data_3BYH
# 
_entry.id   3BYH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BYH         
RCSB  RCSB046114   
WWPDB D_1000046114 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3BYH 
_pdbx_database_status.recvd_initial_deposition_date   2008-01-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Galkin, V.E.'    1 
'Orlova, A.'      2 
'Cherepanova, O.' 3 
'Lebart, M.C.'    4 
'Egelman, E.H.'   5 
# 
_citation.id                        primary 
_citation.title                     'High-resolution cryo-EM structure of the F-actin-fimbrin/plastin ABD2 complex.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                1494 
_citation.page_last                 1498 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18234857 
_citation.pdbx_database_id_DOI      10.1073/pnas.0708667105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Galkin, V.E.'    1 
primary 'Orlova, A.'      2 
primary 'Cherepanova, O.' 3 
primary 'Lebart, M.C.'    4 
primary 'Egelman, E.H.'   5 
# 
_cell.entry_id           3BYH 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3BYH 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Actin          41651.465 1 ? ? ? ? 
2 polymer man 'fimbrin ABD2' 26764.367 1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Beta-actin, PS1TP5-binding protein 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD
MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTH
TVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE
LPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA
PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
;DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD
MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTH
TVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE
LPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA
PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
A ? 
2 'polypeptide(L)' no no 
;DVETCRDERCYRLWINSLGIDSYVNNVFEDVRNGWILLEVLDKVSPSSVNWKHASKPPIKMPFRKVENCNQVIKIGKQLK
FSLVNVAGNDIVQGNKKLILGLLWQLMRFHMLQLLKSLRSEMTDADILSWANRKVRTMGRKLQIESFKDKSLSSGLFFLN
LLWAVEPRVVNWNLVTKGETDDEKRLNATYIVSVARKLGCSVFLLPEDIVEVNQKMILILTASIMYWSLQR
;
;DVETCRDERCYRLWINSLGIDSYVNNVFEDVRNGWILLEVLDKVSPSSVNWKHASKPPIKMPFRKVENCNQVIKIGKQLK
FSLVNVAGNDIVQGNKKLILGLLWQLMRFHMLQLLKSLRSEMTDADILSWANRKVRTMGRKLQIESFKDKSLSSGLFFLN
LLWAVEPRVVNWNLVTKGETDDEKRLNATYIVSVARKLGCSVFLLPEDIVEVNQKMILILTASIMYWSLQR
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   ASP n 
1 4   ILE n 
1 5   ALA n 
1 6   ALA n 
1 7   LEU n 
1 8   VAL n 
1 9   VAL n 
1 10  ASP n 
1 11  ASN n 
1 12  GLY n 
1 13  SER n 
1 14  GLY n 
1 15  MET n 
1 16  CYS n 
1 17  LYS n 
1 18  ALA n 
1 19  GLY n 
1 20  PHE n 
1 21  ALA n 
1 22  GLY n 
1 23  ASP n 
1 24  ASP n 
1 25  ALA n 
1 26  PRO n 
1 27  ARG n 
1 28  ALA n 
1 29  VAL n 
1 30  PHE n 
1 31  PRO n 
1 32  SER n 
1 33  ILE n 
1 34  VAL n 
1 35  GLY n 
1 36  ARG n 
1 37  PRO n 
1 38  ARG n 
1 39  HIS n 
1 40  GLN n 
1 41  GLY n 
1 42  VAL n 
1 43  MET n 
1 44  VAL n 
1 45  GLY n 
1 46  MET n 
1 47  GLY n 
1 48  GLN n 
1 49  LYS n 
1 50  ASP n 
1 51  SER n 
1 52  TYR n 
1 53  VAL n 
1 54  GLY n 
1 55  ASP n 
1 56  GLU n 
1 57  ALA n 
1 58  GLN n 
1 59  SER n 
1 60  LYS n 
1 61  ARG n 
1 62  GLY n 
1 63  ILE n 
1 64  LEU n 
1 65  THR n 
1 66  LEU n 
1 67  LYS n 
1 68  TYR n 
1 69  PRO n 
1 70  ILE n 
1 71  GLU n 
1 72  HIS n 
1 73  GLY n 
1 74  ILE n 
1 75  VAL n 
1 76  THR n 
1 77  ASN n 
1 78  TRP n 
1 79  ASP n 
1 80  ASP n 
1 81  MET n 
1 82  GLU n 
1 83  LYS n 
1 84  ILE n 
1 85  TRP n 
1 86  HIS n 
1 87  HIS n 
1 88  THR n 
1 89  PHE n 
1 90  TYR n 
1 91  ASN n 
1 92  GLU n 
1 93  LEU n 
1 94  ARG n 
1 95  VAL n 
1 96  ALA n 
1 97  PRO n 
1 98  GLU n 
1 99  GLU n 
1 100 HIS n 
1 101 PRO n 
1 102 VAL n 
1 103 LEU n 
1 104 LEU n 
1 105 THR n 
1 106 GLU n 
1 107 ALA n 
1 108 PRO n 
1 109 LEU n 
1 110 ASN n 
1 111 PRO n 
1 112 LYS n 
1 113 ALA n 
1 114 ASN n 
1 115 ARG n 
1 116 GLU n 
1 117 LYS n 
1 118 MET n 
1 119 THR n 
1 120 GLN n 
1 121 ILE n 
1 122 MET n 
1 123 PHE n 
