.00 19.55  ? 1273 LEU A CD2   1 
ATOM   5601 H  H     . LEU A 1 403 ? -0.184  10.845  -5.114  1.00 22.54  ? 1273 LEU A H     1 
ATOM   5602 H  HA    . LEU A 1 403 ? 1.713   9.047   -5.139  1.00 19.10  ? 1273 LEU A HA    1 
ATOM   5603 H  HB2   . LEU A 1 403 ? -0.308  8.421   -5.972  1.00 20.68  ? 1273 LEU A HB2   1 
ATOM   5604 H  HB3   . LEU A 1 403 ? -0.292  9.578   -7.053  1.00 20.68  ? 1273 LEU A HB3   1 
ATOM   5605 H  HG    . LEU A 1 403 ? 1.372   8.439   -8.246  1.00 20.47  ? 1273 LEU A HG    1 
ATOM   5606 H  HD11  . LEU A 1 403 ? 1.155   6.409   -6.304  1.00 20.24  ? 1273 LEU A HD11  1 
ATOM   5607 H  HD12  . LEU A 1 403 ? 2.031   6.294   -7.604  1.00 20.24  ? 1273 LEU A HD12  1 
ATOM   5608 H  HD13  . LEU A 1 403 ? 2.416   7.331   -6.487  1.00 20.24  ? 1273 LEU A HD13  1 
ATOM   5609 H  HD21  . LEU A 1 403 ? -0.835  7.961   -8.854  1.00 23.46  ? 1273 LEU A HD21  1 
ATOM   5610 H  HD22  . LEU A 1 403 ? 0.049   6.675   -9.047  1.00 23.46  ? 1273 LEU A HD22  1 
ATOM   5611 H  HD23  . LEU A 1 403 ? -0.889  6.803   -7.792  1.00 23.46  ? 1273 LEU A HD23  1 
ATOM   5612 N  N     . SER A 1 404 ? 2.150   11.395  -7.269  1.00 17.08  ? 1274 SER A N     1 
ATOM   5613 C  CA    . SER A 1 404 ? 3.107   11.936  -8.225  1.00 19.27  ? 1274 SER A CA    1 
ATOM   5614 C  C     . SER A 1 404 ? 4.408   12.284  -7.513  1.00 21.69  ? 1274 SER A C     1 
ATOM   5615 O  O     . SER A 1 404 ? 5.499   12.055  -8.048  1.00 18.57  ? 1274 SER A O     1 
ATOM   5616 C  CB    . SER A 1 404 ? 2.528   13.162  -8.945  1.00 18.30  ? 1274 SER A CB    1 
ATOM   5617 O  OG    . SER A 1 404 ? 1.471   12.771  -9.805  1.00 18.78  ? 1274 SER A OG    1 
ATOM   5618 H  H     . SER A 1 404 ? 1.449   11.878  -7.150  1.00 20.49  ? 1274 SER A H     1 
ATOM   5619 H  HA    . SER A 1 404 ? 3.304   11.254  -8.900  1.00 23.12  ? 1274 SER A HA    1 
ATOM   5620 H  HB2   . SER A 1 404 ? 2.187   13.786  -8.285  1.00 21.95  ? 1274 SER A HB2   1 
ATOM   5621 H  HB3   . SER A 1 404 ? 3.227   13.581  -9.470  1.00 21.95  ? 1274 SER A HB3   1 
ATOM   5622 H  HG    . SER A 1 404 ? 1.164   13.428  -10.188 1.00 22.54  ? 1274 SER A HG    1 
ATOM   5623 N  N     . TRP A 1 405 ? 4.288   12.831  -6.305  1.00 17.80  ? 1275 TRP A N     1 
ATOM   5624 C  CA    . TRP A 1 405 ? 5.463   13.167  -5.512  1.00 18.84  ? 1275 TRP A CA    1 
ATOM   5625 C  C     . TRP A 1 405 ? 6.242   11.907  -5.112  1.00 19.44  ? 1275 TRP A C     1 
ATOM   5626 O  O     . TRP A 1 405 ? 7.471   11.916  -5.156  1.00 20.10  ? 1275 TRP A O     1 
ATOM   5627 C  CB    . TRP A 1 405 ? 5.096   14.048  -4.304  1.00 18.86  ? 1275 TRP A CB    1 
ATOM   5628 C  CG    . TRP A 1 405 ? 4.831   15.472  -4.740  1.00 17.48  ? 1275 TRP A CG    1 
ATOM   5629 C  CD1   . TRP A 1 405 ? 3.627   16.015  -5.093  1.00 21.72  ? 1275 TRP A CD1   1 
ATOM   5630 C  CD2   . TRP A 1 405 ? 5.805   16.520  -4.903  1.00 18.40  ? 1275 TRP A CD2   1 
ATOM   5631 N  NE1   . TRP A 1 405 ? 3.790   17.337  -5.471  1.00 18.72  ? 1275 TRP A NE1   1 
ATOM   5632 C  CE2   . TRP A 1 405 ? 5.117   17.667  -5.360  1.00 19.56  ? 1275 TRP A CE2   1 
ATOM   5633 C  CE3   . TRP A 1 405 ? 7.190   16.595  -4.709  1.00 21.94  ? 1275 TRP A CE3   1 
ATOM   5634 C  CZ2   . TRP A 1 405 ? 5.765   18.880  -5.616  1.00 21.14  ? 1275 TRP A CZ2   1 
ATOM   5635 C  CZ3   . TRP A 1 405 ? 7.836   17.802  -4.969  1.00 23.77  ? 1275 TRP A CZ3   1 
ATOM   5636 C  CH2   . TRP A 1 405 ? 7.120   18.927  -5.412  1.00 25.27  ? 1275 TRP A CH2   1 
ATOM   5637 H  H     . TRP A 1 405 ? 3.539   13.016  -5.925  1.00 21.36  ? 1275 TRP A H     1 
ATOM   5638 H  HA    . TRP A 1 405 ? 6.061   13.700  -6.077  1.00 22.61  ? 1275 TRP A HA    1 
ATOM   5639 H  HB2   . TRP A 1 405 ? 4.292   13.701  -3.885  1.00 22.63  ? 1275 TRP A HB2   1 
ATOM   5640 H  HB3   . TRP A 1 405 ? 5.832   14.053  -3.672  1.00 22.63  ? 1275 TRP A HB3   1 
ATOM   5641 H  HD1   . TRP A 1 405 ? 2.818   15.558  -5.094  1.00 26.07  ? 1275 TRP A HD1   1 
ATOM   5642 H  HE1   . TRP A 1 405 ? 3.161   17.867  -5.723  1.00 22.47  ? 1275 TRP A HE1   1 
ATOM   5643 H  HE3   . TRP A 1 405 ? 7.670   15.853  -4.417  1.00 26.33  ? 1275 TRP A HE3   1 
ATOM   5644 H  HZ2   . TRP A 1 405 ? 5.294   19.627  -5.908  1.00 25.37  ? 1275 TRP A HZ2   1 
ATOM   5645 H  HZ3   . TRP A 1 405 ? 8.755   17.866  -4.842  1.00 28.52  ? 1275 TRP A HZ3   1 
ATOM   5646 H  HH2   . TRP A 1 405 ? 7.576   19.721  -5.576  1.00 30.33  ? 1275 TRP A HH2   1 
ATOM   5647 N  N     . ASN A 1 406 ? 5.544   10.827  -4.750  1.00 21.00  ? 1276 ASN A N     1 
ATOM   5648 C  CA    . ASN A 1 406 ? 6.223   9.549   -4.477  1.00 21.18  ? 1276 ASN A CA    1 
ATOM   5649 C  C     . ASN A 1 406 ? 6.903   8.968   -5.707  1.00 23.44  ? 1276 ASN A C     1 
ATOM   5650 O  O     . ASN A 1 406 ? 8.016   8.442   -5.619  1.00 20.54  ? 1276 ASN A O     1 
ATOM   5651 C  CB    . ASN A 1 406 ? 5.254   8.504   -3.898  1.00 16.84  ? 1276 ASN A CB    1 
ATOM   5652 C  CG    . ASN A 1 406 ? 5.064   8.661   -2.404  1.00 27.90  ? 1276 ASN A CG    1 
ATOM   5653 O  OD1   . ASN A 1 406 ? 5.834   9.357   -1.741  1.00 26.75  ? 1276 ASN A OD1   1 
ATOM   5654 N  ND2   . ASN A 1 406 ? 4.044   8.007   -1.865  1.00 24.11  ? 1276 ASN A ND2   1 
ATOM   5655 H  H     . ASN A 1 406 ? 4.689   10.804  -4.656  1.00 25.20  ? 1276 ASN A H     1 
ATOM   5656 H  HA    . ASN A 1 406 ? 6.918   9.707   -3.805  1.00 25.42  ? 1276 ASN A HA    1 
ATOM   5657 H  HB2   . ASN A 1 406 ? 4.388   8.603   -4.324  1.00 20.20  ? 1276 ASN A HB2   1 
ATOM   5658 H  HB3   . ASN A 1 406 ? 5.607   7.616   -4.065  1.00 20.20  ? 1276 ASN A HB3   1 
ATOM   5659 H  HD21  . ASN A 1 406 ? 3.895   8.064   -1.020  1.00 28.94  ? 1276 ASN A HD21  1 
ATOM   5660 H  HD22  . ASN A 1 406 ? 3.532   7.526   -2.361  1.00 28.94  ? 1276 ASN A HD22  1 
ATOM   5661 N  N     . MET A 1 407 ? 6.230   9.044   -6.853  1.00 18.21  ? 1277 MET A N     1 
ATOM   5662 C  CA    . MET A 1 407 ? 6.844   8.641   -8.110  1.00 18.30  ? 1277 MET A CA    1 
ATOM   5663 C  C     . MET A 1 407 ? 8.130   9.417   -8.314  1.00 21.75  ? 1277 MET A C     1 
ATOM   5664 O  O     . MET A 1 407 ? 9.132   8.851   -8.722  1.00 21.60  ? 1277 MET A O     1 
ATOM   5665 C  CB    . MET A 1 407 ? 5.898   8.883   -9.300  1.00 16.93  ? 1277 MET A CB    1 
ATOM   5666 C  CG    . MET A 1 407 ? 4.700   7.940   -9.317  1.00 20.11  ? 1277 MET A CG    1 
ATOM   5667 S  SD    . MET A 1 407 ? 3.392   8.445   -10.452 1.00 21.30  ? 1277 MET A SD    1 
ATOM   5668 C  CE    . MET A 1 407 ? 4.284   8.499   -12.009 1.00 16.93  ? 1277 MET A CE    1 
ATOM   5669 H  H     . MET A 1 407 ? 5.420   9.325   -6.927  1.00 21.85  ? 1277 MET A H     1 
ATOM   5670 H  HA    . MET A 1 407 ? 7.049   7.683   -8.074  1.00 21.96  ? 1277 MET A HA    1 
ATOM   5671 H  HB2   . MET A 1 407 ? 5.561   9.792   -9.255  1.00 20.32  ? 1277 MET A HB2   1 
ATOM   5672 H  HB3   . MET A 1 407 ? 6.391   8.754   -10.126 1.00 20.32  ? 1277 MET A HB3   1 
ATOM   5673 H  HG2   . MET A 1 407 ? 5.001   7.058   -9.586  1.00 24.13  ? 1277 MET A HG2   1 
ATOM   5674 H  HG3   . MET A 1 407 ? 4.320   7.901   -8.426  1.00 24.13  ? 1277 MET A HG3   1 
ATOM   5675 H  HE1   . MET A 1 407 ? 4.998   9.136   -11.938 1.00 20.32  ? 1277 MET A HE1   1 
ATOM   5676 H  HE2   . MET A 1 407 ? 4.639   7.627   -12.196 1.00 20.32  ? 1277 MET A HE2   1 
ATOM   5677 H  HE3   . MET A 1 407 ? 3.678   8.762   -12.707 1.00 20.32  ? 1277 MET A HE3   1 
ATOM   5678 N  N     . ALA A 1 408 ? 8.105   10.714  -8.018  1.00 17.59  ? 1278 ALA A N     1 
ATOM   5679 C  CA    . ALA A 1 408 ? 9.286   11.548  -8.210  1.00 22.88  ? 1278 ALA A CA    1 
ATOM   5680 C  C     . ALA A 1 408 ? 10.398  11.141  -7.243  1.00 25.62  ? 1278 ALA A C     1 
ATOM   5681 O  O     . ALA A 1 408 ? 11.572  11.251  -7.573  1.00 23.48  ? 1278 ALA A O     1 
ATOM   5682 C  CB    . ALA A 1 408 ? 8.943   13.022  -8.043  1.00 22.56  ? 1278 ALA A CB    1 
ATOM   5683 H  H     . ALA A 1 408 ? 7.421   11.132  -7.707  1.00 21.11  ? 1278 ALA A H     1 
ATOM   5684 H  HA    . ALA A 1 408 ? 9.619   11.419  -9.122  1.00 27.45  ? 1278 ALA A HA    1 
ATOM   5685 H  HB1   . ALA A 1 408 ? 8.280   13.263  -8.695  1.00 27.08  ? 1278 ALA A HB1   1 
ATOM   5686 H  HB2   . ALA A 1 408 ? 8.599   13.164  -7.158  1.00 27.08  ? 1278 ALA A HB2   1 
ATOM   5687 H  HB3   . ALA A 1 408 ? 9.737   13.544  -8.175  1.00 27.08  ? 1278 ALA A HB3   1 
ATOM   5688 N  N     A ARG A 1 409 ? 10.030  10.672  -6.055  0.56 24.90  ? 1279 ARG A N     1 
ATOM   5689 N  N     B ARG A 1 409 ? 10.017  10.661  -6.062  0.44 25.50  ? 1279 ARG A N     1 
ATOM   5690 C  CA    A ARG A 1 409 ? 11.028  10.213  -5.093  0.56 26.49  ? 1279 ARG A CA    1 
ATOM   5691 C  CA    B ARG A 1 409 ? 10.991  10.218  -5.068  0.44 26.93  ? 1279 ARG A CA    1 
ATOM   5692 C  C     A ARG A 1 409 ? 11.651  8.896   -5.533  0.56 31.08  ? 1279 ARG A C     1 
ATOM   5693 C  C     B ARG A 1 409 ? 11.616  8.876   -5.447  0.44 31.17  ? 1279 ARG A C     1 
ATOM   5694 O  O     A ARG A 1 409 ? 12.861  8.698   -5.406  0.56 31.34  ? 1279 ARG A O     1 
ATOM   5695 O  O     B ARG A 1 409 ? 12.802  8.646   -5.200  0.44 28.03  ? 1279 ARG A O     1 
ATOM   5696 C  CB    A ARG A 1 409 ? 10.402  10.010  -3.713  0.56 24.86  ? 1279 ARG A CB    1 
ATOM   5697 C  CB    B ARG A 1 409 ? 10.337  10.088  -3.686  0.44 26.28  ? 1279 ARG A CB    1 
ATOM   5698 C  CG    A ARG A 1 409 ? 10.018  11.276  -2.998  0.56 28.62  ? 1279 ARG A CG    1 
ATOM   5699 C  CG    B ARG A 1 409 ? 9.812   11.391  -3.113  0.44 28.92  ? 1279 ARG A CG    1 
ATOM   5700 C  CD    A ARG A 1 409 ? 9.475   10.964  -1.608  0.56 32.01  ? 1279 ARG A CD    1 
ATOM   5701 C  CD    B ARG A 1 409 ? 9.373   11.242  -1.655  0.44 33.57  ? 1279 ARG A CD    1 
ATOM   5702 N  NE    A ARG A 1 409 ? 8.792   12.117  -1.032  0.56 31.02  ? 1279 ARG A NE    1 
ATOM   5703 N  NE    B ARG A 1 409 ? 8.903   12.515  -1.106  0.44 31.19  ? 1279 ARG A NE    1 
ATOM   5704 C  CZ    A ARG A 1 409 ? 9.378   13.042  -0.281  0.56 26.99  ? 1279 ARG A CZ    1 
ATOM   5705 C  CZ    B ARG A 1 409 ? 7.627   12.877  -1.022  0.44 32.05  ? 1279 ARG A CZ    1 
ATOM   5706 N  NH1   A ARG A 1 409 ? 10.673  12.959  0.007   0.56 26.70  ? 1279 ARG A NH1   1 
ATOM   5707 N  NH1   B ARG A 1 409 ? 6.662   12.060  -1.426  0.44 17.06  ? 1279 ARG A NH1   1 
ATOM   5708 N  NH2   A ARG A 1 409 ? 8.658   14.054  0.185   0.56 26.45  ? 1279 ARG A NH2   1 
ATOM   5709 N  NH2   B ARG A 1 409 ? 7.312   14.060  -0.516  0.44 37.00  ? 1279 ARG A NH2   1 
ATOM   5710 H  H     A ARG A 1 409 ? 9.217   10.609  -5.783  0.56 29.88  ? 1279 ARG A H     1 
ATOM   5711 H  H     B ARG A 1 409 ? 9.199   10.583  -5.810  0.44 30.60  ? 1279 ARG A H     1 
ATOM   5712 H  HA    A ARG A 1 409 ? 11.739  10.883  -5.016  0.56 31.79  ? 1279 ARG A HA    1 
ATOM   5713 H  HA    B ARG A 1 409 ? 11.710  10.881  -5.004  0.44 32.32  ? 1279 ARG A HA    1 
ATOM   5714 H  HB2   A ARG A 1 409 ? 9.599   9.475   -3.814  0.56 29.83  ? 1279 ARG A HB2   1 
ATOM   5715 H  HB2   B ARG A 1 409 ? 9.590   9.474   -3.753  0.44 31.54  ? 1279 ARG A HB2   1 
ATOM   5716 H  HB3   A ARG A 1 409 ? 11.038  9.538   -3.152  0.56 29.83  ? 1279 ARG A HB3   1 
ATOM   5717 H  HB3   B ARG A 1 409 ? 10.993  9.737   -3.064  0.44 31.54  ? 1279 ARG A HB3   1 
ATOM   5718 H  HG2   A ARG A 1 409 ? 10.799  11.843  -2.902  0.56 34.35  ? 1279 ARG A HG2   1 
ATOM   5719 H  HG2   B ARG A 1 409 ? 10.512  12.061  -3.151  0.44 34.70  ? 1279 ARG A HG2   1 
ATOM   5720 H  HG3   A ARG A 1 409 ? 9.327   11.735  -3.501  0.56 34.35  ? 1279 ARG A HG3   1 
ATOM   5721 H  HG3   B ARG A 1 409 ? 9.044   11.680  -3.631  0.44 34.70  ? 1279 ARG A HG3   1 
ATOM   5722 H  HD2   A ARG A 1 409 ? 8.840   10.233  -1.668  0.56 38.41  ? 1279 ARG A HD2   1 
ATOM   5723 H  HD2   B ARG A 1 409 ? 8.646   10.601  -1.602  0.44 40.29  ? 1279 ARG A HD2   1 
ATOM   5724 H  HD3   A ARG A 1 409 ? 10.211  10.723  -1.023  0.56 38.41  ? 1279 ARG A HD3   1 
ATOM   5725 H  HD3   B ARG A 1 409 ? 10.125  10.940  -1.122  0.44 40.29  ? 1279 ARG A HD3   1 
ATOM   5726 H  HE    A ARG A 1 409 ? 7.952   12.204  -1.190  0.56 37.22  ? 1279 ARG A HE    1 
ATOM   5727 H  HE    B ARG A 1 409 ? 9.496   13.068  -0.818  0.44 37.43  ? 1279 ARG A HE    1 
ATOM   5728 H  HH11  A ARG A 1 409 ? 11.140  12.304  -0.297  0.56 32.04  ? 1279 ARG A HH11  1 
ATOM   5729 H  HH11  B ARG A 1 409 ? 6.860   11.291  -1.757  0.44 20.47  ? 1279 ARG A HH11  1 
ATOM   5730 H  HH12  A ARG A 1 409 ? 11.045  13.562  0.495   0.56 32.04  ? 1279 ARG A HH12  1 
ATOM   5731 H  HH12  B ARG A 1 409 ? 5.839   12.302  -1.364  0.44 20.47  ? 1279 ARG A HH12  1 
ATOM   5732 H  HH21  A ARG A 1 409 ? 7.820   14.106  0.001   0.56 31.73  ? 1279 ARG A HH21  1 
ATOM   5733 H  HH21  B ARG A 1 409 ? 7.932   14.592  -0.248  0.44 44.40  ? 1279 ARG A HH21  1 
ATOM   5734 H  HH22  A ARG A 1 409 ? 9.029   14.656  0.675   0.56 31.73  ? 1279 ARG A HH22  1 
ATOM   5735 H  HH22  B ARG A 1 409 ? 6.487   14.295  -0.453  0.44 44.40  ? 1279 ARG A HH22  1 
ATOM   5736 N  N     . ASN A 1 410 ? 10.815  8.002   -6.053  1.00 25.66  ? 1280 ASN A N     1 
ATOM   5737 C  CA    . ASN A 1 410 ? 11.186  6.591   -6.222  1.00 31.10  ? 1280 ASN A CA    1 
ATOM   5738 C  C     . ASN A 1 410 ? 11.607  6.111   -7.609  1.00 30.58  ? 1280 ASN A C     1 
ATOM   5739 O  O     . ASN A 1 410 ? 12.273  5.083   -7.721  1.00 26.35  ? 1280 ASN A O     1 
ATOM   5740 C  CB    . ASN A 1 410 ? 10.008  5.702   -5.789  1.00 28.79  ? 1280 ASN A CB    1 
ATOM   5741 C  CG    . ASN A 1 410 ? 9.566   5.966   -4.362  1.00 33.96  ? 1280 ASN A CG    1 
ATOM   5742 O  OD1   . ASN A 1 410 ? 10.325  6.506   -3.563  1.00 31.19  ? 1280 ASN A OD1   1 
ATOM   5743 N  ND2   . ASN A 1 410 ? 8.335   5.571   -4.031  1.00 33.57  ? 1280 ASN A ND2   1 
ATOM   5744 H  H     A ASN A 1 410 ? 10.019  8.185   -6.320  0.50 30.79  ? 1280 ASN A H     1 
ATOM   5745 H  H     B ASN A 1 410 ? 10.045  8.200   -6.379  0.50 30.79  ? 1280 ASN A H     1 
ATOM   5746 H  HA    . ASN A 1 410 ? 11.932  6.400   -5.615  1.00 37.32  ? 1280 ASN A HA    1 
ATOM   5747 H  HB2   . ASN A 1 410 ? 9.253   5.873   -6.373  1.00 34.55  ? 1280 ASN A HB2   1 
ATOM   5748 H  HB3   . ASN A 1 410 ? 10.274  4.772   -5.854  1.00 34.55  ? 1280 ASN A HB3   1 
ATOM   5749 H  HD21  . ASN A 1 410 ? 7.834   5.188   -4.617  1.00 40.28  ? 1280 ASN A HD21  1 
ATOM   5750 H  HD22  . ASN A 1 410 ? 8.042   5.700   -3.233  1.00 40.28  ? 1280 ASN A HD22  1 
ATOM   5751 N  N     . ILE A 1 411 ? 11.203  6.813   -8.662  1.00 22.02  ? 1281 ILE A N     1 
ATOM   5752 C  CA    . ILE A 1 411 ? 11.259  6.227   -10.000 1.00 19.79  ? 1281 ILE A CA    1 
ATOM   5753 C  C     . ILE A 1 411 ? 12.109  7.064   -10.921 1.00 27.89  ? 1281 ILE A C     1 
ATOM   5754 O  O     . ILE A 1 411 ? 11.917  8.270   -11.028 1.00 23.73  ? 1281 ILE A O     1 
ATOM   5755 C  CB    . ILE A 1 411 ? 9.857   6.114   -10.611 1.00 22.89  ? 1281 ILE A CB    1 
ATOM   5756 C  CG1   . ILE A 1 411 ? 8.940   5.332   -9.673  1.00 22.98  ? 1281 ILE A CG1   1 
ATOM   5757 C  CG2   . ILE A 1 411 ? 9.914   5.442   -12.001 1.00 23.16  ? 1281 ILE A CG2   1 
ATOM   5758 C  CD1   . ILE A 1 411 ? 7.504   5.205   -10.202 1.00 22.18  ? 1281 ILE A CD1   1 
ATOM   5759 H  H     . ILE A 1 411 ? 10.897  7.617   -8.633  1.00 26.42  ? 1281 ILE A H     1 
ATOM   5760 H  HA    . ILE A 1 411 ? 11.648  5.330   -9.947  1.00 23.75  ? 1281 ILE A HA    1 
ATOM   5761 H  HB    . ILE A 1 411 ? 9.497   7.008   -10.718 1.00 27.47  ? 1281 ILE A HB    1 
ATOM   5762 H  HG12  . ILE A 1 411 ? 9.296   4.437   -9.558  1.00 27.57  ? 1281 ILE A HG12  1 
ATOM   5763 H  HG13  . ILE A 1 411 ? 8.903   5.786   -8.817  1.00 27.57  ? 1281 ILE A HG13  1 
ATOM   5764 H  HG21  . ILE A 1 411 ? 10.287  4.562   -11.908 1.00 27.79  ? 1281 ILE A HG21  1 
ATOM   5765 H  HG22  . ILE A 1 411 ? 9.025   5.385   -12.357 1.00 27.79  ? 1281 ILE A HG22  1 
ATOM   5766 H  HG23  . ILE A 1 411 ? 10.467  5.971   -12.581 1.00 27.79  ? 1281 ILE A HG23  1 
ATOM   5767 H  HD11  . ILE A 1 411 ? 6.981   4.706   -9.570  1.00 26.62  ? 1281 ILE A HD11  1 
ATOM   5768 H  HD12  . ILE A 1 411 ? 7.133   6.083   -10.313 1.00 26.62  ? 1281 ILE A HD12  1 
ATOM   5769 H  HD13  . ILE A 1 411 ? 7.521   4.748   -11.046 1.00 26.62  ? 1281 ILE A HD13  1 
ATOM   5770 N  N     . LYS A 1 412 ? 13.054  6.423   -11.591 1.00 25.40  ? 1282 LYS A N     1 
ATOM   5771 C  CA    . LYS A 1 412 ? 13.830  7.121   -12.602 1.00 27.74  ? 1282 LYS A CA    1 
ATOM   5772 C  C     . LYS A 1 412 ? 13.123  6.955   -13.942 1.00 29.71  ? 1282 LYS A C     1 
ATOM   5773 O  O     . LYS A 1 412 ? 12.983  5.848   -14.463 1.00 29.68  ? 1282 LYS A O     1 
ATOM   5774 C  CB    . LYS A 1 412 ? 15.275  6.627   -12.595 1.00 31.78  ? 1282 LYS A CB    1 
ATOM   5775 C  CG    . LYS A 1 412 ? 15.957  6.988   -11.278 1.00 41.28  ? 1282 LYS A CG    1 
ATOM   5776 C  CD    . LYS A 1 412 ? 17.425  6.625   -11.221 1.00 59.13  ? 1282 LYS A CD    1 
ATOM   5777 C  CE    . LYS A 1 412 ? 18.068  7.181   -9.951  1.00 63.90  ? 1282 LYS A CE    1 
ATOM   5778 N  NZ    . LYS A 1 412 ? 17.969  8.669   -9.854  1.00 64.62  ? 1282 LYS A NZ    1 
ATOM   5779 H  H     . LYS A 1 412 ? 13.264  5.596   -11.482 1.00 30.48  ? 1282 LYS A H     1 
ATOM   5780 H  HA    . LYS A 1 412 ? 13.842  8.077   -12.387 1.00 33.29  ? 1282 LYS A HA    1 
ATOM   5781 H  HB2   . LYS A 1 412 ? 15.287  5.662   -12.693 1.00 38.13  ? 1282 LYS A HB2   1 
ATOM   5782 H  HB3   . LYS A 1 412 ? 15.764  7.047   -13.319 1.00 38.13  ? 1282 LYS A HB3   1 
ATOM   5783 H  HG2   . LYS A 1 412 ? 15.884  7.945   -11.141 1.00 49.54  ? 1282 LYS A HG2   1 
ATOM   5784 H  HG3   . LYS A 1 412 ? 15.509  6.519   -10.556 1.00 49.54  ? 1282 LYS A HG3   1 
ATOM   5785 H  HD2   . LYS A 1 412 ? 17.519  5.659   -11.215 1.00 70.95  ? 1282 LYS A HD2   1 
ATOM   5786 H  HD3   . LYS A 1 412 ? 17.881  7.005   -11.988 1.00 70.95  ? 1282 LYS A HD3   1 
ATOM   5787 H  HE2   . LYS A 1 412 ? 17.622  6.800   -9.179  1.00 76.68  ? 1282 LYS A HE2   1 
ATOM   5788 H  HE3   . LYS A 1 412 ? 19.008  6.942   -9.943  1.00 76.68  ? 1282 LYS A HE3   1 
ATOM   5789 H  HZ1   . LYS A 1 412 ? 18.354  8.951   -9.102  1.00 77.54  ? 1282 LYS A HZ1   1 
ATOM   5790 H  HZ2   . LYS A 1 412 ? 18.378  9.047   -10.548 1.00 77.54  ? 1282 LYS A HZ2   1 
ATOM   5791 H  HZ3   . LYS A 1 412 ? 17.115  8.917   -9.851  1.00 77.54  ? 1282 LYS A HZ3   1 
ATOM   5792 N  N     . VAL A 1 413 ? 12.623  8.073   -14.462 1.00 24.12  ? 1283 VAL A N     1 
ATOM   5793 C  CA    . VAL A 1 413 ? 11.746  8.069   -15.624 1.00 27.69  ? 1283 VAL A CA    1 
ATOM   5794 C  C     . VAL A 1 413 ? 12.552  8.438   -16.856 1.00 25.69  ? 1283 VAL A C     1 
ATOM   5795 O  O     . VAL A 1 413 ? 13.134  9.521   -16.916 1.00 23.70  ? 1283 VAL A O     1 
ATOM   5796 C  CB    . VAL A 1 413 ? 10.577  9.079   -15.442 1.00 24.76  ? 1283 VAL A CB    1 
ATOM   5797 C  CG1   . VAL A 1 413 ? 9.681   9.107   -16.679 1.00 24.81  ? 1283 VAL A CG1   1 
ATOM   5798 C  CG2   . VAL A 1 413 ? 9.759   8.718   -14.189 1.00 21.86  ? 1283 VAL A CG2   1 
ATOM   5799 H  H     . VAL A 1 413 ? 12.782  8.859   -14.152 1.00 28.94  ? 1283 VAL A H     1 
ATOM   5800 H  HA    . VAL A 1 413 ? 11.370  7.173   -15.752 1.00 33.23  ? 1283 VAL A HA    1 
ATOM   5801 H  HB    . VAL A 1 413 ? 10.947  9.978   -15.314 1.00 29.71  ? 1283 VAL A HB    1 
ATOM   5802 H  HG11  . VAL A 1 413 ? 10.026  8.487   -17.327 1.00 29.77  ? 1283 VAL A HG11  1 
ATOM   5803 H  HG12  . VAL A 1 413 ? 8.791   8.854   -16.426 1.00 29.77  ? 1283 VAL A HG12  1 
ATOM   5804 H  HG13  . VAL A 1 413 ? 9.680   9.995   -17.043 1.00 29.77  ? 1283 VAL A HG13  1 
ATOM   5805 H  HG21  . VAL A 1 413 ? 10.144  7.939   -13.779 1.00 26.23  ? 1283 VAL A HG21  1 
ATOM   5806 H  HG22  . VAL A 1 413 ? 9.783   9.457   -13.577 1.00 26.23  ? 1283 VAL A HG22  1 
ATOM   5807 H  HG23  . VAL A 1 413 ? 8.853   8.537   -14.450 1.00 26.23  ? 1283 VAL A HG23  1 
ATOM   5808 N  N     . SER A 1 414 ? 12.591  7.540   -17.832 1.00 24.86  ? 1284 SER A N     1 
ATOM   5809 C  CA    . SER A 1 414 ? 13.411  7.750   -19.025 1.00 26.53  ? 1284 SER A CA    1 
ATOM   5810 C  C     . SER A 1 414 ? 12.583  8.169   -20.234 1.00 28.90  ? 1284 SER A C     1 
ATOM   5811 O  O     . SER A 1 414 ? 13.133  8.637   -21.226 1.00 28.71  ? 1284 SER A O     1 
ATOM   5812 C  CB    . SER A 1 414 ? 14.197  6.476   -19.365 1.00 26.52  ? 1284 SER A CB    1 
ATOM   5813 O  OG    . SER A 1 414 ? 13.311  5.408   -19.644 1.00 30.77  ? 1284 SER A OG    1 
ATOM   5814 H  H     . SER A 1 414 ? 12.153  6.799   -17.830 1.00 29.83  ? 1284 SER A H     1 
ATOM   5815 H  HA    . SER A 1 414 ? 14.058  8.463   -18.843 1.00 31.84  ? 1284 SER A HA    1 
ATOM   5816 H  HB2   . SER A 1 414 ? 14.749  6.642   -20.145 1.00 31.82  ? 1284 SER A HB2   1 
ATOM   5817 H  HB3   . SER A 1 414 ? 14.754  6.236   -18.608 1.00 31.82  ? 1284 SER A HB3   1 
ATOM   5818 H  HG    . SER A 1 414 ? 12.535  5.662   -19.574 1.00 36.92  ? 1284 SER A HG    1 
ATOM   5819 N  N     . ASP A 1 415 ? 11.267  7.994   -20.177 1.00 24.72  ? 1285 ASP A N     1 
ATOM   5820 C  CA    . ASP A 1 415 ? 10.435  8.423   -21.302 1.00 27.17  ? 1285 ASP A CA    1 
ATOM   5821 C  C     . ASP A 1 415 ? 10.169  9.918   -21.226 1.00 26.60  ? 1285 ASP A C     1 
ATOM   5822 O  O     . ASP A 1 415 ? 9.561   10.380  -20.275 1.00 27.00  ? 1285 ASP A O     1 
ATOM   5823 C  CB    . ASP A 1 415 ? 9.091   7.709   -21.338 1.00 28.92  ? 1285 ASP A CB    1 
ATOM   5824 C  CG    . ASP A 1 415 ? 8.216   8.216   -22.467 1.00 33.48  ? 1285 ASP A CG    1 
ATOM   5825 O  OD1   . ASP A 1 415 ? 8.713   8.286   -23.615 1.00 35.72  ? 1285 ASP A OD1   1 
ATOM   5826 O  OD2   . ASP A 1 415 ? 7.054   8.586   -22.215 1.00 26.35  ? 1285 ASP A OD2   1 
ATOM   5827 H  H     . ASP A 1 415 ? 10.838  7.640   -19.520 1.00 29.67  ? 1285 ASP A H     1 
ATOM   5828 H  HA    . ASP A 1 415 ? 10.906  8.236   -22.141 1.00 32.60  ? 1285 ASP A HA    1 
ATOM   5829 H  HB2   . ASP A 1 415 ? 9.237   6.759   -21.471 1.00 34.71  ? 1285 ASP A HB2   1 
ATOM   5830 H  HB3   . ASP A 1 415 ? 8.625   7.862   -20.501 1.00 34.71  ? 1285 ASP A HB3   1 
ATOM   5831 N  N     . PRO A 1 416 ? 10.598  10.679  -22.241 1.00 26.85  ? 1286 PRO A N     1 
ATOM   5832 C  CA    . PRO A 1 416 ? 10.416  12.127  -22.101 1.00 22.12  ? 1286 PRO A CA    1 
ATOM   5833 C  C     . PRO A 1 416 ? 8.960   12.557  -21.902 1.00 25.51  ? 1286 PRO A C     1 
ATOM   5834 O  O     . PRO A 1 416 ? 8.726   13.470  -21.119 1.00 23.69  ? 1286 PRO A O     1 
ATOM   5835 C  CB    . PRO A 1 416 ? 10.959  12.680  -23.424 1.00 24.70  ? 1286 PRO A CB    1 
ATOM   5836 C  CG    . PRO A 1 416 ? 11.940  11.638  -23.886 1.00 32.17  ? 1286 PRO A CG    1 
ATOM   5837 C  CD    . PRO A 1 416 ? 11.321  10.330  -23.479 1.00 25.70  ? 1286 PRO A CD    1 
ATOM   5838 H  HA    . PRO A 1 416 ? 10.960  12.468  -21.360 1.00 26.54  ? 1286 PRO A HA    1 
ATOM   5839 H  HB2   . PRO A 1 416 ? 10.235  12.779  -24.062 1.00 29.64  ? 1286 PRO A HB2   1 
ATOM   5840 H  HB3   . PRO A 1 416 ? 11.403  13.528  -23.269 1.00 29.64  ? 1286 PRO A HB3   1 
ATOM   5841 H  HG2   . PRO A 1 416 ? 12.042  11.686  -24.849 1.00 38.61  ? 1286 PRO A HG2   1 
ATOM   5842 H  HG3   . PRO A 1 416 ? 12.792  11.769  -23.441 1.00 38.61  ? 1286 PRO A HG3   1 
ATOM   5843 H  HD2   . PRO A 1 416 ? 10.702  10.021  -24.159 1.00 30.84  ? 1286 PRO A HD2   1 
ATOM   5844 H  HD3   . PRO A 1 416 ? 12.010  9.671   -23.296 1.00 30.84  ? 1286 PRO A HD3   1 
ATOM   5845 N  N     . LYS A 1 417 ? 8.004   11.943  -22.591 1.00 20.18  ? 1287 LYS A N     1 
ATOM   5846 C  CA    . LYS A 1 417 ? 6.625   12.410  -22.478 1.00 23.43  ? 1287 LYS A CA    1 
ATOM   5847 C  C     . LYS A 1 417 ? 6.131   12.201  -21.056 1.00 23.49  ? 1287 LYS A C     1 
ATOM   5848 O  O     . LYS A 1 417 ? 5.538   13.101  -20.457 1.00 19.34  ? 1287 LYS A O     1 
ATOM   5849 C  CB    . LYS A 1 417 ? 5.693   11.719  -23.482 1.00 26.50  ? 1287 LYS A CB    1 
ATOM   5850 C  CG    . LYS A 1 417 ? 4.210   12.063  -23.281 1.00 30.58  ? 1287 LYS A CG    1 
ATOM   5851 C  CD    . LYS A 1 417 ? 3.351   11.813  -24.537 1.00 58.95  ? 1287 LYS A CD    1 
ATOM   5852 C  CE    . LYS A 1 417 ? 2.587   10.483  -24.492 1.00 72.59  ? 1287 LYS A CE    1 
ATOM   5853 N  NZ    . LYS A 1 417 ? 1.118   10.627  -24.201 1.00 68.55  ? 1287 LYS A NZ    1 
ATOM   5854 H  H     . LYS A 1 417 ? 8.120   11.272  -23.117 1.00 24.22  ? 1287 LYS A H     1 
ATOM   5855 H  HA    . LYS A 1 417 ? 6.602   13.372  -22.664 1.00 28.11  ? 1287 LYS A HA    1 
ATOM   5856 H  HB2   . LYS A 1 417 ? 5.943   11.990  -24.379 1.00 31.80  ? 1287 LYS A HB2   1 
ATOM   5857 H  HB3   . LYS A 1 417 ? 5.791   10.758  -23.389 1.00 31.80  ? 1287 LYS A HB3   1 
ATOM   5858 H  HG2   . LYS A 1 417 ? 3.855   11.516  -22.563 1.00 36.70  ? 1287 LYS A HG2   1 
ATOM   5859 H  HG3   . LYS A 1 417 ? 4.134   13.002  -23.050 1.00 36.70  ? 1287 LYS A HG3   1 
ATOM   5860 H  HD2   . LYS A 1 417 ? 2.701   12.528  -24.621 1.00 70.74  ? 1287 LYS A HD2   1 
ATOM   5861 H  HD3   . LYS A 1 417 ? 3.929   11.799  -25.316 1.00 70.74  ? 1287 LYS A HD3   1 
ATOM   5862 H  HE2   . LYS A 1 417 ? 2.676   10.043  -25.352 1.00 87.11  ? 1287 LYS A HE2   1 
ATOM   5863 H  HE3   . LYS A 1 417 ? 2.972   9.926   -23.798 1.00 87.11  ? 1287 LYS A HE3   1 
ATOM   5864 H  HZ1   . LYS A 1 417 ? 0.730   9.826   -24.188 1.00 82.26  ? 1287 LYS A HZ1   1 
ATOM   5865 H  HZ2   . LYS A 1 417 ? 1.002   11.018  -23.410 1.00 82.26  ? 1287 LYS A HZ2   1 
ATOM   5866 H  HZ3   . LYS A 1 417 ? 0.731   11.125  -24.829 1.00 82.26  ? 1287 LYS A HZ3   1 
ATOM   5867 N  N     . LEU A 1 418 ? 6.387   11.018  -20.503 1.00 16.77  ? 1288 LEU A N     1 
ATOM   5868 C  CA    . LEU A 1 418 ? 5.914   10.730  -19.157 1.00 19.01  ? 1288 LEU A CA    1 
ATOM   5869 C  C     . LEU A 1 418 ? 6.648   11.615  -18.155 1.00 18.89  ? 1288 LEU A C     1 
ATOM   5870 O  O     . LEU A 1 418 ? 6.046   12.134  -17.223 1.00 17.07  ? 1288 LEU A O     1 
ATOM   5871 C  CB    . LEU A 1 418 ? 6.122   9.248   -18.822 1.00 18.09  ? 1288 LEU A CB    1 
ATOM   5872 C  CG    . LEU A 1 418 ? 5.766   8.813   -17.398 1.00 20.01  ? 1288 LEU A CG    1 
ATOM   5873 C  CD1   . LEU A 1 418 ? 4.326   9.149   -17.090 1.00 15.87  ? 1288 LEU A CD1   1 
ATOM   5874 C  CD2   . LEU A 1 418 ? 6.012   7.295   -17.243 1.00 20.35  ? 1288 LEU A CD2   1 
ATOM   5875 H  H     . LEU A 1 418 ? 6.824   10.380  -20.878 1.00 20.12  ? 1288 LEU A H     1 
ATOM   5876 H  HA    . LEU A 1 418 ? 4.956   10.927  -19.100 1.00 22.81  ? 1288 LEU A HA    1 
ATOM   5877 H  HB2   . LEU A 1 418 ? 5.579   8.721   -19.428 1.00 21.71  ? 1288 LEU A HB2   1 
ATOM   5878 H  HB3   . LEU A 1 418 ? 7.058   9.034   -18.962 1.00 21.71  ? 1288 LEU A HB3   1 
ATOM   5879 H  HG    . LEU A 1 418 ? 6.332   9.282   -16.766 1.00 24.01  ? 1288 LEU A HG    1 
ATOM   5880 H  HD11  . LEU A 1 418 ? 3.758   8.689   -17.713 1.00 19.05  ? 1288 LEU A HD11  1 
ATOM   5881 H  HD12  . LEU A 1 418 ? 4.125   8.868   -16.194 1.00 19.05  ? 1288 LEU A HD12  1 
ATOM   5882 H  HD13  . LEU A 1 418 ? 4.202   10.097  -17.172 1.00 19.05  ? 1288 LEU A HD13  1 
ATOM   5883 H  HD21  . LEU A 1 418 ? 5.786   7.032   -16.348 1.00 24.42  ? 1288 LEU A HD21  1 
ATOM   5884 H  HD22  . LEU A 1 418 ? 5.462   6.824   -17.872 1.00 24.42  ? 1288 LEU A HD22  1 
ATOM   5885 H  HD23  . LEU A 1 418 ? 6.939   7.111   -17.415 1.00 24.42  ? 1288 LEU A HD23  1 
ATOM   5886 N  N     . PHE A 1 419 ? 7.953   11.771  -18.338 1.00 18.75  ? 1289 PHE A N     1 
ATOM   5887 C  CA    . PHE A 1 419 ? 8.730   12.632  -17.461 1.00 17.15  ? 1289 PHE A CA    1 
ATOM   5888 C  C     . PHE A 1 419 ? 8.136   14.044  -17.419 1.00 19.48  ? 1289 PHE A C     1 
ATOM   5889 O  O     . PHE A 1 419 ? 7.965   14.616  -16.342 1.00 19.97  ? 1289 PHE A O     1 
ATOM   5890 C  CB    . PHE A 1 419 ? 10.184  12.729  -17.914 1.00 18.36  ? 1289 PHE A CB    1 
ATOM   5891 C  CG    . PHE A 1 419 ? 10.947  13.807  -17.192 1.00 20.29  ? 1289 PHE A CG    1 
ATOM   5892 C  CD1   . PHE A 1 419 ? 11.414  13.591  -15.908 1.00 21.64  ? 1289 PHE A CD1   1 
ATOM   5893 C  CD2   . PHE A 1 419 ? 11.137  15.051  -17.775 1.00 26.88  ? 1289 PHE A CD2   1 
ATOM   5894 C  CE1   . PHE A 1 419 ? 12.089  14.583  -15.222 1.00 26.23  ? 1289 PHE A CE1   1 
ATOM   5895 C  CE2   . PHE A 1 419 ? 11.816  16.055  -17.094 1.00 30.18  ? 1289 PHE A CE2   1 
ATOM   5896 C  CZ    . PHE A 1 419 ? 12.289  15.816  -15.810 1.00 24.94  ? 1289 PHE A CZ    1 
ATOM   5897 H  H     . PHE A 1 419 ? 8.409   11.391  -18.961 1.00 22.50  ? 1289 PHE A H     1 
ATOM   5898 H  HA    . PHE A 1 419 ? 8.715   12.265  -16.553 1.00 20.58  ? 1289 PHE A HA    1 
ATOM   5899 H  HB2   . PHE A 1 419 ? 10.626  11.883  -17.742 1.00 22.03  ? 1289 PHE A HB2   1 
ATOM   5900 H  HB3   . PHE A 1 419 ? 10.207  12.929  -18.863 1.00 22.03  ? 1289 PHE A HB3   1 
ATOM   5901 H  HD1   . PHE A 1 419 ? 11.280  12.764  -15.504 1.00 25.96  ? 1289 PHE A HD1   1 
ATOM   5902 H  HD2   . PHE A 1 419 ? 10.817  15.211  -18.633 1.00 32.26  ? 1289 PHE A HD2   1 
ATOM   5903 H  HE1   . PHE A 1 419 ? 12.408  14.420  -14.363 1.00 31.48  ? 1289 PHE A HE1   1 
ATOM   5904 H  HE2   . PHE A 1 419 ? 11.950  16.884  -17.494 1.00 36.21  ? 1289 PHE A HE2   1 
ATOM   5905 H  HZ    . PHE A 1 419 ? 12.748  16.482  -15.351 1.00 29.93  ? 1289 PHE A HZ    1 
ATOM   5906 N  N     . GLU A 1 420 ? 7.825   14.603  -18.586 1.00 18.68  ? 1290 GLU A N     1 
ATOM   5907 C  CA    . GLU A 1 420 ? 7.297   15.967  -18.651 1.00 19.40  ? 1290 GLU A CA    1 
ATOM   5908 C  C     . GLU A 1 420 ? 5.940   16.092  -17.964 1.00 18.84  ? 1290 GLU A C     1 
ATOM   5909 O  O     . GLU A 1 420 ? 5.664   17.098  -17.317 1.00 19.02  ? 1290 GLU A O     1 
ATOM   5910 C  CB    . GLU A 1 420 ? 7.198   16.448  -20.106 1.00 16.93  ? 1290 GLU A CB    1 
ATOM   5911 C  CG    . GLU A 1 420 ? 8.541   16.760  -20.727 1.00 19.16  ? 1290 GLU A CG    1 
ATOM   5912 C  CD    . GLU A 1 420 ? 8.413   17.356  -22.116 1.00 24.09  ? 1290 GLU A CD    1 
ATOM   5913 O  OE1   . GLU A 1 420 ? 7.299   17.770  -22.504 1.00 24.58  ? 1290 GLU A OE1   1 
ATOM   5914 O  OE2   . GLU A 1 420 ? 9.432   17.391  -22.820 1.00 21.99  ? 1290 GLU A OE2   1 
ATOM   5915 H  H     . GLU A 1 420 ? 7.910   14.219  -19.350 1.00 22.41  ? 1290 GLU A H     1 
ATOM   5916 H  HA    . GLU A 1 420 ? 7.919   16.563  -18.185 1.00 23.27  ? 1290 GLU A HA    1 
ATOM   5917 H  HB2   . GLU A 1 420 ? 6.777   15.754  -20.638 1.00 20.32  ? 1290 GLU A HB2   1 
ATOM   5918 H  HB3   . GLU A 1 420 ? 6.662   17.256  -20.134 1.00 20.32  ? 1290 GLU A HB3   1 
ATOM   5919 H  HG2   . GLU A 1 420 ? 9.008   17.399  -20.167 1.00 23.00  ? 1290 GLU A HG2   1 
ATOM   5920 H  HG3   . GLU A 1 420 ? 9.056   15.940  -20.797 1.00 23.00  ? 1290 GLU A HG3   1 
ATOM   5921 N  N     . MET A 1 421 ? 5.091   15.076  -18.097 1.00 16.45  ? 1291 MET A N     1 
ATOM   5922 C  CA    . MET A 1 421 ? 3.787   15.126  -17.452 1.00 17.68  ? 1291 MET A CA    1 
ATOM   5923 C  C     . MET A 1 421 ? 3.955   15.159  -15.946 1.00 15.50  ? 1291 MET A C     1 
ATOM   5924 O  O     . MET A 1 421 ? 3.306   15.947  -15.254 1.00 17.29  ? 1291 MET A O     1 
ATOM   5925 C  CB    . MET A 1 421 ? 2.941   13.908  -17.825 1.00 16.08  ? 1291 MET A CB    1 
ATOM   5926 C  CG    . MET A 1 421 ? 2.473   13.905  -19.275 1.00 17.77  ? 1291 MET A CG    1 
ATOM   5927 S  SD    . MET A 1 421 ? 1.659   12.332  -19.617 1.00 22.31  ? 1291 MET A SD    1 
ATOM   5928 C  CE    . MET A 1 421 ? 1.000   12.681  -21.249 1.00 33.80  ? 1291 MET A CE    1 
ATOM   5929 H  H     . MET A 1 421 ? 5.243   14.359  -18.547 1.00 19.74  ? 1291 MET A H     1 
ATOM   5930 H  HA    . MET A 1 421 ? 3.312   15.932  -17.744 1.00 21.22  ? 1291 MET A HA    1 
ATOM   5931 H  HB2   . MET A 1 421 ? 3.467   13.106  -17.681 1.00 19.29  ? 1291 MET A HB2   1 
ATOM   5932 H  HB3   . MET A 1 421 ? 2.153   13.890  -17.259 1.00 19.29  ? 1291 MET A HB3   1 
ATOM   5933 H  HG2   . MET A 1 421 ? 1.838   14.623  -19.417 1.00 21.32  ? 1291 MET A HG2   1 
ATOM   5934 H  HG3   . MET A 1 421 ? 3.236   13.997  -19.867 1.00 21.32  ? 1291 MET A HG3   1 
ATOM   5935 H  HE1   . MET A 1 421 ? 1.726   12.886  -21.842 1.00 40.56  ? 1291 MET A HE1   1 
ATOM   5936 H  HE2   . MET A 1 421 ? 0.526   11.908  -21.566 1.00 40.56  ? 1291 MET A HE2   1 
ATOM   5937 H  HE3   . MET A 1 421 ? 0.402   13.430  -21.191 1.00 40.56  ? 1291 MET A HE3   1 
ATOM   5938 N  N     . ILE A 1 422 ? 4.804   14.283  -15.420 1.00 15.17  ? 1292 ILE A N     1 
ATOM   5939 C  CA    . ILE A 1 422 ? 4.970   14.214  -13.964 1.00 15.82  ? 1292 ILE A CA    1 
ATOM   5940 C  C     . ILE A 1 422 ? 5.570   15.520  -13.447 1.00 19.87  ? 1292 ILE A C     1 
ATOM   5941 O  O     . ILE A 1 422 ? 5.098   16.083  -12.459 1.00 18.09  ? 1292 ILE A O     1 
ATOM   5942 C  CB    . ILE A 1 422 ? 5.878   13.041  -13.566 1.00 13.01  ? 1292 ILE A CB    1 
ATOM   5943 C  CG1   . ILE A 1 422 ? 5.213   11.710  -13.941 1.00 17.39  ? 1292 ILE A CG1   1 
ATOM   5944 C  CG2   . ILE A 1 422 ? 6.188   13.083  -12.074 1.00 14.87  ? 1292 ILE A CG2   1 
ATOM   5945 C  CD1   . ILE A 1 422 ? 6.206   10.530  -14.030 1.00 16.85  ? 1292 ILE A CD1   1 
ATOM   5946 H  H     . ILE A 1 422 ? 5.287   13.730  -15.867 1.00 18.20  ? 1292 ILE A H     1 
ATOM   5947 H  HA    . ILE A 1 422 ? 4.094   14.087  -13.542 1.00 18.99  ? 1292 ILE A HA    1 
ATOM   5948 H  HB    . ILE A 1 422 ? 6.712   13.117  -14.056 1.00 15.61  ? 1292 ILE A HB    1 
ATOM   5949 H  HG12  . ILE A 1 422 ? 4.550   11.490  -13.268 1.00 20.87  ? 1292 ILE A HG12  1 
ATOM   5950 H  HG13  . ILE A 1 422 ? 4.786   11.805  -14.807 1.00 20.87  ? 1292 ILE A HG13  1 
ATOM   5951 H  HG21  . ILE A 1 422 ? 6.633   13.909  -11.871 1.00 17.85  ? 1292 ILE A HG21  1 
ATOM   5952 H  HG22  . ILE A 1 422 ? 5.365   13.025  -11.583 1.00 17.85  ? 1292 ILE A HG22  1 
ATOM   5953 H  HG23  . ILE A 1 422 ? 6.755   12.342  -11.852 1.00 17.85  ? 1292 ILE A HG23  1 
ATOM   5954 H  HD11  . ILE A 1 422 ? 6.865   10.727  -14.700 1.00 20.22  ? 1292 ILE A HD11  1 
ATOM   5955 H  HD12  . ILE A 1 422 ? 6.631   10.415  -13.177 1.00 20.22  ? 1292 ILE A HD12  1 
ATOM   5956 H  HD13  . ILE A 1 422 ? 5.724   9.734   -14.267 1.00 20.22  ? 1292 ILE A HD13  1 
ATOM   5957 N  N     . LYS A 1 423 ? 6.607   16.027  -14.114 1.00 17.62  ? 1293 LYS A N     1 
ATOM   5958 C  CA    . LYS A 1 423 ? 7.296   17.186  -13.562 1.00 16.83  ? 1293 LYS A CA    1 
ATOM   5959 C  C     . LYS A 1 423 ? 6.378   18.400  -13.654 1.00 19.56  ? 1293 LYS A C     1 
ATOM   5960 O  O     . LYS A 1 423 ? 6.445   19.316  -12.828 1.00 18.37  ? 1293 LYS A O     1 
ATOM   5961 C  CB    . LYS A 1 423 ? 8.630   17.463  -14.261 1.00 21.66  ? 1293 LYS A CB    1 
ATOM   5962 C  CG    . LYS A 1 423 ? 9.389   18.595  -13.592 1.00 27.09  ? 1293 LYS A CG    1 
ATOM   5963 C  CD    . LYS A 1 423 ? 10.833  18.259  -13.336 1.00 29.29  ? 1293 LYS A CD    1 
ATOM   5964 C  CE    . LYS A 1 423 ? 11.506  19.343  -12.507 1.00 29.78  ? 1293 LYS A CE    1 
ATOM   5965 N  NZ    . LYS A 1 423 ? 12.956  19.076  -12.335 1.00 27.64  ? 1293 LYS A NZ    1 
ATOM   5966 H  H     . LYS A 1 423 ? 6.919   15.731  -14.858 1.00 21.14  ? 1293 LYS A H     1 
ATOM   5967 H  HA    . LYS A 1 423 ? 7.483   17.022  -12.614 1.00 20.19  ? 1293 LYS A HA    1 
ATOM   5968 H  HB2   . LYS A 1 423 ? 9.181   16.665  -14.226 1.00 25.99  ? 1293 LYS A HB2   1 
ATOM   5969 H  HB3   . LYS A 1 423 ? 8.461   17.714  -15.183 1.00 25.99  ? 1293 LYS A HB3   1 
ATOM   5970 H  HG2   . LYS A 1 423 ? 9.360   19.376  -14.166 1.00 32.51  ? 1293 LYS A HG2   1 
ATOM   5971 H  HG3   . LYS A 1 423 ? 8.971   18.794  -12.740 1.00 32.51  ? 1293 LYS A HG3   1 
ATOM   5972 H  HD2   . LYS A 1 423 ? 10.887  17.423  -12.847 1.00 35.15  ? 1293 LYS A HD2   1 
ATOM   5973 H  HD3   . LYS A 1 423 ? 11.302  18.186  -14.182 1.00 35.15  ? 1293 LYS A HD3   1 
ATOM   5974 H  HE2   . LYS A 1 423 ? 11.406  20.197  -12.955 1.00 35.74  ? 1293 LYS A HE2   1 
ATOM   5975 H  HE3   . LYS A 1 423 ? 11.097  19.374  -11.628 1.00 35.74  ? 1293 LYS A HE3   1 
ATOM   5976 H  HZ1   . LYS A 1 423 ? 13.074  18.297  -11.922 1.00 33.17  ? 1293 LYS A HZ1   1 
ATOM   5977 H  HZ2   . LYS A 1 423 ? 13.355  19.046  -13.130 1.00 33.17  ? 1293 LYS A HZ2   1 
ATOM   5978 H  HZ3   . LYS A 1 423 ? 13.328  19.721  -11.848 1.00 33.17  ? 1293 LYS A HZ3   1 
ATOM   5979 N  N     . TYR A 1 424 ? 5.509   18.407  -14.659 1.00 18.16  ? 1294 TYR A N     1 
ATOM   5980 C  CA    . TYR A 1 424 ? 4.541   19.496  -14.806 1.00 20.68  ? 1294 TYR A CA    1 
ATOM   5981 C  C     . TYR A 1 424 ? 3.586   19.469  -13.607 1.00 21.03  ? 1294 TYR A C     1 
ATOM   5982 O  O     . TYR A 1 424 ? 3.253   20.513  -13.044 1.00 18.13  ? 1294 TYR A O     1 
ATOM   5983 C  CB    . TYR A 1 424 ? 3.781   19.342  -16.123 1.00 20.15  ? 1294 TYR A CB    1 
ATOM   5984 C  CG    . TYR A 1 424 ? 2.801   20.447  -16.461 1.00 22.99  ? 1294 TYR A CG    1 
ATOM   5985 C  CD1   . TYR A 1 424 ? 2.998   21.752  -16.035 1.00 26.16  ? 1294 TYR A CD1   1 
ATOM   5986 C  CD2   . TYR A 1 424 ? 1.686   20.178  -17.242 1.00 35.93  ? 1294 TYR A CD2   1 
ATOM   5987 C  CE1   . TYR A 1 424 ? 2.091   22.768  -16.373 1.00 27.25  ? 1294 TYR A CE1   1 
ATOM   5988 C  CE2   . TYR A 1 424 ? 0.786   21.169  -17.578 1.00 46.99  ? 1294 TYR A CE2   1 
ATOM   5989 C  CZ    . TYR A 1 424 ? 0.989   22.460  -17.138 1.00 40.65  ? 1294 TYR A CZ    1 
ATOM   5990 O  OH    . TYR A 1 424 ? 0.081   23.437  -17.480 1.00 46.96  ? 1294 TYR A OH    1 
ATOM   5991 H  H     . TYR A 1 424 ? 5.457   17.800  -15.266 1.00 21.79  ? 1294 TYR A H     1 
ATOM   5992 H  HA    . TYR A 1 424 ? 5.010   20.356  -14.814 1.00 24.81  ? 1294 TYR A HA    1 
ATOM   5993 H  HB2   . TYR A 1 424 ? 4.428   19.299  -16.844 1.00 24.18  ? 1294 TYR A HB2   1 
ATOM   5994 H  HB3   . TYR A 1 424 ? 3.281   18.511  -16.090 1.00 24.18  ? 1294 TYR A HB3   1 
ATOM   5995 H  HD1   . TYR A 1 424 ? 3.742   21.956  -15.516 1.00 31.39  ? 1294 TYR A HD1   1 
ATOM   5996 H  HD2   . TYR A 1 424 ? 1.540   19.310  -17.541 1.00 43.11  ? 1294 TYR A HD2   1 
ATOM   5997 H  HE1   . TYR A 1 424 ? 2.228   23.639  -16.075 1.00 32.70  ? 1294 TYR A HE1   1 
ATOM   5998 H  HE2   . TYR A 1 424 ? 0.042   20.964  -18.096 1.00 56.38  ? 1294 TYR A HE2   1 
ATOM   5999 H  HH    . TYR A 1 424 ? 0.453   24.027  -17.911 1.00 56.35  ? 1294 TYR A HH    1 
ATOM   6000 N  N     . CYS A 1 425 ? 3.156   18.274  -13.201 1.00 18.28  ? 1295 CYS A N     1 
ATOM   6001 C  CA    . CYS A 1 425 ? 2.324   18.147  -12.001 1.00 17.66  ? 1295 CYS A CA    1 
ATOM   6002 C  C     . CYS A 1 425 ? 3.075   18.635  -10.750 1.00 20.93  ? 1295 CYS A C     1 
ATOM   6003 O  O     . CYS A 1 425 ? 2.518   19.346  -9.911  1.00 20.36  ? 1295 CYS A O     1 
ATOM   6004 C  CB    . CYS A 1 425 ? 1.874   16.692  -11.808 1.00 17.58  ? 1295 CYS A CB    1 
ATOM   6005 S  SG    . CYS A 1 425 ? 1.124   16.390  -10.180 1.00 24.58  ? 1295 CYS A SG    1 
ATOM   6006 H  H     . CYS A 1 425 ? 3.327   17.530  -13.597 1.00 21.93  ? 1295 CYS A H     1 
ATOM   6007 H  HA    . CYS A 1 425 ? 1.523   18.701  -12.108 1.00 21.19  ? 1295 CYS A HA    1 
ATOM   6008 H  HB2   . CYS A 1 425 ? 1.216   16.473  -12.486 1.00 21.10  ? 1295 CYS A HB2   1 
ATOM   6009 H  HB3   . CYS A 1 425 ? 2.645   16.109  -11.895 1.00 21.10  ? 1295 CYS A HB3   1 
ATOM   6010 H  HG    . CYS A 1 425 ? 1.928   16.644  -9.326  1.00 29.49  ? 1295 CYS A HG    1 
ATOM   6011 N  N     . LEU A 1 426 ? 4.344   18.272  -10.629 1.00 18.89  ? 1296 LEU A N     1 
ATOM   6012 C  CA    . LEU A 1 426 ? 5.137   18.715  -9.485  1.00 23.21  ? 1296 LEU A CA    1 
ATOM   6013 C  C     . LEU A 1 426 ? 5.259   20.234  -9.502  1.00 21.87  ? 1296 LEU A C     1 
ATOM   6014 O  O     . LEU A 1 426 ? 5.133   20.873  -8.466  1.00 19.28  ? 1296 LEU A O     1 
ATOM   6015 C  CB    . LEU A 1 426 ? 6.533   18.087  -9.499  1.00 17.98  ? 1296 LEU A CB    1 
ATOM   6016 C  CG    . LEU A 1 426 ? 6.613   16.560  -9.557  1.00 20.91  ? 1296 LEU A CG    1 
ATOM   6017 C  CD1   . LEU A 1 426 ? 8.070   16.119  -9.575  1.00 22.42  ? 1296 LEU A CD1   1 
ATOM   6018 C  CD2   . LEU A 1 426 ? 5.874   15.922  -8.384  1.00 20.53  ? 1296 LEU A CD2   1 
ATOM   6019 H  H     . LEU A 1 426 ? 4.769   17.775  -11.188 1.00 22.67  ? 1296 LEU A H     1 
ATOM   6020 H  HA    . LEU A 1 426 ? 4.687   18.450  -8.656  1.00 27.85  ? 1296 LEU A HA    1 
ATOM   6021 H  HB2   . LEU A 1 426 ? 7.007   18.427  -10.273 1.00 21.58  ? 1296 LEU A HB2   1 
ATOM   6022 H  HB3   . LEU A 1 426 ? 6.996   18.367  -8.694  1.00 21.58  ? 1296 LEU A HB3   1 
ATOM   6023 H  HG    . LEU A 1 426 ? 6.197   16.252  -10.377 1.00 25.09  ? 1296 LEU A HG    1 
ATOM   6024 H  HD11  . LEU A 1 426 ? 8.502   16.433  -8.777  1.00 26.91  ? 1296 LEU A HD11  1 
ATOM   6025 H  HD12  . LEU A 1 426 ? 8.106   15.160  -9.611  1.00 26.91  ? 1296 LEU A HD12  1 
ATOM   6026 H  HD13  . LEU A 1 426 ? 8.500   16.493  -10.348 1.00 26.91  ? 1296 LEU A HD13  1 
ATOM   6027 H  HD21  . LEU A 1 426 ? 5.945   14.967  -8.452  1.00 24.63  ? 1296 LEU A HD21  1 
ATOM   6028 H  HD22  . LEU A 1 426 ? 6.272   16.222  -7.563  1.00 24.63  ? 1296 LEU A HD22  1 
ATOM   6029 H  HD23  . LEU A 1 426 ? 4.951   16.184  -8.416  1.00 24.63  ? 1296 LEU A HD23  1 
ATOM   6030 N  N     . LEU A 1 427 ? 5.484   20.816  -10.680 1.00 18.95  ? 1297 LEU A N     1 
ATOM   6031 C  CA    . LEU A 1 427 ? 5.639   22.262  -10.773 1.00 20.51  ? 1297 LEU A CA    1 
ATOM   6032 C  C     . LEU A 1 427 ? 4.359   22.965  -10.315 1.00 21.81  ? 1297 LEU A C     1 
ATOM   6033 O  O     . LEU A 1 427 ? 4.405   23.867  -9.477  1.00 22.88  ? 1297 LEU A O     1 
ATOM   6034 C  CB    . LEU A 1 427 ? 5.993   22.683  -12.203 1.00 18.43  ? 1297 LEU A CB    1 
ATOM   6035 C  CG    . LEU A 1 427 ? 5.970   24.185  -12.493 1.00 18.33  ? 1297 LEU A CG    1 
ATOM   6036 C  CD1   . LEU A 1 427 ? 6.903   24.936  -11.541 1.00 21.45  ? 1297 LEU A CD1   1 
ATOM   6037 C  CD2   . LEU A 1 427 ? 6.362   24.444  -13.972 1.00 17.66  ? 1297 LEU A CD2   1 
ATOM   6038 H  H     . LEU A 1 427 ? 5.549   20.400  -11.429 1.00 22.74  ? 1297 LEU A H     1 
ATOM   6039 H  HA    . LEU A 1 427 ? 6.369   22.545  -10.184 1.00 24.62  ? 1297 LEU A HA    1 
ATOM   6040 H  HB2   . LEU A 1 427 ? 6.888   22.365  -12.401 1.00 22.12  ? 1297 LEU A HB2   1 
ATOM   6041 H  HB3   . LEU A 1 427 ? 5.362   22.263  -12.808 1.00 22.12  ? 1297 LEU A HB3   1 
ATOM   6042 H  HG    . LEU A 1 427 ? 5.070   24.520  -12.358 1.00 22.00  ? 1297 LEU A HG    1 
ATOM   6043 H  HD11  . LEU A 1 427 ? 6.869   25.873  -11.745 1.00 25.74  ? 1297 LEU A HD11  1 
ATOM   6044 H  HD12  . LEU A 1 427 ? 6.614   24.786  -10.638 1.00 25.74  ? 1297 LEU A HD12  1 
ATOM   6045 H  HD13  . LEU A 1 427 ? 7.798   24.607  -11.657 1.00 25.74  ? 1297 LEU A HD13  1 
ATOM   6046 H  HD21  . LEU A 1 427 ? 6.343   25.389  -14.139 1.00 21.19  ? 1297 LEU A HD21  1 
ATOM   6047 H  HD22  . LEU A 1 427 ? 7.246   24.101  -14.125 1.00 21.19  ? 1297 LEU A HD22  1 
ATOM   6048 H  HD23  . LEU A 1 427 ? 5.734   23.997  -14.545 1.00 21.19  ? 1297 LEU A HD23  1 
ATOM   6049 N  N     . ARG A 1 428 ? 3.219   22.558  -10.868 1.00 18.61  ? 1298 ARG A N     1 
ATOM   6050 C  CA    . ARG A 1 428 ? 1.940   23.191  -10.545 1.00 17.74  ? 1298 ARG A CA    1 
ATOM   6051 C  C     . ARG A 1 428 ? 1.652   23.099  -9.054  1.00 21.92  ? 1298 ARG A C     1 
ATOM   6052 O  O     . ARG A 1 428 ? 1.217   24.072  -8.439  1.00 21.65  ? 1298 ARG A O     1 
ATOM   6053 C  CB    . ARG A 1 428 ? 0.784   22.517  -11.284 1.00 23.52  ? 1298 ARG A CB    1 
ATOM   6054 C  CG    . ARG A 1 428 ? 0.716   22.812  -12.780 1.00 37.61  ? 1298 ARG A CG    1 
ATOM   6055 C  CD    . ARG A 1 428 ? -0.529  22.167  -13.383 1.00 39.06  ? 1298 ARG A CD    1 
ATOM   6056 N  NE    . ARG A 1 428 ? -0.363  20.722  -13.546 1.00 57.66  ? 1298 ARG A NE    1 
ATOM   6057 C  CZ    . ARG A 1 428 ? -1.313  19.818  -13.321 1.00 65.21  ? 1298 ARG A CZ    1 
ATOM   6058 N  NH1   . ARG A 1 428 ? -2.518  20.196  -12.909 1.00 77.59  ? 1298 ARG A NH1   1 
ATOM   6059 N  NH2   . ARG A 1 428 ? -1.057  18.526  -13.509 1.00 39.64  ? 1298 ARG A NH2   1 
ATOM   6060 H  H     . ARG A 1 428 ? 3.158   21.915  -11.435 1.00 22.33  ? 1298 ARG A H     1 
ATOM   6061 H  HA    . ARG A 1 428 ? 1.967   24.137  -10.801 1.00 21.29  ? 1298 ARG A HA    1 
ATOM   6062 H  HB2   . ARG A 1 428 ? 0.869   21.556  -11.179 1.00 28.22  ? 1298 ARG A HB2   1 
ATOM   6063 H  HB3   . ARG A 1 428 ? -0.050  22.814  -10.889 1.00 28.22  ? 1298 ARG A HB3   1 
ATOM   6064 H  HG2   . ARG A 1 428 ? 0.665   23.771  -12.919 1.00 45.13  ? 1298 ARG A HG2   1 
ATOM   6065 H  HG3   . ARG A 1 428 ? 1.499   22.445  -13.219 1.00 45.13  ? 1298 ARG A HG3   1 
ATOM   6066 H  HD2   . ARG A 1 428 ? -1.286  22.321  -12.796 1.00 46.88  ? 1298 ARG A HD2   1 
ATOM   6067 H  HD3   . ARG A 1 428 ? -0.697  22.553  -14.257 1.00 46.88  ? 1298 ARG A HD3   1 
ATOM   6068 H  HE    . ARG A 1 428 ? 0.405   20.436  -13.806 1.00 69.19  ? 1298 ARG A HE    1 
ATOM   6069 H  HH11  . ARG A 1 428 ? -2.689  21.030  -12.788 1.00 93.11  ? 1298 ARG A HH11  1 
ATOM   6070 H  HH12  . ARG A 1 428 ? -3.127  19.607  -12.764 1.00 93.11  ? 1298 ARG A HH12  1 
ATOM   6071 H  HH21  . ARG A 1 428 ? -0.277  18.277  -13.774 1.00 47.57  ? 1298 ARG A HH21  1 
ATOM   6072 H  HH22  . ARG A 1 428 ? -1.668  17.940  -13.361 1.00 47.57  ? 1298 ARG A HH22  1 
ATOM   6073 N  N     . THR A 1 429 ? 1.875   21.927  -8.471  1.00 15.73  ? 1299 THR A N     1 
ATOM   6074 C  CA    . THR A 1 429 ? 1.539   21.740  -7.055  1.00 19.13  ? 1299 THR A CA    1 
ATOM   6075 C  C     . THR A 1 429 ? 2.570   22.385  -6.120  1.00 23.96  ? 1299 THR A C     1 
ATOM   6076 O  O     . THR A 1 429 ? 2.215   22.900  -5.067  1.00 26.12  ? 1299 THR A O     1 
ATOM   6077 C  CB    . THR A 1 429 ? 1.341   20.256  -6.696  1.00 23.89  ? 1299 THR A CB    1 
ATOM   6078 O  OG1   . THR A 1 429 ? 2.523   19.509  -7.023  1.00 24.78  ? 1299 THR A OG1   1 
ATOM   6079 C  CG2   . THR A 1 429 ? 0.132   19.685  -7.456  1.00 24.35  ? 1299 THR A CG2   1 
ATOM   6080 H  H     . THR A 1 429 ? 2.212   21.237  -8.858  1.00 18.87  ? 1299 THR A H     1 
ATOM   6081 H  HA    . THR A 1 429 ? 0.684   22.189  -6.888  1.00 22.96  ? 1299 THR A HA    1 
ATOM   6082 H  HB    . THR A 1 429 ? 1.166   20.177  -5.745  1.00 28.67  ? 1299 THR A HB    1 
ATOM   6083 H  HG1   . THR A 1 429 ? 3.164   19.800  -6.604  1.00 29.74  ? 1299 THR A HG1   1 
ATOM   6084 H  HG21  . THR A 1 429 ? 0.010   18.760  -7.231  1.00 29.22  ? 1299 THR A HG21  1 
ATOM   6085 H  HG22  . THR A 1 429 ? -0.662  20.171  -7.221  1.00 29.22  ? 1299 THR A HG22  1 
ATOM   6086 H  HG23  . THR A 1 429 ? 0.274   19.760  -8.403  1.00 29.22  ? 1299 THR A HG23  1 
ATOM   6087 N  N     . LEU A 1 430 ? 3.840   22.371  -6.501  1.00 25.45  ? 1300 LEU A N     1 
ATOM   6088 C  CA    . LEU A 1 430 ? 4.867   23.036  -5.699  1.00 21.06  ? 1300 LEU A CA    1 
ATOM   6089 C  C     . LEU A 1 430 ? 4.549   24.522  -5.677  1.00 25.18  ? 1300 LEU A C     1 
ATOM   6090 O  O     . LEU A 1 430 ? 4.620   25.159  -4.630  1.00 27.71  ? 1300 LEU A O     1 
ATOM   6091 C  CB    . LEU A 1 430 ? 6.260   22.815  -6.295  1.00 23.72  ? 1300 LEU A CB    1 
ATOM   6092 C  CG    . LEU A 1 430 ? 7.423   23.474  -5.564  1.00 25.01  ? 1300 LEU A CG    1 
ATOM   6093 C  CD1   . LEU A 1 430 ? 7.573   22.885  -4.156  1.00 25.72  ? 1300 LEU A CD1   1 
ATOM   6094 C  CD2   . LEU A 1 430 ? 8.707   23.302  -6.379  1.00 21.69  ? 1300 LEU A CD2   1 
ATOM   6095 H  H     . LEU A 1 430 ? 4.135   21.989  -7.213  1.00 30.53  ? 1300 LEU A H     1 
ATOM   6096 H  HA    . LEU A 1 430 ? 4.853   22.691  -4.781  1.00 25.27  ? 1300 LEU A HA    1 
ATOM   6097 H  HB2   . LEU A 1 430 ? 6.434   21.861  -6.312  1.00 28.46  ? 1300 LEU A HB2   1 
ATOM   6098 H  HB3   . LEU A 1 430 ? 6.259   23.158  -7.203  1.00 28.46  ? 1300 LEU A HB3   1 
ATOM   6099 H  HG    . LEU A 1 430 ? 7.247   24.424  -5.477  1.00 30.01  ? 1300 LEU A HG    1 
ATOM   6100 H  HD11  . LEU A 1 430 ? 6.763   23.040  -3.666  1.00 30.86  ? 1300 LEU A HD11  1 
ATOM   6101 H  HD12  . LEU A 1 430 ? 7.738   21.942  -4.228  1.00 30.86  ? 1300 LEU A HD12  1 
ATOM   6102 H  HD13  . LEU A 1 430 ? 8.310   23.314  -3.715  1.00 30.86  ? 1300 LEU A HD13  1 
ATOM   6103 H  HD21  . LEU A 1 430 ? 8.884   22.365  -6.489  1.00 26.02  ? 1300 LEU A HD21  1 
ATOM   6104 H  HD22  . LEU A 1 430 ? 8.589   23.716  -7.238  1.00 26.02  ? 1300 LEU A HD22  1 
ATOM   6105 H  HD23  . LEU A 1 430 ? 9.433   23.721  -5.910  1.00 26.02  ? 1300 LEU A HD23  1 
ATOM   6106 N  N     . LYS A 1 431 ? 4.179   25.074  -6.833  1.00 20.65  ? 1301 LYS A N     1 
ATOM   6107 C  CA    . LYS A 1 431 ? 3.836   26.487  -6.903  1.00 20.37  ? 1301 LYS A CA    1 
ATOM   6108 C  C     . LYS A 1 431 ? 2.594   26.792  -6.060  1.00 23.91  ? 1301 LYS A C     1 
ATOM   6109 O  O     . LYS A 1 431 ? 2.556   27.791  -5.327  1.00 25.51  ? 1301 LYS A O     1 
ATOM   6110 C  CB    . LYS A 1 431 ? 3.617   26.919  -8.352  1.00 20.34  ? 1301 LYS A CB    1 
ATOM   6111 C  CG    . LYS A 1 431 ? 3.254   28.380  -8.507  1.00 27.89  ? 1301 LYS A CG    1 
ATOM   6112 C  CD    . LYS A 1 431 ? 3.399   28.811  -9.961  1.00 38.45  ? 1301 LYS A CD    1 
ATOM   6113 C  CE    . LYS A 1 431 ? 2.984   30.263  -10.162 1.00 52.57  ? 1301 LYS A CE    1 
ATOM   6114 N  NZ    . LYS A 1 431 ? 1.515   30.405  -10.360 1.00 58.30  ? 1301 LYS A NZ    1 
ATOM   6115 H  H     . LYS A 1 431 ? 4.121   24.655  -7.582  1.00 24.78  ? 1301 LYS A H     1 
ATOM   6116 H  HA    . LYS A 1 431 ? 4.581   27.012  -6.543  1.00 24.45  ? 1301 LYS A HA    1 
ATOM   6117 H  HB2   . LYS A 1 431 ? 4.433   26.762  -8.852  1.00 24.40  ? 1301 LYS A HB2   1 
ATOM   6118 H  HB3   . LYS A 1 431 ? 2.895   26.392  -8.729  1.00 24.40  ? 1301 LYS A HB3   1 
ATOM   6119 H  HG2   . LYS A 1 431 ? 2.332   28.515  -8.237  1.00 33.46  ? 1301 LYS A HG2   1 
ATOM   6120 H  HG3   . LYS A 1 431 ? 3.849   28.921  -7.966  1.00 33.46  ? 1301 LYS A HG3   1 
ATOM   6121 H  HD2   . LYS A 1 431 ? 4.326   28.720  -10.230 1.00 46.15  ? 1301 LYS A HD2   1 
ATOM   6122 H  HD3   . LYS A 1 431 ? 2.832   28.254  -10.517 1.00 46.15  ? 1301 LYS A HD3   1 
ATOM   6123 H  HE2   . LYS A 1 431 ? 3.234   30.777  -9.378  1.00 63.08  ? 1301 LYS A HE2   1 
ATOM   6124 H  HE3   . LYS A 1 431 ? 3.430   30.615  -10.948 1.00 63.08  ? 1301 LYS A HE3   1 
ATOM   6125 H  HZ1   . LYS A 1 431 ? 1.305   31.262  -10.474 1.00 69.96  ? 1301 LYS A HZ1   1 
ATOM   6126 H  HZ2   . LYS A 1 431 ? 1.259   29.946  -11.078 1.00 69.96  ? 1301 LYS A HZ2   1 
ATOM   6127 H  HZ3   . LYS A 1 431 ? 1.081   30.093  -9.648  1.00 69.96  ? 1301 LYS A HZ3   1 
ATOM   6128 N  N     . GLN A 1 432 ? 1.584   25.938  -6.156  1.00 21.23  ? 1302 GLN A N     1 
ATOM   6129 C  CA    . GLN A 1 432 ? 0.368   26.128  -5.369  1.00 21.72  ? 1302 GLN A CA    1 
ATOM   6130 C  C     . GLN A 1 432 ? 0.675   26.093  -3.870  1.00 27.83  ? 1302 GLN A C     1 
ATOM   6131 O  O     . GLN A 1 432 ? 0.165   26.914  -3.114  1.00 26.87  ? 1302 GLN A O     1 
ATOM   6132 C  CB    . GLN A 1 432 ? -0.687  25.077  -5.749  1.00 27.09  ? 1302 GLN A CB    1 
ATOM   6133 C  CG    . GLN A 1 432 ? -1.242  25.282  -7.156  1.00 39.83  ? 1302 GLN A CG    1 
ATOM   6134 C  CD    . GLN A 1 432 ? -2.046  24.096  -7.669  1.00 54.23  ? 1302 GLN A CD    1 
ATOM   6135 O  OE1   . GLN A 1 432 ? -2.007  23.006  -7.094  1.00 53.42  ? 1302 GLN A OE1   1 
ATOM   6136 N  NE2   . GLN A 1 432 ? -2.781  24.307  -8.763  1.00 49.75  ? 1302 GLN A NE2   1 
ATOM   6137 H  H     . GLN A 1 432 ? 1.575   25.244  -6.664  1.00 25.47  ? 1302 GLN A H     1 
ATOM   6138 H  HA    . GLN A 1 432 ? -0.004  27.010  -5.576  1.00 26.06  ? 1302 GLN A HA    1 
ATOM   6139 H  HB2   . GLN A 1 432 ? -0.284  24.196  -5.710  1.00 32.51  ? 1302 GLN A HB2   1 
ATOM   6140 H  HB3   . GLN A 1 432 ? -1.427  25.131  -5.123  1.00 32.51  ? 1302 GLN A HB3   1 
ATOM   6141 H  HG2   . GLN A 1 432 ? -1.825  26.057  -7.153  1.00 47.80  ? 1302 GLN A HG2   1 
ATOM   6142 H  HG3   . GLN A 1 432 ? -0.503  25.427  -7.766  1.00 47.80  ? 1302 GLN A HG3   1 
ATOM   6143 H  HE21  . GLN A 1 432 ? -2.783  25.082  -9.138  1.00 59.70  ? 1302 GLN A HE21  1 
ATOM   6144 H  HE22  . GLN A 1 432 ? -3.254  23.669  -9.094  1.00 59.70  ? 1302 GLN A HE22  1 
ATOM   6145 N  N     . CYS A 1 433 ? 1.527   25.165  -3.442  1.00 24.57  ? 1303 CYS A N     1 
ATOM   6146 C  CA    . CYS A 1 433 ? 1.872   25.047  -2.022  1.00 27.76  ? 1303 CYS A CA    1 
ATOM   6147 C  C     . CYS A 1 433 ? 2.648   26.257  -1.510  1.00 27.57  ? 1303 CYS A C     1 
ATOM   6148 O  O     . CYS A 1 433 ? 2.392   26.748  -0.412  1.00 27.66  ? 1303 CYS A O     1 
ATOM   6149 C  CB    . CYS A 1 433 ? 2.717   23.805  -1.780  1.00 24.16  ? 1303 CYS A CB    1 
ATOM   6150 S  SG    . CYS A 1 433 ? 1.788   22.263  -1.791  1.00 32.64  ? 1303 CYS A SG    1 
ATOM   6151 H  H     . CYS A 1 433 ? 1.919   24.592  -3.950  1.00 29.49  ? 1303 CYS A H     1 
ATOM   6152 H  HA    . CYS A 1 433 ? 1.049   24.966  -1.496  1.00 33.31  ? 1303 CYS A HA    1 
ATOM   6153 H  HB2   . CYS A 1 433 ? 3.391   23.747  -2.475  1.00 29.00  ? 1303 CYS A HB2   1 
ATOM   6154 H  HB3   . CYS A 1 433 ? 3.146   23.884  -0.914  1.00 29.00  ? 1303 CYS A HB3   1 
ATOM   6155 H  HG    . CYS A 1 433 ? 1.261   22.133  -2.860  1.00 39.17  ? 1303 CYS A HG    1 
ATOM   6156 N  N     . GLN A 1 434 ? 3.621   26.715  -2.285  1.00 25.78  ? 1304 GLN A N     1 
ATOM   6157 C  CA    . GLN A 1 434 ? 4.443   27.843  -1.856  1.00 26.86  ? 1304 GLN A CA    1 
ATOM   6158 C  C     . GLN A 1 434 ? 3.616   29.120  -1.846  1.00 30.94  ? 1304 GLN A C     1 
ATOM   6159 O  O     . GLN A 1 434 ? 3.783   29.974  -0.981  1.00 37.46  ? 1304 GLN A O     1 
ATOM   6160 C  CB    . GLN A 1 434 ? 5.659   28.008  -2.768  1.00 33.13  ? 1304 GLN A CB    1 
ATOM   6161 C  CG    . GLN A 1 434 ? 6.708   26.916  -2.625  1.00 54.07  ? 1304 GLN A CG    1 
ATOM   6162 C  CD    . GLN A 1 434 ? 7.838   27.058  -3.633  1.00 79.23  ? 1304 GLN A CD    1 
ATOM   6163 O  OE1   . GLN A 1 434 ? 7.656   27.630  -4.705  1.00 93.81  ? 1304 GLN A OE1   1 
ATOM   6164 N  NE2   . GLN A 1 434 ? 9.012   26.538  -3.288  1.00 77.44  ? 1304 GLN A NE2   1 
ATOM   6165 H  H     . GLN A 1 434 ? 3.826   26.396  -3.057  1.00 30.93  ? 1304 GLN A H     1 
ATOM   6166 H  HA    . GLN A 1 434 ? 4.764   27.679  -0.945  1.00 32.23  ? 1304 GLN A HA    1 
ATOM   6167 H  HB2   . GLN A 1 434 ? 5.358   28.008  -3.690  1.00 39.76  ? 1304 GLN A HB2   1 
ATOM   6168 H  HB3   . GLN A 1 434 ? 6.086   28.855  -2.564  1.00 39.76  ? 1304 GLN A HB3   1 
ATOM   6169 H  HG2   . GLN A 1 434 ? 7.091   26.960  -1.735  1.00 64.88  ? 1304 GLN A HG2   1 
ATOM   6170 H  HG3   . GLN A 1 434 ? 6.287   26.053  -2.764  1.00 64.88  ? 1304 GLN A HG3   1 
ATOM   6171 H  HE21  . GLN A 1 434 ? 9.102   26.146  -2.528  1.00 92.92  ? 1304 GLN A HE21  1 
ATOM   6172 H  HE22  . GLN A 1 434 ? 9.681   26.593  -3.826  1.00 92.92  ? 1304 GLN A HE22  1 
ATOM   6173 N  N     . THR A 1 435 ? 2.713   29.236  -2.810  1.00 28.83  ? 1305 THR A N     1 
ATOM   6174 C  CA    . THR A 1 435 ? 1.855   30.409  -2.934  1.00 29.26  ? 1305 THR A CA    1 
ATOM   6175 C  C     . THR A 1 435 ? 0.912   30.507  -1.744  1.00 31.87  ? 1305 THR A C     1 
ATOM   6176 O  O     . THR A 1 435 ? 0.718   31.581  -1.173  1.00 32.68  ? 1305 THR A O     1 
ATOM   6177 C  CB    . THR A 1 435 ? 1.013   30.346  -4.229  1.00 31.09  ? 1305 THR A CB    1 
ATOM   6178 O  OG1   . THR A 1 435 ? 1.875   30.469  -5.370  1.00 32.75  ? 1305 THR A OG1   1 
ATOM   6179 C  CG2   . THR A 1 435 ? -0.013  31.478  -4.259  1.00 32.49  ? 1305 THR A CG2   1 
ATOM   6180 H  H     . THR A 1 435 ? 2.575   28.640  -3.415  1.00 34.60  ? 1305 THR A H     1 
ATOM   6181 H  HA    . THR A 1 435 ? 2.408   31.218  -2.961  1.00 35.11  ? 1305 THR A HA    1 
ATOM   6182 H  HB    . THR A 1 435 ? 0.540   29.499  -4.269  1.00 37.31  ? 1305 THR A HB    1 
ATOM   6183 H  HG1   . THR A 1 435 ? 1.433   30.436  -6.060  1.00 39.30  ? 1305 THR A HG1   1 
ATOM   6184 H  HG21  . THR A 1 435 ? -0.603  31.406  -3.505  1.00 38.98  ? 1305 THR A HG21  1 
ATOM   6185 H  HG22  . THR A 1 435 ? 0.434   32.327  -4.225  1.00 38.98  ? 1305 THR A HG22  1 
ATOM   6186 H  HG23  . THR A 1 435 ? -0.531  31.430  -5.066  1.00 38.98  ? 1305 THR A HG23  1 
ATOM   6187 N  N     . LEU A 1 436 ? 0.324   29.377  -1.375  1.00 27.34  ? 1306 LEU A N     1 
ATOM   6188 C  CA    . LEU A 1 436 ? -0.596  29.330  -0.250  1.00 29.21  ? 1306 LEU A CA    1 
ATOM   6189 C  C     . LEU A 1 436 ? 0.165   29.598  1.043   1.00 33.39  ? 1306 LEU A C     1 
ATOM   6190 O  O     . LEU A 1 436 ? -0.273  30.375  1.888   1.00 34.07  ? 1306 LEU A O     1 
ATOM   6191 C  CB    . LEU A 1 436 ? -1.282  27.971  -0.207  1.00 28.70  ? 1306 LEU A CB    1 
ATOM   6192 C  CG    . LEU A 1 436 ? -2.152  27.676  1.016   1.00 35.33  ? 1306 LEU A CG    1 
ATOM   6193 C  CD1   . LEU A 1 436 ? -3.175  28.778  1.243   1.00 30.53  ? 1306 LEU A CD1   1 
ATOM   6194 C  CD2   . LEU A 1 436 ? -2.835  26.319  0.839   1.00 35.69  ? 1306 LEU A CD2   1 
ATOM   6195 H  H     . LEU A 1 436 ? 0.443   28.618  -1.763  1.00 32.81  ? 1306 LEU A H     1 
ATOM   6196 H  HA    . LEU A 1 436 ? -1.281  30.023  -0.358  1.00 35.05  ? 1306 LEU A HA    1 
ATOM   6197 H  HB2   . LEU A 1 436 ? -1.852  27.895  -0.989  1.00 34.44  ? 1306 LEU A HB2   1 
ATOM   6198 H  HB3   . LEU A 1 436 ? -0.597  27.286  -0.244  1.00 34.44  ? 1306 LEU A HB3   1 
ATOM   6199 H  HG    . LEU A 1 436 ? -1.586  27.626  1.802   1.00 42.40  ? 1306 LEU A HG    1 
ATOM   6200 H  HD11  . LEU A 1 436 ? -2.714  29.608  1.383   1.00 36.64  ? 1306 LEU A HD11  1 
ATOM   6201 H  HD12  . LEU A 1 436 ? -3.740  28.844  0.469   1.00 36.64  ? 1306 LEU A HD12  1 
ATOM   6202 H  HD13  . LEU A 1 436 ? -3.702  28.561  2.015   1.00 36.64  ? 1306 LEU A HD13  1 
ATOM   6203 H  HD21  . LEU A 1 436 ? -2.162  25.640  0.748   1.00 42.83  ? 1306 LEU A HD21  1 
ATOM   6204 H  HD22  . LEU A 1 436 ? -3.379  26.140  1.609   1.00 42.83  ? 1306 LEU A HD22  1 
ATOM   6205 H  HD23  . LEU A 1 436 ? -3.382  26.346  0.050   1.00 42.83  ? 1306 LEU A HD23  1 
ATOM   6206 N  N     . ARG A 1 437 ? 1.323   28.966  1.185   1.00 28.22  ? 1307 ARG A N     1 
ATOM   6207 C  CA    . ARG A 1 437 ? 2.146   29.134  2.371   1.00 36.51  ? 1307 ARG A CA    1 
ATOM   6208 C  C     . ARG A 1 437 ? 2.519   30.607  2.559   1.00 44.46  ? 1307 ARG A C     1 
ATOM   6209 O  O     . ARG A 1 437 ? 2.529   31.118  3.682   1.00 41.29  ? 1307 ARG A O     1 
ATOM   6210 C  CB    . ARG A 1 437 ? 3.397   28.272  2.246   1.00 42.75  ? 1307 ARG A CB    1 
ATOM   6211 C  CG    . ARG A 1 437 ? 4.276   28.280  3.465   1.00 57.01  ? 1307 ARG A CG    1 
ATOM   6212 C  CD    . ARG A 1 437 ? 5.256   27.121  3.453   1.00 56.19  ? 1307 ARG A CD    1 
ATOM   6213 N  NE    . ARG A 1 437 ? 5.444   26.606  4.803   1.00 58.88  ? 1307 ARG A NE    1 
ATOM   6214 C  CZ    . ARG A 1 437 ? 6.280   27.127  5.697   1.00 75.56  ? 1307 ARG A CZ    1 
ATOM   6215 N  NH1   . ARG A 1 437 ? 7.027   28.179  5.382   1.00 78.04  ? 1307 ARG A NH1   1 
