data_3BX9
# 
_entry.id   3BX9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BX9         
RCSB  RCSB046070   
WWPDB D_1000046070 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1UIS 'Red Fluorescent Protein eqFP611'                                    unspecified 
PDB 3BXA 'Monomeric Far-red Fluorescent Protein mKate Crystallized at pH 4.2' unspecified 
PDB 3BXB 'Monomeric Far-red Fluorescent Protein mKate Crystallized at pH 7.0' unspecified 
PDB 3BXC 'Monomeric Far-red Fluorescent Protein mKate Crystallized at pH 9.0' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3BX9 
_pdbx_database_status.recvd_initial_deposition_date   2008-01-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pletnev, S.'  1 
'Pletneva, N.' 2 
'Pletnev, V.'  3 
# 
_citation.id                        primary 
_citation.title                     
'A Crystallographic Study of Bright Far-Red Fluorescent Protein mKate Reveals pH-induced cis-trans Isomerization of the Chromophore.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            283 
_citation.page_first                28980 
_citation.page_last                 28987 
_citation.year                      2008 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18682399 
_citation.pdbx_database_id_DOI      10.1074/jbc.M800599200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pletnev, S.'    1 
primary 'Shcherbo, D.'   2 
primary 'Chudakov, D.M.' 3 
primary 'Pletneva, N.'   4 
primary 'Merzlyak, E.M.' 5 
primary 'Wlodawer, A.'   6 
primary 'Dauter, Z.'     7 
primary 'Pletnev, V.'    8 
# 
_cell.entry_id           3BX9 
_cell.length_a           67.852 
_cell.length_b           67.852 
_cell.length_c           413.030 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3BX9 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Far-red fluorescent protein mKate' 27640.482 2   ? ? ? ? 
2 non-polymer syn 'CITRIC ACID'                       192.124   6   ? ? ? ? 
3 non-polymer syn GLYCEROL                            92.094    2   ? ? ? ? 
4 water       nat water                               18.015    259 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MRGSHHHHHHGSMSELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSF(NRQ)S
KTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEM
LYPADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPS
KLGHKLN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRGSHHHHHHGSMSELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKT
FINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLY
PADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKL
GHKLN
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  GLY n 
1 12  SER n 
1 13  MET n 
1 14  SER n 
1 15  GLU n 
1 16  LEU n 
1 17  ILE n 
1 18  THR n 
1 19  GLU n 
1 20  ASN n 
1 21  MET n 
1 22  HIS n 
1 23  MET n 
1 24  LYS n 
1 25  LEU n 
1 26  TYR n 
1 27  MET n 
1 28  GLU n 
1 29  GLY n 
1 30  THR n 
1 31  VAL n 
1 32  ASN n 
1 33  ASN n 
1 34  HIS n 
1 35  HIS n 
1 36  PHE n 
1 37  LYS n 
1 38  CYS n 
1 39  THR n 
1 40  SER n 
1 41  GLU n 
1 42  GLY n 
1 43  GLU n 
1 44  GLY n 
1 45  LYS n 
1 46  PRO n 
1 47  TYR n 
1 48  GLU n 
1 49  GLY n 
1 50  THR n 
1 51  GLN n 
1 52  THR n 
1 53  MET n 
1 54  ARG n 
1 55  ILE n 
1 56  LYS n 
1 57  VAL n 
1 58  VAL n 
1 59  GLU n 
1 60  GLY n 
1 61  GLY n 
1 62  PRO n 
1 63  LEU n 
1 64  PRO n 
1 65  PHE n 
1 66  ALA n 
1 67  PHE n 
1 68  ASP n 
1 69  ILE n 
1 70  LEU n 
1 71  ALA n 
1 72  THR n 
1 73  SER n 
1 74  PHE n 
1 75  NRQ n 
1 76  SER n 
1 77  LYS n 
1 78  THR n 
1 79  PHE n 
1 80  ILE n 
1 81  ASN n 
1 82  HIS n 
1 83  THR n 
1 84  GLN n 
1 85  GLY n 
1 86  ILE n 
1 87  PRO n 
1 88  ASP n 
1 89  PHE n 
1 90  PHE n 
1 91  LYS n 
1 92  GLN n 
1 93  SER n 
1 94  PHE n 
1 95  PRO n 
1 96  GLU n 
1 97  GLY n 
1 98  PHE n 
1 99  THR n 
1 100 TRP n 
1 101 GLU n 
1 102 ARG n 
1 103 VAL n 
1 104 THR n 
1 105 THR n 
1 106 TYR n 
1 107 GLU n 
1 108 ASP n 
1 109 GLY n 
1 110 GLY n 
1 111 VAL n 
1 112 LEU n 
1 113 THR n 
1 114 ALA n 
1 115 THR n 
1 116 GLN n 
1 117 ASP n 
1 118 THR n 
1 119 SER n 
1 120 LEU n 
1 121 GLN n 
1 122 ASP n 
1 123 GLY n 
1 124 CYS n 
1 125 LEU n 
1 126 ILE n 
1 127 TYR n 
1 128 ASN n 
1 129 VAL n 
1 130 LYS n 
1 131 ILE n 
1 132 ARG n 
1 133 GLY n 
1 134 VAL n 
1 135 ASN n 
1 136 PHE n 
1 137 PRO n 
1 138 SER n 
1 139 ASN n 
1 140 GLY n 
1 141 PRO n 
1 142 VAL n 
1 143 MET n 
1 144 GLN n 
1 145 LYS n 
1 146 LYS n 
1 147 THR n 
1 148 LEU n 
1 149 GLY n 
1 150 TRP n 
1 151 GLU n 
1 152 ALA n 
1 153 SER n 
1 154 THR n 
1 155 GLU n 
1 156 MET n 
1 157 LEU n 
1 158 TYR n 
1 159 PRO n 
1 160 ALA n 
1 161 ASP n 
1 162 GLY n 
1 163 GLY n 
1 164 LEU n 
1 165 GLU n 
1 166 GLY n 
1 167 ARG n 
1 168 SER n 
1 169 ASP n 
1 170 MET n 
1 171 ALA n 
1 172 LEU n 
1 173 LYS n 
1 174 LEU n 
1 175 VAL n 
1 176 GLY n 
1 177 GLY n 
1 178 GLY n 
1 179 HIS n 
1 180 LEU n 
1 181 ILE n 
1 182 CYS n 
1 183 ASN n 
1 184 LEU n 
1 185 LYS n 
1 186 THR n 
1 187 THR n 
1 188 TYR n 
1 189 ARG n 
1 190 SER n 
1 191 LYS n 
1 192 LYS n 
1 193 PRO n 
1 194 ALA n 
1 195 LYS n 
1 196 ASN n 
1 197 LEU n 
1 198 LYS n 
1 199 MET n 
1 200 PRO n 
1 201 GLY n 
1 202 VAL n 
1 203 TYR n 
1 204 TYR n 
1 205 VAL n 
1 206 ASP n 
1 207 ARG n 
1 208 ARG n 
1 209 LEU n 
1 210 GLU n 
1 211 ARG n 
1 212 ILE n 
1 213 LYS n 
1 214 GLU n 
1 215 ALA n 
1 216 ASP n 
1 217 LYS n 
1 218 GLU n 
1 219 THR n 
1 220 TYR n 
1 221 VAL n 
1 222 GLU n 
1 223 GLN n 
1 224 HIS n 
1 225 GLU n 
1 226 VAL n 
1 227 ALA n 
1 228 VAL n 
1 229 ALA n 
1 230 ARG n 
1 231 TYR n 
1 232 CYS n 
1 233 ASP n 
1 234 LEU n 
1 235 PRO n 
1 236 SER n 
1 237 LYS n 
1 238 LEU n 
1 239 GLY n 
1 240 HIS n 
1 241 LYS n 
1 242 LEU n 
1 243 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Entacmaea quadricolor' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6118 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'XL1 Blue' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               pQE30 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    3BX9 
_struct_ref.pdbx_db_accession          3BX9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRGSHHHHHHGSMSELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKT
FINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLY
PADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKL
GHKLN
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BX9 A 1 ? 243 ? 3BX9 1 ? 245 ? -11 233 
2 1 3BX9 B 1 ? 243 ? 3BX9 1 ? 245 ? -11 233 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'      133.103 
CIT non-polymer         . 'CITRIC ACID' ?                               'C6 H8 O7'        192.124 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'   149.211 
NRQ 'L-peptide linking' n 
'{(4Z)-4-(4-hydroxybenzylidene)-2-[3-(methylthio)propanimidoyl]-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 
'CHROMOPHORE (MET-TYR-GLY)'     'C16 H17 N3 O4 S' 347.389 
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3BX9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_percent_sol   52.97 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              2.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'20% w/v PEG 3350, 0.2M ammonium citrate tribasic, 0.4M citric acid, pH 2.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3BX9 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.430 
_reflns.d_resolution_high            1.800 
_reflns.number_obs                   52642 
_reflns.number_all                   53976 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              14.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.556 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.63 
_reflns_shell.pdbx_redundancy        14.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3BX9 
_refine.ls_number_reflns_obs                     52642 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    97.7 
_refine.ls_R_factor_obs                          0.205 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.205 
_refine.ls_R_factor_R_free                       0.247 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.200 
_refine.ls_number_reflns_R_free                  1150 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.932 
_refine.B_iso_mean                               27.12 
_refine.aniso_B[1][1]                            0.15000 
_refine.aniso_B[2][2]                            0.15000 
_refine.aniso_B[3][3]                            -0.22000 
_refine.aniso_B[1][2]                            0.07000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1UIS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.099 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.224 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3582 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         90 
_refine_hist.number_atoms_solvent             259 
_refine_hist.number_atoms_total               3931 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017  0.022  ? 3803 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.773  2.019  ? 5147 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.181  5.000  ? 456  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.238 24.364 ? 165  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.917 15.000 ? 652  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.984 15.000 ? 18   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.112  0.200  ? 534  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 2912 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.210  0.200  ? 1739 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.305  0.200  ? 2541 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.151  0.200  ? 296  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.217  0.200  ? 87   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.166  0.200  ? 32   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.140  1.500  ? 2341 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.695  2.000  ? 3664 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.657  3.000  ? 1683 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.913  4.500  ? 1483 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.85 
_refine_ls_shell.number_reflns_R_work             3739 
_refine_ls_shell.R_factor_R_work                  0.2810 
_refine_ls_shell.percent_reflns_obs               98.84 
_refine_ls_shell.R_factor_R_free                  0.3260 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             86 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3BX9 
_struct.title                     'Monomeric Far-red Fluorescent Protein mKate Crystallized at pH 2.0' 
_struct.pdbx_descriptor           'Far-red fluorescent protein mKate' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BX9 
_struct_keywords.pdbx_keywords   'FLUORESCENT PROTEIN' 
_struct_keywords.text            
'Far-red fluorescent protein, E. quadricolor, Chromophore structure, pH-induced cis-trans izomerization, FLUORESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 66  ? PHE A 74  ? ALA A 54  PHE A 62  5 ? 9 
HELX_P HELX_P2 2 PHE A 90  ? PHE A 94  ? PHE A 80  PHE A 84  5 ? 5 
HELX_P HELX_P3 3 PRO A 193 ? LEU A 197 ? PRO A 183 LEU A 187 5 ? 5 
HELX_P HELX_P4 4 ALA B 66  ? PHE B 74  ? ALA B 54  PHE B 62  5 ? 9 
HELX_P HELX_P5 5 PHE B 90  ? PHE B 94  ? PHE B 80  PHE B 84  5 ? 5 
HELX_P HELX_P6 6 PRO B 193 ? LEU B 197 ? PRO B 183 LEU B 187 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A PHE 74 C  ? ? ? 1_555 A NRQ 75 N1 ? ? A PHE 62 A NRQ 63 1_555 ? ? ? ? ? ? ? 1.297 ? 
covale2 covale ? ? A NRQ 75 C3 ? ? ? 1_555 A SER 76 N  ? ? A NRQ 63 A SER 66 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3 covale ? ? B PHE 74 C  ? ? ? 1_555 B NRQ 75 N1 ? ? B PHE 62 B NRQ 63 1_555 ? ? ? ? ? ? ? 1.298 ? 
covale4 covale ? ? B NRQ 75 C3 ? ? ? 1_555 B SER 76 N  ? ? B NRQ 63 B SER 66 1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 61 A . ? GLY 49 A PRO 62 A ? PRO 50 A 1 -3.77 
2 PHE 94 A . ? PHE 84 A PRO 95 A ? PRO 85 A 1 9.50  
3 GLY 61 B . ? GLY 49 B PRO 62 B ? PRO 50 B 1 1.26  
4 PHE 94 B . ? PHE 84 B PRO 95 B ? PRO 85 B 1 8.99  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 11 ? 
B ? 6  ? 
C ? 11 ? 
D ? 6  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? parallel      
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
B 1  2  ? parallel      
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
C 1  2  ? parallel      
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
C 4  5  ? anti-parallel 
C 5  6  ? parallel      
C 6  7  ? anti-parallel 
C 7  8  ? anti-parallel 
C 8  9  ? anti-parallel 
C 9  10 ? anti-parallel 
C 10 11 ? anti-parallel 
D 1  2  ? parallel      
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ASN A 81  ? HIS A 82  ? ASN A 71  HIS A 72  
A 2  TYR A 220 ? ARG A 230 ? TYR A 210 ARG A 220 
A 3  THR A 50  ? GLU A 59  ? THR A 38  GLU A 47  
A 4  HIS A 34  ? LYS A 45  ? HIS A 22  LYS A 33  
A 5  MET A 21  ? VAL A 31  ? MET A 9   VAL A 19  
A 6  CYS A 124 ? VAL A 134 ? CYS A 114 VAL A 124 
A 7  VAL A 111 ? GLN A 121 ? VAL A 101 GLN A 111 
A 8  PHE A 98  ? TYR A 106 ? PHE A 88  TYR A 96  
A 9  HIS A 179 ? SER A 190 ? HIS A 169 SER A 180 
A 10 GLY A 163 ? LEU A 174 ? GLY A 153 LEU A 164 
A 11 THR A 147 ? TRP A 150 ? THR A 137 TRP A 140 
B 1  ASN A 81  ? HIS A 82  ? ASN A 71  HIS A 72  
B 2  TYR A 220 ? ARG A 230 ? TYR A 210 ARG A 220 
B 3  TYR A 203 ? ALA A 215 ? TYR A 193 ALA A 205 
B 4  SER A 153 ? ALA A 160 ? SER A 143 ALA A 150 
B 5  GLY A 163 ? LEU A 174 ? GLY A 153 LEU A 164 
B 6  THR A 147 ? TRP A 150 ? THR A 137 TRP A 140 
C 1  ASN B 81  ? HIS B 82  ? ASN B 71  HIS B 72  
C 2  TYR B 220 ? ARG B 230 ? TYR B 210 ARG B 220 
C 3  THR B 50  ? GLU B 59  ? THR B 38  GLU B 47  
C 4  HIS B 34  ? LYS B 45  ? HIS B 22  LYS B 33  
C 5  MET B 21  ? VAL B 31  ? MET B 9   VAL B 19  
C 6  CYS B 124 ? VAL B 134 ? CYS B 114 VAL B 124 
C 7  VAL B 111 ? GLN B 121 ? VAL B 101 GLN B 111 
C 8  PHE B 98  ? TYR B 106 ? PHE B 88  TYR B 96  
C 9  HIS B 179 ? SER B 190 ? HIS B 169 SER B 180 
C 10 GLY B 163 ? LEU B 174 ? GLY B 153 LEU B 164 
C 11 THR B 147 ? TRP B 150 ? THR B 137 TRP B 140 
D 1  ASN B 81  ? HIS B 82  ? ASN B 71  HIS B 72  
D 2  TYR B 220 ? ARG B 230 ? TYR B 210 ARG B 220 
D 3  TYR B 203 ? ALA B 215 ? TYR B 193 ALA B 205 
D 4  SER B 153 ? ALA B 160 ? SER B 143 ALA B 150 
D 5  GLY B 163 ? LEU B 174 ? GLY B 153 LEU B 164 
D 6  THR B 147 ? TRP B 150 ? THR B 137 TRP B 140 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N ASN A 81  ? N ASN A 71  O ALA A 229 ? O ALA A 219 
A 2  3  O VAL A 221 ? O VAL A 211 N ILE A 55  ? N ILE A 43  
A 3  4  O ARG A 54  ? O ARG A 42  N GLU A 41  ? N GLU A 29  
A 4  5  O CYS A 38  ? O CYS A 26  N MET A 27  ? N MET A 15  
A 5  6  N TYR A 26  ? N TYR A 14  O VAL A 129 ? O VAL A 119 
A 6  7  O ARG A 132 ? O ARG A 122 N THR A 113 ? N THR A 103 
A 7  8  O GLN A 116 ? O GLN A 106 N TRP A 100 ? N TRP A 90  
A 8  9  N GLU A 101 ? N GLU A 91  O THR A 187 ? O THR A 177 
A 9  10 O TYR A 188 ? O TYR A 178 N LEU A 164 ? N LEU A 154 
A 10 11 O LYS A 173 ? O LYS A 163 N LEU A 148 ? N LEU A 138 
B 1  2  N ASN A 81  ? N ASN A 71  O ALA A 229 ? O ALA A 219 
B 2  3  O HIS A 224 ? O HIS A 214 N GLU A 210 ? N GLU A 200 
B 3  4  O TYR A 203 ? O TYR A 193 N LEU A 157 ? N LEU A 147 
B 4  5  N TYR A 158 ? N TYR A 148 O GLU A 165 ? O GLU A 155 
B 5  6  O LYS A 173 ? O LYS A 163 N LEU A 148 ? N LEU A 138 
C 1  2  N ASN B 81  ? N ASN B 71  O ALA B 229 ? O ALA B 219 
C 2  3  O VAL B 221 ? O VAL B 211 N ILE B 55  ? N ILE B 43  
C 3  4  O LYS B 56  ? O LYS B 44  N THR B 39  ? N THR B 27  
C 4  5  O CYS B 38  ? O CYS B 26  N MET B 27  ? N MET B 15  
C 5  6  N LYS B 24  ? N LYS B 12  O TYR B 127 ? O TYR B 117 
C 6  7  O ILE B 126 ? O ILE B 116 N SER B 119 ? N SER B 109 
C 7  8  O LEU B 112 ? O LEU B 102 N THR B 104 ? N THR B 94  
C 8  9  N GLU B 101 ? N GLU B 91  O THR B 187 ? O THR B 177 
C 9  10 O LEU B 184 ? O LEU B 174 N SER B 168 ? N SER B 158 
C 10 11 O LYS B 173 ? O LYS B 163 N GLY B 149 ? N GLY B 139 
D 1  2  N ASN B 81  ? N ASN B 71  O ALA B 229 ? O ALA B 219 
D 2  3  O HIS B 224 ? O HIS B 214 N GLU B 210 ? N GLU B 200 
D 3  4  O VAL B 205 ? O VAL B 195 N GLU B 155 ? N GLU B 145 
D 4  5  N TYR B 158 ? N TYR B 148 O GLU B 165 ? O GLU B 155 
D 5  6  O LYS B 173 ? O LYS B 163 N GLY B 149 ? N GLY B 139 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CIT A 234' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CIT B 234' 
AC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CIT B 235' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CIT A 235' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CIT A 236' 
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CIT B 236' 
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL B 237' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 237' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 ASN A 32  ? ASN A 20  . ? 1_555  ? 
2  AC1 16 ASN A 33  ? ASN A 21  . ? 1_555  ? 
3  AC1 16 ASN A 135 ? ASN A 125 . ? 1_555  ? 
4  AC1 16 PHE A 136 ? PHE A 126 . ? 1_555  ? 
5  AC1 16 SER A 138 ? SER A 128 . ? 1_555  ? 
6  AC1 16 HOH K .   ? HOH A 279 . ? 1_555  ? 
7  AC1 16 HOH K .   ? HOH A 317 . ? 10_555 ? 
8  AC1 16 HOH K .   ? HOH A 318 . ? 1_555  ? 
9  AC1 16 HOH K .   ? HOH A 320 . ? 1_555  ? 
10 AC1 16 ALA B 160 ? ALA B 150 . ? 1_555  ? 
11 AC1 16 ASP B 161 ? ASP B 151 . ? 1_555  ? 
12 AC1 16 GLU B 165 ? GLU B 155 . ? 1_555  ? 
13 AC1 16 THR B 187 ? THR B 177 . ? 1_555  ? 
14 AC1 16 ARG B 189 ? ARG B 179 . ? 1_555  ? 
15 AC1 16 HOH L .   ? HOH B 240 . ? 1_555  ? 
16 AC1 16 HOH L .   ? HOH B 310 . ? 1_555  ? 
17 AC2 7  ASN B 20  ? ASN B 8   . ? 1_555  ? 
18 AC2 7  GLU B 43  ? GLU B 31  . ? 1_555  ? 
19 AC2 7  GLY B 44  ? GLY B 32  . ? 1_555  ? 
20 AC2 7  LYS B 45  ? LYS B 33  . ? 1_555  ? 
21 AC2 7  THR B 50  ? THR B 38  . ? 1_555  ? 
22 AC2 7  THR B 52  ? THR B 40  . ? 1_555  ? 
23 AC2 7  HIS B 224 ? HIS B 214 . ? 1_555  ? 
24 AC3 12 ASP A 161 ? ASP A 151 . ? 1_555  ? 
25 AC3 12 GLU A 165 ? GLU A 155 . ? 1_555  ? 
26 AC3 12 THR A 187 ? THR A 177 . ? 1_555  ? 
27 AC3 12 ARG A 189 ? ARG A 179 . ? 1_555  ? 
28 AC3 12 ASN B 32  ? ASN B 20  . ? 1_555  ? 
29 AC3 12 ASN B 33  ? ASN B 21  . ? 1_555  ? 
30 AC3 12 ASN B 135 ? ASN B 125 . ? 1_555  ? 
31 AC3 12 PHE B 136 ? PHE B 126 . ? 1_555  ? 
32 AC3 12 HOH L .   ? HOH B 264 . ? 1_555  ? 
33 AC3 12 HOH L .   ? HOH B 277 . ? 1_555  ? 
34 AC3 12 HOH L .   ? HOH B 323 . ? 1_555  ? 
35 AC3 12 HOH L .   ? HOH B 332 . ? 1_555  ? 
36 AC4 9  ASN A 81  ? ASN A 71  . ? 1_555  ? 
37 AC4 9  THR A 83  ? THR A 73  . ? 1_555  ? 
38 AC4 9  ASP A 206 ? ASP A 196 . ? 8_555  ? 
39 AC4 9  HOH K .   ? HOH A 283 . ? 1_555  ? 
40 AC4 9  HOH K .   ? HOH A 356 . ? 8_555  ? 
41 AC4 9  HOH K .   ? HOH A 363 . ? 1_555  ? 
42 AC4 9  ASP B 233 ? ASP B 223 . ? 6_554  ? 
43 AC4 9  LEU B 234 ? LEU B 224 . ? 6_554  ? 
44 AC4 9  HOH L .   ? HOH B 266 . ? 6_554  ? 
45 AC5 9  GLU A 43  ? GLU A 31  . ? 1_555  ? 
46 AC5 9  LYS A 45  ? LYS A 33  . ? 1_555  ? 
47 AC5 9  THR A 50  ? THR A 38  . ? 1_555  ? 
48 AC5 9  GLN A 51  ? GLN A 39  . ? 1_555  ? 
49 AC5 9  THR A 52  ? THR A 40  . ? 1_555  ? 
50 AC5 9  HIS A 224 ? HIS A 214 . ? 1_555  ? 
51 AC5 9  HOH K .   ? HOH A 350 . ? 1_555  ? 
52 AC5 9  SER B 236 ? SER B 226 . ? 6_554  ? 
53 AC5 9  HOH L .   ? HOH B 361 . ? 6_554  ? 
54 AC6 9  TYR A 26  ? TYR A 14  . ? 10_665 ? 
55 AC6 9  LYS A 37  ? LYS A 25  . ? 10_665 ? 
56 AC6 9  THR A 39  ? THR A 27  . ? 10_665 ? 
57 AC6 9  PRO B 95  ? PRO B 85  . ? 1_555  ? 
58 AC6 9  LEU B 120 ? LEU B 110 . ? 1_555  ? 
59 AC6 9  ASP B 122 ? ASP B 112 . ? 1_555  ? 
60 AC6 9  GLY B 123 ? GLY B 113 . ? 1_555  ? 
61 AC6 9  HOH L .   ? HOH B 272 . ? 1_555  ? 
62 AC6 9  HOH L .   ? HOH B 326 . ? 1_555  ? 
63 AC7 7  ASP B 108 ? ASP B 98  . ? 1_555  ? 
64 AC7 7  ASN B 139 ? ASN B 129 . ? 1_555  ? 
65 AC7 7  GLY B 140 ? GLY B 130 . ? 1_555  ? 
66 AC7 7  PRO B 141 ? PRO B 131 . ? 1_555  ? 
67 AC7 7  HOH L .   ? HOH B 295 . ? 1_555  ? 
68 AC7 7  HOH L .   ? HOH B 344 . ? 1_555  ? 
69 AC7 7  HOH L .   ? HOH B 365 . ? 10_555 ? 
70 AC8 6  ASP A 108 ? ASP A 98  . ? 1_555  ? 
71 AC8 6  GLY A 140 ? GLY A 130 . ? 1_555  ? 
72 AC8 6  PRO A 141 ? PRO A 131 . ? 1_555  ? 
73 AC8 6  HOH K .   ? HOH A 292 . ? 1_555  ? 
74 AC8 6  HOH K .   ? HOH A 299 . ? 1_555  ? 
75 AC8 6  HOH K .   ? HOH A 346 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          3BX9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3BX9 
_atom_sites.fract_transf_matrix[1][1]   0.014738 
_atom_sites.fract_transf_matrix[1][2]   0.008509 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017018 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002421 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 14  ? -0.245  26.968  -3.505 1.00 43.47 ? 2   SER A N   1 
ATOM   2    C CA  . SER A 1 14  ? -1.426  26.546  -2.686 1.00 43.51 ? 2   SER A CA  1 
ATOM   3    C C   . SER A 1 14  ? -1.319  25.171  -1.988 1.00 42.81 ? 2   SER A C   1 
ATOM   4    O O   . SER A 1 14  ? -1.856  24.999  -0.882 1.00 43.61 ? 2   SER A O   1 
ATOM   5    C CB  . SER A 1 14  ? -2.692  26.562  -3.534 1.00 44.20 ? 2   SER A CB  1 
ATOM   6    O OG  . SER A 1 14  ? -3.726  25.854  -2.867 1.00 46.78 ? 2   SER A OG  1 
ATOM   7    N N   . GLU A 1 15  ? -0.708  24.181  -2.645 1.00 40.80 ? 3   GLU A N   1 
ATOM   8    C CA  . GLU A 1 15  ? -0.458  22.919  -1.965 1.00 38.55 ? 3   GLU A CA  1 
ATOM   9    C C   . GLU A 1 15  ? 0.854   23.000  -1.251 1.00 36.20 ? 3   GLU A C   1 
ATOM   10   O O   . GLU A 1 15  ? 1.899   23.225  -1.862 1.00 36.66 ? 3   GLU A O   1 
ATOM   11   C CB  . GLU A 1 15  ? -0.491  21.707  -2.886 1.00 38.87 ? 3   GLU A CB  1 
ATOM   12   C CG  . GLU A 1 15  ? -0.303  20.393  -2.104 1.00 41.17 ? 3   GLU A CG  1 
ATOM   13   C CD  . GLU A 1 15  ? -1.169  20.317  -0.836 1.00 46.18 ? 3   GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 15  ? -0.604  20.326  0.287  1.00 45.54 ? 3   GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 15  ? -2.422  20.276  -0.965 1.00 48.99 ? 3   GLU A OE2 1 
ATOM   16   N N   . LEU A 1 16  ? 0.787   22.824  0.064  1.00 33.28 ? 4   LEU A N   1 
ATOM   17   C CA  . LEU A 1 16  ? 1.929   23.052  0.917  1.00 30.55 ? 4   LEU A CA  1 
ATOM   18   C C   . LEU A 1 16  ? 2.756   21.797  1.181  1.00 28.95 ? 4   LEU A C   1 
ATOM   19   O O   . LEU A 1 16  ? 3.948   21.887  1.436  1.00 28.48 ? 4   LEU A O   1 
ATOM   20   C CB  . LEU A 1 16  ? 1.444   23.650  2.234  1.00 30.63 ? 4   LEU A CB  1 
ATOM   21   C CG  . LEU A 1 16  ? 0.771   24.995  2.000  1.00 31.75 ? 4   LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 16  ? 0.157   25.488  3.295  1.00 33.51 ? 4   LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 16  ? 1.830   25.963  1.444  1.00 32.78 ? 4   LEU A CD2 1 
ATOM   24   N N   . ILE A 1 17  ? 2.101   20.647  1.101  1.00 27.20 ? 5   ILE A N   1 
ATOM   25   C CA  . ILE A 1 17  ? 2.757   19.355  1.285  1.00 26.93 ? 5   ILE A CA  1 
ATOM   26   C C   . ILE A 1 17  ? 2.908   18.764  -0.105 1.00 26.36 ? 5   ILE A C   1 
ATOM   27   O O   . ILE A 1 17  ? 1.930   18.385  -0.734 1.00 26.82 ? 5   ILE A O   1 
ATOM   28   C CB  . ILE A 1 17  ? 1.909   18.435  2.208  1.00 27.12 ? 5   ILE A CB  1 
ATOM   29   C CG1 . ILE A 1 17  ? 1.705   19.084  3.590  1.00 26.93 ? 5   ILE A CG1 1 
ATOM   30   C CG2 . ILE A 1 17  ? 2.564   17.061  2.334  1.00 26.32 ? 5   ILE A CG2 1 
ATOM   31   C CD1 . ILE A 1 17  ? 3.024   19.452  4.248  1.00 27.33 ? 5   ILE A CD1 1 
ATOM   32   N N   . THR A 1 18  ? 4.137   18.736  -0.590 1.00 26.29 ? 6   THR A N   1 
ATOM   33   C CA  . THR A 1 18  ? 4.380   18.368  -1.971 1.00 25.63 ? 6   THR A CA  1 
ATOM   34   C C   . THR A 1 18  ? 4.846   16.895  -2.011 1.00 25.64 ? 6   THR A C   1 
ATOM   35   O O   . THR A 1 18  ? 4.875   16.246  -0.965 1.00 22.92 ? 6   THR A O   1 
ATOM   36   C CB  . THR A 1 18  ? 5.356   19.363  -2.635 1.00 25.53 ? 6   THR A CB  1 
ATOM   37   O OG1 . THR A 1 18  ? 6.548   19.496  -1.843 1.00 27.44 ? 6   THR A OG1 1 
ATOM   38   C CG2 . THR A 1 18  ? 4.663   20.709  -2.743 1.00 25.44 ? 6   THR A CG2 1 
ATOM   39   N N   . GLU A 1 19  ? 5.136   16.384  -3.207 1.00 24.60 ? 7   GLU A N   1 
ATOM   40   C CA  . GLU A 1 19  ? 5.568   14.985  -3.387 1.00 25.27 ? 7   GLU A CA  1 
ATOM   41   C C   . GLU A 1 19  ? 6.866   14.644  -2.644 1.00 24.56 ? 7   GLU A C   1 
ATOM   42   O O   . GLU A 1 19  ? 7.058   13.515  -2.174 1.00 24.02 ? 7   GLU A O   1 
ATOM   43   C CB  . GLU A 1 19  ? 5.753   14.725  -4.904 1.00 26.13 ? 7   GLU A CB  1 
ATOM   44   C CG  . GLU A 1 19  ? 6.238   13.325  -5.249 1.00 26.92 ? 7   GLU A CG  1 
ATOM   45   C CD  . GLU A 1 19  ? 6.702   13.188  -6.694 1.00 28.63 ? 7   GLU A CD  1 
ATOM   46   O OE1 . GLU A 1 19  ? 6.871   14.214  -7.379 1.00 30.02 ? 7   GLU A OE1 1 
ATOM   47   O OE2 . GLU A 1 19  ? 6.899   12.031  -7.130 1.00 36.37 ? 7   GLU A OE2 1 
ATOM   48   N N   . ASN A 1 20  ? 7.785   15.608  -2.544 1.00 24.34 ? 8   ASN A N   1 
ATOM   49   C CA  . ASN A 1 20  ? 8.994   15.411  -1.762 1.00 25.02 ? 8   ASN A CA  1 
ATOM   50   C C   . ASN A 1 20  ? 9.068   16.508  -0.688 1.00 24.87 ? 8   ASN A C   1 
ATOM   51   O O   . ASN A 1 20  ? 8.899   17.692  -1.018 1.00 25.44 ? 8   ASN A O   1 
ATOM   52   C CB  . ASN A 1 20  ? 10.227  15.525  -2.626 1.00 26.47 ? 8   ASN A CB  1 
ATOM   53   C CG  . ASN A 1 20  ? 10.224  14.569  -3.786 1.00 29.94 ? 8   ASN A CG  1 
ATOM   54   O OD1 . ASN A 1 20  ? 10.461  13.396  -3.596 1.00 34.87 ? 8   ASN A OD1 1 
ATOM   55   N ND2 . ASN A 1 20  ? 10.051  15.084  -5.014 1.00 34.54 ? 8   ASN A ND2 1 
ATOM   56   N N   . MET A 1 21  ? 9.344   16.134  0.564  1.00 23.60 ? 9   MET A N   1 
ATOM   57   C CA  . MET A 1 21  ? 9.474   17.140  1.653  1.00 23.60 ? 9   MET A CA  1 
ATOM   58   C C   . MET A 1 21  ? 10.742  16.873  2.467  1.00 24.07 ? 9   MET A C   1 
ATOM   59   O O   . MET A 1 21  ? 11.160  15.719  2.624  1.00 24.01 ? 9   MET A O   1 
ATOM   60   C CB  . MET A 1 21  ? 8.246   17.204  2.574  1.00 24.66 ? 9   MET A CB  1 
ATOM   61   C CG  . MET A 1 21  ? 6.914   17.669  1.992  1.00 26.96 ? 9   MET A CG  1 
ATOM   62   S SD  . MET A 1 21  ? 6.897   19.367  1.417  1.00 35.17 ? 9   MET A SD  1 
ATOM   63   C CE  . MET A 1 21  ? 6.742   20.275  2.981  1.00 29.38 ? 9   MET A CE  1 
ATOM   64   N N   . HIS A 1 22  ? 11.376  17.943  2.953  1.00 22.71 ? 10  HIS A N   1 
ATOM   65   C CA  . HIS A 1 22  ? 12.565  17.861  3.807  1.00 23.08 ? 10  HIS A CA  1 
ATOM   66   C C   . HIS A 1 22  ? 12.128  18.132  5.238  1.00 21.45 ? 10  HIS A C   1 
ATOM   67   O O   . HIS A 1 22  ? 11.099  18.767  5.442  1.00 19.62 ? 10  HIS A O   1 
ATOM   68   C CB  . HIS A 1 22  ? 13.687  18.853  3.368  1.00 23.62 ? 10  HIS A CB  1 
ATOM   69   C CG  . HIS A 1 22  ? 15.009  18.586  4.026  1.00 29.05 ? 10  HIS A CG  1 
ATOM   70   N ND1 . HIS A 1 22  ? 15.920  17.679  3.527  1.00 31.03 ? 10  HIS A ND1 1 
ATOM   71   C CD2 . HIS A 1 22  ? 15.549  19.056  5.185  1.00 33.99 ? 10  HIS A CD2 1 
ATOM   72   C CE1 . HIS A 1 22  ? 16.975  17.624  4.328  1.00 32.86 ? 10  HIS A CE1 1 
ATOM   73   N NE2 . HIS A 1 22  ? 16.777  18.454  5.338  1.00 32.89 ? 10  HIS A NE2 1 
ATOM   74   N N   . MET A 1 23  ? 12.861  17.584  6.209  1.00 22.10 ? 11  MET A N   1 
ATOM   75   C CA  . MET A 1 23  ? 12.533  17.777  7.637  1.00 24.48 ? 11  MET A CA  1 
ATOM   76   C C   . MET A 1 23  ? 13.791  18.138  8.388  1.00 21.52 ? 11  MET A C   1 
ATOM   77   O O   . MET A 1 23  ? 14.881  17.637  8.069  1.00 20.09 ? 11  MET A O   1 
ATOM   78   C CB  . MET A 1 23  ? 12.029  16.485  8.287  1.00 24.38 ? 11  MET A CB  1 
ATOM   79   C CG  . MET A 1 23  ? 10.718  15.911  7.853  1.00 29.41 ? 11  MET A CG  1 
ATOM   80   S SD  . MET A 1 23  ? 10.732  14.086  8.221  1.00 35.03 ? 11  MET A SD  1 
ATOM   81   C CE  . MET A 1 23  ? 11.497  13.534  6.716  1.00 31.06 ? 11  MET A CE  1 
ATOM   82   N N   . LYS A 1 24  ? 13.628  18.971  9.421  1.00 21.77 ? 12  LYS A N   1 
ATOM   83   C CA  . LYS A 1 24  ? 14.677  19.207  10.421 1.00 22.24 ? 12  LYS A CA  1 
ATOM   84   C C   . LYS A 1 24  ? 14.068  19.028  11.776 1.00 19.56 ? 12  LYS A C   1 
ATOM   85   O O   . LYS A 1 24  ? 12.962  19.476  12.031 1.00 20.63 ? 12  LYS A O   1 
ATOM   86   C CB  . LYS A 1 24  ? 15.277  20.632  10.367 1.00 22.24 ? 12  LYS A CB  1 
ATOM   87   C CG  . LYS A 1 24  ? 16.048  20.898  9.120  1.00 28.15 ? 12  LYS A CG  1 
ATOM   88   C CD  . LYS A 1 24  ? 16.403  22.401  8.998  1.00 27.61 ? 12  LYS A CD  1 
ATOM   89   C CE  . LYS A 1 24  ? 17.306  22.603  7.795  1.00 35.17 ? 12  LYS A CE  1 
ATOM   90   N NZ  . LYS A 1 24  ? 18.668  21.987  8.103  1.00 39.75 ? 12  LYS A NZ  1 
ATOM   91   N N   . LEU A 1 25  ? 14.800  18.362  12.649 1.00 19.68 ? 13  LEU A N   1 
ATOM   92   C CA  . LEU A 1 25  ? 14.288  18.096  13.994 1.00 18.39 ? 13  LEU A CA  1 
ATOM   93   C C   . LEU A 1 25  ? 15.300  18.520  15.083 1.00 19.09 ? 13  LEU A C   1 
ATOM   94   O O   . LEU A 1 25  ? 16.500  18.377  14.912 1.00 19.14 ? 13  LEU A O   1 
ATOM   95   C CB  . LEU A 1 25  ? 13.910  16.584  14.132 1.00 18.17 ? 13  LEU A CB  1 
ATOM   96   C CG  . LEU A 1 25  ? 13.740  16.043  15.571 1.00 16.42 ? 13  LEU A CG  1 
ATOM   97   C CD1 . LEU A 1 25  ? 12.652  14.918  15.501 1.00 16.05 ? 13  LEU A CD1 1 
ATOM   98   C CD2 . LEU A 1 25  ? 15.017  15.565  16.171 1.00 18.14 ? 13  LEU A CD2 1 
ATOM   99   N N   . TYR A 1 26  ? 14.765  19.007  16.202 1.00 19.53 ? 14  TYR A N   1 
ATOM   100  C CA  . TYR A 1 26  ? 15.522  19.268  17.412 1.00 20.40 ? 14  TYR A CA  1 
ATOM   101  C C   . TYR A 1 26  ? 14.837  18.476  18.536 1.00 19.36 ? 14  TYR A C   1 
ATOM   102  O O   . TYR A 1 26  ? 13.625  18.608  18.730 1.00 19.44 ? 14  TYR A O   1 
ATOM   103  C CB  . TYR A 1 26  ? 15.431  20.746  17.731 1.00 22.44 ? 14  TYR A CB  1 
ATOM   104  C CG  . TYR A 1 26  ? 15.897  21.563  16.550 1.00 23.68 ? 14  TYR A CG  1 
ATOM   105  C CD1 . TYR A 1 26  ? 17.269  21.722  16.313 1.00 27.49 ? 14  TYR A CD1 1 
ATOM   106  C CD2 . TYR A 1 26  ? 14.981  22.124  15.657 1.00 24.13 ? 14  TYR A CD2 1 
ATOM   107  C CE1 . TYR A 1 26  ? 17.725  22.464  15.220 1.00 26.26 ? 14  TYR A CE1 1 
ATOM   108  C CE2 . TYR A 1 26  ? 15.435  22.879  14.542 1.00 24.53 ? 14  TYR A CE2 1 
ATOM   109  C CZ  . TYR A 1 26  ? 16.801  23.025  14.360 1.00 25.21 ? 14  TYR A CZ  1 
ATOM   110  O OH  . TYR A 1 26  ? 17.266  23.728  13.274 1.00 28.80 ? 14  TYR A OH  1 
ATOM   111  N N   . MET A 1 27  ? 15.639  17.720  19.262 1.00 20.01 ? 15  MET A N   1 
ATOM   112  C CA  . MET A 1 27  ? 15.159  16.947  20.412 1.00 20.18 ? 15  MET A CA  1 
ATOM   113  C C   . MET A 1 27  ? 15.971  17.178  21.686 1.00 19.91 ? 15  MET A C   1 
ATOM   114  O O   . MET A 1 27  ? 17.190  17.171  21.646 1.00 20.03 ? 15  MET A O   1 
ATOM   115  C CB  . MET A 1 27  ? 15.232  15.459  20.079 1.00 20.34 ? 15  MET A CB  1 
ATOM   116  C CG  . MET A 1 27  ? 14.908  14.556  21.272 1.00 20.50 ? 15  MET A CG  1 
ATOM   117  S SD  . MET A 1 27  ? 15.023  12.796  20.829 1.00 21.54 ? 15  MET A SD  1 
ATOM   118  C CE  . MET A 1 27  ? 13.560  12.591  19.761 1.00 21.07 ? 15  MET A CE  1 
ATOM   119  N N   . GLU A 1 28  ? 15.280  17.348  22.811 1.00 19.64 ? 16  GLU A N   1 
ATOM   120  C CA  . GLU A 1 28  ? 15.946  17.400  24.097 1.00 22.14 ? 16  GLU A CA  1 
ATOM   121  C C   . GLU A 1 28  ? 15.208  16.548  25.117 1.00 21.23 ? 16  GLU A C   1 
ATOM   122  O O   . GLU A 1 28  ? 13.971  16.506  25.123 1.00 21.08 ? 16  GLU A O   1 
ATOM   123  C CB  . GLU A 1 28  ? 16.001  18.843  24.615 1.00 22.40 ? 16  GLU A CB  1 
ATOM   124  C CG  . GLU A 1 28  ? 16.853  18.961  25.890 1.00 23.41 ? 16  GLU A CG  1 
ATOM   125  C CD  . GLU A 1 28  ? 17.259  20.409  26.240 1.00 26.89 ? 16  GLU A CD  1 
ATOM   126  O OE1 . GLU A 1 28  ? 16.689  21.392  25.672 1.00 28.99 ? 16  GLU A OE1 1 
ATOM   127  O OE2 . GLU A 1 28  ? 18.120  20.537  27.143 1.00 30.91 ? 16  GLU A OE2 1 
ATOM   128  N N   . GLY A 1 29  ? 15.959  15.907  26.003 1.00 22.28 ? 17  GLY A N   1 
ATOM   129  C CA  . GLY A 1 29  ? 15.292  15.333  27.183 1.00 21.80 ? 17  GLY A CA  1 
ATOM   130  C C   . GLY A 1 29  ? 16.203  14.568  28.095 1.00 20.27 ? 17  GLY A C   1 
ATOM   131  O O   . GLY A 1 29  ? 17.410  14.672  28.032 1.00 20.15 ? 17  GLY A O   1 
ATOM   132  N N   A THR A 1 30  ? 15.595  13.756  28.956 0.50 19.87 ? 18  THR A N   1 
ATOM   133  N N   B THR A 1 30  ? 15.609  13.803  29.002 0.50 20.59 ? 18  THR A N   1 
ATOM   134  C CA  A THR A 1 30  ? 16.335  13.081  30.018 0.50 17.56 ? 18  THR A CA  1 
ATOM   135  C CA  B THR A 1 30  ? 16.415  13.016  29.932 0.50 19.10 ? 18  THR A CA  1 
ATOM   136  C C   A THR A 1 30  ? 15.689  11.721  30.228 0.50 18.08 ? 18  THR A C   1 
ATOM   137  C C   B THR A 1 30  ? 15.706  11.704  30.094 0.50 18.89 ? 18  THR A C   1 
ATOM   138  O O   A THR A 1 30  ? 14.467  11.668  30.311 0.50 17.50 ? 18  THR A O   1 
ATOM   139  O O   B THR A 1 30  ? 14.479  11.663  30.007 0.50 17.96 ? 18  THR A O   1 
ATOM   140  C CB  A THR A 1 30  ? 16.202  13.870  31.339 0.50 18.44 ? 18  THR A CB  1 
ATOM   141  C CB  B THR A 1 30  ? 16.510  13.670  31.319 0.50 20.25 ? 18  THR A CB  1 
ATOM   142  O OG1 A THR A 1 30  ? 16.579  15.251  31.148 0.50 15.97 ? 18  THR A OG1 1 
ATOM   143  O OG1 B THR A 1 30  ? 15.191  13.878  31.832 0.50 20.09 ? 18  THR A OG1 1 
ATOM   144  C CG2 A THR A 1 30  ? 17.047  13.224  32.434 0.50 13.69 ? 18  THR A CG2 1 
ATOM   145  C CG2 B THR A 1 30  ? 17.190  15.029  31.237 0.50 19.29 ? 18  THR A CG2 1 
ATOM   146  N N   . VAL A 1 31  ? 16.491  10.654  30.288 1.00 16.94 ? 19  VAL A N   1 
ATOM   147  C CA  . VAL A 1 31  ? 15.942  9.301   30.577 1.00 19.50 ? 19  VAL A CA  1 
ATOM   148  C C   . VAL A 1 31  ? 16.720  8.753   31.750 1.00 19.34 ? 19  VAL A C   1 
ATOM   149  O O   . VAL A 1 31  ? 17.979  8.617   31.668 1.00 20.03 ? 19  VAL A O   1 
ATOM   150  C CB  . VAL A 1 31  ? 16.086  8.362   29.386 1.00 18.25 ? 19  VAL A CB  1 
ATOM   151  C CG1 . VAL A 1 31  ? 15.645  6.877   29.778 1.00 20.16 ? 19  VAL A CG1 1 
ATOM   152  C CG2 . VAL A 1 31  ? 15.300  8.934   28.148 1.00 18.51 ? 19  VAL A CG2 1 
ATOM   153  N N   . ASN A 1 32  ? 15.972  8.413   32.816 1.00 21.04 ? 20  ASN A N   1 
ATOM   154  C CA  . ASN A 1 32  ? 16.565  7.929   34.068 1.00 20.06 ? 20  ASN A CA  1 
ATOM   155  C C   . ASN A 1 32  ? 17.717  8.895   34.461 1.00 21.83 ? 20  ASN A C   1 
ATOM   156  O O   . ASN A 1 32  ? 18.839  8.452   34.700 1.00 20.89 ? 20  ASN A O   1 
ATOM   157  C CB  . ASN A 1 32  ? 17.127  6.531   33.871 1.00 19.88 ? 20  ASN A CB  1 
ATOM   158  C CG  . ASN A 1 32  ? 16.077  5.441   34.062 1.00 20.02 ? 20  ASN A CG  1 
ATOM   159  O OD1 . ASN A 1 32  ? 14.873  5.680   33.859 1.00 20.80 ? 20  ASN A OD1 1 
ATOM   160  N ND2 . ASN A 1 32  ? 16.522  4.268   34.555 1.00 19.30 ? 20  ASN A ND2 1 
ATOM   161  N N   . ASN A 1 33  ? 17.436  10.183  34.423 1.00 22.97 ? 21  ASN A N   1 
ATOM   162  C CA  . ASN A 1 33  ? 18.438  11.198  34.794 1.00 25.90 ? 21  ASN A CA  1 
ATOM   163  C C   . ASN A 1 33  ? 19.662  11.363  33.906 1.00 26.89 ? 21  ASN A C   1 
ATOM   164  O O   . ASN A 1 33  ? 20.660  12.023  34.337 1.00 26.88 ? 21  ASN A O   1 
ATOM   165  C CB  . ASN A 1 33  ? 18.869  11.007  36.251 1.00 26.16 ? 21  ASN A CB  1 
ATOM   166  C CG  . ASN A 1 33  ? 17.691  11.061  37.180 1.00 29.39 ? 21  ASN A CG  1 
ATOM   167  O OD1 . ASN A 1 33  ? 17.077  12.133  37.360 1.00 33.54 ? 21  ASN A OD1 1 
ATOM   168  N ND2 . ASN A 1 33  ? 17.313  9.907   37.733 1.00 28.05 ? 21  ASN A ND2 1 
ATOM   169  N N   . HIS A 1 34  ? 19.641  10.771  32.705 1.00 26.52 ? 22  HIS A N   1 
ATOM   170  C CA  . HIS A 1 34  ? 20.690  11.073  31.742 1.00 27.19 ? 22  HIS A CA  1 
ATOM   171  C C   . HIS A 1 34  ? 20.175  12.080  30.736 1.00 27.24 ? 22  HIS A C   1 
ATOM   172  O O   . HIS A 1 34  ? 19.238  11.800  29.974 1.00 25.85 ? 22  HIS A O   1 
ATOM   173  C CB  . HIS A 1 34  ? 21.211  9.864   31.005 1.00 28.19 ? 22  HIS A CB  1 
ATOM   174  C CG  . HIS A 1 34  ? 22.446  10.165  30.205 1.00 31.55 ? 22  HIS A CG  1 
ATOM   175  N ND1 . HIS A 1 34  ? 22.407  10.479  28.857 1.00 32.93 ? 22  HIS A ND1 1 
ATOM   176  C CD2 . HIS A 1 34  ? 23.745  10.293  30.585 1.00 32.06 ? 22  HIS A CD2 1 
ATOM   177  C CE1 . HIS A 1 34  ? 23.630  10.722  28.429 1.00 30.67 ? 22  HIS A CE1 1 
ATOM   178  N NE2 . HIS A 1 34  ? 24.461  10.620  29.459 1.00 35.82 ? 22  HIS A NE2 1 
ATOM   179  N N   . HIS A 1 35  ? 20.786  13.260  30.749 1.00 25.77 ? 23  HIS A N   1 
ATOM   180  C CA  . HIS A 1 35  ? 20.387  14.307  29.821 1.00 25.66 ? 23  HIS A CA  1 
ATOM   181  C C   . HIS A 1 35  ? 21.054  14.127  28.448 1.00 23.42 ? 23  HIS A C   1 
ATOM   182  O O   . HIS A 1 35  ? 22.186  13.648  28.336 1.00 22.95 ? 23  HIS A O   1 
ATOM   183  C CB  . HIS A 1 35  ? 20.647  15.688  30.443 1.00 26.19 ? 23  HIS A CB  1 
ATOM   184  C CG  . HIS A 1 35  ? 20.152  16.819  29.606 1.00 29.81 ? 23  HIS A CG  1 
ATOM   185  N ND1 . HIS A 1 35  ? 20.988  17.559  28.797 1.00 32.44 ? 23  HIS A ND1 1 
ATOM   186  C CD2 . HIS A 1 35  ? 18.911  17.340  29.448 1.00 32.06 ? 23  HIS A CD2 1 
ATOM   187  C CE1 . HIS A 1 35  ? 20.283  18.492  28.178 1.00 31.49 ? 23  HIS A CE1 1 
ATOM   188  N NE2 . HIS A 1 35  ? 19.022  18.380  28.553 1.00 31.30 ? 23  HIS A NE2 1 
ATOM   189  N N   . PHE A 1 36  ? 20.311  14.465  27.397 1.00 23.07 ? 24  PHE A N   1 
ATOM   190  C CA  . PHE A 1 36  ? 20.801  14.327  26.018 1.00 22.42 ? 24  PHE A CA  1 
ATOM   191  C C   . PHE A 1 36  ? 20.081  15.348  25.087 1.00 21.33 ? 24  PHE A C   1 
ATOM   192  O O   . PHE A 1 36  ? 19.015  15.914  25.420 1.00 20.30 ? 24  PHE A O   1 
ATOM   193  C CB  . PHE A 1 36  ? 20.618  12.887  25.519 1.00 23.32 ? 24  PHE A CB  1 
ATOM   194  C CG  . PHE A 1 36  ? 19.186  12.518  25.337 1.00 23.94 ? 24  PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 36  ? 18.568  12.687  24.104 1.00 23.43 ? 24  PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 36  ? 18.431  12.053  26.416 1.00 25.77 ? 24  PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 36  ? 17.192  12.389  23.938 1.00 25.82 ? 24  PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 36  ? 17.061  11.765  26.254 1.00 25.76 ? 24  PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 36  ? 16.460  11.925  25.005 1.00 26.39 ? 24  PHE A CZ  1 
ATOM   200  N N   . LYS A 1 37  ? 20.724  15.626  23.951 1.00 21.09 ? 25  LYS A N   1 
ATOM   201  C CA  . LYS A 1 37  ? 20.066  16.324  22.868 1.00 20.68 ? 25  LYS A CA  1 
ATOM   202  C C   . LYS A 1 37  ? 20.409  15.608  21.592 1.00 19.06 ? 25  LYS A C   1 
ATOM   203  O O   . LYS A 1 37  ? 21.493  15.049  21.466 1.00 19.14 ? 25  LYS A O   1 
ATOM   204  C CB  . LYS A 1 37  ? 20.553  17.793  22.760 1.00 20.68 ? 25  LYS A CB  1 
ATOM   205  C CG  . LYS A 1 37  ? 19.931  18.743  23.736 1.00 23.69 ? 25  LYS A CG  1 
ATOM   206  C CD  . LYS A 1 37  ? 20.787  19.993  23.735 1.00 27.89 ? 25  LYS A CD  1 
ATOM   207  C CE  . LYS A 1 37  ? 19.990  21.239  24.008 1.00 34.08 ? 25  LYS A CE  1 
ATOM   208  N NZ  . LYS A 1 37  ? 20.966  22.430  24.022 1.00 36.10 ? 25  LYS A NZ  1 
ATOM   209  N N   . CYS A 1 38  ? 19.472  15.597  20.662 1.00 19.47 ? 26  CYS A N   1 
ATOM   210  C CA  . CYS A 1 38  ? 19.720  15.146  19.295 1.00 19.62 ? 26  CYS A CA  1 
ATOM   211  C C   . CYS A 1 38  ? 19.233  16.184  18.281 1.00 19.24 ? 26  CYS A C   1 
ATOM   212  O O   . CYS A 1 38  ? 18.335  16.957  18.580 1.00 18.39 ? 26  CYS A O   1 
ATOM   213  C CB  . CYS A 1 38  ? 18.931  13.852  18.964 1.00 19.63 ? 26  CYS A CB  1 
ATOM   214  S SG  . CYS A 1 38  ? 19.214  12.505  20.129 1.00 23.15 ? 26  CYS A SG  1 
ATOM   215  N N   . THR A 1 39  ? 19.769  16.092  17.062 1.00 19.57 ? 27  THR A N   1 
ATOM   216  C CA  . THR A 1 39  ? 19.243  16.797  15.925 1.00 21.08 ? 27  THR A CA  1 
ATOM   217  C C   . THR A 1 39  ? 19.074  15.790  14.804 1.00 20.63 ? 27  THR A C   1 
ATOM   218  O O   . THR A 1 39  ? 19.734  14.753  14.797 1.00 20.96 ? 27  THR A O   1 
ATOM   219  C CB  . THR A 1 39  ? 20.173  17.983  15.453 1.00 21.33 ? 27  THR A CB  1 
ATOM   220  O OG1 . THR A 1 39  ? 21.494  17.484  15.158 1.00 23.17 ? 27  THR A OG1 1 
ATOM   221  C CG2 . THR A 1 39  ? 20.258  19.068  16.551 1.00 23.83 ? 27  THR A CG2 1 
ATOM   222  N N   . SER A 1 40  ? 18.160  16.048  13.881 1.00 20.58 ? 28  SER A N   1 
ATOM   223  C CA  . SER A 1 40  ? 18.203  15.259  12.665 1.00 21.92 ? 28  SER A CA  1 
ATOM   224  C C   . SER A 1 40  ? 17.801  16.068  11.433 1.00 22.23 ? 28  SER A C   1 
ATOM   225  O O   . SER A 1 40  ? 17.189  17.154  11.535 1.00 22.90 ? 28  SER A O   1 
ATOM   226  C CB  . SER A 1 40  ? 17.293  14.018  12.790 1.00 20.46 ? 28  SER A CB  1 
ATOM   227  O OG  . SER A 1 40  ? 15.966  14.475  12.764 1.00 23.67 ? 28  SER A OG  1 
ATOM   228  N N   . GLU A 1 41  ? 18.145  15.498  10.276 1.00 23.46 ? 29  GLU A N   1 
ATOM   229  C CA  . GLU A 1 41  ? 17.741  15.960  8.947  1.00 24.05 ? 29  GLU A CA  1 
ATOM   230  C C   . GLU A 1 41  ? 17.235  14.733  8.213  1.00 23.21 ? 29  GLU A C   1 
ATOM   231  O O   . GLU A 1 41  ? 17.853  13.671  8.304  1.00 23.87 ? 29  GLU A O   1 
ATOM   232  C CB  . GLU A 1 41  ? 18.955  16.412  8.145  1.00 25.24 ? 29  GLU A CB  1 
ATOM   233  C CG  . GLU A 1 41  ? 19.751  17.545  8.732  1.00 30.99 ? 29  GLU A CG  1 
ATOM   234  C CD  . GLU A 1 41  ? 19.293  18.936  8.278  1.00 39.43 ? 29  GLU A CD  1 
ATOM   235  O OE1 . GLU A 1 41  ? 18.249  19.067  7.584  1.00 42.97 ? 29  GLU A OE1 1 
ATOM   236  O OE2 . GLU A 1 41  ? 20.003  19.912  8.635  1.00 41.76 ? 29  GLU A OE2 1 
ATOM   237  N N   . GLY A 1 42  ? 16.151  14.892  7.466  1.00 23.27 ? 30  GLY A N   1 
ATOM   238  C CA  . GLY A 1 42  ? 15.684  13.839  6.557  1.00 23.65 ? 30  GLY A CA  1 
ATOM   239  C C   . GLY A 1 42  ? 14.820  14.313  5.406  1.00 24.19 ? 30  GLY A C   1 
ATOM   240  O O   . GLY A 1 42  ? 14.564  15.514  5.223  1.00 23.71 ? 30  GLY A O   1 
ATOM   241  N N   A GLU A 1 43  ? 14.329  13.346  4.642  0.50 23.62 ? 31  GLU A N   1 
ATOM   242  N N   B GLU A 1 43  ? 14.360  13.359  4.605  0.50 24.24 ? 31  GLU A N   1 
ATOM   243  C CA  A GLU A 1 43  ? 13.522  13.616  3.470  0.50 22.64 ? 31  GLU A CA  1 
ATOM   244  C CA  B GLU A 1 43  ? 13.481  13.661  3.486  0.50 23.99 ? 31  GLU A CA  1 
ATOM   245  C C   A GLU A 1 43  ? 12.465  12.522  3.463  0.50 22.66 ? 31  GLU A C   1 
ATOM   246  C C   B GLU A 1 43  ? 12.528  12.499  3.332  0.50 23.42 ? 31  GLU A C   1 
ATOM   247  O O   A GLU A 1 43  ? 12.651  11.474  4.087  0.50 21.56 ? 31  GLU A O   1 
ATOM   248  O O   B GLU A 1 43  ? 12.861  11.372  3.708  0.50 22.88 ? 31  GLU A O   1 
ATOM   249  C CB  A GLU A 1 43  ? 14.399  13.558  2.213  0.50 23.09 ? 31  GLU A CB  1 
ATOM   250  C CB  B GLU A 1 43  ? 14.259  13.918  2.189  0.50 24.46 ? 31  GLU A CB  1 
ATOM   251  C CG  A GLU A 1 43  ? 13.692  13.864  0.875  0.50 23.46 ? 31  GLU A CG  1 
ATOM   252  C CG  B GLU A 1 43  ? 15.285  12.855  1.799  0.50 25.76 ? 31  GLU A CG  1 
ATOM   253  C CD  A GLU A 1 43  ? 13.462  15.365  0.580  0.50 24.61 ? 31  GLU A CD  1 
ATOM   254  C CD  B GLU A 1 43  ? 15.853  13.039  0.385  0.50 26.21 ? 31  GLU A CD  1 
ATOM   255  O OE1 A GLU A 1 43  ? 13.861  16.211  1.388  0.50 25.69 ? 31  GLU A OE1 1 
ATOM   256  O OE1 B GLU A 1 43  ? 15.299  13.811  -0.421 0.50 30.55 ? 31  GLU A OE1 1 
ATOM   257  O OE2 A GLU A 1 43  ? 12.861  15.702  -0.462 0.50 24.21 ? 31  GLU A OE2 1 
ATOM   258  O OE2 B GLU A 1 43  ? 16.861  12.380  0.061  0.50 32.68 ? 31  GLU A OE2 1 
ATOM   259  N N   . GLY A 1 44  ? 11.345  12.790  2.818  1.00 22.33 ? 32  GLY A N   1 
ATOM   260  C CA  . GLY A 1 44  ? 10.311  11.795  2.681  1.00 23.17 ? 32  GLY A CA  1 
ATOM   261  C C   . GLY A 1 44  ? 9.377   12.080  1.538  1.00 23.42 ? 32  GLY A C   1 
ATOM   262  O O   . GLY A 1 44  ? 9.361   13.171  0.937  1.00 22.32 ? 32  GLY A O   1 
ATOM   263  N N   . LYS A 1 45  ? 8.530   11.103  1.298  1.00 22.69 ? 33  LYS A N   1 
ATOM   264  C CA  . LYS A 1 45  ? 7.505   11.234  0.311  1.00 21.37 ? 33  LYS A CA  1 
ATOM   265  C C   . LYS A 1 45  ? 6.207   11.116  1.058  1.00 20.09 ? 33  LYS A C   1 
ATOM   266  O O   . LYS A 1 45  ? 5.720   9.994   1.344  1.00 20.80 ? 33  LYS A O   1 
ATOM   267  C CB  . LYS A 1 45  ? 7.692   10.123  -0.740 1.00 21.28 ? 33  LYS A CB  1 
ATOM   268  C CG  . LYS A 1 45  ? 9.068   10.168  -1.346 1.00 23.03 ? 33  LYS A CG  1 
ATOM   269  C CD  . LYS A 1 45  ? 8.946   10.729  -2.735 1.00 27.80 ? 33  LYS A CD  1 
ATOM   270  C CE  . LYS A 1 45  ? 10.102  10.318  -3.630 1.00 29.43 ? 33  LYS A CE  1 
ATOM   271  N NZ  . LYS A 1 45  ? 10.112  11.236  -4.807 1.00 33.59 ? 33  LYS A NZ  1 
ATOM   272  N N   . PRO A 1 46  ? 5.612   12.264  1.391  1.00 19.03 ? 34  PRO A N   1 
ATOM   273  C CA  . PRO A 1 46  ? 4.459   12.258  2.238  1.00 17.79 ? 34  PRO A CA  1 
ATOM   274  C C   . PRO A 1 46  ? 3.266   11.444  1.743  1.00 17.88 ? 34  PRO A C   1 
ATOM   275  O O   . PRO A 1 46  ? 2.528   10.960  2.561  1.00 17.70 ? 34  PRO A O   1 
ATOM   276  C CB  . PRO A 1 46  ? 4.075   13.768  2.370  1.00 18.09 ? 34  PRO A CB  1 
ATOM   277  C CG  . PRO A 1 46  ? 5.199   14.501  1.929  1.00 17.55 ? 34  PRO A CG  1 
ATOM   278  C CD  . PRO A 1 46  ? 6.029   13.640  1.008  1.00 18.34 ? 34  PRO A CD  1 
ATOM   279  N N   . TYR A 1 47  ? 3.048   11.334  0.428  1.00 18.27 ? 35  TYR A N   1 
ATOM   280  C CA  . TYR A 1 47  ? 1.858   10.636  -0.076 1.00 18.62 ? 35  TYR A CA  1 
ATOM   281  C C   . TYR A 1 47  ? 2.090   9.119   -0.273 1.00 18.28 ? 35  TYR A C   1 
ATOM   282  O O   . TYR A 1 47  ? 1.096   8.350   -0.352 1.00 19.68 ? 35  TYR A O   1 
ATOM   283  C CB  . TYR A 1 47  ? 1.398   11.286  -1.403 1.00 18.68 ? 35  TYR A CB  1 
ATOM   284  C CG  . TYR A 1 47  ? 0.992   12.736  -1.125 1.00 19.24 ? 35  TYR A CG  1 
ATOM   285  C CD1 . TYR A 1 47  ? 1.895   13.790  -1.293 1.00 22.21 ? 35  TYR A CD1 1 
ATOM   286  C CD2 . TYR A 1 47  ? -0.279  13.013  -0.647 1.00 19.48 ? 35  TYR A CD2 1 
ATOM   287  C CE1 . TYR A 1 47  ? 1.489   15.118  -1.001 1.00 20.14 ? 35  TYR A CE1 1 
ATOM   288  C CE2 . TYR A 1 47  ? -0.688  14.322  -0.370 1.00 22.43 ? 35  TYR A CE2 1 
ATOM   289  C CZ  . TYR A 1 47  ? 0.202   15.343  -0.553 1.00 21.74 ? 35  TYR A CZ  1 
ATOM   290  O OH  . TYR A 1 47  ? -0.240  16.613  -0.234 1.00 21.52 ? 35  TYR A OH  1 
ATOM   291  N N   . GLU A 1 48  ? 3.354   8.770   -0.360 1.00 18.13 ? 36  GLU A N   1 
ATOM   292  C CA  . GLU A 1 48  ? 3.845   7.366   -0.303 1.00 20.61 ? 36  GLU A CA  1 
ATOM   293  C C   . GLU A 1 48  ? 3.888   6.819   1.123  1.00 21.54 ? 36  GLU A C   1 
ATOM   294  O O   . GLU A 1 48  ? 3.952   5.598   1.330  1.00 22.96 ? 36  GLU A O   1 
ATOM   295  C CB  . GLU A 1 48  ? 5.249   7.264   -0.855 1.00 19.34 ? 36  GLU A CB  1 
ATOM   296  C CG  . GLU A 1 48  ? 5.392   7.548   -2.351 1.00 20.31 ? 36  GLU A CG  1 
ATOM   297  C CD  . GLU A 1 48  ? 6.790   7.331   -2.864 1.00 21.39 ? 36  GLU A CD  1 
ATOM   298  O OE1 . GLU A 1 48  ? 7.637   6.764   -2.128 1.00 23.90 ? 36  GLU A OE1 1 
ATOM   299  O OE2 . GLU A 1 48  ? 7.066   7.694   -4.034 1.00 25.47 ? 36  GLU A OE2 1 
ATOM   300  N N   . GLY A 1 49  ? 3.955   7.712   2.100  1.00 21.54 ? 37  GLY A N   1 
ATOM   301  C CA  . GLY A 1 49  ? 4.161   7.305   3.503  1.00 19.82 ? 37  GLY A CA  1 
ATOM   302  C C   . GLY A 1 49  ? 5.568   6.851   3.828  1.00 20.09 ? 37  GLY A C   1 
ATOM   303  O O   . GLY A 1 49  ? 5.772   6.055   4.736  1.00 20.87 ? 37  GLY A O   1 
ATOM   304  N N   . THR A 1 50  ? 6.571   7.353   3.135  1.00 19.42 ? 38  THR A N   1 
ATOM   305  C CA  . THR A 1 50  ? 7.925   6.933   3.430  1.00 19.10 ? 38  THR A CA  1 
ATOM   306  C C   . THR A 1 50  ? 8.781   8.150   3.866  1.00 19.69 ? 38  THR A C   1 
ATOM   307  O O   . THR A 1 50  ? 8.577   9.250   3.367  1.00 18.73 ? 38  THR A O   1 
ATOM   308  C CB  . THR A 1 50  ? 8.612   6.255   2.241  1.00 20.08 ? 38  THR A CB  1 
ATOM   309  O OG1 . THR A 1 50  ? 8.532   7.120   1.104  1.00 20.20 ? 38  THR A OG1 1 
ATOM   310  C CG2 . THR A 1 50  ? 7.867   4.940   1.855  1.00 20.55 ? 38  THR A CG2 1 
ATOM   311  N N   . GLN A 1 51  ? 9.776   7.870   4.696  1.00 19.26 ? 39  GLN A N   1 
ATOM   312  C CA  . GLN A 1 51  ? 10.675  8.869   5.202  1.00 18.88 ? 39  GLN A CA  1 
ATOM   313  C C   . GLN A 1 51  ? 11.929  8.264   5.758  1.00 19.75 ? 39  GLN A C   1 
ATOM   314  O O   . GLN A 1 51  ? 11.948  7.124   6.282  1.00 19.57 ? 39  GLN A O   1 
ATOM   315  C CB  . GLN A 1 51  ? 9.958   9.735   6.229  1.00 18.19 ? 39  GLN A CB  1 
ATOM   316  C CG  . GLN A 1 51  ? 9.546   9.028   7.483  1.00 18.30 ? 39  GLN A CG  1 
ATOM   317  C CD  . GLN A 1 51  ? 8.862   9.958   8.417  1.00 18.34 ? 39  GLN A CD  1 
ATOM   318  O OE1 . GLN A 1 51  ? 9.439   10.988  8.762  1.00 18.32 ? 39  GLN A OE1 1 
ATOM   319  N NE2 . GLN A 1 51  ? 7.625   9.653   8.792  1.00 18.06 ? 39  GLN A NE2 1 
ATOM   320  N N   . THR A 1 52  ? 13.021  9.002   5.623  1.00 21.03 ? 40  THR A N   1 
ATOM   321  C CA  . THR A 1 52  ? 14.268  8.592   6.234  1.00 22.18 ? 40  THR A CA  1 
ATOM   322  C C   . THR A 1 52  ? 14.819  9.795   6.977  1.00 23.71 ? 40  THR A C   1 
ATOM   323  O O   . THR A 1 52  ? 14.648  10.942  6.522  1.00 23.26 ? 40  THR A O   1 
ATOM   324  C CB  . THR A 1 52  ? 15.281  8.025   5.222  1.00 23.47 ? 40  THR A CB  1 
ATOM   325  O OG1 . THR A 1 52  ? 14.704  6.871   4.589  1.00 26.11 ? 40  THR A OG1 1 
ATOM   326  C CG2 . THR A 1 52  ? 16.561  7.643   5.906  1.00 23.50 ? 40  THR A CG2 1 
ATOM   327  N N   . MET A 1 53  ? 15.422  9.516   8.133  1.00 23.95 ? 41  MET A N   1 
ATOM   328  C CA  . MET A 1 53  ? 16.145  10.519  8.916  1.00 25.43 ? 41  MET A CA  1 
ATOM   329  C C   . MET A 1 53  ? 17.541  10.117  9.260  1.00 24.86 ? 41  MET A C   1 
ATOM   330  O O   . MET A 1 53  ? 17.806  8.967   9.597  1.00 24.42 ? 41  MET A O   1 
ATOM   331  C CB  . MET A 1 53  ? 15.412  10.819  10.223 1.00 25.36 ? 41  MET A CB  1 
ATOM   332  C CG  . MET A 1 53  ? 14.417  11.967  10.111 1.00 25.79 ? 41  MET A CG  1 
ATOM   333  S SD  . MET A 1 53  ? 13.715  12.154  11.752 1.00 28.51 ? 41  MET A SD  1 