1 124 GLU n 
1 125 THR n 
1 126 PHE n 
1 127 ASN n 
1 128 THR n 
1 129 PRO n 
1 130 ALA n 
1 131 MET n 
1 132 TYR n 
1 133 VAL n 
1 134 ALA n 
1 135 ILE n 
1 136 GLN n 
1 137 ALA n 
1 138 VAL n 
1 139 LEU n 
1 140 SER n 
1 141 LEU n 
1 142 TYR n 
1 143 ALA n 
1 144 SER n 
1 145 GLY n 
1 146 ARG n 
1 147 THR n 
1 148 THR n 
1 149 GLY n 
1 150 ILE n 
1 151 VAL n 
1 152 MET n 
1 153 ASP n 
1 154 SER n 
1 155 GLY n 
1 156 ASP n 
1 157 GLY n 
1 158 VAL n 
1 159 THR n 
1 160 HIS n 
1 161 THR n 
1 162 VAL n 
1 163 PRO n 
1 164 ILE n 
1 165 TYR n 
1 166 GLU n 
1 167 GLY n 
1 168 TYR n 
1 169 ALA n 
1 170 LEU n 
1 171 PRO n 
1 172 HIS n 
1 173 ALA n 
1 174 ILE n 
1 175 LEU n 
1 176 ARG n 
1 177 LEU n 
1 178 ASP n 
1 179 LEU n 
1 180 ALA n 
1 181 GLY n 
1 182 ARG n 
1 183 ASP n 
1 184 LEU n 
1 185 THR n 
1 186 ASP n 
1 187 TYR n 
1 188 LEU n 
1 189 MET n 
1 190 LYS n 
1 191 ILE n 
1 192 LEU n 
1 193 THR n 
1 194 GLU n 
1 195 ARG n 
1 196 GLY n 
1 197 TYR n 
1 198 SER n 
1 199 PHE n 
1 200 THR n 
1 201 THR n 
1 202 THR n 
1 203 ALA n 
1 204 GLU n 
1 205 ARG n 
1 206 GLU n 
1 207 ILE n 
1 208 VAL n 
1 209 ARG n 
1 210 ASP n 
1 211 ILE n 
1 212 LYS n 
1 213 GLU n 
1 214 LYS n 
1 215 LEU n 
1 216 CYS n 
1 217 TYR n 
1 218 VAL n 
1 219 ALA n 
1 220 LEU n 
1 221 ASP n 
1 222 PHE n 
1 223 GLU n 
1 224 GLN n 
1 225 GLU n 
1 226 MET n 
1 227 ALA n 
1 228 THR n 
1 229 ALA n 
1 230 ALA n 
1 231 SER n 
1 232 SER n 
1 233 SER n 
1 234 SER n 
1 235 LEU n 
1 236 GLU n 
1 237 LYS n 
1 238 SER n 
1 239 TYR n 
1 240 GLU n 
1 241 LEU n 
1 242 PRO n 
1 243 ASP n 
1 244 GLY n 
1 245 GLN n 
1 246 VAL n 
1 247 ILE n 
1 248 THR n 
1 249 ILE n 
1 250 GLY n 
1 251 ASN n 
1 252 GLU n 
1 253 ARG n 
1 254 PHE n 
1 255 ARG n 
1 256 CYS n 
1 257 PRO n 
1 258 GLU n 
1 259 ALA n 
1 260 LEU n 
1 261 PHE n 
1 262 GLN n 
1 263 PRO n 
1 264 SER n 
1 265 PHE n 
1 266 LEU n 
1 267 GLY n 
1 268 MET n 
1 269 GLU n 
1 270 SER n 
1 271 CYS n 
1 272 GLY n 
1 273 ILE n 
1 274 HIS n 
1 275 GLU n 
1 276 THR n 
1 277 THR n 
1 278 PHE n 
1 279 ASN n 
1 280 SER n 
1 281 ILE n 
1 282 MET n 
1 283 LYS n 
1 284 CYS n 
1 285 ASP n 
1 286 VAL n 
1 287 ASP n 
1 288 ILE n 
1 289 ARG n 
1 290 LYS n 
1 291 ASP n 
1 292 LEU n 
1 293 TYR n 
1 294 ALA n 
1 295 ASN n 
1 296 THR n 
1 297 VAL n 
1 298 LEU n 
1 299 SER n 
1 300 GLY n 
1 301 GLY n 
1 302 THR n 
1 303 THR n 
1 304 MET n 
1 305 TYR n 
1 306 PRO n 
1 307 GLY n 
1 308 ILE n 
1 309 ALA n 
1 310 ASP n 
1 311 ARG n 
1 312 MET n 
1 313 GLN n 
1 314 LYS n 
1 315 GLU n 
1 316 ILE n 
1 317 THR n 
1 318 ALA n 
1 319 LEU n 
1 320 ALA n 
1 321 PRO n 
1 322 SER n 
1 323 THR n 
1 324 MET n 
1 325 LYS n 
1 326 ILE n 
1 327 LYS n 
1 328 ILE n 
1 329 ILE n 
1 330 ALA n 
1 331 PRO n 
1 332 PRO n 
1 333 GLU n 
1 334 ARG n 
1 335 LYS n 
1 336 TYR n 
1 337 SER n 
1 338 VAL n 
1 339 TRP n 
1 340 ILE n 
1 341 GLY n 
1 342 GLY n 
1 343 SER n 
1 344 ILE n 
1 345 LEU n 
1 346 ALA n 
1 347 SER n 
1 348 LEU n 
1 349 SER n 
1 350 THR n 
1 351 PHE n 
1 352 GLN n 
1 353 GLN n 
1 354 MET n 
1 355 TRP n 
1 356 ILE n 
1 357 SER n 
1 358 LYS n 
1 359 GLN n 
1 360 GLU n 
1 361 TYR n 
1 362 ASP n 
1 363 GLU n 
1 364 SER n 
1 365 GLY n 
1 366 PRO n 
1 367 SER n 
1 368 ILE n 
1 369 VAL n 
1 370 HIS n 
1 371 ARG n 
1 372 LYS n 
1 373 CYS n 
1 374 PHE n 
2 1   ASP n 
2 2   VAL n 
2 3   GLU n 
2 4   THR n 
2 5   CYS n 
2 6   ARG n 
2 7   ASP n 
2 8   GLU n 
2 9   ARG n 
2 10  CYS n 
2 11  TYR n 
2 12  ARG n 
2 13  LEU n 
2 14  TRP n 
2 15  ILE n 
2 16  ASN n 
2 17  SER n 
2 18  LEU n 
2 19  GLY n 
2 20  ILE n 
2 21  ASP n 
2 22  SER n 
2 23  TYR n 
2 24  VAL n 
2 25  ASN n 
2 26  ASN n 
2 27  VAL n 
2 28  PHE n 
2 29  GLU n 
2 30  ASP n 
2 31  VAL n 
2 32  ARG n 
2 33  ASN n 
2 34  GLY n 
2 35  TRP n 
2 36  ILE n 
2 37  LEU n 
2 38  LEU n 
2 39  GLU n 
2 40  VAL n 
2 41  LEU n 
2 42  ASP n 
2 43  LYS n 
2 44  VAL n 
2 45  SER n 
2 46  PRO n 
2 47  SER n 
2 48  SER n 
2 49  VAL n 
2 50  ASN n 
2 51  TRP n 
2 52  LYS n 
2 53  HIS n 
2 54  ALA n 
2 55  SER n 
2 56  LYS n 
2 57  PRO n 