ATOM   6216 N  NH2   . ARG A 1 437 ? 6.370   26.594  6.912   1.00 62.51  ? 1307 ARG A NH2   1 
ATOM   6217 H  H     . ARG A 1 437 ? 1.657   28.430  0.601   1.00 33.86  ? 1307 ARG A H     1 
ATOM   6218 H  HA    . ARG A 1 437 ? 1.644   28.839  3.160   1.00 43.81  ? 1307 ARG A HA    1 
ATOM   6219 H  HB2   . ARG A 1 437 ? 3.128   27.355  2.081   1.00 51.30  ? 1307 ARG A HB2   1 
ATOM   6220 H  HB3   . ARG A 1 437 ? 3.925   28.597  1.499   1.00 51.30  ? 1307 ARG A HB3   1 
ATOM   6221 H  HG2   . ARG A 1 437 ? 4.783   29.106  3.489   1.00 68.41  ? 1307 ARG A HG2   1 
ATOM   6222 H  HG3   . ARG A 1 437 ? 3.723   28.202  4.258   1.00 68.41  ? 1307 ARG A HG3   1 
ATOM   6223 H  HD2   . ARG A 1 437 ? 4.908   26.407  2.897   1.00 67.43  ? 1307 ARG A HD2   1 
ATOM   6224 H  HD3   . ARG A 1 437 ? 6.114   27.426  3.118   1.00 67.43  ? 1307 ARG A HD3   1 
ATOM   6225 H  HE    . ARG A 1 437 ? 4.983   25.918  5.037   1.00 70.65  ? 1307 ARG A HE    1 
ATOM   6226 H  HH11  . ARG A 1 437 ? 6.969   28.528  4.599   1.00 93.65  ? 1307 ARG A HH11  1 
ATOM   6227 H  HH12  . ARG A 1 437 ? 7.568   28.511  5.962   1.00 93.65  ? 1307 ARG A HH12  1 
ATOM   6228 H  HH21  . ARG A 1 437 ? 5.890   25.911  7.119   1.00 75.01  ? 1307 ARG A HH21  1 
ATOM   6229 H  HH22  . ARG A 1 437 ? 6.915   26.927  7.488   1.00 75.01  ? 1307 ARG A HH22  1 
ATOM   6230 N  N     . GLU A 1 438 ? 2.808   31.296  1.460   1.00 34.03  ? 1308 GLU A N     1 
ATOM   6231 C  CA    . GLU A 1 438 ? 3.193   32.705  1.531   1.00 44.22  ? 1308 GLU A CA    1 
ATOM   6232 C  C     . GLU A 1 438 ? 1.996   33.560  1.926   1.00 48.94  ? 1308 GLU A C     1 
ATOM   6233 O  O     . GLU A 1 438 ? 2.119   34.478  2.734   1.00 48.67  ? 1308 GLU A O     1 
ATOM   6234 C  CB    . GLU A 1 438 ? 3.758   33.184  0.194   1.00 46.60  ? 1308 GLU A CB    1 
ATOM   6235 C  CG    . GLU A 1 438 ? 5.148   32.662  -0.101  1.00 60.40  ? 1308 GLU A CG    1 
ATOM   6236 C  CD    . GLU A 1 438 ? 6.218   33.407  0.667   1.00 73.07  ? 1308 GLU A CD    1 
ATOM   6237 O  OE1   . GLU A 1 438 ? 6.086   34.639  0.824   1.00 78.63  ? 1308 GLU A OE1   1 
ATOM   6238 O  OE2   . GLU A 1 438 ? 7.187   32.758  1.115   1.00 68.86  ? 1308 GLU A OE2   1 
ATOM   6239 H  H     . GLU A 1 438 ? 2.789   30.974  0.662   1.00 40.84  ? 1308 GLU A H     1 
ATOM   6240 H  HA    . GLU A 1 438 ? 3.887   32.815  2.214   1.00 53.07  ? 1308 GLU A HA    1 
ATOM   6241 H  HB2   . GLU A 1 438 ? 3.172   32.886  -0.519  1.00 55.92  ? 1308 GLU A HB2   1 
ATOM   6242 H  HB3   . GLU A 1 438 ? 3.800   34.153  0.201   1.00 55.92  ? 1308 GLU A HB3   1 
ATOM   6243 H  HG2   . GLU A 1 438 ? 5.195   31.726  0.149   1.00 72.48  ? 1308 GLU A HG2   1 
ATOM   6244 H  HG3   . GLU A 1 438 ? 5.331   32.764  -1.048  1.00 72.48  ? 1308 GLU A HG3   1 
ATOM   6245 N  N     . ALA A 1 439 ? 0.838   33.253  1.353   1.00 38.27  ? 1309 ALA A N     1 
ATOM   6246 C  CA    . ALA A 1 439 ? -0.386  33.971  1.685   1.00 49.09  ? 1309 ALA A CA    1 
ATOM   6247 C  C     . ALA A 1 439 ? -0.694  33.844  3.179   1.00 55.99  ? 1309 ALA A C     1 
ATOM   6248 O  O     . ALA A 1 439 ? -1.019  34.833  3.843   1.00 48.79  ? 1309 ALA A O     1 
ATOM   6249 C  CB    . ALA A 1 439 ? -1.545  33.448  0.850   1.00 49.44  ? 1309 ALA A CB    1 
ATOM   6250 H  H     . ALA A 1 439 ? 0.733   32.632  0.767   1.00 45.93  ? 1309 ALA A H     1 
ATOM   6251 H  HA    . ALA A 1 439 ? -0.266  34.921  1.479   1.00 58.91  ? 1309 ALA A HA    1 
ATOM   6252 H  HB1   . ALA A 1 439 ? -1.343  33.577  -0.080  1.00 59.33  ? 1309 ALA A HB1   1 
ATOM   6253 H  HB2   . ALA A 1 439 ? -1.665  32.513  1.033   1.00 59.33  ? 1309 ALA A HB2   1 
ATOM   6254 H  HB3   . ALA A 1 439 ? -2.341  33.932  1.082   1.00 59.33  ? 1309 ALA A HB3   1 
ATOM   6255 N  N     . LEU A 1 440 ? -0.573  32.631  3.714   1.00 40.07  ? 1310 LEU A N     1 
ATOM   6256 C  CA    . LEU A 1 440 ? -0.947  32.386  5.105   1.00 43.91  ? 1310 LEU A CA    1 
ATOM   6257 C  C     . LEU A 1 440 ? -0.042  33.180  6.045   1.00 53.07  ? 1310 LEU A C     1 
ATOM   6258 O  O     . LEU A 1 440 ? -0.513  33.807  6.989   1.00 46.24  ? 1310 LEU A O     1 
ATOM   6259 C  CB    . LEU A 1 440 ? -0.886  30.891  5.438   1.00 40.85  ? 1310 LEU A CB    1 
ATOM   6260 C  CG    . LEU A 1 440 ? -1.936  30.014  4.743   1.00 44.57  ? 1310 LEU A CG    1 
ATOM   6261 C  CD1   . LEU A 1 440 ? -1.544  28.543  4.799   1.00 46.86  ? 1310 LEU A CD1   1 
ATOM   6262 C  CD2   . LEU A 1 440 ? -3.330  30.223  5.346   1.00 33.35  ? 1310 LEU A CD2   1 
ATOM   6263 H  H     . LEU A 1 440 ? -0.280  31.938  3.296   1.00 48.08  ? 1310 LEU A H     1 
ATOM   6264 H  HA    . LEU A 1 440 ? -1.868  32.690  5.246   1.00 52.69  ? 1310 LEU A HA    1 
ATOM   6265 H  HB2   . LEU A 1 440 ? -0.013  30.556  5.183   1.00 49.01  ? 1310 LEU A HB2   1 
ATOM   6266 H  HB3   . LEU A 1 440 ? -1.006  30.785  6.395   1.00 49.01  ? 1310 LEU A HB3   1 
ATOM   6267 H  HG    . LEU A 1 440 ? -1.981  30.270  3.809   1.00 53.48  ? 1310 LEU A HG    1 
ATOM   6268 H  HD11  . LEU A 1 440 ? -1.471  28.274  5.718   1.00 56.23  ? 1310 LEU A HD11  1 
ATOM   6269 H  HD12  . LEU A 1 440 ? -2.219  28.023  4.358   1.00 56.23  ? 1310 LEU A HD12  1 
ATOM   6270 H  HD13  . LEU A 1 440 ? -0.700  28.429  4.357   1.00 56.23  ? 1310 LEU A HD13  1 
ATOM   6271 H  HD21  . LEU A 1 440 ? -3.956  29.659  4.886   1.00 40.01  ? 1310 LEU A HD21  1 
ATOM   6272 H  HD22  . LEU A 1 440 ? -3.305  29.994  6.278   1.00 40.01  ? 1310 LEU A HD22  1 
ATOM   6273 H  HD23  . LEU A 1 440 ? -3.580  31.144  5.242   1.00 40.01  ? 1310 LEU A HD23  1 
ATOM   6274 N  N     . ILE A 1 441 ? 1.259   33.156  5.779   1.00 51.98  ? 1311 ILE A N     1 
ATOM   6275 C  CA    . ILE A 1 441 ? 2.206   33.893  6.599   1.00 62.27  ? 1311 ILE A CA    1 
ATOM   6276 C  C     . ILE A 1 441 ? 1.959   35.388  6.488   1.00 63.73  ? 1311 ILE A C     1 
ATOM   6277 O  O     . ILE A 1 441 ? 2.110   36.119  7.462   1.00 56.72  ? 1311 ILE A O     1 
ATOM   6278 C  CB    . ILE A 1 441 ? 3.642   33.600  6.182   1.00 64.64  ? 1311 ILE A CB    1 
ATOM   6279 C  CG1   . ILE A 1 441 ? 3.979   32.144  6.487   1.00 62.30  ? 1311 ILE A CG1   1 
ATOM   6280 C  CG2   . ILE A 1 441 ? 4.599   34.524  6.916   1.00 69.17  ? 1311 ILE A CG2   1 
ATOM   6281 C  CD1   . ILE A 1 441 ? 5.236   31.673  5.820   1.00 66.65  ? 1311 ILE A CD1   1 
ATOM   6282 H  H     . ILE A 1 441 ? 1.616   32.721  5.130   1.00 62.38  ? 1311 ILE A H     1 
ATOM   6283 H  HA    . ILE A 1 441 ? 2.097   33.631  7.537   1.00 74.72  ? 1311 ILE A HA    1 
ATOM   6284 H  HB    . ILE A 1 441 ? 3.729   33.750  5.228   1.00 77.56  ? 1311 ILE A HB    1 
ATOM   6285 H  HG12  . ILE A 1 441 ? 4.094   32.042  7.445   1.00 74.75  ? 1311 ILE A HG12  1 
ATOM   6286 H  HG13  . ILE A 1 441 ? 3.250   31.582  6.180   1.00 74.75  ? 1311 ILE A HG13  1 
ATOM   6287 H  HG21  . ILE A 1 441 ? 4.383   35.434  6.698   1.00 83.01  ? 1311 ILE A HG21  1 
ATOM   6288 H  HG22  . ILE A 1 441 ? 4.506   34.383  7.861   1.00 83.01  ? 1311 ILE A HG22  1 
ATOM   6289 H  HG23  . ILE A 1 441 ? 5.497   34.326  6.641   1.00 83.01  ? 1311 ILE A HG23  1 
ATOM   6290 H  HD11  . ILE A 1 441 ? 5.970   32.213  6.121   1.00 79.98  ? 1311 ILE A HD11  1 
ATOM   6291 H  HD12  . ILE A 1 441 ? 5.387   30.754  6.053   1.00 79.98  ? 1311 ILE A HD12  1 
ATOM   6292 H  HD13  . ILE A 1 441 ? 5.135   31.757  4.869   1.00 79.98  ? 1311 ILE A HD13  1 
ATOM   6293 N  N     . ALA A 1 442 ? 1.580   35.836  5.296   1.00 63.11  ? 1312 ALA A N     1 
ATOM   6294 C  CA    . ALA A 1 442 ? 1.275   37.242  5.064   1.00 66.87  ? 1312 ALA A CA    1 
ATOM   6295 C  C     . ALA A 1 442 ? 0.057   37.642  5.879   1.00 66.74  ? 1312 ALA A C     1 
ATOM   6296 O  O     . ALA A 1 442 ? -0.128  38.812  6.214   1.00 66.00  ? 1312 ALA A O     1 
ATOM   6297 C  CB    . ALA A 1 442 ? 1.020   37.490  3.588   1.00 65.04  ? 1312 ALA A CB    1 
ATOM   6298 H  H     . ALA A 1 442 ? 1.492   35.340  4.599   1.00 75.73  ? 1312 ALA A H     1 
ATOM   6299 H  HA    . ALA A 1 442 ? 2.035   37.794  5.346   1.00 80.25  ? 1312 ALA A HA    1 
ATOM   6300 H  HB1   . ALA A 1 442 ? 0.275   36.953  3.306   1.00 78.05  ? 1312 ALA A HB1   1 
ATOM   6301 H  HB2   . ALA A 1 442 ? 0.821   38.420  3.457   1.00 78.05  ? 1312 ALA A HB2   1 
ATOM   6302 H  HB3   . ALA A 1 442 ? 1.804   37.249  3.090   1.00 78.05  ? 1312 ALA A HB3   1 
ATOM   6303 N  N     . ALA A 1 443 ? -0.775  36.658  6.191   1.00 57.12  ? 1313 ALA A N     1 
ATOM   6304 C  CA    . ALA A 1 443 ? -1.973  36.892  6.981   1.00 66.88  ? 1313 ALA A CA    1 
ATOM   6305 C  C     . ALA A 1 443 ? -1.702  36.665  8.471   1.00 57.94  ? 1313 ALA A C     1 
ATOM   6306 O  O     . ALA A 1 443 ? -2.587  36.831  9.304   1.00 53.16  ? 1313 ALA A O     1 
ATOM   6307 C  CB    . ALA A 1 443 ? -3.087  35.987  6.501   1.00 71.78  ? 1313 ALA A CB    1 
ATOM   6308 H  H     . ALA A 1 443 ? -0.667  35.839  5.954   1.00 68.54  ? 1313 ALA A H     1 
ATOM   6309 H  HA    . ALA A 1 443 ? -2.262  37.821  6.862   1.00 80.26  ? 1313 ALA A HA    1 
ATOM   6310 H  HB1   . ALA A 1 443 ? -2.810  35.073  6.598   1.00 86.13  ? 1313 ALA A HB1   1 
ATOM   6311 H  HB2   . ALA A 1 443 ? -3.872  36.150  7.030   1.00 86.13  ? 1313 ALA A HB2   1 
ATOM   6312 H  HB3   . ALA A 1 443 ? -3.268  36.178  5.578   1.00 86.13  ? 1313 ALA A HB3   1 
ATOM   6313 N  N     . GLY A 1 444 ? -0.472  36.282  8.794   1.00 49.08  ? 1314 GLY A N     1 
ATOM   6314 C  CA    . GLY A 1 444 ? -0.085  36.007  10.166  1.00 51.68  ? 1314 GLY A CA    1 
ATOM   6315 C  C     . GLY A 1 444 ? -0.684  34.718  10.704  1.00 63.45  ? 1314 GLY A C     1 
ATOM   6316 O  O     . GLY A 1 444 ? -0.590  34.443  11.899  1.00 71.38  ? 1314 GLY A O     1 
ATOM   6317 H  H     . GLY A 1 444 ? 0.164   36.174  8.226   1.00 58.89  ? 1314 GLY A H     1 
ATOM   6318 H  HA2   . GLY A 1 444 ? 0.882   35.941  10.220  1.00 62.01  ? 1314 GLY A HA2   1 
ATOM   6319 H  HA3   . GLY A 1 444 ? -0.373  36.739  10.734  1.00 62.01  ? 1314 GLY A HA3   1 
ATOM   6320 N  N     . LYS A 1 445 ? -1.306  33.930  9.829   1.00 49.86  ? 1315 LYS A N     1 
ATOM   6321 C  CA    . LYS A 1 445 ? -1.849  32.632  10.216  1.00 47.26  ? 1315 LYS A CA    1 
ATOM   6322 C  C     . LYS A 1 445 ? -0.696  31.669  10.466  1.00 49.16  ? 1315 LYS A C     1 
ATOM   6323 O  O     . LYS A 1 445 ? 0.183   31.515  9.623   1.00 56.78  ? 1315 LYS A O     1 
ATOM   6324 C  CB    . LYS A 1 445 ? -2.754  32.091  9.107   1.00 50.93  ? 1315 LYS A CB    1 
ATOM   6325 C  CG    . LYS A 1 445 ? -3.561  30.857  9.487   1.00 51.58  ? 1315 LYS A CG    1 
ATOM   6326 C  CD    . LYS A 1 445 ? -4.588  31.172  10.569  1.00 59.09  ? 1315 LYS A CD    1 
ATOM   6327 C  CE    . LYS A 1 445 ? -5.356  29.931  10.986  1.00 56.23  ? 1315 LYS A CE    1 
ATOM   6328 N  NZ    . LYS A 1 445 ? -6.441  30.253  11.950  1.00 48.86  ? 1315 LYS A NZ    1 
ATOM   6329 H  H     . LYS A 1 445 ? -1.426  34.126  9.000   1.00 59.84  ? 1315 LYS A H     1 
ATOM   6330 H  HA    . LYS A 1 445 ? -2.373  32.721  11.039  1.00 56.71  ? 1315 LYS A HA    1 
ATOM   6331 H  HB2   . LYS A 1 445 ? -3.382  32.786  8.854   1.00 61.12  ? 1315 LYS A HB2   1 
ATOM   6332 H  HB3   . LYS A 1 445 ? -2.203  31.857  8.344   1.00 61.12  ? 1315 LYS A HB3   1 
ATOM   6333 H  HG2   . LYS A 1 445 ? -4.034  30.531  8.705   1.00 61.90  ? 1315 LYS A HG2   1 
ATOM   6334 H  HG3   . LYS A 1 445 ? -2.962  30.175  9.826   1.00 61.90  ? 1315 LYS A HG3   1 
ATOM   6335 H  HD2   . LYS A 1 445 ? -4.133  31.524  11.350  1.00 70.90  ? 1315 LYS A HD2   1 
ATOM   6336 H  HD3   . LYS A 1 445 ? -5.223  31.822  10.229  1.00 70.90  ? 1315 LYS A HD3   1 
ATOM   6337 H  HE2   . LYS A 1 445 ? -5.757  29.526  10.202  1.00 67.47  ? 1315 LYS A HE2   1 
ATOM   6338 H  HE3   . LYS A 1 445 ? -4.747  29.307  11.412  1.00 67.47  ? 1315 LYS A HE3   1 
ATOM   6339 H  HZ1   . LYS A 1 445 ? -6.097  30.623  12.682  1.00 58.63  ? 1315 LYS A HZ1   1 
ATOM   6340 H  HZ2   . LYS A 1 445 ? -7.017  30.822  11.580  1.00 58.63  ? 1315 LYS A HZ2   1 
ATOM   6341 H  HZ3   . LYS A 1 445 ? -6.875  29.510  12.178  1.00 58.63  ? 1315 LYS A HZ3   1 
ATOM   6342 N  N     . GLU A 1 446 ? -0.702  31.006  11.615  1.00 45.79  ? 1316 GLU A N     1 
ATOM   6343 C  CA    . GLU A 1 446 ? 0.408   30.134  11.979  1.00 55.64  ? 1316 GLU A CA    1 
ATOM   6344 C  C     . GLU A 1 446 ? 0.315   28.822  11.218  1.00 49.55  ? 1316 GLU A C     1 
ATOM   6345 O  O     . GLU A 1 446 ? -0.782  28.342  10.939  1.00 44.11  ? 1316 GLU A O     1 
ATOM   6346 C  CB    . GLU A 1 446 ? 0.420   29.856  13.484  1.00 73.79  ? 1316 GLU A CB    1 
ATOM   6347 C  CG    . GLU A 1 446 ? 0.740   31.073  14.341  1.00 90.49  ? 1316 GLU A CG    1 
ATOM   6348 C  CD    . GLU A 1 446 ? -0.442  32.018  14.503  1.00 95.95  ? 1316 GLU A CD    1 
ATOM   6349 O  OE1   . GLU A 1 446 ? -1.584  31.616  14.182  1.00 91.50  ? 1316 GLU A OE1   1 
ATOM   6350 O  OE2   . GLU A 1 446 ? -0.226  33.161  14.961  1.00 93.48  ? 1316 GLU A OE2   1 
ATOM   6351 H  H     . GLU A 1 446 ? -1.333  31.042  12.198  1.00 54.95  ? 1316 GLU A H     1 
ATOM   6352 H  HA    . GLU A 1 446 ? 1.253   30.569  11.740  1.00 66.77  ? 1316 GLU A HA    1 
ATOM   6353 H  HB2   . GLU A 1 446 ? -0.455  29.531  13.747  1.00 88.55  ? 1316 GLU A HB2   1 
ATOM   6354 H  HB3   . GLU A 1 446 ? 1.090   29.179  13.670  1.00 88.55  ? 1316 GLU A HB3   1 
ATOM   6355 H  HG2   . GLU A 1 446 ? 1.007   30.774  15.225  1.00 108.59 ? 1316 GLU A HG2   1 
ATOM   6356 H  HG3   . GLU A 1 446 ? 1.464   31.568  13.927  1.00 108.59 ? 1316 GLU A HG3   1 
ATOM   6357 N  N     . ILE A 1 447 ? 1.468   28.254  10.878  1.00 47.35  ? 1317 ILE A N     1 
ATOM   6358 C  CA    . ILE A 1 447 ? 1.523   26.943  10.246  1.00 45.56  ? 1317 ILE A CA    1 
ATOM   6359 C  C     . ILE A 1 447 ? 2.210   25.975  11.197  1.00 42.01  ? 1317 ILE A C     1 
ATOM   6360 O  O     . ILE A 1 447 ? 3.384   26.138  11.521  1.00 45.58  ? 1317 ILE A O     1 
ATOM   6361 C  CB    . ILE A 1 447 ? 2.272   26.985  8.897   1.00 42.92  ? 1317 ILE A CB    1 
ATOM   6362 C  CG1   . ILE A 1 447 ? 1.517   27.874  7.904   1.00 40.78  ? 1317 ILE A CG1   1 
ATOM   6363 C  CG2   . ILE A 1 447 ? 2.422   25.576  8.321   1.00 45.65  ? 1317 ILE A CG2   1 
ATOM   6364 C  CD1   . ILE A 1 447 ? 2.303   28.227  6.654   1.00 38.89  ? 1317 ILE A CD1   1 
ATOM   6365 H  H     . ILE A 1 447 ? 2.239   28.613  11.005  1.00 56.82  ? 1317 ILE A H     1 
ATOM   6366 H  HA    . ILE A 1 447 ? 0.612   26.622  10.083  1.00 54.68  ? 1317 ILE A HA    1 
ATOM   6367 H  HB    . ILE A 1 447 ? 3.156   27.359  9.042   1.00 51.51  ? 1317 ILE A HB    1 
ATOM   6368 H  HG12  . ILE A 1 447 ? 0.711   27.412  7.625   1.00 48.93  ? 1317 ILE A HG12  1 
ATOM   6369 H  HG13  . ILE A 1 447 ? 1.281   28.704  8.347   1.00 48.93  ? 1317 ILE A HG13  1 
ATOM   6370 H  HG21  . ILE A 1 447 ? 2.919   25.037  8.941   1.00 54.77  ? 1317 ILE A HG21  1 
ATOM   6371 H  HG22  . ILE A 1 447 ? 1.550   25.199  8.186   1.00 54.77  ? 1317 ILE A HG22  1 
ATOM   6372 H  HG23  . ILE A 1 447 ? 2.890   25.628  7.484   1.00 54.77  ? 1317 ILE A HG23  1 
ATOM   6373 H  HD11  . ILE A 1 447 ? 3.099   28.698  6.909   1.00 46.66  ? 1317 ILE A HD11  1 
ATOM   6374 H  HD12  . ILE A 1 447 ? 2.534   27.418  6.192   1.00 46.66  ? 1317 ILE A HD12  1 
ATOM   6375 H  HD13  . ILE A 1 447 ? 1.759   28.782  6.090   1.00 46.66  ? 1317 ILE A HD13  1 
ATOM   6376 N  N     . ILE A 1 448 ? 1.459   24.976  11.651  1.00 35.05  ? 1318 ILE A N     1 
ATOM   6377 C  CA    . ILE A 1 448 ? 1.940   24.025  12.645  1.00 44.17  ? 1318 ILE A CA    1 
ATOM   6378 C  C     . ILE A 1 448 ? 2.531   22.796  11.981  1.00 49.71  ? 1318 ILE A C     1 
ATOM   6379 O  O     . ILE A 1 448 ? 1.878   22.148  11.165  1.00 43.77  ? 1318 ILE A O     1 
ATOM   6380 C  CB    . ILE A 1 448 ? 0.806   23.555  13.573  1.00 45.14  ? 1318 ILE A CB    1 
ATOM   6381 C  CG1   . ILE A 1 448 ? 0.201   24.739  14.328  1.00 60.36  ? 1318 ILE A CG1   1 
ATOM   6382 C  CG2   . ILE A 1 448 ? 1.324   22.513  14.558  1.00 44.12  ? 1318 ILE A CG2   1 
ATOM   6383 C  CD1   . ILE A 1 448 ? -0.627  25.669  13.467  1.00 74.13  ? 1318 ILE A CD1   1 
ATOM   6384 H  H     . ILE A 1 448 ? 0.652   24.827  11.393  1.00 42.06  ? 1318 ILE A H     1 
ATOM   6385 H  HA    . ILE A 1 448 ? 2.635   24.448  13.192  1.00 53.00  ? 1318 ILE A HA    1 
ATOM   6386 H  HB    . ILE A 1 448 ? 0.112   23.148  13.030  1.00 54.17  ? 1318 ILE A HB    1 
ATOM   6387 H  HG12  . ILE A 1 448 ? -0.373  24.399  15.031  1.00 72.43  ? 1318 ILE A HG12  1 
ATOM   6388 H  HG13  . ILE A 1 448 ? 0.921   25.260  14.716  1.00 72.43  ? 1318 ILE A HG13  1 
ATOM   6389 H  HG21  . ILE A 1 448 ? 2.024   22.904  15.086  1.00 52.94  ? 1318 ILE A HG21  1 
ATOM   6390 H  HG22  . ILE A 1 448 ? 0.602   22.234  15.126  1.00 52.94  ? 1318 ILE A HG22  1 
ATOM   6391 H  HG23  . ILE A 1 448 ? 1.665   21.761  14.067  1.00 52.94  ? 1318 ILE A HG23  1 
ATOM   6392 H  HD11  . ILE A 1 448 ? -0.968  26.380  14.015  1.00 88.95  ? 1318 ILE A HD11  1 
ATOM   6393 H  HD12  . ILE A 1 448 ? -0.072  26.027  12.771  1.00 88.95  ? 1318 ILE A HD12  1 
ATOM   6394 H  HD13  . ILE A 1 448 ? -1.355  25.173  13.084  1.00 88.95  ? 1318 ILE A HD13  1 
ATOM   6395 N  N     . TRP A 1 449 ? 3.765   22.470  12.339  1.00 42.04  ? 1319 TRP A N     1 
ATOM   6396 C  CA    . TRP A 1 449 ? 4.412   21.292  11.794  1.00 42.98  ? 1319 TRP A CA    1 
ATOM   6397 C  C     . TRP A 1 449 ? 3.699   20.033  12.258  1.00 47.01  ? 1319 TRP A C     1 
ATOM   6398 O  O     . TRP A 1 449 ? 3.580   19.773  13.450  1.00 40.61  ? 1319 TRP A O     1 
ATOM   6399 C  CB    . TRP A 1 449 ? 5.879   21.243  12.201  1.00 48.51  ? 1319 TRP A CB    1 
ATOM   6400 C  CG    . TRP A 1 449 ? 6.531   19.982  11.761  1.00 43.99  ? 1319 TRP A CG    1 
ATOM   6401 C  CD1   . TRP A 1 449 ? 7.052   19.008  12.555  1.00 44.17  ? 1319 TRP A CD1   1 
ATOM   6402 C  CD2   . TRP A 1 449 ? 6.718   19.544  10.409  1.00 39.86  ? 1319 TRP A CD2   1 
ATOM   6403 N  NE1   . TRP A 1 449 ? 7.559   17.988  11.785  1.00 48.51  ? 1319 TRP A NE1   1 
ATOM   6404 C  CE2   . TRP A 1 449 ? 7.365   18.293  10.462  1.00 46.39  ? 1319 TRP A CE2   1 
ATOM   6405 C  CE3   . TRP A 1 449 ? 6.403   20.090  9.162   1.00 43.44  ? 1319 TRP A CE3   1 
ATOM   6406 C  CZ2   . TRP A 1 449 ? 7.706   17.577  9.312   1.00 44.59  ? 1319 TRP A CZ2   1 
ATOM   6407 C  CZ3   . TRP A 1 449 ? 6.741   19.378  8.019   1.00 45.09  ? 1319 TRP A CZ3   1 
ATOM   6408 C  CH2   . TRP A 1 449 ? 7.386   18.136  8.103   1.00 43.38  ? 1319 TRP A CH2   1 
ATOM   6409 H  H     . TRP A 1 449 ? 4.247   22.915  12.896  1.00 50.44  ? 1319 TRP A H     1 
ATOM   6410 H  HA    . TRP A 1 449 ? 4.368   21.326  10.816  1.00 51.58  ? 1319 TRP A HA    1 
ATOM   6411 H  HB2   . TRP A 1 449 ? 6.349   21.986  11.791  1.00 58.22  ? 1319 TRP A HB2   1 
ATOM   6412 H  HB3   . TRP A 1 449 ? 5.945   21.297  13.167  1.00 58.22  ? 1319 TRP A HB3   1 
ATOM   6413 H  HD1   . TRP A 1 449 ? 7.063   19.029  13.484  1.00 53.01  ? 1319 TRP A HD1   1 
ATOM   6414 H  HE1   . TRP A 1 449 ? 7.935   17.275  12.084  1.00 58.21  ? 1319 TRP A HE1   1 
ATOM   6415 H  HE3   . TRP A 1 449 ? 5.975   20.913  9.098   1.00 52.13  ? 1319 TRP A HE3   1 
ATOM   6416 H  HZ2   . TRP A 1 449 ? 8.135   16.754  9.365   1.00 53.50  ? 1319 TRP A HZ2   1 
ATOM   6417 H  HZ3   . TRP A 1 449 ? 6.536   19.731  7.183   1.00 54.10  ? 1319 TRP A HZ3   1 
ATOM   6418 H  HH2   . TRP A 1 449 ? 7.602   17.681  7.321   1.00 52.06  ? 1319 TRP A HH2   1 
ATOM   6419 N  N     . HIS A 1 450 ? 3.221   19.249  11.303  1.00 37.14  ? 1320 HIS A N     1 
ATOM   6420 C  CA    . HIS A 1 450 ? 2.464   18.055  11.617  1.00 35.26  ? 1320 HIS A CA    1 
ATOM   6421 C  C     . HIS A 1 450 ? 3.236   16.827  11.176  1.00 43.00  ? 1320 HIS A C     1 
ATOM   6422 O  O     . HIS A 1 450 ? 3.257   15.820  11.874  1.00 49.63  ? 1320 HIS A O     1 
ATOM   6423 C  CB    . HIS A 1 450 ? 1.108   18.099  10.925  1.00 34.79  ? 1320 HIS A CB    1 
ATOM   6424 C  CG    . HIS A 1 450 ? 0.138   17.086  11.441  1.00 31.61  ? 1320 HIS A CG    1 
ATOM   6425 N  ND1   . HIS A 1 450 ? -0.416  16.112  10.643  1.00 39.96  ? 1320 HIS A ND1   1 
ATOM   6426 C  CD2   . HIS A 1 450 ? -0.370  16.894  12.681  1.00 34.23  ? 1320 HIS A CD2   1 
ATOM   6427 C  CE1   . HIS A 1 450 ? -1.234  15.366  11.365  1.00 42.84  ? 1320 HIS A CE1   1 
ATOM   6428 N  NE2   . HIS A 1 450 ? -1.222  15.819  12.605  1.00 42.52  ? 1320 HIS A NE2   1 
ATOM   6429 H  H     . HIS A 1 450 ? 3.324   19.390  10.461  1.00 44.57  ? 1320 HIS A H     1 
ATOM   6430 H  HA    . HIS A 1 450 ? 2.319   18.003  12.585  1.00 42.32  ? 1320 HIS A HA    1 
ATOM   6431 H  HB2   . HIS A 1 450 ? 0.718   18.977  11.055  1.00 41.75  ? 1320 HIS A HB2   1 
ATOM   6432 H  HB3   . HIS A 1 450 ? 1.235   17.932  9.977   1.00 41.75  ? 1320 HIS A HB3   1 
ATOM   6433 H  HD1   . HIS A 1 450 ? -0.261  16.009  9.804   1.00 47.96  ? 1320 HIS A HD1   1 
ATOM   6434 H  HD2   . HIS A 1 450 ? -0.183  17.398  13.439  1.00 41.07  ? 1320 HIS A HD2   1 
ATOM   6435 H  HE1   . HIS A 1 450 ? -1.728  14.643  11.054  1.00 51.41  ? 1320 HIS A HE1   1 
ATOM   6436 H  HE2   . HIS A 1 450 ? -1.674  15.493  13.260  1.00 51.03  ? 1320 HIS A HE2   1 
ATOM   6437 N  N     . GLY A 1 451 ? 3.871   16.919  10.011  1.00 38.80  ? 1321 GLY A N     1 
ATOM   6438 C  CA    . GLY A 1 451 ? 4.695   15.841  9.500   1.00 36.87  ? 1321 GLY A CA    1 
ATOM   6439 C  C     . GLY A 1 451 ? 3.863   14.696  8.960   1.00 42.37  ? 1321 GLY A C     1 
ATOM   6440 O  O     . GLY A 1 451 ? 2.642   14.801  8.848   1.00 39.36  ? 1321 GLY A O     1 
ATOM   6441 H  H     . GLY A 1 451 ? 3.838   17.607  9.495   1.00 46.55  ? 1321 GLY A H     1 
ATOM   6442 H  HA2   . GLY A 1 451 ? 5.260   16.175  8.786   1.00 44.25  ? 1321 GLY A HA2   1 
ATOM   6443 H  HA3   . GLY A 1 451 ? 5.262   15.502  10.209  1.00 44.25  ? 1321 GLY A HA3   1 
ATOM   6444 N  N     A ARG A 1 452 ? 4.527   13.595  8.649   0.50 43.77  ? 1322 ARG A N     1 
ATOM   6445 N  N     B ARG A 1 452 ? 4.539   13.611  8.582   0.50 43.72  ? 1322 ARG A N     1 
ATOM   6446 C  CA    A ARG A 1 452 ? 3.832   12.404  8.210   0.50 50.37  ? 1322 ARG A CA    1 
ATOM   6447 C  CA    B ARG A 1 452 ? 3.888   12.396  8.086   0.50 48.71  ? 1322 ARG A CA    1 
ATOM   6448 C  C     A ARG A 1 452 ? 4.405   11.185  8.892   0.50 55.53  ? 1322 ARG A C     1 
ATOM   6449 C  C     B ARG A 1 452 ? 4.404   11.195  8.881   0.50 55.00  ? 1322 ARG A C     1 
ATOM   6450 O  O     A ARG A 1 452 ? 5.590   11.135  9.220   0.50 52.38  ? 1322 ARG A O     1 
ATOM   6451 O  O     B ARG A 1 452 ? 5.567   11.169  9.280   0.50 52.10  ? 1322 ARG A O     1 
ATOM   6452 C  CB    A ARG A 1 452 ? 3.934   12.245  6.700   0.50 43.86  ? 1322 ARG A CB    1 
ATOM   6453 C  CB    B ARG A 1 452 ? 4.201   12.166  6.598   0.50 43.40  ? 1322 ARG A CB    1 
ATOM   6454 C  CG    A ARG A 1 452 ? 3.014   13.165  5.934   0.50 42.13  ? 1322 ARG A CG    1 
ATOM   6455 C  CG    B ARG A 1 452 ? 3.715   13.240  5.614   0.50 40.52  ? 1322 ARG A CG    1 
ATOM   6456 C  CD    A ARG A 1 452 ? 3.047   12.853  4.453   0.50 28.82  ? 1322 ARG A CD    1 
ATOM   6457 C  CD    B ARG A 1 452 ? 2.250   13.061  5.181   0.50 34.00  ? 1322 ARG A CD    1 
ATOM   6458 N  NE    A ARG A 1 452 ? 2.676   11.465  4.188   0.50 31.12  ? 1322 ARG A NE    1 
ATOM   6459 N  NE    B ARG A 1 452 ? 2.000   11.787  4.505   0.50 30.86  ? 1322 ARG A NE    1 
ATOM   6460 C  CZ    A ARG A 1 452 ? 3.542   10.463  4.063   0.50 32.65  ? 1322 ARG A CZ    1 
ATOM   6461 C  CZ    B ARG A 1 452 ? 0.801   11.366  4.109   0.50 23.28  ? 1322 ARG A CZ    1 
ATOM   6462 N  NH1   A ARG A 1 452 ? 4.847   10.687  4.174   0.50 26.07  ? 1322 ARG A NH1   1 
ATOM   6463 N  NH1   B ARG A 1 452 ? -0.276  12.103  4.318   0.50 19.09  ? 1322 ARG A NH1   1 
ATOM   6464 N  NH2   A ARG A 1 452 ? 3.102   9.232   3.830   0.50 21.35  ? 1322 ARG A NH2   1 
ATOM   6465 N  NH2   B ARG A 1 452 ? 0.672   10.197  3.506   0.50 30.99  ? 1322 ARG A NH2   1 
ATOM   6466 H  H     A ARG A 1 452 ? 5.383   13.513  8.684   0.50 52.52  ? 1322 ARG A H     1 
ATOM   6467 H  H     B ARG A 1 452 ? 5.396   13.552  8.604   0.50 52.46  ? 1322 ARG A H     1 
ATOM   6468 H  HA    A ARG A 1 452 ? 2.884   12.475  8.450   0.50 60.44  ? 1322 ARG A HA    1 
ATOM   6469 H  HA    B ARG A 1 452 ? 2.917   12.464  8.203   0.50 58.45  ? 1322 ARG A HA    1 
ATOM   6470 H  HB2   A ARG A 1 452 ? 4.844   12.438  6.426   0.50 52.63  ? 1322 ARG A HB2   1 
ATOM   6471 H  HB2   B ARG A 1 452 ? 5.163   12.100  6.499   0.50 52.08  ? 1322 ARG A HB2   1 
ATOM   6472 H  HB3   A ARG A 1 452 ? 3.705   11.332  6.465   0.50 52.63  ? 1322 ARG A HB3   1 
ATOM   6473 H  HB3   B ARG A 1 452 ? 3.793   11.327  6.330   0.50 52.08  ? 1322 ARG A HB3   1 
ATOM   6474 H  HG2   A ARG A 1 452 ? 2.104   13.048  6.250   0.50 50.55  ? 1322 ARG A HG2   1 
ATOM   6475 H  HG2   B ARG A 1 452 ? 3.797   14.110  6.035   0.50 48.62  ? 1322 ARG A HG2   1 
ATOM   6476 H  HG3   A ARG A 1 452 ? 3.299   14.083  6.059   0.50 50.55  ? 1322 ARG A HG3   1 
ATOM   6477 H  HG3   B ARG A 1 452 ? 4.267   13.207  4.817   0.50 48.62  ? 1322 ARG A HG3   1 
ATOM   6478 H  HD2   A ARG A 1 452 ? 2.418   13.429  3.991   0.50 34.58  ? 1322 ARG A HD2   1 
ATOM   6479 H  HD2   B ARG A 1 452 ? 1.683   13.098  5.967   0.50 40.81  ? 1322 ARG A HD2   1 
ATOM   6480 H  HD3   A ARG A 1 452 ? 3.945   12.997  4.116   0.50 34.58  ? 1322 ARG A HD3   1 
ATOM   6481 H  HD3   B ARG A 1 452 ? 2.013   13.775  4.569   0.50 40.81  ? 1322 ARG A HD3   1 
ATOM   6482 H  HE    A ARG A 1 452 ? 1.839   11.283  4.106   0.50 37.34  ? 1322 ARG A HE    1 
ATOM   6483 H  HE    B ARG A 1 452 ? 2.675   11.275  4.354   0.50 37.03  ? 1322 ARG A HE    1 
ATOM   6484 H  HH11  A ARG A 1 452 ? 5.135   11.482  4.328   0.50 31.28  ? 1322 ARG A HH11  1 
ATOM   6485 H  HH11  B ARG A 1 452 ? -0.206  12.866  4.710   0.50 22.90  ? 1322 ARG A HH11  1 
ATOM   6486 H  HH12  A ARG A 1 452 ? 5.404   10.036  4.092   0.50 31.28  ? 1322 ARG A HH12  1 
ATOM   6487 H  HH12  B ARG A 1 452 ? -1.046  11.822  4.058   0.50 22.90  ? 1322 ARG A HH12  1 
ATOM   6488 H  HH21  A ARG A 1 452 ? 2.258   9.084   3.756   0.50 25.63  ? 1322 ARG A HH21  1 
ATOM   6489 H  HH21  B ARG A 1 452 ? 1.365   9.707   3.365   0.50 37.19  ? 1322 ARG A HH21  1 
ATOM   6490 H  HH22  A ARG A 1 452 ? 3.661   8.584   3.746   0.50 25.63  ? 1322 ARG A HH22  1 
ATOM   6491 H  HH22  B ARG A 1 452 ? -0.104  9.927   3.251   0.50 37.19  ? 1322 ARG A HH22  1 
ATOM   6492 N  N     . THR A 1 453 ? 3.546   10.203  9.110   1.00 60.85  ? 1323 THR A N     1 
ATOM   6493 C  CA    . THR A 1 453 ? 3.976   8.946   9.692   1.00 56.38  ? 1323 THR A CA    1 
ATOM   6494 C  C     . THR A 1 453 ? 4.142   7.967   8.542   1.00 67.21  ? 1323 THR A C     1 
ATOM   6495 O  O     . THR A 1 453 ? 3.597   8.170   7.456   1.00 58.47  ? 1323 THR A O     1 
ATOM   6496 C  CB    . THR A 1 453 ? 2.968   8.412   10.719  1.00 49.26  ? 1323 THR A CB    1 
ATOM   6497 O  OG1   . THR A 1 453 ? 1.669   8.332   10.123  1.00 42.03  ? 1323 THR A OG1   1 
ATOM   6498 C  CG2   . THR A 1 453 ? 2.913   9.332   11.936  1.00 47.71  ? 1323 THR A CG2   1 
ATOM   6499 H  H     . THR A 1 453 ? 2.706   10.240  8.932   1.00 73.03  ? 1323 THR A H     1 
ATOM   6500 H  HA    . THR A 1 453 ? 4.843   9.065   10.133  1.00 67.65  ? 1323 THR A HA    1 
ATOM   6501 H  HB    . THR A 1 453 ? 3.244   7.530   11.013  1.00 59.12  ? 1323 THR A HB    1 
ATOM   6502 H  HG1   . THR A 1 453 ? 1.128   8.047   10.669  1.00 50.43  ? 1323 THR A HG1   1 
ATOM   6503 H  HG21  . THR A 1 453 ? 2.643   10.214  11.669  1.00 57.25  ? 1323 THR A HG21  1 
ATOM   6504 H  HG22  . THR A 1 453 ? 2.281   8.993   12.575  1.00 57.25  ? 1323 THR A HG22  1 
ATOM   6505 H  HG23  . THR A 1 453 ? 3.778   9.382   12.349  1.00 57.25  ? 1323 THR A HG23  1 
ATOM   6506 N  N     . LYS A 1 454 ? 4.924   6.923   8.773   1.00 79.36  ? 1324 LYS A N     1 
ATOM   6507 C  CA    . LYS A 1 454 ? 5.161   5.903   7.768   1.00 83.38  ? 1324 LYS A CA    1 
ATOM   6508 C  C     . LYS A 1 454 ? 3.808   5.351   7.317   1.00 65.65  ? 1324 LYS A C     1 
ATOM   6509 O  O     . LYS A 1 454 ? 2.987   4.955   8.144   1.00 48.95  ? 1324 LYS A O     1 
ATOM   6510 C  CB    . LYS A 1 454 ? 6.032   4.802   8.382   1.00 99.12  ? 1324 LYS A CB    1 
ATOM   6511 C  CG    . LYS A 1 454 ? 6.403   3.626   7.484   1.00 107.36 ? 1324 LYS A CG    1 
ATOM   6512 C  CD    . LYS A 1 454 ? 7.017   4.019   6.144   1.00 114.44 ? 1324 LYS A CD    1 
ATOM   6513 C  CE    . LYS A 1 454 ? 7.387   2.753   5.373   1.00 118.27 ? 1324 LYS A CE    1 
ATOM   6514 N  NZ    . LYS A 1 454 ? 7.865   2.976   3.981   1.00 115.21 ? 1324 LYS A NZ    1 
ATOM   6515 H  H     . LYS A 1 454 ? 5.334   6.782   9.516   1.00 95.23  ? 1324 LYS A H     1 
ATOM   6516 H  HA    . LYS A 1 454 ? 5.625   6.289   6.997   1.00 100.05 ? 1324 LYS A HA    1 
ATOM   6517 H  HB2   . LYS A 1 454 ? 6.862   5.206   8.680   1.00 118.94 ? 1324 LYS A HB2   1 
ATOM   6518 H  HB3   . LYS A 1 454 ? 5.562   4.439   9.149   1.00 118.94 ? 1324 LYS A HB3   1 
ATOM   6519 H  HG2   . LYS A 1 454 ? 7.047   3.070   7.950   1.00 128.83 ? 1324 LYS A HG2   1 
ATOM   6520 H  HG3   . LYS A 1 454 ? 5.601   3.112   7.300   1.00 128.83 ? 1324 LYS A HG3   1 
ATOM   6521 H  HD2   . LYS A 1 454 ? 6.372   4.523   5.624   1.00 137.33 ? 1324 LYS A HD2   1 
ATOM   6522 H  HD3   . LYS A 1 454 ? 7.821   4.540   6.293   1.00 137.33 ? 1324 LYS A HD3   1 
ATOM   6523 H  HE2   . LYS A 1 454 ? 8.095   2.295   5.855   1.00 141.92 ? 1324 LYS A HE2   1 
ATOM   6524 H  HE3   . LYS A 1 454 ? 6.605   2.181   5.326   1.00 141.92 ? 1324 LYS A HE3   1 
ATOM   6525 H  HZ1   . LYS A 1 454 ? 8.594   3.486   3.988   1.00 138.25 ? 1324 LYS A HZ1   1 
ATOM   6526 H  HZ2   . LYS A 1 454 ? 8.061   2.196   3.598   1.00 138.25 ? 1324 LYS A HZ2   1 
ATOM   6527 H  HZ3   . LYS A 1 454 ? 7.233   3.382   3.504   1.00 138.25 ? 1324 LYS A HZ3   1 
ATOM   6528 N  N     . GLU A 1 455 ? 3.542   5.378   6.016   1.00 60.19  ? 1325 GLU A N     1 
ATOM   6529 C  CA    . GLU A 1 455 ? 2.351   4.716   5.487   1.00 55.84  ? 1325 GLU A CA    1 
ATOM   6530 C  C     . GLU A 1 455 ? 1.081   5.558   5.718   1.00 38.14  ? 1325 GLU A C     1 
ATOM   6531 O  O     . GLU A 1 455 ? -0.020  5.118   5.421   1.00 43.59  ? 1325 GLU A O     1 
ATOM   6532 C  CB    . GLU A 1 455 ? 2.223   3.304   6.112   1.00 62.72  ? 1325 GLU A CB    1 
ATOM   6533 C  CG    . GLU A 1 455 ? 0.971   2.485   5.764   1.00 82.73  ? 1325 GLU A CG    1 
ATOM   6534 C  CD    . GLU A 1 455 ? -0.286  2.990   6.463   1.00 96.92  ? 1325 GLU A CD    1 
ATOM   6535 O  OE1   . GLU A 1 455 ? -0.270  3.102   7.706   1.00 95.55  ? 1325 GLU A OE1   1 
ATOM   6536 O  OE2   . GLU A 1 455 ? -1.290  3.280   5.773   1.00 104.41 ? 1325 GLU A OE2   1 
ATOM   6537 H  H     . GLU A 1 455 ? 4.028   5.767   5.422   1.00 72.23  ? 1325 GLU A H     1 
ATOM   6538 H  HA    . GLU A 1 455 ? 2.459   4.604   4.520   1.00 67.00  ? 1325 GLU A HA    1 
ATOM   6539 H  HB2   . GLU A 1 455 ? 2.991   2.782   5.832   1.00 75.26  ? 1325 GLU A HB2   1 
ATOM   6540 H  HB3   . GLU A 1 455 ? 2.240   3.401   7.077   1.00 75.26  ? 1325 GLU A HB3   1 
ATOM   6541 H  HG2   . GLU A 1 455 ? 0.820   2.531   4.807   1.00 99.28  ? 1325 GLU A HG2   1 
ATOM   6542 H  HG3   . GLU A 1 455 ? 1.113   1.563   6.033   1.00 99.28  ? 1325 GLU A HG3   1 
ATOM   6543 N  N     . GLU A 1 456 ? 1.218   6.769   6.245   1.00 35.26  ? 1326 GLU A N     1 
ATOM   6544 C  CA    . GLU A 1 456 ? 0.033   7.599   6.467   1.00 38.38  ? 1326 GLU A CA    1 
ATOM   6545 C  C     . GLU A 1 456 ? -0.697  7.786   5.131   1.00 43.56  ? 1326 GLU A C     1 
ATOM   6546 O  O     . GLU A 1 456 ? -0.056  8.024   4.116   1.00 43.63  ? 1326 GLU A O     1 
ATOM   6547 C  CB    . GLU A 1 456 ? 0.426   8.960   7.044   1.00 34.45  ? 1326 GLU A CB    1 
ATOM   6548 C  CG    . GLU A 1 456 ? -0.742  9.887   7.350   1.00 32.28  ? 1326 GLU A CG    1 
ATOM   6549 C  CD    . GLU A 1 456 ? -0.291  11.130  8.092   1.00 37.63  ? 1326 GLU A CD    1 
ATOM   6550 O  OE1   . GLU A 1 456 ? 0.894   11.190  8.461   1.00 44.22  ? 1326 GLU A OE1   1 
ATOM   6551 O  OE2   . GLU A 1 456 ? -1.114  12.037  8.321   1.00 35.08  ? 1326 GLU A OE2   1 
ATOM   6552 H  H     . GLU A 1 456 ? 1.964   7.129   6.479   1.00 42.31  ? 1326 GLU A H     1 
ATOM   6553 H  HA    . GLU A 1 456 ? -0.571  7.153   7.097   1.00 46.06  ? 1326 GLU A HA    1 
ATOM   6554 H  HB2   . GLU A 1 456 ? 0.911   8.816   7.872   1.00 41.34  ? 1326 GLU A HB2   1 
ATOM   6555 H  HB3   . GLU A 1 456 ? 1.000   9.412   6.406   1.00 41.34  ? 1326 GLU A HB3   1 
ATOM   6556 H  HG2   . GLU A 1 456 ? -1.156  10.164  6.518   1.00 38.73  ? 1326 GLU A HG2   1 
ATOM   6557 H  HG3   . GLU A 1 456 ? -1.385  9.418   7.905   1.00 38.73  ? 1326 GLU A HG3   1 
ATOM   6558 N  N     . PRO A 1 457 ? -2.033  7.649   5.123   1.00 29.77  ? 1327 PRO A N     1 
ATOM   6559 C  CA    . PRO A 1 457 ? -2.829  7.902   3.911   1.00 30.41  ? 1327 PRO A CA    1 
ATOM   6560 C  C     . PRO A 1 457 ? -2.891  9.370   3.494   1.00 31.59  ? 1327 PRO A C     1 
ATOM   6561 O  O     . PRO A 1 457 ? -2.706  10.267  4.318   1.00 27.45  ? 1327 PRO A O     1 
ATOM   6562 C  CB    . PRO A 1 457 ? -4.232  7.449   4.316   1.00 30.31  ? 1327 PRO A CB    1 
ATOM   6563 C  CG    . PRO A 1 457 ? -4.247  7.569   5.812   1.00 42.17  ? 1327 PRO A CG    1 
ATOM   6564 C  CD    . PRO A 1 457 ? -2.870  7.143   6.223   1.00 33.75  ? 1327 PRO A CD    1 
ATOM   6565 H  HA    . PRO A 1 457 ? -2.508  7.356   3.163   1.00 36.50  ? 1327 PRO A HA    1 
ATOM   6566 H  HB2   . PRO A 1 457 ? -4.895  8.035   3.917   1.00 36.37  ? 1327 PRO A HB2   1 
ATOM   6567 H  HB3   . PRO A 1 457 ? -4.373  6.530   4.042   1.00 36.37  ? 1327 PRO A HB3   1 
ATOM   6568 H  HG2   . PRO A 1 457 ? -4.416  8.489   6.068   1.00 50.60  ? 1327 PRO A HG2   1 
ATOM   6569 H  HG3   . PRO A 1 457 ? -4.918  6.976   6.184   1.00 50.60  ? 1327 PRO A HG3   1 
ATOM   6570 H  HD2   . PRO A 1 457 ? -2.620  7.563   7.061   1.00 40.50  ? 1327 PRO A HD2   1 
ATOM   6571 H  HD3   . PRO A 1 457 ? -2.815  6.176   6.275   1.00 40.50  ? 1327 PRO A HD3   1 
ATOM   6572 N  N     . ALA A 1 458 ? -3.168  9.609   2.216   1.00 28.67  ? 1328 ALA A N     1 
ATOM   6573 C  CA    . ALA A 1 458 ? -3.451  10.955  1.739   1.00 23.59  ? 1328 ALA A CA    1 
ATOM   6574 C  C     . ALA A 1 458 ? -4.745  11.414  2.394   1.00 23.01  ? 1328 ALA A C     1 
ATOM   6575 O  O     . ALA A 1 458 ? -5.641  10.599  2.632   1.00 24.18  ? 1328 ALA A O     1 
ATOM   6576 C  CB    . ALA A 1 458 ? -3.595  10.958  0.201   1.00 21.07  ? 1328 ALA A CB    1 
ATOM   6577 H  H     . ALA A 1 458 ? -3.198  9.005   1.604   1.00 34.41  ? 1328 ALA A H     1 
ATOM   6578 H  HA    . ALA A 1 458 ? -2.727  11.564  1.996   1.00 28.31  ? 1328 ALA A HA    1 
ATOM   6579 H  HB1   . ALA A 1 458 ? -3.781  11.852  -0.093  1.00 25.29  ? 1328 ALA A HB1   1 
ATOM   6580 H  HB2   . ALA A 1 458 ? -2.775  10.648  -0.189  1.00 25.29  ? 1328 ALA A HB2   1 
ATOM   6581 H  HB3   . ALA A 1 458 ? -4.317  10.374  -0.045  1.00 25.29  ? 1328 ALA A HB3   1 
ATOM   6582 N  N     . HIS A 1 459 ? -4.848  12.710  2.690   1.00 19.72  ? 1329 HIS A N     1 
ATOM   6583 C  CA    . HIS A 1 459 ? -6.047  13.250  3.318   1.00 21.71  ? 1329 HIS A CA    1 
ATOM   6584 C  C     . HIS A 1 459 ? -6.919  13.967  2.313   1.00 25.04  ? 1329 HIS A C     1 
ATOM   6585 O  O     . HIS A 1 459 ? -6.435  14.447  1.289   1.00 24.67  ? 1329 HIS A O     1 
ATOM   6586 C  CB    . HIS A 1 459 ? -5.668  14.204  4.451   1.00 24.71  ? 1329 HIS A CB    1 
ATOM   6587 C  CG    . HIS A 1 459 ? -4.883  13.534  5.527   1.00 27.39  ? 1329 HIS A CG    1 
ATOM   6588 N  ND1   . HIS A 1 459 ? -5.446  12.624  6.393   1.00 32.56  ? 1329 HIS A ND1   1 
ATOM   6589 C  CD2   . HIS A 1 459 ? -3.567  13.599  5.841   1.00 28.76  ? 1329 HIS A CD2   1 
ATOM   6590 C  CE1   . HIS A 1 459 ? -4.515  12.171  7.214   1.00 39.82  ? 1329 HIS A CE1   1 
ATOM   6591 N  NE2   . HIS A 1 459 ? -3.369  12.746  6.901   1.00 32.92  ? 1329 HIS A NE2   1 
ATOM   6592 H  H     . HIS A 1 459 ? -4.236  13.294  2.536   1.00 23.67  ? 1329 HIS A H     1 
ATOM   6593 H  HA    . HIS A 1 459 ? -6.568  12.514  3.702   1.00 26.05  ? 1329 HIS A HA    1 
ATOM   6594 H  HB2   . HIS A 1 459 ? -5.129  14.925  4.091   1.00 29.65  ? 1329 HIS A HB2   1 
ATOM   6595 H  HB3   . HIS A 1 459 ? -6.478  14.560  4.849   1.00 29.65  ? 1329 HIS A HB3   1 
ATOM   6596 H  HD1   . HIS A 1 459 ? -6.274  12.393  6.403   1.00 39.08  ? 1329 HIS A HD1   1 
ATOM   6597 H  HD2   . HIS A 1 459 ? -2.923  14.126  5.426   1.00 34.51  ? 1329 HIS A HD2   1 
ATOM   6598 H  HE1   . HIS A 1 459 ? -4.646  11.555  7.898   1.00 47.79  ? 1329 HIS A HE1   1 
ATOM   6599 H  HE2   . HIS A 1 459 ? -2.618  12.612  7.298   1.00 39.50  ? 1329 HIS A HE2   1 
ATOM   6600 N  N     . TYR A 1 460 ? -8.212  14.026  2.612   1.00 22.89  ? 1330 TYR A N     1 
ATOM   6601 C  CA    . TYR A 1 460 ? -9.184  14.619  1.701   1.00 27.32  ? 1330 TYR A CA    1 
ATOM   6602 C  C     . TYR A 1 460 ? -10.079 15.588  2.461   1.00 27.06  ? 1330 TYR A C     1 
ATOM   6603 O  O     . TYR A 1 460 ? -10.256 15.450  3.668   1.00 26.12  ? 1330 TYR A O     1 
ATOM   6604 C  CB    . TYR A 1 460 ? -10.057 13.536  1.069   1.00 22.46  ? 1330 TYR A CB    1 
ATOM   6605 C  CG    . TYR A 1 460 ? -9.344  12.605  0.098   1.00 21.38  ? 1330 TYR A CG    1 
ATOM   6606 C  CD1   . TYR A 1 460 ? -9.464  12.774  -1.279  1.00 21.03  ? 1330 TYR A CD1   1 
ATOM   6607 C  CD2   . TYR A 1 460 ? -8.570  11.551  0.562   1.00 20.61  ? 1330 TYR A CD2   1 
ATOM   6608 C  CE1   . TYR A 1 460 ? -8.832  11.910  -2.169  1.00 18.71  ? 1330 TYR A CE1   1 
ATOM   6609 C  CE2   . TYR A 1 460 ? -7.928  10.690  -0.315  1.00 19.49  ? 1330 TYR A CE2   1 
ATOM   6610 C  CZ    . TYR A 1 460 ? -8.067  10.871  -1.681  1.00 20.27  ? 1330 TYR A CZ    1 
ATOM   6611 O  OH    . TYR A 1 460 ? -7.424  10.018  -2.554  1.00 21.76  ? 1330 TYR A OH    1 
ATOM   6612 H  H     . TYR A 1 460 ? -8.554  13.728  3.342   1.00 27.47  ? 1330 TYR A H     1 
ATOM   6613 H  HA    . TYR A 1 460 ? -8.719  15.107  0.989   1.00 32.79  ? 1330 TYR A HA    1 
ATOM   6614 H  HB2   . TYR A 1 460 ? -10.428 12.988  1.778   1.00 26.95  ? 1330 TYR A HB2   1 
ATOM   6615 H  HB3   . TYR A 1 460 ? -10.778 13.968  0.583   1.00 26.95  ? 1330 TYR A HB3   1 
ATOM   6616 H  HD1   . TYR A 1 460 ? -9.985  13.469  -1.611  1.00 25.24  ? 1330 TYR A HD1   1 
ATOM   6617 H  HD2   . TYR A 1 460 ? -8.480  11.420  1.478   1.00 24.73  ? 1330 TYR A HD2   1 
ATOM   6618 H  HE1   . TYR A 1 460 ? -8.919  12.038  -3.086  1.00 22.45  ? 1330 TYR A HE1   1 
ATOM   6619 H  HE2   . TYR A 1 460 ? -7.413  9.988   0.013   1.00 23.39  ? 1330 TYR A HE2   1 
ATOM   6620 H  HH    . TYR A 1 460 ? -7.686  9.250   -2.440  1.00 26.11  ? 1330 TYR A HH    1 
ATOM   6621 N  N     . CYS A 1 461 ? -10.670 16.535  1.740   1.00 23.36  ? 1331 CYS A N     1 
ATOM   6622 C  CA    . CYS A 1 461 ? -11.593 17.501  2.325   1.00 24.43  ? 1331 CYS A CA    1 
ATOM   6623 C  C     . CYS A 1 461 ? -12.889 16.800  2.736   1.00 29.56  ? 1331 CYS A C     1 
ATOM   6624 O  O     . CYS A 1 461 ? -13.537 16.157  1.916   1.00 28.38  ? 1331 CYS A O     1 
ATOM   6625 C  CB    . CYS A 1 461 ? -11.912 18.590  1.305   1.00 26.52  ? 1331 CYS A CB    1 
ATOM   6626 S  SG    . CYS A 1 461 ? -13.069 19.847  1.947   1.00 29.78  ? 1331 CYS A SG    1 
ATOM   6627 H  H     . CYS A 1 461 ? -10.550 16.640  0.895   1.00 28.03  ? 1331 CYS A H     1 
ATOM   6628 H  HA    . CYS A 1 461 ? -11.188 17.914  3.116   1.00 29.32  ? 1331 CYS A HA    1 
ATOM   6629 H  HB2   . CYS A 1 461 ? -11.089 19.040  1.056   1.00 31.82  ? 1331 CYS A HB2   1 
ATOM   6630 H  HB3   . CYS A 1 461 ? -12.317 18.182  0.524   1.00 31.82  ? 1331 CYS A HB3   1 
ATOM   6631 N  N     . SER A 1 462 ? -13.274 16.935  4.001   1.00 34.05  ? 1332 SER A N     1 
ATOM   6632 C  CA    . SER A 1 462 ? -14.458 16.244  4.506   1.00 33.89  ? 1332 SER A CA    1 
ATOM   6633 C  C     . SER A 1 462 ? -15.724 16.753  3.828   1.00 33.38  ? 1332 SER A C     1 
ATOM   6634 O  O     . SER A 1 462 ? -16.763 16.095  3.868   1.00 36.62  ? 1332 SER A O     1 
ATOM   6635 C  CB    . SER A 1 462 ? -14.582 16.427  6.016   1.00 39.72  ? 1332 SER A CB    1 
ATOM   6636 O  OG    . SER A 1 462 ? -14.683 17.801  6.331   1.00 52.04  ? 1332 SER A OG    1 
ATOM   6637 H  H     . SER A 1 462 ? -12.869 17.419  4.586   1.00 40.86  ? 1332 SER A H     1 
ATOM   6638 H  HA    . SER A 1 462 ? -14.375 15.286  4.320   1.00 40.67  ? 1332 SER A HA    1 
ATOM   6639 H  HB2   . SER A 1 462 ? -15.379 15.970  6.328   1.00 47.67  ? 1332 SER A HB2   1 
ATOM   6640 H  HB3   . SER A 1 462 ? -13.795 16.059  6.448   1.00 47.67  ? 1332 SER A HB3   1 
ATOM   6641 H  HG    . SER A 1 462 ? -14.656 18.249  5.644   1.00 62.44  ? 1332 SER A HG    1 
ATOM   6642 N  N     . ILE A 1 463 ? -15.633 17.920  3.202   1.00 28.89  ? 1333 ILE A N     1 
ATOM   6643 C  CA    . ILE A 1 463 ? -16.790 18.531  2.561   1.00 33.87  ? 1333 ILE A CA    1 
ATOM   6644 C  C     . ILE A 1 463 ? -16.870 18.204  1.074   1.00 37.95  ? 1333 ILE A C     1 
ATOM   6645 O  O     . ILE A 1 463 ? -17.836 17.584  0.629   1.00 35.85  ? 1333 ILE A O     1 
ATOM   6646 C  CB    . ILE A 1 463 ? -16.791 20.065  2.724   1.00 39.75  ? 1333 ILE A CB    1 
ATOM   6647 C  CG1   . ILE A 1 463 ? -16.641 20.453  4.198   1.00 59.12  ? 1333 ILE A CG1   1 
ATOM   6648 C  CG2   . ILE A 1 463 ? -18.062 20.659  2.136   1.00 37.52  ? 1333 ILE A CG2   1 
ATOM   6649 C  CD1   . ILE A 1 463 ? -17.334 19.518  5.158   1.00 73.99  ? 1333 ILE A CD1   1 
ATOM   6650 H  H     . ILE A 1 463 ? -14.910 18.380  3.134   1.00 34.67  ? 1333 ILE A H     1 
ATOM   6651 H  HA    . ILE A 1 463 ? -17.603 18.186  2.986   1.00 40.65  ? 1333 ILE A HA    1 
ATOM   6652 H  HB    . ILE A 1 463 ? -16.033 20.423  2.236   1.00 47.70  ? 1333 ILE A HB    1 
ATOM   6653 H  HG12  . ILE A 1 463 ? -15.698 20.462  4.423   1.00 70.94  ? 1333 ILE A HG12  1 
ATOM   6654 H  HG13  . ILE A 1 463 ? -17.017 21.339  4.326   1.00 70.94  ? 1333 ILE A HG13  1 
ATOM   6655 H  HG21  . ILE A 1 463 ? -18.042 21.612  2.247   1.00 45.02  ? 1333 ILE A HG21  1 
ATOM   6656 H  HG22  . ILE A 1 463 ? -18.106 20.439  1.202   1.00 45.02  ? 1333 ILE A HG22  1 
ATOM   6657 H  HG23  . ILE A 1 463 ? -18.821 20.291  2.595   1.00 45.02  ? 1333 ILE A HG23  1 
ATOM   6658 H  HD11  . ILE A 1 463 ? -18.273 19.506  4.959   1.00 88.78  ? 1333 ILE A HD11  1 
ATOM   6659 H  HD12  . ILE A 1 463 ? -16.966 18.637  5.056   1.00 88.78  ? 1333 ILE A HD12  1 
ATOM   6660 H  HD13  . ILE A 1 463 ? -17.193 19.830  6.055   1.00 88.78  ? 1333 ILE A HD13  1 
ATOM   6661 N  N     . CYS A 1 464 ? -15.871 18.622  0.299   1.00 28.13  ? 1334 CYS A N     1 
ATOM   6662 C  CA    . CYS A 1 464 ? -15.928 18.418  -1.153  1.00 26.24  ? 1334 CYS A CA    1 
ATOM   6663 C  C     . CYS A 1 464 ? -15.180 17.169  -1.639  1.00 22.68  ? 1334 CYS A C     1 
ATOM   6664 O  O     . CYS A 1 464 ? -15.277 16.803  -2.808  1.00 28.50  ? 1334 CYS A O     1 
ATOM   6665 C  CB    . CYS A 1 464 ? -15.394 19.653  -1.881  1.00 32.06  ? 1334 CYS A CB    1 
ATOM   6666 S  SG    . CYS A 1 464 ? -13.609 19.864  -1.766  1.00 28.09  ? 1334 CYS A SG    1 
ATOM   6667 H  H     . CYS A 1 464 ? -15.162 19.019  0.580   1.00 33.76  ? 1334 CYS A H     1 
ATOM   6668 H  HA    . CYS A 1 464 ? -16.867 18.312  -1.411  1.00 31.49  ? 1334 CYS A HA    1 
ATOM   6669 H  HB2   . CYS A 1 464 ? -15.623 19.584  -2.821  1.00 38.47  ? 1334 CYS A HB2   1 
ATOM   6670 H  HB3   . CYS A 1 464 ? -15.809 20.443  -1.500  1.00 38.47  ? 1334 CYS A HB3   1 
ATOM   6671 N  N     . GLU A 1 465 ? -14.422 16.548  -0.742  1.00 25.21  ? 1335 GLU A N     1 
ATOM   6672 C  CA    . GLU A 1 465 ? -13.710 15.297  -1.021  1.00 22.94  ? 1335 GLU A CA    1 
ATOM   6673 C  C     . GLU A 1 465 ? -12.517 15.439  -1.970  1.00 20.17  ? 1335 GLU A C     1 
ATOM   6674 O  O     . GLU A 1 465 ? -12.017 14.449  -2.482  1.00 22.04  ? 1335 GLU A O     1 
ATOM   6675 C  CB    . GLU A 1 465 ? -14.670 14.233  -1.544  1.00 30.99  ? 1335 GLU A CB    1 
ATOM   6676 C  CG    . GLU A 1 465 ? -15.696 13.810  -0.514  1.00 35.42  ? 1335 GLU A CG    1 
ATOM   6677 C  CD    . GLU A 1 465 ? -16.414 12.539  -0.910  1.00 35.59  ? 1335 GLU A CD    1 
ATOM   6678 O  OE1   . GLU A 1 465 ? -17.170 12.572  -1.906  1.00 40.61  ? 1335 GLU A OE1   1 
ATOM   6679 O  OE2   . GLU A 1 465 ? -16.207 11.511  -0.235  1.00 36.94  ? 1335 GLU A OE2   1 
ATOM   6680 H  H     . GLU A 1 465 ? -14.299 16.837  0.058   1.00 30.25  ? 1335 GLU A H     1 
ATOM   6681 H  HA    . GLU A 1 465 ? -13.354 14.962  -0.171  1.00 27.53  ? 1335 GLU A HA    1 
ATOM   6682 H  HB2   . GLU A 1 465 ? -15.144 14.587  -2.312  1.00 37.19  ? 1335 GLU A HB2   1 
ATOM   6683 H  HB3   . GLU A 1 465 ? -14.161 13.448  -1.801  1.00 37.19  ? 1335 GLU A HB3   1 
ATOM   6684 H  HG2   . GLU A 1 465 ? -15.250 13.653  0.333   1.00 42.51  ? 1335 GLU A HG2   1 
ATOM   6685 H  HG3   . GLU A 1 465 ? -16.358 14.513  -0.417  1.00 42.51  ? 1335 GLU A HG3   1 
ATOM   6686 N  N     . VAL A 1 466 ? -12.042 16.661  -2.177  1.00 22.89  ? 1336 VAL A N     1 
ATOM   6687 C  CA    . VAL A 1 466 ? -10.833 16.853  -2.975  1.00 22.25  ? 1336 VAL A CA    1 
ATOM   6688 C  C     . VAL A 1 466 ? -9.620  16.416  -2.153  1.00 21.12  ? 1336 VAL A C     1 
ATOM   6689 O  O     . VAL A 1 466 ? -9.626  16.520  -0.934  1.00 20.98  ? 1336 VAL A O     1 
ATOM   6690 C  CB    . VAL A 1 466 ? -10.652 18.323  -3.404  1.00 21.05  ? 1336 VAL A CB    1 
ATOM   6691 C  CG1   . VAL A 1 466 ? -10.295 19.184  -2.208  1.00 19.47  ? 1336 VAL A CG1   1 
ATOM   6692 C  CG2   . VAL A 1 466 ? -9.581  18.437  -4.491  1.00 26.73  ? 1336 VAL A CG2   1 
ATOM   6693 H  H     . VAL A 1 466 ? -12.393 17.385  -1.873  1.00 27.46  ? 1336 VAL A H     1 
ATOM   6694 H  HA    . VAL A 1 466 ? -10.880 16.297  -3.780  1.00 26.70  ? 1336 VAL A HA    1 
ATOM   6695 H  HB    . VAL A 1 466 ? -11.497 18.654  -3.774  1.00 25.26  ? 1336 VAL A HB    1 
ATOM   6696 H  HG11  . VAL A 1 466 ? -10.188 20.093  -2.499  1.00 23.36  ? 1336 VAL A HG11  1 
ATOM   6697 H  HG12  . VAL A 1 466 ? -11.002 19.128  -1.561  1.00 23.36  ? 1336 VAL A HG12  1 
ATOM   6698 H  HG13  . VAL A 1 466 ? -9.475  18.863  -1.826  1.00 23.36  ? 1336 VAL A HG13  1 
ATOM   6699 H  HG21  . VAL A 1 466 ? -9.487  19.359  -4.741  1.00 32.08  ? 1336 VAL A HG21  1 
ATOM   6700 H  HG22  . VAL A 1 466 ? -8.749  18.104  -4.146  1.00 32.08  ? 1336 VAL A HG22  1 
ATOM   6701 H  HG23  . VAL A 1 466 ? -9.852  17.917  -5.252  1.00 32.08  ? 1336 VAL A HG23  1 
ATOM   6702 N  N     . GLU A 1 467 ? -8.583  15.912  -2.811  1.00 18.68  ? 1337 GLU A N     1 
ATOM   6703 C  CA    . GLU A 1 467 ? -7.347  15.603  -2.098  1.00 22.15  ? 1337 GLU A CA    1 
ATOM   6704 C  C     . GLU A 1 467 ? -6.778  16.913  -1.544  1.00 28.09  ? 1337 GLU A C     1 
ATOM   6705 O  O     . GLU A 1 467 ? -6.808  17.937  -2.220  1.00 23.42  ? 1337 GLU A O     1 
ATOM   6706 C  CB    . GLU A 1 467 ? -6.326  14.948  -3.031  1.00 18.95  ? 1337 GLU A CB    1 
ATOM   6707 C  CG    . GLU A 1 467 ? -4.958  14.756  -2.397  1.00 19.18  ? 1337 GLU A CG    1 
ATOM   6708 C  CD    . GLU A 1 467 ? -3.928  14.192  -3.358  1.00 20.51  ? 1337 GLU A CD    1 
ATOM   6709 O  OE1   . GLU A 1 467 ? -4.220  14.078  -4.567  1.00 20.08  ? 1337 GLU A OE1   1 
ATOM   6710 O  OE2   . GLU A 1 467 ? -2.815  13.861  -2.900  1.00 21.50  ? 1337 GLU A OE2   1 
ATOM   6711 H  H     . GLU A 1 467 ? -8.566  15.742  -3.654  1.00 22.42  ? 1337 GLU A H     1 
ATOM   6712 H  HA    . GLU A 1 467 ? -7.533  14.995  -1.352  1.00 26.58  ? 1337 GLU A HA    1 
ATOM   6713 H  HB2   . GLU A 1 467 ? -6.657  14.075  -3.295  1.00 22.74  ? 1337 GLU A HB2   1 
ATOM   6714 H  HB3   . GLU A 1 467 ? -6.214  15.508  -3.815  1.00 22.74  ? 1337 GLU A HB3   1 
ATOM   6715 H  HG2   . GLU A 1 467 ? -4.634  15.614  -2.081  1.00 23.02  ? 1337 GLU A HG2   1 
ATOM   6716 H  HG3   . GLU A 1 467 ? -5.041  14.140  -1.652  1.00 23.02  ? 1337 GLU A HG3   1 
ATOM   6717 N  N     . VAL A 1 468 ? -6.267  16.879  -0.318  1.00 19.70  ? 1338 VAL A N     1 
ATOM   6718 C  CA    . VAL A 1 468 ? -5.668  18.065  0.303   1.00 20.65  ? 1338 VAL A CA    1 
ATOM   6719 C  C     . VAL A 1 468 ? -4.213  17.730  0.603   1.00 24.72  ? 1338 VAL A C     1 
ATOM   6720 O  O     . VAL A 1 468 ? -3.907  16.957  1.508   1.00 27.80  ? 1338 VAL A O     1 
ATOM   6721 C  CB    . VAL A 1 468 ? -6.413  18.487  1.582   1.00 24.80  ? 1338 VAL A CB    1 
ATOM   6722 C  CG1   . VAL A 1 468 ? -5.728  19.694  2.233   1.00 24.72  ? 1338 VAL A CG1   1 
ATOM   6723 C  CG2   . VAL A 1 468 ? -7.872  18.798  1.267   1.00 21.27  ? 1338 VAL A CG2   1 
ATOM   6724 H  H     . VAL A 1 468 ? -6.253  16.179  0.181   1.00 23.64  ? 1338 VAL A H     1 
ATOM   6725 H  HA    . VAL A 1 468 ? -5.691  18.812  -0.330  1.00 24.78  ? 1338 VAL A HA    1 
ATOM   6726 H  HB    . VAL A 1 468 ? -6.392  17.745  2.223   1.00 29.76  ? 1338 VAL A HB    1 
ATOM   6727 H  HG11  . VAL A 1 468 ? -6.210  19.936  3.027   1.00 29.66  ? 1338 VAL A HG11  1 
ATOM   6728 H  HG12  . VAL A 1 468 ? -4.825  19.457  2.458   1.00 29.66  ? 1338 VAL A HG12  1 
ATOM   6729 H  HG13  . VAL A 1 468 ? -5.729  20.426  1.612   1.00 29.66  ? 1338 VAL A HG13  1 
ATOM   6730 H  HG21  . VAL A 1 468 ? -8.024  18.664  0.329   1.00 25.52  ? 1338 VAL A HG21  1 
ATOM   6731 H  HG22  . VAL A 1 468 ? -8.433  18.209  1.777   1.00 25.52  ? 1338 VAL A HG22  1 
ATOM   6732 H  HG23  . VAL A 1 468 ? -8.054  19.710  1.503   1.00 25.52  ? 1338 VAL A HG23  1 
ATOM   6733 N  N     . PHE A 1 469 ? -3.325  18.290  -0.206  1.00 22.64  ? 1339 PHE A N     1 
ATOM   6734 C  CA    . PHE A 1 469 ? -1.911  17.939  -0.170  1.00 21.95  ? 1339 PHE A CA    1 
ATOM   6735 C  C     . PHE A 1 469 ? -1.105  18.956  0.640   1.00 24.44  ? 1339 PHE A C     1 
ATOM   6736 O  O     . PHE A 1 469 ? -1.199  20.161  0.408   1.00 22.37  ? 1339 PHE A O     1 
ATOM   6737 C  CB    . PHE A 1 469 ? -1.374  17.864  -1.604  1.00 20.16  ? 1339 PHE A CB    1 
ATOM   6738 C  CG    . PHE A 1 469 ? 0.111   17.585  -1.696  1.00 20.81  ? 1339 PHE A CG    1 
ATOM   6739 C  CD1   . PHE A 1 469 ? 0.615   16.312  -1.480  1.00 23.32  ? 1339 PHE A CD1   1 
ATOM   6740 C  CD2   . PHE A 1 469 ? 0.995   18.597  -2.018  1.00 20.57  ? 1339 PHE A CD2   1 
ATOM   6741 C  CE1   . PHE A 1 469 ? 1.982   16.057  -1.584  1.00 23.99  ? 1339 PHE A CE1   1 
ATOM   6742 C  CE2   . PHE A 1 469 ? 2.363   18.347  -2.125  1.00 22.13  ? 1339 PHE A CE2   1 
ATOM   6743 C  CZ    . PHE A 1 469 ? 2.855   17.085  -1.904  1.00 21.26  ? 1339 PHE A CZ    1 
ATOM   6744 H  H     . PHE A 1 469 ? -3.518  18.885  -0.796  1.00 27.17  ? 1339 PHE A H     1 
ATOM   6745 H  HA    . PHE A 1 469 ? -1.805  17.058  0.247   1.00 26.34  ? 1339 PHE A HA    1 
ATOM   6746 H  HB2   . PHE A 1 469 ? -1.837  17.154  -2.073  1.00 24.19  ? 1339 PHE A HB2   1 
ATOM   6747 H  HB3   . PHE A 1 469 ? -1.543  18.712  -2.044  1.00 24.19  ? 1339 PHE A HB3   1 
ATOM   6748 H  HD1   . PHE A 1 469 ? 0.034   15.618  -1.267  1.00 27.99  ? 1339 PHE A HD1   1 
ATOM   6749 H  HD2   . PHE A 1 469 ? 0.672   19.456  -2.172  1.00 24.68  ? 1339 PHE A HD2   1 
ATOM   6750 H  HE1   . PHE A 1 469 ? 2.309   15.200  -1.432  1.00 28.78  ? 1339 PHE A HE1   1 
ATOM   6751 H  HE2   . PHE A 1 469 ? 2.945   19.040  -2.338  1.00 26.56  ? 1339 PHE A HE2   1 
ATOM   6752 H  HZ    . PHE A 1 469 ? 3.768   16.920  -1.970  1.00 25.51  ? 1339 PHE A HZ    1 
ATOM   6753 N  N     . ASP A 1 470 ? -0.331  18.445  1.594   1.00 25.49  ? 1340 ASP A N     1 
ATOM   6754 C  CA    . ASP A 1 470 ? 0.677   19.219  2.329   1.00 27.05  ? 1340 ASP A CA    1 
ATOM   6755 C  C     . ASP A 1 470 ? 0.100   20.131  3.403   1.00 32.44  ? 1340 ASP A C     1 
ATOM   6756 O  O     . ASP A 1 470 ? 0.369   19.944  4.586   1.00 36.71  ? 1340 ASP A O     1 
ATOM   6757 C  CB    . ASP A 1 470 ? 1.557   20.041  1.380   1.00 25.41  ? 1340 ASP A CB    1 
ATOM   6758 C  CG    . ASP A 1 470 ? 2.752   20.671  2.095   1.00 34.00  ? 1340 ASP A CG    1 
ATOM   6759 O  OD1   . ASP A 1 470 ? 3.146   20.160  3.164   1.00 35.80  ? 1340 ASP A OD1   1 
ATOM   6760 O  OD2   . ASP A 1 470 ? 3.304   21.668  1.585   1.00 30.74  ? 1340 ASP A OD2   1 
ATOM   6761 H  H     . ASP A 1 470 ? -0.371  17.623  1.844   1.00 30.58  ? 1340 ASP A H     1 
ATOM   6762 H  HA    . ASP A 1 470 ? 1.267   18.583  2.785   1.00 32.46  ? 1340 ASP A HA    1 
ATOM   6763 H  HB2   . ASP A 1 470 ? 1.897   19.461  0.680   1.00 30.49  ? 1340 ASP A HB2   1 
ATOM   6764 H  HB3   . ASP A 1 470 ? 1.027   20.754  0.993   1.00 30.49  ? 1340 ASP A HB3   1 
ATOM   6765 N  N     . LEU A 1 471 ? -0.673  21.131  2.998   1.00 28.10  ? 1341 LEU A N     1 
ATOM   6766 C  CA    . LEU A 1 471 ? -1.250  22.064  3.966   1.00 24.23  ? 1341 LEU A CA    1 
ATOM   6767 C  C     . LEU A 1 471 ? -2.707  21.699  4.244   1.00 26.35  ? 1341 LEU A C     1 
ATOM   6768 O  O     . LEU A 1 471 ? -3.570  21.813  3.373   1.00 26.20  ? 1341 LEU A O     1 
ATOM   6769 C  CB    . LEU A 1 471 ? -1.133  23.492  3.438   1.00 30.70  ? 1341 LEU A CB    1 
ATOM   6770 C  CG    . LEU A 1 471 ? 0.323   23.953  3.317   1.00 36.62  ? 1341 LEU A CG    1 
ATOM   6771 C  CD1   . LEU A 1 471 ? 0.468   25.096  2.329   1.00 37.93  ? 1341 LEU A CD1   1 
ATOM   6772 C  CD2   . LEU A 1 471 ? 0.854   24.343  4.693   1.00 35.01  ? 1341 LEU A CD2   1 
ATOM   6773 H  H     . LEU A 1 471 ? -0.880  21.292  2.179   1.00 33.72  ? 1341 LEU A H     1 
ATOM   6774 H  HA    . LEU A 1 471 ? -0.752  22.006  4.808   1.00 29.08  ? 1341 LEU A HA    1 
ATOM   6775 H  HB2   . LEU A 1 471 ? -1.538  23.539  2.557   1.00 36.84  ? 1341 LEU A HB2   1 
ATOM   6776 H  HB3   . LEU A 1 471 ? -1.590  24.094  4.046   1.00 36.84  ? 1341 LEU A HB3   1 
ATOM   6777 H  HG    . LEU A 1 471 ? 0.859   23.212  2.992   1.00 43.94  ? 1341 LEU A HG    1 
ATOM   6778 H  HD11  . LEU A 1 471 ? 0.167   24.803  1.466   1.00 45.52  ? 1341 LEU A HD11  1 
ATOM   6779 H  HD12  . LEU A 1 471 ? -0.064  25.837  2.628   1.00 45.52  ? 1341 LEU A HD12  1 
ATOM   6780 H  HD13  . LEU A 1 471 ? 1.392   25.354  2.283   1.00 45.52  ? 1341 LEU A HD13  1 
ATOM   6781 H  HD21  . LEU A 1 471 ? 0.804   23.581  5.274   1.00 42.02  ? 1341 LEU A HD21  1 
ATOM   6782 H  HD22  . LEU A 1 471 ? 1.766   24.630  4.606   1.00 42.02  ? 1341 LEU A HD22  1 
ATOM   6783 H  HD23  . LEU A 1 471 ? 0.318   25.058  5.043   1.00 42.02  ? 1341 LEU A HD23  1 
ATOM   6784 N  N     . LEU A 1 472 ? -2.962  21.239  5.459   1.00 23.87  ? 1342 LEU A N     1 
ATOM   6785 C  CA    . LEU A 1 472 ? -4.282  20.757  5.852   1.00 29.08  ? 1342 LEU A CA    1 
ATOM   6786 C  C     . LEU A 1 472 ? -4.990  21.803  6.705   1.00 32.66  ? 1342 LEU A C     1 
ATOM   6787 O  O     . LEU A 1 472 ? -4.436  22.259  7.692   1.00 32.50  ? 1342 LEU A O     1 
ATOM   6788 C  CB    . LEU A 1 472 ? -4.132  19.485  6.682   1.00 25.35  ? 1342 LEU A CB    1 
ATOM   6789 C  CG    . LEU A 1 472 ? -3.136  18.461  6.138   1.00 29.06  ? 1342 LEU A CG    1 
ATOM   6790 C  CD1   . LEU A 1 472 ? -3.064  17.251  7.058   1.00 34.11  ? 1342 LEU A CD1   1 
ATOM   6791 C  CD2   . LEU A 1 472 ? -3.529  18.052  4.733   1.00 25.98  ? 1342 LEU A CD2   1 
ATOM   6792 H  H     . LEU A 1 472 ? -2.378  21.193  6.088   1.00 28.65  ? 1342 LEU A H     1 
ATOM   6793 H  HA    . LEU A 1 472 ? -4.825  20.565  5.059   1.00 34.90  ? 1342 LEU A HA    1 
ATOM   6794 H  HB2   . LEU A 1 472 ? -3.838  19.732  7.573   1.00 30.42  ? 1342 LEU A HB2   1 
ATOM   6795 H  HB3   . LEU A 1 472 ? -4.997  19.049  6.735   1.00 30.42  ? 1342 LEU A HB3   1 
ATOM   6796 H  HG    . LEU A 1 472 ? -2.255  18.864  6.100   1.00 34.87  ? 1342 LEU A HG    1 
ATOM   6797 H  HD11  . LEU A 1 472 ? -3.934  16.848  7.113   1.00 40.93  ? 1342 LEU A HD11  1 
ATOM   6798 H  HD12  . LEU A 1 472 ? -2.434  16.622  6.698   1.00 40.93  ? 1342 LEU A HD12  1 
ATOM   6799 H  HD13  . LEU A 1 472 ? -2.780  17.538  7.929   1.00 40.93  ? 1342 LEU A HD13  1 
ATOM   6800 H  HD21  . LEU A 1 472 ? -2.895  17.410  4.406   1.00 31.18  ? 1342 LEU A HD21  1 
ATOM   6801 H  HD22  . LEU A 1 472 ? -4.407  17.664  4.755   1.00 31.18  ? 1342 LEU A HD22  1 
ATOM   6802 H  HD23  . LEU A 1 472 ? -3.529  18.830  4.170   1.00 31.18  ? 1342 LEU A HD23  1 
ATOM   6803 N  N     . PHE A 1 473 ? -6.215  22.169  6.342   1.00 26.90  ? 1343 PHE A N     1 
ATOM   6804 C  CA    . PHE A 1 473 ? -6.997  23.094  7.163   1.00 25.53  ? 1343 PHE A CA    1 
ATOM   6805 C  C     . PHE A 1 473 ? -7.921  22.275  8.043   1.00 31.21  ? 1343 PHE A C     1 
ATOM   6806 O  O     . PHE A 1 473 ? -8.844  21.633  7.547   1.00 29.57  ? 1343 PHE A O     1 
ATOM   6807 C  CB    . PHE A 1 473 ? -7.789  24.036  6.263   1.00 28.38  ? 1343 PHE A CB    1 
ATOM   6808 C  CG    . PHE A 1 473 ? -6.921  24.904  5.416   1.00 32.23  ? 1343 PHE A CG    1 
ATOM   6809 C  CD1   . PHE A 1 473 ? -6.678  26.220  5.773   1.00 33.84  ? 1343 PHE A CD1   1 
ATOM   6810 C  CD2   . PHE A 1 473 ? -6.314  24.393  4.279   1.00 29.14  ? 1343 PHE A CD2   1 
ATOM   6811 C  CE1   . PHE A 1 473 ? -5.863  27.022  4.997   1.00 37.82  ? 1343 PHE A CE1   1 
ATOM   6812 C  CE2   . PHE A 1 473 ? -5.490  25.185  3.502   1.00 30.75  ? 1343 PHE A CE2   1 
ATOM   6813 C  CZ    . PHE A 1 473 ? -5.264  26.505  3.859   1.00 34.12  ? 1343 PHE A CZ    1 
ATOM   6814 H  H     . PHE A 1 473 ? -6.616  21.899  5.630   1.00 32.28  ? 1343 PHE A H     1 
ATOM   6815 H  HA    . PHE A 1 473 ? -6.400  23.623  7.732   1.00 30.63  ? 1343 PHE A HA    1 
ATOM   6816 H  HB2   . PHE A 1 473 ? -8.352  23.510  5.674   1.00 34.05  ? 1343 PHE A HB2   1 
ATOM   6817 H  HB3   . PHE A 1 473 ? -8.338  24.613  6.817   1.00 34.05  ? 1343 PHE A HB3   1 
ATOM   6818 H  HD1   . PHE A 1 473 ? -7.078  26.572  6.535   1.00 40.60  ? 1343 PHE A HD1   1 
ATOM   6819 H  HD2   . PHE A 1 473 ? -6.462  23.508  4.036   1.00 34.97  ? 1343 PHE A HD2   1 
ATOM   6820 H  HE1   . PHE A 1 473 ? -5.711  27.906  5.241   1.00 45.38  ? 1343 PHE A HE1   1 
ATOM   6821 H  HE2   . PHE A 1 473 ? -5.094  24.836  2.737   1.00 36.91  ? 1343 PHE A HE2   1 
ATOM   6822 H  HZ    . PHE A 1 473 ? -4.715  27.043  3.336   1.00 40.94  ? 1343 PHE A HZ    1 
ATOM   6823 N  N     . VAL A 1 474 ? -7.668  22.280  9.348   1.00 30.49  ? 1344 VAL A N     1 
ATOM   6824 C  CA    . VAL A 1 474 ? -8.371  21.368  10.229  1.00 28.09  ? 1344 VAL A CA    1 
ATOM   6825 C  C     . VAL A 1 474 ? -9.104  22.119  11.330  1.00 36.94  ? 1344 VAL A C     1 
ATOM   6826 O  O     . VAL A 1 474 ? -8.612  23.112  11.860  1.00 34.69  ? 1344 VAL A O     1 
ATOM   6827 C  CB    . VAL A 1 474 ? -7.402  20.324  10.840  1.00 34.36  ? 1344 VAL A CB    1 
ATOM   6828 C  CG1   . VAL A 1 474 ? -6.622  19.627  9.721   1.00 34.47  ? 1344 VAL A CG1   1 
ATOM   6829 C  CG2   . VAL A 1 474 ? -6.443  20.969  11.831  1.00 31.35  ? 1344 VAL A CG2   1 
ATOM   6830 H  H     . VAL A 1 474 ? -7.101  22.794  9.739   1.00 36.58  ? 1344 VAL A H     1 