ATOM   334  C CE  . MET A 1 53  ? 12.298  13.148  11.304 1.00 23.58 ? 41  MET A CE  1 
ATOM   335  N N   . ARG A 1 54  ? 18.446  11.098  9.227  1.00 25.20 ? 42  ARG A N   1 
ATOM   336  C CA  . ARG A 1 54  ? 19.781  10.900  9.716  1.00 25.35 ? 42  ARG A CA  1 
ATOM   337  C C   . ARG A 1 54  ? 19.888  11.727  10.990 1.00 25.04 ? 42  ARG A C   1 
ATOM   338  O O   . ARG A 1 54  ? 19.742  12.967  10.969 1.00 24.49 ? 42  ARG A O   1 
ATOM   339  C CB  . ARG A 1 54  ? 20.819  11.354  8.704  1.00 26.91 ? 42  ARG A CB  1 
ATOM   340  C CG  . ARG A 1 54  ? 21.157  10.306  7.663  1.00 31.85 ? 42  ARG A CG  1 
ATOM   341  C CD  . ARG A 1 54  ? 22.306  10.808  6.757  1.00 40.59 ? 42  ARG A CD  1 
ATOM   342  N NE  . ARG A 1 54  ? 21.862  11.948  5.964  1.00 46.22 ? 42  ARG A NE  1 
ATOM   343  C CZ  . ARG A 1 54  ? 21.025  11.863  4.928  1.00 51.74 ? 42  ARG A CZ  1 
ATOM   344  N NH1 . ARG A 1 54  ? 20.529  10.678  4.547  1.00 53.92 ? 42  ARG A NH1 1 
ATOM   345  N NH2 . ARG A 1 54  ? 20.671  12.967  4.273  1.00 53.06 ? 42  ARG A NH2 1 
ATOM   346  N N   . ILE A 1 55  ? 20.125  11.026  12.085 1.00 23.68 ? 43  ILE A N   1 
ATOM   347  C CA  . ILE A 1 55  ? 20.044  11.584  13.436 1.00 23.04 ? 43  ILE A CA  1 
ATOM   348  C C   . ILE A 1 55  ? 21.435  11.593  14.053 1.00 23.01 ? 43  ILE A C   1 
ATOM   349  O O   . ILE A 1 55  ? 22.212  10.652  13.865 1.00 24.17 ? 43  ILE A O   1 
ATOM   350  C CB  . ILE A 1 55  ? 19.104  10.682  14.357 1.00 21.74 ? 43  ILE A CB  1 
ATOM   351  C CG1 . ILE A 1 55  ? 17.723  10.526  13.756 1.00 22.69 ? 43  ILE A CG1 1 
ATOM   352  C CG2 . ILE A 1 55  ? 18.990  11.265  15.769 1.00 21.47 ? 43  ILE A CG2 1 
ATOM   353  C CD1 . ILE A 1 55  ? 16.913  9.240   14.221 1.00 19.93 ? 43  ILE A CD1 1 
ATOM   354  N N   . LYS A 1 56  ? 21.734  12.642  14.823 1.00 23.42 ? 44  LYS A N   1 
ATOM   355  C CA  . LYS A 1 56  ? 22.977  12.756  15.552 1.00 26.01 ? 44  LYS A CA  1 
ATOM   356  C C   . LYS A 1 56  ? 22.676  13.086  17.013 1.00 24.52 ? 44  LYS A C   1 
ATOM   357  O O   . LYS A 1 56  ? 21.859  13.988  17.313 1.00 23.87 ? 44  LYS A O   1 
ATOM   358  C CB  . LYS A 1 56  ? 23.877  13.876  14.953 1.00 26.56 ? 44  LYS A CB  1 
ATOM   359  C CG  . LYS A 1 56  ? 24.361  13.566  13.516 1.00 30.34 ? 44  LYS A CG  1 
ATOM   360  C CD  . LYS A 1 56  ? 25.202  14.697  12.814 1.00 30.88 ? 44  LYS A CD  1 
ATOM   361  C CE  . LYS A 1 56  ? 25.715  14.183  11.448 1.00 35.06 ? 44  LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 56  ? 27.024  14.784  11.048 1.00 40.92 ? 44  LYS A NZ  1 
ATOM   363  N N   . VAL A 1 57  ? 23.359  12.386  17.909 1.00 23.42 ? 45  VAL A N   1 
ATOM   364  C CA  . VAL A 1 57  ? 23.303  12.715  19.337 1.00 22.84 ? 45  VAL A CA  1 
ATOM   365  C C   . VAL A 1 57  ? 24.314  13.842  19.541 1.00 23.51 ? 45  VAL A C   1 
ATOM   366  O O   . VAL A 1 57  ? 25.498  13.619  19.352 1.00 23.99 ? 45  VAL A O   1 
ATOM   367  C CB  . VAL A 1 57  ? 23.671  11.510  20.234 1.00 22.07 ? 45  VAL A CB  1 
ATOM   368  C CG1 . VAL A 1 57  ? 23.772  11.936  21.707 1.00 21.93 ? 45  VAL A CG1 1 
ATOM   369  C CG2 . VAL A 1 57  ? 22.589  10.383  20.097 1.00 21.73 ? 45  VAL A CG2 1 
ATOM   370  N N   . VAL A 1 58  ? 23.838  15.023  19.910 1.00 24.78 ? 46  VAL A N   1 
ATOM   371  C CA  . VAL A 1 58  ? 24.718  16.217  19.966 1.00 25.00 ? 46  VAL A CA  1 
ATOM   372  C C   . VAL A 1 58  ? 25.157  16.587  21.359 1.00 27.01 ? 46  VAL A C   1 
ATOM   373  O O   . VAL A 1 58  ? 26.156  17.307  21.551 1.00 27.13 ? 46  VAL A O   1 
ATOM   374  C CB  . VAL A 1 58  ? 24.106  17.436  19.217 1.00 24.59 ? 46  VAL A CB  1 
ATOM   375  C CG1 . VAL A 1 58  ? 23.832  17.068  17.735 1.00 23.34 ? 46  VAL A CG1 1 
ATOM   376  C CG2 . VAL A 1 58  ? 22.862  17.956  19.902 1.00 23.54 ? 46  VAL A CG2 1 
ATOM   377  N N   . GLU A 1 59  ? 24.445  16.078  22.350 1.00 28.03 ? 47  GLU A N   1 
ATOM   378  C CA  . GLU A 1 59  ? 24.881  16.245  23.734 1.00 29.88 ? 47  GLU A CA  1 
ATOM   379  C C   . GLU A 1 59  ? 24.489  14.998  24.531 1.00 30.36 ? 47  GLU A C   1 
ATOM   380  O O   . GLU A 1 59  ? 23.495  14.358  24.215 1.00 29.25 ? 47  GLU A O   1 
ATOM   381  C CB  . GLU A 1 59  ? 24.255  17.492  24.325 1.00 30.48 ? 47  GLU A CB  1 
ATOM   382  C CG  . GLU A 1 59  ? 24.839  17.897  25.651 1.00 35.82 ? 47  GLU A CG  1 
ATOM   383  C CD  . GLU A 1 59  ? 23.746  18.087  26.663 1.00 45.59 ? 47  GLU A CD  1 
ATOM   384  O OE1 . GLU A 1 59  ? 23.471  19.264  27.033 1.00 49.15 ? 47  GLU A OE1 1 
ATOM   385  O OE2 . GLU A 1 59  ? 23.129  17.058  27.059 1.00 47.37 ? 47  GLU A OE2 1 
ATOM   386  N N   . GLY A 1 60  ? 25.311  14.647  25.520 1.00 31.20 ? 48  GLY A N   1 
ATOM   387  C CA  . GLY A 1 60  ? 25.029  13.561  26.446 1.00 31.42 ? 48  GLY A CA  1 
ATOM   388  C C   . GLY A 1 60  ? 25.301  12.192  25.845 1.00 31.99 ? 48  GLY A C   1 
ATOM   389  O O   . GLY A 1 60  ? 24.780  11.189  26.337 1.00 32.67 ? 48  GLY A O   1 
ATOM   390  N N   . GLY A 1 61  ? 26.112  12.134  24.787 1.00 31.30 ? 49  GLY A N   1 
ATOM   391  C CA  . GLY A 1 61  ? 26.451  10.859  24.135 1.00 31.74 ? 49  GLY A CA  1 
ATOM   392  C C   . GLY A 1 61  ? 27.775  10.295  24.644 1.00 33.12 ? 49  GLY A C   1 
ATOM   393  O O   . GLY A 1 61  ? 28.587  11.045  25.202 1.00 33.50 ? 49  GLY A O   1 
ATOM   394  N N   . PRO A 1 62  ? 28.006  8.969   24.473 1.00 33.11 ? 50  PRO A N   1 
ATOM   395  C CA  . PRO A 1 62  ? 27.039  8.011   23.901 1.00 32.28 ? 50  PRO A CA  1 
ATOM   396  C C   . PRO A 1 62  ? 25.883  7.737   24.898 1.00 30.52 ? 50  PRO A C   1 
ATOM   397  O O   . PRO A 1 62  ? 26.095  7.821   26.092 1.00 29.92 ? 50  PRO A O   1 
ATOM   398  C CB  . PRO A 1 62  ? 27.887  6.754   23.663 1.00 32.43 ? 50  PRO A CB  1 
ATOM   399  C CG  . PRO A 1 62  ? 29.309  7.179   23.836 1.00 34.51 ? 50  PRO A CG  1 
ATOM   400  C CD  . PRO A 1 62  ? 29.265  8.305   24.827 1.00 33.57 ? 50  PRO A CD  1 
ATOM   401  N N   . LEU A 1 63  ? 24.677  7.454   24.395 1.00 29.61 ? 51  LEU A N   1 
ATOM   402  C CA  . LEU A 1 63  ? 23.483  7.285   25.250 1.00 28.08 ? 51  LEU A CA  1 
ATOM   403  C C   . LEU A 1 63  ? 23.682  6.030   26.076 1.00 27.14 ? 51  LEU A C   1 
ATOM   404  O O   . LEU A 1 63  ? 24.066  5.009   25.528 1.00 28.66 ? 51  LEU A O   1 
ATOM   405  C CB  . LEU A 1 63  ? 22.201  7.156   24.399 1.00 26.48 ? 51  LEU A CB  1 
ATOM   406  C CG  . LEU A 1 63  ? 21.843  8.371   23.536 1.00 26.33 ? 51  LEU A CG  1 
ATOM   407  C CD1 . LEU A 1 63  ? 20.515  8.178   22.777 1.00 27.46 ? 51  LEU A CD1 1 
ATOM   408  C CD2 . LEU A 1 63  ? 21.831  9.650   24.355 1.00 20.08 ? 51  LEU A CD2 1 
ATOM   409  N N   . PRO A 1 64  ? 23.456  6.099   27.386 1.00 27.49 ? 52  PRO A N   1 
ATOM   410  C CA  . PRO A 1 64  ? 23.633  4.861   28.147 1.00 27.70 ? 52  PRO A CA  1 
ATOM   411  C C   . PRO A 1 64  ? 22.333  4.043   28.238 1.00 27.25 ? 52  PRO A C   1 
ATOM   412  O O   . PRO A 1 64  ? 22.102  3.364   29.230 1.00 28.07 ? 52  PRO A O   1 
ATOM   413  C CB  . PRO A 1 64  ? 24.001  5.379   29.527 1.00 28.09 ? 52  PRO A CB  1 
ATOM   414  C CG  . PRO A 1 64  ? 23.226  6.660   29.670 1.00 27.13 ? 52  PRO A CG  1 
ATOM   415  C CD  . PRO A 1 64  ? 23.076  7.229   28.267 1.00 27.27 ? 52  PRO A CD  1 
ATOM   416  N N   . PHE A 1 65  ? 21.470  4.180   27.243 1.00 26.09 ? 53  PHE A N   1 
ATOM   417  C CA  . PHE A 1 65  ? 20.190  3.478   27.211 1.00 24.59 ? 53  PHE A CA  1 
ATOM   418  C C   . PHE A 1 65  ? 19.888  3.224   25.752 1.00 24.33 ? 53  PHE A C   1 
ATOM   419  O O   . PHE A 1 65  ? 20.542  3.800   24.883 1.00 23.10 ? 53  PHE A O   1 
ATOM   420  C CB  . PHE A 1 65  ? 19.070  4.294   27.872 1.00 24.49 ? 53  PHE A CB  1 
ATOM   421  C CG  . PHE A 1 65  ? 18.831  5.648   27.243 1.00 24.04 ? 53  PHE A CG  1 
ATOM   422  C CD1 . PHE A 1 65  ? 18.070  5.775   26.078 1.00 23.01 ? 53  PHE A CD1 1 
ATOM   423  C CD2 . PHE A 1 65  ? 19.357  6.798   27.825 1.00 23.66 ? 53  PHE A CD2 1 
ATOM   424  C CE1 . PHE A 1 65  ? 17.849  7.040   25.498 1.00 22.85 ? 53  PHE A CE1 1 
ATOM   425  C CE2 . PHE A 1 65  ? 19.133  8.079   27.244 1.00 21.98 ? 53  PHE A CE2 1 
ATOM   426  C CZ  . PHE A 1 65  ? 18.395  8.184   26.096 1.00 23.23 ? 53  PHE A CZ  1 
ATOM   427  N N   . ALA A 1 66  ? 18.908  2.355   25.473 1.00 22.14 ? 54  ALA A N   1 
ATOM   428  C CA  . ALA A 1 66  ? 18.680  1.901   24.110 1.00 21.11 ? 54  ALA A CA  1 
ATOM   429  C C   . ALA A 1 66  ? 18.064  3.013   23.306 1.00 20.36 ? 54  ALA A C   1 
ATOM   430  O O   . ALA A 1 66  ? 17.071  3.580   23.700 1.00 20.44 ? 54  ALA A O   1 
ATOM   431  C CB  . ALA A 1 66  ? 17.732  0.677   24.096 1.00 20.33 ? 54  ALA A CB  1 
ATOM   432  N N   . PHE A 1 67  ? 18.673  3.301   22.162 1.00 20.26 ? 55  PHE A N   1 
ATOM   433  C CA  . PHE A 1 67  ? 18.175  4.326   21.246 1.00 19.40 ? 55  PHE A CA  1 
ATOM   434  C C   . PHE A 1 67  ? 16.747  4.042   20.792 1.00 18.45 ? 55  PHE A C   1 
ATOM   435  O O   . PHE A 1 67  ? 15.979  4.959   20.618 1.00 17.28 ? 55  PHE A O   1 
ATOM   436  C CB  . PHE A 1 67  ? 19.152  4.470   20.061 1.00 20.81 ? 55  PHE A CB  1 
ATOM   437  C CG  . PHE A 1 67  ? 18.893  5.682   19.205 1.00 21.22 ? 55  PHE A CG  1 
ATOM   438  C CD1 . PHE A 1 67  ? 19.665  6.848   19.348 1.00 23.73 ? 55  PHE A CD1 1 
ATOM   439  C CD2 . PHE A 1 67  ? 17.901  5.638   18.221 1.00 20.31 ? 55  PHE A CD2 1 
ATOM   440  C CE1 . PHE A 1 67  ? 19.410  7.973   18.526 1.00 24.25 ? 55  PHE A CE1 1 
ATOM   441  C CE2 . PHE A 1 67  ? 17.618  6.746   17.418 1.00 23.64 ? 55  PHE A CE2 1 
ATOM   442  C CZ  . PHE A 1 67  ? 18.389  7.928   17.578 1.00 25.43 ? 55  PHE A CZ  1 
ATOM   443  N N   . ASP A 1 68  ? 16.355  2.753   20.722 1.00 16.80 ? 56  ASP A N   1 
ATOM   444  C CA  . ASP A 1 68  ? 15.026  2.360   20.286 1.00 16.77 ? 56  ASP A CA  1 
ATOM   445  C C   . ASP A 1 68  ? 13.894  3.066   21.002 1.00 15.48 ? 56  ASP A C   1 
ATOM   446  O O   . ASP A 1 68  ? 12.827  3.264   20.409 1.00 15.94 ? 56  ASP A O   1 
ATOM   447  C CB  . ASP A 1 68  ? 14.837  0.824   20.434 1.00 17.17 ? 56  ASP A CB  1 
ATOM   448  C CG  . ASP A 1 68  ? 15.567  0.018   19.379 1.00 18.86 ? 56  ASP A CG  1 
ATOM   449  O OD1 . ASP A 1 68  ? 15.683  0.452   18.204 1.00 19.84 ? 56  ASP A OD1 1 
ATOM   450  O OD2 . ASP A 1 68  ? 16.052  -1.068  19.730 1.00 21.74 ? 56  ASP A OD2 1 
ATOM   451  N N   . ILE A 1 69  ? 14.103  3.434   22.280 1.00 15.86 ? 57  ILE A N   1 
ATOM   452  C CA  . ILE A 1 69  ? 13.054  4.120   23.025 1.00 16.80 ? 57  ILE A CA  1 
ATOM   453  C C   . ILE A 1 69  ? 12.761  5.509   22.524 1.00 16.38 ? 57  ILE A C   1 
ATOM   454  O O   . ILE A 1 69  ? 11.745  6.090   22.882 1.00 16.07 ? 57  ILE A O   1 
ATOM   455  C CB  . ILE A 1 69  ? 13.248  4.082   24.590 1.00 17.37 ? 57  ILE A CB  1 
ATOM   456  C CG1 . ILE A 1 69  ? 14.329  5.085   25.033 1.00 15.80 ? 57  ILE A CG1 1 
ATOM   457  C CG2 . ILE A 1 69  ? 13.494  2.593   25.023 1.00 17.22 ? 57  ILE A CG2 1 
ATOM   458  C CD1 . ILE A 1 69  ? 14.419  5.329   26.574 1.00 15.72 ? 57  ILE A CD1 1 
ATOM   459  N N   . LEU A 1 70  ? 13.662  6.041   21.691 1.00 17.30 ? 58  LEU A N   1 
ATOM   460  C CA  . LEU A 1 70  ? 13.433  7.369   21.126 1.00 17.46 ? 58  LEU A CA  1 
ATOM   461  C C   . LEU A 1 70  ? 12.826  7.321   19.727 1.00 16.57 ? 58  LEU A C   1 
ATOM   462  O O   . LEU A 1 70  ? 12.427  8.380   19.163 1.00 16.62 ? 58  LEU A O   1 
ATOM   463  C CB  . LEU A 1 70  ? 14.745  8.130   21.053 1.00 16.86 ? 58  LEU A CB  1 
ATOM   464  C CG  . LEU A 1 70  ? 15.517  8.317   22.351 1.00 18.55 ? 58  LEU A CG  1 
ATOM   465  C CD1 . LEU A 1 70  ? 16.793  9.146   22.030 1.00 21.52 ? 58  LEU A CD1 1 
ATOM   466  C CD2 . LEU A 1 70  ? 14.658  9.012   23.422 1.00 14.23 ? 58  LEU A CD2 1 
ATOM   467  N N   . ALA A 1 71  ? 12.706  6.105   19.181 1.00 16.36 ? 59  ALA A N   1 
ATOM   468  C CA  . ALA A 1 71  ? 12.456  6.005   17.744 1.00 17.05 ? 59  ALA A CA  1 
ATOM   469  C C   . ALA A 1 71  ? 11.138  6.661   17.345 1.00 17.07 ? 59  ALA A C   1 
ATOM   470  O O   . ALA A 1 71  ? 11.063  7.327   16.306 1.00 17.36 ? 59  ALA A O   1 
ATOM   471  C CB  . ALA A 1 71  ? 12.582  4.521   17.265 1.00 17.92 ? 59  ALA A CB  1 
ATOM   472  N N   . THR A 1 72  ? 10.096  6.516   18.150 1.00 18.48 ? 60  THR A N   1 
ATOM   473  C CA  . THR A 1 72  ? 8.788   7.020   17.783 1.00 18.59 ? 60  THR A CA  1 
ATOM   474  C C   . THR A 1 72  ? 8.638   8.511   18.014 1.00 17.86 ? 60  THR A C   1 
ATOM   475  O O   . THR A 1 72  ? 7.569   9.095   17.763 1.00 17.92 ? 60  THR A O   1 
ATOM   476  C CB  . THR A 1 72  ? 7.672   6.411   18.614 1.00 20.71 ? 60  THR A CB  1 
ATOM   477  O OG1 . THR A 1 72  ? 7.972   6.603   20.004 1.00 18.47 ? 60  THR A OG1 1 
ATOM   478  C CG2 . THR A 1 72  ? 7.516   4.890   18.270 1.00 19.97 ? 60  THR A CG2 1 
ATOM   479  N N   . SER A 1 73  ? 9.695   9.116   18.525 1.00 18.91 ? 61  SER A N   1 
ATOM   480  C CA  . SER A 1 73  ? 9.628   10.528  18.838 1.00 19.33 ? 61  SER A CA  1 
ATOM   481  C C   . SER A 1 73  ? 10.199  11.346  17.676 1.00 20.71 ? 61  SER A C   1 
ATOM   482  O O   . SER A 1 73  ? 9.946   12.541  17.597 1.00 20.74 ? 61  SER A O   1 
ATOM   483  C CB  . SER A 1 73  ? 10.398  10.807  20.105 1.00 18.81 ? 61  SER A CB  1 
ATOM   484  O OG  . SER A 1 73  ? 9.730   10.300  21.245 1.00 20.41 ? 61  SER A OG  1 
ATOM   485  N N   . PHE A 1 74  ? 10.959  10.671  16.841 1.00 21.14 ? 62  PHE A N   1 
ATOM   486  C CA  . PHE A 1 74  ? 11.528  11.300  15.622 1.00 21.45 ? 62  PHE A CA  1 
ATOM   487  C C   . PHE A 1 74  ? 10.529  11.513  14.478 1.00 22.88 ? 62  PHE A C   1 
ATOM   488  O O   . PHE A 1 74  ? 10.663  12.436  13.663 1.00 24.85 ? 62  PHE A O   1 
ATOM   489  C CB  . PHE A 1 74  ? 12.784  10.567  15.142 1.00 20.41 ? 62  PHE A CB  1 
ATOM   490  C CG  . PHE A 1 74  ? 13.960  10.699  16.081 1.00 18.94 ? 62  PHE A CG  1 
ATOM   491  C CD1 . PHE A 1 74  ? 14.238  9.737   17.029 1.00 19.70 ? 62  PHE A CD1 1 
ATOM   492  C CD2 . PHE A 1 74  ? 14.775  11.848  16.046 1.00 18.85 ? 62  PHE A CD2 1 
ATOM   493  C CE1 . PHE A 1 74  ? 15.302  9.842   17.904 1.00 18.81 ? 62  PHE A CE1 1 
ATOM   494  C CE2 . PHE A 1 74  ? 15.833  11.978  16.889 1.00 17.62 ? 62  PHE A CE2 1 
ATOM   495  C CZ  . PHE A 1 74  ? 16.120  10.989  17.842 1.00 22.41 ? 62  PHE A CZ  1 
HETATM 496  N N1  . NRQ A 1 75  ? 9.455   10.909  14.072 1.00 23.84 ? 63  NRQ A N1  1 
HETATM 497  C CE  . NRQ A 1 75  ? 12.355  8.905   10.475 1.00 23.89 ? 63  NRQ A CE  1 
HETATM 498  S SD  . NRQ A 1 75  ? 11.057  7.795   11.012 1.00 21.07 ? 63  NRQ A SD  1 
HETATM 499  C CG1 . NRQ A 1 75  ? 9.752   8.781   11.823 1.00 20.84 ? 63  NRQ A CG1 1 
HETATM 500  C CB1 . NRQ A 1 75  ? 9.820   8.665   13.344 1.00 23.16 ? 63  NRQ A CB1 1 
HETATM 501  C CA1 . NRQ A 1 75  ? 8.943   9.685   14.063 1.00 22.14 ? 63  NRQ A CA1 1 
HETATM 502  C C1  . NRQ A 1 75  ? 7.693   9.127   14.543 1.00 21.15 ? 63  NRQ A C1  1 
HETATM 503  N N2  . NRQ A 1 75  ? 7.414   7.827   14.573 1.00 16.33 ? 63  NRQ A N2  1 
HETATM 504  O OH  . NRQ A 1 75  ? 1.019   4.604   18.101 1.00 27.17 ? 63  NRQ A OH  1 
HETATM 505  C CD2 . NRQ A 1 75  ? 3.150   6.951   16.355 1.00 29.53 ? 63  NRQ A CD2 1 
HETATM 506  C CE2 . NRQ A 1 75  ? 2.071   6.416   17.089 1.00 17.62 ? 63  NRQ A CE2 1 
HETATM 507  C CZ  . NRQ A 1 75  ? 2.061   5.091   17.440 1.00 26.03 ? 63  NRQ A CZ  1 
HETATM 508  C CE1 . NRQ A 1 75  ? 3.126   4.261   17.091 1.00 28.55 ? 63  NRQ A CE1 1 
HETATM 509  C CD1 . NRQ A 1 75  ? 4.216   4.793   16.383 1.00 26.43 ? 63  NRQ A CD1 1 
HETATM 510  C CG2 . NRQ A 1 75  ? 4.219   6.143   15.967 1.00 25.41 ? 63  NRQ A CG2 1 
HETATM 511  C CB2 . NRQ A 1 75  ? 5.450   6.557   15.299 1.00 23.03 ? 63  NRQ A CB2 1 
HETATM 512  C CA2 . NRQ A 1 75  ? 6.159   7.713   15.142 1.00 20.05 ? 63  NRQ A CA2 1 
HETATM 513  C C2  . NRQ A 1 75  ? 5.680   9.087   15.498 1.00 17.16 ? 63  NRQ A C2  1 
HETATM 514  O O2  . NRQ A 1 75  ? 4.658   9.492   16.003 1.00 16.50 ? 63  NRQ A O2  1 
HETATM 515  N N3  . NRQ A 1 75  ? 6.699   9.896   15.078 1.00 18.04 ? 63  NRQ A N3  1 
HETATM 516  C CA3 . NRQ A 1 75  ? 6.613   11.316  15.347 1.00 19.79 ? 63  NRQ A CA3 1 
HETATM 517  C C3  . NRQ A 1 75  ? 6.515   12.237  14.196 1.00 19.72 ? 63  NRQ A C3  1 
HETATM 518  O O3  . NRQ A 1 75  ? 6.693   13.436  14.393 1.00 20.04 ? 63  NRQ A O3  1 
ATOM   519  N N   . SER A 1 76  ? 6.243   11.729  12.999 1.00 18.12 ? 66  SER A N   1 
ATOM   520  C CA  . SER A 1 76  ? 6.430   12.534  11.768 1.00 17.05 ? 66  SER A CA  1 
ATOM   521  C C   . SER A 1 76  ? 5.250   12.167  10.892 1.00 18.09 ? 66  SER A C   1 
ATOM   522  O O   . SER A 1 76  ? 5.425   11.549  9.844  1.00 18.50 ? 66  SER A O   1 
ATOM   523  C CB  . SER A 1 76  ? 7.833   12.218  11.179 1.00 17.02 ? 66  SER A CB  1 
ATOM   524  O OG  . SER A 1 76  ? 8.039   12.803  9.892  1.00 17.23 ? 66  SER A OG  1 
ATOM   525  N N   . LYS A 1 77  ? 4.058   12.592  11.351 1.00 16.89 ? 67  LYS A N   1 
ATOM   526  C CA  . LYS A 1 77  ? 2.737   12.082  10.961 1.00 17.84 ? 67  LYS A CA  1 
ATOM   527  C C   . LYS A 1 77  ? 2.334   12.668  9.603  1.00 18.14 ? 67  LYS A C   1 
ATOM   528  O O   . LYS A 1 77  ? 1.363   12.235  9.017  1.00 19.02 ? 67  LYS A O   1 
ATOM   529  C CB  . LYS A 1 77  ? 1.663   12.472  11.987 1.00 18.11 ? 67  LYS A CB  1 
ATOM   530  C CG  . LYS A 1 77  ? 1.878   12.082  13.465 1.00 17.86 ? 67  LYS A CG  1 
ATOM   531  C CD  . LYS A 1 77  ? 2.059   10.561  13.664 1.00 21.17 ? 67  LYS A CD  1 
ATOM   532  C CE  . LYS A 1 77  ? 0.754   9.836   13.628 1.00 23.54 ? 67  LYS A CE  1 
ATOM   533  N NZ  . LYS A 1 77  ? 0.925   8.426   14.237 1.00 29.54 ? 67  LYS A NZ  1 
ATOM   534  N N   . THR A 1 78  ? 3.073   13.665  9.105  1.00 17.88 ? 68  THR A N   1 
ATOM   535  C CA  . THR A 1 78  ? 2.768   14.179  7.750  1.00 18.75 ? 68  THR A CA  1 
ATOM   536  C C   . THR A 1 78  ? 3.088   13.079  6.687  1.00 19.57 ? 68  THR A C   1 
ATOM   537  O O   . THR A 1 78  ? 2.563   13.109  5.567  1.00 19.53 ? 68  THR A O   1 
ATOM   538  C CB  . THR A 1 78  ? 3.532   15.498  7.461  1.00 19.94 ? 68  THR A CB  1 
ATOM   539  O OG1 . THR A 1 78  ? 3.109   16.455  8.447  1.00 19.16 ? 68  THR A OG1 1 
ATOM   540  C CG2 . THR A 1 78  ? 3.204   16.009  6.038  1.00 20.46 ? 68  THR A CG2 1 
ATOM   541  N N   . PHE A 1 79  ? 3.965   12.131  7.025  1.00 18.69 ? 69  PHE A N   1 
ATOM   542  C CA  . PHE A 1 79  ? 4.388   11.157  6.023  1.00 18.35 ? 69  PHE A CA  1 
ATOM   543  C C   . PHE A 1 79  ? 3.658   9.829   6.239  1.00 18.75 ? 69  PHE A C   1 
ATOM   544  O O   . PHE A 1 79  ? 4.307   8.799   6.465  1.00 19.20 ? 69  PHE A O   1 
ATOM   545  C CB  . PHE A 1 79  ? 5.870   10.921  6.047  1.00 17.96 ? 69  PHE A CB  1 
ATOM   546  C CG  . PHE A 1 79  ? 6.692   12.172  5.784  1.00 19.02 ? 69  PHE A CG  1 
ATOM   547  C CD1 . PHE A 1 79  ? 6.994   13.051  6.824  1.00 20.93 ? 69  PHE A CD1 1 
ATOM   548  C CD2 . PHE A 1 79  ? 7.161   12.452  4.491  1.00 19.56 ? 69  PHE A CD2 1 
ATOM   549  C CE1 . PHE A 1 79  ? 7.784   14.190  6.575  1.00 22.43 ? 69  PHE A CE1 1 
ATOM   550  C CE2 . PHE A 1 79  ? 7.931   13.597  4.227  1.00 19.46 ? 69  PHE A CE2 1 
ATOM   551  C CZ  . PHE A 1 79  ? 8.268   14.455  5.282  1.00 19.10 ? 69  PHE A CZ  1 
ATOM   552  N N   . ILE A 1 80  ? 2.344   9.910   6.252  1.00 19.01 ? 70  ILE A N   1 
ATOM   553  C CA  . ILE A 1 80  ? 1.490   8.699   6.231  1.00 19.66 ? 70  ILE A CA  1 
ATOM   554  C C   . ILE A 1 80  ? 0.655   8.761   4.956  1.00 21.20 ? 70  ILE A C   1 
ATOM   555  O O   . ILE A 1 80  ? -0.038  9.764   4.676  1.00 20.82 ? 70  ILE A O   1 
ATOM   556  C CB  . ILE A 1 80  ? 0.553   8.630   7.420  1.00 19.92 ? 70  ILE A CB  1 
ATOM   557  C CG1 . ILE A 1 80  ? 1.314   8.698   8.745  1.00 21.18 ? 70  ILE A CG1 1 
ATOM   558  C CG2 . ILE A 1 80  ? -0.470  7.400   7.325  1.00 19.67 ? 70  ILE A CG2 1 
ATOM   559  C CD1 . ILE A 1 80  ? 0.327   8.879   9.967  1.00 20.49 ? 70  ILE A CD1 1 
ATOM   560  N N   . ASN A 1 81  ? 0.696   7.656   4.201  1.00 20.74 ? 71  ASN A N   1 
ATOM   561  C CA  . ASN A 1 81  ? -0.152  7.468   3.040  1.00 21.23 ? 71  ASN A CA  1 
ATOM   562  C C   . ASN A 1 81  ? -1.618  7.236   3.431  1.00 23.04 ? 71  ASN A C   1 
ATOM   563  O O   . ASN A 1 81  ? -2.030  6.130   3.865  1.00 21.36 ? 71  ASN A O   1 
ATOM   564  C CB  . ASN A 1 81  ? 0.444   6.327   2.208  1.00 22.31 ? 71  ASN A CB  1 
ATOM   565  C CG  . ASN A 1 81  ? -0.308  6.069   0.908  1.00 21.00 ? 71  ASN A CG  1 
ATOM   566  O OD1 . ASN A 1 81  ? -1.365  6.664   0.635  1.00 18.79 ? 71  ASN A OD1 1 
ATOM   567  N ND2 . ASN A 1 81  ? 0.262   5.186   0.084  1.00 21.69 ? 71  ASN A ND2 1 
ATOM   568  N N   . HIS A 1 82  ? -2.424  8.287   3.338  1.00 22.48 ? 72  HIS A N   1 
ATOM   569  C CA  . HIS A 1 82  ? -3.833  8.144   3.687  1.00 24.49 ? 72  HIS A CA  1 
ATOM   570  C C   . HIS A 1 82  ? -4.645  7.611   2.492  1.00 27.00 ? 72  HIS A C   1 
ATOM   571  O O   . HIS A 1 82  ? -4.913  8.336   1.542  1.00 28.51 ? 72  HIS A O   1 
ATOM   572  C CB  . HIS A 1 82  ? -4.397  9.463   4.208  1.00 24.13 ? 72  HIS A CB  1 
ATOM   573  C CG  . HIS A 1 82  ? -4.152  9.693   5.672  1.00 22.85 ? 72  HIS A CG  1 
ATOM   574  N ND1 . HIS A 1 82  ? -2.911  10.003  6.185  1.00 21.12 ? 72  HIS A ND1 1 
ATOM   575  C CD2 . HIS A 1 82  ? -4.994  9.656   6.731  1.00 23.30 ? 72  HIS A CD2 1 
ATOM   576  C CE1 . HIS A 1 82  ? -2.996  10.139  7.497  1.00 21.29 ? 72  HIS A CE1 1 
ATOM   577  N NE2 . HIS A 1 82  ? -4.250  9.932   7.855  1.00 25.94 ? 72  HIS A NE2 1 
ATOM   578  N N   . THR A 1 83  ? -5.038  6.333   2.524  1.00 28.21 ? 73  THR A N   1 
ATOM   579  C CA  . THR A 1 83  ? -5.784  5.737   1.401  1.00 29.69 ? 73  THR A CA  1 
ATOM   580  C C   . THR A 1 83  ? -7.290  5.864   1.620  1.00 30.31 ? 73  THR A C   1 
ATOM   581  O O   . THR A 1 83  ? -7.732  6.366   2.656  1.00 29.46 ? 73  THR A O   1 
ATOM   582  C CB  . THR A 1 83  ? -5.461  4.237   1.249  1.00 29.78 ? 73  THR A CB  1 
ATOM   583  O OG1 . THR A 1 83  ? -6.021  3.545   2.362  1.00 29.35 ? 73  THR A OG1 1 
ATOM   584  C CG2 . THR A 1 83  ? -3.969  4.000   1.233  1.00 29.36 ? 73  THR A CG2 1 
ATOM   585  N N   . GLN A 1 84  ? -8.072  5.368   0.646  1.00 31.97 ? 74  GLN A N   1 
ATOM   586  C CA  . GLN A 1 84  ? -9.536  5.303   0.725  1.00 33.04 ? 74  GLN A CA  1 
ATOM   587  C C   . GLN A 1 84  ? -10.180 6.678   1.033  1.00 32.69 ? 74  GLN A C   1 
ATOM   588  O O   . GLN A 1 84  ? -11.270 6.755   1.619  1.00 33.99 ? 74  GLN A O   1 
ATOM   589  C CB  . GLN A 1 84  ? -9.977  4.270   1.772  1.00 33.21 ? 74  GLN A CB  1 
ATOM   590  C CG  . GLN A 1 84  ? -9.408  2.839   1.561  1.00 34.44 ? 74  GLN A CG  1 
ATOM   591  C CD  . GLN A 1 84  ? -9.956  1.841   2.581  1.00 35.99 ? 74  GLN A CD  1 
ATOM   592  O OE1 . GLN A 1 84  ? -9.215  1.366   3.445  1.00 38.48 ? 74  GLN A OE1 1 
ATOM   593  N NE2 . GLN A 1 84  ? -11.274 1.528   2.491  1.00 36.69 ? 74  GLN A NE2 1 
ATOM   594  N N   . GLY A 1 85  ? -9.520  7.754   0.623  1.00 32.54 ? 75  GLY A N   1 
ATOM   595  C CA  . GLY A 1 85  ? -10.014 9.111   0.920  1.00 31.82 ? 75  GLY A CA  1 
ATOM   596  C C   . GLY A 1 85  ? -10.173 9.462   2.387  1.00 30.85 ? 75  GLY A C   1 
ATOM   597  O O   . GLY A 1 85  ? -11.037 10.309  2.741  1.00 32.25 ? 75  GLY A O   1 
ATOM   598  N N   . ILE A 1 86  ? -9.384  8.827   3.258  1.00 28.27 ? 76  ILE A N   1 
ATOM   599  C CA  . ILE A 1 86  ? -9.460  9.131   4.677  1.00 27.70 ? 76  ILE A CA  1 
ATOM   600  C C   . ILE A 1 86  ? -9.013  10.576  4.818  1.00 27.21 ? 76  ILE A C   1 
ATOM   601  O O   . ILE A 1 86  ? -7.946  10.909  4.340  1.00 27.12 ? 76  ILE A O   1 
ATOM   602  C CB  . ILE A 1 86  ? -8.567  8.242   5.556  1.00 26.70 ? 76  ILE A CB  1 
ATOM   603  C CG1 . ILE A 1 86  ? -9.087  6.788   5.514  1.00 26.54 ? 76  ILE A CG1 1 
ATOM   604  C CG2 . ILE A 1 86  ? -8.589  8.739   7.033  1.00 24.55 ? 76  ILE A CG2 1 
ATOM   605  C CD1 . ILE A 1 86  ? -8.051  5.710   5.793  1.00 26.19 ? 76  ILE A CD1 1 
ATOM   606  N N   . PRO A 1 87  ? -9.852  11.422  5.427  1.00 28.38 ? 77  PRO A N   1 
ATOM   607  C CA  . PRO A 1 87  ? -9.414  12.792  5.673  1.00 28.10 ? 77  PRO A CA  1 
ATOM   608  C C   . PRO A 1 87  ? -8.136  12.788  6.494  1.00 28.10 ? 77  PRO A C   1 
ATOM   609  O O   . PRO A 1 87  ? -8.032  12.077  7.495  1.00 28.89 ? 77  PRO A O   1 
ATOM   610  C CB  . PRO A 1 87  ? -10.549 13.378  6.485  1.00 28.70 ? 77  PRO A CB  1 
ATOM   611  C CG  . PRO A 1 87  ? -11.771 12.556  6.044  1.00 29.86 ? 77  PRO A CG  1 
ATOM   612  C CD  . PRO A 1 87  ? -11.234 11.195  5.888  1.00 28.40 ? 77  PRO A CD  1 
ATOM   613  N N   . ASP A 1 88  ? -7.185  13.598  6.050  1.00 26.23 ? 78  ASP A N   1 
ATOM   614  C CA  . ASP A 1 88  ? -5.828  13.593  6.563  1.00 26.29 ? 78  ASP A CA  1 
ATOM   615  C C   . ASP A 1 88  ? -5.702  14.784  7.522  1.00 25.45 ? 78  ASP A C   1 
ATOM   616  O O   . ASP A 1 88  ? -5.560  15.916  7.077  1.00 27.09 ? 78  ASP A O   1 
ATOM   617  C CB  . ASP A 1 88  ? -4.892  13.722  5.388  1.00 23.97 ? 78  ASP A CB  1 
ATOM   618  C CG  . ASP A 1 88  ? -3.468  13.396  5.741  1.00 25.29 ? 78  ASP A CG  1 
ATOM   619  O OD1 . ASP A 1 88  ? -3.044  13.562  6.912  1.00 25.01 ? 78  ASP A OD1 1 
ATOM   620  O OD2 . ASP A 1 88  ? -2.754  12.993  4.828  1.00 23.28 ? 78  ASP A OD2 1 
ATOM   621  N N   . PHE A 1 89  ? -5.797  14.530  8.829  1.00 24.75 ? 79  PHE A N   1 
ATOM   622  C CA  . PHE A 1 89  ? -5.746  15.593  9.871  1.00 23.55 ? 79  PHE A CA  1 
ATOM   623  C C   . PHE A 1 89  ? -4.412  16.322  9.841  1.00 23.21 ? 79  PHE A C   1 
ATOM   624  O O   . PHE A 1 89  ? -4.299  17.538  10.110 1.00 23.41 ? 79  PHE A O   1 
ATOM   625  C CB  . PHE A 1 89  ? -5.968  14.877  11.194 1.00 23.77 ? 79  PHE A CB  1 
ATOM   626  C CG  . PHE A 1 89  ? -5.981  15.739  12.432 1.00 23.20 ? 79  PHE A CG  1 
ATOM   627  C CD1 . PHE A 1 89  ? -7.161  16.327  12.878 1.00 23.81 ? 79  PHE A CD1 1 
ATOM   628  C CD2 . PHE A 1 89  ? -4.833  15.888  13.196 1.00 22.52 ? 79  PHE A CD2 1 
ATOM   629  C CE1 . PHE A 1 89  ? -7.196  17.073  14.066 1.00 25.21 ? 79  PHE A CE1 1 
ATOM   630  C CE2 . PHE A 1 89  ? -4.857  16.620  14.388 1.00 23.82 ? 79  PHE A CE2 1 
ATOM   631  C CZ  . PHE A 1 89  ? -6.028  17.215  14.829 1.00 24.52 ? 79  PHE A CZ  1 
ATOM   632  N N   . PHE A 1 90  ? -3.370  15.573  9.542  1.00 21.66 ? 80  PHE A N   1 
ATOM   633  C CA  . PHE A 1 90  ? -2.006  16.104  9.575  1.00 21.86 ? 80  PHE A CA  1 
ATOM   634  C C   . PHE A 1 90  ? -1.691  16.981  8.383  1.00 22.41 ? 80  PHE A C   1 
ATOM   635  O O   . PHE A 1 90  ? -1.273  18.145  8.521  1.00 22.57 ? 80  PHE A O   1 
ATOM   636  C CB  . PHE A 1 90  ? -1.057  14.929  9.728  1.00 21.12 ? 80  PHE A CB  1 
ATOM   637  C CG  . PHE A 1 90  ? -1.432  14.065  10.896 1.00 22.92 ? 80  PHE A CG  1 
ATOM   638  C CD1 . PHE A 1 90  ? -2.049  12.829  10.692 1.00 20.37 ? 80  PHE A CD1 1 
ATOM   639  C CD2 . PHE A 1 90  ? -1.279  14.545  12.207 1.00 22.61 ? 80  PHE A CD2 1 
ATOM   640  C CE1 . PHE A 1 90  ? -2.418  12.047  11.772 1.00 22.74 ? 80  PHE A CE1 1 
ATOM   641  C CE2 . PHE A 1 90  ? -1.642  13.785  13.272 1.00 23.44 ? 80  PHE A CE2 1 
ATOM   642  C CZ  . PHE A 1 90  ? -2.222  12.508  13.054 1.00 23.61 ? 80  PHE A CZ  1 
ATOM   643  N N   . LYS A 1 91  ? -1.933  16.460  7.193  1.00 23.02 ? 81  LYS A N   1 
ATOM   644  C CA  . LYS A 1 91  ? -1.717  17.264  5.986  1.00 23.52 ? 81  LYS A CA  1 
ATOM   645  C C   . LYS A 1 91  ? -2.654  18.478  5.923  1.00 24.57 ? 81  LYS A C   1 
ATOM   646  O O   . LYS A 1 91  ? -2.227  19.595  5.538  1.00 25.85 ? 81  LYS A O   1 
ATOM   647  C CB  . LYS A 1 91  ? -1.813  16.367  4.731  1.00 22.44 ? 81  LYS A CB  1 
ATOM   648  C CG  . LYS A 1 91  ? -0.526  15.491  4.552  1.00 24.57 ? 81  LYS A CG  1 
ATOM   649  C CD  . LYS A 1 91  ? -0.463  14.822  3.148  1.00 21.30 ? 81  LYS A CD  1 
ATOM   650  C CE  . LYS A 1 91  ? 0.546   13.727  3.135  1.00 19.29 ? 81  LYS A CE  1 
ATOM   651  N NZ  . LYS A 1 91  ? -0.032  12.530  3.845  1.00 15.95 ? 81  LYS A NZ  1 
ATOM   652  N N   . GLN A 1 92  ? -3.902  18.303  6.347  1.00 25.06 ? 82  GLN A N   1 
ATOM   653  C CA  . GLN A 1 92  ? -4.858  19.406  6.397  1.00 25.55 ? 82  GLN A CA  1 
ATOM   654  C C   . GLN A 1 92  ? -4.470  20.544  7.361  1.00 26.34 ? 82  GLN A C   1 
ATOM   655  O O   . GLN A 1 92  ? -5.032  21.663  7.256  1.00 25.90 ? 82  GLN A O   1 
ATOM   656  C CB  . GLN A 1 92  ? -6.228  18.923  6.840  1.00 25.51 ? 82  GLN A CB  1 
ATOM   657  C CG  . GLN A 1 92  ? -7.110  18.310  5.793  1.00 27.50 ? 82  GLN A CG  1 
ATOM   658  C CD  . GLN A 1 92  ? -8.488  18.027  6.369  1.00 31.31 ? 82  GLN A CD  1 
ATOM   659  O OE1 . GLN A 1 92  ? -9.351  18.914  6.429  1.00 33.35 ? 82  GLN A OE1 1 
ATOM   660  N NE2 . GLN A 1 92  ? -8.694  16.804  6.834  1.00 33.33 ? 82  GLN A NE2 1 
ATOM   661  N N   . SER A 1 93  ? -3.573  20.254  8.310  1.00 25.28 ? 83  SER A N   1 
ATOM   662  C CA  . SER A 1 93  ? -3.217  21.205  9.364  1.00 25.70 ? 83  SER A CA  1 
ATOM   663  C C   . SER A 1 93  ? -2.323  22.371  8.910  1.00 25.55 ? 83  SER A C   1 
ATOM   664  O O   . SER A 1 93  ? -2.171  23.375  9.637  1.00 26.13 ? 83  SER A O   1 
ATOM   665  C CB  . SER A 1 93  ? -2.576  20.465  10.544 1.00 24.81 ? 83  SER A CB  1 
ATOM   666  O OG  . SER A 1 93  ? -3.606  19.887  11.317 1.00 24.75 ? 83  SER A OG  1 
ATOM   667  N N   . PHE A 1 94  ? -1.694  22.224  7.758  1.00 25.15 ? 84  PHE A N   1 
ATOM   668  C CA  . PHE A 1 94  ? -0.770  23.245  7.270  1.00 25.35 ? 84  PHE A CA  1 
ATOM   669  C C   . PHE A 1 94  ? -1.552  24.387  6.588  1.00 25.89 ? 84  PHE A C   1 
ATOM   670  O O   . PHE A 1 94  ? -2.635  24.148  6.061  1.00 25.84 ? 84  PHE A O   1 
ATOM   671  C CB  . PHE A 1 94  ? 0.324   22.616  6.408  1.00 24.94 ? 84  PHE A CB  1 
ATOM   672  C CG  . PHE A 1 94  ? 1.158   21.629  7.172  1.00 24.85 ? 84  PHE A CG  1 
ATOM   673  C CD1 . PHE A 1 94  ? 0.859   20.280  7.119  1.00 25.07 ? 84  PHE A CD1 1 
ATOM   674  C CD2 . PHE A 1 94  ? 2.181   22.058  8.024  1.00 25.48 ? 84  PHE A CD2 1 
ATOM   675  C CE1 . PHE A 1 94  ? 1.601   19.357  7.880  1.00 26.28 ? 84  PHE A CE1 1 
ATOM   676  C CE2 . PHE A 1 94  ? 2.922   21.168  8.792  1.00 23.46 ? 84  PHE A CE2 1 
ATOM   677  C CZ  . PHE A 1 94  ? 2.640   19.790  8.707  1.00 25.90 ? 84  PHE A CZ  1 
ATOM   678  N N   . PRO A 1 95  ? -1.019  25.634  6.639  1.00 26.79 ? 85  PRO A N   1 
ATOM   679  C CA  . PRO A 1 95  ? 0.307   26.017  7.099  1.00 26.19 ? 85  PRO A CA  1 
ATOM   680  C C   . PRO A 1 95  ? 0.517   26.044  8.628  1.00 26.17 ? 85  PRO A C   1 
ATOM   681  O O   . PRO A 1 95  ? 1.688   26.091  9.053  1.00 25.33 ? 85  PRO A O   1 
ATOM   682  C CB  . PRO A 1 95  ? 0.439   27.460  6.556  1.00 26.49 ? 85  PRO A CB  1 
ATOM   683  C CG  . PRO A 1 95  ? -0.947  27.962  6.645  1.00 26.36 ? 85  PRO A CG  1 
ATOM   684  C CD  . PRO A 1 95  ? -1.795  26.821  6.212  1.00 26.73 ? 85  PRO A CD  1 
ATOM   685  N N   . GLU A 1 96  ? -0.563  26.046  9.431  1.00 25.84 ? 86  GLU A N   1 
ATOM   686  C CA  . GLU A 1 96  ? -0.388  26.231  10.878 1.00 26.32 ? 86  GLU A CA  1 
ATOM   687  C C   . GLU A 1 96  ? 0.417   25.106  11.524 1.00 26.57 ? 86  GLU A C   1 
ATOM   688  O O   . GLU A 1 96  ? 1.220   25.362  12.410 1.00 26.81 ? 86  GLU A O   1 
ATOM   689  C CB  . GLU A 1 96  ? -1.718  26.435  11.590 1.00 27.63 ? 86  GLU A CB  1 
ATOM   690  C CG  . GLU A 1 96  ? -2.469  27.766  11.266 1.00 29.58 ? 86  GLU A CG  1 
ATOM   691  C CD  . GLU A 1 96  ? -3.387  27.670  10.065 1.00 35.82 ? 86  GLU A CD  1 
ATOM   692  O OE1 . GLU A 1 96  ? -3.139  26.821  9.169  1.00 35.23 ? 86  GLU A OE1 1 
ATOM   693  O OE2 . GLU A 1 96  ? -4.374  28.461  10.009 1.00 39.43 ? 86  GLU A OE2 1 
ATOM   694  N N   . GLY A 1 97  ? 0.188   23.864  11.073 1.00 25.75 ? 87  GLY A N   1 
ATOM   695  C CA  . GLY A 1 97  ? 0.862   22.674  11.650 1.00 23.44 ? 87  GLY A CA  1 
ATOM   696  C C   . GLY A 1 97  ? 0.033   22.049  12.751 1.00 22.28 ? 87  GLY A C   1 
ATOM   697  O O   . GLY A 1 97  ? -1.183  22.289  12.873 1.00 22.01 ? 87  GLY A O   1 
ATOM   698  N N   . PHE A 1 98  ? 0.688   21.216  13.572 1.00 21.87 ? 88  PHE A N   1 
ATOM   699  C CA  . PHE A 1 98  ? -0.041  20.471  14.604 1.00 20.46 ? 88  PHE A CA  1 
ATOM   700  C C   . PHE A 1 98  ? 0.915   20.132  15.758 1.00 19.10 ? 88  PHE A C   1 
ATOM   701  O O   . PHE A 1 98  ? 2.122   20.344  15.655 1.00 18.57 ? 88  PHE A O   1 
ATOM   702  C CB  . PHE A 1 98  ? -0.713  19.190  13.995 1.00 20.90 ? 88  PHE A CB  1 
ATOM   703  C CG  . PHE A 1 98  ? 0.256   18.224  13.350 1.00 22.50 ? 88  PHE A CG  1 
ATOM   704  C CD1 . PHE A 1 98  ? 0.463   18.254  11.977 1.00 21.74 ? 88  PHE A CD1 1 
ATOM   705  C CD2 . PHE A 1 98  ? 0.952   17.261  14.122 1.00 22.46 ? 88  PHE A CD2 1 
ATOM   706  C CE1 . PHE A 1 98  ? 1.346   17.391  11.365 1.00 22.13 ? 88  PHE A CE1 1 
ATOM   707  C CE2 . PHE A 1 98  ? 1.871   16.414  13.535 1.00 20.59 ? 88  PHE A CE2 1 
ATOM   708  C CZ  . PHE A 1 98  ? 2.076   16.453  12.141 1.00 20.34 ? 88  PHE A CZ  1 
ATOM   709  N N   . THR A 1 99  ? 0.392   19.552  16.834 1.00 19.58 ? 89  THR A N   1 
ATOM   710  C CA  . THR A 1 99  ? 1.249   19.088  17.928 1.00 19.90 ? 89  THR A CA  1 
ATOM   711  C C   . THR A 1 99  ? 0.857   17.651  18.244 1.00 19.98 ? 89  THR A C   1 
ATOM   712  O O   . THR A 1 99  ? -0.244  17.205  17.902 1.00 19.77 ? 89  THR A O   1 
ATOM   713  C CB  . THR A 1 99  ? 1.092   19.940  19.255 1.00 20.07 ? 89  THR A CB  1 
ATOM   714  O OG1 . THR A 1 99  ? -0.265  19.901  19.716 1.00 23.36 ? 89  THR A OG1 1 
ATOM   715  C CG2 . THR A 1 99  ? 1.509   21.433  19.031 1.00 19.89 ? 89  THR A CG2 1 
ATOM   716  N N   . TRP A 1 100 ? 1.770   16.935  18.882 1.00 20.13 ? 90  TRP A N   1 
ATOM   717  C CA  . TRP A 1 100 ? 1.373   15.657  19.496 1.00 18.66 ? 90  TRP A CA  1 
ATOM   718  C C   . TRP A 1 100 ? 1.961   15.498  20.889 1.00 18.34 ? 90  TRP A C   1 
ATOM   719  O O   . TRP A 1 100 ? 3.024   16.005  21.182 1.00 17.93 ? 90  TRP A O   1 
ATOM   720  C CB  . TRP A 1 100 ? 1.690   14.439  18.560 1.00 17.51 ? 90  TRP A CB  1 
ATOM   721  C CG  . TRP A 1 100 ? 3.127   14.166  18.179 1.00 17.31 ? 90  TRP A CG  1 
ATOM   722  C CD1 . TRP A 1 100 ? 3.710   14.449  16.960 1.00 17.66 ? 90  TRP A CD1 1 
ATOM   723  C CD2 . TRP A 1 100 ? 4.149   13.497  18.958 1.00 16.10 ? 90  TRP A CD2 1 
ATOM   724  N NE1 . TRP A 1 100 ? 5.004   14.017  16.957 1.00 17.09 ? 90  TRP A NE1 1 
ATOM   725  C CE2 . TRP A 1 100 ? 5.296   13.419  18.156 1.00 18.14 ? 90  TRP A CE2 1 
ATOM   726  C CE3 . TRP A 1 100 ? 4.202   12.976  20.277 1.00 16.73 ? 90  TRP A CE3 1 
ATOM   727  C CZ2 . TRP A 1 100 ? 6.503   12.862  18.608 1.00 15.15 ? 90  TRP A CZ2 1 
ATOM   728  C CZ3 . TRP A 1 100 ? 5.372   12.380  20.711 1.00 15.67 ? 90  TRP A CZ3 1 
ATOM   729  C CH2 . TRP A 1 100 ? 6.527   12.356  19.889 1.00 18.82 ? 90  TRP A CH2 1 
ATOM   730  N N   . GLU A 1 101 ? 1.226   14.819  21.762 1.00 18.29 ? 91  GLU A N   1 
ATOM   731  C CA  . GLU A 1 101 ? 1.688   14.524  23.105 1.00 19.95 ? 91  GLU A CA  1 
ATOM   732  C C   . GLU A 1 101 ? 1.409   13.043  23.350 1.00 19.75 ? 91  GLU A C   1 
ATOM   733  O O   . GLU A 1 101 ? 0.306   12.585  23.011 1.00 20.03 ? 91  GLU A O   1 
ATOM   734  C CB  . GLU A 1 101 ? 0.855   15.323  24.107 1.00 20.22 ? 91  GLU A CB  1 
ATOM   735  C CG  . GLU A 1 101 ? 0.960   16.906  23.986 1.00 25.50 ? 91  GLU A CG  1 
ATOM   736  C CD  . GLU A 1 101 ? 0.261   17.553  22.757 1.00 34.70 ? 91  GLU A CD  1 
ATOM   737  O OE1 . GLU A 1 101 ? -0.789  17.074  22.230 1.00 37.99 ? 91  GLU A OE1 1 
ATOM   738  O OE2 . GLU A 1 101 ? 0.796   18.594  22.307 1.00 40.20 ? 91  GLU A OE2 1 
ATOM   739  N N   . ARG A 1 102 ? 2.372   12.356  23.952 1.00 19.16 ? 92  ARG A N   1 
ATOM   740  C CA  . ARG A 1 102 ? 2.315   10.897  24.112 1.00 17.46 ? 92  ARG A CA  1 
ATOM   741  C C   . ARG A 1 102 ? 2.829   10.401  25.456 1.00 18.30 ? 92  ARG A C   1 
ATOM   742  O O   . ARG A 1 102 ? 3.802   10.955  25.995 1.00 18.84 ? 92  ARG A O   1 
ATOM   743  C CB  . ARG A 1 102 ? 3.072   10.244  22.954 1.00 17.98 ? 92  ARG A CB  1 
ATOM   744  C CG  . ARG A 1 102 ? 3.058   8.651   22.928 1.00 17.46 ? 92  ARG A CG  1 
ATOM   745  C CD  . ARG A 1 102 ? 3.911   8.144   21.784 1.00 16.64 ? 92  ARG A CD  1 
ATOM   746  N NE  . ARG A 1 102 ? 3.301   8.558   20.526 1.00 16.97 ? 92  ARG A NE  1 
ATOM   747  C CZ  . ARG A 1 102 ? 3.963   8.937   19.431 1.00 16.31 ? 92  ARG A CZ  1 
ATOM   748  N NH1 . ARG A 1 102 ? 5.290   8.983   19.418 1.00 18.75 ? 92  ARG A NH1 1 
ATOM   749  N NH2 . ARG A 1 102 ? 3.280   9.242   18.348 1.00 18.87 ? 92  ARG A NH2 1 
ATOM   750  N N   A VAL A 1 103 ? 2.165   9.388   26.024 0.50 17.06 ? 93  VAL A N   1 
ATOM   751  N N   B VAL A 1 103 ? 2.197   9.340   25.970 0.50 17.13 ? 93  VAL A N   1 
ATOM   752  C CA  A VAL A 1 103 ? 2.803   8.570   27.062 0.50 17.05 ? 93  VAL A CA  1 
ATOM   753  C CA  B VAL A 1 103 ? 2.715   8.576   27.110 0.50 17.36 ? 93  VAL A CA  1 
ATOM   754  C C   A VAL A 1 103 ? 2.976   7.178   26.515 0.50 16.73 ? 93  VAL A C   1 
ATOM   755  C C   B VAL A 1 103 ? 2.935   7.129   26.659 0.50 16.83 ? 93  VAL A C   1 
ATOM   756  O O   A VAL A 1 103 ? 2.062   6.637   25.915 0.50 16.71 ? 93  VAL A O   1 
ATOM   757  O O   B VAL A 1 103 ? 1.995   6.500   26.237 0.50 17.35 ? 93  VAL A O   1 
ATOM   758  C CB  A VAL A 1 103 ? 2.036   8.463   28.409 0.50 17.03 ? 93  VAL A CB  1 
ATOM   759  C CB  B VAL A 1 103 ? 1.763   8.660   28.367 0.50 17.09 ? 93  VAL A CB  1 
ATOM   760  C CG1 A VAL A 1 103 ? 2.970   7.809   29.476 0.50 15.64 ? 93  VAL A CG1 1 
ATOM   761  C CG1 B VAL A 1 103 ? 0.305   8.478   27.989 0.50 16.70 ? 93  VAL A CG1 1 
ATOM   762  C CG2 A VAL A 1 103 ? 1.575   9.829   28.890 0.50 17.22 ? 93  VAL A CG2 1 
ATOM   763  C CG2 B VAL A 1 103 ? 2.203   7.686   29.483 0.50 18.25 ? 93  VAL A CG2 1 
ATOM   764  N N   . THR A 1 104 ? 4.180   6.654   26.677 1.00 16.58 ? 94  THR A N   1 
ATOM   765  C CA  . THR A 1 104 ? 4.506   5.282   26.326 1.00 16.35 ? 94  THR A CA  1 
ATOM   766  C C   . THR A 1 104 ? 4.758   4.543   27.646 1.00 16.58 ? 94  THR A C   1 
ATOM   767  O O   . THR A 1 104 ? 5.639   4.921   28.426 1.00 16.74 ? 94  THR A O   1 
ATOM   768  C CB  . THR A 1 104 ? 5.763   5.199   25.412 1.00 16.68 ? 94  THR A CB  1 
ATOM   769  O OG1 . THR A 1 104 ? 5.466   5.882   24.204 1.00 15.04 ? 94  THR A OG1 1 
ATOM   770  C CG2 . THR A 1 104 ? 6.064   3.744   25.021 1.00 15.31 ? 94  THR A CG2 1 
ATOM   771  N N   . THR A 1 105 ? 3.977   3.477   27.903 1.00 16.92 ? 95  THR A N   1 
ATOM   772  C CA  . THR A 1 105 ? 4.092   2.719   29.141 1.00 16.86 ? 95  THR A CA  1 
ATOM   773  C C   . THR A 1 105 ? 4.709   1.322   28.825 1.00 17.26 ? 95  THR A C   1 
ATOM   774  O O   . THR A 1 105 ? 4.040   0.485   28.203 1.00 15.37 ? 95  THR A O   1 
ATOM   775  C CB  . THR A 1 105 ? 2.677   2.644   29.792 1.00 19.43 ? 95  THR A CB  1 
ATOM   776  O OG1 . THR A 1 105 ? 2.306   3.953   30.253 1.00 19.99 ? 95  THR A OG1 1 
ATOM   777  C CG2 . THR A 1 105 ? 2.586   1.681   31.009 1.00 21.38 ? 95  THR A CG2 1 
ATOM   778  N N   . TYR A 1 106 ? 5.958   1.080   29.231 1.00 14.51 ? 96  TYR A N   1 
ATOM   779  C CA  . TYR A 1 106 ? 6.605   -0.233  29.042 1.00 15.40 ? 96  TYR A CA  1 
ATOM   780  C C   . TYR A 1 106 ? 6.058   -1.234  30.075 1.00 15.52 ? 96  TYR A C   1 
ATOM   781  O O   . TYR A 1 106 ? 5.742   -0.850  31.225 1.00 15.73 ? 96  TYR A O   1 
ATOM   782  C CB  . TYR A 1 106 ? 8.125   -0.079  29.125 1.00 16.15 ? 96  TYR A CB  1 
ATOM   783  C CG  . TYR A 1 106 ? 8.651   0.584   27.881 1.00 16.06 ? 96  TYR A CG  1 
ATOM   784  C CD1 . TYR A 1 106 ? 8.492   1.988   27.663 1.00 15.85 ? 96  TYR A CD1 1 
ATOM   785  C CD2 . TYR A 1 106 ? 9.304   -0.176  26.908 1.00 19.12 ? 96  TYR A CD2 1 
ATOM   786  C CE1 . TYR A 1 106 ? 8.971   2.579   26.467 1.00 16.00 ? 96  TYR A CE1 1 
ATOM   787  C CE2 . TYR A 1 106 ? 9.803   0.414   25.716 1.00 19.81 ? 96  TYR A CE2 1 
ATOM   788  C CZ  . TYR A 1 106 ? 9.625   1.798   25.507 1.00 19.61 ? 96  TYR A CZ  1 
ATOM   789  O OH  . TYR A 1 106 ? 10.104  2.371   24.312 1.00 16.86 ? 96  TYR A OH  1 
ATOM   790  N N   . GLU A 1 107 ? 5.955   -2.506  29.697 1.00 16.20 ? 97  GLU A N   1 
ATOM   791  C CA  . GLU A 1 107 ? 5.386   -3.485  30.651 1.00 17.27 ? 97  GLU A CA  1 
ATOM   792  C C   . GLU A 1 107 ? 6.314   -3.794  31.845 1.00 17.01 ? 97  GLU A C   1 
ATOM   793  O O   . GLU A 1 107 ? 5.893   -4.342  32.899 1.00 17.99 ? 97  GLU A O   1 
ATOM   794  C CB  . GLU A 1 107 ? 4.944   -4.727  29.876 1.00 15.86 ? 97  GLU A CB  1 
ATOM   795  C CG  . GLU A 1 107 ? 3.668   -4.422  29.108 1.00 17.57 ? 97  GLU A CG  1 
ATOM   796  C CD  . GLU A 1 107 ? 3.111   -5.668  28.387 1.00 19.23 ? 97  GLU A CD  1 
ATOM   797  O OE1 . GLU A 1 107 ? 3.773   -6.734  28.474 1.00 18.49 ? 97  GLU A OE1 1 
ATOM   798  O OE2 . GLU A 1 107 ? 2.070   -5.538  27.700 1.00 16.32 ? 97  GLU A OE2 1 
ATOM   799  N N   . ASP A 1 108 ? 7.563   -3.367  31.741 1.00 18.07 ? 98  ASP A N   1 
ATOM   800  C CA  . ASP A 1 108 ? 8.455   -3.477  32.883 1.00 17.87 ? 98  ASP A CA  1 
ATOM   801  C C   . ASP A 1 108 ? 8.540   -2.182  33.718 1.00 18.28 ? 98  ASP A C   1 
ATOM   802  O O   . ASP A 1 108 ? 9.401   -2.079  34.610 1.00 20.22 ? 98  ASP A O   1 
ATOM   803  C CB  . ASP A 1 108 ? 9.842   -4.026  32.483 1.00 17.36 ? 98  ASP A CB  1 
ATOM   804  C CG  . ASP A 1 108 ? 10.622  -3.079  31.565 1.00 20.12 ? 98  ASP A CG  1 
ATOM   805  O OD1 . ASP A 1 108 ? 10.060  -2.014  31.267 1.00 17.65 ? 98  ASP A OD1 1 
ATOM   806  O OD2 . ASP A 1 108 ? 11.778  -3.427  31.192 1.00 17.75 ? 98  ASP A OD2 1 
ATOM   807  N N   . GLY A 1 109 ? 7.648   -1.224  33.442 1.00 18.37 ? 99  GLY A N   1 
ATOM   808  C CA  . GLY A 1 109 ? 7.407   -0.067  34.282 1.00 17.11 ? 99  GLY A CA  1 
ATOM   809  C C   . GLY A 1 109 ? 8.104   1.237   33.793 1.00 17.93 ? 99  GLY A C   1 
ATOM   810  O O   . GLY A 1 109 ? 7.828   2.315   34.345 1.00 17.65 ? 99  GLY A O   1 
ATOM   811  N N   . GLY A 1 110 ? 9.002   1.129   32.799 1.00 18.68 ? 100 GLY A N   1 
ATOM   812  C CA  . GLY A 1 110 ? 9.535   2.354   32.106 1.00 18.43 ? 100 GLY A CA  1 
ATOM   813  C C   . GLY A 1 110 ? 8.378   3.212   31.615 1.00 18.41 ? 100 GLY A C   1 
ATOM   814  O O   . GLY A 1 110 ? 7.368   2.731   31.082 1.00 17.84 ? 100 GLY A O   1 
ATOM   815  N N   . VAL A 1 111 ? 8.496   4.519   31.752 1.00 17.72 ? 101 VAL A N   1 
ATOM   816  C CA  . VAL A 1 111 ? 7.441   5.401   31.257 1.00 16.91 ? 101 VAL A CA  1 
ATOM   817  C C   . VAL A 1 111 ? 8.176   6.533   30.495 1.00 19.02 ? 101 VAL A C   1 
ATOM   818  O O   . VAL A 1 111 ? 9.099   7.145   31.026 1.00 19.11 ? 101 VAL A O   1 
ATOM   819  C CB  . VAL A 1 111 ? 6.587   5.978   32.385 1.00 17.27 ? 101 VAL A CB  1 
ATOM   820  C CG1 . VAL A 1 111 ? 5.663   7.122   31.865 1.00 17.76 ? 101 VAL A CG1 1 
ATOM   821  C CG2 . VAL A 1 111 ? 5.745   4.871   33.123 1.00 17.33 ? 101 VAL A CG2 1 
ATOM   822  N N   . LEU A 1 112 ? 7.804   6.749   29.241 1.00 19.89 ? 102 LEU A N   1 
ATOM   823  C CA  . LEU A 1 112 ? 8.401   7.815   28.441 1.00 19.90 ? 102 LEU A CA  1 
ATOM   824  C C   . LEU A 1 112 ? 7.317   8.735   27.907 1.00 21.02 ? 102 LEU A C   1 
ATOM   825  O O   . LEU A 1 112 ? 6.412   8.323   27.139 1.00 20.95 ? 102 LEU A O   1 
ATOM   826  C CB  . LEU A 1 112 ? 9.257   7.209   27.327 1.00 19.98 ? 102 LEU A CB  1 
ATOM   827  C CG  . LEU A 1 112 ? 10.127  8.296   26.672 1.00 19.79 ? 102 LEU A CG  1 
ATOM   828  C CD1 . LEU A 1 112 ? 11.467  7.692   26.328 1.00 22.64 ? 102 LEU A CD1 1 
ATOM   829  C CD2 . LEU A 1 112 ? 9.413   8.961   25.460 1.00 18.24 ? 102 LEU A CD2 1 
ATOM   830  N N   . THR A 1 113 ? 7.406   10.018  28.301 1.00 21.33 ? 103 THR A N   1 
ATOM   831  C CA  . THR A 1 113 ? 6.443   11.006  27.892 1.00 21.02 ? 103 THR A CA  1 
ATOM   832  C C   . THR A 1 113 ? 7.205   11.938  26.927 1.00 21.37 ? 103 THR A C   1 
ATOM   833  O O   . THR A 1 113 ? 8.425   12.159  27.091 1.00 18.22 ? 103 THR A O   1 
ATOM   834  C CB  . THR A 1 113 ? 5.995   11.814  29.080 1.00 24.28 ? 103 THR A CB  1 
ATOM   835  O OG1 . THR A 1 113 ? 7.181   12.297  29.717 1.00 27.56 ? 103 THR A OG1 1 
ATOM   836  C CG2 . THR A 1 113 ? 5.237   10.934  30.084 1.00 22.65 ? 103 THR A CG2 1 
ATOM   837  N N   . ALA A 1 114 ? 6.502   12.391  25.891 1.00 20.52 ? 104 ALA A N   1 
ATOM   838  C CA  . ALA A 1 114 ? 7.118   13.149  24.792 1.00 20.17 ? 104 ALA A CA  1 
ATOM   839  C C   . ALA A 1 114 ? 6.106   14.132  24.285 1.00 20.48 ? 104 ALA A C   1 
ATOM   840  O O   . ALA A 1 114 ? 4.944   13.810  24.162 1.00 19.66 ? 104 ALA A O   1 
ATOM   841  C CB  . ALA A 1 114 ? 7.528   12.247  23.667 1.00 20.62 ? 104 ALA A CB  1 
ATOM   842  N N   . THR A 1 115 ? 6.553   15.338  23.924 1.00 19.54 ? 105 THR A N   1 
ATOM   843  C CA  . THR A 1 115 ? 5.621   16.314  23.403 1.00 19.96 ? 105 THR A CA  1 
ATOM   844  C C   . THR A 1 115 ? 6.337   16.933  22.231 1.00 18.98 ? 105 THR A C   1 
ATOM   845  O O   . THR A 1 115 ? 7.568   17.081  22.243 1.00 19.18 ? 105 THR A O   1 
ATOM   846  C CB  . THR A 1 115 ? 5.195   17.400  24.419 1.00 21.60 ? 105 THR A CB  1 
ATOM   847  O OG1 . THR A 1 115 ? 6.358   18.047  24.928 1.00 23.33 ? 105 THR A OG1 1 
ATOM   848  C CG2 . THR A 1 115 ? 4.426   16.751  25.590 1.00 22.65 ? 105 THR A CG2 1 
ATOM   849  N N   . GLN A 1 116 ? 5.561   17.250  21.211 1.00 18.44 ? 106 GLN A N   1 
ATOM   850  C CA  . GLN A 1 116 ? 6.146   17.616  19.934 1.00 18.25 ? 106 GLN A CA  1 
ATOM   851  C C   . GLN A 1 116 ? 5.329   18.711  19.295 1.00 17.82 ? 106 GLN A C   1 
ATOM   852  O O   . GLN A 1 116 ? 4.130   18.721  19.390 1.00 16.97 ? 106 GLN A O   1 
ATOM   853  C CB  . GLN A 1 116 ? 6.218   16.395  19.024 1.00 17.98 ? 106 GLN A CB  1 
ATOM   854  C CG  . GLN A 1 116 ? 7.163   16.462  17.849 1.00 16.96 ? 106 GLN A CG  1 
ATOM   855  C CD  . GLN A 1 116 ? 6.495   16.939  16.562 1.00 16.00 ? 106 GLN A CD  1 
ATOM   856  O OE1 . GLN A 1 116 ? 5.430   17.599  16.574 1.00 20.14 ? 106 GLN A OE1 1 
ATOM   857  N NE2 . GLN A 1 116 ? 7.103   16.575  15.421 1.00 17.47 ? 106 GLN A NE2 1 
ATOM   858  N N   . ASP A 1 117 ? 6.049   19.634  18.660 1.00 19.16 ? 107 ASP A N   1 
ATOM   859  C CA  . ASP A 1 117 ? 5.522   20.637  17.762 1.00 19.95 ? 107 ASP A CA  1 
ATOM   860  C C   . ASP A 1 117 ? 6.009   20.409  16.329 1.00 18.28 ? 107 ASP A C   1 
ATOM   861  O O   . ASP A 1 117 ? 7.205   20.206  16.071 1.00 21.79 ? 107 ASP A O   1 
ATOM   862  C CB  . ASP A 1 117 ? 5.980   22.047  18.192 1.00 20.22 ? 107 ASP A CB  1 
ATOM   863  C CG  . ASP A 1 117 ? 5.292   23.126  17.390 1.00 23.38 ? 107 ASP A CG  1 
ATOM   864  O OD1 . ASP A 1 117 ? 4.171   23.496  17.740 1.00 28.00 ? 107 ASP A OD1 1 
ATOM   865  O OD2 . ASP A 1 117 ? 5.872   23.592  16.388 1.00 28.59 ? 107 ASP A OD2 1 
ATOM   866  N N   . THR A 1 118 ? 5.064   20.473  15.405 1.00 19.36 ? 108 THR A N   1 
ATOM   867  C CA  . THR A 1 118 ? 5.312   20.407  13.975 1.00 19.15 ? 108 THR A CA  1 
ATOM   868  C C   . THR A 1 118 ? 4.851   21.692  13.334 1.00 20.25 ? 108 THR A C   1 
ATOM   869  O O   . THR A 1 118 ? 3.680   22.073  13.454 1.00 20.16 ? 108 THR A O   1 
ATOM   870  C CB  . THR A 1 118 ? 4.595   19.188  13.304 1.00 20.25 ? 108 THR A CB  1 
ATOM   871  O OG1 . THR A 1 118 ? 5.056   17.997  13.938 1.00 17.98 ? 108 THR A OG1 1 
ATOM   872  C CG2 . THR A 1 118 ? 4.942   19.091  11.830 1.00 18.53 ? 108 THR A CG2 1 
ATOM   873  N N   . SER A 1 119 ? 5.800   22.332  12.673 1.00 20.86 ? 109 SER A N   1 
ATOM   874  C CA  . SER A 1 119 ? 5.545   23.549  11.914 1.00 22.89 ? 109 SER A CA  1 
ATOM   875  C C   . SER A 1 119 ? 6.160   23.413  10.519 1.00 23.06 ? 109 SER A C   1 
ATOM   876  O O   . SER A 1 119 ? 6.913   22.484  10.235 1.00 21.89 ? 109 SER A O   1 
ATOM   877  C CB  . SER A 1 119 ? 6.122   24.751  12.689 1.00 21.59 ? 109 SER A CB  1 
ATOM   878  O OG  . SER A 1 119 ? 7.536   24.690  12.751 1.00 27.47 ? 109 SER A OG  1 
ATOM   879  N N   . LEU A 1 120 ? 5.841   24.375  9.657  1.00 24.44 ? 110 LEU A N   1 
ATOM   880  C CA  . LEU A 1 120 ? 6.381   24.433  8.325  1.00 25.04 ? 110 LEU A CA  1 
ATOM   881  C C   . LEU A 1 120 ? 6.900   25.849  8.119  1.00 26.21 ? 110 LEU A C   1 
ATOM   882  O O   . LEU A 1 120 ? 6.154   26.818  8.259  1.00 26.07 ? 110 LEU A O   1 
ATOM   883  C CB  . LEU A 1 120 ? 5.315   24.086  7.309  1.00 25.05 ? 110 LEU A CB  1 
ATOM   884  C CG  . LEU A 1 120 ? 5.655   24.186  5.799  1.00 26.34 ? 110 LEU A CG  1 
ATOM   885  C CD1 . LEU A 1 120 ? 6.708   23.201  5.350  1.00 24.27 ? 110 LEU A CD1 1 
ATOM   886  C CD2 . LEU A 1 120 ? 4.381   24.030  4.964  1.00 26.49 ? 110 LEU A CD2 1 
ATOM   887  N N   . GLN A 1 121 ? 8.177   25.929  7.819  1.00 26.37 ? 111 GLN A N   1 
ATOM   888  C CA  . GLN A 1 121 ? 8.897   27.197  7.741  1.00 29.68 ? 111 GLN A CA  1 
ATOM   889  C C   . GLN A 1 121 ? 9.791   27.157  6.521  1.00 29.80 ? 111 GLN A C   1 
ATOM   890  O O   . GLN A 1 121 ? 10.660  26.292  6.420  1.00 30.40 ? 111 GLN A O   1 
ATOM   891  C CB  . GLN A 1 121 ? 9.733   27.391  9.023  1.00 28.43 ? 111 GLN A CB  1 
ATOM   892  C CG  . GLN A 1 121 ? 8.891   27.483  10.319 1.00 31.61 ? 111 GLN A CG  1 
ATOM   893  C CD  . GLN A 1 121 ? 9.750   27.676  11.563 1.00 31.57 ? 111 GLN A CD  1 
ATOM   894  O OE1 . GLN A 1 121 ? 10.759  28.393  11.529 1.00 33.87 ? 111 GLN A OE1 1 
ATOM   895  N NE2 . GLN A 1 121 ? 9.392   26.996  12.652 1.00 31.30 ? 111 GLN A NE2 1 
ATOM   896  N N   . ASP A 1 122 ? 9.583   28.079  5.578  1.00 32.03 ? 112 ASP A N   1 
ATOM   897  C CA  . ASP A 1 122 ? 10.407  28.128  4.348  1.00 33.82 ? 112 ASP A CA  1 
ATOM   898  C C   . ASP A 1 122 ? 10.380  26.794  3.565  1.00 32.83 ? 112 ASP A C   1 
ATOM   899  O O   . ASP A 1 122 ? 11.408  26.342  3.075  1.00 34.14 ? 112 ASP A O   1 
ATOM   900  C CB  . ASP A 1 122 ? 11.872  28.445  4.684  1.00 34.78 ? 112 ASP A CB  1 
ATOM   901  C CG  . ASP A 1 122 ? 12.079  29.872  5.149  1.00 39.00 ? 112 ASP A CG  1 
ATOM   902  O OD1 . ASP A 1 122 ? 11.515  30.781  4.520  1.00 45.55 ? 112 ASP A OD1 1 
ATOM   903  O OD2 . ASP A 1 122 ? 12.820  30.086  6.143  1.00 45.04 ? 112 ASP A OD2 1 
ATOM   904  N N   . GLY A 1 123 ? 9.219   26.154  3.496  1.00 32.77 ? 113 GLY A N   1 