2 58  PRO n 
2 59  ILE n 
2 60  LYS n 
2 61  MET n 
2 62  PRO n 
2 63  PHE n 
2 64  ARG n 
2 65  LYS n 
2 66  VAL n 
2 67  GLU n 
2 68  ASN n 
2 69  CYS n 
2 70  ASN n 
2 71  GLN n 
2 72  VAL n 
2 73  ILE n 
2 74  LYS n 
2 75  ILE n 
2 76  GLY n 
2 77  LYS n 
2 78  GLN n 
2 79  LEU n 
2 80  LYS n 
2 81  PHE n 
2 82  SER n 
2 83  LEU n 
2 84  VAL n 
2 85  ASN n 
2 86  VAL n 
2 87  ALA n 
2 88  GLY n 
2 89  ASN n 
2 90  ASP n 
2 91  ILE n 
2 92  VAL n 
2 93  GLN n 
2 94  GLY n 
2 95  ASN n 
2 96  LYS n 
2 97  LYS n 
2 98  LEU n 
2 99  ILE n 
2 100 LEU n 
2 101 GLY n 
2 102 LEU n 
2 103 LEU n 
2 104 TRP n 
2 105 GLN n 
2 106 LEU n 
2 107 MET n 
2 108 ARG n 
2 109 PHE n 
2 110 HIS n 
2 111 MET n 
2 112 LEU n 
2 113 GLN n 
2 114 LEU n 
2 115 LEU n 
2 116 LYS n 
2 117 SER n 
2 118 LEU n 
2 119 ARG n 
2 120 SER n 
2 121 GLU n 
2 122 MET n 
2 123 THR n 
2 124 ASP n 
2 125 ALA n 
2 126 ASP n 
2 127 ILE n 
2 128 LEU n 
2 129 SER n 
2 130 TRP n 
2 131 ALA n 
2 132 ASN n 
2 133 ARG n 
2 134 LYS n 
2 135 VAL n 
2 136 ARG n 
2 137 THR n 
2 138 MET n 
2 139 GLY n 
2 140 ARG n 
2 141 LYS n 
2 142 LEU n 
2 143 GLN n 
2 144 ILE n 
2 145 GLU n 
2 146 SER n 
2 147 PHE n 
2 148 LYS n 
2 149 ASP n 
2 150 LYS n 
2 151 SER n 
2 152 LEU n 
2 153 SER n 
2 154 SER n 
2 155 GLY n 
2 156 LEU n 
2 157 PHE n 
2 158 PHE n 
2 159 LEU n 
2 160 ASN n 
2 161 LEU n 
2 162 LEU n 
2 163 TRP n 
2 164 ALA n 
2 165 VAL n 
2 166 GLU n 
2 167 PRO n 
2 168 ARG n 
2 169 VAL n 
2 170 VAL n 
2 171 ASN n 
2 172 TRP n 
2 173 ASN n 
2 174 LEU n 
2 175 VAL n 
2 176 THR n 
2 177 LYS n 
2 178 GLY n 
2 179 GLU n 
2 180 THR n 
2 181 ASP n 
2 182 ASP n 
2 183 GLU n 
2 184 LYS n 
2 185 ARG n 
2 186 LEU n 
2 187 ASN n 
2 188 ALA n 
2 189 THR n 
2 190 TYR n 
2 191 ILE n 
2 192 VAL n 
2 193 SER n 
2 194 VAL n 
2 195 ALA n 
2 196 ARG n 
2 197 LYS n 
2 198 LEU n 
2 199 GLY n 
2 200 CYS n 
2 201 SER n 
2 202 VAL n 
2 203 PHE n 
2 204 LEU n 
2 205 LEU n 
2 206 PRO n 
2 207 GLU n 
2 208 ASP n 
2 209 ILE n 
2 210 VAL n 
2 211 GLU n 
2 212 VAL n 
2 213 ASN n 
2 214 GLN n 
2 215 LYS n 
2 216 MET n 
2 217 ILE n 
2 218 LEU n 
2 219 ILE n 
2 220 LEU n 
2 221 THR n 
2 222 ALA n 
2 223 SER n 
2 224 ILE n 
2 225 MET n 
2 226 TYR n 
2 227 TRP n 
2 228 SER n 
2 229 LEU n 
2 230 GLN n 
2 231 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo PS1TP5BP1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ?         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q1KLZ0_HUMAN Q1KLZ0 1 
;DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD
MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTH
TVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE
LPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA
PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
2 ? 
2 PDB 3BYH         3BYH   2 
;DVETCRDERCYRLWINSLGIDSYVNNVFEDVRNGWILLEVLDKVSPSSVNWKHASKPPIKMPFRKVENCNQVIKIGKQLK
FSLVNVAGNDIVQGNKKLILGLLWQLMRFHMLQLLKSLRSEMTDADILSWANRKVRTMGRKLQIESFKDKSLSSGLFFLN
LLWAVEPRVVNWNLVTKGETDDEKRLNATYIVSVARKLGCSVFLLPEDIVEVNQKMILILTASIMYWSLQR
;
? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BYH A 1 ? 374 ? Q1KLZ0 2   ? 375 ? 2   375 
2 2 3BYH B 1 ? 231 ? 3BYH   388 ? 623 ? 388 623 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3BYH 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4795 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4795 
_refine_hist.d_res_high                       . 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  3BYH 
_struct.title                     'Model of actin-fimbrin ABD2 complex' 
_struct.pdbx_descriptor           'Actin, fimbrin ABD2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BYH 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            
;helical filament, protein polymer, Acetylation, ATP-binding, Cytoplasm, Cytoskeleton, Methylation, Nucleotide-binding, Phosphoprotein, Structural protein
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 55  ? LEU A 64  ? ASP A 56  LEU A 65  5 ? 10 
HELX_P HELX_P2  2  ASN A 77  ? ASN A 91  ? ASN A 78  ASN A 92  1 ? 15 