ATOM   6831 H  HA    . VAL A 1 474 ? -9.041  20.881  9.705   1.00 33.70  ? 1344 VAL A HA    1 
ATOM   6832 H  HB    . VAL A 1 474 ? -7.922  19.644  11.317  1.00 41.23  ? 1344 VAL A HB    1 
ATOM   6833 H  HG11  . VAL A 1 474 ? -6.026  18.983  10.110  1.00 41.36  ? 1344 VAL A HG11  1 
ATOM   6834 H  HG12  . VAL A 1 474 ? -7.243  19.187  9.135   1.00 41.36  ? 1344 VAL A HG12  1 
ATOM   6835 H  HG13  . VAL A 1 474 ? -6.121  20.285  9.233   1.00 41.36  ? 1344 VAL A HG13  1 
ATOM   6836 H  HG21  . VAL A 1 474 ? -5.860  20.294  12.187  1.00 37.63  ? 1344 VAL A HG21  1 
ATOM   6837 H  HG22  . VAL A 1 474 ? -5.928  21.640  11.375  1.00 37.63  ? 1344 VAL A HG22  1 
ATOM   6838 H  HG23  . VAL A 1 474 ? -6.950  21.372  12.540  1.00 37.63  ? 1344 VAL A HG23  1 
ATOM   6839 N  N     . THR A 1 475 ? -10.296 21.633  11.650  1.00 40.03  ? 1345 THR A N     1 
ATOM   6840 C  CA    . THR A 1 475 ? -11.090 22.180  12.738  1.00 41.53  ? 1345 THR A CA    1 
ATOM   6841 C  C     . THR A 1 475 ? -11.666 21.008  13.519  1.00 40.76  ? 1345 THR A C     1 
ATOM   6842 O  O     . THR A 1 475 ? -11.837 19.914  12.975  1.00 36.83  ? 1345 THR A O     1 
ATOM   6843 C  CB    . THR A 1 475 ? -12.233 23.040  12.196  1.00 41.84  ? 1345 THR A CB    1 
ATOM   6844 O  OG1   . THR A 1 475 ? -12.908 23.686  13.279  1.00 42.77  ? 1345 THR A OG1   1 
ATOM   6845 C  CG2   . THR A 1 475 ? -13.219 22.179  11.419  1.00 40.83  ? 1345 THR A CG2   1 
ATOM   6846 H  H     . THR A 1 475 ? -10.672 20.974  11.244  1.00 48.04  ? 1345 THR A H     1 
ATOM   6847 H  HA    . THR A 1 475 ? -10.529 22.721  13.332  1.00 49.84  ? 1345 THR A HA    1 
ATOM   6848 H  HB    . THR A 1 475 ? -11.873 23.711  11.595  1.00 50.21  ? 1345 THR A HB    1 
ATOM   6849 H  HG1   . THR A 1 475 ? -13.216 23.125  13.792  1.00 51.33  ? 1345 THR A HG1   1 
ATOM   6850 H  HG21  . THR A 1 475 ? -13.586 21.503  11.992  1.00 49.00  ? 1345 THR A HG21  1 
ATOM   6851 H  HG22  . THR A 1 475 ? -13.934 22.724  11.081  1.00 49.00  ? 1345 THR A HG22  1 
ATOM   6852 H  HG23  . THR A 1 475 ? -12.774 21.756  10.681  1.00 49.00  ? 1345 THR A HG23  1 
ATOM   6853 N  N     . ASN A 1 476 ? -11.971 21.217  14.791  1.00 39.05  ? 1346 ASN A N     1 
ATOM   6854 C  CA    . ASN A 1 476 ? -12.424 20.105  15.612  1.00 34.10  ? 1346 ASN A CA    1 
ATOM   6855 C  C     . ASN A 1 476 ? -13.709 19.462  15.096  1.00 42.74  ? 1346 ASN A C     1 
ATOM   6856 O  O     . ASN A 1 476 ? -14.610 20.142  14.609  1.00 39.65  ? 1346 ASN A O     1 
ATOM   6857 C  CB    . ASN A 1 476 ? -12.594 20.556  17.065  1.00 43.94  ? 1346 ASN A CB    1 
ATOM   6858 C  CG    . ASN A 1 476 ? -11.367 20.265  17.898  1.00 59.02  ? 1346 ASN A CG    1 
ATOM   6859 O  OD1   . ASN A 1 476 ? -10.886 19.133  17.929  1.00 69.58  ? 1346 ASN A OD1   1 
ATOM   6860 N  ND2   . ASN A 1 476 ? -10.833 21.288  18.552  1.00 55.35  ? 1346 ASN A ND2   1 
ATOM   6861 H  H     . ASN A 1 476 ? -11.926 21.974  15.196  1.00 46.86  ? 1346 ASN A H     1 
ATOM   6862 H  HA    . ASN A 1 476 ? -11.730 19.414  15.602  1.00 40.93  ? 1346 ASN A HA    1 
ATOM   6863 H  HB2   . ASN A 1 476 ? -12.753 21.513  17.084  1.00 52.73  ? 1346 ASN A HB2   1 
ATOM   6864 H  HB3   . ASN A 1 476 ? -13.345 20.085  17.459  1.00 52.73  ? 1346 ASN A HB3   1 
ATOM   6865 H  HD21  . ASN A 1 476 ? -10.134 21.169  19.038  1.00 66.42  ? 1346 ASN A HD21  1 
ATOM   6866 H  HD22  . ASN A 1 476 ? -11.186 22.070  18.489  1.00 66.42  ? 1346 ASN A HD22  1 
ATOM   6867 N  N     . GLU A 1 477 ? -13.779 18.139  15.188  1.00 41.77  ? 1347 GLU A N     1 
ATOM   6868 C  CA    . GLU A 1 477 ? -15.017 17.431  14.922  1.00 39.44  ? 1347 GLU A CA    1 
ATOM   6869 C  C     . GLU A 1 477 ? -16.033 17.868  15.966  1.00 45.19  ? 1347 GLU A C     1 
ATOM   6870 O  O     . GLU A 1 477 ? -15.658 18.245  17.076  1.00 40.36  ? 1347 GLU A O     1 
ATOM   6871 C  CB    . GLU A 1 477 ? -14.796 15.923  14.995  1.00 56.31  ? 1347 GLU A CB    1 
ATOM   6872 C  CG    . GLU A 1 477 ? -16.021 15.105  14.654  1.00 68.28  ? 1347 GLU A CG    1 
ATOM   6873 C  CD    . GLU A 1 477 ? -15.718 13.621  14.556  1.00 74.08  ? 1347 GLU A CD    1 
ATOM   6874 O  OE1   . GLU A 1 477 ? -16.339 12.837  15.303  1.00 76.03  ? 1347 GLU A OE1   1 
ATOM   6875 O  OE2   . GLU A 1 477 ? -14.860 13.241  13.729  1.00 68.39  ? 1347 GLU A OE2   1 
ATOM   6876 H  H     . GLU A 1 477 ? -13.120 17.629  15.404  1.00 50.12  ? 1347 GLU A H     1 
ATOM   6877 H  HA    . GLU A 1 477 ? -15.353 17.663  14.031  1.00 47.33  ? 1347 GLU A HA    1 
ATOM   6878 H  HB2   . GLU A 1 477 ? -14.094 15.680  14.371  1.00 67.57  ? 1347 GLU A HB2   1 
ATOM   6879 H  HB3   . GLU A 1 477 ? -14.527 15.690  15.897  1.00 67.57  ? 1347 GLU A HB3   1 
ATOM   6880 H  HG2   . GLU A 1 477 ? -16.689 15.231  15.345  1.00 81.93  ? 1347 GLU A HG2   1 
ATOM   6881 H  HG3   . GLU A 1 477 ? -16.369 15.398  13.797  1.00 81.93  ? 1347 GLU A HG3   1 
ATOM   6882 N  N     . SER A 1 478 ? -17.314 17.821  15.613  1.00 51.35  ? 1348 SER A N     1 
ATOM   6883 C  CA    . SER A 1 478 ? -18.370 18.254  16.523  1.00 74.34  ? 1348 SER A CA    1 
ATOM   6884 C  C     . SER A 1 478 ? -18.287 17.489  17.843  1.00 61.29  ? 1348 SER A C     1 
ATOM   6885 O  O     . SER A 1 478 ? -18.123 16.272  17.849  1.00 42.06  ? 1348 SER A O     1 
ATOM   6886 C  CB    . SER A 1 478 ? -19.743 18.054  15.878  1.00 92.13  ? 1348 SER A CB    1 
ATOM   6887 O  OG    . SER A 1 478 ? -19.887 18.890  14.744  1.00 109.05 ? 1348 SER A OG    1 
ATOM   6888 H  H     . SER A 1 478 ? -17.599 17.542  14.851  1.00 61.62  ? 1348 SER A H     1 
ATOM   6889 H  HA    . SER A 1 478 ? -18.259 19.208  16.716  1.00 89.21  ? 1348 SER A HA    1 
ATOM   6890 H  HB2   . SER A 1 478 ? -19.831 17.128  15.602  1.00 110.56 ? 1348 SER A HB2   1 
ATOM   6891 H  HB3   . SER A 1 478 ? -20.432 18.276  16.524  1.00 110.56 ? 1348 SER A HB3   1 
ATOM   6892 H  HG    . SER A 1 478 ? -20.624 18.777  14.404  1.00 130.86 ? 1348 SER A HG    1 
ATOM   6893 N  N     . ASN A 1 479 ? -18.376 18.213  18.955  1.00 62.38  ? 1349 ASN A N     1 
ATOM   6894 C  CA    . ASN A 1 479 ? -18.376 17.600  20.284  1.00 63.08  ? 1349 ASN A CA    1 
ATOM   6895 C  C     . ASN A 1 479 ? -17.081 16.871  20.620  1.00 62.85  ? 1349 ASN A C     1 
ATOM   6896 O  O     . ASN A 1 479 ? -17.055 15.983  21.475  1.00 61.88  ? 1349 ASN A O     1 
ATOM   6897 C  CB    . ASN A 1 479 ? -19.561 16.644  20.430  1.00 48.81  ? 1349 ASN A CB    1 
ATOM   6898 C  CG    . ASN A 1 479 ? -20.876 17.375  20.521  1.00 53.27  ? 1349 ASN A CG    1 
ATOM   6899 O  OD1   . ASN A 1 479 ? -20.913 18.557  20.864  1.00 45.26  ? 1349 ASN A OD1   1 
ATOM   6900 N  ND2   . ASN A 1 479 ? -21.965 16.681  20.218  1.00 52.54  ? 1349 ASN A ND2   1 
ATOM   6901 H  H     . ASN A 1 479 ? -18.437 19.070  18.968  1.00 74.85  ? 1349 ASN A H     1 
ATOM   6902 H  HA    . ASN A 1 479 ? -18.491 18.310  20.949  1.00 75.69  ? 1349 ASN A HA    1 
ATOM   6903 H  HB2   . ASN A 1 479 ? -19.594 16.059  19.658  1.00 58.57  ? 1349 ASN A HB2   1 
ATOM   6904 H  HB3   . ASN A 1 479 ? -19.450 16.122  21.240  1.00 58.57  ? 1349 ASN A HB3   1 
ATOM   6905 H  HD21  . ASN A 1 479 ? -22.738 17.056  20.255  1.00 63.05  ? 1349 ASN A HD21  1 
ATOM   6906 H  HD22  . ASN A 1 479 ? -21.898 15.856  19.984  1.00 63.05  ? 1349 ASN A HD22  1 
ATOM   6907 N  N     . SER A 1 480 ? -16.005 17.257  19.946  1.00 50.20  ? 1350 SER A N     1 
ATOM   6908 C  CA    . SER A 1 480 ? -14.702 16.673  20.198  1.00 53.09  ? 1350 SER A CA    1 
ATOM   6909 C  C     . SER A 1 480 ? -13.644 17.768  20.288  1.00 60.86  ? 1350 SER A C     1 
ATOM   6910 O  O     . SER A 1 480 ? -13.697 18.766  19.566  1.00 52.58  ? 1350 SER A O     1 
ATOM   6911 C  CB    . SER A 1 480 ? -14.343 15.683  19.090  1.00 57.81  ? 1350 SER A CB    1 
ATOM   6912 O  OG    . SER A 1 480 ? -13.093 15.074  19.353  1.00 50.66  ? 1350 SER A OG    1 
ATOM   6913 H  H     . SER A 1 480 ? -16.007 17.860  19.333  1.00 60.24  ? 1350 SER A H     1 
ATOM   6914 H  HA    . SER A 1 480 ? -14.721 16.190  21.051  1.00 63.71  ? 1350 SER A HA    1 
ATOM   6915 H  HB2   . SER A 1 480 ? -15.027 14.996  19.045  1.00 69.38  ? 1350 SER A HB2   1 
ATOM   6916 H  HB3   . SER A 1 480 ? -14.293 16.157  18.245  1.00 69.38  ? 1350 SER A HB3   1 
ATOM   6917 H  HG    . SER A 1 480 ? -12.783 15.362  20.055  1.00 60.79  ? 1350 SER A HG    1 
ATOM   6918 N  N     . ARG A 1 481 ? -12.696 17.587  21.198  1.00 63.76  ? 1351 ARG A N     1 
ATOM   6919 C  CA    . ARG A 1 481 ? -11.521 18.443  21.250  1.00 74.07  ? 1351 ARG A CA    1 
ATOM   6920 C  C     . ARG A 1 481 ? -10.291 17.614  20.836  1.00 61.72  ? 1351 ARG A C     1 
ATOM   6921 O  O     . ARG A 1 481 ? -9.172  18.122  20.787  1.00 54.99  ? 1351 ARG A O     1 
ATOM   6922 C  CB    . ARG A 1 481 ? -11.352 19.054  22.653  1.00 82.27  ? 1351 ARG A CB    1 
ATOM   6923 C  CG    . ARG A 1 481 ? -12.620 19.695  23.274  1.00 103.72 ? 1351 ARG A CG    1 
ATOM   6924 C  CD    . ARG A 1 481 ? -13.424 20.556  22.296  1.00 125.96 ? 1351 ARG A CD    1 
ATOM   6925 N  NE    . ARG A 1 481 ? -14.462 21.346  22.968  1.00 136.64 ? 1351 ARG A NE    1 
ATOM   6926 C  CZ    . ARG A 1 481 ? -15.754 21.021  23.021  1.00 134.35 ? 1351 ARG A CZ    1 
ATOM   6927 N  NH1   . ARG A 1 481 ? -16.192 19.909  22.444  1.00 127.36 ? 1351 ARG A NH1   1 
ATOM   6928 N  NH2   . ARG A 1 481 ? -16.614 21.810  23.656  1.00 133.99 ? 1351 ARG A NH2   1 
ATOM   6929 H  H     . ARG A 1 481 ? -12.709 16.971  21.799  1.00 76.51  ? 1351 ARG A H     1 
ATOM   6930 H  HA    . ARG A 1 481 ? -11.627 19.176  20.608  1.00 88.89  ? 1351 ARG A HA    1 
ATOM   6931 H  HB2   . ARG A 1 481 ? -11.057 18.354  23.256  1.00 98.72  ? 1351 ARG A HB2   1 
ATOM   6932 H  HB3   . ARG A 1 481 ? -10.673 19.744  22.605  1.00 98.72  ? 1351 ARG A HB3   1 
ATOM   6933 H  HG2   . ARG A 1 481 ? -13.203 18.988  23.593  1.00 124.47 ? 1351 ARG A HG2   1 
ATOM   6934 H  HG3   . ARG A 1 481 ? -12.353 20.260  24.015  1.00 124.47 ? 1351 ARG A HG3   1 
ATOM   6935 H  HD2   . ARG A 1 481 ? -12.823 21.170  21.846  1.00 151.16 ? 1351 ARG A HD2   1 
ATOM   6936 H  HD3   . ARG A 1 481 ? -13.857 19.980  21.647  1.00 151.16 ? 1351 ARG A HD3   1 
ATOM   6937 H  HE    . ARG A 1 481 ? -14.219 22.074  23.358  1.00 163.96 ? 1351 ARG A HE    1 
ATOM   6938 H  HH11  . ARG A 1 481 ? -15.641 19.394  22.030  1.00 152.84 ? 1351 ARG A HH11  1 
ATOM   6939 H  HH12  . ARG A 1 481 ? -17.026 19.704  22.481  1.00 152.84 ? 1351 ARG A HH12  1 
ATOM   6940 H  HH21  . ARG A 1 481 ? -16.338 22.532  24.033  1.00 160.79 ? 1351 ARG A HH21  1 
ATOM   6941 H  HH22  . ARG A 1 481 ? -17.447 21.598  23.690  1.00 160.79 ? 1351 ARG A HH22  1 
ATOM   6942 N  N     . LYS A 1 482 ? -10.525 16.340  20.515  1.00 55.28  ? 1352 LYS A N     1 
ATOM   6943 C  CA    . LYS A 1 482 ? -9.466  15.386  20.173  1.00 50.95  ? 1352 LYS A CA    1 
ATOM   6944 C  C     . LYS A 1 482 ? -9.290  15.210  18.667  1.00 52.53  ? 1352 LYS A C     1 
ATOM   6945 O  O     . LYS A 1 482 ? -8.177  15.257  18.148  1.00 55.31  ? 1352 LYS A O     1 
ATOM   6946 C  CB    . LYS A 1 482 ? -9.796  14.012  20.757  1.00 58.35  ? 1352 LYS A CB    1 
ATOM   6947 C  CG    . LYS A 1 482 ? -8.864  12.902  20.287  1.00 54.47  ? 1352 LYS A CG    1 
ATOM   6948 C  CD    . LYS A 1 482 ? -9.499  11.534  20.456  1.00 57.68  ? 1352 LYS A CD    1 
ATOM   6949 C  CE    . LYS A 1 482 ? -8.466  10.502  20.865  1.00 57.72  ? 1352 LYS A CE    1 
ATOM   6950 N  NZ    . LYS A 1 482 ? -8.903  9.110   20.557  1.00 45.91  ? 1352 LYS A NZ    1 
ATOM   6951 H  H     . LYS A 1 482 ? -11.312 15.995  20.488  1.00 66.34  ? 1352 LYS A H     1 
ATOM   6952 H  HA    . LYS A 1 482 ? -8.615  15.691  20.553  1.00 61.14  ? 1352 LYS A HA    1 
ATOM   6953 H  HB2   . LYS A 1 482 ? -9.735  14.060  21.724  1.00 70.02  ? 1352 LYS A HB2   1 
ATOM   6954 H  HB3   . LYS A 1 482 ? -10.699 13.771  20.497  1.00 70.02  ? 1352 LYS A HB3   1 
ATOM   6955 H  HG2   . LYS A 1 482 ? -8.663  13.030  19.346  1.00 65.37  ? 1352 LYS A HG2   1 
ATOM   6956 H  HG3   . LYS A 1 482 ? -8.048  12.925  20.811  1.00 65.37  ? 1352 LYS A HG3   1 
ATOM   6957 H  HD2   . LYS A 1 482 ? -10.178 11.577  21.147  1.00 69.21  ? 1352 LYS A HD2   1 
ATOM   6958 H  HD3   . LYS A 1 482 ? -9.892  11.255  19.614  1.00 69.21  ? 1352 LYS A HD3   1 
ATOM   6959 H  HE2   . LYS A 1 482 ? -7.641  10.672  20.385  1.00 69.26  ? 1352 LYS A HE2   1 
ATOM   6960 H  HE3   . LYS A 1 482 ? -8.316  10.566  21.821  1.00 69.26  ? 1352 LYS A HE3   1 
ATOM   6961 H  HZ1   . LYS A 1 482 ? -9.043  9.022   19.682  1.00 55.10  ? 1352 LYS A HZ1   1 
ATOM   6962 H  HZ2   . LYS A 1 482 ? -8.275  8.532   20.809  1.00 55.10  ? 1352 LYS A HZ2   1 
ATOM   6963 H  HZ3   . LYS A 1 482 ? -9.658  8.926   20.990  1.00 55.10  ? 1352 LYS A HZ3   1 
ATOM   6964 N  N     . THR A 1 483 ? -10.403 14.974  17.984  1.00 41.46  ? 1353 THR A N     1 
ATOM   6965 C  CA    . THR A 1 483 ? -10.397 14.593  16.576  1.00 42.47  ? 1353 THR A CA    1 
ATOM   6966 C  C     . THR A 1 483 ? -10.607 15.814  15.696  1.00 40.15  ? 1353 THR A C     1 
ATOM   6967 O  O     . THR A 1 483 ? -11.454 16.655  15.992  1.00 36.99  ? 1353 THR A O     1 
ATOM   6968 C  CB    . THR A 1 483 ? -11.510 13.567  16.307  1.00 48.04  ? 1353 THR A CB    1 
ATOM   6969 O  OG1   . THR A 1 483 ? -11.256 12.388  17.080  1.00 48.76  ? 1353 THR A OG1   1 
ATOM   6970 C  CG2   . THR A 1 483 ? -11.581 13.201  14.833  1.00 44.59  ? 1353 THR A CG2   1 
ATOM   6971 H  H     . THR A 1 483 ? -11.193 15.029  18.321  1.00 49.75  ? 1353 THR A H     1 
ATOM   6972 H  HA    . THR A 1 483 ? -9.534  14.188  16.348  1.00 50.97  ? 1353 THR A HA    1 
ATOM   6973 H  HB    . THR A 1 483 ? -12.364 13.944  16.569  1.00 57.65  ? 1353 THR A HB    1 
ATOM   6974 H  HG1   . THR A 1 483 ? -10.532 12.066  16.871  1.00 58.51  ? 1353 THR A HG1   1 
ATOM   6975 H  HG21  . THR A 1 483 ? -11.761 13.984  14.309  1.00 53.51  ? 1353 THR A HG21  1 
ATOM   6976 H  HG22  . THR A 1 483 ? -10.746 12.821  14.549  1.00 53.51  ? 1353 THR A HG22  1 
ATOM   6977 H  HG23  . THR A 1 483 ? -12.281 12.560  14.688  1.00 53.51  ? 1353 THR A HG23  1 
ATOM   6978 N  N     . TYR A 1 484 ? -9.830  15.913  14.619  1.00 35.40  ? 1354 TYR A N     1 
ATOM   6979 C  CA    . TYR A 1 484 ? -9.939  17.037  13.694  1.00 39.75  ? 1354 TYR A CA    1 
ATOM   6980 C  C     . TYR A 1 484 ? -10.408 16.577  12.327  1.00 39.96  ? 1354 TYR A C     1 
ATOM   6981 O  O     . TYR A 1 484 ? -10.138 15.458  11.904  1.00 39.05  ? 1354 TYR A O     1 
ATOM   6982 C  CB    . TYR A 1 484 ? -8.607  17.773  13.559  1.00 39.52  ? 1354 TYR A CB    1 
ATOM   6983 C  CG    . TYR A 1 484 ? -8.241  18.537  14.813  1.00 46.04  ? 1354 TYR A CG    1 
ATOM   6984 C  CD1   . TYR A 1 484 ? -8.657  19.857  14.997  1.00 51.27  ? 1354 TYR A CD1   1 
ATOM   6985 C  CD2   . TYR A 1 484 ? -7.497  17.935  15.824  1.00 42.22  ? 1354 TYR A CD2   1 
ATOM   6986 C  CE1   . TYR A 1 484 ? -8.332  20.559  16.153  1.00 54.90  ? 1354 TYR A CE1   1 
ATOM   6987 C  CE2   . TYR A 1 484 ? -7.175  18.627  16.986  1.00 46.93  ? 1354 TYR A CE2   1 
ATOM   6988 C  CZ    . TYR A 1 484 ? -7.587  19.940  17.141  1.00 53.56  ? 1354 TYR A CZ    1 
ATOM   6989 O  OH    . TYR A 1 484 ? -7.263  20.633  18.291  1.00 55.12  ? 1354 TYR A OH    1 
ATOM   6990 H  H     . TYR A 1 484 ? -9.229  15.339  14.402  1.00 42.48  ? 1354 TYR A H     1 
ATOM   6991 H  HA    . TYR A 1 484 ? -10.600 17.672  14.042  1.00 47.70  ? 1354 TYR A HA    1 
ATOM   6992 H  HB2   . TYR A 1 484 ? -7.905  17.128  13.383  1.00 47.42  ? 1354 TYR A HB2   1 
ATOM   6993 H  HB3   . TYR A 1 484 ? -8.668  18.407  12.827  1.00 47.42  ? 1354 TYR A HB3   1 
ATOM   6994 H  HD1   . TYR A 1 484 ? -9.156  20.275  14.333  1.00 61.53  ? 1354 TYR A HD1   1 
ATOM   6995 H  HD2   . TYR A 1 484 ? -7.216  17.054  15.723  1.00 50.67  ? 1354 TYR A HD2   1 
ATOM   6996 H  HE1   . TYR A 1 484 ? -8.612  21.439  16.260  1.00 65.88  ? 1354 TYR A HE1   1 
ATOM   6997 H  HE2   . TYR A 1 484 ? -6.671  18.215  17.651  1.00 56.31  ? 1354 TYR A HE2   1 
ATOM   6998 H  HH    . TYR A 1 484 ? -6.448  20.681  18.370  1.00 66.14  ? 1354 TYR A HH    1 
ATOM   6999 N  N     . ILE A 1 485 ? -11.118 17.465  11.649  1.00 35.14  ? 1355 ILE A N     1 
ATOM   7000 C  CA    . ILE A 1 485 ? -11.675 17.194  10.345  1.00 32.25  ? 1355 ILE A CA    1 
ATOM   7001 C  C     . ILE A 1 485 ? -10.913 18.013  9.308   1.00 39.22  ? 1355 ILE A C     1 
ATOM   7002 O  O     . ILE A 1 485 ? -10.823 19.234  9.430   1.00 29.42  ? 1355 ILE A O     1 
ATOM   7003 C  CB    . ILE A 1 485 ? -13.142 17.612  10.309  1.00 35.47  ? 1355 ILE A CB    1 
ATOM   7004 C  CG1   . ILE A 1 485 ? -13.951 16.777  11.303  1.00 49.92  ? 1355 ILE A CG1   1 
ATOM   7005 C  CG2   . ILE A 1 485 ? -13.699 17.463  8.906   1.00 41.55  ? 1355 ILE A CG2   1 
ATOM   7006 C  CD1   . ILE A 1 485 ? -13.899 15.291  11.023  1.00 49.59  ? 1355 ILE A CD1   1 
ATOM   7007 H  H     . ILE A 1 485 ? -11.294 18.255  11.938  1.00 42.17  ? 1355 ILE A H     1 
ATOM   7008 H  HA    . ILE A 1 485 ? -11.600 16.240  10.130  1.00 38.70  ? 1355 ILE A HA    1 
ATOM   7009 H  HB    . ILE A 1 485 ? -13.204 18.544  10.568  1.00 42.57  ? 1355 ILE A HB    1 
ATOM   7010 H  HG12  . ILE A 1 485 ? -13.599 16.924  12.195  1.00 59.90  ? 1355 ILE A HG12  1 
ATOM   7011 H  HG13  . ILE A 1 485 ? -14.879 17.055  11.264  1.00 59.90  ? 1355 ILE A HG13  1 
ATOM   7012 H  HG21  . ILE A 1 485 ? -13.196 18.022  8.310   1.00 49.86  ? 1355 ILE A HG21  1 
ATOM   7013 H  HG22  . ILE A 1 485 ? -13.625 16.545  8.637   1.00 49.86  ? 1355 ILE A HG22  1 
ATOM   7014 H  HG23  . ILE A 1 485 ? -14.621 17.731  8.907   1.00 49.86  ? 1355 ILE A HG23  1 
ATOM   7015 H  HD11  . ILE A 1 485 ? -14.425 14.831  11.682  1.00 59.50  ? 1355 ILE A HD11  1 
ATOM   7016 H  HD12  . ILE A 1 485 ? -14.254 15.126  10.147  1.00 59.50  ? 1355 ILE A HD12  1 
ATOM   7017 H  HD13  . ILE A 1 485 ? -12.987 14.997  11.068  1.00 59.50  ? 1355 ILE A HD13  1 
ATOM   7018 N  N     . VAL A 1 486 ? -10.369 17.340  8.296   1.00 29.48  ? 1356 VAL A N     1 
ATOM   7019 C  CA    . VAL A 1 486 ? -9.593  18.003  7.256   1.00 29.70  ? 1356 VAL A CA    1 
ATOM   7020 C  C     . VAL A 1 486 ? -10.506 18.721  6.267   1.00 26.53  ? 1356 VAL A C     1 
ATOM   7021 O  O     . VAL A 1 486 ? -11.523 18.185  5.832   1.00 28.86  ? 1356 VAL A O     1 
ATOM   7022 C  CB    . VAL A 1 486 ? -8.718  16.983  6.474   1.00 26.56  ? 1356 VAL A CB    1 
ATOM   7023 C  CG1   . VAL A 1 486 ? -8.061  17.644  5.243   1.00 25.14  ? 1356 VAL A CG1   1 
ATOM   7024 C  CG2   . VAL A 1 486 ? -7.666  16.368  7.391   1.00 25.65  ? 1356 VAL A CG2   1 
ATOM   7025 H  H     . VAL A 1 486 ? -10.437 16.489  8.190   1.00 35.37  ? 1356 VAL A H     1 
ATOM   7026 H  HA    . VAL A 1 486 ? -9.000  18.666  7.667   1.00 35.64  ? 1356 VAL A HA    1 
ATOM   7027 H  HB    . VAL A 1 486 ? -9.293  16.258  6.152   1.00 31.87  ? 1356 VAL A HB    1 
ATOM   7028 H  HG11  . VAL A 1 486 ? -8.327  18.565  5.204   1.00 30.16  ? 1356 VAL A HG11  1 
ATOM   7029 H  HG12  . VAL A 1 486 ? -7.107  17.581  5.327   1.00 30.16  ? 1356 VAL A HG12  1 
ATOM   7030 H  HG13  . VAL A 1 486 ? -8.352  17.186  4.451   1.00 30.16  ? 1356 VAL A HG13  1 
ATOM   7031 H  HG21  . VAL A 1 486 ? -7.140  15.743  6.886   1.00 30.78  ? 1356 VAL A HG21  1 
ATOM   7032 H  HG22  . VAL A 1 486 ? -7.105  17.066  7.734   1.00 30.78  ? 1356 VAL A HG22  1 
ATOM   7033 H  HG23  . VAL A 1 486 ? -8.108  15.916  8.114   1.00 30.78  ? 1356 VAL A HG23  1 
ATOM   7034 N  N     . HIS A 1 487 ? -10.118 19.937  5.902   1.00 24.62  ? 1357 HIS A N     1 
ATOM   7035 C  CA    . HIS A 1 487 ? -10.823 20.712  4.895   1.00 27.05  ? 1357 HIS A CA    1 
ATOM   7036 C  C     . HIS A 1 487 ? -9.799  21.181  3.879   1.00 23.32  ? 1357 HIS A C     1 
ATOM   7037 O  O     . HIS A 1 487 ? -8.632  21.360  4.221   1.00 23.76  ? 1357 HIS A O     1 
ATOM   7038 C  CB    . HIS A 1 487 ? -11.486 21.945  5.519   1.00 28.68  ? 1357 HIS A CB    1 
ATOM   7039 C  CG    . HIS A 1 487 ? -12.648 21.625  6.408   1.00 42.05  ? 1357 HIS A CG    1 
ATOM   7040 N  ND1   . HIS A 1 487 ? -12.508 20.942  7.592   1.00 50.00  ? 1357 HIS A ND1   1 
ATOM   7041 C  CD2   . HIS A 1 487 ? -13.968 21.905  6.281   1.00 52.31  ? 1357 HIS A CD2   1 
ATOM   7042 C  CE1   . HIS A 1 487 ? -13.697 20.808  8.163   1.00 52.50  ? 1357 HIS A CE1   1 
ATOM   7043 N  NE2   . HIS A 1 487 ? -14.595 21.381  7.387   1.00 55.44  ? 1357 HIS A NE2   1 
ATOM   7044 H  H     . HIS A 1 487 ? -9.435  20.341  6.232   1.00 29.54  ? 1357 HIS A H     1 
ATOM   7045 H  HA    . HIS A 1 487 ? -11.502 20.163  4.450   1.00 32.46  ? 1357 HIS A HA    1 
ATOM   7046 H  HB2   . HIS A 1 487 ? -10.827 22.418  6.052   1.00 34.41  ? 1357 HIS A HB2   1 
ATOM   7047 H  HB3   . HIS A 1 487 ? -11.806 22.521  4.808   1.00 34.41  ? 1357 HIS A HB3   1 
ATOM   7048 H  HD1   . HIS A 1 487 ? -11.767 20.647  7.912   1.00 59.99  ? 1357 HIS A HD1   1 
ATOM   7049 H  HD2   . HIS A 1 487 ? -14.372 22.360  5.578   1.00 62.77  ? 1357 HIS A HD2   1 
ATOM   7050 H  HE1   . HIS A 1 487 ? -13.868 20.381  8.971   1.00 63.00  ? 1357 HIS A HE1   1 
ATOM   7051 H  HE2   . HIS A 1 487 ? -15.438 21.422  7.548   1.00 66.52  ? 1357 HIS A HE2   1 
ATOM   7052 N  N     . CYS A 1 488 ? -10.228 21.388  2.639   1.00 24.37  ? 1358 CYS A N     1 
ATOM   7053 C  CA    . CYS A 1 488 ? -9.395  22.111  1.684   1.00 29.22  ? 1358 CYS A CA    1 
ATOM   7054 C  C     . CYS A 1 488 ? -9.468  23.605  2.017   1.00 37.63  ? 1358 CYS A C     1 
ATOM   7055 O  O     . CYS A 1 488 ? -10.246 24.018  2.879   1.00 29.29  ? 1358 CYS A O     1 
ATOM   7056 C  CB    . CYS A 1 488 ? -9.859  21.859  0.250   1.00 30.14  ? 1358 CYS A CB    1 
ATOM   7057 S  SG    . CYS A 1 488 ? -11.430 22.651  -0.164  1.00 29.47  ? 1358 CYS A SG    1 
ATOM   7058 H  H     . CYS A 1 488 ? -10.985 21.125  2.328   1.00 29.24  ? 1358 CYS A H     1 
ATOM   7059 H  HA    . CYS A 1 488 ? -8.464  21.816  1.768   1.00 35.06  ? 1358 CYS A HA    1 
ATOM   7060 H  HB2   . CYS A 1 488 ? -9.186  22.200  -0.360  1.00 36.17  ? 1358 CYS A HB2   1 
ATOM   7061 H  HB3   . CYS A 1 488 ? -9.966  20.904  0.120   1.00 36.17  ? 1358 CYS A HB3   1 
ATOM   7062 N  N     . GLN A 1 489 ? -8.661  24.415  1.343   1.00 31.87  ? 1359 GLN A N     1 
ATOM   7063 C  CA    . GLN A 1 489 ? -8.619  25.845  1.629   1.00 35.73  ? 1359 GLN A CA    1 
ATOM   7064 C  C     . GLN A 1 489 ? -9.965  26.524  1.388   1.00 29.78  ? 1359 GLN A C     1 
ATOM   7065 O  O     . GLN A 1 489 ? -10.441 27.293  2.224   1.00 32.39  ? 1359 GLN A O     1 
ATOM   7066 C  CB    . GLN A 1 489 ? -7.562  26.539  0.777   1.00 37.40  ? 1359 GLN A CB    1 
ATOM   7067 C  CG    . GLN A 1 489 ? -7.549  28.043  0.998   1.00 44.25  ? 1359 GLN A CG    1 
ATOM   7068 C  CD    . GLN A 1 489 ? -6.507  28.769  0.168   1.00 43.00  ? 1359 GLN A CD    1 
ATOM   7069 O  OE1   . GLN A 1 489 ? -6.084  29.864  0.527   1.00 42.67  ? 1359 GLN A OE1   1 
ATOM   7070 N  NE2   . GLN A 1 489 ? -6.093  28.168  -0.950  1.00 36.39  ? 1359 GLN A NE2   1 
ATOM   7071 H  H     . GLN A 1 489 ? -8.128  24.163  0.716   1.00 38.25  ? 1359 GLN A H     1 
ATOM   7072 H  HA    . GLN A 1 489 ? -8.380  25.974  2.571   1.00 42.87  ? 1359 GLN A HA    1 
ATOM   7073 H  HB2   . GLN A 1 489 ? -6.687  26.192  1.010   1.00 44.88  ? 1359 GLN A HB2   1 
ATOM   7074 H  HB3   . GLN A 1 489 ? -7.750  26.373  -0.160  1.00 44.88  ? 1359 GLN A HB3   1 
ATOM   7075 H  HG2   . GLN A 1 489 ? -8.419  28.402  0.763   1.00 53.10  ? 1359 GLN A HG2   1 
ATOM   7076 H  HG3   . GLN A 1 489 ? -7.361  28.221  1.933   1.00 53.10  ? 1359 GLN A HG3   1 
ATOM   7077 H  HE21  . GLN A 1 489 ? -5.503  28.546  -1.449  1.00 43.67  ? 1359 GLN A HE21  1 
ATOM   7078 H  HE22  . GLN A 1 489 ? -6.416  27.402  -1.172  1.00 43.67  ? 1359 GLN A HE22  1 
ATOM   7079 N  N     . ASP A 1 490 ? -10.571 26.245  0.242   1.00 28.55  ? 1360 ASP A N     1 
ATOM   7080 C  CA    . ASP A 1 490 ? -11.823 26.889  -0.135  1.00 40.78  ? 1360 ASP A CA    1 
ATOM   7081 C  C     . ASP A 1 490 ? -12.945 26.580  0.843   1.00 44.31  ? 1360 ASP A C     1 
ATOM   7082 O  O     . ASP A 1 490 ? -13.660 27.477  1.289   1.00 43.64  ? 1360 ASP A O     1 
ATOM   7083 C  CB    . ASP A 1 490 ? -12.219 26.463  -1.542  1.00 37.34  ? 1360 ASP A CB    1 
ATOM   7084 C  CG    . ASP A 1 490 ? -11.267 27.001  -2.590  1.00 51.56  ? 1360 ASP A CG    1 
ATOM   7085 O  OD1   . ASP A 1 490 ? -10.498 27.932  -2.269  1.00 52.93  ? 1360 ASP A OD1   1 
ATOM   7086 O  OD2   . ASP A 1 490 ? -11.286 26.496  -3.726  1.00 53.58  ? 1360 ASP A OD2   1 
ATOM   7087 H  H     . ASP A 1 490 ? -10.276 25.683  -0.339  1.00 34.26  ? 1360 ASP A H     1 
ATOM   7088 H  HA    . ASP A 1 490 ? -11.689 27.860  -0.142  1.00 48.93  ? 1360 ASP A HA    1 
ATOM   7089 H  HB2   . ASP A 1 490 ? -12.211 25.495  -1.595  1.00 44.81  ? 1360 ASP A HB2   1 
ATOM   7090 H  HB3   . ASP A 1 490 ? -13.107 26.801  -1.738  1.00 44.81  ? 1360 ASP A HB3   1 
ATOM   7091 N  N     . CYS A 1 491 ? -13.090 25.308  1.187   1.00 31.19  ? 1361 CYS A N     1 
ATOM   7092 C  CA    . CYS A 1 491 ? -14.141 24.895  2.106   1.00 35.20  ? 1361 CYS A CA    1 
ATOM   7093 C  C     . CYS A 1 491 ? -13.925 25.470  3.510   1.00 42.77  ? 1361 CYS A C     1 
ATOM   7094 O  O     . CYS A 1 491 ? -14.880 25.840  4.189   1.00 40.50  ? 1361 CYS A O     1 
ATOM   7095 C  CB    . CYS A 1 491 ? -14.258 23.368  2.125   1.00 34.24  ? 1361 CYS A CB    1 
ATOM   7096 S  SG    . CYS A 1 491 ? -15.080 22.730  0.659   1.00 34.79  ? 1361 CYS A SG    1 
ATOM   7097 H  H     . CYS A 1 491 ? -12.594 24.665  0.904   1.00 37.43  ? 1361 CYS A H     1 
ATOM   7098 H  HA    . CYS A 1 491 ? -14.994 25.248  1.775   1.00 42.24  ? 1361 CYS A HA    1 
ATOM   7099 H  HB2   . CYS A 1 491 ? -13.369 22.982  2.165   1.00 41.08  ? 1361 CYS A HB2   1 
ATOM   7100 H  HB3   . CYS A 1 491 ? -14.773 23.099  2.902   1.00 41.08  ? 1361 CYS A HB3   1 
ATOM   7101 N  N     . ALA A 1 492 ? -12.673 25.573  3.941   1.00 37.17  ? 1362 ALA A N     1 
ATOM   7102 C  CA    . ALA A 1 492 ? -12.377 26.148  5.248   1.00 42.95  ? 1362 ALA A CA    1 
ATOM   7103 C  C     . ALA A 1 492 ? -12.830 27.608  5.297   1.00 47.87  ? 1362 ALA A C     1 
ATOM   7104 O  O     . ALA A 1 492 ? -13.410 28.057  6.282   1.00 41.87  ? 1362 ALA A O     1 
ATOM   7105 C  CB    . ALA A 1 492 ? -10.893 26.051  5.553   1.00 40.59  ? 1362 ALA A CB    1 
ATOM   7106 H  H     . ALA A 1 492 ? -11.980 25.318  3.500   1.00 44.60  ? 1362 ALA A H     1 
ATOM   7107 H  HA    . ALA A 1 492 ? -12.866 25.652  5.938   1.00 51.54  ? 1362 ALA A HA    1 
ATOM   7108 H  HB1   . ALA A 1 492 ? -10.725 26.435  6.416   1.00 48.70  ? 1362 ALA A HB1   1 
ATOM   7109 H  HB2   . ALA A 1 492 ? -10.634 25.126  5.550   1.00 48.70  ? 1362 ALA A HB2   1 
ATOM   7110 H  HB3   . ALA A 1 492 ? -10.404 26.530  4.880   1.00 48.70  ? 1362 ALA A HB3   1 
ATOM   7111 N  N     . ARG A 1 493 ? -12.572 28.343  4.222   1.00 47.71  ? 1363 ARG A N     1 
ATOM   7112 C  CA    . ARG A 1 493 ? -12.896 29.766  4.182   1.00 57.29  ? 1363 ARG A CA    1 
ATOM   7113 C  C     . ARG A 1 493 ? -14.386 30.059  4.067   1.00 63.15  ? 1363 ARG A C     1 
ATOM   7114 O  O     . ARG A 1 493 ? -14.823 31.165  4.373   1.00 65.83  ? 1363 ARG A O     1 
ATOM   7115 C  CB    . ARG A 1 493 ? -12.190 30.438  3.016   1.00 49.45  ? 1363 ARG A CB    1 
ATOM   7116 C  CG    . ARG A 1 493 ? -10.729 30.670  3.256   1.00 59.04  ? 1363 ARG A CG    1 
ATOM   7117 C  CD    . ARG A 1 493 ? -10.126 31.461  2.119   1.00 74.28  ? 1363 ARG A CD    1 
ATOM   7118 N  NE    . ARG A 1 493 ? -8.677  31.326  2.122   1.00 79.36  ? 1363 ARG A NE    1 
ATOM   7119 C  CZ    . ARG A 1 493 ? -7.875  31.926  2.994   1.00 78.06  ? 1363 ARG A CZ    1 
ATOM   7120 N  NH1   . ARG A 1 493 ? -8.373  32.733  3.925   1.00 80.16  ? 1363 ARG A NH1   1 
ATOM   7121 N  NH2   . ARG A 1 493 ? -6.567  31.730  2.925   1.00 69.10  ? 1363 ARG A NH2   1 
ATOM   7122 H  H     . ARG A 1 493 ? -12.210 28.043  3.503   1.00 57.26  ? 1363 ARG A H     1 
ATOM   7123 H  HA    . ARG A 1 493 ? -12.573 30.184  5.007   1.00 68.75  ? 1363 ARG A HA    1 
ATOM   7124 H  HB2   . ARG A 1 493 ? -12.278 29.876  2.231   1.00 59.34  ? 1363 ARG A HB2   1 
ATOM   7125 H  HB3   . ARG A 1 493 ? -12.605 31.300  2.853   1.00 59.34  ? 1363 ARG A HB3   1 
ATOM   7126 H  HG2   . ARG A 1 493 ? -10.611 31.174  4.076   1.00 70.85  ? 1363 ARG A HG2   1 
ATOM   7127 H  HG3   . ARG A 1 493 ? -10.271 29.817  3.313   1.00 70.85  ? 1363 ARG A HG3   1 
ATOM   7128 H  HD2   . ARG A 1 493 ? -10.465 31.123  1.275   1.00 89.14  ? 1363 ARG A HD2   1 
ATOM   7129 H  HD3   . ARG A 1 493 ? -10.348 32.399  2.223   1.00 89.14  ? 1363 ARG A HD3   1 
ATOM   7130 H  HE    . ARG A 1 493 ? -8.314  30.866  1.492   1.00 95.23  ? 1363 ARG A HE    1 
ATOM   7131 H  HH11  . ARG A 1 493 ? -9.222  32.860  3.974   1.00 96.20  ? 1363 ARG A HH11  1 
ATOM   7132 H  HH12  . ARG A 1 493 ? -7.847  33.122  4.483   1.00 96.20  ? 1363 ARG A HH12  1 
ATOM   7133 H  HH21  . ARG A 1 493 ? -6.240  31.213  2.320   1.00 82.92  ? 1363 ARG A HH21  1 
ATOM   7134 H  HH22  . ARG A 1 493 ? -6.043  32.125  3.481   1.00 82.92  ? 1363 ARG A HH22  1 
ATOM   7135 N  N     . LYS A 1 494 ? -15.162 29.090  3.596   1.00 60.16  ? 1364 LYS A N     1 
ATOM   7136 C  CA    . LYS A 1 494 ? -16.600 29.297  3.474   1.00 67.40  ? 1364 LYS A CA    1 
ATOM   7137 C  C     . LYS A 1 494 ? -17.311 28.998  4.792   1.00 71.27  ? 1364 LYS A C     1 
ATOM   7138 O  O     . LYS A 1 494 ? -18.448 29.415  5.005   1.00 81.08  ? 1364 LYS A O     1 
ATOM   7139 C  CB    . LYS A 1 494 ? -17.189 28.469  2.332   1.00 69.67  ? 1364 LYS A CB    1 
ATOM   7140 C  CG    . LYS A 1 494 ? -16.902 26.979  2.388   1.00 87.29  ? 1364 LYS A CG    1 
ATOM   7141 C  CD    . LYS A 1 494 ? -17.649 26.254  1.283   1.00 91.73  ? 1364 LYS A CD    1 
ATOM   7142 C  CE    . LYS A 1 494 ? -17.509 27.001  -0.035  1.00 88.14  ? 1364 LYS A CE    1 
ATOM   7143 N  NZ    . LYS A 1 494 ? -17.926 26.187  -1.208  1.00 85.00  ? 1364 LYS A NZ    1 
ATOM   7144 H  H     . LYS A 1 494 ? -14.887 28.315  3.345   1.00 72.19  ? 1364 LYS A H     1 
ATOM   7145 H  HA    . LYS A 1 494 ? -16.759 30.240  3.263   1.00 80.88  ? 1364 LYS A HA    1 
ATOM   7146 H  HB2   . LYS A 1 494 ? -18.153 28.580  2.338   1.00 83.60  ? 1364 LYS A HB2   1 
ATOM   7147 H  HB3   . LYS A 1 494 ? -16.830 28.803  1.494   1.00 83.60  ? 1364 LYS A HB3   1 
ATOM   7148 H  HG2   . LYS A 1 494 ? -15.952 26.828  2.268   1.00 104.75 ? 1364 LYS A HG2   1 
ATOM   7149 H  HG3   . LYS A 1 494 ? -17.196 26.626  3.242   1.00 104.75 ? 1364 LYS A HG3   1 
ATOM   7150 H  HD2   . LYS A 1 494 ? -17.279 25.364  1.172   1.00 110.07 ? 1364 LYS A HD2   1 
ATOM   7151 H  HD3   . LYS A 1 494 ? -18.591 26.203  1.509   1.00 110.07 ? 1364 LYS A HD3   1 
ATOM   7152 H  HE2   . LYS A 1 494 ? -18.065 27.795  -0.008  1.00 105.77 ? 1364 LYS A HE2   1 
ATOM   7153 H  HE3   . LYS A 1 494 ? -16.580 27.251  -0.159  1.00 105.77 ? 1364 LYS A HE3   1 
ATOM   7154 H  HZ1   . LYS A 1 494 ? -17.426 25.453  -1.262  1.00 102.00 ? 1364 LYS A HZ1   1 
ATOM   7155 H  HZ2   . LYS A 1 494 ? -18.780 25.950  -1.124  1.00 102.00 ? 1364 LYS A HZ2   1 
ATOM   7156 H  HZ3   . LYS A 1 494 ? -17.829 26.659  -1.956  1.00 102.00 ? 1364 LYS A HZ3   1 
ATOM   7157 N  N     . THR A 1 495 ? -16.624 28.284  5.676   1.00 68.64  ? 1365 THR A N     1 
ATOM   7158 C  CA    . THR A 1 495 ? -17.113 28.071  7.030   1.00 83.55  ? 1365 THR A CA    1 
ATOM   7159 C  C     . THR A 1 495 ? -16.694 29.243  7.921   1.00 85.74  ? 1365 THR A C     1 
ATOM   7160 O  O     . THR A 1 495 ? -17.467 29.702  8.757   1.00 93.19  ? 1365 THR A O     1 
ATOM   7161 C  CB    . THR A 1 495 ? -16.563 26.764  7.630   1.00 95.14  ? 1365 THR A CB    1 
ATOM   7162 O  OG1   . THR A 1 495 ? -15.142 26.864  7.764   1.00 108.22 ? 1365 THR A OG1   1 
ATOM   7163 C  CG2   . THR A 1 495 ? -16.903 25.559  6.752   1.00 89.54  ? 1365 THR A CG2   1 
ATOM   7164 H  H     . THR A 1 495 ? -15.867 27.910  5.514   1.00 82.36  ? 1365 THR A H     1 
ATOM   7165 H  HA    . THR A 1 495 ? -18.092 28.022  7.021   1.00 100.26 ? 1365 THR A HA    1 
ATOM   7166 H  HB    . THR A 1 495 ? -16.957 26.623  8.505   1.00 114.17 ? 1365 THR A HB    1 
ATOM   7167 H  HG1   . THR A 1 495 ? -14.841 26.171  8.084   1.00 129.86 ? 1365 THR A HG1   1 
ATOM   7168 H  HG21  . THR A 1 495 ? -16.521 25.672  5.878   1.00 107.45 ? 1365 THR A HG21  1 
ATOM   7169 H  HG22  . THR A 1 495 ? -16.551 24.757  7.145   1.00 107.45 ? 1365 THR A HG22  1 
ATOM   7170 H  HG23  . THR A 1 495 ? -17.855 25.473  6.667   1.00 107.45 ? 1365 THR A HG23  1 
ATOM   7171 N  N     . SER A 1 496 ? -15.469 29.728  7.728   1.00 74.43  ? 1366 SER A N     1 
ATOM   7172 C  CA    . SER A 1 496 ? -14.940 30.845  8.506   1.00 86.47  ? 1366 SER A CA    1 
ATOM   7173 C  C     . SER A 1 496 ? -14.083 31.737  7.605   1.00 85.28  ? 1366 SER A C     1 
ATOM   7174 O  O     . SER A 1 496 ? -12.993 31.342  7.193   1.00 69.75  ? 1366 SER A O     1 
ATOM   7175 C  CB    . SER A 1 496 ? -14.124 30.319  9.695   1.00 92.48  ? 1366 SER A CB    1 
ATOM   7176 O  OG    . SER A 1 496 ? -13.593 31.373  10.476  1.00 97.08  ? 1366 SER A OG    1 
ATOM   7177 H  H     . SER A 1 496 ? -14.918 29.422  7.143   1.00 89.32  ? 1366 SER A H     1 
ATOM   7178 H  HA    . SER A 1 496 ? -15.683 31.380  8.854   1.00 103.77 ? 1366 SER A HA    1 
ATOM   7179 H  HB2   . SER A 1 496 ? -14.701 29.776  10.253  1.00 110.98 ? 1366 SER A HB2   1 
ATOM   7180 H  HB3   . SER A 1 496 ? -13.391 29.781  9.357   1.00 110.98 ? 1366 SER A HB3   1 
ATOM   7181 H  HG    . SER A 1 496 ? -13.163 31.067  11.104  1.00 116.49 ? 1366 SER A HG    1 
ATOM   7182 N  N     . GLY A 1 497 ? -14.587 32.930  7.291   1.00 88.63  ? 1367 GLY A N     1 
ATOM   7183 C  CA    . GLY A 1 497 ? -13.938 33.823  6.342   1.00 79.52  ? 1367 GLY A CA    1 
ATOM   7184 C  C     . GLY A 1 497 ? -12.452 34.007  6.563   1.00 78.94  ? 1367 GLY A C     1 
ATOM   7185 O  O     . GLY A 1 497 ? -11.681 34.108  5.612   1.00 66.84  ? 1367 GLY A O     1 
ATOM   7186 H  H     . GLY A 1 497 ? -15.316 33.246  7.622   1.00 106.35 ? 1367 GLY A H     1 
ATOM   7187 H  HA2   . GLY A 1 497 ? -14.067 33.477  5.445   1.00 95.43  ? 1367 GLY A HA2   1 
ATOM   7188 H  HA3   . GLY A 1 497 ? -14.359 34.695  6.391   1.00 95.43  ? 1367 GLY A HA3   1 
ATOM   7189 N  N     . ASN A 1 498 ? -12.057 34.044  7.827   1.00 91.11  ? 1368 ASN A N     1 
ATOM   7190 C  CA    . ASN A 1 498 ? -10.696 34.389  8.208   1.00 96.70  ? 1368 ASN A CA    1 
ATOM   7191 C  C     . ASN A 1 498 ? -9.983  33.217  8.880   1.00 81.38  ? 1368 ASN A C     1 
ATOM   7192 O  O     . ASN A 1 498 ? -8.881  33.368  9.406   1.00 68.92  ? 1368 ASN A O     1 
ATOM   7193 C  CB    . ASN A 1 498 ? -10.738 35.607  9.129   1.00 115.94 ? 1368 ASN A CB    1 
ATOM   7194 C  CG    . ASN A 1 498 ? -11.628 35.383  10.342  1.00 135.17 ? 1368 ASN A CG    1 
ATOM   7195 O  OD1   . ASN A 1 498 ? -12.455 34.468  10.357  1.00 142.78 ? 1368 ASN A OD1   1 
ATOM   7196 N  ND2   . ASN A 1 498 ? -11.475 36.222  11.358  1.00 140.75 ? 1368 ASN A ND2   1 
ATOM   7197 H  H     . ASN A 1 498 ? -12.568 33.870  8.496   1.00 109.34 ? 1368 ASN A H     1 
ATOM   7198 H  HA    . ASN A 1 498 ? -10.190 34.632  7.404   1.00 116.04 ? 1368 ASN A HA    1 
ATOM   7199 H  HB2   . ASN A 1 498 ? -9.841  35.797  9.445   1.00 139.13 ? 1368 ASN A HB2   1 
ATOM   7200 H  HB3   . ASN A 1 498 ? -11.086 36.366  8.636   1.00 139.13 ? 1368 ASN A HB3   1 
ATOM   7201 H  HD21  . ASN A 1 498 ? -10.893 36.854  11.310  1.00 168.90 ? 1368 ASN A HD21  1 
ATOM   7202 H  HD22  . ASN A 1 498 ? -11.957 36.134  12.065  1.00 168.90 ? 1368 ASN A HD22  1 
ATOM   7203 N  N     . LEU A 1 499 ? -10.628 32.052  8.852   1.00 74.42  ? 1369 LEU A N     1 
ATOM   7204 C  CA    . LEU A 1 499 ? -10.040 30.806  9.343   1.00 74.06  ? 1369 LEU A CA    1 
ATOM   7205 C  C     . LEU A 1 499 ? -9.957  30.770  10.868  1.00 75.68  ? 1369 LEU A C     1 
ATOM   7206 O  O     . LEU A 1 499 ? -9.090  30.108  11.428  1.00 52.53  ? 1369 LEU A O     1 
ATOM   7207 C  CB    . LEU A 1 499 ? -8.647  30.592  8.738   1.00 73.43  ? 1369 LEU A CB    1 
ATOM   7208 C  CG    . LEU A 1 499 ? -8.580  30.471  7.214   1.00 60.78  ? 1369 LEU A CG    1 
ATOM   7209 C  CD1   . LEU A 1 499 ? -7.138  30.287  6.767   1.00 53.52  ? 1369 LEU A CD1   1 
ATOM   7210 C  CD2   . LEU A 1 499 ? -9.448  29.318  6.725   1.00 58.48  ? 1369 LEU A CD2   1 
ATOM   7211 H  H     . LEU A 1 499 ? -11.425 31.956  8.546   1.00 89.30  ? 1369 LEU A H     1 
ATOM   7212 H  HA    . LEU A 1 499 ? -10.606 30.058  9.058   1.00 88.87  ? 1369 LEU A HA    1 
ATOM   7213 H  HB2   . LEU A 1 499 ? -8.087  31.343  8.992   1.00 88.11  ? 1369 LEU A HB2   1 
ATOM   7214 H  HB3   . LEU A 1 499 ? -8.277  29.776  9.109   1.00 88.11  ? 1369 LEU A HB3   1 
ATOM   7215 H  HG    . LEU A 1 499 ? -8.916  31.289  6.816   1.00 72.93  ? 1369 LEU A HG    1 
ATOM   7216 H  HD11  . LEU A 1 499 ? -6.787  29.488  7.167   1.00 64.22  ? 1369 LEU A HD11  1 
ATOM   7217 H  HD12  . LEU A 1 499 ? -7.115  30.213  5.810   1.00 64.22  ? 1369 LEU A HD12  1 
ATOM   7218 H  HD13  . LEU A 1 499 ? -6.625  31.048  7.050   1.00 64.22  ? 1369 LEU A HD13  1 
ATOM   7219 H  HD21  . LEU A 1 499 ? -10.357 29.480  6.987   1.00 70.18  ? 1369 LEU A HD21  1 
ATOM   7220 H  HD22  . LEU A 1 499 ? -9.387  29.266  5.769   1.00 70.18  ? 1369 LEU A HD22  1 
ATOM   7221 H  HD23  . LEU A 1 499 ? -9.133  28.502  7.119   1.00 70.18  ? 1369 LEU A HD23  1 
ATOM   7222 N  N     . GLU A 1 500 ? -10.872 31.466  11.536  1.00 98.60  ? 1370 GLU A N     1 
ATOM   7223 C  CA    . GLU A 1 500 ? -10.822 31.594  12.994  1.00 120.09 ? 1370 GLU A CA    1 
ATOM   7224 C  C     . GLU A 1 500 ? -10.698 30.288  13.759  1.00 107.24 ? 1370 GLU A C     1 
ATOM   7225 O  O     . GLU A 1 500 ? -9.817  30.146  14.605  1.00 113.52 ? 1370 GLU A O     1 
ATOM   7226 C  CB    . GLU A 1 500 ? -12.038 32.359  13.507  1.00 145.39 ? 1370 GLU A CB    1 
ATOM   7227 C  CG    . GLU A 1 500 ? -11.965 33.808  13.154  1.00 163.79 ? 1370 GLU A CG    1 
ATOM   7228 C  CD    . GLU A 1 500 ? -10.625 34.393  13.517  1.00 176.30 ? 1370 GLU A CD    1 
ATOM   7229 O  OE1   . GLU A 1 500 ? -10.442 34.777  14.689  1.00 181.53 ? 1370 GLU A OE1   1 
ATOM   7230 O  OE2   . GLU A 1 500 ? -9.753  34.462  12.621  1.00 178.10 ? 1370 GLU A OE2   1 
ATOM   7231 H  H     . GLU A 1 500 ? -11.534 31.875  11.170  1.00 118.32 ? 1370 GLU A H     1 
ATOM   7232 H  HA    . GLU A 1 500 ? -10.033 32.129  13.220  1.00 144.11 ? 1370 GLU A HA    1 
ATOM   7233 H  HB2   . GLU A 1 500 ? -12.841 31.989  13.107  1.00 174.47 ? 1370 GLU A HB2   1 
ATOM   7234 H  HB3   . GLU A 1 500 ? -12.080 32.283  14.474  1.00 174.47 ? 1370 GLU A HB3   1 
ATOM   7235 H  HG2   . GLU A 1 500 ? -12.093 33.912  12.198  1.00 196.55 ? 1370 GLU A HG2   1 
ATOM   7236 H  HG3   . GLU A 1 500 ? -12.650 34.292  13.640  1.00 196.55 ? 1370 GLU A HG3   1 
ATOM   7237 N  N     . ASN A 1 501 ? -11.589 29.346  13.486  1.00 82.83  ? 1371 ASN A N     1 
ATOM   7238 C  CA    . ASN A 1 501 ? -11.580 28.098  14.234  1.00 86.71  ? 1371 ASN A CA    1 
ATOM   7239 C  C     . ASN A 1 501 ? -10.787 27.003  13.534  1.00 68.79  ? 1371 ASN A C     1 
ATOM   7240 O  O     . ASN A 1 501 ? -10.985 25.814  13.788  1.00 54.62  ? 1371 ASN A O     1 
ATOM   7241 C  CB    . ASN A 1 501 ? -13.005 27.626  14.511  1.00 107.20 ? 1371 ASN A CB    1 
ATOM   7242 C  CG    . ASN A 1 501 ? -13.769 28.584  15.396  1.00 125.91 ? 1371 ASN A CG    1 
ATOM   7243 O  OD1   . ASN A 1 501 ? -14.898 28.961  15.089  1.00 136.92 ? 1371 ASN A OD1   1 
ATOM   7244 N  ND2   . ASN A 1 501 ? -13.152 28.993  16.502  1.00 125.91 ? 1371 ASN A ND2   1 
ATOM   7245 H  H     . ASN A 1 501 ? -12.199 29.401  12.883  1.00 99.39  ? 1371 ASN A H     1 
ATOM   7246 H  HA    . ASN A 1 501 ? -11.152 28.261  15.100  1.00 104.05 ? 1371 ASN A HA    1 
ATOM   7247 H  HB2   . ASN A 1 501 ? -13.482 27.548  13.670  1.00 128.64 ? 1371 ASN A HB2   1 
ATOM   7248 H  HB3   . ASN A 1 501 ? -12.972 26.765  14.957  1.00 128.64 ? 1371 ASN A HB3   1 
ATOM   7249 H  HD21  . ASN A 1 501 ? -12.359 28.711  16.680  1.00 151.10 ? 1371 ASN A HD21  1 
ATOM   7250 H  HD22  . ASN A 1 501 ? -13.545 29.538  17.037  1.00 151.10 ? 1371 ASN A HD22  1 
ATOM   7251 N  N     . PHE A 1 502 ? -9.878  27.414  12.657  1.00 53.66  ? 1372 PHE A N     1 
ATOM   7252 C  CA    . PHE A 1 502 ? -9.041  26.473  11.930  1.00 45.60  ? 1372 PHE A CA    1 
ATOM   7253 C  C     . PHE A 1 502 ? -7.580  26.560  12.337  1.00 43.66  ? 1372 PHE A C     1 
ATOM   7254 O  O     . PHE A 1 502 ? -7.087  27.607  12.734  1.00 45.46  ? 1372 PHE A O     1 
ATOM   7255 C  CB    . PHE A 1 502 ? -9.169  26.696  10.424  1.00 41.29  ? 1372 PHE A CB    1 
ATOM   7256 C  CG    . PHE A 1 502 ? -10.420 26.124  9.844   1.00 44.17  ? 1372 PHE A CG    1 
ATOM   7257 C  CD1   . PHE A 1 502 ? -10.425 24.856  9.286   1.00 42.78  ? 1372 PHE A CD1   1 
ATOM   7258 C  CD2   . PHE A 1 502 ? -11.598 26.841  9.877   1.00 56.11  ? 1372 PHE A CD2   1 
ATOM   7259 C  CE1   . PHE A 1 502 ? -11.584 24.321  8.761   1.00 41.99  ? 1372 PHE A CE1   1 
ATOM   7260 C  CE2   . PHE A 1 502 ? -12.757 26.315  9.355   1.00 60.48  ? 1372 PHE A CE2   1 
ATOM   7261 C  CZ    . PHE A 1 502 ? -12.752 25.050  8.792   1.00 56.72  ? 1372 PHE A CZ    1 
ATOM   7262 H  H     . PHE A 1 502 ? -9.727  28.239  12.466  1.00 64.39  ? 1372 PHE A H     1 
ATOM   7263 H  HA    . PHE A 1 502 ? -9.350  25.564  12.124  1.00 54.72  ? 1372 PHE A HA    1 
ATOM   7264 H  HB2   . PHE A 1 502 ? -9.167  27.650  10.246  1.00 49.55  ? 1372 PHE A HB2   1 
ATOM   7265 H  HB3   . PHE A 1 502 ? -8.415  26.276  9.979   1.00 49.55  ? 1372 PHE A HB3   1 
ATOM   7266 H  HD1   . PHE A 1 502 ? -9.638  24.361  9.262   1.00 51.34  ? 1372 PHE A HD1   1 
ATOM   7267 H  HD2   . PHE A 1 502 ? -11.608 27.692  10.252  1.00 67.33  ? 1372 PHE A HD2   1 
ATOM   7268 H  HE1   . PHE A 1 502 ? -11.576 23.471  8.384   1.00 50.39  ? 1372 PHE A HE1   1 
ATOM   7269 H  HE2   . PHE A 1 502 ? -13.544 26.810  9.378   1.00 72.57  ? 1372 PHE A HE2   1 
ATOM   7270 H  HZ    . PHE A 1 502 ? -13.534 24.694  8.439   1.00 68.07  ? 1372 PHE A HZ    1 
ATOM   7271 N  N     . VAL A 1 503 ? -6.908  25.423  12.248  1.00 34.05  ? 1373 VAL A N     1 
ATOM   7272 C  CA    . VAL A 1 503 ? -5.473  25.330  12.430  1.00 39.17  ? 1373 VAL A CA    1 
ATOM   7273 C  C     . VAL A 1 503 ? -4.915  24.868  11.091  1.00 42.11  ? 1373 VAL A C     1 
ATOM   7274 O  O     . VAL A 1 503 ? -5.570  24.097  10.400  1.00 37.28  ? 1373 VAL A O     1 
ATOM   7275 C  CB    . VAL A 1 503 ? -5.140  24.279  13.493  1.00 51.32  ? 1373 VAL A CB    1 
ATOM   7276 C  CG1   . VAL A 1 503 ? -3.642  24.026  13.554  1.00 44.14  ? 1373 VAL A CG1   1 
ATOM   7277 C  CG2   . VAL A 1 503 ? -5.691  24.712  14.851  1.00 69.80  ? 1373 VAL A CG2   1 
ATOM   7278 H  H     . VAL A 1 503 ? -7.278  24.666  12.078  1.00 40.86  ? 1373 VAL A H     1 
ATOM   7279 H  HA    . VAL A 1 503 ? -5.088  26.197  12.677  1.00 47.01  ? 1373 VAL A HA    1 
ATOM   7280 H  HB    . VAL A 1 503 ? -5.575  23.436  13.249  1.00 61.58  ? 1373 VAL A HB    1 
ATOM   7281 H  HG11  . VAL A 1 503 ? -3.204  24.583  12.906  1.00 52.97  ? 1373 VAL A HG11  1 
ATOM   7282 H  HG12  . VAL A 1 503 ? -3.325  24.238  14.435  1.00 52.97  ? 1373 VAL A HG12  1 
ATOM   7283 H  HG13  . VAL A 1 503 ? -3.473  23.101  13.359  1.00 52.97  ? 1373 VAL A HG13  1 
ATOM   7284 H  HG21  . VAL A 1 503 ? -6.134  25.558  14.752  1.00 83.76  ? 1373 VAL A HG21  1 
ATOM   7285 H  HG22  . VAL A 1 503 ? -6.314  24.049  15.160  1.00 83.76  ? 1373 VAL A HG22  1 
ATOM   7286 H  HG23  . VAL A 1 503 ? -4.964  24.793  15.472  1.00 83.76  ? 1373 VAL A HG23  1 
ATOM   7287 N  N     . VAL A 1 504 ? -3.730  25.326  10.704  1.00 33.70  ? 1374 VAL A N     1 
ATOM   7288 C  CA    . VAL A 1 504 ? -3.135  24.820  9.460   1.00 34.86  ? 1374 VAL A CA    1 
ATOM   7289 C  C     . VAL A 1 504 ? -1.985  23.876  9.772   1.00 33.98  ? 1374 VAL A C     1 
ATOM   7290 O  O     . VAL A 1 504 ? -1.016  24.262  10.407  1.00 35.34  ? 1374 VAL A O     1 
ATOM   7291 C  CB    . VAL A 1 504 ? -2.616  25.935  8.541   1.00 37.68  ? 1374 VAL A CB    1 
ATOM   7292 C  CG1   . VAL A 1 504 ? -2.005  25.322  7.285   1.00 42.34  ? 1374 VAL A CG1   1 
ATOM   7293 C  CG2   . VAL A 1 504 ? -3.735  26.890  8.177   1.00 39.67  ? 1374 VAL A CG2   1 
ATOM   7294 H  H     . VAL A 1 504 ? -3.258  25.910  11.124  1.00 40.44  ? 1374 VAL A H     1 
ATOM   7295 H  HA    . VAL A 1 504 ? -3.815  24.314  8.967   1.00 41.84  ? 1374 VAL A HA    1 
ATOM   7296 H  HB    . VAL A 1 504 ? -1.918  26.441  9.008   1.00 45.21  ? 1374 VAL A HB    1 
ATOM   7297 H  HG11  . VAL A 1 504 ? -1.684  26.027  6.718   1.00 50.81  ? 1374 VAL A HG11  1 
ATOM   7298 H  HG12  . VAL A 1 504 ? -1.278  24.749  7.539   1.00 50.81  ? 1374 VAL A HG12  1 
ATOM   7299 H  HG13  . VAL A 1 504 ? -2.678  24.814  6.826   1.00 50.81  ? 1374 VAL A HG13  1 
ATOM   7300 H  HG21  . VAL A 1 504 ? -3.385  27.577  7.604   1.00 47.61  ? 1374 VAL A HG21  1 
ATOM   7301 H  HG22  . VAL A 1 504 ? -4.425  26.403  7.721   1.00 47.61  ? 1374 VAL A HG22  1 
ATOM   7302 H  HG23  . VAL A 1 504 ? -4.085  27.282  8.980   1.00 47.61  ? 1374 VAL A HG23  1 
ATOM   7303 N  N     . LEU A 1 505 ? -2.102  22.632  9.331   1.00 30.32  ? 1375 LEU A N     1 
ATOM   7304 C  CA    . LEU A 1 505 ? -1.055  21.651  9.549   1.00 32.78  ? 1375 LEU A CA    1 
ATOM   7305 C  C     . LEU A 1 505 ? -0.213  21.520  8.288   1.00 38.88  ? 1375 LEU A C     1 
ATOM   7306 O  O     . LEU A 1 505 ? -0.743  21.567  7.184   1.00 30.36  ? 1375 LEU A O     1 
ATOM   7307 C  CB    . LEU A 1 505 ? -1.680  20.306  9.907   1.00 32.15  ? 1375 LEU A CB    1 
ATOM   7308 C  CG    . LEU A 1 505 ? -2.576  20.324  11.149  1.00 35.60  ? 1375 LEU A CG    1 
ATOM   7309 C  CD1   . LEU A 1 505 ? -3.299  18.993  11.327  1.00 37.69  ? 1375 LEU A CD1   1 
ATOM   7310 C  CD2   . LEU A 1 505 ? -1.761  20.661  12.387  1.00 34.99  ? 1375 LEU A CD2   1 
ATOM   7311 H  H     . LEU A 1 505 ? -2.782  22.331  8.900   1.00 36.38  ? 1375 LEU A H     1 
ATOM   7312 H  HA    . LEU A 1 505 ? -0.478  21.938  10.287  1.00 39.33  ? 1375 LEU A HA    1 
ATOM   7313 H  HB2   . LEU A 1 505 ? -2.222  20.008  9.159   1.00 38.58  ? 1375 LEU A HB2   1 
ATOM   7314 H  HB3   . LEU A 1 505 ? -0.968  19.667  10.068  1.00 38.58  ? 1375 LEU A HB3   1 
ATOM   7315 H  HG    . LEU A 1 505 ? -3.248  21.015  11.040  1.00 42.72  ? 1375 LEU A HG    1 
ATOM   7316 H  HD11  . LEU A 1 505 ? -3.844  18.827  10.554  1.00 45.22  ? 1375 LEU A HD11  1 
ATOM   7317 H  HD12  . LEU A 1 505 ? -2.647  18.294  11.425  1.00 45.22  ? 1375 LEU A HD12  1 
ATOM   7318 H  HD13  . LEU A 1 505 ? -3.849  19.039  12.112  1.00 45.22  ? 1375 LEU A HD13  1 
ATOM   7319 H  HD21  . LEU A 1 505 ? -1.362  21.527  12.272  1.00 41.98  ? 1375 LEU A HD21  1 
ATOM   7320 H  HD22  . LEU A 1 505 ? -2.342  20.667  13.151  1.00 41.98  ? 1375 LEU A HD22  1 
ATOM   7321 H  HD23  . LEU A 1 505 ? -1.077  19.997  12.500  1.00 41.98  ? 1375 LEU A HD23  1 
ATOM   7322 N  N     . GLU A 1 506 ? 1.095   21.352  8.450   1.00 27.37  ? 1376 GLU A N     1 
ATOM   7323 C  CA    . GLU A 1 506 ? 1.992   21.175  7.314   1.00 31.24  ? 1376 GLU A CA    1 
ATOM   7324 C  C     . GLU A 1 506 ? 2.609   19.787  7.376   1.00 33.79  ? 1376 GLU A C     1 
ATOM   7325 O  O     . GLU A 1 506 ? 3.187   19.410  8.396   1.00 32.85  ? 1376 GLU A O     1 
ATOM   7326 C  CB    . GLU A 1 506 ? 3.091   22.239  7.336   1.00 33.34  ? 1376 GLU A CB    1 
ATOM   7327 C  CG    . GLU A 1 506 ? 4.035   22.154  6.151   1.00 29.54  ? 1376 GLU A CG    1 
ATOM   7328 C  CD    . GLU A 1 506 ? 5.028   23.305  6.113   1.00 35.66  ? 1376 GLU A CD    1 
ATOM   7329 O  OE1   . GLU A 1 506 ? 5.532   23.702  7.186   1.00 34.56  ? 1376 GLU A OE1   1 
ATOM   7330 O  OE2   . GLU A 1 506 ? 5.297   23.817  5.013   1.00 36.27  ? 1376 GLU A OE2   1 
ATOM   7331 H  H     . GLU A 1 506 ? 1.491   21.337  9.213   1.00 32.84  ? 1376 GLU A H     1 
ATOM   7332 H  HA    . GLU A 1 506 ? 1.488   21.259  6.478   1.00 37.49  ? 1376 GLU A HA    1 
ATOM   7333 H  HB2   . GLU A 1 506 ? 2.679   23.117  7.325   1.00 40.00  ? 1376 GLU A HB2   1 
ATOM   7334 H  HB3   . GLU A 1 506 ? 3.617   22.130  8.144   1.00 40.00  ? 1376 GLU A HB3   1 
ATOM   7335 H  HG2   . GLU A 1 506 ? 4.537   21.325  6.205   1.00 35.45  ? 1376 GLU A HG2   1 
ATOM   7336 H  HG3   . GLU A 1 506 ? 3.517   22.176  5.331   1.00 35.45  ? 1376 GLU A HG3   1 
ATOM   7337 N  N     . GLN A 1 507 ? 2.487   19.025  6.293   1.00 25.43  ? 1377 GLN A N     1 
ATOM   7338 C  CA    . GLN A 1 507 ? 2.890   17.626  6.316   1.00 28.73  ? 1377 GLN A CA    1 
ATOM   7339 C  C     . GLN A 1 507 ? 4.292   17.376  5.784   1.00 30.09  ? 1377 GLN A C     1 
ATOM   7340 O  O     . GLN A 1 507 ? 4.935   16.399  6.175   1.00 32.23  ? 1377 GLN A O     1 
ATOM   7341 C  CB    . GLN A 1 507 ? 1.876   16.779  5.549   1.00 31.88  ? 1377 GLN A CB    1 
ATOM   7342 C  CG    . GLN A 1 507 ? 0.534   16.707  6.243   1.00 38.23  ? 1377 GLN A CG    1 
ATOM   7343 C  CD    . GLN A 1 507 ? 0.005   15.291  6.308   1.00 45.77  ? 1377 GLN A CD    1 
ATOM   7344 O  OE1   . GLN A 1 507 ? -0.416  14.741  5.295   1.00 29.26  ? 1377 GLN A OE1   1 
ATOM   7345 N  NE2   . GLN A 1 507 ? 0.043   14.684  7.498   1.00 36.23  ? 1377 GLN A NE2   1 
ATOM   7346 H  H     . GLN A 1 507 ? 2.175   19.293  5.538   1.00 30.52  ? 1377 GLN A H     1 
ATOM   7347 H  HA    . GLN A 1 507 ? 2.876   17.320  7.247   1.00 34.47  ? 1377 GLN A HA    1 
ATOM   7348 H  HB2   . GLN A 1 507 ? 1.740   17.168  4.671   1.00 38.26  ? 1377 GLN A HB2   1 
ATOM   7349 H  HB3   . GLN A 1 507 ? 2.219   15.876  5.463   1.00 38.26  ? 1377 GLN A HB3   1 
ATOM   7350 H  HG2   . GLN A 1 507 ? 0.626   17.037  7.150   1.00 45.87  ? 1377 GLN A HG2   1 
ATOM   7351 H  HG3   . GLN A 1 507 ? -0.107  17.247  5.754   1.00 45.87  ? 1377 GLN A HG3   1 
ATOM   7352 H  HE21  . GLN A 1 507 ? -0.247  13.879  7.580   1.00 43.48  ? 1377 GLN A HE21  1 
ATOM   7353 H  HE22  . GLN A 1 507 ? 0.358   15.099  8.182   1.00 43.48  ? 1377 GLN A HE22  1 
ATOM   7354 N  N     . TYR A 1 508 ? 4.754   18.252  4.893   1.00 24.24  ? 1378 TYR A N     1 
ATOM   7355 C  CA    . TYR A 1 508 ? 6.073   18.120  4.285   1.00 29.47  ? 1378 TYR A CA    1 
ATOM   7356 C  C     . TYR A 1 508 ? 6.898   19.386  4.495   1.00 32.73  ? 1378 TYR A C     1 
ATOM   7357 O  O     . TYR A 1 508 ? 6.368   20.489  4.415   1.00 28.94  ? 1378 TYR A O     1 
ATOM   7358 C  CB    . TYR A 1 508 ? 5.932   17.897  2.787   1.00 29.15  ? 1378 TYR A CB    1 
ATOM   7359 C  CG    . TYR A 1 508 ? 5.231   16.613  2.433   1.00 28.45  ? 1378 TYR A CG    1 
ATOM   7360 C  CD1   . TYR A 1 508 ? 5.922   15.410  2.398   1.00 28.18  ? 1378 TYR A CD1   1 
ATOM   7361 C  CD2   . TYR A 1 508 ? 3.880   16.602  2.141   1.00 28.36  ? 1378 TYR A CD2   1 
ATOM   7362 C  CE1   . TYR A 1 508 ? 5.279   14.227  2.073   1.00 39.43  ? 1378 TYR A CE1   1 
ATOM   7363 C  CE2   . TYR A 1 508 ? 3.227   15.423  1.819   1.00 28.38  ? 1378 TYR A CE2   1 
ATOM   7364 C  CZ    . TYR A 1 508 ? 3.930   14.243  1.788   1.00 38.17  ? 1378 TYR A CZ    1 
ATOM   7365 O  OH    . TYR A 1 508 ? 3.280   13.075  1.465   1.00 42.25  ? 1378 TYR A OH    1 
ATOM   7366 H  H     . TYR A 1 508 ? 4.315   18.939  4.622   1.00 29.08  ? 1378 TYR A H     1 
ATOM   7367 H  HA    . TYR A 1 508 ? 6.550   17.360  4.678   1.00 35.37  ? 1378 TYR A HA    1 
ATOM   7368 H  HB2   . TYR A 1 508 ? 5.422   18.629  2.408   1.00 34.98  ? 1378 TYR A HB2   1 
ATOM   7369 H  HB3   . TYR A 1 508 ? 6.817   17.872  2.390   1.00 34.98  ? 1378 TYR A HB3   1 
ATOM   7370 H  HD1   . TYR A 1 508 ? 6.831   15.399  2.591   1.00 33.81  ? 1378 TYR A HD1   1 
ATOM   7371 H  HD2   . TYR A 1 508 ? 3.401   17.399  2.163   1.00 34.04  ? 1378 TYR A HD2   1 
ATOM   7372 H  HE1   . TYR A 1 508 ? 5.753   13.427  2.053   1.00 47.32  ? 1378 TYR A HE1   1 
ATOM   7373 H  HE2   . TYR A 1 508 ? 2.318   15.431  1.624   1.00 34.05  ? 1378 TYR A HE2   1 
ATOM   7374 H  HH    . TYR A 1 508 ? 2.955   13.132  0.715   1.00 50.70  ? 1378 TYR A HH    1 
ATOM   7375 N  N     . LYS A 1 509 ? 8.192   19.233  4.753   1.00 30.94  ? 1379 LYS A N     1 
ATOM   7376 C  CA    . LYS A 1 509 ? 9.084   20.389  4.768   1.00 27.60  ? 1379 LYS A CA    1 
ATOM   7377 C  C     . LYS A 1 509 ? 9.215   20.909  3.344   1.00 28.79  ? 1379 LYS A C     1 
ATOM   7378 O  O     . LYS A 1 509 ? 9.456   20.138  2.418   1.00 25.51  ? 1379 LYS A O     1 
ATOM   7379 C  CB    . LYS A 1 509 ? 10.458  20.016  5.333   1.00 37.74  ? 1379 LYS A CB    1 
ATOM   7380 C  CG    . LYS A 1 509 ? 10.479  19.795  6.849   1.00 45.90  ? 1379 LYS A CG    1 
ATOM   7381 C  CD    . LYS A 1 509 ? 9.992   21.031  7.608   1.00 60.78  ? 1379 LYS A CD    1 
ATOM   7382 C  CE    . LYS A 1 509 ? 10.276  20.922  9.109   1.00 66.44  ? 1379 LYS A CE    1 
ATOM   7383 N  NZ    . LYS A 1 509 ? 9.821   22.132  9.857   1.00 55.72  ? 1379 LYS A NZ    1 
ATOM   7384 H  H     . LYS A 1 509 ? 8.575   18.482  4.920   1.00 37.13  ? 1379 LYS A H     1 
ATOM   7385 H  HA    . LYS A 1 509 ? 8.697   21.097  5.325   1.00 33.12  ? 1379 LYS A HA    1 
ATOM   7386 H  HB2   . LYS A 1 509 ? 10.754  19.194  4.911   1.00 45.29  ? 1379 LYS A HB2   1 
ATOM   7387 H  HB3   . LYS A 1 509 ? 11.082  20.730  5.130   1.00 45.29  ? 1379 LYS A HB3   1 
ATOM   7388 H  HG2   . LYS A 1 509 ? 9.896   19.053  7.072   1.00 55.08  ? 1379 LYS A HG2   1 
ATOM   7389 H  HG3   . LYS A 1 509 ? 11.387  19.604  7.131   1.00 55.08  ? 1379 LYS A HG3   1 
ATOM   7390 H  HD2   . LYS A 1 509 ? 10.451  21.816  7.269   1.00 72.94  ? 1379 LYS A HD2   1 
ATOM   7391 H  HD3   . LYS A 1 509 ? 9.035   21.124  7.486   1.00 72.94  ? 1379 LYS A HD3   1 
ATOM   7392 H  HE2   . LYS A 1 509 ? 9.806   20.152  9.466   1.00 79.73  ? 1379 LYS A HE2   1 
ATOM   7393 H  HE3   . LYS A 1 509 ? 11.231  20.824  9.246   1.00 79.73  ? 1379 LYS A HE3   1 
ATOM   7394 H  HZ1   . LYS A 1 509 ? 10.242  22.854  9.551   1.00 66.86  ? 1379 LYS A HZ1   1 
ATOM   7395 H  HZ2   . LYS A 1 509 ? 8.944   22.242  9.752   1.00 66.86  ? 1379 LYS A HZ2   1 
ATOM   7396 H  HZ3   . LYS A 1 509 ? 9.999   22.038  10.723  1.00 66.86  ? 1379 LYS A HZ3   1 
ATOM   7397 N  N     . MET A 1 510 ? 9.053   22.216  3.161   1.00 26.62  ? 1380 MET A N     1 
ATOM   7398 C  CA    . MET A 1 510 ? 9.115   22.790  1.830   1.00 28.77  ? 1380 MET A CA    1 
ATOM   7399 C  C     . MET A 1 510 ? 10.480  22.480  1.227   1.00 30.23  ? 1380 MET A C     1 
ATOM   7400 O  O     . MET A 1 510 ? 10.605  22.246  0.028   1.00 28.05  ? 1380 MET A O     1 
ATOM   7401 C  CB    . MET A 1 510 ? 8.858   24.296  1.887   1.00 36.96  ? 1380 MET A CB    1 
ATOM   7402 C  CG    . MET A 1 510 ? 8.932   24.984  0.533   1.00 37.64  ? 1380 MET A CG    1 
ATOM   7403 S  SD    . MET A 1 510 ? 7.797   24.258  -0.681  1.00 36.78  ? 1380 MET A SD    1 
ATOM   7404 C  CE    . MET A 1 510 ? 6.210   24.559  0.074   1.00 27.43  ? 1380 MET A CE    1 
ATOM   7405 H  H     . MET A 1 510 ? 8.906   22.785  3.789   1.00 31.94  ? 1380 MET A H     1 
ATOM   7406 H  HA    . MET A 1 510 ? 8.419   22.384  1.273   1.00 34.53  ? 1380 MET A HA    1 
ATOM   7407 H  HB2   . MET A 1 510 ? 7.970   24.448  2.248   1.00 44.35  ? 1380 MET A HB2   1 
ATOM   7408 H  HB3   . MET A 1 510 ? 9.522   24.705  2.463   1.00 44.35  ? 1380 MET A HB3   1 
ATOM   7409 H  HG2   . MET A 1 510 ? 8.700   25.919  0.640   1.00 45.16  ? 1380 MET A HG2   1 
ATOM   7410 H  HG3   . MET A 1 510 ? 9.834   24.903  0.186   1.00 45.16  ? 1380 MET A HG3   1 
ATOM   7411 H  HE1   . MET A 1 510 ? 6.092   25.505  0.187   1.00 32.92  ? 1380 MET A HE1   1 
ATOM   7412 H  HE2   . MET A 1 510 ? 5.521   24.208  -0.495  1.00 32.92  ? 1380 MET A HE2   1 
ATOM   7413 H  HE3   . MET A 1 510 ? 6.183   24.121  0.929   1.00 32.92  ? 1380 MET A HE3   1 
ATOM   7414 N  N     . GLU A 1 511 ? 11.502  22.432  2.074   1.00 30.69  ? 1381 GLU A N     1 
ATOM   7415 C  CA    . GLU A 1 511 ? 12.849  22.149  1.606   1.00 33.34  ? 1381 GLU A CA    1 
ATOM   7416 C  C     . GLU A 1 511 ? 12.915  20.736  1.020   1.00 26.87  ? 1381 GLU A C     1 
ATOM   7417 O  O     . GLU A 1 511 ? 13.639  20.485  0.059   1.00 29.64  ? 1381 GLU A O     1 
ATOM   7418 C  CB    . GLU A 1 511 ? 13.855  22.299  2.752   1.00 47.06  ? 1381 GLU A CB    1 
ATOM   7419 C  CG    . GLU A 1 511 ? 14.072  23.736  3.260   1.00 77.27  ? 1381 GLU A CG    1 
ATOM   7420 C  CD    . GLU A 1 511 ? 12.955  24.278  4.157   1.00 84.51  ? 1381 GLU A CD    1 
ATOM   7421 O  OE1   . GLU A 1 511 ? 12.154  23.488  4.709   1.00 49.35  ? 1381 GLU A OE1   1 
ATOM   7422 O  OE2   . GLU A 1 511 ? 12.892  25.521  4.301   1.00 101.13 ? 1381 GLU A OE2   1 
ATOM   7423 H  H     . GLU A 1 511 ? 11.440  22.559  2.922   1.00 36.83  ? 1381 GLU A H     1 
ATOM   7424 H  HA    . GLU A 1 511 ? 13.088  22.786  0.901   1.00 40.01  ? 1381 GLU A HA    1 
ATOM   7425 H  HB2   . GLU A 1 511 ? 13.546  21.769  3.504   1.00 56.47  ? 1381 GLU A HB2   1 
ATOM   7426 H  HB3   . GLU A 1 511 ? 14.715  21.965  2.452   1.00 56.47  ? 1381 GLU A HB3   1 
ATOM   7427 H  HG2   . GLU A 1 511 ? 14.896  23.762  3.771   1.00 92.73  ? 1381 GLU A HG2   1 
ATOM   7428 H  HG3   . GLU A 1 511 ? 14.145  24.326  2.494   1.00 92.73  ? 1381 GLU A HG3   1 
ATOM   7429 N  N     . ASP A 1 512 ? 12.149  19.823  1.607   1.00 27.13  ? 1382 ASP A N     1 
ATOM   7430 C  CA    . ASP A 1 512 ? 12.042  18.446  1.121   1.00 28.15  ? 1382 ASP A CA    1 
ATOM   7431 C  C     . ASP A 1 512 ? 11.415  18.396  -0.283  1.00 28.84  ? 1382 ASP A C     1 
ATOM   7432 O  O     . ASP A 1 512 ? 11.973  17.802  -1.203  1.00 26.44  ? 1382 ASP A O     1 
ATOM   7433 C  CB    . ASP A 1 512 ? 11.212  17.635  2.124   1.00 30.16  ? 1382 ASP A CB    1 
ATOM   7434 C  CG    . ASP A 1 512 ? 10.963  16.200  1.684   1.00 48.48  ? 1382 ASP A CG    1 
ATOM   7435 O  OD1   . ASP A 1 512 ? 11.746  15.658  0.876   1.00 55.02  ? 1382 ASP A OD1   1 
ATOM   7436 O  OD2   . ASP A 1 512 ? 9.977   15.603  2.175   1.00 48.87  ? 1382 ASP A OD2   1 
ATOM   7437 H  H     . ASP A 1 512 ? 11.670  19.978  2.304   1.00 32.56  ? 1382 ASP A H     1 
ATOM   7438 H  HA    . ASP A 1 512 ? 12.937  18.050  1.071   1.00 33.78  ? 1382 ASP A HA    1 
ATOM   7439 H  HB2   . ASP A 1 512 ? 11.682  17.609  2.972   1.00 36.19  ? 1382 ASP A HB2   1 
ATOM   7440 H  HB3   . ASP A 1 512 ? 10.350  18.065  2.238   1.00 36.19  ? 1382 ASP A HB3   1 
ATOM   7441 N  N     . LEU A 1 513 ? 10.260  19.034  -0.443  1.00 22.08  ? 1383 LEU A N     1 
ATOM   7442 C  CA    . LEU A 1 513 ? 9.581   19.071  -1.735  1.00 22.69  ? 1383 LEU A CA    1 
ATOM   7443 C  C     . LEU A 1 513 ? 10.483  19.701  -2.794  1.00 23.95  ? 1383 LEU A C     1 
ATOM   7444 O  O     . LEU A 1 513 ? 10.544  19.233  -3.919  1.00 21.74  ? 1383 LEU A O     1 
ATOM   7445 C  CB    . LEU A 1 513 ? 8.281   19.867  -1.621  1.00 21.09  ? 1383 LEU A CB    1 