ATOM   905  C CA  . GLY A 1 123 ? 9.070   24.899  2.765  1.00 31.23 ? 113 GLY A CA  1 
ATOM   906  C C   . GLY A 1 123 ? 9.597   23.656  3.480  1.00 30.44 ? 113 GLY A C   1 
ATOM   907  O O   . GLY A 1 123 ? 9.509   22.545  2.930  1.00 30.73 ? 113 GLY A O   1 
ATOM   908  N N   . CYS A 1 124 ? 10.153  23.835  4.691  1.00 28.80 ? 114 CYS A N   1 
ATOM   909  C CA  . CYS A 1 124 ? 10.779  22.732  5.441  1.00 27.30 ? 114 CYS A CA  1 
ATOM   910  C C   . CYS A 1 124 ? 9.932   22.395  6.636  1.00 26.27 ? 114 CYS A C   1 
ATOM   911  O O   . CYS A 1 124 ? 9.451   23.271  7.356  1.00 26.03 ? 114 CYS A O   1 
ATOM   912  C CB  . CYS A 1 124 ? 12.187  23.094  5.910  1.00 27.98 ? 114 CYS A CB  1 
ATOM   913  S SG  . CYS A 1 124 ? 13.145  21.726  6.557  1.00 27.99 ? 114 CYS A SG  1 
ATOM   914  N N   . LEU A 1 125 ? 9.750   21.096  6.864  1.00 24.14 ? 115 LEU A N   1 
ATOM   915  C CA  . LEU A 1 125 ? 9.080   20.667  8.073  1.00 22.31 ? 115 LEU A CA  1 
ATOM   916  C C   . LEU A 1 125 ? 10.045  20.780  9.246  1.00 19.85 ? 115 LEU A C   1 
ATOM   917  O O   . LEU A 1 125 ? 11.193  20.381  9.152  1.00 20.52 ? 115 LEU A O   1 
ATOM   918  C CB  . LEU A 1 125 ? 8.574   19.216  7.899  1.00 21.54 ? 115 LEU A CB  1 
ATOM   919  C CG  . LEU A 1 125 ? 7.402   19.053  6.931  1.00 21.50 ? 115 LEU A CG  1 
ATOM   920  C CD1 . LEU A 1 125 ? 7.149   17.561  6.520  1.00 22.13 ? 115 LEU A CD1 1 
ATOM   921  C CD2 . LEU A 1 125 ? 6.164   19.640  7.547  1.00 18.52 ? 115 LEU A CD2 1 
ATOM   922  N N   . ILE A 1 126 ? 9.552   21.356  10.332 1.00 19.88 ? 116 ILE A N   1 
ATOM   923  C CA  . ILE A 1 126 ? 10.340  21.595  11.532 1.00 19.32 ? 116 ILE A CA  1 
ATOM   924  C C   . ILE A 1 126 ? 9.694   20.914  12.721 1.00 18.47 ? 116 ILE A C   1 
ATOM   925  O O   . ILE A 1 126 ? 8.548   21.197  13.077 1.00 18.77 ? 116 ILE A O   1 
ATOM   926  C CB  . ILE A 1 126 ? 10.522  23.135  11.877 1.00 19.73 ? 116 ILE A CB  1 
ATOM   927  C CG1 . ILE A 1 126 ? 11.045  23.924  10.636 1.00 20.49 ? 116 ILE A CG1 1 
ATOM   928  C CG2 . ILE A 1 126 ? 11.383  23.256  13.091 1.00 19.79 ? 116 ILE A CG2 1 
ATOM   929  C CD1 . ILE A 1 126 ? 12.479  23.606  10.207 1.00 22.18 ? 116 ILE A CD1 1 
ATOM   930  N N   . TYR A 1 127 ? 10.441  19.989  13.320 1.00 19.48 ? 117 TYR A N   1 
ATOM   931  C CA  . TYR A 1 127 ? 9.981   19.272  14.511 1.00 18.24 ? 117 TYR A CA  1 
ATOM   932  C C   . TYR A 1 127 ? 10.768  19.696  15.753 1.00 18.01 ? 117 TYR A C   1 
ATOM   933  O O   . TYR A 1 127 ? 11.997  19.716  15.748 1.00 18.30 ? 117 TYR A O   1 
ATOM   934  C CB  . TYR A 1 127 ? 10.218  17.779  14.330 1.00 18.68 ? 117 TYR A CB  1 
ATOM   935  C CG  . TYR A 1 127 ? 9.594   17.214  13.100 1.00 16.75 ? 117 TYR A CG  1 
ATOM   936  C CD1 . TYR A 1 127 ? 8.440   17.781  12.546 1.00 17.31 ? 117 TYR A CD1 1 
ATOM   937  C CD2 . TYR A 1 127 ? 10.052  16.000  12.594 1.00 19.03 ? 117 TYR A CD2 1 
ATOM   938  C CE1 . TYR A 1 127 ? 7.845   17.217  11.410 1.00 18.04 ? 117 TYR A CE1 1 
ATOM   939  C CE2 . TYR A 1 127 ? 9.491   15.452  11.485 1.00 21.22 ? 117 TYR A CE2 1 
ATOM   940  C CZ  . TYR A 1 127 ? 8.376   16.021  10.913 1.00 20.14 ? 117 TYR A CZ  1 
ATOM   941  O OH  . TYR A 1 127 ? 7.793   15.385  9.805  1.00 18.78 ? 117 TYR A OH  1 
ATOM   942  N N   . ASN A 1 128 ? 10.037  19.930  16.832 1.00 18.63 ? 118 ASN A N   1 
ATOM   943  C CA  . ASN A 1 128 ? 10.676  20.191  18.125 1.00 20.01 ? 118 ASN A CA  1 
ATOM   944  C C   . ASN A 1 128 ? 10.144  19.244  19.183 1.00 17.90 ? 118 ASN A C   1 
ATOM   945  O O   . ASN A 1 128 ? 8.978   19.290  19.451 1.00 19.00 ? 118 ASN A O   1 
ATOM   946  C CB  . ASN A 1 128 ? 10.508  21.680  18.518 1.00 21.33 ? 118 ASN A CB  1 
ATOM   947  C CG  . ASN A 1 128 ? 11.693  22.171  19.318 1.00 28.10 ? 118 ASN A CG  1 
ATOM   948  O OD1 . ASN A 1 128 ? 11.910  21.762  20.457 1.00 32.05 ? 118 ASN A OD1 1 
ATOM   949  N ND2 . ASN A 1 128 ? 12.500  23.034  18.698 1.00 34.77 ? 118 ASN A ND2 1 
ATOM   950  N N   . VAL A 1 129 ? 11.016  18.393  19.721 1.00 17.85 ? 119 VAL A N   1 
ATOM   951  C CA  . VAL A 1 129 ? 10.606  17.290  20.601 1.00 18.86 ? 119 VAL A CA  1 
ATOM   952  C C   . VAL A 1 129 ? 11.205  17.380  22.003 1.00 18.57 ? 119 VAL A C   1 
ATOM   953  O O   . VAL A 1 129 ? 12.425  17.581  22.145 1.00 19.57 ? 119 VAL A O   1 
ATOM   954  C CB  . VAL A 1 129 ? 10.987  15.887  20.045 1.00 18.61 ? 119 VAL A CB  1 
ATOM   955  C CG1 . VAL A 1 129 ? 9.999   14.867  20.622 1.00 21.07 ? 119 VAL A CG1 1 
ATOM   956  C CG2 . VAL A 1 129 ? 10.949  15.830  18.570 1.00 22.01 ? 119 VAL A CG2 1 
ATOM   957  N N   . LYS A 1 130 ? 10.375  17.193  23.035 1.00 19.80 ? 120 LYS A N   1 
ATOM   958  C CA  . LYS A 1 130 ? 10.883  17.120  24.422 1.00 19.27 ? 120 LYS A CA  1 
ATOM   959  C C   . LYS A 1 130 ? 10.564  15.755  25.043 1.00 19.98 ? 120 LYS A C   1 
ATOM   960  O O   . LYS A 1 130 ? 9.420   15.359  24.965 1.00 18.93 ? 120 LYS A O   1 
ATOM   961  C CB  . LYS A 1 130 ? 10.212  18.199  25.257 1.00 21.53 ? 120 LYS A CB  1 
ATOM   962  C CG  . LYS A 1 130 ? 10.763  19.603  24.875 1.00 22.53 ? 120 LYS A CG  1 
ATOM   963  C CD  . LYS A 1 130 ? 9.809   20.727  25.193 1.00 32.78 ? 120 LYS A CD  1 
ATOM   964  C CE  . LYS A 1 130 ? 10.472  22.055  24.827 1.00 34.91 ? 120 LYS A CE  1 
ATOM   965  N NZ  . LYS A 1 130 ? 9.655   22.829  23.861 1.00 37.46 ? 120 LYS A NZ  1 
ATOM   966  N N   . ILE A 1 131 ? 11.537  15.110  25.682 1.00 18.16 ? 121 ILE A N   1 
ATOM   967  C CA  . ILE A 1 131 ? 11.372  13.698  26.139 1.00 19.59 ? 121 ILE A CA  1 
ATOM   968  C C   . ILE A 1 131 ? 11.610  13.609  27.636 1.00 20.46 ? 121 ILE A C   1 
ATOM   969  O O   . ILE A 1 131 ? 12.608  14.164  28.145 1.00 19.20 ? 121 ILE A O   1 
ATOM   970  C CB  . ILE A 1 131 ? 12.418  12.803  25.417 1.00 19.62 ? 121 ILE A CB  1 
ATOM   971  C CG1 . ILE A 1 131 ? 12.203  12.755  23.883 1.00 22.22 ? 121 ILE A CG1 1 
ATOM   972  C CG2 . ILE A 1 131 ? 12.527  11.381  26.026 1.00 19.62 ? 121 ILE A CG2 1 
ATOM   973  C CD1 . ILE A 1 131 ? 10.795  12.642  23.453 1.00 25.01 ? 121 ILE A CD1 1 
ATOM   974  N N   . ARG A 1 132 ? 10.747  12.887  28.356 1.00 19.89 ? 122 ARG A N   1 
ATOM   975  C CA  . ARG A 1 132 ? 11.070  12.572  29.746 1.00 21.08 ? 122 ARG A CA  1 
ATOM   976  C C   . ARG A 1 132 ? 10.779  11.104  30.008 1.00 19.11 ? 122 ARG A C   1 
ATOM   977  O O   . ARG A 1 132 ? 9.647   10.726  29.952 1.00 20.65 ? 122 ARG A O   1 
ATOM   978  C CB  . ARG A 1 132 ? 10.260  13.448  30.710 1.00 20.48 ? 122 ARG A CB  1 
ATOM   979  C CG  . ARG A 1 132 ? 10.480  13.111  32.188 1.00 26.08 ? 122 ARG A CG  1 
ATOM   980  C CD  . ARG A 1 132 ? 11.808  12.335  32.300 1.00 32.07 ? 122 ARG A CD  1 
ATOM   981  N NE  . ARG A 1 132 ? 12.729  12.688  33.351 1.00 37.38 ? 122 ARG A NE  1 
ATOM   982  C CZ  . ARG A 1 132 ? 13.296  13.886  33.451 1.00 41.37 ? 122 ARG A CZ  1 
ATOM   983  N NH1 . ARG A 1 132 ? 12.970  14.830  32.569 1.00 39.29 ? 122 ARG A NH1 1 
ATOM   984  N NH2 . ARG A 1 132 ? 14.172  14.140  34.436 1.00 38.68 ? 122 ARG A NH2 1 
ATOM   985  N N   . GLY A 1 133 ? 11.821  10.319  30.236 1.00 19.06 ? 123 GLY A N   1 
ATOM   986  C CA  . GLY A 1 133 ? 11.680  8.886   30.571 1.00 18.54 ? 123 GLY A CA  1 
ATOM   987  C C   . GLY A 1 133 ? 12.087  8.612   32.012 1.00 19.59 ? 123 GLY A C   1 
ATOM   988  O O   . GLY A 1 133 ? 13.208  9.014   32.471 1.00 17.32 ? 123 GLY A O   1 
ATOM   989  N N   . VAL A 1 134 ? 11.169  7.963   32.754 1.00 18.09 ? 124 VAL A N   1 
ATOM   990  C CA  . VAL A 1 134 ? 11.436  7.643   34.160 1.00 19.11 ? 124 VAL A CA  1 
ATOM   991  C C   . VAL A 1 134 ? 11.183  6.122   34.423 1.00 18.33 ? 124 VAL A C   1 
ATOM   992  O O   . VAL A 1 134 ? 10.451  5.475   33.639 1.00 17.55 ? 124 VAL A O   1 
ATOM   993  C CB  . VAL A 1 134 ? 10.567  8.521   35.091 1.00 19.70 ? 124 VAL A CB  1 
ATOM   994  C CG1 . VAL A 1 134 ? 10.885  10.038  34.899 1.00 21.90 ? 124 VAL A CG1 1 
ATOM   995  C CG2 . VAL A 1 134 ? 9.080   8.210   34.897 1.00 20.50 ? 124 VAL A CG2 1 
ATOM   996  N N   . ASN A 1 135 ? 11.830  5.570   35.458 1.00 18.49 ? 125 ASN A N   1 
ATOM   997  C CA  . ASN A 1 135 ? 11.599  4.182   35.929 1.00 18.74 ? 125 ASN A CA  1 
ATOM   998  C C   . ASN A 1 135 ? 11.913  3.037   34.987 1.00 18.82 ? 125 ASN A C   1 
ATOM   999  O O   . ASN A 1 135 ? 11.294  1.945   35.047 1.00 17.25 ? 125 ASN A O   1 
ATOM   1000 C CB  . ASN A 1 135 ? 10.164  4.066   36.449 1.00 19.01 ? 125 ASN A CB  1 
ATOM   1001 C CG  . ASN A 1 135 ? 9.908   4.963   37.618 1.00 18.61 ? 125 ASN A CG  1 
ATOM   1002 O OD1 . ASN A 1 135 ? 9.322   5.999   37.476 1.00 19.68 ? 125 ASN A OD1 1 
ATOM   1003 N ND2 . ASN A 1 135 ? 10.367  4.573   38.783 1.00 19.99 ? 125 ASN A ND2 1 
ATOM   1004 N N   . PHE A 1 136 ? 12.850  3.251   34.080 1.00 18.70 ? 126 PHE A N   1 
ATOM   1005 C CA  . PHE A 1 136 ? 13.312  2.148   33.268 1.00 18.76 ? 126 PHE A CA  1 
ATOM   1006 C C   . PHE A 1 136 ? 14.127  1.317   34.240 1.00 20.02 ? 126 PHE A C   1 
ATOM   1007 O O   . PHE A 1 136 ? 15.038  1.853   34.935 1.00 21.37 ? 126 PHE A O   1 
ATOM   1008 C CB  . PHE A 1 136 ? 14.114  2.637   32.025 1.00 18.31 ? 126 PHE A CB  1 
ATOM   1009 C CG  . PHE A 1 136 ? 13.215  3.219   30.977 1.00 18.39 ? 126 PHE A CG  1 
ATOM   1010 C CD1 . PHE A 1 136 ? 12.747  2.408   29.942 1.00 16.06 ? 126 PHE A CD1 1 
ATOM   1011 C CD2 . PHE A 1 136 ? 12.767  4.539   31.075 1.00 19.19 ? 126 PHE A CD2 1 
ATOM   1012 C CE1 . PHE A 1 136 ? 11.858  2.924   28.978 1.00 16.96 ? 126 PHE A CE1 1 
ATOM   1013 C CE2 . PHE A 1 136 ? 11.892  5.077   30.141 1.00 20.07 ? 126 PHE A CE2 1 
ATOM   1014 C CZ  . PHE A 1 136 ? 11.400  4.264   29.093 1.00 18.94 ? 126 PHE A CZ  1 
ATOM   1015 N N   . PRO A 1 137 ? 13.813  0.023   34.328 1.00 20.89 ? 127 PRO A N   1 
ATOM   1016 C CA  . PRO A 1 137 ? 14.566  -0.811  35.301 1.00 21.87 ? 127 PRO A CA  1 
ATOM   1017 C C   . PRO A 1 137 ? 16.066  -0.797  35.035 1.00 21.70 ? 127 PRO A C   1 
ATOM   1018 O O   . PRO A 1 137 ? 16.528  -0.940  33.894 1.00 22.11 ? 127 PRO A O   1 
ATOM   1019 C CB  . PRO A 1 137 ? 13.965  -2.212  35.147 1.00 21.14 ? 127 PRO A CB  1 
ATOM   1020 C CG  . PRO A 1 137 ? 12.955  -2.133  34.040 1.00 22.14 ? 127 PRO A CG  1 
ATOM   1021 C CD  . PRO A 1 137 ? 12.842  -0.733  33.514 1.00 20.27 ? 127 PRO A CD  1 
ATOM   1022 N N   . SER A 1 138 ? 16.844  -0.604  36.089 1.00 22.50 ? 128 SER A N   1 
ATOM   1023 C CA  . SER A 1 138 ? 18.271  -0.305  35.918 1.00 24.11 ? 128 SER A CA  1 
ATOM   1024 C C   . SER A 1 138 ? 19.010  -1.512  35.318 1.00 24.91 ? 128 SER A C   1 
ATOM   1025 O O   . SER A 1 138 ? 20.053  -1.349  34.661 1.00 25.84 ? 128 SER A O   1 
ATOM   1026 C CB  . SER A 1 138 ? 18.879  0.107   37.263 1.00 24.86 ? 128 SER A CB  1 
ATOM   1027 O OG  . SER A 1 138 ? 18.900  -0.999  38.153 1.00 26.07 ? 128 SER A OG  1 
ATOM   1028 N N   . ASN A 1 139 ? 18.463  -2.710  35.512 1.00 25.06 ? 129 ASN A N   1 
ATOM   1029 C CA  . ASN A 1 139 ? 19.047  -3.912  34.897 1.00 27.21 ? 129 ASN A CA  1 
ATOM   1030 C C   . ASN A 1 139 ? 18.169  -4.477  33.758 1.00 26.62 ? 129 ASN A C   1 
ATOM   1031 O O   . ASN A 1 139 ? 18.374  -5.616  33.302 1.00 27.66 ? 129 ASN A O   1 
ATOM   1032 C CB  . ASN A 1 139 ? 19.389  -4.980  35.964 1.00 28.48 ? 129 ASN A CB  1 
ATOM   1033 C CG  . ASN A 1 139 ? 20.240  -4.409  37.127 1.00 34.85 ? 129 ASN A CG  1 
ATOM   1034 O OD1 . ASN A 1 139 ? 19.779  -4.328  38.294 1.00 41.01 ? 129 ASN A OD1 1 
ATOM   1035 N ND2 . ASN A 1 139 ? 21.459  -3.965  36.807 1.00 38.80 ? 129 ASN A ND2 1 
ATOM   1036 N N   . GLY A 1 140 ? 17.216  -3.670  33.280 1.00 25.67 ? 130 GLY A N   1 
ATOM   1037 C CA  . GLY A 1 140 ? 16.364  -4.044  32.152 1.00 24.76 ? 130 GLY A CA  1 
ATOM   1038 C C   . GLY A 1 140 ? 17.044  -3.876  30.796 1.00 24.35 ? 130 GLY A C   1 
ATOM   1039 O O   . GLY A 1 140 ? 18.134  -3.308  30.723 1.00 24.05 ? 130 GLY A O   1 
ATOM   1040 N N   . PRO A 1 141 ? 16.407  -4.387  29.719 1.00 23.79 ? 131 PRO A N   1 
ATOM   1041 C CA  . PRO A 1 141 ? 17.026  -4.382  28.392 1.00 22.70 ? 131 PRO A CA  1 
ATOM   1042 C C   . PRO A 1 141 ? 17.248  -2.982  27.832 1.00 22.23 ? 131 PRO A C   1 
ATOM   1043 O O   . PRO A 1 141 ? 18.182  -2.794  27.056 1.00 21.37 ? 131 PRO A O   1 
ATOM   1044 C CB  . PRO A 1 141 ? 16.047  -5.171  27.520 1.00 23.13 ? 131 PRO A CB  1 
ATOM   1045 C CG  . PRO A 1 141 ? 14.795  -5.253  28.271 1.00 23.41 ? 131 PRO A CG  1 
ATOM   1046 C CD  . PRO A 1 141 ? 15.097  -5.064  29.726 1.00 23.84 ? 131 PRO A CD  1 
ATOM   1047 N N   . VAL A 1 142 ? 16.382  -2.027  28.179 1.00 21.10 ? 132 VAL A N   1 
ATOM   1048 C CA  . VAL A 1 142 ? 16.558  -0.632  27.704 1.00 21.08 ? 132 VAL A CA  1 
ATOM   1049 C C   . VAL A 1 142 ? 17.858  -0.046  28.275 1.00 22.19 ? 132 VAL A C   1 
ATOM   1050 O O   . VAL A 1 142 ? 18.699  0.440   27.523 1.00 22.43 ? 132 VAL A O   1 
ATOM   1051 C CB  . VAL A 1 142 ? 15.327  0.286   28.042 1.00 21.05 ? 132 VAL A CB  1 
ATOM   1052 C CG1 . VAL A 1 142 ? 15.679  1.795   27.833 1.00 21.83 ? 132 VAL A CG1 1 
ATOM   1053 C CG2 . VAL A 1 142 ? 14.143  -0.105  27.207 1.00 17.26 ? 132 VAL A CG2 1 
ATOM   1054 N N   . MET A 1 143 ? 18.035  -0.125  29.596 1.00 21.42 ? 133 MET A N   1 
ATOM   1055 C CA  . MET A 1 143 ? 19.189  0.492   30.248 1.00 23.07 ? 133 MET A CA  1 
ATOM   1056 C C   . MET A 1 143 ? 20.470  -0.310  30.057 1.00 23.98 ? 133 MET A C   1 
ATOM   1057 O O   . MET A 1 143 ? 21.584  0.229   30.206 1.00 25.22 ? 133 MET A O   1 
ATOM   1058 C CB  . MET A 1 143 ? 18.903  0.719   31.745 1.00 22.88 ? 133 MET A CB  1 
ATOM   1059 C CG  . MET A 1 143 ? 17.784  1.708   32.061 1.00 21.95 ? 133 MET A CG  1 
ATOM   1060 S SD  . MET A 1 143 ? 17.798  3.314   31.136 1.00 23.66 ? 133 MET A SD  1 
ATOM   1061 C CE  . MET A 1 143 ? 19.397  3.978   31.595 1.00 17.55 ? 133 MET A CE  1 
ATOM   1062 N N   . GLN A 1 144 ? 20.341  -1.585  29.705 1.00 23.74 ? 134 GLN A N   1 
ATOM   1063 C CA  . GLN A 1 144 ? 21.523  -2.395  29.420 1.00 25.43 ? 134 GLN A CA  1 
ATOM   1064 C C   . GLN A 1 144 ? 21.766  -2.510  27.913 1.00 25.50 ? 134 GLN A C   1 
ATOM   1065 O O   . GLN A 1 144 ? 22.621  -3.265  27.480 1.00 25.58 ? 134 GLN A O   1 
ATOM   1066 C CB  . GLN A 1 144 ? 21.391  -3.785  30.066 1.00 26.63 ? 134 GLN A CB  1 
ATOM   1067 C CG  . GLN A 1 144 ? 21.287  -3.765  31.598 1.00 28.87 ? 134 GLN A CG  1 
ATOM   1068 C CD  . GLN A 1 144 ? 22.484  -3.092  32.250 1.00 35.07 ? 134 GLN A CD  1 
ATOM   1069 O OE1 . GLN A 1 144 ? 23.627  -3.365  31.880 1.00 37.12 ? 134 GLN A OE1 1 
ATOM   1070 N NE2 . GLN A 1 144 ? 22.229  -2.188  33.204 1.00 37.52 ? 134 GLN A NE2 1 
ATOM   1071 N N   . LYS A 1 145 ? 20.967  -1.786  27.119 1.00 25.97 ? 135 LYS A N   1 
ATOM   1072 C CA  . LYS A 1 145 ? 21.104  -1.761  25.644 1.00 27.08 ? 135 LYS A CA  1 
ATOM   1073 C C   . LYS A 1 145 ? 21.094  -3.170  25.030 1.00 26.37 ? 135 LYS A C   1 
ATOM   1074 O O   . LYS A 1 145 ? 22.005  -3.601  24.303 1.00 26.18 ? 135 LYS A O   1 
ATOM   1075 C CB  . LYS A 1 145 ? 22.333  -0.957  25.216 1.00 27.56 ? 135 LYS A CB  1 
ATOM   1076 C CG  . LYS A 1 145 ? 22.218  0.559   25.483 1.00 30.45 ? 135 LYS A CG  1 
ATOM   1077 C CD  . LYS A 1 145 ? 23.540  1.273   25.185 1.00 29.96 ? 135 LYS A CD  1 
ATOM   1078 C CE  . LYS A 1 145 ? 24.106  0.850   23.828 1.00 35.06 ? 135 LYS A CE  1 
ATOM   1079 N NZ  . LYS A 1 145 ? 25.419  1.539   23.467 1.00 36.46 ? 135 LYS A NZ  1 
ATOM   1080 N N   . LYS A 1 146 ? 20.031  -3.893  25.339 1.00 25.02 ? 136 LYS A N   1 
ATOM   1081 C CA  . LYS A 1 146 ? 19.867  -5.255  24.865 1.00 25.06 ? 136 LYS A CA  1 
ATOM   1082 C C   . LYS A 1 146 ? 18.636  -5.358  23.952 1.00 24.52 ? 136 LYS A C   1 
ATOM   1083 O O   . LYS A 1 146 ? 17.988  -6.410  23.860 1.00 24.13 ? 136 LYS A O   1 
ATOM   1084 C CB  . LYS A 1 146 ? 19.764  -6.202  26.074 1.00 25.81 ? 136 LYS A CB  1 
ATOM   1085 C CG  . LYS A 1 146 ? 21.029  -6.191  26.975 1.00 26.86 ? 136 LYS A CG  1 
ATOM   1086 C CD  . LYS A 1 146 ? 22.134  -6.952  26.244 1.00 29.64 ? 136 LYS A CD  1 
ATOM   1087 C CE  . LYS A 1 146 ? 23.355  -7.177  27.127 1.00 33.63 ? 136 LYS A CE  1 
ATOM   1088 N NZ  . LYS A 1 146 ? 24.372  -6.092  26.907 1.00 39.46 ? 136 LYS A NZ  1 
ATOM   1089 N N   . THR A 1 147 ? 18.355  -4.274  23.232 1.00 23.20 ? 137 THR A N   1 
ATOM   1090 C CA  . THR A 1 147 ? 17.221  -4.245  22.293 1.00 22.00 ? 137 THR A CA  1 
ATOM   1091 C C   . THR A 1 147 ? 17.677  -4.317  20.833 1.00 21.12 ? 137 THR A C   1 
ATOM   1092 O O   . THR A 1 147 ? 18.848  -4.004  20.484 1.00 20.87 ? 137 THR A O   1 
ATOM   1093 C CB  . THR A 1 147 ? 16.342  -3.003  22.472 1.00 21.96 ? 137 THR A CB  1 
ATOM   1094 O OG1 . THR A 1 147 ? 17.071  -1.857  22.010 1.00 23.45 ? 137 THR A OG1 1 
ATOM   1095 C CG2 . THR A 1 147 ? 15.916  -2.786  23.971 1.00 23.44 ? 137 THR A CG2 1 
ATOM   1096 N N   . LEU A 1 148 ? 16.774  -4.774  19.984 1.00 19.30 ? 138 LEU A N   1 
ATOM   1097 C CA  . LEU A 1 148 ? 17.048  -4.938  18.557 1.00 19.97 ? 138 LEU A CA  1 
ATOM   1098 C C   . LEU A 1 148 ? 15.937  -4.402  17.643 1.00 19.81 ? 138 LEU A C   1 
ATOM   1099 O O   . LEU A 1 148 ? 15.592  -5.036  16.643 1.00 20.85 ? 138 LEU A O   1 
ATOM   1100 C CB  . LEU A 1 148 ? 17.328  -6.417  18.246 1.00 21.02 ? 138 LEU A CB  1 
ATOM   1101 C CG  . LEU A 1 148 ? 18.424  -7.119  19.037 1.00 23.30 ? 138 LEU A CG  1 
ATOM   1102 C CD1 . LEU A 1 148 ? 18.358  -8.665  18.862 1.00 22.28 ? 138 LEU A CD1 1 
ATOM   1103 C CD2 . LEU A 1 148 ? 19.780  -6.557  18.643 1.00 24.01 ? 138 LEU A CD2 1 
ATOM   1104 N N   . GLY A 1 149 ? 15.344  -3.260  17.990 1.00 19.23 ? 139 GLY A N   1 
ATOM   1105 C CA  . GLY A 1 149 ? 14.435  -2.604  17.076 1.00 18.96 ? 139 GLY A CA  1 
ATOM   1106 C C   . GLY A 1 149 ? 13.019  -3.080  17.286 1.00 18.54 ? 139 GLY A C   1 
ATOM   1107 O O   . GLY A 1 149 ? 12.788  -3.968  18.134 1.00 18.85 ? 139 GLY A O   1 
ATOM   1108 N N   . TRP A 1 150 ? 12.100  -2.491  16.511 1.00 16.88 ? 140 TRP A N   1 
ATOM   1109 C CA  . TRP A 1 150 ? 10.662  -2.608  16.690 1.00 17.22 ? 140 TRP A CA  1 
ATOM   1110 C C   . TRP A 1 150 ? 10.051  -3.530  15.682 1.00 16.82 ? 140 TRP A C   1 
ATOM   1111 O O   . TRP A 1 150 ? 10.359  -3.439  14.479 1.00 17.03 ? 140 TRP A O   1 
ATOM   1112 C CB  . TRP A 1 150 ? 9.968   -1.226  16.560 1.00 17.37 ? 140 TRP A CB  1 
ATOM   1113 C CG  . TRP A 1 150 ? 10.393  -0.288  17.671 1.00 17.44 ? 140 TRP A CG  1 
ATOM   1114 C CD1 . TRP A 1 150 ? 11.411  0.697   17.637 1.00 16.37 ? 140 TRP A CD1 1 
ATOM   1115 C CD2 . TRP A 1 150 ? 9.934   -0.352  19.020 1.00 17.07 ? 140 TRP A CD2 1 
ATOM   1116 N NE1 . TRP A 1 150 ? 11.521  1.268   18.884 1.00 14.86 ? 140 TRP A NE1 1 
ATOM   1117 C CE2 . TRP A 1 150 ? 10.601  0.669   19.737 1.00 18.24 ? 140 TRP A CE2 1 
ATOM   1118 C CE3 . TRP A 1 150 ? 8.917   -1.113  19.673 1.00 15.70 ? 140 TRP A CE3 1 
ATOM   1119 C CZ2 . TRP A 1 150 ? 10.355  0.899   21.118 1.00 17.53 ? 140 TRP A CZ2 1 
ATOM   1120 C CZ3 . TRP A 1 150 ? 8.640   -0.873  21.039 1.00 14.79 ? 140 TRP A CZ3 1 
ATOM   1121 C CH2 . TRP A 1 150 ? 9.355   0.149   21.745 1.00 17.19 ? 140 TRP A CH2 1 
ATOM   1122 N N   . GLU A 1 151 ? 9.123   -4.370  16.146 1.00 17.85 ? 141 GLU A N   1 
ATOM   1123 C CA  . GLU A 1 151 ? 8.162   -5.005  15.214 1.00 17.08 ? 141 GLU A CA  1 
ATOM   1124 C C   . GLU A 1 151 ? 7.210   -4.008  14.551 1.00 17.75 ? 141 GLU A C   1 
ATOM   1125 O O   . GLU A 1 151 ? 6.963   -2.901  15.063 1.00 16.29 ? 141 GLU A O   1 
ATOM   1126 C CB  . GLU A 1 151 ? 7.326   -6.133  15.887 1.00 16.84 ? 141 GLU A CB  1 
ATOM   1127 C CG  . GLU A 1 151 ? 8.181   -7.198  16.630 1.00 15.00 ? 141 GLU A CG  1 
ATOM   1128 C CD  . GLU A 1 151 ? 9.001   -8.116  15.740 1.00 17.65 ? 141 GLU A CD  1 
ATOM   1129 O OE1 . GLU A 1 151 ? 8.915   -8.041  14.500 1.00 20.41 ? 141 GLU A OE1 1 
ATOM   1130 O OE2 . GLU A 1 151 ? 9.740   -8.948  16.302 1.00 18.71 ? 141 GLU A OE2 1 
ATOM   1131 N N   . ALA A 1 152 ? 6.721   -4.365  13.370 1.00 17.01 ? 142 ALA A N   1 
ATOM   1132 C CA  . ALA A 1 152 ? 5.687   -3.557  12.731 1.00 18.47 ? 142 ALA A CA  1 
ATOM   1133 C C   . ALA A 1 152 ? 4.507   -3.405  13.691 1.00 19.14 ? 142 ALA A C   1 
ATOM   1134 O O   . ALA A 1 152 ? 4.352   -4.224  14.607 1.00 19.52 ? 142 ALA A O   1 
ATOM   1135 C CB  . ALA A 1 152 ? 5.223   -4.213  11.411 1.00 18.30 ? 142 ALA A CB  1 
ATOM   1136 N N   . SER A 1 153 ? 3.707   -2.339  13.557 1.00 18.10 ? 143 SER A N   1 
ATOM   1137 C CA  . SER A 1 153 ? 2.624   -2.104  14.516 1.00 18.68 ? 143 SER A CA  1 
ATOM   1138 C C   . SER A 1 153 ? 1.472   -1.346  13.851 1.00 18.42 ? 143 SER A C   1 
ATOM   1139 O O   . SER A 1 153 ? 1.635   -0.875  12.737 1.00 18.55 ? 143 SER A O   1 
ATOM   1140 C CB  . SER A 1 153 ? 3.178   -1.309  15.729 1.00 19.36 ? 143 SER A CB  1 
ATOM   1141 O OG  . SER A 1 153 ? 3.388   0.053   15.325 1.00 21.01 ? 143 SER A OG  1 
ATOM   1142 N N   . THR A 1 154 ? 0.307   -1.343  14.499 1.00 17.54 ? 144 THR A N   1 
ATOM   1143 C CA  . THR A 1 154 ? -0.933  -0.720  14.028 1.00 18.67 ? 144 THR A CA  1 
ATOM   1144 C C   . THR A 1 154 ? -1.409  0.286   15.089 1.00 19.31 ? 144 THR A C   1 
ATOM   1145 O O   . THR A 1 154 ? -1.599  -0.049  16.261 1.00 20.05 ? 144 THR A O   1 
ATOM   1146 C CB  . THR A 1 154 ? -2.073  -1.772  13.679 1.00 19.25 ? 144 THR A CB  1 
ATOM   1147 O OG1 . THR A 1 154 ? -1.668  -2.534  12.529 1.00 21.46 ? 144 THR A OG1 1 
ATOM   1148 C CG2 . THR A 1 154 ? -3.347  -1.052  13.290 1.00 17.87 ? 144 THR A CG2 1 
ATOM   1149 N N   . GLU A 1 155 ? -1.566  1.526   14.665 1.00 19.32 ? 145 GLU A N   1 
ATOM   1150 C CA  . GLU A 1 155 ? -2.180  2.522   15.516 1.00 20.44 ? 145 GLU A CA  1 
ATOM   1151 C C   . GLU A 1 155 ? -3.630  2.684   15.134 1.00 20.76 ? 145 GLU A C   1 
ATOM   1152 O O   . GLU A 1 155 ? -3.950  2.818   13.943 1.00 22.85 ? 145 GLU A O   1 
ATOM   1153 C CB  . GLU A 1 155 ? -1.443  3.858   15.321 1.00 19.60 ? 145 GLU A CB  1 
ATOM   1154 C CG  . GLU A 1 155 ? -1.981  4.973   16.203 1.00 21.30 ? 145 GLU A CG  1 
ATOM   1155 C CD  . GLU A 1 155 ? -1.228  6.293   15.986 1.00 22.42 ? 145 GLU A CD  1 
ATOM   1156 O OE1 . GLU A 1 155 ? -0.549  6.417   14.940 1.00 22.44 ? 145 GLU A OE1 1 
ATOM   1157 O OE2 . GLU A 1 155 ? -1.353  7.186   16.884 1.00 23.67 ? 145 GLU A OE2 1 
ATOM   1158 N N   . MET A 1 156 ? -4.515  2.697   16.129 1.00 20.81 ? 146 MET A N   1 
ATOM   1159 C CA  . MET A 1 156 ? -5.894  3.035   15.932 1.00 22.40 ? 146 MET A CA  1 
ATOM   1160 C C   . MET A 1 156 ? -6.065  4.504   16.273 1.00 22.23 ? 146 MET A C   1 
ATOM   1161 O O   . MET A 1 156 ? -5.680  4.920   17.378 1.00 21.04 ? 146 MET A O   1 
ATOM   1162 C CB  . MET A 1 156 ? -6.776  2.173   16.849 1.00 22.34 ? 146 MET A CB  1 
ATOM   1163 C CG  . MET A 1 156 ? -8.244  2.461   16.747 1.00 23.20 ? 146 MET A CG  1 
ATOM   1164 S SD  . MET A 1 156 ? -9.255  1.468   17.869 1.00 26.21 ? 146 MET A SD  1 
ATOM   1165 C CE  . MET A 1 156 ? -8.252  1.518   19.385 1.00 22.21 ? 146 MET A CE  1 
ATOM   1166 N N   . LEU A 1 157 ? -6.664  5.251   15.343 1.00 22.58 ? 147 LEU A N   1 
ATOM   1167 C CA  . LEU A 1 157 ? -6.940  6.685   15.528 1.00 22.87 ? 147 LEU A CA  1 
ATOM   1168 C C   . LEU A 1 157 ? -8.431  6.960   15.573 1.00 22.92 ? 147 LEU A C   1 
ATOM   1169 O O   . LEU A 1 157 ? -9.215  6.352   14.832 1.00 23.63 ? 147 LEU A O   1 
ATOM   1170 C CB  . LEU A 1 157 ? -6.240  7.533   14.465 1.00 23.09 ? 147 LEU A CB  1 
ATOM   1171 C CG  . LEU A 1 157 ? -4.730  7.578   14.599 1.00 24.88 ? 147 LEU A CG  1 
ATOM   1172 C CD1 . LEU A 1 157 ? -4.079  6.668   13.598 1.00 26.24 ? 147 LEU A CD1 1 
ATOM   1173 C CD2 . LEU A 1 157 ? -4.278  8.989   14.373 1.00 27.83 ? 147 LEU A CD2 1 
ATOM   1174 N N   . TYR A 1 158 ? -8.833  7.849   16.474 1.00 21.46 ? 148 TYR A N   1 
ATOM   1175 C CA  . TYR A 1 158 ? -10.233 8.225   16.583 1.00 22.80 ? 148 TYR A CA  1 
ATOM   1176 C C   . TYR A 1 158 ? -10.343 9.672   17.013 1.00 23.79 ? 148 TYR A C   1 
ATOM   1177 O O   . TYR A 1 158 ? -9.504  10.154  17.777 1.00 23.07 ? 148 TYR A O   1 
ATOM   1178 C CB  . TYR A 1 158 ? -10.969 7.321   17.578 1.00 21.76 ? 148 TYR A CB  1 
ATOM   1179 C CG  . TYR A 1 158 ? -10.344 7.193   18.949 1.00 22.55 ? 148 TYR A CG  1 
ATOM   1180 C CD1 . TYR A 1 158 ? -9.197  6.414   19.158 1.00 23.49 ? 148 TYR A CD1 1 
ATOM   1181 C CD2 . TYR A 1 158 ? -10.902 7.861   20.033 1.00 21.15 ? 148 TYR A CD2 1 
ATOM   1182 C CE1 . TYR A 1 158 ? -8.638  6.312   20.431 1.00 21.57 ? 148 TYR A CE1 1 
ATOM   1183 C CE2 . TYR A 1 158 ? -10.362 7.765   21.290 1.00 21.18 ? 148 TYR A CE2 1 
ATOM   1184 C CZ  . TYR A 1 158 ? -9.228  7.003   21.486 1.00 18.44 ? 148 TYR A CZ  1 
ATOM   1185 O OH  . TYR A 1 158 ? -8.735  6.925   22.766 1.00 20.84 ? 148 TYR A OH  1 
ATOM   1186 N N   . PRO A 1 159 ? -11.367 10.373  16.508 1.00 26.20 ? 149 PRO A N   1 
ATOM   1187 C CA  . PRO A 1 159 ? -11.522 11.765  16.912 1.00 27.65 ? 149 PRO A CA  1 
ATOM   1188 C C   . PRO A 1 159 ? -12.026 11.852  18.336 1.00 28.73 ? 149 PRO A C   1 
ATOM   1189 O O   . PRO A 1 159 ? -12.860 11.046  18.749 1.00 28.24 ? 149 PRO A O   1 
ATOM   1190 C CB  . PRO A 1 159 ? -12.570 12.318  15.925 1.00 27.86 ? 149 PRO A CB  1 
ATOM   1191 C CG  . PRO A 1 159 ? -13.334 11.183  15.478 1.00 27.33 ? 149 PRO A CG  1 
ATOM   1192 C CD  . PRO A 1 159 ? -12.412 9.957   15.548 1.00 26.12 ? 149 PRO A CD  1 
ATOM   1193 N N   . ALA A 1 160 ? -11.507 12.833  19.070 1.00 30.04 ? 150 ALA A N   1 
ATOM   1194 C CA  . ALA A 1 160 ? -11.909 13.106  20.436 1.00 31.29 ? 150 ALA A CA  1 
ATOM   1195 C C   . ALA A 1 160 ? -11.595 14.578  20.769 1.00 32.57 ? 150 ALA A C   1 
ATOM   1196 O O   . ALA A 1 160 ? -10.459 15.036  20.600 1.00 32.93 ? 150 ALA A O   1 
ATOM   1197 C CB  . ALA A 1 160 ? -11.192 12.178  21.402 1.00 30.85 ? 150 ALA A CB  1 
ATOM   1198 N N   . ASP A 1 161 ? -12.616 15.301  21.230 1.00 34.02 ? 151 ASP A N   1 
ATOM   1199 C CA  . ASP A 1 161 ? -12.512 16.692  21.687 1.00 34.60 ? 151 ASP A CA  1 
ATOM   1200 C C   . ASP A 1 161 ? -11.813 17.602  20.658 1.00 33.68 ? 151 ASP A C   1 
ATOM   1201 O O   . ASP A 1 161 ? -10.928 18.372  21.002 1.00 34.86 ? 151 ASP A O   1 
ATOM   1202 C CB  . ASP A 1 161 ? -11.805 16.720  23.051 1.00 35.08 ? 151 ASP A CB  1 
ATOM   1203 C CG  . ASP A 1 161 ? -12.373 17.777  24.013 1.00 38.90 ? 151 ASP A CG  1 
ATOM   1204 O OD1 . ASP A 1 161 ? -13.331 18.538  23.676 1.00 38.77 ? 151 ASP A OD1 1 
ATOM   1205 O OD2 . ASP A 1 161 ? -11.832 17.841  25.141 1.00 42.39 ? 151 ASP A OD2 1 
ATOM   1206 N N   . GLY A 1 162 ? -12.192 17.495  19.387 1.00 32.95 ? 152 GLY A N   1 
ATOM   1207 C CA  . GLY A 1 162 ? -11.583 18.326  18.344 1.00 31.75 ? 152 GLY A CA  1 
ATOM   1208 C C   . GLY A 1 162 ? -10.173 17.961  17.882 1.00 30.48 ? 152 GLY A C   1 
ATOM   1209 O O   . GLY A 1 162 ? -9.600  18.626  17.017 1.00 30.71 ? 152 GLY A O   1 
ATOM   1210 N N   . GLY A 1 163 ? -9.601  16.911  18.461 1.00 28.05 ? 153 GLY A N   1 
ATOM   1211 C CA  . GLY A 1 163 ? -8.307  16.423  18.018 1.00 26.03 ? 153 GLY A CA  1 
ATOM   1212 C C   . GLY A 1 163 ? -8.430  14.957  17.689 1.00 24.38 ? 153 GLY A C   1 
ATOM   1213 O O   . GLY A 1 163 ? -9.537  14.417  17.596 1.00 24.47 ? 153 GLY A O   1 
ATOM   1214 N N   . LEU A 1 164 ? -7.311  14.280  17.561 1.00 22.71 ? 154 LEU A N   1 
ATOM   1215 C CA  . LEU A 1 164 ? -7.366  12.838  17.355 1.00 21.27 ? 154 LEU A CA  1 
ATOM   1216 C C   . LEU A 1 164 ? -6.655  12.164  18.525 1.00 21.28 ? 154 LEU A C   1 
ATOM   1217 O O   . LEU A 1 164 ? -5.655  12.693  19.014 1.00 20.56 ? 154 LEU A O   1 
ATOM   1218 C CB  . LEU A 1 164 ? -6.632  12.497  16.062 1.00 22.90 ? 154 LEU A CB  1 
ATOM   1219 C CG  . LEU A 1 164 ? -7.206  12.767  14.678 1.00 22.28 ? 154 LEU A CG  1 
ATOM   1220 C CD1 . LEU A 1 164 ? -6.217  12.344  13.592 1.00 24.02 ? 154 LEU A CD1 1 
ATOM   1221 C CD2 . LEU A 1 164 ? -8.550  12.031  14.510 1.00 25.25 ? 154 LEU A CD2 1 
ATOM   1222 N N   . GLU A 1 165 ? -7.161  11.017  18.976 1.00 19.12 ? 155 GLU A N   1 
ATOM   1223 C CA  . GLU A 1 165 ? -6.430  10.148  19.891 1.00 19.95 ? 155 GLU A CA  1 
ATOM   1224 C C   . GLU A 1 165 ? -5.872  8.981   19.095 1.00 19.64 ? 155 GLU A C   1 
ATOM   1225 O O   . GLU A 1 165 ? -6.462  8.564   18.097 1.00 19.25 ? 155 GLU A O   1 
ATOM   1226 C CB  . GLU A 1 165 ? -7.322  9.630   21.021 1.00 21.19 ? 155 GLU A CB  1 
ATOM   1227 C CG  . GLU A 1 165 ? -7.595  10.668  22.101 1.00 23.50 ? 155 GLU A CG  1 
ATOM   1228 C CD  . GLU A 1 165 ? -6.358  10.981  22.954 1.00 25.05 ? 155 GLU A CD  1 
ATOM   1229 O OE1 . GLU A 1 165 ? -5.821  10.084  23.641 1.00 24.86 ? 155 GLU A OE1 1 
ATOM   1230 O OE2 . GLU A 1 165 ? -5.917  12.156  22.932 1.00 28.46 ? 155 GLU A OE2 1 
ATOM   1231 N N   . GLY A 1 166 ? -4.738  8.469   19.551 1.00 18.68 ? 156 GLY A N   1 
ATOM   1232 C CA  . GLY A 1 166 ? -4.077  7.343   18.895 1.00 18.60 ? 156 GLY A CA  1 
ATOM   1233 C C   . GLY A 1 166 ? -3.723  6.343   19.976 1.00 19.82 ? 156 GLY A C   1 
ATOM   1234 O O   . GLY A 1 166 ? -3.391  6.714   21.120 1.00 18.18 ? 156 GLY A O   1 
ATOM   1235 N N   . ARG A 1 167 ? -3.835  5.053   19.634 1.00 18.87 ? 157 ARG A N   1 
ATOM   1236 C CA  . ARG A 1 167 ? -3.443  3.964   20.577 1.00 17.44 ? 157 ARG A CA  1 
ATOM   1237 C C   . ARG A 1 167 ? -2.754  2.904   19.809 1.00 16.90 ? 157 ARG A C   1 
ATOM   1238 O O   . ARG A 1 167 ? -3.185  2.600   18.712 1.00 17.15 ? 157 ARG A O   1 
ATOM   1239 C CB  . ARG A 1 167 ? -4.669  3.355   21.268 1.00 16.88 ? 157 ARG A CB  1 
ATOM   1240 C CG  . ARG A 1 167 ? -5.515  4.307   22.128 1.00 17.48 ? 157 ARG A CG  1 
ATOM   1241 C CD  . ARG A 1 167 ? -4.764  4.585   23.430 1.00 15.00 ? 157 ARG A CD  1 
ATOM   1242 N NE  . ARG A 1 167 ? -5.542  5.376   24.374 1.00 19.23 ? 157 ARG A NE  1 
ATOM   1243 C CZ  . ARG A 1 167 ? -5.653  6.699   24.308 1.00 17.52 ? 157 ARG A CZ  1 
ATOM   1244 N NH1 . ARG A 1 167 ? -5.049  7.378   23.320 1.00 16.71 ? 157 ARG A NH1 1 
ATOM   1245 N NH2 . ARG A 1 167 ? -6.378  7.330   25.223 1.00 18.52 ? 157 ARG A NH2 1 
ATOM   1246 N N   A SER A 1 168 ? -1.669  2.360   20.358 0.50 17.39 ? 158 SER A N   1 
ATOM   1247 N N   B SER A 1 168 ? -1.651  2.373   20.362 0.50 17.04 ? 158 SER A N   1 
ATOM   1248 C CA  A SER A 1 168 ? -0.950  1.237   19.749 0.50 17.76 ? 158 SER A CA  1 
ATOM   1249 C CA  B SER A 1 168 ? -0.918  1.238   19.763 0.50 17.06 ? 158 SER A CA  1 
ATOM   1250 C C   A SER A 1 168 ? -0.334  0.468   20.905 0.50 17.78 ? 158 SER A C   1 
ATOM   1251 C C   B SER A 1 168 ? -0.046  0.490   20.769 0.50 17.74 ? 158 SER A C   1 
ATOM   1252 O O   A SER A 1 168 ? -0.187  1.032   21.989 0.50 15.09 ? 158 SER A O   1 
ATOM   1253 O O   B SER A 1 168 ? 0.658   1.078   21.600 0.50 16.13 ? 158 SER A O   1 
ATOM   1254 C CB  A SER A 1 168 ? 0.101   1.763   18.762 0.50 18.76 ? 158 SER A CB  1 
ATOM   1255 C CB  B SER A 1 168 ? -0.070  1.687   18.572 0.50 17.62 ? 158 SER A CB  1 
ATOM   1256 O OG  A SER A 1 168 ? 0.886   0.738   18.186 0.50 21.18 ? 158 SER A OG  1 
ATOM   1257 O OG  B SER A 1 168 ? 1.149   2.245   19.030 0.50 16.64 ? 158 SER A OG  1 
ATOM   1258 N N   . ASP A 1 169 ? -0.084  -0.837  20.706 1.00 17.55 ? 159 ASP A N   1 
ATOM   1259 C CA  . ASP A 1 169 ? 0.887   -1.617  21.463 1.00 18.39 ? 159 ASP A CA  1 
ATOM   1260 C C   . ASP A 1 169 ? 2.017   -1.807  20.499 1.00 18.37 ? 159 ASP A C   1 
ATOM   1261 O O   . ASP A 1 169 ? 1.763   -2.011  19.302 1.00 20.75 ? 159 ASP A O   1 
ATOM   1262 C CB  . ASP A 1 169 ? 0.340   -3.030  21.866 1.00 19.50 ? 159 ASP A CB  1 
ATOM   1263 C CG  . ASP A 1 169 ? -0.556  -2.992  23.088 1.00 24.43 ? 159 ASP A CG  1 
ATOM   1264 O OD1 . ASP A 1 169 ? -0.021  -2.886  24.205 1.00 28.21 ? 159 ASP A OD1 1 
ATOM   1265 O OD2 . ASP A 1 169 ? -1.795  -3.060  22.945 1.00 30.38 ? 159 ASP A OD2 1 
ATOM   1266 N N   . MET A 1 170 ? 3.254   -1.769  20.983 1.00 16.14 ? 160 MET A N   1 
ATOM   1267 C CA  . MET A 1 170 ? 4.410   -2.044  20.168 1.00 16.89 ? 160 MET A CA  1 
ATOM   1268 C C   . MET A 1 170 ? 5.295   -3.008  20.872 1.00 16.44 ? 160 MET A C   1 
ATOM   1269 O O   . MET A 1 170 ? 5.349   -3.063  22.138 1.00 16.15 ? 160 MET A O   1 
ATOM   1270 C CB  . MET A 1 170 ? 5.222   -0.734  19.838 1.00 16.45 ? 160 MET A CB  1 
ATOM   1271 C CG  . MET A 1 170 ? 4.425   0.302   19.058 1.00 19.66 ? 160 MET A CG  1 
ATOM   1272 S SD  . MET A 1 170 ? 5.560   1.688   18.705 1.00 21.14 ? 160 MET A SD  1 
ATOM   1273 C CE  . MET A 1 170 ? 6.613   1.001   17.481 1.00 20.25 ? 160 MET A CE  1 
ATOM   1274 N N   . ALA A 1 171 ? 5.976   -3.802  20.046 1.00 16.63 ? 161 ALA A N   1 
ATOM   1275 C CA  . ALA A 1 171 ? 6.852   -4.845  20.509 1.00 17.66 ? 161 ALA A CA  1 
ATOM   1276 C C   . ALA A 1 171 ? 8.311   -4.578  20.203 1.00 17.34 ? 161 ALA A C   1 
ATOM   1277 O O   . ALA A 1 171 ? 8.722   -4.581  19.031 1.00 16.93 ? 161 ALA A O   1 
ATOM   1278 C CB  . ALA A 1 171 ? 6.429   -6.183  19.886 1.00 17.71 ? 161 ALA A CB  1 
ATOM   1279 N N   . LEU A 1 172 ? 9.093   -4.473  21.264 1.00 17.52 ? 162 LEU A N   1 
ATOM   1280 C CA  . LEU A 1 172 ? 10.546  -4.273  21.189 1.00 18.31 ? 162 LEU A CA  1 
ATOM   1281 C C   . LEU A 1 172 ? 11.287  -5.616  21.197 1.00 18.76 ? 162 LEU A C   1 
ATOM   1282 O O   . LEU A 1 172 ? 11.192  -6.407  22.163 1.00 18.89 ? 162 LEU A O   1 
ATOM   1283 C CB  . LEU A 1 172 ? 11.033  -3.343  22.320 1.00 17.78 ? 162 LEU A CB  1 
ATOM   1284 C CG  . LEU A 1 172 ? 12.503  -2.873  22.290 1.00 16.86 ? 162 LEU A CG  1 
ATOM   1285 C CD1 . LEU A 1 172 ? 12.870  -2.249  20.936 1.00 16.34 ? 162 LEU A CD1 1 
ATOM   1286 C CD2 . LEU A 1 172 ? 12.733  -1.880  23.438 1.00 19.79 ? 162 LEU A CD2 1 
ATOM   1287 N N   . LYS A 1 173 ? 12.006  -5.890  20.120 1.00 18.05 ? 163 LYS A N   1 
ATOM   1288 C CA  . LYS A 1 173 ? 12.829  -7.105  20.033 1.00 20.04 ? 163 LYS A CA  1 
ATOM   1289 C C   . LYS A 1 173 ? 13.977  -7.039  21.000 1.00 19.66 ? 163 LYS A C   1 
ATOM   1290 O O   . LYS A 1 173 ? 14.584  -5.987  21.172 1.00 19.79 ? 163 LYS A O   1 
ATOM   1291 C CB  . LYS A 1 173 ? 13.359  -7.351  18.592 1.00 18.56 ? 163 LYS A CB  1 
ATOM   1292 C CG  . LYS A 1 173 ? 12.241  -7.529  17.593 1.00 21.59 ? 163 LYS A CG  1 
ATOM   1293 C CD  . LYS A 1 173 ? 12.813  -7.735  16.179 1.00 24.41 ? 163 LYS A CD  1 
ATOM   1294 C CE  . LYS A 1 173 ? 13.021  -6.396  15.499 1.00 27.37 ? 163 LYS A CE  1 
ATOM   1295 N NZ  . LYS A 1 173 ? 13.324  -6.649  14.046 1.00 33.26 ? 163 LYS A NZ  1 
ATOM   1296 N N   . LEU A 1 174 ? 14.329  -8.193  21.599 1.00 19.20 ? 164 LEU A N   1 
ATOM   1297 C CA  . LEU A 1 174 ? 15.370  -8.251  22.610 1.00 19.43 ? 164 LEU A CA  1 
ATOM   1298 C C   . LEU A 1 174 ? 16.483  -9.214  22.199 1.00 21.16 ? 164 LEU A C   1 
ATOM   1299 O O   . LEU A 1 174 ? 16.224  -10.180 21.480 1.00 21.82 ? 164 LEU A O   1 
ATOM   1300 C CB  . LEU A 1 174 ? 14.749  -8.738  23.948 1.00 19.47 ? 164 LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 174 ? 13.601  -7.926  24.541 1.00 18.49 ? 164 LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 174 ? 13.215  -8.539  25.902 1.00 20.70 ? 164 LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 174 ? 14.026  -6.409  24.713 1.00 16.25 ? 164 LEU A CD2 1 
ATOM   1304 N N   . VAL A 1 175 ? 17.720  -8.918  22.610 1.00 23.06 ? 165 VAL A N   1 
ATOM   1305 C CA  . VAL A 1 175 ? 18.820  -9.882  22.486 1.00 26.60 ? 165 VAL A CA  1 
ATOM   1306 C C   . VAL A 1 175 ? 18.341  -11.177 23.173 1.00 27.79 ? 165 VAL A C   1 
ATOM   1307 O O   . VAL A 1 175 ? 17.750  -11.120 24.256 1.00 28.56 ? 165 VAL A O   1 
ATOM   1308 C CB  . VAL A 1 175 ? 20.078  -9.324  23.158 1.00 26.59 ? 165 VAL A CB  1 
ATOM   1309 C CG1 . VAL A 1 175 ? 21.206  -10.348 23.185 1.00 27.53 ? 165 VAL A CG1 1 
ATOM   1310 C CG2 . VAL A 1 175 ? 20.537  -8.028  22.437 1.00 27.00 ? 165 VAL A CG2 1 
ATOM   1311 N N   . GLY A 1 176 ? 18.512  -12.331 22.527 1.00 30.23 ? 166 GLY A N   1 
ATOM   1312 C CA  . GLY A 1 176 ? 17.942  -13.575 23.056 1.00 31.03 ? 166 GLY A CA  1 
ATOM   1313 C C   . GLY A 1 176 ? 16.665  -14.034 22.369 1.00 31.74 ? 166 GLY A C   1 
ATOM   1314 O O   . GLY A 1 176 ? 16.345  -15.232 22.391 1.00 33.75 ? 166 GLY A O   1 
ATOM   1315 N N   . GLY A 1 177 ? 15.932  -13.099 21.766 1.00 30.74 ? 167 GLY A N   1 
ATOM   1316 C CA  . GLY A 1 177 ? 14.778  -13.404 20.917 1.00 29.59 ? 167 GLY A CA  1 
ATOM   1317 C C   . GLY A 1 177 ? 13.405  -13.065 21.495 1.00 28.51 ? 167 GLY A C   1 
ATOM   1318 O O   . GLY A 1 177 ? 12.383  -13.147 20.787 1.00 29.98 ? 167 GLY A O   1 
ATOM   1319 N N   . GLY A 1 178 ? 13.374  -12.681 22.766 1.00 26.60 ? 168 GLY A N   1 
ATOM   1320 C CA  . GLY A 1 178 ? 12.135  -12.253 23.419 1.00 24.33 ? 168 GLY A CA  1 
ATOM   1321 C C   . GLY A 1 178 ? 11.657  -10.893 22.956 1.00 23.28 ? 168 GLY A C   1 
ATOM   1322 O O   . GLY A 1 178 ? 12.215  -10.296 22.023 1.00 21.65 ? 168 GLY A O   1 
ATOM   1323 N N   . HIS A 1 179 ? 10.581  -10.419 23.581 1.00 21.70 ? 169 HIS A N   1 
ATOM   1324 C CA  . HIS A 1 179 ? 10.025  -9.074  23.272 1.00 20.38 ? 169 HIS A CA  1 
ATOM   1325 C C   . HIS A 1 179 ? 9.606   -8.393  24.533 1.00 20.25 ? 169 HIS A C   1 
ATOM   1326 O O   . HIS A 1 179 ? 9.195   -9.051  25.512 1.00 18.05 ? 169 HIS A O   1 
ATOM   1327 C CB  . HIS A 1 179 ? 8.794   -9.165  22.420 1.00 20.27 ? 169 HIS A CB  1 
ATOM   1328 C CG  . HIS A 1 179 ? 9.075   -9.562  21.011 1.00 22.81 ? 169 HIS A CG  1 
ATOM   1329 N ND1 . HIS A 1 179 ? 9.179   -10.883 20.618 1.00 22.48 ? 169 HIS A ND1 1 
ATOM   1330 C CD2 . HIS A 1 179 ? 9.298   -8.817  19.904 1.00 24.19 ? 169 HIS A CD2 1 
ATOM   1331 C CE1 . HIS A 1 179 ? 9.412   -10.926 19.315 1.00 24.34 ? 169 HIS A CE1 1 
ATOM   1332 N NE2 . HIS A 1 179 ? 9.502   -9.690  18.864 1.00 24.88 ? 169 HIS A NE2 1 
ATOM   1333 N N   . LEU A 1 180 ? 9.728   -7.071  24.536 1.00 17.16 ? 170 LEU A N   1 
ATOM   1334 C CA  . LEU A 1 180 ? 9.201   -6.286  25.624 1.00 16.16 ? 170 LEU A CA  1 
ATOM   1335 C C   . LEU A 1 180 ? 8.152   -5.361  25.009 1.00 16.35 ? 170 LEU A C   1 
ATOM   1336 O O   . LEU A 1 180 ? 8.466   -4.654  24.011 1.00 16.76 ? 170 LEU A O   1 
ATOM   1337 C CB  . LEU A 1 180 ? 10.333  -5.462  26.300 1.00 14.94 ? 170 LEU A CB  1 
ATOM   1338 C CG  . LEU A 1 180 ? 9.904   -4.391  27.311 1.00 16.41 ? 170 LEU A CG  1 
ATOM   1339 C CD1 . LEU A 1 180 ? 9.249   -5.045  28.549 1.00 15.54 ? 170 LEU A CD1 1 
ATOM   1340 C CD2 . LEU A 1 180 ? 11.135  -3.509  27.761 1.00 15.94 ? 170 LEU A CD2 1 
ATOM   1341 N N   . ILE A 1 181 ? 6.927   -5.381  25.554 1.00 14.50 ? 171 ILE A N   1 
ATOM   1342 C CA  . ILE A 1 181 ? 5.820   -4.648  24.957 1.00 15.47 ? 171 ILE A CA  1 
ATOM   1343 C C   . ILE A 1 181 ? 5.639   -3.296  25.670 1.00 15.05 ? 171 ILE A C   1 
ATOM   1344 O O   . ILE A 1 181 ? 5.822   -3.163  26.894 1.00 14.37 ? 171 ILE A O   1 
ATOM   1345 C CB  . ILE A 1 181 ? 4.483   -5.508  24.881 1.00 15.89 ? 171 ILE A CB  1 
ATOM   1346 C CG1 . ILE A 1 181 ? 4.477   -6.477  23.648 1.00 19.45 ? 171 ILE A CG1 1 
ATOM   1347 C CG2 . ILE A 1 181 ? 3.207   -4.639  24.705 1.00 15.66 ? 171 ILE A CG2 1 
ATOM   1348 C CD1 . ILE A 1 181 ? 5.723   -7.228  23.315 1.00 24.23 ? 171 ILE A CD1 1 
ATOM   1349 N N   . CYS A 1 182 ? 5.292   -2.268  24.894 1.00 16.11 ? 172 CYS A N   1 
ATOM   1350 C CA  . CYS A 1 182 ? 4.882   -1.013  25.490 1.00 15.30 ? 172 CYS A CA  1 
ATOM   1351 C C   . CYS A 1 182 ? 3.559   -0.574  24.861 1.00 14.35 ? 172 CYS A C   1 
ATOM   1352 O O   . CYS A 1 182 ? 3.241   -0.971  23.723 1.00 15.93 ? 172 CYS A O   1 
ATOM   1353 C CB  . CYS A 1 182 ? 5.972   0.067   25.315 1.00 15.83 ? 172 CYS A CB  1 
ATOM   1354 S SG  . CYS A 1 182 ? 6.340   0.450   23.593 1.00 16.85 ? 172 CYS A SG  1 
ATOM   1355 N N   . ASN A 1 183 ? 2.759   0.219   25.571 1.00 14.25 ? 173 ASN A N   1 
ATOM   1356 C CA  . ASN A 1 183 ? 1.511   0.733   25.039 1.00 15.80 ? 173 ASN A CA  1 
ATOM   1357 C C   . ASN A 1 183 ? 1.602   2.258   24.925 1.00 16.42 ? 173 ASN A C   1 
ATOM   1358 O O   . ASN A 1 183 ? 2.089   2.886   25.848 1.00 16.07 ? 173 ASN A O   1 
ATOM   1359 C CB  . ASN A 1 183 ? 0.330   0.346   25.939 1.00 19.10 ? 173 ASN A CB  1 
ATOM   1360 C CG  . ASN A 1 183 ? -1.040  0.649   25.289 1.00 22.72 ? 173 ASN A CG  1 
ATOM   1361 O OD1 . ASN A 1 183 ? -2.013  0.990   25.979 1.00 30.44 ? 173 ASN A OD1 1 
ATOM   1362 N ND2 . ASN A 1 183 ? -1.123  0.514   23.978 1.00 28.23 ? 173 ASN A ND2 1 
ATOM   1363 N N   . LEU A 1 184 ? 1.145   2.804   23.808 1.00 16.73 ? 174 LEU A N   1 
ATOM   1364 C CA  . LEU A 1 184 ? 1.217   4.271   23.502 1.00 14.71 ? 174 LEU A CA  1 
ATOM   1365 C C   . LEU A 1 184 ? -0.166  4.903   23.492 1.00 15.87 ? 174 LEU A C   1 
ATOM   1366 O O   . LEU A 1 184 ? -1.094  4.394   22.819 1.00 16.67 ? 174 LEU A O   1 
ATOM   1367 C CB  . LEU A 1 184 ? 1.834   4.450   22.097 1.00 15.21 ? 174 LEU A CB  1 
ATOM   1368 C CG  . LEU A 1 184 ? 3.325   4.240   21.862 1.00 16.11 ? 174 LEU A CG  1 
ATOM   1369 C CD1 . LEU A 1 184 ? 3.827   2.816   22.028 1.00 18.42 ? 174 LEU A CD1 1 
ATOM   1370 C CD2 . LEU A 1 184 ? 3.677   4.712   20.477 1.00 15.87 ? 174 LEU A CD2 1 
ATOM   1371 N N   . LYS A 1 185 ? -0.334  6.007   24.234 1.00 15.50 ? 175 LYS A N   1 
ATOM   1372 C CA  . LYS A 1 185 ? -1.538  6.859   24.144 1.00 16.55 ? 175 LYS A CA  1 
ATOM   1373 C C   . LYS A 1 185 ? -1.037  8.182   23.657 1.00 17.25 ? 175 LYS A C   1 
ATOM   1374 O O   . LYS A 1 185 ? -0.140  8.761   24.304 1.00 16.36 ? 175 LYS A O   1 
ATOM   1375 C CB  . LYS A 1 185 ? -2.189  7.024   25.531 1.00 16.68 ? 175 LYS A CB  1 
ATOM   1376 C CG  . LYS A 1 185 ? -2.546  5.599   26.143 1.00 21.25 ? 175 LYS A CG  1 
ATOM   1377 C CD  . LYS A 1 185 ? -3.213  5.788   27.496 1.00 28.98 ? 175 LYS A CD  1 
ATOM   1378 C CE  . LYS A 1 185 ? -3.316  4.462   28.232 1.00 32.67 ? 175 LYS A CE  1 
ATOM   1379 N NZ  . LYS A 1 185 ? -3.706  4.588   29.691 1.00 36.63 ? 175 LYS A NZ  1 
ATOM   1380 N N   . THR A 1 186 ? -1.596  8.618   22.534 1.00 17.39 ? 176 THR A N   1 
ATOM   1381 C CA  . THR A 1 186 ? -1.173  9.828   21.851 1.00 17.40 ? 176 THR A CA  1 
ATOM   1382 C C   . THR A 1 186 ? -2.327  10.754  21.642 1.00 17.62 ? 176 THR A C   1 
ATOM   1383 O O   . THR A 1 186 ? -3.427  10.349  21.266 1.00 17.39 ? 176 THR A O   1 
ATOM   1384 C CB  . THR A 1 186 ? -0.503  9.557   20.469 1.00 17.53 ? 176 THR A CB  1 
ATOM   1385 O OG1 . THR A 1 186 ? 0.451   8.485   20.578 1.00 18.43 ? 176 THR A OG1 1 
ATOM   1386 C CG2 . THR A 1 186 ? 0.245   10.873  19.970 1.00 17.08 ? 176 THR A CG2 1 
ATOM   1387 N N   . THR A 1 187 ? -2.060  12.039  21.835 1.00 17.69 ? 177 THR A N   1 
ATOM   1388 C CA  . THR A 1 187 ? -3.080  13.059  21.556 1.00 18.57 ? 177 THR A CA  1 
ATOM   1389 C C   . THR A 1 187 ? -2.557  13.971  20.448 1.00 19.45 ? 177 THR A C   1 
ATOM   1390 O O   . THR A 1 187 ? -1.429  14.491  20.561 1.00 20.11 ? 177 THR A O   1 
ATOM   1391 C CB  . THR A 1 187 ? -3.332  13.927  22.820 1.00 19.49 ? 177 THR A CB  1 
ATOM   1392 O OG1 . THR A 1 187 ? -3.669  13.105  23.961 1.00 20.60 ? 177 THR A OG1 1 
ATOM   1393 C CG2 . THR A 1 187 ? -4.470  14.925  22.532 1.00 20.12 ? 177 THR A CG2 1 
ATOM   1394 N N   . TYR A 1 188 ? -3.333  14.143  19.384 1.00 18.72 ? 178 TYR A N   1 
ATOM   1395 C CA  . TYR A 1 188 ? -2.926  14.939  18.267 1.00 18.66 ? 178 TYR A CA  1 
ATOM   1396 C C   . TYR A 1 188 ? -3.802  16.161  18.191 1.00 20.02 ? 178 TYR A C   1 
ATOM   1397 O O   . TYR A 1 188 ? -5.032  16.056  18.176 1.00 18.90 ? 178 TYR A O   1 
ATOM   1398 C CB  . TYR A 1 188 ? -3.033  14.164  16.931 1.00 19.45 ? 178 TYR A CB  1 
ATOM   1399 C CG  . TYR A 1 188 ? -2.218  12.885  16.896 1.00 16.55 ? 178 TYR A CG  1 
ATOM   1400 C CD1 . TYR A 1 188 ? -0.847  12.916  16.669 1.00 16.39 ? 178 TYR A CD1 1 
ATOM   1401 C CD2 . TYR A 1 188 ? -2.820  11.659  17.139 1.00 18.82 ? 178 TYR A CD2 1 
ATOM   1402 C CE1 . TYR A 1 188 ? -0.079  11.760  16.647 1.00 15.75 ? 178 TYR A CE1 1 
ATOM   1403 C CE2 . TYR A 1 188 ? -2.045  10.455  17.118 1.00 16.00 ? 178 TYR A CE2 1 
ATOM   1404 C CZ  . TYR A 1 188 ? -0.709  10.516  16.867 1.00 18.22 ? 178 TYR A CZ  1 
ATOM   1405 O OH  . TYR A 1 188 ? 0.036   9.344   16.855 1.00 17.71 ? 178 TYR A OH  1 
ATOM   1406 N N   . ARG A 1 189 ? -3.180  17.332  18.071 1.00 22.57 ? 179 ARG A N   1 
ATOM   1407 C CA  . ARG A 1 189 ? -3.975  18.569  18.078 1.00 23.66 ? 179 ARG A CA  1 
ATOM   1408 C C   . ARG A 1 189 ? -3.567  19.470  16.923 1.00 23.40 ? 179 ARG A C   1 
ATOM   1409 O O   . ARG A 1 189 ? -2.375  19.669  16.683 1.00 24.35 ? 179 ARG A O   1 
ATOM   1410 C CB  . ARG A 1 189 ? -3.786  19.336  19.395 1.00 24.01 ? 179 ARG A CB  1 
ATOM   1411 C CG  . ARG A 1 189 ? -3.971  18.518  20.691 1.00 26.75 ? 179 ARG A CG  1 
ATOM   1412 C CD  . ARG A 1 189 ? -5.438  18.214  20.931 1.00 32.12 ? 179 ARG A CD  1 
ATOM   1413 N NE  . ARG A 1 189 ? -6.212  19.447  20.941 1.00 34.32 ? 179 ARG A NE  1 
ATOM   1414 C CZ  . ARG A 1 189 ? -7.532  19.490  21.048 1.00 36.75 ? 179 ARG A CZ  1 
ATOM   1415 N NH1 . ARG A 1 189 ? -8.239  18.365  21.158 1.00 37.55 ? 179 ARG A NH1 1 
ATOM   1416 N NH2 . ARG A 1 189 ? -8.141  20.670  21.046 1.00 37.97 ? 179 ARG A NH2 1 
ATOM   1417 N N   . SER A 1 190 ? -4.552  20.015  16.218 1.00 23.92 ? 180 SER A N   1 
ATOM   1418 C CA  . SER A 1 190 ? -4.251  20.849  15.066 1.00 25.26 ? 180 SER A CA  1 
ATOM   1419 C C   . SER A 1 190 ? -4.116  22.318  15.501 1.00 26.68 ? 180 SER A C   1 
ATOM   1420 O O   . SER A 1 190 ? -4.818  22.764  16.377 1.00 27.69 ? 180 SER A O   1 
ATOM   1421 C CB  . SER A 1 190 ? -5.338  20.700  14.014 1.00 25.63 ? 180 SER A CB  1 
ATOM   1422 O OG  . SER A 1 190 ? -5.027  21.454  12.856 1.00 25.19 ? 180 SER A OG  1 
ATOM   1423 N N   . LYS A 1 191 ? -3.175  23.036  14.911 1.00 28.37 ? 181 LYS A N   1 
ATOM   1424 C CA  . LYS A 1 191 ? -3.051  24.484  15.128 1.00 30.27 ? 181 LYS A CA  1 
ATOM   1425 C C   . LYS A 1 191 ? -3.976  25.297  14.190 1.00 32.13 ? 181 LYS A C   1 
ATOM   1426 O O   . LYS A 1 191 ? -4.060  26.534  14.289 1.00 32.91 ? 181 LYS A O   1 
ATOM   1427 C CB  . LYS A 1 191 ? -1.580  24.909  15.020 1.00 29.16 ? 181 LYS A CB  1 
ATOM   1428 C CG  . LYS A 1 191 ? -0.712  24.613  16.283 1.00 28.70 ? 181 LYS A CG  1 
ATOM   1429 C CD  . LYS A 1 191 ? 0.750   25.100  16.094 1.00 30.49 ? 181 LYS A CD  1 
ATOM   1430 C CE  . LYS A 1 191 ? 1.690   24.008  15.507 1.00 31.53 ? 181 LYS A CE  1 
ATOM   1431 N NZ  . LYS A 1 191 ? 2.979   24.437  14.782 1.00 27.96 ? 181 LYS A NZ  1 
ATOM   1432 N N   . LYS A 1 192 ? -4.667  24.612  13.284 1.00 33.08 ? 182 LYS A N   1 
ATOM   1433 C CA  . LYS A 1 192 ? -5.630  25.244  12.397 1.00 34.95 ? 182 LYS A CA  1 
ATOM   1434 C C   . LYS A 1 192 ? -7.010  25.190  13.042 1.00 36.55 ? 182 LYS A C   1 
ATOM   1435 O O   . LYS A 1 192 ? -7.342  24.191  13.678 1.00 37.41 ? 182 LYS A O   1 
ATOM   1436 C CB  . LYS A 1 192 ? -5.661  24.508  11.058 1.00 35.06 ? 182 LYS A CB  1 
ATOM   1437 C CG  . LYS A 1 192 ? -6.605  25.090  10.040 1.00 34.82 ? 182 LYS A CG  1 
ATOM   1438 C CD  . LYS A 1 192 ? -6.566  24.323  8.737  1.00 34.95 ? 182 LYS A CD  1 
ATOM   1439 C CE  . LYS A 1 192 ? -5.364  24.725  7.947  1.00 30.98 ? 182 LYS A CE  1 
ATOM   1440 N NZ  . LYS A 1 192 ? -5.616  24.408  6.564  1.00 32.64 ? 182 LYS A NZ  1 
ATOM   1441 N N   . PRO A 1 193 ? -7.820  26.265  12.885 1.00 37.80 ? 183 PRO A N   1 
ATOM   1442 C CA  . PRO A 1 193 ? -9.175  26.311  13.458 1.00 38.83 ? 183 PRO A CA  1 
ATOM   1443 C C   . PRO A 1 193 ? -10.030 25.117  13.044 1.00 39.87 ? 183 PRO A C   1 
ATOM   1444 O O   . PRO A 1 193 ? -9.966  24.664  11.890 1.00 40.53 ? 183 PRO A O   1 
ATOM   1445 C CB  . PRO A 1 193 ? -9.770  27.592  12.854 1.00 39.17 ? 183 PRO A CB  1 
ATOM   1446 C CG  . PRO A 1 193 ? -8.576  28.453  12.512 1.00 38.61 ? 183 PRO A CG  1 
ATOM   1447 C CD  . PRO A 1 193 ? -7.476  27.501  12.156 1.00 37.38 ? 183 PRO A CD  1 
ATOM   1448 N N   . ALA A 1 194 ? -10.863 24.645  13.960 1.00 41.17 ? 184 ALA A N   1 
ATOM   1449 C CA  . ALA A 1 194 ? -11.733 23.490  13.694 1.00 42.30 ? 184 ALA A CA  1 
ATOM   1450 C C   . ALA A 1 194 ? -12.688 23.659  12.509 1.00 43.23 ? 184 ALA A C   1 
ATOM   1451 O O   . ALA A 1 194 ? -13.094 22.662  11.900 1.00 43.76 ? 184 ALA A O   1 
ATOM   1452 C CB  . ALA A 1 194 ? -12.495 23.107  14.937 1.00 42.55 ? 184 ALA A CB  1 
ATOM   1453 N N   . LYS A 1 195 ? -13.047 24.902  12.168 1.00 43.95 ? 185 LYS A N   1 
ATOM   1454 C CA  . LYS A 1 195 ? -13.985 25.129  11.040 1.00 44.13 ? 185 LYS A CA  1 
ATOM   1455 C C   . LYS A 1 195 ? -13.342 24.859  9.665  1.00 43.26 ? 185 LYS A C   1 
ATOM   1456 O O   . LYS A 1 195 ? -14.039 24.575  8.680  1.00 43.31 ? 185 LYS A O   1 
ATOM   1457 C CB  . LYS A 1 195 ? -14.674 26.514  11.106 1.00 44.28 ? 185 LYS A CB  1 
ATOM   1458 C CG  . LYS A 1 195 ? -13.766 27.743  11.033 1.00 45.91 ? 185 LYS A CG  1 
ATOM   1459 C CD  . LYS A 1 195 ? -14.532 29.006  10.546 1.00 45.77 ? 185 LYS A CD  1 
ATOM   1460 C CE  . LYS A 1 195 ? -14.842 28.956  9.024  1.00 48.37 ? 185 LYS A CE  1 
ATOM   1461 N NZ  . LYS A 1 195 ? -15.404 30.230  8.455  1.00 48.73 ? 185 LYS A NZ  1 
ATOM   1462 N N   . ASN A 1 196 ? -12.018 24.936  9.606  1.00 41.65 ? 186 ASN A N   1 
ATOM   1463 C CA  . ASN A 1 196 ? -11.306 24.694  8.373  1.00 41.05 ? 186 ASN A CA  1 
ATOM   1464 C C   . ASN A 1 196 ? -10.824 23.256  8.198  1.00 40.01 ? 186 ASN A C   1 
ATOM   1465 O O   . ASN A 1 196 ? -10.086 22.984  7.258  1.00 39.18 ? 186 ASN A O   1 
ATOM   1466 C CB  . ASN A 1 196 ? -10.093 25.629  8.259  1.00 41.89 ? 186 ASN A CB  1 
ATOM   1467 C CG  . ASN A 1 196 ? -10.471 27.065  7.911  1.00 45.05 ? 186 ASN A CG  1 
ATOM   1468 O OD1 . ASN A 1 196 ? -11.646 27.398  7.701  1.00 48.12 ? 186 ASN A OD1 1 
ATOM   1469 N ND2 . ASN A 1 196 ? -9.456  27.928  7.827  1.00 48.07 ? 186 ASN A ND2 1 
ATOM   1470 N N   . LEU A 1 197 ? -11.234 22.348  9.085  1.00 38.80 ? 187 LEU A N   1 
ATOM   1471 C CA  . LEU A 1 197 ? -10.742 20.950  9.043  1.00 37.53 ? 187 LEU A CA  1 
ATOM   1472 C C   . LEU A 1 197 ? -11.862 19.944  8.861  1.00 36.44 ? 187 LEU A C   1 
ATOM   1473 O O   . LEU A 1 197 ? -12.898 20.028  9.529  1.00 36.87 ? 187 LEU A O   1 
ATOM   1474 C CB  . LEU A 1 197 ? -9.992  20.564  10.332 1.00 37.61 ? 187 LEU A CB  1 