HELX_P HELX_P3  3  ALA A 96  ? HIS A 100 ? ALA A 97  HIS A 101 5 ? 5  
HELX_P HELX_P4  4  PRO A 111 ? ASN A 127 ? PRO A 112 ASN A 128 1 ? 17 
HELX_P HELX_P5  5  GLN A 136 ? SER A 144 ? GLN A 137 SER A 145 1 ? 9  
HELX_P HELX_P6  6  PRO A 171 ? ILE A 174 ? PRO A 172 ILE A 175 5 ? 4  
HELX_P HELX_P7  7  ALA A 180 ? ARG A 195 ? ALA A 181 ARG A 196 1 ? 16 
HELX_P HELX_P8  8  THR A 201 ? ARG A 205 ? THR A 202 ARG A 206 5 ? 5  
HELX_P HELX_P9  9  GLU A 206 ? CYS A 216 ? GLU A 207 CYS A 217 1 ? 11 
HELX_P HELX_P10 10 ASP A 221 ? SER A 231 ? ASP A 222 SER A 232 1 ? 11 
HELX_P HELX_P11 11 ASN A 251 ? CYS A 256 ? ASN A 252 CYS A 257 1 ? 6  
HELX_P HELX_P12 12 PRO A 257 ? LEU A 260 ? PRO A 258 LEU A 261 5 ? 4  
HELX_P HELX_P13 13 GLY A 272 ? MET A 282 ? GLY A 273 MET A 283 1 ? 11 
HELX_P HELX_P14 14 ILE A 288 ? ASN A 295 ? ILE A 289 ASN A 296 1 ? 8  
HELX_P HELX_P15 15 GLY A 300 ? MET A 304 ? GLY A 301 MET A 305 5 ? 5  
HELX_P HELX_P16 16 GLY A 307 ? ALA A 320 ? GLY A 308 ALA A 321 1 ? 14 
HELX_P HELX_P17 17 TYR A 336 ? ALA A 346 ? TYR A 337 ALA A 347 1 ? 11 
HELX_P HELX_P18 18 SER A 347 ? GLN A 353 ? SER A 348 GLN A 354 5 ? 7  
HELX_P HELX_P19 19 LYS A 358 ? GLY A 365 ? LYS A 359 GLY A 366 1 ? 8  
HELX_P HELX_P20 20 ILE A 368 ? CYS A 373 ? ILE A 369 CYS A 374 1 ? 6  
HELX_P HELX_P21 21 VAL B 2   ? ASN B 16  ? VAL B 389 ASN B 403 1 ? 15 
HELX_P HELX_P22 22 ASN B 26  ? VAL B 31  ? ASN B 413 VAL B 418 1 ? 6  
HELX_P HELX_P23 23 GLY B 34  ? SER B 45  ? GLY B 421 SER B 432 1 ? 12 
HELX_P HELX_P24 24 ASN B 50  ? ALA B 54  ? ASN B 437 ALA B 441 5 ? 5  
HELX_P HELX_P25 25 MET B 61  ? LEU B 79  ? MET B 448 LEU B 466 1 ? 19 
HELX_P HELX_P26 26 ALA B 87  ? GLN B 93  ? ALA B 474 GLN B 480 1 ? 7  
HELX_P HELX_P27 27 ASN B 95  ? SER B 117 ? ASN B 482 SER B 504 1 ? 23 
HELX_P HELX_P28 28 THR B 123 ? THR B 137 ? THR B 515 THR B 529 1 ? 15 
HELX_P HELX_P29 29 ASP B 149 ? SER B 154 ? ASP B 541 SER B 546 5 ? 6  
HELX_P HELX_P30 30 GLY B 155 ? GLU B 166 ? GLY B 547 GLU B 558 1 ? 12 
HELX_P HELX_P31 31 PRO B 167 ? VAL B 170 ? PRO B 559 VAL B 562 5 ? 4  
HELX_P HELX_P32 32 THR B 180 ? GLY B 199 ? THR B 572 GLY B 591 1 ? 20 
HELX_P HELX_P33 33 LEU B 205 ? GLU B 211 ? LEU B 597 GLU B 603 1 ? 7  
HELX_P HELX_P34 34 ASN B 213 ? LEU B 229 ? ASN B 605 LEU B 621 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PRO 
_struct_mon_prot_cis.label_seq_id           57 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PRO 
_struct_mon_prot_cis.auth_seq_id            444 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    58 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     445 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.44 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 5 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 28  ? PRO A 31  ? ALA A 29  PRO A 32  
A 2 MET A 15  ? PHE A 20  ? MET A 16  PHE A 21  
A 3 LEU A 7   ? ASN A 11  ? LEU A 8   ASN A 12  
A 4 VAL A 102 ? GLU A 106 ? VAL A 103 GLU A 107 
A 5 ALA A 130 ? ILE A 135 ? ALA A 131 ILE A 136 
A 6 ILE A 356 ? SER A 357 ? ILE A 357 SER A 358 
B 1 TYR A 52  ? VAL A 53  ? TYR A 53  VAL A 54  
B 2 VAL A 34  ? ARG A 36  ? VAL A 35  ARG A 37  
B 3 THR A 65  ? LYS A 67  ? THR A 66  LYS A 68  
C 1 ILE A 70  ? GLU A 71  ? ILE A 71  GLU A 72  
C 2 ILE A 74  ? VAL A 75  ? ILE A 75  VAL A 76  
D 1 TYR A 168 ? ALA A 169 ? TYR A 169 ALA A 170 
D 2 THR A 159 ? TYR A 165 ? THR A 160 TYR A 166 
D 3 LEU A 175 ? LEU A 177 ? LEU A 176 LEU A 178 
E 1 TYR A 168 ? ALA A 169 ? TYR A 169 ALA A 170 
E 2 THR A 159 ? TYR A 165 ? THR A 160 TYR A 166 
E 3 GLY A 149 ? SER A 154 ? GLY A 150 SER A 155 
E 4 THR A 296 ? SER A 299 ? THR A 297 SER A 300 
E 5 ILE A 328 ? ILE A 329 ? ILE A 329 ILE A 330 
F 1 LYS A 237 ? GLU A 240 ? LYS A 238 GLU A 241 
F 2 VAL A 246 ? ILE A 249 ? VAL A 247 ILE A 250 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 30  ? O PHE A 31  N CYS A 16  ? N CYS A 17  
A 2 3 O LYS A 17  ? O LYS A 18  N ASP A 10  ? N ASP A 11  
A 3 4 N VAL A 9   ? N VAL A 10  O LEU A 103 ? O LEU A 104 