ATOM   7446 C  CG    . LEU A 1 513 ? 7.212   19.298  -0.689  1.00 30.06  ? 1383 LEU A CG    1 
ATOM   7447 C  CD1   . LEU A 1 513 ? 6.003   20.227  -0.661  1.00 27.83  ? 1383 LEU A CD1   1 
ATOM   7448 C  CD2   . LEU A 1 513 ? 6.821   17.892  -1.135  1.00 31.20  ? 1383 LEU A CD2   1 
ATOM   7449 H  H     . LEU A 1 513 ? 9.846   19.454  0.183   1.00 26.49  ? 1383 LEU A H     1 
ATOM   7450 H  HA    . LEU A 1 513 ? 9.363   18.158  -2.016  1.00 27.23  ? 1383 LEU A HA    1 
ATOM   7451 H  HB2   . LEU A 1 513 ? 8.497   20.757  -1.300  1.00 25.31  ? 1383 LEU A HB2   1 
ATOM   7452 H  HB3   . LEU A 1 513 ? 7.887   19.932  -2.505  1.00 25.31  ? 1383 LEU A HB3   1 
ATOM   7453 H  HG    . LEU A 1 513 ? 7.571   19.241  0.210   1.00 36.08  ? 1383 LEU A HG    1 
ATOM   7454 H  HD11  . LEU A 1 513 ? 5.340   19.858  -0.073  1.00 33.40  ? 1383 LEU A HD11  1 
ATOM   7455 H  HD12  . LEU A 1 513 ? 6.280   21.090  -0.343  1.00 33.40  ? 1383 LEU A HD12  1 
ATOM   7456 H  HD13  . LEU A 1 513 ? 5.647   20.304  -1.550  1.00 33.40  ? 1383 LEU A HD13  1 
ATOM   7457 H  HD21  . LEU A 1 513 ? 6.475   17.934  -2.029  1.00 37.44  ? 1383 LEU A HD21  1 
ATOM   7458 H  HD22  . LEU A 1 513 ? 7.598   17.330  -1.110  1.00 37.44  ? 1383 LEU A HD22  1 
ATOM   7459 H  HD23  . LEU A 1 513 ? 6.150   17.552  -0.539  1.00 37.44  ? 1383 LEU A HD23  1 
ATOM   7460 N  N     . MET A 1 514 ? 11.191  20.760  -2.419  1.00 21.98  ? 1384 MET A N     1 
ATOM   7461 C  CA    . MET A 1 514 ? 12.062  21.458  -3.354  1.00 19.51  ? 1384 MET A CA    1 
ATOM   7462 C  C     . MET A 1 514 ? 13.159  20.511  -3.825  1.00 26.15  ? 1384 MET A C     1 
ATOM   7463 O  O     . MET A 1 514 ? 13.492  20.488  -5.006  1.00 23.36  ? 1384 MET A O     1 
ATOM   7464 C  CB    . MET A 1 514 ? 12.652  22.715  -2.690  1.00 20.76  ? 1384 MET A CB    1 
ATOM   7465 C  CG    . MET A 1 514 ? 11.609  23.797  -2.474  1.00 26.07  ? 1384 MET A CG    1 
ATOM   7466 S  SD    . MET A 1 514 ? 12.201  25.217  -1.520  1.00 37.59  ? 1384 MET A SD    1 
ATOM   7467 C  CE    . MET A 1 514 ? 13.207  26.061  -2.740  1.00 42.94  ? 1384 MET A CE    1 
ATOM   7468 H  H     . MET A 1 514 ? 11.184  21.095  -1.627  1.00 26.37  ? 1384 MET A H     1 
ATOM   7469 H  HA    . MET A 1 514 ? 11.534  21.744  -4.129  1.00 23.41  ? 1384 MET A HA    1 
ATOM   7470 H  HB2   . MET A 1 514 ? 13.020  22.475  -1.826  1.00 24.91  ? 1384 MET A HB2   1 
ATOM   7471 H  HB3   . MET A 1 514 ? 13.348  23.078  -3.260  1.00 24.91  ? 1384 MET A HB3   1 
ATOM   7472 H  HG2   . MET A 1 514 ? 11.315  24.124  -3.338  1.00 31.29  ? 1384 MET A HG2   1 
ATOM   7473 H  HG3   . MET A 1 514 ? 10.857  23.414  -1.996  1.00 31.29  ? 1384 MET A HG3   1 
ATOM   7474 H  HE1   . MET A 1 514 ? 13.908  25.472  -3.029  1.00 51.53  ? 1384 MET A HE1   1 
ATOM   7475 H  HE2   . MET A 1 514 ? 12.654  26.303  -3.487  1.00 51.53  ? 1384 MET A HE2   1 
ATOM   7476 H  HE3   . MET A 1 514 ? 13.584  26.850  -2.343  1.00 51.53  ? 1384 MET A HE3   1 
ATOM   7477 N  N     . GLN A 1 515 ? 13.688  19.708  -2.907  1.00 27.65  ? 1385 GLN A N     1 
ATOM   7478 C  CA    . GLN A 1 515 ? 14.747  18.764  -3.238  1.00 30.85  ? 1385 GLN A CA    1 
ATOM   7479 C  C     . GLN A 1 515 ? 14.245  17.666  -4.160  1.00 25.12  ? 1385 GLN A C     1 
ATOM   7480 O  O     . GLN A 1 515 ? 14.911  17.309  -5.117  1.00 26.02  ? 1385 GLN A O     1 
ATOM   7481 C  CB    . GLN A 1 515 ? 15.324  18.123  -1.976  1.00 44.77  ? 1385 GLN A CB    1 
ATOM   7482 C  CG    . GLN A 1 515 ? 16.207  19.048  -1.166  1.00 78.82  ? 1385 GLN A CG    1 
ATOM   7483 C  CD    . GLN A 1 515 ? 17.551  19.280  -1.821  1.00 102.31 ? 1385 GLN A CD    1 
ATOM   7484 O  OE1   . GLN A 1 515 ? 17.667  20.075  -2.756  1.00 104.96 ? 1385 GLN A OE1   1 
ATOM   7485 N  NE2   . GLN A 1 515 ? 18.574  18.578  -1.345  1.00 110.52 ? 1385 GLN A NE2   1 
ATOM   7486 H  H     . GLN A 1 515 ? 13.449  19.691  -2.081  1.00 33.18  ? 1385 GLN A H     1 
ATOM   7487 H  HA    . GLN A 1 515 ? 15.470  19.241  -3.697  1.00 37.02  ? 1385 GLN A HA    1 
ATOM   7488 H  HB2   . GLN A 1 515 ? 14.591  17.840  -1.407  1.00 53.72  ? 1385 GLN A HB2   1 
ATOM   7489 H  HB3   . GLN A 1 515 ? 15.857  17.354  -2.232  1.00 53.72  ? 1385 GLN A HB3   1 
ATOM   7490 H  HG2   . GLN A 1 515 ? 15.765  19.907  -1.071  1.00 94.58  ? 1385 GLN A HG2   1 
ATOM   7491 H  HG3   . GLN A 1 515 ? 16.361  18.655  -0.292  1.00 94.58  ? 1385 GLN A HG3   1 
ATOM   7492 H  HE21  . GLN A 1 515 ? 18.452  18.026  -0.697  1.00 132.63 ? 1385 GLN A HE21  1 
ATOM   7493 H  HE22  . GLN A 1 515 ? 19.358  18.675  -1.685  1.00 132.63 ? 1385 GLN A HE22  1 
ATOM   7494 N  N     . VAL A 1 516 ? 13.075  17.112  -3.862  1.00 20.76  ? 1386 VAL A N     1 
ATOM   7495 C  CA    . VAL A 1 516 ? 12.511  16.049  -4.692  1.00 18.03  ? 1386 VAL A CA    1 
ATOM   7496 C  C     . VAL A 1 516 ? 12.277  16.599  -6.100  1.00 22.15  ? 1386 VAL A C     1 
ATOM   7497 O  O     . VAL A 1 516 ? 12.572  15.945  -7.108  1.00 22.45  ? 1386 VAL A O     1 
ATOM   7498 C  CB    . VAL A 1 516 ? 11.179  15.548  -4.113  1.00 19.37  ? 1386 VAL A CB    1 
ATOM   7499 C  CG1   . VAL A 1 516 ? 10.485  14.595  -5.089  1.00 19.77  ? 1386 VAL A CG1   1 
ATOM   7500 C  CG2   . VAL A 1 516 ? 11.416  14.874  -2.756  1.00 32.49  ? 1386 VAL A CG2   1 
ATOM   7501 H  H     . VAL A 1 516 ? 12.589  17.331  -3.187  1.00 24.92  ? 1386 VAL A H     1 
ATOM   7502 H  HA    . VAL A 1 516 ? 13.138  15.297  -4.744  1.00 21.64  ? 1386 VAL A HA    1 
ATOM   7503 H  HB    . VAL A 1 516 ? 10.586  16.315  -3.969  1.00 23.24  ? 1386 VAL A HB    1 
ATOM   7504 H  HG11  . VAL A 1 516 ? 11.030  14.502  -5.874  1.00 23.73  ? 1386 VAL A HG11  1 
ATOM   7505 H  HG12  . VAL A 1 516 ? 10.373  13.742  -4.664  1.00 23.73  ? 1386 VAL A HG12  1 
ATOM   7506 H  HG13  . VAL A 1 516 ? 9.629   14.959  -5.325  1.00 23.73  ? 1386 VAL A HG13  1 
ATOM   7507 H  HG21  . VAL A 1 516 ? 12.353  14.906  -2.551  1.00 38.99  ? 1386 VAL A HG21  1 
ATOM   7508 H  HG22  . VAL A 1 516 ? 10.917  15.342  -2.083  1.00 38.99  ? 1386 VAL A HG22  1 
ATOM   7509 H  HG23  . VAL A 1 516 ? 11.122  13.961  -2.806  1.00 38.99  ? 1386 VAL A HG23  1 
ATOM   7510 N  N     . TYR A 1 517 ? 11.753  17.817  -6.161  1.00 19.85  ? 1387 TYR A N     1 
ATOM   7511 C  CA    . TYR A 1 517 ? 11.457  18.449  -7.445  1.00 19.76  ? 1387 TYR A CA    1 
ATOM   7512 C  C     . TYR A 1 517 ? 12.746  18.625  -8.255  1.00 21.58  ? 1387 TYR A C     1 
ATOM   7513 O  O     . TYR A 1 517 ? 12.807  18.259  -9.432  1.00 21.12  ? 1387 TYR A O     1 
ATOM   7514 C  CB    . TYR A 1 517 ? 10.756  19.799  -7.213  1.00 20.17  ? 1387 TYR A CB    1 
ATOM   7515 C  CG    . TYR A 1 517 ? 10.566  20.626  -8.472  1.00 20.95  ? 1387 TYR A CG    1 
ATOM   7516 C  CD1   . TYR A 1 517 ? 9.445   20.458  -9.278  1.00 20.85  ? 1387 TYR A CD1   1 
ATOM   7517 C  CD2   . TYR A 1 517 ? 11.505  21.584  -8.848  1.00 21.55  ? 1387 TYR A CD2   1 
ATOM   7518 C  CE1   . TYR A 1 517 ? 9.266   21.216  -10.431 1.00 20.65  ? 1387 TYR A CE1   1 
ATOM   7519 C  CE2   . TYR A 1 517 ? 11.336  22.339  -10.009 1.00 21.13  ? 1387 TYR A CE2   1 
ATOM   7520 C  CZ    . TYR A 1 517 ? 10.212  22.162  -10.787 1.00 23.13  ? 1387 TYR A CZ    1 
ATOM   7521 O  OH    . TYR A 1 517 ? 10.047  22.919  -11.943 1.00 20.44  ? 1387 TYR A OH    1 
ATOM   7522 H  H     . TYR A 1 517 ? 11.559  18.299  -5.476  1.00 23.82  ? 1387 TYR A H     1 
ATOM   7523 H  HA    . TYR A 1 517 ? 10.851  17.873  -7.956  1.00 23.72  ? 1387 TYR A HA    1 
ATOM   7524 H  HB2   . TYR A 1 517 ? 9.879   19.633  -6.834  1.00 24.20  ? 1387 TYR A HB2   1 
ATOM   7525 H  HB3   . TYR A 1 517 ? 11.288  20.323  -6.593  1.00 24.20  ? 1387 TYR A HB3   1 
ATOM   7526 H  HD1   . TYR A 1 517 ? 8.804   19.827  -9.043  1.00 25.02  ? 1387 TYR A HD1   1 
ATOM   7527 H  HD2   . TYR A 1 517 ? 12.264  21.712  -8.326  1.00 25.86  ? 1387 TYR A HD2   1 
ATOM   7528 H  HE1   . TYR A 1 517 ? 8.511   21.090  -10.960 1.00 24.78  ? 1387 TYR A HE1   1 
ATOM   7529 H  HE2   . TYR A 1 517 ? 11.971  22.976  -10.246 1.00 25.36  ? 1387 TYR A HE2   1 
ATOM   7530 H  HH    . TYR A 1 517 ? 9.352   23.352  -11.898 1.00 24.53  ? 1387 TYR A HH    1 
ATOM   7531 N  N     . ASP A 1 518 ? 13.793  19.157  -7.624  1.00 21.82  ? 1388 ASP A N     1 
ATOM   7532 C  CA    . ASP A 1 518 ? 15.042  19.410  -8.337  1.00 23.85  ? 1388 ASP A CA    1 
ATOM   7533 C  C     . ASP A 1 518 ? 15.765  18.115  -8.718  1.00 23.70  ? 1388 ASP A C     1 
ATOM   7534 O  O     . ASP A 1 518 ? 16.450  18.066  -9.727  1.00 24.96  ? 1388 ASP A O     1 
ATOM   7535 C  CB    . ASP A 1 518 ? 15.986  20.298  -7.511  1.00 25.52  ? 1388 ASP A CB    1 
ATOM   7536 C  CG    . ASP A 1 518 ? 15.578  21.763  -7.532  1.00 29.23  ? 1388 ASP A CG    1 
ATOM   7537 O  OD1   . ASP A 1 518 ? 14.853  22.179  -8.459  1.00 26.42  ? 1388 ASP A OD1   1 
ATOM   7538 O  OD2   . ASP A 1 518 ? 15.973  22.497  -6.615  1.00 26.05  ? 1388 ASP A OD2   1 
ATOM   7539 H  H     . ASP A 1 518 ? 13.805  19.379  -6.793  1.00 26.19  ? 1388 ASP A H     1 
ATOM   7540 H  HA    . ASP A 1 518 ? 14.836  19.888  -9.167  1.00 28.63  ? 1388 ASP A HA    1 
ATOM   7541 H  HB2   . ASP A 1 518 ? 15.978  19.996  -6.589  1.00 30.62  ? 1388 ASP A HB2   1 
ATOM   7542 H  HB3   . ASP A 1 518 ? 16.883  20.230  -7.875  1.00 30.62  ? 1388 ASP A HB3   1 
ATOM   7543 N  N     A GLN A 1 519 ? 15.619  17.069  -7.915  0.40 22.38  ? 1389 GLN A N     1 
ATOM   7544 N  N     B GLN A 1 519 ? 15.598  17.077  -7.904  0.60 22.33  ? 1389 GLN A N     1 
ATOM   7545 C  CA    A GLN A 1 519 ? 16.309  15.821  -8.215  0.40 24.76  ? 1389 GLN A CA    1 
ATOM   7546 C  CA    B GLN A 1 519 ? 16.258  15.799  -8.152  0.60 25.35  ? 1389 GLN A CA    1 
ATOM   7547 C  C     A GLN A 1 519 ? 15.474  14.927  -9.133  0.40 24.68  ? 1389 GLN A C     1 
ATOM   7548 C  C     B GLN A 1 519 ? 15.505  14.969  -9.188  0.60 25.02  ? 1389 GLN A C     1 
ATOM   7549 O  O     A GLN A 1 519 ? 15.879  13.810  -9.449  0.40 24.60  ? 1389 GLN A O     1 
ATOM   7550 O  O     B GLN A 1 519 ? 16.001  13.945  -9.650  0.60 25.82  ? 1389 GLN A O     1 
ATOM   7551 C  CB    A GLN A 1 519 ? 16.677  15.073  -6.927  0.40 31.36  ? 1389 GLN A CB    1 
ATOM   7552 C  CB    B GLN A 1 519 ? 16.388  14.993  -6.851  0.60 30.59  ? 1389 GLN A CB    1 
ATOM   7553 C  CG    A GLN A 1 519 ? 17.653  15.825  -6.027  0.40 39.32  ? 1389 GLN A CG    1 
ATOM   7554 C  CG    B GLN A 1 519 ? 17.452  15.521  -5.895  0.60 35.45  ? 1389 GLN A CG    1 
ATOM   7555 C  CD    A GLN A 1 519 ? 18.951  16.174  -6.730  0.40 56.96  ? 1389 GLN A CD    1 
ATOM   7556 C  CD    B GLN A 1 519 ? 17.678  14.625  -4.681  0.60 52.10  ? 1389 GLN A CD    1 
ATOM   7557 O  OE1   A GLN A 1 519 ? 19.460  15.397  -7.539  0.40 56.82  ? 1389 GLN A OE1   1 
ATOM   7558 O  OE1   B GLN A 1 519 ? 18.231  15.065  -3.673  0.60 53.00  ? 1389 GLN A OE1   1 
ATOM   7559 N  NE2   A GLN A 1 519 ? 19.490  17.353  -6.429  0.40 62.34  ? 1389 GLN A NE2   1 
ATOM   7560 N  NE2   B GLN A 1 519 ? 17.263  13.365  -4.775  0.60 58.74  ? 1389 GLN A NE2   1 
ATOM   7561 H  H     A GLN A 1 519 ? 15.137  17.054  -7.204  0.40 26.86  ? 1389 GLN A H     1 
ATOM   7562 H  H     B GLN A 1 519 ? 15.105  17.087  -7.199  0.60 26.80  ? 1389 GLN A H     1 
ATOM   7563 H  HA    A GLN A 1 519 ? 17.143  16.030  -8.684  0.40 29.71  ? 1389 GLN A HA    1 
ATOM   7564 H  HA    B GLN A 1 519 ? 17.160  15.967  -8.496  0.60 30.42  ? 1389 GLN A HA    1 
ATOM   7565 H  HB2   A GLN A 1 519 ? 15.868  14.913  -6.417  0.40 37.63  ? 1389 GLN A HB2   1 
ATOM   7566 H  HB2   B GLN A 1 519 ? 15.537  15.012  -6.386  0.60 36.71  ? 1389 GLN A HB2   1 
ATOM   7567 H  HB3   A GLN A 1 519 ? 17.087  14.226  -7.164  0.40 37.63  ? 1389 GLN A HB3   1 
ATOM   7568 H  HB3   B GLN A 1 519 ? 16.620  14.078  -7.074  0.60 36.71  ? 1389 GLN A HB3   1 
ATOM   7569 H  HG2   A GLN A 1 519 ? 17.239  16.652  -5.734  0.40 47.18  ? 1389 GLN A HG2   1 
ATOM   7570 H  HG2   B GLN A 1 519 ? 18.293  15.594  -6.372  0.60 42.54  ? 1389 GLN A HG2   1 
ATOM   7571 H  HG3   A GLN A 1 519 ? 17.867  15.271  -5.260  0.40 47.18  ? 1389 GLN A HG3   1 
ATOM   7572 H  HG3   B GLN A 1 519 ? 17.178  16.394  -5.574  0.60 42.54  ? 1389 GLN A HG3   1 
ATOM   7573 H  HE21  A GLN A 1 519 ? 19.102  17.871  -5.862  0.40 74.81  ? 1389 GLN A HE21  1 
ATOM   7574 H  HE21  B GLN A 1 519 ? 17.371  12.826  -4.114  0.60 70.49  ? 1389 GLN A HE21  1 
ATOM   7575 H  HE22  A GLN A 1 519 ? 20.226  17.597  -6.801  0.40 74.81  ? 1389 GLN A HE22  1 
ATOM   7576 H  HE22  B GLN A 1 519 ? 16.886  13.090  -5.498  0.60 70.49  ? 1389 GLN A HE22  1 
ATOM   7577 N  N     . PHE A 1 520 ? 14.308  15.411  -9.555  1.00 23.52  ? 1390 PHE A N     1 
ATOM   7578 C  CA    . PHE A 1 520 ? 13.513  14.684  -10.536 1.00 19.63  ? 1390 PHE A CA    1 
ATOM   7579 C  C     . PHE A 1 520 ? 13.898  15.153  -11.935 1.00 25.46  ? 1390 PHE A C     1 
ATOM   7580 O  O     . PHE A 1 520 ? 13.452  16.203  -12.397 1.00 26.89  ? 1390 PHE A O     1 
ATOM   7581 C  CB    . PHE A 1 520 ? 12.014  14.860  -10.315 1.00 19.95  ? 1390 PHE A CB    1 
ATOM   7582 C  CG    . PHE A 1 520 ? 11.183  13.959  -11.186 1.00 21.94  ? 1390 PHE A CG    1 
ATOM   7583 C  CD1   . PHE A 1 520 ? 11.296  12.578  -11.071 1.00 23.24  ? 1390 PHE A CD1   1 
ATOM   7584 C  CD2   . PHE A 1 520 ? 10.319  14.483  -12.139 1.00 18.47  ? 1390 PHE A CD2   1 
ATOM   7585 C  CE1   . PHE A 1 520 ? 10.554  11.733  -11.880 1.00 21.77  ? 1390 PHE A CE1   1 
ATOM   7586 C  CE2   . PHE A 1 520 ? 9.565   13.644  -12.958 1.00 19.41  ? 1390 PHE A CE2   1 
ATOM   7587 C  CZ    . PHE A 1 520 ? 9.686   12.264  -12.833 1.00 19.65  ? 1390 PHE A CZ    1 
ATOM   7588 H  H     . PHE A 1 520 ? 13.949  16.139  -9.271  1.00 28.23  ? 1390 PHE A H     1 
ATOM   7589 H  HA    . PHE A 1 520 ? 13.719  13.728  -10.468 1.00 23.55  ? 1390 PHE A HA    1 
ATOM   7590 H  HB2   . PHE A 1 520 ? 11.806  14.657  -9.389  1.00 23.94  ? 1390 PHE A HB2   1 
ATOM   7591 H  HB3   . PHE A 1 520 ? 11.772  15.778  -10.515 1.00 23.94  ? 1390 PHE A HB3   1 
ATOM   7592 H  HD1   . PHE A 1 520 ? 11.877  12.217  -10.441 1.00 27.89  ? 1390 PHE A HD1   1 
ATOM   7593 H  HD2   . PHE A 1 520 ? 10.240  15.405  -12.230 1.00 22.16  ? 1390 PHE A HD2   1 
ATOM   7594 H  HE1   . PHE A 1 520 ? 10.636  10.811  -11.788 1.00 26.13  ? 1390 PHE A HE1   1 
ATOM   7595 H  HE2   . PHE A 1 520 ? 8.987   14.006  -13.590 1.00 23.29  ? 1390 PHE A HE2   1 
ATOM   7596 H  HZ    . PHE A 1 520 ? 9.181   11.699  -13.372 1.00 23.58  ? 1390 PHE A HZ    1 
ATOM   7597 N  N     . THR A 1 521 ? 14.731  14.362  -12.603 1.00 22.89  ? 1391 THR A N     1 
ATOM   7598 C  CA    . THR A 1 521 ? 15.253  14.743  -13.903 1.00 23.42  ? 1391 THR A CA    1 
ATOM   7599 C  C     . THR A 1 521 ? 15.136  13.569  -14.861 1.00 26.99  ? 1391 THR A C     1 
ATOM   7600 O  O     . THR A 1 521 ? 15.012  12.412  -14.439 1.00 24.81  ? 1391 THR A O     1 
ATOM   7601 C  CB    . THR A 1 521 ? 16.719  15.183  -13.795 1.00 30.37  ? 1391 THR A CB    1 
ATOM   7602 O  OG1   . THR A 1 521 ? 17.496  14.115  -13.246 1.00 31.52  ? 1391 THR A OG1   1 
ATOM   7603 C  CG2   . THR A 1 521 ? 16.835  16.405  -12.879 1.00 33.92  ? 1391 THR A CG2   1 
ATOM   7604 H  H     . THR A 1 521 ? 15.007  13.598  -12.323 1.00 27.46  ? 1391 THR A H     1 
ATOM   7605 H  HA    . THR A 1 521 ? 14.729  15.490  -14.260 1.00 28.10  ? 1391 THR A HA    1 
ATOM   7606 H  HB    . THR A 1 521 ? 17.057  15.417  -14.674 1.00 36.45  ? 1391 THR A HB    1 
ATOM   7607 H  HG1   . THR A 1 521 ? 17.217  13.920  -12.500 1.00 37.83  ? 1391 THR A HG1   1 
ATOM   7608 H  HG21  . THR A 1 521 ? 17.753  16.679  -12.813 1.00 40.71  ? 1391 THR A HG21  1 
ATOM   7609 H  HG22  . THR A 1 521 ? 16.318  17.131  -13.234 1.00 40.71  ? 1391 THR A HG22  1 
ATOM   7610 H  HG23  . THR A 1 521 ? 16.510  16.189  -12.002 1.00 40.71  ? 1391 THR A HG23  1 
ATOM   7611 N  N     . LEU A 1 522 ? 15.168  13.863  -16.154 1.00 24.00  ? 1392 LEU A N     1 
ATOM   7612 C  CA    . LEU A 1 522 ? 14.993  12.819  -17.163 1.00 23.59  ? 1392 LEU A CA    1 
ATOM   7613 C  C     . LEU A 1 522 ? 16.129  11.797  -17.103 1.00 28.41  ? 1392 LEU A C     1 
ATOM   7614 O  O     . LEU A 1 522 ? 17.307  12.138  -17.214 1.00 28.01  ? 1392 LEU A O     1 
ATOM   7615 C  CB    . LEU A 1 522 ? 14.911  13.424  -18.564 1.00 23.11  ? 1392 LEU A CB    1 
ATOM   7616 C  CG    . LEU A 1 522 ? 14.658  12.422  -19.690 1.00 25.28  ? 1392 LEU A CG    1 
ATOM   7617 C  CD1   . LEU A 1 522 ? 13.228  11.902  -19.653 1.00 18.73  ? 1392 LEU A CD1   1 
ATOM   7618 C  CD2   . LEU A 1 522 ? 14.947  13.083  -21.030 1.00 32.48  ? 1392 LEU A CD2   1 
ATOM   7619 H  H     . LEU A 1 522 ? 15.287  14.652  -16.475 1.00 28.80  ? 1392 LEU A H     1 
ATOM   7620 H  HA    . LEU A 1 522 ? 14.153  12.346  -16.989 1.00 28.31  ? 1392 LEU A HA    1 
ATOM   7621 H  HB2   . LEU A 1 522 ? 14.186  14.068  -18.579 1.00 27.73  ? 1392 LEU A HB2   1 
ATOM   7622 H  HB3   . LEU A 1 522 ? 15.749  13.873  -18.756 1.00 27.73  ? 1392 LEU A HB3   1 
ATOM   7623 H  HG    . LEU A 1 522 ? 15.259  11.668  -19.588 1.00 30.34  ? 1392 LEU A HG    1 
ATOM   7624 H  HD11  . LEU A 1 522 ? 13.076  11.467  -18.811 1.00 22.48  ? 1392 LEU A HD11  1 
ATOM   7625 H  HD12  . LEU A 1 522 ? 12.625  12.641  -19.754 1.00 22.48  ? 1392 LEU A HD12  1 
ATOM   7626 H  HD13  . LEU A 1 522 ? 13.105  11.277  -20.372 1.00 22.48  ? 1392 LEU A HD13  1 
ATOM   7627 H  HD21  . LEU A 1 522 ? 15.864  13.366  -21.048 1.00 38.97  ? 1392 LEU A HD21  1 
ATOM   7628 H  HD22  . LEU A 1 522 ? 14.786  12.448  -21.732 1.00 38.97  ? 1392 LEU A HD22  1 
ATOM   7629 H  HD23  . LEU A 1 522 ? 14.368  13.841  -21.135 1.00 38.97  ? 1392 LEU A HD23  1 
ATOM   7630 N  N     . ALA A 1 523 ? 15.760  10.533  -16.937 1.00 28.68  ? 1393 ALA A N     1 
ATOM   7631 C  CA    . ALA A 1 523 ? 16.740  9.461   -16.823 1.00 27.98  ? 1393 ALA A CA    1 
ATOM   7632 C  C     . ALA A 1 523 ? 17.213  9.026   -18.201 1.00 25.87  ? 1393 ALA A C     1 
ATOM   7633 O  O     . ALA A 1 523 ? 16.474  9.135   -19.186 1.00 29.65  ? 1393 ALA A O     1 
ATOM   7634 C  CB    . ALA A 1 523 ? 16.133  8.276   -16.079 1.00 29.76  ? 1393 ALA A CB    1 
ATOM   7635 H  H     . ALA A 1 523 ? 14.944  10.268  -16.886 1.00 34.42  ? 1393 ALA A H     1 
ATOM   7636 H  HA    . ALA A 1 523 ? 17.515  9.781   -16.316 1.00 33.57  ? 1393 ALA A HA    1 
ATOM   7637 H  HB1   . ALA A 1 523 ? 15.368  7.961   -16.565 1.00 35.71  ? 1393 ALA A HB1   1 
ATOM   7638 H  HB2   . ALA A 1 523 ? 16.789  7.579   -16.012 1.00 35.71  ? 1393 ALA A HB2   1 
ATOM   7639 H  HB3   . ALA A 1 523 ? 15.868  8.562   -15.201 1.00 35.71  ? 1393 ALA A HB3   1 
ATOM   7640 N  N     . PRO A 1 524 ? 18.445  8.516   -18.282 1.00 37.07  ? 1394 PRO A N     1 
ATOM   7641 C  CA    . PRO A 1 524 ? 18.851  7.981   -19.578 1.00 41.35  ? 1394 PRO A CA    1 
ATOM   7642 C  C     . PRO A 1 524 ? 18.161  6.638   -19.803 1.00 43.43  ? 1394 PRO A C     1 
ATOM   7643 O  O     . PRO A 1 524 ? 17.898  5.920   -18.837 1.00 41.93  ? 1394 PRO A O     1 
ATOM   7644 C  CB    . PRO A 1 524 ? 20.361  7.817   -19.425 1.00 44.73  ? 1394 PRO A CB    1 
ATOM   7645 C  CG    . PRO A 1 524 ? 20.559  7.535   -17.966 1.00 42.45  ? 1394 PRO A CG    1 
ATOM   7646 C  CD    . PRO A 1 524 ? 19.448  8.256   -17.230 1.00 39.45  ? 1394 PRO A CD    1 
ATOM   7647 H  HA    . PRO A 1 524 ? 18.644  8.603   -20.306 1.00 49.62  ? 1394 PRO A HA    1 
ATOM   7648 H  HB2   . PRO A 1 524 ? 20.668  7.072   -19.965 1.00 53.67  ? 1394 PRO A HB2   1 
ATOM   7649 H  HB3   . PRO A 1 524 ? 20.809  8.638   -19.682 1.00 53.67  ? 1394 PRO A HB3   1 
ATOM   7650 H  HG2   . PRO A 1 524 ? 20.502  6.579   -17.812 1.00 50.94  ? 1394 PRO A HG2   1 
ATOM   7651 H  HG3   . PRO A 1 524 ? 21.424  7.873   -17.686 1.00 50.94  ? 1394 PRO A HG3   1 
ATOM   7652 H  HD2   . PRO A 1 524 ? 19.073  7.685   -16.541 1.00 47.34  ? 1394 PRO A HD2   1 
ATOM   7653 H  HD3   . PRO A 1 524 ? 19.774  9.091   -16.861 1.00 47.34  ? 1394 PRO A HD3   1 
ATOM   7654 N  N     . PRO A 1 525 ? 17.850  6.317   -21.064 1.00 48.10  ? 1395 PRO A N     1 
ATOM   7655 C  CA    . PRO A 1 525 ? 17.157  5.081   -21.451 1.00 50.58  ? 1395 PRO A CA    1 
ATOM   7656 C  C     . PRO A 1 525 ? 17.987  3.826   -21.185 1.00 53.15  ? 1395 PRO A C     1 
ATOM   7657 O  O     . PRO A 1 525 ? 19.206  3.862   -21.362 1.00 59.83  ? 1395 PRO A O     1 
ATOM   7658 C  CB    . PRO A 1 525 ? 16.935  5.267   -22.956 1.00 49.83  ? 1395 PRO A CB    1 
ATOM   7659 C  CG    . PRO A 1 525 ? 18.018  6.205   -23.381 1.00 49.93  ? 1395 PRO A CG    1 
ATOM   7660 C  CD    . PRO A 1 525 ? 18.193  7.147   -22.231 1.00 43.75  ? 1395 PRO A CD    1 
ATOM   7661 H  HA    . PRO A 1 525 ? 16.292  5.010   -20.996 1.00 60.70  ? 1395 PRO A HA    1 
ATOM   7662 H  HB2   . PRO A 1 525 ? 17.021  4.413   -23.409 1.00 59.79  ? 1395 PRO A HB2   1 
ATOM   7663 H  HB3   . PRO A 1 525 ? 16.061  5.656   -23.114 1.00 59.79  ? 1395 PRO A HB3   1 
ATOM   7664 H  HG2   . PRO A 1 525 ? 18.835  5.708   -23.544 1.00 59.91  ? 1395 PRO A HG2   1 
ATOM   7665 H  HG3   . PRO A 1 525 ? 17.742  6.683   -24.178 1.00 59.91  ? 1395 PRO A HG3   1 
ATOM   7666 H  HD2   . PRO A 1 525 ? 19.114  7.447   -22.175 1.00 52.50  ? 1395 PRO A HD2   1 
ATOM   7667 H  HD3   . PRO A 1 525 ? 17.578  7.894   -22.308 1.00 52.50  ? 1395 PRO A HD3   1 
ATOM   7668 N  N     . ARG B 2 1   ? 0.355   15.020  18.982  1.00 83.29  ? 17   ARG B N     1 
ATOM   7669 C  CA    . ARG B 2 1   ? 0.146   15.241  17.555  1.00 82.04  ? 17   ARG B CA    1 
ATOM   7670 C  C     . ARG B 2 1   ? -1.328  15.067  17.202  1.00 71.31  ? 17   ARG B C     1 
ATOM   7671 O  O     . ARG B 2 1   ? -1.935  14.042  17.524  1.00 61.15  ? 17   ARG B O     1 
ATOM   7672 C  CB    . ARG B 2 1   ? 0.975   14.260  16.736  1.00 77.23  ? 17   ARG B CB    1 
ATOM   7673 C  CG    . ARG B 2 1   ? 1.031   14.603  15.267  1.00 73.94  ? 17   ARG B CG    1 
ATOM   7674 C  CD    . ARG B 2 1   ? 1.066   13.345  14.432  1.00 79.93  ? 17   ARG B CD    1 
ATOM   7675 N  NE    . ARG B 2 1   ? 1.300   13.632  13.022  1.00 75.94  ? 17   ARG B NE    1 
ATOM   7676 C  CZ    . ARG B 2 1   ? 1.109   12.758  12.042  1.00 69.82  ? 17   ARG B CZ    1 
ATOM   7677 N  NH1   . ARG B 2 1   ? 0.670   11.538  12.310  1.00 71.69  ? 17   ARG B NH1   1 
ATOM   7678 N  NH2   . ARG B 2 1   ? 1.351   13.110  10.790  1.00 62.17  ? 17   ARG B NH2   1 
ATOM   7679 H  HA    . ARG B 2 1   ? 0.418   16.153  17.320  1.00 98.45  ? 17   ARG B HA    1 
ATOM   7680 H  HB2   . ARG B 2 1   ? 1.884   14.257  17.076  1.00 92.68  ? 17   ARG B HB2   1 
ATOM   7681 H  HB3   . ARG B 2 1   ? 0.589   13.375  16.821  1.00 92.68  ? 17   ARG B HB3   1 
ATOM   7682 H  HG2   . ARG B 2 1   ? 0.242   15.112  15.024  1.00 88.73  ? 17   ARG B HG2   1 
ATOM   7683 H  HG3   . ARG B 2 1   ? 1.835   15.115  15.085  1.00 88.73  ? 17   ARG B HG3   1 
ATOM   7684 H  HD2   . ARG B 2 1   ? 1.784   12.773  14.747  1.00 95.92  ? 17   ARG B HD2   1 
ATOM   7685 H  HD3   . ARG B 2 1   ? 0.215   12.887  14.511  1.00 95.92  ? 17   ARG B HD3   1 
ATOM   7686 H  HE    . ARG B 2 1   ? 1.580   14.417  12.812  1.00 91.13  ? 17   ARG B HE    1 
ATOM   7687 H  HH11  . ARG B 2 1   ? 0.512   11.307  13.124  1.00 86.02  ? 17   ARG B HH11  1 
ATOM   7688 H  HH12  . ARG B 2 1   ? 0.545   10.975  11.672  1.00 86.02  ? 17   ARG B HH12  1 
ATOM   7689 H  HH21  . ARG B 2 1   ? 1.634   13.903  10.613  1.00 74.61  ? 17   ARG B HH21  1 
ATOM   7690 H  HH22  . ARG B 2 1   ? 1.225   12.547  10.153  1.00 74.61  ? 17   ARG B HH22  1 
ATOM   7691 N  N     . LYS B 2 2   ? -1.896  16.056  16.519  1.00 52.59  ? 18   LYS B N     1 
ATOM   7692 C  CA    . LYS B 2 2   ? -3.335  16.067  16.268  1.00 45.80  ? 18   LYS B CA    1 
ATOM   7693 C  C     . LYS B 2 2   ? -3.785  14.815  15.521  1.00 50.92  ? 18   LYS B C     1 
ATOM   7694 O  O     . LYS B 2 2   ? -3.096  14.337  14.619  1.00 47.62  ? 18   LYS B O     1 
ATOM   7695 C  CB    . LYS B 2 2   ? -3.744  17.322  15.504  1.00 41.90  ? 18   LYS B CB    1 
ATOM   7696 C  CG    . LYS B 2 2   ? -3.411  18.610  16.235  1.00 58.22  ? 18   LYS B CG    1 
ATOM   7697 C  CD    . LYS B 2 2   ? -4.514  19.630  16.039  1.00 69.17  ? 18   LYS B CD    1 
ATOM   7698 C  CE    . LYS B 2 2   ? -4.056  21.047  16.316  1.00 67.72  ? 18   LYS B CE    1 
ATOM   7699 N  NZ    . LYS B 2 2   ? -3.666  21.206  17.750  1.00 60.61  ? 18   LYS B NZ    1 
ATOM   7700 H  H     . LYS B 2 2   ? -1.474  16.730  16.192  1.00 63.11  ? 18   LYS B H     1 
ATOM   7701 H  HA    . LYS B 2 2   ? -3.802  16.081  17.130  1.00 54.96  ? 18   LYS B HA    1 
ATOM   7702 H  HB2   . LYS B 2 2   ? -3.281  17.335  14.652  1.00 50.28  ? 18   LYS B HB2   1 
ATOM   7703 H  HB3   . LYS B 2 2   ? -4.703  17.302  15.358  1.00 50.28  ? 18   LYS B HB3   1 
ATOM   7704 H  HG2   . LYS B 2 2   ? -3.324  18.430  17.184  1.00 69.86  ? 18   LYS B HG2   1 
ATOM   7705 H  HG3   . LYS B 2 2   ? -2.585  18.978  15.882  1.00 69.86  ? 18   LYS B HG3   1 
ATOM   7706 H  HD2   . LYS B 2 2   ? -4.823  19.589  15.120  1.00 83.01  ? 18   LYS B HD2   1 
ATOM   7707 H  HD3   . LYS B 2 2   ? -5.244  19.427  16.644  1.00 83.01  ? 18   LYS B HD3   1 
ATOM   7708 H  HE2   . LYS B 2 2   ? -3.284  21.250  15.764  1.00 81.26  ? 18   LYS B HE2   1 
ATOM   7709 H  HE3   . LYS B 2 2   ? -4.780  21.664  16.125  1.00 81.26  ? 18   LYS B HE3   1 
ATOM   7710 H  HZ1   . LYS B 2 2   ? -3.000  20.649  17.947  1.00 72.73  ? 18   LYS B HZ1   1 
ATOM   7711 H  HZ2   . LYS B 2 2   ? -3.399  22.042  17.901  1.00 72.73  ? 18   LYS B HZ2   1 
ATOM   7712 H  HZ3   . LYS B 2 2   ? -4.361  21.025  18.276  1.00 72.73  ? 18   LYS B HZ3   1 
ATOM   7713 N  N     . GLN B 2 3   ? -4.944  14.291  15.912  1.00 45.31  ? 19   GLN B N     1 
ATOM   7714 C  CA    . GLN B 2 3   ? -5.504  13.093  15.303  1.00 47.69  ? 19   GLN B CA    1 
ATOM   7715 C  C     . GLN B 2 3   ? -6.520  13.490  14.245  1.00 48.31  ? 19   GLN B C     1 
ATOM   7716 O  O     . GLN B 2 3   ? -7.470  14.215  14.536  1.00 42.58  ? 19   GLN B O     1 
ATOM   7717 C  CB    . GLN B 2 3   ? -6.167  12.227  16.377  1.00 55.53  ? 19   GLN B CB    1 
ATOM   7718 C  CG    . GLN B 2 3   ? -5.172  11.626  17.356  1.00 80.18  ? 19   GLN B CG    1 
ATOM   7719 C  CD    . GLN B 2 3   ? -4.263  10.612  16.690  1.00 98.12  ? 19   GLN B CD    1 
ATOM   7720 O  OE1   . GLN B 2 3   ? -4.734  9.701   16.009  1.00 106.45 ? 19   GLN B OE1   1 
ATOM   7721 N  NE2   . GLN B 2 3   ? -2.954  10.773  16.864  1.00 98.94  ? 19   GLN B NE2   1 
ATOM   7722 H  H     . GLN B 2 3   ? -5.432  14.619  16.540  1.00 54.37  ? 19   GLN B H     1 
ATOM   7723 H  HA    . GLN B 2 3   ? -4.790  12.574  14.876  1.00 57.23  ? 19   GLN B HA    1 
ATOM   7724 H  HB2   . GLN B 2 3   ? -6.790  12.774  16.881  1.00 66.64  ? 19   GLN B HB2   1 
ATOM   7725 H  HB3   . GLN B 2 3   ? -6.640  11.498  15.946  1.00 66.64  ? 19   GLN B HB3   1 
ATOM   7726 H  HG2   . GLN B 2 3   ? -4.619  12.333  17.724  1.00 96.21  ? 19   GLN B HG2   1 
ATOM   7727 H  HG3   . GLN B 2 3   ? -5.656  11.177  18.067  1.00 96.21  ? 19   GLN B HG3   1 
ATOM   7728 H  HE21  . GLN B 2 3   ? -2.661  11.429  17.337  1.00 118.73 ? 19   GLN B HE21  1 
ATOM   7729 H  HE22  . GLN B 2 3   ? -2.402  10.222  16.504  1.00 118.73 ? 19   GLN B HE22  1 
ATOM   7730 N  N     . LEU B 2 4   ? -6.312  13.031  13.014  1.00 42.73  ? 20   LEU B N     1 
ATOM   7731 C  CA    . LEU B 2 4   ? -7.166  13.418  11.900  1.00 41.76  ? 20   LEU B CA    1 
ATOM   7732 C  C     . LEU B 2 4   ? -8.169  12.312  11.613  1.00 45.04  ? 20   LEU B C     1 
ATOM   7733 O  O     . LEU B 2 4   ? -7.803  11.140  11.541  1.00 42.05  ? 20   LEU B O     1 
ATOM   7734 C  CB    . LEU B 2 4   ? -6.320  13.688  10.649  1.00 42.37  ? 20   LEU B CB    1 
ATOM   7735 C  CG    . LEU B 2 4   ? -5.180  14.685  10.852  1.00 45.95  ? 20   LEU B CG    1 
ATOM   7736 C  CD1   . LEU B 2 4   ? -4.605  15.123  9.513   1.00 39.85  ? 20   LEU B CD1   1 
ATOM   7737 C  CD2   . LEU B 2 4   ? -5.660  15.886  11.647  1.00 50.22  ? 20   LEU B CD2   1 
ATOM   7738 H  H     . LEU B 2 4   ? -5.679  12.490  12.799  1.00 51.28  ? 20   LEU B H     1 
ATOM   7739 H  HA    . LEU B 2 4   ? -7.657  14.235  12.129  1.00 50.11  ? 20   LEU B HA    1 
ATOM   7740 H  HB2   . LEU B 2 4   ? -5.929  12.851  10.353  1.00 50.84  ? 20   LEU B HB2   1 
ATOM   7741 H  HB3   . LEU B 2 4   ? -6.899  14.040  9.954   1.00 50.84  ? 20   LEU B HB3   1 
ATOM   7742 H  HG    . LEU B 2 4   ? -4.471  14.256  11.357  1.00 55.14  ? 20   LEU B HG    1 
ATOM   7743 H  HD11  . LEU B 2 4   ? -4.270  14.352  9.050   1.00 47.82  ? 20   LEU B HD11  1 
ATOM   7744 H  HD12  . LEU B 2 4   ? -5.299  15.540  8.997   1.00 47.82  ? 20   LEU B HD12  1 
ATOM   7745 H  HD13  . LEU B 2 4   ? -3.893  15.748  9.668   1.00 47.82  ? 20   LEU B HD13  1 
ATOM   7746 H  HD21  . LEU B 2 4   ? -5.975  15.588  12.503  1.00 60.26  ? 20   LEU B HD21  1 
ATOM   7747 H  HD22  . LEU B 2 4   ? -4.929  16.497  11.762  1.00 60.26  ? 20   LEU B HD22  1 
ATOM   7748 H  HD23  . LEU B 2 4   ? -6.372  16.314  11.166  1.00 60.26  ? 20   LEU B HD23  1 
ATOM   7749 N  N     . ALA B 2 5   ? -9.433  12.693  11.462  1.00 41.84  ? 21   ALA B N     1 
ATOM   7750 C  CA    . ALA B 2 5   ? -10.475 11.767  11.047  1.00 47.42  ? 21   ALA B CA    1 
ATOM   7751 C  C     . ALA B 2 5   ? -10.153 11.332  9.629   1.00 48.04  ? 21   ALA B C     1 
ATOM   7752 O  O     . ALA B 2 5   ? -9.663  12.133  8.831   1.00 42.63  ? 21   ALA B O     1 
ATOM   7753 C  CB    . ALA B 2 5   ? -11.831 12.445  11.093  1.00 45.75  ? 21   ALA B CB    1 
ATOM   7754 H  H     . ALA B 2 5   ? -9.714  13.494  11.596  1.00 50.21  ? 21   ALA B H     1 
ATOM   7755 H  HA    . ALA B 2 5   ? -10.485 10.981  11.633  1.00 56.90  ? 21   ALA B HA    1 
ATOM   7756 H  HB1   . ALA B 2 5   ? -11.823 13.200  10.500  1.00 54.90  ? 21   ALA B HB1   1 
ATOM   7757 H  HB2   . ALA B 2 5   ? -12.503 11.818  10.817  1.00 54.90  ? 21   ALA B HB2   1 
ATOM   7758 H  HB3   . ALA B 2 5   ? -12.004 12.736  11.992  1.00 54.90  ? 21   ALA B HB3   1 
ATOM   7759 N  N     . THR B 2 6   ? -10.417 10.070  9.309   1.00 47.49  ? 22   THR B N     1 
ATOM   7760 C  CA    . THR B 2 6   ? -10.161 9.571   7.960   1.00 53.16  ? 22   THR B CA    1 
ATOM   7761 C  C     . THR B 2 6   ? -11.121 8.442   7.605   1.00 59.92  ? 22   THR B C     1 
ATOM   7762 O  O     . THR B 2 6   ? -11.765 7.860   8.473   1.00 45.26  ? 22   THR B O     1 
ATOM   7763 C  CB    . THR B 2 6   ? -8.709  9.071   7.802   1.00 63.19  ? 22   THR B CB    1 
ATOM   7764 O  OG1   . THR B 2 6   ? -8.505  8.593   6.465   1.00 73.42  ? 22   THR B OG1   1 
ATOM   7765 C  CG2   . THR B 2 6   ? -8.412  7.949   8.792   1.00 58.25  ? 22   THR B CG2   1 
ATOM   7766 H  H     . THR B 2 6   ? -10.743 9.485   9.849   1.00 56.99  ? 22   THR B H     1 
ATOM   7767 H  HA    . THR B 2 6   ? -10.301 10.300  7.319   1.00 63.79  ? 22   THR B HA    1 
ATOM   7768 H  HB    . THR B 2 6   ? -8.096  9.802   7.978   1.00 75.82  ? 22   THR B HB    1 
ATOM   7769 H  HG1   . THR B 2 6   ? -7.735  8.326   6.377   1.00 88.10  ? 22   THR B HG1   1 
ATOM   7770 H  HG21  . THR B 2 6   ? -8.531  8.266   9.691   1.00 69.90  ? 22   THR B HG21  1 
ATOM   7771 H  HG22  . THR B 2 6   ? -9.008  7.212   8.640   1.00 69.90  ? 22   THR B HG22  1 
ATOM   7772 H  HG23  . THR B 2 6   ? -7.508  7.647   8.684   1.00 69.90  ? 22   THR B HG23  1 
ATOM   7773 N  N     . LYS B 2 7   ? -11.225 8.154   6.316   1.00 58.44  ? 23   LYS B N     1 
ATOM   7774 C  CA    . LYS B 2 7   ? -12.018 7.034   5.846   1.00 74.00  ? 23   LYS B CA    1 
ATOM   7775 C  C     . LYS B 2 7   ? -11.145 6.221   4.899   1.00 59.41  ? 23   LYS B C     1 
ATOM   7776 O  O     . LYS B 2 7   ? -10.352 6.782   4.143   1.00 38.59  ? 23   LYS B O     1 
ATOM   7777 C  CB    . LYS B 2 7   ? -13.298 7.527   5.160   1.00 90.95  ? 23   LYS B CB    1 
ATOM   7778 C  CG    . LYS B 2 7   ? -13.181 8.908   4.484   1.00 104.27 ? 23   LYS B CG    1 
ATOM   7779 C  CD    . LYS B 2 7   ? -14.545 9.388   3.964   1.00 109.49 ? 23   LYS B CD    1 
ATOM   7780 C  CE    . LYS B 2 7   ? -14.522 10.804  3.385   1.00 108.77 ? 23   LYS B CE    1 
ATOM   7781 N  NZ    . LYS B 2 7   ? -13.408 11.070  2.446   1.00 101.02 ? 23   LYS B NZ    1 
ATOM   7782 H  H     . LYS B 2 7   ? -10.840 8.598   5.688   1.00 70.13  ? 23   LYS B H     1 
ATOM   7783 H  HA    . LYS B 2 7   ? -12.269 6.467   6.604   1.00 88.80  ? 23   LYS B HA    1 
ATOM   7784 H  HB2   . LYS B 2 7   ? -13.548 6.887   4.476   1.00 109.14 ? 23   LYS B HB2   1 
ATOM   7785 H  HB3   . LYS B 2 7   ? -14.002 7.585   5.825   1.00 109.14 ? 23   LYS B HB3   1 
ATOM   7786 H  HG2   . LYS B 2 7   ? -12.855 9.555   5.129   1.00 125.12 ? 23   LYS B HG2   1 
ATOM   7787 H  HG3   . LYS B 2 7   ? -12.572 8.846   3.731   1.00 125.12 ? 23   LYS B HG3   1 
ATOM   7788 H  HD2   . LYS B 2 7   ? -14.842 8.786   3.263   1.00 131.39 ? 23   LYS B HD2   1 
ATOM   7789 H  HD3   . LYS B 2 7   ? -15.180 9.378   4.697   1.00 131.39 ? 23   LYS B HD3   1 
ATOM   7790 H  HE2   . LYS B 2 7   ? -15.352 10.957  2.907   1.00 130.52 ? 23   LYS B HE2   1 
ATOM   7791 H  HE3   . LYS B 2 7   ? -14.447 11.437  4.117   1.00 130.52 ? 23   LYS B HE3   1 
ATOM   7792 H  HZ1   . LYS B 2 7   ? -13.455 10.514  1.753   1.00 121.23 ? 23   LYS B HZ1   1 
ATOM   7793 H  HZ2   . LYS B 2 7   ? -13.454 11.908  2.149   1.00 121.23 ? 23   LYS B HZ2   1 
ATOM   7794 H  HZ3   . LYS B 2 7   ? -12.628 10.953  2.859   1.00 121.23 ? 23   LYS B HZ3   1 
ATOM   7795 N  N     . ALA B 2 8   ? -11.262 4.901   4.969   1.00 47.35  ? 24   ALA B N     1 
ATOM   7796 C  CA    . ALA B 2 8   ? -10.421 4.025   4.173   1.00 40.99  ? 24   ALA B CA    1 
ATOM   7797 C  C     . ALA B 2 8   ? -10.770 4.150   2.691   1.00 43.19  ? 24   ALA B C     1 
ATOM   7798 O  O     . ALA B 2 8   ? -11.905 3.900   2.294   1.00 47.92  ? 24   ALA B O     1 
ATOM   7799 C  CB    . ALA B 2 8   ? -10.583 2.580   4.633   1.00 47.02  ? 24   ALA B CB    1 
ATOM   7800 H  H     . ALA B 2 8   ? -11.823 4.488   5.473   1.00 56.82  ? 24   ALA B H     1 
ATOM   7801 H  HA    . ALA B 2 8   ? -9.482  4.282   4.290   1.00 49.19  ? 24   ALA B HA    1 
ATOM   7802 H  HB1   . ALA B 2 8   ? -11.502 2.321   4.530   1.00 56.42  ? 24   ALA B HB1   1 
ATOM   7803 H  HB2   . ALA B 2 8   ? -10.021 2.017   4.096   1.00 56.42  ? 24   ALA B HB2   1 
ATOM   7804 H  HB3   . ALA B 2 8   ? -10.326 2.516   5.556   1.00 56.42  ? 24   ALA B HB3   1 
ATOM   7805 N  N     . ALA B 2 9   ? -9.796  4.548   1.879   1.00 28.63  ? 25   ALA B N     1 
ATOM   7806 C  CA    . ALA B 2 9   ? -9.995  4.620   0.431   1.00 30.53  ? 25   ALA B CA    1 
ATOM   7807 C  C     . ALA B 2 9   ? -10.318 3.215   -0.054  1.00 31.62  ? 25   ALA B C     1 
ATOM   7808 O  O     . ALA B 2 9   ? -9.615  2.262   0.287   1.00 29.39  ? 25   ALA B O     1 
ATOM   7809 C  CB    . ALA B 2 9   ? -8.748  5.137   -0.251  1.00 29.64  ? 25   ALA B CB    1 
ATOM   7810 H  H     . ALA B 2 9   ? -9.011  4.783   2.139   1.00 34.35  ? 25   ALA B H     1 
ATOM   7811 H  HA    . ALA B 2 9   ? -10.746 5.213   0.222   1.00 36.63  ? 25   ALA B HA    1 
ATOM   7812 H  HB1   . ALA B 2 9   ? -8.903  5.175   -1.197  1.00 35.57  ? 25   ALA B HB1   1 
ATOM   7813 H  HB2   . ALA B 2 9   ? -8.551  6.015   0.085   1.00 35.57  ? 25   ALA B HB2   1 
ATOM   7814 H  HB3   . ALA B 2 9   ? -8.019  4.542   -0.061  1.00 35.57  ? 25   ALA B HB3   1 
ATOM   7815 N  N     . ARG B 2 10  ? -11.367 3.072   -0.856  1.00 30.92  ? 26   ARG B N     1 
ATOM   7816 C  CA    . ARG B 2 10  ? -11.790 1.740   -1.267  1.00 22.69  ? 26   ARG B CA    1 
ATOM   7817 C  C     . ARG B 2 10  ? -12.584 1.736   -2.579  1.00 27.89  ? 26   ARG B C     1 
ATOM   7818 O  O     . ARG B 2 10  ? -13.462 2.564   -2.802  1.00 26.88  ? 26   ARG B O     1 
ATOM   7819 C  CB    . ARG B 2 10  ? -12.618 1.095   -0.138  1.00 25.06  ? 26   ARG B CB    1 
ATOM   7820 C  CG    . ARG B 2 10  ? -13.343 -0.199  -0.540  1.00 32.17  ? 26   ARG B CG    1 
ATOM   7821 C  CD    . ARG B 2 10  ? -13.896 -0.915  0.697   1.00 32.34  ? 26   ARG B CD    1 
ATOM   7822 N  NE    . ARG B 2 10  ? -14.547 -2.176  0.348   1.00 28.74  ? 26   ARG B NE    1 
ATOM   7823 C  CZ    . ARG B 2 10  ? -15.836 -2.298  0.061   1.00 29.94  ? 26   ARG B CZ    1 
ATOM   7824 N  NH1   . ARG B 2 10  ? -16.632 -1.232  0.078   1.00 28.48  ? 26   ARG B NH1   1 
ATOM   7825 N  NH2   . ARG B 2 10  ? -16.323 -3.495  -0.242  1.00 28.28  ? 26   ARG B NH2   1 
ATOM   7826 H  H     . ARG B 2 10  ? -11.843 3.716   -1.169  1.00 37.10  ? 26   ARG B H     1 
ATOM   7827 H  HA    . ARG B 2 10  ? -10.992 1.187   -1.402  1.00 27.22  ? 26   ARG B HA    1 
ATOM   7828 H  HB2   . ARG B 2 10  ? -12.025 0.883   0.600   1.00 30.07  ? 26   ARG B HB2   1 
ATOM   7829 H  HB3   . ARG B 2 10  ? -13.291 1.730   0.155   1.00 30.07  ? 26   ARG B HB3   1 
ATOM   7830 H  HG2   . ARG B 2 10  ? -14.085 0.015   -1.127  1.00 38.60  ? 26   ARG B HG2   1 
ATOM   7831 H  HG3   . ARG B 2 10  ? -12.719 -0.794  -0.985  1.00 38.60  ? 26   ARG B HG3   1 
ATOM   7832 H  HD2   . ARG B 2 10  ? -13.166 -1.109  1.306   1.00 38.81  ? 26   ARG B HD2   1 
ATOM   7833 H  HD3   . ARG B 2 10  ? -14.551 -0.345  1.129   1.00 38.81  ? 26   ARG B HD3   1 
ATOM   7834 H  HE    . ARG B 2 10  ? -14.062 -2.885  0.328   1.00 34.49  ? 26   ARG B HE    1 
ATOM   7835 H  HH11  . ARG B 2 10  ? -16.311 -0.459  0.276   1.00 34.18  ? 26   ARG B HH11  1 
ATOM   7836 H  HH12  . ARG B 2 10  ? -17.467 -1.317  -0.108  1.00 34.18  ? 26   ARG B HH12  1 
ATOM   7837 H  HH21  . ARG B 2 10  ? -15.804 -4.181  -0.251  1.00 33.93  ? 26   ARG B HH21  1 
ATOM   7838 H  HH22  . ARG B 2 10  ? -17.158 -3.585  -0.429  1.00 33.93  ? 26   ARG B HH22  1 
HETATM 7839 N  N     . M3L B 2 11  ? -12.220 0.808   -3.450  1.00 22.81  ? 27   M3L B N     1 
HETATM 7840 C  CA    . M3L B 2 11  ? -12.963 0.474   -4.659  1.00 22.06  ? 27   M3L B CA    1 
HETATM 7841 C  CB    . M3L B 2 11  ? -12.042 -0.472  -5.475  1.00 19.71  ? 27   M3L B CB    1 
HETATM 7842 C  CG    . M3L B 2 11  ? -12.736 -1.092  -6.699  1.00 24.10  ? 27   M3L B CG    1 
HETATM 7843 C  CD    . M3L B 2 11  ? -11.697 -2.010  -7.402  1.00 24.33  ? 27   M3L B CD    1 
HETATM 7844 C  CE    . M3L B 2 11  ? -12.364 -2.834  -8.520  1.00 22.30  ? 27   M3L B CE    1 
HETATM 7845 N  NZ    . M3L B 2 11  ? -11.471 -3.913  -9.006  1.00 24.01  ? 27   M3L B NZ    1 
HETATM 7846 C  C     . M3L B 2 11  ? -14.279 -0.214  -4.303  1.00 31.81  ? 27   M3L B C     1 
HETATM 7847 O  O     . M3L B 2 11  ? -14.252 -1.212  -3.526  1.00 23.19  ? 27   M3L B O     1 
HETATM 7848 C  CM1   . M3L B 2 11  ? -10.213 -3.368  -9.482  1.00 22.91  ? 27   M3L B CM1   1 
HETATM 7849 C  CM2   . M3L B 2 11  ? -12.130 -4.596  -10.126 1.00 20.15  ? 27   M3L B CM2   1 
HETATM 7850 C  CM3   . M3L B 2 11  ? -11.195 -4.846  -7.944  1.00 18.00  ? 27   M3L B CM3   1 
HETATM 7851 H  H     . M3L B 2 11  ? -11.464 0.298   -3.390  1.00 27.37  ? 27   M3L B H     1 
HETATM 7852 H  HA    . M3L B 2 11  ? -13.169 1.266   -5.164  1.00 26.48  ? 27   M3L B HA    1 
HETATM 7853 H  HB2   . M3L B 2 11  ? -11.705 -1.181  -4.894  1.00 23.66  ? 27   M3L B HB2   1 
HETATM 7854 H  HB3   . M3L B 2 11  ? -11.277 0.046   -5.801  1.00 23.66  ? 27   M3L B HB3   1 
HETATM 7855 H  HG2   . M3L B 2 11  ? -13.031 -0.395  -7.312  1.00 28.92  ? 27   M3L B HG2   1 
HETATM 7856 H  HG3   . M3L B 2 11  ? -13.497 -1.616  -6.418  1.00 28.92  ? 27   M3L B HG3   1 
HETATM 7857 H  HD2   . M3L B 2 11  ? -11.340 -2.620  -6.748  1.00 29.20  ? 27   M3L B HD2   1 
HETATM 7858 H  HD3   . M3L B 2 11  ? -10.974 -1.476  -7.768  1.00 29.20  ? 27   M3L B HD3   1 
HETATM 7859 H  HE2   . M3L B 2 11  ? -12.593 -2.240  -9.262  1.00 26.76  ? 27   M3L B HE2   1 
HETATM 7860 H  HE3   . M3L B 2 11  ? -13.182 -3.240  -8.172  1.00 26.76  ? 27   M3L B HE3   1 
HETATM 7861 H  HM11  . M3L B 2 11  ? -9.749  -2.934  -8.746  1.00 27.49  ? 27   M3L B HM11  1 
HETATM 7862 H  HM12  . M3L B 2 11  ? -10.388 -2.707  -10.197 1.00 27.49  ? 27   M3L B HM12  1 
HETATM 7863 H  HM13  . M3L B 2 11  ? -9.656  -4.095  -9.838  1.00 27.49  ? 27   M3L B HM13  1 
HETATM 7864 H  HM21  . M3L B 2 11  ? -12.026 -4.065  -10.939 1.00 24.17  ? 27   M3L B HM21  1 
HETATM 7865 H  HM22  . M3L B 2 11  ? -11.720 -5.482  -10.258 1.00 24.17  ? 27   M3L B HM22  1 
HETATM 7866 H  HM23  . M3L B 2 11  ? -13.079 -4.703  -9.928  1.00 24.17  ? 27   M3L B HM23  1 
HETATM 7867 H  HM31  . M3L B 2 11  ? -10.485 -4.482  -7.363  1.00 21.60  ? 27   M3L B HM31  1 
HETATM 7868 H  HM32  . M3L B 2 11  ? -10.903 -5.691  -8.322  1.00 21.60  ? 27   M3L B HM32  1 
HETATM 7869 H  HM33  . M3L B 2 11  ? -12.005 -4.988  -7.417  1.00 21.60  ? 27   M3L B HM33  1 
ATOM   7870 N  N     . SER B 2 12  ? -15.403 0.251   -4.838  1.00 24.36  ? 28   SER B N     1 
ATOM   7871 C  CA    . SER B 2 12  ? -16.693 -0.374  -4.533  1.00 23.84  ? 28   SER B CA    1 
ATOM   7872 C  C     . SER B 2 12  ? -17.665 -0.178  -5.686  1.00 28.26  ? 28   SER B C     1 
ATOM   7873 O  O     . SER B 2 12  ? -17.466 0.696   -6.533  1.00 28.85  ? 28   SER B O     1 
ATOM   7874 C  CB    . SER B 2 12  ? -17.286 0.195   -3.234  1.00 31.96  ? 28   SER B CB    1 
ATOM   7875 O  OG    . SER B 2 12  ? -17.457 1.599   -3.314  1.00 33.72  ? 28   SER B OG    1 
ATOM   7876 H  H     . SER B 2 12  ? -15.450 0.921   -5.376  1.00 29.24  ? 28   SER B H     1 
ATOM   7877 H  HA    . SER B 2 12  ? -16.560 -1.337  -4.409  1.00 28.60  ? 28   SER B HA    1 
ATOM   7878 H  HB2   . SER B 2 12  ? -18.149 -0.217  -3.076  1.00 38.35  ? 28   SER B HB2   1 
ATOM   7879 H  HB3   . SER B 2 12  ? -16.685 -0.006  -2.500  1.00 38.35  ? 28   SER B HB3   1 
ATOM   7880 H  HG    . SER B 2 12  ? -17.208 1.871   -4.047  1.00 40.47  ? 28   SER B HG    1 
ATOM   7881 N  N     . ALA B 2 13  ? -18.702 -1.011  -5.728  1.00 24.08  ? 29   ALA B N     1 
ATOM   7882 C  CA    . ALA B 2 13  ? -19.696 -0.952  -6.805  1.00 26.43  ? 29   ALA B CA    1 
ATOM   7883 C  C     . ALA B 2 13  ? -20.797 0.063   -6.515  1.00 27.87  ? 29   ALA B C     1 
ATOM   7884 O  O     . ALA B 2 13  ? -21.059 0.399   -5.355  1.00 28.38  ? 29   ALA B O     1 
ATOM   7885 C  CB    . ALA B 2 13  ? -20.310 -2.331  -7.030  1.00 28.18  ? 29   ALA B CB    1 
ATOM   7886 H  H     . ALA B 2 13  ? -18.855 -1.623  -5.144  1.00 28.89  ? 29   ALA B H     1 
ATOM   7887 H  HA    . ALA B 2 13  ? -19.249 -0.682  -7.634  1.00 31.71  ? 29   ALA B HA    1 
ATOM   7888 H  HB1   . ALA B 2 13  ? -20.736 -2.619  -6.219  1.00 33.81  ? 29   ALA B HB1   1 
ATOM   7889 H  HB2   . ALA B 2 13  ? -20.957 -2.273  -7.736  1.00 33.81  ? 29   ALA B HB2   1 
ATOM   7890 H  HB3   . ALA B 2 13  ? -19.615 -2.947  -7.272  1.00 33.81  ? 29   ALA B HB3   1 
ATOM   7891 N  N     . PRO B 2 14  ? -21.455 0.549   -7.572  1.00 26.53  ? 30   PRO B N     1 
ATOM   7892 C  CA    . PRO B 2 14  ? -22.598 1.455   -7.423  1.00 33.20  ? 30   PRO B CA    1 
ATOM   7893 C  C     . PRO B 2 14  ? -23.700 0.774   -6.626  1.00 32.87  ? 30   PRO B C     1 
ATOM   7894 O  O     . PRO B 2 14  ? -23.736 -0.454  -6.577  1.00 29.77  ? 30   PRO B O     1 
ATOM   7895 C  CB    . PRO B 2 14  ? -23.067 1.675   -8.866  1.00 39.90  ? 30   PRO B CB    1 
ATOM   7896 C  CG    . PRO B 2 14  ? -21.920 1.263   -9.731  1.00 41.02  ? 30   PRO B CG    1 
ATOM   7897 C  CD    . PRO B 2 14  ? -21.185 0.209   -8.986  1.00 25.78  ? 30   PRO B CD    1 
ATOM   7898 H  HA    . PRO B 2 14  ? -22.338 2.303   -7.009  1.00 39.84  ? 30   PRO B HA    1 
ATOM   7899 H  HB2   . PRO B 2 14  ? -23.844 1.121   -9.044  1.00 47.88  ? 30   PRO B HB2   1 
ATOM   7900 H  HB3   . PRO B 2 14  ? -23.277 2.612   -9.001  1.00 47.88  ? 30   PRO B HB3   1 
ATOM   7901 H  HG2   . PRO B 2 14  ? -22.257 0.913   -10.570 1.00 49.23  ? 30   PRO B HG2   1 
ATOM   7902 H  HG3   . PRO B 2 14  ? -21.345 2.028   -9.889  1.00 49.23  ? 30   PRO B HG3   1 
ATOM   7903 H  HD2   . PRO B 2 14  ? -21.543 -0.668  -9.198  1.00 30.93  ? 30   PRO B HD2   1 
ATOM   7904 H  HD3   . PRO B 2 14  ? -20.235 0.262   -9.172  1.00 30.93  ? 30   PRO B HD3   1 
ATOM   7905 N  N     . ALA B 2 15  ? -24.572 1.558   -6.006  1.00 28.63  ? 31   ALA B N     1 
ATOM   7906 C  CA    . ALA B 2 15  ? -25.726 1.021   -5.297  1.00 33.46  ? 31   ALA B CA    1 
ATOM   7907 C  C     . ALA B 2 15  ? -26.900 1.961   -5.522  1.00 39.49  ? 31   ALA B C     1 
ATOM   7908 O  O     . ALA B 2 15  ? -26.720 3.175   -5.600  1.00 37.73  ? 31   ALA B O     1 
ATOM   7909 C  CB    . ALA B 2 15  ? -25.429 0.888   -3.811  1.00 45.72  ? 31   ALA B CB    1 
ATOM   7910 H  H     . ALA B 2 15  ? -24.517 2.416   -5.981  1.00 34.36  ? 31   ALA B H     1 
ATOM   7911 H  HA    . ALA B 2 15  ? -25.955 0.138   -5.655  1.00 40.16  ? 31   ALA B HA    1 
ATOM   7912 H  HB1   . ALA B 2 15  ? -24.683 0.295   -3.694  1.00 54.87  ? 31   ALA B HB1   1 
ATOM   7913 H  HB2   . ALA B 2 15  ? -25.217 1.755   -3.456  1.00 54.87  ? 31   ALA B HB2   1 
ATOM   7914 H  HB3   . ALA B 2 15  ? -26.203 0.533   -3.368  1.00 54.87  ? 31   ALA B HB3   1 
ATOM   7915 N  N     . THR B 2 16  ? -28.100 1.400   -5.632  1.00 35.40  ? 32   THR B N     1 
ATOM   7916 C  CA    . THR B 2 16  ? -29.291 2.194   -5.912  1.00 40.21  ? 32   THR B CA    1 
ATOM   7917 C  C     . THR B 2 16  ? -30.222 2.218   -4.707  1.00 54.35  ? 32   THR B C     1 
ATOM   7918 O  O     . THR B 2 16  ? -31.267 2.869   -4.728  1.00 54.41  ? 32   THR B O     1 
ATOM   7919 C  CB    . THR B 2 16  ? -30.055 1.620   -7.100  1.00 40.58  ? 32   THR B CB    1 
ATOM   7920 O  OG1   . THR B 2 16  ? -30.419 0.266   -6.810  1.00 34.70  ? 32   THR B OG1   1 
ATOM   7921 C  CG2   . THR B 2 16  ? -29.192 1.658   -8.351  1.00 34.40  ? 32   THR B CG2   1 
ATOM   7922 H  H     . THR B 2 16  ? -28.251 0.558   -5.548  1.00 42.48  ? 32   THR B H     1 
ATOM   7923 H  HA    . THR B 2 16  ? -29.029 3.114   -6.123  1.00 48.25  ? 32   THR B HA    1 
ATOM   7924 H  HB    . THR B 2 16  ? -30.855 2.147   -7.258  1.00 48.69  ? 32   THR B HB    1 
ATOM   7925 H  HG1   . THR B 2 16  ? -30.832 -0.055  -7.442  1.00 41.64  ? 32   THR B HG1   1 
ATOM   7926 H  HG21  . THR B 2 16  ? -29.678 1.296   -9.095  1.00 41.29  ? 32   THR B HG21  1 
ATOM   7927 H  HG22  . THR B 2 16  ? -28.944 2.563   -8.551  1.00 41.29  ? 32   THR B HG22  1 
ATOM   7928 H  HG23  . THR B 2 16  ? -28.397 1.138   -8.216  1.00 41.29  ? 32   THR B HG23  1 
ATOM   7929 N  N     . GLY B 2 17  ? -29.841 1.492   -3.665  1.00 50.71  ? 33   GLY B N     1 
ATOM   7930 C  CA    . GLY B 2 17  ? -30.593 1.475   -2.426  1.00 72.21  ? 33   GLY B CA    1 
ATOM   7931 C  C     . GLY B 2 17  ? -29.956 0.509   -1.450  1.00 71.00  ? 33   GLY B C     1 
ATOM   7932 O  O     . GLY B 2 17  ? -28.762 0.219   -1.558  1.00 43.31  ? 33   GLY B O     1 
ATOM   7933 H  H     . GLY B 2 17  ? -29.140 0.994   -3.653  1.00 60.85  ? 33   GLY B H     1 
ATOM   7934 H  HA2   . GLY B 2 17  ? -30.603 2.362   -2.032  1.00 86.65  ? 33   GLY B HA2   1 
ATOM   7935 H  HA3   . GLY B 2 17  ? -31.506 1.196   -2.596  1.00 86.65  ? 33   GLY B HA3   1 
HETATM 7936 C  C1    . OGA C 3 .   ? -13.052 -5.613  -13.054 1.00 30.08  ? 1501 OGA A C1    1 
HETATM 7937 C  C2    . OGA C 3 .   ? -14.536 -5.657  -12.851 1.00 33.27  ? 1501 OGA A C2    1 
HETATM 7938 C  C4    . OGA C 3 .   ? -16.514 -6.878  -12.053 1.00 35.77  ? 1501 OGA A C4    1 
HETATM 7939 C  C5    . OGA C 3 .   ? -16.938 -8.304  -11.943 1.00 33.61  ? 1501 OGA A C5    1 
HETATM 7940 O  O1    . OGA C 3 .   ? -12.356 -6.625  -12.745 1.00 16.57  ? 1501 OGA A O1    1 
HETATM 7941 O  O2    . OGA C 3 .   ? -12.514 -4.568  -13.492 1.00 24.78  ? 1501 OGA A O2    1 
HETATM 7942 O  "O2'" . OGA C 3 .   ? -15.266 -4.720  -13.165 1.00 23.45  ? 1501 OGA A "O2'" 1 
HETATM 7943 O  O3    . OGA C 3 .   ? -16.065 -9.228  -11.905 1.00 24.23  ? 1501 OGA A O3    1 
HETATM 7944 N  N1    . OGA C 3 .   ? -15.093 -6.830  -12.261 1.00 38.16  ? 1501 OGA A N1    1 
HETATM 7945 O  O4    . OGA C 3 .   ? -18.169 -8.548  -11.895 1.00 30.60  ? 1501 OGA A O4    1 
HETATM 7946 H  H4C1  . OGA C 3 .   ? -16.970 -6.457  -12.809 1.00 42.92  ? 1501 OGA A H4C1  1 
HETATM 7947 H  H4C2  . OGA C 3 .   ? -16.751 -6.393  -11.235 1.00 42.92  ? 1501 OGA A H4C2  1 
HETATM 7948 H  H1    . OGA C 3 .   ? -14.560 -7.533  -12.023 1.00 45.79  ? 1501 OGA A H1    1 
HETATM 7949 ZN ZN    . ZN  D 4 .   ? -13.247 21.203  0.130   1.00 29.01  ? 1502 ZN  A ZN    1 
HETATM 7950 NI NI    . NI  E 5 .   ? -14.009 -2.957  -13.592 1.00 27.31  ? 1503 NI  A NI    1 
HETATM 7951 C  C1    . EDO F 6 .   ? 7.945   -0.214  -5.063  1.00 45.57  ? 1    EDO A C1    1 
HETATM 7952 O  O1    . EDO F 6 .   ? 7.782   0.372   -3.763  1.00 51.00  ? 1    EDO A O1    1 
HETATM 7953 C  C2    . EDO F 6 .   ? 8.462   -1.645  -4.939  1.00 56.74  ? 1    EDO A C2    1 
HETATM 7954 O  O2    . EDO F 6 .   ? 7.367   -2.567  -4.853  1.00 56.69  ? 1    EDO A O2    1 
HETATM 7955 H  H11   . EDO F 6 .   ? 8.651   0.381   -5.648  1.00 54.69  ? 1    EDO A H11   1 
HETATM 7956 H  H12   . EDO F 6 .   ? 6.988   -0.214  -5.588  1.00 54.69  ? 1    EDO A H12   1 
HETATM 7957 H  HO1   . EDO F 6 .   ? 7.455   1.277   -3.856  1.00 61.20  ? 1    EDO A HO1   1 
HETATM 7958 H  H21   . EDO F 6 .   ? 9.078   -1.888  -5.808  1.00 68.08  ? 1    EDO A H21   1 
HETATM 7959 H  H22   . EDO F 6 .   ? 9.086   -1.733  -4.048  1.00 68.08  ? 1    EDO A H22   1 
HETATM 7960 H  HO2   . EDO F 6 .   ? 7.710   -3.468  -4.775  1.00 68.02  ? 1    EDO A HO2   1 
HETATM 7961 C  C1    . EDO G 6 .   ? -2.416  15.128  -18.094 1.00 32.42  ? 2    EDO A C1    1 
HETATM 7962 O  O1    . EDO G 6 .   ? -2.530  15.681  -19.414 1.00 40.61  ? 2    EDO A O1    1 
HETATM 7963 C  C2    . EDO G 6 .   ? -0.970  14.731  -17.834 1.00 27.10  ? 2    EDO A C2    1 
HETATM 7964 O  O2    . EDO G 6 .   ? -0.180  15.927  -17.752 1.00 27.23  ? 2    EDO A O2    1 
HETATM 7965 H  H11   . EDO G 6 .   ? -2.735  15.867  -17.355 1.00 38.91  ? 2    EDO A H11   1 
HETATM 7966 H  H12   . EDO G 6 .   ? -3.063  14.253  -18.003 1.00 38.91  ? 2    EDO A H12   1 
HETATM 7967 H  HO1   . EDO G 6 .   ? -3.449  15.934  -19.579 1.00 48.73  ? 2    EDO A HO1   1 
HETATM 7968 H  H21   . EDO G 6 .   ? -0.605  14.097  -18.646 1.00 32.52  ? 2    EDO A H21   1 
HETATM 7969 H  H22   . EDO G 6 .   ? -0.898  14.171  -16.900 1.00 32.52  ? 2    EDO A H22   1 
HETATM 7970 H  HO2   . EDO G 6 .   ? 0.744   15.692  -17.587 1.00 32.67  ? 2    EDO A HO2   1 
HETATM 7971 C  C1    . EDO H 6 .   ? -15.638 -3.401  6.533   1.00 44.84  ? 3    EDO A C1    1 
HETATM 7972 O  O1    . EDO H 6 .   ? -15.720 -4.364  7.595   1.00 51.92  ? 3    EDO A O1    1 
HETATM 7973 C  C2    . EDO H 6 .   ? -17.016 -2.807  6.252   1.00 30.82  ? 3    EDO A C2    1 
HETATM 7974 O  O2    . EDO H 6 .   ? -16.908 -1.651  5.403   1.00 53.40  ? 3    EDO A O2    1 
HETATM 7975 H  H11   . EDO H 6 .   ? -15.254 -3.881  5.631   1.00 53.81  ? 3    EDO A H11   1 
HETATM 7976 H  H12   . EDO H 6 .   ? -14.945 -2.604  6.813   1.00 53.81  ? 3    EDO A H12   1 
HETATM 7977 H  HO1   . EDO H 6 .   ? -14.842 -4.732  7.764   1.00 62.31  ? 3    EDO A HO1   1 
HETATM 7978 H  H21   . EDO H 6 .   ? -17.491 -2.526  7.194   1.00 36.98  ? 3    EDO A H21   1 
HETATM 7979 H  H22   . EDO H 6 .   ? -17.645 -3.558  5.769   1.00 36.98  ? 3    EDO A H22   1 
HETATM 7980 H  HO2   . EDO H 6 .   ? -17.789 -1.290  5.236   1.00 64.07  ? 3    EDO A HO2   1 
HETATM 7981 C  C1    . EDO I 6 .   ? 12.847  28.227  -18.925 1.00 38.85  ? 4    EDO A C1    1 
HETATM 7982 O  O1    . EDO I 6 .   ? 13.554  29.366  -18.411 1.00 31.07  ? 4    EDO A O1    1 
HETATM 7983 C  C2    . EDO I 6 .   ? 12.811  27.128  -17.865 1.00 29.58  ? 4    EDO A C2    1 
HETATM 7984 O  O2    . EDO I 6 .   ? 12.284  27.683  -16.659 1.00 32.80  ? 4    EDO A O2    1 
HETATM 7985 H  H11   . EDO I 6 .   ? 11.828  28.515  -19.193 1.00 46.62  ? 4    EDO A H11   1 
HETATM 7986 H  H12   . EDO I 6 .   ? 13.344  27.858  -19.824 1.00 46.62  ? 4    EDO A H12   1 
HETATM 7987 H  HO1   . EDO I 6 .   ? 13.576  30.061  -19.082 1.00 37.28  ? 4    EDO A HO1   1 
HETATM 7988 H  H21   . EDO I 6 .   ? 12.182  26.302  -18.204 1.00 35.50  ? 4    EDO A H21   1 
HETATM 7989 H  H22   . EDO I 6 .   ? 13.819  26.744  -17.691 1.00 35.50  ? 4    EDO A H22   1 
HETATM 7990 H  HO2   . EDO I 6 .   ? 12.254  27.000  -15.976 1.00 39.37  ? 4    EDO A HO2   1 
HETATM 7991 C  C1    . EDO J 6 .   ? -20.069 -22.870 -6.721  1.00 46.31  ? 5    EDO A C1    1 
HETATM 7992 O  O1    . EDO J 6 .   ? -19.952 -21.477 -7.031  1.00 47.17  ? 5    EDO A O1    1 
HETATM 7993 C  C2    . EDO J 6 .   ? -21.052 -23.055 -5.564  1.00 35.66  ? 5    EDO A C2    1 
HETATM 7994 O  O2    . EDO J 6 .   ? -20.537 -22.489 -4.340  1.00 36.14  ? 5    EDO A O2    1 
HETATM 7995 H  H11   . EDO J 6 .   ? -20.423 -23.415 -7.598  1.00 55.57  ? 5    EDO A H11   1 
HETATM 7996 H  H12   . EDO J 6 .   ? -19.091 -23.269 -6.443  1.00 55.57  ? 5    EDO A H12   1 
HETATM 7997 H  HO1   . EDO J 6 .   ? -19.331 -21.361 -7.762  1.00 56.60  ? 5    EDO A HO1   1 
HETATM 7998 H  H21   . EDO J 6 .   ? -21.244 -24.120 -5.418  1.00 42.79  ? 5    EDO A H21   1 
HETATM 7999 H  H22   . EDO J 6 .   ? -22.001 -22.576 -5.814  1.00 42.79  ? 5    EDO A H22   1 
HETATM 8000 H  HO2   . EDO J 6 .   ? -21.178 -22.622 -3.629  1.00 43.37  ? 5    EDO A HO2   1 
HETATM 8001 C  C1    . EDO K 6 .   ? -27.845 -13.557 1.858   1.00 55.85  ? 6    EDO A C1    1 
HETATM 8002 O  O1    . EDO K 6 .   ? -28.425 -12.273 1.600   1.00 56.65  ? 6    EDO A O1    1 
HETATM 8003 C  C2    . EDO K 6 .   ? -26.342 -13.408 1.713   1.00 40.97  ? 6    EDO A C2    1 
HETATM 8004 O  O2    . EDO K 6 .   ? -25.677 -14.280 2.630   1.00 36.52  ? 6    EDO A O2    1 
HETATM 8005 H  H11   . EDO K 6 .   ? -28.096 -13.889 2.868   1.00 67.01  ? 6    EDO A H11   1 
HETATM 8006 H  H12   . EDO K 6 .   ? -28.222 -14.292 1.144   1.00 67.01  ? 6    EDO A H12   1 
HETATM 8007 H  HO1   . EDO K 6 .   ? -29.387 -12.331 1.684   1.00 67.98  ? 6    EDO A HO1   1 
HETATM 8008 H  H21   . EDO K 6 .   ? -26.045 -13.653 0.691   1.00 49.16  ? 6    EDO A H21   1 
HETATM 8009 H  H22   . EDO K 6 .   ? -26.053 -12.374 1.913   1.00 49.16  ? 6    EDO A H22   1 
HETATM 8010 H  HO2   . EDO K 6 .   ? -24.720 -14.181 2.533   1.00 43.82  ? 6    EDO A HO2   1 
HETATM 8011 C  C1    . EDO L 6 .   ? 8.325   -11.392 -13.338 1.00 42.83  ? 7    EDO A C1    1 
HETATM 8012 O  O1    . EDO L 6 .   ? 8.066   -10.934 -14.670 1.00 37.90  ? 7    EDO A O1    1 
HETATM 8013 C  C2    . EDO L 6 .   ? 9.816   -11.287 -13.034 1.00 58.08  ? 7    EDO A C2    1 
HETATM 8014 O  O2    . EDO L 6 .   ? 10.030  -10.445 -11.892 1.00 60.30  ? 7    EDO A O2    1 
HETATM 8015 H  H11   . EDO L 6 .   ? 8.001   -12.430 -13.236 1.00 51.39  ? 7    EDO A H11   1 
HETATM 8016 H  H12   . EDO L 6 .   ? 7.761   -10.788 -12.625 1.00 51.39  ? 7    EDO A H12   1 
HETATM 8017 H  HO1   . EDO L 6 .   ? 7.119   -11.004 -14.856 1.00 45.48  ? 7    EDO A HO1   1 
HETATM 8018 H  H21   . EDO L 6 .   ? 10.339  -10.872 -13.899 1.00 69.69  ? 7    EDO A H21   1 
HETATM 8019 H  H22   . EDO L 6 .   ? 10.222  -12.282 -12.838 1.00 69.69  ? 7    EDO A H22   1 
HETATM 8020 H  HO2   . EDO L 6 .   ? 10.977  -10.385 -11.708 1.00 72.36  ? 7    EDO A HO2   1 
HETATM 8021 C  C1    . EDO M 6 .   ? -1.468  1.584   -20.165 1.00 37.23  ? 8    EDO A C1    1 
HETATM 8022 O  O1    . EDO M 6 .   ? -0.330  2.140   -20.850 1.00 33.38  ? 8    EDO A O1    1 
HETATM 8023 C  C2    . EDO M 6 .   ? -2.740  2.269   -20.648 1.00 39.24  ? 8    EDO A C2    1 
HETATM 8024 O  O2    . EDO M 6 .   ? -2.707  2.404   -22.075 1.00 49.55  ? 8    EDO A O2    1 
HETATM 8025 H  H11   . EDO M 6 .   ? -1.357  1.728   -19.088 1.00 44.67  ? 8    EDO A H11   1 
HETATM 8026 H  H12   . EDO M 6 .   ? -1.529  0.511   -20.361 1.00 44.67  ? 8    EDO A H12   1 
HETATM 8027 H  HO1   . EDO M 6 .   ? 0.476   1.704   -20.543 1.00 40.06  ? 8    EDO A HO1   1 
HETATM 8028 H  H21   . EDO M 6 .   ? -2.826  3.255   -20.186 1.00 47.09  ? 8    EDO A H21   1 
HETATM 8029 H  H22   . EDO M 6 .   ? -3.611  1.679   -20.354 1.00 47.09  ? 8    EDO A H22   1 
HETATM 8030 H  HO2   . EDO M 6 .   ? -3.516  2.840   -22.376 1.00 59.46  ? 8    EDO A HO2   1 
HETATM 8031 C  C1    . EDO N 6 .   ? -11.943 -23.238 -7.969  1.00 39.49  ? 9    EDO A C1    1 
HETATM 8032 O  O1    . EDO N 6 .   ? -11.516 -24.516 -7.496  1.00 38.48  ? 9    EDO A O1    1 
HETATM 8033 C  C2    . EDO N 6 .   ? -13.352 -23.351 -8.536  1.00 42.59  ? 9    EDO A C2    1 
HETATM 8034 O  O2    . EDO N 6 .   ? -14.279 -23.640 -7.483  1.00 40.21  ? 9    EDO A O2    1 
HETATM 8035 H  H11   . EDO N 6 .   ? -11.931 -22.517 -7.149  1.00 47.39  ? 9    EDO A H11   1 
HETATM 8036 H  H12   . EDO N 6 .   ? -11.260 -22.883 -8.744  1.00 47.39  ? 9    EDO A H12   1 
HETATM 8037 H  HO1   . EDO N 6 .   ? -10.622 -24.444 -7.136  1.00 46.18  ? 9    EDO A HO1   1 
HETATM 8038 H  H21   . EDO N 6 .   ? -13.385 -24.146 -9.284  1.00 51.11  ? 9    EDO A H21   1 
HETATM 8039 H  H22   . EDO N 6 .   ? -13.629 -22.414 -9.024  1.00 51.11  ? 9    EDO A H22   1 
HETATM 8040 H  HO2   . EDO N 6 .   ? -15.171 -23.710 -7.848  1.00 48.25  ? 9    EDO A HO2   1 
HETATM 8041 CL CL    . CL  O 7 .   ? 6.054   7.030   3.785   1.00 69.40  ? 1402 CL  A CL    1 
HETATM 8042 CL CL    . CL  P 7 .   ? 8.986   -5.850  -8.554  1.00 57.03  ? 1403 CL  A CL    1 
HETATM 8043 O  O     . HOH Q 8 .   ? -10.014 4.676   -27.201 1.00 23.94  ? 10   HOH A O     1 
HETATM 8044 O  O     . HOH Q 8 .   ? -18.926 12.129  -16.153 1.00 21.14  ? 11   HOH A O     1 
HETATM 8045 O  O     . HOH Q 8 .   ? 6.881   19.478  -24.485 1.00 21.20  ? 12   HOH A O     1 
HETATM 8046 O  O     . HOH Q 8 .   ? -19.433 -5.215  -8.651  1.00 18.61  ? 13   HOH A O     1 
HETATM 8047 O  O     . HOH Q 8 .   ? -1.856  -2.599  -7.394  1.00 17.15  ? 14   HOH A O     1 
HETATM 8048 O  O     . HOH Q 8 .   ? -8.814  -9.232  4.536   1.00 23.40  ? 15   HOH A O     1 
HETATM 8049 O  O     . HOH Q 8 .   ? -20.935 11.674  -14.077 1.00 21.60  ? 16   HOH A O     1 
HETATM 8050 O  O     . HOH Q 8 .   ? -15.055 -15.367 -25.965 1.00 18.26  ? 17   HOH A O     1 
HETATM 8051 O  O     . HOH Q 8 .   ? 10.251  26.337  -20.494 1.00 18.76  ? 18   HOH A O     1 
HETATM 8052 O  O     . HOH Q 8 .   ? -22.891 1.608   -13.363 1.00 18.66  ? 19   HOH A O     1 
HETATM 8053 O  O     . HOH Q 8 .   ? -10.901 0.653   -9.685  1.00 17.40  ? 20   HOH A O     1 
HETATM 8054 O  O     . HOH Q 8 .   ? -9.031  1.057   -16.799 1.00 20.45  ? 21   HOH A O     1 
HETATM 8055 O  O     . HOH Q 8 .   ? 13.456  13.276  -6.982  1.00 22.55  ? 22   HOH A O     1 
HETATM 8056 O  O     . HOH Q 8 .   ? 1.998   -4.885  -11.420 1.00 21.01  ? 23   HOH A O     1 
HETATM 8057 O  O     . HOH Q 8 .   ? -11.990 7.425   -7.534  1.00 19.42  ? 24   HOH A O     1 
HETATM 8058 O  O     . HOH Q 8 .   ? -12.034 7.979   -10.301 1.00 18.92  ? 25   HOH A O     1 
HETATM 8059 O  O     . HOH Q 8 .   ? -22.234 -4.608  -8.821  1.00 19.66  ? 26   HOH A O     1 
HETATM 8060 O  O     . HOH Q 8 .   ? -8.114  -20.909 -18.792 1.00 21.99  ? 27   HOH A O     1 