ATOM   1475 C CG  . LEU A 1 197 ? -8.750  21.238  10.890 1.00 36.77 ? 187 LEU A CG  1 
ATOM   1476 C CD1 . LEU A 1 197 ? -8.607  20.748  12.317 1.00 36.48 ? 187 LEU A CD1 1 
ATOM   1477 C CD2 . LEU A 1 197 ? -7.478  20.929  10.086 1.00 37.52 ? 187 LEU A CD2 1 
ATOM   1478 N N   . LYS A 1 198 ? -11.637 18.983  7.972  1.00 35.78 ? 188 LYS A N   1 
ATOM   1479 C CA  . LYS A 1 198 ? -12.529 17.845  7.839  1.00 35.96 ? 188 LYS A CA  1 
ATOM   1480 C C   . LYS A 1 198 ? -11.991 16.657  8.657  1.00 34.81 ? 188 LYS A C   1 
ATOM   1481 O O   . LYS A 1 198 ? -10.947 16.084  8.342  1.00 34.45 ? 188 LYS A O   1 
ATOM   1482 C CB  . LYS A 1 198 ? -12.738 17.452  6.368  1.00 35.54 ? 188 LYS A CB  1 
ATOM   1483 C CG  . LYS A 1 198 ? -13.718 16.269  6.226  1.00 38.04 ? 188 LYS A CG  1 
ATOM   1484 C CD  . LYS A 1 198 ? -13.714 15.660  4.825  1.00 37.56 ? 188 LYS A CD  1 
ATOM   1485 C CE  . LYS A 1 198 ? -14.678 14.493  4.762  1.00 43.09 ? 188 LYS A CE  1 
ATOM   1486 N NZ  . LYS A 1 198 ? -14.628 13.847  3.418  1.00 43.58 ? 188 LYS A NZ  1 
ATOM   1487 N N   . MET A 1 199 ? -12.730 16.296  9.700  1.00 34.56 ? 189 MET A N   1 
ATOM   1488 C CA  . MET A 1 199 ? -12.311 15.239  10.607 1.00 33.50 ? 189 MET A CA  1 
ATOM   1489 C C   . MET A 1 199 ? -12.472 13.847  9.982  1.00 32.78 ? 189 MET A C   1 
ATOM   1490 O O   . MET A 1 199 ? -13.411 13.608  9.229  1.00 32.13 ? 189 MET A O   1 
ATOM   1491 C CB  . MET A 1 199 ? -13.080 15.331  11.926 1.00 33.82 ? 189 MET A CB  1 
ATOM   1492 C CG  . MET A 1 199 ? -12.739 16.533  12.808 1.00 35.67 ? 189 MET A CG  1 
ATOM   1493 S SD  . MET A 1 199 ? -10.981 16.700  13.229 1.00 37.77 ? 189 MET A SD  1 
ATOM   1494 C CE  . MET A 1 199 ? -10.760 15.469  14.543 1.00 32.49 ? 189 MET A CE  1 
ATOM   1495 N N   . PRO A 1 200 ? -11.532 12.925  10.263 1.00 31.99 ? 190 PRO A N   1 
ATOM   1496 C CA  . PRO A 1 200 ? -11.774 11.520  9.908  1.00 31.10 ? 190 PRO A CA  1 
ATOM   1497 C C   . PRO A 1 200 ? -12.638 10.788  10.936 1.00 30.01 ? 190 PRO A C   1 
ATOM   1498 O O   . PRO A 1 200 ? -12.836 11.270  12.039 1.00 31.11 ? 190 PRO A O   1 
ATOM   1499 C CB  . PRO A 1 200 ? -10.368 10.919  9.901  1.00 31.04 ? 190 PRO A CB  1 
ATOM   1500 C CG  . PRO A 1 200 ? -9.624  11.732  10.991 1.00 30.75 ? 190 PRO A CG  1 
ATOM   1501 C CD  . PRO A 1 200 ? -10.180 13.138  10.846 1.00 32.69 ? 190 PRO A CD  1 
ATOM   1502 N N   . GLY A 1 201 ? -13.156 9.634   10.553 1.00 30.42 ? 191 GLY A N   1 
ATOM   1503 C CA  . GLY A 1 201 ? -13.834 8.704   11.483 1.00 29.27 ? 191 GLY A CA  1 
ATOM   1504 C C   . GLY A 1 201 ? -12.734 7.835   12.080 1.00 28.22 ? 191 GLY A C   1 
ATOM   1505 O O   . GLY A 1 201 ? -11.550 8.186   11.982 1.00 27.52 ? 191 GLY A O   1 
ATOM   1506 N N   . VAL A 1 202 ? -13.102 6.716   12.703 1.00 26.82 ? 192 VAL A N   1 
ATOM   1507 C CA  . VAL A 1 202 ? -12.107 5.826   13.246 1.00 25.56 ? 192 VAL A CA  1 
ATOM   1508 C C   . VAL A 1 202 ? -11.351 5.184   12.108 1.00 25.42 ? 192 VAL A C   1 
ATOM   1509 O O   . VAL A 1 202 ? -11.950 4.702   11.137 1.00 26.27 ? 192 VAL A O   1 
ATOM   1510 C CB  . VAL A 1 202 ? -12.726 4.711   14.129 1.00 25.79 ? 192 VAL A CB  1 
ATOM   1511 C CG1 . VAL A 1 202 ? -11.620 3.695   14.589 1.00 27.23 ? 192 VAL A CG1 1 
ATOM   1512 C CG2 . VAL A 1 202 ? -13.500 5.300   15.321 1.00 25.32 ? 192 VAL A CG2 1 
ATOM   1513 N N   . TYR A 1 203 ? -10.035 5.129   12.221 1.00 23.39 ? 193 TYR A N   1 
ATOM   1514 C CA  . TYR A 1 203 ? -9.241  4.450   11.214 1.00 21.14 ? 193 TYR A CA  1 
ATOM   1515 C C   . TYR A 1 203 ? -7.918  3.902   11.777 1.00 20.85 ? 193 TYR A C   1 
ATOM   1516 O O   . TYR A 1 203 ? -7.665  3.993   12.987 1.00 20.71 ? 193 TYR A O   1 
ATOM   1517 C CB  . TYR A 1 203 ? -9.006  5.312   9.981  1.00 21.42 ? 193 TYR A CB  1 
ATOM   1518 C CG  . TYR A 1 203 ? -7.996  6.453   10.145 1.00 21.66 ? 193 TYR A CG  1 
ATOM   1519 C CD1 . TYR A 1 203 ? -8.389  7.641   10.749 1.00 22.97 ? 193 TYR A CD1 1 
ATOM   1520 C CD2 . TYR A 1 203 ? -6.688  6.341   9.684  1.00 18.48 ? 193 TYR A CD2 1 
ATOM   1521 C CE1 . TYR A 1 203 ? -7.515  8.704   10.888 1.00 21.59 ? 193 TYR A CE1 1 
ATOM   1522 C CE2 . TYR A 1 203 ? -5.752  7.425   9.821  1.00 19.94 ? 193 TYR A CE2 1 
ATOM   1523 C CZ  . TYR A 1 203 ? -6.218  8.608   10.436 1.00 22.27 ? 193 TYR A CZ  1 
ATOM   1524 O OH  . TYR A 1 203 ? -5.386  9.710   10.592 1.00 23.24 ? 193 TYR A OH  1 
ATOM   1525 N N   . TYR A 1 204 ? -7.091  3.347   10.897 1.00 19.94 ? 194 TYR A N   1 
ATOM   1526 C CA  . TYR A 1 204 ? -5.933  2.540   11.324 1.00 19.87 ? 194 TYR A CA  1 
ATOM   1527 C C   . TYR A 1 204 ? -4.712  2.869   10.484 1.00 20.70 ? 194 TYR A C   1 
ATOM   1528 O O   . TYR A 1 204 ? -4.818  3.072   9.265  1.00 22.52 ? 194 TYR A O   1 
ATOM   1529 C CB  . TYR A 1 204 ? -6.267  1.010   11.301 1.00 19.97 ? 194 TYR A CB  1 
ATOM   1530 C CG  . TYR A 1 204 ? -7.545  0.694   12.057 1.00 17.52 ? 194 TYR A CG  1 
ATOM   1531 C CD1 . TYR A 1 204 ? -8.782  0.800   11.433 1.00 20.08 ? 194 TYR A CD1 1 
ATOM   1532 C CD2 . TYR A 1 204 ? -7.526  0.396   13.419 1.00 18.11 ? 194 TYR A CD2 1 
ATOM   1533 C CE1 . TYR A 1 204 ? -9.977  0.584   12.144 1.00 16.90 ? 194 TYR A CE1 1 
ATOM   1534 C CE2 . TYR A 1 204 ? -8.725  0.160   14.129 1.00 19.15 ? 194 TYR A CE2 1 
ATOM   1535 C CZ  . TYR A 1 204 ? -9.912  0.264   13.494 1.00 17.74 ? 194 TYR A CZ  1 
ATOM   1536 O OH  . TYR A 1 204 ? -11.048 0.068   14.218 1.00 21.11 ? 194 TYR A OH  1 
ATOM   1537 N N   . VAL A 1 205 ? -3.556  2.919   11.128 1.00 17.93 ? 195 VAL A N   1 
ATOM   1538 C CA  . VAL A 1 205 ? -2.321  3.101   10.440 1.00 19.16 ? 195 VAL A CA  1 
ATOM   1539 C C   . VAL A 1 205 ? -1.377  1.937   10.729 1.00 18.75 ? 195 VAL A C   1 
ATOM   1540 O O   . VAL A 1 205 ? -1.050  1.649   11.896 1.00 19.55 ? 195 VAL A O   1 
ATOM   1541 C CB  . VAL A 1 205 ? -1.606  4.419   10.879 1.00 19.22 ? 195 VAL A CB  1 
ATOM   1542 C CG1 . VAL A 1 205 ? -0.264  4.587   10.211 1.00 20.26 ? 195 VAL A CG1 1 
ATOM   1543 C CG2 . VAL A 1 205 ? -2.523  5.619   10.604 1.00 18.55 ? 195 VAL A CG2 1 
ATOM   1544 N N   . ASP A 1 206 ? -0.919  1.298   9.656  1.00 19.27 ? 196 ASP A N   1 
ATOM   1545 C CA  . ASP A 1 206 ? 0.059   0.223   9.757  1.00 18.51 ? 196 ASP A CA  1 
ATOM   1546 C C   . ASP A 1 206 ? 1.392   0.856   9.465  1.00 18.48 ? 196 ASP A C   1 
ATOM   1547 O O   . ASP A 1 206 ? 1.511   1.659   8.533  1.00 19.19 ? 196 ASP A O   1 
ATOM   1548 C CB  . ASP A 1 206 ? -0.219  -0.829  8.685  1.00 18.69 ? 196 ASP A CB  1 
ATOM   1549 C CG  . ASP A 1 206 ? -1.603  -1.540  8.858  1.00 20.67 ? 196 ASP A CG  1 
ATOM   1550 O OD1 . ASP A 1 206 ? -2.087  -1.763  9.990  1.00 23.62 ? 196 ASP A OD1 1 
ATOM   1551 O OD2 . ASP A 1 206 ? -2.210  -1.887  7.827  1.00 24.86 ? 196 ASP A OD2 1 
ATOM   1552 N N   . ARG A 1 207 ? 2.402   0.517   10.245 1.00 18.14 ? 197 ARG A N   1 
ATOM   1553 C CA  . ARG A 1 207 ? 3.729   1.053   9.984  1.00 19.89 ? 197 ARG A CA  1 
ATOM   1554 C C   . ARG A 1 207 ? 4.853   0.116   10.316 1.00 19.92 ? 197 ARG A C   1 
ATOM   1555 O O   . ARG A 1 207 ? 4.726   -0.721  11.215 1.00 19.92 ? 197 ARG A O   1 
ATOM   1556 C CB  . ARG A 1 207 ? 3.903   2.309   10.800 1.00 20.80 ? 197 ARG A CB  1 
ATOM   1557 C CG  . ARG A 1 207 ? 4.168   2.029   12.222 1.00 25.55 ? 197 ARG A CG  1 
ATOM   1558 C CD  . ARG A 1 207 ? 4.644   3.310   12.890 1.00 35.79 ? 197 ARG A CD  1 
ATOM   1559 N NE  . ARG A 1 207 ? 3.555   4.180   13.329 1.00 34.58 ? 197 ARG A NE  1 
ATOM   1560 C CZ  . ARG A 1 207 ? 2.357   3.799   13.793 1.00 38.82 ? 197 ARG A CZ  1 
ATOM   1561 N NH1 . ARG A 1 207 ? 1.959   2.519   13.840 1.00 33.36 ? 197 ARG A NH1 1 
ATOM   1562 N NH2 . ARG A 1 207 ? 1.525   4.751   14.178 1.00 34.48 ? 197 ARG A NH2 1 
ATOM   1563 N N   . ARG A 1 208 ? 5.985   0.323   9.644  1.00 17.52 ? 198 ARG A N   1 
ATOM   1564 C CA  . ARG A 1 208 ? 7.240   -0.258  10.024 1.00 19.58 ? 198 ARG A CA  1 
ATOM   1565 C C   . ARG A 1 208 ? 8.173   0.892   10.404 1.00 21.50 ? 198 ARG A C   1 
ATOM   1566 O O   . ARG A 1 208 ? 8.187   1.906   9.717  1.00 21.28 ? 198 ARG A O   1 
ATOM   1567 C CB  . ARG A 1 208 ? 7.884   -0.978  8.862  1.00 18.64 ? 198 ARG A CB  1 
ATOM   1568 C CG  . ARG A 1 208 ? 7.127   -2.161  8.349  1.00 21.99 ? 198 ARG A CG  1 
ATOM   1569 C CD  . ARG A 1 208 ? 8.037   -2.896  7.405  1.00 23.22 ? 198 ARG A CD  1 
ATOM   1570 N NE  . ARG A 1 208 ? 7.335   -4.021  6.770  1.00 23.54 ? 198 ARG A NE  1 
ATOM   1571 C CZ  . ARG A 1 208 ? 7.244   -5.235  7.307  1.00 24.90 ? 198 ARG A CZ  1 
ATOM   1572 N NH1 . ARG A 1 208 ? 7.793   -5.501  8.495  1.00 21.39 ? 198 ARG A NH1 1 
ATOM   1573 N NH2 . ARG A 1 208 ? 6.615   -6.189  6.632  1.00 24.46 ? 198 ARG A NH2 1 
ATOM   1574 N N   . LEU A 1 209 ? 8.932   0.694   11.471 1.00 21.33 ? 199 LEU A N   1 
ATOM   1575 C CA  . LEU A 1 209 ? 9.941   1.631   11.923 1.00 23.85 ? 199 LEU A CA  1 
ATOM   1576 C C   . LEU A 1 209 ? 11.251  0.876   11.957 1.00 24.87 ? 199 LEU A C   1 
ATOM   1577 O O   . LEU A 1 209 ? 11.417  -0.087  12.728 1.00 26.56 ? 199 LEU A O   1 
ATOM   1578 C CB  . LEU A 1 209 ? 9.546   2.145   13.311 1.00 22.95 ? 199 LEU A CB  1 
ATOM   1579 C CG  . LEU A 1 209 ? 10.264  3.288   14.051 1.00 25.08 ? 199 LEU A CG  1 
ATOM   1580 C CD1 . LEU A 1 209 ? 10.364  4.513   13.193 1.00 27.48 ? 199 LEU A CD1 1 
ATOM   1581 C CD2 . LEU A 1 209 ? 9.516   3.622   15.345 1.00 24.80 ? 199 LEU A CD2 1 
ATOM   1582 N N   . GLU A 1 210 ? 12.194  1.289   11.121 1.00 26.29 ? 200 GLU A N   1 
ATOM   1583 C CA  . GLU A 1 210 ? 13.415  0.523   10.910 1.00 28.78 ? 200 GLU A CA  1 
ATOM   1584 C C   . GLU A 1 210 ? 14.696  1.322   11.089 1.00 29.82 ? 200 GLU A C   1 
ATOM   1585 O O   . GLU A 1 210 ? 14.813  2.428   10.565 1.00 28.91 ? 200 GLU A O   1 
ATOM   1586 C CB  . GLU A 1 210 ? 13.396  -0.098  9.507  1.00 28.30 ? 200 GLU A CB  1 
ATOM   1587 C CG  . GLU A 1 210 ? 12.089  -0.832  9.223  1.00 31.23 ? 200 GLU A CG  1 
ATOM   1588 C CD  . GLU A 1 210 ? 11.887  -1.256  7.764  1.00 32.66 ? 200 GLU A CD  1 
ATOM   1589 O OE1 . GLU A 1 210 ? 11.894  -0.390  6.856  1.00 35.40 ? 200 GLU A OE1 1 
ATOM   1590 O OE2 . GLU A 1 210 ? 11.649  -2.467  7.544  1.00 36.51 ? 200 GLU A OE2 1 
ATOM   1591 N N   . ARG A 1 211 ? 15.661  0.736   11.806 1.00 29.46 ? 201 ARG A N   1 
ATOM   1592 C CA  . ARG A 1 211 ? 16.977  1.309   11.921 1.00 30.90 ? 201 ARG A CA  1 
ATOM   1593 C C   . ARG A 1 211 ? 17.754  0.752   10.765 1.00 31.19 ? 201 ARG A C   1 
ATOM   1594 O O   . ARG A 1 211 ? 17.899  -0.465  10.623 1.00 32.74 ? 201 ARG A O   1 
ATOM   1595 C CB  . ARG A 1 211 ? 17.677  0.930   13.218 1.00 30.88 ? 201 ARG A CB  1 
ATOM   1596 C CG  . ARG A 1 211 ? 19.179  1.299   13.196 1.00 32.54 ? 201 ARG A CG  1 
ATOM   1597 C CD  . ARG A 1 211 ? 19.778  1.359   14.568 1.00 33.26 ? 201 ARG A CD  1 
ATOM   1598 N NE  . ARG A 1 211 ? 18.760  1.897   15.450 1.00 38.14 ? 201 ARG A NE  1 
ATOM   1599 C CZ  . ARG A 1 211 ? 18.810  1.925   16.776 1.00 36.09 ? 201 ARG A CZ  1 
ATOM   1600 N NH1 . ARG A 1 211 ? 19.887  1.475   17.429 1.00 34.37 ? 201 ARG A NH1 1 
ATOM   1601 N NH2 . ARG A 1 211 ? 17.767  2.422   17.426 1.00 30.22 ? 201 ARG A NH2 1 
ATOM   1602 N N   . ILE A 1 212 ? 18.237  1.655   9.926  1.00 31.80 ? 202 ILE A N   1 
ATOM   1603 C CA  . ILE A 1 212 ? 18.922  1.301   8.705  1.00 32.48 ? 202 ILE A CA  1 
ATOM   1604 C C   . ILE A 1 212 ? 20.392  1.106   9.027  1.00 33.30 ? 202 ILE A C   1 
ATOM   1605 O O   . ILE A 1 212 ? 20.984  0.110   8.621  1.00 34.70 ? 202 ILE A O   1 
ATOM   1606 C CB  . ILE A 1 212 ? 18.699  2.394   7.616  1.00 32.50 ? 202 ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 212 ? 17.211  2.504   7.213  1.00 31.90 ? 202 ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 212 ? 19.654  2.207   6.384  1.00 33.51 ? 202 ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 212 ? 16.459  1.165   7.023  1.00 33.08 ? 202 ILE A CD1 1 
ATOM   1610 N N   . LYS A 1 213 ? 20.981  2.046   9.766  1.00 33.72 ? 203 LYS A N   1 
ATOM   1611 C CA  . LYS A 1 213 ? 22.354  1.907   10.254 1.00 35.01 ? 203 LYS A CA  1 
ATOM   1612 C C   . LYS A 1 213 ? 22.616  2.810   11.464 1.00 34.51 ? 203 LYS A C   1 
ATOM   1613 O O   . LYS A 1 213 ? 21.839  3.714   11.764 1.00 33.32 ? 203 LYS A O   1 
ATOM   1614 C CB  . LYS A 1 213 ? 23.385  2.143   9.129  1.00 35.12 ? 203 LYS A CB  1 
ATOM   1615 C CG  . LYS A 1 213 ? 23.659  3.600   8.784  1.00 37.31 ? 203 LYS A CG  1 
ATOM   1616 C CD  . LYS A 1 213 ? 24.351  3.759   7.405  1.00 36.89 ? 203 LYS A CD  1 
ATOM   1617 C CE  . LYS A 1 213 ? 25.165  5.062   7.357  1.00 41.26 ? 203 LYS A CE  1 
ATOM   1618 N NZ  . LYS A 1 213 ? 25.815  5.369   6.034  1.00 40.44 ? 203 LYS A NZ  1 
ATOM   1619 N N   . GLU A 1 214 ? 23.685  2.486   12.177 1.00 35.24 ? 204 GLU A N   1 
ATOM   1620 C CA  . GLU A 1 214 ? 24.176  3.241   13.327 1.00 36.25 ? 204 GLU A CA  1 
ATOM   1621 C C   . GLU A 1 214 ? 25.697  3.301   13.262 1.00 36.85 ? 204 GLU A C   1 
ATOM   1622 O O   . GLU A 1 214 ? 26.340  2.401   12.689 1.00 36.59 ? 204 GLU A O   1 
ATOM   1623 C CB  . GLU A 1 214 ? 23.713  2.617   14.666 1.00 36.17 ? 204 GLU A CB  1 
ATOM   1624 C CG  . GLU A 1 214 ? 24.475  1.342   15.147 1.00 36.66 ? 204 GLU A CG  1 
ATOM   1625 C CD  . GLU A 1 214 ? 25.716  1.620   16.025 1.00 38.46 ? 204 GLU A CD  1 
ATOM   1626 O OE1 . GLU A 1 214 ? 25.908  2.745   16.533 1.00 38.45 ? 204 GLU A OE1 1 
ATOM   1627 O OE2 . GLU A 1 214 ? 26.506  0.687   16.234 1.00 40.57 ? 204 GLU A OE2 1 
ATOM   1628 N N   . ALA A 1 215 ? 26.252  4.348   13.869 1.00 36.65 ? 205 ALA A N   1 
ATOM   1629 C CA  . ALA A 1 215 ? 27.692  4.517   14.010 1.00 37.50 ? 205 ALA A CA  1 
ATOM   1630 C C   . ALA A 1 215 ? 28.006  5.037   15.401 1.00 37.45 ? 205 ALA A C   1 
ATOM   1631 O O   . ALA A 1 215 ? 27.228  5.826   15.954 1.00 38.20 ? 205 ALA A O   1 
ATOM   1632 C CB  . ALA A 1 215 ? 28.219  5.497   12.963 1.00 37.01 ? 205 ALA A CB  1 
ATOM   1633 N N   . ASP A 1 216 ? 29.136  4.588   15.954 1.00 38.03 ? 206 ASP A N   1 
ATOM   1634 C CA  . ASP A 1 216 ? 29.703  5.087   17.224 1.00 37.69 ? 206 ASP A CA  1 
ATOM   1635 C C   . ASP A 1 216 ? 28.741  5.040   18.412 1.00 36.38 ? 206 ASP A C   1 
ATOM   1636 O O   . ASP A 1 216 ? 28.443  6.062   19.012 1.00 35.08 ? 206 ASP A O   1 
ATOM   1637 C CB  . ASP A 1 216 ? 30.277  6.518   17.081 1.00 39.08 ? 206 ASP A CB  1 
ATOM   1638 C CG  . ASP A 1 216 ? 31.259  6.654   15.922 1.00 41.99 ? 206 ASP A CG  1 
ATOM   1639 O OD1 . ASP A 1 216 ? 32.200  5.824   15.821 1.00 45.57 ? 206 ASP A OD1 1 
ATOM   1640 O OD2 . ASP A 1 216 ? 31.093  7.607   15.124 1.00 45.68 ? 206 ASP A OD2 1 
ATOM   1641 N N   . LYS A 1 217 ? 28.288  3.847   18.774 1.00 35.43 ? 207 LYS A N   1 
ATOM   1642 C CA  . LYS A 1 217 ? 27.360  3.682   19.910 1.00 35.25 ? 207 LYS A CA  1 
ATOM   1643 C C   . LYS A 1 217 ? 26.077  4.501   19.726 1.00 34.03 ? 207 LYS A C   1 
ATOM   1644 O O   . LYS A 1 217 ? 25.632  5.210   20.648 1.00 34.23 ? 207 LYS A O   1 
ATOM   1645 C CB  . LYS A 1 217 ? 28.028  4.066   21.241 1.00 35.60 ? 207 LYS A CB  1 
ATOM   1646 C CG  . LYS A 1 217 ? 29.422  3.455   21.484 1.00 38.72 ? 207 LYS A CG  1 
ATOM   1647 C CD  . LYS A 1 217 ? 29.405  1.949   21.309 1.00 39.36 ? 207 LYS A CD  1 
ATOM   1648 C CE  . LYS A 1 217 ? 30.518  1.286   22.105 1.00 42.72 ? 207 LYS A CE  1 
ATOM   1649 N NZ  . LYS A 1 217 ? 30.447  -0.208  21.954 1.00 44.60 ? 207 LYS A NZ  1 
ATOM   1650 N N   . GLU A 1 218 ? 25.493  4.407   18.537 1.00 33.14 ? 208 GLU A N   1 
ATOM   1651 C CA  . GLU A 1 218 ? 24.269  5.146   18.206 1.00 33.72 ? 208 GLU A CA  1 
ATOM   1652 C C   . GLU A 1 218 ? 24.403  6.662   18.399 1.00 33.47 ? 208 GLU A C   1 
ATOM   1653 O O   . GLU A 1 218 ? 23.407  7.344   18.664 1.00 33.88 ? 208 GLU A O   1 
ATOM   1654 C CB  . GLU A 1 218 ? 23.033  4.591   18.963 1.00 33.95 ? 208 GLU A CB  1 
ATOM   1655 C CG  . GLU A 1 218 ? 22.659  3.146   18.603 1.00 33.32 ? 208 GLU A CG  1 
ATOM   1656 C CD  . GLU A 1 218 ? 23.685  2.101   19.080 1.00 36.05 ? 208 GLU A CD  1 
ATOM   1657 O OE1 . GLU A 1 218 ? 24.384  2.322   20.094 1.00 35.25 ? 208 GLU A OE1 1 
ATOM   1658 O OE2 . GLU A 1 218 ? 23.801  1.036   18.435 1.00 38.70 ? 208 GLU A OE2 1 
ATOM   1659 N N   . THR A 1 219 ? 25.621  7.202   18.266 1.00 33.29 ? 209 THR A N   1 
ATOM   1660 C CA  . THR A 1 219 ? 25.723  8.666   18.156 1.00 33.90 ? 209 THR A CA  1 
ATOM   1661 C C   . THR A 1 219 ? 25.228  9.155   16.778 1.00 32.17 ? 209 THR A C   1 
ATOM   1662 O O   . THR A 1 219 ? 24.755  10.300  16.654 1.00 31.24 ? 209 THR A O   1 
ATOM   1663 C CB  . THR A 1 219 ? 27.111  9.259   18.554 1.00 34.32 ? 209 THR A CB  1 
ATOM   1664 O OG1 . THR A 1 219 ? 28.122  8.272   18.397 1.00 38.93 ? 209 THR A OG1 1 
ATOM   1665 C CG2 . THR A 1 219 ? 27.127  9.623   20.028 1.00 36.56 ? 209 THR A CG2 1 
ATOM   1666 N N   . TYR A 1 220 ? 25.308  8.281   15.768 1.00 31.28 ? 210 TYR A N   1 
ATOM   1667 C CA  . TYR A 1 220 ? 24.702  8.539   14.448 1.00 30.41 ? 210 TYR A CA  1 
ATOM   1668 C C   . TYR A 1 220 ? 23.770  7.394   14.125 1.00 29.23 ? 210 TYR A C   1 
ATOM   1669 O O   . TYR A 1 220 ? 24.197  6.242   14.125 1.00 29.38 ? 210 TYR A O   1 
ATOM   1670 C CB  . TYR A 1 220 ? 25.753  8.656   13.332 1.00 32.10 ? 210 TYR A CB  1 
ATOM   1671 C CG  . TYR A 1 220 ? 26.839  9.670   13.628 1.00 34.02 ? 210 TYR A CG  1 
ATOM   1672 C CD1 . TYR A 1 220 ? 26.662  11.020  13.302 1.00 36.01 ? 210 TYR A CD1 1 
ATOM   1673 C CD2 . TYR A 1 220 ? 28.032  9.286   14.252 1.00 36.38 ? 210 TYR A CD2 1 
ATOM   1674 C CE1 . TYR A 1 220 ? 27.673  11.980  13.595 1.00 38.32 ? 210 TYR A CE1 1 
ATOM   1675 C CE2 . TYR A 1 220 ? 29.035  10.210  14.541 1.00 37.68 ? 210 TYR A CE2 1 
ATOM   1676 C CZ  . TYR A 1 220 ? 28.851  11.554  14.209 1.00 38.11 ? 210 TYR A CZ  1 
ATOM   1677 O OH  . TYR A 1 220 ? 29.853  12.466  14.505 1.00 37.93 ? 210 TYR A OH  1 
ATOM   1678 N N   . VAL A 1 221 ? 22.520  7.714   13.832 1.00 26.62 ? 211 VAL A N   1 
ATOM   1679 C CA  . VAL A 1 221 ? 21.526  6.690   13.535 1.00 25.74 ? 211 VAL A CA  1 
ATOM   1680 C C   . VAL A 1 221 ? 20.797  7.130   12.301 1.00 24.76 ? 211 VAL A C   1 
ATOM   1681 O O   . VAL A 1 221 ? 20.399  8.293   12.206 1.00 23.85 ? 211 VAL A O   1 
ATOM   1682 C CB  . VAL A 1 221 ? 20.501  6.504   14.701 1.00 24.71 ? 211 VAL A CB  1 
ATOM   1683 C CG1 . VAL A 1 221 ? 19.335  5.560   14.284 1.00 25.80 ? 211 VAL A CG1 1 
ATOM   1684 C CG2 . VAL A 1 221 ? 21.199  5.964   15.934 1.00 26.74 ? 211 VAL A CG2 1 
ATOM   1685 N N   . GLU A 1 222 ? 20.600  6.202   11.369 1.00 24.43 ? 212 GLU A N   1 
ATOM   1686 C CA  . GLU A 1 222 ? 19.682  6.405   10.260 1.00 25.14 ? 212 GLU A CA  1 
ATOM   1687 C C   . GLU A 1 222 ? 18.427  5.544   10.449 1.00 24.22 ? 212 GLU A C   1 
ATOM   1688 O O   . GLU A 1 222 ? 18.515  4.329   10.613 1.00 24.03 ? 212 GLU A O   1 
ATOM   1689 C CB  . GLU A 1 222 ? 20.365  6.037   8.934  1.00 25.15 ? 212 GLU A CB  1 
ATOM   1690 C CG  . GLU A 1 222 ? 19.509  6.280   7.691  1.00 27.10 ? 212 GLU A CG  1 
ATOM   1691 C CD  . GLU A 1 222 ? 20.170  5.778   6.378  1.00 30.63 ? 212 GLU A CD  1 
ATOM   1692 O OE1 . GLU A 1 222 ? 21.428  5.645   6.329  1.00 34.40 ? 212 GLU A OE1 1 
ATOM   1693 O OE2 . GLU A 1 222 ? 19.424  5.509   5.407  1.00 33.63 ? 212 GLU A OE2 1 
ATOM   1694 N N   . GLN A 1 223 ? 17.266  6.170   10.337 1.00 23.70 ? 213 GLN A N   1 
ATOM   1695 C CA  . GLN A 1 223 ? 16.011  5.521   10.691 1.00 23.04 ? 213 GLN A CA  1 
ATOM   1696 C C   . GLN A 1 223 ? 15.019  5.729   9.563  1.00 21.81 ? 213 GLN A C   1 
ATOM   1697 O O   . GLN A 1 223 ? 14.967  6.796   8.987  1.00 21.74 ? 213 GLN A O   1 
ATOM   1698 C CB  . GLN A 1 223 ? 15.506  6.121   12.015 1.00 23.44 ? 213 GLN A CB  1 
ATOM   1699 C CG  . GLN A 1 223 ? 14.260  5.503   12.584 1.00 26.00 ? 213 GLN A CG  1 
ATOM   1700 C CD  . GLN A 1 223 ? 13.898  6.099   13.921 1.00 21.99 ? 213 GLN A CD  1 
ATOM   1701 O OE1 . GLN A 1 223 ? 14.595  5.913   14.925 1.00 23.29 ? 213 GLN A OE1 1 
ATOM   1702 N NE2 . GLN A 1 223 ? 12.797  6.793   13.949 1.00 22.23 ? 213 GLN A NE2 1 
ATOM   1703 N N   . HIS A 1 224 ? 14.198  4.722   9.271  1.00 20.65 ? 214 HIS A N   1 
ATOM   1704 C CA  . HIS A 1 224 ? 13.269  4.796   8.180  1.00 20.38 ? 214 HIS A CA  1 
ATOM   1705 C C   . HIS A 1 224 ? 11.876  4.335   8.606  1.00 20.49 ? 214 HIS A C   1 
ATOM   1706 O O   . HIS A 1 224 ? 11.766  3.425   9.433  1.00 21.10 ? 214 HIS A O   1 
ATOM   1707 C CB  . HIS A 1 224 ? 13.804  3.939   7.008  1.00 21.52 ? 214 HIS A CB  1 
ATOM   1708 C CG  . HIS A 1 224 ? 12.828  3.773   5.883  1.00 24.00 ? 214 HIS A CG  1 
ATOM   1709 N ND1 . HIS A 1 224 ? 12.731  4.665   4.835  1.00 24.65 ? 214 HIS A ND1 1 
ATOM   1710 C CD2 . HIS A 1 224 ? 11.897  2.815   5.651  1.00 25.23 ? 214 HIS A CD2 1 
ATOM   1711 C CE1 . HIS A 1 224 ? 11.771  4.273   4.015  1.00 27.48 ? 214 HIS A CE1 1 
ATOM   1712 N NE2 . HIS A 1 224 ? 11.269  3.139   4.473  1.00 28.17 ? 214 HIS A NE2 1 
ATOM   1713 N N   . GLU A 1 225 ? 10.835  5.000   8.118  1.00 19.12 ? 215 GLU A N   1 
ATOM   1714 C CA  . GLU A 1 225 ? 9.476   4.560   8.324  1.00 21.10 ? 215 GLU A CA  1 
ATOM   1715 C C   . GLU A 1 225 ? 8.731   4.422   7.023  1.00 21.07 ? 215 GLU A C   1 
ATOM   1716 O O   . GLU A 1 225 ? 8.932   5.237   6.110  1.00 21.57 ? 215 GLU A O   1 
ATOM   1717 C CB  . GLU A 1 225 ? 8.700   5.523   9.241  1.00 20.65 ? 215 GLU A CB  1 
ATOM   1718 C CG  . GLU A 1 225 ? 7.283   5.056   9.605  1.00 23.51 ? 215 GLU A CG  1 
ATOM   1719 C CD  . GLU A 1 225 ? 6.567   6.036   10.535 1.00 24.83 ? 215 GLU A CD  1 
ATOM   1720 O OE1 . GLU A 1 225 ? 7.178   7.044   10.949 1.00 29.51 ? 215 GLU A OE1 1 
ATOM   1721 O OE2 . GLU A 1 225 ? 5.379   5.807   10.829 1.00 32.02 ? 215 GLU A OE2 1 
ATOM   1722 N N   . VAL A 1 226 ? 7.865   3.397   6.947  1.00 18.71 ? 216 VAL A N   1 
ATOM   1723 C CA  . VAL A 1 226 ? 6.803   3.349   5.975  1.00 18.46 ? 216 VAL A CA  1 
ATOM   1724 C C   . VAL A 1 226 ? 5.524   3.250   6.768  1.00 18.61 ? 216 VAL A C   1 
ATOM   1725 O O   . VAL A 1 226 ? 5.436   2.426   7.716  1.00 18.56 ? 216 VAL A O   1 
ATOM   1726 C CB  . VAL A 1 226 ? 6.939   2.239   4.876  1.00 18.65 ? 216 VAL A CB  1 
ATOM   1727 C CG1 . VAL A 1 226 ? 7.169   0.845   5.482  1.00 19.07 ? 216 VAL A CG1 1 
ATOM   1728 C CG2 . VAL A 1 226 ? 5.711   2.234   3.933  1.00 19.77 ? 216 VAL A CG2 1 
ATOM   1729 N N   . ALA A 1 227 ? 4.548   4.091   6.418  1.00 18.85 ? 217 ALA A N   1 
ATOM   1730 C CA  . ALA A 1 227 ? 3.258   4.121   7.093  1.00 19.31 ? 217 ALA A CA  1 
ATOM   1731 C C   . ALA A 1 227 ? 2.072   4.296   6.130  1.00 20.10 ? 217 ALA A C   1 
ATOM   1732 O O   . ALA A 1 227 ? 2.094   5.199   5.270  1.00 20.85 ? 217 ALA A O   1 
ATOM   1733 C CB  . ALA A 1 227 ? 3.230   5.236   8.173  1.00 20.06 ? 217 ALA A CB  1 
ATOM   1734 N N   . VAL A 1 228 ? 1.023   3.472   6.300  1.00 18.85 ? 218 VAL A N   1 
ATOM   1735 C CA  . VAL A 1 228 ? -0.139  3.512   5.428  1.00 19.83 ? 218 VAL A CA  1 
ATOM   1736 C C   . VAL A 1 228 ? -1.390  3.457   6.248  1.00 19.85 ? 218 VAL A C   1 
ATOM   1737 O O   . VAL A 1 228 ? -1.500  2.599   7.135  1.00 19.83 ? 218 VAL A O   1 
ATOM   1738 C CB  . VAL A 1 228 ? -0.145  2.356   4.367  1.00 19.40 ? 218 VAL A CB  1 
ATOM   1739 C CG1 . VAL A 1 228 ? -1.458  2.349   3.591  1.00 20.43 ? 218 VAL A CG1 1 
ATOM   1740 C CG2 . VAL A 1 228 ? 1.033   2.428   3.425  1.00 19.11 ? 218 VAL A CG2 1 
ATOM   1741 N N   . ALA A 1 229 ? -2.331  4.360   5.955  1.00 19.59 ? 219 ALA A N   1 
ATOM   1742 C CA  . ALA A 1 229 ? -3.607  4.484   6.658  1.00 20.28 ? 219 ALA A CA  1 
ATOM   1743 C C   . ALA A 1 229 ? -4.761  3.916   5.889  1.00 21.47 ? 219 ALA A C   1 
ATOM   1744 O O   . ALA A 1 229 ? -4.835  4.080   4.664  1.00 21.94 ? 219 ALA A O   1 
ATOM   1745 C CB  . ALA A 1 229 ? -3.928  5.945   7.027  1.00 21.07 ? 219 ALA A CB  1 
ATOM   1746 N N   . ARG A 1 230 ? -5.641  3.232   6.610  1.00 23.03 ? 220 ARG A N   1 
ATOM   1747 C CA  . ARG A 1 230 ? -6.731  2.422   5.999  1.00 26.13 ? 220 ARG A CA  1 
ATOM   1748 C C   . ARG A 1 230 ? -7.888  2.298   6.949  1.00 26.67 ? 220 ARG A C   1 
ATOM   1749 O O   . ARG A 1 230 ? -7.729  2.447   8.173  1.00 25.74 ? 220 ARG A O   1 
ATOM   1750 C CB  . ARG A 1 230 ? -6.242  0.988   5.641  1.00 24.86 ? 220 ARG A CB  1 
ATOM   1751 C CG  . ARG A 1 230 ? -5.683  0.242   6.874  1.00 27.93 ? 220 ARG A CG  1 
ATOM   1752 C CD  . ARG A 1 230 ? -5.475  -1.289  6.714  1.00 29.71 ? 220 ARG A CD  1 
ATOM   1753 N NE  . ARG A 1 230 ? -4.855  -1.821  7.929  1.00 35.05 ? 220 ARG A NE  1 
ATOM   1754 C CZ  . ARG A 1 230 ? -5.517  -2.150  9.045  1.00 36.18 ? 220 ARG A CZ  1 
ATOM   1755 N NH1 . ARG A 1 230 ? -6.843  -2.015  9.113  1.00 36.86 ? 220 ARG A NH1 1 
ATOM   1756 N NH2 . ARG A 1 230 ? -4.848  -2.611  10.109 1.00 35.37 ? 220 ARG A NH2 1 
ATOM   1757 N N   . TYR A 1 231 ? -9.071  2.042   6.404  1.00 28.33 ? 221 TYR A N   1 
ATOM   1758 C CA  . TYR A 1 231 ? -10.165 1.616   7.254  1.00 31.20 ? 221 TYR A CA  1 
ATOM   1759 C C   . TYR A 1 231 ? -10.045 0.120   7.488  1.00 32.43 ? 221 TYR A C   1 
ATOM   1760 O O   . TYR A 1 231 ? -9.245  -0.561  6.844  1.00 33.40 ? 221 TYR A O   1 
ATOM   1761 C CB  . TYR A 1 231 ? -11.514 1.927   6.604  1.00 31.77 ? 221 TYR A CB  1 
ATOM   1762 C CG  . TYR A 1 231 ? -11.805 3.402   6.462  1.00 30.77 ? 221 TYR A CG  1 
ATOM   1763 C CD1 . TYR A 1 231 ? -11.939 3.982   5.200  1.00 31.88 ? 221 TYR A CD1 1 
ATOM   1764 C CD2 . TYR A 1 231 ? -11.933 4.216   7.585  1.00 31.61 ? 221 TYR A CD2 1 
ATOM   1765 C CE1 . TYR A 1 231 ? -12.229 5.329   5.063  1.00 31.08 ? 221 TYR A CE1 1 
ATOM   1766 C CE2 . TYR A 1 231 ? -12.198 5.544   7.470  1.00 31.05 ? 221 TYR A CE2 1 
ATOM   1767 C CZ  . TYR A 1 231 ? -12.360 6.099   6.198  1.00 32.93 ? 221 TYR A CZ  1 
ATOM   1768 O OH  . TYR A 1 231 ? -12.614 7.451   6.079  1.00 33.93 ? 221 TYR A OH  1 
ATOM   1769 N N   . CYS A 1 232 ? -10.805 -0.392  8.444  1.00 34.01 ? 222 CYS A N   1 
ATOM   1770 C CA  . CYS A 1 232 ? -10.994 -1.828  8.523  1.00 35.11 ? 222 CYS A CA  1 
ATOM   1771 C C   . CYS A 1 232 ? -11.791 -2.266  7.280  1.00 36.50 ? 222 CYS A C   1 
ATOM   1772 O O   . CYS A 1 232 ? -12.935 -1.818  7.058  1.00 36.77 ? 222 CYS A O   1 
ATOM   1773 C CB  . CYS A 1 232 ? -11.756 -2.212  9.772  1.00 34.85 ? 222 CYS A CB  1 
ATOM   1774 S SG  . CYS A 1 232 ? -11.939 -3.995  9.836  1.00 34.58 ? 222 CYS A SG  1 
ATOM   1775 N N   . ASP A 1 233 ? -11.154 -3.112  6.475  1.00 37.62 ? 223 ASP A N   1 
ATOM   1776 C CA  . ASP A 1 233 ? -11.723 -3.576  5.213  1.00 39.11 ? 223 ASP A CA  1 
ATOM   1777 C C   . ASP A 1 233 ? -12.479 -4.929  5.307  1.00 39.12 ? 223 ASP A C   1 
ATOM   1778 O O   . ASP A 1 233 ? -13.063 -5.394  4.323  1.00 39.13 ? 223 ASP A O   1 
ATOM   1779 C CB  . ASP A 1 233 ? -10.648 -3.535  4.111  1.00 39.65 ? 223 ASP A CB  1 
ATOM   1780 C CG  . ASP A 1 233 ? -10.050 -2.103  3.923  1.00 42.94 ? 223 ASP A CG  1 
ATOM   1781 O OD1 . ASP A 1 233 ? -10.833 -1.129  3.761  1.00 43.91 ? 223 ASP A OD1 1 
ATOM   1782 O OD2 . ASP A 1 233 ? -8.800  -1.941  3.957  1.00 44.89 ? 223 ASP A OD2 1 
ATOM   1783 N N   . LEU A 1 234 ? -12.520 -5.524  6.497  1.00 38.04 ? 224 LEU A N   1 
ATOM   1784 C CA  . LEU A 1 234 ? -13.318 -6.744  6.723  1.00 38.23 ? 224 LEU A CA  1 
ATOM   1785 C C   . LEU A 1 234 ? -14.806 -6.488  6.528  1.00 38.96 ? 224 LEU A C   1 
ATOM   1786 O O   . LEU A 1 234 ? -15.293 -5.421  6.860  1.00 38.34 ? 224 LEU A O   1 
ATOM   1787 C CB  . LEU A 1 234 ? -13.092 -7.290  8.147  1.00 37.37 ? 224 LEU A CB  1 
ATOM   1788 C CG  . LEU A 1 234 ? -11.684 -7.715  8.533  1.00 35.69 ? 224 LEU A CG  1 
ATOM   1789 C CD1 . LEU A 1 234 ? -11.584 -7.823  10.052 1.00 33.96 ? 224 LEU A CD1 1 
ATOM   1790 C CD2 . LEU A 1 234 ? -11.263 -9.014  7.864  1.00 34.68 ? 224 LEU A CD2 1 
ATOM   1791 N N   . PRO A 1 235 ? -15.545 -7.485  6.007  1.00 40.43 ? 225 PRO A N   1 
ATOM   1792 C CA  . PRO A 1 235 ? -16.998 -7.330  5.877  1.00 41.85 ? 225 PRO A CA  1 
ATOM   1793 C C   . PRO A 1 235 ? -17.647 -7.023  7.215  1.00 42.85 ? 225 PRO A C   1 
ATOM   1794 O O   . PRO A 1 235 ? -17.256 -7.593  8.236  1.00 42.58 ? 225 PRO A O   1 
ATOM   1795 C CB  . PRO A 1 235 ? -17.464 -8.704  5.380  1.00 41.60 ? 225 PRO A CB  1 
ATOM   1796 C CG  . PRO A 1 235 ? -16.258 -9.309  4.735  1.00 41.72 ? 225 PRO A CG  1 
ATOM   1797 C CD  . PRO A 1 235 ? -15.074 -8.794  5.516  1.00 40.74 ? 225 PRO A CD  1 
ATOM   1798 N N   . SER A 1 236 ? -18.602 -6.093  7.210  1.00 44.36 ? 226 SER A N   1 
ATOM   1799 C CA  . SER A 1 236 ? -19.458 -5.847  8.363  1.00 45.74 ? 226 SER A CA  1 
ATOM   1800 C C   . SER A 1 236 ? -20.774 -6.554  8.106  1.00 46.99 ? 226 SER A C   1 
ATOM   1801 O O   . SER A 1 236 ? -21.123 -6.809  6.953  1.00 46.88 ? 226 SER A O   1 
ATOM   1802 C CB  . SER A 1 236 ? -19.708 -4.347  8.552  1.00 45.78 ? 226 SER A CB  1 
ATOM   1803 O OG  . SER A 1 236 ? -20.573 -4.109  9.652  1.00 46.74 ? 226 SER A OG  1 
ATOM   1804 N N   . LYS A 1 237 ? -21.487 -6.886  9.180  1.00 48.30 ? 227 LYS A N   1 
ATOM   1805 C CA  . LYS A 1 237 ? -22.880 -7.340  9.085  1.00 50.06 ? 227 LYS A CA  1 
ATOM   1806 C C   . LYS A 1 237 ? -23.838 -6.287  9.674  1.00 50.87 ? 227 LYS A C   1 
ATOM   1807 O O   . LYS A 1 237 ? -25.042 -6.515  9.790  1.00 51.05 ? 227 LYS A O   1 
ATOM   1808 C CB  . LYS A 1 237 ? -23.055 -8.719  9.739  1.00 50.16 ? 227 LYS A CB  1 
ATOM   1809 C CG  . LYS A 1 237 ? -22.298 -9.820  8.985  1.00 50.84 ? 227 LYS A CG  1 
ATOM   1810 C CD  . LYS A 1 237 ? -22.802 -11.209 9.320  1.00 51.52 ? 227 LYS A CD  1 
ATOM   1811 C CE  . LYS A 1 237 ? -22.278 -12.247 8.339  1.00 51.45 ? 227 LYS A CE  1 
ATOM   1812 N NZ  . LYS A 1 237 ? -22.776 -12.030 6.953  1.00 51.14 ? 227 LYS A NZ  1 
ATOM   1813 N N   . LEU A 1 238 ? -23.281 -5.134  10.041 1.00 52.08 ? 228 LEU A N   1 
ATOM   1814 C CA  . LEU A 1 238 ? -24.056 -3.976  10.494 1.00 53.27 ? 228 LEU A CA  1 
ATOM   1815 C C   . LEU A 1 238 ? -24.297 -3.016  9.327  1.00 54.02 ? 228 LEU A C   1 
ATOM   1816 O O   . LEU A 1 238 ? -23.534 -3.001  8.353  1.00 54.64 ? 228 LEU A O   1 
ATOM   1817 C CB  . LEU A 1 238 ? -23.347 -3.237  11.651 1.00 53.42 ? 228 LEU A CB  1 
ATOM   1818 C CG  . LEU A 1 238 ? -23.245 -3.873  13.055 1.00 54.40 ? 228 LEU A CG  1 
ATOM   1819 C CD1 . LEU A 1 238 ? -22.598 -2.902  14.040 1.00 53.87 ? 228 LEU A CD1 1 
ATOM   1820 C CD2 . LEU A 1 238 ? -24.608 -4.334  13.586 1.00 54.26 ? 228 LEU A CD2 1 
ATOM   1821 N N   . SER B 1 14  ? 23.970  21.725  59.423 1.00 45.97 ? 2   SER B N   1 
ATOM   1822 C CA  . SER B 1 14  ? 23.073  22.545  60.294 1.00 46.02 ? 2   SER B CA  1 
ATOM   1823 C C   . SER B 1 14  ? 23.240  24.046  60.018 1.00 45.16 ? 2   SER B C   1 
ATOM   1824 O O   . SER B 1 14  ? 22.335  24.847  60.289 1.00 45.47 ? 2   SER B O   1 
ATOM   1825 C CB  . SER B 1 14  ? 23.309  22.213  61.776 1.00 46.69 ? 2   SER B CB  1 
ATOM   1826 O OG  . SER B 1 14  ? 24.494  22.813  62.286 1.00 48.71 ? 2   SER B OG  1 
ATOM   1827 N N   . GLU B 1 15  ? 24.398  24.425  59.479 1.00 43.84 ? 3   GLU B N   1 
ATOM   1828 C CA  . GLU B 1 15  ? 24.600  25.794  59.012 1.00 42.10 ? 3   GLU B CA  1 
ATOM   1829 C C   . GLU B 1 15  ? 23.783  26.079  57.760 1.00 39.45 ? 3   GLU B C   1 
ATOM   1830 O O   . GLU B 1 15  ? 23.198  27.146  57.647 1.00 40.15 ? 3   GLU B O   1 
ATOM   1831 C CB  . GLU B 1 15  ? 26.073  26.089  58.724 1.00 43.21 ? 3   GLU B CB  1 
ATOM   1832 C CG  . GLU B 1 15  ? 26.297  27.560  58.340 1.00 45.82 ? 3   GLU B CG  1 
ATOM   1833 C CD  . GLU B 1 15  ? 27.333  27.761  57.237 1.00 52.22 ? 3   GLU B CD  1 
ATOM   1834 O OE1 . GLU B 1 15  ? 27.048  28.534  56.279 1.00 53.89 ? 3   GLU B OE1 1 
ATOM   1835 O OE2 . GLU B 1 15  ? 28.432  27.162  57.323 1.00 54.62 ? 3   GLU B OE2 1 
ATOM   1836 N N   . LEU B 1 16  ? 23.738  25.125  56.829 1.00 36.48 ? 4   LEU B N   1 
ATOM   1837 C CA  . LEU B 1 16  ? 23.066  25.317  55.524 1.00 33.78 ? 4   LEU B CA  1 
ATOM   1838 C C   . LEU B 1 16  ? 21.558  25.265  55.637 1.00 32.08 ? 4   LEU B C   1 
ATOM   1839 O O   . LEU B 1 16  ? 20.833  26.142  55.141 1.00 31.05 ? 4   LEU B O   1 
ATOM   1840 C CB  . LEU B 1 16  ? 23.543  24.254  54.532 1.00 34.25 ? 4   LEU B CB  1 
ATOM   1841 C CG  . LEU B 1 16  ? 25.046  24.217  54.308 1.00 34.15 ? 4   LEU B CG  1 
ATOM   1842 C CD1 . LEU B 1 16  ? 25.412  23.040  53.437 1.00 34.75 ? 4   LEU B CD1 1 
ATOM   1843 C CD2 . LEU B 1 16  ? 25.476  25.518  53.676 1.00 34.18 ? 4   LEU B CD2 1 
ATOM   1844 N N   . ILE B 1 17  ? 21.065  24.202  56.259 1.00 30.35 ? 5   ILE B N   1 
ATOM   1845 C CA  . ILE B 1 17  ? 19.632  24.109  56.477 1.00 30.47 ? 5   ILE B CA  1 
ATOM   1846 C C   . ILE B 1 17  ? 19.291  24.535  57.913 1.00 30.76 ? 5   ILE B C   1 
ATOM   1847 O O   . ILE B 1 17  ? 19.595  23.813  58.857 1.00 30.68 ? 5   ILE B O   1 
ATOM   1848 C CB  . ILE B 1 17  ? 19.093  22.664  56.154 1.00 29.81 ? 5   ILE B CB  1 
ATOM   1849 C CG1 . ILE B 1 17  ? 19.384  22.277  54.684 1.00 29.32 ? 5   ILE B CG1 1 
ATOM   1850 C CG2 . ILE B 1 17  ? 17.577  22.585  56.456 1.00 27.93 ? 5   ILE B CG2 1 
ATOM   1851 C CD1 . ILE B 1 17  ? 18.863  23.276  53.616 1.00 30.23 ? 5   ILE B CD1 1 
ATOM   1852 N N   . THR B 1 18  ? 18.668  25.704  58.064 1.00 30.83 ? 6   THR B N   1 
ATOM   1853 C CA  . THR B 1 18  ? 18.417  26.260  59.381 1.00 32.61 ? 6   THR B CA  1 
ATOM   1854 C C   . THR B 1 18  ? 16.975  26.023  59.817 1.00 33.06 ? 6   THR B C   1 
ATOM   1855 O O   . THR B 1 18  ? 16.223  25.332  59.126 1.00 33.03 ? 6   THR B O   1 
ATOM   1856 C CB  . THR B 1 18  ? 18.770  27.788  59.432 1.00 32.60 ? 6   THR B CB  1 
ATOM   1857 O OG1 . THR B 1 18  ? 17.908  28.509  58.541 1.00 34.36 ? 6   THR B OG1 1 
ATOM   1858 C CG2 . THR B 1 18  ? 20.201  28.006  59.037 1.00 33.88 ? 6   THR B CG2 1 
ATOM   1859 N N   . GLU B 1 19  ? 16.587  26.599  60.956 1.00 32.87 ? 7   GLU B N   1 
ATOM   1860 C CA  . GLU B 1 19  ? 15.361  26.220  61.633 1.00 33.48 ? 7   GLU B CA  1 
ATOM   1861 C C   . GLU B 1 19  ? 14.170  26.886  60.980 1.00 32.81 ? 7   GLU B C   1 
ATOM   1862 O O   . GLU B 1 19  ? 13.055  26.357  61.027 1.00 31.75 ? 7   GLU B O   1 
ATOM   1863 C CB  . GLU B 1 19  ? 15.443  26.549  63.138 1.00 34.40 ? 7   GLU B CB  1 
ATOM   1864 C CG  . GLU B 1 19  ? 14.198  26.164  63.947 1.00 40.00 ? 7   GLU B CG  1 
ATOM   1865 C CD  . GLU B 1 19  ? 14.272  24.756  64.545 1.00 47.58 ? 7   GLU B CD  1 
ATOM   1866 O OE1 . GLU B 1 19  ? 15.313  24.471  65.203 1.00 49.97 ? 7   GLU B OE1 1 
ATOM   1867 O OE2 . GLU B 1 19  ? 13.294  23.949  64.379 1.00 49.53 ? 7   GLU B OE2 1 
ATOM   1868 N N   . ASN B 1 20  ? 14.405  28.046  60.368 1.00 32.05 ? 8   ASN B N   1 
ATOM   1869 C CA  . ASN B 1 20  ? 13.396  28.665  59.498 1.00 32.32 ? 8   ASN B CA  1 
ATOM   1870 C C   . ASN B 1 20  ? 14.012  28.941  58.141 1.00 32.14 ? 8   ASN B C   1 
ATOM   1871 O O   . ASN B 1 20  ? 15.127  29.463  58.073 1.00 30.09 ? 8   ASN B O   1 
ATOM   1872 C CB  . ASN B 1 20  ? 12.839  29.950  60.096 1.00 34.09 ? 8   ASN B CB  1 
ATOM   1873 C CG  . ASN B 1 20  ? 12.088  29.713  61.394 1.00 35.81 ? 8   ASN B CG  1 
ATOM   1874 O OD1 . ASN B 1 20  ? 10.867  29.623  61.411 1.00 38.11 ? 8   ASN B OD1 1 
ATOM   1875 N ND2 . ASN B 1 20  ? 12.825  29.610  62.493 1.00 40.71 ? 8   ASN B ND2 1 
ATOM   1876 N N   . MET B 1 21  ? 13.312  28.556  57.069 1.00 31.24 ? 9   MET B N   1 
ATOM   1877 C CA  . MET B 1 21  ? 13.880  28.645  55.709 1.00 32.21 ? 9   MET B CA  1 
ATOM   1878 C C   . MET B 1 21  ? 12.898  29.210  54.741 1.00 30.55 ? 9   MET B C   1 
ATOM   1879 O O   . MET B 1 21  ? 11.696  28.947  54.862 1.00 30.88 ? 9   MET B O   1 
ATOM   1880 C CB  . MET B 1 21  ? 14.315  27.282  55.193 1.00 31.47 ? 9   MET B CB  1 
ATOM   1881 C CG  . MET B 1 21  ? 15.263  26.578  56.084 1.00 34.67 ? 9   MET B CG  1 
ATOM   1882 S SD  . MET B 1 21  ? 16.697  25.971  55.214 1.00 39.88 ? 9   MET B SD  1 
ATOM   1883 C CE  . MET B 1 21  ? 17.485  27.551  54.989 1.00 32.25 ? 9   MET B CE  1 
ATOM   1884 N N   A HIS B 1 22  ? 13.422  29.932  53.755 0.50 29.52 ? 10  HIS B N   1 
ATOM   1885 N N   B HIS B 1 22  ? 13.363  30.021  53.783 0.50 29.13 ? 10  HIS B N   1 
ATOM   1886 C CA  A HIS B 1 22  ? 12.604  30.513  52.720 0.50 28.95 ? 10  HIS B CA  1 
ATOM   1887 C CA  B HIS B 1 22  ? 12.464  30.559  52.749 0.50 28.06 ? 10  HIS B CA  1 
ATOM   1888 C C   A HIS B 1 22  ? 12.677  29.654  51.452 0.50 28.10 ? 10  HIS B C   1 
ATOM   1889 C C   B HIS B 1 22  ? 12.671  29.758  51.451 0.50 27.59 ? 10  HIS B C   1 
ATOM   1890 O O   A HIS B 1 22  ? 13.672  28.938  51.219 0.50 27.27 ? 10  HIS B O   1 
ATOM   1891 O O   B HIS B 1 22  ? 13.753  29.188  51.201 0.50 26.79 ? 10  HIS B O   1 
ATOM   1892 C CB  A HIS B 1 22  ? 13.054  31.957  52.452 0.50 28.99 ? 10  HIS B CB  1 
ATOM   1893 C CB  B HIS B 1 22  ? 12.674  32.084  52.523 0.50 27.64 ? 10  HIS B CB  1 
ATOM   1894 C CG  A HIS B 1 22  ? 12.886  32.865  53.633 0.50 29.03 ? 10  HIS B CG  1 
ATOM   1895 C CG  B HIS B 1 22  ? 11.593  32.759  51.712 0.50 25.47 ? 10  HIS B CG  1 
ATOM   1896 N ND1 A HIS B 1 22  ? 11.800  33.699  53.781 0.50 28.84 ? 10  HIS B ND1 1 
ATOM   1897 N ND1 B HIS B 1 22  ? 10.414  33.218  52.265 0.50 23.86 ? 10  HIS B ND1 1 
ATOM   1898 C CD2 A HIS B 1 22  ? 13.657  33.056  54.727 0.50 29.45 ? 10  HIS B CD2 1 
ATOM   1899 C CD2 B HIS B 1 22  ? 11.533  33.082  50.394 0.50 25.91 ? 10  HIS B CD2 1 
ATOM   1900 C CE1 A HIS B 1 22  ? 11.912  34.372  54.912 0.50 28.16 ? 10  HIS B CE1 1 
ATOM   1901 C CE1 B HIS B 1 22  ? 9.667   33.773  51.324 0.50 21.08 ? 10  HIS B CE1 1 
ATOM   1902 N NE2 A HIS B 1 22  ? 13.029  33.997  55.508 0.50 28.11 ? 10  HIS B NE2 1 
ATOM   1903 N NE2 B HIS B 1 22  ? 10.323  33.703  50.177 0.50 21.64 ? 10  HIS B NE2 1 
ATOM   1904 N N   . MET B 1 23  ? 11.608  29.703  50.659 1.00 28.12 ? 11  MET B N   1 
ATOM   1905 C CA  . MET B 1 23  ? 11.612  29.063  49.329 1.00 29.62 ? 11  MET B CA  1 
ATOM   1906 C C   . MET B 1 23  ? 11.035  30.012  48.282 1.00 27.05 ? 11  MET B C   1 
ATOM   1907 O O   . MET B 1 23  ? 10.062  30.740  48.546 1.00 27.15 ? 11  MET B O   1 
ATOM   1908 C CB  . MET B 1 23  ? 10.703  27.819  49.294 1.00 29.61 ? 11  MET B CB  1 
ATOM   1909 C CG  . MET B 1 23  ? 10.821  26.825  50.417 1.00 33.39 ? 11  MET B CG  1 
ATOM   1910 S SD  . MET B 1 23  ? 9.227   25.935  50.514 1.00 37.91 ? 11  MET B SD  1 
ATOM   1911 C CE  . MET B 1 23  ? 8.285   27.010  51.605 1.00 37.72 ? 11  MET B CE  1 
ATOM   1912 N N   . LYS B 1 24  ? 11.581  29.913  47.074 1.00 25.95 ? 12  LYS B N   1 
ATOM   1913 C CA  . LYS B 1 24  ? 11.006  30.538  45.890 1.00 25.58 ? 12  LYS B CA  1 
ATOM   1914 C C   . LYS B 1 24  ? 10.876  29.471  44.805 1.00 23.73 ? 12  LYS B C   1 
ATOM   1915 O O   . LYS B 1 24  ? 11.799  28.685  44.588 1.00 22.79 ? 12  LYS B O   1 
ATOM   1916 C CB  . LYS B 1 24  ? 11.922  31.641  45.345 1.00 24.76 ? 12  LYS B CB  1 
ATOM   1917 C CG  . LYS B 1 24  ? 11.843  32.925  46.200 1.00 31.19 ? 12  LYS B CG  1 
ATOM   1918 C CD  . LYS B 1 24  ? 12.683  34.113  45.639 1.00 28.71 ? 12  LYS B CD  1 
ATOM   1919 C CE  . LYS B 1 24  ? 14.148  33.770  45.503 1.00 33.71 ? 12  LYS B CE  1 
ATOM   1920 N NZ  . LYS B 1 24  ? 15.075  34.940  45.162 1.00 37.11 ? 12  LYS B NZ  1 
ATOM   1921 N N   . LEU B 1 25  ? 9.754   29.494  44.113 1.00 22.86 ? 13  LEU B N   1 
ATOM   1922 C CA  . LEU B 1 25  ? 9.526   28.458  43.092 1.00 22.82 ? 13  LEU B CA  1 
ATOM   1923 C C   . LEU B 1 25  ? 9.081   29.015  41.748 1.00 22.68 ? 13  LEU B C   1 
ATOM   1924 O O   . LEU B 1 25  ? 8.347   30.021  41.666 1.00 23.92 ? 13  LEU B O   1 
ATOM   1925 C CB  . LEU B 1 25  ? 8.574   27.389  43.640 1.00 22.38 ? 13  LEU B CB  1 
ATOM   1926 C CG  . LEU B 1 25  ? 7.836   26.498  42.621 1.00 22.29 ? 13  LEU B CG  1 
ATOM   1927 C CD1 . LEU B 1 25  ? 7.433   25.228  43.352 1.00 18.70 ? 13  LEU B CD1 1 
ATOM   1928 C CD2 . LEU B 1 25  ? 6.633   27.241  42.043 1.00 22.28 ? 13  LEU B CD2 1 
ATOM   1929 N N   . TYR B 1 26  ? 9.545   28.358  40.689 1.00 23.88 ? 14  TYR B N   1 
ATOM   1930 C CA  . TYR B 1 26  ? 9.149   28.716  39.328 1.00 25.32 ? 14  TYR B CA  1 
ATOM   1931 C C   . TYR B 1 26  ? 8.672   27.404  38.690 1.00 24.33 ? 14  TYR B C   1 
ATOM   1932 O O   . TYR B 1 26  ? 9.394   26.401  38.728 1.00 23.80 ? 14  TYR B O   1 
ATOM   1933 C CB  . TYR B 1 26  ? 10.340  29.287  38.558 1.00 27.42 ? 14  TYR B CB  1 
ATOM   1934 C CG  . TYR B 1 26  ? 11.011  30.441  39.284 1.00 30.94 ? 14  TYR B CG  1 
ATOM   1935 C CD1 . TYR B 1 26  ? 10.719  31.767  38.953 1.00 36.46 ? 14  TYR B CD1 1 
ATOM   1936 C CD2 . TYR B 1 26  ? 11.938  30.205  40.312 1.00 33.79 ? 14  TYR B CD2 1 
ATOM   1937 C CE1 . TYR B 1 26  ? 11.338  32.847  39.648 1.00 35.99 ? 14  TYR B CE1 1 
ATOM   1938 C CE2 . TYR B 1 26  ? 12.548  31.257  41.001 1.00 34.83 ? 14  TYR B CE2 1 
ATOM   1939 C CZ  . TYR B 1 26  ? 12.239  32.575  40.670 1.00 36.27 ? 14  TYR B CZ  1 
ATOM   1940 O OH  . TYR B 1 26  ? 12.864  33.626  41.373 1.00 36.57 ? 14  TYR B OH  1 
ATOM   1941 N N   . MET B 1 27  ? 7.456   27.446  38.154 1.00 24.79 ? 15  MET B N   1 
ATOM   1942 C CA  . MET B 1 27  ? 6.817   26.277  37.528 1.00 25.01 ? 15  MET B CA  1 
ATOM   1943 C C   . MET B 1 27  ? 6.213   26.617  36.175 1.00 24.73 ? 15  MET B C   1 
ATOM   1944 O O   . MET B 1 27  ? 5.478   27.607  36.043 1.00 24.77 ? 15  MET B O   1 
ATOM   1945 C CB  . MET B 1 27  ? 5.686   25.742  38.404 1.00 25.16 ? 15  MET B CB  1 
ATOM   1946 C CG  . MET B 1 27  ? 4.797   24.677  37.742 1.00 26.17 ? 15  MET B CG  1 
ATOM   1947 S SD  . MET B 1 27  ? 3.404   24.257  38.820 1.00 27.22 ? 15  MET B SD  1 
ATOM   1948 C CE  . MET B 1 27  ? 4.267   23.535  40.237 1.00 28.60 ? 15  MET B CE  1 
ATOM   1949 N N   . GLU B 1 28  ? 6.485   25.757  35.186 1.00 24.40 ? 16  GLU B N   1 
ATOM   1950 C CA  . GLU B 1 28  ? 5.852   25.917  33.884 1.00 25.82 ? 16  GLU B CA  1 
ATOM   1951 C C   . GLU B 1 28  ? 5.304   24.540  33.468 1.00 24.82 ? 16  GLU B C   1 
ATOM   1952 O O   . GLU B 1 28  ? 5.941   23.492  33.728 1.00 23.19 ? 16  GLU B O   1 
ATOM   1953 C CB  . GLU B 1 28  ? 6.851   26.427  32.850 1.00 24.99 ? 16  GLU B CB  1 
ATOM   1954 C CG  . GLU B 1 28  ? 6.165   26.895  31.560 1.00 30.82 ? 16  GLU B CG  1 
ATOM   1955 C CD  . GLU B 1 28  ? 7.136   27.421  30.469 1.00 32.16 ? 16  GLU B CD  1 
ATOM   1956 O OE1 . GLU B 1 28  ? 8.388   27.437  30.699 1.00 38.49 ? 16  GLU B OE1 1 
ATOM   1957 O OE2 . GLU B 1 28  ? 6.634   27.816  29.377 1.00 37.60 ? 16  GLU B OE2 1 
ATOM   1958 N N   . GLY B 1 29  ? 4.139   24.545  32.833 1.00 24.75 ? 17  GLY B N   1 
ATOM   1959 C CA  . GLY B 1 29  ? 3.606   23.253  32.335 1.00 24.97 ? 17  GLY B CA  1 
ATOM   1960 C C   . GLY B 1 29  ? 2.471   23.347  31.349 1.00 24.56 ? 17  GLY B C   1 
ATOM   1961 O O   . GLY B 1 29  ? 2.020   24.427  30.980 1.00 24.63 ? 17  GLY B O   1 
ATOM   1962 N N   . THR B 1 30  ? 1.983   22.179  30.947 1.00 24.60 ? 18  THR B N   1 
ATOM   1963 C CA  . THR B 1 30  ? 0.847   22.090  30.074 1.00 24.10 ? 18  THR B CA  1 
ATOM   1964 C C   . THR B 1 30  ? 0.041   20.884  30.558 1.00 23.50 ? 18  THR B C   1 
ATOM   1965 O O   . THR B 1 30  ? 0.623   19.837  30.791 1.00 22.95 ? 18  THR B O   1 
ATOM   1966 C CB  . THR B 1 30  ? 1.323   21.836  28.624 1.00 24.17 ? 18  THR B CB  1 
ATOM   1967 O OG1 . THR B 1 30  ? 2.249   22.866  28.219 1.00 25.66 ? 18  THR B OG1 1 
ATOM   1968 C CG2 . THR B 1 30  ? 0.165   21.850  27.664 1.00 24.29 ? 18  THR B CG2 1 
ATOM   1969 N N   . VAL B 1 31  ? -1.261  21.064  30.712 1.00 23.62 ? 19  VAL B N   1 
ATOM   1970 C CA  . VAL B 1 31  ? -2.166  19.957  31.100 1.00 24.08 ? 19  VAL B CA  1 
ATOM   1971 C C   . VAL B 1 31  ? -3.297  19.881  30.077 1.00 24.91 ? 19  VAL B C   1 
ATOM   1972 O O   . VAL B 1 31  ? -4.061  20.839  29.923 1.00 26.04 ? 19  VAL B O   1 
ATOM   1973 C CB  . VAL B 1 31  ? -2.749  20.151  32.491 1.00 23.73 ? 19  VAL B CB  1 
ATOM   1974 C CG1 . VAL B 1 31  ? -3.892  19.131  32.753 1.00 24.22 ? 19  VAL B CG1 1 
ATOM   1975 C CG2 . VAL B 1 31  ? -1.623  20.038  33.536 1.00 23.18 ? 19  VAL B CG2 1 
ATOM   1976 N N   . ASN B 1 32  ? -3.442  18.729  29.409 1.00 25.25 ? 20  ASN B N   1 
ATOM   1977 C CA  . ASN B 1 32  ? -4.428  18.620  28.327 1.00 25.10 ? 20  ASN B CA  1 
ATOM   1978 C C   . ASN B 1 32  ? -4.339  19.799  27.351 1.00 25.99 ? 20  ASN B C   1 
ATOM   1979 O O   . ASN B 1 32  ? -5.325  20.413  26.985 1.00 24.80 ? 20  ASN B O   1 
ATOM   1980 C CB  . ASN B 1 32  ? -5.834  18.451  28.893 1.00 25.78 ? 20  ASN B CB  1 
ATOM   1981 C CG  . ASN B 1 32  ? -6.108  17.015  29.288 1.00 24.85 ? 20  ASN B CG  1 
ATOM   1982 O OD1 . ASN B 1 32  ? -5.183  16.284  29.651 1.00 23.14 ? 20  ASN B OD1 1 
ATOM   1983 N ND2 . ASN B 1 32  ? -7.372  16.595  29.195 1.00 27.10 ? 20  ASN B ND2 1 
ATOM   1984 N N   . ASN B 1 33  ? -3.122  20.112  26.956 1.00 26.17 ? 21  ASN B N   1 
ATOM   1985 C CA  . ASN B 1 33  ? -2.914  21.216  26.020 1.00 28.93 ? 21  ASN B CA  1 
ATOM   1986 C C   . ASN B 1 33  ? -3.248  22.603  26.519 1.00 28.89 ? 21  ASN B C   1 
ATOM   1987 O O   . ASN B 1 33  ? -3.385  23.506  25.715 1.00 30.05 ? 21  ASN B O   1 
ATOM   1988 C CB  . ASN B 1 33  ? -3.622  20.928  24.711 1.00 28.24 ? 21  ASN B CB  1 
ATOM   1989 C CG  . ASN B 1 33  ? -3.205  19.594  24.155 1.00 31.52 ? 21  ASN B CG  1 
ATOM   1990 O OD1 . ASN B 1 33  ? -2.038  19.425  23.775 1.00 35.40 ? 21  ASN B OD1 1 
ATOM   1991 N ND2 . ASN B 1 33  ? -4.126  18.625  24.142 1.00 29.92 ? 21  ASN B ND2 1 
ATOM   1992 N N   . HIS B 1 34  ? -3.396  22.789  27.822 1.00 30.21 ? 22  HIS B N   1 
ATOM   1993 C CA  . HIS B 1 34  ? -3.433  24.160  28.334 1.00 30.90 ? 22  HIS B CA  1 
ATOM   1994 C C   . HIS B 1 34  ? -2.108  24.537  29.021 1.00 30.42 ? 22  HIS B C   1 
ATOM   1995 O O   . HIS B 1 34  ? -1.747  23.940  30.038 1.00 28.48 ? 22  HIS B O   1 
ATOM   1996 C CB  . HIS B 1 34  ? -4.628  24.417  29.254 1.00 32.34 ? 22  HIS B CB  1 
ATOM   1997 C CG  . HIS B 1 34  ? -4.688  25.837  29.725 1.00 35.54 ? 22  HIS B CG  1 
ATOM   1998 N ND1 . HIS B 1 34  ? -4.143  26.247  30.926 1.00 38.07 ? 22  HIS B ND1 1 
ATOM   1999 C CD2 . HIS B 1 34  ? -5.155  26.956  29.122 1.00 37.40 ? 22  HIS B CD2 1 
ATOM   2000 C CE1 . HIS B 1 34  ? -4.311  27.547  31.061 1.00 37.33 ? 22  HIS B CE1 1 
ATOM   2001 N NE2 . HIS B 1 34  ? -4.921  28.003  29.983 1.00 40.22 ? 22  HIS B NE2 1 
ATOM   2002 N N   . HIS B 1 35  ? -1.390  25.516  28.442 1.00 28.71 ? 23  HIS B N   1 
ATOM   2003 C CA  . HIS B 1 35  ? -0.112  25.980  28.971 1.00 29.47 ? 23  HIS B CA  1 
ATOM   2004 C C   . HIS B 1 35  ? -0.322  26.972  30.124 1.00 28.30 ? 23  HIS B C   1 
ATOM   2005 O O   . HIS B 1 35  ? -1.299  27.703  30.142 1.00 27.14 ? 23  HIS B O   1 
ATOM   2006 C CB  . HIS B 1 35  ? 0.750   26.600  27.856 1.00 29.32 ? 23  HIS B CB  1 
ATOM   2007 C CG  . HIS B 1 35  ? 2.063   27.141  28.331 1.00 34.77 ? 23  HIS B CG  1 
ATOM   2008 N ND1 . HIS B 1 35  ? 2.231   28.453  28.741 1.00 37.18 ? 23  HIS B ND1 1 
ATOM   2009 C CD2 . HIS B 1 35  ? 3.276   26.549  28.460 1.00 37.61 ? 23  HIS B CD2 1 
ATOM   2010 C CE1 . HIS B 1 35  ? 3.492   28.647  29.084 1.00 38.45 ? 23  HIS B CE1 1 
ATOM   2011 N NE2 . HIS B 1 35  ? 4.145   27.504  28.933 1.00 37.40 ? 23  HIS B NE2 1 
ATOM   2012 N N   . PHE B 1 36  ? 0.571   26.914  31.109 1.00 28.63 ? 24  PHE B N   1 
ATOM   2013 C CA  . PHE B 1 36  ? 0.532   27.806  32.300 1.00 27.73 ? 24  PHE B CA  1 
ATOM   2014 C C   . PHE B 1 36  ? 1.915   27.951  32.935 1.00 27.19 ? 24  PHE B C   1 
ATOM   2015 O O   . PHE B 1 36  ? 2.850   27.181  32.663 1.00 25.91 ? 24  PHE B O   1 
ATOM   2016 C CB  . PHE B 1 36  ? -0.452  27.289  33.362 1.00 28.22 ? 24  PHE B CB  1 
ATOM   2017 C CG  . PHE B 1 36  ? -0.046  25.942  33.929 1.00 26.91 ? 24  PHE B CG  1 
ATOM   2018 C CD1 . PHE B 1 36  ? 0.675   25.856  35.111 1.00 28.43 ? 24  PHE B CD1 1 
ATOM   2019 C CD2 . PHE B 1 36  ? -0.351  24.774  33.248 1.00 29.03 ? 24  PHE B CD2 1 
ATOM   2020 C CE1 . PHE B 1 36  ? 1.091   24.604  35.616 1.00 30.16 ? 24  PHE B CE1 1 
ATOM   2021 C CE2 . PHE B 1 36  ? 0.048   23.545  33.731 1.00 27.98 ? 24  PHE B CE2 1 
ATOM   2022 C CZ  . PHE B 1 36  ? 0.760   23.461  34.921 1.00 29.81 ? 24  PHE B CZ  1 
ATOM   2023 N N   . LYS B 1 37  ? 2.020   28.946  33.805 1.00 26.91 ? 25  LYS B N   1 
ATOM   2024 C CA  . LYS B 1 37  ? 3.236   29.206  34.562 1.00 27.80 ? 25  LYS B CA  1 
ATOM   2025 C C   . LYS B 1 37  ? 2.766   29.594  35.924 1.00 26.40 ? 25  LYS B C   1 
ATOM   2026 O O   . LYS B 1 37  ? 1.752   30.282  36.043 1.00 25.56 ? 25  LYS B O   1 
ATOM   2027 C CB  . LYS B 1 37  ? 4.000   30.406  33.975 1.00 28.19 ? 25  LYS B CB  1 
ATOM   2028 C CG  . LYS B 1 37  ? 4.650   30.164  32.637 1.00 31.45 ? 25  LYS B CG  1 
ATOM   2029 C CD  . LYS B 1 37  ? 5.814   31.139  32.450 1.00 35.62 ? 25  LYS B CD  1 
ATOM   2030 C CE  . LYS B 1 37  ? 6.736   30.683  31.329 1.00 37.59 ? 25  LYS B CE  1 
ATOM   2031 N NZ  . LYS B 1 37  ? 8.048   31.399  31.294 1.00 39.25 ? 25  LYS B NZ  1 
ATOM   2032 N N   . CYS B 1 38  ? 3.469   29.105  36.947 1.00 26.74 ? 26  CYS B N   1 
ATOM   2033 C CA  . CYS B 1 38  ? 3.216   29.516  38.326 1.00 26.60 ? 26  CYS B CA  1 
ATOM   2034 C C   . CYS B 1 38  ? 4.516   30.007  38.960 1.00 26.50 ? 26  CYS B C   1 
ATOM   2035 O O   . CYS B 1 38  ? 5.619   29.595  38.581 1.00 25.22 ? 26  CYS B O   1 
ATOM   2036 C CB  . CYS B 1 38  ? 2.610   28.370  39.161 1.00 26.99 ? 26  CYS B CB  1 
ATOM   2037 S SG  . CYS B 1 38  ? 0.933   27.854  38.618 1.00 28.96 ? 26  CYS B SG  1 
ATOM   2038 N N   . THR B 1 39  ? 4.372   30.902  39.936 1.00 27.05 ? 27  THR B N   1 
ATOM   2039 C CA  . THR B 1 39  ? 5.501   31.240  40.805 1.00 27.18 ? 27  THR B CA  1 
ATOM   2040 C C   . THR B 1 39  ? 4.990   31.141  42.232 1.00 26.28 ? 27  THR B C   1 
ATOM   2041 O O   . THR B 1 39  ? 3.786   31.264  42.498 1.00 26.08 ? 27  THR B O   1 
ATOM   2042 C CB  . THR B 1 39  ? 6.042   32.669  40.602 1.00 27.25 ? 27  THR B CB  1 
ATOM   2043 O OG1 . THR B 1 39  ? 4.959   33.585  40.801 1.00 26.50 ? 27  THR B OG1 1 
ATOM   2044 C CG2 . THR B 1 39  ? 6.719   32.845  39.212 1.00 29.05 ? 27  THR B CG2 1 
ATOM   2045 N N   . SER B 1 40  ? 5.900   30.919  43.156 1.00 26.74 ? 28  SER B N   1 