A 4 5 N LEU A 104 ? N LEU A 105 O TYR A 132 ? O TYR A 133 
A 5 6 N MET A 131 ? N MET A 132 O ILE A 356 ? O ILE A 357 
B 1 2 O TYR A 52  ? O TYR A 53  N GLY A 35  ? N GLY A 36  
B 2 3 N VAL A 34  ? N VAL A 35  O LYS A 67  ? O LYS A 68  
C 1 2 N GLU A 71  ? N GLU A 72  O ILE A 74  ? O ILE A 75  
D 1 2 O TYR A 168 ? O TYR A 169 N TYR A 165 ? N TYR A 166 
D 2 3 N THR A 159 ? N THR A 160 O LEU A 177 ? O LEU A 178 
E 1 2 O TYR A 168 ? O TYR A 169 N TYR A 165 ? N TYR A 166 
E 2 3 O ILE A 164 ? O ILE A 165 N GLY A 149 ? N GLY A 150 
E 3 4 N MET A 152 ? N MET A 153 O SER A 299 ? O SER A 300 
E 4 5 N THR A 296 ? N THR A 297 O ILE A 329 ? O ILE A 330 
F 1 2 N LYS A 237 ? N LYS A 238 O ILE A 249 ? O ILE A 250 
# 
_database_PDB_matrix.entry_id          3BYH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3BYH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ASP A 1 1   ? -12.794 -43.675 228.683 1.00 30.00 ? 2   ASP A N   1 
ATOM 2    C CA  . ASP A 1 1   ? -12.201 -44.343 227.500 1.00 30.00 ? 2   ASP A CA  1 
ATOM 3    C C   . ASP A 1 1   ? -12.673 -43.877 226.077 1.00 30.00 ? 2   ASP A C   1 
ATOM 4    O O   . ASP A 1 1   ? -13.572 -44.409 225.404 1.00 30.00 ? 2   ASP A O   1 
ATOM 5    C CB  . ASP A 1 1   ? -12.385 -45.886 227.726 1.00 30.00 ? 2   ASP A CB  1 
ATOM 6    C CG  . ASP A 1 1   ? -12.034 -46.485 229.122 1.00 30.00 ? 2   ASP A CG  1 
ATOM 7    O OD1 . ASP A 1 1   ? -11.467 -45.745 229.953 1.00 30.00 ? 2   ASP A OD1 1 
ATOM 8    O OD2 . ASP A 1 1   ? -12.321 -47.684 229.373 1.00 30.00 ? 2   ASP A OD2 1 
ATOM 9    N N   . ASP A 1 2   ? -11.985 -42.793 225.656 1.00 30.00 ? 3   ASP A N   1 
ATOM 10   C CA  . ASP A 1 2   ? -12.098 -42.039 224.390 1.00 30.00 ? 3   ASP A CA  1 
ATOM 11   C C   . ASP A 1 2   ? -13.375 -41.247 224.240 1.00 30.00 ? 3   ASP A C   1 
ATOM 12   O O   . ASP A 1 2   ? -13.401 -40.039 223.982 1.00 30.00 ? 3   ASP A O   1 
ATOM 13   C CB  . ASP A 1 2   ? -11.984 -42.933 223.102 1.00 30.00 ? 3   ASP A CB  1 
ATOM 14   C CG  . ASP A 1 2   ? -12.157 -42.231 221.713 1.00 30.00 ? 3   ASP A CG  1 
ATOM 15   O OD1 . ASP A 1 2   ? -12.122 -40.980 221.611 1.00 30.00 ? 3   ASP A OD1 1 
ATOM 16   O OD2 . ASP A 1 2   ? -12.356 -42.967 220.714 1.00 30.00 ? 3   ASP A OD2 1 
ATOM 17   N N   . ASP A 1 3   ? -14.467 -41.962 224.250 1.00 30.00 ? 4   ASP A N   1 
ATOM 18   C CA  . ASP A 1 3   ? -15.733 -41.319 224.123 1.00 30.00 ? 4   ASP A CA  1 
ATOM 19   C C   . ASP A 1 3   ? -15.992 -41.422 225.601 1.00 30.00 ? 4   ASP A C   1 
ATOM 20   O O   . ASP A 1 3   ? -16.021 -42.479 226.253 1.00 30.00 ? 4   ASP A O   1 
ATOM 21   C CB  . ASP A 1 3   ? -16.604 -42.180 223.216 1.00 30.00 ? 4   ASP A CB  1 
ATOM 22   C CG  . ASP A 1 3   ? -16.684 -41.687 221.761 1.00 30.00 ? 4   ASP A CG  1 
ATOM 23   O OD1 . ASP A 1 3   ? -16.074 -40.654 221.403 1.00 30.00 ? 4   ASP A OD1 1 
ATOM 24   O OD2 . ASP A 1 3   ? -17.400 -42.356 220.995 1.00 30.00 ? 4   ASP A OD2 1 
ATOM 25   N N   . ILE A 1 4   ? -15.658 -40.174 225.937 1.00 30.00 ? 5   ILE A N   1 
ATOM 26   C CA  . ILE A 1 4   ? -15.649 -39.527 227.226 1.00 30.00 ? 5   ILE A CA  1 
ATOM 27   C C   . ILE A 1 4   ? -14.349 -39.655 227.980 1.00 30.00 ? 5   ILE A C   1 
ATOM 28   O O   . ILE A 1 4   ? -13.656 -40.642 228.249 1.00 30.00 ? 5   ILE A O   1 
ATOM 29   C CB  . ILE A 1 4   ? -16.857 -39.970 228.076 1.00 30.00 ? 5   ILE A CB  1 
ATOM 30   C CG1 . ILE A 1 4   ? -17.921 -38.994 227.521 1.00 30.00 ? 5   ILE A CG1 1 
ATOM 31   C CG2 . ILE A 1 4   ? -16.728 -39.914 229.610 1.00 30.00 ? 5   ILE A CG2 1 
ATOM 32   C CD1 . ILE A 1 4   ? -17.513 -37.480 227.579 1.00 30.00 ? 5   ILE A CD1 1 
ATOM 33   N N   . ALA A 1 5   ? -14.061 -38.371 227.760 1.00 30.00 ? 6   ALA A N   1 
ATOM 34   C CA  . ALA A 1 5   ? -12.793 -37.725 227.941 1.00 30.00 ? 6   ALA A CA  1 
ATOM 35   C C   . ALA A 1 5   ? -13.145 -36.313 227.452 1.00 30.00 ? 6   ALA A C   1 
ATOM 36   O O   . ALA A 1 5   ? -13.921 -36.094 226.492 1.00 30.00 ? 6   ALA A O   1 