HETATM 8061 O  O     . HOH Q 8 .   ? -12.276 15.152  -6.495  1.00 18.74  ? 28   HOH A O     1 
HETATM 8062 O  O     . HOH Q 8 .   ? 15.639  16.744  -16.922 1.00 30.52  ? 29   HOH A O     1 
HETATM 8063 O  O     . HOH Q 8 .   ? 1.264   1.561   -2.345  1.00 24.33  ? 30   HOH A O     1 
HETATM 8064 O  O     . HOH Q 8 .   ? -4.649  -20.835 -24.233 1.00 20.98  ? 31   HOH A O     1 
HETATM 8065 O  O     . HOH Q 8 .   ? 5.163   -0.571  -15.724 1.00 20.25  ? 32   HOH A O     1 
HETATM 8066 O  O     . HOH Q 8 .   ? -6.192  -21.984 -17.093 1.00 21.57  ? 33   HOH A O     1 
HETATM 8067 O  O     . HOH Q 8 .   ? -17.944 5.507   -34.269 1.00 20.57  ? 34   HOH A O     1 
HETATM 8068 O  O     . HOH Q 8 .   ? 16.698  25.180  -6.946  1.00 27.32  ? 35   HOH A O     1 
HETATM 8069 O  O     . HOH Q 8 .   ? -16.773 -3.850  -8.489  1.00 20.85  ? 36   HOH A O     1 
HETATM 8070 O  O     . HOH Q 8 .   ? 1.385   7.121   2.127   1.00 25.47  ? 37   HOH A O     1 
HETATM 8071 O  O     . HOH Q 8 .   ? -13.306 6.766   -12.975 1.00 23.04  ? 38   HOH A O     1 
HETATM 8072 O  O     . HOH Q 8 .   ? -11.825 12.167  -17.377 1.00 22.74  ? 39   HOH A O     1 
HETATM 8073 O  O     . HOH Q 8 .   ? -30.342 -1.467  -21.050 1.00 22.95  ? 40   HOH A O     1 
HETATM 8074 O  O     . HOH Q 8 .   ? -2.078  14.318  -0.355  1.00 25.30  ? 41   HOH A O     1 
HETATM 8075 O  O     . HOH Q 8 .   ? -4.413  -8.031  -1.014  1.00 20.98  ? 42   HOH A O     1 
HETATM 8076 O  O     . HOH Q 8 .   ? 0.484   -10.477 -7.118  1.00 27.02  ? 43   HOH A O     1 
HETATM 8077 O  O     . HOH Q 8 .   ? -28.503 -6.511  -0.882  1.00 27.66  ? 44   HOH A O     1 
HETATM 8078 O  O     . HOH Q 8 .   ? -16.332 -24.424 -3.499  1.00 26.61  ? 45   HOH A O     1 
HETATM 8079 O  O     . HOH Q 8 .   ? -11.535 1.836   -16.868 1.00 19.92  ? 46   HOH A O     1 
HETATM 8080 O  O     . HOH Q 8 .   ? 1.531   -3.221  -15.683 1.00 21.91  ? 47   HOH A O     1 
HETATM 8081 O  O     . HOH Q 8 .   ? -22.935 11.788  -16.042 1.00 24.60  ? 48   HOH A O     1 
HETATM 8082 O  O     . HOH Q 8 .   ? 13.161  10.010  -9.448  1.00 26.53  ? 49   HOH A O     1 
HETATM 8083 O  O     . HOH Q 8 .   ? 3.842   7.827   1.209   1.00 25.76  ? 50   HOH A O     1 
HETATM 8084 O  O     . HOH Q 8 .   ? -25.330 -4.580  -22.343 1.00 21.63  ? 51   HOH A O     1 
HETATM 8085 O  O     . HOH Q 8 .   ? -8.699  15.065  -5.446  1.00 26.53  ? 52   HOH A O     1 
HETATM 8086 O  O     . HOH Q 8 .   ? -21.442 -22.648 -13.331 1.00 20.20  ? 53   HOH A O     1 
HETATM 8087 O  O     . HOH Q 8 .   ? 5.626   6.333   -21.500 1.00 27.44  ? 54   HOH A O     1 
HETATM 8088 O  O     . HOH Q 8 .   ? -17.247 -20.433 -7.026  1.00 26.02  ? 55   HOH A O     1 
HETATM 8089 O  O     . HOH Q 8 .   ? -15.979 -22.261 -5.534  1.00 24.08  ? 56   HOH A O     1 
HETATM 8090 O  O     . HOH Q 8 .   ? -9.957  -7.645  6.826   1.00 35.38  ? 57   HOH A O     1 
HETATM 8091 O  O     . HOH Q 8 .   ? 0.100   13.351  1.089   1.00 27.52  ? 58   HOH A O     1 
HETATM 8092 O  O     . HOH Q 8 .   ? -28.814 -4.531  -24.142 1.00 24.84  ? 59   HOH A O     1 
HETATM 8093 O  O     . HOH Q 8 .   ? -10.096 -12.402 -31.284 1.00 22.33  ? 60   HOH A O     1 
HETATM 8094 O  O     . HOH Q 8 .   ? -14.219 -9.018  7.953   1.00 29.97  ? 61   HOH A O     1 
HETATM 8095 O  O     . HOH Q 8 .   ? -15.188 -9.174  -29.016 1.00 24.95  ? 62   HOH A O     1 
HETATM 8096 O  O     . HOH Q 8 .   ? -20.237 -9.907  -12.696 1.00 23.78  ? 63   HOH A O     1 
HETATM 8097 O  O     . HOH Q 8 .   ? -20.867 -21.078 -16.939 1.00 25.26  ? 64   HOH A O     1 
HETATM 8098 O  O     . HOH Q 8 .   ? -27.317 -10.118 5.096   1.00 25.58  ? 65   HOH A O     1 
HETATM 8099 O  O     . HOH Q 8 .   ? -33.444 4.086   -19.396 1.00 35.13  ? 66   HOH A O     1 
HETATM 8100 O  O     . HOH Q 8 .   ? -0.875  -15.938 -28.211 1.00 23.53  ? 67   HOH A O     1 
HETATM 8101 O  O     . HOH Q 8 .   ? -14.628 -7.919  3.114   1.00 22.00  ? 68   HOH A O     1 
HETATM 8102 O  O     . HOH Q 8 .   ? -27.869 5.193   -10.416 1.00 30.12  ? 70   HOH A O     1 
HETATM 8103 O  O     . HOH Q 8 .   ? -2.788  14.720  2.369   1.00 25.03  ? 71   HOH A O     1 
HETATM 8104 O  O     . HOH Q 8 .   ? -31.012 -5.584  -11.320 1.00 25.34  ? 72   HOH A O     1 
HETATM 8105 O  O     . HOH Q 8 .   ? -13.763 17.011  -5.246  1.00 29.59  ? 73   HOH A O     1 
HETATM 8106 O  O     . HOH Q 8 .   ? -17.013 11.337  -35.956 1.00 26.84  ? 74   HOH A O     1 
HETATM 8107 O  O     . HOH Q 8 .   ? -28.149 -12.025 -16.733 1.00 34.39  ? 75   HOH A O     1 
HETATM 8108 O  O     . HOH Q 8 .   ? -17.343 5.098   -14.127 1.00 33.19  ? 76   HOH A O     1 
HETATM 8109 O  O     . HOH Q 8 .   ? 7.268   12.458  4.658   1.00 39.03  ? 77   HOH A O     1 
HETATM 8110 O  O     . HOH Q 8 .   ? -19.183 -2.652  -3.449  1.00 31.61  ? 78   HOH A O     1 
HETATM 8111 O  O     . HOH Q 8 .   ? -27.385 7.910   -11.150 1.00 28.12  ? 79   HOH A O     1 
HETATM 8112 O  O     . HOH Q 8 .   ? -11.412 8.614   -19.858 1.00 24.77  ? 80   HOH A O     1 
HETATM 8113 O  O     . HOH Q 8 .   ? -13.645 4.600   -39.735 1.00 27.65  ? 81   HOH A O     1 
HETATM 8114 O  O     . HOH Q 8 .   ? -4.187  22.944  0.926   1.00 26.88  ? 82   HOH A O     1 
HETATM 8115 O  O     . HOH Q 8 .   ? -6.746  20.778  -1.913  1.00 27.53  ? 83   HOH A O     1 
HETATM 8116 O  O     . HOH Q 8 .   ? -27.217 -5.812  5.694   1.00 26.50  ? 84   HOH A O     1 
HETATM 8117 O  O     . HOH Q 8 .   ? 2.079   5.769   -23.371 1.00 23.57  ? 85   HOH A O     1 
HETATM 8118 O  O     . HOH Q 8 .   ? -6.462  23.191  -0.164  1.00 25.98  ? 86   HOH A O     1 
HETATM 8119 O  O     . HOH Q 8 .   ? -22.391 -1.861  -31.125 1.00 26.10  ? 87   HOH A O     1 
HETATM 8120 O  O     . HOH Q 8 .   ? -14.539 8.699   -11.122 1.00 25.04  ? 88   HOH A O     1 
HETATM 8121 O  O     . HOH Q 8 .   ? -0.384  15.851  2.988   1.00 30.45  ? 89   HOH A O     1 
HETATM 8122 O  O     . HOH Q 8 .   ? -4.053  20.536  -2.032  1.00 29.61  ? 90   HOH A O     1 
HETATM 8123 O  O     . HOH Q 8 .   ? 7.884   -0.495  -16.145 1.00 34.69  ? 91   HOH A O     1 
HETATM 8124 O  O     . HOH Q 8 .   ? -6.098  25.212  -2.050  1.00 35.09  ? 92   HOH A O     1 
HETATM 8125 O  O     . HOH Q 8 .   ? 2.318   -9.148  -5.620  1.00 26.71  ? 93   HOH A O     1 
HETATM 8126 O  O     . HOH Q 8 .   ? -16.815 -23.018 -17.179 1.00 31.27  ? 94   HOH A O     1 
HETATM 8127 O  O     . HOH Q 8 .   ? 9.803   5.951   -18.318 1.00 32.13  ? 95   HOH A O     1 
HETATM 8128 O  O     . HOH Q 8 .   ? -6.780  8.049   1.697   1.00 34.91  ? 96   HOH A O     1 
HETATM 8129 O  O     . HOH Q 8 .   ? -12.033 14.615  -18.765 1.00 25.51  ? 97   HOH A O     1 
HETATM 8130 O  O     . HOH Q 8 .   ? -25.929 -12.782 -22.498 1.00 36.49  ? 98   HOH A O     1 
HETATM 8131 O  O     . HOH Q 8 .   ? -15.752 -13.325 -28.101 1.00 28.59  ? 99   HOH A O     1 
HETATM 8132 O  O     . HOH Q 8 .   ? 9.181   16.563  4.718   1.00 27.17  ? 100  HOH A O     1 
HETATM 8133 O  O     . HOH Q 8 .   ? -31.108 -3.753  -22.487 1.00 25.19  ? 101  HOH A O     1 
HETATM 8134 O  O     . HOH Q 8 .   ? 15.085  11.341  -11.002 1.00 32.67  ? 102  HOH A O     1 
HETATM 8135 O  O     . HOH Q 8 .   ? 5.461   -18.324 -11.926 1.00 29.28  ? 103  HOH A O     1 
HETATM 8136 O  O     . HOH Q 8 .   ? 14.823  28.486  -15.576 1.00 32.07  ? 104  HOH A O     1 
HETATM 8137 O  O     . HOH Q 8 .   ? -6.223  3.195   -23.091 1.00 33.91  ? 105  HOH A O     1 
HETATM 8138 O  O     . HOH Q 8 .   ? 15.709  9.231   -21.726 1.00 32.54  ? 106  HOH A O     1 
HETATM 8139 O  O     . HOH Q 8 .   ? 6.087   -8.566  -16.484 1.00 29.91  ? 107  HOH A O     1 
HETATM 8140 O  O     . HOH Q 8 .   ? 5.158   -11.236 -19.523 1.00 37.10  ? 108  HOH A O     1 
HETATM 8141 O  O     . HOH Q 8 .   ? 2.959   -21.427 -26.737 1.00 31.77  ? 109  HOH A O     1 
HETATM 8142 O  O     . HOH Q 8 .   ? -11.278 -23.320 -18.259 1.00 36.94  ? 110  HOH A O     1 
HETATM 8143 O  O     . HOH Q 8 .   ? 18.223  21.637  -5.120  1.00 34.08  ? 112  HOH A O     1 
HETATM 8144 O  O     . HOH Q 8 .   ? -13.830 -1.868  -34.701 1.00 31.63  ? 113  HOH A O     1 
HETATM 8145 O  O     . HOH Q 8 .   ? 3.735   12.428  -1.495  1.00 30.81  ? 114  HOH A O     1 
HETATM 8146 O  O     . HOH Q 8 .   ? 0.630   16.862  -15.316 1.00 26.04  ? 115  HOH A O     1 
HETATM 8147 O  O     . HOH Q 8 .   ? -31.513 -9.384  -0.479  1.00 32.00  ? 116  HOH A O     1 
HETATM 8148 O  O     . HOH Q 8 .   ? -8.734  -22.696 3.954   1.00 31.87  ? 117  HOH A O     1 
HETATM 8149 O  O     . HOH Q 8 .   ? 0.009   26.276  -9.804  1.00 38.07  ? 118  HOH A O     1 
HETATM 8150 O  O     . HOH Q 8 .   ? 7.190   14.885  5.939   1.00 28.20  ? 119  HOH A O     1 
HETATM 8151 O  O     . HOH Q 8 .   ? -31.006 5.870   -24.644 1.00 29.80  ? 120  HOH A O     1 
HETATM 8152 O  O     . HOH Q 8 .   ? -12.278 -11.740 8.874   1.00 33.37  ? 121  HOH A O     1 
HETATM 8153 O  O     . HOH Q 8 .   ? -15.179 7.906   -5.449  1.00 29.09  ? 122  HOH A O     1 
HETATM 8154 O  O     . HOH Q 8 .   ? -9.881  -4.779  4.547   1.00 31.14  ? 123  HOH A O     1 
HETATM 8155 O  O     . HOH Q 8 .   ? -17.799 -7.795  -30.324 1.00 29.56  ? 124  HOH A O     1 
HETATM 8156 O  O     . HOH Q 8 .   ? -0.026  -20.432 -2.164  1.00 32.25  ? 125  HOH A O     1 
HETATM 8157 O  O     . HOH Q 8 .   ? 5.278   22.567  2.869   1.00 32.82  ? 126  HOH A O     1 
HETATM 8158 O  O     . HOH Q 8 .   ? -17.437 10.630  -4.261  1.00 34.91  ? 127  HOH A O     1 
HETATM 8159 O  O     . HOH Q 8 .   ? -19.745 4.017   -13.467 1.00 30.76  ? 129  HOH A O     1 
HETATM 8160 O  O     . HOH Q 8 .   ? -37.974 -1.520  -24.826 1.00 39.54  ? 130  HOH A O     1 
HETATM 8161 O  O     . HOH Q 8 .   ? -17.970 8.130   -33.682 1.00 23.41  ? 131  HOH A O     1 
HETATM 8162 O  O     . HOH Q 8 .   ? -15.712 -5.682  2.030   1.00 33.17  ? 132  HOH A O     1 
HETATM 8163 O  O     . HOH Q 8 .   ? -24.100 -3.054  -29.571 1.00 30.25  ? 133  HOH A O     1 
HETATM 8164 O  O     . HOH Q 8 .   ? -28.978 -17.182 -10.569 1.00 32.36  ? 134  HOH A O     1 
HETATM 8165 O  O     . HOH Q 8 .   ? -28.844 5.566   -29.893 1.00 34.14  ? 135  HOH A O     1 
HETATM 8166 O  O     . HOH Q 8 .   ? -17.580 -5.815  -36.221 1.00 29.13  ? 136  HOH A O     1 
HETATM 8167 O  O     . HOH Q 8 .   ? -21.867 -16.411 9.583   1.00 39.65  ? 137  HOH A O     1 
HETATM 8168 O  O     . HOH Q 8 .   ? 13.591  3.502   -11.134 1.00 31.51  ? 138  HOH A O     1 
HETATM 8169 O  O     . HOH Q 8 .   ? 6.444   5.087   -1.882  1.00 34.83  ? 140  HOH A O     1 
HETATM 8170 O  O     . HOH Q 8 .   ? -10.344 20.103  -12.181 1.00 27.09  ? 141  HOH A O     1 
HETATM 8171 O  O     . HOH Q 8 .   ? 5.248   19.507  -20.905 1.00 32.33  ? 142  HOH A O     1 
HETATM 8172 O  O     . HOH Q 8 .   ? -8.799  2.309   -27.940 1.00 35.50  ? 143  HOH A O     1 
HETATM 8173 O  O     . HOH Q 8 .   ? -2.077  22.638  -0.929  1.00 35.25  ? 144  HOH A O     1 
HETATM 8174 O  O     . HOH Q 8 .   ? -29.083 -10.414 -14.350 1.00 33.07  ? 145  HOH A O     1 
HETATM 8175 O  O     . HOH Q 8 .   ? -29.015 -5.080  -14.707 1.00 27.10  ? 146  HOH A O     1 
HETATM 8176 O  O     . HOH Q 8 .   ? -21.011 13.612  -12.198 1.00 35.28  ? 147  HOH A O     1 
HETATM 8177 O  O     . HOH Q 8 .   ? -13.193 12.381  -29.679 1.00 26.96  ? 148  HOH A O     1 
HETATM 8178 O  O     . HOH Q 8 .   ? -32.269 -3.925  -13.255 1.00 33.77  ? 149  HOH A O     1 
HETATM 8179 O  O     . HOH Q 8 .   ? -6.401  -5.458  5.853   1.00 32.22  ? 150  HOH A O     1 
HETATM 8180 O  O     . HOH Q 8 .   ? -33.354 4.086   -16.531 1.00 34.99  ? 151  HOH A O     1 
HETATM 8181 O  O     . HOH Q 8 .   ? 8.267   24.012  5.314   1.00 31.34  ? 152  HOH A O     1 
HETATM 8182 O  O     . HOH Q 8 .   ? -10.119 10.802  -18.910 1.00 31.10  ? 153  HOH A O     1 
HETATM 8183 O  O     . HOH Q 8 .   ? -20.694 13.929  -22.793 1.00 42.34  ? 154  HOH A O     1 
HETATM 8184 O  O     . HOH Q 8 .   ? 0.920   34.264  -1.908  1.00 37.28  ? 155  HOH A O     1 
HETATM 8185 O  O     . HOH Q 8 .   ? -11.396 5.611   -29.528 1.00 37.89  ? 156  HOH A O     1 
HETATM 8186 O  O     . HOH Q 8 .   ? -13.628 -15.685 10.483  1.00 35.63  ? 157  HOH A O     1 
HETATM 8187 O  O     . HOH Q 8 .   ? -7.249  1.589   -24.772 1.00 33.98  ? 158  HOH A O     1 
HETATM 8188 O  O     . HOH Q 8 .   ? -27.140 -18.227 3.516   1.00 40.44  ? 159  HOH A O     1 
HETATM 8189 O  O     . HOH Q 8 .   ? 13.363  10.617  -13.328 1.00 32.18  ? 160  HOH A O     1 
HETATM 8190 O  O     . HOH Q 8 .   ? -13.068 4.450   -33.115 1.00 31.33  ? 161  HOH A O     1 
HETATM 8191 O  O     . HOH Q 8 .   ? 7.342   4.883   -19.928 1.00 32.46  ? 162  HOH A O     1 
HETATM 8192 O  O     . HOH Q 8 .   ? 5.546   7.973   -24.781 1.00 37.27  ? 163  HOH A O     1 
HETATM 8193 O  O     . HOH Q 8 .   ? 0.842   -0.303  -0.539  1.00 34.45  ? 164  HOH A O     1 
HETATM 8194 O  O     . HOH Q 8 .   ? -20.747 7.818   -31.334 1.00 39.95  ? 165  HOH A O     1 
HETATM 8195 O  O     . HOH Q 8 .   ? 7.753   -23.164 -19.760 1.00 37.41  ? 166  HOH A O     1 
HETATM 8196 O  O     . HOH Q 8 .   ? -11.653 11.801  -32.181 1.00 31.89  ? 167  HOH A O     1 
HETATM 8197 O  O     . HOH Q 8 .   ? -5.167  3.897   3.422   1.00 24.75  ? 168  HOH A O     1 
HETATM 8198 O  O     . HOH Q 8 .   ? 1.291   -2.231  -2.125  1.00 39.64  ? 169  HOH A O     1 
HETATM 8199 O  O     . HOH Q 8 .   ? -12.505 10.397  -27.983 1.00 29.54  ? 171  HOH A O     1 
HETATM 8200 O  O     . HOH Q 8 .   ? -5.903  18.425  -5.067  1.00 38.98  ? 174  HOH A O     1 
HETATM 8201 O  O     . HOH Q 8 .   ? 11.491  4.783   -17.011 1.00 36.08  ? 175  HOH A O     1 
HETATM 8202 O  O     . HOH Q 8 .   ? 15.366  9.089   -7.753  1.00 44.73  ? 176  HOH A O     1 
HETATM 8203 O  O     . HOH Q 8 .   ? -13.083 -19.982 9.577   1.00 36.27  ? 177  HOH A O     1 
HETATM 8204 O  O     . HOH Q 8 .   ? 16.870  25.412  -3.961  1.00 36.46  ? 178  HOH A O     1 
HETATM 8205 O  O     . HOH Q 8 .   ? -36.991 -14.463 -6.475  1.00 48.33  ? 179  HOH A O     1 
HETATM 8206 O  O     . HOH Q 8 .   ? -11.338 -23.559 -11.632 1.00 32.25  ? 180  HOH A O     1 
HETATM 8207 O  O     . HOH Q 8 .   ? 14.148  31.108  -3.943  1.00 37.87  ? 181  HOH A O     1 
HETATM 8208 O  O     . HOH Q 8 .   ? -14.896 -26.775 -4.035  1.00 41.88  ? 182  HOH A O     1 
HETATM 8209 O  O     . HOH Q 8 .   ? -6.624  -21.586 2.681   1.00 31.77  ? 183  HOH A O     1 
HETATM 8210 O  O     . HOH Q 8 .   ? -12.636 -3.953  3.945   1.00 31.51  ? 184  HOH A O     1 
HETATM 8211 O  O     . HOH Q 8 .   ? -3.169  -23.971 -27.277 1.00 36.56  ? 185  HOH A O     1 
HETATM 8212 O  O     . HOH Q 8 .   ? 5.256   2.475   -1.479  1.00 40.08  ? 186  HOH A O     1 
HETATM 8213 O  O     . HOH Q 8 .   ? -6.552  -24.670 -10.366 1.00 33.17  ? 187  HOH A O     1 
HETATM 8214 O  O     . HOH Q 8 .   ? -18.927 -2.090  2.582   1.00 38.24  ? 188  HOH A O     1 
HETATM 8215 O  O     . HOH Q 8 .   ? -3.509  19.759  -4.525  1.00 33.57  ? 189  HOH A O     1 
HETATM 8216 O  O     . HOH Q 8 .   ? -13.375 -23.296 -24.146 1.00 34.65  ? 190  HOH A O     1 
HETATM 8217 O  O     . HOH Q 8 .   ? -16.212 -1.632  -10.017 1.00 39.56  ? 191  HOH A O     1 
HETATM 8218 O  O     . HOH Q 8 .   ? -21.095 -5.220  -36.668 1.00 40.18  ? 192  HOH A O     1 
HETATM 8219 O  O     . HOH Q 8 .   ? -6.568  7.487   -1.127  1.00 30.71  ? 194  HOH A O     1 
HETATM 8220 O  O     . HOH Q 8 .   ? -20.703 -6.770  -29.916 1.00 44.37  ? 195  HOH A O     1 
HETATM 8221 O  O     . HOH Q 8 .   ? -21.065 -1.451  -42.576 1.00 45.33  ? 196  HOH A O     1 
HETATM 8222 O  O     . HOH Q 8 .   ? -26.930 -17.282 -17.041 1.00 39.33  ? 197  HOH A O     1 
HETATM 8223 O  O     . HOH Q 8 .   ? -4.833  15.710  -20.827 1.00 38.90  ? 198  HOH A O     1 
HETATM 8224 O  O     . HOH Q 8 .   ? -8.135  21.937  -3.944  1.00 36.75  ? 199  HOH A O     1 
HETATM 8225 O  O     . HOH Q 8 .   ? 3.642   -6.841  -28.159 1.00 35.17  ? 200  HOH A O     1 
HETATM 8226 O  O     . HOH Q 8 .   ? 8.347   10.347  -25.275 1.00 36.87  ? 201  HOH A O     1 
HETATM 8227 O  O     . HOH Q 8 .   ? -0.169  28.648  -7.862  1.00 43.96  ? 202  HOH A O     1 
HETATM 8228 O  O     . HOH Q 8 .   ? -13.046 -0.733  -31.983 1.00 39.34  ? 203  HOH A O     1 
HETATM 8229 O  O     . HOH Q 8 .   ? -1.653  -1.114  -32.551 1.00 41.88  ? 205  HOH A O     1 
HETATM 8230 O  O     . HOH Q 8 .   ? 11.623  1.715   -10.107 1.00 39.66  ? 206  HOH A O     1 
HETATM 8231 O  O     . HOH Q 8 .   ? -19.647 -9.583  -30.484 1.00 43.77  ? 207  HOH A O     1 
HETATM 8232 O  O     . HOH Q 8 .   ? -7.860  17.722  -17.811 1.00 37.38  ? 208  HOH A O     1 
HETATM 8233 O  O     . HOH Q 8 .   ? -29.570 -18.089 -7.961  1.00 44.34  ? 209  HOH A O     1 
HETATM 8234 O  O     . HOH Q 8 .   ? -19.049 -24.322 -2.682  1.00 35.15  ? 210  HOH A O     1 
HETATM 8235 O  O     . HOH Q 8 .   ? -34.138 -1.031  -27.529 1.00 42.58  ? 211  HOH A O     1 
HETATM 8236 O  O     . HOH Q 8 .   ? -1.863  -24.807 -3.444  1.00 40.70  ? 212  HOH A O     1 
HETATM 8237 O  O     . HOH Q 8 .   ? 7.629   1.498   -18.465 1.00 47.12  ? 213  HOH A O     1 
HETATM 8238 O  O     . HOH Q 8 .   ? -9.417  12.404  4.703   1.00 34.27  ? 214  HOH A O     1 
HETATM 8239 O  O     . HOH Q 8 .   ? -7.483  20.258  -16.434 1.00 43.24  ? 215  HOH A O     1 
HETATM 8240 O  O     . HOH Q 8 .   ? -2.040  29.061  -6.698  1.00 41.35  ? 216  HOH A O     1 
HETATM 8241 O  O     . HOH Q 8 .   ? -15.136 24.515  -1.984  1.00 40.91  ? 217  HOH A O     1 
HETATM 8242 O  O     . HOH Q 8 .   ? -14.131 29.682  -0.053  1.00 41.99  ? 218  HOH A O     1 
HETATM 8243 O  O     . HOH Q 8 .   ? -2.308  12.606  10.660  1.00 47.78  ? 219  HOH A O     1 
HETATM 8244 O  O     . HOH Q 8 .   ? -22.575 -13.845 11.967  1.00 35.28  ? 220  HOH A O     1 
HETATM 8245 O  O     . HOH Q 8 .   ? -20.763 -20.446 -20.608 1.00 40.23  ? 222  HOH A O     1 
HETATM 8246 O  O     . HOH Q 8 .   ? -20.546 3.752   -10.913 1.00 43.30  ? 223  HOH A O     1 
HETATM 8247 O  O     . HOH Q 8 .   ? 6.598   -21.354 -25.304 1.00 47.79  ? 224  HOH A O     1 
HETATM 8248 O  O     . HOH Q 8 .   ? -16.309 -11.234 -30.453 1.00 38.38  ? 225  HOH A O     1 
HETATM 8249 O  O     . HOH Q 8 .   ? 5.413   -3.956  -13.286 1.00 36.96  ? 226  HOH A O     1 
HETATM 8250 O  O     . HOH Q 8 .   ? 15.948  10.826  -24.183 1.00 46.35  ? 227  HOH A O     1 
HETATM 8251 O  O     . HOH Q 8 .   ? -15.270 -25.440 -14.510 1.00 34.99  ? 228  HOH A O     1 
HETATM 8252 O  O     . HOH Q 8 .   ? 9.556   -0.060  -14.166 1.00 45.93  ? 229  HOH A O     1 
HETATM 8253 O  O     . HOH Q 8 .   ? 14.563  12.790  -4.559  1.00 31.63  ? 230  HOH A O     1 
HETATM 8254 O  O     . HOH Q 8 .   ? -9.038  24.886  -2.095  1.00 38.60  ? 231  HOH A O     1 
HETATM 8255 O  O     . HOH Q 8 .   ? -12.169 6.011   -34.975 1.00 37.46  ? 232  HOH A O     1 
HETATM 8256 O  O     . HOH Q 8 .   ? -11.428 3.651   -38.390 1.00 43.33  ? 233  HOH A O     1 
HETATM 8257 O  O     . HOH Q 8 .   ? -11.748 14.269  5.585   1.00 37.50  ? 234  HOH A O     1 
HETATM 8258 O  O     . HOH Q 8 .   ? -23.751 -5.430  -29.940 1.00 45.54  ? 235  HOH A O     1 
HETATM 8259 O  O     . HOH Q 8 .   ? -8.267  -7.741  8.947   1.00 41.12  ? 236  HOH A O     1 
HETATM 8260 O  O     . HOH Q 8 .   ? -13.476 -6.646  5.281   1.00 40.58  ? 237  HOH A O     1 
HETATM 8261 O  O     . HOH Q 8 .   ? 7.593   13.683  8.433   1.00 40.78  ? 238  HOH A O     1 
HETATM 8262 O  O     . HOH Q 8 .   ? 18.137  28.300  -9.732  1.00 40.34  ? 239  HOH A O     1 
HETATM 8263 O  O     . HOH Q 8 .   ? 9.364   1.759   -11.568 1.00 41.06  ? 240  HOH A O     1 
HETATM 8264 O  O     . HOH Q 8 .   ? -5.589  -24.091 1.781   1.00 40.32  ? 241  HOH A O     1 
HETATM 8265 O  O     . HOH Q 8 .   ? -5.601  15.103  18.668  1.00 39.62  ? 242  HOH A O     1 
HETATM 8266 O  O     . HOH Q 8 .   ? -14.891 -5.291  -36.608 1.00 41.43  ? 243  HOH A O     1 
HETATM 8267 O  O     . HOH Q 8 .   ? -1.448  -2.214  -0.280  1.00 49.31  ? 244  HOH A O     1 
HETATM 8268 O  O     . HOH Q 8 .   ? 15.136  4.410   -15.988 1.00 45.69  ? 245  HOH A O     1 
HETATM 8269 O  O     . HOH Q 8 .   ? 14.695  22.311  -13.526 1.00 35.75  ? 246  HOH A O     1 
HETATM 8270 O  O     . HOH Q 8 .   ? -13.244 -23.820 -19.808 1.00 40.67  ? 247  HOH A O     1 
HETATM 8271 O  O     . HOH Q 8 .   ? 2.492   -2.746  -13.437 1.00 40.78  ? 248  HOH A O     1 
HETATM 8272 O  O     . HOH Q 8 .   ? -20.927 -13.049 -25.724 1.00 42.32  ? 249  HOH A O     1 
HETATM 8273 O  O     . HOH Q 8 .   ? -21.465 14.205  -9.727  1.00 38.80  ? 250  HOH A O     1 
HETATM 8274 O  O     . HOH Q 8 .   ? -10.749 17.377  -21.132 1.00 49.56  ? 251  HOH A O     1 
HETATM 8275 O  O     . HOH Q 8 .   ? -10.530 23.011  -3.159  1.00 39.33  ? 252  HOH A O     1 
HETATM 8276 O  O     . HOH Q 8 .   ? -1.835  -7.270  5.848   1.00 47.03  ? 253  HOH A O     1 
HETATM 8277 O  O     . HOH Q 8 .   ? -13.328 -24.765 -12.354 1.00 45.49  ? 254  HOH A O     1 
HETATM 8278 O  O     . HOH Q 8 .   ? 10.215  11.232  -27.081 1.00 43.59  ? 255  HOH A O     1 
HETATM 8279 O  O     . HOH Q 8 .   ? 11.240  2.306   -7.872  1.00 43.88  ? 256  HOH A O     1 
HETATM 8280 O  O     . HOH Q 8 .   ? -31.035 -5.179  0.005   1.00 40.41  ? 257  HOH A O     1 
HETATM 8281 O  O     . HOH Q 8 .   ? -9.382  -25.258 -10.452 1.00 43.49  ? 258  HOH A O     1 
HETATM 8282 O  O     . HOH Q 8 .   ? -22.646 9.649   -30.836 1.00 46.34  ? 259  HOH A O     1 
HETATM 8283 O  O     . HOH Q 8 .   ? 4.317   -0.802  -21.750 1.00 46.17  ? 260  HOH A O     1 
HETATM 8284 O  O     . HOH Q 8 .   ? 5.070   -10.034 -5.373  1.00 40.72  ? 261  HOH A O     1 
HETATM 8285 O  O     . HOH Q 8 .   ? 4.087   -0.885  -2.332  1.00 42.01  ? 262  HOH A O     1 
HETATM 8286 O  O     . HOH Q 8 .   ? -23.051 -3.928  -42.970 1.00 45.88  ? 263  HOH A O     1 
HETATM 8287 O  O     . HOH Q 8 .   ? -22.770 -5.320  -40.602 1.00 49.29  ? 264  HOH A O     1 
HETATM 8288 O  O     . HOH Q 8 .   ? -13.854 -2.516  -11.284 1.00 24.98  ? 265  HOH A O     1 
HETATM 8289 O  O     . HOH Q 8 .   ? -1.029  -5.599  -1.597  1.00 37.74  ? 266  HOH A O     1 
HETATM 8290 O  O     . HOH Q 8 .   ? 14.666  21.348  -11.432 1.00 41.21  ? 267  HOH A O     1 
HETATM 8291 O  O     . HOH Q 8 .   ? 4.545   10.830  0.931   1.00 43.93  ? 268  HOH A O     1 
HETATM 8292 O  O     . HOH Q 8 .   ? -7.786  -13.945 -31.454 1.00 21.29  ? 269  HOH A O     1 
HETATM 8293 O  O     . HOH Q 8 .   ? -9.576  -6.534  -32.281 1.00 29.29  ? 270  HOH A O     1 
HETATM 8294 O  O     . HOH Q 8 .   ? -26.697 -14.814 -20.292 1.00 46.23  ? 272  HOH A O     1 
HETATM 8295 O  O     . HOH Q 8 .   ? -3.272  -2.945  -32.339 1.00 50.48  ? 273  HOH A O     1 
HETATM 8296 O  O     . HOH Q 8 .   ? -15.548 -23.843 -22.587 1.00 47.04  ? 274  HOH A O     1 
HETATM 8297 O  O     . HOH Q 8 .   ? -27.803 -9.766  2.443   1.00 33.97  ? 275  HOH A O     1 
HETATM 8298 O  O     . HOH Q 8 .   ? -0.953  17.322  -10.253 1.00 31.73  ? 276  HOH A O     1 
HETATM 8299 O  O     . HOH Q 8 .   ? -3.179  17.126  -11.568 1.00 39.41  ? 277  HOH A O     1 
HETATM 8300 O  O     . HOH Q 8 .   ? 3.844   -2.487  -16.311 1.00 47.44  ? 278  HOH A O     1 
HETATM 8301 O  O     . HOH Q 8 .   ? -2.867  27.660  12.292  1.00 40.70  ? 279  HOH A O     1 
HETATM 8302 O  O     . HOH Q 8 .   ? -3.935  -26.224 -25.322 1.00 40.68  ? 280  HOH A O     1 
HETATM 8303 O  O     . HOH Q 8 .   ? 2.480   -0.861  -25.887 1.00 42.28  ? 281  HOH A O     1 
HETATM 8304 O  O     . HOH Q 8 .   ? -3.486  -16.801 6.660   1.00 46.81  ? 283  HOH A O     1 
HETATM 8305 O  O     . HOH Q 8 .   ? -25.627 -21.145 -16.226 1.00 43.55  ? 284  HOH A O     1 
HETATM 8306 O  O     . HOH Q 8 .   ? 17.010  19.881  -11.508 1.00 38.49  ? 285  HOH A O     1 
HETATM 8307 O  O     . HOH Q 8 .   ? -35.644 -13.880 -13.908 1.00 44.31  ? 286  HOH A O     1 
HETATM 8308 O  O     . HOH Q 8 .   ? 6.646   -4.153  -14.921 1.00 48.75  ? 287  HOH A O     1 
HETATM 8309 O  O     . HOH Q 8 .   ? -21.072 -21.826 4.406   1.00 38.75  ? 288  HOH A O     1 
HETATM 8310 O  O     . HOH Q 8 .   ? -5.584  17.169  -17.434 1.00 45.24  ? 289  HOH A O     1 
HETATM 8311 O  O     . HOH Q 8 .   ? 15.258  13.359  -24.801 1.00 44.26  ? 290  HOH A O     1 
HETATM 8312 O  O     . HOH Q 8 .   ? -11.837 14.614  -28.650 1.00 48.62  ? 291  HOH A O     1 
HETATM 8313 O  O     . HOH Q 8 .   ? -30.217 -15.489 -19.858 1.00 50.34  ? 292  HOH A O     1 
HETATM 8314 O  O     . HOH Q 8 .   ? -2.382  27.875  -3.665  1.00 40.04  ? 293  HOH A O     1 
HETATM 8315 O  O     . HOH Q 8 .   ? 6.179   -2.455  -2.041  1.00 49.36  ? 295  HOH A O     1 
HETATM 8316 O  O     . HOH Q 8 .   ? -30.399 -10.018 1.928   1.00 43.99  ? 296  HOH A O     1 
HETATM 8317 O  O     . HOH Q 8 .   ? -7.690  -22.547 6.549   1.00 46.75  ? 297  HOH A O     1 
HETATM 8318 O  O     . HOH Q 8 .   ? -10.835 14.021  -42.189 1.00 31.60  ? 298  HOH A O     1 
HETATM 8319 O  O     . HOH Q 8 .   ? 4.281   -20.850 -11.632 1.00 43.24  ? 299  HOH A O     1 
HETATM 8320 O  O     . HOH Q 8 .   ? 4.736   16.518  -23.825 1.00 47.58  ? 300  HOH A O     1 
HETATM 8321 O  O     . HOH Q 8 .   ? -2.862  28.355  14.858  1.00 48.63  ? 301  HOH A O     1 
HETATM 8322 O  O     . HOH Q 8 .   ? 12.920  6.387   -2.826  1.00 48.38  ? 302  HOH A O     1 
HETATM 8323 O  O     . HOH Q 8 .   ? -34.438 -2.637  -13.290 1.00 47.13  ? 303  HOH A O     1 
HETATM 8324 O  O     . HOH Q 8 .   ? -33.083 6.099   -15.029 1.00 45.88  ? 304  HOH A O     1 
HETATM 8325 O  O     . HOH Q 8 .   ? -2.260  -14.020 -29.569 1.00 42.67  ? 306  HOH A O     1 
HETATM 8326 O  O     . HOH Q 8 .   ? -2.875  -23.023 -20.643 1.00 50.03  ? 307  HOH A O     1 
HETATM 8327 O  O     . HOH Q 8 .   ? -5.278  -18.734 3.984   1.00 51.53  ? 308  HOH A O     1 
HETATM 8328 O  O     . HOH Q 8 .   ? 6.501   -8.067  -7.237  1.00 39.49  ? 310  HOH A O     1 
HETATM 8329 O  O     . HOH Q 8 .   ? 14.330  15.231  -0.170  1.00 45.16  ? 311  HOH A O     1 
HETATM 8330 O  O     . HOH Q 8 .   ? -13.856 7.394   1.083   1.00 35.99  ? 312  HOH A O     1 
HETATM 8331 O  O     . HOH Q 8 .   ? -13.580 15.969  -27.891 1.00 44.12  ? 313  HOH A O     1 
HETATM 8332 O  O     . HOH Q 8 .   ? 3.165   32.370  -12.860 1.00 40.51  ? 314  HOH A O     1 
HETATM 8333 O  O     . HOH Q 8 .   ? -15.406 4.994   -5.814  1.00 53.74  ? 315  HOH A O     1 
HETATM 8334 O  O     . HOH Q 8 .   ? -15.829 -24.944 3.860   1.00 43.72  ? 316  HOH A O     1 
HETATM 8335 O  O     . HOH Q 8 .   ? 1.201   -14.306 1.580   1.00 35.47  ? 317  HOH A O     1 
HETATM 8336 O  O     . HOH Q 8 .   ? 2.682   -13.058 -0.388  1.00 43.71  ? 318  HOH A O     1 
HETATM 8337 O  O     . HOH Q 8 .   ? 11.766  16.205  -22.120 1.00 39.08  ? 320  HOH A O     1 
HETATM 8338 O  O     . HOH Q 8 .   ? -16.082 21.212  -18.664 1.00 40.95  ? 321  HOH A O     1 
HETATM 8339 O  O     . HOH Q 8 .   ? -1.826  -7.340  -0.418  1.00 46.48  ? 322  HOH A O     1 
HETATM 8340 O  O     . HOH Q 8 .   ? 9.567   -16.088 -21.204 1.00 49.49  ? 323  HOH A O     1 
HETATM 8341 O  O     . HOH Q 8 .   ? -1.964  23.625  -3.440  1.00 45.93  ? 324  HOH A O     1 
HETATM 8342 O  O     . HOH Q 8 .   ? 16.961  24.106  -13.504 1.00 52.58  ? 325  HOH A O     1 
HETATM 8343 O  O     . HOH Q 8 .   ? -15.878 -22.636 -19.926 1.00 39.12  ? 326  HOH A O     1 
HETATM 8344 O  O     . HOH Q 8 .   ? -19.430 10.994  -35.819 1.00 42.30  ? 327  HOH A O     1 
HETATM 8345 O  O     . HOH Q 8 .   ? 12.930  19.317  -18.877 1.00 46.36  ? 328  HOH A O     1 
HETATM 8346 O  O     . HOH Q 8 .   ? 0.541   2.586   -23.513 1.00 43.35  ? 329  HOH A O     1 
HETATM 8347 O  O     . HOH Q 8 .   ? -29.298 -7.940  5.712   1.00 42.82  ? 330  HOH A O     1 
HETATM 8348 O  O     . HOH Q 8 .   ? -11.515 -26.347 -3.210  1.00 44.45  ? 331  HOH A O     1 
HETATM 8349 O  O     . HOH Q 8 .   ? -1.341  -25.334 -20.170 1.00 50.69  ? 332  HOH A O     1 
HETATM 8350 O  O     . HOH Q 8 .   ? 5.703   6.226   11.635  1.00 51.63  ? 333  HOH A O     1 
HETATM 8351 O  O     . HOH Q 8 .   ? 6.723   -12.266 -7.203  1.00 47.30  ? 334  HOH A O     1 
HETATM 8352 O  O     . HOH Q 8 .   ? -11.948 15.080  -23.202 1.00 50.83  ? 335  HOH A O     1 
HETATM 8353 O  O     . HOH Q 8 .   ? -8.053  6.177   -26.024 1.00 45.24  ? 336  HOH A O     1 
HETATM 8354 O  O     . HOH Q 8 .   ? -33.948 -12.165 -24.651 1.00 48.90  ? 337  HOH A O     1 
HETATM 8355 O  O     . HOH Q 8 .   ? -35.576 -10.876 -24.275 1.00 48.85  ? 340  HOH A O     1 
HETATM 8356 O  O     . HOH Q 8 .   ? -2.672  4.099   8.531   1.00 48.50  ? 341  HOH A O     1 
HETATM 8357 O  O     . HOH Q 8 .   ? -8.688  0.588   -31.141 1.00 47.72  ? 342  HOH A O     1 
HETATM 8358 O  O     . HOH Q 8 .   ? -16.908 -3.894  3.576   1.00 45.60  ? 343  HOH A O     1 
HETATM 8359 O  O     . HOH Q 8 .   ? -3.705  29.733  -2.497  1.00 44.11  ? 344  HOH A O     1 
HETATM 8360 O  O     . HOH Q 8 .   ? -7.548  -23.368 -15.017 1.00 50.20  ? 345  HOH A O     1 
HETATM 8361 O  O     . HOH Q 8 .   ? 1.551   -18.980 -27.096 1.00 47.99  ? 346  HOH A O     1 
HETATM 8362 O  O     . HOH Q 8 .   ? -31.303 -14.827 -17.546 1.00 48.20  ? 347  HOH A O     1 
HETATM 8363 O  O     . HOH Q 8 .   ? 7.665   -6.176  -16.480 1.00 52.58  ? 348  HOH A O     1 
HETATM 8364 O  O     . HOH Q 8 .   ? -30.250 -16.603 1.263   1.00 54.07  ? 349  HOH A O     1 
HETATM 8365 O  O     . HOH Q 8 .   ? 4.729   20.161  16.018  1.00 47.73  ? 350  HOH A O     1 
HETATM 8366 O  O     . HOH Q 8 .   ? -14.141 -26.735 -10.751 1.00 52.54  ? 351  HOH A O     1 
HETATM 8367 O  O     . HOH Q 8 .   ? -2.203  1.756   4.487   1.00 33.31  ? 352  HOH A O     1 
HETATM 8368 O  O     . HOH Q 8 .   ? -32.822 1.792   -23.407 1.00 46.68  ? 353  HOH A O     1 
HETATM 8369 O  O     . HOH Q 8 .   ? -2.249  15.729  -10.814 1.00 48.82  ? 354  HOH A O     1 
HETATM 8370 O  O     . HOH Q 8 .   ? 2.449   1.187   -24.257 1.00 48.90  ? 355  HOH A O     1 
HETATM 8371 O  O     . HOH Q 8 .   ? -33.761 -28.767 -10.850 1.00 55.68  ? 356  HOH A O     1 
HETATM 8372 O  O     . HOH Q 8 .   ? -4.234  19.444  -9.138  1.00 44.80  ? 357  HOH A O     1 
HETATM 8373 O  O     . HOH Q 8 .   ? 12.386  11.056  -0.862  1.00 49.73  ? 358  HOH A O     1 
HETATM 8374 O  O     . HOH Q 8 .   ? 2.367   -26.642 -20.281 1.00 51.37  ? 359  HOH A O     1 
HETATM 8375 O  O     . HOH Q 8 .   ? -6.706  5.680   -24.584 1.00 50.72  ? 360  HOH A O     1 
HETATM 8376 O  O     . HOH Q 8 .   ? 11.862  33.294  -10.360 1.00 26.81  ? 361  HOH A O     1 
HETATM 8377 O  O     . HOH Q 8 .   ? -0.057  -11.052 -3.638  1.00 35.19  ? 362  HOH A O     1 
HETATM 8378 O  O     . HOH Q 8 .   ? -15.722 6.105   -12.175 1.00 50.93  ? 363  HOH A O     1 
HETATM 8379 O  O     . HOH Q 8 .   ? 2.085   -25.231 -17.343 1.00 47.26  ? 364  HOH A O     1 
HETATM 8380 O  O     . HOH Q 8 .   ? -14.519 19.519  -6.067  1.00 42.25  ? 365  HOH A O     1 
HETATM 8381 O  O     . HOH Q 8 .   ? -20.088 -7.008  -37.838 1.00 50.67  ? 366  HOH A O     1 
HETATM 8382 O  O     . HOH Q 8 .   ? -3.328  -18.731 4.664   1.00 48.81  ? 367  HOH A O     1 
HETATM 8383 O  O     . HOH Q 8 .   ? -12.856 -26.566 -5.973  1.00 47.82  ? 368  HOH A O     1 
HETATM 8384 O  O     . HOH Q 8 .   ? -1.940  25.251  -13.084 1.00 47.45  ? 369  HOH A O     1 
HETATM 8385 O  O     . HOH Q 8 .   ? 0.954   5.820   9.763   1.00 50.86  ? 370  HOH A O     1 
HETATM 8386 O  O     . HOH Q 8 .   ? -8.967  -25.373 3.304   1.00 54.77  ? 371  HOH A O     1 
HETATM 8387 O  O     . HOH Q 8 .   ? 10.240  -2.279  -13.087 1.00 49.99  ? 372  HOH A O     1 
HETATM 8388 O  O     . HOH Q 8 .   ? 8.793   15.754  -25.360 1.00 51.31  ? 373  HOH A O     1 
HETATM 8389 O  O     . HOH Q 8 .   ? -29.241 -7.186  -12.716 1.00 36.23  ? 374  HOH A O     1 
HETATM 8390 O  O     . HOH Q 8 .   ? 4.970   -25.236 -18.358 1.00 48.51  ? 375  HOH A O     1 
HETATM 8391 O  O     . HOH Q 8 .   ? 17.191  31.370  -14.808 1.00 42.25  ? 376  HOH A O     1 
HETATM 8392 O  O     . HOH Q 8 .   ? -14.970 4.702   -10.779 1.00 50.84  ? 377  HOH A O     1 
HETATM 8393 O  O     . HOH Q 8 .   ? -7.654  -16.702 9.461   1.00 40.47  ? 378  HOH A O     1 
HETATM 8394 O  O     . HOH Q 8 .   ? 15.180  28.856  -2.444  1.00 48.37  ? 379  HOH A O     1 
HETATM 8395 O  O     . HOH Q 8 .   ? -5.820  -9.802  11.546  1.00 53.59  ? 380  HOH A O     1 
HETATM 8396 O  O     . HOH Q 8 .   ? -18.581 15.159  -2.885  1.00 52.26  ? 381  HOH A O     1 
HETATM 8397 O  O     . HOH Q 8 .   ? -19.460 19.486  -8.870  1.00 50.76  ? 382  HOH A O     1 
HETATM 8398 O  O     . HOH Q 8 .   ? -7.249  -23.119 -20.417 1.00 42.32  ? 383  HOH A O     1 
HETATM 8399 O  O     . HOH Q 8 .   ? -19.787 -23.706 -16.761 1.00 54.22  ? 384  HOH A O     1 
HETATM 8400 O  O     . HOH Q 8 .   ? 9.465   -11.480 -18.250 1.00 47.59  ? 385  HOH A O     1 
HETATM 8401 O  O     . HOH Q 8 .   ? 10.002  21.185  12.724  1.00 52.97  ? 386  HOH A O     1 
HETATM 8402 O  O     . HOH Q 8 .   ? -0.250  1.739   -30.324 1.00 49.33  ? 387  HOH A O     1 
HETATM 8403 O  O     . HOH Q 8 .   ? -9.066  -23.761 -19.713 1.00 50.19  ? 388  HOH A O     1 
HETATM 8404 O  O     . HOH Q 8 .   ? -8.909  -5.686  -0.656  1.00 19.54  ? 1404 HOH A O     1 
HETATM 8405 O  O     . HOH Q 8 .   ? -5.516  -4.383  -23.574 1.00 17.22  ? 1405 HOH A O     1 
HETATM 8406 O  O     . HOH Q 8 .   ? -10.067 14.496  -7.865  1.00 18.18  ? 1406 HOH A O     1 
HETATM 8407 O  O     . HOH Q 8 .   ? -10.852 13.680  -4.685  1.00 20.89  ? 1407 HOH A O     1 
HETATM 8408 O  O     . HOH Q 8 .   ? -9.776  1.661   -24.337 1.00 20.04  ? 1408 HOH A O     1 
HETATM 8409 O  O     . HOH Q 8 .   ? -17.194 -6.998  0.433   1.00 26.57  ? 1409 HOH A O     1 
HETATM 8410 O  O     . HOH Q 8 .   ? -16.638 9.909   -26.348 1.00 19.31  ? 1410 HOH A O     1 
HETATM 8411 O  O     . HOH Q 8 .   ? -23.874 -2.590  -8.460  1.00 21.84  ? 1411 HOH A O     1 
HETATM 8412 O  O     . HOH Q 8 .   ? 0.792   -2.366  -4.967  1.00 20.70  ? 1412 HOH A O     1 
HETATM 8413 O  O     . HOH R 8 .   ? -7.825  1.855   2.317   1.00 27.05  ? 69   HOH B O     1 
HETATM 8414 O  O     . HOH R 8 .   ? -16.159 1.624   0.740   1.00 31.99  ? 111  HOH B O     1 
HETATM 8415 O  O     . HOH R 8 .   ? -9.468  8.294   2.203   1.00 28.29  ? 128  HOH B O     1 
HETATM 8416 O  O     . HOH R 8 .   ? -10.921 14.488  8.121   1.00 32.83  ? 139  HOH B O     1 
HETATM 8417 O  O     . HOH R 8 .   ? -15.091 2.597   -6.625  1.00 33.71  ? 170  HOH B O     1 
HETATM 8418 O  O     . HOH R 8 .   ? -7.245  5.600   2.934   1.00 27.67  ? 172  HOH B O     1 
HETATM 8419 O  O     . HOH R 8 .   ? -7.652  0.507   4.660   1.00 38.30  ? 173  HOH B O     1 
HETATM 8420 O  O     . HOH R 8 .   ? -14.991 7.008   -2.436  1.00 42.73  ? 193  HOH B O     1 
HETATM 8421 O  O     . HOH R 8 .   ? -20.493 2.232   -3.613  1.00 37.83  ? 204  HOH B O     1 
HETATM 8422 O  O     . HOH R 8 .   ? -15.811 2.853   -1.537  1.00 34.60  ? 221  HOH B O     1 
HETATM 8423 O  O     . HOH R 8 .   ? 0.048   18.572  15.255  1.00 39.01  ? 271  HOH B O     1 
HETATM 8424 O  O     . HOH R 8 .   ? -3.691  11.501  12.740  1.00 45.43  ? 282  HOH B O     1 
HETATM 8425 O  O     . HOH R 8 .   ? 0.542   19.462  17.534  1.00 47.13  ? 294  HOH B O     1 
HETATM 8426 O  O     . HOH R 8 .   ? -11.354 8.624   11.579  1.00 46.97  ? 305  HOH B O     1 
HETATM 8427 O  O     . HOH R 8 .   ? -7.535  6.170   5.666   1.00 47.48  ? 309  HOH B O     1 
HETATM 8428 O  O     . HOH R 8 .   ? -13.359 5.425   -0.666  1.00 31.06  ? 319  HOH B O     1 
HETATM 8429 O  O     . HOH R 8 .   ? -27.192 5.227   -7.792  1.00 49.84  ? 338  HOH B O     1 
HETATM 8430 O  O     . HOH R 8 .   ? -6.698  -1.784  5.194   1.00 43.64  ? 339  HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 16  ? 1.0366 0.9435 0.8954 -0.0001 -0.0064 0.0819  886  SER A N   
2    C CA  . SER A 16  ? 1.0202 0.9303 0.8775 -0.0059 -0.0105 0.0742  886  SER A CA  
3    C C   . SER A 16  ? 0.9375 0.8494 0.7969 -0.0091 -0.0091 0.0706  886  SER A C   
4    O O   . SER A 16  ? 0.9167 0.8307 0.7824 -0.0154 -0.0073 0.0730  886  SER A O   
5    C CB  . SER A 16  ? 1.0431 0.9566 0.9039 -0.0155 -0.0137 0.0746  886  SER A CB  
6    O OG  . SER A 16  ? 1.0716 0.9889 0.9391 -0.0232 -0.0126 0.0774  886  SER A OG  
11   N N   . VAL A 17  ? 0.7380 0.6497 0.5924 -0.0047 -0.0099 0.0646  887  VAL A N   
12   C CA  . VAL A 17  ? 0.5869 0.4993 0.4423 -0.0055 -0.0077 0.0617  887  VAL A CA  
13   C C   . VAL A 17  ? 0.5709 0.4876 0.4275 -0.0145 -0.0114 0.0548  887  VAL A C   
14   O O   . VAL A 17  ? 0.5285 0.4468 0.3815 -0.0149 -0.0154 0.0492  887  VAL A O   
15   C CB  . VAL A 17  ? 0.5400 0.4499 0.3890 0.0063  -0.0054 0.0601  887  VAL A CB  
16   C CG1 . VAL A 17  ? 0.4609 0.3716 0.3108 0.0054  -0.0029 0.0570  887  VAL A CG1 
17   C CG2 . VAL A 17  ? 0.5346 0.4400 0.3827 0.0157  -0.0007 0.0676  887  VAL A CG2 
27   N N   . SER A 18  ? 0.4103 0.3290 0.2724 -0.0218 -0.0099 0.0549  888  SER A N   
28   C CA  . SER A 18  ? 0.4762 0.3989 0.3395 -0.0300 -0.0127 0.0486  888  SER A CA  
29   C C   . SER A 18  ? 0.4667 0.3885 0.3271 -0.0255 -0.0106 0.0443  888  SER A C   
30   O O   . SER A 18  ? 0.4567 0.3756 0.3185 -0.0210 -0.0055 0.0475  888  SER A O   
31   C CB  . SER A 18  ? 0.6195 0.5458 0.4903 -0.0402 -0.0122 0.0505  888  SER A CB  
32   O OG  . SER A 18  ? 0.8540 0.7840 0.7257 -0.0476 -0.0143 0.0446  888  SER A OG  
38   N N   . ILE A 19  ? 0.3921 0.3163 0.2489 -0.0264 -0.0141 0.0373  889  ILE A N   
39   C CA  . ILE A 19  ? 0.3284 0.2526 0.1821 -0.0220 -0.0124 0.0330  889  ILE A CA  
40   C C   . ILE A 19  ? 0.3739 0.3016 0.2310 -0.0318 -0.0139 0.0282  889  ILE A C   
41   O O   . ILE A 19  ? 0.3524 0.2806 0.2076 -0.0299 -0.0127 0.0242  889  ILE A O   
42   C CB  . ILE A 19  ? 0.3423 0.2674 0.1888 -0.0136 -0.0150 0.0278  889  ILE A CB  
43   C CG1 . ILE A 19  ? 0.3492 0.2779 0.1955 -0.0198 -0.0207 0.0218  889  ILE A CG1 
44   C CG2 . ILE A 19  ? 0.3366 0.2585 0.1791 -0.0026 -0.0133 0.0323  889  ILE A CG2 
45   C CD1 . ILE A 19  ? 0.3781 0.3091 0.2185 -0.0122 -0.0233 0.0149  889  ILE A CD1 
57   N N   . TYR A 20  ? 0.3643 0.2947 0.2260 -0.0419 -0.0163 0.0287  890  TYR A N   
58   C CA  . TYR A 20  ? 0.3268 0.2611 0.1913 -0.0513 -0.0180 0.0241  890  TYR A CA  
59   C C   . TYR A 20  ? 0.3746 0.3101 0.2460 -0.0581 -0.0152 0.0275  890  TYR A C   
60   O O   . TYR A 20  ? 0.3874 0.3225 0.2623 -0.0588 -0.0141 0.0330  890  TYR A O   
61   C CB  . TYR A 20  ? 0.3412 0.2788 0.2051 -0.0575 -0.0231 0.0209  890  TYR A CB  
62   C CG  . TYR A 20  ? 0.3566 0.2938 0.2150 -0.0520 -0.0257 0.0155  890  TYR A CG  
63   C CD1 . TYR A 20  ? 0.3344 0.2730 0.1901 -0.0500 -0.0261 0.0092  890  TYR A CD1 
64   C CD2 . TYR A 20  ? 0.3411 0.2770 0.1975 -0.0488 -0.0276 0.0165  890  TYR A CD2 
65   C CE1 . TYR A 20  ? 0.3601 0.2998 0.2116 -0.0449 -0.0287 0.0034  890  TYR A CE1 
66   C CE2 . TYR A 20  ? 0.3522 0.2887 0.2047 -0.0440 -0.0299 0.0105  890  TYR A CE2 
67   C CZ  . TYR A 20  ? 0.4359 0.3747 0.2861 -0.0421 -0.0306 0.0037  890  TYR A CZ  
68   O OH  . TYR A 20  ? 0.3807 0.3214 0.2276 -0.0373 -0.0331 -0.0031 890  TYR A OH  
78   N N   . PRO A 21  ? 0.3751 0.3124 0.2490 -0.0631 -0.0141 0.0237  891  PRO A N   
79   C CA  . PRO A 21  ? 0.3490 0.2884 0.2304 -0.0702 -0.0115 0.0255  891  PRO A CA  
80   C C   . PRO A 21  ? 0.3662 0.3116 0.2507 -0.0794 -0.0156 0.0258  891  PRO A C   
81   O O   . PRO A 21  ? 0.3644 0.3117 0.2453 -0.0813 -0.0200 0.0236  891  PRO A O   
82   C CB  . PRO A 21  ? 0.3627 0.3027 0.2450 -0.0729 -0.0097 0.0203  891  PRO A CB  
83   C CG  . PRO A 21  ? 0.3586 0.2997 0.2346 -0.0719 -0.0139 0.0150  891  PRO A CG  
84   C CD  . PRO A 21  ? 0.3580 0.2962 0.2285 -0.0628 -0.0151 0.0172  891  PRO A CD  
92   N N   . SER A 22  ? 0.3897 0.3384 0.2812 -0.0847 -0.0139 0.0284  892  SER A N   
93   C CA  . SER A 22  ? 0.3949 0.3508 0.2892 -0.0930 -0.0176 0.0285  892  SER A CA  
94   C C   . SER A 22  ? 0.3640 0.3246 0.2586 -0.1005 -0.0198 0.0225  892  SER A C   
95   O O   . SER A 22  ? 0.3470 0.3056 0.2414 -0.1003 -0.0178 0.0183  892  SER A O   
96   C CB  . SER A 22  ? 0.4550 0.4145 0.3572 -0.0962 -0.0150 0.0321  892  SER A CB  
97   O OG  . SER A 22  ? 0.3832 0.3432 0.2910 -0.0994 -0.0112 0.0288  892  SER A OG  
103  N N   . SER A 23  ? 0.3482 0.3152 0.2431 -0.1068 -0.0237 0.0222  893  SER A N   
104  C CA  . SER A 23  ? 0.3459 0.3179 0.2408 -0.1139 -0.0259 0.0169  893  SER A CA  
105  C C   . SER A 23  ? 0.4027 0.3779 0.3040 -0.1187 -0.0231 0.0140  893  SER A C   
106  O O   . SER A 23  ? 0.3711 0.3467 0.2720 -0.1217 -0.0229 0.0087  893  SER A O   
107  C CB  . SER A 23  ? 0.3541 0.3328 0.2485 -0.1191 -0.0298 0.0184  893  SER A CB  
108  O OG  . SER A 23  ? 0.3794 0.3647 0.2795 -0.1223 -0.0294 0.0216  893  SER A OG  
114  N N   . ALA A 24  ? 0.3725 0.3498 0.2800 -0.1193 -0.0206 0.0171  894  ALA A N   
115  C CA  . ALA A 24  ? 0.4803 0.4608 0.3954 -0.1240 -0.0173 0.0139  894  ALA A CA  
116  C C   . ALA A 24  ? 0.4642 0.4367 0.3792 -0.1198 -0.0124 0.0116  894  ALA A C   
117  O O   . ALA A 24  ? 0.4102 0.3839 0.3282 -0.1241 -0.0105 0.0066  894  ALA A O   
118  C CB  . ALA A 24  ? 0.5163 0.5006 0.4391 -0.1249 -0.0151 0.0176  894  ALA A CB  
124  N N   . GLU A 25  ? 0.4057 0.3701 0.3168 -0.1109 -0.0101 0.0153  895  GLU A N   
125  C CA  . GLU A 25  ? 0.4260 0.3828 0.3356 -0.1051 -0.0053 0.0140  895  GLU A CA  
126  C C   . GLU A 25  ? 0.4006 0.3569 0.3041 -0.1056 -0.0077 0.0087  895  GLU A C   
127  O O   . GLU A 25  ? 0.4123 0.3659 0.3166 -0.1051 -0.0042 0.0054  895  GLU A O   
128  C CB  . GLU A 25  ? 0.4279 0.3773 0.3336 -0.0945 -0.0028 0.0193  895  GLU A CB  
129  C CG  . GLU A 25  ? 0.5292 0.4774 0.4417 -0.0930 0.0016  0.0245  895  GLU A CG  
130  C CD  . GLU A 25  ? 0.5865 0.5286 0.4946 -0.0829 0.0030  0.0304  895  GLU A CD  
131  O OE1 . GLU A 25  ? 0.4902 0.4307 0.3902 -0.0781 -0.0008 0.0306  895  GLU A OE1 
132  O OE2 . GLU A 25  ? 0.5998 0.5388 0.5130 -0.0798 0.0082  0.0348  895  GLU A OE2 
139  N N   . VAL A 26  ? 0.3660 0.3247 0.2637 -0.1063 -0.0134 0.0078  896  VAL A N   
140  C CA  . VAL A 26  ? 0.3948 0.3537 0.2875 -0.1073 -0.0159 0.0025  896  VAL A CA  
141  C C   . VAL A 26  ? 0.4265 0.3906 0.3234 -0.1161 -0.0160 -0.0023 896  VAL A C   
142  O O   . VAL A 26  ? 0.3925 0.3549 0.2884 -0.1162 -0.0143 -0.0066 896  VAL A O   
143  C CB  . VAL A 26  ? 0.3602 0.3212 0.2478 -0.1076 -0.0215 0.0023  896  VAL A CB  
144  C CG1 . VAL A 26  ? 0.4467 0.4086 0.3303 -0.1094 -0.0238 -0.0037 896  VAL A CG1 
145  C CG2 . VAL A 26  ? 0.4396 0.3956 0.3232 -0.0988 -0.0214 0.0063  896  VAL A CG2 
155  N N   . LEU A 27  ? 0.3752 0.3461 0.2766 -0.1232 -0.0179 -0.0017 897  LEU A N   
156  C CA  . LEU A 27  ? 0.5153 0.4925 0.4205 -0.1318 -0.0185 -0.0065 897  LEU A CA  
157  C C   . LEU A 27  ? 0.5249 0.4997 0.4361 -0.1325 -0.0127 -0.0090 897  LEU A C   
158  O O   . LEU A 27  ? 0.4364 0.4115 0.3476 -0.1358 -0.0118 -0.0141 897  LEU A O   
159  C CB  . LEU A 27  ? 0.6151 0.6013 0.5241 -0.1380 -0.0215 -0.0050 897  LEU A CB  
160  C CG  . LEU A 27  ? 0.8013 0.7958 0.7138 -0.1468 -0.0228 -0.0102 897  LEU A CG  
161  C CD1 . LEU A 27  ? 0.9383 0.9329 0.8450 -0.1487 -0.0255 -0.0144 897  LEU A CD1 
162  C CD2 . LEU A 27  ? 0.8097 0.8141 0.7251 -0.1513 -0.0259 -0.0081 897  LEU A CD2 
174  N N   . LYS A 28  ? 0.4547 0.4262 0.3709 -0.1293 -0.0081 -0.0054 898  LYS A N   
175  C CA  . LYS A 28  ? 0.5083 0.4768 0.4314 -0.1300 -0.0014 -0.0075 898  LYS A CA  
176  C C   . LYS A 28  ? 0.5972 0.5575 0.5152 -0.1235 0.0020  -0.0088 898  LYS A C   
177  O O   . LYS A 28  ? 0.5322 0.4906 0.4537 -0.1255 0.0064  -0.0124 898  LYS A O   
178  C CB  . LYS A 28  ? 0.6829 0.6497 0.6136 -0.1282 0.0034  -0.0033 898  LYS A CB  
179  C CG  . LYS A 28  ? 1.0851 1.0459 1.0116 -0.1190 0.0041  0.0035  898  LYS A CG  
180  C CD  . LYS A 28  ? 1.3242 1.2833 1.2594 -0.1176 0.0097  0.0074  898  LYS A CD  
181  C CE  . LYS A 28  ? 1.0269 0.9767 0.9577 -0.1064 0.0134  0.0135  898  LYS A CE  
182  N NZ  . LYS A 28  ? 0.8813 0.8309 0.8178 -0.1046 0.0158  0.0189  898  LYS A NZ  
196  N N   . ALA A 29  ? 0.6012 0.5572 0.5111 -0.1157 0.0000  -0.0061 899  ALA A N   
197  C CA  . ALA A 29  ? 0.5510 0.5012 0.4552 -0.1089 0.0024  -0.0077 899  ALA A CA  
198  C C   . ALA A 29  ? 0.5640 0.5177 0.4661 -0.1146 -0.0004 -0.0141 899  ALA A C   
199  O O   . ALA A 29  ? 0.5999 0.5503 0.5018 -0.1128 0.0035  -0.0168 899  ALA A O   
200  C CB  . ALA A 29  ? 0.5015 0.4484 0.3976 -0.0997 -0.0002 -0.0046 899  ALA A CB  
206  N N   . CYS A 30  ? 0.4654 0.4257 0.3659 -0.1210 -0.0068 -0.0161 900  CYS A N   
207  C CA  . CYS A 30  ? 0.5200 0.4839 0.4183 -0.1263 -0.0096 -0.0219 900  CYS A CA  
208  C C   . CYS A 30  ? 0.7459 0.7127 0.6507 -0.1339 -0.0067 -0.0259 900  CYS A C   
209  O O   . CYS A 30  ? 0.8577 0.8257 0.7612 -0.1371 -0.0071 -0.0308 900  CYS A O   
210  C CB  . CYS A 30  ? 0.3867 0.3564 0.2817 -0.1308 -0.0164 -0.0225 900  CYS A CB  
211  S SG  . CYS A 30  ? 0.5499 0.5164 0.4376 -0.1227 -0.0198 -0.0197 900  CYS A SG  
217  N N   . ARG A 31  ? 0.7683 0.7366 0.6808 -0.1370 -0.0037 -0.0243 901  ARG A N   
218  C CA  . ARG A 31  ? 0.9765 0.9494 0.8965 -0.1452 -0.0015 -0.0290 901  ARG A CA  
219  C C   . ARG A 31  ? 1.2209 1.1874 1.1435 -0.1433 0.0055  -0.0317 901  ARG A C   
220  O O   . ARG A 31  ? 1.2942 1.2638 1.2218 -0.1500 0.0073  -0.0369 901  ARG A O   
221  C CB  . ARG A 31  ? 0.9811 0.9590 0.9094 -0.1494 -0.0007 -0.0273 901  ARG A CB  
222  C CG  . ARG A 31  ? 1.0427 1.0299 0.9693 -0.1539 -0.0077 -0.0263 901  ARG A CG  
223  C CD  . ARG A 31  ? 1.1926 1.1863 1.1277 -0.1578 -0.0071 -0.0250 901  ARG A CD  
224  N NE  . ARG A 31  ? 1.2558 1.2605 1.1899 -0.1634 -0.0134 -0.0257 901  ARG A NE  
225  C CZ  . ARG A 31  ? 1.2951 1.3041 1.2285 -0.1623 -0.0166 -0.0209 901  ARG A CZ  
226  N NH1 . ARG A 31  ? 1.2702 1.2733 1.2040 -0.1560 -0.0144 -0.0152 901  ARG A NH1 
227  N NH2 . ARG A 31  ? 1.2714 1.2908 1.2035 -0.1670 -0.0217 -0.0215 901  ARG A NH2 
241  N N   . ASN A 32  ? 1.3527 1.3107 1.2717 -0.1338 0.0096  -0.0283 902  ASN A N   
242  C CA  . ASN A 32  ? 1.4277 1.3793 1.3460 -0.1302 0.0156  -0.0304 902  ASN A CA  
243  C C   . ASN A 32  ? 1.3873 1.3380 1.2958 -0.1254 0.0118  -0.0318 902  ASN A C   
244  O O   . ASN A 32  ? 1.3357 1.2866 1.2429 -0.1275 0.0125  -0.0363 902  ASN A O   
245  C CB  . ASN A 32  ? 1.4647 1.4076 1.3861 -0.1220 0.0241  -0.0258 902  ASN A CB  
246  C CG  . ASN A 32  ? 1.5235 1.4648 1.4435 -0.1161 0.0231  -0.0194 902  ASN A CG  
247  O OD1 . ASN A 32  ? 1.5431 1.4879 1.4693 -0.1207 0.0225  -0.0179 902  ASN A OD1 
248  N ND2 . ASN A 32  ? 1.4940 1.4305 1.4059 -0.1057 0.0230  -0.0158 902  ASN A ND2 
255  N N   . ASN A 40  ? 0.9927 0.8938 0.9020 -0.0638 0.0615  -0.0007 910  ASN A N   
256  C CA  . ASN A 40  ? 1.0558 0.9567 0.9655 -0.0606 0.0599  0.0046  910  ASN A CA  
257  C C   . ASN A 40  ? 0.7236 0.6285 0.6220 -0.0539 0.0514  0.0057  910  ASN A C   
258  O O   . ASN A 40  ? 0.5028 0.4110 0.3937 -0.0522 0.0466  0.0019  910  ASN A O   
259  C CB  . ASN A 40  ? 1.1239 1.0295 1.0433 -0.0732 0.0570  0.0027  910  ASN A CB  
260  C CG  . ASN A 40  ? 1.1670 1.0817 1.0851 -0.0838 0.0473  -0.0038 910  ASN A CG  
261  O OD1 . ASN A 40  ? 1.2128 1.1310 1.1218 -0.0815 0.0402  -0.0054 910  ASN A OD1 
262  N ND2 . ASN A 40  ? 1.0505 0.9693 0.9780 -0.0954 0.0473  -0.0079 910  ASN A ND2 
268  N N   . SER A 41  ? 0.5811 0.4857 0.4788 -0.0506 0.0496  0.0104  911  SER A N   
269  C CA  . SER A 41  ? 0.5785 0.4852 0.4660 -0.0416 0.0438  0.0122  911  SER A CA  
270  C C   . SER A 41  ? 0.5374 0.4521 0.4210 -0.0486 0.0327  0.0071  911  SER A C   
271  O O   . SER A 41  ? 0.4806 0.3996 0.3697 -0.0602 0.0289  0.0042  911  SER A O   
272  C CB  . SER A 41  ? 0.4721 0.3751 0.3603 -0.0351 0.0465  0.0193  911  SER A CB  
273  O OG  . SER A 41  ? 0.4199 0.3252 0.3165 -0.0450 0.0446  0.0199  911  SER A OG  
279  N N   . SER A 42  ? 0.4842 0.4012 0.3583 -0.0410 0.0279  0.0061  912  SER A N   
280  C CA  . SER A 42  ? 0.6198 0.5437 0.4902 -0.0463 0.0182  0.0013  912  SER A CA  
281  C C   . SER A 42  ? 0.5967 0.5217 0.4668 -0.0462 0.0141  0.0047  912  SER A C   
282  O O   . SER A 42  ? 0.6187 0.5395 0.4885 -0.0386 0.0180  0.0104  912  SER A O   
283  C CB  . SER A 42  ? 0.7693 0.6956 0.6307 -0.0377 0.0155  -0.0022 912  SER A CB  
284  O OG  . SER A 42  ? 0.7248 0.6485 0.5849 -0.0329 0.0214  -0.0031 912  SER A OG  
290  N N   . ILE A 43  ? 0.4016 0.3319 0.2718 -0.0541 0.0067  0.0016  913  ILE A N   
291  C CA  . ILE A 43  ? 0.4095 0.3405 0.2787 -0.0528 0.0031  0.0050  913  ILE A CA  
292  C C   . ILE A 43  ? 0.4408 0.3739 0.3020 -0.0459 -0.0018 0.0024  913  ILE A C   
293  O O   . ILE A 43  ? 0.4121 0.3439 0.2705 -0.0394 -0.0025 0.0058  913  ILE A O   
294  C CB  . ILE A 43  ? 0.6132 0.5482 0.4878 -0.0645 -0.0011 0.0050  913  ILE A CB  
295  C CG1 . ILE A 43  ? 0.7101 0.6506 0.5831 -0.0720 -0.0072 -0.0012 913  ILE A CG1 
296  C CG2 . ILE A 43  ? 0.6220 0.5561 0.5053 -0.0709 0.0037  0.0070  913  ILE A CG2 
297  C CD1 . ILE A 43  ? 0.7217 0.6663 0.5980 -0.0808 -0.0117 -0.0004 913  ILE A CD1 
309  N N   . LEU A 44  ? 0.3742 0.3110 0.2322 -0.0473 -0.0051 -0.0040 914  LEU A N   
310  C CA  . LEU A 44  ? 0.4641 0.4037 0.3152 -0.0398 -0.0090 -0.0077 914  LEU A CA  
311  C C   . LEU A 44  ? 0.4527 0.3956 0.3004 -0.0382 -0.0100 -0.0142 914  LEU A C   
312  O O   . LEU A 44  ? 0.4932 0.4367 0.3439 -0.0450 -0.0088 -0.0166 914  LEU A O   
313  C CB  . LEU A 44  ? 0.6243 0.5667 0.4754 -0.0441 -0.0151 -0.0090 914  LEU A CB  
314  C CG  . LEU A 44  ? 0.7210 0.6668 0.5758 -0.0565 -0.0196 -0.0121 914  LEU A CG  
315  C CD1 . LEU A 44  ? 0.6970 0.6443 0.5550 -0.0642 -0.0185 -0.0151 914  LEU A CD1 
316  C CD2 . LEU A 44  ? 0.7336 0.6831 0.5853 -0.0558 -0.0249 -0.0177 914  LEU A CD2 
328  N N   . LEU A 45  ? 0.5081 0.4539 0.3497 -0.0288 -0.0119 -0.0173 915  LEU A N   
329  C CA  . LEU A 45  ? 0.6976 0.6473 0.5354 -0.0249 -0.0125 -0.0233 915  LEU A CA  
330  C C   . LEU A 45  ? 0.9375 0.8915 0.7781 -0.0359 -0.0168 -0.0299 915  LEU A C   
331  O O   . LEU A 45  ? 1.0248 0.9791 0.8661 -0.0384 -0.0147 -0.0321 915  LEU A O   
332  C CB  . LEU A 45  ? 0.6452 0.5990 0.4764 -0.0130 -0.0148 -0.0262 915  LEU A CB  
333  C CG  . LEU A 45  ? 0.6301 0.5896 0.4565 -0.0060 -0.0153 -0.0323 915  LEU A CG  
334  C CD1 . LEU A 45  ? 0.5987 0.5554 0.4257 -0.0060 -0.0097 -0.0305 915  LEU A CD1 
335  C CD2 . LEU A 45  ? 0.6302 0.5925 0.4497 0.0088  -0.0151 -0.0321 915  LEU A CD2 
347  N N   . ASP A 46  ? 1.0119 0.9688 0.8540 -0.0421 -0.0223 -0.0330 916  ASP A N   
348  C CA  . ASP A 46  ? 1.2522 1.2124 1.0975 -0.0531 -0.0259 -0.0382 916  ASP A CA  
349  C C   . ASP A 46  ? 1.3849 1.3508 1.2272 -0.0503 -0.0289 -0.0464 916  ASP A C   
350  O O   . ASP A 46  ? 1.3853 1.3548 1.2299 -0.0575 -0.0328 -0.0517 916  ASP A O   
351  C CB  . ASP A 46  ? 1.2786 1.2365 1.1281 -0.0614 -0.0228 -0.0362 916  ASP A CB  
352  C CG  . ASP A 46  ? 1.3341 1.2953 1.1832 -0.0648 -0.0233 -0.0422 916  ASP A CG  
353  O OD1 . ASP A 46  ? 1.3007 1.2648 1.1457 -0.0574 -0.0237 -0.0464 916  ASP A OD1 
354  O OD2 . ASP A 46  ? 1.3906 1.3520 1.2436 -0.0746 -0.0234 -0.0429 916  ASP A OD2 
359  N N   . LYS A 47  ? 1.4680 1.4353 1.3056 -0.0392 -0.0268 -0.0473 917  LYS A N   
360  C CA  . LYS A 47  ? 1.3946 1.3688 1.2292 -0.0346 -0.0295 -0.0552 917  LYS A CA  
361  C C   . LYS A 47  ? 1.3695 1.3470 1.2012 -0.0267 -0.0325 -0.0574 917  LYS A C   
362  O O   . LYS A 47  ? 1.4576 1.4319 1.2871 -0.0197 -0.0304 -0.0519 917  LYS A O   
363  C CB  . LYS A 47  ? 1.2789 1.2533 1.1096 -0.0264 -0.0250 -0.0545 917  LYS A CB  
364  C CG  . LYS A 47  ? 1.2153 1.1978 1.0425 -0.0205 -0.0273 -0.0625 917  LYS A CG  
365  C CD  . LYS A 47  ? 1.2494 1.2368 1.0805 -0.0306 -0.0324 -0.0703 917  LYS A CD  
366  C CE  . LYS A 47  ? 1.2737 1.2705 1.1019 -0.0237 -0.0356 -0.0790 917  LYS A CE  
367  N NZ  . LYS A 47  ? 1.2833 1.2821 1.1057 -0.0120 -0.0317 -0.0778 917  LYS A NZ  
381  N N   . CYS A 48  ? 1.1704 1.1545 1.0028 -0.0279 -0.0372 -0.0658 918  CYS A N   
382  C CA  . CYS A 48  ? 0.9772 0.9641 0.8091 -0.0239 -0.0405 -0.0688 918  CYS A CA  
383  C C   . CYS A 48  ? 0.8130 0.8095 0.6437 -0.0191 -0.0442 -0.0793 918  CYS A C   
384  O O   . CYS A 48  ? 0.8667 0.8670 0.7000 -0.0250 -0.0458 -0.0853 918  CYS A O   
385  C CB  . CYS A 48  ? 0.9814 0.9649 0.8189 -0.0350 -0.0426 -0.0678 918  CYS A CB  
386  S SG  . CYS A 48  ? 1.3177 1.2919 1.1565 -0.0385 -0.0392 -0.0560 918  CYS A SG  
392  N N   . PRO A 49  ? 0.8763 0.5358 0.6553 -0.0314 0.0069  0.0242  919  PRO A N   
393  C CA  . PRO A 49  ? 0.9769 0.6406 0.7593 -0.0177 0.0012  0.0269  919  PRO A CA  
394  C C   . PRO A 49  ? 0.9268 0.6184 0.7311 -0.0097 0.0002  0.0224  919  PRO A C   
395  O O   . PRO A 49  ? 0.8491 0.5632 0.6668 -0.0159 0.0038  0.0201  919  PRO A O   
396  C CB  . PRO A 49  ? 0.8907 0.5580 0.6684 -0.0229 0.0021  0.0321  919  PRO A CB  
397  C CG  . PRO A 49  ? 0.8022 0.4771 0.5819 -0.0383 0.0093  0.0306  919  PRO A CG  
398  C CD  . PRO A 49  ? 0.8095 0.4690 0.5825 -0.0442 0.0115  0.0273  919  PRO A CD  
406  N N   . PRO A 50  ? 0.9887 0.6786 0.7966 0.0038  -0.0045 0.0211  920  PRO A N   
407  C CA  . PRO A 50  ? 0.9568 0.6723 0.7844 0.0112  -0.0050 0.0170  920  PRO A CA  
408  C C   . PRO A 50  ? 0.7810 0.5191 0.6198 0.0120  -0.0057 0.0193  920  PRO A C   
409  O O   . PRO A 50  ? 0.7135 0.4456 0.5456 0.0148  -0.0091 0.0240  920  PRO A O   
410  C CB  . PRO A 50  ? 1.0401 0.7456 0.8668 0.0256  -0.0099 0.0158  920  PRO A CB  
411  C CG  . PRO A 50  ? 1.1250 0.8024 0.9323 0.0274  -0.0139 0.0213  920  PRO A CG  
412  C CD  . PRO A 50  ? 1.0966 0.7597 0.8903 0.0127  -0.0092 0.0229  920  PRO A CD  
420  N N   . PRO A 51  ? 0.7212 0.4841 0.5760 0.0097  -0.0028 0.0160  921  PRO A N   
421  C CA  . PRO A 51  ? 0.6584 0.4428 0.5247 0.0111  -0.0034 0.0175  921  PRO A CA  
422  C C   . PRO A 51  ? 0.6987 0.4837 0.5671 0.0233  -0.0091 0.0191  921  PRO A C   
423  O O   . PRO A 51  ? 0.6702 0.4483 0.5389 0.0321  -0.0117 0.0168  921  PRO A O   
424  C CB  . PRO A 51  ? 0.6223 0.4284 0.5041 0.0097  -0.0004 0.0128  921  PRO A CB  
425  C CG  . PRO A 51  ? 0.5858 0.3824 0.4653 0.0127  -0.0001 0.0086  921  PRO A CG  
426  C CD  . PRO A 51  ? 0.6706 0.4414 0.5332 0.0080  0.0000  0.0104  921  PRO A CD  
434  N N   . ARG A 52  ? 0.6192 0.4126 0.4893 0.0238  -0.0112 0.0225  922  ARG A N   
435  C CA  . ARG A 52  ? 0.5495 0.3441 0.4214 0.0344  -0.0175 0.0243  922  ARG A CA  
436  C C   . ARG A 52  ? 0.6349 0.4485 0.5148 0.0326  -0.0178 0.0258  922  ARG A C   
437  O O   . ARG A 52  ? 0.6164 0.4354 0.4956 0.0232  -0.0134 0.0267  922  ARG A O   
438  C CB  . ARG A 52  ? 0.6443 0.4129 0.4975 0.0366  -0.0221 0.0290  922  ARG A CB  
439  C CG  . ARG A 52  ? 0.9205 0.6874 0.7755 0.0497  -0.0300 0.0302  922  ARG A CG  
440  C CD  . ARG A 52  ? 1.2324 0.9731 1.0669 0.0512  -0.0354 0.0360  922  ARG A CD  
441  N NE  . ARG A 52  ? 1.3268 1.0606 1.1481 0.0394  -0.0322 0.0402  922  ARG A NE  
442  C CZ  . ARG A 52  ? 1.3265 1.0339 1.1263 0.0342  -0.0324 0.0446  922  ARG A CZ  
443  N NH1 . ARG A 52  ? 1.2532 0.9368 1.0413 0.0402  -0.0362 0.0457  922  ARG A NH1 
444  N NH2 . ARG A 52  ? 1.3271 1.0313 1.1167 0.0229  -0.0283 0.0477  922  ARG A NH2 
458  N N   . PRO A 53  ? 0.5515 0.3757 0.4397 0.0415  -0.0229 0.0257  923  PRO A N   
459  C CA  . PRO A 53  ? 0.4458 0.2870 0.3408 0.0391  -0.0231 0.0268  923  PRO A CA  
460  C C   . PRO A 53  ? 0.5419 0.3707 0.4221 0.0367  -0.0265 0.0321  923  PRO A C   
461  O O   . PRO A 53  ? 0.6248 0.4378 0.4945 0.0427  -0.0326 0.0350  923  PRO A O   
462  C CB  . PRO A 53  ? 0.4738 0.3308 0.3833 0.0490  -0.0273 0.0241  923  PRO A CB  
463  C CG  . PRO A 53  ? 0.5619 0.4124 0.4742 0.0563  -0.0279 0.0208  923  PRO A CG  
464  C CD  . PRO A 53  ? 0.5646 0.3892 0.4591 0.0536  -0.0279 0.0236  923  PRO A CD  
472  N N   . PRO A 54  ? 0.5207 0.3560 0.3992 0.0282  -0.0228 0.0334  924  PRO A N   
473  C CA  . PRO A 54  ? 0.5562 0.3778 0.4179 0.0242  -0.0247 0.0383  924  PRO A CA  
474  C C   . PRO A 54  ? 0.5453 0.3678 0.4053 0.0322  -0.0333 0.0405  924  PRO A C   
475  O O   . PRO A 54  ? 0.5187 0.3593 0.3939 0.0380  -0.0360 0.0378  924  PRO A O   
476  C CB  . PRO A 54  ? 0.4445 0.2779 0.3096 0.0146  -0.0181 0.0376  924  PRO A CB  
477  C CG  . PRO A 54  ? 0.4039 0.2605 0.2893 0.0169  -0.0160 0.0331  924  PRO A CG  
478  C CD  . PRO A 54  ? 0.4139 0.2690 0.3056 0.0227  -0.0170 0.0304  924  PRO A CD  
486  N N   . SER A 55  ? 0.5361 0.3390 0.3772 0.0321  -0.0378 0.0454  925  SER A N   
487  C CA  . SER A 55  ? 0.5115 0.3151 0.3495 0.0387  -0.0468 0.0479  925  SER A CA  
488  C C   . SER A 55  ? 0.5520 0.3695 0.3923 0.0323  -0.0444 0.0476  925  SER A C   
489  O O   . SER A 55  ? 0.5139 0.3365 0.3556 0.0233  -0.0359 0.0462  925  SER A O   
490  C CB  . SER A 55  ? 0.8015 0.5774 0.6155 0.0398  -0.0525 0.0538  925  SER A CB  
491  O OG  . SER A 55  ? 0.7861 0.5490 0.5833 0.0280  -0.0461 0.0564  925  SER A OG  
497  N N   . SER A 56  ? 0.6244 0.4483 0.4655 0.0371  -0.0519 0.0487  926  SER A N   
498  C CA  . SER A 56  ? 0.6272 0.4630 0.4693 0.0311  -0.0500 0.0481  926  SER A CA  
499  C C   . SER A 56  ? 0.5325 0.3542 0.3565 0.0202  -0.0434 0.0507  926  SER A C   
500  O O   . SER A 56  ? 0.5352 0.3346 0.3392 0.0185  -0.0453 0.0550  926  SER A O   
501  C CB  . SER A 56  ? 0.8569 0.6953 0.6963 0.0369  -0.0605 0.0498  926  SER A CB  
502  O OG  . SER A 56  ? 0.8693 0.7244 0.7158 0.0324  -0.0587 0.0475  926  SER A OG  
508  N N   . PRO A 57  ? 0.4409 0.2751 0.2716 0.0126  -0.0354 0.0479  927  PRO A N   
509  C CA  . PRO A 57  ? 0.4455 0.2692 0.2618 0.0022  -0.0278 0.0493  927  PRO A CA  
510  C C   . PRO A 57  ? 0.5671 0.3743 0.3605 -0.0005 -0.0320 0.0537  927  PRO A C   
511  O O   . PRO A 57  ? 0.4901 0.3002 0.2814 0.0040  -0.0400 0.0547  927  PRO A O   
512  C CB  . PRO A 57  ? 0.4781 0.3214 0.3085 -0.0025 -0.0209 0.0451  927  PRO A CB  
513  C CG  . PRO A 57  ? 0.5547 0.4154 0.4071 0.0038  -0.0219 0.0415  927  PRO A CG  
514  C CD  . PRO A 57  ? 0.4465 0.3043 0.2993 0.0134  -0.0319 0.0430  927  PRO A CD  
522  N N   . TYR A 58  ? 0.4605 0.2501 0.2362 -0.0084 -0.0264 0.0562  928  TYR A N   
523  C CA  . TYR A 58  ? 0.5644 0.3369 0.3156 -0.0136 -0.0279 0.0602  928  TYR A CA  
524  C C   . TYR A 58  ? 0.6504 0.4265 0.3986 -0.0249 -0.0162 0.0579  928  TYR A C   
525  O O   . TYR A 58  ? 0.6480 0.4293 0.4055 -0.0296 -0.0074 0.0552  928  TYR A O   
526  C CB  . TYR A 58  ? 0.5873 0.3327 0.3170 -0.0137 -0.0312 0.0655  928  TYR A CB  
527  C CG  . TYR A 58  ? 0.6148 0.3400 0.3160 -0.0196 -0.0327 0.0702  928  TYR A CG  
528  C CD1 . TYR A 58  ? 0.6060 0.3215 0.2941 -0.0131 -0.0449 0.0743  928  TYR A CD1 
529  C CD2 . TYR A 58  ? 0.6236 0.3405 0.3113 -0.0320 -0.0219 0.0702  928  TYR A CD2 
530  C CE1 . TYR A 58  ? 0.6272 0.3307 0.2960 -0.0186 -0.0455 0.0758  928  TYR A CE1 
531  C CE2 . TYR A 58  ? 0.6262 0.3312 0.2949 -0.0374 -0.0219 0.0714  928  TYR A CE2 
532  C CZ  . TYR A 58  ? 0.6602 0.3581 0.3191 -0.0308 -0.0338 0.0743  928  TYR A CZ  
533  O OH  . TYR A 58  ? 0.6348 0.3206 0.2745 -0.0364 -0.0340 0.0754  928  TYR A OH  