ATOM   2046 C CA  . SER B 1 40  ? 5.486   30.994  44.538 1.00 26.98 ? 28  SER B CA  1 
ATOM   2047 C C   . SER B 1 40  ? 6.639   31.384  45.443 1.00 27.36 ? 28  SER B C   1 
ATOM   2048 O O   . SER B 1 40  ? 7.812   31.152  45.117 1.00 26.58 ? 28  SER B O   1 
ATOM   2049 C CB  . SER B 1 40  ? 4.889   29.654  44.986 1.00 27.26 ? 28  SER B CB  1 
ATOM   2050 O OG  . SER B 1 40  ? 5.900   28.744  45.269 1.00 26.36 ? 28  SER B OG  1 
ATOM   2051 N N   . GLU B 1 41  ? 6.270   31.950  46.593 1.00 28.09 ? 29  GLU B N   1 
ATOM   2052 C CA  . GLU B 1 41  ? 7.190   32.143  47.701 1.00 29.89 ? 29  GLU B CA  1 
ATOM   2053 C C   . GLU B 1 41  ? 6.609   31.540  48.969 1.00 28.62 ? 29  GLU B C   1 
ATOM   2054 O O   . GLU B 1 41  ? 5.393   31.538  49.182 1.00 27.77 ? 29  GLU B O   1 
ATOM   2055 C CB  . GLU B 1 41  ? 7.549   33.640  47.883 1.00 30.20 ? 29  GLU B CB  1 
ATOM   2056 C CG  . GLU B 1 41  ? 8.485   34.122  46.758 1.00 34.15 ? 29  GLU B CG  1 
ATOM   2057 C CD  . GLU B 1 41  ? 8.927   35.590  46.892 1.00 34.76 ? 29  GLU B CD  1 
ATOM   2058 O OE1 . GLU B 1 41  ? 9.382   35.981  47.998 1.00 41.98 ? 29  GLU B OE1 1 
ATOM   2059 O OE2 . GLU B 1 41  ? 8.830   36.332  45.888 1.00 38.97 ? 29  GLU B OE2 1 
ATOM   2060 N N   . GLY B 1 42  ? 7.478   30.970  49.788 1.00 28.34 ? 30  GLY B N   1 
ATOM   2061 C CA  . GLY B 1 42  ? 7.034   30.495  51.079 1.00 28.18 ? 30  GLY B CA  1 
ATOM   2062 C C   . GLY B 1 42  ? 8.112   30.395  52.131 1.00 28.09 ? 30  GLY B C   1 
ATOM   2063 O O   . GLY B 1 42  ? 9.288   30.758  51.926 1.00 27.45 ? 30  GLY B O   1 
ATOM   2064 N N   A GLU B 1 43  ? 7.703   29.836  53.257 0.50 28.11 ? 31  GLU B N   1 
ATOM   2065 N N   B GLU B 1 43  ? 7.707   29.935  53.307 0.50 28.12 ? 31  GLU B N   1 
ATOM   2066 C CA  A GLU B 1 43  ? 8.580   29.642  54.384 0.50 28.28 ? 31  GLU B CA  1 
ATOM   2067 C CA  B GLU B 1 43  ? 8.653   29.625  54.370 0.50 28.37 ? 31  GLU B CA  1 
ATOM   2068 C C   A GLU B 1 43  ? 8.122   28.415  55.158 0.50 27.60 ? 31  GLU B C   1 
ATOM   2069 C C   B GLU B 1 43  ? 8.137   28.453  55.181 0.50 27.55 ? 31  GLU B C   1 
ATOM   2070 O O   A GLU B 1 43  ? 6.931   28.060  55.130 0.50 27.62 ? 31  GLU B O   1 
ATOM   2071 O O   B GLU B 1 43  ? 6.924   28.186  55.218 0.50 27.40 ? 31  GLU B O   1 
ATOM   2072 C CB  A GLU B 1 43  ? 8.583   30.901  55.280 0.50 29.14 ? 31  GLU B CB  1 
ATOM   2073 C CB  B GLU B 1 43  ? 8.928   30.844  55.286 0.50 29.00 ? 31  GLU B CB  1 
ATOM   2074 C CG  A GLU B 1 43  ? 7.214   31.427  55.691 0.50 30.39 ? 31  GLU B CG  1 
ATOM   2075 C CG  B GLU B 1 43  ? 9.886   30.538  56.452 0.50 28.94 ? 31  GLU B CG  1 
ATOM   2076 C CD  A GLU B 1 43  ? 6.462   32.205  54.600 0.50 34.11 ? 31  GLU B CD  1 
ATOM   2077 C CD  B GLU B 1 43  ? 10.593  31.752  57.028 0.50 30.14 ? 31  GLU B CD  1 
ATOM   2078 O OE1 A GLU B 1 43  ? 7.096   32.898  53.757 0.50 35.12 ? 31  GLU B OE1 1 
ATOM   2079 O OE1 B GLU B 1 43  ? 9.936   32.801  57.235 0.50 34.16 ? 31  GLU B OE1 1 
ATOM   2080 O OE2 A GLU B 1 43  ? 5.211   32.140  54.611 0.50 34.64 ? 31  GLU B OE2 1 
ATOM   2081 O OE2 B GLU B 1 43  ? 11.813  31.649  57.282 0.50 30.31 ? 31  GLU B OE2 1 
ATOM   2082 N N   . GLY B 1 44  ? 9.073   27.757  55.813 1.00 27.18 ? 32  GLY B N   1 
ATOM   2083 C CA  . GLY B 1 44  ? 8.744   26.711  56.744 1.00 27.39 ? 32  GLY B CA  1 
ATOM   2084 C C   . GLY B 1 44  ? 9.839   26.341  57.707 1.00 27.82 ? 32  GLY B C   1 
ATOM   2085 O O   . GLY B 1 44  ? 10.925  26.960  57.763 1.00 26.62 ? 32  GLY B O   1 
ATOM   2086 N N   . LYS B 1 45  ? 9.536   25.296  58.472 1.00 27.65 ? 33  LYS B N   1 
ATOM   2087 C CA  . LYS B 1 45  ? 10.429  24.777  59.463 1.00 28.42 ? 33  LYS B CA  1 
ATOM   2088 C C   . LYS B 1 45  ? 10.886  23.363  59.091 1.00 28.19 ? 33  LYS B C   1 
ATOM   2089 O O   . LYS B 1 45  ? 10.184  22.364  59.377 1.00 29.01 ? 33  LYS B O   1 
ATOM   2090 C CB  . LYS B 1 45  ? 9.739   24.823  60.837 1.00 28.43 ? 33  LYS B CB  1 
ATOM   2091 C CG  . LYS B 1 45  ? 9.474   26.224  61.331 1.00 30.95 ? 33  LYS B CG  1 
ATOM   2092 C CD  . LYS B 1 45  ? 8.753   26.240  62.659 1.00 34.68 ? 33  LYS B CD  1 
ATOM   2093 C CE  . LYS B 1 45  ? 8.878   27.631  63.297 1.00 35.44 ? 33  LYS B CE  1 
ATOM   2094 N NZ  . LYS B 1 45  ? 10.284  27.869  63.787 1.00 35.85 ? 33  LYS B NZ  1 
ATOM   2095 N N   . PRO B 1 46  ? 12.079  23.258  58.492 1.00 27.38 ? 34  PRO B N   1 
ATOM   2096 C CA  . PRO B 1 46  ? 12.551  22.017  57.913 1.00 27.44 ? 34  PRO B CA  1 
ATOM   2097 C C   . PRO B 1 46  ? 12.662  20.886  58.915 1.00 27.74 ? 34  PRO B C   1 
ATOM   2098 O O   . PRO B 1 46  ? 12.501  19.732  58.547 1.00 26.70 ? 34  PRO B O   1 
ATOM   2099 C CB  . PRO B 1 46  ? 13.940  22.388  57.377 1.00 27.24 ? 34  PRO B CB  1 
ATOM   2100 C CG  . PRO B 1 46  ? 13.894  23.889  57.220 1.00 27.42 ? 34  PRO B CG  1 
ATOM   2101 C CD  . PRO B 1 46  ? 13.091  24.327  58.370 1.00 26.81 ? 34  PRO B CD  1 
ATOM   2102 N N   . TYR B 1 47  ? 12.969  21.208  60.173 1.00 27.90 ? 35  TYR B N   1 
ATOM   2103 C CA  . TYR B 1 47  ? 13.158  20.173  61.173 1.00 27.97 ? 35  TYR B CA  1 
ATOM   2104 C C   . TYR B 1 47  ? 11.860  19.742  61.864 1.00 27.52 ? 35  TYR B C   1 
ATOM   2105 O O   . TYR B 1 47  ? 11.807  18.670  62.466 1.00 28.54 ? 35  TYR B O   1 
ATOM   2106 C CB  . TYR B 1 47  ? 14.249  20.587  62.178 1.00 27.59 ? 35  TYR B CB  1 
ATOM   2107 C CG  . TYR B 1 47  ? 15.588  20.789  61.483 1.00 27.98 ? 35  TYR B CG  1 
ATOM   2108 C CD1 . TYR B 1 47  ? 15.986  22.062  61.028 1.00 27.66 ? 35  TYR B CD1 1 
ATOM   2109 C CD2 . TYR B 1 47  ? 16.427  19.721  61.253 1.00 25.46 ? 35  TYR B CD2 1 
ATOM   2110 C CE1 . TYR B 1 47  ? 17.211  22.242  60.370 1.00 27.07 ? 35  TYR B CE1 1 
ATOM   2111 C CE2 . TYR B 1 47  ? 17.662  19.885  60.590 1.00 25.85 ? 35  TYR B CE2 1 
ATOM   2112 C CZ  . TYR B 1 47  ? 18.041  21.142  60.167 1.00 27.61 ? 35  TYR B CZ  1 
ATOM   2113 O OH  . TYR B 1 47  ? 19.242  21.268  59.510 1.00 28.29 ? 35  TYR B OH  1 
ATOM   2114 N N   . GLU B 1 48  ? 10.843  20.584  61.799 1.00 28.36 ? 36  GLU B N   1 
ATOM   2115 C CA  . GLU B 1 48  ? 9.534   20.250  62.318 1.00 30.54 ? 36  GLU B CA  1 
ATOM   2116 C C   . GLU B 1 48  ? 8.602   19.637  61.254 1.00 29.90 ? 36  GLU B C   1 
ATOM   2117 O O   . GLU B 1 48  ? 7.491   19.180  61.588 1.00 31.26 ? 36  GLU B O   1 
ATOM   2118 C CB  . GLU B 1 48  ? 8.863   21.482  62.892 1.00 30.11 ? 36  GLU B CB  1 
ATOM   2119 C CG  . GLU B 1 48  ? 9.298   21.880  64.304 1.00 34.03 ? 36  GLU B CG  1 
ATOM   2120 C CD  . GLU B 1 48  ? 8.642   23.182  64.769 1.00 35.17 ? 36  GLU B CD  1 
ATOM   2121 O OE1 . GLU B 1 48  ? 7.393   23.328  64.658 1.00 39.38 ? 36  GLU B OE1 1 
ATOM   2122 O OE2 . GLU B 1 48  ? 9.368   24.059  65.285 1.00 41.83 ? 36  GLU B OE2 1 
ATOM   2123 N N   . GLY B 1 49  ? 9.019   19.696  59.986 1.00 29.38 ? 37  GLY B N   1 
ATOM   2124 C CA  . GLY B 1 49  ? 8.205   19.187  58.873 1.00 27.76 ? 37  GLY B CA  1 
ATOM   2125 C C   . GLY B 1 49  ? 7.026   20.039  58.430 1.00 27.74 ? 37  GLY B C   1 
ATOM   2126 O O   . GLY B 1 49  ? 6.021   19.500  57.950 1.00 27.68 ? 37  GLY B O   1 
ATOM   2127 N N   . THR B 1 50  ? 7.116   21.370  58.559 1.00 26.62 ? 38  THR B N   1 
ATOM   2128 C CA  . THR B 1 50  ? 5.979   22.243  58.204 1.00 25.92 ? 38  THR B CA  1 
ATOM   2129 C C   . THR B 1 50  ? 6.400   23.337  57.209 1.00 26.30 ? 38  THR B C   1 
ATOM   2130 O O   . THR B 1 50  ? 7.538   23.813  57.242 1.00 24.72 ? 38  THR B O   1 
ATOM   2131 C CB  . THR B 1 50  ? 5.360   22.949  59.438 1.00 27.43 ? 38  THR B CB  1 
ATOM   2132 O OG1 . THR B 1 50  ? 6.395   23.677  60.116 1.00 26.11 ? 38  THR B OG1 1 
ATOM   2133 C CG2 . THR B 1 50  ? 4.661   21.967  60.403 1.00 26.83 ? 38  THR B CG2 1 
ATOM   2134 N N   . GLN B 1 51  ? 5.486   23.714  56.319 1.00 25.95 ? 39  GLN B N   1 
ATOM   2135 C CA  . GLN B 1 51  ? 5.753   24.751  55.314 1.00 25.54 ? 39  GLN B CA  1 
ATOM   2136 C C   . GLN B 1 51  ? 4.462   25.315  54.752 1.00 26.89 ? 39  GLN B C   1 
ATOM   2137 O O   . GLN B 1 51  ? 3.429   24.637  54.686 1.00 26.79 ? 39  GLN B O   1 
ATOM   2138 C CB  . GLN B 1 51  ? 6.630   24.226  54.162 1.00 25.95 ? 39  GLN B CB  1 
ATOM   2139 C CG  . GLN B 1 51  ? 5.983   22.995  53.406 1.00 24.38 ? 39  GLN B CG  1 
ATOM   2140 C CD  . GLN B 1 51  ? 6.909   22.379  52.374 1.00 25.42 ? 39  GLN B CD  1 
ATOM   2141 O OE1 . GLN B 1 51  ? 7.393   23.071  51.483 1.00 29.38 ? 39  GLN B OE1 1 
ATOM   2142 N NE2 . GLN B 1 51  ? 7.172   21.061  52.496 1.00 25.46 ? 39  GLN B NE2 1 
ATOM   2143 N N   . THR B 1 52  ? 4.517   26.562  54.302 1.00 27.03 ? 40  THR B N   1 
ATOM   2144 C CA  . THR B 1 52  ? 3.370   27.155  53.658 1.00 28.69 ? 40  THR B CA  1 
ATOM   2145 C C   . THR B 1 52  ? 3.921   27.825  52.411 1.00 29.54 ? 40  THR B C   1 
ATOM   2146 O O   . THR B 1 52  ? 5.018   28.368  52.467 1.00 29.67 ? 40  THR B O   1 
ATOM   2147 C CB  . THR B 1 52  ? 2.721   28.197  54.571 1.00 28.87 ? 40  THR B CB  1 
ATOM   2148 O OG1 . THR B 1 52  ? 2.315   27.570  55.788 1.00 29.97 ? 40  THR B OG1 1 
ATOM   2149 C CG2 . THR B 1 52  ? 1.506   28.822  53.912 1.00 30.60 ? 40  THR B CG2 1 
ATOM   2150 N N   . MET B 1 53  ? 3.164   27.789  51.315 1.00 29.76 ? 41  MET B N   1 
ATOM   2151 C CA  . MET B 1 53  ? 3.464   28.561  50.114 1.00 30.90 ? 41  MET B CA  1 
ATOM   2152 C C   . MET B 1 53  ? 2.353   29.486  49.688 1.00 31.11 ? 41  MET B C   1 
ATOM   2153 O O   . MET B 1 53  ? 1.166   29.133  49.780 1.00 31.01 ? 41  MET B O   1 
ATOM   2154 C CB  . MET B 1 53  ? 3.771   27.640  48.935 1.00 30.94 ? 41  MET B CB  1 
ATOM   2155 C CG  . MET B 1 53  ? 5.114   27.030  48.981 1.00 32.52 ? 41  MET B CG  1 
ATOM   2156 S SD  . MET B 1 53  ? 5.350   26.184  47.421 1.00 32.23 ? 41  MET B SD  1 
ATOM   2157 C CE  . MET B 1 53  ? 7.016   25.603  47.628 1.00 30.23 ? 41  MET B CE  1 
ATOM   2158 N N   . ARG B 1 54  ? 2.709   30.681  49.205 1.00 31.02 ? 42  ARG B N   1 
ATOM   2159 C CA  . ARG B 1 54  ? 1.686   31.512  48.541 1.00 31.98 ? 42  ARG B CA  1 
ATOM   2160 C C   . ARG B 1 54  ? 1.941   31.438  47.047 1.00 31.05 ? 42  ARG B C   1 
ATOM   2161 O O   . ARG B 1 54  ? 2.989   31.884  46.560 1.00 31.22 ? 42  ARG B O   1 
ATOM   2162 C CB  . ARG B 1 54  ? 1.671   32.983  49.017 1.00 32.29 ? 42  ARG B CB  1 
ATOM   2163 C CG  . ARG B 1 54  ? 1.409   33.189  50.530 1.00 34.89 ? 42  ARG B CG  1 
ATOM   2164 C CD  . ARG B 1 54  ? 2.124   34.484  51.059 1.00 34.80 ? 42  ARG B CD  1 
ATOM   2165 N NE  . ARG B 1 54  ? 3.587   34.443  50.869 1.00 43.80 ? 42  ARG B NE  1 
ATOM   2166 C CZ  . ARG B 1 54  ? 4.452   33.925  51.746 1.00 45.74 ? 42  ARG B CZ  1 
ATOM   2167 N NH1 . ARG B 1 54  ? 4.014   33.390  52.881 1.00 46.62 ? 42  ARG B NH1 1 
ATOM   2168 N NH2 . ARG B 1 54  ? 5.761   33.928  51.486 1.00 48.74 ? 42  ARG B NH2 1 
ATOM   2169 N N   . ILE B 1 55  ? 0.991   30.860  46.319 1.00 29.95 ? 43  ILE B N   1 
ATOM   2170 C CA  . ILE B 1 55  ? 1.215   30.546  44.911 1.00 29.22 ? 43  ILE B CA  1 
ATOM   2171 C C   . ILE B 1 55  ? 0.456   31.482  44.008 1.00 29.62 ? 43  ILE B C   1 
ATOM   2172 O O   . ILE B 1 55  ? -0.704  31.796  44.283 1.00 30.13 ? 43  ILE B O   1 
ATOM   2173 C CB  . ILE B 1 55  ? 0.755   29.097  44.598 1.00 29.17 ? 43  ILE B CB  1 
ATOM   2174 C CG1 . ILE B 1 55  ? 1.566   28.097  45.440 1.00 26.99 ? 43  ILE B CG1 1 
ATOM   2175 C CG2 . ILE B 1 55  ? 0.851   28.812  43.088 1.00 28.60 ? 43  ILE B CG2 1 
ATOM   2176 C CD1 . ILE B 1 55  ? 0.776   26.881  45.846 1.00 26.64 ? 43  ILE B CD1 1 
ATOM   2177 N N   . LYS B 1 56  ? 1.084   31.882  42.907 1.00 30.00 ? 44  LYS B N   1 
ATOM   2178 C CA  . LYS B 1 56  ? 0.382   32.670  41.890 1.00 31.55 ? 44  LYS B CA  1 
ATOM   2179 C C   . LYS B 1 56  ? 0.475   32.038  40.505 1.00 29.74 ? 44  LYS B C   1 
ATOM   2180 O O   . LYS B 1 56  ? 1.554   31.697  40.055 1.00 28.84 ? 44  LYS B O   1 
ATOM   2181 C CB  . LYS B 1 56  ? 0.956   34.093  41.794 1.00 31.35 ? 44  LYS B CB  1 
ATOM   2182 C CG  . LYS B 1 56  ? 1.005   34.888  43.096 1.00 36.50 ? 44  LYS B CG  1 
ATOM   2183 C CD  . LYS B 1 56  ? 1.817   36.191  42.846 1.00 35.06 ? 44  LYS B CD  1 
ATOM   2184 C CE  . LYS B 1 56  ? 1.938   37.078  44.092 1.00 40.45 ? 44  LYS B CE  1 
ATOM   2185 N NZ  . LYS B 1 56  ? 2.923   38.203  43.851 1.00 41.27 ? 44  LYS B NZ  1 
ATOM   2186 N N   . VAL B 1 57  ? -0.668  31.939  39.838 1.00 30.44 ? 45  VAL B N   1 
ATOM   2187 C CA  . VAL B 1 57  ? -0.745  31.615  38.417 1.00 31.31 ? 45  VAL B CA  1 
ATOM   2188 C C   . VAL B 1 57  ? -0.450  32.893  37.631 1.00 31.72 ? 45  VAL B C   1 
ATOM   2189 O O   . VAL B 1 57  ? -1.231  33.855  37.655 1.00 32.64 ? 45  VAL B O   1 
ATOM   2190 C CB  . VAL B 1 57  ? -2.136  31.067  38.011 1.00 31.57 ? 45  VAL B CB  1 
ATOM   2191 C CG1 . VAL B 1 57  ? -2.167  30.775  36.505 1.00 31.10 ? 45  VAL B CG1 1 
ATOM   2192 C CG2 . VAL B 1 57  ? -2.466  29.817  38.836 1.00 31.22 ? 45  VAL B CG2 1 
ATOM   2193 N N   . VAL B 1 58  ? 0.691   32.902  36.959 1.00 31.78 ? 46  VAL B N   1 
ATOM   2194 C CA  . VAL B 1 58  ? 1.132   34.122  36.264 1.00 31.96 ? 46  VAL B CA  1 
ATOM   2195 C C   . VAL B 1 58  ? 0.862   34.123  34.748 1.00 33.18 ? 46  VAL B C   1 
ATOM   2196 O O   . VAL B 1 58  ? 0.700   35.183  34.143 1.00 33.35 ? 46  VAL B O   1 
ATOM   2197 C CB  . VAL B 1 58  ? 2.584   34.531  36.640 1.00 31.20 ? 46  VAL B CB  1 
ATOM   2198 C CG1 . VAL B 1 58  ? 2.650   34.828  38.131 1.00 31.54 ? 46  VAL B CG1 1 
ATOM   2199 C CG2 . VAL B 1 58  ? 3.617   33.496  36.248 1.00 31.06 ? 46  VAL B CG2 1 
ATOM   2200 N N   . GLU B 1 59  ? 0.749   32.930  34.159 1.00 33.40 ? 47  GLU B N   1 
ATOM   2201 C CA  . GLU B 1 59  ? 0.388   32.769  32.760 1.00 33.57 ? 47  GLU B CA  1 
ATOM   2202 C C   . GLU B 1 59  ? -0.566  31.575  32.667 1.00 33.46 ? 47  GLU B C   1 
ATOM   2203 O O   . GLU B 1 59  ? -0.430  30.607  33.420 1.00 32.08 ? 47  GLU B O   1 
ATOM   2204 C CB  . GLU B 1 59  ? 1.645   32.499  31.978 1.00 33.53 ? 47  GLU B CB  1 
ATOM   2205 C CG  . GLU B 1 59  ? 1.470   32.226  30.522 1.00 37.96 ? 47  GLU B CG  1 
ATOM   2206 C CD  . GLU B 1 59  ? 2.796   32.277  29.808 1.00 43.11 ? 47  GLU B CD  1 
ATOM   2207 O OE1 . GLU B 1 59  ? 3.777   32.757  30.429 1.00 48.19 ? 47  GLU B OE1 1 
ATOM   2208 O OE2 . GLU B 1 59  ? 2.869   31.856  28.631 1.00 47.30 ? 47  GLU B OE2 1 
ATOM   2209 N N   . GLY B 1 60  ? -1.537  31.664  31.764 1.00 34.34 ? 48  GLY B N   1 
ATOM   2210 C CA  . GLY B 1 60  ? -2.521  30.593  31.542 1.00 34.55 ? 48  GLY B CA  1 
ATOM   2211 C C   . GLY B 1 60  ? -3.727  30.636  32.458 1.00 35.08 ? 48  GLY B C   1 
ATOM   2212 O O   . GLY B 1 60  ? -4.562  29.724  32.449 1.00 35.01 ? 48  GLY B O   1 
ATOM   2213 N N   . GLY B 1 61  ? -3.821  31.681  33.270 1.00 34.63 ? 49  GLY B N   1 
ATOM   2214 C CA  . GLY B 1 61  ? -4.884  31.797  34.251 1.00 34.82 ? 49  GLY B CA  1 
ATOM   2215 C C   . GLY B 1 61  ? -6.139  32.461  33.720 1.00 35.56 ? 49  GLY B C   1 
ATOM   2216 O O   . GLY B 1 61  ? -6.067  33.318  32.835 1.00 35.53 ? 49  GLY B O   1 
ATOM   2217 N N   . PRO B 1 62  ? -7.311  32.073  34.248 1.00 35.63 ? 50  PRO B N   1 
ATOM   2218 C CA  . PRO B 1 62  ? -7.508  31.083  35.313 1.00 35.86 ? 50  PRO B CA  1 
ATOM   2219 C C   . PRO B 1 62  ? -7.364  29.658  34.741 1.00 35.02 ? 50  PRO B C   1 
ATOM   2220 O O   . PRO B 1 62  ? -7.694  29.434  33.580 1.00 35.51 ? 50  PRO B O   1 
ATOM   2221 C CB  . PRO B 1 62  ? -8.936  31.345  35.789 1.00 35.56 ? 50  PRO B CB  1 
ATOM   2222 C CG  . PRO B 1 62  ? -9.593  32.124  34.724 1.00 36.04 ? 50  PRO B CG  1 
ATOM   2223 C CD  . PRO B 1 62  ? -8.582  32.589  33.718 1.00 35.98 ? 50  PRO B CD  1 
ATOM   2224 N N   . LEU B 1 63  ? -6.812  28.731  35.516 1.00 34.19 ? 51  LEU B N   1 
ATOM   2225 C CA  . LEU B 1 63  ? -6.611  27.349  35.010 1.00 33.77 ? 51  LEU B CA  1 
ATOM   2226 C C   . LEU B 1 63  ? -7.943  26.651  34.714 1.00 33.24 ? 51  LEU B C   1 
ATOM   2227 O O   . LEU B 1 63  ? -8.870  26.738  35.518 1.00 33.37 ? 51  LEU B O   1 
ATOM   2228 C CB  . LEU B 1 63  ? -5.764  26.521  35.990 1.00 32.98 ? 51  LEU B CB  1 
ATOM   2229 C CG  . LEU B 1 63  ? -4.399  27.149  36.303 1.00 32.77 ? 51  LEU B CG  1 
ATOM   2230 C CD1 . LEU B 1 63  ? -3.796  26.473  37.527 1.00 32.03 ? 51  LEU B CD1 1 
ATOM   2231 C CD2 . LEU B 1 63  ? -3.450  27.091  35.109 1.00 28.83 ? 51  LEU B CD2 1 
ATOM   2232 N N   . PRO B 1 64  ? -8.058  25.982  33.545 1.00 32.82 ? 52  PRO B N   1 
ATOM   2233 C CA  . PRO B 1 64  ? -9.294  25.248  33.219 1.00 32.57 ? 52  PRO B CA  1 
ATOM   2234 C C   . PRO B 1 64  ? -9.361  23.828  33.805 1.00 32.03 ? 52  PRO B C   1 
ATOM   2235 O O   . PRO B 1 64  ? -10.154 22.999  33.341 1.00 33.24 ? 52  PRO B O   1 
ATOM   2236 C CB  . PRO B 1 64  ? -9.267  25.188  31.692 1.00 32.52 ? 52  PRO B CB  1 
ATOM   2237 C CG  . PRO B 1 64  ? -7.827  25.251  31.325 1.00 33.37 ? 52  PRO B CG  1 
ATOM   2238 C CD  . PRO B 1 64  ? -7.077  25.907  32.458 1.00 33.28 ? 52  PRO B CD  1 
ATOM   2239 N N   . PHE B 1 65  ? -8.534  23.554  34.802 1.00 30.07 ? 53  PHE B N   1 
ATOM   2240 C CA  . PHE B 1 65  ? -8.477  22.246  35.436 1.00 29.16 ? 53  PHE B CA  1 
ATOM   2241 C C   . PHE B 1 65  ? -8.227  22.458  36.915 1.00 28.47 ? 53  PHE B C   1 
ATOM   2242 O O   . PHE B 1 65  ? -7.823  23.565  37.327 1.00 28.50 ? 53  PHE B O   1 
ATOM   2243 C CB  . PHE B 1 65  ? -7.379  21.366  34.816 1.00 28.79 ? 53  PHE B CB  1 
ATOM   2244 C CG  . PHE B 1 65  ? -5.998  21.959  34.904 1.00 29.14 ? 53  PHE B CG  1 
ATOM   2245 C CD1 . PHE B 1 65  ? -5.221  21.798  36.056 1.00 29.77 ? 53  PHE B CD1 1 
ATOM   2246 C CD2 . PHE B 1 65  ? -5.467  22.693  33.839 1.00 28.74 ? 53  PHE B CD2 1 
ATOM   2247 C CE1 . PHE B 1 65  ? -3.932  22.350  36.139 1.00 28.69 ? 53  PHE B CE1 1 
ATOM   2248 C CE2 . PHE B 1 65  ? -4.165  23.256  33.915 1.00 28.50 ? 53  PHE B CE2 1 
ATOM   2249 C CZ  . PHE B 1 65  ? -3.404  23.084  35.065 1.00 28.73 ? 53  PHE B CZ  1 
ATOM   2250 N N   . ALA B 1 66  ? -8.432  21.397  37.698 1.00 26.56 ? 54  ALA B N   1 
ATOM   2251 C CA  . ALA B 1 66  ? -8.348  21.439  39.140 1.00 26.00 ? 54  ALA B CA  1 
ATOM   2252 C C   . ALA B 1 66  ? -6.914  21.683  39.577 1.00 26.09 ? 54  ALA B C   1 
ATOM   2253 O O   . ALA B 1 66  ? -6.016  20.938  39.193 1.00 25.61 ? 54  ALA B O   1 
ATOM   2254 C CB  . ALA B 1 66  ? -8.899  20.122  39.753 1.00 26.61 ? 54  ALA B CB  1 
ATOM   2255 N N   . PHE B 1 67  ? -6.712  22.753  40.357 1.00 26.10 ? 55  PHE B N   1 
ATOM   2256 C CA  . PHE B 1 67  ? -5.395  23.102  40.896 1.00 25.28 ? 55  PHE B CA  1 
ATOM   2257 C C   . PHE B 1 67  ? -4.777  21.940  41.705 1.00 24.25 ? 55  PHE B C   1 
ATOM   2258 O O   . PHE B 1 67  ? -3.560  21.775  41.702 1.00 24.27 ? 55  PHE B O   1 
ATOM   2259 C CB  . PHE B 1 67  ? -5.495  24.395  41.753 1.00 26.64 ? 55  PHE B CB  1 
ATOM   2260 C CG  . PHE B 1 67  ? -4.162  24.974  42.125 1.00 27.28 ? 55  PHE B CG  1 
ATOM   2261 C CD1 . PHE B 1 67  ? -3.579  25.963  41.326 1.00 29.71 ? 55  PHE B CD1 1 
ATOM   2262 C CD2 . PHE B 1 67  ? -3.496  24.547  43.274 1.00 26.87 ? 55  PHE B CD2 1 
ATOM   2263 C CE1 . PHE B 1 67  ? -2.344  26.493  41.653 1.00 29.98 ? 55  PHE B CE1 1 
ATOM   2264 C CE2 . PHE B 1 67  ? -2.229  25.082  43.603 1.00 29.65 ? 55  PHE B CE2 1 
ATOM   2265 C CZ  . PHE B 1 67  ? -1.670  26.044  42.789 1.00 29.21 ? 55  PHE B CZ  1 
ATOM   2266 N N   . ASP B 1 68  ? -5.627  21.129  42.344 1.00 23.93 ? 56  ASP B N   1 
ATOM   2267 C CA  . ASP B 1 68  ? -5.192  19.986  43.159 1.00 23.48 ? 56  ASP B CA  1 
ATOM   2268 C C   . ASP B 1 68  ? -4.168  19.061  42.491 1.00 22.45 ? 56  ASP B C   1 
ATOM   2269 O O   . ASP B 1 68  ? -3.338  18.470  43.176 1.00 22.31 ? 56  ASP B O   1 
ATOM   2270 C CB  . ASP B 1 68  ? -6.394  19.140  43.590 1.00 23.76 ? 56  ASP B CB  1 
ATOM   2271 C CG  . ASP B 1 68  ? -7.240  19.800  44.677 1.00 25.71 ? 56  ASP B CG  1 
ATOM   2272 O OD1 . ASP B 1 68  ? -6.703  20.587  45.515 1.00 27.83 ? 56  ASP B OD1 1 
ATOM   2273 O OD2 . ASP B 1 68  ? -8.444  19.498  44.714 1.00 24.88 ? 56  ASP B OD2 1 
ATOM   2274 N N   . ILE B 1 69  ? -4.233  18.929  41.154 1.00 21.58 ? 57  ILE B N   1 
ATOM   2275 C CA  . ILE B 1 69  ? -3.337  18.023  40.441 1.00 20.73 ? 57  ILE B CA  1 
ATOM   2276 C C   . ILE B 1 69  ? -1.916  18.582  40.412 1.00 21.93 ? 57  ILE B C   1 
ATOM   2277 O O   . ILE B 1 69  ? -0.966  17.874  40.116 1.00 21.15 ? 57  ILE B O   1 
ATOM   2278 C CB  . ILE B 1 69  ? -3.826  17.677  38.995 1.00 21.00 ? 57  ILE B CB  1 
ATOM   2279 C CG1 . ILE B 1 69  ? -3.725  18.894  38.061 1.00 20.27 ? 57  ILE B CG1 1 
ATOM   2280 C CG2 . ILE B 1 69  ? -5.248  17.078  39.048 1.00 21.64 ? 57  ILE B CG2 1 
ATOM   2281 C CD1 . ILE B 1 69  ? -3.884  18.494  36.576 1.00 20.78 ? 57  ILE B CD1 1 
ATOM   2282 N N   . LEU B 1 70  ? -1.790  19.874  40.736 1.00 21.14 ? 58  LEU B N   1 
ATOM   2283 C CA  . LEU B 1 70  ? -0.450  20.479  40.837 1.00 21.97 ? 58  LEU B CA  1 
ATOM   2284 C C   . LEU B 1 70  ? 0.160   20.475  42.247 1.00 21.88 ? 58  LEU B C   1 
ATOM   2285 O O   . LEU B 1 70  ? 1.349   20.763  42.401 1.00 21.93 ? 58  LEU B O   1 
ATOM   2286 C CB  . LEU B 1 70  ? -0.514  21.928  40.341 1.00 22.03 ? 58  LEU B CB  1 
ATOM   2287 C CG  . LEU B 1 70  ? -1.018  22.185  38.915 1.00 22.86 ? 58  LEU B CG  1 
ATOM   2288 C CD1 . LEU B 1 70  ? -0.916  23.699  38.637 1.00 25.29 ? 58  LEU B CD1 1 
ATOM   2289 C CD2 . LEU B 1 70  ? -0.257  21.335  37.834 1.00 18.93 ? 58  LEU B CD2 1 
ATOM   2290 N N   . ALA B 1 71  ? -0.636  20.139  43.257 1.00 22.27 ? 59  ALA B N   1 
ATOM   2291 C CA  . ALA B 1 71  ? -0.250  20.362  44.677 1.00 22.42 ? 59  ALA B CA  1 
ATOM   2292 C C   . ALA B 1 71  ? 1.059   19.673  45.097 1.00 22.81 ? 59  ALA B C   1 
ATOM   2293 O O   . ALA B 1 71  ? 1.890   20.242  45.816 1.00 23.13 ? 59  ALA B O   1 
ATOM   2294 C CB  . ALA B 1 71  ? -1.387  19.946  45.574 1.00 22.29 ? 59  ALA B CB  1 
ATOM   2295 N N   . THR B 1 72  ? 1.281   18.445  44.648 1.00 21.32 ? 60  THR B N   1 
ATOM   2296 C CA  . THR B 1 72  ? 2.497   17.736  45.006 1.00 21.55 ? 60  THR B CA  1 
ATOM   2297 C C   . THR B 1 72  ? 3.708   18.202  44.227 1.00 21.74 ? 60  THR B C   1 
ATOM   2298 O O   . THR B 1 72  ? 4.792   17.722  44.446 1.00 21.62 ? 60  THR B O   1 
ATOM   2299 C CB  . THR B 1 72  ? 2.325   16.233  44.770 1.00 21.94 ? 60  THR B CB  1 
ATOM   2300 O OG1 . THR B 1 72  ? 2.103   16.030  43.365 1.00 21.35 ? 60  THR B OG1 1 
ATOM   2301 C CG2 . THR B 1 72  ? 1.116   15.747  45.579 1.00 21.81 ? 60  THR B CG2 1 
ATOM   2302 N N   . SER B 1 73  ? 3.523   19.126  43.294 1.00 22.83 ? 61  SER B N   1 
ATOM   2303 C CA  . SER B 1 73  ? 4.667   19.612  42.521 1.00 23.26 ? 61  SER B CA  1 
ATOM   2304 C C   . SER B 1 73  ? 5.309   20.859  43.142 1.00 23.96 ? 61  SER B C   1 
ATOM   2305 O O   . SER B 1 73  ? 6.453   21.176  42.809 1.00 24.22 ? 61  SER B O   1 
ATOM   2306 C CB  . SER B 1 73  ? 4.258   19.902  41.084 1.00 23.17 ? 61  SER B CB  1 
ATOM   2307 O OG  . SER B 1 73  ? 3.968   18.680  40.406 1.00 25.01 ? 61  SER B OG  1 
ATOM   2308 N N   . PHE B 1 74  ? 4.568   21.491  44.027 1.00 25.41 ? 62  PHE B N   1 
ATOM   2309 C CA  . PHE B 1 74  ? 5.088   22.651  44.788 1.00 26.34 ? 62  PHE B CA  1 
ATOM   2310 C C   . PHE B 1 74  ? 5.962   22.303  45.988 1.00 26.67 ? 62  PHE B C   1 
ATOM   2311 O O   . PHE B 1 74  ? 6.872   23.074  46.362 1.00 28.53 ? 62  PHE B O   1 
ATOM   2312 C CB  . PHE B 1 74  ? 3.932   23.563  45.219 1.00 25.89 ? 62  PHE B CB  1 
ATOM   2313 C CG  . PHE B 1 74  ? 3.237   24.242  44.071 1.00 27.24 ? 62  PHE B CG  1 
ATOM   2314 C CD1 . PHE B 1 74  ? 2.037   23.745  43.576 1.00 26.43 ? 62  PHE B CD1 1 
ATOM   2315 C CD2 . PHE B 1 74  ? 3.770   25.384  43.490 1.00 27.32 ? 62  PHE B CD2 1 
ATOM   2316 C CE1 . PHE B 1 74  ? 1.378   24.366  42.518 1.00 27.66 ? 62  PHE B CE1 1 
ATOM   2317 C CE2 . PHE B 1 74  ? 3.115   26.012  42.424 1.00 28.55 ? 62  PHE B CE2 1 
ATOM   2318 C CZ  . PHE B 1 74  ? 1.921   25.500  41.922 1.00 27.17 ? 62  PHE B CZ  1 
HETATM 2319 N N1  . NRQ B 1 75  ? 5.870   21.272  46.771 1.00 26.41 ? 63  NRQ B N1  1 
HETATM 2320 C CE  . NRQ B 1 75  ? 4.249   24.078  50.548 1.00 27.93 ? 63  NRQ B CE  1 
HETATM 2321 S SD  . NRQ B 1 75  ? 3.318   22.528  50.347 1.00 30.24 ? 63  NRQ B SD  1 
HETATM 2322 C CG1 . NRQ B 1 75  ? 4.638   21.567  49.596 1.00 29.36 ? 63  NRQ B CG1 1 
HETATM 2323 C CB1 . NRQ B 1 75  ? 4.163   20.849  48.344 1.00 25.01 ? 63  NRQ B CB1 1 
HETATM 2324 C CA1 . NRQ B 1 75  ? 5.263   20.323  47.423 1.00 25.70 ? 63  NRQ B CA1 1 
HETATM 2325 C C1  . NRQ B 1 75  ? 5.378   18.851  47.385 1.00 22.87 ? 63  NRQ B C1  1 
HETATM 2326 N N2  . NRQ B 1 75  ? 4.465   18.100  47.952 1.00 22.13 ? 63  NRQ B N2  1 
HETATM 2327 O OH  . NRQ B 1 75  ? 4.542   10.109  47.268 1.00 27.54 ? 63  NRQ B OH  1 
HETATM 2328 C CD2 . NRQ B 1 75  ? 5.530   13.610  47.515 1.00 27.32 ? 63  NRQ B CD2 1 
HETATM 2329 C CE2 . NRQ B 1 75  ? 5.534   12.210  47.282 1.00 19.99 ? 63  NRQ B CE2 1 
HETATM 2330 C CZ  . NRQ B 1 75  ? 4.440   11.418  47.510 1.00 28.47 ? 63  NRQ B CZ  1 
HETATM 2331 C CE1 . NRQ B 1 75  ? 3.262   12.016  47.941 1.00 28.35 ? 63  NRQ B CE1 1 
HETATM 2332 C CD1 . NRQ B 1 75  ? 3.231   13.413  48.156 1.00 24.90 ? 63  NRQ B CD1 1 
HETATM 2333 C CG2 . NRQ B 1 75  ? 4.364   14.222  47.978 1.00 25.55 ? 63  NRQ B CG2 1 
HETATM 2334 C CB2 . NRQ B 1 75  ? 4.179   15.673  48.174 1.00 26.03 ? 63  NRQ B CB2 1 
HETATM 2335 C CA2 . NRQ B 1 75  ? 4.842   16.772  47.721 1.00 20.95 ? 63  NRQ B CA2 1 
HETATM 2336 C C2  . NRQ B 1 75  ? 6.142   16.779  46.970 1.00 21.16 ? 63  NRQ B C2  1 
HETATM 2337 O O2  . NRQ B 1 75  ? 6.891   15.921  46.561 1.00 20.80 ? 63  NRQ B O2  1 
HETATM 2338 N N3  . NRQ B 1 75  ? 6.437   18.130  46.820 1.00 21.72 ? 63  NRQ B N3  1 
HETATM 2339 C CA3 . NRQ B 1 75  ? 7.622   18.538  46.036 1.00 21.53 ? 63  NRQ B CA3 1 
HETATM 2340 C C3  . NRQ B 1 75  ? 8.638   19.376  46.758 1.00 21.24 ? 63  NRQ B C3  1 
HETATM 2341 O O3  . NRQ B 1 75  ? 9.568   19.921  46.115 1.00 23.63 ? 63  NRQ B O3  1 
ATOM   2342 N N   . SER B 1 76  ? 8.586   19.440  48.084 1.00 20.95 ? 66  SER B N   1 
ATOM   2343 C CA  . SER B 1 76  ? 9.480   20.358  48.887 1.00 21.27 ? 66  SER B CA  1 
ATOM   2344 C C   . SER B 1 76  ? 10.064  19.525  50.015 1.00 21.67 ? 66  SER B C   1 
ATOM   2345 O O   . SER B 1 76  ? 9.758   19.718  51.189 1.00 22.32 ? 66  SER B O   1 
ATOM   2346 C CB  . SER B 1 76  ? 8.659   21.574  49.355 1.00 21.75 ? 66  SER B CB  1 
ATOM   2347 O OG  . SER B 1 76  ? 9.448   22.483  50.123 1.00 22.60 ? 66  SER B OG  1 
ATOM   2348 N N   . LYS B 1 77  ? 10.912  18.565  49.639 1.00 20.89 ? 67  LYS B N   1 
ATOM   2349 C CA  . LYS B 1 77  ? 11.203  17.445  50.493 1.00 21.46 ? 67  LYS B CA  1 
ATOM   2350 C C   . LYS B 1 77  ? 12.215  17.812  51.590 1.00 21.54 ? 67  LYS B C   1 
ATOM   2351 O O   . LYS B 1 77  ? 12.547  16.985  52.426 1.00 19.13 ? 67  LYS B O   1 
ATOM   2352 C CB  . LYS B 1 77  ? 11.827  16.296  49.682 1.00 22.74 ? 67  LYS B CB  1 
ATOM   2353 C CG  . LYS B 1 77  ? 11.133  15.866  48.349 1.00 24.40 ? 67  LYS B CG  1 
ATOM   2354 C CD  . LYS B 1 77  ? 9.718   15.352  48.564 1.00 29.56 ? 67  LYS B CD  1 
ATOM   2355 C CE  . LYS B 1 77  ? 9.628   14.018  49.310 1.00 30.41 ? 67  LYS B CE  1 
ATOM   2356 N NZ  . LYS B 1 77  ? 8.199   13.451  49.260 1.00 31.15 ? 67  LYS B NZ  1 
ATOM   2357 N N   . THR B 1 78  ? 12.795  19.019  51.511 1.00 20.29 ? 68  THR B N   1 
ATOM   2358 C CA  . THR B 1 78  ? 13.643  19.470  52.622 1.00 20.36 ? 68  THR B CA  1 
ATOM   2359 C C   . THR B 1 78  ? 12.881  19.660  53.927 1.00 20.75 ? 68  THR B C   1 
ATOM   2360 O O   . THR B 1 78  ? 13.491  19.591  55.012 1.00 22.42 ? 68  THR B O   1 
ATOM   2361 C CB  . THR B 1 78  ? 14.441  20.780  52.245 1.00 18.78 ? 68  THR B CB  1 
ATOM   2362 O OG1 . THR B 1 78  ? 15.118  20.561  51.030 1.00 18.24 ? 68  THR B OG1 1 
ATOM   2363 C CG2 . THR B 1 78  ? 15.477  21.116  53.284 1.00 20.29 ? 68  THR B CG2 1 
ATOM   2364 N N   . PHE B 1 79  ? 11.579  19.915  53.835 1.00 20.54 ? 69  PHE B N   1 
ATOM   2365 C CA  . PHE B 1 79  ? 10.760  20.218  54.994 1.00 20.89 ? 69  PHE B CA  1 
ATOM   2366 C C   . PHE B 1 79  ? 10.029  18.976  55.481 1.00 21.04 ? 69  PHE B C   1 
ATOM   2367 O O   . PHE B 1 79  ? 8.823   19.012  55.664 1.00 23.64 ? 69  PHE B O   1 
ATOM   2368 C CB  . PHE B 1 79  ? 9.731   21.296  54.675 1.00 20.61 ? 69  PHE B CB  1 
ATOM   2369 C CG  . PHE B 1 79  ? 10.346  22.633  54.308 1.00 22.97 ? 69  PHE B CG  1 
ATOM   2370 C CD1 . PHE B 1 79  ? 10.708  22.902  52.999 1.00 23.58 ? 69  PHE B CD1 1 
ATOM   2371 C CD2 . PHE B 1 79  ? 10.579  23.594  55.281 1.00 24.95 ? 69  PHE B CD2 1 
ATOM   2372 C CE1 . PHE B 1 79  ? 11.303  24.097  52.651 1.00 23.83 ? 69  PHE B CE1 1 
ATOM   2373 C CE2 . PHE B 1 79  ? 11.153  24.830  54.946 1.00 22.89 ? 69  PHE B CE2 1 
ATOM   2374 C CZ  . PHE B 1 79  ? 11.517  25.076  53.624 1.00 24.75 ? 69  PHE B CZ  1 
ATOM   2375 N N   . ILE B 1 80  ? 10.760  17.904  55.683 1.00 21.90 ? 70  ILE B N   1 
ATOM   2376 C CA  . ILE B 1 80  ? 10.178  16.671  56.289 1.00 22.55 ? 70  ILE B CA  1 
ATOM   2377 C C   . ILE B 1 80  ? 10.947  16.448  57.579 1.00 22.86 ? 70  ILE B C   1 
ATOM   2378 O O   . ILE B 1 80  ? 12.198  16.341  57.560 1.00 22.78 ? 70  ILE B O   1 
ATOM   2379 C CB  . ILE B 1 80  ? 10.379  15.438  55.408 1.00 22.61 ? 70  ILE B CB  1 
ATOM   2380 C CG1 . ILE B 1 80  ? 9.672   15.592  54.055 1.00 22.21 ? 70  ILE B CG1 1 
ATOM   2381 C CG2 . ILE B 1 80  ? 9.896   14.147  56.154 1.00 23.90 ? 70  ILE B CG2 1 
ATOM   2382 C CD1 . ILE B 1 80  ? 10.021  14.484  53.028 1.00 22.01 ? 70  ILE B CD1 1 
ATOM   2383 N N   . ASN B 1 81  ? 10.217  16.375  58.689 1.00 22.59 ? 71  ASN B N   1 
ATOM   2384 C CA  . ASN B 1 81  ? 10.817  15.974  59.961 1.00 22.72 ? 71  ASN B CA  1 
ATOM   2385 C C   . ASN B 1 81  ? 11.316  14.520  59.941 1.00 23.96 ? 71  ASN B C   1 
ATOM   2386 O O   . ASN B 1 81  ? 10.503  13.580  60.054 1.00 23.74 ? 71  ASN B O   1 
ATOM   2387 C CB  . ASN B 1 81  ? 9.818   16.262  61.081 1.00 23.43 ? 71  ASN B CB  1 
ATOM   2388 C CG  . ASN B 1 81  ? 10.331  15.894  62.455 1.00 24.64 ? 71  ASN B CG  1 
ATOM   2389 O OD1 . ASN B 1 81  ? 11.446  15.399  62.615 1.00 25.75 ? 71  ASN B OD1 1 
ATOM   2390 N ND2 . ASN B 1 81  ? 9.498   16.111  63.457 1.00 27.63 ? 71  ASN B ND2 1 
ATOM   2391 N N   . HIS B 1 82  ? 12.631  14.319  59.794 1.00 23.94 ? 72  HIS B N   1 
ATOM   2392 C CA  . HIS B 1 82  ? 13.182  12.956  59.789 1.00 23.91 ? 72  HIS B CA  1 
ATOM   2393 C C   . HIS B 1 82  ? 13.438  12.521  61.233 1.00 25.53 ? 72  HIS B C   1 
ATOM   2394 O O   . HIS B 1 82  ? 14.450  12.894  61.845 1.00 25.77 ? 72  HIS B O   1 
ATOM   2395 C CB  . HIS B 1 82  ? 14.418  12.812  58.884 1.00 24.57 ? 72  HIS B CB  1 
ATOM   2396 C CG  . HIS B 1 82  ? 14.091  12.709  57.415 1.00 24.73 ? 72  HIS B CG  1 
ATOM   2397 N ND1 . HIS B 1 82  ? 13.562  13.758  56.696 1.00 25.11 ? 72  HIS B ND1 1 
ATOM   2398 C CD2 . HIS B 1 82  ? 14.203  11.677  56.540 1.00 25.21 ? 72  HIS B CD2 1 
ATOM   2399 C CE1 . HIS B 1 82  ? 13.362  13.380  55.441 1.00 26.14 ? 72  HIS B CE1 1 
ATOM   2400 N NE2 . HIS B 1 82  ? 13.752  12.127  55.317 1.00 24.83 ? 72  HIS B NE2 1 
ATOM   2401 N N   . THR B 1 83  ? 12.485  11.778  61.800 1.00 25.32 ? 73  THR B N   1 
ATOM   2402 C CA  . THR B 1 83  ? 12.579  11.301  63.182 1.00 25.01 ? 73  THR B CA  1 
ATOM   2403 C C   . THR B 1 83  ? 13.392  9.999   63.214 1.00 25.75 ? 73  THR B C   1 
ATOM   2404 O O   . THR B 1 83  ? 13.797  9.479   62.163 1.00 25.45 ? 73  THR B O   1 
ATOM   2405 C CB  . THR B 1 83  ? 11.164  11.106  63.776 1.00 26.08 ? 73  THR B CB  1 
ATOM   2406 O OG1 . THR B 1 83  ? 10.540  9.992   63.122 1.00 25.14 ? 73  THR B OG1 1 
ATOM   2407 C CG2 . THR B 1 83  ? 10.298  12.323  63.512 1.00 24.35 ? 73  THR B CG2 1 
ATOM   2408 N N   . GLN B 1 84  ? 13.656  9.464   64.413 1.00 25.43 ? 74  GLN B N   1 
ATOM   2409 C CA  . GLN B 1 84  ? 14.402  8.200   64.614 1.00 24.09 ? 74  GLN B CA  1 
ATOM   2410 C C   . GLN B 1 84  ? 15.824  8.061   64.070 1.00 25.48 ? 74  GLN B C   1 
ATOM   2411 O O   . GLN B 1 84  ? 16.349  6.937   63.939 1.00 26.18 ? 74  GLN B O   1 
ATOM   2412 C CB  . GLN B 1 84  ? 13.572  6.985   64.178 1.00 25.39 ? 74  GLN B CB  1 
ATOM   2413 C CG  . GLN B 1 84  ? 12.133  7.128   64.562 1.00 21.26 ? 74  GLN B CG  1 
ATOM   2414 C CD  . GLN B 1 84  ? 11.348  5.860   64.304 1.00 27.56 ? 74  GLN B CD  1 
ATOM   2415 O OE1 . GLN B 1 84  ? 10.118  5.896   64.199 1.00 25.68 ? 74  GLN B OE1 1 
ATOM   2416 N NE2 . GLN B 1 84  ? 12.046  4.739   64.220 1.00 24.16 ? 74  GLN B NE2 1 
ATOM   2417 N N   . GLY B 1 85  ? 16.485  9.178   63.804 1.00 25.70 ? 75  GLY B N   1 
ATOM   2418 C CA  . GLY B 1 85  ? 17.796  9.075   63.153 1.00 25.64 ? 75  GLY B CA  1 
ATOM   2419 C C   . GLY B 1 85  ? 17.803  8.576   61.722 1.00 25.71 ? 75  GLY B C   1 
ATOM   2420 O O   . GLY B 1 85  ? 18.853  8.102   61.237 1.00 25.66 ? 75  GLY B O   1 
ATOM   2421 N N   . ILE B 1 86  ? 16.653  8.656   61.024 1.00 24.10 ? 76  ILE B N   1 
ATOM   2422 C CA  . ILE B 1 86  ? 16.635  8.206   59.621 1.00 23.04 ? 76  ILE B CA  1 
ATOM   2423 C C   . ILE B 1 86  ? 17.601  9.129   58.862 1.00 23.00 ? 76  ILE B C   1 
ATOM   2424 O O   . ILE B 1 86  ? 17.419  10.324  58.930 1.00 23.38 ? 76  ILE B O   1 
ATOM   2425 C CB  . ILE B 1 86  ? 15.240  8.307   58.952 1.00 21.98 ? 76  ILE B CB  1 
ATOM   2426 C CG1 . ILE B 1 86  ? 14.211  7.332   59.584 1.00 20.62 ? 76  ILE B CG1 1 
ATOM   2427 C CG2 . ILE B 1 86  ? 15.370  8.091   57.432 1.00 20.28 ? 76  ILE B CG2 1 
ATOM   2428 C CD1 . ILE B 1 86  ? 12.768  7.871   59.452 1.00 22.67 ? 76  ILE B CD1 1 
ATOM   2429 N N   . PRO B 1 87  ? 18.622  8.579   58.168 1.00 24.85 ? 77  PRO B N   1 
ATOM   2430 C CA  . PRO B 1 87  ? 19.490  9.443   57.322 1.00 25.69 ? 77  PRO B CA  1 
ATOM   2431 C C   . PRO B 1 87  ? 18.694  10.225  56.277 1.00 26.06 ? 77  PRO B C   1 
ATOM   2432 O O   . PRO B 1 87  ? 17.952  9.627   55.495 1.00 26.40 ? 77  PRO B O   1 
ATOM   2433 C CB  . PRO B 1 87  ? 20.453  8.451   56.673 1.00 26.43 ? 77  PRO B CB  1 
ATOM   2434 C CG  . PRO B 1 87  ? 20.474  7.311   57.646 1.00 27.24 ? 77  PRO B CG  1 
ATOM   2435 C CD  . PRO B 1 87  ? 19.056  7.180   58.110 1.00 25.41 ? 77  PRO B CD  1 
ATOM   2436 N N   . ASP B 1 88  ? 18.867  11.554  56.290 1.00 25.10 ? 78  ASP B N   1 
ATOM   2437 C CA  . ASP B 1 88  ? 18.048  12.488  55.544 1.00 25.13 ? 78  ASP B CA  1 
ATOM   2438 C C   . ASP B 1 88  ? 18.747  12.770  54.200 1.00 25.09 ? 78  ASP B C   1 
ATOM   2439 O O   . ASP B 1 88  ? 19.752  13.491  54.129 1.00 25.19 ? 78  ASP B O   1 
ATOM   2440 C CB  . ASP B 1 88  ? 17.846  13.751  56.404 1.00 24.60 ? 78  ASP B CB  1 
ATOM   2441 C CG  . ASP B 1 88  ? 16.759  14.685  55.897 1.00 23.69 ? 78  ASP B CG  1 
ATOM   2442 O OD1 . ASP B 1 88  ? 16.458  14.774  54.683 1.00 25.93 ? 78  ASP B OD1 1 
ATOM   2443 O OD2 . ASP B 1 88  ? 16.173  15.391  56.725 1.00 26.14 ? 78  ASP B OD2 1 
ATOM   2444 N N   . PHE B 1 89  ? 18.245  12.140  53.153 1.00 23.68 ? 79  PHE B N   1 
ATOM   2445 C CA  . PHE B 1 89  ? 18.842  12.195  51.831 1.00 24.11 ? 79  PHE B CA  1 
ATOM   2446 C C   . PHE B 1 89  ? 18.804  13.625  51.326 1.00 23.76 ? 79  PHE B C   1 
ATOM   2447 O O   . PHE B 1 89  ? 19.724  14.056  50.634 1.00 25.71 ? 79  PHE B O   1 
ATOM   2448 C CB  . PHE B 1 89  ? 18.061  11.236  50.908 1.00 23.94 ? 79  PHE B CB  1 
ATOM   2449 C CG  . PHE B 1 89  ? 18.587  11.114  49.497 1.00 23.18 ? 79  PHE B CG  1 
ATOM   2450 C CD1 . PHE B 1 89  ? 19.601  10.200  49.186 1.00 24.68 ? 79  PHE B CD1 1 
ATOM   2451 C CD2 . PHE B 1 89  ? 17.994  11.832  48.462 1.00 23.04 ? 79  PHE B CD2 1 
ATOM   2452 C CE1 . PHE B 1 89  ? 20.036  10.050  47.871 1.00 22.48 ? 79  PHE B CE1 1 
ATOM   2453 C CE2 . PHE B 1 89  ? 18.412  11.691  47.158 1.00 19.30 ? 79  PHE B CE2 1 
ATOM   2454 C CZ  . PHE B 1 89  ? 19.458  10.787  46.861 1.00 21.43 ? 79  PHE B CZ  1 
ATOM   2455 N N   . PHE B 1 90  ? 17.739  14.328  51.689 1.00 22.80 ? 80  PHE B N   1 
ATOM   2456 C CA  . PHE B 1 90  ? 17.411  15.640  51.180 1.00 23.79 ? 80  PHE B CA  1 
ATOM   2457 C C   . PHE B 1 90  ? 18.276  16.714  51.855 1.00 23.93 ? 80  PHE B C   1 
ATOM   2458 O O   . PHE B 1 90  ? 19.010  17.446  51.163 1.00 25.26 ? 80  PHE B O   1 
ATOM   2459 C CB  . PHE B 1 90  ? 15.907  15.886  51.301 1.00 23.49 ? 80  PHE B CB  1 
ATOM   2460 C CG  . PHE B 1 90  ? 15.091  14.791  50.645 1.00 24.65 ? 80  PHE B CG  1 
ATOM   2461 C CD1 . PHE B 1 90  ? 14.443  13.837  51.414 1.00 24.86 ? 80  PHE B CD1 1 
ATOM   2462 C CD2 . PHE B 1 90  ? 15.062  14.664  49.243 1.00 24.41 ? 80  PHE B CD2 1 
ATOM   2463 C CE1 . PHE B 1 90  ? 13.730  12.769  50.772 1.00 24.92 ? 80  PHE B CE1 1 
ATOM   2464 C CE2 . PHE B 1 90  ? 14.343  13.607  48.615 1.00 21.97 ? 80  PHE B CE2 1 
ATOM   2465 C CZ  . PHE B 1 90  ? 13.691  12.698  49.383 1.00 22.33 ? 80  PHE B CZ  1 
ATOM   2466 N N   . LYS B 1 91  ? 18.216  16.794  53.185 1.00 23.46 ? 81  LYS B N   1 
ATOM   2467 C CA  . LYS B 1 91  ? 19.051  17.812  53.907 1.00 23.54 ? 81  LYS B CA  1 
ATOM   2468 C C   . LYS B 1 91  ? 20.546  17.560  53.716 1.00 23.84 ? 81  LYS B C   1 
ATOM   2469 O O   . LYS B 1 91  ? 21.299  18.518  53.664 1.00 25.01 ? 81  LYS B O   1 
ATOM   2470 C CB  . LYS B 1 91  ? 18.712  17.897  55.389 1.00 22.11 ? 81  LYS B CB  1 
ATOM   2471 C CG  . LYS B 1 91  ? 17.357  18.506  55.640 1.00 21.77 ? 81  LYS B CG  1 
ATOM   2472 C CD  . LYS B 1 91  ? 17.052  18.473  57.130 1.00 22.19 ? 81  LYS B CD  1 
ATOM   2473 C CE  . LYS B 1 91  ? 15.722  19.099  57.382 1.00 20.85 ? 81  LYS B CE  1 
ATOM   2474 N NZ  . LYS B 1 91  ? 14.566  18.120  57.300 1.00 23.87 ? 81  LYS B NZ  1 
ATOM   2475 N N   . GLN B 1 92  ? 20.969  16.295  53.611 1.00 23.79 ? 82  GLN B N   1 
ATOM   2476 C CA  . GLN B 1 92  ? 22.378  15.955  53.399 1.00 24.68 ? 82  GLN B CA  1 
ATOM   2477 C C   . GLN B 1 92  ? 22.944  16.367  52.032 1.00 24.96 ? 82  GLN B C   1 
ATOM   2478 O O   . GLN B 1 92  ? 24.163  16.327  51.823 1.00 25.14 ? 82  GLN B O   1 
ATOM   2479 C CB  . GLN B 1 92  ? 22.597  14.444  53.496 1.00 24.96 ? 82  GLN B CB  1 
ATOM   2480 C CG  . GLN B 1 92  ? 22.502  13.780  54.870 1.00 25.88 ? 82  GLN B CG  1 
ATOM   2481 C CD  . GLN B 1 92  ? 22.859  12.337  54.727 1.00 31.22 ? 82  GLN B CD  1 
ATOM   2482 O OE1 . GLN B 1 92  ? 24.009  12.009  54.422 1.00 33.31 ? 82  GLN B OE1 1 
ATOM   2483 N NE2 . GLN B 1 92  ? 21.857  11.441  54.862 1.00 31.41 ? 82  GLN B NE2 1 
ATOM   2484 N N   . SER B 1 93  ? 22.053  16.641  51.084 1.00 24.22 ? 83  SER B N   1 
ATOM   2485 C CA  . SER B 1 93  ? 22.417  16.867  49.698 1.00 24.16 ? 83  SER B CA  1 
ATOM   2486 C C   . SER B 1 93  ? 22.925  18.291  49.496 1.00 23.49 ? 83  SER B C   1 
ATOM   2487 O O   . SER B 1 93  ? 23.461  18.583  48.452 1.00 23.81 ? 83  SER B O   1 
ATOM   2488 C CB  . SER B 1 93  ? 21.192  16.674  48.795 1.00 23.56 ? 83  SER B CB  1 
ATOM   2489 O OG  . SER B 1 93  ? 20.976  15.280  48.594 1.00 26.36 ? 83  SER B OG  1 
ATOM   2490 N N   . PHE B 1 94  ? 22.674  19.156  50.469 1.00 24.69 ? 84  PHE B N   1 
ATOM   2491 C CA  . PHE B 1 94  ? 23.082  20.568  50.355 1.00 25.03 ? 84  PHE B CA  1 
ATOM   2492 C C   . PHE B 1 94  ? 24.578  20.726  50.631 1.00 25.78 ? 84  PHE B C   1 
ATOM   2493 O O   . PHE B 1 94  ? 25.185  19.915  51.344 1.00 26.21 ? 84  PHE B O   1 
ATOM   2494 C CB  . PHE B 1 94  ? 22.197  21.433  51.217 1.00 24.52 ? 84  PHE B CB  1 
ATOM   2495 C CG  . PHE B 1 94  ? 20.779  21.458  50.736 1.00 25.59 ? 84  PHE B CG  1 
ATOM   2496 C CD1 . PHE B 1 94  ? 19.802  20.691  51.375 1.00 25.83 ? 84  PHE B CD1 1 
ATOM   2497 C CD2 . PHE B 1 94  ? 20.429  22.145  49.568 1.00 23.42 ? 84  PHE B CD2 1 
ATOM   2498 C CE1 . PHE B 1 94  ? 18.468  20.692  50.896 1.00 24.73 ? 84  PHE B CE1 1 
ATOM   2499 C CE2 . PHE B 1 94  ? 19.095  22.142  49.087 1.00 22.98 ? 84  PHE B CE2 1 
ATOM   2500 C CZ  . PHE B 1 94  ? 18.117  21.390  49.753 1.00 23.02 ? 84  PHE B CZ  1 
ATOM   2501 N N   . PRO B 1 95  ? 25.197  21.765  50.028 1.00 25.82 ? 85  PRO B N   1 
ATOM   2502 C CA  . PRO B 1 95  ? 24.550  22.848  49.294 1.00 25.17 ? 85  PRO B CA  1 
ATOM   2503 C C   . PRO B 1 95  ? 24.161  22.545  47.830 1.00 24.33 ? 85  PRO B C   1 
ATOM   2504 O O   . PRO B 1 95  ? 23.465  23.352  47.233 1.00 25.48 ? 85  PRO B O   1 
ATOM   2505 C CB  . PRO B 1 95  ? 25.652  23.934  49.286 1.00 25.26 ? 85  PRO B CB  1 
ATOM   2506 C CG  . PRO B 1 95  ? 26.864  23.153  49.155 1.00 24.65 ? 85  PRO B CG  1 
ATOM   2507 C CD  . PRO B 1 95  ? 26.664  21.938  50.046 1.00 26.36 ? 85  PRO B CD  1 
ATOM   2508 N N   . GLU B 1 96  ? 24.648  21.460  47.251 1.00 24.85 ? 86  GLU B N   1 
ATOM   2509 C CA  . GLU B 1 96  ? 24.383  21.134  45.834 1.00 25.53 ? 86  GLU B CA  1 
ATOM   2510 C C   . GLU B 1 96  ? 22.914  20.876  45.560 1.00 25.59 ? 86  GLU B C   1 
ATOM   2511 O O   . GLU B 1 96  ? 22.388  21.270  44.529 1.00 27.02 ? 86  GLU B O   1 
ATOM   2512 C CB  . GLU B 1 96  ? 25.187  19.935  45.370 1.00 25.63 ? 86  GLU B CB  1 
ATOM   2513 C CG  . GLU B 1 96  ? 26.698  20.118  45.417 1.00 27.98 ? 86  GLU B CG  1 
ATOM   2514 C CD  . GLU B 1 96  ? 27.278  19.635  46.714 1.00 29.35 ? 86  GLU B CD  1 
ATOM   2515 O OE1 . GLU B 1 96  ? 26.676  19.887  47.775 1.00 31.45 ? 86  GLU B OE1 1 
ATOM   2516 O OE2 . GLU B 1 96  ? 28.325  18.965  46.676 1.00 35.16 ? 86  GLU B OE2 1 
ATOM   2517 N N   . GLY B 1 97  ? 22.250  20.204  46.491 1.00 25.50 ? 87  GLY B N   1 
ATOM   2518 C CA  . GLY B 1 97  ? 20.805  19.967  46.377 1.00 23.96 ? 87  GLY B CA  1 
ATOM   2519 C C   . GLY B 1 97  ? 20.488  18.642  45.702 1.00 22.77 ? 87  GLY B C   1 
ATOM   2520 O O   . GLY B 1 97  ? 21.316  17.731  45.663 1.00 22.90 ? 87  GLY B O   1 
ATOM   2521 N N   . PHE B 1 98  ? 19.275  18.543  45.167 1.00 21.93 ? 88  PHE B N   1 
ATOM   2522 C CA  . PHE B 1 98  ? 18.783  17.261  44.621 1.00 21.56 ? 88  PHE B CA  1 
ATOM   2523 C C   . PHE B 1 98  ? 17.727  17.540  43.584 1.00 21.12 ? 88  PHE B C   1 
ATOM   2524 O O   . PHE B 1 98  ? 17.219  18.682  43.456 1.00 21.41 ? 88  PHE B O   1 
ATOM   2525 C CB  . PHE B 1 98  ? 18.188  16.357  45.745 1.00 21.66 ? 88  PHE B CB  1 
ATOM   2526 C CG  . PHE B 1 98  ? 17.092  17.000  46.533 1.00 20.82 ? 88  PHE B CG  1 
ATOM   2527 C CD1 . PHE B 1 98  ? 17.403  17.773  47.664 1.00 19.98 ? 88  PHE B CD1 1 
ATOM   2528 C CD2 . PHE B 1 98  ? 15.735  16.881  46.146 1.00 20.22 ? 88  PHE B CD2 1 
ATOM   2529 C CE1 . PHE B 1 98  ? 16.376  18.414  48.423 1.00 20.14 ? 88  PHE B CE1 1 
ATOM   2530 C CE2 . PHE B 1 98  ? 14.732  17.505  46.867 1.00 21.00 ? 88  PHE B CE2 1 
ATOM   2531 C CZ  . PHE B 1 98  ? 15.047  18.289  48.046 1.00 19.30 ? 88  PHE B CZ  1 
ATOM   2532 N N   . THR B 1 99  ? 17.349  16.494  42.847 1.00 21.21 ? 89  THR B N   1 
ATOM   2533 C CA  . THR B 1 99  ? 16.228  16.650  41.933 1.00 20.08 ? 89  THR B CA  1 
ATOM   2534 C C   . THR B 1 99  ? 15.202  15.570  42.260 1.00 20.07 ? 89  THR B C   1 
ATOM   2535 O O   . THR B 1 99  ? 15.553  14.565  42.891 1.00 20.34 ? 89  THR B O   1 
ATOM   2536 C CB  . THR B 1 99  ? 16.670  16.464  40.480 1.00 20.84 ? 89  THR B CB  1 
ATOM   2537 O OG1 . THR B 1 99  ? 17.238  15.160  40.305 1.00 22.78 ? 89  THR B OG1 1 
ATOM   2538 C CG2 . THR B 1 99  ? 17.735  17.575  40.070 1.00 22.33 ? 89  THR B CG2 1 
ATOM   2539 N N   . TRP B 1 100 ? 13.972  15.796  41.814 1.00 17.90 ? 90  TRP B N   1 
ATOM   2540 C CA  . TRP B 1 100 ? 12.966  14.710  41.775 1.00 18.37 ? 90  TRP B CA  1 
ATOM   2541 C C   . TRP B 1 100 ? 12.226  14.640  40.435 1.00 18.19 ? 90  TRP B C   1 
ATOM   2542 O O   . TRP B 1 100 ? 12.005  15.651  39.734 1.00 17.54 ? 90  TRP B O   1 
ATOM   2543 C CB  . TRP B 1 100 ? 12.056  14.732  43.009 1.00 15.85 ? 90  TRP B CB  1 
ATOM   2544 C CG  . TRP B 1 100 ? 11.193  15.917  43.178 1.00 16.90 ? 90  TRP B CG  1 
ATOM   2545 C CD1 . TRP B 1 100 ? 11.383  16.950  44.070 1.00 18.97 ? 90  TRP B CD1 1 
ATOM   2546 C CD2 . TRP B 1 100 ? 9.961   16.193  42.494 1.00 18.90 ? 90  TRP B CD2 1 
ATOM   2547 N NE1 . TRP B 1 100 ? 10.355  17.847  43.975 1.00 18.20 ? 90  TRP B NE1 1 
ATOM   2548 C CE2 . TRP B 1 100 ? 9.455   17.410  43.026 1.00 17.70 ? 90  TRP B CE2 1 
ATOM   2549 C CE3 . TRP B 1 100 ? 9.209   15.506  41.502 1.00 19.48 ? 90  TRP B CE3 1 
ATOM   2550 C CZ2 . TRP B 1 100 ? 8.272   18.016  42.564 1.00 18.48 ? 90  TRP B CZ2 1 
ATOM   2551 C CZ3 . TRP B 1 100 ? 8.005   16.103  41.037 1.00 17.90 ? 90  TRP B CZ3 1 
ATOM   2552 C CH2 . TRP B 1 100 ? 7.542   17.336  41.573 1.00 21.58 ? 90  TRP B CH2 1 
ATOM   2553 N N   . GLU B 1 101 ? 11.876  13.413  40.033 1.00 19.65 ? 91  GLU B N   1 
ATOM   2554 C CA  . GLU B 1 101 ? 11.071  13.203  38.812 1.00 20.57 ? 91  GLU B CA  1 
ATOM   2555 C C   . GLU B 1 101 ? 9.983   12.199  39.194 1.00 19.67 ? 91  GLU B C   1 
ATOM   2556 O O   . GLU B 1 101 ? 10.285  11.240  39.879 1.00 18.25 ? 91  GLU B O   1 
ATOM   2557 C CB  . GLU B 1 101 ? 11.939  12.606  37.707 1.00 22.06 ? 91  GLU B CB  1 
ATOM   2558 C CG  . GLU B 1 101 ? 13.185  13.415  37.374 1.00 28.90 ? 91  GLU B CG  1 
ATOM   2559 C CD  . GLU B 1 101 ? 14.310  13.234  38.404 1.00 39.01 ? 91  GLU B CD  1 
ATOM   2560 O OE1 . GLU B 1 101 ? 14.563  12.074  38.858 1.00 43.94 ? 91  GLU B OE1 1 
ATOM   2561 O OE2 . GLU B 1 101 ? 14.938  14.263  38.773 1.00 41.42 ? 91  GLU B OE2 1 
ATOM   2562 N N   . ARG B 1 102 ? 8.755   12.485  38.779 1.00 19.58 ? 92  ARG B N   1 
ATOM   2563 C CA  . ARG B 1 102 ? 7.560   11.739  39.133 1.00 19.43 ? 92  ARG B CA  1 
ATOM   2564 C C   . ARG B 1 102 ? 6.636   11.520  37.947 1.00 19.93 ? 92  ARG B C   1 
ATOM   2565 O O   . ARG B 1 102 ? 6.439   12.405  37.095 1.00 19.31 ? 92  ARG B O   1 
ATOM   2566 C CB  . ARG B 1 102 ? 6.819   12.510  40.224 1.00 18.85 ? 92  ARG B CB  1 
ATOM   2567 C CG  . ARG B 1 102 ? 5.587   11.870  40.918 1.00 20.86 ? 92  ARG B CG  1 
ATOM   2568 C CD  . ARG B 1 102 ? 4.936   12.866  41.927 1.00 20.24 ? 92  ARG B CD  1 
ATOM   2569 N NE  . ARG B 1 102 ? 5.854   12.970  43.054 1.00 22.51 ? 92  ARG B NE  1 
ATOM   2570 C CZ  . ARG B 1 102 ? 6.093   14.045  43.796 1.00 23.30 ? 92  ARG B CZ  1 
ATOM   2571 N NH1 . ARG B 1 102 ? 5.424   15.165  43.613 1.00 21.49 ? 92  ARG B NH1 1 
ATOM   2572 N NH2 . ARG B 1 102 ? 7.000   13.948  44.769 1.00 21.97 ? 92  ARG B NH2 1 
ATOM   2573 N N   . VAL B 1 103 ? 5.988   10.354  37.976 1.00 18.57 ? 93  VAL B N   1 
ATOM   2574 C CA  . VAL B 1 103 ? 4.801   10.103  37.197 1.00 19.78 ? 93  VAL B CA  1 
ATOM   2575 C C   . VAL B 1 103 ? 3.683   9.751   38.159 1.00 18.46 ? 93  VAL B C   1 
ATOM   2576 O O   . VAL B 1 103 ? 3.855   8.854   39.009 1.00 18.63 ? 93  VAL B O   1 
ATOM   2577 C CB  . VAL B 1 103 ? 5.044   8.994   36.112 1.00 20.45 ? 93  VAL B CB  1 
ATOM   2578 C CG1 . VAL B 1 103 ? 5.682   7.704   36.728 1.00 23.71 ? 93  VAL B CG1 1 
ATOM   2579 C CG2 . VAL B 1 103 ? 3.739   8.687   35.350 1.00 20.48 ? 93  VAL B CG2 1 
ATOM   2580 N N   . THR B 1 104 ? 2.598   10.528  38.064 1.00 17.89 ? 94  THR B N   1 
ATOM   2581 C CA  . THR B 1 104 ? 1.359   10.345  38.804 1.00 17.89 ? 94  THR B CA  1 
ATOM   2582 C C   . THR B 1 104 ? 0.289   9.841   37.823 1.00 17.33 ? 94  THR B C   1 
ATOM   2583 O O   . THR B 1 104 ? -0.017  10.500  36.814 1.00 17.81 ? 94  THR B O   1 
ATOM   2584 C CB  . THR B 1 104 ? 0.884   11.648  39.428 1.00 17.17 ? 94  THR B CB  1 
ATOM   2585 O OG1 . THR B 1 104 ? 1.882   12.117  40.332 1.00 18.55 ? 94  THR B OG1 1 
ATOM   2586 C CG2 . THR B 1 104 ? -0.407  11.422  40.226 1.00 17.36 ? 94  THR B CG2 1 
ATOM   2587 N N   . THR B 1 105 ? -0.225  8.644   38.102 1.00 18.60 ? 95  THR B N   1 
ATOM   2588 C CA  . THR B 1 105 ? -1.225  7.990   37.242 1.00 18.50 ? 95  THR B CA  1 
ATOM   2589 C C   . THR B 1 105 ? -2.556  7.915   37.973 1.00 17.83 ? 95  THR B C   1 
ATOM   2590 O O   . THR B 1 105 ? -2.642  7.271   39.020 1.00 17.45 ? 95  THR B O   1 
ATOM   2591 C CB  . THR B 1 105 ? -0.740  6.550   36.893 1.00 20.23 ? 95  THR B CB  1 
ATOM   2592 O OG1 . THR B 1 105 ? 0.550   6.619   36.284 1.00 20.77 ? 95  THR B OG1 1 
ATOM   2593 C CG2 . THR B 1 105 ? -1.676  5.918   35.872 1.00 20.56 ? 95  THR B CG2 1 
ATOM   2594 N N   . TYR B 1 106 ? -3.574  8.615   37.450 1.00 17.27 ? 96  TYR B N   1 
ATOM   2595 C CA  . TYR B 1 106 ? -4.899  8.681   38.012 1.00 16.80 ? 96  TYR B CA  1 
ATOM   2596 C C   . TYR B 1 106 ? -5.666  7.471   37.494 1.00 18.95 ? 96  TYR B C   1 
ATOM   2597 O O   . TYR B 1 106 ? -5.338  6.959   36.386 1.00 19.21 ? 96  TYR B O   1 
ATOM   2598 C CB  . TYR B 1 106 ? -5.595  9.965   37.537 1.00 18.38 ? 96  TYR B CB  1 
ATOM   2599 C CG  . TYR B 1 106 ? -5.061  11.187  38.300 1.00 17.76 ? 96  TYR B CG  1 
ATOM   2600 C CD1 . TYR B 1 106 ? -3.786  11.717  37.999 1.00 21.25 ? 96  TYR B CD1 1 
ATOM   2601 C CD2 . TYR B 1 106 ? -5.775  11.721  39.374 1.00 18.03 ? 96  TYR B CD2 1 
ATOM   2602 C CE1 . TYR B 1 106 ? -3.267  12.804  38.708 1.00 19.04 ? 96  TYR B CE1 1 
ATOM   2603 C CE2 . TYR B 1 106 ? -5.253  12.816  40.122 1.00 21.22 ? 96  TYR B CE2 1 
ATOM   2604 C CZ  . TYR B 1 106 ? -3.999  13.332  39.790 1.00 22.01 ? 96  TYR B CZ  1 
ATOM   2605 O OH  . TYR B 1 106 ? -3.493  14.420  40.529 1.00 20.38 ? 96  TYR B OH  1 
ATOM   2606 N N   . GLU B 1 107 ? -6.615  6.989   38.303 1.00 18.43 ? 97  GLU B N   1 
ATOM   2607 C CA  . GLU B 1 107 ? -7.286  5.696   37.975 1.00 19.15 ? 97  GLU B CA  1 
ATOM   2608 C C   . GLU B 1 107 ? -8.248  5.836   36.792 1.00 19.14 ? 97  GLU B C   1 
ATOM   2609 O O   . GLU B 1 107 ? -8.661  4.836   36.184 1.00 20.26 ? 97  GLU B O   1 
ATOM   2610 C CB  . GLU B 1 107 ? -7.952  5.087   39.209 1.00 17.81 ? 97  GLU B CB  1 
ATOM   2611 C CG  . GLU B 1 107 ? -6.880  4.463   40.121 1.00 18.98 ? 97  GLU B CG  1 
ATOM   2612 C CD  . GLU B 1 107 ? -7.428  3.741   41.336 1.00 19.12 ? 97  GLU B CD  1 
ATOM   2613 O OE1 . GLU B 1 107 ? -8.661  3.817   41.574 1.00 19.46 ? 97  GLU B OE1 1 
ATOM   2614 O OE2 . GLU B 1 107 ? -6.587  3.182   42.099 1.00 18.13 ? 97  GLU B OE2 1 
ATOM   2615 N N   . ASP B 1 108 ? -8.573  7.083   36.443 1.00 20.27 ? 98  ASP B N   1 
ATOM   2616 C CA  . ASP B 1 108 ? -9.338  7.408   35.220 1.00 20.37 ? 98  ASP B CA  1 