ATOM 37   C CB  . ALA A 1 5   ? -11.694 -38.260 226.997 1.00 30.00 ? 6   ALA A CB  1 
ATOM 38   N N   . ALA A 1 6   ? -12.633 -35.368 228.230 1.00 30.00 ? 7   ALA A N   1 
ATOM 39   C CA  . ALA A 1 6   ? -12.669 -33.974 227.923 1.00 30.00 ? 7   ALA A CA  1 
ATOM 40   C C   . ALA A 1 6   ? -11.755 -33.785 226.714 1.00 30.00 ? 7   ALA A C   1 
ATOM 41   O O   . ALA A 1 6   ? -10.869 -34.606 226.434 1.00 30.00 ? 7   ALA A O   1 
ATOM 42   C CB  . ALA A 1 6   ? -12.143 -33.233 229.129 1.00 30.00 ? 7   ALA A CB  1 
ATOM 43   N N   . LEU A 1 7   ? -11.950 -32.716 225.969 1.00 30.00 ? 8   LEU A N   1 
ATOM 44   C CA  . LEU A 1 7   ? -11.100 -32.400 224.840 1.00 30.00 ? 8   LEU A CA  1 
ATOM 45   C C   . LEU A 1 7   ? -10.187 -31.291 225.339 1.00 30.00 ? 8   LEU A C   1 
ATOM 46   O O   . LEU A 1 7   ? -10.739 -30.265 225.791 1.00 30.00 ? 8   LEU A O   1 
ATOM 47   C CB  . LEU A 1 7   ? -11.894 -31.835 223.676 1.00 30.00 ? 8   LEU A CB  1 
ATOM 48   C CG  . LEU A 1 7   ? -13.276 -32.348 223.351 1.00 30.00 ? 8   LEU A CG  1 
ATOM 49   C CD1 . LEU A 1 7   ? -13.821 -31.548 222.199 1.00 30.00 ? 8   LEU A CD1 1 
ATOM 50   C CD2 . LEU A 1 7   ? -13.228 -33.797 223.034 1.00 30.00 ? 8   LEU A CD2 1 
ATOM 51   N N   . VAL A 1 8   ? -8.858  -31.403 225.352 1.00 30.00 ? 9   VAL A N   1 
ATOM 52   C CA  . VAL A 1 8   ? -8.080  -30.246 225.763 1.00 30.00 ? 9   VAL A CA  1 
ATOM 53   C C   . VAL A 1 8   ? -7.851  -29.354 224.520 1.00 30.00 ? 9   VAL A C   1 
ATOM 54   O O   . VAL A 1 8   ? -7.399  -29.857 223.482 1.00 30.00 ? 9   VAL A O   1 
ATOM 55   C CB  . VAL A 1 8   ? -6.732  -30.689 226.339 1.00 30.00 ? 9   VAL A CB  1 
ATOM 56   C CG1 . VAL A 1 8   ? -6.155  -29.484 227.121 1.00 30.00 ? 9   VAL A CG1 1 
ATOM 57   C CG2 . VAL A 1 8   ? -6.860  -31.888 227.213 1.00 30.00 ? 9   VAL A CG2 1 
ATOM 58   N N   . VAL A 1 9   ? -8.107  -28.055 224.501 1.00 30.00 ? 10  VAL A N   1 
ATOM 59   C CA  . VAL A 1 9   ? -7.898  -27.182 223.349 1.00 30.00 ? 10  VAL A CA  1 
ATOM 60   C C   . VAL A 1 9   ? -6.913  -26.144 223.883 1.00 30.00 ? 10  VAL A C   1 
ATOM 61   O O   . VAL A 1 9   ? -7.182  -25.387 224.850 1.00 30.00 ? 10  VAL A O   1 
ATOM 62   C CB  . VAL A 1 9   ? -9.240  -26.500 222.922 1.00 30.00 ? 10  VAL A CB  1 
ATOM 63   C CG1 . VAL A 1 9   ? -9.056  -25.429 221.893 1.00 30.00 ? 10  VAL A CG1 1 
ATOM 64   C CG2 . VAL A 1 9   ? -10.138 -27.529 222.278 1.00 30.00 ? 10  VAL A CG2 1 
ATOM 65   N N   . ASP A 1 10  ? -5.728  -26.115 223.279 1.00 30.00 ? 11  ASP A N   1 
ATOM 66   C CA  . ASP A 1 10  ? -4.744  -25.142 223.682 1.00 30.00 ? 11  ASP A CA  1 
ATOM 67   C C   . ASP A 1 10  ? -4.708  -24.157 222.570 1.00 30.00 ? 11  ASP A C   1 
ATOM 68   O O   . ASP A 1 10  ? -4.464  -24.553 221.443 1.00 30.00 ? 11  ASP A O   1 
ATOM 69   C CB  . ASP A 1 10  ? -3.382  -25.778 223.865 1.00 30.00 ? 11  ASP A CB  1 
ATOM 70   C CG  . ASP A 1 10  ? -2.282  -24.805 224.265 1.00 30.00 ? 11  ASP A CG  1 
ATOM 71   O OD1 . ASP A 1 10  ? -2.514  -23.678 224.696 1.00 30.00 ? 11  ASP A OD1 1 
ATOM 72   O OD2 . ASP A 1 10  ? -1.147  -25.203 224.123 1.00 30.00 ? 11  ASP A OD2 1 
ATOM 73   N N   . ASN A 1 11  ? -4.948  -22.900 222.904 1.00 30.00 ? 12  ASN A N   1 
ATOM 74   C CA  . ASN A 1 11  ? -5.101  -21.796 221.943 1.00 30.00 ? 12  ASN A CA  1 
ATOM 75   C C   . ASN A 1 11  ? -3.924  -20.886 221.932 1.00 30.00 ? 12  ASN A C   1 
ATOM 76   O O   . ASN A 1 11  ? -3.828  -20.000 222.804 1.00 30.00 ? 12  ASN A O   1 
ATOM 77   C CB  . ASN A 1 11  ? -6.260  -20.857 222.223 1.00 30.00 ? 12  ASN A CB  1 
ATOM 78   C CG  . ASN A 1 11  ? -7.512  -21.667 222.262 1.00 30.00 ? 12  ASN A CG  1 
ATOM 79   O OD1 . ASN A 1 11  ? -8.060  -22.037 221.221 1.00 30.00 ? 12  ASN A OD1 1 
ATOM 80   N ND2 . ASN A 1 11  ? -7.919  -22.001 223.494 1.00 30.00 ? 12  ASN A ND2 1 
ATOM 81   N N   . GLY A 1 12  ? -3.030  -21.217 220.998 1.00 30.00 ? 13  GLY A N   1 
ATOM 82   C CA  . GLY A 1 12  ? -1.842  -20.440 220.801 1.00 30.00 ? 13  GLY A CA  1 
ATOM 83   C C   . GLY A 1 12  ? -1.993  -19.460 219.644 1.00 30.00 ? 13  GLY A C   1 