543  N N   . PRO A 59  ? 0.6142 0.3883 0.3501 -0.0291 -0.0160 0.0583  929  PRO A N   
544  C CA  . PRO A 59  ? 0.6262 0.3949 0.3500 -0.0248 -0.0266 0.0612  929  PRO A CA  
545  C C   . PRO A 59  ? 0.5073 0.2982 0.2527 -0.0169 -0.0328 0.0578  929  PRO A C   
546  O O   . PRO A 59  ? 0.4745 0.2846 0.2403 -0.0176 -0.0267 0.0530  929  PRO A O   
547  C CB  . PRO A 59  ? 0.6488 0.4110 0.3549 -0.0347 -0.0203 0.0610  929  PRO A CB  
548  C CG  . PRO A 59  ? 0.7075 0.4847 0.4294 -0.0408 -0.0073 0.0556  929  PRO A CG  
549  C CD  . PRO A 59  ? 0.5815 0.3592 0.3149 -0.0394 -0.0041 0.0554  929  PRO A CD  
557  N N   . PRO A 60  ? 0.5043 0.2929 0.2451 -0.0097 -0.0451 0.0603  930  PRO A N   
558  C CA  . PRO A 60  ? 0.5101 0.3206 0.2713 -0.0033 -0.0509 0.0568  930  PRO A CA  
559  C C   . PRO A 60  ? 0.4721 0.2928 0.2337 -0.0099 -0.0463 0.0535  930  PRO A C   
560  O O   . PRO A 60  ? 0.4801 0.2880 0.2213 -0.0173 -0.0431 0.0549  930  PRO A O   
561  C CB  . PRO A 60  ? 0.4881 0.2910 0.2408 0.0048  -0.0654 0.0607  930  PRO A CB  
562  C CG  . PRO A 60  ? 0.5194 0.2957 0.2408 -0.0004 -0.0667 0.0662  930  PRO A CG  
563  C CD  . PRO A 60  ? 0.4873 0.2531 0.2028 -0.0081 -0.0543 0.0663  930  PRO A CD  
571  N N   . LEU A 61  ? 0.4833 0.3256 0.2668 -0.0075 -0.0456 0.0489  931  LEU A N   
572  C CA  . LEU A 61  ? 0.4541 0.3060 0.2390 -0.0129 -0.0419 0.0453  931  LEU A CA  
573  C C   . LEU A 61  ? 0.4651 0.3205 0.2464 -0.0097 -0.0534 0.0458  931  LEU A C   
574  O O   . LEU A 61  ? 0.4312 0.2949 0.2241 -0.0017 -0.0625 0.0462  931  LEU A O   
575  C CB  . LEU A 61  ? 0.3958 0.2679 0.2055 -0.0124 -0.0354 0.0403  931  LEU A CB  
576  C CG  . LEU A 61  ? 0.4260 0.2982 0.2423 -0.0156 -0.0243 0.0390  931  LEU A CG  
577  C CD1 . LEU A 61  ? 0.3589 0.2507 0.1990 -0.0139 -0.0200 0.0345  931  LEU A CD1 
578  C CD2 . LEU A 61  ? 0.4699 0.3313 0.2705 -0.0244 -0.0156 0.0389  931  LEU A CD2 
590  N N   . PRO A 62  ? 0.4311 0.2812 0.1970 -0.0161 -0.0531 0.0453  932  PRO A N   
591  C CA  . PRO A 62  ? 0.4603 0.3163 0.2242 -0.0142 -0.0639 0.0448  932  PRO A CA  
592  C C   . PRO A 62  ? 0.4454 0.3242 0.2329 -0.0130 -0.0631 0.0394  932  PRO A C   
593  O O   . PRO A 62  ? 0.3927 0.2806 0.1947 -0.0148 -0.0533 0.0361  932  PRO A O   
594  C CB  . PRO A 62  ? 0.5554 0.3974 0.2943 -0.0230 -0.0610 0.0451  932  PRO A CB  
595  C CG  . PRO A 62  ? 0.5143 0.3550 0.2548 -0.0296 -0.0457 0.0424  932  PRO A CG  
596  C CD  . PRO A 62  ? 0.5145 0.3543 0.2652 -0.0256 -0.0422 0.0444  932  PRO A CD  
604  N N   . LYS A 63  ? 0.4327 0.3205 0.2237 -0.0106 -0.0735 0.0385  933  LYS A N   
605  C CA  . LYS A 63  ? 0.4966 0.4062 0.3102 -0.0098 -0.0734 0.0334  933  LYS A CA  
606  C C   . LYS A 63  ? 0.4525 0.3651 0.2671 -0.0178 -0.0624 0.0291  933  LYS A C   
607  O O   . LYS A 63  ? 0.4577 0.3851 0.2915 -0.0176 -0.0578 0.0254  933  LYS A O   
608  C CB  . LYS A 63  ? 0.6071 0.5251 0.4218 -0.0076 -0.0865 0.0329  933  LYS A CB  
609  C CG  . LYS A 63  ? 0.5149 0.4326 0.3321 0.0019  -0.0986 0.0365  933  LYS A CG  
610  C CD  . LYS A 63  ? 0.4572 0.3885 0.2989 0.0092  -0.0964 0.0351  933  LYS A CD  
611  C CE  . LYS A 63  ? 0.5267 0.4613 0.3747 0.0196  -0.1091 0.0373  933  LYS A CE  
612  N NZ  . LYS A 63  ? 0.5327 0.4738 0.3986 0.0270  -0.1058 0.0368  933  LYS A NZ  
626  N N   . ASP A 64  ? 0.4150 0.3130 0.2084 -0.0247 -0.0581 0.0295  934  ASP A N   
627  C CA  . ASP A 64  ? 0.4538 0.3536 0.2469 -0.0318 -0.0481 0.0250  934  ASP A CA  
628  C C   . ASP A 64  ? 0.4984 0.3998 0.3021 -0.0322 -0.0357 0.0237  934  ASP A C   
629  O O   . ASP A 64  ? 0.4715 0.3760 0.2791 -0.0364 -0.0271 0.0198  934  ASP A O   
630  C CB  . ASP A 64  ? 0.5155 0.3990 0.2821 -0.0390 -0.0468 0.0252  934  ASP A CB  
631  C CG  . ASP A 64  ? 0.6792 0.5443 0.4268 -0.0402 -0.0438 0.0297  934  ASP A CG  
632  O OD1 . ASP A 64  ? 0.7507 0.6109 0.4969 -0.0439 -0.0318 0.0286  934  ASP A OD1 
633  O OD2 . ASP A 64  ? 0.6421 0.4976 0.3763 -0.0377 -0.0536 0.0343  934  ASP A OD2 
638  N N   . LYS A 65  ? 0.3842 0.2835 0.1929 -0.0277 -0.0351 0.0268  935  LYS A N   
639  C CA  . LYS A 65  ? 0.3659 0.2680 0.1856 -0.0279 -0.0245 0.0257  935  LYS A CA  
640  C C   . LYS A 65  ? 0.4334 0.3497 0.2760 -0.0216 -0.0258 0.0251  935  LYS A C   
641  O O   . LYS A 65  ? 0.4072 0.3247 0.2579 -0.0208 -0.0192 0.0250  935  LYS A O   
642  C CB  . LYS A 65  ? 0.4594 0.3459 0.2646 -0.0299 -0.0202 0.0291  935  LYS A CB  
643  C CG  . LYS A 65  ? 0.6089 0.4829 0.3943 -0.0377 -0.0135 0.0282  935  LYS A CG  
644  C CD  . LYS A 65  ? 0.6995 0.5569 0.4679 -0.0405 -0.0103 0.0320  935  LYS A CD  
645  C CE  . LYS A 65  ? 0.8413 0.6864 0.5893 -0.0490 -0.0025 0.0307  935  LYS A CE  
646  N NZ  . LYS A 65  ? 0.9220 0.7500 0.6520 -0.0529 0.0010  0.0345  935  LYS A NZ  
660  N N   . LEU A 66  ? 0.3278 0.2555 0.1808 -0.0177 -0.0340 0.0243  936  LEU A N   
661  C CA  . LEU A 66  ? 0.2982 0.2388 0.1714 -0.0117 -0.0352 0.0236  936  LEU A CA  
662  C C   . LEU A 66  ? 0.3441 0.2981 0.2331 -0.0136 -0.0296 0.0195  936  LEU A C   
663  O O   . LEU A 66  ? 0.3093 0.2743 0.2143 -0.0097 -0.0296 0.0184  936  LEU A O   
664  C CB  . LEU A 66  ? 0.3757 0.3227 0.2537 -0.0057 -0.0467 0.0247  936  LEU A CB  
665  C CG  . LEU A 66  ? 0.3388 0.2715 0.2014 -0.0023 -0.0539 0.0294  936  LEU A CG  
666  C CD1 . LEU A 66  ? 0.4114 0.3526 0.2818 0.0048  -0.0657 0.0299  936  LEU A CD1 
667  C CD2 . LEU A 66  ? 0.3220 0.2446 0.1823 -0.0004 -0.0487 0.0319  936  LEU A CD2 
679  N N   . ASN A 67  ? 0.3448 0.2967 0.2280 -0.0195 -0.0248 0.0170  937  ASN A N   
680  C CA  . ASN A 67  ? 0.3801 0.3418 0.2759 -0.0214 -0.0196 0.0134  937  ASN A CA  
681  C C   . ASN A 67  ? 0.3826 0.3372 0.2733 -0.0256 -0.0097 0.0119  937  ASN A C   
682  O O   . ASN A 67  ? 0.3633 0.3169 0.2506 -0.0299 -0.0069 0.0090  937  ASN A O   
683  C CB  . ASN A 67  ? 0.4544 0.4234 0.3517 -0.0240 -0.0250 0.0108  937  ASN A CB  
684  C CG  . ASN A 67  ? 0.6430 0.6237 0.5512 -0.0192 -0.0340 0.0113  937  ASN A CG  
685  O OD1 . ASN A 67  ? 0.7556 0.7478 0.6798 -0.0166 -0.0328 0.0100  937  ASN A OD1 
686  N ND2 . ASN A 67  ? 0.5944 0.5725 0.4939 -0.0180 -0.0429 0.0129  937  ASN A ND2 
693  N N   . PRO A 68  ? 0.3595 0.3093 0.2502 -0.0244 -0.0045 0.0135  938  PRO A N   
694  C CA  . PRO A 68  ? 0.3017 0.2454 0.1881 -0.0279 0.0047  0.0120  938  PRO A CA  
695  C C   . PRO A 68  ? 0.2764 0.2273 0.1752 -0.0281 0.0101  0.0089  938  PRO A C   
696  O O   . PRO A 68  ? 0.2932 0.2532 0.2049 -0.0252 0.0081  0.0088  938  PRO A O   
697  C CB  . PRO A 68  ? 0.3713 0.3110 0.2579 -0.0263 0.0075  0.0145  938  PRO A CB  
698  C CG  . PRO A 68  ? 0.3519 0.2992 0.2500 -0.0208 0.0017  0.0163  938  PRO A CG  
699  C CD  . PRO A 68  ? 0.3425 0.2928 0.2381 -0.0197 -0.0069 0.0164  938  PRO A CD  
707  N N   . PRO A 69  ? 0.3005 0.2464 0.1945 -0.0314 0.0171  0.0063  939  PRO A N   
708  C CA  . PRO A 69  ? 0.2897 0.2403 0.1945 -0.0308 0.0223  0.0036  939  PRO A CA  
709  C C   . PRO A 69  ? 0.3452 0.3005 0.2618 -0.0274 0.0256  0.0047  939  PRO A C   
710  O O   . PRO A 69  ? 0.2716 0.2244 0.1858 -0.0272 0.0270  0.0064  939  PRO A O   
711  C CB  . PRO A 69  ? 0.3120 0.2544 0.2071 -0.0344 0.0290  0.0005  939  PRO A CB  
712  C CG  . PRO A 69  ? 0.4085 0.3433 0.2910 -0.0366 0.0301  0.0021  939  PRO A CG  
713  C CD  . PRO A 69  ? 0.3823 0.3174 0.2604 -0.0355 0.0210  0.0056  939  PRO A CD  
721  N N   . THR A 70  ? 0.2721 0.2334 0.2002 -0.0253 0.0269  0.0036  940  THR A N   
722  C CA  . THR A 70  ? 0.2382 0.2045 0.1775 -0.0221 0.0288  0.0047  940  THR A CA  
723  C C   . THR A 70  ? 0.2517 0.2161 0.1932 -0.0223 0.0360  0.0027  940  THR A C   
724  O O   . THR A 70  ? 0.2796 0.2413 0.2202 -0.0230 0.0397  0.0000  940  THR A O   
725  C CB  . THR A 70  ? 0.3791 0.3519 0.3285 -0.0199 0.0265  0.0047  940  THR A CB  
726  O OG1 . THR A 70  ? 0.3484 0.3252 0.2980 -0.0195 0.0205  0.0061  940  THR A OG1 
727  C CG2 . THR A 70  ? 0.3230 0.3002 0.2823 -0.0168 0.0282  0.0057  940  THR A CG2 
735  N N   . PRO A 71  ? 0.2214 0.1874 0.1663 -0.0216 0.0381  0.0038  941  PRO A N   
736  C CA  . PRO A 71  ? 0.2400 0.2069 0.1899 -0.0216 0.0448  0.0016  941  PRO A CA  
737  C C   . PRO A 71  ? 0.2443 0.2158 0.2051 -0.0182 0.0456  0.0001  941  PRO A C   
738  O O   . PRO A 71  ? 0.2724 0.2483 0.2400 -0.0157 0.0415  0.0019  941  PRO A O   
739  C CB  . PRO A 71  ? 0.2652 0.2351 0.2192 -0.0217 0.0450  0.0034  941  PRO A CB  
740  C CG  . PRO A 71  ? 0.2313 0.1962 0.1751 -0.0230 0.0400  0.0063  941  PRO A CG  
741  C CD  . PRO A 71  ? 0.2477 0.2142 0.1919 -0.0211 0.0345  0.0068  941  PRO A CD  
749  N N   . SER A 72  ? 0.2282 0.1973 0.1893 -0.0180 0.0507  -0.0031 942  SER A N   
750  C CA  . SER A 72  ? 0.2438 0.2138 0.2123 -0.0145 0.0507  -0.0043 942  SER A CA  
751  C C   . SER A 72  ? 0.2854 0.2581 0.2626 -0.0117 0.0563  -0.0071 942  SER A C   
752  O O   . SER A 72  ? 0.3159 0.2874 0.2906 -0.0135 0.0621  -0.0099 942  SER A O   
753  C CB  . SER A 72  ? 0.2726 0.2353 0.2322 -0.0163 0.0503  -0.0058 942  SER A CB  
754  O OG  . SER A 72  ? 0.2745 0.2369 0.2282 -0.0187 0.0447  -0.0036 942  SER A OG  
760  N N   . ILE A 73  ? 0.2672 0.2433 0.2545 -0.0071 0.0544  -0.0067 943  ILE A N   
761  C CA  . ILE A 73  ? 0.2886 0.2677 0.2860 -0.0030 0.0585  -0.0095 943  ILE A CA  
762  C C   . ILE A 73  ? 0.2804 0.2530 0.2775 0.0005  0.0574  -0.0102 943  ILE A C   
763  O O   . ILE A 73  ? 0.2572 0.2277 0.2528 0.0010  0.0522  -0.0074 943  ILE A O   
764  C CB  . ILE A 73  ? 0.2759 0.2650 0.2859 -0.0004 0.0561  -0.0079 943  ILE A CB  
765  C CG1 . ILE A 73  ? 0.2797 0.2733 0.2887 -0.0047 0.0584  -0.0078 943  ILE A CG1 
766  C CG2 . ILE A 73  ? 0.3246 0.3181 0.3472 0.0053  0.0585  -0.0106 943  ILE A CG2 
767  C CD1 . ILE A 73  ? 0.4603 0.4610 0.4763 -0.0043 0.0541  -0.0052 943  ILE A CD1 
779  N N   . TYR A 74  ? 0.2256 0.1939 0.2232 0.0026  0.0628  -0.0143 944  TYR A N   
780  C CA  . TYR A 74  ? 0.2798 0.2389 0.2749 0.0057  0.0622  -0.0153 944  TYR A CA  
781  C C   . TYR A 74  ? 0.3148 0.2768 0.3230 0.0133  0.0630  -0.0167 944  TYR A C   
782  O O   . TYR A 74  ? 0.3282 0.2915 0.3416 0.0159  0.0690  -0.0211 944  TYR A O   
783  C CB  . TYR A 74  ? 0.3412 0.2902 0.3243 0.0023  0.0672  -0.0191 944  TYR A CB  
784  C CG  . TYR A 74  ? 0.3033 0.2498 0.2736 -0.0049 0.0652  -0.0176 944  TYR A CG  
785  C CD1 . TYR A 74  ? 0.2853 0.2274 0.2489 -0.0076 0.0598  -0.0150 944  TYR A CD1 
786  C CD2 . TYR A 74  ? 0.3035 0.2523 0.2687 -0.0090 0.0685  -0.0187 944  TYR A CD2 
787  C CE1 . TYR A 74  ? 0.3126 0.2542 0.2665 -0.0134 0.0572  -0.0139 944  TYR A CE1 
788  C CE2 . TYR A 74  ? 0.3281 0.2742 0.2814 -0.0146 0.0656  -0.0171 944  TYR A CE2 
789  C CZ  . TYR A 74  ? 0.3092 0.2525 0.2578 -0.0164 0.0597  -0.0148 944  TYR A CZ  
790  O OH  . TYR A 74  ? 0.3019 0.2440 0.2403 -0.0214 0.0561  -0.0135 944  TYR A OH  
800  N N   . LEU A 75  ? 0.2393 0.2026 0.2527 0.0169  0.0569  -0.0132 945  LEU A N   
801  C CA  . LEU A 75  ? 0.2178 0.1847 0.2440 0.0247  0.0557  -0.0138 945  LEU A CA  
802  C C   . LEU A 75  ? 0.2612 0.2146 0.2830 0.0291  0.0561  -0.0150 945  LEU A C   
803  O O   . LEU A 75  ? 0.2983 0.2403 0.3080 0.0259  0.0541  -0.0132 945  LEU A O   
804  C CB  . LEU A 75  ? 0.2075 0.1804 0.2393 0.0265  0.0483  -0.0091 945  LEU A CB  
805  C CG  . LEU A 75  ? 0.2305 0.2157 0.2666 0.0225  0.0473  -0.0078 945  LEU A CG  
806  C CD1 . LEU A 75  ? 0.2883 0.2784 0.3298 0.0249  0.0401  -0.0039 945  LEU A CD1 
807  C CD2 . LEU A 75  ? 0.2835 0.2790 0.3299 0.0227  0.0532  -0.0119 945  LEU A CD2 
819  N N   . GLU A 76  ? 0.2582 0.2130 0.2905 0.0364  0.0585  -0.0183 946  GLU A N   
820  C CA  . GLU A 76  ? 0.3712 0.3120 0.4004 0.0422  0.0587  -0.0197 946  GLU A CA  
821  C C   . GLU A 76  ? 0.4649 0.4091 0.5070 0.0517  0.0536  -0.0183 946  GLU A C   
822  O O   . GLU A 76  ? 0.4794 0.4114 0.5162 0.0555  0.0487  -0.0154 946  GLU A O   
823  C CB  . GLU A 76  ? 0.3832 0.3196 0.4111 0.0429  0.0675  -0.0263 946  GLU A CB  
824  C CG  . GLU A 76  ? 0.5066 0.4383 0.5198 0.0334  0.0718  -0.0277 946  GLU A CG  
825  C CD  . GLU A 76  ? 0.7615 0.6880 0.7712 0.0332  0.0809  -0.0346 946  GLU A CD  
826  O OE1 . GLU A 76  ? 0.5692 0.5059 0.5908 0.0366  0.0865  -0.0387 946  GLU A OE1 
827  O OE2 . GLU A 76  ? 0.5167 0.4291 0.5115 0.0290  0.0827  -0.0360 946  GLU A OE2 
834  N N   . ASN A 77  ? 0.3668 0.3277 0.4256 0.0552  0.0545  -0.0204 947  ASN A N   
835  C CA  . ASN A 77  ? 0.4708 0.4382 0.5448 0.0649  0.0496  -0.0200 947  ASN A CA  
836  C C   . ASN A 77  ? 0.3635 0.3453 0.4455 0.0633  0.0432  -0.0162 947  ASN A C   
837  O O   . ASN A 77  ? 0.3076 0.2972 0.3873 0.0556  0.0448  -0.0155 947  ASN A O   
838  C CB  . ASN A 77  ? 0.4327 0.4097 0.5225 0.0709  0.0563  -0.0269 947  ASN A CB  
839  C CG  . ASN A 77  ? 0.6410 0.6042 0.7225 0.0717  0.0642  -0.0318 947  ASN A CG  
840  O OD1 . ASN A 77  ? 0.5767 0.5235 0.6510 0.0767  0.0621  -0.0312 947  ASN A OD1 
841  N ND2 . ASN A 77  ? 0.5038 0.4727 0.5852 0.0666  0.0734  -0.0369 947  ASN A ND2 
848  N N   . LYS A 78  ? 0.3489 0.3334 0.4397 0.0708  0.0356  -0.0138 948  LYS A N   
849  C CA  . LYS A 78  ? 0.3373 0.3357 0.4363 0.0697  0.0292  -0.0108 948  LYS A CA  
850  C C   . LYS A 78  ? 0.2978 0.3158 0.4114 0.0665  0.0346  -0.0152 948  LYS A C   
851  O O   . LYS A 78  ? 0.3073 0.3336 0.4202 0.0599  0.0333  -0.0134 948  LYS A O   
852  C CB  . LYS A 78  ? 0.4722 0.4710 0.5798 0.0794  0.0202  -0.0085 948  LYS A CB  
853  C CG  . LYS A 78  ? 0.5421 0.5558 0.6592 0.0788  0.0129  -0.0061 948  LYS A CG  
854  C CD  . LYS A 78  ? 0.8598 0.8714 0.9827 0.0887  0.0028  -0.0034 948  LYS A CD  
855  C CE  . LYS A 78  ? 1.0981 1.1277 1.2344 0.0892  -0.0042 -0.0026 948  LYS A CE  
856  N NZ  . LYS A 78  ? 1.2073 1.2347 1.3304 0.0805  -0.0077 0.0020  948  LYS A NZ  
870  N N   . ARG A 79  ? 0.2815 0.3061 0.4074 0.0709  0.0412  -0.0212 949  ARG A N   
871  C CA  . ARG A 79  ? 0.4970 0.5403 0.6370 0.0674  0.0473  -0.0258 949  ARG A CA  
872  C C   . ARG A 79  ? 0.4340 0.4754 0.5611 0.0561  0.0532  -0.0255 949  ARG A C   
873  O O   . ARG A 79  ? 0.3071 0.3613 0.4404 0.0505  0.0551  -0.0263 949  ARG A O   
874  C CB  . ARG A 79  ? 0.6728 0.7229 0.8277 0.0738  0.0548  -0.0330 949  ARG A CB  
875  C CG  . ARG A 79  ? 0.9191 0.9542 1.0620 0.0734  0.0634  -0.0365 949  ARG A CG  
876  C CD  . ARG A 79  ? 1.1210 1.1649 1.2809 0.0805  0.0711  -0.0443 949  ARG A CD  
877  N NE  . ARG A 79  ? 1.2373 1.2666 1.3859 0.0806  0.0798  -0.0486 949  ARG A NE  
878  C CZ  . ARG A 79  ? 1.2248 1.2370 1.3665 0.0877  0.0780  -0.0485 949  ARG A CZ  
879  N NH1 . ARG A 79  ? 1.2975 1.3040 1.4414 0.0955  0.0676  -0.0440 949  ARG A NH1 
880  N NH2 . ARG A 79  ? 1.1141 1.1133 1.2450 0.0867  0.0865  -0.0531 949  ARG A NH2 
894  N N   . ASP A 80  ? 0.3086 0.3336 0.4175 0.0526  0.0557  -0.0242 950  ASP A N   
895  C CA  . ASP A 80  ? 0.2934 0.3154 0.3890 0.0426  0.0602  -0.0237 950  ASP A CA  
896  C C   . ASP A 80  ? 0.2764 0.3037 0.3694 0.0372  0.0544  -0.0189 950  ASP A C   
897  O O   . ASP A 80  ? 0.2686 0.3008 0.3590 0.0303  0.0579  -0.0193 950  ASP A O   
898  C CB  . ASP A 80  ? 0.3625 0.3664 0.4393 0.0401  0.0614  -0.0224 950  ASP A CB  
899  C CG  . ASP A 80  ? 0.4531 0.4495 0.5290 0.0437  0.0684  -0.0277 950  ASP A CG  
900  O OD1 . ASP A 80  ? 0.4735 0.4796 0.5624 0.0469  0.0743  -0.0329 950  ASP A OD1 
901  O OD2 . ASP A 80  ? 0.3504 0.3311 0.4125 0.0431  0.0683  -0.0270 950  ASP A OD2 
906  N N   . ALA A 81  ? 0.2803 0.3046 0.3722 0.0403  0.0457  -0.0144 951  ALA A N   
907  C CA  . ALA A 81  ? 0.3072 0.3345 0.3949 0.0356  0.0402  -0.0101 951  ALA A CA  
908  C C   . ALA A 81  ? 0.3105 0.3542 0.4123 0.0342  0.0396  -0.0115 951  ALA A C   
909  O O   . ALA A 81  ? 0.2823 0.3289 0.3801 0.0282  0.0383  -0.0096 951  ALA A O   
910  C CB  . ALA A 81  ? 0.3289 0.3483 0.4111 0.0390  0.0318  -0.0055 951  ALA A CB  
916  N N   . PHE A 82  ? 0.2809 0.3354 0.3996 0.0397  0.0407  -0.0153 952  PHE A N   
917  C CA  . PHE A 82  ? 0.3859 0.4578 0.5203 0.0384  0.0398  -0.0172 952  PHE A CA  
918  C C   . PHE A 82  ? 0.4409 0.5220 0.5822 0.0336  0.0500  -0.0225 952  PHE A C   
919  O O   . PHE A 82  ? 0.4311 0.5279 0.5876 0.0323  0.0512  -0.0254 952  PHE A O   
920  C CB  . PHE A 82  ? 0.3252 0.4058 0.4758 0.0475  0.0332  -0.0178 952  PHE A CB  
921  C CG  . PHE A 82  ? 0.2978 0.3700 0.4405 0.0508  0.0227  -0.0121 952  PHE A CG  
922  C CD1 . PHE A 82  ? 0.2610 0.3406 0.4066 0.0487  0.0153  -0.0096 952  PHE A CD1 
923  C CD2 . PHE A 82  ? 0.4425 0.4980 0.5730 0.0550  0.0207  -0.0094 952  PHE A CD2 
924  C CE1 . PHE A 82  ? 0.2974 0.3680 0.4336 0.0510  0.0062  -0.0045 952  PHE A CE1 
925  C CE2 . PHE A 82  ? 0.4837 0.5302 0.6050 0.0570  0.0118  -0.0041 952  PHE A CE2 
926  C CZ  . PHE A 82  ? 0.3484 0.4025 0.4723 0.0551  0.0047  -0.0017 952  PHE A CZ  
936  N N   . PHE A 83  ? 0.3586 0.4295 0.4878 0.0305  0.0573  -0.0238 953  PHE A N   
937  C CA  . PHE A 83  ? 0.3693 0.4453 0.4999 0.0246  0.0675  -0.0283 953  PHE A CA  
938  C C   . PHE A 83  ? 0.3537 0.4333 0.4796 0.0155  0.0674  -0.0262 953  PHE A C   
939  O O   . PHE A 83  ? 0.3612 0.4301 0.4714 0.0115  0.0642  -0.0219 953  PHE A O   
940  C CB  . PHE A 83  ? 0.4264 0.4876 0.5406 0.0228  0.0735  -0.0291 953  PHE A CB  
941  C CG  . PHE A 83  ? 0.4225 0.4864 0.5361 0.0176  0.0847  -0.0342 953  PHE A CG  
942  C CD1 . PHE A 83  ? 0.4611 0.5395 0.5929 0.0199  0.0910  -0.0401 953  PHE A CD1 
943  C CD2 . PHE A 83  ? 0.3436 0.3955 0.4380 0.0106  0.0890  -0.0333 953  PHE A CD2 
944  C CE1 . PHE A 83  ? 0.4517 0.5323 0.5818 0.0143  0.1024  -0.0451 953  PHE A CE1 
945  C CE2 . PHE A 83  ? 0.4312 0.4839 0.5223 0.0053  0.0994  -0.0377 953  PHE A CE2 
946  C CZ  . PHE A 83  ? 0.4448 0.5115 0.5533 0.0069  0.1066  -0.0437 953  PHE A CZ  
956  N N   . PRO A 84  ? 0.3573 0.4520 0.4973 0.0123  0.0709  -0.0296 954  PRO A N   
957  C CA  . PRO A 84  ? 0.3015 0.3989 0.4376 0.0037  0.0702  -0.0277 954  PRO A CA  
958  C C   . PRO A 84  ? 0.3781 0.4613 0.4930 -0.0040 0.0740  -0.0253 954  PRO A C   
959  O O   . PRO A 84  ? 0.3912 0.4691 0.4971 -0.0076 0.0689  -0.0212 954  PRO A O   
960  C CB  . PRO A 84  ? 0.3595 0.4746 0.5138 0.0008  0.0765  -0.0333 954  PRO A CB  
961  C CG  . PRO A 84  ? 0.4135 0.5394 0.5867 0.0107  0.0745  -0.0365 954  PRO A CG  
962  C CD  . PRO A 84  ? 0.3881 0.4990 0.5499 0.0168  0.0749  -0.0354 954  PRO A CD  
970  N N   . PRO A 85  ? 0.3515 0.4285 0.4583 -0.0064 0.0825  -0.0278 955  PRO A N   
971  C CA  . PRO A 85  ? 0.3543 0.4174 0.4402 -0.0134 0.0850  -0.0252 955  PRO A CA  
972  C C   . PRO A 85  ? 0.4368 0.4868 0.5081 -0.0115 0.0772  -0.0198 955  PRO A C   
973  O O   . PRO A 85  ? 0.3793 0.4190 0.4347 -0.0164 0.0770  -0.0171 955  PRO A O   
974  C CB  . PRO A 85  ? 0.4400 0.4987 0.5203 -0.0145 0.0945  -0.0293 955  PRO A CB  
975  C CG  . PRO A 85  ? 0.4120 0.4864 0.5131 -0.0115 0.1000  -0.0352 955  PRO A CG  
976  C CD  . PRO A 85  ? 0.3688 0.4522 0.4856 -0.0036 0.0909  -0.0338 955  PRO A CD  
984  N N   . LEU A 86  ? 0.3273 0.3777 0.4039 -0.0043 0.0708  -0.0185 956  LEU A N   
985  C CA  . LEU A 86  ? 0.3392 0.3788 0.4036 -0.0029 0.0641  -0.0139 956  LEU A CA  
986  C C   . LEU A 86  ? 0.2948 0.3343 0.3554 -0.0065 0.0589  -0.0103 956  LEU A C   
987  O O   . LEU A 86  ? 0.2701 0.3003 0.3171 -0.0093 0.0568  -0.0073 956  LEU A O   
988  C CB  . LEU A 86  ? 0.4592 0.4994 0.5308 0.0050  0.0591  -0.0134 956  LEU A CB  
989  C CG  . LEU A 86  ? 0.4949 0.5255 0.5564 0.0069  0.0523  -0.0092 956  LEU A CG  
990  C CD1 . LEU A 86  ? 0.4903 0.5099 0.5359 0.0030  0.0544  -0.0082 956  LEU A CD1 
991  C CD2 . LEU A 86  ? 0.3856 0.4143 0.4523 0.0141  0.0495  -0.0094 956  LEU A CD2 
1003 N N   . HIS A 87  ? 0.2771 0.3274 0.3502 -0.0065 0.0568  -0.0109 957  HIS A N   
1004 C CA  . HIS A 87  ? 0.3421 0.3927 0.4127 -0.0102 0.0524  -0.0084 957  HIS A CA  
1005 C C   . HIS A 87  ? 0.3203 0.3638 0.3787 -0.0174 0.0567  -0.0078 957  HIS A C   
1006 O O   . HIS A 87  ? 0.2715 0.3068 0.3189 -0.0193 0.0530  -0.0045 957  HIS A O   
1007 C CB  . HIS A 87  ? 0.5038 0.5686 0.5910 -0.0101 0.0509  -0.0106 957  HIS A CB  
1008 C CG  . HIS A 87  ? 0.5272 0.5925 0.6126 -0.0137 0.0459  -0.0085 957  HIS A CG  
1009 N ND1 . HIS A 87  ? 0.5913 0.6687 0.6897 -0.0157 0.0444  -0.0105 957  HIS A ND1 
1010 C CD2 . HIS A 87  ? 0.5879 0.6433 0.6604 -0.0155 0.0421  -0.0050 957  HIS A CD2 
1011 C CE1 . HIS A 87  ? 0.6148 0.6883 0.7069 -0.0190 0.0400  -0.0083 957  HIS A CE1 
1012 N NE2 . HIS A 87  ? 0.6181 0.6783 0.6948 -0.0186 0.0387  -0.0050 957  HIS A NE2 
1021 N N   . GLN A 88  ? 0.3189 0.3648 0.3787 -0.0214 0.0646  -0.0109 958  GLN A N   
1022 C CA  . GLN A 88  ? 0.3644 0.4023 0.4114 -0.0289 0.0687  -0.0101 958  GLN A CA  
1023 C C   . GLN A 88  ? 0.3101 0.3337 0.3391 -0.0289 0.0682  -0.0075 958  GLN A C   
1024 O O   . GLN A 88  ? 0.2826 0.2966 0.2985 -0.0328 0.0671  -0.0047 958  GLN A O   
1025 C CB  . GLN A 88  ? 0.5075 0.5520 0.5603 -0.0344 0.0780  -0.0144 958  GLN A CB  
1026 C CG  . GLN A 88  ? 0.8319 0.8791 0.8882 -0.0320 0.0848  -0.0183 958  GLN A CG  
1027 C CD  . GLN A 88  ? 1.0192 1.0788 1.0884 -0.0360 0.0937  -0.0236 958  GLN A CD  
1028 O OE1 . GLN A 88  ? 0.9457 1.0192 1.0318 -0.0357 0.0922  -0.0255 958  GLN A OE1 
1029 N NE2 . GLN A 88  ? 1.0563 1.1116 1.1177 -0.0401 0.1029  -0.0264 958  GLN A NE2 
1038 N N   . PHE A 89  ? 0.2760 0.2978 0.3043 -0.0243 0.0685  -0.0083 959  PHE A N   
1039 C CA  . PHE A 89  ? 0.2645 0.2743 0.2772 -0.0242 0.0670  -0.0062 959  PHE A CA  
1040 C C   . PHE A 89  ? 0.2570 0.2622 0.2644 -0.0224 0.0587  -0.0020 959  PHE A C   
1041 O O   . PHE A 89  ? 0.2724 0.2686 0.2667 -0.0247 0.0568  0.0005  959  PHE A O   
1042 C CB  . PHE A 89  ? 0.3057 0.3148 0.3200 -0.0198 0.0686  -0.0084 959  PHE A CB  
1043 C CG  . PHE A 89  ? 0.2370 0.2347 0.2356 -0.0207 0.0675  -0.0071 959  PHE A CG  
1044 C CD1 . PHE A 89  ? 0.3247 0.3158 0.3125 -0.0247 0.0736  -0.0091 959  PHE A CD1 
1045 C CD2 . PHE A 89  ? 0.2680 0.2619 0.2627 -0.0179 0.0605  -0.0042 959  PHE A CD2 
1046 C CE1 . PHE A 89  ? 0.3814 0.3624 0.3546 -0.0258 0.0718  -0.0081 959  PHE A CE1 
1047 C CE2 . PHE A 89  ? 0.3247 0.3099 0.3066 -0.0191 0.0591  -0.0034 959  PHE A CE2 
1048 C CZ  . PHE A 89  ? 0.3647 0.3434 0.3357 -0.0229 0.0643  -0.0053 959  PHE A CZ  
1058 N N   . CYS A 90  ? 0.2391 0.2505 0.2564 -0.0181 0.0538  -0.0013 960  CYS A N   
1059 C CA  . CYS A 90  ? 0.2359 0.2440 0.2491 -0.0163 0.0469  0.0020  960  CYS A CA  
1060 C C   . CYS A 90  ? 0.2827 0.2880 0.2913 -0.0198 0.0452  0.0038  960  CYS A C   
1061 O O   . CYS A 90  ? 0.2426 0.2415 0.2427 -0.0194 0.0414  0.0062  960  CYS A O   
1062 C CB  . CYS A 90  ? 0.2040 0.2186 0.2275 -0.0116 0.0427  0.0022  960  CYS A CB  
1063 S SG  . CYS A 90  ? 0.2524 0.2656 0.2774 -0.0069 0.0429  0.0012  960  CYS A SG  
1069 N N   . THR A 91  ? 0.2414 0.2518 0.2563 -0.0230 0.0480  0.0023  961  THR A N   
1070 C CA  . THR A 91  ? 0.2976 0.3040 0.3079 -0.0269 0.0466  0.0037  961  THR A CA  
1071 C C   . THR A 91  ? 0.3407 0.3367 0.3375 -0.0320 0.0502  0.0047  961  THR A C   
1072 O O   . THR A 91  ? 0.3476 0.3365 0.3371 -0.0347 0.0485  0.0065  961  THR A O   
1073 C CB  . THR A 91  ? 0.4043 0.4203 0.4266 -0.0294 0.0475  0.0016  961  THR A CB  
1074 O OG1 . THR A 91  ? 0.3333 0.3553 0.3617 -0.0326 0.0544  -0.0015 961  THR A OG1 
1075 C CG2 . THR A 91  ? 0.3063 0.3310 0.3398 -0.0243 0.0425  0.0013  961  THR A CG2 
1083 N N   . ASN A 92  ? 0.2925 0.2864 0.2848 -0.0335 0.0553  0.0034  962  ASN A N   
1084 C CA  . ASN A 92  ? 0.3191 0.3015 0.2960 -0.0385 0.0585  0.0047  962  ASN A CA  
1085 C C   . ASN A 92  ? 0.3262 0.2974 0.2904 -0.0367 0.0521  0.0086  962  ASN A C   
1086 O O   . ASN A 92  ? 0.3052 0.2762 0.2685 -0.0320 0.0476  0.0096  962  ASN A O   
1087 C CB  . ASN A 92  ? 0.3212 0.3023 0.2937 -0.0389 0.0634  0.0027  962  ASN A CB  
1088 C CG  . ASN A 92  ? 0.5006 0.4692 0.4554 -0.0446 0.0672  0.0039  962  ASN A CG  
1089 O OD1 . ASN A 92  ? 0.4004 0.3589 0.3437 -0.0468 0.0642  0.0071  962  ASN A OD1 
1090 N ND2 . ASN A 92  ? 0.5069 0.4751 0.4582 -0.0469 0.0738  0.0011  962  ASN A ND2 
1097 N N   . PRO A 93  ? 0.3869 0.3488 0.3418 -0.0405 0.0516  0.0106  963  PRO A N   
1098 C CA  . PRO A 93  ? 0.3694 0.3212 0.3140 -0.0375 0.0450  0.0140  963  PRO A CA  
1099 C C   . PRO A 93  ? 0.3800 0.3245 0.3128 -0.0357 0.0427  0.0157  963  PRO A C   
1100 O O   . PRO A 93  ? 0.4011 0.3423 0.3305 -0.0313 0.0364  0.0177  963  PRO A O   
1101 C CB  . PRO A 93  ? 0.4462 0.3869 0.3810 -0.0427 0.0461  0.0157  963  PRO A CB  
1102 C CG  . PRO A 93  ? 0.5619 0.5109 0.5069 -0.0478 0.0519  0.0128  963  PRO A CG  
1103 C CD  . PRO A 93  ? 0.4227 0.3836 0.3777 -0.0473 0.0566  0.0096  963  PRO A CD  
1111 N N   . ASN A 94  ? 0.3194 0.2619 0.2462 -0.0393 0.0479  0.0145  964  ASN A N   
1112 C CA  . ASN A 94  ? 0.4176 0.3534 0.3326 -0.0382 0.0454  0.0157  964  ASN A CA  
1113 C C   . ASN A 94  ? 0.3486 0.2930 0.2722 -0.0329 0.0421  0.0144  964  ASN A C   
1114 O O   . ASN A 94  ? 0.3360 0.2763 0.2514 -0.0316 0.0386  0.0153  964  ASN A O   
1115 C CB  . ASN A 94  ? 0.4660 0.3959 0.3702 -0.0442 0.0525  0.0144  964  ASN A CB  
1116 C CG  . ASN A 94  ? 0.6503 0.5686 0.5418 -0.0505 0.0557  0.0164  964  ASN A CG  
1117 O OD1 . ASN A 94  ? 0.6343 0.5418 0.5156 -0.0498 0.0502  0.0201  964  ASN A OD1 
1118 N ND2 . ASN A 94  ? 0.5794 0.4999 0.4721 -0.0567 0.0647  0.0136  964  ASN A ND2 
1125 N N   . ASN A 95  ? 0.2860 0.2418 0.2252 -0.0303 0.0431  0.0123  965  ASN A N   
1126 C CA  . ASN A 95  ? 0.2536 0.2164 0.2005 -0.0259 0.0403  0.0113  965  ASN A CA  
1127 C C   . ASN A 95  ? 0.2530 0.2200 0.2070 -0.0216 0.0344  0.0127  965  ASN A C   
1128 O O   . ASN A 95  ? 0.2469 0.2202 0.2110 -0.0207 0.0349  0.0119  965  ASN A O   
1129 C CB  . ASN A 95  ? 0.2488 0.2200 0.2069 -0.0256 0.0454  0.0080  965  ASN A CB  
1130 C CG  . ASN A 95  ? 0.3421 0.3098 0.2938 -0.0290 0.0518  0.0056  965  ASN A CG  
1131 O OD1 . ASN A 95  ? 0.3452 0.3048 0.2838 -0.0309 0.0511  0.0064  965  ASN A OD1 
1132 N ND2 . ASN A 95  ? 0.3628 0.3370 0.3238 -0.0298 0.0579  0.0025  965  ASN A ND2 
1139 N N   . PRO A 96  ? 0.2481 0.2122 0.1970 -0.0191 0.0288  0.0144  966  PRO A N   
1140 C CA  . PRO A 96  ? 0.2668 0.2348 0.2220 -0.0152 0.0240  0.0152  966  PRO A CA  
1141 C C   . PRO A 96  ? 0.2190 0.1962 0.1854 -0.0129 0.0240  0.0137  966  PRO A C   
1142 O O   . PRO A 96  ? 0.2023 0.1833 0.1749 -0.0108 0.0222  0.0138  966  PRO A O   
1143 C CB  . PRO A 96  ? 0.2924 0.2567 0.2406 -0.0131 0.0186  0.0167  966  PRO A CB  
1144 C CG  . PRO A 96  ? 0.4150 0.3698 0.3499 -0.0164 0.0197  0.0178  966  PRO A CG  
1145 C CD  . PRO A 96  ? 0.3205 0.2775 0.2572 -0.0200 0.0263  0.0155  966  PRO A CD  
1153 N N   . VAL A 97  ? 0.2203 0.1997 0.1877 -0.0135 0.0260  0.0123  967  VAL A N   
1154 C CA  . VAL A 97  ? 0.1642 0.1499 0.1399 -0.0116 0.0261  0.0111  967  VAL A CA  
1155 C C   . VAL A 97  ? 0.2328 0.2181 0.2091 -0.0129 0.0307  0.0092  967  VAL A C   
1156 O O   . VAL A 97  ? 0.2332 0.2135 0.2019 -0.0154 0.0331  0.0085  967  VAL A O   
1157 C CB  . VAL A 97  ? 0.1960 0.1835 0.1711 -0.0101 0.0222  0.0114  967  VAL A CB  
1158 C CG1 . VAL A 97  ? 0.2124 0.1957 0.1789 -0.0120 0.0215  0.0111  967  VAL A CG1 
1159 C CG2 . VAL A 97  ? 0.1916 0.1835 0.1731 -0.0091 0.0226  0.0105  967  VAL A CG2 
1169 N N   . THR A 98  ? 0.1947 0.1843 0.1792 -0.0111 0.0319  0.0082  968  THR A N   
1170 C CA  . THR A 98  ? 0.1875 0.1764 0.1736 -0.0111 0.0360  0.0060  968  THR A CA  
1171 C C   . THR A 98  ? 0.2148 0.2048 0.2045 -0.0087 0.0340  0.0060  968  THR A C   
1172 O O   . THR A 98  ? 0.2042 0.1976 0.1992 -0.0067 0.0314  0.0072  968  THR A O   
1173 C CB  . THR A 98  ? 0.2373 0.2303 0.2312 -0.0108 0.0399  0.0045  968  THR A CB  
1174 O OG1 . THR A 98  ? 0.2460 0.2369 0.2351 -0.0143 0.0428  0.0043  968  THR A OG1 
1175 C CG2 . THR A 98  ? 0.2107 0.2037 0.2082 -0.0092 0.0439  0.0018  968  THR A CG2 
1183 N N   . VAL A 99  ? 0.1970 0.1826 0.1824 -0.0093 0.0354  0.0046  969  VAL A N   
1184 C CA  . VAL A 99  ? 0.1832 0.1676 0.1708 -0.0076 0.0342  0.0046  969  VAL A CA  
1185 C C   . VAL A 99  ? 0.2234 0.2060 0.2151 -0.0052 0.0380  0.0026  969  VAL A C   
1186 O O   . VAL A 99  ? 0.2071 0.1865 0.1956 -0.0063 0.0421  0.0001  969  VAL A O   
1187 C CB  . VAL A 99  ? 0.2155 0.1961 0.1959 -0.0102 0.0327  0.0043  969  VAL A CB  
1188 C CG1 . VAL A 99  ? 0.2720 0.2469 0.2448 -0.0127 0.0357  0.0020  969  VAL A CG1 
1189 C CG2 . VAL A 99  ? 0.1966 0.1747 0.1783 -0.0094 0.0318  0.0047  969  VAL A CG2 
1199 N N   . ILE A 100 ? 0.2239 0.2086 0.2226 -0.0017 0.0364  0.0034  970  ILE A N   
1200 C CA  . ILE A 100 ? 0.2133 0.1972 0.2181 0.0021  0.0389  0.0016  970  ILE A CA  
1201 C C   . ILE A 100 ? 0.2441 0.2197 0.2446 0.0033  0.0380  0.0018  970  ILE A C   
1202 O O   . ILE A 100 ? 0.2506 0.2250 0.2514 0.0046  0.0342  0.0042  970  ILE A O   
1203 C CB  . ILE A 100 ? 0.2146 0.2060 0.2300 0.0055  0.0367  0.0025  970  ILE A CB  
1204 C CG1 . ILE A 100 ? 0.2082 0.2066 0.2266 0.0030  0.0377  0.0023  970  ILE A CG1 
1205 C CG2 . ILE A 100 ? 0.2274 0.2194 0.2509 0.0104  0.0387  0.0003  970  ILE A CG2 
1206 C CD1 . ILE A 100 ? 0.2529 0.2598 0.2826 0.0054  0.0362  0.0023  970  ILE A CD1 
1218 N N   . ARG A 101 ? 0.2575 0.2263 0.2526 0.0023  0.0416  -0.0009 971  ARG A N   
1219 C CA  . ARG A 101 ? 0.2769 0.2357 0.2659 0.0023  0.0413  -0.0011 971  ARG A CA  
1220 C C   . ARG A 101 ? 0.2840 0.2388 0.2785 0.0084  0.0413  -0.0014 971  ARG A C   
1221 O O   . ARG A 101 ? 0.2455 0.2041 0.2480 0.0124  0.0440  -0.0036 971  ARG A O   
1222 C CB  . ARG A 101 ? 0.2353 0.1873 0.2156 -0.0012 0.0451  -0.0043 971  ARG A CB  
1223 C CG  . ARG A 101 ? 0.2933 0.2486 0.2673 -0.0068 0.0442  -0.0040 971  ARG A CG  
1224 C CD  . ARG A 101 ? 0.2766 0.2329 0.2475 -0.0099 0.0396  -0.0014 971  ARG A CD  
1225 N NE  . ARG A 101 ? 0.2559 0.2151 0.2214 -0.0144 0.0381  -0.0016 971  ARG A NE  
1226 C CZ  . ARG A 101 ? 0.2776 0.2394 0.2410 -0.0175 0.0345  -0.0004 971  ARG A CZ  
1227 N NH1 . ARG A 101 ? 0.2483 0.2097 0.2136 -0.0176 0.0328  0.0010  971  ARG A NH1 
1228 N NH2 . ARG A 101 ? 0.2660 0.2307 0.2252 -0.0205 0.0324  -0.0006 971  ARG A NH2 
1242 N N   . GLY A 102 ? 0.2636 0.2105 0.2539 0.0090  0.0383  0.0007  972  GLY A N   
1243 C CA  . GLY A 102 ? 0.2699 0.2098 0.2630 0.0152  0.0375  0.0009  972  GLY A CA  
1244 C C   . GLY A 102 ? 0.2760 0.2242 0.2801 0.0208  0.0340  0.0026  972  GLY A C   
1245 O O   . GLY A 102 ? 0.2987 0.2444 0.3088 0.0274  0.0336  0.0018  972  GLY A O   
1249 N N   . LEU A 103 ? 0.2458 0.2037 0.2527 0.0185  0.0312  0.0048  973  LEU A N   
1250 C CA  . LEU A 103 ? 0.2287 0.1954 0.2458 0.0228  0.0276  0.0062  973  LEU A CA  
1251 C C   . LEU A 103 ? 0.2312 0.1906 0.2466 0.0273  0.0222  0.0093  973  LEU A C   
1252 O O   . LEU A 103 ? 0.2910 0.2529 0.3152 0.0338  0.0200  0.0089  973  LEU A O   
1253 C CB  . LEU A 103 ? 0.2524 0.2286 0.2706 0.0187  0.0256  0.0078  973  LEU A CB  
1254 C CG  . LEU A 103 ? 0.4138 0.3976 0.4405 0.0224  0.0209  0.0093  973  LEU A CG  
1255 C CD1 . LEU A 103 ? 0.3136 0.3085 0.3534 0.0247  0.0231  0.0063  973  LEU A CD1 
1256 C CD2 . LEU A 103 ? 0.6612 0.6482 0.6839 0.0186  0.0176  0.0119  973  LEU A CD2 
1268 N N   . ALA A 104 ? 0.2636 0.2141 0.2677 0.0238  0.0201  0.0123  974  ALA A N   
1269 C CA  . ALA A 104 ? 0.3083 0.2497 0.3077 0.0272  0.0150  0.0158  974  ALA A CA  
1270 C C   . ALA A 104 ? 0.3368 0.2676 0.3368 0.0335  0.0154  0.0147  974  ALA A C   
1271 O O   . ALA A 104 ? 0.3155 0.2443 0.3197 0.0403  0.0107  0.0163  974  ALA A O   
1272 C CB  . ALA A 104 ? 0.3391 0.2715 0.3247 0.0210  0.0144  0.0186  974  ALA A CB  
1278 N N   . GLY A 105 ? 0.3185 0.2421 0.3141 0.0315  0.0206  0.0118  975  GLY A N   
1279 C CA  . GLY A 105 ? 0.3591 0.2706 0.3538 0.0373  0.0218  0.0102  975  GLY A CA  
1280 C C   . GLY A 105 ? 0.3988 0.3198 0.4091 0.0454  0.0226  0.0069  975  GLY A C   
1281 O O   . GLY A 105 ? 0.3650 0.2791 0.3786 0.0533  0.0203  0.0069  975  GLY A O   
1285 N N   . ALA A 106 ? 0.3250 0.2617 0.3450 0.0434  0.0258  0.0041  976  ALA A N   
1286 C CA  . ALA A 106 ? 0.3604 0.3087 0.3966 0.0498  0.0275  0.0005  976  ALA A CA  
1287 C C   . ALA A 106 ? 0.3941 0.3489 0.4400 0.0563  0.0200  0.0031  976  ALA A C   
1288 O O   . ALA A 106 ? 0.3641 0.3221 0.4218 0.0646  0.0190  0.0011  976  ALA A O   
1289 C CB  . ALA A 106 ? 0.3646 0.3272 0.4070 0.0447  0.0325  -0.0025 976  ALA A CB  
1295 N N   . LEU A 107 ? 0.2768 0.2341 0.3181 0.0525  0.0147  0.0074  977  LEU A N   
1296 C CA  . LEU A 107 ? 0.3049 0.2690 0.3539 0.0574  0.0070  0.0100  977  LEU A CA  
1297 C C   . LEU A 107 ? 0.4062 0.3542 0.4448 0.0616  0.0004  0.0146  977  LEU A C   
1298 O O   . LEU A 107 ? 0.3542 0.3048 0.3970 0.0666  -0.0072 0.0172  977  LEU A O   
1299 C CB  . LEU A 107 ? 0.3102 0.2847 0.3585 0.0510  0.0048  0.0120  977  LEU A CB  
1300 C CG  . LEU A 107 ? 0.3899 0.3795 0.4479 0.0469  0.0101  0.0082  977  LEU A CG  
1301 C CD1 . LEU A 107 ? 0.3260 0.3223 0.3808 0.0406  0.0077  0.0103  977  LEU A CD1 
1302 C CD2 . LEU A 107 ? 0.3492 0.3521 0.4258 0.0528  0.0105  0.0045  977  LEU A CD2 
1314 N N   . LYS A 108 ? 0.3298 0.2606 0.3540 0.0592  0.0030  0.0156  978  LYS A N   
1315 C CA  . LYS A 108 ? 0.3501 0.2628 0.3605 0.0610  -0.0024 0.0204  978  LYS A CA  
1316 C C   . LYS A 108 ? 0.5442 0.4587 0.5473 0.0567  -0.0082 0.0252  978  LYS A C   
1317 O O   . LYS A 108 ? 0.4353 0.3426 0.4338 0.0610  -0.0156 0.0292  978  LYS A O   
1318 C CB  . LYS A 108 ? 0.4058 0.3124 0.4230 0.0725  -0.0070 0.0204  978  LYS A CB  
1319 C CG  . LYS A 108 ? 0.4192 0.3217 0.4417 0.0765  -0.0002 0.0151  978  LYS A CG  
1320 C CD  . LYS A 108 ? 0.8265 0.7195 0.8540 0.0885  -0.0042 0.0148  978  LYS A CD  
1321 C CE  . LYS A 108 ? 0.9843 0.8756 1.0185 0.0921  0.0040  0.0084  978  LYS A CE  
1322 N NZ  . LYS A 108 ? 1.0099 0.8872 1.0279 0.0835  0.0111  0.0072  978  LYS A NZ  
1336 N N   . LEU A 109 ? 0.3924 0.3157 0.3935 0.0484  -0.0049 0.0246  979  LEU A N   
1337 C CA  . LEU A 109 ? 0.3623 0.2861 0.3547 0.0433  -0.0087 0.0284  979  LEU A CA  
1338 C C   . LEU A 109 ? 0.4849 0.3900 0.4585 0.0393  -0.0090 0.0321  979  LEU A C   
1339 O O   . LEU A 109 ? 0.5400 0.4367 0.5069 0.0352  -0.0037 0.0308  979  LEU A O   
1340 C CB  . LEU A 109 ? 0.4144 0.3508 0.4092 0.0359  -0.0043 0.0264  979  LEU A CB  
1341 C CG  . LEU A 109 ? 0.4843 0.4388 0.4947 0.0370  -0.0031 0.0230  979  LEU A CG  
1342 C CD1 . LEU A 109 ? 0.5303 0.4924 0.5379 0.0298  -0.0015 0.0230  979  LEU A CD1 
1343 C CD2 . LEU A 109 ? 0.4476 0.4093 0.4685 0.0437  -0.0097 0.0236  979  LEU A CD2 
1355 N N   . ASP A 110 ? 0.4546 0.3530 0.4189 0.0395  -0.0152 0.0366  980  ASP A N   
1356 C CA  . ASP A 110 ? 0.4095 0.2900 0.3544 0.0342  -0.0150 0.0403  980  ASP A CA  
1357 C C   . ASP A 110 ? 0.4378 0.3248 0.3772 0.0245  -0.0108 0.0399  980  ASP A C   
1358 O O   . ASP A 110 ? 0.3982 0.2890 0.3336 0.0222  -0.0139 0.0419  980  ASP A O   
1359 C CB  . ASP A 110 ? 0.4484 0.3174 0.3835 0.0383  -0.0234 0.0456  980  ASP A CB  
1360 C CG  . ASP A 110 ? 0.5529 0.4002 0.4661 0.0328  -0.0227 0.0497  980  ASP A CG  
1361 O OD1 . ASP A 110 ? 0.5483 0.3918 0.4556 0.0252  -0.0156 0.0480  980  ASP A OD1 
1362 O OD2 . ASP A 110 ? 0.6161 0.4499 0.5176 0.0357  -0.0295 0.0545  980  ASP A OD2 
1367 N N   . LEU A 111 ? 0.4313 0.3201 0.3710 0.0190  -0.0039 0.0369  981  LEU A N   
1368 C CA  . LEU A 111 ? 0.3821 0.2778 0.3182 0.0104  0.0003  0.0359  981  LEU A CA  
1369 C C   . LEU A 111 ? 0.4130 0.2958 0.3320 0.0046  -0.0001 0.0396  981  LEU A C   
1370 O O   . LEU A 111 ? 0.3876 0.2763 0.3031 -0.0015 0.0021  0.0393  981  LEU A O   
1371 C CB  . LEU A 111 ? 0.3825 0.2814 0.3218 0.0060  0.0068  0.0321  981  LEU A CB  
1372 C CG  . LEU A 111 ? 0.5073 0.4183 0.4611 0.0098  0.0087  0.0282  981  LEU A CG  
1373 C CD1 . LEU A 111 ? 0.4667 0.3783 0.4197 0.0044  0.0144  0.0250  981  LEU A CD1 
1374 C CD2 . LEU A 111 ? 0.4240 0.3514 0.3877 0.0106  0.0072  0.0273  981  LEU A CD2 
1386 N N   . GLY A 112 ? 0.3854 0.2497 0.2932 0.0066  -0.0026 0.0428  982  GLY A N   
1387 C CA  . GLY A 112 ? 0.3998 0.2491 0.2889 0.0008  -0.0028 0.0467  982  GLY A CA  
1388 C C   . GLY A 112 ? 0.3729 0.2261 0.2574 0.0004  -0.0071 0.0493  982  GLY A C   
1389 O O   . GLY A 112 ? 0.4204 0.2665 0.2906 -0.0067 -0.0054 0.0514  982  GLY A O   
1393 N N   . LEU A 113 ? 0.3829 0.2474 0.2791 0.0074  -0.0123 0.0489  983  LEU A N   
1394 C CA  . LEU A 113 ? 0.4004 0.2699 0.2928 0.0067  -0.0166 0.0507  983  LEU A CA  
1395 C C   . LEU A 113 ? 0.3976 0.2789 0.2907 -0.0010 -0.0108 0.0478  983  LEU A C   
1396 O O   . LEU A 113 ? 0.4148 0.2965 0.2998 -0.0041 -0.0123 0.0491  983  LEU A O   
1397 C CB  . LEU A 113 ? 0.4101 0.2913 0.3171 0.0151  -0.0232 0.0499  983  LEU A CB  
1398 C CG  . LEU A 113 ? 0.4639 0.3341 0.3692 0.0238  -0.0313 0.0533  983  LEU A CG  
1399 C CD1 . LEU A 113 ? 0.4420 0.3283 0.3667 0.0316  -0.0361 0.0510  983  LEU A CD1 
1400 C CD2 . LEU A 113 ? 0.4734 0.3284 0.3590 0.0223  -0.0374 0.0588  983  LEU A CD2 
1412 N N   . PHE A 114 ? 0.3655 0.2559 0.2678 -0.0040 -0.0043 0.0438  984  PHE A N   
1413 C CA  . PHE A 114 ? 0.3381 0.2403 0.2430 -0.0102 0.0011  0.0408  984  PHE A CA  
1414 C C   . PHE A 114 ? 0.4275 0.3247 0.3250 -0.0182 0.0078  0.0398  984  PHE A C   
1415 O O   . PHE A 114 ? 0.3271 0.2356 0.2298 -0.0227 0.0126  0.0365  984  PHE A O   
1416 C CB  . PHE A 114 ? 0.2916 0.2108 0.2143 -0.0072 0.0023  0.0367  984  PHE A CB  
1417 C CG  . PHE A 114 ? 0.3031 0.2294 0.2344 -0.0008 -0.0034 0.0369  984  PHE A CG  
1418 C CD1 . PHE A 114 ? 0.2924 0.2263 0.2241 -0.0019 -0.0051 0.0363  984  PHE A CD1 
1419 C CD2 . PHE A 114 ? 0.2942 0.2197 0.2335 0.0060  -0.0069 0.0372  984  PHE A CD2 
1420 C CE1 . PHE A 114 ? 0.3183 0.2591 0.2580 0.0030  -0.0104 0.0362  984  PHE A CE1 
1421 C CE2 . PHE A 114 ? 0.2859 0.2198 0.2348 0.0113  -0.0120 0.0369  984  PHE A CE2 
1422 C CZ  . PHE A 114 ? 0.3223 0.2638 0.2712 0.0094  -0.0140 0.0365  984  PHE A CZ  
1432 N N   . SER A 115 ? 0.3425 0.2229 0.2282 -0.0199 0.0079  0.0426  985  SER A N   
1433 C CA  . SER A 115 ? 0.3711 0.2461 0.2485 -0.0289 0.0143  0.0417  985  SER A CA  
1434 C C   . SER A 115 ? 0.3889 0.2648 0.2564 -0.0357 0.0171  0.0422  985  SER A C   
1435 O O   . SER A 115 ? 0.3820 0.2545 0.2424 -0.0338 0.0131  0.0448  985  SER A O   
1436 C CB  . SER A 115 ? 0.3873 0.2410 0.2516 -0.0299 0.0137  0.0449  985  SER A CB  
1437 O OG  . SER A 115 ? 0.4161 0.2543 0.2644 -0.0293 0.0093  0.0500  985  SER A OG  
1443 N N   . THR A 116 ? 0.3629 0.2438 0.2298 -0.0441 0.0240  0.0394  986  THR A N   
1444 C CA  . THR A 116 ? 0.4062 0.2887 0.2642 -0.0512 0.0282  0.0391  986  THR A CA  
1445 C C   . THR A 116 ? 0.4592 0.3207 0.2952 -0.0541 0.0263  0.0444  986  THR A C   
1446 O O   . THR A 116 ? 0.4145 0.2748 0.2416 -0.0553 0.0255  0.0456  986  THR A O   
1447 C CB  . THR A 116 ? 0.3776 0.2691 0.2397 -0.0599 0.0363  0.0349  986  THR A CB  
1448 O OG1 . THR A 116 ? 0.3504 0.2615 0.2319 -0.0564 0.0368  0.0303  986  THR A OG1 
1449 C CG2 . THR A 116 ? 0.3720 0.2649 0.2246 -0.0679 0.0419  0.0340  986  THR A CG2 
1457 N N   . LYS A 117 ? 0.4296 0.2734 0.2558 -0.0549 0.0251  0.0475  987  LYS A N   
1458 C CA  . LYS A 117 ? 0.4637 0.2845 0.2673 -0.0573 0.0227  0.0532  987  LYS A CA  
1459 C C   . LYS A 117 ? 0.4416 0.2582 0.2411 -0.0490 0.0138  0.0569  987  LYS A C   
1460 O O   . LYS A 117 ? 0.4662 0.2729 0.2489 -0.0521 0.0124  0.0601  987  LYS A O   
1461 C CB  . LYS A 117 ? 0.4951 0.2972 0.2913 -0.0573 0.0219  0.0556  987  LYS A CB  
1462 C CG  . LYS A 117 ? 0.8238 0.5986 0.5962 -0.0575 0.0175  0.0623  987  LYS A CG  
1463 C CD  . LYS A 117 ? 1.0426 0.7990 0.8103 -0.0552 0.0159  0.0643  987  LYS A CD  
1464 C CE  . LYS A 117 ? 1.2324 0.9593 0.9754 -0.0546 0.0108  0.0714  987  LYS A CE  
1465 N NZ  . LYS A 117 ? 1.2919 1.0089 1.0165 -0.0671 0.0169  0.0721  987  LYS A NZ  
1479 N N   . THR A 118 ? 0.4130 0.2372 0.2277 -0.0387 0.0078  0.0563  988  THR A N   
1480 C CA  . THR A 118 ? 0.4887 0.3109 0.3026 -0.0304 -0.0014 0.0594  988  THR A CA  
1481 C C   . THR A 118 ? 0.4866 0.3226 0.3028 -0.0318 -0.0013 0.0575  988  THR A C   
1482 O O   . THR A 118 ? 0.4191 0.2481 0.2240 -0.0303 -0.0071 0.0607  988  THR A O   
1483 C CB  . THR A 118 ? 0.5143 0.3444 0.3467 -0.0197 -0.0066 0.0582  988  THR A CB  
1484 O OG1 . THR A 118 ? 0.4662 0.2804 0.2942 -0.0170 -0.0078 0.0604  988  THR A OG1 
1485 C CG2 . THR A 118 ? 0.5383 0.3717 0.3737 -0.0117 -0.0158 0.0603  988  THR A CG2 
1493 N N   . LEU A 119 ? 0.4065 0.2611 0.2368 -0.0345 0.0048  0.0521  989  LEU A N   
1494 C CA  . LEU A 119 ? 0.3989 0.2666 0.2329 -0.0352 0.0053  0.0495  989  LEU A CA  
1495 C C   . LEU A 119 ? 0.4517 0.3109 0.2662 -0.0436 0.0092  0.0506  989  LEU A C   
1496 O O   . LEU A 119 ? 0.4742 0.3333 0.2815 -0.0433 0.0061  0.0512  989  LEU A O   
1497 C CB  . LEU A 119 ? 0.3923 0.2803 0.2456 -0.0355 0.0108  0.0436  989  LEU A CB  
1498 C CG  . LEU A 119 ? 0.4705 0.3679 0.3423 -0.0278 0.0075  0.0421  989  LEU A CG  
1499 C CD1 . LEU A 119 ? 0.5047 0.4187 0.3919 -0.0293 0.0133  0.0369  989  LEU A CD1 
1500 C CD2 . LEU A 119 ? 0.4328 0.3345 0.3100 -0.0207 -0.0001 0.0430  989  LEU A CD2 
1512 N N   . VAL A 120 ? 0.4789 0.3311 0.2846 -0.0517 0.0164  0.0505  990  VAL A N   
1513 C CA  . VAL A 120 ? 0.5961 0.4400 0.3827 -0.0610 0.0217  0.0511  990  VAL A CA  
1514 C C   . VAL A 120 ? 0.6297 0.4518 0.3934 -0.0604 0.0148  0.0577  990  VAL A C   
1515 O O   . VAL A 120 ? 0.5667 0.3847 0.3161 -0.0640 0.0149  0.0584  990  VAL A O   
1516 C CB  . VAL A 120 ? 0.5801 0.4208 0.3630 -0.0704 0.0309  0.0497  990  VAL A CB  
1517 C CG1 . VAL A 120 ? 0.6659 0.4924 0.4248 -0.0805 0.0360  0.0517  990  VAL A CG1 
1518 C CG2 . VAL A 120 ? 0.5577 0.4216 0.3615 -0.0721 0.0379  0.0428  990  VAL A CG2 
1528 N N   . GLU A 121 ? 0.5404 0.3483 0.3002 -0.0555 0.0085  0.0623  991  GLU A N   
1529 C CA  . GLU A 121 ? 0.6053 0.3918 0.3440 -0.0533 0.0002  0.0690  991  GLU A CA  
1530 C C   . GLU A 121 ? 0.6379 0.4311 0.3795 -0.0464 -0.0086 0.0695  991  GLU A C   
1531 O O   . GLU A 121 ? 0.6770 0.4568 0.3985 -0.0479 -0.0135 0.0736  991  GLU A O   
1532 C CB  . GLU A 121 ? 0.5949 0.3664 0.3325 -0.0474 -0.0053 0.0731  991  GLU A CB  
1533 C CG  . GLU A 121 ? 0.9537 0.7108 0.6797 -0.0561 0.0023  0.0740  991  GLU A CG  
1534 C CD  . GLU A 121 ? 1.1553 0.8997 0.8838 -0.0500 -0.0018 0.0765  991  GLU A CD  
1535 O OE1 . GLU A 121 ? 1.0788 0.8274 0.8199 -0.0385 -0.0101 0.0772  991  GLU A OE1 
1536 O OE2 . GLU A 121 ? 1.2212 0.9515 0.9392 -0.0570 0.0037  0.0774  991  GLU A OE2 
1543 N N   . ALA A 122 ? 0.4975 0.3112 0.2631 -0.0396 -0.0105 0.0654  992  ALA A N   
1544 C CA  . ALA A 122 ? 0.4970 0.3186 0.2679 -0.0333 -0.0189 0.0653  992  ALA A CA  
1545 C C   . ALA A 122 ? 0.5489 0.3759 0.3114 -0.0394 -0.0154 0.0626  992  ALA A C   
1546 O O   . ALA A 122 ? 0.5663 0.3864 0.3155 -0.0389 -0.0221 0.0651  992  ALA A O   
1547 C CB  . ALA A 122 ? 0.5105 0.3517 0.3091 -0.0255 -0.0207 0.0613  992  ALA A CB  
1553 N N   . ASN A 123 ? 0.5391 0.3786 0.3095 -0.0450 -0.0050 0.0572  993  ASN A N   
1554 C CA  . ASN A 123 ? 0.5124 0.3596 0.2787 -0.0499 -0.0004 0.0532  993  ASN A CA  
1555 C C   . ASN A 123 ? 0.5465 0.3982 0.3120 -0.0585 0.0123  0.0492  993  ASN A C   
1556 O O   . ASN A 123 ? 0.4635 0.3326 0.2469 -0.0581 0.0180  0.0436  993  ASN A O   
1557 C CB  . ASN A 123 ? 0.5013 0.3673 0.2882 -0.0438 -0.0031 0.0488  993  ASN A CB  
1558 C CG  . ASN A 123 ? 0.5895 0.4539 0.3788 -0.0362 -0.0153 0.0518  993  ASN A CG  
1559 O OD1 . ASN A 123 ? 0.5579 0.4160 0.3336 -0.0370 -0.0209 0.0534  993  ASN A OD1 
1560 N ND2 . ASN A 123 ? 0.4960 0.3664 0.3027 -0.0290 -0.0194 0.0524  993  ASN A ND2 
1567 N N   . ASN A 124 ? 0.4860 0.3216 0.2302 -0.0663 0.0163  0.0522  994  ASN A N   
1568 C CA  . ASN A 124 ? 0.5786 0.4168 0.3208 -0.0756 0.0284  0.0489  994  ASN A CA  
1569 C C   . ASN A 124 ? 0.5453 0.4011 0.2965 -0.0787 0.0367  0.0417  994  ASN A C   
1570 O O   . ASN A 124 ? 0.5614 0.4292 0.3243 -0.0827 0.0456  0.0371  994  ASN A O   
1571 C CB  . ASN A 124 ? 0.8577 0.6734 0.5705 -0.0844 0.0307  0.0536  994  ASN A CB  
1572 C CG  . ASN A 124 ? 1.0960 0.9136 0.8099 -0.0935 0.0419  0.0504  994  ASN A CG  
1573 O OD1 . ASN A 124 ? 1.1822 0.9987 0.9035 -0.0937 0.0430  0.0513  994  ASN A OD1 
1574 N ND2 . ASN A 124 ? 1.0867 0.9080 0.7950 -0.1008 0.0497  0.0460  994  ASN A ND2 
1581 N N   . GLU A 125 ? 0.4764 0.3330 0.2215 -0.0770 0.0336  0.0406  995  GLU A N   
1582 C CA  . GLU A 125 ? 0.4538 0.3232 0.2028 -0.0802 0.0417  0.0339  995  GLU A CA  
1583 C C   . GLU A 125 ? 0.4860 0.3738 0.2586 -0.0722 0.0392  0.0292  995  GLU A C   
1584 O O   . GLU A 125 ? 0.4472 0.3445 0.2236 -0.0730 0.0442  0.0236  995  GLU A O   
1585 C CB  . GLU A 125 ? 0.5386 0.3954 0.2630 -0.0846 0.0408  0.0349  995  GLU A CB  
1586 C CG  . GLU A 125 ? 0.7534 0.5934 0.4548 -0.0937 0.0453  0.0380  995  GLU A CG  
1587 C CD  . GLU A 125 ? 0.9983 0.8489 0.7086 -0.1007 0.0584  0.0322  995  GLU A CD  
1588 O OE1 . GLU A 125 ? 0.9652 0.8144 0.6806 -0.1030 0.0607  0.0337  995  GLU A OE1 
1589 O OE2 . GLU A 125 ? 1.1880 1.0487 0.9011 -0.1036 0.0661  0.0258  995  GLU A OE2 
1596 N N   . HIS A 126 ? 0.4101 0.3019 0.1978 -0.0647 0.0319  0.0314  996  HIS A N   
1597 C CA  . HIS A 126 ? 0.3796 0.2865 0.1876 -0.0574 0.0288  0.0278  996  HIS A CA  
1598 C C   . HIS A 126 ? 0.4114 0.3348 0.2354 -0.0582 0.0377  0.0211  996  HIS A C   
1599 O O   . HIS A 126 ? 0.3963 0.3244 0.2263 -0.0615 0.0441  0.0197  996  HIS A O   
1600 C CB  . HIS A 126 ? 0.3510 0.2595 0.1725 -0.0503 0.0212  0.0310  996  HIS A CB  
1601 C CG  . HIS A 126 ? 0.3845 0.3028 0.2201 -0.0433 0.0154  0.0292  996  HIS A CG  
1602 N ND1 . HIS A 126 ? 0.4446 0.3587 0.2729 -0.0413 0.0081  0.0305  996  HIS A ND1 
1603 C CD2 . HIS A 126 ? 0.3923 0.3241 0.2482 -0.0387 0.0158  0.0262  996  HIS A CD2 
1604 C CE1 . HIS A 126 ? 0.4433 0.3681 0.2874 -0.0360 0.0048  0.0282  996  HIS A CE1 
1605 N NE2 . HIS A 126 ? 0.3811 0.3161 0.2414 -0.0343 0.0095  0.0257  996  HIS A NE2 
1614 N N   . MET A 127 ? 0.3626 0.2946 0.1937 -0.0550 0.0377  0.0168  997  MET A N   
1615 C CA  . MET A 127 ? 0.4022 0.3493 0.2488 -0.0540 0.0447  0.0104  997  MET A CA  
1616 C C   . MET A 127 ? 0.3596 0.3174 0.2266 -0.0496 0.0440  0.0101  997  MET A C   
1617 O O   . MET A 127 ? 0.3320 0.2897 0.2065 -0.0442 0.0368  0.0128  997  MET A O   
1618 C CB  . MET A 127 ? 0.4244 0.3751 0.2735 -0.0502 0.0426  0.0068  997  MET A CB  
1619 C CG  . MET A 127 ? 0.4377 0.4027 0.3038 -0.0470 0.0479  0.0007  997  MET A CG  
1620 S SD  . MET A 127 ? 0.5803 0.5512 0.4436 -0.0532 0.0606  -0.0051 997  MET A SD  
1621 C CE  . MET A 127 ? 0.3964 0.3631 0.2483 -0.0534 0.0627  -0.0098 997  MET A CE  
1631 N N   . VAL A 128 ? 0.3202 0.2877 0.1961 -0.0522 0.0514  0.0065  998  VAL A N   
1632 C CA  . VAL A 128 ? 0.3393 0.3178 0.2342 -0.0484 0.0509  0.0054  998  VAL A CA  
1633 C C   . VAL A 128 ? 0.2869 0.2804 0.1956 -0.0468 0.0566  -0.0010 998  VAL A C   
1634 O O   . VAL A 128 ? 0.2976 0.2963 0.2055 -0.0516 0.0643  -0.0047 998  VAL A O   
1635 C CB  . VAL A 128 ? 0.3092 0.2853 0.2032 -0.0531 0.0531  0.0077  998  VAL A CB  
1636 C CG1 . VAL A 128 ? 0.2708 0.2593 0.1837 -0.0500 0.0530  0.0057  998  VAL A CG1 
1637 C CG2 . VAL A 128 ? 0.3160 0.2767 0.1979 -0.0531 0.0467  0.0142  998  VAL A CG2 
1647 N N   . GLU A 129 ? 0.2683 0.2683 0.1895 -0.0399 0.0528  -0.0025 999  GLU A N   
1648 C CA  . GLU A 129 ? 0.2884 0.3018 0.2238 -0.0368 0.0568  -0.0081 999  GLU A CA  
1649 C C   . GLU A 129 ? 0.3103 0.3333 0.2584 -0.0374 0.0581  -0.0085 999  GLU A C   
1650 O O   . GLU A 129 ? 0.2852 0.3047 0.2347 -0.0369 0.0535  -0.0046 999  GLU A O   
1651 C CB  . GLU A 129 ? 0.3063 0.3207 0.2487 -0.0294 0.0517  -0.0090 999  GLU A CB  
1652 C CG  . GLU A 129 ? 0.3448 0.3712 0.3017 -0.0248 0.0545  -0.0142 999  GLU A CG  
1653 C CD  . GLU A 129 ? 0.3368 0.3610 0.2971 -0.0184 0.0502  -0.0151 999  GLU A CD  
1654 O OE1 . GLU A 129 ? 0.3432 0.3589 0.2978 -0.0176 0.0446  -0.0115 999  GLU A OE1 
1655 O OE2 . GLU A 129 ? 0.3051 0.3360 0.2741 -0.0141 0.0525  -0.0196 999  GLU A OE2 
1662 N N   . VAL A 130 ? 0.2932 0.3286 0.2507 -0.0385 0.0642  -0.0137 1000 VAL A N   
1663 C CA  . VAL A 130 ? 0.3370 0.3826 0.3058 -0.0407 0.0658  -0.0147 1000 VAL A CA  
1664 C C   . VAL A 130 ? 0.3366 0.3968 0.3235 -0.0342 0.0652  -0.0191 1000 VAL A C   
1665 O O   . VAL A 130 ? 0.2877 0.3519 0.2780 -0.0302 0.0673  -0.0231 1000 VAL A O   
1666 C CB  . VAL A 130 ? 0.3532 0.4021 0.3175 -0.0494 0.0742  -0.0172 1000 VAL A CB  
1667 C CG1 . VAL A 130 ? 0.3177 0.3799 0.2958 -0.0522 0.0762  -0.0195 1000 VAL A CG1 
1668 C CG2 . VAL A 130 ? 0.3261 0.3582 0.2704 -0.0559 0.0742  -0.0120 1000 VAL A CG2 
1678 N N   . ARG A 131 ? 0.2899 0.3567 0.2873 -0.0331 0.0619  -0.0184 1001 ARG A N   
1679 C CA  . ARG A 131 ? 0.2004 0.2822 0.2149 -0.0282 0.0613  -0.0226 1001 ARG A CA  
1680 C C   . ARG A 131 ? 0.2228 0.3162 0.2451 -0.0344 0.0650  -0.0249 1001 ARG A C   
1681 O O   . ARG A 131 ? 0.2626 0.3510 0.2804 -0.0394 0.0634  -0.0216 1001 ARG A O   
1682 C CB  . ARG A 131 ? 0.1786 0.2582 0.1983 -0.0215 0.0533  -0.0198 1001 ARG A CB  
1683 C CG  . ARG A 131 ? 0.2317 0.3023 0.2467 -0.0152 0.0497  -0.0185 1001 ARG A CG  
1684 C CD  . ARG A 131 ? 0.2659 0.3427 0.2864 -0.0107 0.0530  -0.0238 1001 ARG A CD  
1685 N NE  . ARG A 131 ? 0.2784 0.3453 0.2933 -0.0055 0.0498  -0.0228 1001 ARG A NE  
1686 C CZ  . ARG A 131 ? 0.3610 0.4175 0.3634 -0.0077 0.0511  -0.0219 1001 ARG A CZ  
1687 N NH1 . ARG A 131 ? 0.2973 0.3510 0.2903 -0.0145 0.0554  -0.0214 1001 ARG A NH1 
1688 N NH2 . ARG A 131 ? 0.2888 0.3370 0.2871 -0.0035 0.0479  -0.0214 1001 ARG A NH2 
1702 N N   . THR A 132 ? 0.1926 0.3016 0.2270 -0.0341 0.0700  -0.0309 1002 THR A N   
1703 C CA  . THR A 132 ? 0.2335 0.3568 0.2786 -0.0400 0.0733  -0.0341 1002 THR A CA  
1704 C C   . THR A 132 ? 0.2250 0.3615 0.2875 -0.0329 0.0672  -0.0361 1002 THR A C   
1705 O O   . THR A 132 ? 0.2237 0.3659 0.2947 -0.0244 0.0655  -0.0388 1002 THR A O   
1706 C CB  . THR A 132 ? 0.2694 0.4040 0.3184 -0.0448 0.0832  -0.0402 1002 THR A CB  
1707 O OG1 . THR A 132 ? 0.2824 0.4029 0.3124 -0.0524 0.0885  -0.0377 1002 THR A OG1 
1708 C CG2 . THR A 132 ? 0.3046 0.4572 0.3680 -0.0509 0.0864  -0.0443 1002 THR A CG2 
1716 N N   . GLN A 133 ? 0.1972 0.3374 0.2638 -0.0366 0.0638  -0.0347 1003 GLN A N   
1717 C CA  . GLN A 133 ? 0.1740 0.3225 0.2529 -0.0303 0.0561  -0.0350 1003 GLN A CA  
1718 C C   . GLN A 133 ? 0.2389 0.4028 0.3292 -0.0367 0.0568  -0.0381 1003 GLN A C   
1719 O O   . GLN A 133 ? 0.2418 0.4065 0.3281 -0.0466 0.0630  -0.0390 1003 GLN A O   
1720 C CB  . GLN A 133 ? 0.1868 0.3189 0.2548 -0.0277 0.0490  -0.0287 1003 GLN A CB  
1721 C CG  . GLN A 133 ? 0.2027 0.3207 0.2608 -0.0216 0.0473  -0.0256 1003 GLN A CG  
1722 C CD  . GLN A 133 ? 0.2626 0.3654 0.3102 -0.0206 0.0417  -0.0198 1003 GLN A CD  
1723 O OE1 . GLN A 133 ? 0.2670 0.3667 0.3114 -0.0255 0.0403  -0.0177 1003 GLN A OE1 
1724 N NE2 . GLN A 133 ? 0.2082 0.3016 0.2507 -0.0146 0.0389  -0.0176 1003 GLN A NE2 
1733 N N   . LEU A 134 ? 0.2537 0.4293 0.3574 -0.0315 0.0503  -0.0398 1004 LEU A N   
1734 C CA  . LEU A 134 ? 0.2898 0.4792 0.4037 -0.0376 0.0489  -0.0423 1004 LEU A CA  
1735 C C   . LEU A 134 ? 0.3004 0.4767 0.4036 -0.0407 0.0430  -0.0372 1004 LEU A C   
1736 O O   . LEU A 134 ? 0.3119 0.4758 0.4077 -0.0342 0.0371  -0.0329 1004 LEU A O   
1737 C CB  . LEU A 134 ? 0.2951 0.5048 0.4294 -0.0301 0.0439  -0.0469 1004 LEU A CB  
1738 C CG  . LEU A 134 ? 0.3657 0.5910 0.5140 -0.0258 0.0496  -0.0531 1004 LEU A CG  
1739 C CD1 . LEU A 134 ? 0.3612 0.6015 0.5275 -0.0148 0.0420  -0.0561 1004 LEU A CD1 
1740 C CD2 . LEU A 134 ? 0.4554 0.6954 0.6111 -0.0366 0.0589  -0.0583 1004 LEU A CD2 
1752 N N   . LEU A 135 ? 0.2811 0.4595 0.3829 -0.0510 0.0452  -0.0379 1005 LEU A N   
1753 C CA  . LEU A 135 ? 0.2847 0.4508 0.3764 -0.0545 0.0404  -0.0340 1005 LEU A CA  
1754 C C   . LEU A 135 ? 0.3708 0.5483 0.4736 -0.0503 0.0318  -0.0355 1005 LEU A C   
1755 O O   . LEU A 135 ? 0.3293 0.5246 0.4455 -0.0545 0.0311  -0.0401 1005 LEU A O   
1756 C CB  . LEU A 135 ? 0.3383 0.5014 0.4238 -0.0674 0.0460  -0.0347 1005 LEU A CB  
1757 C CG  . LEU A 135 ? 0.3997 0.5496 0.4745 -0.0719 0.0419  -0.0315 1005 LEU A CG  
1758 C CD1 . LEU A 135 ? 0.3387 0.4667 0.3978 -0.0663 0.0395  -0.0255 1005 LEU A CD1 
1759 C CD2 . LEU A 135 ? 0.3569 0.5034 0.4256 -0.0850 0.0478  -0.0326 1005 LEU A CD2 
1771 N N   . GLN A 136 ? 0.2106 0.3777 0.3075 -0.0423 0.0250  -0.0317 1006 GLN A N   
1772 C CA  . GLN A 136 ? 0.2023 0.3772 0.3069 -0.0371 0.0159  -0.0323 1006 GLN A CA  
1773 C C   . GLN A 136 ? 0.2435 0.4091 0.3383 -0.0428 0.0120  -0.0301 1006 GLN A C   
1774 O O   . GLN A 136 ? 0.2665 0.4148 0.3465 -0.0468 0.0149  -0.0267 1006 GLN A O   
1775 C CB  . GLN A 136 ? 0.2191 0.3864 0.3210 -0.0256 0.0112  -0.0294 1006 GLN A CB  
1776 C CG  . GLN A 136 ? 0.2242 0.3999 0.3357 -0.0189 0.0143  -0.0320 1006 GLN A CG  
1777 C CD  . GLN A 136 ? 0.2630 0.4607 0.3942 -0.0143 0.0104  -0.0371 1006 GLN A CD  
1778 O OE1 . GLN A 136 ? 0.2359 0.4410 0.3723 -0.0144 0.0032  -0.0376 1006 GLN A OE1 
1779 N NE2 . GLN A 136 ? 0.2941 0.5025 0.4361 -0.0101 0.0150  -0.0411 1006 GLN A NE2 
1788 N N   . PRO A 137 ? 0.2471 0.4239 0.3498 -0.0428 0.0048  -0.0322 1007 PRO A N   
1789 C CA  . PRO A 137 ? 0.3304 0.4985 0.4232 -0.0485 0.0008  -0.0307 1007 PRO A CA  
1790 C C   . PRO A 137 ? 0.2847 0.4348 0.3635 -0.0424 -0.0038 -0.0258 1007 PRO A C   
1791 O O   . PRO A 137 ? 0.2583 0.4091 0.3396 -0.0332 -0.0087 -0.0243 1007 PRO A O   
1792 C CB  . PRO A 137 ? 0.3286 0.5167 0.4358 -0.0497 -0.0060 -0.0350 1007 PRO A CB  
1793 C CG  . PRO A 137 ? 0.3674 0.5697 0.4893 -0.0393 -0.0091 -0.0367 1007 PRO A CG  
1794 C CD  . PRO A 137 ? 0.2437 0.4419 0.3650 -0.0372 -0.0002 -0.0362 1007 PRO A CD  
1802 N N   . ALA A 138 ? 0.2326 0.3662 0.2967 -0.0477 -0.0019 -0.0234 1008 ALA A N   
1803 C CA  . ALA A 138 ? 0.2954 0.4126 0.3461 -0.0437 -0.0054 -0.0194 1008 ALA A CA  
1804 C C   . ALA A 138 ? 0.2675 0.3789 0.3168 -0.0341 -0.0058 -0.0163 1008 ALA A C   
1805 O O   . ALA A 138 ? 0.2805 0.3884 0.3296 -0.0327 -0.0002 -0.0153 1008 ALA A O   
1806 C CB  . ALA A 138 ? 0.3093 0.4304 0.3594 -0.0442 -0.0137 -0.0204 1008 ALA A CB  
1812 N N   . ASP A 139 ? 0.2363 0.3456 0.2833 -0.0280 -0.0126 -0.0146 1009 ASP A N   
1813 C CA  . ASP A 139 ? 0.2295 0.3305 0.2727 -0.0198 -0.0132 -0.0114 1009 ASP A CA  
1814 C C   . ASP A 139 ? 0.2708 0.3841 0.3261 -0.0122 -0.0175 -0.0128 1009 ASP A C   
1815 O O   . ASP A 139 ? 0.3233 0.4299 0.3753 -0.0050 -0.0202 -0.0103 1009 ASP A O   
1816 C CB  . ASP A 139 ? 0.2941 0.3808 0.3236 -0.0184 -0.0169 -0.0082 1009 ASP A CB  
1817 C CG  . ASP A 139 ? 0.4470 0.5385 0.4757 -0.0196 -0.0249 -0.0092 1009 ASP A CG  
1818 O OD1 . ASP A 139 ? 0.3479 0.4549 0.3888 -0.0182 -0.0294 -0.0119 1009 ASP A OD1 
1819 O OD2 . ASP A 139 ? 0.4852 0.5651 0.5010 -0.0219 -0.0266 -0.0076 1009 ASP A OD2 
1824 N N   . GLU A 140 ? 0.2306 0.3617 0.3001 -0.0139 -0.0178 -0.0170 1010 GLU A N   
1825 C CA  . GLU A 140 ? 0.2104 0.3560 0.2940 -0.0065 -0.0227 -0.0193 1010 GLU A CA  
1826 C C   . GLU A 140 ? 0.2442 0.3975 0.3378 -0.0041 -0.0161 -0.0218 1010 GLU A C   
1827 O O   . GLU A 140 ? 0.2569 0.4068 0.3473 -0.0098 -0.0081 -0.0221 1010 GLU A O   
1828 C CB  . GLU A 140 ? 0.2260 0.3895 0.3213 -0.0099 -0.0280 -0.0233 1010 GLU A CB  
1829 C CG  . GLU A 140 ? 0.2919 0.4486 0.3768 -0.0127 -0.0354 -0.0214 1010 GLU A CG  
1830 C CD  . GLU A 140 ? 0.3360 0.5094 0.4308 -0.0190 -0.0397 -0.0257 1010 GLU A CD  
1831 O OE1 . GLU A 140 ? 0.2717 0.4636 0.3830 -0.0212 -0.0367 -0.0303 1010 GLU A OE1 
1832 O OE2 . GLU A 140 ? 0.4383 0.6065 0.5240 -0.0221 -0.0459 -0.0247 1010 GLU A OE2 
1839 N N   . ASN A 141 ? 0.2364 0.3994 0.3413 0.0045  -0.0196 -0.0237 1011 ASN A N   
1840 C CA  . ASN A 141 ? 0.1856 0.3575 0.3011 0.0072  -0.0133 -0.0271 1011 ASN A CA  
1841 C C   . ASN A 141 ? 0.2055 0.3979 0.3402 0.0135  -0.0180 -0.0317 1011 ASN A C   
1842 O O   . ASN A 141 ? 0.2252 0.4163 0.3615 0.0225  -0.0261 -0.0305 1011 ASN A O   
1843 C CB  . ASN A 141 ? 0.2028 0.3589 0.3088 0.0133  -0.0108 -0.0240 1011 ASN A CB  
1844 C CG  . ASN A 141 ? 0.2608 0.4239 0.3751 0.0155  -0.0036 -0.0277 1011 ASN A CG  
1845 O OD1 . ASN A 141 ? 0.2483 0.4126 0.3612 0.0084  0.0043  -0.0291 1011 ASN A OD1 
1846 N ND2 . ASN A 141 ? 0.2318 0.3985 0.3538 0.0252  -0.0063 -0.0294 1011 ASN A ND2 
1853 N N   . TRP A 142 ? 0.2606 0.4718 0.4098 0.0086  -0.0130 -0.0372 1012 TRP A N   
1854 C CA  . TRP A 142 ? 0.2475 0.4824 0.4183 0.0133  -0.0168 -0.0427 1012 TRP A CA  
1855 C C   . TRP A 142 ? 0.2766 0.5214 0.4594 0.0175  -0.0090 -0.0474 1012 TRP A C   
1856 O O   . TRP A 142 ? 0.2311 0.4688 0.4066 0.0124  0.0007  -0.0474 1012 TRP A O   
1857 C CB  . TRP A 142 ? 0.2569 0.5086 0.4371 0.0031  -0.0167 -0.0464 1012 TRP A CB  
1858 C CG  . TRP A 142 ? 0.3055 0.5502 0.4759 -0.0008 -0.0249 -0.0431 1012 TRP A CG  
1859 C CD1 . TRP A 142 ? 0.2722 0.4978 0.4233 -0.0081 -0.0231 -0.0387 1012 TRP A CD1 
1860 C CD2 . TRP A 142 ? 0.2586 0.5150 0.4377 0.0025  -0.0363 -0.0442 1012 TRP A CD2 
1861 N NE1 . TRP A 142 ? 0.3381 0.5624 0.4845 -0.0100 -0.0321 -0.0373 1012 TRP A NE1 
1862 C CE2 . TRP A 142 ? 0.2880 0.5307 0.4507 -0.0037 -0.0407 -0.0404 1012 TRP A CE2 
1863 C CE3 . TRP A 142 ? 0.3622 0.6395 0.5615 0.0106  -0.0437 -0.0483 1012 TRP A CE3 
1864 C CZ2 . TRP A 142 ? 0.3378 0.5862 0.5019 -0.0030 -0.0521 -0.0403 1012 TRP A CZ2 
1865 C CZ3 . TRP A 142 ? 0.2971 0.5807 0.4988 0.0119  -0.0558 -0.0479 1012 TRP A CZ3 
1866 C CH2 . TRP A 142 ? 0.4009 0.6697 0.5843 0.0047  -0.0600 -0.0439 1012 TRP A CH2 
1877 N N   . ASP A 143 ? 0.2281 0.4893 0.4290 0.0270  -0.0134 -0.0516 1013 ASP A N   
1878 C CA  . ASP A 143 ? 0.2397 0.5129 0.4540 0.0309  -0.0054 -0.0574 1013 ASP A CA  
1879 C C   . ASP A 143 ? 0.3442 0.6340 0.5674 0.0187  0.0039  -0.0624 1013 ASP A C   
1880 O O   . ASP A 143 ? 0.3368 0.6324 0.5604 0.0097  0.0017  -0.0622 1013 ASP A O   
1881 C CB  . ASP A 143 ? 0.3855 0.6749 0.6196 0.0437  -0.0126 -0.0615 1013 ASP A CB  
1882 C CG  . ASP A 143 ? 0.3999 0.7185 0.6568 0.0407  -0.0151 -0.0675 1013 ASP A CG  
1883 O OD1 . ASP A 143 ? 0.4419 0.7805 0.7166 0.0398  -0.0072 -0.0747 1013 ASP A OD1 
1884 O OD2 . ASP A 143 ? 0.4266 0.7483 0.6835 0.0387  -0.0248 -0.0654 1013 ASP A OD2 
1889 N N   . PRO A 144 ? 0.4586 0.7546 0.6874 0.0177  0.0147  -0.0670 1014 PRO A N   
1890 C CA  . PRO A 144 ? 0.4990 0.8065 0.7320 0.0047  0.0253  -0.0711 1014 PRO A CA  
1891 C C   . PRO A 144 ? 0.5017 0.8361 0.7554 -0.0005 0.0228  -0.0765 1014 PRO A C   
1892 O O   . PRO A 144 ? 0.5148 0.8532 0.7663 -0.0138 0.0284  -0.0775 1014 PRO A O   
1893 C CB  . PRO A 144 ? 0.5070 0.8192 0.7454 0.0080  0.0357  -0.0761 1014 PRO A CB  
1894 C CG  . PRO A 144 ? 0.4506 0.7428 0.6772 0.0194  0.0319  -0.0720 1014 PRO A CG  
1895 C CD  . PRO A 144 ? 0.3771 0.6676 0.6065 0.0280  0.0181  -0.0685 1014 PRO A CD  