ATOM   2617 C C   . ASP B 1 108 ? -8.498  7.764   33.993 1.00 19.73 ? 98  ASP B C   1 
ATOM   2618 O O   . ASP B 1 108 ? -9.013  8.195   32.957 1.00 21.39 ? 98  ASP B O   1 
ATOM   2619 C CB  . ASP B 1 108 ? -10.436 8.443   35.527 1.00 19.82 ? 98  ASP B CB  1 
ATOM   2620 C CG  . ASP B 1 108 ? -9.861  9.829   35.840 1.00 25.30 ? 98  ASP B CG  1 
ATOM   2621 O OD1 . ASP B 1 108 ? -8.614  9.955   35.868 1.00 23.87 ? 98  ASP B OD1 1 
ATOM   2622 O OD2 . ASP B 1 108 ? -10.671 10.768  35.984 1.00 22.99 ? 98  ASP B OD2 1 
ATOM   2623 N N   . GLY B 1 109 ? -7.192  7.543   34.070 1.00 19.64 ? 99  GLY B N   1 
ATOM   2624 C CA  . GLY B 1 109 ? -6.337  7.591   32.886 1.00 19.82 ? 99  GLY B CA  1 
ATOM   2625 C C   . GLY B 1 109 ? -5.471  8.839   32.744 1.00 19.84 ? 99  GLY B C   1 
ATOM   2626 O O   . GLY B 1 109 ? -4.525  8.831   31.966 1.00 19.30 ? 99  GLY B O   1 
ATOM   2627 N N   . GLY B 1 110 ? -5.829  9.912   33.448 1.00 20.71 ? 100 GLY B N   1 
ATOM   2628 C CA  . GLY B 1 110 ? -4.928  11.062  33.568 1.00 19.62 ? 100 GLY B CA  1 
ATOM   2629 C C   . GLY B 1 110 ? -3.509  10.709  34.001 1.00 20.73 ? 100 GLY B C   1 
ATOM   2630 O O   . GLY B 1 110 ? -3.278  9.880   34.901 1.00 19.32 ? 100 GLY B O   1 
ATOM   2631 N N   . VAL B 1 111 ? -2.532  11.327  33.355 1.00 19.58 ? 101 VAL B N   1 
ATOM   2632 C CA  . VAL B 1 111 ? -1.140  11.029  33.672 1.00 19.42 ? 101 VAL B CA  1 
ATOM   2633 C C   . VAL B 1 111 ? -0.426  12.380  33.780 1.00 21.08 ? 101 VAL B C   1 
ATOM   2634 O O   . VAL B 1 111 ? -0.474  13.158  32.841 1.00 20.66 ? 101 VAL B O   1 
ATOM   2635 C CB  . VAL B 1 111 ? -0.444  10.165  32.601 1.00 20.83 ? 101 VAL B CB  1 
ATOM   2636 C CG1 . VAL B 1 111 ? 1.022   10.005  32.922 1.00 20.65 ? 101 VAL B CG1 1 
ATOM   2637 C CG2 . VAL B 1 111 ? -1.118  8.749   32.424 1.00 18.87 ? 101 VAL B CG2 1 
ATOM   2638 N N   . LEU B 1 112 ? 0.207   12.653  34.927 1.00 21.12 ? 102 LEU B N   1 
ATOM   2639 C CA  . LEU B 1 112 ? 0.968   13.913  35.090 1.00 22.16 ? 102 LEU B CA  1 
ATOM   2640 C C   . LEU B 1 112 ? 2.409   13.546  35.415 1.00 22.42 ? 102 LEU B C   1 
ATOM   2641 O O   . LEU B 1 112 ? 2.659   12.847  36.410 1.00 23.36 ? 102 LEU B O   1 
ATOM   2642 C CB  . LEU B 1 112 ? 0.343   14.785  36.189 1.00 22.44 ? 102 LEU B CB  1 
ATOM   2643 C CG  . LEU B 1 112 ? 0.918   16.225  36.296 1.00 23.47 ? 102 LEU B CG  1 
ATOM   2644 C CD1 . LEU B 1 112 ? -0.238  17.194  36.511 1.00 24.26 ? 102 LEU B CD1 1 
ATOM   2645 C CD2 . LEU B 1 112 ? 1.998   16.357  37.411 1.00 20.24 ? 102 LEU B CD2 1 
ATOM   2646 N N   . THR B 1 113 ? 3.341   13.977  34.570 1.00 22.64 ? 103 THR B N   1 
ATOM   2647 C CA  . THR B 1 113 ? 4.759   13.802  34.817 1.00 23.88 ? 103 THR B CA  1 
ATOM   2648 C C   . THR B 1 113 ? 5.360   15.149  35.241 1.00 23.59 ? 103 THR B C   1 
ATOM   2649 O O   . THR B 1 113 ? 4.987   16.191  34.708 1.00 23.15 ? 103 THR B O   1 
ATOM   2650 C CB  . THR B 1 113 ? 5.527   13.218  33.599 1.00 25.57 ? 103 THR B CB  1 
ATOM   2651 O OG1 . THR B 1 113 ? 5.394   14.080  32.476 1.00 32.55 ? 103 THR B OG1 1 
ATOM   2652 C CG2 . THR B 1 113 ? 4.964   11.822  33.191 1.00 24.79 ? 103 THR B CG2 1 
ATOM   2653 N N   . ALA B 1 114 ? 6.212   15.120  36.251 1.00 22.31 ? 104 ALA B N   1 
ATOM   2654 C CA  . ALA B 1 114 ? 6.813   16.351  36.810 1.00 23.07 ? 104 ALA B CA  1 
ATOM   2655 C C   . ALA B 1 114 ? 8.286   16.125  37.031 1.00 22.79 ? 104 ALA B C   1 
ATOM   2656 O O   . ALA B 1 114 ? 8.687   15.036  37.456 1.00 23.21 ? 104 ALA B O   1 
ATOM   2657 C CB  . ALA B 1 114 ? 6.143   16.707  38.112 1.00 24.00 ? 104 ALA B CB  1 
ATOM   2658 N N   . THR B 1 115 ? 9.105   17.152  36.764 1.00 22.99 ? 105 THR B N   1 
ATOM   2659 C CA  . THR B 1 115 ? 10.503  17.053  37.072 1.00 22.26 ? 105 THR B CA  1 
ATOM   2660 C C   . THR B 1 115 ? 10.886  18.373  37.759 1.00 21.27 ? 105 THR B C   1 
ATOM   2661 O O   . THR B 1 115 ? 10.292  19.423  37.499 1.00 20.45 ? 105 THR B O   1 
ATOM   2662 C CB  . THR B 1 115 ? 11.381  16.807  35.834 1.00 23.64 ? 105 THR B CB  1 
ATOM   2663 O OG1 . THR B 1 115 ? 11.140  17.849  34.890 1.00 23.96 ? 105 THR B OG1 1 
ATOM   2664 C CG2 . THR B 1 115 ? 11.054  15.452  35.177 1.00 23.07 ? 105 THR B CG2 1 
ATOM   2665 N N   . GLN B 1 116 ? 11.805  18.247  38.692 1.00 20.17 ? 106 GLN B N   1 
ATOM   2666 C CA  . GLN B 1 116 ? 12.063  19.342  39.622 1.00 19.69 ? 106 GLN B CA  1 
ATOM   2667 C C   . GLN B 1 116 ? 13.549  19.377  39.972 1.00 19.82 ? 106 GLN B C   1 
ATOM   2668 O O   . GLN B 1 116 ? 14.216  18.342  40.082 1.00 19.57 ? 106 GLN B O   1 
ATOM   2669 C CB  . GLN B 1 116 ? 11.147  19.225  40.856 1.00 20.14 ? 106 GLN B CB  1 
ATOM   2670 C CG  . GLN B 1 116 ? 11.044  20.488  41.732 1.00 18.22 ? 106 GLN B CG  1 
ATOM   2671 C CD  . GLN B 1 116 ? 12.069  20.510  42.887 1.00 17.09 ? 106 GLN B CD  1 
ATOM   2672 O OE1 . GLN B 1 116 ? 13.129  19.854  42.853 1.00 18.23 ? 106 GLN B OE1 1 
ATOM   2673 N NE2 . GLN B 1 116 ? 11.703  21.217  43.942 1.00 17.82 ? 106 GLN B NE2 1 
ATOM   2674 N N   . ASP B 1 117 ? 14.075  20.616  40.067 1.00 19.38 ? 107 ASP B N   1 
ATOM   2675 C CA  . ASP B 1 117 ? 15.396  20.867  40.575 1.00 20.38 ? 107 ASP B CA  1 
ATOM   2676 C C   . ASP B 1 117 ? 15.232  21.663  41.858 1.00 18.34 ? 107 ASP B C   1 
ATOM   2677 O O   . ASP B 1 117 ? 14.428  22.594  41.907 1.00 19.37 ? 107 ASP B O   1 
ATOM   2678 C CB  . ASP B 1 117 ? 16.239  21.702  39.584 1.00 21.31 ? 107 ASP B CB  1 
ATOM   2679 C CG  . ASP B 1 117 ? 17.623  21.878  40.062 1.00 24.82 ? 107 ASP B CG  1 
ATOM   2680 O OD1 . ASP B 1 117 ? 18.386  20.896  40.063 1.00 27.29 ? 107 ASP B OD1 1 
ATOM   2681 O OD2 . ASP B 1 117 ? 17.931  22.998  40.495 1.00 31.86 ? 107 ASP B OD2 1 
ATOM   2682 N N   . THR B 1 118 ? 15.938  21.232  42.885 1.00 18.47 ? 108 THR B N   1 
ATOM   2683 C CA  . THR B 1 118 ? 16.017  21.897  44.191 1.00 19.00 ? 108 THR B CA  1 
ATOM   2684 C C   . THR B 1 118 ? 17.469  22.336  44.417 1.00 20.75 ? 108 THR B C   1 
ATOM   2685 O O   . THR B 1 118 ? 18.398  21.509  44.435 1.00 20.11 ? 108 THR B O   1 
ATOM   2686 C CB  . THR B 1 118 ? 15.563  20.917  45.308 1.00 19.30 ? 108 THR B CB  1 
ATOM   2687 O OG1 . THR B 1 118 ? 14.139  20.713  45.182 1.00 18.26 ? 108 THR B OG1 1 
ATOM   2688 C CG2 . THR B 1 118 ? 15.902  21.490  46.716 1.00 19.21 ? 108 THR B CG2 1 
ATOM   2689 N N   . SER B 1 119 ? 17.648  23.652  44.580 1.00 21.78 ? 109 SER B N   1 
ATOM   2690 C CA  . SER B 1 119 ? 18.947  24.208  44.823 1.00 22.08 ? 109 SER B CA  1 
ATOM   2691 C C   . SER B 1 119 ? 18.856  25.164  46.020 1.00 21.93 ? 109 SER B C   1 
ATOM   2692 O O   . SER B 1 119 ? 17.776  25.601  46.417 1.00 22.16 ? 109 SER B O   1 
ATOM   2693 C CB  . SER B 1 119 ? 19.422  24.927  43.544 1.00 23.87 ? 109 SER B CB  1 
ATOM   2694 O OG  . SER B 1 119 ? 18.507  25.968  43.176 1.00 25.80 ? 109 SER B OG  1 
ATOM   2695 N N   . LEU B 1 120 ? 20.013  25.508  46.573 1.00 22.82 ? 110 LEU B N   1 
ATOM   2696 C CA  . LEU B 1 120 ? 20.093  26.438  47.683 1.00 21.99 ? 110 LEU B CA  1 
ATOM   2697 C C   . LEU B 1 120 ? 20.928  27.615  47.178 1.00 22.76 ? 110 LEU B C   1 
ATOM   2698 O O   . LEU B 1 120 ? 22.092  27.448  46.883 1.00 21.77 ? 110 LEU B O   1 
ATOM   2699 C CB  . LEU B 1 120 ? 20.788  25.758  48.849 1.00 22.53 ? 110 LEU B CB  1 
ATOM   2700 C CG  . LEU B 1 120 ? 20.945  26.559  50.150 1.00 23.02 ? 110 LEU B CG  1 
ATOM   2701 C CD1 . LEU B 1 120 ? 19.610  27.095  50.754 1.00 20.68 ? 110 LEU B CD1 1 
ATOM   2702 C CD2 . LEU B 1 120 ? 21.738  25.731  51.176 1.00 23.37 ? 110 LEU B CD2 1 
ATOM   2703 N N   . GLN B 1 121 ? 20.312  28.763  47.044 1.00 23.89 ? 111 GLN B N   1 
ATOM   2704 C CA  . GLN B 1 121 ? 21.026  29.893  46.450 1.00 27.97 ? 111 GLN B CA  1 
ATOM   2705 C C   . GLN B 1 121 ? 21.008  31.075  47.376 1.00 26.08 ? 111 GLN B C   1 
ATOM   2706 O O   . GLN B 1 121 ? 19.950  31.650  47.666 1.00 26.53 ? 111 GLN B O   1 
ATOM   2707 C CB  . GLN B 1 121 ? 20.458  30.237  45.077 1.00 27.28 ? 111 GLN B CB  1 
ATOM   2708 C CG  . GLN B 1 121 ? 20.673  29.101  44.051 1.00 30.87 ? 111 GLN B CG  1 
ATOM   2709 C CD  . GLN B 1 121 ? 20.113  29.474  42.680 1.00 33.57 ? 111 GLN B CD  1 
ATOM   2710 O OE1 . GLN B 1 121 ? 20.161  30.661  42.266 1.00 37.65 ? 111 GLN B OE1 1 
ATOM   2711 N NE2 . GLN B 1 121 ? 19.551  28.468  41.971 1.00 34.57 ? 111 GLN B NE2 1 
ATOM   2712 N N   . ASP B 1 122 ? 22.203  31.431  47.855 1.00 27.15 ? 112 ASP B N   1 
ATOM   2713 C CA  . ASP B 1 122 ? 22.323  32.641  48.712 1.00 26.71 ? 112 ASP B CA  1 
ATOM   2714 C C   . ASP B 1 122 ? 21.263  32.675  49.843 1.00 26.71 ? 112 ASP B C   1 
ATOM   2715 O O   . ASP B 1 122 ? 20.580  33.691  50.113 1.00 27.46 ? 112 ASP B O   1 
ATOM   2716 C CB  . ASP B 1 122 ? 22.341  33.904  47.820 1.00 26.40 ? 112 ASP B CB  1 
ATOM   2717 C CG  . ASP B 1 122 ? 23.339  33.762  46.674 1.00 25.31 ? 112 ASP B CG  1 
ATOM   2718 O OD1 . ASP B 1 122 ? 24.502  33.388  46.938 1.00 26.50 ? 112 ASP B OD1 1 
ATOM   2719 O OD2 . ASP B 1 122 ? 22.957  33.978  45.501 1.00 28.45 ? 112 ASP B OD2 1 
ATOM   2720 N N   . GLY B 1 123 ? 21.128  31.526  50.487 1.00 26.94 ? 113 GLY B N   1 
ATOM   2721 C CA  . GLY B 1 123 ? 20.303  31.398  51.684 1.00 26.58 ? 113 GLY B CA  1 
ATOM   2722 C C   . GLY B 1 123 ? 18.861  30.989  51.473 1.00 27.63 ? 113 GLY B C   1 
ATOM   2723 O O   . GLY B 1 123 ? 18.158  30.814  52.439 1.00 27.16 ? 113 GLY B O   1 
ATOM   2724 N N   . CYS B 1 124 ? 18.432  30.834  50.216 1.00 27.48 ? 114 CYS B N   1 
ATOM   2725 C CA  . CYS B 1 124 ? 17.026  30.568  49.880 1.00 27.65 ? 114 CYS B CA  1 
ATOM   2726 C C   . CYS B 1 124 ? 16.945  29.273  49.064 1.00 26.54 ? 114 CYS B C   1 
ATOM   2727 O O   . CYS B 1 124 ? 17.780  29.027  48.185 1.00 26.59 ? 114 CYS B O   1 
ATOM   2728 C CB  . CYS B 1 124 ? 16.420  31.731  49.079 1.00 28.79 ? 114 CYS B CB  1 
ATOM   2729 S SG  . CYS B 1 124 ? 14.633  31.685  48.706 1.00 29.87 ? 114 CYS B SG  1 
ATOM   2730 N N   . LEU B 1 125 ? 15.967  28.433  49.404 1.00 24.81 ? 115 LEU B N   1 
ATOM   2731 C CA  . LEU B 1 125 ? 15.656  27.237  48.609 1.00 24.42 ? 115 LEU B CA  1 
ATOM   2732 C C   . LEU B 1 125 ? 15.004  27.663  47.311 1.00 22.72 ? 115 LEU B C   1 
ATOM   2733 O O   . LEU B 1 125 ? 14.023  28.399  47.321 1.00 24.37 ? 115 LEU B O   1 
ATOM   2734 C CB  . LEU B 1 125 ? 14.680  26.334  49.393 1.00 23.35 ? 115 LEU B CB  1 
ATOM   2735 C CG  . LEU B 1 125 ? 15.376  25.644  50.557 1.00 23.46 ? 115 LEU B CG  1 
ATOM   2736 C CD1 . LEU B 1 125 ? 14.362  25.058  51.528 1.00 24.50 ? 115 LEU B CD1 1 
ATOM   2737 C CD2 . LEU B 1 125 ? 16.460  24.645  50.148 1.00 23.24 ? 115 LEU B CD2 1 
ATOM   2738 N N   . ILE B 1 126 ? 15.524  27.174  46.195 1.00 21.63 ? 116 ILE B N   1 
ATOM   2739 C CA  . ILE B 1 126 ? 14.990  27.588  44.904 1.00 20.12 ? 116 ILE B CA  1 
ATOM   2740 C C   . ILE B 1 126 ? 14.459  26.334  44.193 1.00 19.47 ? 116 ILE B C   1 
ATOM   2741 O O   . ILE B 1 126 ? 15.212  25.394  44.003 1.00 19.29 ? 116 ILE B O   1 
ATOM   2742 C CB  . ILE B 1 126 ? 16.085  28.100  44.009 1.00 19.70 ? 116 ILE B CB  1 
ATOM   2743 C CG1 . ILE B 1 126 ? 16.786  29.324  44.679 1.00 19.32 ? 116 ILE B CG1 1 
ATOM   2744 C CG2 . ILE B 1 126 ? 15.501  28.444  42.649 1.00 18.99 ? 116 ILE B CG2 1 
ATOM   2745 C CD1 . ILE B 1 126 ? 15.817  30.405  45.000 1.00 19.97 ? 116 ILE B CD1 1 
ATOM   2746 N N   . TYR B 1 127 ? 13.205  26.366  43.791 1.00 19.77 ? 117 TYR B N   1 
ATOM   2747 C CA  . TYR B 1 127 ? 12.623  25.198  43.074 1.00 20.98 ? 117 TYR B CA  1 
ATOM   2748 C C   . TYR B 1 127 ? 12.273  25.574  41.616 1.00 20.82 ? 117 TYR B C   1 
ATOM   2749 O O   . TYR B 1 127 ? 11.633  26.611  41.359 1.00 22.24 ? 117 TYR B O   1 
ATOM   2750 C CB  . TYR B 1 127 ? 11.350  24.723  43.768 1.00 21.25 ? 117 TYR B CB  1 
ATOM   2751 C CG  . TYR B 1 127 ? 11.449  24.410  45.251 1.00 19.04 ? 117 TYR B CG  1 
ATOM   2752 C CD1 . TYR B 1 127 ? 12.609  23.909  45.812 1.00 20.26 ? 117 TYR B CD1 1 
ATOM   2753 C CD2 . TYR B 1 127 ? 10.333  24.566  46.078 1.00 21.09 ? 117 TYR B CD2 1 
ATOM   2754 C CE1 . TYR B 1 127 ? 12.662  23.582  47.173 1.00 20.01 ? 117 TYR B CE1 1 
ATOM   2755 C CE2 . TYR B 1 127 ? 10.383  24.240  47.439 1.00 20.53 ? 117 TYR B CE2 1 
ATOM   2756 C CZ  . TYR B 1 127 ? 11.554  23.769  47.967 1.00 19.90 ? 117 TYR B CZ  1 
ATOM   2757 O OH  . TYR B 1 127 ? 11.623  23.439  49.307 1.00 22.12 ? 117 TYR B OH  1 
ATOM   2758 N N   . ASN B 1 128 ? 12.638  24.706  40.682 1.00 20.19 ? 118 ASN B N   1 
ATOM   2759 C CA  . ASN B 1 128 ? 12.208  24.876  39.292 1.00 20.13 ? 118 ASN B CA  1 
ATOM   2760 C C   . ASN B 1 128 ? 11.488  23.608  38.868 1.00 19.36 ? 118 ASN B C   1 
ATOM   2761 O O   . ASN B 1 128 ? 12.079  22.526  38.992 1.00 19.62 ? 118 ASN B O   1 
ATOM   2762 C CB  . ASN B 1 128 ? 13.419  25.090  38.400 1.00 22.00 ? 118 ASN B CB  1 
ATOM   2763 C CG  . ASN B 1 128 ? 13.930  26.524  38.468 1.00 25.88 ? 118 ASN B CG  1 
ATOM   2764 O OD1 . ASN B 1 128 ? 13.351  27.425  37.846 1.00 30.75 ? 118 ASN B OD1 1 
ATOM   2765 N ND2 . ASN B 1 128 ? 14.992  26.746  39.251 1.00 29.60 ? 118 ASN B ND2 1 
ATOM   2766 N N   . VAL B 1 129 ? 10.244  23.759  38.438 1.00 18.23 ? 119 VAL B N   1 
ATOM   2767 C CA  . VAL B 1 129 ? 9.341   22.625  38.143 1.00 20.57 ? 119 VAL B CA  1 
ATOM   2768 C C   . VAL B 1 129 ? 8.826   22.698  36.706 1.00 21.56 ? 119 VAL B C   1 
ATOM   2769 O O   . VAL B 1 129 ? 8.429   23.777  36.240 1.00 22.62 ? 119 VAL B O   1 
ATOM   2770 C CB  . VAL B 1 129 ? 8.116   22.606  39.066 1.00 20.64 ? 119 VAL B CB  1 
ATOM   2771 C CG1 . VAL B 1 129 ? 7.462   21.164  39.093 1.00 19.91 ? 119 VAL B CG1 1 
ATOM   2772 C CG2 . VAL B 1 129 ? 8.460   23.058  40.473 1.00 21.25 ? 119 VAL B CG2 1 
ATOM   2773 N N   . LYS B 1 130 ? 8.768   21.541  36.033 1.00 22.26 ? 120 LYS B N   1 
ATOM   2774 C CA  . LYS B 1 130 ? 8.179   21.436  34.681 1.00 22.42 ? 120 LYS B CA  1 
ATOM   2775 C C   . LYS B 1 130 ? 7.153   20.308  34.720 1.00 22.07 ? 120 LYS B C   1 
ATOM   2776 O O   . LYS B 1 130 ? 7.450   19.250  35.252 1.00 22.45 ? 120 LYS B O   1 
ATOM   2777 C CB  . LYS B 1 130 ? 9.266   21.130  33.665 1.00 23.21 ? 120 LYS B CB  1 
ATOM   2778 C CG  . LYS B 1 130 ? 10.116  22.368  33.330 1.00 27.88 ? 120 LYS B CG  1 
ATOM   2779 C CD  . LYS B 1 130 ? 11.187  22.047  32.281 1.00 34.74 ? 120 LYS B CD  1 
ATOM   2780 C CE  . LYS B 1 130 ? 12.267  23.153  32.278 1.00 39.50 ? 120 LYS B CE  1 
ATOM   2781 N NZ  . LYS B 1 130 ? 13.157  23.006  31.102 1.00 41.24 ? 120 LYS B NZ  1 
ATOM   2782 N N   . ILE B 1 131 ? 5.955   20.581  34.217 1.00 22.20 ? 121 ILE B N   1 
ATOM   2783 C CA  . ILE B 1 131 ? 4.792   19.686  34.375 1.00 22.33 ? 121 ILE B CA  1 
ATOM   2784 C C   . ILE B 1 131 ? 4.274   19.342  32.985 1.00 22.98 ? 121 ILE B C   1 
ATOM   2785 O O   . ILE B 1 131 ? 4.090   20.256  32.162 1.00 22.18 ? 121 ILE B O   1 
ATOM   2786 C CB  . ILE B 1 131 ? 3.654   20.436  35.170 1.00 22.59 ? 121 ILE B CB  1 
ATOM   2787 C CG1 . ILE B 1 131 ? 4.024   20.772  36.633 1.00 24.25 ? 121 ILE B CG1 1 
ATOM   2788 C CG2 . ILE B 1 131 ? 2.287   19.686  35.146 1.00 23.46 ? 121 ILE B CG2 1 
ATOM   2789 C CD1 . ILE B 1 131 ? 4.846   19.807  37.306 1.00 26.13 ? 121 ILE B CD1 1 
ATOM   2790 N N   . ARG B 1 132 ? 4.022   18.047  32.714 1.00 22.56 ? 122 ARG B N   1 
ATOM   2791 C CA  . ARG B 1 132 ? 3.180   17.658  31.566 1.00 22.37 ? 122 ARG B CA  1 
ATOM   2792 C C   . ARG B 1 132 ? 2.069   16.690  31.999 1.00 21.36 ? 122 ARG B C   1 
ATOM   2793 O O   . ARG B 1 132 ? 2.367   15.608  32.446 1.00 21.43 ? 122 ARG B O   1 
ATOM   2794 C CB  . ARG B 1 132 ? 4.040   17.028  30.467 1.00 23.50 ? 122 ARG B CB  1 
ATOM   2795 C CG  . ARG B 1 132 ? 3.242   16.622  29.155 1.00 23.95 ? 122 ARG B CG  1 
ATOM   2796 C CD  . ARG B 1 132 ? 2.458   17.804  28.520 1.00 28.77 ? 122 ARG B CD  1 
ATOM   2797 N NE  . ARG B 1 132 ? 3.393   18.815  28.032 1.00 30.66 ? 122 ARG B NE  1 
ATOM   2798 C CZ  . ARG B 1 132 ? 3.228   19.594  26.958 1.00 31.16 ? 122 ARG B CZ  1 
ATOM   2799 N NH1 . ARG B 1 132 ? 2.134   19.495  26.204 1.00 28.39 ? 122 ARG B NH1 1 
ATOM   2800 N NH2 . ARG B 1 132 ? 4.190   20.466  26.645 1.00 26.83 ? 122 ARG B NH2 1 
ATOM   2801 N N   . GLY B 1 133 ? 0.812   17.108  31.858 1.00 21.08 ? 123 GLY B N   1 
ATOM   2802 C CA  . GLY B 1 133 ? -0.371  16.251  32.123 1.00 20.71 ? 123 GLY B CA  1 
ATOM   2803 C C   . GLY B 1 133 ? -1.090  15.918  30.829 1.00 21.56 ? 123 GLY B C   1 
ATOM   2804 O O   . GLY B 1 133 ? -1.318  16.793  29.974 1.00 21.10 ? 123 GLY B O   1 
ATOM   2805 N N   . VAL B 1 134 ? -1.484  14.649  30.655 1.00 21.07 ? 124 VAL B N   1 
ATOM   2806 C CA  . VAL B 1 134 ? -2.089  14.224  29.373 1.00 20.21 ? 124 VAL B CA  1 
ATOM   2807 C C   . VAL B 1 134 ? -3.212  13.244  29.692 1.00 19.12 ? 124 VAL B C   1 
ATOM   2808 O O   . VAL B 1 134 ? -3.263  12.732  30.791 1.00 17.51 ? 124 VAL B O   1 
ATOM   2809 C CB  . VAL B 1 134 ? -1.080  13.585  28.346 1.00 19.73 ? 124 VAL B CB  1 
ATOM   2810 C CG1 . VAL B 1 134 ? 0.011   14.593  27.874 1.00 21.11 ? 124 VAL B CG1 1 
ATOM   2811 C CG2 . VAL B 1 134 ? -0.434  12.371  28.891 1.00 20.45 ? 124 VAL B CG2 1 
ATOM   2812 N N   . ASN B 1 135 ? -4.172  13.102  28.778 1.00 20.21 ? 125 ASN B N   1 
ATOM   2813 C CA  . ASN B 1 135 ? -5.287  12.155  28.958 1.00 21.03 ? 125 ASN B CA  1 
ATOM   2814 C C   . ASN B 1 135 ? -6.221  12.292  30.169 1.00 21.13 ? 125 ASN B C   1 
ATOM   2815 O O   . ASN B 1 135 ? -6.787  11.302  30.626 1.00 21.17 ? 125 ASN B O   1 
ATOM   2816 C CB  . ASN B 1 135 ? -4.715  10.758  28.889 1.00 20.54 ? 125 ASN B CB  1 
ATOM   2817 C CG  . ASN B 1 135 ? -4.059  10.516  27.580 1.00 20.92 ? 125 ASN B CG  1 
ATOM   2818 O OD1 . ASN B 1 135 ? -2.854  10.444  27.495 1.00 24.04 ? 125 ASN B OD1 1 
ATOM   2819 N ND2 . ASN B 1 135 ? -4.870  10.450  26.505 1.00 20.34 ? 125 ASN B ND2 1 
ATOM   2820 N N   . PHE B 1 136 ? -6.370  13.496  30.714 1.00 20.09 ? 126 PHE B N   1 
ATOM   2821 C CA  . PHE B 1 136 ? -7.304  13.717  31.780 1.00 20.98 ? 126 PHE B CA  1 
ATOM   2822 C C   . PHE B 1 136 ? -8.641  13.735  31.075 1.00 21.72 ? 126 PHE B C   1 
ATOM   2823 O O   . PHE B 1 136 ? -8.772  14.399  30.044 1.00 22.02 ? 126 PHE B O   1 
ATOM   2824 C CB  . PHE B 1 136 ? -7.015  15.026  32.529 1.00 21.38 ? 126 PHE B CB  1 
ATOM   2825 C CG  . PHE B 1 136 ? -5.843  14.905  33.461 1.00 19.33 ? 126 PHE B CG  1 
ATOM   2826 C CD1 . PHE B 1 136 ? -6.048  14.597  34.805 1.00 18.84 ? 126 PHE B CD1 1 
ATOM   2827 C CD2 . PHE B 1 136 ? -4.540  15.028  32.981 1.00 20.69 ? 126 PHE B CD2 1 
ATOM   2828 C CE1 . PHE B 1 136 ? -4.966  14.450  35.685 1.00 21.27 ? 126 PHE B CE1 1 
ATOM   2829 C CE2 . PHE B 1 136 ? -3.437  14.883  33.847 1.00 23.95 ? 126 PHE B CE2 1 
ATOM   2830 C CZ  . PHE B 1 136 ? -3.656  14.579  35.208 1.00 21.89 ? 126 PHE B CZ  1 
ATOM   2831 N N   . PRO B 1 137 ? -9.593  12.913  31.551 1.00 22.89 ? 127 PRO B N   1 
ATOM   2832 C CA  . PRO B 1 137 ? -10.846 12.791  30.801 1.00 24.40 ? 127 PRO B CA  1 
ATOM   2833 C C   . PRO B 1 137 ? -11.567 14.121  30.752 1.00 27.47 ? 127 PRO B C   1 
ATOM   2834 O O   . PRO B 1 137 ? -11.703 14.806  31.783 1.00 27.53 ? 127 PRO B O   1 
ATOM   2835 C CB  . PRO B 1 137 ? -11.669 11.795  31.613 1.00 23.90 ? 127 PRO B CB  1 
ATOM   2836 C CG  . PRO B 1 137 ? -10.803 11.216  32.607 1.00 24.04 ? 127 PRO B CG  1 
ATOM   2837 C CD  . PRO B 1 137 ? -9.561  12.066  32.748 1.00 22.53 ? 127 PRO B CD  1 
ATOM   2838 N N   . SER B 1 138 ? -12.044 14.460  29.551 1.00 28.82 ? 128 SER B N   1 
ATOM   2839 C CA  . SER B 1 138 ? -12.572 15.774  29.238 1.00 30.21 ? 128 SER B CA  1 
ATOM   2840 C C   . SER B 1 138 ? -13.762 16.114  30.119 1.00 30.72 ? 128 SER B C   1 
ATOM   2841 O O   . SER B 1 138 ? -13.956 17.269  30.475 1.00 31.53 ? 128 SER B O   1 
ATOM   2842 C CB  . SER B 1 138 ? -12.922 15.849  27.749 1.00 30.17 ? 128 SER B CB  1 
ATOM   2843 O OG  . SER B 1 138 ? -13.922 14.893  27.422 1.00 32.50 ? 128 SER B OG  1 
ATOM   2844 N N   . ASN B 1 139 ? -14.532 15.104  30.511 1.00 31.45 ? 129 ASN B N   1 
ATOM   2845 C CA  . ASN B 1 139 ? -15.638 15.319  31.443 1.00 32.22 ? 129 ASN B CA  1 
ATOM   2846 C C   . ASN B 1 139 ? -15.363 14.764  32.840 1.00 31.87 ? 129 ASN B C   1 
ATOM   2847 O O   . ASN B 1 139 ? -16.274 14.625  33.641 1.00 32.26 ? 129 ASN B O   1 
ATOM   2848 C CB  . ASN B 1 139 ? -16.967 14.796  30.866 1.00 33.98 ? 129 ASN B CB  1 
ATOM   2849 C CG  . ASN B 1 139 ? -17.806 15.912  30.270 1.00 37.84 ? 129 ASN B CG  1 
ATOM   2850 O OD1 . ASN B 1 139 ? -18.771 16.363  30.892 1.00 46.01 ? 129 ASN B OD1 1 
ATOM   2851 N ND2 . ASN B 1 139 ? -17.412 16.407  29.095 1.00 40.47 ? 129 ASN B ND2 1 
ATOM   2852 N N   . GLY B 1 140 ? -14.096 14.459  33.134 1.00 30.69 ? 130 GLY B N   1 
ATOM   2853 C CA  . GLY B 1 140 ? -13.708 13.963  34.473 1.00 30.61 ? 130 GLY B CA  1 
ATOM   2854 C C   . GLY B 1 140 ? -13.658 15.091  35.493 1.00 30.29 ? 130 GLY B C   1 
ATOM   2855 O O   . GLY B 1 140 ? -13.763 16.247  35.104 1.00 29.74 ? 130 GLY B O   1 
ATOM   2856 N N   . PRO B 1 141 ? -13.529 14.757  36.799 1.00 30.47 ? 131 PRO B N   1 
ATOM   2857 C CA  . PRO B 1 141 ? -13.532 15.775  37.872 1.00 30.51 ? 131 PRO B CA  1 
ATOM   2858 C C   . PRO B 1 141 ? -12.361 16.766  37.842 1.00 30.12 ? 131 PRO B C   1 
ATOM   2859 O O   . PRO B 1 141 ? -12.512 17.873  38.331 1.00 30.24 ? 131 PRO B O   1 
ATOM   2860 C CB  . PRO B 1 141 ? -13.461 14.947  39.148 1.00 30.65 ? 131 PRO B CB  1 
ATOM   2861 C CG  . PRO B 1 141 ? -12.828 13.637  38.727 1.00 31.65 ? 131 PRO B CG  1 
ATOM   2862 C CD  . PRO B 1 141 ? -13.452 13.393  37.359 1.00 30.36 ? 131 PRO B CD  1 
ATOM   2863 N N   . VAL B 1 142 ? -11.208 16.362  37.302 1.00 29.73 ? 132 VAL B N   1 
ATOM   2864 C CA  . VAL B 1 142 ? -10.069 17.280  37.172 1.00 28.81 ? 132 VAL B CA  1 
ATOM   2865 C C   . VAL B 1 142 ? -10.362 18.354  36.139 1.00 29.42 ? 132 VAL B C   1 
ATOM   2866 O O   . VAL B 1 142 ? -10.239 19.541  36.447 1.00 28.60 ? 132 VAL B O   1 
ATOM   2867 C CB  . VAL B 1 142 ? -8.771  16.561  36.799 1.00 28.66 ? 132 VAL B CB  1 
ATOM   2868 C CG1 . VAL B 1 142 ? -7.744  17.536  36.303 1.00 26.37 ? 132 VAL B CG1 1 
ATOM   2869 C CG2 . VAL B 1 142 ? -8.238  15.799  38.004 1.00 28.19 ? 132 VAL B CG2 1 
ATOM   2870 N N   . MET B 1 143 ? -10.773 17.954  34.931 1.00 29.20 ? 133 MET B N   1 
ATOM   2871 C CA  . MET B 1 143 ? -11.058 18.949  33.877 1.00 29.98 ? 133 MET B CA  1 
ATOM   2872 C C   . MET B 1 143 ? -12.352 19.721  34.122 1.00 30.80 ? 133 MET B C   1 
ATOM   2873 O O   . MET B 1 143 ? -12.544 20.811  33.563 1.00 32.15 ? 133 MET B O   1 
ATOM   2874 C CB  . MET B 1 143 ? -11.045 18.316  32.478 1.00 29.80 ? 133 MET B CB  1 
ATOM   2875 C CG  . MET B 1 143 ? -9.717  17.690  32.103 1.00 27.19 ? 133 MET B CG  1 
ATOM   2876 S SD  . MET B 1 143 ? -8.232  18.734  32.276 1.00 29.31 ? 133 MET B SD  1 
ATOM   2877 C CE  . MET B 1 143 ? -8.577  20.065  31.117 1.00 27.25 ? 133 MET B CE  1 
ATOM   2878 N N   . GLN B 1 144 ? -13.235 19.182  34.959 1.00 31.34 ? 134 GLN B N   1 
ATOM   2879 C CA  . GLN B 1 144 ? -14.471 19.883  35.277 1.00 32.34 ? 134 GLN B CA  1 
ATOM   2880 C C   . GLN B 1 144 ? -14.389 20.661  36.585 1.00 32.71 ? 134 GLN B C   1 
ATOM   2881 O O   . GLN B 1 144 ? -15.383 21.260  37.027 1.00 33.28 ? 134 GLN B O   1 
ATOM   2882 C CB  . GLN B 1 144 ? -15.656 18.923  35.285 1.00 33.11 ? 134 GLN B CB  1 
ATOM   2883 C CG  . GLN B 1 144 ? -15.981 18.396  33.902 1.00 34.35 ? 134 GLN B CG  1 
ATOM   2884 C CD  . GLN B 1 144 ? -16.262 19.513  32.912 1.00 37.45 ? 134 GLN B CD  1 
ATOM   2885 O OE1 . GLN B 1 144 ? -17.165 20.341  33.126 1.00 38.71 ? 134 GLN B OE1 1 
ATOM   2886 N NE2 . GLN B 1 144 ? -15.484 19.557  31.823 1.00 37.83 ? 134 GLN B NE2 1 
ATOM   2887 N N   . LYS B 1 145 ? -13.206 20.632  37.202 1.00 32.67 ? 135 LYS B N   1 
ATOM   2888 C CA  . LYS B 1 145 ? -12.957 21.285  38.483 1.00 32.78 ? 135 LYS B CA  1 
ATOM   2889 C C   . LYS B 1 145 ? -13.952 20.871  39.586 1.00 32.15 ? 135 LYS B C   1 
ATOM   2890 O O   . LYS B 1 145 ? -14.547 21.714  40.264 1.00 32.60 ? 135 LYS B O   1 
ATOM   2891 C CB  . LYS B 1 145 ? -12.909 22.807  38.294 1.00 32.83 ? 135 LYS B CB  1 
ATOM   2892 C CG  . LYS B 1 145 ? -11.653 23.311  37.646 1.00 34.77 ? 135 LYS B CG  1 
ATOM   2893 C CD  . LYS B 1 145 ? -11.414 24.845  37.924 1.00 35.03 ? 135 LYS B CD  1 
ATOM   2894 C CE  . LYS B 1 145 ? -12.646 25.707  37.722 1.00 38.66 ? 135 LYS B CE  1 
ATOM   2895 N NZ  . LYS B 1 145 ? -12.358 27.206  37.809 1.00 39.02 ? 135 LYS B NZ  1 
ATOM   2896 N N   . LYS B 1 146 ? -14.125 19.561  39.757 1.00 31.16 ? 136 LYS B N   1 
ATOM   2897 C CA  . LYS B 1 146 ? -15.032 18.997  40.776 1.00 31.10 ? 136 LYS B CA  1 
ATOM   2898 C C   . LYS B 1 146 ? -14.277 18.281  41.908 1.00 29.82 ? 136 LYS B C   1 
ATOM   2899 O O   . LYS B 1 146 ? -14.768 17.291  42.461 1.00 30.31 ? 136 LYS B O   1 
ATOM   2900 C CB  . LYS B 1 146 ? -16.045 18.049  40.132 1.00 30.19 ? 136 LYS B CB  1 
ATOM   2901 C CG  . LYS B 1 146 ? -16.886 18.736  39.071 1.00 32.92 ? 136 LYS B CG  1 
ATOM   2902 C CD  . LYS B 1 146 ? -17.798 19.800  39.721 1.00 35.80 ? 136 LYS B CD  1 
ATOM   2903 C CE  . LYS B 1 146 ? -18.799 20.349  38.727 1.00 37.99 ? 136 LYS B CE  1 
ATOM   2904 N NZ  . LYS B 1 146 ? -19.933 21.011  39.440 1.00 39.95 ? 136 LYS B NZ  1 
ATOM   2905 N N   . THR B 1 147 ? -13.099 18.807  42.253 1.00 28.52 ? 137 THR B N   1 
ATOM   2906 C CA  . THR B 1 147 ? -12.231 18.235  43.284 1.00 26.64 ? 137 THR B CA  1 
ATOM   2907 C C   . THR B 1 147 ? -12.156 19.129  44.512 1.00 27.43 ? 137 THR B C   1 
ATOM   2908 O O   . THR B 1 147 ? -12.370 20.335  44.408 1.00 27.05 ? 137 THR B O   1 
ATOM   2909 C CB  . THR B 1 147 ? -10.828 17.957  42.751 1.00 27.06 ? 137 THR B CB  1 
ATOM   2910 O OG1 . THR B 1 147 ? -10.044 19.182  42.669 1.00 25.55 ? 137 THR B OG1 1 
ATOM   2911 C CG2 . THR B 1 147 ? -10.910 17.314  41.374 1.00 24.18 ? 137 THR B CG2 1 
ATOM   2912 N N   . LEU B 1 148 ? -11.869 18.534  45.667 1.00 26.56 ? 138 LEU B N   1 
ATOM   2913 C CA  . LEU B 1 148 ? -11.932 19.230  46.962 1.00 27.46 ? 138 LEU B CA  1 
ATOM   2914 C C   . LEU B 1 148 ? -10.757 18.880  47.875 1.00 26.82 ? 138 LEU B C   1 
ATOM   2915 O O   . LEU B 1 148 ? -10.928 18.704  49.084 1.00 27.24 ? 138 LEU B O   1 
ATOM   2916 C CB  . LEU B 1 148 ? -13.264 18.942  47.659 1.00 27.61 ? 138 LEU B CB  1 
ATOM   2917 C CG  . LEU B 1 148 ? -14.582 19.444  47.040 1.00 29.64 ? 138 LEU B CG  1 
ATOM   2918 C CD1 . LEU B 1 148 ? -15.759 18.743  47.722 1.00 29.95 ? 138 LEU B CD1 1 
ATOM   2919 C CD2 . LEU B 1 148 ? -14.737 20.959  47.150 1.00 31.74 ? 138 LEU B CD2 1 
ATOM   2920 N N   . GLY B 1 149 ? -9.566  18.769  47.284 1.00 26.45 ? 139 GLY B N   1 
ATOM   2921 C CA  . GLY B 1 149 ? -8.321  18.591  48.031 1.00 25.63 ? 139 GLY B CA  1 
ATOM   2922 C C   . GLY B 1 149 ? -7.996  17.133  48.328 1.00 25.47 ? 139 GLY B C   1 
ATOM   2923 O O   . GLY B 1 149 ? -8.790  16.234  48.016 1.00 24.79 ? 139 GLY B O   1 
ATOM   2924 N N   . TRP B 1 150 ? -6.844  16.925  48.957 1.00 23.78 ? 140 TRP B N   1 
ATOM   2925 C CA  . TRP B 1 150 ? -6.248  15.598  49.148 1.00 23.07 ? 140 TRP B CA  1 
ATOM   2926 C C   . TRP B 1 150 ? -6.423  15.051  50.542 1.00 22.91 ? 140 TRP B C   1 
ATOM   2927 O O   . TRP B 1 150 ? -6.333  15.782  51.531 1.00 22.84 ? 140 TRP B O   1 
ATOM   2928 C CB  . TRP B 1 150 ? -4.758  15.671  48.856 1.00 22.86 ? 140 TRP B CB  1 
ATOM   2929 C CG  . TRP B 1 150 ? -4.474  15.972  47.430 1.00 22.82 ? 140 TRP B CG  1 
ATOM   2930 C CD1 . TRP B 1 150 ? -4.142  17.187  46.890 1.00 22.87 ? 140 TRP B CD1 1 
ATOM   2931 C CD2 . TRP B 1 150 ? -4.539  15.051  46.341 1.00 22.81 ? 140 TRP B CD2 1 
ATOM   2932 N NE1 . TRP B 1 150 ? -3.975  17.068  45.534 1.00 22.33 ? 140 TRP B NE1 1 
ATOM   2933 C CE2 . TRP B 1 150 ? -4.240  15.770  45.168 1.00 23.24 ? 140 TRP B CE2 1 
ATOM   2934 C CE3 . TRP B 1 150 ? -4.876  13.688  46.241 1.00 22.18 ? 140 TRP B CE3 1 
ATOM   2935 C CZ2 . TRP B 1 150 ? -4.191  15.160  43.904 1.00 23.40 ? 140 TRP B CZ2 1 
ATOM   2936 C CZ3 . TRP B 1 150 ? -4.841  13.074  44.988 1.00 21.32 ? 140 TRP B CZ3 1 
ATOM   2937 C CH2 . TRP B 1 150 ? -4.496  13.805  43.832 1.00 21.16 ? 140 TRP B CH2 1 
ATOM   2938 N N   . GLU B 1 151 ? -6.656  13.745  50.645 1.00 20.35 ? 141 GLU B N   1 
ATOM   2939 C CA  . GLU B 1 151 ? -6.633  13.071  51.930 1.00 21.11 ? 141 GLU B CA  1 
ATOM   2940 C C   . GLU B 1 151 ? -5.175  12.947  52.317 1.00 20.41 ? 141 GLU B C   1 
ATOM   2941 O O   . GLU B 1 151 ? -4.302  13.032  51.446 1.00 21.98 ? 141 GLU B O   1 
ATOM   2942 C CB  . GLU B 1 151 ? -7.272  11.652  51.824 1.00 19.67 ? 141 GLU B CB  1 
ATOM   2943 C CG  . GLU B 1 151 ? -8.753  11.708  51.361 1.00 19.66 ? 141 GLU B CG  1 
ATOM   2944 C CD  . GLU B 1 151 ? -9.728  12.143  52.467 1.00 23.99 ? 141 GLU B CD  1 
ATOM   2945 O OE1 . GLU B 1 151 ? -9.267  12.522  53.594 1.00 22.24 ? 141 GLU B OE1 1 
ATOM   2946 O OE2 . GLU B 1 151 ? -10.964 12.081  52.204 1.00 22.36 ? 141 GLU B OE2 1 
ATOM   2947 N N   . ALA B 1 152 ? -4.908  12.759  53.607 1.00 21.59 ? 142 ALA B N   1 
ATOM   2948 C CA  . ALA B 1 152 ? -3.548  12.478  54.076 1.00 21.98 ? 142 ALA B CA  1 
ATOM   2949 C C   . ALA B 1 152 ? -3.007  11.247  53.386 1.00 22.35 ? 142 ALA B C   1 
ATOM   2950 O O   . ALA B 1 152 ? -3.780  10.407  52.889 1.00 22.68 ? 142 ALA B O   1 
ATOM   2951 C CB  . ALA B 1 152 ? -3.534  12.287  55.565 1.00 22.38 ? 142 ALA B CB  1 
ATOM   2952 N N   . SER B 1 153 ? -1.693  11.107  53.346 1.00 20.69 ? 143 SER B N   1 
ATOM   2953 C CA  . SER B 1 153 ? -1.136  9.959   52.648 1.00 21.42 ? 143 SER B CA  1 
ATOM   2954 C C   . SER B 1 153 ? 0.184   9.573   53.269 1.00 20.74 ? 143 SER B C   1 
ATOM   2955 O O   . SER B 1 153 ? 0.750   10.332  54.062 1.00 20.46 ? 143 SER B O   1 
ATOM   2956 C CB  . SER B 1 153 ? -0.969  10.256  51.135 1.00 21.40 ? 143 SER B CB  1 
ATOM   2957 O OG  . SER B 1 153 ? 0.033   11.253  50.889 1.00 24.46 ? 143 SER B OG  1 
ATOM   2958 N N   . THR B 1 154 ? 0.647   8.387   52.914 1.00 19.59 ? 144 THR B N   1 
ATOM   2959 C CA  . THR B 1 154 ? 1.921   7.866   53.351 1.00 21.18 ? 144 THR B CA  1 
ATOM   2960 C C   . THR B 1 154 ? 2.685   7.529   52.097 1.00 22.10 ? 144 THR B C   1 
ATOM   2961 O O   . THR B 1 154 ? 2.140   6.847   51.204 1.00 22.32 ? 144 THR B O   1 
ATOM   2962 C CB  . THR B 1 154 ? 1.723   6.606   54.300 1.00 21.55 ? 144 THR B CB  1 
ATOM   2963 O OG1 . THR B 1 154 ? 1.041   7.028   55.482 1.00 23.22 ? 144 THR B OG1 1 
ATOM   2964 C CG2 . THR B 1 154 ? 3.020   5.947   54.698 1.00 19.80 ? 144 THR B CG2 1 
ATOM   2965 N N   . GLU B 1 155 ? 3.923   8.040   52.011 1.00 20.31 ? 145 GLU B N   1 
ATOM   2966 C CA  . GLU B 1 155 ? 4.881   7.655   51.006 1.00 20.62 ? 145 GLU B CA  1 
ATOM   2967 C C   . GLU B 1 155 ? 5.816   6.666   51.646 1.00 21.03 ? 145 GLU B C   1 
ATOM   2968 O O   . GLU B 1 155 ? 6.187   6.793   52.825 1.00 21.44 ? 145 GLU B O   1 
ATOM   2969 C CB  . GLU B 1 155 ? 5.717   8.848   50.493 1.00 19.58 ? 145 GLU B CB  1 
ATOM   2970 C CG  . GLU B 1 155 ? 6.777   8.498   49.423 1.00 19.21 ? 145 GLU B CG  1 
ATOM   2971 C CD  . GLU B 1 155 ? 7.551   9.755   48.960 1.00 22.00 ? 145 GLU B CD  1 
ATOM   2972 O OE1 . GLU B 1 155 ? 7.573   10.761  49.735 1.00 21.16 ? 145 GLU B OE1 1 
ATOM   2973 O OE2 . GLU B 1 155 ? 8.068   9.728   47.827 1.00 20.52 ? 145 GLU B OE2 1 
ATOM   2974 N N   . MET B 1 156 ? 6.181   5.680   50.849 1.00 20.79 ? 146 MET B N   1 
ATOM   2975 C CA  . MET B 1 156 ? 7.156   4.685   51.187 1.00 21.74 ? 146 MET B CA  1 
ATOM   2976 C C   . MET B 1 156 ? 8.381   4.950   50.371 1.00 20.85 ? 146 MET B C   1 
ATOM   2977 O O   . MET B 1 156 ? 8.323   4.941   49.111 1.00 20.59 ? 146 MET B O   1 
ATOM   2978 C CB  . MET B 1 156 ? 6.625   3.283   50.847 1.00 19.95 ? 146 MET B CB  1 
ATOM   2979 C CG  . MET B 1 156 ? 7.645   2.210   51.095 1.00 21.22 ? 146 MET B CG  1 
ATOM   2980 S SD  . MET B 1 156 ? 7.098   0.512   50.720 1.00 26.64 ? 146 MET B SD  1 
ATOM   2981 C CE  . MET B 1 156 ? 6.381   0.720   49.051 1.00 18.10 ? 146 MET B CE  1 
ATOM   2982 N N   . LEU B 1 157 ? 9.510   5.178   51.054 1.00 21.27 ? 147 LEU B N   1 
ATOM   2983 C CA  . LEU B 1 157 ? 10.751  5.489   50.345 1.00 20.69 ? 147 LEU B CA  1 
ATOM   2984 C C   . LEU B 1 157 ? 11.720  4.372   50.532 1.00 20.16 ? 147 LEU B C   1 
ATOM   2985 O O   . LEU B 1 157 ? 11.827  3.819   51.604 1.00 19.95 ? 147 LEU B O   1 
ATOM   2986 C CB  . LEU B 1 157 ? 11.399  6.804   50.834 1.00 20.61 ? 147 LEU B CB  1 
ATOM   2987 C CG  . LEU B 1 157 ? 10.534  8.000   50.494 1.00 23.07 ? 147 LEU B CG  1 
ATOM   2988 C CD1 . LEU B 1 157 ? 9.618   8.373   51.642 1.00 22.10 ? 147 LEU B CD1 1 
ATOM   2989 C CD2 . LEU B 1 157 ? 11.428  9.186   50.120 1.00 25.50 ? 147 LEU B CD2 1 
ATOM   2990 N N   . TYR B 1 158 ? 12.475  4.095   49.491 1.00 20.09 ? 148 TYR B N   1 
ATOM   2991 C CA  . TYR B 1 158 ? 13.515  3.067   49.566 1.00 20.69 ? 148 TYR B CA  1 
ATOM   2992 C C   . TYR B 1 158 ? 14.712  3.389   48.666 1.00 21.11 ? 148 TYR B C   1 
ATOM   2993 O O   . TYR B 1 158 ? 14.535  3.945   47.584 1.00 20.14 ? 148 TYR B O   1 
ATOM   2994 C CB  . TYR B 1 158 ? 12.908  1.699   49.243 1.00 19.45 ? 148 TYR B CB  1 
ATOM   2995 C CG  . TYR B 1 158 ? 12.232  1.633   47.895 1.00 17.19 ? 148 TYR B CG  1 
ATOM   2996 C CD1 . TYR B 1 158 ? 10.936  2.137   47.710 1.00 17.38 ? 148 TYR B CD1 1 
ATOM   2997 C CD2 . TYR B 1 158 ? 12.892  1.130   46.810 1.00 15.55 ? 148 TYR B CD2 1 
ATOM   2998 C CE1 . TYR B 1 158 ? 10.352  2.118   46.472 1.00 17.87 ? 148 TYR B CE1 1 
ATOM   2999 C CE2 . TYR B 1 158 ? 12.278  1.095   45.544 1.00 17.71 ? 148 TYR B CE2 1 
ATOM   3000 C CZ  . TYR B 1 158 ? 11.013  1.595   45.413 1.00 18.65 ? 148 TYR B CZ  1 
ATOM   3001 O OH  . TYR B 1 158 ? 10.396  1.551   44.199 1.00 20.74 ? 148 TYR B OH  1 
ATOM   3002 N N   . PRO B 1 159 ? 15.930  2.965   49.073 1.00 23.19 ? 149 PRO B N   1 
ATOM   3003 C CA  . PRO B 1 159 ? 17.091  3.248   48.237 1.00 23.91 ? 149 PRO B CA  1 
ATOM   3004 C C   . PRO B 1 159 ? 17.115  2.428   46.963 1.00 24.23 ? 149 PRO B C   1 
ATOM   3005 O O   . PRO B 1 159 ? 16.836  1.218   46.993 1.00 24.78 ? 149 PRO B O   1 
ATOM   3006 C CB  . PRO B 1 159 ? 18.273  2.850   49.127 1.00 24.06 ? 149 PRO B CB  1 
ATOM   3007 C CG  . PRO B 1 159 ? 17.717  1.768   50.003 1.00 24.43 ? 149 PRO B CG  1 
ATOM   3008 C CD  . PRO B 1 159 ? 16.310  2.221   50.301 1.00 22.74 ? 149 PRO B CD  1 
ATOM   3009 N N   . ALA B 1 160 ? 17.484  3.066   45.855 1.00 23.35 ? 150 ALA B N   1 
ATOM   3010 C CA  . ALA B 1 160 ? 17.635  2.385   44.569 1.00 24.43 ? 150 ALA B CA  1 
ATOM   3011 C C   . ALA B 1 160 ? 18.721  3.064   43.692 1.00 26.03 ? 150 ALA B C   1 
ATOM   3012 O O   . ALA B 1 160 ? 18.582  4.223   43.351 1.00 24.55 ? 150 ALA B O   1 
ATOM   3013 C CB  . ALA B 1 160 ? 16.287  2.322   43.819 1.00 25.37 ? 150 ALA B CB  1 
ATOM   3014 N N   . ASP B 1 161 ? 19.774  2.308   43.359 1.00 28.54 ? 151 ASP B N   1 
ATOM   3015 C CA  . ASP B 1 161 ? 20.789  2.680   42.343 1.00 30.35 ? 151 ASP B CA  1 
ATOM   3016 C C   . ASP B 1 161 ? 21.381  4.057   42.655 1.00 31.20 ? 151 ASP B C   1 
ATOM   3017 O O   . ASP B 1 161 ? 21.499  4.942   41.777 1.00 32.42 ? 151 ASP B O   1 
ATOM   3018 C CB  . ASP B 1 161 ? 20.185  2.660   40.931 1.00 31.21 ? 151 ASP B CB  1 
ATOM   3019 C CG  . ASP B 1 161 ? 21.243  2.565   39.822 1.00 33.77 ? 151 ASP B CG  1 
ATOM   3020 O OD1 . ASP B 1 161 ? 22.452  2.487   40.121 1.00 36.59 ? 151 ASP B OD1 1 
ATOM   3021 O OD2 . ASP B 1 161 ? 20.860  2.600   38.640 1.00 35.66 ? 151 ASP B OD2 1 
ATOM   3022 N N   . GLY B 1 162 ? 21.693  4.245   43.930 1.00 30.94 ? 152 GLY B N   1 
ATOM   3023 C CA  . GLY B 1 162 ? 22.299  5.482   44.417 1.00 30.38 ? 152 GLY B CA  1 
ATOM   3024 C C   . GLY B 1 162 ? 21.368  6.638   44.620 1.00 30.10 ? 152 GLY B C   1 
ATOM   3025 O O   . GLY B 1 162 ? 21.825  7.749   44.971 1.00 29.97 ? 152 GLY B O   1 
ATOM   3026 N N   . GLY B 1 163 ? 20.073  6.417   44.380 1.00 27.44 ? 153 GLY B N   1 
ATOM   3027 C CA  . GLY B 1 163 ? 19.095  7.414   44.729 1.00 25.65 ? 153 GLY B CA  1 
ATOM   3028 C C   . GLY B 1 163 ? 18.020  6.843   45.639 1.00 24.73 ? 153 GLY B C   1 
ATOM   3029 O O   . GLY B 1 163 ? 18.218  5.790   46.273 1.00 23.38 ? 153 GLY B O   1 
ATOM   3030 N N   . LEU B 1 164 ? 16.891  7.539   45.695 1.00 23.80 ? 154 LEU B N   1 
ATOM   3031 C CA  . LEU B 1 164 ? 15.742  7.093   46.469 1.00 23.87 ? 154 LEU B CA  1 
ATOM   3032 C C   . LEU B 1 164 ? 14.555  6.902   45.524 1.00 22.88 ? 154 LEU B C   1 
ATOM   3033 O O   . LEU B 1 164 ? 14.316  7.756   44.646 1.00 23.42 ? 154 LEU B O   1 
ATOM   3034 C CB  . LEU B 1 164 ? 15.371  8.186   47.472 1.00 24.50 ? 154 LEU B CB  1 
ATOM   3035 C CG  . LEU B 1 164 ? 15.646  7.949   48.958 1.00 25.86 ? 154 LEU B CG  1 
ATOM   3036 C CD1 . LEU B 1 164 ? 16.965  7.310   49.253 1.00 27.23 ? 154 LEU B CD1 1 
ATOM   3037 C CD2 . LEU B 1 164 ? 15.286  9.023   49.942 1.00 25.18 ? 154 LEU B CD2 1 
ATOM   3038 N N   . GLU B 1 165 ? 13.787  5.827   45.704 1.00 21.35 ? 155 GLU B N   1 
ATOM   3039 C CA  . GLU B 1 165 ? 12.489  5.789   45.051 1.00 19.79 ? 155 GLU B CA  1 
ATOM   3040 C C   . GLU B 1 165 ? 11.421  6.068   46.090 1.00 18.93 ? 155 GLU B C   1 
ATOM   3041 O O   . GLU B 1 165 ? 11.577  5.660   47.242 1.00 20.41 ? 155 GLU B O   1 
ATOM   3042 C CB  . GLU B 1 165 ? 12.266  4.433   44.371 1.00 19.70 ? 155 GLU B CB  1 
ATOM   3043 C CG  . GLU B 1 165 ? 13.098  4.208   43.099 1.00 20.03 ? 155 GLU B CG  1 
ATOM   3044 C CD  . GLU B 1 165 ? 12.597  5.067   41.981 1.00 25.01 ? 155 GLU B CD  1 
ATOM   3045 O OE1 . GLU B 1 165 ? 11.390  4.986   41.667 1.00 22.28 ? 155 GLU B OE1 1 
ATOM   3046 O OE2 . GLU B 1 165 ? 13.408  5.868   41.448 1.00 23.31 ? 155 GLU B OE2 1 
ATOM   3047 N N   . GLY B 1 166 ? 10.340  6.746   45.708 1.00 18.66 ? 156 GLY B N   1 
ATOM   3048 C CA  . GLY B 1 166 ? 9.160   6.863   46.568 1.00 16.81 ? 156 GLY B CA  1 
ATOM   3049 C C   . GLY B 1 166 ? 7.906   6.292   45.876 1.00 17.82 ? 156 GLY B C   1 
ATOM   3050 O O   . GLY B 1 166 ? 7.801   6.371   44.636 1.00 17.32 ? 156 GLY B O   1 
ATOM   3051 N N   . ARG B 1 167 ? 6.958   5.744   46.662 1.00 16.56 ? 157 ARG B N   1 
ATOM   3052 C CA  . ARG B 1 167 ? 5.639   5.298   46.164 1.00 16.65 ? 157 ARG B CA  1 
ATOM   3053 C C   . ARG B 1 167 ? 4.511   5.732   47.098 1.00 16.82 ? 157 ARG B C   1 
ATOM   3054 O O   . ARG B 1 167 ? 4.633   5.620   48.308 1.00 16.96 ? 157 ARG B O   1 
ATOM   3055 C CB  . ARG B 1 167 ? 5.649   3.754   46.049 1.00 15.90 ? 157 ARG B CB  1 
ATOM   3056 C CG  . ARG B 1 167 ? 6.657   3.212   45.065 1.00 16.45 ? 157 ARG B CG  1 
ATOM   3057 C CD  . ARG B 1 167 ? 6.224   3.472   43.570 1.00 14.64 ? 157 ARG B CD  1 
ATOM   3058 N NE  . ARG B 1 167 ? 7.087   2.835   42.585 1.00 16.78 ? 157 ARG B NE  1 
ATOM   3059 C CZ  . ARG B 1 167 ? 8.271   3.268   42.180 1.00 19.46 ? 157 ARG B CZ  1 
ATOM   3060 N NH1 . ARG B 1 167 ? 8.774   4.406   42.641 1.00 16.12 ? 157 ARG B NH1 1 
ATOM   3061 N NH2 . ARG B 1 167 ? 8.941   2.567   41.274 1.00 20.06 ? 157 ARG B NH2 1 
ATOM   3062 N N   . SER B 1 168 ? 3.394   6.184   46.553 1.00 17.57 ? 158 SER B N   1 
ATOM   3063 C CA  . SER B 1 168 ? 2.285   6.633   47.343 1.00 19.14 ? 158 SER B CA  1 
ATOM   3064 C C   . SER B 1 168 ? 1.017   6.429   46.522 1.00 19.88 ? 158 SER B C   1 
ATOM   3065 O O   . SER B 1 168 ? 1.041   6.689   45.332 1.00 20.78 ? 158 SER B O   1 
ATOM   3066 C CB  . SER B 1 168 ? 2.454   8.153   47.623 1.00 19.67 ? 158 SER B CB  1 
ATOM   3067 O OG  . SER B 1 168 ? 1.531   8.604   48.582 1.00 27.58 ? 158 SER B OG  1 
ATOM   3068 N N   . ASP B 1 169 ? -0.073  5.940   47.125 1.00 18.27 ? 159 ASP B N   1 
ATOM   3069 C CA  . ASP B 1 169 ? -1.401  6.116   46.547 1.00 19.54 ? 159 ASP B CA  1 
ATOM   3070 C C   . ASP B 1 169 ? -1.997  7.353   47.212 1.00 19.67 ? 159 ASP B C   1 
ATOM   3071 O O   . ASP B 1 169 ? -1.932  7.486   48.452 1.00 21.63 ? 159 ASP B O   1 
ATOM   3072 C CB  . ASP B 1 169 ? -2.318  4.894   46.859 1.00 19.22 ? 159 ASP B CB  1 
ATOM   3073 C CG  . ASP B 1 169 ? -2.038  3.689   45.964 1.00 23.85 ? 159 ASP B CG  1 
ATOM   3074 O OD1 . ASP B 1 169 ? -2.437  3.686   44.787 1.00 31.97 ? 159 ASP B OD1 1 
ATOM   3075 O OD2 . ASP B 1 169 ? -1.435  2.712   46.439 1.00 28.48 ? 159 ASP B OD2 1 
ATOM   3076 N N   . MET B 1 170 ? -2.556  8.281   46.454 1.00 19.74 ? 160 MET B N   1 
ATOM   3077 C CA  . MET B 1 170 ? -3.263  9.379   47.070 1.00 19.50 ? 160 MET B CA  1 
ATOM   3078 C C   . MET B 1 170 ? -4.745  9.430   46.682 1.00 19.66 ? 160 MET B C   1 
ATOM   3079 O O   . MET B 1 170 ? -5.106  9.139   45.541 1.00 19.64 ? 160 MET B O   1 
ATOM   3080 C CB  . MET B 1 170 ? -2.564  10.711  46.764 1.00 19.41 ? 160 MET B CB  1 
ATOM   3081 C CG  . MET B 1 170 ? -1.077  10.773  47.231 1.00 20.18 ? 160 MET B CG  1 
ATOM   3082 S SD  . MET B 1 170 ? -0.409  12.444  46.853 1.00 24.77 ? 160 MET B SD  1 
ATOM   3083 C CE  . MET B 1 170 ? -1.466  13.442  47.884 1.00 23.98 ? 160 MET B CE  1 
ATOM   3084 N N   . ALA B 1 171 ? -5.569  9.900   47.608 1.00 20.43 ? 161 ALA B N   1 
ATOM   3085 C CA  . ALA B 1 171 ? -7.028  10.026  47.387 1.00 20.98 ? 161 ALA B CA  1 
ATOM   3086 C C   . ALA B 1 171 ? -7.507  11.481  47.225 1.00 22.57 ? 161 ALA B C   1 
ATOM   3087 O O   . ALA B 1 171 ? -7.486  12.266  48.177 1.00 22.88 ? 161 ALA B O   1 
ATOM   3088 C CB  . ALA B 1 171 ? -7.769  9.357   48.515 1.00 21.14 ? 161 ALA B CB  1 
ATOM   3089 N N   . LEU B 1 172 ? -7.950  11.813  46.019 1.00 22.52 ? 162 LEU B N   1 
ATOM   3090 C CA  . LEU B 1 172 ? -8.496  13.131  45.693 1.00 22.99 ? 162 LEU B CA  1 
ATOM   3091 C C   . LEU B 1 172 ? -9.971  13.163  46.060 1.00 24.05 ? 162 LEU B C   1 
ATOM   3092 O O   . LEU B 1 172 ? -10.749 12.354  45.541 1.00 25.12 ? 162 LEU B O   1 
ATOM   3093 C CB  . LEU B 1 172 ? -8.278  13.447  44.212 1.00 21.84 ? 162 LEU B CB  1 
ATOM   3094 C CG  . LEU B 1 172 ? -8.725  14.844  43.682 1.00 22.64 ? 162 LEU B CG  1 
ATOM   3095 C CD1 . LEU B 1 172 ? -8.158  16.023  44.545 1.00 21.00 ? 162 LEU B CD1 1 
ATOM   3096 C CD2 . LEU B 1 172 ? -8.364  15.004  42.221 1.00 22.01 ? 162 LEU B CD2 1 
ATOM   3097 N N   . LYS B 1 173 ? -10.345 14.061  46.981 1.00 23.93 ? 163 LYS B N   1 
ATOM   3098 C CA  . LYS B 1 173 ? -11.740 14.254  47.367 1.00 25.20 ? 163 LYS B CA  1 
ATOM   3099 C C   . LYS B 1 173 ? -12.537 14.836  46.236 1.00 24.76 ? 163 LYS B C   1 
ATOM   3100 O O   . LYS B 1 173 ? -12.054 15.726  45.544 1.00 23.61 ? 163 LYS B O   1 
ATOM   3101 C CB  . LYS B 1 173 ? -11.843 15.198  48.563 1.00 25.12 ? 163 LYS B CB  1 
ATOM   3102 C CG  . LYS B 1 173 ? -11.479 14.558  49.860 1.00 27.48 ? 163 LYS B CG  1 
ATOM   3103 C CD  . LYS B 1 173 ? -11.772 15.569  50.969 1.00 29.34 ? 163 LYS B CD  1 
ATOM   3104 C CE  . LYS B 1 173 ? -10.791 15.413  52.066 1.00 32.42 ? 163 LYS B CE  1 
ATOM   3105 N NZ  . LYS B 1 173 ? -10.818 16.635  52.956 1.00 36.00 ? 163 LYS B NZ  1 
ATOM   3106 N N   . LEU B 1 174 ? -13.779 14.365  46.062 1.00 24.90 ? 164 LEU B N   1 
ATOM   3107 C CA  . LEU B 1 174 ? -14.599 14.847  44.964 1.00 26.06 ? 164 LEU B CA  1 
ATOM   3108 C C   . LEU B 1 174 ? -15.890 15.520  45.437 1.00 27.24 ? 164 LEU B C   1 
ATOM   3109 O O   . LEU B 1 174 ? -16.389 15.233  46.506 1.00 27.49 ? 164 LEU B O   1 
ATOM   3110 C CB  . LEU B 1 174 ? -14.909 13.709  43.970 1.00 26.63 ? 164 LEU B CB  1 
ATOM   3111 C CG  . LEU B 1 174 ? -13.724 12.924  43.388 1.00 25.83 ? 164 LEU B CG  1 
ATOM   3112 C CD1 . LEU B 1 174 ? -14.261 11.780  42.516 1.00 26.27 ? 164 LEU B CD1 1 
ATOM   3113 C CD2 . LEU B 1 174 ? -12.767 13.814  42.558 1.00 23.06 ? 164 LEU B CD2 1 
ATOM   3114 N N   . VAL B 1 175 ? -16.377 16.459  44.653 1.00 29.66 ? 165 VAL B N   1 
ATOM   3115 C CA  . VAL B 1 175 ? -17.726 16.981  44.857 1.00 32.79 ? 165 VAL B CA  1 
ATOM   3116 C C   . VAL B 1 175 ? -18.703 15.785  44.842 1.00 33.54 ? 165 VAL B C   1 
ATOM   3117 O O   . VAL B 1 175 ? -18.661 14.953  43.906 1.00 33.74 ? 165 VAL B O   1 
ATOM   3118 C CB  . VAL B 1 175 ? -18.053 18.038  43.796 1.00 33.14 ? 165 VAL B CB  1 
ATOM   3119 C CG1 . VAL B 1 175 ? -19.520 18.447  43.869 1.00 34.22 ? 165 VAL B CG1 1 
ATOM   3120 C CG2 . VAL B 1 175 ? -17.124 19.264  43.984 1.00 34.20 ? 165 VAL B CG2 1 
ATOM   3121 N N   . GLY B 1 176 ? -19.507 15.673  45.910 1.00 33.74 ? 166 GLY B N   1 
ATOM   3122 C CA  . GLY B 1 176 ? -20.449 14.564  46.092 1.00 34.00 ? 166 GLY B CA  1 
ATOM   3123 C C   . GLY B 1 176 ? -20.009 13.534  47.108 1.00 33.94 ? 166 GLY B C   1 
ATOM   3124 O O   . GLY B 1 176 ? -20.773 12.638  47.458 1.00 35.16 ? 166 GLY B O   1 
ATOM   3125 N N   . GLY B 1 177 ? -18.770 13.634  47.580 1.00 33.56 ? 167 GLY B N   1 
ATOM   3126 C CA  . GLY B 1 177 ? -18.271 12.748  48.623 1.00 32.91 ? 167 GLY B CA  1 
ATOM   3127 C C   . GLY B 1 177 ? -17.376 11.595  48.175 1.00 32.27 ? 167 GLY B C   1 
ATOM   3128 O O   . GLY B 1 177 ? -16.750 10.924  49.009 1.00 32.67 ? 167 GLY B O   1 
ATOM   3129 N N   . GLY B 1 178 ? -17.290 11.361  46.871 1.00 30.88 ? 168 GLY B N   1 
ATOM   3130 C CA  . GLY B 1 178 ? -16.416 10.305  46.372 1.00 29.58 ? 168 GLY B CA  1 
ATOM   3131 C C   . GLY B 1 178 ? -14.927 10.661  46.409 1.00 28.17 ? 168 GLY B C   1 
ATOM   3132 O O   . GLY B 1 178 ? -14.537 11.722  46.934 1.00 27.51 ? 168 GLY B O   1 
ATOM   3133 N N   . HIS B 1 179 ? -14.095 9.763   45.870 1.00 26.09 ? 169 HIS B N   1 
ATOM   3134 C CA  . HIS B 1 179 ? -12.644 9.968   45.752 1.00 24.65 ? 169 HIS B CA  1 
ATOM   3135 C C   . HIS B 1 179 ? -12.195 9.491   44.376 1.00 25.02 ? 169 HIS B C   1 
ATOM   3136 O O   . HIS B 1 179 ? -12.762 8.516   43.822 1.00 24.61 ? 169 HIS B O   1 
ATOM   3137 C CB  . HIS B 1 179 ? -11.891 9.148   46.815 1.00 24.77 ? 169 HIS B CB  1 
ATOM   3138 C CG  . HIS B 1 179 ? -12.100 9.635   48.221 1.00 25.30 ? 169 HIS B CG  1 
ATOM   3139 N ND1 . HIS B 1 179 ? -13.140 9.201   49.026 1.00 21.72 ? 169 HIS B ND1 1 
ATOM   3140 C CD2 . HIS B 1 179 ? -11.389 10.514  48.966 1.00 23.99 ? 169 HIS B CD2 1 
ATOM   3141 C CE1 . HIS B 1 179 ? -13.052 9.791   50.208 1.00 26.62 ? 169 HIS B CE1 1 
ATOM   3142 N NE2 . HIS B 1 179 ? -12.010 10.613  50.187 1.00 25.50 ? 169 HIS B NE2 1 
ATOM   3143 N N   . LEU B 1 180 ? -11.156 10.120  43.853 1.00 23.53 ? 170 LEU B N   1 
ATOM   3144 C CA  . LEU B 1 180 ? -10.421 9.593   42.723 1.00 23.61 ? 170 LEU B CA  1 
ATOM   3145 C C   . LEU B 1 180 ? -8.998  9.287   43.188 1.00 23.23 ? 170 LEU B C   1 
ATOM   3146 O O   . LEU B 1 180 ? -8.343  10.147  43.774 1.00 23.31 ? 170 LEU B O   1 
ATOM   3147 C CB  . LEU B 1 180 ? -10.398 10.592  41.560 1.00 23.28 ? 170 LEU B CB  1 
ATOM   3148 C CG  . LEU B 1 180 ? -9.585  10.242  40.305 1.00 22.81 ? 170 LEU B CG  1 
ATOM   3149 C CD1 . LEU B 1 180 ? -10.062 8.949   39.597 1.00 23.07 ? 170 LEU B CD1 1 
ATOM   3150 C CD2 . LEU B 1 180 ? -9.642  11.405  39.314 1.00 24.96 ? 170 LEU B CD2 1 
ATOM   3151 N N   . ILE B 1 181 ? -8.541  8.067   42.968 1.00 21.27 ? 171 ILE B N   1 
ATOM   3152 C CA  . ILE B 1 181 ? -7.229  7.640   43.443 1.00 21.26 ? 171 ILE B CA  1 
ATOM   3153 C C   . ILE B 1 181 ? -6.177  7.840   42.359 1.00 20.13 ? 171 ILE B C   1 
ATOM   3154 O O   . ILE B 1 181 ? -6.465  7.690   41.158 1.00 20.09 ? 171 ILE B O   1 
ATOM   3155 C CB  . ILE B 1 181 ? -7.227  6.139   43.884 1.00 21.12 ? 171 ILE B CB  1 
ATOM   3156 C CG1 . ILE B 1 181 ? -8.205  5.865   45.025 1.00 21.91 ? 171 ILE B CG1 1 
ATOM   3157 C CG2 . ILE B 1 181 ? -5.844  5.679   44.317 1.00 20.07 ? 171 ILE B CG2 1 
ATOM   3158 C CD1 . ILE B 1 181 ? -8.339  6.897   46.060 1.00 21.37 ? 171 ILE B CD1 1 
ATOM   3159 N N   . CYS B 1 182 ? -4.946  8.187   42.775 1.00 19.84 ? 172 CYS B N   1 
ATOM   3160 C CA  . CYS B 1 182 ? -3.808  8.144   41.869 1.00 18.54 ? 172 CYS B CA  1 
ATOM   3161 C C   . CYS B 1 182 ? -2.580  7.492   42.526 1.00 18.51 ? 172 CYS B C   1 
ATOM   3162 O O   . CYS B 1 182 ? -2.481  7.420   43.751 1.00 18.94 ? 172 CYS B O   1 
ATOM   3163 C CB  . CYS B 1 182 ? -3.476  9.538   41.312 1.00 19.01 ? 172 CYS B CB  1 
ATOM   3164 S SG  . CYS B 1 182 ? -3.002  10.735  42.628 1.00 22.27 ? 172 CYS B SG  1 
ATOM   3165 N N   . ASN B 1 183 ? -1.646  6.989   41.723 1.00 17.64 ? 173 ASN B N   1 
ATOM   3166 C CA  . ASN B 1 183 ? -0.460  6.386   42.268 1.00 18.56 ? 173 ASN B CA  1 
ATOM   3167 C C   . ASN B 1 183 ? 0.733   7.185   41.802 1.00 18.16 ? 173 ASN B C   1 
ATOM   3168 O O   . ASN B 1 183 ? 0.807   7.537   40.613 1.00 17.86 ? 173 ASN B O   1 
ATOM   3169 C CB  . ASN B 1 183 ? -0.321  4.926   41.793 1.00 19.36 ? 173 ASN B CB  1 
ATOM   3170 C CG  . ASN B 1 183 ? 0.647   4.094   42.668 1.00 24.21 ? 173 ASN B CG  1 
ATOM   3171 O OD1 . ASN B 1 183 ? 1.415   3.244   42.147 1.00 34.35 ? 173 ASN B OD1 1 
ATOM   3172 N ND2 . ASN B 1 183 ? 0.594   4.289   43.979 1.00 26.78 ? 173 ASN B ND2 1 
ATOM   3173 N N   . LEU B 1 184 ? 1.661   7.466   42.741 1.00 18.45 ? 174 LEU B N   1 
ATOM   3174 C CA  . LEU B 1 184 ? 2.848   8.285   42.475 1.00 18.14 ? 174 LEU B CA  1 
ATOM   3175 C C   . LEU B 1 184 ? 4.078   7.414   42.447 1.00 16.98 ? 174 LEU B C   1 
ATOM   3176 O O   . LEU B 1 184 ? 4.275   6.651   43.379 1.00 17.09 ? 174 LEU B O   1 
ATOM   3177 C CB  . LEU B 1 184 ? 3.024   9.343   43.606 1.00 17.68 ? 174 LEU B CB  1 
ATOM   3178 C CG  . LEU B 1 184 ? 2.031   10.496  43.585 1.00 18.42 ? 174 LEU B CG  1 
ATOM   3179 C CD1 . LEU B 1 184 ? 0.591   10.102  43.910 1.00 18.04 ? 174 LEU B CD1 1 
ATOM   3180 C CD2 . LEU B 1 184 ? 2.513   11.561  44.571 1.00 19.57 ? 174 LEU B CD2 1 
ATOM   3181 N N   . LYS B 1 185 ? 4.938   7.562   41.434 1.00 16.84 ? 175 LYS B N   1 
ATOM   3182 C CA  . LYS B 1 185 ? 6.206   6.858   41.415 1.00 18.24 ? 175 LYS B CA  1 
ATOM   3183 C C   . LYS B 1 185 ? 7.250   7.972   41.294 1.00 18.02 ? 175 LYS B C   1 
ATOM   3184 O O   . LYS B 1 185 ? 7.234   8.699   40.305 1.00 17.05 ? 175 LYS B O   1 
ATOM   3185 C CB  . LYS B 1 185 ? 6.317   5.927   40.191 1.00 20.03 ? 175 LYS B CB  1 
ATOM   3186 C CG  . LYS B 1 185 ? 5.277   4.786   40.152 1.00 22.07 ? 175 LYS B CG  1 
ATOM   3187 C CD  . LYS B 1 185 ? 5.677   3.693   39.133 1.00 21.42 ? 175 LYS B CD  1 