ATOM 84   O O   . GLY A 1 12  ? -2.757  -19.651 218.678 1.00 30.00 ? 13  GLY A O   1 
ATOM 85   N N   . SER A 1 13  ? -1.204  -18.398 219.846 1.00 30.00 ? 14  SER A N   1 
ATOM 86   C CA  . SER A 1 13  ? -0.972  -17.331 218.894 1.00 30.00 ? 14  SER A CA  1 
ATOM 87   C C   . SER A 1 13  ? -0.462  -17.833 217.530 1.00 30.00 ? 14  SER A C   1 
ATOM 88   O O   . SER A 1 13  ? -0.838  -17.346 216.476 1.00 30.00 ? 14  SER A O   1 
ATOM 89   C CB  . SER A 1 13  ? 0.042   -16.375 219.495 1.00 30.00 ? 14  SER A CB  1 
ATOM 90   O OG  . SER A 1 13  ? -0.315  -15.838 220.767 1.00 30.00 ? 14  SER A OG  1 
ATOM 91   N N   . GLY A 1 14  ? 0.444   -18.780 217.489 1.00 30.00 ? 15  GLY A N   1 
ATOM 92   C CA  . GLY A 1 14  ? 0.881   -19.321 216.234 1.00 30.00 ? 15  GLY A CA  1 
ATOM 93   C C   . GLY A 1 14  ? 0.278   -20.667 215.901 1.00 30.00 ? 15  GLY A C   1 
ATOM 94   O O   . GLY A 1 14  ? -0.032  -20.912 214.736 1.00 30.00 ? 15  GLY A O   1 
ATOM 95   N N   . MET A 1 15  ? 0.037   -21.484 216.923 1.00 30.00 ? 16  MET A N   1 
ATOM 96   C CA  . MET A 1 15  ? -0.374  -22.869 216.825 1.00 30.00 ? 16  MET A CA  1 
ATOM 97   C C   . MET A 1 15  ? -1.506  -23.253 217.791 1.00 30.00 ? 16  MET A C   1 
ATOM 98   O O   . MET A 1 15  ? -1.587  -22.759 218.911 1.00 30.00 ? 16  MET A O   1 
ATOM 99   C CB  . MET A 1 15  ? 0.841   -23.729 217.113 1.00 30.00 ? 16  MET A CB  1 
ATOM 100  C CG  . MET A 1 15  ? 2.022   -23.700 216.175 1.00 30.00 ? 16  MET A CG  1 
ATOM 101  S SD  . MET A 1 15  ? 1.459   -24.213 214.520 1.00 30.00 ? 16  MET A SD  1 
ATOM 102  C CE  . MET A 1 15  ? 1.400   -25.983 214.529 1.00 30.00 ? 16  MET A CE  1 
ATOM 103  N N   . CYS A 1 16  ? -2.408  -24.155 217.432 1.00 30.00 ? 17  CYS A N   1 
ATOM 104  C CA  . CYS A 1 16  ? -3.455  -24.651 218.309 1.00 30.00 ? 17  CYS A CA  1 
ATOM 105  C C   . CYS A 1 16  ? -3.176  -26.132 218.392 1.00 30.00 ? 17  CYS A C   1 
ATOM 106  O O   . CYS A 1 16  ? -2.790  -26.712 217.378 1.00 30.00 ? 17  CYS A O   1 
ATOM 107  C CB  . CYS A 1 16  ? -4.896  -24.511 217.753 1.00 30.00 ? 17  CYS A CB  1 
ATOM 108  S SG  . CYS A 1 16  ? -5.708  -22.880 217.693 1.00 30.00 ? 17  CYS A SG  1 
ATOM 109  N N   . LYS A 1 17  ? -3.352  -26.786 219.529 1.00 30.00 ? 18  LYS A N   1 
ATOM 110  C CA  . LYS A 1 17  ? -3.124  -28.219 219.692 1.00 30.00 ? 18  LYS A CA  1 
ATOM 111  C C   . LYS A 1 17  ? -4.369  -28.647 220.462 1.00 30.00 ? 18  LYS A C   1 
ATOM 112  O O   . LYS A 1 17  ? -4.814  -27.969 221.402 1.00 30.00 ? 18  LYS A O   1 
ATOM 113  C CB  . LYS A 1 17  ? -1.850  -28.564 220.543 1.00 30.00 ? 18  LYS A CB  1 
ATOM 114  C CG  . LYS A 1 17  ? -0.871  -27.482 221.073 1.00 30.00 ? 18  LYS A CG  1 
ATOM 115  C CD  . LYS A 1 17  ? -0.043  -26.724 220.034 1.00 30.00 ? 18  LYS A CD  1 
ATOM 116  C CE  . LYS A 1 17  ? 0.788   -25.595 220.615 1.00 30.00 ? 18  LYS A CE  1 
ATOM 117  N NZ  . LYS A 1 17  ? -0.059  -24.443 220.787 1.00 30.00 ? 18  LYS A NZ  1 
ATOM 118  N N   . ALA A 1 18  ? -5.020  -29.710 219.988 1.00 30.00 ? 19  ALA A N   1 
ATOM 119  C CA  . ALA A 1 18  ? -6.290  -30.177 220.509 1.00 30.00 ? 19  ALA A CA  1 
ATOM 120  C C   . ALA A 1 18  ? -6.334  -31.683 220.547 1.00 30.00 ? 19  ALA A C   1 
ATOM 121  O O   . ALA A 1 18  ? -5.857  -32.370 219.647 1.00 30.00 ? 19  ALA A O   1 
ATOM 122  C CB  . ALA A 1 18  ? -7.431  -29.731 219.660 1.00 30.00 ? 19  ALA A CB  1 
ATOM 123  N N   . GLY A 1 19  ? -6.829  -32.251 221.615 1.00 30.00 ? 20  GLY A N   1 
ATOM 124  C CA  . GLY A 1 19  ? -6.840  -33.684 221.715 1.00 30.00 ? 20  GLY A CA  1 
ATOM 125  C C   . GLY A 1 19  ? -7.759  -34.125 222.825 1.00 30.00 ? 20  GLY A C   1 
ATOM 126  O O   . GLY A 1 19  ? -8.648  -33.387 223.286 1.00 30.00 ? 20  GLY A O   1 
ATOM 127  N N   . PHE A 1 20  ? -7.450  -35.329 223.276 1.00 30.00 ? 21  PHE A N   1 
ATOM 128  C CA  . PHE A 1 20  ? -8.307  -35.948 224.237 1.00 30.00 ? 21  PHE A CA  1 
ATOM 129  C C   . PHE A 1 20  ? -7.539  -36.196 225.512 1.00 30.00 ? 21  PHE A C   1 
ATOM 130  O O   . PHE A 1 20  ? -6.381  -36.636 225.501 1.00 30.00 ? 21  PHE A O   1 