1903 N N   . THR A 145 ? 0.3756 0.7276 0.6488 0.0098  0.0142  -0.0799 1015 THR A N   
1904 C CA  . THR A 145 ? 0.4004 0.7708 0.6886 0.0055  0.0102  -0.0830 1015 THR A CA  
1905 C C   . THR A 145 ? 0.4727 0.8424 0.7561 0.0001  0.0002  -0.0798 1015 THR A C   
1906 O O   . THR A 145 ? 0.5131 0.8960 0.8063 -0.0051 -0.0038 -0.0819 1015 THR A O   
1907 C CB  . THR A 145 ? 0.4235 0.8069 0.7300 0.0189  0.0037  -0.0859 1015 THR A CB  
1908 O OG1 . THR A 145 ? 0.4052 0.7810 0.7089 0.0306  -0.0095 -0.0819 1015 THR A OG1 
1909 C CG2 . THR A 145 ? 0.4070 0.7899 0.7175 0.0252  0.0133  -0.0894 1015 THR A CG2 
1917 N N   . GLY A 146 ? 0.3605 0.7064 0.6227 0.0010  -0.0039 -0.0729 1016 GLY A N   
1918 C CA  . GLY A 146 ? 0.2927 0.6297 0.5435 -0.0044 -0.0125 -0.0684 1016 GLY A CA  
1919 C C   . GLY A 146 ? 0.3478 0.6963 0.6102 0.0047  -0.0269 -0.0689 1016 GLY A C   
1920 O O   . GLY A 146 ? 0.3455 0.6978 0.6069 -0.0010 -0.0344 -0.0683 1016 GLY A O   
1924 N N   . THR A 147 ? 0.3067 0.6593 0.5789 0.0191  -0.0312 -0.0698 1017 THR A N   
1925 C CA  . THR A 147 ? 0.4032 0.7667 0.6872 0.0296  -0.0455 -0.0702 1017 THR A CA  
1926 C C   . THR A 147 ? 0.4280 0.7655 0.6902 0.0362  -0.0558 -0.0620 1017 THR A C   
1927 O O   . THR A 147 ? 0.3409 0.6800 0.6014 0.0368  -0.0676 -0.0601 1017 THR A O   
1928 C CB  . THR A 147 ? 0.4900 0.8626 0.7903 0.0421  -0.0448 -0.0735 1017 THR A CB  
1929 O OG1 . THR A 147 ? 0.4647 0.8540 0.7794 0.0351  -0.0342 -0.0793 1017 THR A OG1 
1930 C CG2 . THR A 147 ? 0.5317 0.9085 0.8392 0.0529  -0.0596 -0.0718 1017 THR A CG2 
1938 N N   . LYS A 148 ? 0.3375 0.6512 0.5827 0.0407  -0.0512 -0.0574 1018 LYS A N   
1939 C CA  . LYS A 148 ? 0.2646 0.5534 0.4896 0.0474  -0.0596 -0.0500 1018 LYS A CA  
1940 C C   . LYS A 148 ? 0.2395 0.5018 0.4412 0.0426  -0.0511 -0.0448 1018 LYS A C   
1941 O O   . LYS A 148 ? 0.2553 0.5172 0.4580 0.0395  -0.0398 -0.0469 1018 LYS A O   
1942 C CB  . LYS A 148 ? 0.4170 0.7062 0.6501 0.0637  -0.0666 -0.0502 1018 LYS A CB  
1943 C CG  . LYS A 148 ? 0.5340 0.8241 0.7745 0.0696  -0.0566 -0.0537 1018 LYS A CG  
1944 C CD  . LYS A 148 ? 0.6829 0.9713 0.9304 0.0863  -0.0643 -0.0539 1018 LYS A CD  
1945 C CE  . LYS A 148 ? 0.7581 1.0371 1.0043 0.0925  -0.0549 -0.0556 1018 LYS A CE  
1946 N NZ  . LYS A 148 ? 0.7885 1.0807 1.0442 0.0846  -0.0405 -0.0615 1018 LYS A NZ  
1960 N N   . LYS A 149 ? 0.2801 0.5207 0.4608 0.0419  -0.0565 -0.0382 1019 LYS A N   
1961 C CA  . LYS A 149 ? 0.3215 0.5376 0.4815 0.0388  -0.0496 -0.0333 1019 LYS A CA  
1962 C C   . LYS A 149 ? 0.2891 0.4951 0.4475 0.0499  -0.0488 -0.0322 1019 LYS A C   
1963 O O   . LYS A 149 ? 0.3075 0.5139 0.4702 0.0605  -0.0576 -0.0317 1019 LYS A O   
1964 C CB  . LYS A 149 ? 0.2621 0.4592 0.4012 0.0348  -0.0551 -0.0274 1019 LYS A CB  
1965 C CG  . LYS A 149 ? 0.3356 0.5401 0.4741 0.0241  -0.0565 -0.0285 1019 LYS A CG  
1966 C CD  . LYS A 149 ? 0.5066 0.6925 0.6248 0.0220  -0.0631 -0.0232 1019 LYS A CD  
1967 C CE  . LYS A 149 ? 0.5892 0.7787 0.7035 0.0104  -0.0631 -0.0244 1019 LYS A CE  
1968 N NZ  . LYS A 149 ? 0.7361 0.9082 0.8306 0.0086  -0.0694 -0.0199 1019 LYS A NZ  
1982 N N   . ILE A 150 ? 0.2322 0.4283 0.3838 0.0474  -0.0388 -0.0318 1020 ILE A N   
1983 C CA  . ILE A 150 ? 0.1715 0.3559 0.3195 0.0563  -0.0370 -0.0309 1020 ILE A CA  
1984 C C   . ILE A 150 ? 0.2505 0.4125 0.3785 0.0513  -0.0308 -0.0263 1020 ILE A C   
1985 O O   . ILE A 150 ? 0.2332 0.3922 0.3537 0.0414  -0.0262 -0.0250 1020 ILE A O   
1986 C CB  . ILE A 150 ? 0.2707 0.4713 0.4362 0.0597  -0.0298 -0.0376 1020 ILE A CB  
1987 C CG1 . ILE A 150 ? 0.2170 0.4237 0.3828 0.0481  -0.0186 -0.0401 1020 ILE A CG1 
1988 C CG2 . ILE A 150 ? 0.3663 0.5908 0.5542 0.0661  -0.0360 -0.0428 1020 ILE A CG2 
1989 C CD1 . ILE A 150 ? 0.3237 0.5422 0.5021 0.0502  -0.0095 -0.0463 1020 ILE A CD1 
2001 N N   . TRP A 151 ? 0.1959 0.3424 0.3156 0.0582  -0.0310 -0.0240 1021 TRP A N   
2002 C CA  . TRP A 151 ? 0.2411 0.3679 0.3435 0.0537  -0.0257 -0.0201 1021 TRP A CA  
2003 C C   . TRP A 151 ? 0.2304 0.3603 0.3357 0.0503  -0.0153 -0.0234 1021 TRP A C   
2004 O O   . TRP A 151 ? 0.2177 0.3375 0.3118 0.0434  -0.0099 -0.0211 1021 TRP A O   
2005 C CB  . TRP A 151 ? 0.2679 0.3755 0.3587 0.0611  -0.0303 -0.0162 1021 TRP A CB  
2006 C CG  . TRP A 151 ? 0.2686 0.3651 0.3474 0.0607  -0.0384 -0.0110 1021 TRP A CG  
2007 C CD1 . TRP A 151 ? 0.3422 0.4467 0.4254 0.0627  -0.0470 -0.0107 1021 TRP A CD1 
2008 C CD2 . TRP A 151 ? 0.2492 0.3246 0.3090 0.0577  -0.0384 -0.0055 1021 TRP A CD2 
2009 N NE1 . TRP A 151 ? 0.2549 0.3433 0.3214 0.0610  -0.0522 -0.0053 1021 TRP A NE1 
2010 C CE2 . TRP A 151 ? 0.2872 0.3580 0.3396 0.0578  -0.0466 -0.0022 1021 TRP A CE2 
2011 C CE3 . TRP A 151 ? 0.2140 0.2747 0.2627 0.0545  -0.0323 -0.0035 1021 TRP A CE3 
2012 C CZ2 . TRP A 151 ? 0.2908 0.3425 0.3247 0.0546  -0.0478 0.0030  1021 TRP A CZ2 
2013 C CZ3 . TRP A 151 ? 0.2423 0.2858 0.2746 0.0515  -0.0338 0.0015  1021 TRP A CZ3 
2014 C CH2 . TRP A 151 ? 0.2615 0.3003 0.2863 0.0515  -0.0410 0.0046  1021 TRP A CH2 
2025 N N   . HIS A 152 ? 0.2214 0.3651 0.3413 0.0551  -0.0124 -0.0290 1022 HIS A N   
2026 C CA  . HIS A 152 ? 0.2392 0.3845 0.3600 0.0521  -0.0024 -0.0324 1022 HIS A CA  
2027 C C   . HIS A 152 ? 0.2273 0.3786 0.3466 0.0405  0.0039  -0.0327 1022 HIS A C   
2028 O O   . HIS A 152 ? 0.2371 0.4042 0.3668 0.0365  0.0034  -0.0351 1022 HIS A O   
2029 C CB  . HIS A 152 ? 0.2670 0.4279 0.4050 0.0592  0.0002  -0.0392 1022 HIS A CB  
2030 C CG  . HIS A 152 ? 0.3773 0.5407 0.5154 0.0551  0.0111  -0.0432 1022 HIS A CG  
2031 N ND1 . HIS A 152 ? 0.4445 0.6244 0.5917 0.0477  0.0181  -0.0474 1022 HIS A ND1 
2032 C CD2 . HIS A 152 ? 0.3996 0.5501 0.5284 0.0567  0.0162  -0.0436 1022 HIS A CD2 
2033 C CE1 . HIS A 152 ? 0.5172 0.6938 0.6599 0.0451  0.0271  -0.0501 1022 HIS A CE1 
2034 N NE2 . HIS A 152 ? 0.5303 0.6894 0.6620 0.0506  0.0258  -0.0479 1022 HIS A NE2 
2043 N N   . CYS A 153 ? 0.2127 0.3512 0.3189 0.0350  0.0096  -0.0304 1023 CYS A N   
2044 C CA  . CYS A 153 ? 0.2326 0.3719 0.3337 0.0244  0.0151  -0.0296 1023 CYS A CA  
2045 C C   . CYS A 153 ? 0.2333 0.3771 0.3360 0.0213  0.0243  -0.0336 1023 CYS A C   
2046 O O   . CYS A 153 ? 0.2390 0.3709 0.3323 0.0223  0.0275  -0.0328 1023 CYS A O   
2047 C CB  . CYS A 153 ? 0.2265 0.3471 0.3107 0.0206  0.0137  -0.0235 1023 CYS A CB  
2048 S SG  . CYS A 153 ? 0.2966 0.4135 0.3718 0.0089  0.0200  -0.0219 1023 CYS A SG  
2054 N N   A GLU A 154 ? 0.2331 0.3938 0.3472 0.0168  0.0288  -0.0382 1024 GLU A N   
2055 N N   B GLU A 154 ? 0.2344 0.3953 0.3487 0.0170  0.0287  -0.0382 1024 GLU A N   
2056 C CA  A GLU A 154 ? 0.2100 0.3761 0.3256 0.0132  0.0384  -0.0425 1024 GLU A CA  
2057 C CA  B GLU A 154 ? 0.2167 0.3828 0.3320 0.0127  0.0383  -0.0424 1024 GLU A CA  
2058 C C   A GLU A 154 ? 0.2136 0.3660 0.3123 0.0042  0.0433  -0.0389 1024 GLU A C   
2059 C C   B GLU A 154 ? 0.2030 0.3536 0.3006 0.0046  0.0425  -0.0383 1024 GLU A C   
2060 O O   A GLU A 154 ? 0.2010 0.3523 0.2955 -0.0035 0.0433  -0.0365 1024 GLU A O   
2061 O O   B GLU A 154 ? 0.2375 0.3839 0.3289 -0.0019 0.0410  -0.0348 1024 GLU A O   
2062 C CB  A GLU A 154 ? 0.2860 0.4749 0.4187 0.0097  0.0422  -0.0486 1024 GLU A CB  
2063 C CB  B GLU A 154 ? 0.2884 0.4759 0.4188 0.0075  0.0424  -0.0477 1024 GLU A CB  
2064 C CG  A GLU A 154 ? 0.3239 0.5208 0.4607 0.0077  0.0526  -0.0544 1024 GLU A CG  
2065 C CG  B GLU A 154 ? 0.3358 0.5292 0.4669 0.0023  0.0535  -0.0525 1024 GLU A CG  
2066 C CD  A GLU A 154 ? 0.3794 0.5796 0.5246 0.0189  0.0528  -0.0587 1024 GLU A CD  
2067 C CD  B GLU A 154 ? 0.4210 0.6358 0.5668 -0.0046 0.0585  -0.0578 1024 GLU A CD  
2068 O OE1 A GLU A 154 ? 0.3668 0.5793 0.5277 0.0271  0.0471  -0.0613 1024 GLU A OE1 
2069 O OE1 B GLU A 154 ? 0.5159 0.7487 0.6803 0.0004  0.0545  -0.0617 1024 GLU A OE1 
2070 O OE2 A GLU A 154 ? 0.4930 0.6829 0.6284 0.0196  0.0582  -0.0596 1024 GLU A OE2 
2071 O OE2 B GLU A 154 ? 0.4156 0.6291 0.5540 -0.0152 0.0662  -0.0582 1024 GLU A OE2 
2084 N N   . SER A 155 ? 0.1971 0.3387 0.2860 0.0053  0.0472  -0.0388 1025 SER A N   
2085 C CA  . SER A 155 ? 0.2147 0.3410 0.2865 -0.0013 0.0498  -0.0346 1025 SER A CA  
2086 C C   . SER A 155 ? 0.2699 0.3919 0.3350 -0.0016 0.0565  -0.0374 1025 SER A C   
2087 O O   . SER A 155 ? 0.2538 0.3654 0.3127 0.0036  0.0546  -0.0365 1025 SER A O   
2088 C CB  . SER A 155 ? 0.2719 0.3830 0.3344 0.0020  0.0426  -0.0287 1025 SER A CB  
2089 O OG  . SER A 155 ? 0.2474 0.3458 0.2958 -0.0041 0.0434  -0.0243 1025 SER A OG  
2096 N N   . ASN A 156 ? 0.2389 0.3683 0.3044 -0.0084 0.0644  -0.0408 1026 ASN A N   
2097 C CA  . ASN A 156 ? 0.3071 0.4348 0.3674 -0.0090 0.0719  -0.0448 1026 ASN A CA  
2098 C C   . ASN A 156 ? 0.2997 0.4108 0.3395 -0.0159 0.0743  -0.0408 1026 ASN A C   
2099 O O   . ASN A 156 ? 0.2931 0.3997 0.3256 -0.0232 0.0741  -0.0369 1026 ASN A O   
2100 C CB  . ASN A 156 ? 0.3492 0.4955 0.4218 -0.0126 0.0802  -0.0517 1026 ASN A CB  
2101 C CG  . ASN A 156 ? 0.4875 0.6521 0.5823 -0.0049 0.0771  -0.0561 1026 ASN A CG  
2102 O OD1 . ASN A 156 ? 0.4425 0.6051 0.5422 0.0051  0.0720  -0.0566 1026 ASN A OD1 
2103 N ND2 . ASN A 156 ? 0.4493 0.6313 0.5571 -0.0098 0.0798  -0.0593 1026 ASN A ND2 
2110 N N   . ARG A 157 ? 0.2710 0.3728 0.3015 -0.0134 0.0760  -0.0419 1027 ARG A N   
2111 C CA  . ARG A 157 ? 0.3647 0.4498 0.3754 -0.0184 0.0762  -0.0378 1027 ARG A CA  
2112 C C   . ARG A 157 ? 0.3632 0.4477 0.3637 -0.0270 0.0850  -0.0401 1027 ARG A C   
2113 O O   . ARG A 157 ? 0.3102 0.4043 0.3162 -0.0272 0.0927  -0.0465 1027 ARG A O   
2114 C CB  . ARG A 157 ? 0.4430 0.5175 0.4473 -0.0124 0.0732  -0.0380 1027 ARG A CB  
2115 C CG  . ARG A 157 ? 0.4746 0.5324 0.4595 -0.0166 0.0713  -0.0336 1027 ARG A CG  
2116 C CD  . ARG A 157 ? 0.5208 0.5688 0.5005 -0.0112 0.0674  -0.0339 1027 ARG A CD  
2117 N NE  . ARG A 157 ? 0.9236 0.9699 0.8973 -0.0114 0.0738  -0.0395 1027 ARG A NE  
2118 C CZ  . ARG A 157 ? 0.8538 0.8875 0.8120 -0.0134 0.0734  -0.0392 1027 ARG A CZ  
2119 N NH1 . ARG A 157 ? 0.5990 0.6217 0.5474 -0.0151 0.0666  -0.0335 1027 ARG A NH1 
2120 N NH2 . ARG A 157 ? 0.9658 0.9984 0.9186 -0.0136 0.0800  -0.0452 1027 ARG A NH2 
2134 N N   . SER A 158 ? 0.3200 0.3924 0.3050 -0.0340 0.0841  -0.0348 1028 SER A N   
2135 C CA  . SER A 158 ? 0.3750 0.4412 0.3444 -0.0424 0.0914  -0.0355 1028 SER A CA  
2136 C C   . SER A 158 ? 0.3865 0.4341 0.3370 -0.0456 0.0859  -0.0283 1028 SER A C   
2137 O O   . SER A 158 ? 0.3369 0.3790 0.2889 -0.0411 0.0776  -0.0238 1028 SER A O   
2138 C CB  . SER A 158 ? 0.3267 0.4035 0.3012 -0.0504 0.0987  -0.0378 1028 SER A CB  
2139 O OG  . SER A 158 ? 0.3631 0.4370 0.3378 -0.0535 0.0939  -0.0326 1028 SER A OG  
2145 N N   . HIS A 159 ? 0.3101 0.3482 0.2429 -0.0533 0.0905  -0.0273 1029 HIS A N   
2146 C CA  . HIS A 159 ? 0.3487 0.3690 0.2633 -0.0558 0.0846  -0.0204 1029 HIS A CA  
2147 C C   . HIS A 159 ? 0.3933 0.4057 0.2932 -0.0657 0.0890  -0.0177 1029 HIS A C   
2148 O O   . HIS A 159 ? 0.3605 0.3773 0.2570 -0.0722 0.0984  -0.0218 1029 HIS A O   
2149 C CB  . HIS A 159 ? 0.3696 0.3800 0.2715 -0.0536 0.0827  -0.0209 1029 HIS A CB  
2150 C CG  . HIS A 159 ? 0.3316 0.3456 0.2447 -0.0446 0.0772  -0.0225 1029 HIS A CG  
2151 N ND1 . HIS A 159 ? 0.3406 0.3654 0.2662 -0.0398 0.0813  -0.0290 1029 HIS A ND1 
2152 C CD2 . HIS A 159 ? 0.3517 0.3596 0.2656 -0.0397 0.0681  -0.0184 1029 HIS A CD2 
2153 C CE1 . HIS A 159 ? 0.3533 0.3767 0.2853 -0.0326 0.0748  -0.0284 1029 HIS A CE1 
2154 N NE2 . HIS A 159 ? 0.3771 0.3910 0.3024 -0.0328 0.0671  -0.0222 1029 HIS A NE2 
2163 N N   . THR A 160 ? 0.3314 0.3312 0.2220 -0.0669 0.0825  -0.0108 1030 THR A N   
2164 C CA  . THR A 160 ? 0.3692 0.3581 0.2442 -0.0759 0.0854  -0.0072 1030 THR A CA  
2165 C C   . THR A 160 ? 0.3600 0.3299 0.2179 -0.0748 0.0768  0.0001  1030 THR A C   
2166 O O   . THR A 160 ? 0.3666 0.3336 0.2243 -0.0684 0.0701  0.0012  1030 THR A O   
2167 C CB  . THR A 160 ? 0.3906 0.3870 0.2773 -0.0788 0.0871  -0.0070 1030 THR A CB  
2168 O OG1 . THR A 160 ? 0.3946 0.3796 0.2651 -0.0887 0.0913  -0.0040 1030 THR A OG1 
2169 C CG2 . THR A 160 ? 0.4026 0.3977 0.2986 -0.0718 0.0776  -0.0030 1030 THR A CG2 
2177 N N   . THR A 161 ? 0.3931 0.3497 0.2364 -0.0811 0.0768  0.0050  1031 THR A N   
2178 C CA  . THR A 161 ? 0.3934 0.3321 0.2220 -0.0791 0.0677  0.0122  1031 THR A CA  
2179 C C   . THR A 161 ? 0.4085 0.3452 0.2451 -0.0768 0.0630  0.0159  1031 THR A C   
2180 O O   . THR A 161 ? 0.3673 0.3126 0.2147 -0.0797 0.0677  0.0136  1031 THR A O   
2181 C CB  . THR A 161 ? 0.4568 0.3773 0.2586 -0.0874 0.0701  0.0158  1031 THR A CB  
2182 O OG1 . THR A 161 ? 0.4485 0.3660 0.2463 -0.0958 0.0768  0.0163  1031 THR A OG1 
2183 C CG2 . THR A 161 ? 0.4967 0.4179 0.2878 -0.0910 0.0761  0.0116  1031 THR A CG2 
2191 N N   . ILE A 162 ? 0.3488 0.2743 0.1803 -0.0715 0.0536  0.0214  1032 ILE A N   
2192 C CA  . ILE A 162 ? 0.3643 0.2872 0.2032 -0.0686 0.0492  0.0245  1032 ILE A CA  
2193 C C   . ILE A 162 ? 0.3913 0.3025 0.2176 -0.0771 0.0538  0.0269  1032 ILE A C   
2194 O O   . ILE A 162 ? 0.4021 0.3165 0.2374 -0.0782 0.0552  0.0264  1032 ILE A O   
2195 C CB  . ILE A 162 ? 0.4383 0.3526 0.2755 -0.0607 0.0385  0.0293  1032 ILE A CB  
2196 C CG1 . ILE A 162 ? 0.5812 0.4958 0.4297 -0.0564 0.0349  0.0310  1032 ILE A CG1 
2197 C CG2 . ILE A 162 ? 0.4735 0.3682 0.2872 -0.0631 0.0344  0.0347  1032 ILE A CG2 
2198 C CD1 . ILE A 162 ? 0.5118 0.4271 0.3681 -0.0473 0.0259  0.0331  1032 ILE A CD1 
2210 N N   . ALA A 163 ? 0.4262 0.3232 0.2307 -0.0838 0.0563  0.0294  1033 ALA A N   
2211 C CA  . ALA A 163 ? 0.4399 0.3242 0.2301 -0.0933 0.0616  0.0316  1033 ALA A CA  
2212 C C   . ALA A 163 ? 0.4417 0.3417 0.2446 -0.1002 0.0718  0.0256  1033 ALA A C   
2213 O O   . ALA A 163 ? 0.4496 0.3463 0.2533 -0.1051 0.0743  0.0263  1033 ALA A O   
2214 C CB  . ALA A 163 ? 0.5352 0.4018 0.2980 -0.1000 0.0634  0.0349  1033 ALA A CB  
2220 N N   . LYS A 164 ? 0.3974 0.3146 0.2106 -0.1006 0.0775  0.0195  1034 LYS A N   
2221 C CA  . LYS A 164 ? 0.3943 0.3285 0.2211 -0.1067 0.0869  0.0133  1034 LYS A CA  
2222 C C   . LYS A 164 ? 0.3739 0.3235 0.2247 -0.1009 0.0838  0.0109  1034 LYS A C   
2223 O O   . LYS A 164 ? 0.4120 0.3682 0.2704 -0.1065 0.0881  0.0087  1034 LYS A O   
2224 C CB  . LYS A 164 ? 0.4562 0.4038 0.2868 -0.1082 0.0943  0.0071  1034 LYS A CB  
2225 C CG  . LYS A 164 ? 0.5541 0.4887 0.3639 -0.1150 0.0981  0.0078  1034 LYS A CG  
2226 C CD  . LYS A 164 ? 0.6473 0.5968 0.4666 -0.1207 0.1078  0.0003  1034 LYS A CD  
2227 C CE  . LYS A 164 ? 0.8103 0.7475 0.6103 -0.1263 0.1110  0.0002  1034 LYS A CE  
2228 N NZ  . LYS A 164 ? 0.9824 0.9352 0.7927 -0.1314 0.1210  -0.0076 1034 LYS A NZ  
2242 N N   . TYR A 165 ? 0.3668 0.3220 0.2290 -0.0902 0.0763  0.0112  1035 TYR A N   
2243 C CA  . TYR A 165 ? 0.3593 0.3270 0.2416 -0.0851 0.0732  0.0093  1035 TYR A CA  
2244 C C   . TYR A 165 ? 0.3834 0.3381 0.2600 -0.0873 0.0700  0.0137  1035 TYR A C   
2245 O O   . TYR A 165 ? 0.3463 0.3088 0.2335 -0.0898 0.0717  0.0115  1035 TYR A O   
2246 C CB  . TYR A 165 ? 0.3395 0.3141 0.2337 -0.0739 0.0661  0.0090  1035 TYR A CB  
2247 C CG  . TYR A 165 ? 0.3062 0.2942 0.2196 -0.0703 0.0645  0.0065  1035 TYR A CG  
2248 C CD1 . TYR A 165 ? 0.3232 0.3300 0.2523 -0.0707 0.0689  0.0006  1035 TYR A CD1 
2249 C CD2 . TYR A 165 ? 0.2448 0.2262 0.1600 -0.0671 0.0587  0.0099  1035 TYR A CD2 
2250 C CE1 . TYR A 165 ? 0.3542 0.3724 0.2993 -0.0678 0.0666  -0.0014 1035 TYR A CE1 
2251 C CE2 . TYR A 165 ? 0.2515 0.2436 0.1817 -0.0648 0.0573  0.0076  1035 TYR A CE2 
2252 C CZ  . TYR A 165 ? 0.3510 0.3612 0.2956 -0.0652 0.0608  0.0022  1035 TYR A CZ  
2253 O OH  . TYR A 165 ? 0.2805 0.3002 0.2384 -0.0629 0.0583  0.0005  1035 TYR A OH  
2263 N N   . ALA A 166 ? 0.3759 0.3103 0.2349 -0.0866 0.0654  0.0197  1036 ALA A N   
2264 C CA  . ALA A 166 ? 0.4011 0.3205 0.2529 -0.0881 0.0625  0.0238  1036 ALA A CA  
2265 C C   . ALA A 166 ? 0.3979 0.3151 0.2449 -0.0996 0.0701  0.0223  1036 ALA A C   
2266 O O   . ALA A 166 ? 0.3976 0.3130 0.2492 -0.1011 0.0694  0.0223  1036 ALA A O   
2267 C CB  . ALA A 166 ? 0.4041 0.3014 0.2365 -0.0856 0.0564  0.0305  1036 ALA A CB  
2273 N N   . GLN A 167 ? 0.4220 0.3389 0.2590 -0.1085 0.0777  0.0208  1037 GLN A N   
2274 C CA  . GLN A 167 ? 0.4594 0.3749 0.2918 -0.1209 0.0859  0.0189  1037 GLN A CA  
2275 C C   . GLN A 167 ? 0.4706 0.4094 0.3264 -0.1220 0.0891  0.0125  1037 GLN A C   
2276 O O   . GLN A 167 ? 0.3947 0.3332 0.2527 -0.1286 0.0914  0.0112  1037 GLN A O   
2277 C CB  . GLN A 167 ? 0.4951 0.4113 0.3192 -0.1269 0.0918  0.0162  1037 GLN A CB  
2278 C CG  . GLN A 167 ? 0.9366 0.8289 0.7364 -0.1279 0.0887  0.0216  1037 GLN A CG  
2279 C CD  . GLN A 167 ? 1.3376 1.2336 1.1311 -0.1321 0.0944  0.0183  1037 GLN A CD  
2280 O OE1 . GLN A 167 ? 1.3986 1.3130 1.2052 -0.1363 0.1017  0.0117  1037 GLN A OE1 
2281 N NE2 . GLN A 167 ? 1.4164 1.2952 1.1903 -0.1307 0.0907  0.0227  1037 GLN A NE2 
2290 N N   . TYR A 168 ? 0.4038 0.3628 0.2770 -0.1152 0.0885  0.0082  1038 TYR A N   
2291 C CA  . TYR A 168 ? 0.4047 0.3867 0.3010 -0.1144 0.0901  0.0022  1038 TYR A CA  
2292 C C   . TYR A 168 ? 0.4084 0.3889 0.3128 -0.1094 0.0830  0.0038  1038 TYR A C   
2293 O O   . TYR A 168 ? 0.3339 0.3223 0.2470 -0.1145 0.0847  0.0009  1038 TYR A O   
2294 C CB  . TYR A 168 ? 0.3697 0.3699 0.2806 -0.1064 0.0898  -0.0020 1038 TYR A CB  
2295 C CG  . TYR A 168 ? 0.3698 0.3915 0.3045 -0.1023 0.0882  -0.0069 1038 TYR A CG  
2296 C CD1 . TYR A 168 ? 0.4961 0.5351 0.4431 -0.1094 0.0945  -0.0126 1038 TYR A CD1 
2297 C CD2 . TYR A 168 ? 0.3742 0.3988 0.3186 -0.0916 0.0800  -0.0057 1038 TYR A CD2 
2298 C CE1 . TYR A 168 ? 0.4240 0.4826 0.3923 -0.1052 0.0919  -0.0169 1038 TYR A CE1 
2299 C CE2 . TYR A 168 ? 0.3617 0.4042 0.3256 -0.0879 0.0779  -0.0097 1038 TYR A CE2 
2300 C CZ  . TYR A 168 ? 0.3812 0.4405 0.3568 -0.0944 0.0833  -0.0151 1038 TYR A CZ  
2301 O OH  . TYR A 168 ? 0.3347 0.4118 0.3295 -0.0902 0.0801  -0.0189 1038 TYR A OH  
2311 N N   . GLN A 169 ? 0.2970 0.2675 0.1981 -0.0999 0.0752  0.0080  1039 GLN A N   
2312 C CA  . GLN A 169 ? 0.3276 0.2959 0.2355 -0.0946 0.0690  0.0093  1039 GLN A CA  
2313 C C   . GLN A 169 ? 0.4113 0.3633 0.3075 -0.1019 0.0700  0.0117  1039 GLN A C   
2314 O O   . GLN A 169 ? 0.3672 0.3239 0.2713 -0.1041 0.0695  0.0095  1039 GLN A O   
2315 C CB  . GLN A 169 ? 0.2980 0.2581 0.2035 -0.0838 0.0615  0.0132  1039 GLN A CB  
2316 C CG  . GLN A 169 ? 0.3034 0.2629 0.2169 -0.0774 0.0557  0.0140  1039 GLN A CG  
2317 C CD  . GLN A 169 ? 0.3711 0.3213 0.2809 -0.0681 0.0492  0.0180  1039 GLN A CD  
2318 O OE1 . GLN A 169 ? 0.3482 0.2824 0.2436 -0.0682 0.0477  0.0222  1039 GLN A OE1 
2319 N NE2 . GLN A 169 ? 0.2934 0.2538 0.2160 -0.0603 0.0453  0.0166  1039 GLN A NE2 
2328 N N   . ALA A 170 ? 0.4042 0.3360 0.2804 -0.1059 0.0711  0.0162  1040 ALA A N   
2329 C CA  . ALA A 170 ? 0.5196 0.4311 0.3814 -0.1121 0.0716  0.0193  1040 ALA A CA  
2330 C C   . ALA A 170 ? 0.5622 0.4800 0.4258 -0.1249 0.0791  0.0152  1040 ALA A C   
2331 O O   . ALA A 170 ? 0.5146 0.4262 0.3777 -0.1288 0.0787  0.0148  1040 ALA A O   
2332 C CB  . ALA A 170 ? 0.6007 0.4883 0.4392 -0.1133 0.0707  0.0254  1040 ALA A CB  
2338 N N   . SER A 171 ? 0.5826 0.5130 0.4487 -0.1317 0.0861  0.0118  1041 SER A N   
2339 C CA  . SER A 171 ? 0.8288 0.7693 0.7009 -0.1417 0.0918  0.0065  1041 SER A CA  
2340 C C   . SER A 171 ? 0.7398 0.7029 0.6340 -0.1418 0.0916  0.0013  1041 SER A C   
2341 O O   . SER A 171 ? 0.6619 0.6286 0.5606 -0.1486 0.0929  -0.0020 1041 SER A O   
2342 C CB  . SER A 171 ? 0.8564 0.8061 0.7284 -0.1457 0.0977  0.0031  1041 SER A CB  
2343 O OG  . SER A 171 ? 0.9330 0.9067 0.8229 -0.1412 0.0995  -0.0012 1041 SER A OG  
2349 N N   . SER A 172 ? 0.6196 0.5978 0.5287 -0.1314 0.0874  -0.0001 1042 SER A N   
2350 C CA  . SER A 172 ? 0.6089 0.6065 0.5386 -0.1274 0.0838  -0.0044 1042 SER A CA  
2351 C C   . SER A 172 ? 0.6286 0.6142 0.5544 -0.1283 0.0795  -0.0028 1042 SER A C   
2352 O O   . SER A 172 ? 0.6320 0.6271 0.5664 -0.1343 0.0802  -0.0066 1042 SER A O   
2353 C CB  . SER A 172 ? 0.5386 0.5456 0.4790 -0.1139 0.0780  -0.0042 1042 SER A CB  
2354 O OG  . SER A 172 ? 0.6849 0.7099 0.6439 -0.1099 0.0743  -0.0080 1042 SER A OG  
2360 N N   . PHE A 173 ? 0.4269 0.3916 0.3396 -0.1221 0.0749  0.0027  1043 PHE A N   
2361 C CA  . PHE A 173 ? 0.4742 0.4243 0.3815 -0.1208 0.0707  0.0046  1043 PHE A CA  
2362 C C   . PHE A 173 ? 0.7355 0.6733 0.6315 -0.1340 0.0755  0.0041  1043 PHE A C   
2363 O O   . PHE A 173 ? 0.6115 0.5384 0.5034 -0.1354 0.0733  0.0042  1043 PHE A O   
2364 C CB  . PHE A 173 ? 0.5377 0.4684 0.4332 -0.1114 0.0658  0.0105  1043 PHE A CB  
2365 C CG  . PHE A 173 ? 0.8767 0.7906 0.7658 -0.1086 0.0619  0.0125  1043 PHE A CG  
2366 C CD1 . PHE A 173 ? 1.0437 0.9585 0.9394 -0.0972 0.0560  0.0134  1043 PHE A CD1 
2367 C CD2 . PHE A 173 ? 1.0330 0.9289 0.9087 -0.1173 0.0645  0.0133  1043 PHE A CD2 
2368 C CE1 . PHE A 173 ? 1.1142 1.0139 1.0044 -0.0942 0.0531  0.0146  1043 PHE A CE1 
2369 C CE2 . PHE A 173 ? 1.1632 1.0426 1.0327 -0.1140 0.0612  0.0147  1043 PHE A CE2 
2370 C CZ  . PHE A 173 ? 1.1747 1.0564 1.0518 -0.1021 0.0557  0.0152  1043 PHE A CZ  
2380 N N   . GLN A 174 ? 0.8137 0.7533 0.7043 -0.1442 0.0826  0.0030  1044 GLN A N   
2381 C CA  . GLN A 174 ? 0.9176 0.8466 0.7985 -0.1550 0.0860  0.0016  1044 GLN A CA  
2382 C C   . GLN A 174 ? 1.0123 0.9657 0.9102 -0.1624 0.0892  -0.0057 1044 GLN A C   
2383 O O   . GLN A 174 ? 1.1373 1.0890 1.0358 -0.1685 0.0887  -0.0083 1044 GLN A O   
2384 C CB  . GLN A 174 ? 1.0721 0.9851 0.9352 -0.1579 0.0890  0.0046  1044 GLN A CB  
2385 C CG  . GLN A 174 ? 1.1952 1.0765 1.0363 -0.1548 0.0854  0.0113  1044 GLN A CG  
2386 C CD  . GLN A 174 ? 1.2538 1.1283 1.0950 -0.1438 0.0797  0.0158  1044 GLN A CD  
2387 O OE1 . GLN A 174 ? 1.4166 1.3097 1.2741 -0.1382 0.0780  0.0138  1044 GLN A OE1 
2388 N NE2 . GLN A 174 ? 1.1032 0.9519 0.9274 -0.1392 0.0758  0.0216  1044 GLN A NE2 
2397 N N   . GLU A 175 ? 1.0405 1.0165 0.9523 -0.1614 0.0920  -0.0092 1045 GLU A N   
2398 C CA  . GLU A 175 ? 1.2862 1.2891 1.2179 -0.1660 0.0942  -0.0163 1045 GLU A CA  
2399 C C   . GLU A 175 ? 1.4111 1.4255 1.3564 -0.1657 0.0895  -0.0191 1045 GLU A C   
2400 O O   . GLU A 175 ? 1.3951 1.4183 1.3469 -0.1730 0.0900  -0.0236 1045 GLU A O   
2401 C CB  . GLU A 175 ? 1.3724 1.3967 1.3182 -0.1608 0.0966  -0.0189 1045 GLU A CB  
2402 C CG  . GLU A 175 ? 1.4424 1.4973 1.4122 -0.1623 0.0976  -0.0263 1045 GLU A CG  
2403 C CD  . GLU A 175 ? 1.4812 1.5550 1.4647 -0.1548 0.0991  -0.0286 1045 GLU A CD  
2404 O OE1 . GLU A 175 ? 1.4466 1.5151 1.4270 -0.1466 0.0967  -0.0249 1045 GLU A OE1 
2405 O OE2 . GLU A 175 ? 1.5080 1.6015 1.5051 -0.1568 0.1028  -0.0343 1045 GLU A OE2 
2412 N N   . SER A 176 ? 1.4703 1.4845 1.4193 -0.1572 0.0846  -0.0167 1046 SER A N   
2413 C CA  . SER A 176 ? 1.4246 1.4483 1.3852 -0.1534 0.0779  -0.0192 1046 SER A CA  
2414 C C   . SER A 176 ? 1.4689 1.4763 1.4183 -0.1626 0.0778  -0.0193 1046 SER A C   
2415 O O   . SER A 176 ? 1.6068 1.6255 1.5655 -0.1672 0.0755  -0.0236 1046 SER A O   
2416 C CB  . SER A 176 ? 1.2276 1.2459 1.1885 -0.1384 0.0706  -0.0156 1046 SER A CB  
2417 O OG  . SER A 176 ? 1.1298 1.1211 1.0726 -0.1366 0.0690  -0.0107 1046 SER A OG  
2423 N N   . LEU A 177 ? 1.0898 1.0659 0.9696 -0.0956 0.0498  0.0385  1047 LEU A N   
2424 C CA  . LEU A 177 ? 1.0167 0.9861 0.8915 -0.0969 0.0492  0.0379  1047 LEU A CA  
2425 C C   . LEU A 177 ? 1.1773 1.1401 1.0471 -0.0995 0.0532  0.0365  1047 LEU A C   
2426 O O   . LEU A 177 ? 1.1655 1.1294 1.0369 -0.1032 0.0544  0.0352  1047 LEU A O   
2427 C CB  . LEU A 177 ? 0.8120 0.7719 0.6788 -0.0930 0.0466  0.0391  1047 LEU A CB  
2428 C CG  . LEU A 177 ? 0.8275 0.7754 0.6856 -0.0926 0.0467  0.0390  1047 LEU A CG  
2429 C CD1 . LEU A 177 ? 0.7337 0.6739 0.5854 -0.0879 0.0440  0.0408  1047 LEU A CD1 
2430 C CD2 . LEU A 177 ? 0.8844 0.8250 0.7366 -0.0947 0.0506  0.0379  1047 LEU A CD2 
2442 N N   . PRO A 208 ? 0.9702 1.1168 1.0536 -0.0777 0.0592  0.0545  1078 PRO A N   
2443 C CA  . PRO A 208 ? 0.9910 1.1319 1.0631 -0.0824 0.0573  0.0530  1078 PRO A CA  
2444 C C   . PRO A 208 ? 0.9504 1.0781 1.0049 -0.0810 0.0555  0.0511  1078 PRO A C   
2445 O O   . PRO A 208 ? 1.0253 1.1486 1.0705 -0.0839 0.0524  0.0504  1078 PRO A O   
2446 C CB  . PRO A 208 ? 0.9546 1.1061 1.0338 -0.0843 0.0507  0.0554  1078 PRO A CB  
2447 C CG  . PRO A 208 ? 0.8542 1.0117 0.9409 -0.0792 0.0475  0.0578  1078 PRO A CG  
2448 C CD  . PRO A 208 ? 0.8299 0.9871 0.9233 -0.0754 0.0534  0.0576  1078 PRO A CD  
2456 N N   . PHE A 209 ? 0.7361 0.8575 0.7866 -0.0767 0.0575  0.0503  1079 PHE A N   
2457 C CA  . PHE A 209 ? 0.5902 0.7000 0.6255 -0.0749 0.0552  0.0487  1079 PHE A CA  
2458 C C   . PHE A 209 ? 0.5178 0.6149 0.5405 -0.0757 0.0598  0.0461  1079 PHE A C   
2459 O O   . PHE A 209 ? 0.4833 0.5789 0.5084 -0.0755 0.0656  0.0453  1079 PHE A O   
2460 C CB  . PHE A 209 ? 0.5739 0.6846 0.6113 -0.0695 0.0525  0.0495  1079 PHE A CB  
2461 C CG  . PHE A 209 ? 0.4264 0.5484 0.4748 -0.0683 0.0479  0.0522  1079 PHE A CG  
2462 C CD1 . PHE A 209 ? 0.4696 0.5930 0.5146 -0.0704 0.0425  0.0529  1079 PHE A CD1 
2463 C CD2 . PHE A 209 ? 0.5116 0.6419 0.5730 -0.0651 0.0490  0.0540  1079 PHE A CD2 
2464 C CE1 . PHE A 209 ? 0.5543 0.6874 0.6083 -0.0695 0.0381  0.0555  1079 PHE A CE1 
2465 C CE2 . PHE A 209 ? 0.4701 0.6104 0.5411 -0.0638 0.0445  0.0568  1079 PHE A CE2 
2466 C CZ  . PHE A 209 ? 0.5094 0.6510 0.5763 -0.0661 0.0389  0.0576  1079 PHE A CZ  
2476 N N   . LYS A 210 ? 0.5311 0.6186 0.5400 -0.0766 0.0572  0.0450  1080 LYS A N   
2477 C CA  . LYS A 210 ? 0.5137 0.5881 0.5086 -0.0771 0.0602  0.0429  1080 LYS A CA  
2478 C C   . LYS A 210 ? 0.4758 0.5449 0.4667 -0.0723 0.0600  0.0422  1080 LYS A C   
2479 O O   . LYS A 210 ? 0.4827 0.5566 0.4789 -0.0689 0.0563  0.0432  1080 LYS A O   
2480 C CB  . LYS A 210 ? 0.5320 0.5989 0.5151 -0.0792 0.0569  0.0424  1080 LYS A CB  
2481 C CG  . LYS A 210 ? 0.8150 0.8677 0.7826 -0.0795 0.0589  0.0407  1080 LYS A CG  
2482 C CD  . LYS A 210 ? 0.9261 0.9724 0.8838 -0.0816 0.0558  0.0406  1080 LYS A CD  
2483 C CE  . LYS A 210 ? 0.9641 0.9962 0.9065 -0.0820 0.0579  0.0393  1080 LYS A CE  
2484 N NZ  . LYS A 210 ? 0.9653 0.9950 0.9060 -0.0864 0.0637  0.0386  1080 LYS A NZ  
2498 N N   . THR A 211 ? 0.3859 0.4450 0.3673 -0.0723 0.0640  0.0405  1081 THR A N   
2499 C CA  . THR A 211 ? 0.4667 0.5195 0.4422 -0.0683 0.0631  0.0396  1081 THR A CA  
2500 C C   . THR A 211 ? 0.4408 0.4825 0.4013 -0.0680 0.0594  0.0388  1081 THR A C   
2501 O O   . THR A 211 ? 0.3390 0.3739 0.2905 -0.0711 0.0603  0.0383  1081 THR A O   
2502 C CB  . THR A 211 ? 0.5679 0.6156 0.5410 -0.0684 0.0695  0.0381  1081 THR A CB  
2503 O OG1 . THR A 211 ? 0.6612 0.6994 0.6229 -0.0719 0.0729  0.0370  1081 THR A OG1 
2504 C CG2 . THR A 211 ? 0.7194 0.7777 0.7081 -0.0685 0.0740  0.0389  1081 THR A CG2 
2512 N N   . ILE A 212 ? 0.3344 0.3742 0.2928 -0.0643 0.0552  0.0386  1082 ILE A N   
2513 C CA  . ILE A 212 ? 0.3180 0.3476 0.2635 -0.0633 0.0514  0.0380  1082 ILE A CA  
2514 C C   . ILE A 212 ? 0.3554 0.3793 0.2960 -0.0601 0.0510  0.0368  1082 ILE A C   
2515 O O   . ILE A 212 ? 0.3166 0.3455 0.2648 -0.0581 0.0528  0.0365  1082 ILE A O   
2516 C CB  . ILE A 212 ? 0.2993 0.3325 0.2475 -0.0621 0.0457  0.0390  1082 ILE A CB  
2517 C CG1 . ILE A 212 ? 0.2945 0.3373 0.2548 -0.0589 0.0439  0.0398  1082 ILE A CG1 
2518 C CG2 . ILE A 212 ? 0.3156 0.3520 0.2653 -0.0660 0.0457  0.0399  1082 ILE A CG2 
2519 C CD1 . ILE A 212 ? 0.4404 0.4848 0.4018 -0.0570 0.0385  0.0404  1082 ILE A CD1 
2531 N N   . LYS A 213 ? 0.2873 0.3006 0.2151 -0.0595 0.0485  0.0361  1083 LYS A N   
2532 C CA  . LYS A 213 ? 0.2895 0.2967 0.2114 -0.0568 0.0473  0.0348  1083 LYS A CA  
2533 C C   . LYS A 213 ? 0.3429 0.3471 0.2614 -0.0540 0.0409  0.0351  1083 LYS A C   
2534 O O   . LYS A 213 ? 0.3294 0.3303 0.2432 -0.0549 0.0382  0.0359  1083 LYS A O   
2535 C CB  . LYS A 213 ? 0.3336 0.3298 0.2424 -0.0588 0.0506  0.0338  1083 LYS A CB  
2536 C CG  . LYS A 213 ? 0.4031 0.4014 0.3153 -0.0615 0.0578  0.0333  1083 LYS A CG  
2537 C CD  . LYS A 213 ? 0.5056 0.4920 0.4039 -0.0636 0.0616  0.0320  1083 LYS A CD  
2538 C CE  . LYS A 213 ? 0.7402 0.7194 0.6287 -0.0669 0.0623  0.0327  1083 LYS A CE  
2539 N NZ  . LYS A 213 ? 0.8512 0.8225 0.7312 -0.0702 0.0690  0.0316  1083 LYS A NZ  
2553 N N   . PHE A 214 ? 0.3384 0.3436 0.2594 -0.0507 0.0388  0.0342  1084 PHE A N   
2554 C CA  . PHE A 214 ? 0.2759 0.2809 0.1978 -0.0477 0.0331  0.0343  1084 PHE A CA  
2555 C C   . PHE A 214 ? 0.3154 0.3128 0.2292 -0.0459 0.0313  0.0328  1084 PHE A C   
2556 O O   . PHE A 214 ? 0.3113 0.3099 0.2273 -0.0451 0.0337  0.0316  1084 PHE A O   
2557 C CB  . PHE A 214 ? 0.2423 0.2584 0.1782 -0.0456 0.0326  0.0348  1084 PHE A CB  
2558 C CG  . PHE A 214 ? 0.2563 0.2733 0.1953 -0.0422 0.0276  0.0346  1084 PHE A CG  
2559 C CD1 . PHE A 214 ? 0.2676 0.2772 0.1989 -0.0412 0.0234  0.0344  1084 PHE A CD1 
2560 C CD2 . PHE A 214 ? 0.2367 0.2620 0.1870 -0.0400 0.0275  0.0348  1084 PHE A CD2 
2561 C CE1 . PHE A 214 ? 0.2478 0.2589 0.1835 -0.0382 0.0193  0.0341  1084 PHE A CE1 
2562 C CE2 . PHE A 214 ? 0.2728 0.2989 0.2263 -0.0371 0.0236  0.0345  1084 PHE A CE2 
2563 C CZ  . PHE A 214 ? 0.2648 0.2840 0.2113 -0.0362 0.0196  0.0340  1084 PHE A CZ  
2573 N N   . GLY A 215 ? 0.2671 0.2562 0.1712 -0.0454 0.0272  0.0330  1085 GLY A N   
2574 C CA  . GLY A 215 ? 0.2863 0.2687 0.1832 -0.0436 0.0242  0.0318  1085 GLY A CA  
2575 C C   . GLY A 215 ? 0.3046 0.2920 0.2100 -0.0401 0.0201  0.0313  1085 GLY A C   
2576 O O   . GLY A 215 ? 0.2854 0.2744 0.1942 -0.0388 0.0166  0.0323  1085 GLY A O   
2580 N N   . THR A 216 ? 0.2832 0.2727 0.1920 -0.0387 0.0209  0.0297  1086 THR A N   
2581 C CA  . THR A 216 ? 0.2426 0.2383 0.1616 -0.0356 0.0182  0.0291  1086 THR A CA  
2582 C C   . THR A 216 ? 0.2551 0.2469 0.1708 -0.0338 0.0154  0.0272  1086 THR A C   
2583 O O   . THR A 216 ? 0.3164 0.3029 0.2244 -0.0351 0.0172  0.0259  1086 THR A O   
2584 C CB  . THR A 216 ? 0.2609 0.2664 0.1921 -0.0353 0.0225  0.0293  1086 THR A CB  
2585 O OG1 . THR A 216 ? 0.3031 0.3144 0.2439 -0.0324 0.0201  0.0290  1086 THR A OG1 
2586 C CG2 . THR A 216 ? 0.2717 0.2769 0.2022 -0.0363 0.0275  0.0279  1086 THR A CG2 
2594 N N   . ASN A 217 ? 0.2819 0.2762 0.2036 -0.0310 0.0112  0.0268  1087 ASN A N   
2595 C CA  . ASN A 217 ? 0.2837 0.2755 0.2043 -0.0294 0.0080  0.0249  1087 ASN A CA  
2596 C C   . ASN A 217 ? 0.3247 0.3066 0.2313 -0.0307 0.0055  0.0244  1087 ASN A C   
2597 O O   . ASN A 217 ? 0.3111 0.2896 0.2127 -0.0314 0.0061  0.0225  1087 ASN A O   
2598 C CB  . ASN A 217 ? 0.2878 0.2844 0.2149 -0.0290 0.0122  0.0231  1087 ASN A CB  
2599 C CG  . ASN A 217 ? 0.2846 0.2908 0.2249 -0.0278 0.0149  0.0241  1087 ASN A CG  
2600 O OD1 . ASN A 217 ? 0.2798 0.2896 0.2228 -0.0292 0.0195  0.0251  1087 ASN A OD1 
2601 N ND2 . ASN A 217 ? 0.2853 0.2955 0.2337 -0.0252 0.0120  0.0239  1087 ASN A ND2 
2608 N N   . ILE A 218 ? 0.2525 0.2292 0.1521 -0.0313 0.0028  0.0262  1088 ILE A N   
2609 C CA  . ILE A 218 ? 0.2693 0.2360 0.1549 -0.0325 -0.0001 0.0263  1088 ILE A CA  
2610 C C   . ILE A 218 ? 0.2907 0.2557 0.1770 -0.0300 -0.0069 0.0257  1088 ILE A C   
2611 O O   . ILE A 218 ? 0.2784 0.2465 0.1721 -0.0277 -0.0104 0.0266  1088 ILE A O   
2612 C CB  . ILE A 218 ? 0.2538 0.2154 0.1322 -0.0338 -0.0003 0.0287  1088 ILE A CB  
2613 C CG1 . ILE A 218 ? 0.3303 0.2947 0.2098 -0.0365 0.0064  0.0292  1088 ILE A CG1 
2614 C CG2 . ILE A 218 ? 0.2779 0.2284 0.1410 -0.0350 -0.0033 0.0292  1088 ILE A CG2 
2615 C CD1 . ILE A 218 ? 0.3162 0.2787 0.1932 -0.0377 0.0070  0.0315  1088 ILE A CD1 
2627 N N   . ASP A 219 ? 0.3194 0.2795 0.1983 -0.0306 -0.0088 0.0240  1089 ASP A N   
2628 C CA  . ASP A 219 ? 0.3105 0.2708 0.1922 -0.0284 -0.0150 0.0229  1089 ASP A CA  
2629 C C   . ASP A 219 ? 0.3430 0.2963 0.2168 -0.0276 -0.0218 0.0247  1089 ASP A C   
2630 O O   . ASP A 219 ? 0.3828 0.3276 0.2429 -0.0294 -0.0234 0.0252  1089 ASP A O   
2631 C CB  . ASP A 219 ? 0.3307 0.2900 0.2096 -0.0295 -0.0139 0.0200  1089 ASP A CB  
2632 C CG  . ASP A 219 ? 0.4166 0.3843 0.3074 -0.0290 -0.0083 0.0182  1089 ASP A CG  
2633 O OD1 . ASP A 219 ? 0.3400 0.3149 0.2435 -0.0265 -0.0094 0.0182  1089 ASP A OD1 
2634 O OD2 . ASP A 219 ? 0.3842 0.3512 0.2719 -0.0311 -0.0025 0.0171  1089 ASP A OD2 
2639 N N   . LEU A 220 ? 0.2919 0.2486 0.1747 -0.0248 -0.0257 0.0259  1090 LEU A N   
2640 C CA  . LEU A 220 ? 0.3221 0.2733 0.2004 -0.0233 -0.0325 0.0277  1090 LEU A CA  
2641 C C   . LEU A 220 ? 0.3582 0.3109 0.2412 -0.0214 -0.0386 0.0261  1090 LEU A C   
2642 O O   . LEU A 220 ? 0.3734 0.3276 0.2634 -0.0188 -0.0435 0.0271  1090 LEU A O   
2643 C CB  . LEU A 220 ? 0.3521 0.3058 0.2380 -0.0215 -0.0327 0.0299  1090 LEU A CB  
2644 C CG  . LEU A 220 ? 0.4981 0.4460 0.3754 -0.0230 -0.0306 0.0326  1090 LEU A CG  
2645 C CD1 . LEU A 220 ? 0.4019 0.3477 0.2707 -0.0265 -0.0245 0.0321  1090 LEU A CD1 
2646 C CD2 . LEU A 220 ? 0.3752 0.3274 0.2622 -0.0217 -0.0290 0.0339  1090 LEU A CD2 
2658 N N   . SER A 221 ? 0.3293 0.2817 0.2088 -0.0229 -0.0379 0.0235  1091 SER A N   
2659 C CA  . SER A 221 ? 0.3161 0.2709 0.2009 -0.0216 -0.0430 0.0214  1091 SER A CA  
2660 C C   . SER A 221 ? 0.3912 0.3386 0.2657 -0.0218 -0.0509 0.0223  1091 SER A C   
2661 O O   . SER A 221 ? 0.4130 0.3627 0.2935 -0.0202 -0.0568 0.0213  1091 SER A O   
2662 C CB  . SER A 221 ? 0.3964 0.3538 0.2819 -0.0234 -0.0386 0.0180  1091 SER A CB  
2663 O OG  . SER A 221 ? 0.3871 0.3372 0.2577 -0.0267 -0.0359 0.0177  1091 SER A OG  
2669 N N   . ASP A 222 ? 0.3596 0.2983 0.2187 -0.0238 -0.0512 0.0241  1092 ASP A N   
2670 C CA  . ASP A 222 ? 0.3997 0.3305 0.2467 -0.0244 -0.0586 0.0250  1092 ASP A CA  
2671 C C   . ASP A 222 ? 0.4900 0.4191 0.3396 -0.0215 -0.0651 0.0284  1092 ASP A C   
2672 O O   . ASP A 222 ? 0.4481 0.3731 0.2929 -0.0213 -0.0635 0.0313  1092 ASP A O   
2673 C CB  . ASP A 222 ? 0.4780 0.3990 0.3062 -0.0281 -0.0558 0.0255  1092 ASP A CB  
2674 C CG  . ASP A 222 ? 0.6201 0.5324 0.4340 -0.0293 -0.0632 0.0260  1092 ASP A CG  
2675 O OD1 . ASP A 222 ? 0.5660 0.4786 0.3833 -0.0269 -0.0714 0.0275  1092 ASP A OD1 
2676 O OD2 . ASP A 222 ? 0.5747 0.4798 0.3738 -0.0329 -0.0607 0.0248  1092 ASP A OD2 
2681 N N   . ASP A 223 ? 0.5017 0.4340 0.3595 -0.0192 -0.0722 0.0281  1093 ASP A N   
2682 C CA  . ASP A 223 ? 0.5111 0.4428 0.3741 -0.0159 -0.0782 0.0313  1093 ASP A CA  
2683 C C   . ASP A 223 ? 0.5291 0.4502 0.3761 -0.0165 -0.0830 0.0348  1093 ASP A C   
2684 O O   . ASP A 223 ? 0.6098 0.5286 0.4586 -0.0141 -0.0858 0.0381  1093 ASP A O   
2685 C CB  . ASP A 223 ? 0.6662 0.6039 0.5423 -0.0134 -0.0848 0.0301  1093 ASP A CB  
2686 C CG  . ASP A 223 ? 0.9591 0.8965 0.8424 -0.0097 -0.0905 0.0334  1093 ASP A CG  
2687 O OD1 . ASP A 223 ? 0.9489 0.8894 0.8414 -0.0078 -0.0865 0.0346  1093 ASP A OD1 
2688 O OD2 . ASP A 223 ? 1.0023 0.9363 0.8820 -0.0088 -0.0989 0.0349  1093 ASP A OD2 
2693 N N   . LYS A 224 ? 0.4764 0.3906 0.3075 -0.0198 -0.0838 0.0339  1094 LYS A N   
2694 C CA  . LYS A 224 ? 0.6835 0.5866 0.4974 -0.0208 -0.0875 0.0372  1094 LYS A CA  
2695 C C   . LYS A 224 ? 0.7090 0.6077 0.5167 -0.0217 -0.0804 0.0393  1094 LYS A C   
2696 O O   . LYS A 224 ? 0.8096 0.7020 0.6114 -0.0205 -0.0830 0.0431  1094 LYS A O   
2697 C CB  . LYS A 224 ? 0.7086 0.6047 0.5059 -0.0245 -0.0894 0.0355  1094 LYS A CB  
2698 C CG  . LYS A 224 ? 0.9218 0.8217 0.7240 -0.0241 -0.0969 0.0333  1094 LYS A CG  
2699 C CD  . LYS A 224 ? 1.1770 1.0699 0.9623 -0.0284 -0.0980 0.0310  1094 LYS A CD  
2700 C CE  . LYS A 224 ? 1.2183 1.1141 1.0042 -0.0314 -0.0887 0.0267  1094 LYS A CE  
2701 N NZ  . LYS A 224 ? 1.1062 1.0142 0.9126 -0.0294 -0.0862 0.0239  1094 LYS A NZ  
2715 N N   . LYS A 225 ? 0.4593 0.3616 0.2692 -0.0237 -0.0716 0.0370  1095 LYS A N   
2716 C CA  . LYS A 225 ? 0.4664 0.3648 0.2700 -0.0253 -0.0645 0.0385  1095 LYS A CA  
2717 C C   . LYS A 225 ? 0.4768 0.3803 0.2932 -0.0226 -0.0624 0.0403  1095 LYS A C   
2718 O O   . LYS A 225 ? 0.4388 0.3377 0.2497 -0.0233 -0.0590 0.0425  1095 LYS A O   
2719 C CB  . LYS A 225 ? 0.5345 0.4348 0.3358 -0.0286 -0.0559 0.0354  1095 LYS A CB  
2720 C CG  . LYS A 225 ? 0.5474 0.4393 0.3316 -0.0322 -0.0556 0.0340  1095 LYS A CG  
2721 C CD  . LYS A 225 ? 0.5215 0.4170 0.3071 -0.0350 -0.0472 0.0305  1095 LYS A CD  
2722 C CE  . LYS A 225 ? 0.6169 0.5027 0.3843 -0.0389 -0.0460 0.0290  1095 LYS A CE  
2723 N NZ  . LYS A 225 ? 0.5932 0.4820 0.3625 -0.0415 -0.0375 0.0256  1095 LYS A NZ  
2737 N N   . TRP A 226 ? 0.4090 0.3219 0.2423 -0.0199 -0.0640 0.0391  1096 TRP A N   
2738 C CA  . TRP A 226 ? 0.4036 0.3218 0.2494 -0.0179 -0.0608 0.0400  1096 TRP A CA  
2739 C C   . TRP A 226 ? 0.4335 0.3548 0.2912 -0.0139 -0.0672 0.0413  1096 TRP A C   
2740 O O   . TRP A 226 ? 0.3570 0.2856 0.2291 -0.0120 -0.0652 0.0405  1096 TRP A O   
2741 C CB  . TRP A 226 ? 0.4074 0.3347 0.2638 -0.0187 -0.0541 0.0370  1096 TRP A CB  
2742 C CG  . TRP A 226 ? 0.3986 0.3239 0.2456 -0.0224 -0.0476 0.0356  1096 TRP A CG  
2743 C CD1 . TRP A 226 ? 0.3803 0.3076 0.2256 -0.0243 -0.0456 0.0326  1096 TRP A CD1 
2744 C CD2 . TRP A 226 ? 0.3531 0.2740 0.1918 -0.0248 -0.0419 0.0370  1096 TRP A CD2 
2745 N NE1 . TRP A 226 ? 0.3888 0.3132 0.2256 -0.0275 -0.0389 0.0322  1096 TRP A NE1 
2746 C CE2 . TRP A 226 ? 0.3841 0.3048 0.2169 -0.0279 -0.0367 0.0348  1096 TRP A CE2 
2747 C CE3 . TRP A 226 ? 0.3849 0.3020 0.2209 -0.0248 -0.0405 0.0397  1096 TRP A CE3 
2748 C CZ2 . TRP A 226 ? 0.3784 0.2957 0.2037 -0.0309 -0.0302 0.0352  1096 TRP A CZ2 
2749 C CZ3 . TRP A 226 ? 0.4005 0.3140 0.2283 -0.0279 -0.0342 0.0401  1096 TRP A CZ3 
2750 C CH2 . TRP A 226 ? 0.4313 0.3451 0.2541 -0.0309 -0.0292 0.0379  1096 TRP A CH2 
2761 N N   . LYS A 227 ? 0.4455 0.3610 0.2969 -0.0126 -0.0749 0.0433  1097 LYS A N   
2762 C CA  . LYS A 227 ? 0.4517 0.3707 0.3152 -0.0088 -0.0816 0.0443  1097 LYS A CA  
2763 C C   . LYS A 227 ? 0.3967 0.3185 0.2721 -0.0062 -0.0790 0.0460  1097 LYS A C   
2764 O O   . LYS A 227 ? 0.3965 0.3255 0.2875 -0.0038 -0.0798 0.0447  1097 LYS A O   
2765 C CB  . LYS A 227 ? 0.5148 0.4259 0.3683 -0.0078 -0.0903 0.0473  1097 LYS A CB  
2766 C CG  . LYS A 227 ? 0.8156 0.7305 0.6825 -0.0038 -0.0979 0.0486  1097 LYS A CG  
2767 C CD  . LYS A 227 ? 1.1487 1.0560 1.0058 -0.0027 -0.1071 0.0520  1097 LYS A CD  
2768 C CE  . LYS A 227 ? 1.4064 1.3050 1.2557 -0.0015 -0.1067 0.0566  1097 LYS A CE  
2769 N NZ  . LYS A 227 ? 1.4959 1.3869 1.3356 -0.0003 -0.1160 0.0604  1097 LYS A NZ  
2783 N N   . LEU A 228 ? 0.4025 0.3180 0.2702 -0.0068 -0.0758 0.0486  1098 LEU A N   
2784 C CA  . LEU A 228 ? 0.4535 0.3701 0.3309 -0.0046 -0.0736 0.0503  1098 LEU A CA  
2785 C C   . LEU A 228 ? 0.4165 0.3409 0.3041 -0.0056 -0.0663 0.0476  1098 LEU A C   
2786 O O   . LEU A 228 ? 0.3857 0.3148 0.2866 -0.0033 -0.0654 0.0474  1098 LEU A O   
2787 C CB  . LEU A 228 ? 0.5097 0.4167 0.3752 -0.0054 -0.0718 0.0537  1098 LEU A CB  
2788 C CG  . LEU A 228 ? 0.7259 0.6242 0.5815 -0.0039 -0.0793 0.0572  1098 LEU A CG  
2789 C CD1 . LEU A 228 ? 0.7220 0.6104 0.5652 -0.0049 -0.0764 0.0605  1098 LEU A CD1 
2790 C CD2 . LEU A 228 ? 0.6739 0.5750 0.5426 0.0005  -0.0860 0.0587  1098 LEU A CD2 
2802 N N   . GLN A 229 ? 0.3900 0.3157 0.2713 -0.0089 -0.0609 0.0457  1099 GLN A N   
2803 C CA  . GLN A 229 ? 0.3874 0.3209 0.2778 -0.0100 -0.0543 0.0433  1099 GLN A CA  
2804 C C   . GLN A 229 ? 0.3734 0.3153 0.2787 -0.0078 -0.0562 0.0409  1099 GLN A C   
2805 O O   . GLN A 229 ? 0.3668 0.3137 0.2837 -0.0065 -0.0534 0.0403  1099 GLN A O   
2806 C CB  . GLN A 229 ? 0.3452 0.2792 0.2273 -0.0136 -0.0493 0.0416  1099 GLN A CB  
2807 C CG  . GLN A 229 ? 0.3694 0.2969 0.2395 -0.0164 -0.0449 0.0433  1099 GLN A CG  
2808 C CD  . GLN A 229 ? 0.4476 0.3644 0.3032 -0.0166 -0.0490 0.0459  1099 GLN A CD  
2809 O OE1 . GLN A 229 ? 0.3721 0.2862 0.2227 -0.0160 -0.0544 0.0459  1099 GLN A OE1 
2810 N NE2 . GLN A 229 ? 0.4291 0.3396 0.2776 -0.0177 -0.0464 0.0483  1099 GLN A NE2 
2819 N N   . LEU A 230 ? 0.3180 0.2610 0.2225 -0.0075 -0.0607 0.0394  1100 LEU A N   
2820 C CA  . LEU A 230 ? 0.3660 0.3171 0.2840 -0.0059 -0.0618 0.0367  1100 LEU A CA  
2821 C C   . LEU A 230 ? 0.4538 0.4062 0.3835 -0.0023 -0.0664 0.0378  1100 LEU A C   
2822 O O   . LEU A 230 ? 0.3561 0.3151 0.2995 -0.0008 -0.0649 0.0361  1100 LEU A O   
2823 C CB  . LEU A 230 ? 0.4123 0.3639 0.3257 -0.0072 -0.0649 0.0345  1100 LEU A CB  
2824 C CG  . LEU A 230 ? 0.4029 0.3537 0.3064 -0.0107 -0.0595 0.0329  1100 LEU A CG  
2825 C CD1 . LEU A 230 ? 0.4296 0.3801 0.3284 -0.0120 -0.0624 0.0305  1100 LEU A CD1 
2826 C CD2 . LEU A 230 ? 0.3620 0.3197 0.2741 -0.0113 -0.0521 0.0313  1100 LEU A CD2 
2838 N N   . HIS A 231 ? 0.4201 0.3661 0.3448 -0.0008 -0.0717 0.0409  1101 HIS A N   
2839 C CA  . HIS A 231 ? 0.4520 0.3992 0.3887 0.0029  -0.0759 0.0422  1101 HIS A CA  
2840 C C   . HIS A 231 ? 0.3582 0.3070 0.3035 0.0038  -0.0701 0.0426  1101 HIS A C   
2841 O O   . HIS A 231 ? 0.3954 0.3486 0.3549 0.0062  -0.0704 0.0419  1101 HIS A O   
2842 C CB  . HIS A 231 ? 0.5145 0.4542 0.4442 0.0045  -0.0828 0.0459  1101 HIS A CB  
2843 C CG  . HIS A 231 ? 0.6163 0.5572 0.5595 0.0085  -0.0865 0.0476  1101 HIS A CG  
2844 N ND1 . HIS A 231 ? 0.7473 0.6838 0.6920 0.0101  -0.0845 0.0504  1101 HIS A ND1 
2845 C CD2 . HIS A 231 ? 0.6412 0.5873 0.5978 0.0111  -0.0916 0.0466  1101 HIS A CD2 
2846 C CE1 . HIS A 231 ? 0.7893 0.7280 0.7478 0.0137  -0.0881 0.0513  1101 HIS A CE1 
2847 N NE2 . HIS A 231 ? 0.8051 0.7499 0.7714 0.0144  -0.0925 0.0490  1101 HIS A NE2 
2856 N N   . GLU A 232 ? 0.3282 0.2735 0.2649 0.0015  -0.0646 0.0436  1102 GLU A N   
2857 C CA  . GLU A 232 ? 0.3613 0.3074 0.3044 0.0017  -0.0591 0.0440  1102 GLU A CA  
2858 C C   . GLU A 232 ? 0.4084 0.3629 0.3639 0.0018  -0.0553 0.0408  1102 GLU A C   
2859 O O   . GLU A 232 ? 0.3482 0.3047 0.3140 0.0033  -0.0529 0.0406  1102 GLU A O   
2860 C CB  . GLU A 232 ? 0.3540 0.2955 0.2851 -0.0014 -0.0538 0.0451  1102 GLU A CB  
2861 C CG  . GLU A 232 ? 0.4295 0.3694 0.3643 -0.0015 -0.0489 0.0461  1102 GLU A CG  
2862 C CD  . GLU A 232 ? 0.4679 0.4016 0.4048 0.0014  -0.0519 0.0490  1102 GLU A CD  
2863 O OE1 . GLU A 232 ? 0.4250 0.3555 0.3599 0.0035  -0.0583 0.0507  1102 GLU A OE1 
2864 O OE2 . GLU A 232 ? 0.4525 0.3845 0.3932 0.0014  -0.0478 0.0496  1102 GLU A OE2 
2871 N N   . LEU A 233 ? 0.3137 0.2730 0.2681 0.0002  -0.0545 0.0383  1103 LEU A N   
2872 C CA  . LEU A 233 ? 0.3318 0.2987 0.2966 0.0001  -0.0505 0.0355  1103 LEU A CA  
2873 C C   . LEU A 233 ? 0.3889 0.3601 0.3677 0.0031  -0.0539 0.0341  1103 LEU A C   
2874 O O   . LEU A 233 ? 0.3041 0.2809 0.2927 0.0034  -0.0505 0.0320  1103 LEU A O   
2875 C CB  . LEU A 233 ? 0.3739 0.3440 0.3331 -0.0025 -0.0481 0.0335  1103 LEU A CB  
2876 C CG  . LEU A 233 ? 0.3327 0.2994 0.2796 -0.0056 -0.0439 0.0347  1103 LEU A CG  
2877 C CD1 . LEU A 233 ? 0.2809 0.2512 0.2243 -0.0079 -0.0411 0.0326  1103 LEU A CD1 
2878 C CD2 . LEU A 233 ? 0.3038 0.2709 0.2533 -0.0065 -0.0387 0.0356  1103 LEU A CD2 
2890 N N   . THR A 234 ? 0.3095 0.2781 0.2895 0.0052  -0.0605 0.0353  1104 THR A N   
2891 C CA  . THR A 234 ? 0.3548 0.3276 0.3491 0.0080  -0.0638 0.0340  1104 THR A CA  
2892 C C   . THR A 234 ? 0.3419 0.3142 0.3467 0.0102  -0.0614 0.0350  1104 THR A C   
2893 O O   . THR A 234 ? 0.3771 0.3532 0.3956 0.0125  -0.0624 0.0337  1104 THR A O   
2894 C CB  . THR A 234 ? 0.4720 0.4431 0.4651 0.0095  -0.0724 0.0349  1104 THR A CB  
2895 O OG1 . THR A 234 ? 0.4692 0.4335 0.4573 0.0109  -0.0756 0.0386  1104 THR A OG1 
2896 C CG2 . THR A 234 ? 0.5580 0.5285 0.5392 0.0068  -0.0744 0.0337  1104 THR A CG2 
2904 N N   . LYS A 235 ? 0.3358 0.3033 0.3343 0.0093  -0.0576 0.0371  1105 LYS A N   
2905 C CA  . LYS A 235 ? 0.3427 0.3087 0.3493 0.0107  -0.0539 0.0378  1105 LYS A CA  
2906 C C   . LYS A 235 ? 0.4130 0.3841 0.4269 0.0096  -0.0474 0.0352  1105 LYS A C   
2907 O O   . LYS A 235 ? 0.3155 0.2862 0.3381 0.0107  -0.0441 0.0350  1105 LYS A O   
2908 C CB  . LYS A 235 ? 0.3255 0.2843 0.3215 0.0094  -0.0514 0.0406  1105 LYS A CB  
2909 C CG  . LYS A 235 ? 0.4585 0.4106 0.4476 0.0109  -0.0572 0.0439  1105 LYS A CG  
2910 C CD  . LYS A 235 ? 0.5363 0.4812 0.5147 0.0092  -0.0536 0.0463  1105 LYS A CD  
2911 C CE  . LYS A 235 ? 0.7038 0.6411 0.6760 0.0110  -0.0587 0.0500  1105 LYS A CE  
2912 N NZ  . LYS A 235 ? 0.5959 0.5258 0.5603 0.0097  -0.0542 0.0522  1105 LYS A NZ  
2926 N N   . LEU A 236 ? 0.2485 0.2238 0.2586 0.0074  -0.0453 0.0332  1106 LEU A N   
2927 C CA  . LEU A 236 ? 0.2619 0.2418 0.2776 0.0062  -0.0394 0.0311  1106 LEU A CA  
2928 C C   . LEU A 236 ? 0.2697 0.2541 0.3002 0.0086  -0.0399 0.0289  1106 LEU A C   
2929 O O   . LEU A 236 ? 0.2869 0.2730 0.3224 0.0104  -0.0451 0.0282  1106 LEU A O   
2930 C CB  . LEU A 236 ? 0.2738 0.2573 0.2823 0.0036  -0.0375 0.0299  1106 LEU A CB  
2931 C CG  . LEU A 236 ? 0.2707 0.2508 0.2657 0.0008  -0.0355 0.0316  1106 LEU A CG  
2932 C CD1 . LEU A 236 ? 0.2992 0.2830 0.2886 -0.0013 -0.0345 0.0303  1106 LEU A CD1 
2933 C CD2 . LEU A 236 ? 0.2695 0.2483 0.2638 -0.0008 -0.0299 0.0323  1106 LEU A CD2 
2945 N N   . PRO A 237 ? 0.2614 0.2477 0.2986 0.0084  -0.0344 0.0276  1107 PRO A N   
2946 C CA  . PRO A 237 ? 0.2919 0.2826 0.3427 0.0102  -0.0337 0.0251  1107 PRO A CA  
2947 C C   . PRO A 237 ? 0.2938 0.2900 0.3453 0.0097  -0.0353 0.0229  1107 PRO A C   
2948 O O   . PRO A 237 ? 0.2188 0.2160 0.2611 0.0075  -0.0341 0.0230  1107 PRO A O   
2949 C CB  . PRO A 237 ? 0.3053 0.2961 0.3584 0.0089  -0.0266 0.0244  1107 PRO A CB  
2950 C CG  . PRO A 237 ? 0.3655 0.3513 0.4079 0.0069  -0.0244 0.0267  1107 PRO A CG  
2951 C CD  . PRO A 237 ? 0.2690 0.2536 0.3007 0.0060  -0.0285 0.0282  1107 PRO A CD  
2959 N N   . ALA A 238 ? 0.2997 0.2992 0.3626 0.0117  -0.0376 0.0209  1108 ALA A N   
2960 C CA  . ALA A 238 ? 0.2618 0.2658 0.3256 0.0113  -0.0400 0.0187  1108 ALA A CA  
2961 C C   . ALA A 238 ? 0.2556 0.2626 0.3149 0.0092  -0.0349 0.0174  1108 ALA A C   
2962 O O   . ALA A 238 ? 0.2643 0.2730 0.3178 0.0079  -0.0364 0.0166  1108 ALA A O   
2963 C CB  . ALA A 238 ? 0.2742 0.2817 0.3528 0.0135  -0.0418 0.0164  1108 ALA A CB  
2969 N N   . PHE A 239 ? 0.2389 0.2463 0.3010 0.0087  -0.0290 0.0173  1109 PHE A N   
2970 C CA  . PHE A 239 ? 0.2281 0.2390 0.2884 0.0072  -0.0244 0.0161  1109 PHE A CA  
2971 C C   . PHE A 239 ? 0.2597 0.2700 0.3073 0.0047  -0.0235 0.0177  1109 PHE A C   
2972 O O   . PHE A 239 ? 0.2605 0.2741 0.3063 0.0036  -0.0207 0.0170  1109 PHE A O   
2973 C CB  . PHE A 239 ? 0.2866 0.2979 0.3532 0.0073  -0.0186 0.0156  1109 PHE A CB  
2974 C CG  . PHE A 239 ? 0.2559 0.2641 0.3152 0.0055  -0.0152 0.0178  1109 PHE A CG  
2975 C CD1 . PHE A 239 ? 0.2137 0.2238 0.2669 0.0034  -0.0115 0.0183  1109 PHE A CD1 
2976 C CD2 . PHE A 239 ? 0.2797 0.2831 0.3389 0.0060  -0.0156 0.0192  1109 PHE A CD2 
2977 C CE1 . PHE A 239 ? 0.2868 0.2943 0.3335 0.0015  -0.0086 0.0202  1109 PHE A CE1 
2978 C CE2 . PHE A 239 ? 0.3205 0.3207 0.3727 0.0040  -0.0122 0.0209  1109 PHE A CE2 
2979 C CZ  . PHE A 239 ? 0.2918 0.2942 0.3377 0.0016  -0.0089 0.0213  1109 PHE A CZ  
2989 N N   . VAL A 240 ? 0.2090 0.2151 0.2481 0.0040  -0.0257 0.0200  1110 VAL A N   
2990 C CA  . VAL A 240 ? 0.2095 0.2150 0.2369 0.0016  -0.0248 0.0213  1110 VAL A CA  
2991 C C   . VAL A 240 ? 0.2590 0.2621 0.2787 0.0013  -0.0298 0.0218  1110 VAL A C   
2992 O O   . VAL A 240 ? 0.2316 0.2334 0.2412 -0.0007 -0.0291 0.0228  1110 VAL A O   
2993 C CB  . VAL A 240 ? 0.2055 0.2078 0.2264 -0.0001 -0.0219 0.0236  1110 VAL A CB  
2994 C CG1 . VAL A 240 ? 0.2159 0.2206 0.2415 -0.0007 -0.0167 0.0232  1110 VAL A CG1 
2995 C CG2 . VAL A 240 ? 0.2136 0.2104 0.2336 0.0010  -0.0247 0.0252  1110 VAL A CG2 
3005 N N   . ARG A 241 ? 0.2001 0.2022 0.2244 0.0032  -0.0349 0.0212  1111 ARG A N   
3006 C CA  . ARG A 241 ? 0.2222 0.2215 0.2386 0.0029  -0.0402 0.0218  1111 ARG A CA  
3007 C C   . ARG A 241 ? 0.2831 0.2847 0.2947 0.0013  -0.0399 0.0200  1111 ARG A C   
3008 O O   . ARG A 241 ? 0.2646 0.2708 0.2827 0.0014  -0.0372 0.0177  1111 ARG A O   
3009 C CB  . ARG A 241 ? 0.2480 0.2466 0.2716 0.0054  -0.0462 0.0215  1111 ARG A CB  
3010 C CG  . ARG A 241 ? 0.2965 0.2912 0.3230 0.0071  -0.0473 0.0239  1111 ARG A CG  
3011 C CD  . ARG A 241 ? 0.3881 0.3804 0.4169 0.0092  -0.0547 0.0249  1111 ARG A CD  
3012 N NE  . ARG A 241 ? 0.5603 0.5570 0.6029 0.0112  -0.0572 0.0226  1111 ARG A NE  
3013 C CZ  . ARG A 241 ? 0.6616 0.6589 0.7167 0.0137  -0.0576 0.0228  1111 ARG A CZ  
3014 N NH1 . ARG A 241 ? 0.4956 0.4888 0.5508 0.0146  -0.0555 0.0251  1111 ARG A NH1 
3015 N NH2 . ARG A 241 ? 0.5125 0.5141 0.5802 0.0153  -0.0599 0.0206  1111 ARG A NH2 
3029 N N   . VAL A 242 ? 0.2572 0.2550 0.2569 -0.0003 -0.0423 0.0210  1112 VAL A N   
3030 C CA  . VAL A 242 ? 0.2322 0.2308 0.2256 -0.0021 -0.0419 0.0194  1112 VAL A CA  
3031 C C   . VAL A 242 ? 0.2709 0.2721 0.2710 -0.0012 -0.0455 0.0167  1112 VAL A C   
3032 O O   . VAL A 242 ? 0.2654 0.2696 0.2666 -0.0021 -0.0431 0.0143  1112 VAL A O   
3033 C CB  . VAL A 242 ? 0.3426 0.3351 0.3214 -0.0039 -0.0445 0.0211  1112 VAL A CB  
3034 C CG1 . VAL A 242 ? 0.4387 0.4314 0.4105 -0.0062 -0.0428 0.0192  1112 VAL A CG1 
3035 C CG2 . VAL A 242 ? 0.3814 0.3708 0.3536 -0.0050 -0.0413 0.0237  1112 VAL A CG2 
3045 N N   . VAL A 243 ? 0.2403 0.2404 0.2454 0.0007  -0.0511 0.0170  1113 VAL A N   
3046 C CA  . VAL A 243 ? 0.2827 0.2855 0.2951 0.0016  -0.0554 0.0145  1113 VAL A CA  
3047 C C   . VAL A 243 ? 0.3065 0.3122 0.3338 0.0044  -0.0565 0.0142  1113 VAL A C   
3048 O O   . VAL A 243 ? 0.3047 0.3077 0.3334 0.0059  -0.0586 0.0166  1113 VAL A O   
3049 C CB  . VAL A 243 ? 0.3569 0.3554 0.3609 0.0010  -0.0629 0.0152  1113 VAL A CB  
3050 C CG1 . VAL A 243 ? 0.3748 0.3764 0.3865 0.0015  -0.0676 0.0124  1113 VAL A CG1 
3051 C CG2 . VAL A 243 ? 0.4155 0.4096 0.4034 -0.0019 -0.0616 0.0156  1113 VAL A CG2 
3061 N N   . SER A 244 ? 0.2618 0.2724 0.3001 0.0050  -0.0546 0.0113  1114 SER A N   
3062 C CA  . SER A 244 ? 0.3171 0.3305 0.3703 0.0075  -0.0558 0.0105  1114 SER A CA  
3063 C C   . SER A 244 ? 0.2877 0.3061 0.3506 0.0075  -0.0544 0.0067  1114 SER A C   
3064 O O   . SER A 244 ? 0.2478 0.2677 0.3070 0.0058  -0.0505 0.0051  1114 SER A O   
3065 C CB  . SER A 244 ? 0.3414 0.3545 0.3997 0.0087  -0.0506 0.0120  1114 SER A CB  
3066 O OG  . SER A 244 ? 0.4280 0.4441 0.4888 0.0079  -0.0438 0.0105  1114 SER A OG  
3072 N N   . ALA A 245 ? 0.3389 0.3598 0.4148 0.0093  -0.0574 0.0054  1115 ALA A N   
3073 C CA  . ALA A 245 ? 0.3272 0.3527 0.4134 0.0093  -0.0564 0.0016  1115 ALA A CA  
3074 C C   . ALA A 245 ? 0.3099 0.3375 0.3999 0.0091  -0.0480 0.0004  1115 ALA A C   
3075 O O   . ALA A 245 ? 0.2895 0.3200 0.3828 0.0082  -0.0455 -0.0025 1115 ALA A O   
3076 C CB  . ALA A 245 ? 0.4264 0.4543 0.5273 0.0114  -0.0606 0.0008  1115 ALA A CB  
3082 N N   . GLY A 246 ? 0.2664 0.2924 0.3555 0.0098  -0.0435 0.0026  1116 GLY A N   
3083 C CA  . GLY A 246 ? 0.2565 0.2842 0.3487 0.0096  -0.0359 0.0019  1116 GLY A CA  
3084 C C   . GLY A 246 ? 0.2814 0.3085 0.3622 0.0077  -0.0320 0.0029  1116 GLY A C   
3085 O O   . GLY A 246 ? 0.3161 0.3444 0.3981 0.0075  -0.0260 0.0030  1116 GLY A O   
3089 N N   . ASN A 247 ? 0.2303 0.2554 0.3000 0.0062  -0.0353 0.0038  1117 ASN A N   
3090 C CA  . ASN A 247 ? 0.2020 0.2266 0.2612 0.0043  -0.0317 0.0047  1117 ASN A CA  
3091 C C   . ASN A 247 ? 0.2029 0.2292 0.2608 0.0030  -0.0312 0.0019  1117 ASN A C   
3092 O O   . ASN A 247 ? 0.2088 0.2339 0.2633 0.0022  -0.0362 0.0007  1117 ASN A O   
3093 C CB  . ASN A 247 ? 0.1670 0.1873 0.2140 0.0033  -0.0350 0.0074  1117 ASN A CB  
3094 C CG  . ASN A 247 ? 0.2467 0.2662 0.2830 0.0012  -0.0313 0.0084  1117 ASN A CG  
3095 O OD1 . ASN A 247 ? 0.2084 0.2308 0.2463 0.0006  -0.0267 0.0072  1117 ASN A OD1 
3096 N ND2 . ASN A 247 ? 0.2529 0.2685 0.2786 0.0001  -0.0333 0.0108  1117 ASN A ND2 
3103 N N   . LEU A 248 ? 0.2186 0.2477 0.2794 0.0028  -0.0253 0.0008  1118 LEU A N   
3104 C CA  . LEU A 248 ? 0.1816 0.2119 0.2418 0.0016  -0.0241 -0.0020 1118 LEU A CA  
3105 C C   . LEU A 248 ? 0.2274 0.2546 0.2749 -0.0006 -0.0264 -0.0017 1118 LEU A C   
3106 O O   . LEU A 248 ? 0.2132 0.2399 0.2588 -0.0018 -0.0284 -0.0042 1118 LEU A O   
3107 C CB  . LEU A 248 ? 0.1759 0.2089 0.2393 0.0017  -0.0168 -0.0024 1118 LEU A CB  
3108 C CG  . LEU A 248 ? 0.2199 0.2553 0.2947 0.0036  -0.0132 -0.0028 1118 LEU A CG  
3109 C CD1 . LEU A 248 ? 0.2537 0.2913 0.3300 0.0035  -0.0065 -0.0030 1118 LEU A CD1 
3110 C CD2 . LEU A 248 ? 0.3051 0.3416 0.3901 0.0045  -0.0160 -0.0058 1118 LEU A CD2 
3122 N N   . LEU A 249 ? 0.1685 0.1934 0.2069 -0.0013 -0.0260 0.0013  1119 LEU A N   
3123 C CA  . LEU A 249 ? 0.1666 0.1879 0.1922 -0.0035 -0.0273 0.0017  1119 LEU A CA  
3124 C C   . LEU A 249 ? 0.2364 0.2541 0.2569 -0.0041 -0.0348 0.0012  1119 LEU A C   
3125 O O   . LEU A 249 ? 0.2360 0.2502 0.2461 -0.0062 -0.0364 0.0007  1119 LEU A O   
3126 C CB  . LEU A 249 ? 0.1838 0.2035 0.2014 -0.0043 -0.0245 0.0049  1119 LEU A CB  
3127 C CG  . LEU A 249 ? 0.2363 0.2597 0.2580 -0.0040 -0.0175 0.0056  1119 LEU A CG  
3128 C CD1 . LEU A 249 ? 0.2171 0.2395 0.2323 -0.0048 -0.0156 0.0088  1119 LEU A CD1 
3129 C CD2 . LEU A 249 ? 0.2113 0.2359 0.2321 -0.0051 -0.0135 0.0035  1119 LEU A CD2 
3141 N N   . SER A 250 ? 0.2054 0.2237 0.2332 -0.0022 -0.0393 0.0016  1120 SER A N   
3142 C CA  . SER A 250 ? 0.2017 0.2174 0.2268 -0.0024 -0.0472 0.0013  1120 SER A CA  
3143 C C   . SER A 250 ? 0.2725 0.2902 0.3025 -0.0031 -0.0495 -0.0025 1120 SER A C   
3144 O O   . SER A 250 ? 0.2796 0.2954 0.3066 -0.0038 -0.0563 -0.0031 1120 SER A O   
3145 C CB  . SER A 250 ? 0.2540 0.2698 0.2865 0.0001  -0.0509 0.0033  1120 SER A CB  
3146 O OG  . SER A 250 ? 0.2286 0.2420 0.2560 0.0005  -0.0486 0.0066  1120 SER A OG  
3152 N N   . HIS A 251 ? 0.2332 0.2545 0.2704 -0.0031 -0.0439 -0.0049 1121 HIS A N   
3153 C CA  . HIS A 251 ? 0.2239 0.2471 0.2661 -0.0041 -0.0450 -0.0089 1121 HIS A CA  
3154 C C   . HIS A 251 ? 0.2971 0.3184 0.3301 -0.0068 -0.0413 -0.0108 1121 HIS A C   
3155 O O   . HIS A 251 ? 0.2572 0.2794 0.2929 -0.0081 -0.0412 -0.0144 1121 HIS A O   
3156 C CB  . HIS A 251 ? 0.1794 0.2076 0.2369 -0.0022 -0.0410 -0.0107 1121 HIS A CB  
3157 C CG  . HIS A 251 ? 0.2344 0.2643 0.3024 0.0002  -0.0446 -0.0097 1121 HIS A CG  
3158 N ND1 . HIS A 251 ? 0.2573 0.2889 0.3334 0.0006  -0.0504 -0.0117 1121 HIS A ND1 
3159 C CD2 . HIS A 251 ? 0.2452 0.2751 0.3166 0.0022  -0.0431 -0.0069 1121 HIS A CD2 
3160 C CE1 . HIS A 251 ? 0.3011 0.3338 0.3861 0.0030  -0.0521 -0.0101 1121 HIS A CE1 
3161 N NE2 . HIS A 251 ? 0.2632 0.2946 0.3451 0.0039  -0.0476 -0.0072 1121 HIS A NE2 
3170 N N   . VAL A 252 ? 0.2068 0.2253 0.2294 -0.0078 -0.0379 -0.0086 1122 VAL A N   
3171 C CA  . VAL A 252 ? 0.2282 0.2442 0.2416 -0.0104 -0.0340 -0.0102 1122 VAL A CA  
3172 C C   . VAL A 252 ? 0.3392 0.3509 0.3434 -0.0130 -0.0400 -0.0122 1122 VAL A C   
3173 O O   . VAL A 252 ? 0.2893 0.3000 0.2911 -0.0151 -0.0381 -0.0155 1122 VAL A O   
3174 C CB  . VAL A 252 ? 0.2478 0.2616 0.2521 -0.0110 -0.0296 -0.0072 1122 VAL A CB  
3175 C CG1 . VAL A 252 ? 0.2956 0.3058 0.2897 -0.0139 -0.0259 -0.0089 1122 VAL A CG1 
3176 C CG2 . VAL A 252 ? 0.2084 0.2268 0.2217 -0.0088 -0.0235 -0.0056 1122 VAL A CG2 
3186 N N   . GLY A 253 ? 0.3245 0.3334 0.3235 -0.0129 -0.0472 -0.0103 1123 GLY A N   
3187 C CA  . GLY A 253 ? 0.3720 0.3768 0.3622 -0.0153 -0.0541 -0.0118 1123 GLY A CA  
3188 C C   . GLY A 253 ? 0.3784 0.3761 0.3507 -0.0180 -0.0538 -0.0107 1123 GLY A C   
3189 O O   . GLY A 253 ? 0.3515 0.3446 0.3138 -0.0203 -0.0595 -0.0116 1123 GLY A O   
3193 N N   . HIS A 254 ? 0.3048 0.3016 0.2729 -0.0179 -0.0472 -0.0087 1124 HIS A N   
3194 C CA  . HIS A 254 ? 0.3401 0.3302 0.2919 -0.0205 -0.0458 -0.0075 1124 HIS A CA  
3195 C C   . HIS A 254 ? 0.3637 0.3543 0.3149 -0.0192 -0.0410 -0.0040 1124 HIS A C   
3196 O O   . HIS A 254 ? 0.2939 0.2901 0.2568 -0.0167 -0.0378 -0.0030 1124 HIS A O   
3197 C CB  . HIS A 254 ? 0.3512 0.3386 0.2964 -0.0236 -0.0405 -0.0108 1124 HIS A CB  
3198 C CG  . HIS A 254 ? 0.3756 0.3679 0.3305 -0.0227 -0.0318 -0.0120 1124 HIS A CG  
3199 N ND1 . HIS A 254 ? 0.3278 0.3249 0.2944 -0.0219 -0.0304 -0.0150 1124 HIS A ND1 
3200 C CD2 . HIS A 254 ? 0.3252 0.3185 0.2799 -0.0224 -0.0242 -0.0105 1124 HIS A CD2 
3201 C CE1 . HIS A 254 ? 0.3332 0.3335 0.3059 -0.0210 -0.0223 -0.0151 1124 HIS A CE1 
3202 N NE2 . HIS A 254 ? 0.3380 0.3364 0.3040 -0.0213 -0.0186 -0.0123 1124 HIS A NE2 
3211 N N   . THR A 255 ? 0.3293 0.3138 0.2666 -0.0211 -0.0403 -0.0022 1125 THR A N   
3212 C CA  . THR A 255 ? 0.2545 0.2392 0.1905 -0.0203 -0.0363 0.0012  1125 THR A CA  
3213 C C   . THR A 255 ? 0.2645 0.2526 0.2045 -0.0206 -0.0274 0.0007  1125 THR A C   
3214 O O   . THR A 255 ? 0.3036 0.2897 0.2389 -0.0227 -0.0231 -0.0016 1125 THR A O   
3215 C CB  . THR A 255 ? 0.3605 0.3369 0.2798 -0.0226 -0.0381 0.0031  1125 THR A CB  
3216 O OG1 . THR A 255 ? 0.3833 0.3564 0.2989 -0.0219 -0.0468 0.0045  1125 THR A OG1 
3217 C CG2 . THR A 255 ? 0.3059 0.2824 0.2237 -0.0222 -0.0333 0.0062  1125 THR A CG2 
3225 N N   . ILE A 256 ? 0.2517 0.2447 0.2005 -0.0184 -0.0245 0.0028  1126 ILE A N   
3226 C CA  . ILE A 256 ? 0.2093 0.2054 0.1608 -0.0186 -0.0167 0.0035  1126 ILE A CA  
3227 C C   . ILE A 256 ? 0.2459 0.2405 0.1927 -0.0187 -0.0165 0.0071  1126 ILE A C   
3228 O O   . ILE A 256 ? 0.2463 0.2437 0.1995 -0.0167 -0.0185 0.0090  1126 ILE A O   
3229 C CB  . ILE A 256 ? 0.2505 0.2542 0.2172 -0.0161 -0.0136 0.0030  1126 ILE A CB  
3230 C CG1 . ILE A 256 ? 0.2417 0.2467 0.2138 -0.0160 -0.0142 -0.0006 1126 ILE A CG1 
3231 C CG2 . ILE A 256 ? 0.2261 0.2333 0.1958 -0.0162 -0.0059 0.0042  1126 ILE A CG2 
3232 C CD1 . ILE A 256 ? 0.2696 0.2814 0.2567 -0.0134 -0.0120 -0.0011 1126 ILE A CD1 
3244 N N   . LEU A 257 ? 0.2529 0.2426 0.1884 -0.0211 -0.0139 0.0078  1127 LEU A N   
3245 C CA  . LEU A 257 ? 0.2517 0.2384 0.1805 -0.0217 -0.0144 0.0109  1127 LEU A CA  
3246 C C   . LEU A 257 ? 0.2565 0.2494 0.1946 -0.0202 -0.0109 0.0130  1127 LEU A C   
3247 O O   . LEU A 257 ? 0.2689 0.2663 0.2128 -0.0203 -0.0052 0.0127  1127 LEU A O   
3248 C CB  . LEU A 257 ? 0.3162 0.2968 0.2320 -0.0248 -0.0107 0.0109  1127 LEU A CB  
3249 C CG  . LEU A 257 ? 0.3340 0.3063 0.2368 -0.0268 -0.0150 0.0094  1127 LEU A CG  
3250 C CD1 . LEU A 257 ? 0.3909 0.3572 0.2815 -0.0302 -0.0098 0.0087  1127 LEU A CD1 
3251 C CD2 . LEU A 257 ? 0.3402 0.3081 0.2370 -0.0261 -0.0223 0.0117  1127 LEU A CD2 
3263 N N   . GLY A 258 ? 0.2489 0.2415 0.1881 -0.0190 -0.0143 0.0153  1128 GLY A N   
3264 C CA  . GLY A 258 ? 0.2708 0.2686 0.2177 -0.0181 -0.0113 0.0172  1128 GLY A CA  
3265 C C   . GLY A 258 ? 0.2636 0.2673 0.2235 -0.0154 -0.0121 0.0166  1128 GLY A C   
3266 O O   . GLY A 258 ? 0.2284 0.2354 0.1941 -0.0145 -0.0111 0.0183  1128 GLY A O   
3270 N N   . MET A 259 ? 0.2082 0.2131 0.1726 -0.0144 -0.0137 0.0141  1129 MET A N   