ATOM   3188 C CE  . LYS B 1 185 ? 4.410   2.771   38.786 1.00 27.57 ? 175 LYS B CE  1 
ATOM   3189 N NZ  . LYS B 1 185 ? 4.401   1.950   37.422 1.00 28.06 ? 175 LYS B NZ  1 
ATOM   3190 N N   . THR B 1 186 ? 8.129   8.076   42.286 1.00 17.51 ? 176 THR B N   1 
ATOM   3191 C CA  . THR B 1 186 ? 9.027   9.251   42.362 1.00 16.99 ? 176 THR B CA  1 
ATOM   3192 C C   . THR B 1 186 ? 10.466  8.787   42.396 1.00 18.12 ? 176 THR B C   1 
ATOM   3193 O O   . THR B 1 186 ? 10.792  7.781   43.070 1.00 18.15 ? 176 THR B O   1 
ATOM   3194 C CB  . THR B 1 186 ? 8.709   10.222  43.582 1.00 16.84 ? 176 THR B CB  1 
ATOM   3195 O OG1 . THR B 1 186 ? 7.333   10.567  43.634 1.00 19.44 ? 176 THR B OG1 1 
ATOM   3196 C CG2 . THR B 1 186 ? 9.449   11.602  43.415 1.00 15.92 ? 176 THR B CG2 1 
ATOM   3197 N N   . THR B 1 187 ? 11.357  9.561   41.739 1.00 17.27 ? 177 THR B N   1 
ATOM   3198 C CA  . THR B 1 187 ? 12.774  9.242   41.765 1.00 18.16 ? 177 THR B CA  1 
ATOM   3199 C C   . THR B 1 187 ? 13.438  10.507  42.297 1.00 19.25 ? 177 THR B C   1 
ATOM   3200 O O   . THR B 1 187 ? 13.140  11.580  41.769 1.00 18.25 ? 177 THR B O   1 
ATOM   3201 C CB  . THR B 1 187 ? 13.274  8.949   40.313 1.00 18.91 ? 177 THR B CB  1 
ATOM   3202 O OG1 . THR B 1 187 ? 12.704  7.713   39.849 1.00 20.60 ? 177 THR B OG1 1 
ATOM   3203 C CG2 . THR B 1 187 ? 14.814  8.809   40.228 1.00 18.38 ? 177 THR B CG2 1 
ATOM   3204 N N   . TYR B 1 188 ? 14.219  10.352  43.375 1.00 19.21 ? 178 TYR B N   1 
ATOM   3205 C CA  . TYR B 1 188 ? 14.959  11.457  44.011 1.00 18.97 ? 178 TYR B CA  1 
ATOM   3206 C C   . TYR B 1 188 ? 16.430  11.224  43.782 1.00 19.66 ? 178 TYR B C   1 
ATOM   3207 O O   . TYR B 1 188 ? 16.945  10.138  44.070 1.00 19.72 ? 178 TYR B O   1 
ATOM   3208 C CB  . TYR B 1 188 ? 14.661  11.483  45.517 1.00 17.57 ? 178 TYR B CB  1 
ATOM   3209 C CG  . TYR B 1 188 ? 13.190  11.579  45.861 1.00 17.45 ? 178 TYR B CG  1 
ATOM   3210 C CD1 . TYR B 1 188 ? 12.531  12.786  45.808 1.00 16.47 ? 178 TYR B CD1 1 
ATOM   3211 C CD2 . TYR B 1 188 ? 12.439  10.440  46.231 1.00 16.97 ? 178 TYR B CD2 1 
ATOM   3212 C CE1 . TYR B 1 188 ? 11.177  12.909  46.135 1.00 15.49 ? 178 TYR B CE1 1 
ATOM   3213 C CE2 . TYR B 1 188 ? 11.086  10.568  46.551 1.00 15.71 ? 178 TYR B CE2 1 
ATOM   3214 C CZ  . TYR B 1 188 ? 10.459  11.766  46.503 1.00 16.33 ? 178 TYR B CZ  1 
ATOM   3215 O OH  . TYR B 1 188 ? 9.122   11.909  46.803 1.00 17.79 ? 178 TYR B OH  1 
ATOM   3216 N N   . ARG B 1 189 ? 17.145  12.229  43.255 1.00 19.20 ? 179 ARG B N   1 
ATOM   3217 C CA  . ARG B 1 189 ? 18.548  11.996  42.973 1.00 20.98 ? 179 ARG B CA  1 
ATOM   3218 C C   . ARG B 1 189 ? 19.278  13.157  43.622 1.00 21.35 ? 179 ARG B C   1 
ATOM   3219 O O   . ARG B 1 189 ? 18.780  14.259  43.605 1.00 21.96 ? 179 ARG B O   1 
ATOM   3220 C CB  . ARG B 1 189 ? 18.820  12.041  41.470 1.00 20.70 ? 179 ARG B CB  1 
ATOM   3221 C CG  . ARG B 1 189 ? 18.015  11.026  40.653 1.00 23.40 ? 179 ARG B CG  1 
ATOM   3222 C CD  . ARG B 1 189 ? 18.425  9.630   40.940 1.00 26.48 ? 179 ARG B CD  1 
ATOM   3223 N NE  . ARG B 1 189 ? 19.816  9.391   40.612 1.00 28.86 ? 179 ARG B NE  1 
ATOM   3224 C CZ  . ARG B 1 189 ? 20.390  8.204   40.677 1.00 31.70 ? 179 ARG B CZ  1 
ATOM   3225 N NH1 . ARG B 1 189 ? 19.664  7.137   41.006 1.00 33.84 ? 179 ARG B NH1 1 
ATOM   3226 N NH2 . ARG B 1 189 ? 21.675  8.072   40.375 1.00 35.45 ? 179 ARG B NH2 1 
ATOM   3227 N N   . SER B 1 190 ? 20.431  12.874  44.180 1.00 23.82 ? 180 SER B N   1 
ATOM   3228 C CA  . SER B 1 190 ? 21.211  13.901  44.852 1.00 25.03 ? 180 SER B CA  1 
ATOM   3229 C C   . SER B 1 190 ? 22.248  14.405  43.863 1.00 26.53 ? 180 SER B C   1 
ATOM   3230 O O   . SER B 1 190 ? 22.838  13.615  43.096 1.00 27.42 ? 180 SER B O   1 
ATOM   3231 C CB  . SER B 1 190 ? 21.906  13.273  46.037 1.00 25.59 ? 180 SER B CB  1 
ATOM   3232 O OG  . SER B 1 190 ? 22.695  14.229  46.698 1.00 25.07 ? 180 SER B OG  1 
ATOM   3233 N N   . LYS B 1 191 ? 22.484  15.713  43.909 1.00 28.09 ? 181 LYS B N   1 
ATOM   3234 C CA  . LYS B 1 191 ? 23.540  16.347  43.122 1.00 30.39 ? 181 LYS B CA  1 
ATOM   3235 C C   . LYS B 1 191 ? 24.840  16.429  43.922 1.00 31.59 ? 181 LYS B C   1 
ATOM   3236 O O   . LYS B 1 191 ? 25.851  16.919  43.420 1.00 30.75 ? 181 LYS B O   1 
ATOM   3237 C CB  . LYS B 1 191 ? 23.091  17.729  42.653 1.00 30.22 ? 181 LYS B CB  1 
ATOM   3238 C CG  . LYS B 1 191 ? 21.940  17.715  41.624 1.00 30.79 ? 181 LYS B CG  1 
ATOM   3239 C CD  . LYS B 1 191 ? 21.486  19.123  41.207 1.00 31.27 ? 181 LYS B CD  1 
ATOM   3240 C CE  . LYS B 1 191 ? 20.554  19.763  42.252 1.00 32.64 ? 181 LYS B CE  1 
ATOM   3241 N NZ  . LYS B 1 191 ? 20.578  21.263  42.295 1.00 30.19 ? 181 LYS B NZ  1 
ATOM   3242 N N   . LYS B 1 192 ? 24.816  15.938  45.160 1.00 33.81 ? 182 LYS B N   1 
ATOM   3243 C CA  . LYS B 1 192 ? 26.046  15.726  45.932 1.00 36.93 ? 182 LYS B CA  1 
ATOM   3244 C C   . LYS B 1 192 ? 26.670  14.345  45.634 1.00 38.65 ? 182 LYS B C   1 
ATOM   3245 O O   . LYS B 1 192 ? 25.957  13.362  45.490 1.00 39.39 ? 182 LYS B O   1 
ATOM   3246 C CB  . LYS B 1 192 ? 25.783  15.910  47.442 1.00 36.71 ? 182 LYS B CB  1 
ATOM   3247 C CG  . LYS B 1 192 ? 26.949  15.478  48.363 1.00 36.56 ? 182 LYS B CG  1 
ATOM   3248 C CD  . LYS B 1 192 ? 26.710  15.840  49.812 1.00 37.28 ? 182 LYS B CD  1 
ATOM   3249 C CE  . LYS B 1 192 ? 26.741  17.344  49.980 1.00 38.35 ? 182 LYS B CE  1 
ATOM   3250 N NZ  . LYS B 1 192 ? 26.508  17.783  51.385 1.00 40.61 ? 182 LYS B NZ  1 
ATOM   3251 N N   . PRO B 1 193 ? 28.008  14.279  45.498 1.00 40.50 ? 183 PRO B N   1 
ATOM   3252 C CA  . PRO B 1 193 ? 28.707  12.990  45.335 1.00 41.41 ? 183 PRO B CA  1 
ATOM   3253 C C   . PRO B 1 193 ? 28.317  11.934  46.369 1.00 42.41 ? 183 PRO B C   1 
ATOM   3254 O O   . PRO B 1 193 ? 28.138  12.246  47.557 1.00 42.62 ? 183 PRO B O   1 
ATOM   3255 C CB  . PRO B 1 193 ? 30.186  13.380  45.489 1.00 42.05 ? 183 PRO B CB  1 
ATOM   3256 C CG  . PRO B 1 193 ? 30.233  14.765  44.926 1.00 41.00 ? 183 PRO B CG  1 
ATOM   3257 C CD  . PRO B 1 193 ? 28.953  15.415  45.426 1.00 40.59 ? 183 PRO B CD  1 
ATOM   3258 N N   . ALA B 1 194 ? 28.198  10.694  45.903 1.00 42.96 ? 184 ALA B N   1 
ATOM   3259 C CA  . ALA B 1 194 ? 27.789  9.565   46.733 1.00 43.68 ? 184 ALA B CA  1 
ATOM   3260 C C   . ALA B 1 194 ? 28.588  9.478   48.028 1.00 44.31 ? 184 ALA B C   1 
ATOM   3261 O O   . ALA B 1 194 ? 28.019  9.315   49.109 1.00 44.34 ? 184 ALA B O   1 
ATOM   3262 C CB  . ALA B 1 194 ? 27.917  8.276   45.945 1.00 43.44 ? 184 ALA B CB  1 
ATOM   3263 N N   . LYS B 1 195 ? 29.908  9.618   47.910 1.00 45.31 ? 185 LYS B N   1 
ATOM   3264 C CA  . LYS B 1 195 ? 30.838  9.420   49.027 1.00 46.19 ? 185 LYS B CA  1 
ATOM   3265 C C   . LYS B 1 195 ? 30.465  10.253  50.248 1.00 45.70 ? 185 LYS B C   1 
ATOM   3266 O O   . LYS B 1 195 ? 30.858  9.937   51.364 1.00 46.90 ? 185 LYS B O   1 
ATOM   3267 C CB  . LYS B 1 195 ? 32.280  9.719   48.587 1.00 46.33 ? 185 LYS B CB  1 
ATOM   3268 C CG  . LYS B 1 195 ? 32.698  8.948   47.338 1.00 47.65 ? 185 LYS B CG  1 
ATOM   3269 C CD  . LYS B 1 195 ? 34.172  9.149   46.959 1.00 47.92 ? 185 LYS B CD  1 
ATOM   3270 C CE  . LYS B 1 195 ? 34.497  8.391   45.654 1.00 49.12 ? 185 LYS B CE  1 
ATOM   3271 N NZ  . LYS B 1 195 ? 35.813  8.772   45.037 1.00 51.42 ? 185 LYS B NZ  1 
ATOM   3272 N N   . ASN B 1 196 ? 29.698  11.310  50.037 1.00 44.51 ? 186 ASN B N   1 
ATOM   3273 C CA  . ASN B 1 196 ? 29.336  12.203  51.121 1.00 44.00 ? 186 ASN B CA  1 
ATOM   3274 C C   . ASN B 1 196 ? 27.901  12.000  51.640 1.00 43.18 ? 186 ASN B C   1 
ATOM   3275 O O   . ASN B 1 196 ? 27.374  12.853  52.355 1.00 43.57 ? 186 ASN B O   1 
ATOM   3276 C CB  . ASN B 1 196 ? 29.571  13.667  50.695 1.00 44.61 ? 186 ASN B CB  1 
ATOM   3277 C CG  . ASN B 1 196 ? 31.019  13.937  50.276 1.00 45.11 ? 186 ASN B CG  1 
ATOM   3278 O OD1 . ASN B 1 196 ? 31.957  13.810  51.073 1.00 46.26 ? 186 ASN B OD1 1 
ATOM   3279 N ND2 . ASN B 1 196 ? 31.200  14.306  49.014 1.00 46.52 ? 186 ASN B ND2 1 
ATOM   3280 N N   . LEU B 1 197 ? 27.278  10.872  51.289 1.00 42.15 ? 187 LEU B N   1 
ATOM   3281 C CA  . LEU B 1 197 ? 25.890  10.589  51.711 1.00 41.08 ? 187 LEU B CA  1 
ATOM   3282 C C   . LEU B 1 197 ? 25.771  9.298   52.493 1.00 40.52 ? 187 LEU B C   1 
ATOM   3283 O O   . LEU B 1 197 ? 26.288  8.251   52.072 1.00 40.58 ? 187 LEU B O   1 
ATOM   3284 C CB  . LEU B 1 197 ? 24.943  10.502  50.503 1.00 41.10 ? 187 LEU B CB  1 
ATOM   3285 C CG  . LEU B 1 197 ? 24.676  11.712  49.616 1.00 40.53 ? 187 LEU B CG  1 
ATOM   3286 C CD1 . LEU B 1 197 ? 23.977  11.203  48.344 1.00 39.88 ? 187 LEU B CD1 1 
ATOM   3287 C CD2 . LEU B 1 197 ? 23.857  12.769  50.350 1.00 40.22 ? 187 LEU B CD2 1 
ATOM   3288 N N   . LYS B 1 198 ? 25.109  9.376   53.640 1.00 39.28 ? 188 LYS B N   1 
ATOM   3289 C CA  . LYS B 1 198 ? 24.648  8.163   54.296 1.00 39.07 ? 188 LYS B CA  1 
ATOM   3290 C C   . LYS B 1 198 ? 23.223  7.875   53.824 1.00 37.57 ? 188 LYS B C   1 
ATOM   3291 O O   . LYS B 1 198 ? 22.289  8.643   54.073 1.00 37.39 ? 188 LYS B O   1 
ATOM   3292 C CB  . LYS B 1 198 ? 24.720  8.220   55.820 1.00 39.25 ? 188 LYS B CB  1 
ATOM   3293 C CG  . LYS B 1 198 ? 25.230  6.871   56.355 1.00 41.93 ? 188 LYS B CG  1 
ATOM   3294 C CD  . LYS B 1 198 ? 24.353  6.232   57.431 1.00 45.79 ? 188 LYS B CD  1 
ATOM   3295 C CE  . LYS B 1 198 ? 24.666  4.728   57.541 1.00 45.07 ? 188 LYS B CE  1 
ATOM   3296 N NZ  . LYS B 1 198 ? 23.900  4.051   58.631 1.00 46.69 ? 188 LYS B NZ  1 
ATOM   3297 N N   . MET B 1 199 ? 23.100  6.786   53.078 1.00 37.07 ? 189 MET B N   1 
ATOM   3298 C CA  . MET B 1 199 ? 21.820  6.359   52.536 1.00 35.99 ? 189 MET B CA  1 
ATOM   3299 C C   . MET B 1 199 ? 20.933  5.744   53.608 1.00 34.91 ? 189 MET B C   1 
ATOM   3300 O O   . MET B 1 199 ? 21.395  4.967   54.435 1.00 36.32 ? 189 MET B O   1 
ATOM   3301 C CB  . MET B 1 199 ? 22.032  5.360   51.392 1.00 36.22 ? 189 MET B CB  1 
ATOM   3302 C CG  . MET B 1 199 ? 22.738  5.927   50.191 1.00 36.15 ? 189 MET B CG  1 
ATOM   3303 S SD  . MET B 1 199 ? 21.837  7.301   49.437 1.00 37.22 ? 189 MET B SD  1 
ATOM   3304 C CE  . MET B 1 199 ? 20.483  6.380   48.643 1.00 37.13 ? 189 MET B CE  1 
ATOM   3305 N N   . PRO B 1 200 ? 19.645  6.102   53.603 1.00 33.42 ? 190 PRO B N   1 
ATOM   3306 C CA  . PRO B 1 200 ? 18.682  5.489   54.509 1.00 32.73 ? 190 PRO B CA  1 
ATOM   3307 C C   . PRO B 1 200 ? 18.342  4.079   53.983 1.00 31.59 ? 190 PRO B C   1 
ATOM   3308 O O   . PRO B 1 200 ? 18.758  3.711   52.882 1.00 32.82 ? 190 PRO B O   1 
ATOM   3309 C CB  . PRO B 1 200 ? 17.475  6.425   54.405 1.00 32.17 ? 190 PRO B CB  1 
ATOM   3310 C CG  . PRO B 1 200 ? 17.536  6.930   53.014 1.00 32.21 ? 190 PRO B CG  1 
ATOM   3311 C CD  . PRO B 1 200 ? 19.013  7.100   52.716 1.00 33.34 ? 190 PRO B CD  1 
ATOM   3312 N N   . GLY B 1 201 ? 17.660  3.279   54.781 1.00 31.03 ? 191 GLY B N   1 
ATOM   3313 C CA  . GLY B 1 201 ? 17.020  2.047   54.265 1.00 28.42 ? 191 GLY B CA  1 
ATOM   3314 C C   . GLY B 1 201 ? 15.545  2.397   54.029 1.00 27.02 ? 191 GLY B C   1 
ATOM   3315 O O   . GLY B 1 201 ? 15.218  3.569   53.888 1.00 26.32 ? 191 GLY B O   1 
ATOM   3316 N N   . VAL B 1 202 ? 14.638  1.405   54.015 1.00 23.96 ? 192 VAL B N   1 
ATOM   3317 C CA  . VAL B 1 202 ? 13.213  1.716   53.770 1.00 21.70 ? 192 VAL B CA  1 
ATOM   3318 C C   . VAL B 1 202 ? 12.588  2.545   54.876 1.00 21.00 ? 192 VAL B C   1 
ATOM   3319 O O   . VAL B 1 202 ? 12.744  2.237   56.074 1.00 22.12 ? 192 VAL B O   1 
ATOM   3320 C CB  . VAL B 1 202 ? 12.373  0.411   53.619 1.00 20.82 ? 192 VAL B CB  1 
ATOM   3321 C CG1 . VAL B 1 202 ? 10.897  0.744   53.411 1.00 19.06 ? 192 VAL B CG1 1 
ATOM   3322 C CG2 . VAL B 1 202 ? 12.909  -0.408  52.481 1.00 20.84 ? 192 VAL B CG2 1 
ATOM   3323 N N   . TYR B 1 203 ? 11.840  3.574   54.526 1.00 20.12 ? 193 TYR B N   1 
ATOM   3324 C CA  . TYR B 1 203 ? 11.164  4.265   55.554 1.00 20.47 ? 193 TYR B CA  1 
ATOM   3325 C C   . TYR B 1 203 ? 9.885   4.886   55.021 1.00 20.11 ? 193 TYR B C   1 
ATOM   3326 O O   . TYR B 1 203 ? 9.559   4.726   53.836 1.00 20.41 ? 193 TYR B O   1 
ATOM   3327 C CB  . TYR B 1 203 ? 12.116  5.261   56.243 1.00 21.61 ? 193 TYR B CB  1 
ATOM   3328 C CG  . TYR B 1 203 ? 12.491  6.480   55.406 1.00 21.30 ? 193 TYR B CG  1 
ATOM   3329 C CD1 . TYR B 1 203 ? 13.522  6.420   54.469 1.00 20.76 ? 193 TYR B CD1 1 
ATOM   3330 C CD2 . TYR B 1 203 ? 11.836  7.679   55.596 1.00 22.26 ? 193 TYR B CD2 1 
ATOM   3331 C CE1 . TYR B 1 203 ? 13.888  7.555   53.741 1.00 22.28 ? 193 TYR B CE1 1 
ATOM   3332 C CE2 . TYR B 1 203 ? 12.166  8.793   54.874 1.00 21.19 ? 193 TYR B CE2 1 
ATOM   3333 C CZ  . TYR B 1 203 ? 13.200  8.729   53.972 1.00 22.64 ? 193 TYR B CZ  1 
ATOM   3334 O OH  . TYR B 1 203 ? 13.522  9.902   53.293 1.00 23.20 ? 193 TYR B OH  1 
ATOM   3335 N N   . TYR B 1 204 ? 9.154   5.543   55.889 1.00 20.29 ? 194 TYR B N   1 
ATOM   3336 C CA  . TYR B 1 204 ? 7.825   6.059   55.547 1.00 21.66 ? 194 TYR B CA  1 
ATOM   3337 C C   . TYR B 1 204 ? 7.669   7.534   55.884 1.00 22.35 ? 194 TYR B C   1 
ATOM   3338 O O   . TYR B 1 204 ? 8.157   7.992   56.922 1.00 23.16 ? 194 TYR B O   1 
ATOM   3339 C CB  . TYR B 1 204 ? 6.733   5.206   56.228 1.00 20.73 ? 194 TYR B CB  1 
ATOM   3340 C CG  . TYR B 1 204 ? 6.974   3.749   55.957 1.00 20.40 ? 194 TYR B CG  1 
ATOM   3341 C CD1 . TYR B 1 204 ? 7.870   3.007   56.742 1.00 18.49 ? 194 TYR B CD1 1 
ATOM   3342 C CD2 . TYR B 1 204 ? 6.367   3.113   54.860 1.00 19.61 ? 194 TYR B CD2 1 
ATOM   3343 C CE1 . TYR B 1 204 ? 8.162   1.672   56.474 1.00 17.92 ? 194 TYR B CE1 1 
ATOM   3344 C CE2 . TYR B 1 204 ? 6.637   1.788   54.610 1.00 15.87 ? 194 TYR B CE2 1 
ATOM   3345 C CZ  . TYR B 1 204 ? 7.543   1.083   55.383 1.00 18.73 ? 194 TYR B CZ  1 
ATOM   3346 O OH  . TYR B 1 204 ? 7.787   -0.223  55.074 1.00 17.86 ? 194 TYR B OH  1 
ATOM   3347 N N   . VAL B 1 205 ? 6.953   8.269   55.032 1.00 22.11 ? 195 VAL B N   1 
ATOM   3348 C CA  . VAL B 1 205 ? 6.598   9.661   55.303 1.00 21.36 ? 195 VAL B CA  1 
ATOM   3349 C C   . VAL B 1 205 ? 5.098   9.812   55.315 1.00 22.50 ? 195 VAL B C   1 
ATOM   3350 O O   . VAL B 1 205 ? 4.411   9.532   54.310 1.00 22.82 ? 195 VAL B O   1 
ATOM   3351 C CB  . VAL B 1 205 ? 7.204   10.667  54.248 1.00 20.65 ? 195 VAL B CB  1 
ATOM   3352 C CG1 . VAL B 1 205 ? 6.765   12.062  54.550 1.00 19.38 ? 195 VAL B CG1 1 
ATOM   3353 C CG2 . VAL B 1 205 ? 8.685   10.583  54.242 1.00 20.16 ? 195 VAL B CG2 1 
ATOM   3354 N N   . ASP B 1 206 ? 4.571   10.246  56.456 1.00 22.42 ? 196 ASP B N   1 
ATOM   3355 C CA  . ASP B 1 206 ? 3.141   10.591  56.598 1.00 22.93 ? 196 ASP B CA  1 
ATOM   3356 C C   . ASP B 1 206 ? 2.958   12.069  56.408 1.00 24.51 ? 196 ASP B C   1 
ATOM   3357 O O   . ASP B 1 206 ? 3.684   12.865  57.026 1.00 24.35 ? 196 ASP B O   1 
ATOM   3358 C CB  . ASP B 1 206 ? 2.631   10.251  58.004 1.00 23.66 ? 196 ASP B CB  1 
ATOM   3359 C CG  . ASP B 1 206 ? 2.806   8.774   58.355 1.00 25.48 ? 196 ASP B CG  1 
ATOM   3360 O OD1 . ASP B 1 206 ? 2.771   7.964   57.415 1.00 26.39 ? 196 ASP B OD1 1 
ATOM   3361 O OD2 . ASP B 1 206 ? 2.992   8.423   59.549 1.00 26.49 ? 196 ASP B OD2 1 
ATOM   3362 N N   . ARG B 1 207 ? 1.938   12.449  55.652 1.00 24.62 ? 197 ARG B N   1 
ATOM   3363 C CA  . ARG B 1 207 ? 1.737   13.862  55.347 1.00 25.86 ? 197 ARG B CA  1 
ATOM   3364 C C   . ARG B 1 207 ? 0.304   14.306  55.137 1.00 26.57 ? 197 ARG B C   1 
ATOM   3365 O O   . ARG B 1 207 ? -0.559  13.519  54.761 1.00 25.62 ? 197 ARG B O   1 
ATOM   3366 C CB  . ARG B 1 207 ? 2.627   14.282  54.169 1.00 27.40 ? 197 ARG B CB  1 
ATOM   3367 C CG  . ARG B 1 207 ? 2.178   13.758  52.879 1.00 29.97 ? 197 ARG B CG  1 
ATOM   3368 C CD  . ARG B 1 207 ? 2.923   14.417  51.780 1.00 35.37 ? 197 ARG B CD  1 
ATOM   3369 N NE  . ARG B 1 207 ? 4.175   13.727  51.518 1.00 39.74 ? 197 ARG B NE  1 
ATOM   3370 C CZ  . ARG B 1 207 ? 4.281   12.415  51.326 1.00 40.17 ? 197 ARG B CZ  1 
ATOM   3371 N NH1 . ARG B 1 207 ? 3.203   11.604  51.406 1.00 36.18 ? 197 ARG B NH1 1 
ATOM   3372 N NH2 . ARG B 1 207 ? 5.478   11.926  51.062 1.00 39.36 ? 197 ARG B NH2 1 
ATOM   3373 N N   . ARG B 1 208 ? 0.059   15.581  55.409 1.00 27.20 ? 198 ARG B N   1 
ATOM   3374 C CA  . ARG B 1 208 ? -1.173  16.235  55.071 1.00 29.04 ? 198 ARG B CA  1 
ATOM   3375 C C   . ARG B 1 208 ? -0.750  17.397  54.218 1.00 30.61 ? 198 ARG B C   1 
ATOM   3376 O O   . ARG B 1 208 ? 0.222   18.085  54.536 1.00 30.84 ? 198 ARG B O   1 
ATOM   3377 C CB  . ARG B 1 208 ? -1.895  16.837  56.275 1.00 28.90 ? 198 ARG B CB  1 
ATOM   3378 C CG  . ARG B 1 208 ? -2.470  15.928  57.295 1.00 30.64 ? 198 ARG B CG  1 
ATOM   3379 C CD  . ARG B 1 208 ? -3.408  16.786  58.157 1.00 29.06 ? 198 ARG B CD  1 
ATOM   3380 N NE  . ARG B 1 208 ? -3.853  16.067  59.328 1.00 32.40 ? 198 ARG B NE  1 
ATOM   3381 C CZ  . ARG B 1 208 ? -4.871  15.210  59.344 1.00 32.41 ? 198 ARG B CZ  1 
ATOM   3382 N NH1 . ARG B 1 208 ? -5.579  14.982  58.248 1.00 32.34 ? 198 ARG B NH1 1 
ATOM   3383 N NH2 . ARG B 1 208 ? -5.177  14.593  60.476 1.00 36.22 ? 198 ARG B NH2 1 
ATOM   3384 N N   . LEU B 1 209 ? -1.499  17.603  53.149 1.00 32.26 ? 199 LEU B N   1 
ATOM   3385 C CA  . LEU B 1 209 ? -1.256  18.642  52.190 1.00 33.51 ? 199 LEU B CA  1 
ATOM   3386 C C   . LEU B 1 209 ? -2.588  19.342  52.042 1.00 34.48 ? 199 LEU B C   1 
ATOM   3387 O O   . LEU B 1 209 ? -3.587  18.744  51.615 1.00 34.58 ? 199 LEU B O   1 
ATOM   3388 C CB  . LEU B 1 209 ? -0.769  18.055  50.866 1.00 33.50 ? 199 LEU B CB  1 
ATOM   3389 C CG  . LEU B 1 209 ? -0.449  18.952  49.651 1.00 34.13 ? 199 LEU B CG  1 
ATOM   3390 C CD1 . LEU B 1 209 ? 0.627   19.953  49.943 1.00 35.39 ? 199 LEU B CD1 1 
ATOM   3391 C CD2 . LEU B 1 209 ? -0.038  18.078  48.480 1.00 34.83 ? 199 LEU B CD2 1 
ATOM   3392 N N   . GLU B 1 210 ? -2.617  20.611  52.441 1.00 35.15 ? 200 GLU B N   1 
ATOM   3393 C CA  . GLU B 1 210 ? -3.872  21.329  52.555 1.00 35.69 ? 200 GLU B CA  1 
ATOM   3394 C C   . GLU B 1 210 ? -3.897  22.655  51.812 1.00 36.48 ? 200 GLU B C   1 
ATOM   3395 O O   . GLU B 1 210 ? -2.928  23.428  51.832 1.00 35.31 ? 200 GLU B O   1 
ATOM   3396 C CB  . GLU B 1 210 ? -4.223  21.528  54.031 1.00 36.16 ? 200 GLU B CB  1 
ATOM   3397 C CG  . GLU B 1 210 ? -4.349  20.209  54.729 1.00 37.80 ? 200 GLU B CG  1 
ATOM   3398 C CD  . GLU B 1 210 ? -4.664  20.304  56.187 1.00 41.33 ? 200 GLU B CD  1 
ATOM   3399 O OE1 . GLU B 1 210 ? -4.128  21.202  56.878 1.00 43.31 ? 200 GLU B OE1 1 
ATOM   3400 O OE2 . GLU B 1 210 ? -5.438  19.441  56.642 1.00 44.47 ? 200 GLU B OE2 1 
ATOM   3401 N N   . ARG B 1 211 ? -5.013  22.882  51.136 1.00 36.27 ? 201 ARG B N   1 
ATOM   3402 C CA  . ARG B 1 211 ? -5.329  24.169  50.586 1.00 37.66 ? 201 ARG B CA  1 
ATOM   3403 C C   . ARG B 1 211 ? -5.869  24.997  51.754 1.00 37.68 ? 201 ARG B C   1 
ATOM   3404 O O   . ARG B 1 211 ? -6.933  24.678  52.312 1.00 36.98 ? 201 ARG B O   1 
ATOM   3405 C CB  . ARG B 1 211 ? -6.365  23.992  49.476 1.00 37.93 ? 201 ARG B CB  1 
ATOM   3406 C CG  . ARG B 1 211 ? -7.194  25.188  49.124 1.00 41.04 ? 201 ARG B CG  1 
ATOM   3407 C CD  . ARG B 1 211 ? -6.710  25.837  47.867 1.00 45.85 ? 201 ARG B CD  1 
ATOM   3408 N NE  . ARG B 1 211 ? -6.881  25.006  46.674 1.00 49.49 ? 201 ARG B NE  1 
ATOM   3409 C CZ  . ARG B 1 211 ? -7.921  25.042  45.838 1.00 50.16 ? 201 ARG B CZ  1 
ATOM   3410 N NH1 . ARG B 1 211 ? -8.956  25.846  46.048 1.00 52.73 ? 201 ARG B NH1 1 
ATOM   3411 N NH2 . ARG B 1 211 ? -7.926  24.255  44.778 1.00 49.29 ? 201 ARG B NH2 1 
ATOM   3412 N N   . ILE B 1 212 ? -5.110  26.030  52.143 1.00 37.80 ? 202 ILE B N   1 
ATOM   3413 C CA  . ILE B 1 212 ? -5.535  26.949  53.208 1.00 37.62 ? 202 ILE B CA  1 
ATOM   3414 C C   . ILE B 1 212 ? -6.619  27.879  52.688 1.00 38.26 ? 202 ILE B C   1 
ATOM   3415 O O   . ILE B 1 212 ? -7.630  28.094  53.351 1.00 38.54 ? 202 ILE B O   1 
ATOM   3416 C CB  . ILE B 1 212 ? -4.366  27.816  53.788 1.00 37.83 ? 202 ILE B CB  1 
ATOM   3417 C CG1 . ILE B 1 212 ? -3.229  26.949  54.348 1.00 36.86 ? 202 ILE B CG1 1 
ATOM   3418 C CG2 . ILE B 1 212 ? -4.892  28.782  54.857 1.00 37.54 ? 202 ILE B CG2 1 
ATOM   3419 C CD1 . ILE B 1 212 ? -3.649  25.810  55.258 1.00 36.18 ? 202 ILE B CD1 1 
ATOM   3420 N N   . LYS B 1 213 ? -6.390  28.447  51.513 1.00 38.73 ? 203 LYS B N   1 
ATOM   3421 C CA  . LYS B 1 213 ? -7.363  29.312  50.882 1.00 39.39 ? 203 LYS B CA  1 
ATOM   3422 C C   . LYS B 1 213 ? -6.969  29.639  49.432 1.00 39.40 ? 203 LYS B C   1 
ATOM   3423 O O   . LYS B 1 213 ? -5.820  29.399  49.012 1.00 38.18 ? 203 LYS B O   1 
ATOM   3424 C CB  . LYS B 1 213 ? -7.573  30.591  51.706 1.00 40.03 ? 203 LYS B CB  1 
ATOM   3425 C CG  . LYS B 1 213 ? -6.362  31.497  51.810 1.00 41.96 ? 203 LYS B CG  1 
ATOM   3426 C CD  . LYS B 1 213 ? -6.808  32.954  51.797 1.00 46.66 ? 203 LYS B CD  1 
ATOM   3427 C CE  . LYS B 1 213 ? -5.653  33.891  51.531 1.00 46.19 ? 203 LYS B CE  1 
ATOM   3428 N NZ  . LYS B 1 213 ? -4.983  34.282  52.802 1.00 48.49 ? 203 LYS B NZ  1 
ATOM   3429 N N   . GLU B 1 214 ? -7.940  30.167  48.681 1.00 39.56 ? 204 GLU B N   1 
ATOM   3430 C CA  . GLU B 1 214 ? -7.739  30.569  47.288 1.00 40.14 ? 204 GLU B CA  1 
ATOM   3431 C C   . GLU B 1 214 ? -8.612  31.774  46.947 1.00 40.50 ? 204 GLU B C   1 
ATOM   3432 O O   . GLU B 1 214 ? -9.676  31.966  47.547 1.00 40.70 ? 204 GLU B O   1 
ATOM   3433 C CB  . GLU B 1 214 ? -8.024  29.413  46.307 1.00 39.86 ? 204 GLU B CB  1 
ATOM   3434 C CG  . GLU B 1 214 ? -9.487  28.974  46.207 1.00 41.66 ? 204 GLU B CG  1 
ATOM   3435 C CD  . GLU B 1 214 ? -10.354 29.867  45.302 1.00 42.51 ? 204 GLU B CD  1 
ATOM   3436 O OE1 . GLU B 1 214 ? -9.911  30.274  44.205 1.00 41.94 ? 204 GLU B OE1 1 
ATOM   3437 O OE2 . GLU B 1 214 ? -11.496 30.165  45.699 1.00 45.02 ? 204 GLU B OE2 1 
ATOM   3438 N N   . ALA B 1 215 ? -8.156  32.560  45.974 1.00 40.93 ? 205 ALA B N   1 
ATOM   3439 C CA  . ALA B 1 215 ? -8.897  33.698  45.450 1.00 41.28 ? 205 ALA B CA  1 
ATOM   3440 C C   . ALA B 1 215 ? -8.829  33.675  43.935 1.00 42.05 ? 205 ALA B C   1 
ATOM   3441 O O   . ALA B 1 215 ? -7.863  33.139  43.346 1.00 42.49 ? 205 ALA B O   1 
ATOM   3442 C CB  . ALA B 1 215 ? -8.318  35.004  45.972 1.00 41.07 ? 205 ALA B CB  1 
ATOM   3443 N N   . ASP B 1 216 ? -9.864  34.232  43.305 1.00 42.14 ? 206 ASP B N   1 
ATOM   3444 C CA  . ASP B 1 216 ? -9.869  34.477  41.857 1.00 42.93 ? 206 ASP B CA  1 
ATOM   3445 C C   . ASP B 1 216 ? -9.714  33.194  41.024 1.00 42.19 ? 206 ASP B C   1 
ATOM   3446 O O   . ASP B 1 216 ? -8.891  33.120  40.099 1.00 41.04 ? 206 ASP B O   1 
ATOM   3447 C CB  . ASP B 1 216 ? -8.817  35.541  41.506 1.00 43.26 ? 206 ASP B CB  1 
ATOM   3448 C CG  . ASP B 1 216 ? -9.043  36.858  42.275 1.00 47.15 ? 206 ASP B CG  1 
ATOM   3449 O OD1 . ASP B 1 216 ? -10.219 37.288  42.359 1.00 49.78 ? 206 ASP B OD1 1 
ATOM   3450 O OD2 . ASP B 1 216 ? -8.066  37.456  42.801 1.00 50.40 ? 206 ASP B OD2 1 
ATOM   3451 N N   . LYS B 1 217 ? -10.530 32.192  41.367 1.00 42.43 ? 207 LYS B N   1 
ATOM   3452 C CA  . LYS B 1 217 ? -10.536 30.911  40.649 1.00 42.16 ? 207 LYS B CA  1 
ATOM   3453 C C   . LYS B 1 217 ? -9.124  30.308  40.623 1.00 41.63 ? 207 LYS B C   1 
ATOM   3454 O O   . LYS B 1 217 ? -8.572  30.012  39.559 1.00 41.46 ? 207 LYS B O   1 
ATOM   3455 C CB  . LYS B 1 217 ? -11.103 31.090  39.233 1.00 42.69 ? 207 LYS B CB  1 
ATOM   3456 C CG  . LYS B 1 217 ? -12.624 31.330  39.187 1.00 44.06 ? 207 LYS B CG  1 
ATOM   3457 C CD  . LYS B 1 217 ? -13.413 30.007  39.380 1.00 46.98 ? 207 LYS B CD  1 
ATOM   3458 C CE  . LYS B 1 217 ? -14.849 30.242  39.895 1.00 48.93 ? 207 LYS B CE  1 
ATOM   3459 N NZ  . LYS B 1 217 ? -15.633 31.203  39.055 1.00 49.71 ? 207 LYS B NZ  1 
ATOM   3460 N N   . GLU B 1 218 ? -8.550  30.169  41.818 1.00 40.96 ? 208 GLU B N   1 
ATOM   3461 C CA  . GLU B 1 218 ? -7.219  29.589  42.036 1.00 40.36 ? 208 GLU B CA  1 
ATOM   3462 C C   . GLU B 1 218 ? -6.078  30.280  41.282 1.00 40.39 ? 208 GLU B C   1 
ATOM   3463 O O   . GLU B 1 218 ? -5.051  29.644  40.985 1.00 39.72 ? 208 GLU B O   1 
ATOM   3464 C CB  . GLU B 1 218 ? -7.224  28.081  41.758 1.00 40.28 ? 208 GLU B CB  1 
ATOM   3465 C CG  . GLU B 1 218 ? -8.173  27.292  42.671 1.00 40.97 ? 208 GLU B CG  1 
ATOM   3466 C CD  . GLU B 1 218 ? -9.637  27.476  42.306 1.00 43.15 ? 208 GLU B CD  1 
ATOM   3467 O OE1 . GLU B 1 218 ? -9.957  27.601  41.100 1.00 45.85 ? 208 GLU B OE1 1 
ATOM   3468 O OE2 . GLU B 1 218 ? -10.481 27.495  43.221 1.00 44.65 ? 208 GLU B OE2 1 
ATOM   3469 N N   . THR B 1 219 ? -6.242  31.575  40.976 1.00 40.13 ? 209 THR B N   1 
ATOM   3470 C CA  . THR B 1 219 ? -5.094  32.395  40.505 1.00 39.68 ? 209 THR B CA  1 
ATOM   3471 C C   . THR B 1 219 ? -4.099  32.621  41.663 1.00 39.08 ? 209 THR B C   1 
ATOM   3472 O O   . THR B 1 219 ? -2.888  32.740  41.454 1.00 38.40 ? 209 THR B O   1 
ATOM   3473 C CB  . THR B 1 219 ? -5.533  33.772  39.853 1.00 40.29 ? 209 THR B CB  1 
ATOM   3474 O OG1 . THR B 1 219 ? -6.382  33.542  38.719 1.00 40.44 ? 209 THR B OG1 1 
ATOM   3475 C CG2 . THR B 1 219 ? -4.331  34.563  39.377 1.00 39.92 ? 209 THR B CG2 1 
ATOM   3476 N N   . TYR B 1 220 ? -4.639  32.693  42.878 1.00 39.27 ? 210 TYR B N   1 
ATOM   3477 C CA  . TYR B 1 220 ? -3.852  32.806  44.109 1.00 38.88 ? 210 TYR B CA  1 
ATOM   3478 C C   . TYR B 1 220 ? -4.213  31.641  45.026 1.00 37.57 ? 210 TYR B C   1 
ATOM   3479 O O   . TYR B 1 220 ? -5.397  31.432  45.351 1.00 37.46 ? 210 TYR B O   1 
ATOM   3480 C CB  . TYR B 1 220 ? -4.103  34.151  44.828 1.00 40.79 ? 210 TYR B CB  1 
ATOM   3481 C CG  . TYR B 1 220 ? -3.980  35.367  43.936 1.00 43.44 ? 210 TYR B CG  1 
ATOM   3482 C CD1 . TYR B 1 220 ? -2.732  35.941  43.673 1.00 46.91 ? 210 TYR B CD1 1 
ATOM   3483 C CD2 . TYR B 1 220 ? -5.108  35.941  43.341 1.00 45.26 ? 210 TYR B CD2 1 
ATOM   3484 C CE1 . TYR B 1 220 ? -2.606  37.074  42.841 1.00 46.78 ? 210 TYR B CE1 1 
ATOM   3485 C CE2 . TYR B 1 220 ? -4.997  37.065  42.509 1.00 46.74 ? 210 TYR B CE2 1 
ATOM   3486 C CZ  . TYR B 1 220 ? -3.744  37.621  42.264 1.00 45.94 ? 210 TYR B CZ  1 
ATOM   3487 O OH  . TYR B 1 220 ? -3.636  38.719  41.441 1.00 46.87 ? 210 TYR B OH  1 
ATOM   3488 N N   . VAL B 1 221 ? -3.198  30.878  45.424 1.00 34.99 ? 211 VAL B N   1 
ATOM   3489 C CA  . VAL B 1 221 ? -3.408  29.731  46.300 1.00 33.16 ? 211 VAL B CA  1 
ATOM   3490 C C   . VAL B 1 221 ? -2.414  29.696  47.456 1.00 32.65 ? 211 VAL B C   1 
ATOM   3491 O O   . VAL B 1 221 ? -1.185  29.772  47.265 1.00 32.88 ? 211 VAL B O   1 
ATOM   3492 C CB  . VAL B 1 221 ? -3.354  28.347  45.532 1.00 32.48 ? 211 VAL B CB  1 
ATOM   3493 C CG1 . VAL B 1 221 ? -3.491  27.221  46.512 1.00 30.85 ? 211 VAL B CG1 1 
ATOM   3494 C CG2 . VAL B 1 221 ? -4.455  28.217  44.466 1.00 32.25 ? 211 VAL B CG2 1 
ATOM   3495 N N   . GLU B 1 222 ? -2.953  29.552  48.656 1.00 32.27 ? 212 GLU B N   1 
ATOM   3496 C CA  . GLU B 1 222 ? -2.141  29.260  49.828 1.00 32.79 ? 212 GLU B CA  1 
ATOM   3497 C C   . GLU B 1 222 ? -2.175  27.772  50.175 1.00 31.30 ? 212 GLU B C   1 
ATOM   3498 O O   . GLU B 1 222 ? -3.216  27.233  50.513 1.00 31.47 ? 212 GLU B O   1 
ATOM   3499 C CB  . GLU B 1 222 ? -2.625  30.082  51.026 1.00 33.03 ? 212 GLU B CB  1 
ATOM   3500 C CG  . GLU B 1 222 ? -1.636  30.048  52.192 1.00 35.34 ? 212 GLU B CG  1 
ATOM   3501 C CD  . GLU B 1 222 ? -2.105  30.850  53.405 1.00 35.19 ? 212 GLU B CD  1 
ATOM   3502 O OE1 . GLU B 1 222 ? -3.210  31.422  53.355 1.00 42.06 ? 212 GLU B OE1 1 
ATOM   3503 O OE2 . GLU B 1 222 ? -1.370  30.889  54.403 1.00 41.15 ? 212 GLU B OE2 1 
ATOM   3504 N N   . GLN B 1 223 ? -1.019  27.125  50.138 1.00 30.43 ? 213 GLN B N   1 
ATOM   3505 C CA  . GLN B 1 223 ? -0.955  25.697  50.398 1.00 29.45 ? 213 GLN B CA  1 
ATOM   3506 C C   . GLN B 1 223 ? -0.025  25.439  51.592 1.00 29.41 ? 213 GLN B C   1 
ATOM   3507 O O   . GLN B 1 223 ? 1.021   26.070  51.718 1.00 28.29 ? 213 GLN B O   1 
ATOM   3508 C CB  . GLN B 1 223 ? -0.462  25.032  49.110 1.00 29.63 ? 213 GLN B CB  1 
ATOM   3509 C CG  . GLN B 1 223 ? -0.341  23.535  49.087 1.00 28.92 ? 213 GLN B CG  1 
ATOM   3510 C CD  . GLN B 1 223 ? 0.037   23.066  47.698 1.00 28.82 ? 213 GLN B CD  1 
ATOM   3511 O OE1 . GLN B 1 223 ? -0.756  23.165  46.764 1.00 31.06 ? 213 GLN B OE1 1 
ATOM   3512 N NE2 . GLN B 1 223 ? 1.262   22.583  47.550 1.00 29.54 ? 213 GLN B NE2 1 
ATOM   3513 N N   . HIS B 1 224 ? -0.389  24.482  52.444 1.00 28.40 ? 214 HIS B N   1 
ATOM   3514 C CA  . HIS B 1 224 ? 0.379   24.127  53.624 1.00 29.03 ? 214 HIS B CA  1 
ATOM   3515 C C   . HIS B 1 224 ? 0.601   22.627  53.610 1.00 29.98 ? 214 HIS B C   1 
ATOM   3516 O O   . HIS B 1 224 ? -0.280  21.904  53.150 1.00 29.81 ? 214 HIS B O   1 
ATOM   3517 C CB  . HIS B 1 224 ? -0.388  24.536  54.897 1.00 29.63 ? 214 HIS B CB  1 
ATOM   3518 C CG  . HIS B 1 224 ? 0.282   24.128  56.183 1.00 31.51 ? 214 HIS B CG  1 
ATOM   3519 N ND1 . HIS B 1 224 ? -0.174  23.088  56.967 1.00 35.18 ? 214 HIS B ND1 1 
ATOM   3520 C CD2 . HIS B 1 224 ? 1.372   24.626  56.821 1.00 33.32 ? 214 HIS B CD2 1 
ATOM   3521 C CE1 . HIS B 1 224 ? 0.610   22.958  58.022 1.00 34.20 ? 214 HIS B CE1 1 
ATOM   3522 N NE2 . HIS B 1 224 ? 1.553   23.879  57.960 1.00 35.09 ? 214 HIS B NE2 1 
ATOM   3523 N N   . GLU B 1 225 ? 1.761   22.179  54.096 1.00 30.01 ? 215 GLU B N   1 
ATOM   3524 C CA  . GLU B 1 225 ? 2.065   20.754  54.302 1.00 30.22 ? 215 GLU B CA  1 
ATOM   3525 C C   . GLU B 1 225 ? 2.726   20.517  55.682 1.00 29.46 ? 215 GLU B C   1 
ATOM   3526 O O   . GLU B 1 225 ? 3.511   21.332  56.154 1.00 27.96 ? 215 GLU B O   1 
ATOM   3527 C CB  . GLU B 1 225 ? 2.978   20.201  53.188 1.00 31.06 ? 215 GLU B CB  1 
ATOM   3528 C CG  . GLU B 1 225 ? 3.295   18.680  53.303 1.00 31.82 ? 215 GLU B CG  1 
ATOM   3529 C CD  . GLU B 1 225 ? 4.321   18.160  52.298 1.00 33.56 ? 215 GLU B CD  1 
ATOM   3530 O OE1 . GLU B 1 225 ? 4.787   18.931  51.442 1.00 37.93 ? 215 GLU B OE1 1 
ATOM   3531 O OE2 . GLU B 1 225 ? 4.667   16.968  52.363 1.00 38.07 ? 215 GLU B OE2 1 
ATOM   3532 N N   . VAL B 1 226 ? 2.355   19.418  56.328 1.00 27.55 ? 216 VAL B N   1 
ATOM   3533 C CA  . VAL B 1 226 ? 3.079   18.862  57.454 1.00 26.99 ? 216 VAL B CA  1 
ATOM   3534 C C   . VAL B 1 226 ? 3.443   17.456  57.044 1.00 26.56 ? 216 VAL B C   1 
ATOM   3535 O O   . VAL B 1 226 ? 2.594   16.745  56.503 1.00 26.89 ? 216 VAL B O   1 
ATOM   3536 C CB  . VAL B 1 226 ? 2.286   18.882  58.812 1.00 27.57 ? 216 VAL B CB  1 
ATOM   3537 C CG1 . VAL B 1 226 ? 0.848   18.274  58.673 1.00 26.46 ? 216 VAL B CG1 1 
ATOM   3538 C CG2 . VAL B 1 226 ? 3.058   18.126  59.884 1.00 26.25 ? 216 VAL B CG2 1 
ATOM   3539 N N   . ALA B 1 227 ? 4.710   17.107  57.248 1.00 24.98 ? 217 ALA B N   1 
ATOM   3540 C CA  . ALA B 1 227 ? 5.296   15.848  56.865 1.00 24.07 ? 217 ALA B CA  1 
ATOM   3541 C C   . ALA B 1 227 ? 6.253   15.327  57.907 1.00 24.49 ? 217 ALA B C   1 
ATOM   3542 O O   . ALA B 1 227 ? 7.168   16.039  58.354 1.00 25.79 ? 217 ALA B O   1 
ATOM   3543 C CB  . ALA B 1 227 ? 6.001   15.956  55.506 1.00 22.68 ? 217 ALA B CB  1 
ATOM   3544 N N   . VAL B 1 228 ? 6.101   14.052  58.250 1.00 23.55 ? 218 VAL B N   1 
ATOM   3545 C CA  . VAL B 1 228 ? 6.946   13.414  59.247 1.00 24.08 ? 218 VAL B CA  1 
ATOM   3546 C C   . VAL B 1 228 ? 7.428   12.059  58.758 1.00 23.67 ? 218 VAL B C   1 
ATOM   3547 O O   . VAL B 1 228 ? 6.605   11.226  58.364 1.00 23.32 ? 218 VAL B O   1 
ATOM   3548 C CB  . VAL B 1 228 ? 6.204   13.273  60.627 1.00 23.32 ? 218 VAL B CB  1 
ATOM   3549 C CG1 . VAL B 1 228 ? 7.064   12.482  61.613 1.00 24.98 ? 218 VAL B CG1 1 
ATOM   3550 C CG2 . VAL B 1 228 ? 5.854   14.642  61.168 1.00 26.24 ? 218 VAL B CG2 1 
ATOM   3551 N N   . ALA B 1 229 ? 8.745   11.847  58.725 1.00 23.21 ? 219 ALA B N   1 
ATOM   3552 C CA  . ALA B 1 229 ? 9.316   10.561  58.368 1.00 23.34 ? 219 ALA B CA  1 
ATOM   3553 C C   . ALA B 1 229 ? 9.551   9.657   59.592 1.00 24.72 ? 219 ALA B C   1 
ATOM   3554 O O   . ALA B 1 229 ? 10.029  10.112  60.645 1.00 25.59 ? 219 ALA B O   1 
ATOM   3555 C CB  . ALA B 1 229 ? 10.646  10.753  57.579 1.00 24.72 ? 219 ALA B CB  1 
ATOM   3556 N N   . ARG B 1 230 ? 9.274   8.363   59.434 1.00 23.89 ? 220 ARG B N   1 
ATOM   3557 C CA  . ARG B 1 230 ? 9.357   7.419   60.562 1.00 23.53 ? 220 ARG B CA  1 
ATOM   3558 C C   . ARG B 1 230 ? 9.705   6.052   59.980 1.00 23.02 ? 220 ARG B C   1 
ATOM   3559 O O   . ARG B 1 230 ? 9.539   5.826   58.769 1.00 22.26 ? 220 ARG B O   1 
ATOM   3560 C CB  . ARG B 1 230 ? 7.983   7.369   61.293 1.00 23.98 ? 220 ARG B CB  1 
ATOM   3561 C CG  . ARG B 1 230 ? 6.828   6.956   60.345 1.00 24.75 ? 220 ARG B CG  1 
ATOM   3562 C CD  . ARG B 1 230 ? 5.555   6.354   61.009 1.00 25.95 ? 220 ARG B CD  1 
ATOM   3563 N NE  . ARG B 1 230 ? 4.574   6.206   59.933 1.00 30.01 ? 220 ARG B NE  1 
ATOM   3564 C CZ  . ARG B 1 230 ? 4.433   5.124   59.169 1.00 31.88 ? 220 ARG B CZ  1 
ATOM   3565 N NH1 . ARG B 1 230 ? 5.183   4.054   59.386 1.00 30.50 ? 220 ARG B NH1 1 
ATOM   3566 N NH2 . ARG B 1 230 ? 3.521   5.104   58.189 1.00 30.67 ? 220 ARG B NH2 1 
ATOM   3567 N N   . TYR B 1 231 ? 10.216  5.139   60.795 1.00 20.97 ? 221 TYR B N   1 
ATOM   3568 C CA  . TYR B 1 231 ? 10.274  3.743   60.372 1.00 21.98 ? 221 TYR B CA  1 
ATOM   3569 C C   . TYR B 1 231 ? 8.893   3.117   60.735 1.00 19.95 ? 221 TYR B C   1 
ATOM   3570 O O   . TYR B 1 231 ? 8.104   3.767   61.334 1.00 18.21 ? 221 TYR B O   1 
ATOM   3571 C CB  . TYR B 1 231 ? 11.392  3.039   61.109 1.00 23.10 ? 221 TYR B CB  1 
ATOM   3572 C CG  . TYR B 1 231 ? 12.805  3.414   60.620 1.00 24.17 ? 221 TYR B CG  1 
ATOM   3573 C CD1 . TYR B 1 231 ? 13.696  4.119   61.439 1.00 26.99 ? 221 TYR B CD1 1 
ATOM   3574 C CD2 . TYR B 1 231 ? 13.230  3.069   59.333 1.00 26.28 ? 221 TYR B CD2 1 
ATOM   3575 C CE1 . TYR B 1 231 ? 14.976  4.470   60.977 1.00 27.19 ? 221 TYR B CE1 1 
ATOM   3576 C CE2 . TYR B 1 231 ? 14.519  3.393   58.870 1.00 27.44 ? 221 TYR B CE2 1 
ATOM   3577 C CZ  . TYR B 1 231 ? 15.380  4.094   59.694 1.00 26.61 ? 221 TYR B CZ  1 
ATOM   3578 O OH  . TYR B 1 231 ? 16.661  4.428   59.233 1.00 27.66 ? 221 TYR B OH  1 
ATOM   3579 N N   . CYS B 1 232 ? 8.633   1.861   60.386 1.00 20.04 ? 222 CYS B N   1 
ATOM   3580 C CA  . CYS B 1 232 ? 7.429   1.194   60.901 1.00 19.69 ? 222 CYS B CA  1 
ATOM   3581 C C   . CYS B 1 232 ? 7.594   0.955   62.417 1.00 18.14 ? 222 CYS B C   1 
ATOM   3582 O O   . CYS B 1 232 ? 8.604   0.420   62.872 1.00 20.17 ? 222 CYS B O   1 
ATOM   3583 C CB  . CYS B 1 232 ? 7.223   -0.113  60.155 1.00 19.61 ? 222 CYS B CB  1 
ATOM   3584 S SG  . CYS B 1 232 ? 5.757   -1.013  60.778 1.00 21.34 ? 222 CYS B SG  1 
ATOM   3585 N N   . ASP B 1 233 ? 6.617   1.369   63.200 1.00 17.40 ? 223 ASP B N   1 
ATOM   3586 C CA  . ASP B 1 233 ? 6.707   1.253   64.665 1.00 16.94 ? 223 ASP B CA  1 
ATOM   3587 C C   . ASP B 1 233 ? 5.870   0.132   65.255 1.00 17.16 ? 223 ASP B C   1 
ATOM   3588 O O   . ASP B 1 233 ? 5.700   0.020   66.463 1.00 16.32 ? 223 ASP B O   1 
ATOM   3589 C CB  . ASP B 1 233 ? 6.365   2.603   65.294 1.00 17.19 ? 223 ASP B CB  1 
ATOM   3590 C CG  . ASP B 1 233 ? 7.430   3.684   64.957 1.00 19.53 ? 223 ASP B CG  1 
ATOM   3591 O OD1 . ASP B 1 233 ? 8.591   3.340   64.701 1.00 18.13 ? 223 ASP B OD1 1 
ATOM   3592 O OD2 . ASP B 1 233 ? 7.053   4.840   64.909 1.00 25.25 ? 223 ASP B OD2 1 
ATOM   3593 N N   . LEU B 1 234 ? 5.362   -0.730  64.396 1.00 18.59 ? 224 LEU B N   1 
ATOM   3594 C CA  . LEU B 1 234 ? 4.790   -1.997  64.860 1.00 18.93 ? 224 LEU B CA  1 
ATOM   3595 C C   . LEU B 1 234 ? 5.844   -2.962  65.361 1.00 20.04 ? 224 LEU B C   1 
ATOM   3596 O O   . LEU B 1 234 ? 6.944   -3.069  64.783 1.00 20.29 ? 224 LEU B O   1 
ATOM   3597 C CB  . LEU B 1 234 ? 4.035   -2.692  63.692 1.00 18.23 ? 224 LEU B CB  1 
ATOM   3598 C CG  . LEU B 1 234 ? 2.926   -1.878  63.044 1.00 17.78 ? 224 LEU B CG  1 
ATOM   3599 C CD1 . LEU B 1 234 ? 2.438   -2.499  61.743 1.00 22.96 ? 224 LEU B CD1 1 
ATOM   3600 C CD2 . LEU B 1 234 ? 1.736   -1.741  63.999 1.00 20.50 ? 224 LEU B CD2 1 
ATOM   3601 N N   . PRO B 1 235 ? 5.512   -3.728  66.414 1.00 22.01 ? 225 PRO B N   1 
ATOM   3602 C CA  . PRO B 1 235 ? 6.491   -4.716  66.839 1.00 24.38 ? 225 PRO B CA  1 
ATOM   3603 C C   . PRO B 1 235 ? 6.878   -5.670  65.700 1.00 28.19 ? 225 PRO B C   1 
ATOM   3604 O O   . PRO B 1 235 ? 6.071   -5.952  64.823 1.00 27.10 ? 225 PRO B O   1 
ATOM   3605 C CB  . PRO B 1 235 ? 5.775   -5.457  67.985 1.00 24.36 ? 225 PRO B CB  1 
ATOM   3606 C CG  . PRO B 1 235 ? 4.754   -4.522  68.491 1.00 22.71 ? 225 PRO B CG  1 
ATOM   3607 C CD  . PRO B 1 235 ? 4.271   -3.788  67.225 1.00 22.07 ? 225 PRO B CD  1 
ATOM   3608 N N   . SER B 1 236 ? 8.128   -6.125  65.710 1.00 32.42 ? 226 SER B N   1 
ATOM   3609 C CA  . SER B 1 236 ? 8.658   -7.024  64.699 1.00 37.44 ? 226 SER B CA  1 
ATOM   3610 C C   . SER B 1 236 ? 8.958   -8.403  65.282 1.00 40.76 ? 226 SER B C   1 
ATOM   3611 O O   . SER B 1 236 ? 9.489   -8.513  66.400 1.00 41.00 ? 226 SER B O   1 
ATOM   3612 C CB  . SER B 1 236 ? 9.902   -6.435  63.996 1.00 37.96 ? 226 SER B CB  1 
ATOM   3613 O OG  . SER B 1 236 ? 10.591  -5.404  64.740 1.00 38.33 ? 226 SER B OG  1 
ATOM   3614 N N   . LYS B 1 237 ? 8.569   -9.447  64.539 1.00 44.34 ? 227 LYS B N   1 
ATOM   3615 C CA  . LYS B 1 237 ? 8.902   -10.844 64.870 1.00 47.20 ? 227 LYS B CA  1 
ATOM   3616 C C   . LYS B 1 237 ? 10.158  -11.348 64.147 1.00 48.86 ? 227 LYS B C   1 
ATOM   3617 O O   . LYS B 1 237 ? 10.589  -12.496 64.352 1.00 49.74 ? 227 LYS B O   1 
ATOM   3618 C CB  . LYS B 1 237 ? 7.724   -11.787 64.581 1.00 47.34 ? 227 LYS B CB  1 
ATOM   3619 C CG  . LYS B 1 237 ? 6.734   -11.914 65.744 1.00 48.77 ? 227 LYS B CG  1 
ATOM   3620 C CD  . LYS B 1 237 ? 5.842   -13.154 65.636 1.00 47.98 ? 227 LYS B CD  1 
ATOM   3621 C CE  . LYS B 1 237 ? 6.496   -14.406 66.184 1.00 48.41 ? 227 LYS B CE  1 
ATOM   3622 N NZ  . LYS B 1 237 ? 5.470   -15.485 66.370 1.00 49.45 ? 227 LYS B NZ  1 
ATOM   3623 N N   . LEU B 1 238 ? 10.751  -10.502 63.309 1.00 50.08 ? 228 LEU B N   1 
ATOM   3624 C CA  . LEU B 1 238 ? 11.949  -10.902 62.572 1.00 51.12 ? 228 LEU B CA  1 
ATOM   3625 C C   . LEU B 1 238 ? 13.177  -10.108 63.041 1.00 51.27 ? 228 LEU B C   1 
ATOM   3626 O O   . LEU B 1 238 ? 13.419  -9.984  64.247 1.00 51.31 ? 228 LEU B O   1 
ATOM   3627 C CB  . LEU B 1 238 ? 11.745  -10.785 61.048 1.00 51.33 ? 228 LEU B CB  1 
ATOM   3628 C CG  . LEU B 1 238 ? 10.836  -11.768 60.286 1.00 51.59 ? 228 LEU B CG  1 
ATOM   3629 C CD1 . LEU B 1 238 ? 10.784  -11.401 58.784 1.00 52.67 ? 228 LEU B CD1 1 
ATOM   3630 C CD2 . LEU B 1 238 ? 11.234  -13.241 60.469 1.00 51.11 ? 228 LEU B CD2 1 
HETATM 3631 C C1  . CIT C 2 .   ? 17.373  6.361   37.864 1.00 33.14 ? 234 CIT A C1  1 
HETATM 3632 O O1  . CIT C 2 .   ? 16.442  6.460   37.019 1.00 29.48 ? 234 CIT A O1  1 
HETATM 3633 O O2  . CIT C 2 .   ? 17.991  7.413   38.241 1.00 31.89 ? 234 CIT A O2  1 
HETATM 3634 C C2  . CIT C 2 .   ? 17.707  5.000   38.444 1.00 28.85 ? 234 CIT A C2  1 
HETATM 3635 C C3  . CIT C 2 .   ? 16.402  4.336   38.970 1.00 30.88 ? 234 CIT A C3  1 
HETATM 3636 O O7  . CIT C 2 .   ? 15.592  5.309   39.627 1.00 30.05 ? 234 CIT A O7  1 
HETATM 3637 C C4  . CIT C 2 .   ? 16.678  3.293   40.057 1.00 30.10 ? 234 CIT A C4  1 
HETATM 3638 C C5  . CIT C 2 .   ? 15.459  2.425   40.355 1.00 31.87 ? 234 CIT A C5  1 
HETATM 3639 O O3  . CIT C 2 .   ? 15.627  1.189   40.529 1.00 31.35 ? 234 CIT A O3  1 
HETATM 3640 O O4  . CIT C 2 .   ? 14.302  2.917   40.462 1.00 29.51 ? 234 CIT A O4  1 
HETATM 3641 C C6  . CIT C 2 .   ? 15.572  3.721   37.837 1.00 31.08 ? 234 CIT A C6  1 
HETATM 3642 O O5  . CIT C 2 .   ? 15.938  2.665   37.274 1.00 31.88 ? 234 CIT A O5  1 
HETATM 3643 O O6  . CIT C 2 .   ? 14.507  4.275   37.477 1.00 30.02 ? 234 CIT A O6  1 
HETATM 3644 C C1  . CIT D 2 .   ? -2.510  3.769   -2.244 1.00 46.52 ? 235 CIT A C1  1 
HETATM 3645 O O1  . CIT D 2 .   ? -3.623  3.619   -2.794 1.00 46.04 ? 235 CIT A O1  1 
HETATM 3646 O O2  . CIT D 2 .   ? -1.867  4.843   -2.367 1.00 43.83 ? 235 CIT A O2  1 
HETATM 3647 C C2  . CIT D 2 .   ? -1.905  2.642   -1.444 1.00 47.83 ? 235 CIT A C2  1 
HETATM 3648 C C3  . CIT D 2 .   ? -0.568  2.280   -2.088 1.00 48.76 ? 235 CIT A C3  1 
HETATM 3649 O O7  . CIT D 2 .   ? 0.116   3.488   -2.525 1.00 47.44 ? 235 CIT A O7  1 
HETATM 3650 C C4  . CIT D 2 .   ? -0.844  1.341   -3.262 1.00 46.64 ? 235 CIT A C4  1 
HETATM 3651 C C5  . CIT D 2 .   ? -0.904  1.964   -4.643 1.00 45.03 ? 235 CIT A C5  1 
HETATM 3652 O O3  . CIT D 2 .   ? -1.328  1.271   -5.576 1.00 42.65 ? 235 CIT A O3  1 
HETATM 3653 O O4  . CIT D 2 .   ? -0.545  3.127   -4.907 1.00 42.57 ? 235 CIT A O4  1 
HETATM 3654 C C6  . CIT D 2 .   ? 0.322   1.593   -1.047 1.00 49.59 ? 235 CIT A C6  1 
HETATM 3655 O O5  . CIT D 2 .   ? -0.121  1.336   0.092  1.00 52.31 ? 235 CIT A O5  1 
HETATM 3656 O O6  . CIT D 2 .   ? 1.515   1.295   -1.287 1.00 48.33 ? 235 CIT A O6  1 
HETATM 3657 C C1  . CIT E 2 .   ? 13.884  10.645  -0.620 1.00 64.32 ? 236 CIT A C1  1 
HETATM 3658 O O1  . CIT E 2 .   ? 12.773  10.881  -0.094 1.00 63.08 ? 236 CIT A O1  1 
HETATM 3659 O O2  . CIT E 2 .   ? 14.166  11.219  -1.692 1.00 65.82 ? 236 CIT A O2  1 
HETATM 3660 C C2  . CIT E 2 .   ? 14.895  9.703   0.002  1.00 63.28 ? 236 CIT A C2  1 
HETATM 3661 C C3  . CIT E 2 .   ? 14.273  8.434   0.579  1.00 62.68 ? 236 CIT A C3  1 
HETATM 3662 O O7  . CIT E 2 .   ? 15.381  7.642   1.099  1.00 64.35 ? 236 CIT A O7  1 
HETATM 3663 C C4  . CIT E 2 .   ? 13.317  8.757   1.735  1.00 58.51 ? 236 CIT A C4  1 
HETATM 3664 C C5  . CIT E 2 .   ? 12.034  7.968   1.638  1.00 54.83 ? 236 CIT A C5  1 
HETATM 3665 O O3  . CIT E 2 .   ? 12.032  6.785   2.058  1.00 54.59 ? 236 CIT A O3  1 
HETATM 3666 O O4  . CIT E 2 .   ? 10.993  8.468   1.137  1.00 49.02 ? 236 CIT A O4  1 
HETATM 3667 C C6  . CIT E 2 .   ? 13.550  7.625   -0.499 1.00 63.94 ? 236 CIT A C6  1 
HETATM 3668 O O5  . CIT E 2 .   ? 13.669  6.376   -0.514 1.00 65.11 ? 236 CIT A O5  1 
HETATM 3669 O O6  . CIT E 2 .   ? 12.811  8.174   -1.359 1.00 65.18 ? 236 CIT A O6  1 
HETATM 3670 C C1  . GOL F 3 .   ? 12.861  -5.956  32.982 1.00 37.81 ? 237 GOL A C1  1 
HETATM 3671 O O1  . GOL F 3 .   ? 12.556  -6.077  31.591 1.00 29.73 ? 237 GOL A O1  1 
HETATM 3672 C C2  . GOL F 3 .   ? 14.322  -6.181  33.406 1.00 41.88 ? 237 GOL A C2  1 
HETATM 3673 O O2  . GOL F 3 .   ? 14.481  -5.892  34.795 1.00 41.06 ? 237 GOL A O2  1 
HETATM 3674 C C3  . GOL F 3 .   ? 14.869  -7.592  33.144 1.00 43.57 ? 237 GOL A C3  1 
HETATM 3675 O O3  . GOL F 3 .   ? 14.548  -8.181  31.894 1.00 48.61 ? 237 GOL A O3  1 
HETATM 3676 C C1  . CIT G 2 .   ? 4.618   26.876  58.684 1.00 57.50 ? 234 CIT B C1  1 
HETATM 3677 O O1  . CIT G 2 .   ? 5.739   26.453  59.091 1.00 53.93 ? 234 CIT B O1  1 
HETATM 3678 O O2  . CIT G 2 .   ? 3.601   26.145  58.729 1.00 57.13 ? 234 CIT B O2  1 
HETATM 3679 C C2  . CIT G 2 .   ? 4.447   28.265  58.119 1.00 58.97 ? 234 CIT B C2  1 
HETATM 3680 C C3  . CIT G 2 .   ? 5.238   29.333  58.870 1.00 60.94 ? 234 CIT B C3  1 
HETATM 3681 O O7  . CIT G 2 .   ? 5.137   29.083  60.298 1.00 60.95 ? 234 CIT B O7  1 
HETATM 3682 C C4  . CIT G 2 .   ? 6.699   29.284  58.412 1.00 61.38 ? 234 CIT B C4  1 
HETATM 3683 C C5  . CIT G 2 .   ? 7.721   29.832  59.378 1.00 62.31 ? 234 CIT B C5  1 
HETATM 3684 O O3  . CIT G 2 .   ? 8.836   29.266  59.500 1.00 62.27 ? 234 CIT B O3  1 
HETATM 3685 O O4  . CIT G 2 .   ? 7.490   30.868  60.044 1.00 64.12 ? 234 CIT B O4  1 
HETATM 3686 C C6  . CIT G 2 .   ? 4.638   30.695  58.515 1.00 61.99 ? 234 CIT B C6  1 
HETATM 3687 O O5  . CIT G 2 .   ? 3.948   30.847  57.470 1.00 62.75 ? 234 CIT B O5  1 
HETATM 3688 O O6  . CIT G 2 .   ? 4.833   31.689  59.257 1.00 62.25 ? 234 CIT B O6  1 
HETATM 3689 C C1  . CIT H 2 .   ? -6.843  17.188  25.065 1.00 40.19 ? 235 CIT B C1  1 
HETATM 3690 O O1  . CIT H 2 .   ? -6.001  16.935  25.954 1.00 40.63 ? 235 CIT B O1  1 
HETATM 3691 O O2  . CIT H 2 .   ? -6.535  18.013  24.171 1.00 40.60 ? 235 CIT B O2  1 
HETATM 3692 C C2  . CIT H 2 .   ? -8.217  16.532  25.088 1.00 39.25 ? 235 CIT B C2  1 
HETATM 3693 C C3  . CIT H 2 .   ? -8.149  14.993  25.073 1.00 39.09 ? 235 CIT B C3  1 
HETATM 3694 O O7  . CIT H 2 .   ? -6.977  14.524  24.348 1.00 38.40 ? 235 CIT B O7  1 
HETATM 3695 C C4  . CIT H 2 .   ? -9.405  14.387  24.409 1.00 39.49 ? 235 CIT B C4  1 
HETATM 3696 C C5  . CIT H 2 .   ? -9.625  12.927  24.801 1.00 39.00 ? 235 CIT B C5  1 
HETATM 3697 O O3  . CIT H 2 .   ? -10.763 12.493  25.122 1.00 35.77 ? 235 CIT B O3  1 
HETATM 3698 O O4  . CIT H 2 .   ? -8.646  12.142  24.804 1.00 38.66 ? 235 CIT B O4  1 
HETATM 3699 C C6  . CIT H 2 .   ? -8.037  14.524  26.520 1.00 38.47 ? 235 CIT B C6  1 
HETATM 3700 O O5  . CIT H 2 .   ? -9.012  14.632  27.320 1.00 36.91 ? 235 CIT B O5  1 
HETATM 3701 O O6  . CIT H 2 .   ? -6.954  14.036  26.914 1.00 35.65 ? 235 CIT B O6  1 
HETATM 3702 C C1  . CIT I 2 .   ? 23.718  28.897  51.284 1.00 31.43 ? 236 CIT B C1  1 
HETATM 3703 O O1  . CIT I 2 .   ? 23.246  28.904  52.421 1.00 35.59 ? 236 CIT B O1  1 
HETATM 3704 O O2  . CIT I 2 .   ? 23.032  29.441  50.385 1.00 33.67 ? 236 CIT B O2  1 
HETATM 3705 C C2  . CIT I 2 .   ? 25.053  28.219  51.088 1.00 31.24 ? 236 CIT B C2  1 
HETATM 3706 C C3  . CIT I 2 .   ? 25.500  28.086  49.634 1.00 31.99 ? 236 CIT B C3  1 
HETATM 3707 O O7  . CIT I 2 .   ? 24.588  27.246  48.863 1.00 31.03 ? 236 CIT B O7  1 
HETATM 3708 C C4  . CIT I 2 .   ? 26.916  27.492  49.668 1.00 31.69 ? 236 CIT B C4  1 
HETATM 3709 C C5  . CIT I 2 .   ? 27.560  27.304  48.316 1.00 35.55 ? 236 CIT B C5  1 
HETATM 3710 O O3  . CIT I 2 .   ? 27.317  28.029  47.328 1.00 36.27 ? 236 CIT B O3  1 
HETATM 3711 O O4  . CIT I 2 .   ? 28.376  26.375  48.159 1.00 39.46 ? 236 CIT B O4  1 
HETATM 3712 C C6  . CIT I 2 .   ? 25.467  29.478  49.020 1.00 32.75 ? 236 CIT B C6  1 
HETATM 3713 O O5  . CIT I 2 .   ? 24.817  29.686  47.956 1.00 31.51 ? 236 CIT B O5  1 
HETATM 3714 O O6  . CIT I 2 .   ? 26.086  30.403  49.611 1.00 31.20 ? 236 CIT B O6  1 
HETATM 3715 C C1  . GOL J 3 .   ? -13.468 10.111  35.041 1.00 47.56 ? 237 GOL B C1  1 
HETATM 3716 O O1  . GOL J 3 .   ? -13.303 9.989   36.454 1.00 42.20 ? 237 GOL B O1  1 
HETATM 3717 C C2  . GOL J 3 .   ? -14.690 10.942  34.597 1.00 49.25 ? 237 GOL B C2  1 
HETATM 3718 O O2  . GOL J 3 .   ? -15.080 10.658  33.250 1.00 48.95 ? 237 GOL B O2  1 
HETATM 3719 C C3  . GOL J 3 .   ? -15.838 10.749  35.571 1.00 51.15 ? 237 GOL B C3  1 
HETATM 3720 O O3  . GOL J 3 .   ? -16.692 11.874  35.605 1.00 54.70 ? 237 GOL B O3  1 
HETATM 3721 O O   . HOH K 4 .   ? 2.856   6.814   12.239 1.00 21.07 ? 238 HOH A O   1 
HETATM 3722 O O   . HOH K 4 .   ? -0.464  6.298   19.441 1.00 19.28 ? 239 HOH A O   1 
HETATM 3723 O O   . HOH K 4 .   ? 5.496   -3.398  17.296 1.00 17.20 ? 240 HOH A O   1 
HETATM 3724 O O   . HOH K 4 .   ? 13.584  -2.011  29.972 1.00 16.26 ? 241 HOH A O   1 
HETATM 3725 O O   . HOH K 4 .   ? 4.846   11.695  -1.859 1.00 22.58 ? 242 HOH A O   1 
HETATM 3726 O O   . HOH K 4 .   ? 4.811   15.298  13.121 1.00 19.66 ? 243 HOH A O   1 
HETATM 3727 O O   . HOH K 4 .   ? 5.127   15.468  10.372 1.00 22.62 ? 244 HOH A O   1 
HETATM 3728 O O   . HOH K 4 .   ? 11.484  -0.502  29.724 1.00 23.02 ? 245 HOH A O   1 
HETATM 3729 O O   . HOH K 4 .   ? 5.395   9.163   12.057 1.00 19.63 ? 246 HOH A O   1 
HETATM 3730 O O   . HOH K 4 .   ? 6.187   -7.377  27.635 1.00 15.42 ? 247 HOH A O   1 
HETATM 3731 O O   . HOH K 4 .   ? 9.143   14.514  15.788 1.00 17.31 ? 248 HOH A O   1 
HETATM 3732 O O   . HOH K 4 .   ? 8.772   -2.102  12.248 1.00 17.17 ? 249 HOH A O   1 
HETATM 3733 O O   . HOH K 4 .   ? 6.045   8.431   24.371 1.00 17.74 ? 250 HOH A O   1 
HETATM 3734 O O   . HOH K 4 .   ? 9.528   4.918   24.064 1.00 18.54 ? 251 HOH A O   1 
HETATM 3735 O O   . HOH K 4 .   ? 15.559  -0.755  31.285 1.00 19.24 ? 252 HOH A O   1 
HETATM 3736 O O   . HOH K 4 .   ? 19.811  -1.605  22.755 1.00 23.04 ? 253 HOH A O   1 
HETATM 3737 O O   . HOH K 4 .   ? 7.185   5.152   22.127 1.00 18.15 ? 254 HOH A O   1 
HETATM 3738 O O   . HOH K 4 .   ? 3.147   -7.796  30.908 1.00 21.72 ? 255 HOH A O   1 
HETATM 3739 O O   . HOH K 4 .   ? -0.469  12.426  6.896  1.00 19.91 ? 256 HOH A O   1 
HETATM 3740 O O   . HOH K 4 .   ? 9.989   7.649   21.382 1.00 19.03 ? 257 HOH A O   1 
HETATM 3741 O O   . HOH K 4 .   ? 14.454  1.623   16.044 1.00 22.13 ? 258 HOH A O   1 
HETATM 3742 O O   . HOH K 4 .   ? 10.375  -3.678  36.629 1.00 22.20 ? 259 HOH A O   1 
HETATM 3743 O O   . HOH K 4 .   ? 7.215   9.059   21.805 1.00 21.11 ? 260 HOH A O   1 
HETATM 3744 O O   . HOH K 4 .   ? 10.302  4.430   20.367 1.00 19.35 ? 261 HOH A O   1 
HETATM 3745 O O   . HOH K 4 .   ? 8.199   23.061  15.111 1.00 22.49 ? 262 HOH A O   1 
HETATM 3746 O O   . HOH K 4 .   ? 0.545   4.730   27.895 1.00 19.11 ? 263 HOH A O   1 
HETATM 3747 O O   . HOH K 4 .   ? 13.250  -0.600  14.621 1.00 19.72 ? 264 HOH A O   1 
HETATM 3748 O O   . HOH K 4 .   ? -6.560  11.957  9.615  1.00 26.54 ? 265 HOH A O   1 
HETATM 3749 O O   . HOH K 4 .   ? 10.040  8.117   38.996 1.00 22.98 ? 266 HOH A O   1 
HETATM 3750 O O   . HOH K 4 .   ? -1.873  11.097  2.266  1.00 20.62 ? 267 HOH A O   1 
HETATM 3751 O O   . HOH K 4 .   ? 13.572  20.231  21.929 1.00 25.76 ? 268 HOH A O   1 
HETATM 3752 O O   . HOH K 4 .   ? 6.481   7.382   7.317  1.00 24.39 ? 269 HOH A O   1 
HETATM 3753 O O   . HOH K 4 .   ? -1.681  -1.910  18.300 1.00 25.67 ? 270 HOH A O   1 
HETATM 3754 O O   . HOH K 4 .   ? 14.807  11.033  33.966 1.00 28.37 ? 271 HOH A O   1 
HETATM 3755 O O   . HOH K 4 .   ? 8.005   -8.287  29.714 1.00 25.06 ? 272 HOH A O   1 
HETATM 3756 O O   . HOH K 4 .   ? 14.236  9.632   36.745 1.00 25.83 ? 273 HOH A O   1 
HETATM 3757 O O   . HOH K 4 .   ? 6.473   -0.409  14.219 1.00 29.03 ? 274 HOH A O   1 
HETATM 3758 O O   . HOH K 4 .   ? 17.592  -1.027  16.807 1.00 25.70 ? 275 HOH A O   1 
HETATM 3759 O O   . HOH K 4 .   ? 7.694   2.749   21.028 1.00 25.21 ? 276 HOH A O   1 
HETATM 3760 O O   . HOH K 4 .   ? -3.667  12.761  2.381  1.00 27.00 ? 277 HOH A O   1 
HETATM 3761 O O   . HOH K 4 .   ? 3.775   26.162  10.852 1.00 28.40 ? 278 HOH A O   1 
HETATM 3762 O O   . HOH K 4 .   ? 11.843  2.022   39.829 1.00 21.35 ? 279 HOH A O   1 
HETATM 3763 O O   . HOH K 4 .   ? 18.342  0.685   20.431 1.00 24.63 ? 280 HOH A O   1 
HETATM 3764 O O   . HOH K 4 .   ? 21.229  -4.515  21.529 1.00 31.78 ? 281 HOH A O   1 
HETATM 3765 O O   . HOH K 4 .   ? -6.715  11.453  2.206  1.00 34.68 ? 282 HOH A O   1 
HETATM 3766 O O   . HOH K 4 .   ? 2.794   3.608   -0.097 1.00 25.98 ? 283 HOH A O   1 
HETATM 3767 O O   . HOH K 4 .   ? 21.988  3.297   22.234 1.00 35.15 ? 284 HOH A O   1 
HETATM 3768 O O   . HOH K 4 .   ? 1.914   -1.059  28.937 1.00 22.47 ? 285 HOH A O   1 
HETATM 3769 O O   . HOH K 4 .   ? 12.175  -0.265  38.245 1.00 26.45 ? 286 HOH A O   1 
HETATM 3770 O O   . HOH K 4 .   ? -1.155  9.448   -0.160 1.00 22.53 ? 287 HOH A O   1 
HETATM 3771 O O   . HOH K 4 .   ? 7.312   -7.008  12.458 1.00 28.75 ? 288 HOH A O   1 
HETATM 3772 O O   . HOH K 4 .   ? 10.202  0.049   36.361 1.00 21.84 ? 289 HOH A O   1 
HETATM 3773 O O   . HOH K 4 .   ? 16.013  3.598   15.377 1.00 28.66 ? 290 HOH A O   1 
HETATM 3774 O O   . HOH K 4 .   ? -1.862  11.563  25.094 1.00 27.05 ? 291 HOH A O   1 
HETATM 3775 O O   . HOH K 4 .   ? 10.705  -7.574  33.142 1.00 26.24 ? 292 HOH A O   1 
HETATM 3776 O O   . HOH K 4 .   ? 14.881  -2.050  12.998 1.00 33.12 ? 293 HOH A O   1 
HETATM 3777 O O   . HOH K 4 .   ? 21.049  16.800  12.332 1.00 29.01 ? 294 HOH A O   1 
HETATM 3778 O O   . HOH K 4 .   ? -7.767  15.143  3.745  1.00 28.75 ? 295 HOH A O   1 
HETATM 3779 O O   . HOH K 4 .   ? 19.272  -1.683  19.026 1.00 23.22 ? 296 HOH A O   1 
HETATM 3780 O O   . HOH K 4 .   ? -9.853  7.912   24.764 1.00 27.44 ? 297 HOH A O   1 
HETATM 3781 O O   . HOH K 4 .   ? 9.170   -4.256  10.517 1.00 27.77 ? 298 HOH A O   1 
HETATM 3782 O O   . HOH K 4 .   ? 12.424  -7.696  29.111 1.00 27.27 ? 299 HOH A O   1 
HETATM 3783 O O   . HOH K 4 .   ? 16.565  -4.187  36.872 1.00 31.01 ? 300 HOH A O   1 
HETATM 3784 O O   . HOH K 4 .   ? -7.032  19.755  17.347 1.00 29.77 ? 301 HOH A O   1 
HETATM 3785 O O   . HOH K 4 .   ? 0.749   -3.280  16.988 1.00 30.25 ? 302 HOH A O   1 
HETATM 3786 O O   . HOH K 4 .   ? 19.277  3.344   35.389 1.00 26.96 ? 303 HOH A O   1 
HETATM 3787 O O   . HOH K 4 .   ? 0.950   -3.132  26.897 1.00 34.43 ? 304 HOH A O   1 
HETATM 3788 O O   . HOH K 4 .   ? 21.998  14.538  10.841 1.00 30.07 ? 305 HOH A O   1 
HETATM 3789 O O   . HOH K 4 .   ? 11.093  20.517  1.946  1.00 29.73 ? 306 HOH A O   1 
HETATM 3790 O O   . HOH K 4 .   ? 24.298  0.513   28.779 1.00 36.34 ? 307 HOH A O   1 
HETATM 3791 O O   . HOH K 4 .   ? 24.651  4.014   22.924 1.00 28.21 ? 308 HOH A O   1 
HETATM 3792 O O   . HOH K 4 .   ? 18.216  14.183  36.376 1.00 39.26 ? 309 HOH A O   1 
HETATM 3793 O O   . HOH K 4 .   ? -1.631  22.138  20.490 1.00 34.73 ? 310 HOH A O   1 
HETATM 3794 O O   . HOH K 4 .   ? 10.215  -8.886  28.332 1.00 27.27 ? 311 HOH A O   1 
HETATM 3795 O O   . HOH K 4 .   ? 9.220   -12.600 25.080 1.00 28.47 ? 312 HOH A O   1 
HETATM 3796 O O   . HOH K 4 .   ? 15.044  17.286  29.847 1.00 45.66 ? 313 HOH A O   1 
HETATM 3797 O O   . HOH K 4 .   ? 21.250  1.314   21.323 1.00 39.09 ? 314 HOH A O   1 
HETATM 3798 O O   . HOH K 4 .   ? 6.007   23.748  1.172  1.00 37.89 ? 315 HOH A O   1 
HETATM 3799 O O   . HOH K 4 .   ? 7.929   18.065  -4.218 1.00 30.64 ? 316 HOH A O   1 
HETATM 3800 O O   . HOH K 4 .   ? 7.427   -12.048 26.688 1.00 32.21 ? 317 HOH A O   1 
HETATM 3801 O O   . HOH K 4 .   ? 18.094  -0.171  40.568 1.00 28.45 ? 318 HOH A O   1 
HETATM 3802 O O   . HOH K 4 .   ? 15.347  -10.460 19.061 1.00 33.09 ? 319 HOH A O   1 
HETATM 3803 O O   . HOH K 4 .   ? 14.990  -0.583  38.509 1.00 27.62 ? 320 HOH A O   1 
HETATM 3804 O O   . HOH K 4 .   ? 3.434   -3.232  33.654 1.00 35.63 ? 321 HOH A O   1 
HETATM 3805 O O   . HOH K 4 .   ? 22.658  13.857  32.602 1.00 31.41 ? 322 HOH A O   1 
HETATM 3806 O O   . HOH K 4 .   ? 5.753   10.234  -5.326 1.00 43.38 ? 323 HOH A O   1 
HETATM 3807 O O   . HOH K 4 .   ? -15.242 12.333  12.706 1.00 35.59 ? 324 HOH A O   1 
HETATM 3808 O O   . HOH K 4 .   ? 27.171  14.074  23.019 1.00 32.40 ? 325 HOH A O   1 
HETATM 3809 O O   . HOH K 4 .   ? 17.347  -2.708  14.669 1.00 31.17 ? 326 HOH A O   1 
HETATM 3810 O O   . HOH K 4 .   ? 3.904   27.534  7.593  1.00 36.96 ? 327 HOH A O   1 
HETATM 3811 O O   . HOH K 4 .   ? 15.228  -12.313 24.958 1.00 32.54 ? 328 HOH A O   1 
HETATM 3812 O O   . HOH K 4 .   ? 18.557  -7.043  30.071 1.00 39.73 ? 329 HOH A O   1 
HETATM 3813 O O   . HOH K 4 .   ? 19.679  -12.119 19.841 1.00 32.67 ? 330 HOH A O   1 
HETATM 3814 O O   . HOH K 4 .   ? 6.553   -8.702  7.419  1.00 31.95 ? 331 HOH A O   1 
HETATM 3815 O O   . HOH K 4 .   ? -0.574  0.538   29.605 1.00 34.31 ? 332 HOH A O   1 
HETATM 3816 O O   . HOH K 4 .   ? 10.449  -11.188 15.037 1.00 36.82 ? 333 HOH A O   1 
HETATM 3817 O O   . HOH K 4 .   ? -1.656  2.915   28.778 1.00 41.50 ? 334 HOH A O   1 
HETATM 3818 O O   . HOH K 4 .   ? -12.844 1.605   9.914  1.00 41.26 ? 335 HOH A O   1 
HETATM 3819 O O   . HOH K 4 .   ? 10.381  -14.751 25.787 1.00 40.41 ? 336 HOH A O   1 
HETATM 3820 O O   . HOH K 4 .   ? -5.401  16.631  3.013  1.00 31.76 ? 337 HOH A O   1 
HETATM 3821 O O   . HOH K 4 .   ? -4.155  -0.522  17.780 1.00 49.65 ? 338 HOH A O   1 
HETATM 3822 O O   . HOH K 4 .   ? 22.576  1.949   32.019 1.00 35.95 ? 339 HOH A O   1 
HETATM 3823 O O   . HOH K 4 .   ? 18.004  19.841  12.954 1.00 35.86 ? 340 HOH A O   1 
HETATM 3824 O O   . HOH K 4 .   ? 14.709  16.222  33.001 1.00 34.81 ? 341 HOH A O   1 
HETATM 3825 O O   . HOH K 4 .   ? 20.914  1.491   34.720 1.00 32.43 ? 342 HOH A O   1 
HETATM 3826 O O   . HOH K 4 .   ? -4.817  2.470   31.196 1.00 32.15 ? 343 HOH A O   1 
HETATM 3827 O O   . HOH K 4 .   ? -14.134 4.992   10.131 1.00 37.36 ? 344 HOH A O   1 
HETATM 3828 O O   . HOH K 4 .   ? 22.334  -0.940  21.173 1.00 39.00 ? 345 HOH A O   1 
HETATM 3829 O O   . HOH K 4 .   ? 14.566  -8.919  29.383 1.00 32.82 ? 346 HOH A O   1 
HETATM 3830 O O   . HOH K 4 .   ? 18.117  17.330  33.321 1.00 38.58 ? 347 HOH A O   1 
HETATM 3831 O O   . HOH K 4 .   ? 12.665  -3.599  12.836 1.00 36.29 ? 348 HOH A O   1 
HETATM 3832 O O   . HOH K 4 .   ? -15.060 7.267   8.638  1.00 38.33 ? 349 HOH A O   1 
HETATM 3833 O O   . HOH K 4 .   ? 11.646  12.961  -1.416 1.00 40.44 ? 350 HOH A O   1 
HETATM 3834 O O   . HOH K 4 .   ? 23.357  10.394  11.131 1.00 32.97 ? 351 HOH A O   1 
HETATM 3835 O O   . HOH K 4 .   ? 28.043  15.731  26.120 1.00 42.29 ? 352 HOH A O   1 
HETATM 3836 O O   . HOH K 4 .   ? 22.144  -1.519  18.502 1.00 40.91 ? 353 HOH A O   1 
HETATM 3837 O O   . HOH K 4 .   ? -4.086  12.403  -1.932 1.00 35.72 ? 354 HOH A O   1 
HETATM 3838 O O   . HOH K 4 .   ? 23.515  8.001   9.707  1.00 41.99 ? 355 HOH A O   1 
HETATM 3839 O O   . HOH K 4 .   ? -3.043  0.159   6.286  1.00 46.26 ? 356 HOH A O   1 
HETATM 3840 O O   . HOH K 4 .   ? 12.338  -10.629 19.184 1.00 36.22 ? 357 HOH A O   1 
HETATM 3841 O O   . HOH K 4 .   ? -7.115  8.708   -0.305 1.00 35.89 ? 358 HOH A O   1 
HETATM 3842 O O   . HOH K 4 .   ? -13.161 8.893   7.959  1.00 38.67 ? 359 HOH A O   1 
HETATM 3843 O O   . HOH K 4 .   ? 21.402  -6.952  30.847 1.00 45.75 ? 360 HOH A O   1 
HETATM 3844 O O   . HOH K 4 .   ? 18.027  11.240  4.410  1.00 45.62 ? 361 HOH A O   1 
HETATM 3845 O O   . HOH K 4 .   ? 23.381  8.082   7.230  1.00 50.59 ? 362 HOH A O   1 
HETATM 3846 O O   . HOH K 4 .   ? -6.152  4.667   -2.157 1.00 46.65 ? 363 HOH A O   1 
HETATM 3847 O O   . HOH K 4 .   ? 21.740  6.917   33.146 1.00 38.00 ? 364 HOH A O   1 
HETATM 3848 O O   . HOH K 4 .   ? 3.340   27.591  4.945  1.00 46.98 ? 365 HOH A O   1 
HETATM 3849 O O   . HOH K 4 .   ? 5.910   26.408  2.108  1.00 49.11 ? 366 HOH A O   1 
HETATM 3850 O O   . HOH K 4 .   ? 6.716   27.340  4.460  1.00 33.31 ? 367 HOH A O   1 
HETATM 3851 O O   . HOH L 4 .   ? -10.614 15.177  34.166 1.00 21.25 ? 238 HOH B O   1 
HETATM 3852 O O   . HOH L 4 .   ? 12.282  19.682  46.967 1.00 19.22 ? 239 HOH B O   1 
HETATM 3853 O O   . HOH L 4 .   ? 13.658  7.205   37.213 1.00 18.34 ? 240 HOH B O   1 
HETATM 3854 O O   . HOH L 4 .   ? 6.563   14.862  51.290 1.00 22.53 ? 241 HOH B O   1 
HETATM 3855 O O   . HOH L 4 .   ? 8.853   22.023  43.905 1.00 21.23 ? 242 HOH B O   1 
HETATM 3856 O O   . HOH L 4 .   ? 12.843  21.124  49.294 1.00 25.25 ? 243 HOH B O   1 
HETATM 3857 O O   . HOH L 4 .   ? 12.885  23.642  61.721 1.00 26.98 ? 244 HOH B O   1 
HETATM 3858 O O   . HOH L 4 .   ? 16.221  10.166  53.505 1.00 23.62 ? 245 HOH B O   1 
HETATM 3859 O O   . HOH L 4 .   ? -4.182  10.755  49.980 1.00 20.31 ? 246 HOH B O   1 
HETATM 3860 O O   . HOH L 4 .   ? -10.122 13.268  36.336 1.00 22.01 ? 247 HOH B O   1 
HETATM 3861 O O   . HOH L 4 .   ? 6.595   2.651   36.596 1.00 26.50 ? 248 HOH B O   1 
HETATM 3862 O O   . HOH L 4 .   ? -10.268 5.878   41.854 1.00 19.52 ? 249 HOH B O   1 
HETATM 3863 O O   . HOH L 4 .   ? 3.646   13.692  38.997 1.00 22.24 ? 250 HOH B O   1 
HETATM 3864 O O   . HOH L 4 .   ? 4.144   15.953  40.883 1.00 21.31 ? 251 HOH B O   1 
HETATM 3865 O O   . HOH L 4 .   ? -1.117  16.897  43.360 1.00 21.11 ? 252 HOH B O   1 
HETATM 3866 O O   . HOH L 4 .   ? 14.155  16.390  54.745 1.00 19.93 ? 253 HOH B O   1 
HETATM 3867 O O   . HOH L 4 .   ? 10.479  0.375   58.998 1.00 36.22 ? 254 HOH B O   1 
HETATM 3868 O O   . HOH L 4 .   ? 6.193   9.211   45.710 1.00 21.42 ? 255 HOH B O   1 
HETATM 3869 O O   . HOH L 4 .   ? 1.696   17.525  41.223 1.00 23.92 ? 256 HOH B O   1 
HETATM 3870 O O   . HOH L 4 .   ? -1.243  13.949  43.906 1.00 23.84 ? 257 HOH B O   1 
HETATM 3871 O O   . HOH L 4 .   ? -1.163  15.196  40.074 1.00 22.19 ? 258 HOH B O   1 
HETATM 3872 O O   . HOH L 4 .   ? 0.709   14.030  42.057 1.00 23.56 ? 259 HOH B O   1 
HETATM 3873 O O   . HOH L 4 .   ? -7.710  12.333  36.517 1.00 24.24 ? 260 HOH B O   1 
HETATM 3874 O O   . HOH L 4 .   ? 7.134   17.906  50.204 1.00 27.92 ? 261 HOH B O   1 
HETATM 3875 O O   . HOH L 4 .   ? -11.267 7.463   31.520 1.00 26.06 ? 262 HOH B O   1 
HETATM 3876 O O   . HOH L 4 .   ? 21.232  10.120  43.738 1.00 30.64 ? 263 HOH B O   1 
HETATM 3877 O O   . HOH L 4 .   ? -4.187  14.551  26.365 1.00 23.77 ? 264 HOH B O   1 
HETATM 3878 O O   . HOH L 4 .   ? 16.574  25.086  41.417 1.00 26.51 ? 265 HOH B O   1 
HETATM 3879 O O   . HOH L 4 .   ? 4.276   3.139   62.441 1.00 33.65 ? 266 HOH B O   1 
HETATM 3880 O O   . HOH L 4 .   ? -9.936  1.987   39.981 1.00 25.72 ? 267 HOH B O   1 
HETATM 3881 O O   . HOH L 4 .   ? 2.405   6.330   38.352 1.00 24.60 ? 268 HOH B O   1 
HETATM 3882 O O   . HOH L 4 .   ? -2.403  16.649  25.562 1.00 25.12 ? 269 HOH B O   1 
HETATM 3883 O O   . HOH L 4 .   ? 11.053  1.815   64.712 1.00 24.48 ? 270 HOH B O   1 
HETATM 3884 O O   . HOH L 4 .   ? 6.181   19.699  54.764 1.00 30.77 ? 271 HOH B O   1 
HETATM 3885 O O   . HOH L 4 .   ? 26.115  32.942  48.830 1.00 28.07 ? 272 HOH B O   1 
HETATM 3886 O O   . HOH L 4 .   ? 14.772  16.563  59.651 1.00 26.25 ? 273 HOH B O   1 
HETATM 3887 O O   . HOH L 4 .   ? -11.653 21.173  41.420 1.00 27.55 ? 274 HOH B O   1 
HETATM 3888 O O   . HOH L 4 .   ? 0.393   5.160   49.817 1.00 24.61 ? 275 HOH B O   1 
HETATM 3889 O O   . HOH L 4 .   ? 11.378  -0.053  42.227 1.00 26.87 ? 276 HOH B O   1 
HETATM 3890 O O   . HOH L 4 .   ? -7.928  9.893   26.241 1.00 25.17 ? 277 HOH B O   1 
HETATM 3891 O O   . HOH L 4 .   ? -8.212  9.273   30.606 1.00 24.45 ? 278 HOH B O   1 
HETATM 3892 O O   . HOH L 4 .   ? -5.381  19.318  49.779 1.00 29.31 ? 279 HOH B O   1 
HETATM 3893 O O   . HOH L 4 .   ? -1.569  13.983  51.613 1.00 32.33 ? 280 HOH B O   1 
HETATM 3894 O O   . HOH L 4 .   ? -9.802  18.502  28.124 1.00 26.55 ? 281 HOH B O   1 
HETATM 3895 O O   . HOH L 4 .   ? -4.093  7.118   30.085 1.00 33.61 ? 282 HOH B O   1 
HETATM 3896 O O   . HOH L 4 .   ? -12.346 6.137   40.004 1.00 26.61 ? 283 HOH B O   1 
HETATM 3897 O O   . HOH L 4 .   ? 16.067  11.977  63.872 1.00 34.01 ? 284 HOH B O   1 
HETATM 3898 O O   . HOH L 4 .   ? 13.433  19.237  35.311 1.00 32.95 ? 285 HOH B O   1 
HETATM 3899 O O   . HOH L 4 .   ? -4.527  20.637  47.381 1.00 27.90 ? 286 HOH B O   1 
HETATM 3900 O O   . HOH L 4 .   ? 20.536  1.908   52.327 1.00 31.52 ? 287 HOH B O   1 
HETATM 3901 O O   . HOH L 4 .   ? -4.060  16.179  53.328 1.00 26.39 ? 288 HOH B O   1 
HETATM 3902 O O   . HOH L 4 .   ? 17.186  15.422  59.268 1.00 26.56 ? 289 HOH B O   1 
HETATM 3903 O O   . HOH L 4 .   ? -7.168  20.597  51.290 1.00 33.40 ? 290 HOH B O   1 
HETATM 3904 O O   . HOH L 4 .   ? -0.825  18.383  27.592 1.00 28.34 ? 291 HOH B O   1 
HETATM 3905 O O   . HOH L 4 .   ? -15.083 7.447   48.224 1.00 29.96 ? 292 HOH B O   1 
HETATM 3906 O O   . HOH L 4 .   ? -1.575  6.344   51.869 1.00 32.80 ? 293 HOH B O   1 
HETATM 3907 O O   . HOH L 4 .   ? 16.061  31.056  53.878 1.00 30.20 ? 294 HOH B O   1 
HETATM 3908 O O   . HOH L 4 .   ? -13.790 7.409   36.040 1.00 26.57 ? 295 HOH B O   1 
HETATM 3909 O O   . HOH L 4 .   ? -2.302  34.185  33.789 1.00 40.36 ? 296 HOH B O   1 
HETATM 3910 O O   . HOH L 4 .   ? 17.876  5.351   63.297 1.00 37.52 ? 297 HOH B O   1 
HETATM 3911 O O   . HOH L 4 .   ? -8.480  22.021  46.966 1.00 33.76 ? 298 HOH B O   1 
HETATM 3912 O O   . HOH L 4 .   ? -14.409 12.796  49.486 1.00 35.35 ? 299 HOH B O   1 
HETATM 3913 O O   . HOH L 4 .   ? -7.145  12.530  55.343 1.00 34.70 ? 300 HOH B O   1 
HETATM 3914 O O   . HOH L 4 .   ? 13.047  21.611  36.042 1.00 37.95 ? 301 HOH B O   1 
HETATM 3915 O O   . HOH L 4 .   ? -2.990  4.644   39.317 1.00 27.90 ? 302 HOH B O   1 
HETATM 3916 O O   . HOH L 4 .   ? 20.751  12.752  58.155 1.00 27.68 ? 303 HOH B O   1 
HETATM 3917 O O   . HOH L 4 .   ? -18.444 12.191  44.360 1.00 35.12 ? 304 HOH B O   1 
HETATM 3918 O O   . HOH L 4 .   ? 13.840  17.104  62.407 1.00 31.46 ? 305 HOH B O   1 
HETATM 3919 O O   . HOH L 4 .   ? 17.730  3.420   57.368 1.00 38.58 ? 306 HOH B O   1 
HETATM 3920 O O   . HOH L 4 .   ? 22.299  24.343  45.227 1.00 37.34 ? 307 HOH B O   1 
HETATM 3921 O O   . HOH L 4 .   ? 10.250  25.739  31.989 1.00 51.57 ? 308 HOH B O   1 
HETATM 3922 O O   . HOH L 4 .   ? 15.872  -1.175  54.599 1.00 36.02 ? 309 HOH B O   1 
HETATM 3923 O O   . HOH L 4 .   ? 17.285  6.154   41.865 1.00 32.50 ? 310 HOH B O   1 
HETATM 3924 O O   . HOH L 4 .   ? 13.258  10.868  66.860 1.00 29.06 ? 311 HOH B O   1 
HETATM 3925 O O   . HOH L 4 .   ? -14.637 21.703  43.222 1.00 34.26 ? 312 HOH B O   1 
HETATM 3926 O O   . HOH L 4 .   ? -7.618  18.266  52.348 1.00 32.66 ? 313 HOH B O   1 
HETATM 3927 O O   . HOH L 4 .   ? -9.668  21.957  49.423 1.00 35.75 ? 314 HOH B O   1 
HETATM 3928 O O   . HOH L 4 .   ? 22.259  21.770  57.202 1.00 35.80 ? 315 HOH B O   1 
HETATM 3929 O O   . HOH L 4 .   ? 9.191   8.156   64.790 1.00 46.32 ? 316 HOH B O   1 
HETATM 3930 O O   . HOH L 4 .   ? -16.700 15.441  36.609 1.00 46.63 ? 317 HOH B O   1 
HETATM 3931 O O   . HOH L 4 .   ? -9.826  9.823   28.309 1.00 29.10 ? 318 HOH B O   1 
HETATM 3932 O O   . HOH L 4 .   ? 15.702  -1.046  46.390 1.00 32.30 ? 319 HOH B O   1 
HETATM 3933 O O   . HOH L 4 .   ? -15.750 15.331  49.021 1.00 31.30 ? 320 HOH B O   1 
HETATM 3934 O O   . HOH L 4 .   ? 2.529   -0.409  37.425 1.00 36.10 ? 321 HOH B O   1 
HETATM 3935 O O   . HOH L 4 .   ? -0.955  3.299   38.588 1.00 36.26 ? 322 HOH B O   1 
HETATM 3936 O O   . HOH L 4 .   ? -11.418 12.005  27.490 1.00 34.66 ? 323 HOH B O   1 
HETATM 3937 O O   . HOH L 4 .   ? -4.062  3.903   42.087 1.00 31.55 ? 324 HOH B O   1 
HETATM 3938 O O   . HOH L 4 .   ? 5.161   34.445  43.603 1.00 35.07 ? 325 HOH B O   1 
HETATM 3939 O O   . HOH L 4 .   ? 21.256  28.764  54.089 1.00 34.66 ? 326 HOH B O   1 
HETATM 3940 O O   . HOH L 4 .   ? -15.542 7.331   45.192 1.00 32.03 ? 327 HOH B O   1 
HETATM 3941 O O   . HOH L 4 .   ? -8.378  25.365  39.380 1.00 34.01 ? 328 HOH B O   1 
HETATM 3942 O O   . HOH L 4 .   ? -8.473  22.125  42.945 1.00 30.74 ? 329 HOH B O   1 
HETATM 3943 O O   . HOH L 4 .   ? 3.341   34.386  45.521 1.00 33.79 ? 330 HOH B O   1 
HETATM 3944 O O   . HOH L 4 .   ? -1.223  33.801  46.696 1.00 40.47 ? 331 HOH B O   1 
HETATM 3945 O O   . HOH L 4 .   ? -13.096 13.820  24.937 1.00 31.21 ? 332 HOH B O   1 
HETATM 3946 O O   . HOH L 4 .   ? -7.600  22.967  28.316 1.00 38.79 ? 333 HOH B O   1 
HETATM 3947 O O   . HOH L 4 .   ? 10.061  -5.852  67.674 1.00 40.74 ? 334 HOH B O   1 
HETATM 3948 O O   . HOH L 4 .   ? -10.594 22.265  44.792 1.00 30.50 ? 335 HOH B O   1 
HETATM 3949 O O   . HOH L 4 .   ? 19.490  15.042  39.124 1.00 39.65 ? 336 HOH B O   1 
HETATM 3950 O O   . HOH L 4 .   ? 23.750  19.619  54.008 1.00 34.83 ? 337 HOH B O   1 
HETATM 3951 O O   . HOH L 4 .   ? 20.106  -0.596  44.702 1.00 49.53 ? 338 HOH B O   1 
HETATM 3952 O O   . HOH L 4 .   ? 3.303   10.161  61.729 1.00 36.95 ? 339 HOH B O   1 
HETATM 3953 O O   . HOH L 4 .   ? -3.480  23.100  46.917 1.00 40.88 ? 340 HOH B O   1 
HETATM 3954 O O   . HOH L 4 .   ? 21.567  2.895   46.582 1.00 41.04 ? 341 HOH B O   1 
HETATM 3955 O O   . HOH L 4 .   ? -13.206 12.695  53.845 1.00 35.79 ? 342 HOH B O   1 
HETATM 3956 O O   . HOH L 4 .   ? -12.306 19.499  29.267 1.00 40.91 ? 343 HOH B O   1 
HETATM 3957 O O   . HOH L 4 .   ? -13.791 10.085  39.360 1.00 34.75 ? 344 HOH B O   1 
HETATM 3958 O O   . HOH L 4 .   ? 8.828   28.983  34.975 1.00 38.52 ? 345 HOH B O   1 
HETATM 3959 O O   . HOH L 4 .   ? 4.670   23.102  29.052 1.00 34.01 ? 346 HOH B O   1 
HETATM 3960 O O   . HOH L 4 .   ? 7.245   30.630  36.541 1.00 38.48 ? 347 HOH B O   1 
HETATM 3961 O O   . HOH L 4 .   ? 19.391  19.823  37.887 1.00 39.16 ? 348 HOH B O   1 
HETATM 3962 O O   . HOH L 4 .   ? 17.720  12.438  60.486 1.00 33.33 ? 349 HOH B O   1 
HETATM 3963 O O   . HOH L 4 .   ? -11.910 21.897  30.959 1.00 37.28 ? 350 HOH B O   1 
HETATM 3964 O O   . HOH L 4 .   ? 15.864  29.624  39.157 1.00 39.75 ? 351 HOH B O   1 
HETATM 3965 O O   . HOH L 4 .   ? -13.830 8.327   40.989 1.00 33.93 ? 352 HOH B O   1 
HETATM 3966 O O   . HOH L 4 .   ? -12.143 24.484  42.109 1.00 39.31 ? 353 HOH B O   1 
HETATM 3967 O O   . HOH L 4 .   ? -14.570 12.341  23.388 1.00 41.49 ? 354 HOH B O   1 
HETATM 3968 O O   . HOH L 4 .   ? -5.677  23.177  45.372 1.00 35.42 ? 355 HOH B O   1 
HETATM 3969 O O   . HOH L 4 .   ? 0.242   14.705  50.334 1.00 62.72 ? 356 HOH B O   1 
HETATM 3970 O O   . HOH L 4 .   ? -3.548  6.935   34.399 1.00 40.87 ? 357 HOH B O   1 
HETATM 3971 O O   . HOH L 4 .   ? 1.575   4.042   38.911 1.00 53.41 ? 358 HOH B O   1 
HETATM 3972 O O   . HOH L 4 .   ? 5.733   -8.545  64.593 1.00 43.13 ? 359 HOH B O   1 
HETATM 3973 O O   . HOH L 4 .   ? 8.151   12.558  34.305 1.00 47.81 ? 360 HOH B O   1 
HETATM 3974 O O   . HOH L 4 .   ? 11.659  -9.575  65.794 1.00 53.46 ? 361 HOH B O   1 
HETATM 3975 O O   . HOH L 4 .   ? -14.761 12.316  30.242 1.00 46.24 ? 362 HOH B O   1 
HETATM 3976 O O   . HOH L 4 .   ? 9.962   -8.120  58.484 1.00 53.55 ? 363 HOH B O   1 
HETATM 3977 O O   . HOH L 4 .   ? 25.325  4.900   52.799 1.00 44.15 ? 364 HOH B O   1 
HETATM 3978 O O   . HOH L 4 .   ? -17.726 10.181  31.159 1.00 41.75 ? 365 HOH B O   1 
HETATM 3979 O O   . HOH L 4 .   ? -1.240  20.609  56.554 1.00 42.89 ? 366 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -11 ?   ?   ?   A . n 
A 1 2   ARG 2   -10 ?   ?   ?   A . n 
A 1 3   GLY 3   -9  ?   ?   ?   A . n 
A 1 4   SER 4   -8  ?   ?   ?   A . n 
A 1 5   HIS 5   -7  ?   ?   ?   A . n 
A 1 6   HIS 6   -6  ?   ?   ?   A . n 
A 1 7   HIS 7   -5  ?   ?   ?   A . n 
A 1 8   HIS 8   -4  ?   ?   ?   A . n 
A 1 9   HIS 9   -3  ?   ?   ?   A . n 
A 1 10  HIS 10  -2  ?   ?   ?   A . n 
A 1 11  GLY 11  -1  ?   ?   ?   A . n 
A 1 12  SER 12  0   ?   ?   ?   A . n 
A 1 13  MET 13  1   ?   ?   ?   A . n 
A 1 14  SER 14  2   2   SER SER A . n 
A 1 15  GLU 15  3   3   GLU GLU A . n 
A 1 16  LEU 16  4   4   LEU LEU A . n 
A 1 17  ILE 17  5   5   ILE ILE A . n 
A 1 18  THR 18  6   6   THR THR A . n 
A 1 19  GLU 19  7   7   GLU GLU A . n 
A 1 20  ASN 20  8   8   ASN ASN A . n 
A 1 21  MET 21  9   9   MET MET A . n 
A 1 22  HIS 22  10  10  HIS HIS A . n 
A 1 23  MET 23  11  11  MET MET A . n 
A 1 24  LYS 24  12  12  LYS LYS A . n 
A 1 25  LEU 25  13  13  LEU LEU A . n 
A 1 26  TYR 26  14  14  TYR TYR A . n 
A 1 27  MET 27  15  15  MET MET A . n 
A 1 28  GLU 28  16  16  GLU GLU A . n 
A 1 29  GLY 29  17  17  GLY GLY A . n 
A 1 30  THR 30  18  18  THR THR A . n 
A 1 31  VAL 31  19  19  VAL VAL A . n 
A 1 32  ASN 32  20  20  ASN ASN A . n 
A 1 33  ASN 33  21  21  ASN ASN A . n 
A 1 34  HIS 34  22  22  HIS HIS A . n 
A 1 35  HIS 35  23  23  HIS HIS A . n 
A 1 36  PHE 36  24  24  PHE PHE A . n 
A 1 37  LYS 37  25  25  LYS LYS A . n 
A 1 38  CYS 38  26  26  CYS CYS A . n 
A 1 39  THR 39  27  27  THR THR A . n 
A 1 40  SER 40  28  28  SER SER A . n 
A 1 41  GLU 41  29  29  GLU GLU A . n 
A 1 42  GLY 42  30  30  GLY GLY A . n 
A 1 43  GLU 43  31  31  GLU GLU A . n 
A 1 44  GLY 44  32  32  GLY GLY A . n 
A 1 45  LYS 45  33  33  LYS LYS A . n 
A 1 46  PRO 46  34  34  PRO PRO A . n 
A 1 47  TYR 47  35  35  TYR TYR A . n 
A 1 48  GLU 48  36  36  GLU GLU A . n 
A 1 49  GLY 49  37  37  GLY GLY A . n 
A 1 50  THR 50  38  38  THR THR A . n 
A 1 51  GLN 51  39  39  GLN GLN A . n 
A 1 52  THR 52  40  40  THR THR A . n 
A 1 53  MET 53  41  41  MET MET A . n 
A 1 54  ARG 54  42  42  ARG ARG A . n 
A 1 55  ILE 55  43  43  ILE ILE A . n 
A 1 56  LYS 56  44  44  LYS LYS A . n 
A 1 57  VAL 57  45  45  VAL VAL A . n 
A 1 58  VAL 58  46  46  VAL VAL A . n 
A 1 59  GLU 59  47  47  GLU GLU A . n 
A 1 60  GLY 60  48  48  GLY GLY A . n 
A 1 61  GLY 61  49  49  GLY GLY A . n 
A 1 62  PRO 62  50  50  PRO PRO A . n 
A 1 63  LEU 63  51  51  LEU LEU A . n 
A 1 64  PRO 64  52  52  PRO PRO A . n 
A 1 65  PHE 65  53  53  PHE PHE A . n 
A 1 66  ALA 66  54  54  ALA ALA A . n 
A 1 67  PHE 67  55  55  PHE PHE A . n 
A 1 68  ASP 68  56  56  ASP ASP A . n 
A 1 69  ILE 69  57  57  ILE ILE A . n 
A 1 70  LEU 70  58  58  LEU LEU A . n 
A 1 71  ALA 71  59  59  ALA ALA A . n 
A 1 72  THR 72  60  60  THR THR A . n 
A 1 73  SER 73  61  61  SER SER A . n 
A 1 74  PHE 74  62  62  PHE PHE A . n 
A 1 75  NRQ 75  63  63  NRQ NRQ A . n 
A 1 76  SER 76  66  66  SER SER A . n 
A 1 77  LYS 77  67  67  LYS LYS A . n 
A 1 78  THR 78  68  68  THR THR A . n 
A 1 79  PHE 79  69  69  PHE PHE A . n 
A 1 80  ILE 80  70  70  ILE ILE A . n 
A 1 81  ASN 81  71  71  ASN ASN A . n 
A 1 82  HIS 82  72  72  HIS HIS A . n 
A 1 83  THR 83  73  73  THR THR A . n 
A 1 84  GLN 84  74  74  GLN GLN A . n 
A 1 85  GLY 85  75  75  GLY GLY A . n 
A 1 86  ILE 86  76  76  ILE ILE A . n 
A 1 87  PRO 87  77  77  PRO PRO A . n 
A 1 88  ASP 88  78  78  ASP ASP A . n 
A 1 89  PHE 89  79  79  PHE PHE A . n 
A 1 90  PHE 90  80  80  PHE PHE A . n 
A 1 91  LYS 91  81  81  LYS LYS A . n 
A 1 92  GLN 92  82  82  GLN GLN A . n 
A 1 93  SER 93  83  83  SER SER A . n 
A 1 94  PHE 94  84  84  PHE PHE A . n 
A 1 95  PRO 95  85  85  PRO PRO A . n 
A 1 96  GLU 96  86  86  GLU GLU A . n 
A 1 97  GLY 97  87  87  GLY GLY A . n 
A 1 98  PHE 98  88  88  PHE PHE A . n 
A 1 99  THR 99  89  89  THR THR A . n 
A 1 100 TRP 100 90  90  TRP TRP A . n 
A 1 101 GLU 101 91  91  GLU GLU A . n 
A 1 102 ARG 102 92  92  ARG ARG A . n 
A 1 103 VAL 103 93  93  VAL VAL A . n 
A 1 104 THR 104 94  94  THR THR A . n 
A 1 105 THR 105 95  95  THR THR A . n 
A 1 106 TYR 106 96  96  TYR TYR A . n 
A 1 107 GLU 107 97  97  GLU GLU A . n 
A 1 108 ASP 108 98  98  ASP ASP A . n 
A 1 109 GLY 109 99  99  GLY GLY A . n 
A 1 110 GLY 110 100 100 GLY GLY A . n 
A 1 111 VAL 111 101 101 VAL VAL A . n 
A 1 112 LEU 112 102 102 LEU LEU A . n 
A 1 113 THR 113 103 103 THR THR A . n 
A 1 114 ALA 114 104 104 ALA ALA A . n 
A 1 115 THR 115 105 105 THR THR A . n 
A 1 116 GLN 116 106 106 GLN GLN A . n 
A 1 117 ASP 117 107 107 ASP ASP A . n 
A 1 118 THR 118 108 108 THR THR A . n 
A 1 119 SER 119 109 109 SER SER A . n 
A 1 120 LEU 120 110 110 LEU LEU A . n 
A 1 121 GLN 121 111 111 GLN GLN A . n 
A 1 122 ASP 122 112 112 ASP ASP A . n 
A 1 123 GLY 123 113 113 GLY GLY A . n 
A 1 124 CYS 124 114 114 CYS CYS A . n 
A 1 125 LEU 125 115 115 LEU LEU A . n 
A 1 126 ILE 126 116 116 ILE ILE A . n 
A 1 127 TYR 127 117 117 TYR TYR A . n 
A 1 128 ASN 128 118 118 ASN ASN A . n 
A 1 129 VAL 129 119 119 VAL VAL A . n 
A 1 130 LYS 130 120 120 LYS LYS A . n 
A 1 131 ILE 131 121 121 ILE ILE A . n 
A 1 132 ARG 132 122 122 ARG ARG A . n 
A 1 133 GLY 133 123 123 GLY GLY A . n 
A 1 134 VAL 134 124 124 VAL VAL A . n 
A 1 135 ASN 135 125 125 ASN ASN A . n 
A 1 136 PHE 136 126 126 PHE PHE A . n 
A 1 137 PRO 137 127 127 PRO PRO A . n 
A 1 138 SER 138 128 128 SER SER A . n 
A 1 139 ASN 139 129 129 ASN ASN A . n 
A 1 140 GLY 140 130 130 GLY GLY A . n 
A 1 141 PRO 141 131 131 PRO PRO A . n 
A 1 142 VAL 142 132 132 VAL VAL A . n 
A 1 143 MET 143 133 133 MET MET A . n 
A 1 144 GLN 144 134 134 GLN GLN A . n 
A 1 145 LYS 145 135 135 LYS LYS A . n 
A 1 146 LYS 146 136 136 LYS LYS A . n 
A 1 147 THR 147 137 137 THR THR A . n 
A 1 148 LEU 148 138 138 LEU LEU A . n 
A 1 149 GLY 149 139 139 GLY GLY A . n 
A 1 150 TRP 150 140 140 TRP TRP A . n 
A 1 151 GLU 151 141 141 GLU GLU A . n 
A 1 152 ALA 152 142 142 ALA ALA A . n 
A 1 153 SER 153 143 143 SER SER A . n 
A 1 154 THR 154 144 144 THR THR A . n 
A 1 155 GLU 155 145 145 GLU GLU A . n 
A 1 156 MET 156 146 146 MET MET A . n 
A 1 157 LEU 157 147 147 LEU LEU A . n 
A 1 158 TYR 158 148 148 TYR TYR A . n 
A 1 159 PRO 159 149 149 PRO PRO A . n 
A 1 160 ALA 160 150 150 ALA ALA A . n 
A 1 161 ASP 161 151 151 ASP ASP A . n 
A 1 162 GLY 162 152 152 GLY GLY A . n 
A 1 163 GLY 163 153 153 GLY GLY A . n 
A 1 164 LEU 164 154 154 LEU LEU A . n 
A 1 165 GLU 165 155 155 GLU GLU A . n 
A 1 166 GLY 166 156 156 GLY GLY A . n 
A 1 167 ARG 167 157 157 ARG ARG A . n 
A 1 168 SER 168 158 158 SER SER A . n 
A 1 169 ASP 169 159 159 ASP ASP A . n 
A 1 170 MET 170 160 160 MET MET A . n 
A 1 171 ALA 171 161 161 ALA ALA A . n 
A 1 172 LEU 172 162 162 LEU LEU A . n 
A 1 173 LYS 173 163 163 LYS LYS A . n 
A 1 174 LEU 174 164 164 LEU LEU A . n 
A 1 175 VAL 175 165 165 VAL VAL A . n 
A 1 176 GLY 176 166 166 GLY GLY A . n 
A 1 177 GLY 177 167 167 GLY GLY A . n 
A 1 178 GLY 178 168 168 GLY GLY A . n 
A 1 179 HIS 179 169 169 HIS HIS A . n 
A 1 180 LEU 180 170 170 LEU LEU A . n 
A 1 181 ILE 181 171 171 ILE ILE A . n 
A 1 182 CYS 182 172 172 CYS CYS A . n 
A 1 183 ASN 183 173 173 ASN ASN A . n 
A 1 184 LEU 184 174 174 LEU LEU A . n 
A 1 185 LYS 185 175 175 LYS LYS A . n 
A 1 186 THR 186 176 176 THR THR A . n 
A 1 187 THR 187 177 177 THR THR A . n 
A 1 188 TYR 188 178 178 TYR TYR A . n 
A 1 189 ARG 189 179 179 ARG ARG A . n 
A 1 190 SER 190 180 180 SER SER A . n 
A 1 191 LYS 191 181 181 LYS LYS A . n 
A 1 192 LYS 192 182 182 LYS LYS A . n 
A 1 193 PRO 193 183 183 PRO PRO A . n 
A 1 194 ALA 194 184 184 ALA ALA A . n 
A 1 195 LYS 195 185 185 LYS LYS A . n 
A 1 196 ASN 196 186 186 ASN ASN A . n 
A 1 197 LEU 197 187 187 LEU LEU A . n 
A 1 198 LYS 198 188 188 LYS LYS A . n 
A 1 199 MET 199 189 189 MET MET A . n 
A 1 200 PRO 200 190 190 PRO PRO A . n 
A 1 201 GLY 201 191 191 GLY GLY A . n 
A 1 202 VAL 202 192 192 VAL VAL A . n 
A 1 203 TYR 203 193 193 TYR TYR A . n 
A 1 204 TYR 204 194 194 TYR TYR A . n 
A 1 205 VAL 205 195 195 VAL VAL A . n 
A 1 206 ASP 206 196 196 ASP ASP A . n 
A 1 207 ARG 207 197 197 ARG ARG A . n 
A 1 208 ARG 208 198 198 ARG ARG A . n 
A 1 209 LEU 209 199 199 LEU LEU A . n 
A 1 210 GLU 210 200 200 GLU GLU A . n 
A 1 211 ARG 211 201 201 ARG ARG A . n 
A 1 212 ILE 212 202 202 ILE ILE A . n 
A 1 213 LYS 213 203 203 LYS LYS A . n 
A 1 214 GLU 214 204 204 GLU GLU A . n 
A 1 215 ALA 215 205 205 ALA ALA A . n 
A 1 216 ASP 216 206 206 ASP ASP A . n 
A 1 217 LYS 217 207 207 LYS LYS A . n 
A 1 218 GLU 218 208 208 GLU GLU A . n 
A 1 219 THR 219 209 209 THR THR A . n 
A 1 220 TYR 220 210 210 TYR TYR A . n 
A 1 221 VAL 221 211 211 VAL VAL A . n 
A 1 222 GLU 222 212 212 GLU GLU A . n 
A 1 223 GLN 223 213 213 GLN GLN A . n 
A 1 224 HIS 224 214 214 HIS HIS A . n 
A 1 225 GLU 225 215 215 GLU GLU A . n 
A 1 226 VAL 226 216 216 VAL VAL A . n 
A 1 227 ALA 227 217 217 ALA ALA A . n 
A 1 228 VAL 228 218 218 VAL VAL A . n 
A 1 229 ALA 229 219 219 ALA ALA A . n 
A 1 230 ARG 230 220 220 ARG ARG A . n 
A 1 231 TYR 231 221 221 TYR TYR A . n 
A 1 232 CYS 232 222 222 CYS CYS A . n 
A 1 233 ASP 233 223 223 ASP ASP A . n 
A 1 234 LEU 234 224 224 LEU LEU A . n 
A 1 235 PRO 235 225 225 PRO PRO A . n 
A 1 236 SER 236 226 226 SER SER A . n 
A 1 237 LYS 237 227 227 LYS LYS A . n 
A 1 238 LEU 238 228 228 LEU LEU A . n 
A 1 239 GLY 239 229 ?   ?   ?   A . n 
A 1 240 HIS 240 230 ?   ?   ?   A . n 
A 1 241 LYS 241 231 ?   ?   ?   A . n 
A 1 242 LEU 242 232 ?   ?   ?   A . n 
A 1 243 ASN 243 233 ?   ?   ?   A . n 
B 1 1   MET 1   -11 ?   ?   ?   B . n 
B 1 2   ARG 2   -10 ?   ?   ?   B . n 
B 1 3   GLY 3   -9  ?   ?   ?   B . n 
B 1 4   SER 4   -8  ?   ?   ?   B . n 
B 1 5   HIS 5   -7  ?   ?   ?   B . n 
B 1 6   HIS 6   -6  ?   ?   ?   B . n 
B 1 7   HIS 7   -5  ?   ?   ?   B . n 
B 1 8   HIS 8   -4  ?   ?   ?   B . n 
B 1 9   HIS 9   -3  ?   ?   ?   B . n 
B 1 10  HIS 10  -2  ?   ?   ?   B . n 
B 1 11  GLY 11  -1  ?   ?   ?   B . n 
B 1 12  SER 12  0   ?   ?   ?   B . n 
B 1 13  MET 13  1   ?   ?   ?   B . n 
B 1 14  SER 14  2   2   SER SER B . n 
B 1 15  GLU 15  3   3   GLU GLU B . n 
B 1 16  LEU 16  4   4   LEU LEU B . n 
B 1 17  ILE 17  5   5   ILE ILE B . n 
B 1 18  THR 18  6   6   THR THR B . n 
B 1 19  GLU 19  7   7   GLU GLU B . n 
B 1 20  ASN 20  8   8   ASN ASN B . n 
B 1 21  MET 21  9   9   MET MET B . n 
B 1 22  HIS 22  10  10  HIS HIS B . n 
B 1 23  MET 23  11  11  MET MET B . n 
B 1 24  LYS 24  12  12  LYS LYS B . n 
B 1 25  LEU 25  13  13  LEU LEU B . n 
B 1 26  TYR 26  14  14  TYR TYR B . n 
B 1 27  MET 27  15  15  MET MET B . n 
B 1 28  GLU 28  16  16  GLU GLU B . n 
B 1 29  GLY 29  17  17  GLY GLY B . n 
B 1 30  THR 30  18  18  THR THR B . n 
B 1 31  VAL 31  19  19  VAL VAL B . n 
B 1 32  ASN 32  20  20  ASN ASN B . n 
B 1 33  ASN 33  21  21  ASN ASN B . n 
B 1 34  HIS 34  22  22  HIS HIS B . n 
B 1 35  HIS 35  23  23  HIS HIS B . n 
B 1 36  PHE 36  24  24  PHE PHE B . n 
B 1 37  LYS 37  25  25  LYS LYS B . n 
B 1 38  CYS 38  26  26  CYS CYS B . n 
B 1 39  THR 39  27  27  THR THR B . n 
B 1 40  SER 40  28  28  SER SER B . n 
B 1 41  GLU 41  29  29  GLU GLU B . n 
B 1 42  GLY 42  30  30  GLY GLY B . n 
B 1 43  GLU 43  31  31  GLU GLU B . n 
B 1 44  GLY 44  32  32  GLY GLY B . n 
B 1 45  LYS 45  33  33  LYS LYS B . n 
B 1 46  PRO 46  34  34  PRO PRO B . n 
B 1 47  TYR 47  35  35  TYR TYR B . n 
B 1 48  GLU 48  36  36  GLU GLU B . n 
B 1 49  GLY 49  37  37  GLY GLY B . n 
B 1 50  THR 50  38  38  THR THR B . n 
B 1 51  GLN 51  39  39  GLN GLN B . n 
B 1 52  THR 52  40  40  THR THR B . n 
B 1 53  MET 53  41  41  MET MET B . n 
B 1 54  ARG 54  42  42  ARG ARG B . n 
B 1 55  ILE 55  43  43  ILE ILE B . n 
B 1 56  LYS 56  44  44  LYS LYS B . n 
B 1 57  VAL 57  45  45  VAL VAL B . n 
B 1 58  VAL 58  46  46  VAL VAL B . n 
B 1 59  GLU 59  47  47  GLU GLU B . n 
B 1 60  GLY 60  48  48  GLY GLY B . n 
B 1 61  GLY 61  49  49  GLY GLY B . n 
B 1 62  PRO 62  50  50  PRO PRO B . n 
B 1 63  LEU 63  51  51  LEU LEU B . n 
B 1 64  PRO 64  52  52  PRO PRO B . n 
B 1 65  PHE 65  53  53  PHE PHE B . n 
B 1 66  ALA 66  54  54  ALA ALA B . n 
B 1 67  PHE 67  55  55  PHE PHE B . n 
B 1 68  ASP 68  56  56  ASP ASP B . n 
B 1 69  ILE 69  57  57  ILE ILE B . n 
B 1 70  LEU 70  58  58  LEU LEU B . n 
B 1 71  ALA 71  59  59  ALA ALA B . n 
B 1 72  THR 72  60  60  THR THR B . n 
B 1 73  SER 73  61  61  SER SER B . n 
B 1 74  PHE 74  62  62  PHE PHE B . n 
B 1 75  NRQ 75  63  63  NRQ NRQ B . n 
B 1 76  SER 76  66  66  SER SER B . n 
B 1 77  LYS 77  67  67  LYS LYS B . n 
B 1 78  THR 78  68  68  THR THR B . n 
B 1 79  PHE 79  69  69  PHE PHE B . n 
B 1 80  ILE 80  70  70  ILE ILE B . n 
B 1 81  ASN 81  71  71  ASN ASN B . n 
B 1 82  HIS 82  72  72  HIS HIS B . n 
B 1 83  THR 83  73  73  THR THR B . n 
B 1 84  GLN 84  74  74  GLN GLN B . n 
B 1 85  GLY 85  75  75  GLY GLY B . n 
B 1 86  ILE 86  76  76  ILE ILE B . n 
B 1 87  PRO 87  77  77  PRO PRO B . n 
B 1 88  ASP 88  78  78  ASP ASP B . n 
B 1 89  PHE 89  79  79  PHE PHE B . n 
B 1 90  PHE 90  80  80  PHE PHE B . n 
B 1 91  LYS 91  81  81  LYS LYS B . n 
B 1 92  GLN 92  82  82  GLN GLN B . n 
B 1 93  SER 93  83  83  SER SER B . n 
B 1 94  PHE 94  84  84  PHE PHE B . n 
B 1 95  PRO 95  85  85  PRO PRO B . n 
B 1 96  GLU 96  86  86  GLU GLU B . n 
B 1 97  GLY 97  87  87  GLY GLY B . n 
B 1 98  PHE 98  88  88  PHE PHE B . n 
B 1 99  THR 99  89  89  THR THR B . n 
B 1 100 TRP 100 90  90  TRP TRP B . n 
B 1 101 GLU 101 91  91  GLU GLU B . n 
B 1 102 ARG 102 92  92  ARG ARG B . n 
B 1 103 VAL 103 93  93  VAL VAL B . n 
B 1 104 THR 104 94  94  THR THR B . n 
B 1 105 THR 105 95  95  THR THR B . n 
B 1 106 TYR 106 96  96  TYR TYR B . n 
B 1 107 GLU 107 97  97  GLU GLU B . n 
B 1 108 ASP 108 98  98  ASP ASP B . n 
B 1 109 GLY 109 99  99  GLY GLY B . n 
B 1 110 GLY 110 100 100 GLY GLY B . n 
B 1 111 VAL 111 101 101 VAL VAL B . n 
B 1 112 LEU 112 102 102 LEU LEU B . n 
B 1 113 THR 113 103 103 THR THR B . n 
B 1 114 ALA 114 104 104 ALA ALA B . n 
B 1 115 THR 115 105 105 THR THR B . n 
B 1 116 GLN 116 106 106 GLN GLN B . n 
B 1 117 ASP 117 107 107 ASP ASP B . n 
B 1 118 THR 118 108 108 THR THR B . n 
B 1 119 SER 119 109 109 SER SER B . n 
B 1 120 LEU 120 110 110 LEU LEU B . n 
B 1 121 GLN 121 111 111 GLN GLN B . n 
B 1 122 ASP 122 112 112 ASP ASP B . n 
B 1 123 GLY 123 113 113 GLY GLY B . n 
B 1 124 CYS 124 114 114 CYS CYS B . n 
B 1 125 LEU 125 115 115 LEU LEU B . n 
B 1 126 ILE 126 116 116 ILE ILE B . n 
B 1 127 TYR 127 117 117 TYR TYR B . n 
B 1 128 ASN 128 118 118 ASN ASN B . n 
B 1 129 VAL 129 119 119 VAL VAL B . n 
B 1 130 LYS 130 120 120 LYS LYS B . n 
B 1 131 ILE 131 121 121 ILE ILE B . n 
B 1 132 ARG 132 122 122 ARG ARG B . n 
B 1 133 GLY 133 123 123 GLY GLY B . n 
B 1 134 VAL 134 124 124 VAL VAL B . n 
B 1 135 ASN 135 125 125 ASN ASN B . n 
B 1 136 PHE 136 126 126 PHE PHE B . n 
B 1 137 PRO 137 127 127 PRO PRO B . n 
B 1 138 SER 138 128 128 SER SER B . n 
B 1 139 ASN 139 129 129 ASN ASN B . n 
B 1 140 GLY 140 130 130 GLY GLY B . n 
B 1 141 PRO 141 131 131 PRO PRO B . n 
B 1 142 VAL 142 132 132 VAL VAL B . n 
B 1 143 MET 143 133 133 MET MET B . n 
B 1 144 GLN 144 134 134 GLN GLN B . n 
B 1 145 LYS 145 135 135 LYS LYS B . n 
B 1 146 LYS 146 136 136 LYS LYS B . n 
B 1 147 THR 147 137 137 THR THR B . n 
B 1 148 LEU 148 138 138 LEU LEU B . n 
B 1 149 GLY 149 139 139 GLY GLY B . n 
B 1 150 TRP 150 140 140 TRP TRP B . n 
B 1 151 GLU 151 141 141 GLU GLU B . n 
B 1 152 ALA 152 142 142 ALA ALA B . n 
B 1 153 SER 153 143 143 SER SER B . n 
B 1 154 THR 154 144 144 THR THR B . n 
B 1 155 GLU 155 145 145 GLU GLU B . n 
B 1 156 MET 156 146 146 MET MET B . n 
B 1 157 LEU 157 147 147 LEU LEU B . n 
B 1 158 TYR 158 148 148 TYR TYR B . n 
B 1 159 PRO 159 149 149 PRO PRO B . n 
B 1 160 ALA 160 150 150 ALA ALA B . n 
B 1 161 ASP 161 151 151 ASP ASP B . n 
B 1 162 GLY 162 152 152 GLY GLY B . n 
B 1 163 GLY 163 153 153 GLY GLY B . n 
B 1 164 LEU 164 154 154 LEU LEU B . n 
B 1 165 GLU 165 155 155 GLU GLU B . n 
B 1 166 GLY 166 156 156 GLY GLY B . n 
B 1 167 ARG 167 157 157 ARG ARG B . n 
B 1 168 SER 168 158 158 SER SER B . n 
B 1 169 ASP 169 159 159 ASP ASP B . n 
B 1 170 MET 170 160 160 MET MET B . n 
B 1 171 ALA 171 161 161 ALA ALA B . n 
B 1 172 LEU 172 162 162 LEU LEU B . n 
B 1 173 LYS 173 163 163 LYS LYS B . n 
B 1 174 LEU 174 164 164 LEU LEU B . n 
B 1 175 VAL 175 165 165 VAL VAL B . n 
B 1 176 GLY 176 166 166 GLY GLY B . n 
B 1 177 GLY 177 167 167 GLY GLY B . n 
B 1 178 GLY 178 168 168 GLY GLY B . n 
B 1 179 HIS 179 169 169 HIS HIS B . n 
B 1 180 LEU 180 170 170 LEU LEU B . n 
B 1 181 ILE 181 171 171 ILE ILE B . n 
B 1 182 CYS 182 172 172 CYS CYS B . n 
B 1 183 ASN 183 173 173 ASN ASN B . n 
B 1 184 LEU 184 174 174 LEU LEU B . n 
B 1 185 LYS 185 175 175 LYS LYS B . n 
B 1 186 THR 186 176 176 THR THR B . n 
B 1 187 THR 187 177 177 THR THR B . n 
B 1 188 TYR 188 178 178 TYR TYR B . n 
B 1 189 ARG 189 179 179 ARG ARG B . n 
B 1 190 SER 190 180 180 SER SER B . n 
B 1 191 LYS 191 181 181 LYS LYS B . n 
B 1 192 LYS 192 182 182 LYS LYS B . n 
B 1 193 PRO 193 183 183 PRO PRO B . n 
B 1 194 ALA 194 184 184 ALA ALA B . n 
B 1 195 LYS 195 185 185 LYS LYS B . n 
B 1 196 ASN 196 186 186 ASN ASN B . n 
B 1 197 LEU 197 187 187 LEU LEU B . n 
B 1 198 LYS 198 188 188 LYS LYS B . n 
B 1 199 MET 199 189 189 MET MET B . n 
B 1 200 PRO 200 190 190 PRO PRO B . n 
B 1 201 GLY 201 191 191 GLY GLY B . n 
B 1 202 VAL 202 192 192 VAL VAL B . n 
B 1 203 TYR 203 193 193 TYR TYR B . n 
B 1 204 TYR 204 194 194 TYR TYR B . n 
B 1 205 VAL 205 195 195 VAL VAL B . n 
B 1 206 ASP 206 196 196 ASP ASP B . n 
B 1 207 ARG 207 197 197 ARG ARG B . n 
B 1 208 ARG 208 198 198 ARG ARG B . n 
B 1 209 LEU 209 199 199 LEU LEU B . n 
B 1 210 GLU 210 200 200 GLU GLU B . n 
B 1 211 ARG 211 201 201 ARG ARG B . n 
B 1 212 ILE 212 202 202 ILE ILE B . n 
B 1 213 LYS 213 203 203 LYS LYS B . n 
B 1 214 GLU 214 204 204 GLU GLU B . n 
B 1 215 ALA 215 205 205 ALA ALA B . n 
B 1 216 ASP 216 206 206 ASP ASP B . n 
B 1 217 LYS 217 207 207 LYS LYS B . n 
B 1 218 GLU 218 208 208 GLU GLU B . n 
B 1 219 THR 219 209 209 THR THR B . n 
B 1 220 TYR 220 210 210 TYR TYR B . n 
B 1 221 VAL 221 211 211 VAL VAL B . n 
B 1 222 GLU 222 212 212 GLU GLU B . n 
B 1 223 GLN 223 213 213 GLN GLN B . n 
B 1 224 HIS 224 214 214 HIS HIS B . n 
B 1 225 GLU 225 215 215 GLU GLU B . n 
B 1 226 VAL 226 216 216 VAL VAL B . n 
B 1 227 ALA 227 217 217 ALA ALA B . n 
B 1 228 VAL 228 218 218 VAL VAL B . n 
B 1 229 ALA 229 219 219 ALA ALA B . n 
B 1 230 ARG 230 220 220 ARG ARG B . n 
B 1 231 TYR 231 221 221 TYR TYR B . n 
B 1 232 CYS 232 222 222 CYS CYS B . n 
B 1 233 ASP 233 223 223 ASP ASP B . n 
B 1 234 LEU 234 224 224 LEU LEU B . n 
B 1 235 PRO 235 225 225 PRO PRO B . n 
B 1 236 SER 236 226 226 SER SER B . n 
B 1 237 LYS 237 227 227 LYS LYS B . n 
B 1 238 LEU 238 228 228 LEU LEU B . n 
B 1 239 GLY 239 229 ?   ?   ?   B . n 
B 1 240 HIS 240 230 ?   ?   ?   B . n 
B 1 241 LYS 241 231 ?   ?   ?   B . n 
B 1 242 LEU 242 232 ?   ?   ?   B . n 
B 1 243 ASN 243 233 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CIT 1   234 1   CIT CIT A . 
D 2 CIT 1   235 4   CIT CIT A . 
E 2 CIT 1   236 5   CIT CIT A . 
F 3 GOL 1   237 2   GOL GOL A . 
G 2 CIT 1   234 2   CIT CIT B . 
H 2 CIT 1   235 3   CIT CIT B . 
I 2 CIT 1   236 6   CIT CIT B . 
J 3 GOL 1   237 1   GOL GOL B . 
K 4 HOH 1   238 1   HOH HOH A . 
K 4 HOH 2   239 2   HOH HOH A . 
K 4 HOH 3   240 4   HOH HOH A . 
K 4 HOH 4   241 5   HOH HOH A . 
K 4 HOH 5   242 7   HOH HOH A . 
K 4 HOH 6   243 8   HOH HOH A . 
K 4 HOH 7   244 9   HOH HOH A . 
K 4 HOH 8   245 10  HOH HOH A . 
K 4 HOH 9   246 11  HOH HOH A . 
K 4 HOH 10  247 12  HOH HOH A . 
K 4 HOH 11  248 13  HOH HOH A . 
K 4 HOH 12  249 14  HOH HOH A . 
K 4 HOH 13  250 17  HOH HOH A . 
K 4 HOH 14  251 19  HOH HOH A . 
K 4 HOH 15  252 22  HOH HOH A . 
K 4 HOH 16  253 27  HOH HOH A . 
K 4 HOH 17  254 28  HOH HOH A . 
K 4 HOH 18  255 29  HOH HOH A . 
K 4 HOH 19  256 31  HOH HOH A . 
K 4 HOH 20  257 33  HOH HOH A . 
K 4 HOH 21  258 34  HOH HOH A . 
K 4 HOH 22  259 35  HOH HOH A . 
K 4 HOH 23  260 36  HOH HOH A . 
K 4 HOH 24  261 37  HOH HOH A . 
K 4 HOH 25  262 40  HOH HOH A . 
K 4 HOH 26  263 42  HOH HOH A . 
K 4 HOH 27  264 43  HOH HOH A . 
K 4 HOH 28  265 44  HOH HOH A . 
K 4 HOH 29  266 46  HOH HOH A . 
K 4 HOH 30  267 47  HOH HOH A . 
K 4 HOH 31  268 50  HOH HOH A . 
K 4 HOH 32  269 53  HOH HOH A . 
K 4 HOH 33  270 54  HOH HOH A . 
K 4 HOH 34  271 55  HOH HOH A . 
K 4 HOH 35  272 58  HOH HOH A . 
K 4 HOH 36  273 61  HOH HOH A . 
K 4 HOH 37  274 62  HOH HOH A . 
K 4 HOH 38  275 66  HOH HOH A . 
K 4 HOH 39  276 67  HOH HOH A . 
K 4 HOH 40  277 70  HOH HOH A . 
K 4 HOH 41  278 71  HOH HOH A . 
K 4 HOH 42  279 78  HOH HOH A . 
K 4 HOH 43  280 79  HOH HOH A . 
K 4 HOH 44  281 80  HOH HOH A . 
K 4 HOH 45  282 82  HOH HOH A . 
K 4 HOH 46  283 83  HOH HOH A . 
K 4 HOH 47  284 84  HOH HOH A . 
K 4 HOH 48  285 85  HOH HOH A . 
K 4 HOH 49  286 86  HOH HOH A . 
K 4 HOH 50  287 87  HOH HOH A . 
K 4 HOH 51  288 89  HOH HOH A . 
K 4 HOH 52  289 92  HOH HOH A . 
K 4 HOH 53  290 94  HOH HOH A . 
K 4 HOH 54  291 96  HOH HOH A . 
K 4 HOH 55  292 98  HOH HOH A . 
K 4 HOH 56  293 104 HOH HOH A . 
K 4 HOH 57  294 108 HOH HOH A . 
K 4 HOH 58  295 109 HOH HOH A . 
K 4 HOH 59  296 111 HOH HOH A . 
K 4 HOH 60  297 112 HOH HOH A . 
K 4 HOH 61  298 115 HOH HOH A . 
K 4 HOH 62  299 116 HOH HOH A . 
K 4 HOH 63  300 117 HOH HOH A . 
K 4 HOH 64  301 118 HOH HOH A . 
K 4 HOH 65  302 120 HOH HOH A . 
K 4 HOH 66  303 121 HOH HOH A . 
K 4 HOH 67  304 123 HOH HOH A . 
K 4 HOH 68  305 125 HOH HOH A . 
K 4 HOH 69  306 126 HOH HOH A . 
K 4 HOH 70  307 128 HOH HOH A . 
K 4 HOH 71  308 129 HOH HOH A . 
K 4 HOH 72  309 132 HOH HOH A . 
K 4 HOH 73  310 136 HOH HOH A . 
K 4 HOH 74  311 141 HOH HOH A . 
K 4 HOH 75  312 143 HOH HOH A . 
K 4 HOH 76  313 144 HOH HOH A . 
K 4 HOH 77  314 148 HOH HOH A . 
K 4 HOH 78  315 149 HOH HOH A . 
K 4 HOH 79  316 150 HOH HOH A . 
K 4 HOH 80  317 152 HOH HOH A . 
K 4 HOH 81  318 153 HOH HOH A . 
K 4 HOH 82  319 155 HOH HOH A . 
K 4 HOH 83  320 158 HOH HOH A . 
K 4 HOH 84  321 159 HOH HOH A . 
K 4 HOH 85  322 163 HOH HOH A . 
K 4 HOH 86  323 164 HOH HOH A . 
K 4 HOH 87  324 165 HOH HOH A . 
K 4 HOH 88  325 173 HOH HOH A . 
K 4 HOH 89  326 176 HOH HOH A . 
K 4 HOH 90  327 177 HOH HOH A . 
K 4 HOH 91  328 178 HOH HOH A . 
K 4 HOH 92  329 180 HOH HOH A . 
K 4 HOH 93  330 181 HOH HOH A . 
K 4 HOH 94  331 182 HOH HOH A . 
K 4 HOH 95  332 183 HOH HOH A . 
K 4 HOH 96  333 184 HOH HOH A . 
K 4 HOH 97  334 186 HOH HOH A . 
K 4 HOH 98  335 191 HOH HOH A . 
K 4 HOH 99  336 192 HOH HOH A . 
K 4 HOH 100 337 193 HOH HOH A . 
K 4 HOH 101 338 194 HOH HOH A . 
K 4 HOH 102 339 195 HOH HOH A . 
K 4 HOH 103 340 197 HOH HOH A . 
K 4 HOH 104 341 201 HOH HOH A . 
K 4 HOH 105 342 203 HOH HOH A . 
K 4 HOH 106 343 204 HOH HOH A . 
K 4 HOH 107 344 205 HOH HOH A . 
K 4 HOH 108 345 207 HOH HOH A . 
K 4 HOH 109 346 209 HOH HOH A . 
K 4 HOH 110 347 211 HOH HOH A . 
K 4 HOH 111 348 217 HOH HOH A . 
K 4 HOH 112 349 218 HOH HOH A . 
K 4 HOH 113 350 219 HOH HOH A . 
K 4 HOH 114 351 223 HOH HOH A . 
K 4 HOH 115 352 229 HOH HOH A . 
K 4 HOH 116 353 230 HOH HOH A . 
K 4 HOH 117 354 233 HOH HOH A . 
K 4 HOH 118 355 235 HOH HOH A . 
K 4 HOH 119 356 240 HOH HOH A . 
K 4 HOH 120 357 243 HOH HOH A . 
K 4 HOH 121 358 245 HOH HOH A . 
K 4 HOH 122 359 247 HOH HOH A . 
K 4 HOH 123 360 248 HOH HOH A . 
K 4 HOH 124 361 249 HOH HOH A . 
K 4 HOH 125 362 251 HOH HOH A . 
K 4 HOH 126 363 252 HOH HOH A . 
K 4 HOH 127 364 254 HOH HOH A . 
K 4 HOH 128 365 257 HOH HOH A . 
K 4 HOH 129 366 258 HOH HOH A . 
K 4 HOH 130 367 259 HOH HOH A . 
L 4 HOH 1   238 3   HOH HOH B . 
L 4 HOH 2   239 6   HOH HOH B . 
L 4 HOH 3   240 15  HOH HOH B . 
L 4 HOH 4   241 16  HOH HOH B . 
L 4 HOH 5   242 18  HOH HOH B . 
L 4 HOH 6   243 20  HOH HOH B . 
L 4 HOH 7   244 21  HOH HOH B . 
L 4 HOH 8   245 23  HOH HOH B . 
L 4 HOH 9   246 24  HOH HOH B . 
L 4 HOH 10  247 25  HOH HOH B . 
L 4 HOH 11  248 26  HOH HOH B . 
L 4 HOH 12  249 30  HOH HOH B . 
L 4 HOH 13  250 32  HOH HOH B . 
L 4 HOH 14  251 38  HOH HOH B . 
L 4 HOH 15  252 39  HOH HOH B . 
L 4 HOH 16  253 41  HOH HOH B . 
L 4 HOH 17  254 45  HOH HOH B . 
L 4 HOH 18  255 48  HOH HOH B . 
L 4 HOH 19  256 49  HOH HOH B . 
L 4 HOH 20  257 51  HOH HOH B . 
L 4 HOH 21  258 52  HOH HOH B . 
L 4 HOH 22  259 56  HOH HOH B . 
L 4 HOH 23  260 57  HOH HOH B . 
L 4 HOH 24  261 59  HOH HOH B . 
L 4 HOH 25  262 60  HOH HOH B . 
L 4 HOH 26  263 63  HOH HOH B . 
L 4 HOH 27  264 64  HOH HOH B . 
L 4 HOH 28  265 65  HOH HOH B . 
L 4 HOH 29  266 68  HOH HOH B . 
L 4 HOH 30  267 69  HOH HOH B . 
L 4 HOH 31  268 72  HOH HOH B . 
L 4 HOH 32  269 73  HOH HOH B . 
L 4 HOH 33  270 74  HOH HOH B . 
L 4 HOH 34  271 75  HOH HOH B . 
L 4 HOH 35  272 76  HOH HOH B . 
L 4 HOH 36  273 77  HOH HOH B . 
L 4 HOH 37  274 81  HOH HOH B . 
L 4 HOH 38  275 88  HOH HOH B . 
L 4 HOH 39  276 90  HOH HOH B . 
L 4 HOH 40  277 91  HOH HOH B . 
L 4 HOH 41  278 93  HOH HOH B . 
L 4 HOH 42  279 95  HOH HOH B . 
L 4 HOH 43  280 97  HOH HOH B . 
L 4 HOH 44  281 99  HOH HOH B . 
L 4 HOH 45  282 100 HOH HOH B . 
L 4 HOH 46  283 101 HOH HOH B . 
L 4 HOH 47  284 102 HOH HOH B . 
L 4 HOH 48  285 103 HOH HOH B . 
L 4 HOH 49  286 105 HOH HOH B . 
L 4 HOH 50  287 106 HOH HOH B . 
L 4 HOH 51  288 107 HOH HOH B . 
L 4 HOH 52  289 110 HOH HOH B . 
L 4 HOH 53  290 113 HOH HOH B . 
L 4 HOH 54  291 114 HOH HOH B . 
L 4 HOH 55  292 119 HOH HOH B . 
L 4 HOH 56  293 122 HOH HOH B . 
L 4 HOH 57  294 124 HOH HOH B . 
L 4 HOH 58  295 127 HOH HOH B . 
L 4 HOH 59  296 130 HOH HOH B . 
L 4 HOH 60  297 131 HOH HOH B . 
L 4 HOH 61  298 133 HOH HOH B . 
L 4 HOH 62  299 134 HOH HOH B . 
L 4 HOH 63  300 135 HOH HOH B . 
L 4 HOH 64  301 137 HOH HOH B . 
L 4 HOH 65  302 138 HOH HOH B . 
L 4 HOH 66  303 139 HOH HOH B . 
L 4 HOH 67  304 140 HOH HOH B . 
L 4 HOH 68  305 142 HOH HOH B . 
L 4 HOH 69  306 145 HOH HOH B . 
L 4 HOH 70  307 146 HOH HOH B . 
L 4 HOH 71  308 147 HOH HOH B . 
L 4 HOH 72  309 151 HOH HOH B . 
L 4 HOH 73  310 154 HOH HOH B . 
L 4 HOH 74  311 156 HOH HOH B . 
L 4 HOH 75  312 157 HOH HOH B . 
L 4 HOH 76  313 160 HOH HOH B . 
L 4 HOH 77  314 161 HOH HOH B . 
L 4 HOH 78  315 162 HOH HOH B . 
L 4 HOH 79  316 166 HOH HOH B . 
L 4 HOH 80  317 167 HOH HOH B . 
L 4 HOH 81  318 168 HOH HOH B . 
L 4 HOH 82  319 169 HOH HOH B . 
L 4 HOH 83  320 170 HOH HOH B . 
L 4 HOH 84  321 171 HOH HOH B . 
L 4 HOH 85  322 172 HOH HOH B . 
L 4 HOH 86  323 174 HOH HOH B . 
L 4 HOH 87  324 175 HOH HOH B . 
L 4 HOH 88  325 179 HOH HOH B . 
L 4 HOH 89  326 185 HOH HOH B . 
L 4 HOH 90  327 187 HOH HOH B . 
L 4 HOH 91  328 188 HOH HOH B . 
L 4 HOH 92  329 189 HOH HOH B . 
L 4 HOH 93  330 190 HOH HOH B . 
L 4 HOH 94  331 196 HOH HOH B . 
L 4 HOH 95  332 198 HOH HOH B . 
L 4 HOH 96  333 199 HOH HOH B . 
L 4 HOH 97  334 200 HOH HOH B . 
L 4 HOH 98  335 202 HOH HOH B . 
L 4 HOH 99  336 206 HOH HOH B . 
L 4 HOH 100 337 208 HOH HOH B . 
L 4 HOH 101 338 210 HOH HOH B . 
L 4 HOH 102 339 212 HOH HOH B . 
L 4 HOH 103 340 213 HOH HOH B . 
L 4 HOH 104 341 214 HOH HOH B . 
L 4 HOH 105 342 215 HOH HOH B . 
L 4 HOH 106 343 216 HOH HOH B . 
L 4 HOH 107 344 220 HOH HOH B . 
L 4 HOH 108 345 221 HOH HOH B . 
L 4 HOH 109 346 222 HOH HOH B . 
L 4 HOH 110 347 224 HOH HOH B . 
L 4 HOH 111 348 225 HOH HOH B . 
L 4 HOH 112 349 226 HOH HOH B . 
L 4 HOH 113 350 227 HOH HOH B . 
L 4 HOH 114 351 228 HOH HOH B . 
L 4 HOH 115 352 231 HOH HOH B . 
L 4 HOH 116 353 232 HOH HOH B . 
L 4 HOH 117 354 234 HOH HOH B . 
L 4 HOH 118 355 236 HOH HOH B . 
L 4 HOH 119 356 237 HOH HOH B . 
L 4 HOH 120 357 238 HOH HOH B . 
L 4 HOH 121 358 239 HOH HOH B . 
L 4 HOH 122 359 241 HOH HOH B . 
L 4 HOH 123 360 242 HOH HOH B . 
L 4 HOH 124 361 244 HOH HOH B . 
L 4 HOH 125 362 246 HOH HOH B . 
L 4 HOH 126 363 250 HOH HOH B . 
L 4 HOH 127 364 253 HOH HOH B . 
L 4 HOH 128 365 255 HOH HOH B . 
L 4 HOH 129 366 256 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A NRQ 75 A NRQ 63 ? MET ? 
2 A NRQ 75 A NRQ 63 ? TYR ? 
3 A NRQ 75 A NRQ 63 ? GLY ? 
4 B NRQ 75 B NRQ 63 ? MET ? 
5 B NRQ 75 B NRQ 63 ? TYR ? 
6 B NRQ 75 B NRQ 63 ? GLY ? 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 author_and_software_defined_assembly PQS  monomeric 1 
3 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,K 
2 1 B,G,H,I,J,L 
3 1 B,G,H,I,J,L 
3 2 A,C,D,E,F,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 6210  ? 
3 MORE         -19   ? 
3 'SSA (A^2)'  18330 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 10_555 -y,-x,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 68.8383333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-07-22 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Derived calculations'      
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
SERGUI   'data collection' .        ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
MOLREP   phasing           .        ? 5 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     323 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     270 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   6_554 
_pdbx_validate_symm_contact.dist              2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 69 ? ? -101.99 55.42 
2 1 PHE B 69 ? ? -97.31  51.36 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -11 ? A MET 1   
2  1 Y 1 A ARG -10 ? A ARG 2   
3  1 Y 1 A GLY -9  ? A GLY 3   
4  1 Y 1 A SER -8  ? A SER 4   
5  1 Y 1 A HIS -7  ? A HIS 5   
6  1 Y 1 A HIS -6  ? A HIS 6   
7  1 Y 1 A HIS -5  ? A HIS 7   
8  1 Y 1 A HIS -4  ? A HIS 8   
9  1 Y 1 A HIS -3  ? A HIS 9   
10 1 Y 1 A HIS -2  ? A HIS 10  
11 1 Y 1 A GLY -1  ? A GLY 11  
12 1 Y 1 A SER 0   ? A SER 12  
13 1 Y 1 A MET 1   ? A MET 13  
14 1 Y 1 A GLY 229 ? A GLY 239 
15 1 Y 1 A HIS 230 ? A HIS 240 
16 1 Y 1 A LYS 231 ? A LYS 241 
17 1 Y 1 A LEU 232 ? A LEU 242 
18 1 Y 1 A ASN 233 ? A ASN 243 
19 1 Y 1 B MET -11 ? B MET 1   
20 1 Y 1 B ARG -10 ? B ARG 2   
21 1 Y 1 B GLY -9  ? B GLY 3   
22 1 Y 1 B SER -8  ? B SER 4   
23 1 Y 1 B HIS -7  ? B HIS 5   
24 1 Y 1 B HIS -6  ? B HIS 6   
25 1 Y 1 B HIS -5  ? B HIS 7   
26 1 Y 1 B HIS -4  ? B HIS 8   
27 1 Y 1 B HIS -3  ? B HIS 9   
28 1 Y 1 B HIS -2  ? B HIS 10  
29 1 Y 1 B GLY -1  ? B GLY 11  
30 1 Y 1 B SER 0   ? B SER 12  
31 1 Y 1 B MET 1   ? B MET 13  
32 1 Y 1 B GLY 229 ? B GLY 239 
33 1 Y 1 B HIS 230 ? B HIS 240 
34 1 Y 1 B LYS 231 ? B LYS 241 
35 1 Y 1 B LEU 232 ? B LEU 242 
36 1 Y 1 B ASN 233 ? B ASN 243 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CITRIC ACID' CIT 
3 GLYCEROL      GOL 
4 water         HOH 
#