3271 C CA  . MET A 259 ? 0.1777 0.1877 0.1546 -0.0120 -0.0142 0.0133  1129 MET A CA  
3272 C C   . MET A 259 ? 0.2124 0.2201 0.1909 -0.0105 -0.0206 0.0130  1129 MET A C   
3273 O O   . MET A 259 ? 0.2351 0.2441 0.2191 -0.0090 -0.0219 0.0144  1129 MET A O   
3274 C CB  . MET A 259 ? 0.1958 0.2094 0.1790 -0.0116 -0.0108 0.0107  1129 MET A CB  
3275 C CG  . MET A 259 ? 0.1987 0.2152 0.1824 -0.0126 -0.0043 0.0113  1129 MET A CG  
3276 S SD  . MET A 259 ? 0.2073 0.2292 0.2022 -0.0111 0.0002  0.0092  1129 MET A SD  
3277 C CE  . MET A 259 ? 0.2115 0.2382 0.2178 -0.0085 -0.0005 0.0105  1129 MET A CE  
3287 N N   . ASN A 260 ? 0.2115 0.2158 0.1855 -0.0111 -0.0247 0.0113  1130 ASN A N   
3288 C CA  . ASN A 260 ? 0.2353 0.2375 0.2106 -0.0098 -0.0315 0.0114  1130 ASN A CA  
3289 C C   . ASN A 260 ? 0.2704 0.2656 0.2328 -0.0111 -0.0357 0.0132  1130 ASN A C   
3290 O O   . ASN A 260 ? 0.2837 0.2761 0.2446 -0.0104 -0.0421 0.0132  1130 ASN A O   
3291 C CB  . ASN A 260 ? 0.2445 0.2486 0.2262 -0.0091 -0.0344 0.0083  1130 ASN A CB  
3292 C CG  . ASN A 260 ? 0.2537 0.2549 0.2268 -0.0115 -0.0342 0.0060  1130 ASN A CG  
3293 O OD1 . ASN A 260 ? 0.2400 0.2363 0.2009 -0.0137 -0.0336 0.0069  1130 ASN A OD1 
3294 N ND2 . ASN A 260 ? 0.2436 0.2474 0.2231 -0.0115 -0.0344 0.0028  1130 ASN A ND2 
3301 N N   . THR A 261 ? 0.2483 0.2408 0.2017 -0.0129 -0.0321 0.0149  1131 THR A N   
3302 C CA  . THR A 261 ? 0.2486 0.2343 0.1903 -0.0140 -0.0349 0.0173  1131 THR A CA  
3303 C C   . THR A 261 ? 0.2681 0.2545 0.2089 -0.0145 -0.0302 0.0197  1131 THR A C   
3304 O O   . THR A 261 ? 0.2684 0.2597 0.2146 -0.0148 -0.0248 0.0193  1131 THR A O   
3305 C CB  . THR A 261 ? 0.2918 0.2713 0.2194 -0.0167 -0.0353 0.0165  1131 THR A CB  
3306 O OG1 . THR A 261 ? 0.2820 0.2632 0.2079 -0.0186 -0.0283 0.0156  1131 THR A OG1 
3307 C CG2 . THR A 261 ? 0.3400 0.3184 0.2670 -0.0168 -0.0403 0.0140  1131 THR A CG2 
3315 N N   . VAL A 262 ? 0.2325 0.2137 0.1663 -0.0147 -0.0326 0.0222  1132 VAL A N   
3316 C CA  . VAL A 262 ? 0.2287 0.2103 0.1622 -0.0153 -0.0288 0.0243  1132 VAL A CA  
3317 C C   . VAL A 262 ? 0.2379 0.2178 0.1627 -0.0183 -0.0237 0.0246  1132 VAL A C   
3318 O O   . VAL A 262 ? 0.2919 0.2662 0.2057 -0.0200 -0.0245 0.0243  1132 VAL A O   
3319 C CB  . VAL A 262 ? 0.2478 0.2238 0.1765 -0.0146 -0.0326 0.0269  1132 VAL A CB  
3320 C CG1 . VAL A 262 ? 0.2471 0.2227 0.1739 -0.0159 -0.0283 0.0289  1132 VAL A CG1 
3321 C CG2 . VAL A 262 ? 0.2776 0.2555 0.2164 -0.0116 -0.0371 0.0268  1132 VAL A CG2 
3331 N N   . GLN A 263 ? 0.1893 0.1796 0.1817 -0.0274 -0.0008 0.0171  1133 GLN A N   
3332 C CA  . GLN A 263 ? 0.1948 0.1853 0.1825 -0.0302 0.0018  0.0146  1133 GLN A CA  
3333 C C   . GLN A 263 ? 0.2490 0.2378 0.2372 -0.0297 0.0023  0.0146  1133 GLN A C   
3334 O O   . GLN A 263 ? 0.2456 0.2346 0.2389 -0.0260 0.0022  0.0148  1133 GLN A O   
3335 C CB  . GLN A 263 ? 0.2206 0.2158 0.2097 -0.0291 0.0054  0.0108  1133 GLN A CB  
3336 C CG  . GLN A 263 ? 0.2491 0.2446 0.2337 -0.0324 0.0061  0.0099  1133 GLN A CG  
3337 C CD  . GLN A 263 ? 0.2401 0.2395 0.2269 -0.0307 0.0095  0.0062  1133 GLN A CD  
3338 O OE1 . GLN A 263 ? 0.2737 0.2758 0.2653 -0.0270 0.0108  0.0046  1133 GLN A OE1 
3339 N NE2 . GLN A 263 ? 0.2273 0.2266 0.2104 -0.0334 0.0107  0.0047  1133 GLN A NE2 
3348 N N   . LEU A 264 ? 0.2251 0.2119 0.2075 -0.0339 0.0029  0.0141  1134 LEU A N   
3349 C CA  . LEU A 264 ? 0.2292 0.2137 0.2105 -0.0346 0.0035  0.0140  1134 LEU A CA  
3350 C C   . LEU A 264 ? 0.2319 0.2209 0.2128 -0.0358 0.0073  0.0100  1134 LEU A C   
3351 O O   . LEU A 264 ? 0.2476 0.2397 0.2266 -0.0379 0.0093  0.0077  1134 LEU A O   
3352 C CB  . LEU A 264 ? 0.2409 0.2192 0.2151 -0.0392 0.0009  0.0168  1134 LEU A CB  
3353 C CG  . LEU A 264 ? 0.2622 0.2372 0.2320 -0.0422 0.0018  0.0163  1134 LEU A CG  
3354 C CD1 . LEU A 264 ? 0.2463 0.2177 0.2200 -0.0387 0.0004  0.0180  1134 LEU A CD1 
3355 C CD2 . LEU A 264 ? 0.3018 0.2711 0.2623 -0.0485 -0.0001 0.0185  1134 LEU A CD2 
3367 N N   . TYR A 265 ? 0.1992 0.1885 0.1820 -0.0344 0.0084  0.0090  1135 TYR A N   
3368 C CA  . TYR A 265 ? 0.1787 0.1725 0.1618 -0.0358 0.0115  0.0055  1135 TYR A CA  
3369 C C   . TYR A 265 ? 0.2467 0.2364 0.2254 -0.0391 0.0115  0.0060  1135 TYR A C   
3370 O O   . TYR A 265 ? 0.2501 0.2349 0.2291 -0.0376 0.0098  0.0082  1135 TYR A O   
3371 C CB  . TYR A 265 ? 0.1761 0.1741 0.1656 -0.0311 0.0127  0.0037  1135 TYR A CB  
3372 C CG  . TYR A 265 ? 0.1954 0.1968 0.1888 -0.0279 0.0127  0.0032  1135 TYR A CG  
3373 C CD1 . TYR A 265 ? 0.2203 0.2269 0.2153 -0.0279 0.0148  0.0003  1135 TYR A CD1 
3374 C CD2 . TYR A 265 ? 0.2847 0.2839 0.2804 -0.0249 0.0109  0.0054  1135 TYR A CD2 
3375 C CE1 . TYR A 265 ? 0.2316 0.2401 0.2295 -0.0250 0.0148  -0.0002 1135 TYR A CE1 
3376 C CE2 . TYR A 265 ? 0.3909 0.3926 0.3894 -0.0224 0.0110  0.0049  1135 TYR A CE2 
3377 C CZ  . TYR A 265 ? 0.3372 0.3431 0.3364 -0.0225 0.0129  0.0022  1135 TYR A CZ  
3378 O OH  . TYR A 265 ? 0.3205 0.3278 0.3219 -0.0201 0.0130  0.0018  1135 TYR A OH  
3388 N N   . MET A 266 ? 0.2127 0.2043 0.1876 -0.0436 0.0136  0.0038  1136 MET A N   
3389 C CA  . MET A 266 ? 0.2140 0.2020 0.1844 -0.0474 0.0140  0.0040  1136 MET A CA  
3390 C C   . MET A 266 ? 0.2490 0.2440 0.2224 -0.0479 0.0171  0.0001  1136 MET A C   
3391 O O   . MET A 266 ? 0.2423 0.2433 0.2171 -0.0494 0.0194  -0.0028 1136 MET A O   
3392 C CB  . MET A 266 ? 0.2152 0.1986 0.1770 -0.0536 0.0135  0.0051  1136 MET A CB  
3393 C CG  . MET A 266 ? 0.3027 0.2794 0.2614 -0.0533 0.0097  0.0094  1136 MET A CG  
3394 S SD  . MET A 266 ? 0.2950 0.2660 0.2424 -0.0612 0.0088  0.0109  1136 MET A SD  
3395 C CE  . MET A 266 ? 0.2625 0.2265 0.2033 -0.0654 0.0084  0.0120  1136 MET A CE  
3405 N N   . LYS A 267 ? 0.2124 0.2066 0.1873 -0.0468 0.0170  -0.0001 1137 LYS A N   
3406 C CA  . LYS A 267 ? 0.2234 0.2249 0.2027 -0.0462 0.0191  -0.0034 1137 LYS A CA  
3407 C C   . LYS A 267 ? 0.2514 0.2517 0.2271 -0.0505 0.0202  -0.0045 1137 LYS A C   
3408 O O   . LYS A 267 ? 0.2631 0.2556 0.2336 -0.0524 0.0191  -0.0023 1137 LYS A O   
3409 C CB  . LYS A 267 ? 0.2077 0.2103 0.1926 -0.0406 0.0181  -0.0030 1137 LYS A CB  
3410 C CG  . LYS A 267 ? 0.2599 0.2636 0.2485 -0.0363 0.0171  -0.0020 1137 LYS A CG  
3411 C CD  . LYS A 267 ? 0.2202 0.2249 0.2135 -0.0316 0.0165  -0.0019 1137 LYS A CD  
3412 C CE  . LYS A 267 ? 0.2274 0.2318 0.2236 -0.0277 0.0154  -0.0006 1137 LYS A CE  
3413 N NZ  . LYS A 267 ? 0.2103 0.2151 0.2101 -0.0238 0.0150  -0.0006 1137 LYS A NZ  
3427 N N   . VAL A 268 ? 0.2043 0.2128 0.1834 -0.0519 0.0224  -0.0079 1138 VAL A N   
3428 C CA  . VAL A 268 ? 0.2166 0.2262 0.1944 -0.0551 0.0234  -0.0094 1138 VAL A CA  
3429 C C   . VAL A 268 ? 0.2289 0.2448 0.2136 -0.0512 0.0230  -0.0108 1138 VAL A C   
3430 O O   . VAL A 268 ? 0.2415 0.2616 0.2318 -0.0467 0.0224  -0.0111 1138 VAL A O   
3431 C CB  . VAL A 268 ? 0.3085 0.3233 0.2845 -0.0611 0.0261  -0.0123 1138 VAL A CB  
3432 C CG1 . VAL A 268 ? 0.3009 0.3086 0.2686 -0.0657 0.0263  -0.0107 1138 VAL A CG1 
3433 C CG2 . VAL A 268 ? 0.3027 0.3283 0.2866 -0.0593 0.0278  -0.0156 1138 VAL A CG2 
3443 N N   . PRO A 269 ? 0.2414 0.2575 0.2251 -0.0532 0.0232  -0.0116 1139 PRO A N   
3444 C CA  . PRO A 269 ? 0.2355 0.2568 0.2247 -0.0500 0.0223  -0.0127 1139 PRO A CA  
3445 C C   . PRO A 269 ? 0.2902 0.3222 0.2871 -0.0483 0.0227  -0.0151 1139 PRO A C   
3446 O O   . PRO A 269 ? 0.2773 0.3151 0.2756 -0.0516 0.0246  -0.0175 1139 PRO A O   
3447 C CB  . PRO A 269 ? 0.3018 0.3224 0.2877 -0.0544 0.0229  -0.0137 1139 PRO A CB  
3448 C CG  . PRO A 269 ? 0.2566 0.2671 0.2345 -0.0576 0.0232  -0.0118 1139 PRO A CG  
3449 C CD  . PRO A 269 ? 0.2264 0.2364 0.2031 -0.0583 0.0237  -0.0112 1139 PRO A CD  
3457 N N   . GLY A 270 ? 0.2579 0.2923 0.2598 -0.0432 0.0212  -0.0147 1140 GLY A N   
3458 C CA  . GLY A 270 ? 0.2672 0.3108 0.2768 -0.0407 0.0211  -0.0167 1140 GLY A CA  
3459 C C   . GLY A 270 ? 0.2795 0.3230 0.2911 -0.0378 0.0215  -0.0165 1140 GLY A C   
3460 O O   . GLY A 270 ? 0.3008 0.3506 0.3189 -0.0349 0.0214  -0.0180 1140 GLY A O   
3464 N N   . SER A 271 ? 0.2152 0.2513 0.2213 -0.0385 0.0219  -0.0145 1141 SER A N   
3465 C CA  . SER A 271 ? 0.2199 0.2554 0.2268 -0.0365 0.0223  -0.0142 1141 SER A CA  
3466 C C   . SER A 271 ? 0.2569 0.2919 0.2673 -0.0309 0.0204  -0.0129 1141 SER A C   
3467 O O   . SER A 271 ? 0.2129 0.2424 0.2211 -0.0292 0.0189  -0.0107 1141 SER A O   
3468 C CB  . SER A 271 ? 0.2499 0.2771 0.2497 -0.0387 0.0222  -0.0118 1141 SER A CB  
3469 O OG  . SER A 271 ? 0.2363 0.2628 0.2315 -0.0444 0.0239  -0.0127 1141 SER A OG  
3475 N N   . ARG A 272 ? 0.2029 0.2431 0.2187 -0.0283 0.0207  -0.0145 1142 ARG A N   
3476 C CA  . ARG A 272 ? 0.2351 0.2749 0.2540 -0.0233 0.0188  -0.0135 1142 ARG A CA  
3477 C C   . ARG A 272 ? 0.2029 0.2404 0.2218 -0.0211 0.0191  -0.0129 1142 ARG A C   
3478 O O   . ARG A 272 ? 0.2063 0.2459 0.2259 -0.0223 0.0210  -0.0146 1142 ARG A O   
3479 C CB  . ARG A 272 ? 0.2050 0.2523 0.2309 -0.0213 0.0181  -0.0155 1142 ARG A CB  
3480 C CG  . ARG A 272 ? 0.2144 0.2632 0.2401 -0.0226 0.0166  -0.0153 1142 ARG A CG  
3481 C CD  . ARG A 272 ? 0.2172 0.2741 0.2501 -0.0211 0.0153  -0.0171 1142 ARG A CD  
3482 N NE  . ARG A 272 ? 0.2074 0.2643 0.2388 -0.0224 0.0133  -0.0163 1142 ARG A NE  
3483 C CZ  . ARG A 272 ? 0.2283 0.2913 0.2648 -0.0215 0.0110  -0.0170 1142 ARG A CZ  
3484 N NH1 . ARG A 272 ? 0.2179 0.2877 0.2624 -0.0188 0.0103  -0.0187 1142 ARG A NH1 
3485 N NH2 . ARG A 272 ? 0.2260 0.2880 0.2595 -0.0235 0.0092  -0.0162 1142 ARG A NH2 
3499 N N   . THR A 273 ? 0.1797 0.2126 0.1975 -0.0182 0.0174  -0.0106 1143 THR A N   
3500 C CA  . THR A 273 ? 0.1953 0.2269 0.2140 -0.0155 0.0173  -0.0102 1143 THR A CA  
3501 C C   . THR A 273 ? 0.1995 0.2335 0.2225 -0.0117 0.0158  -0.0106 1143 THR A C   
3502 O O   . THR A 273 ? 0.1849 0.2168 0.2071 -0.0104 0.0141  -0.0091 1143 THR A O   
3503 C CB  . THR A 273 ? 0.2359 0.2610 0.2506 -0.0151 0.0164  -0.0074 1143 THR A CB  
3504 O OG1 . THR A 273 ? 0.2278 0.2502 0.2384 -0.0187 0.0171  -0.0066 1143 THR A OG1 
3505 C CG2 . THR A 273 ? 0.2031 0.2270 0.2185 -0.0129 0.0163  -0.0071 1143 THR A CG2 
3513 N N   . PRO A 274 ? 0.2051 0.2433 0.2326 -0.0100 0.0164  -0.0127 1144 PRO A N   
3514 C CA  . PRO A 274 ? 0.1847 0.2252 0.2167 -0.0064 0.0143  -0.0129 1144 PRO A CA  
3515 C C   . PRO A 274 ? 0.1862 0.2213 0.2161 -0.0036 0.0128  -0.0108 1144 PRO A C   
3516 O O   . PRO A 274 ? 0.2162 0.2466 0.2419 -0.0043 0.0135  -0.0094 1144 PRO A O   
3517 C CB  . PRO A 274 ? 0.1774 0.2236 0.2154 -0.0054 0.0158  -0.0160 1144 PRO A CB  
3518 C CG  . PRO A 274 ? 0.2364 0.2807 0.2713 -0.0079 0.0188  -0.0169 1144 PRO A CG  
3519 C CD  . PRO A 274 ? 0.2037 0.2447 0.2326 -0.0116 0.0190  -0.0151 1144 PRO A CD  
3527 N N   . GLY A 275 ? 0.1811 0.2170 0.2138 -0.0006 0.0106  -0.0106 1145 GLY A N   
3528 C CA  . GLY A 275 ? 0.2197 0.2501 0.2494 0.0015  0.0089  -0.0085 1145 GLY A CA  
3529 C C   . GLY A 275 ? 0.2550 0.2818 0.2830 0.0023  0.0102  -0.0084 1145 GLY A C   
3530 O O   . GLY A 275 ? 0.2216 0.2504 0.2526 0.0031  0.0116  -0.0103 1145 GLY A O   
3534 N N   . HIS A 276 ? 0.2027 0.2244 0.2263 0.0019  0.0100  -0.0064 1146 HIS A N   
3535 C CA  . HIS A 276 ? 0.2236 0.2417 0.2453 0.0024  0.0109  -0.0061 1146 HIS A CA  
3536 C C   . HIS A 276 ? 0.2509 0.2640 0.2686 0.0023  0.0102  -0.0039 1146 HIS A C   
3537 O O   . HIS A 276 ? 0.2223 0.2345 0.2385 0.0015  0.0097  -0.0028 1146 HIS A O   
3538 C CB  . HIS A 276 ? 0.2560 0.2748 0.2766 -0.0001 0.0130  -0.0067 1146 HIS A CB  
3539 C CG  . HIS A 276 ? 0.2681 0.2861 0.2864 -0.0025 0.0132  -0.0053 1146 HIS A CG  
3540 N ND1 . HIS A 276 ? 0.3414 0.3619 0.3604 -0.0037 0.0131  -0.0057 1146 HIS A ND1 
3541 C CD2 . HIS A 276 ? 0.3298 0.3446 0.3453 -0.0038 0.0132  -0.0035 1146 HIS A CD2 
3542 C CE1 . HIS A 276 ? 0.3368 0.3549 0.3533 -0.0056 0.0133  -0.0042 1146 HIS A CE1 
3543 N NE2 . HIS A 276 ? 0.3809 0.3958 0.3957 -0.0054 0.0132  -0.0029 1146 HIS A NE2 
3551 N N   . GLN A 277 ? 0.2203 0.2304 0.2366 0.0030  0.0105  -0.0036 1147 GLN A N   
3552 C CA  . GLN A 277 ? 0.2195 0.2258 0.2325 0.0020  0.0107  -0.0019 1147 GLN A CA  
3553 C C   . GLN A 277 ? 0.2033 0.2099 0.2158 0.0001  0.0121  -0.0020 1147 GLN A C   
3554 O O   . GLN A 277 ? 0.2019 0.2100 0.2152 -0.0003 0.0130  -0.0034 1147 GLN A O   
3555 C CB  . GLN A 277 ? 0.1931 0.1954 0.2041 0.0034  0.0099  -0.0014 1147 GLN A CB  
3556 C CG  . GLN A 277 ? 0.2204 0.2211 0.2304 0.0046  0.0081  -0.0007 1147 GLN A CG  
3557 C CD  . GLN A 277 ? 0.1843 0.1803 0.1919 0.0060  0.0069  -0.0002 1147 GLN A CD  
3558 O OE1 . GLN A 277 ? 0.2743 0.2699 0.2835 0.0078  0.0067  -0.0012 1147 GLN A OE1 
3559 N NE2 . GLN A 277 ? 0.2141 0.2061 0.2176 0.0051  0.0065  0.0011  1147 GLN A NE2 
3568 N N   . GLU A 278 ? 0.1937 0.1990 0.2050 -0.0013 0.0121  -0.0004 1148 GLU A N   
3569 C CA  . GLU A 278 ? 0.1934 0.1986 0.2038 -0.0034 0.0126  0.0001  1148 GLU A CA  
3570 C C   . GLU A 278 ? 0.2616 0.2651 0.2704 -0.0035 0.0130  -0.0005 1148 GLU A C   
3571 O O   . GLU A 278 ? 0.2026 0.2039 0.2107 -0.0020 0.0128  -0.0008 1148 GLU A O   
3572 C CB  . GLU A 278 ? 0.2043 0.2085 0.2149 -0.0042 0.0121  0.0020  1148 GLU A CB  
3573 C CG  . GLU A 278 ? 0.2040 0.2090 0.2160 -0.0042 0.0121  0.0025  1148 GLU A CG  
3574 C CD  . GLU A 278 ? 0.2441 0.2508 0.2560 -0.0056 0.0122  0.0020  1148 GLU A CD  
3575 O OE1 . GLU A 278 ? 0.2391 0.2458 0.2499 -0.0075 0.0120  0.0025  1148 GLU A OE1 
3576 O OE2 . GLU A 278 ? 0.2905 0.2984 0.3030 -0.0052 0.0124  0.0011  1148 GLU A OE2 
3583 N N   . ASN A 279 ? 0.2064 0.2100 0.2137 -0.0058 0.0135  -0.0006 1149 ASN A N   
3584 C CA  . ASN A 279 ? 0.1821 0.1835 0.1870 -0.0068 0.0140  -0.0011 1149 ASN A CA  
3585 C C   . ASN A 279 ? 0.1915 0.1904 0.1954 -0.0065 0.0132  0.0003  1149 ASN A C   
3586 O O   . ASN A 279 ? 0.1795 0.1791 0.1844 -0.0073 0.0123  0.0021  1149 ASN A O   
3587 C CB  . ASN A 279 ? 0.1930 0.1946 0.1954 -0.0102 0.0143  -0.0010 1149 ASN A CB  
3588 C CG  . ASN A 279 ? 0.2789 0.2827 0.2815 -0.0111 0.0158  -0.0031 1149 ASN A CG  
3589 O OD1 . ASN A 279 ? 0.3259 0.3314 0.3289 -0.0123 0.0155  -0.0025 1149 ASN A OD1 
3590 N ND2 . ASN A 279 ? 0.1960 0.1993 0.1984 -0.0106 0.0176  -0.0056 1149 ASN A ND2 
3597 N N   . ASN A 280 ? 0.1632 0.1593 0.1656 -0.0054 0.0137  -0.0006 1150 ASN A N   
3598 C CA  . ASN A 280 ? 0.1895 0.1827 0.1902 -0.0055 0.0132  0.0005  1150 ASN A CA  
3599 C C   . ASN A 280 ? 0.2123 0.2062 0.2146 -0.0047 0.0126  0.0018  1150 ASN A C   
3600 O O   . ASN A 280 ? 0.2011 0.1942 0.2030 -0.0058 0.0125  0.0029  1150 ASN A O   
3601 C CB  . ASN A 280 ? 0.2080 0.2006 0.2066 -0.0085 0.0132  0.0012  1150 ASN A CB  
3602 C CG  . ASN A 280 ? 0.2442 0.2343 0.2396 -0.0096 0.0143  -0.0006 1150 ASN A CG  
3603 O OD1 . ASN A 280 ? 0.2032 0.1944 0.1977 -0.0115 0.0149  -0.0013 1150 ASN A OD1 
3604 N ND2 . ASN A 280 ? 0.2071 0.1931 0.2003 -0.0084 0.0149  -0.0015 1150 ASN A ND2 
3611 N N   . ASN A 281 ? 0.1764 0.1720 0.1807 -0.0030 0.0124  0.0015  1151 ASN A N   
3612 C CA  . ASN A 281 ? 0.1573 0.1528 0.1623 -0.0024 0.0122  0.0023  1151 ASN A CA  
3613 C C   . ASN A 281 ? 0.1735 0.1708 0.1806 -0.0038 0.0124  0.0035  1151 ASN A C   
3614 O O   . ASN A 281 ? 0.1928 0.1894 0.2003 -0.0039 0.0129  0.0039  1151 ASN A O   
3615 C CB  . ASN A 281 ? 0.1742 0.1658 0.1763 -0.0019 0.0120  0.0024  1151 ASN A CB  
3616 C CG  . ASN A 281 ? 0.2726 0.2625 0.2737 0.0003  0.0110  0.0017  1151 ASN A CG  
3617 O OD1 . ASN A 281 ? 0.2792 0.2718 0.2827 0.0014  0.0106  0.0010  1151 ASN A OD1 
3618 N ND2 . ASN A 281 ? 0.2605 0.2459 0.2584 0.0008  0.0105  0.0018  1151 ASN A ND2 
3625 N N   . PHE A 282 ? 0.1821 0.1815 0.1908 -0.0051 0.0120  0.0041  1152 PHE A N   
3626 C CA  . PHE A 282 ? 0.1778 0.1789 0.1896 -0.0058 0.0117  0.0054  1152 PHE A CA  
3627 C C   . PHE A 282 ? 0.2105 0.2125 0.2244 -0.0048 0.0120  0.0054  1152 PHE A C   
3628 O O   . PHE A 282 ? 0.1952 0.1974 0.2082 -0.0043 0.0120  0.0046  1152 PHE A O   
3629 C CB  . PHE A 282 ? 0.1740 0.1762 0.1860 -0.0077 0.0105  0.0065  1152 PHE A CB  
3630 C CG  . PHE A 282 ? 0.1878 0.1894 0.1985 -0.0093 0.0101  0.0070  1152 PHE A CG  
3631 C CD1 . PHE A 282 ? 0.2225 0.2256 0.2364 -0.0100 0.0096  0.0082  1152 PHE A CD1 
3632 C CD2 . PHE A 282 ? 0.2290 0.2285 0.2357 -0.0101 0.0106  0.0059  1152 PHE A CD2 
3633 C CE1 . PHE A 282 ? 0.2549 0.2577 0.2676 -0.0118 0.0093  0.0085  1152 PHE A CE1 
3634 C CE2 . PHE A 282 ? 0.2178 0.2161 0.2226 -0.0118 0.0104  0.0062  1152 PHE A CE2 
3635 C CZ  . PHE A 282 ? 0.1844 0.1845 0.1920 -0.0129 0.0097  0.0075  1152 PHE A CZ  
3645 N N   . CYS A 283 ? 0.1889 0.1914 0.2060 -0.0047 0.0124  0.0060  1153 CYS A N   
3646 C CA  . CYS A 283 ? 0.1692 0.1718 0.1881 -0.0039 0.0130  0.0058  1153 CYS A CA  
3647 C C   . CYS A 283 ? 0.1887 0.1921 0.2081 -0.0044 0.0118  0.0066  1153 CYS A C   
3648 O O   . CYS A 283 ? 0.2018 0.2058 0.2210 -0.0056 0.0104  0.0077  1153 CYS A O   
3649 C CB  . CYS A 283 ? 0.1663 0.1693 0.1894 -0.0036 0.0140  0.0060  1153 CYS A CB  
3650 S SG  . CYS A 283 ? 0.2124 0.2142 0.2339 -0.0040 0.0161  0.0048  1153 CYS A SG  
3656 N N   A SER A 284 ? 0.1816 0.1844 0.2009 -0.0041 0.0122  0.0061  1154 SER A N   
3657 N N   B SER A 284 ? 0.1768 0.1797 0.1961 -0.0041 0.0122  0.0061  1154 SER A N   
3658 C CA  A SER A 284 ? 0.1540 0.1569 0.1731 -0.0051 0.0111  0.0069  1154 SER A CA  
3659 C CA  B SER A 284 ? 0.1760 0.1788 0.1951 -0.0050 0.0112  0.0068  1154 SER A CA  
3660 C C   A SER A 284 ? 0.1898 0.1912 0.2113 -0.0045 0.0115  0.0073  1154 SER A C   
3661 C C   B SER A 284 ? 0.1959 0.1973 0.2177 -0.0044 0.0115  0.0074  1154 SER A C   
3662 O O   A SER A 284 ? 0.1894 0.1900 0.2113 -0.0037 0.0131  0.0061  1154 SER A O   
3663 O O   B SER A 284 ? 0.1617 0.1624 0.1846 -0.0035 0.0132  0.0063  1154 SER A O   
3664 C CB  A SER A 284 ? 0.1883 0.1918 0.2041 -0.0058 0.0113  0.0056  1154 SER A CB  
3665 C CB  B SER A 284 ? 0.2153 0.2187 0.2313 -0.0055 0.0116  0.0055  1154 SER A CB  
3666 O OG  A SER A 284 ? 0.1925 0.1958 0.2079 -0.0052 0.0123  0.0045  1154 SER A OG  
3667 O OG  B SER A 284 ? 0.2403 0.2436 0.2552 -0.0071 0.0109  0.0060  1154 SER A OG  
3678 N N   . VAL A 285 ? 0.1673 0.1679 0.1899 -0.0052 0.0099  0.0089  1155 VAL A N   
3679 C CA  . VAL A 285 ? 0.2082 0.2066 0.2334 -0.0046 0.0100  0.0096  1155 VAL A CA  
3680 C C   . VAL A 285 ? 0.1797 0.1764 0.2012 -0.0063 0.0092  0.0099  1155 VAL A C   
3681 O O   . VAL A 285 ? 0.1836 0.1806 0.2024 -0.0082 0.0076  0.0109  1155 VAL A O   
3682 C CB  . VAL A 285 ? 0.2120 0.2104 0.2422 -0.0039 0.0080  0.0118  1155 VAL A CB  
3683 C CG1 . VAL A 285 ? 0.2264 0.2218 0.2595 -0.0029 0.0077  0.0126  1155 VAL A CG1 
3684 C CG2 . VAL A 285 ? 0.2290 0.2298 0.2633 -0.0026 0.0091  0.0112  1155 VAL A CG2 
3695 N N   . ASN A 286 ? 0.1913 0.1859 0.2121 -0.0063 0.0104  0.0090  1156 ASN A N   
3696 C CA  . ASN A 286 ? 0.1957 0.1887 0.2124 -0.0085 0.0100  0.0091  1156 ASN A CA  
3697 C C   . ASN A 286 ? 0.1741 0.1628 0.1917 -0.0082 0.0103  0.0095  1156 ASN A C   
3698 O O   . ASN A 286 ? 0.1853 0.1730 0.2044 -0.0069 0.0123  0.0080  1156 ASN A O   
3699 C CB  . ASN A 286 ? 0.1931 0.1886 0.2068 -0.0094 0.0115  0.0068  1156 ASN A CB  
3700 C CG  . ASN A 286 ? 0.2185 0.2134 0.2285 -0.0121 0.0115  0.0064  1156 ASN A CG  
3701 O OD1 . ASN A 286 ? 0.1906 0.1820 0.1996 -0.0129 0.0115  0.0068  1156 ASN A OD1 
3702 N ND2 . ASN A 286 ? 0.2044 0.2026 0.2124 -0.0136 0.0116  0.0053  1156 ASN A ND2 
3709 N N   . ILE A 287 ? 0.1684 0.1539 0.1845 -0.0096 0.0084  0.0114  1157 ILE A N   
3710 C CA  . ILE A 287 ? 0.2055 0.1858 0.2219 -0.0093 0.0086  0.0118  1157 ILE A CA  
3711 C C   . ILE A 287 ? 0.2024 0.1805 0.2126 -0.0127 0.0086  0.0115  1157 ILE A C   
3712 O O   . ILE A 287 ? 0.2117 0.1901 0.2183 -0.0153 0.0069  0.0127  1157 ILE A O   
3713 C CB  . ILE A 287 ? 0.2017 0.1789 0.2220 -0.0079 0.0058  0.0148  1157 ILE A CB  
3714 C CG1 . ILE A 287 ? 0.1849 0.1650 0.2124 -0.0047 0.0061  0.0147  1157 ILE A CG1 
3715 C CG2 . ILE A 287 ? 0.2255 0.1962 0.2460 -0.0075 0.0059  0.0152  1157 ILE A CG2 
3716 C CD1 . ILE A 287 ? 0.2174 0.1959 0.2503 -0.0031 0.0027  0.0178  1157 ILE A CD1 
3728 N N   . ASN A 288 ? 0.2006 0.1767 0.2092 -0.0132 0.0106  0.0098  1158 ASN A N   
3729 C CA  . ASN A 288 ? 0.2031 0.1771 0.2060 -0.0167 0.0109  0.0093  1158 ASN A CA  
3730 C C   . ASN A 288 ? 0.1995 0.1662 0.2008 -0.0175 0.0091  0.0116  1158 ASN A C   
3731 O O   . ASN A 288 ? 0.2117 0.1738 0.2160 -0.0152 0.0095  0.0120  1158 ASN A O   
3732 C CB  . ASN A 288 ? 0.2483 0.2231 0.2499 -0.0173 0.0135  0.0065  1158 ASN A CB  
3733 C CG  . ASN A 288 ? 0.3047 0.2779 0.3006 -0.0214 0.0140  0.0058  1158 ASN A CG  
3734 O OD1 . ASN A 288 ? 0.2934 0.2647 0.2860 -0.0239 0.0126  0.0072  1158 ASN A OD1 
3735 N ND2 . ASN A 288 ? 0.2652 0.2392 0.2596 -0.0225 0.0159  0.0035  1158 ASN A ND2 
3742 N N   . ILE A 289 ? 0.2019 0.1670 0.1984 -0.0208 0.0072  0.0132  1159 ILE A N   
3743 C CA  . ILE A 289 ? 0.1984 0.1557 0.1919 -0.0223 0.0049  0.0160  1159 ILE A CA  
3744 C C   . ILE A 289 ? 0.2584 0.2106 0.2473 -0.0247 0.0065  0.0148  1159 ILE A C   
3745 O O   . ILE A 289 ? 0.2757 0.2200 0.2636 -0.0244 0.0053  0.0165  1159 ILE A O   
3746 C CB  . ILE A 289 ? 0.2131 0.1701 0.2012 -0.0261 0.0024  0.0180  1159 ILE A CB  
3747 C CG1 . ILE A 289 ? 0.2277 0.1894 0.2194 -0.0244 0.0008  0.0191  1159 ILE A CG1 
3748 C CG2 . ILE A 289 ? 0.2401 0.1879 0.2240 -0.0280 -0.0008 0.0214  1159 ILE A CG2 
3749 C CD1 . ILE A 289 ? 0.2473 0.2078 0.2462 -0.0199 -0.0012 0.0211  1159 ILE A CD1 
3761 N N   . GLY A 290 ? 0.2422 0.1988 0.2283 -0.0271 0.0091  0.0119  1160 GLY A N   
3762 C CA  . GLY A 290 ? 0.2647 0.2175 0.2459 -0.0302 0.0107  0.0105  1160 GLY A CA  
3763 C C   . GLY A 290 ? 0.2793 0.2306 0.2533 -0.0357 0.0100  0.0111  1160 GLY A C   
3764 O O   . GLY A 290 ? 0.2664 0.2203 0.2390 -0.0372 0.0086  0.0122  1160 GLY A O   
3768 N N   . PRO A 291 ? 0.2702 0.2168 0.2389 -0.0392 0.0111  0.0102  1161 PRO A N   
3769 C CA  . PRO A 291 ? 0.2717 0.2133 0.2404 -0.0383 0.0128  0.0090  1161 PRO A CA  
3770 C C   . PRO A 291 ? 0.3030 0.2515 0.2739 -0.0379 0.0156  0.0056  1161 PRO A C   
3771 O O   . PRO A 291 ? 0.3112 0.2561 0.2828 -0.0366 0.0171  0.0044  1161 PRO A O   
3772 C CB  . PRO A 291 ? 0.3599 0.2944 0.3203 -0.0436 0.0127  0.0095  1161 PRO A CB  
3773 C CG  . PRO A 291 ? 0.3166 0.2570 0.2733 -0.0482 0.0127  0.0090  1161 PRO A CG  
3774 C CD  . PRO A 291 ? 0.3290 0.2739 0.2901 -0.0452 0.0109  0.0105  1161 PRO A CD  
3782 N N   . GLY A 292 ? 0.2739 0.2316 0.2460 -0.0391 0.0161  0.0040  1162 GLY A N   
3783 C CA  . GLY A 292 ? 0.2817 0.2460 0.2556 -0.0391 0.0179  0.0011  1162 GLY A CA  
3784 C C   . GLY A 292 ? 0.2977 0.2667 0.2778 -0.0343 0.0180  0.0007  1162 GLY A C   
3785 O O   . GLY A 292 ? 0.2534 0.2209 0.2368 -0.0309 0.0169  0.0025  1162 GLY A O   
3789 N N   . ASP A 293 ? 0.2384 0.2132 0.2199 -0.0343 0.0190  -0.0016 1163 ASP A N   
3790 C CA  . ASP A 293 ? 0.2328 0.2110 0.2189 -0.0304 0.0191  -0.0020 1163 ASP A CA  
3791 C C   . ASP A 293 ? 0.2093 0.1962 0.1985 -0.0296 0.0182  -0.0026 1163 ASP A C   
3792 O O   . ASP A 293 ? 0.2203 0.2119 0.2086 -0.0324 0.0182  -0.0036 1163 ASP A O   
3793 C CB  . ASP A 293 ? 0.2722 0.2495 0.2568 -0.0310 0.0205  -0.0038 1163 ASP A CB  
3794 C CG  . ASP A 293 ? 0.3617 0.3299 0.3433 -0.0317 0.0220  -0.0039 1163 ASP A CG  
3795 O OD1 . ASP A 293 ? 0.3097 0.2724 0.2929 -0.0294 0.0219  -0.0023 1163 ASP A OD1 
3796 O OD2 . ASP A 293 ? 0.3497 0.3163 0.3275 -0.0346 0.0232  -0.0056 1163 ASP A OD2 
3801 N N   . CYS A 294 ? 0.1977 0.1867 0.1907 -0.0259 0.0178  -0.0022 1164 CYS A N   
3802 C CA  . CYS A 294 ? 0.1818 0.1781 0.1779 -0.0246 0.0171  -0.0029 1164 CYS A CA  
3803 C C   . CYS A 294 ? 0.2543 0.2524 0.2515 -0.0231 0.0171  -0.0039 1164 CYS A C   
3804 O O   . CYS A 294 ? 0.2397 0.2333 0.2361 -0.0220 0.0180  -0.0037 1164 CYS A O   
3805 C CB  . CYS A 294 ? 0.2504 0.2470 0.2492 -0.0219 0.0163  -0.0014 1164 CYS A CB  
3806 S SG  . CYS A 294 ? 0.2910 0.2866 0.2878 -0.0242 0.0157  -0.0002 1164 CYS A SG  
3812 N N   . GLU A 295 ? 0.2003 0.2048 0.1992 -0.0231 0.0162  -0.0050 1165 GLU A N   
3813 C CA  . GLU A 295 ? 0.1647 0.1707 0.1641 -0.0218 0.0155  -0.0055 1165 GLU A CA  
3814 C C   . GLU A 295 ? 0.2193 0.2284 0.2220 -0.0186 0.0144  -0.0049 1165 GLU A C   
3815 O O   . GLU A 295 ? 0.2112 0.2248 0.2167 -0.0181 0.0138  -0.0052 1165 GLU A O   
3816 C CB  . GLU A 295 ? 0.2265 0.2371 0.2254 -0.0244 0.0146  -0.0069 1165 GLU A CB  
3817 C CG  . GLU A 295 ? 0.2683 0.2798 0.2665 -0.0237 0.0132  -0.0071 1165 GLU A CG  
3818 C CD  . GLU A 295 ? 0.3546 0.3707 0.3525 -0.0265 0.0117  -0.0082 1165 GLU A CD  
3819 O OE1 . GLU A 295 ? 0.2985 0.3204 0.2995 -0.0277 0.0114  -0.0091 1165 GLU A OE1 
3820 O OE2 . GLU A 295 ? 0.3184 0.3326 0.3129 -0.0279 0.0110  -0.0083 1165 GLU A OE2 
3827 N N   . TRP A 296 ? 0.1774 0.1837 0.1795 -0.0168 0.0144  -0.0044 1166 TRP A N   
3828 C CA  . TRP A 296 ? 0.2061 0.2137 0.2106 -0.0139 0.0136  -0.0037 1166 TRP A CA  
3829 C C   . TRP A 296 ? 0.2235 0.2325 0.2272 -0.0133 0.0120  -0.0039 1166 TRP A C   
3830 O O   . TRP A 296 ? 0.2190 0.2256 0.2194 -0.0150 0.0121  -0.0043 1166 TRP A O   
3831 C CB  . TRP A 296 ? 0.1693 0.1722 0.1737 -0.0124 0.0149  -0.0027 1166 TRP A CB  
3832 C CG  . TRP A 296 ? 0.1906 0.1923 0.1964 -0.0123 0.0154  -0.0018 1166 TRP A CG  
3833 C CD1 . TRP A 296 ? 0.2033 0.2023 0.2079 -0.0140 0.0162  -0.0017 1166 TRP A CD1 
3834 C CD2 . TRP A 296 ? 0.1976 0.2000 0.2057 -0.0107 0.0150  -0.0008 1166 TRP A CD2 
3835 N NE1 . TRP A 296 ? 0.1794 0.1774 0.1852 -0.0136 0.0158  -0.0003 1166 TRP A NE1 
3836 C CE2 . TRP A 296 ? 0.2268 0.2270 0.2347 -0.0116 0.0151  0.0002  1166 TRP A CE2 
3837 C CE3 . TRP A 296 ? 0.2002 0.2043 0.2098 -0.0088 0.0143  -0.0004 1166 TRP A CE3 
3838 C CZ2 . TRP A 296 ? 0.2365 0.2367 0.2458 -0.0110 0.0144  0.0016  1166 TRP A CZ2 
3839 C CZ3 . TRP A 296 ? 0.2325 0.2366 0.2434 -0.0082 0.0140  0.0006  1166 TRP A CZ3 
3840 C CH2 . TRP A 296 ? 0.2347 0.2371 0.2455 -0.0094 0.0139  0.0017  1166 TRP A CH2 
3851 N N   . PHE A 297 ? 0.1657 0.1778 0.1721 -0.0112 0.0105  -0.0037 1167 PHE A N   
3852 C CA  . PHE A 297 ? 0.2057 0.2186 0.2115 -0.0102 0.0083  -0.0034 1167 PHE A CA  
3853 C C   . PHE A 297 ? 0.2143 0.2250 0.2204 -0.0078 0.0082  -0.0025 1167 PHE A C   
3854 O O   . PHE A 297 ? 0.1885 0.2008 0.1976 -0.0062 0.0086  -0.0025 1167 PHE A O   
3855 C CB  . PHE A 297 ? 0.1966 0.2159 0.2064 -0.0098 0.0061  -0.0041 1167 PHE A CB  
3856 C CG  . PHE A 297 ? 0.2138 0.2363 0.2238 -0.0126 0.0062  -0.0052 1167 PHE A CG  
3857 C CD1 . PHE A 297 ? 0.2859 0.3091 0.2938 -0.0145 0.0044  -0.0053 1167 PHE A CD1 
3858 C CD2 . PHE A 297 ? 0.2223 0.2467 0.2339 -0.0139 0.0081  -0.0061 1167 PHE A CD2 
3859 C CE1 . PHE A 297 ? 0.2638 0.2900 0.2716 -0.0176 0.0045  -0.0064 1167 PHE A CE1 
3860 C CE2 . PHE A 297 ? 0.2377 0.2648 0.2489 -0.0170 0.0084  -0.0072 1167 PHE A CE2 
3861 C CZ  . PHE A 297 ? 0.2565 0.2847 0.2661 -0.0188 0.0066  -0.0074 1167 PHE A CZ  
3871 N N   . VAL A 298 ? 0.1690 0.1758 0.1716 -0.0078 0.0079  -0.0018 1168 VAL A N   
3872 C CA  . VAL A 298 ? 0.1808 0.1847 0.1829 -0.0062 0.0084  -0.0011 1168 VAL A CA  
3873 C C   . VAL A 298 ? 0.1996 0.2014 0.1986 -0.0059 0.0062  -0.0003 1168 VAL A C   
3874 O O   . VAL A 298 ? 0.2025 0.2023 0.1974 -0.0079 0.0053  -0.0002 1168 VAL A O   
3875 C CB  . VAL A 298 ? 0.2574 0.2574 0.2579 -0.0072 0.0113  -0.0011 1168 VAL A CB  
3876 C CG1 . VAL A 298 ? 0.2446 0.2414 0.2434 -0.0065 0.0118  -0.0005 1168 VAL A CG1 
3877 C CG2 . VAL A 298 ? 0.2172 0.2186 0.2213 -0.0067 0.0127  -0.0012 1168 VAL A CG2 
3887 N N   . VAL A 299 ? 0.1843 0.1856 0.1843 -0.0038 0.0052  0.0004  1169 VAL A N   
3888 C CA  . VAL A 299 ? 0.2184 0.2165 0.2150 -0.0034 0.0027  0.0014  1169 VAL A CA  
3889 C C   . VAL A 299 ? 0.2139 0.2081 0.2086 -0.0029 0.0043  0.0019  1169 VAL A C   
3890 O O   . VAL A 299 ? 0.1932 0.1889 0.1913 -0.0016 0.0056  0.0017  1169 VAL A O   
3891 C CB  . VAL A 299 ? 0.2450 0.2465 0.2454 -0.0009 -0.0006 0.0017  1169 VAL A CB  
3892 C CG1 . VAL A 299 ? 0.2224 0.2193 0.2194 0.0002  -0.0033 0.0032  1169 VAL A CG1 
3893 C CG2 . VAL A 299 ? 0.2304 0.2360 0.2324 -0.0019 -0.0026 0.0013  1169 VAL A CG2 
3903 N N   . PRO A 300 ? 0.2239 0.2131 0.2129 -0.0046 0.0041  0.0026  1170 PRO A N   
3904 C CA  . PRO A 300 ? 0.2031 0.1888 0.1903 -0.0047 0.0060  0.0029  1170 PRO A CA  
3905 C C   . PRO A 300 ? 0.1893 0.1748 0.1782 -0.0023 0.0045  0.0035  1170 PRO A C   
3906 O O   . PRO A 300 ? 0.2382 0.2242 0.2281 -0.0005 0.0015  0.0041  1170 PRO A O   
3907 C CB  . PRO A 300 ? 0.2206 0.2008 0.2004 -0.0075 0.0059  0.0034  1170 PRO A CB  
3908 C CG  . PRO A 300 ? 0.2670 0.2478 0.2448 -0.0094 0.0053  0.0029  1170 PRO A CG  
3909 C CD  . PRO A 300 ? 0.2106 0.1967 0.1937 -0.0070 0.0026  0.0031  1170 PRO A CD  
3917 N N   . GLU A 301 ? 0.2169 0.2016 0.2067 -0.0023 0.0067  0.0033  1171 GLU A N   
3918 C CA  . GLU A 301 ? 0.2267 0.2105 0.2174 -0.0005 0.0059  0.0037  1171 GLU A CA  
3919 C C   . GLU A 301 ? 0.2558 0.2349 0.2423 0.0002  0.0029  0.0048  1171 GLU A C   
3920 O O   . GLU A 301 ? 0.2158 0.1949 0.2045 0.0026  0.0012  0.0049  1171 GLU A O   
3921 C CB  . GLU A 301 ? 0.2242 0.2068 0.2146 -0.0018 0.0085  0.0036  1171 GLU A CB  
3922 C CG  . GLU A 301 ? 0.2194 0.2011 0.2106 -0.0006 0.0082  0.0037  1171 GLU A CG  
3923 C CD  . GLU A 301 ? 0.3342 0.3098 0.3199 -0.0008 0.0068  0.0046  1171 GLU A CD  
3924 O OE1 . GLU A 301 ? 0.3446 0.3165 0.3252 -0.0030 0.0069  0.0051  1171 GLU A OE1 
3925 O OE2 . GLU A 301 ? 0.3185 0.2924 0.3044 0.0008  0.0057  0.0046  1171 GLU A OE2 
3932 N N   . GLY A 302 ? 0.2444 0.2191 0.2248 -0.0021 0.0024  0.0056  1172 GLY A N   
3933 C CA  . GLY A 302 ? 0.2694 0.2382 0.2445 -0.0020 -0.0008 0.0071  1172 GLY A CA  
3934 C C   . GLY A 302 ? 0.2957 0.2659 0.2733 0.0007  -0.0050 0.0079  1172 GLY A C   
3935 O O   . GLY A 302 ? 0.2649 0.2307 0.2401 0.0020  -0.0082 0.0093  1172 GLY A O   
3939 N N   . TYR A 303 ? 0.2622 0.2386 0.2450 0.0014  -0.0051 0.0070  1173 TYR A N   
3940 C CA  . TYR A 303 ? 0.2609 0.2402 0.2476 0.0039  -0.0089 0.0074  1173 TYR A CA  
3941 C C   . TYR A 303 ? 0.2348 0.2190 0.2296 0.0074  -0.0085 0.0060  1173 TYR A C   
3942 O O   . TYR A 303 ? 0.2331 0.2216 0.2333 0.0096  -0.0108 0.0057  1173 TYR A O   
3943 C CB  . TYR A 303 ? 0.2165 0.1999 0.2038 0.0021  -0.0094 0.0070  1173 TYR A CB  
3944 C CG  . TYR A 303 ? 0.2747 0.2528 0.2536 -0.0014 -0.0108 0.0084  1173 TYR A CG  
3945 C CD1 . TYR A 303 ? 0.2562 0.2322 0.2324 -0.0014 -0.0159 0.0102  1173 TYR A CD1 
3946 C CD2 . TYR A 303 ? 0.2165 0.1915 0.1900 -0.0048 -0.0071 0.0078  1173 TYR A CD2 
3947 C CE1 . TYR A 303 ? 0.2261 0.1964 0.1930 -0.0054 -0.0173 0.0116  1173 TYR A CE1 
3948 C CE2 . TYR A 303 ? 0.2746 0.2443 0.2396 -0.0086 -0.0078 0.0086  1173 TYR A CE2 
3949 C CZ  . TYR A 303 ? 0.3193 0.2864 0.2804 -0.0091 -0.0129 0.0106  1173 TYR A CZ  
3950 O OH  . TYR A 303 ? 0.3302 0.2914 0.2816 -0.0136 -0.0137 0.0115  1173 TYR A OH  
3960 N N   . TRP A 304 ? 0.2020 0.1859 0.1979 0.0078  -0.0054 0.0051  1174 TRP A N   
3961 C CA  . TRP A 304 ? 0.2062 0.1947 0.2090 0.0103  -0.0044 0.0034  1174 TRP A CA  
3962 C C   . TRP A 304 ? 0.2382 0.2253 0.2439 0.0138  -0.0073 0.0035  1174 TRP A C   
3963 O O   . TRP A 304 ? 0.2321 0.2243 0.2448 0.0161  -0.0072 0.0019  1174 TRP A O   
3964 C CB  . TRP A 304 ? 0.2459 0.2343 0.2485 0.0093  -0.0007 0.0025  1174 TRP A CB  
3965 C CG  . TRP A 304 ? 0.2168 0.1993 0.2162 0.0098  -0.0005 0.0029  1174 TRP A CG  
3966 C CD1 . TRP A 304 ? 0.2338 0.2108 0.2270 0.0077  0.0001  0.0041  1174 TRP A CD1 
3967 C CD2 . TRP A 304 ? 0.2426 0.2241 0.2446 0.0122  -0.0004 0.0019  1174 TRP A CD2 
3968 N NE1 . TRP A 304 ? 0.2724 0.2449 0.2639 0.0085  0.0002  0.0041  1174 TRP A NE1 
3969 C CE2 . TRP A 304 ? 0.2684 0.2432 0.2650 0.0113  -0.0001 0.0027  1174 TRP A CE2 
3970 C CE3 . TRP A 304 ? 0.2211 0.2067 0.2294 0.0148  -0.0003 0.0001  1174 TRP A CE3 
3971 C CZ2 . TRP A 304 ? 0.3180 0.2894 0.3150 0.0130  0.0003  0.0019  1174 TRP A CZ2 
3972 C CZ3 . TRP A 304 ? 0.2890 0.2714 0.2982 0.0166  0.0003  -0.0010 1174 TRP A CZ3 
3973 C CH2 . TRP A 304 ? 0.2733 0.2485 0.2766 0.0158  0.0005  0.0000  1174 TRP A CH2 
3984 N N   . GLY A 305 ? 0.2521 0.2321 0.2526 0.0141  -0.0097 0.0054  1175 GLY A N   
3985 C CA  . GLY A 305 ? 0.3162 0.2936 0.3192 0.0177  -0.0131 0.0059  1175 GLY A CA  
3986 C C   . GLY A 305 ? 0.3048 0.2870 0.3132 0.0197  -0.0169 0.0062  1175 GLY A C   
3987 O O   . GLY A 305 ? 0.3041 0.2895 0.3201 0.0234  -0.0183 0.0051  1175 GLY A O   
3991 N N   . VAL A 306 ? 0.2265 0.2095 0.2313 0.0169  -0.0185 0.0075  1176 VAL A N   
3992 C CA  . VAL A 306 ? 0.2453 0.2335 0.2547 0.0179  -0.0223 0.0079  1176 VAL A CA  
3993 C C   . VAL A 306 ? 0.2736 0.2716 0.2924 0.0191  -0.0199 0.0051  1176 VAL A C   
3994 O O   . VAL A 306 ? 0.2385 0.2416 0.2652 0.0220  -0.0224 0.0044  1176 VAL A O   
3995 C CB  . VAL A 306 ? 0.2234 0.2100 0.2256 0.0137  -0.0236 0.0096  1176 VAL A CB  
3996 C CG1 . VAL A 306 ? 0.3011 0.2937 0.3080 0.0141  -0.0276 0.0099  1176 VAL A CG1 
3997 C CG2 . VAL A 306 ? 0.3166 0.2933 0.3086 0.0118  -0.0260 0.0122  1176 VAL A CG2 
4007 N N   . LEU A 307 ? 0.2447 0.2452 0.2628 0.0168  -0.0151 0.0035  1177 LEU A N   
4008 C CA  . LEU A 307 ? 0.2482 0.2570 0.2739 0.0172  -0.0126 0.0008  1177 LEU A CA  
4009 C C   . LEU A 307 ? 0.2598 0.2704 0.2923 0.0207  -0.0114 -0.0011 1177 LEU A C   
4010 O O   . LEU A 307 ? 0.2622 0.2799 0.3029 0.0223  -0.0111 -0.0032 1177 LEU A O   
4011 C CB  . LEU A 307 ? 0.2159 0.2257 0.2386 0.0139  -0.0081 -0.0001 1177 LEU A CB  
4012 C CG  . LEU A 307 ? 0.3192 0.3317 0.3400 0.0108  -0.0082 0.0002  1177 LEU A CG  
4013 C CD1 . LEU A 307 ? 0.4329 0.4417 0.4486 0.0097  -0.0120 0.0024  1177 LEU A CD1 
4014 C CD2 . LEU A 307 ? 0.4402 0.4510 0.4569 0.0079  -0.0044 -0.0001 1177 LEU A CD2 
4026 N N   . ASN A 308 ? 0.2348 0.2389 0.2637 0.0216  -0.0104 -0.0008 1178 ASN A N   
4027 C CA  . ASN A 308 ? 0.2876 0.2919 0.3219 0.0248  -0.0091 -0.0028 1178 ASN A CA  
4028 C C   . ASN A 308 ? 0.3340 0.3406 0.3758 0.0290  -0.0130 -0.0029 1178 ASN A C   
4029 O O   . ASN A 308 ? 0.2919 0.3043 0.3425 0.0314  -0.0117 -0.0057 1178 ASN A O   
4030 C CB  . ASN A 308 ? 0.2870 0.2826 0.3150 0.0249  -0.0081 -0.0019 1178 ASN A CB  
4031 C CG  . ASN A 308 ? 0.3693 0.3638 0.4020 0.0280  -0.0067 -0.0042 1178 ASN A CG  
4032 O OD1 . ASN A 308 ? 0.3548 0.3533 0.3909 0.0275  -0.0027 -0.0070 1178 ASN A OD1 
4033 N ND2 . ASN A 308 ? 0.3653 0.3537 0.3977 0.0311  -0.0098 -0.0029 1178 ASN A ND2 
4040 N N   . ASP A 309 ? 0.2845 0.2869 0.3230 0.0296  -0.0180 0.0001  1179 ASP A N   
4041 C CA  . ASP A 309 ? 0.3116 0.3159 0.3573 0.0337  -0.0229 0.0007  1179 ASP A CA  
4042 C C   . ASP A 309 ? 0.3060 0.3212 0.3605 0.0339  -0.0236 -0.0009 1179 ASP A C   
4043 O O   . ASP A 309 ? 0.3257 0.3464 0.3908 0.0377  -0.0248 -0.0026 1179 ASP A O   
4044 C CB  . ASP A 309 ? 0.4482 0.4449 0.4866 0.0333  -0.0286 0.0048  1179 ASP A CB  
4045 C CG  . ASP A 309 ? 0.8111 0.7967 0.8419 0.0338  -0.0286 0.0062  1179 ASP A CG  
4046 O OD1 . ASP A 309 ? 0.8268 0.8109 0.8605 0.0359  -0.0254 0.0041  1179 ASP A OD1 
4047 O OD2 . ASP A 309 ? 0.9464 0.9246 0.9678 0.0315  -0.0315 0.0094  1179 ASP A OD2 
4052 N N   . PHE A 310 ? 0.2437 0.2622 0.2945 0.0297  -0.0226 -0.0005 1180 PHE A N   
4053 C CA  . PHE A 310 ? 0.3173 0.3461 0.3757 0.0290  -0.0226 -0.0023 1180 PHE A CA  
4054 C C   . PHE A 310 ? 0.3107 0.3463 0.3777 0.0303  -0.0178 -0.0064 1180 PHE A C   
4055 O O   . PHE A 310 ? 0.3200 0.3637 0.3974 0.0325  -0.0185 -0.0085 1180 PHE A O   
4056 C CB  . PHE A 310 ? 0.2930 0.3229 0.3446 0.0238  -0.0212 -0.0016 1180 PHE A CB  
4057 C CG  . PHE A 310 ? 0.3105 0.3386 0.3576 0.0221  -0.0264 0.0014  1180 PHE A CG  
4058 C CD1 . PHE A 310 ? 0.3583 0.3924 0.4126 0.0237  -0.0313 0.0019  1180 PHE A CD1 
4059 C CD2 . PHE A 310 ? 0.2687 0.2895 0.3045 0.0185  -0.0263 0.0036  1180 PHE A CD2 
4060 C CE1 . PHE A 310 ? 0.4646 0.4968 0.5137 0.0215  -0.0363 0.0048  1180 PHE A CE1 
4061 C CE2 . PHE A 310 ? 0.3508 0.3694 0.3813 0.0162  -0.0307 0.0061  1180 PHE A CE2 
4062 C CZ  . PHE A 310 ? 0.3901 0.4142 0.4268 0.0175  -0.0359 0.0069  1180 PHE A CZ  
4072 N N   . CYS A 311 ? 0.2470 0.2792 0.3094 0.0287  -0.0128 -0.0077 1181 CYS A N   
4073 C CA  . CYS A 311 ? 0.2821 0.3196 0.3508 0.0291  -0.0079 -0.0116 1181 CYS A CA  
4074 C C   . CYS A 311 ? 0.3561 0.3951 0.4343 0.0342  -0.0088 -0.0136 1181 CYS A C   
4075 O O   . CYS A 311 ? 0.3273 0.3750 0.4156 0.0355  -0.0077 -0.0166 1181 CYS A O   
4076 C CB  . CYS A 311 ? 0.2679 0.3002 0.3292 0.0264  -0.0033 -0.0122 1181 CYS A CB  
4077 S SG  . CYS A 311 ? 0.2796 0.3127 0.3334 0.0208  -0.0014 -0.0111 1181 CYS A SG  
4083 N N   . GLU A 312 ? 0.3515 0.3821 0.4265 0.0369  -0.0107 -0.0119 1182 GLU A N   
4084 C CA  . GLU A 312 ? 0.3358 0.3660 0.4193 0.0422  -0.0115 -0.0136 1182 GLU A CA  
4085 C C   . GLU A 312 ? 0.4668 0.5048 0.5616 0.0456  -0.0160 -0.0137 1182 GLU A C   
4086 O O   . GLU A 312 ? 0.3848 0.4290 0.4912 0.0489  -0.0145 -0.0172 1182 GLU A O   
4087 C CB  . GLU A 312 ? 0.4318 0.4504 0.5086 0.0442  -0.0141 -0.0109 1182 GLU A CB  
4088 C CG  . GLU A 312 ? 0.5686 0.5802 0.6368 0.0418  -0.0094 -0.0116 1182 GLU A CG  
4089 C CD  . GLU A 312 ? 0.7385 0.7533 0.8127 0.0427  -0.0039 -0.0163 1182 GLU A CD  
4090 O OE1 . GLU A 312 ? 0.5381 0.5504 0.6060 0.0393  0.0006  -0.0174 1182 GLU A OE1 
4091 O OE2 . GLU A 312 ? 0.7519 0.7717 0.8371 0.0466  -0.0039 -0.0189 1182 GLU A OE2 
4098 N N   . LYS A 313 ? 0.4104 0.4482 0.5019 0.0444  -0.0213 -0.0101 1183 LYS A N   
4099 C CA  . LYS A 313 ? 0.4810 0.5259 0.5824 0.0471  -0.0266 -0.0095 1183 LYS A CA  
4100 C C   . LYS A 313 ? 0.4609 0.5187 0.5718 0.0457  -0.0235 -0.0132 1183 LYS A C   
4101 O O   . LYS A 313 ? 0.4125 0.4786 0.5358 0.0488  -0.0260 -0.0146 1183 LYS A O   
4102 C CB  . LYS A 313 ? 0.6094 0.6504 0.7029 0.0450  -0.0329 -0.0047 1183 LYS A CB  
4103 C CG  . LYS A 313 ? 0.8504 0.8795 0.9367 0.0472  -0.0375 -0.0009 1183 LYS A CG  
4104 C CD  . LYS A 313 ? 1.0514 1.0779 1.1322 0.0455  -0.0447 0.0037  1183 LYS A CD  
4105 C CE  . LYS A 313 ? 1.0911 1.1053 1.1648 0.0476  -0.0495 0.0075  1183 LYS A CE  
4106 N NZ  . LYS A 313 ? 1.1070 1.1210 1.1916 0.0543  -0.0527 0.0070  1183 LYS A NZ  
4120 N N   . ASN A 314 ? 0.3317 0.3911 0.4370 0.0409  -0.0181 -0.0149 1184 ASN A N   
4121 C CA  . ASN A 314 ? 0.3187 0.3894 0.4316 0.0387  -0.0145 -0.0186 1184 ASN A CA  
4122 C C   . ASN A 314 ? 0.4266 0.4993 0.5438 0.0391  -0.0076 -0.0233 1184 ASN A C   
4123 O O   . ASN A 314 ? 0.3493 0.4288 0.4686 0.0357  -0.0031 -0.0265 1184 ASN A O   
4124 C CB  . ASN A 314 ? 0.3135 0.3849 0.4175 0.0326  -0.0133 -0.0174 1184 ASN A CB  
4125 C CG  . ASN A 314 ? 0.4456 0.5187 0.5483 0.0314  -0.0193 -0.0141 1184 ASN A CG  
4126 O OD1 . ASN A 314 ? 0.4597 0.5423 0.5706 0.0311  -0.0210 -0.0153 1184 ASN A OD1 
4127 N ND2 . ASN A 314 ? 0.3257 0.3896 0.4176 0.0303  -0.0224 -0.0102 1184 ASN A ND2 
4134 N N   A ASN A 315 ? 0.4001 0.4664 0.5181 0.0430  -0.0069 -0.0239 1185 ASN A N   
4135 N N   B ASN A 315 ? 0.4005 0.4666 0.5181 0.0429  -0.0069 -0.0238 1185 ASN A N   
4136 C CA  A ASN A 315 ? 0.4297 0.4969 0.5515 0.0435  -0.0004 -0.0286 1185 ASN A CA  
4137 C CA  B ASN A 315 ? 0.4232 0.4901 0.5447 0.0435  -0.0006 -0.0285 1185 ASN A CA  
4138 C C   A ASN A 315 ? 0.4261 0.4912 0.5381 0.0376  0.0053  -0.0298 1185 ASN A C   
4139 C C   B ASN A 315 ? 0.4268 0.4923 0.5390 0.0375  0.0051  -0.0297 1185 ASN A C   
4140 O O   A ASN A 315 ? 0.3714 0.4416 0.4871 0.0357  0.0108  -0.0340 1185 ASN A O   
4141 O O   B ASN A 315 ? 0.4044 0.4758 0.5206 0.0354  0.0104  -0.0339 1185 ASN A O   
4142 C CB  A ASN A 315 ? 0.4640 0.5432 0.6012 0.0456  0.0014  -0.0332 1185 ASN A CB  
4143 C CB  B ASN A 315 ? 0.4694 0.5479 0.6067 0.0461  0.0008  -0.0329 1185 ASN A CB  
4144 C CG  A ASN A 315 ? 0.5215 0.6006 0.6636 0.0470  0.0079  -0.0384 1185 ASN A CG  
4145 C CG  B ASN A 315 ? 0.5912 0.6712 0.7389 0.0525  -0.0054 -0.0315 1185 ASN A CG  
4146 O OD1 A ASN A 315 ? 0.5669 0.6370 0.7053 0.0494  0.0085  -0.0382 1185 ASN A OD1 
4147 O OD1 B ASN A 315 ? 0.6414 0.7137 0.7893 0.0569  -0.0070 -0.0307 1185 ASN A OD1 
4148 N ND2 A ASN A 315 ? 0.4706 0.5596 0.6206 0.0450  0.0129  -0.0433 1185 ASN A ND2 
4149 N ND2 B ASN A 315 ? 0.6596 0.7492 0.8158 0.0529  -0.0093 -0.0310 1185 ASN A ND2 
4162 N N   . LEU A 316 ? 0.3500 0.4075 0.4498 0.0348  0.0038  -0.0260 1186 LEU A N   
4163 C CA  . LEU A 316 ? 0.2812 0.3364 0.3717 0.0295  0.0081  -0.0262 1186 LEU A CA  
4164 C C   . LEU A 316 ? 0.3526 0.3969 0.4333 0.0293  0.0083  -0.0240 1186 LEU A C   
4165 O O   . LEU A 316 ? 0.3430 0.3813 0.4213 0.0320  0.0043  -0.0211 1186 LEU A O   
4166 C CB  . LEU A 316 ? 0.2812 0.3388 0.3669 0.0255  0.0064  -0.0238 1186 LEU A CB  
4167 C CG  . LEU A 316 ? 0.3322 0.4005 0.4257 0.0240  0.0071  -0.0262 1186 LEU A CG  
4168 C CD1 . LEU A 316 ? 0.3376 0.4071 0.4269 0.0212  0.0037  -0.0232 1186 LEU A CD1 
4169 C CD2 . LEU A 316 ? 0.3965 0.4684 0.4899 0.0202  0.0133  -0.0300 1186 LEU A CD2 
4182 N N   . ASN A 317 ? 0.2908 0.3328 0.3656 0.0257  0.0128  -0.0253 1187 ASN A N   
4183 C CA  . ASN A 317 ? 0.2841 0.3167 0.3497 0.0248  0.0132  -0.0234 1187 ASN A CA  
4184 C C   . ASN A 317 ? 0.2881 0.3178 0.3451 0.0214  0.0116  -0.0198 1187 ASN A C   
4185 O O   . ASN A 317 ? 0.2752 0.3082 0.3300 0.0176  0.0134  -0.0201 1187 ASN A O   
4186 C CB  . ASN A 317 ? 0.3198 0.3509 0.3831 0.0224  0.0185  -0.0265 1187 ASN A CB  
4187 C CG  . ASN A 317 ? 0.4577 0.4794 0.5128 0.0220  0.0187  -0.0248 1187 ASN A CG  
4188 O OD1 . ASN A 317 ? 0.3334 0.3520 0.3804 0.0183  0.0190  -0.0228 1187 ASN A OD1 
4189 N ND2 . ASN A 317 ? 0.4702 0.4872 0.5274 0.0258  0.0180  -0.0255 1187 ASN A ND2 
4196 N N   . PHE A 318 ? 0.2383 0.2614 0.2902 0.0226  0.0084  -0.0165 1188 PHE A N   
4197 C CA  . PHE A 318 ? 0.1890 0.2095 0.2336 0.0197  0.0071  -0.0134 1188 PHE A CA  
4198 C C   . PHE A 318 ? 0.2426 0.2614 0.2815 0.0158  0.0105  -0.0137 1188 PHE A C   
4199 O O   . PHE A 318 ? 0.2258 0.2468 0.2625 0.0128  0.0111  -0.0129 1188 PHE A O   
4200 C CB  . PHE A 318 ? 0.2319 0.2450 0.2715 0.0212  0.0037  -0.0103 1188 PHE A CB  
4201 C CG  . PHE A 318 ? 0.2457 0.2557 0.2778 0.0180  0.0032  -0.0076 1188 PHE A CG  
4202 C CD1 . PHE A 318 ? 0.2411 0.2537 0.2728 0.0169  0.0012  -0.0063 1188 PHE A CD1 
4203 C CD2 . PHE A 318 ? 0.2748 0.2795 0.3008 0.0161  0.0049  -0.0068 1188 PHE A CD2 
4204 C CE1 . PHE A 318 ? 0.2510 0.2606 0.2764 0.0141  0.0013  -0.0043 1188 PHE A CE1 
4205 C CE2 . PHE A 318 ? 0.3080 0.3106 0.3286 0.0135  0.0047  -0.0047 1188 PHE A CE2 
4206 C CZ  . PHE A 318 ? 0.2545 0.2594 0.2749 0.0126  0.0031  -0.0036 1188 PHE A CZ  
4216 N N   . LEU A 319 ? 0.2053 0.2198 0.2418 0.0157  0.0126  -0.0146 1189 LEU A N   
4217 C CA  . LEU A 319 ? 0.2731 0.2852 0.3035 0.0119  0.0149  -0.0142 1189 LEU A CA  
4218 C C   . LEU A 319 ? 0.3154 0.3323 0.3469 0.0087  0.0180  -0.0164 1189 LEU A C   
4219 O O   . LEU A 319 ? 0.3332 0.3496 0.3602 0.0053  0.0186  -0.0152 1189 LEU A O   
4220 C CB  . LEU A 319 ? 0.2097 0.2154 0.2363 0.0121  0.0159  -0.0144 1189 LEU A CB  
4221 C CG  . LEU A 319 ? 0.1996 0.1990 0.2227 0.0138  0.0132  -0.0119 1189 LEU A CG  
4222 C CD1 . LEU A 319 ? 0.2119 0.2052 0.2323 0.0142  0.0147  -0.0130 1189 LEU A CD1 
4223 C CD2 . LEU A 319 ? 0.2618 0.2597 0.2797 0.0112  0.0121  -0.0089 1189 LEU A CD2 
4235 N N   . MET A 320 ? 0.3139 0.3350 0.3512 0.0099  0.0200  -0.0198 1190 MET A N   
4236 C CA  . MET A 320 ? 0.3797 0.4045 0.4172 0.0064  0.0237  -0.0226 1190 MET A CA  
4237 C C   . MET A 320 ? 0.3467 0.3793 0.3904 0.0061  0.0243  -0.0244 1190 MET A C   
4238 O O   . MET A 320 ? 0.3254 0.3612 0.3686 0.0026  0.0273  -0.0266 1190 MET A O   
4239 C CB  . MET A 320 ? 0.3843 0.4074 0.4230 0.0068  0.0272  -0.0261 1190 MET A CB  
4240 C CG  . MET A 320 ? 0.5074 0.5228 0.5395 0.0061  0.0274  -0.0250 1190 MET A CG  
4241 S SD  . MET A 320 ? 0.7999 0.8124 0.8228 0.0009  0.0267  -0.0217 1190 MET A SD  
4242 C CE  . MET A 320 ? 1.1101 1.1222 1.1292 -0.0040 0.0314  -0.0250 1190 MET A CE  
4252 N N   . GLY A 321 ? 0.2597 0.2951 0.3087 0.0095  0.0213  -0.0236 1191 GLY A N   
4253 C CA  . GLY A 321 ? 0.2861 0.3296 0.3425 0.0098  0.0215  -0.0257 1191 GLY A CA  
4254 C C   . GLY A 321 ? 0.2449 0.2907 0.2981 0.0063  0.0206  -0.0239 1191 GLY A C   
4255 O O   . GLY A 321 ? 0.2350 0.2759 0.2810 0.0044  0.0195  -0.0209 1191 GLY A O   
4259 N N   . SER A 322 ? 0.2230 0.2762 0.2818 0.0055  0.0211  -0.0258 1192 SER A N   
4260 C CA  . SER A 322 ? 0.2239 0.2793 0.2798 0.0019  0.0205  -0.0246 1192 SER A CA  
4261 C C   . SER A 322 ? 0.2255 0.2851 0.2867 0.0042  0.0168  -0.0236 1192 SER A C   
4262 O O   . SER A 322 ? 0.2178 0.2847 0.2874 0.0055  0.0169  -0.0261 1192 SER A O   
4263 C CB  . SER A 322 ? 0.2628 0.3231 0.3196 -0.0024 0.0245  -0.0278 1192 SER A CB  
4264 O OG  . SER A 322 ? 0.2926 0.3539 0.3457 -0.0062 0.0240  -0.0264 1192 SER A OG  
4270 N N   . TRP A 323 ? 0.1936 0.2486 0.2499 0.0046  0.0136  -0.0201 1193 TRP A N   
4271 C CA  . TRP A 323 ? 0.2315 0.2890 0.2912 0.0067  0.0095  -0.0188 1193 TRP A CA  
4272 C C   . TRP A 323 ? 0.2549 0.3095 0.3081 0.0040  0.0079  -0.0161 1193 TRP A C   
4273 O O   . TRP A 323 ? 0.2552 0.3034 0.3013 0.0027  0.0085  -0.0142 1193 TRP A O   
4274 C CB  . TRP A 323 ? 0.1870 0.2405 0.2480 0.0113  0.0065  -0.0173 1193 TRP A CB  
4275 C CG  . TRP A 323 ? 0.2064 0.2512 0.2601 0.0115  0.0070  -0.0153 1193 TRP A CG  
4276 C CD1 . TRP A 323 ? 0.2525 0.2941 0.3052 0.0122  0.0096  -0.0166 1193 TRP A CD1 
4277 C CD2 . TRP A 323 ? 0.2180 0.2564 0.2643 0.0109  0.0050  -0.0121 1193 TRP A CD2 
4278 N NE1 . TRP A 323 ? 0.2517 0.2859 0.2973 0.0119  0.0090  -0.0140 1193 TRP A NE1 
4279 C CE2 . TRP A 323 ? 0.2381 0.2703 0.2800 0.0112  0.0064  -0.0114 1193 TRP A CE2 
4280 C CE3 . TRP A 323 ? 0.1947 0.2320 0.2377 0.0096  0.0024  -0.0099 1193 TRP A CE3 
4281 C CZ2 . TRP A 323 ? 0.2265 0.2523 0.2616 0.0105  0.0053  -0.0087 1193 TRP A CZ2 
4282 C CZ3 . TRP A 323 ? 0.2295 0.2598 0.2653 0.0089  0.0017  -0.0074 1193 TRP A CZ3 
4283 C CH2 . TRP A 323 ? 0.2088 0.2338 0.2412 0.0094  0.0032  -0.0069 1193 TRP A CH2 
4294 N N   . TRP A 324 ? 0.1993 0.2590 0.2555 0.0031  0.0059  -0.0163 1194 TRP A N   
4295 C CA  . TRP A 324 ? 0.1901 0.2477 0.2407 0.0002  0.0046  -0.0143 1194 TRP A CA  
4296 C C   . TRP A 324 ? 0.2256 0.2834 0.2774 0.0020  0.0000  -0.0126 1194 TRP A C   
4297 O O   . TRP A 324 ? 0.2258 0.2906 0.2843 0.0026  -0.0020 -0.0137 1194 TRP A O   
4298 C CB  . TRP A 324 ? 0.1918 0.2550 0.2438 -0.0038 0.0065  -0.0162 1194 TRP A CB  
4299 C CG  . TRP A 324 ? 0.2195 0.2794 0.2649 -0.0071 0.0057  -0.0145 1194 TRP A CG  
4300 C CD1 . TRP A 324 ? 0.2558 0.3181 0.3015 -0.0082 0.0029  -0.0139 1194 TRP A CD1 
4301 C CD2 . TRP A 324 ? 0.1862 0.2397 0.2240 -0.0098 0.0078  -0.0134 1194 TRP A CD2 
4302 N NE1 . TRP A 324 ? 0.2609 0.3181 0.2991 -0.0116 0.0036  -0.0127 1194 TRP A NE1 
4303 C CE2 . TRP A 324 ? 0.2274 0.2792 0.2612 -0.0123 0.0065  -0.0123 1194 TRP A CE2 
4304 C CE3 . TRP A 324 ? 0.2102 0.2590 0.2443 -0.0104 0.0103  -0.0130 1194 TRP A CE3 
4305 C CZ2 . TRP A 324 ? 0.2327 0.2782 0.2596 -0.0148 0.0081  -0.0112 1194 TRP A CZ2 
4306 C CZ3 . TRP A 324 ? 0.1714 0.2144 0.1991 -0.0128 0.0113  -0.0115 1194 TRP A CZ3 
4307 C CH2 . TRP A 324 ? 0.2141 0.2554 0.2386 -0.0148 0.0103  -0.0108 1194 TRP A CH2 
4318 N N   . PRO A 325 ? 0.2484 0.2989 0.2938 0.0027  -0.0018 -0.0099 1195 PRO A N   
4319 C CA  . PRO A 325 ? 0.2161 0.2657 0.2616 0.0043  -0.0064 -0.0081 1195 PRO A CA  
4320 C C   . PRO A 325 ? 0.2363 0.2907 0.2828 0.0017  -0.0088 -0.0080 1195 PRO A C   
4321 O O   . PRO A 325 ? 0.2354 0.2899 0.2782 -0.0021 -0.0069 -0.0085 1195 PRO A O   
4322 C CB  . PRO A 325 ? 0.2082 0.2486 0.2447 0.0037  -0.0066 -0.0056 1195 PRO A CB  
4323 C CG  . PRO A 325 ? 0.2191 0.2564 0.2540 0.0040  -0.0027 -0.0063 1195 PRO A CG  
4324 C CD  . PRO A 325 ? 0.2457 0.2884 0.2839 0.0020  0.0003  -0.0085 1195 PRO A CD  
4332 N N   . ASN A 326 ? 0.2581 0.3162 0.3096 0.0038  -0.0133 -0.0074 1196 ASN A N   
4333 C CA  . ASN A 326 ? 0.2337 0.2954 0.2851 0.0013  -0.0168 -0.0066 1196 ASN A CA  
4334 C C   . ASN A 326 ? 0.2196 0.2727 0.2608 -0.0005 -0.0190 -0.0037 1196 ASN A C   
4335 O O   . ASN A 326 ? 0.2583 0.3068 0.2976 0.0019  -0.0221 -0.0017 1196 ASN A O   
4336 C CB  . ASN A 326 ? 0.3058 0.3752 0.3675 0.0045  -0.0211 -0.0069 1196 ASN A CB  
4337 C CG  . ASN A 326 ? 0.4067 0.4810 0.4693 0.0017  -0.0254 -0.0061 1196 ASN A CG  
4338 O OD1 . ASN A 326 ? 0.3617 0.4319 0.4155 -0.0026 -0.0255 -0.0049 1196 ASN A OD1 
4339 N ND2 . ASN A 326 ? 0.3918 0.4749 0.4653 0.0041  -0.0288 -0.0068 1196 ASN A ND2 
4346 N N   . LEU A 327 ? 0.2445 0.2950 0.2787 -0.0049 -0.0172 -0.0037 1197 LEU A N   
4347 C CA  . LEU A 327 ? 0.2566 0.2986 0.2807 -0.0071 -0.0181 -0.0016 1197 LEU A CA  
4348 C C   . LEU A 327 ? 0.3334 0.3751 0.3561 -0.0073 -0.0241 0.0006  1197 LEU A C   
4349 O O   . LEU A 327 ? 0.3044 0.3385 0.3192 -0.0081 -0.0256 0.0026  1197 LEU A O   
4350 C CB  . LEU A 327 ? 0.2768 0.3168 0.2948 -0.0119 -0.0150 -0.0025 1197 LEU A CB  
4351 C CG  . LEU A 327 ? 0.2542 0.2919 0.2713 -0.0121 -0.0096 -0.0038 1197 LEU A CG  
4352 C CD1 . LEU A 327 ? 0.3402 0.3747 0.3511 -0.0165 -0.0070 -0.0045 1197 LEU A CD1 
4353 C CD2 . LEU A 327 ? 0.2476 0.2787 0.2617 -0.0095 -0.0080 -0.0028 1197 LEU A CD2 
4365 N N   . GLU A 328 ? 0.3275 0.3776 0.3577 -0.0068 -0.0277 0.0002  1198 GLU A N   
4366 C CA  . GLU A 328 ? 0.3260 0.3761 0.3554 -0.0070 -0.0343 0.0027  1198 GLU A CA  
4367 C C   . GLU A 328 ? 0.3393 0.3859 0.3707 -0.0022 -0.0376 0.0046  1198 GLU A C   
4368 O O   . GLU A 328 ? 0.3325 0.3733 0.3577 -0.0029 -0.0421 0.0074  1198 GLU A O   
4369 C CB  . GLU A 328 ? 0.4533 0.5142 0.4915 -0.0078 -0.0376 0.0018  1198 GLU A CB  
4370 C CG  . GLU A 328 ? 0.6287 0.6921 0.6632 -0.0134 -0.0349 0.0001  1198 GLU A CG  
4371 C CD  . GLU A 328 ? 0.9175 0.9921 0.9608 -0.0146 -0.0380 -0.0009 1198 GLU A CD  
4372 O OE1 . GLU A 328 ? 1.0123 1.0946 1.0671 -0.0105 -0.0410 -0.0012 1198 GLU A OE1 
4373 O OE2 . GLU A 328 ? 0.9747 1.0508 1.0139 -0.0199 -0.0373 -0.0017 1198 GLU A OE2 
4380 N N   . ASP A 329 ? 0.2871 0.3364 0.3264 0.0023  -0.0352 0.0031  1199 ASP A N   
4381 C CA  . ASP A 329 ? 0.3014 0.3460 0.3419 0.0068  -0.0374 0.0046  1199 ASP A CA  
4382 C C   . ASP A 329 ? 0.3251 0.3583 0.3538 0.0053  -0.0357 0.0063  1199 ASP A C   
4383 O O   . ASP A 329 ? 0.2721 0.2987 0.2962 0.0064  -0.0395 0.0089  1199 ASP A O   
4384 C CB  . ASP A 329 ? 0.2737 0.3226 0.3238 0.0112  -0.0340 0.0020  1199 ASP A CB  
4385 C CG  . ASP A 329 ? 0.3992 0.4591 0.4628 0.0139  -0.0362 0.0002  1199 ASP A CG  
4386 O OD1 . ASP A 329 ? 0.3914 0.4553 0.4579 0.0135  -0.0417 0.0017  1199 ASP A OD1 
4387 O OD2 . ASP A 329 ? 0.3187 0.3835 0.3902 0.0163  -0.0323 -0.0028 1199 ASP A OD2 
4392 N N   . LEU A 330 ? 0.2806 0.3114 0.3044 0.0027  -0.0299 0.0048  1200 LEU A N   
4393 C CA  . LEU A 330 ? 0.2961 0.3173 0.3101 0.0013  -0.0275 0.0059  1200 LEU A CA  
4394 C C   . LEU A 330 ? 0.2929 0.3082 0.2969 -0.0027 -0.0306 0.0081  1200 LEU A C   
4395 O O   . LEU A 330 ? 0.2913 0.2988 0.2882 -0.0031 -0.0318 0.0100  1200 LEU A O   
4396 C CB  . LEU A 330 ? 0.3056 0.3264 0.3177 -0.0006 -0.0211 0.0038  1200 LEU A CB  
4397 C CG  . LEU A 330 ? 0.3059 0.3309 0.3256 0.0025  -0.0178 0.0018  1200 LEU A CG  
4398 C CD1 . LEU A 330 ? 0.2398 0.2625 0.2561 0.0004  -0.0123 0.0005  1200 LEU A CD1 
4399 C CD2 . LEU A 330 ? 0.2902 0.3122 0.3120 0.0066  -0.0190 0.0025  1200 LEU A CD2 
4411 N N   . TYR A 331 ? 0.2583 0.2772 0.2613 -0.0062 -0.0316 0.0077  1201 TYR A N   
4412 C CA  . TYR A 331 ? 0.3307 0.3440 0.3234 -0.0108 -0.0341 0.0095  1201 TYR A CA  
4413 C C   . TYR A 331 ? 0.3971 0.4075 0.3881 -0.0096 -0.0411 0.0126  1201 TYR A C   
4414 O O   . TYR A 331 ? 0.3400 0.3419 0.3207 -0.0123 -0.0425 0.0146  1201 TYR A O   
4415 C CB  . TYR A 331 ? 0.3328 0.3511 0.3254 -0.0148 -0.0343 0.0084  1201 TYR A CB  
4416 C CG  . TYR A 331 ? 0.4449 0.4571 0.4260 -0.0204 -0.0364 0.0098  1201 TYR A CG  
4417 C CD1 . TYR A 331 ? 0.5331 0.5382 0.5047 -0.0243 -0.0314 0.0087  1201 TYR A CD1 
4418 C CD2 . TYR A 331 ? 0.5373 0.5508 0.5172 -0.0218 -0.0434 0.0122  1201 TYR A CD2 
4419 C CE1 . TYR A 331 ? 0.6350 0.6341 0.5955 -0.0299 -0.0327 0.0096  1201 TYR A CE1 
4420 C CE2 . TYR A 331 ? 0.5710 0.5785 0.5392 -0.0277 -0.0453 0.0135  1201 TYR A CE2 
4421 C CZ  . TYR A 331 ? 0.5848 0.5849 0.5429 -0.0319 -0.0396 0.0120  1201 TYR A CZ  
4422 O OH  . TYR A 331 ? 0.6633 0.6569 0.6092 -0.0382 -0.0409 0.0128  1201 TYR A OH  
4432 N N   . GLU A 332 ? 0.3836 0.4010 0.3850 -0.0055 -0.0454 0.0131  1202 GLU A N   
4433 C CA  . GLU A 332 ? 0.4172 0.4321 0.4184 -0.0038 -0.0528 0.0163  1202 GLU A CA  
4434 C C   . GLU A 332 ? 0.4686 0.4748 0.4658 -0.0011 -0.0526 0.0178  1202 GLU A C   
4435 O O   . GLU A 332 ? 0.4615 0.4606 0.4519 -0.0018 -0.0577 0.0210  1202 GLU A O   
4436 C CB  . GLU A 332 ? 0.5264 0.5516 0.5416 0.0005  -0.0572 0.0161  1202 GLU A CB  
4437 C CG  . GLU A 332 ? 0.9940 1.0274 1.0120 -0.0030 -0.0589 0.0153  1202 GLU A CG  
4438 C CD  . GLU A 332 ? 1.3812 1.4092 1.3880 -0.0085 -0.0639 0.0182  1202 GLU A CD  
4439 O OE1 . GLU A 332 ? 1.4785 1.4996 1.4800 -0.0079 -0.0693 0.0216  1202 GLU A OE1 
4440 O OE2 . GLU A 332 ? 1.5250 1.5549 1.5273 -0.0137 -0.0623 0.0172  1202 GLU A OE2 
4447 N N   . ALA A 333 ? 0.3557 0.3620 0.3563 0.0015  -0.0469 0.0156  1203 ALA A N   
4448 C CA  . ALA A 333 ? 0.3428 0.3410 0.3395 0.0036  -0.0460 0.0166  1203 ALA A CA  
4449 C C   . ALA A 333 ? 0.2985 0.2882 0.2827 -0.0010 -0.0420 0.0167  1203 ALA A C   
4450 O O   . ALA A 333 ? 0.3178 0.3009 0.2980 -0.0001 -0.0401 0.0171  1203 ALA A O   
4451 C CB  . ALA A 333 ? 0.3452 0.3476 0.3516 0.0085  -0.0421 0.0141  1203 ALA A CB  
4457 N N   . ASN A 334 ? 0.2710 0.2607 0.2491 -0.0060 -0.0404 0.0162  1204 ASN A N   
4458 C CA  . ASN A 334 ? 0.2870 0.2690 0.2539 -0.0106 -0.0362 0.0158  1204 ASN A CA  
4459 C C   . ASN A 334 ? 0.2824 0.2640 0.2515 -0.0091 -0.0295 0.0136  1204 ASN A C   
4460 O O   . ASN A 334 ? 0.2849 0.2596 0.2471 -0.0107 -0.0269 0.0138  1204 ASN A O   
4461 C CB  . ASN A 334 ? 0.4269 0.3992 0.3833 -0.0128 -0.0401 0.0188  1204 ASN A CB  
4462 C CG  . ASN A 334 ? 0.5199 0.4913 0.4713 -0.0160 -0.0466 0.0213  1204 ASN A CG  
4463 O OD1 . ASN A 334 ? 0.4837 0.4597 0.4421 -0.0129 -0.0525 0.0228  1204 ASN A OD1 
4464 N ND2 . ASN A 334 ? 0.6837 0.6492 0.6232 -0.0223 -0.0456 0.0215  1204 ASN A ND2 
4471 N N   . VAL A 335 ? 0.2616 0.2509 0.2403 -0.0064 -0.0268 0.0114  1205 VAL A N   
4472 C CA  . VAL A 335 ? 0.2399 0.2298 0.2209 -0.0055 -0.0208 0.0093  1205 VAL A CA  
4473 C C   . VAL A 335 ? 0.2650 0.2559 0.2435 -0.0092 -0.0165 0.0075  1205 VAL A C   
4474 O O   . VAL A 335 ? 0.2521 0.2482 0.2336 -0.0101 -0.0172 0.0067  1205 VAL A O   
4475 C CB  . VAL A 335 ? 0.2659 0.2629 0.2577 -0.0012 -0.0200 0.0079  1205 VAL A CB  
4476 C CG1 . VAL A 335 ? 0.2707 0.2680 0.2641 -0.0008 -0.0143 0.0061  1205 VAL A CG1 
4477 C CG2 . VAL A 335 ? 0.2490 0.2450 0.2445 0.0029  -0.0238 0.0092  1205 VAL A CG2 
4487 N N   . PRO A 336 ? 0.2470 0.2329 0.2202 -0.0113 -0.0122 0.0068  1206 PRO A N   
4488 C CA  . PRO A 336 ? 0.2201 0.2063 0.1914 -0.0144 -0.0081 0.0050  1206 PRO A CA  
4489 C C   . PRO A 336 ? 0.2161 0.2080 0.1953 -0.0122 -0.0051 0.0033  1206 PRO A C   
4490 O O   . PRO A 336 ? 0.2202 0.2135 0.2041 -0.0091 -0.0041 0.0033  1206 PRO A O   
4491 C CB  . PRO A 336 ? 0.2360 0.2154 0.2006 -0.0167 -0.0045 0.0046  1206 PRO A CB  
4492 C CG  . PRO A 336 ? 0.2309 0.2086 0.1970 -0.0138 -0.0052 0.0057  1206 PRO A CG  
4493 C CD  . PRO A 336 ? 0.2732 0.2529 0.2420 -0.0112 -0.0109 0.0075  1206 PRO A CD  
4501 N N   . VAL A 337 ? 0.2459 0.2406 0.2260 -0.0141 -0.0037 0.0021  1207 VAL A N   
4502 C CA  . VAL A 337 ? 0.2435 0.2427 0.2299 -0.0127 -0.0011 0.0006  1207 VAL A CA  
4503 C C   . VAL A 337 ? 0.2573 0.2535 0.2406 -0.0155 0.0030  -0.0007 1207 VAL A C   
4504 O O   . VAL A 337 ? 0.2371 0.2316 0.2158 -0.0187 0.0030  -0.0012 1207 VAL A O   
4505 C CB  . VAL A 337 ? 0.2831 0.2892 0.2748 -0.0122 -0.0036 0.0003  1207 VAL A CB  
4506 C CG1 . VAL A 337 ? 0.2472 0.2570 0.2438 -0.0117 -0.0005 -0.0012 1207 VAL A CG1 
4507 C CG2 . VAL A 337 ? 0.2565 0.2658 0.2527 -0.0090 -0.0076 0.0013  1207 VAL A CG2 
4517 N N   . TYR A 338 ? 0.1799 0.1752 0.1657 -0.0141 0.0064  -0.0013 1208 TYR A N   
4518 C CA  . TYR A 338 ? 0.1859 0.1788 0.1709 -0.0157 0.0103  -0.0026 1208 TYR A CA  
4519 C C   . TYR A 338 ? 0.2068 0.2039 0.1960 -0.0154 0.0103  -0.0031 1208 TYR A C   
4520 O O   . TYR A 338 ? 0.2453 0.2465 0.2393 -0.0132 0.0092  -0.0027 1208 TYR A O   
4521 C CB  . TYR A 338 ? 0.1949 0.1857 0.1819 -0.0140 0.0131  -0.0026 1208 TYR A CB  
4522 C CG  . TYR A 338 ? 0.2316 0.2182 0.2144 -0.0148 0.0139  -0.0024 1208 TYR A CG  
4523 C CD1 . TYR A 338 ? 0.2764 0.2586 0.2559 -0.0170 0.0174  -0.0037 1208 TYR A CD1 
4524 C CD2 . TYR A 338 ? 0.2465 0.2331 0.2283 -0.0136 0.0112  -0.0011 1208 TYR A CD2 
4525 C CE1 . TYR A 338 ? 0.2656 0.2440 0.2407 -0.0184 0.0186  -0.0039 1208 TYR A CE1 
4526 C CE2 . TYR A 338 ? 0.2262 0.2082 0.2031 -0.0149 0.0119  -0.0008 1208 TYR A CE2 
4527 C CZ  . TYR A 338 ? 0.2971 0.2753 0.2706 -0.0175 0.0157  -0.0023 1208 TYR A CZ  
4528 O OH  . TYR A 338 ? 0.3136 0.2874 0.2818 -0.0194 0.0168  -0.0023 1208 TYR A OH  
4538 N N   . ARG A 339 ? 0.2188 0.2143 0.2058 -0.0180 0.0120  -0.0042 1209 ARG A N   
4539 C CA  . ARG A 339 ? 0.2482 0.2470 0.2378 -0.0186 0.0119  -0.0047 1209 ARG A CA  
4540 C C   . ARG A 339 ? 0.2668 0.2611 0.2546 -0.0203 0.0153  -0.0057 1209 ARG A C   
4541 O O   . ARG A 339 ? 0.2494 0.2392 0.2325 -0.0225 0.0169  -0.0066 1209 ARG A O   
4542 C CB  . ARG A 339 ? 0.3899 0.3921 0.3781 -0.0208 0.0090  -0.0049 1209 ARG A CB  
4543 C CG  . ARG A 339 ? 0.6654 0.6715 0.6557 -0.0223 0.0090  -0.0057 1209 ARG A CG  
4544 C CD  . ARG A 339 ? 0.6091 0.6196 0.5990 -0.0243 0.0057  -0.0058 1209 ARG A CD  
4545 N NE  . ARG A 339 ? 0.5405 0.5558 0.5333 -0.0260 0.0058  -0.0068 1209 ARG A NE  
4546 C CZ  . ARG A 339 ? 0.4506 0.4727 0.4464 -0.0269 0.0029  -0.0071 1209 ARG A CZ  
4547 N NH1 . ARG A 339 ? 0.3285 0.3528 0.3249 -0.0259 -0.0007 -0.0062 1209 ARG A NH1 
4548 N NH2 . ARG A 339 ? 0.4613 0.4877 0.4595 -0.0289 0.0036  -0.0084 1209 ARG A NH2 
4562 N N   . PHE A 340 ? 0.2022 0.1971 0.1933 -0.0193 0.0164  -0.0057 1210 PHE A N   
4563 C CA  . PHE A 340 ? 0.1997 0.1895 0.1896 -0.0204 0.0193  -0.0064 1210 PHE A CA  
4564 C C   . PHE A 340 ? 0.2008 0.1917 0.1931 -0.0204 0.0192  -0.0060 1210 PHE A C   
4565 O O   . PHE A 340 ? 0.1923 0.1879 0.1874 -0.0194 0.0175  -0.0053 1210 PHE A O   
4566 C CB  . PHE A 340 ? 0.1749 0.1608 0.1662 -0.0183 0.0215  -0.0063 1210 PHE A CB  
4567 C CG  . PHE A 340 ? 0.2252 0.2136 0.2215 -0.0152 0.0207  -0.0049 1210 PHE A CG  
4568 C CD1 . PHE A 340 ? 0.2435 0.2307 0.2430 -0.0142 0.0213  -0.0042 1210 PHE A CD1 
4569 C CD2 . PHE A 340 ? 0.2092 0.2005 0.2066 -0.013