ATOM 131  C CB  . PHE A 1 20  ? -8.849  -37.255 223.667 1.00 30.00 ? 21  PHE A CB  1 
ATOM 132  C CG  . PHE A 1 20  ? -9.851  -37.130 222.530 1.00 30.00 ? 21  PHE A CG  1 
ATOM 133  C CD1 . PHE A 1 20  ? -10.693 -36.057 222.387 1.00 30.00 ? 21  PHE A CD1 1 
ATOM 134  C CD2 . PHE A 1 20  ? -9.914  -38.102 221.570 1.00 30.00 ? 21  PHE A CD2 1 
ATOM 135  C CE1 . PHE A 1 20  ? -11.560 -35.969 221.304 1.00 30.00 ? 21  PHE A CE1 1 
ATOM 136  C CE2 . PHE A 1 20  ? -10.781 -38.012 220.494 1.00 30.00 ? 21  PHE A CE2 1 
ATOM 137  C CZ  . PHE A 1 20  ? -11.611 -36.941 220.354 1.00 30.00 ? 21  PHE A CZ  1 
ATOM 138  N N   . ALA A 1 21  ? -8.216  -35.855 226.615 1.00 30.00 ? 22  ALA A N   1 
ATOM 139  C CA  . ALA A 1 21  ? -7.644  -36.039 227.933 1.00 30.00 ? 22  ALA A CA  1 
ATOM 140  C C   . ALA A 1 21  ? -7.466  -37.531 228.144 1.00 30.00 ? 22  ALA A C   1 
ATOM 141  O O   . ALA A 1 21  ? -8.263  -38.354 227.685 1.00 30.00 ? 22  ALA A O   1 
ATOM 142  C CB  . ALA A 1 21  ? -8.553  -35.478 229.006 1.00 30.00 ? 22  ALA A CB  1 
ATOM 143  N N   . GLY A 1 22  ? -6.286  -37.768 228.746 1.00 30.00 ? 23  GLY A N   1 
ATOM 144  C CA  . GLY A 1 22  ? -5.728  -39.081 228.971 1.00 30.00 ? 23  GLY A CA  1 
ATOM 145  C C   . GLY A 1 22  ? -4.671  -39.398 227.923 1.00 30.00 ? 23  GLY A C   1 
ATOM 146  O O   . GLY A 1 22  ? -4.033  -40.456 227.997 1.00 30.00 ? 23  GLY A O   1 
ATOM 147  N N   . ASP A 1 23  ? -4.452  -38.539 226.917 1.00 30.00 ? 24  ASP A N   1 
ATOM 148  C CA  . ASP A 1 23  ? -3.466  -38.799 225.873 1.00 30.00 ? 24  ASP A CA  1 
ATOM 149  C C   . ASP A 1 23  ? -2.146  -38.051 226.060 1.00 30.00 ? 24  ASP A C   1 
ATOM 150  O O   . ASP A 1 23  ? -1.951  -36.932 226.560 1.00 30.00 ? 24  ASP A O   1 
ATOM 151  C CB  . ASP A 1 23  ? -3.967  -38.424 224.487 1.00 30.00 ? 24  ASP A CB  1 
ATOM 152  C CG  . ASP A 1 23  ? -5.115  -39.196 223.837 1.00 30.00 ? 24  ASP A CG  1 
ATOM 153  O OD1 . ASP A 1 23  ? -5.334  -40.364 224.131 1.00 30.00 ? 24  ASP A OD1 1 
ATOM 154  O OD2 . ASP A 1 23  ? -5.782  -38.634 222.967 1.00 30.00 ? 24  ASP A OD2 1 
ATOM 155  N N   . ASP A 1 24  ? -1.196  -38.810 225.575 1.00 30.00 ? 25  ASP A N   1 
ATOM 156  C CA  . ASP A 1 24  ? 0.193   -38.429 225.551 1.00 30.00 ? 25  ASP A CA  1 
ATOM 157  C C   . ASP A 1 24  ? 0.453   -37.229 224.620 1.00 30.00 ? 25  ASP A C   1 
ATOM 158  O O   . ASP A 1 24  ? 1.087   -36.266 225.031 1.00 30.00 ? 25  ASP A O   1 
ATOM 159  C CB  . ASP A 1 24  ? 0.947   -39.770 225.183 1.00 30.00 ? 25  ASP A CB  1 
ATOM 160  C CG  . ASP A 1 24  ? 0.969   -40.834 226.334 1.00 30.00 ? 25  ASP A CG  1 
ATOM 161  O OD1 . ASP A 1 24  ? 1.111   -40.457 227.495 1.00 30.00 ? 25  ASP A OD1 1 
ATOM 162  O OD2 . ASP A 1 24  ? 0.880   -42.050 226.112 1.00 30.00 ? 25  ASP A OD2 1 
ATOM 163  N N   . ALA A 1 25  ? -0.018  -37.126 223.384 1.00 30.00 ? 26  ALA A N   1 
ATOM 164  C CA  . ALA A 1 25  ? 0.313   -35.948 222.579 1.00 30.00 ? 26  ALA A CA  1 
ATOM 165  C C   . ALA A 1 25  ? -0.913  -35.335 221.933 1.00 30.00 ? 26  ALA A C   1 
ATOM 166  O O   . ALA A 1 25  ? -1.931  -36.018 221.805 1.00 30.00 ? 26  ALA A O   1 
ATOM 167  C CB  . ALA A 1 25  ? 1.302   -36.366 221.512 1.00 30.00 ? 26  ALA A CB  1 
ATOM 168  N N   . PRO A 1 26  ? -0.941  -34.076 221.547 1.00 30.00 ? 27  PRO A N   1 
ATOM 169  C CA  . PRO A 1 26  ? -1.998  -33.499 220.730 1.00 30.00 ? 27  PRO A CA  1 
ATOM 170  C C   . PRO A 1 26  ? -2.377  -34.277 219.487 1.00 30.00 ? 27  PRO A C   1 
ATOM 171  O O   . PRO A 1 26  ? -1.445  -34.582 218.738 1.00 30.00 ? 27  PRO A O   1 
ATOM 172  C CB  . PRO A 1 26  ? -1.503  -32.123 220.385 1.00 30.00 ? 27  PRO A CB  1 
ATOM 173  C CG  . PRO A 1 26  ? -0.032  -32.207 220.616 1.00 30.00 ? 27  PRO A CG  1 
ATOM 174  C CD  . PRO A 1 26  ? 0.035   -33.064 221.874 1.00 30.00 ? 27  PRO A CD  1 
ATOM 175  N N   . ARG A 1 27  ? -3.656  -34.578 219.207 1.00 30.00 ? 28  ARG A N   1 
ATOM 176  C CA  . ARG A 1 27  ? -4.026  -35.251 217.967 1.00 30.00 ? 28  ARG A CA  1 
ATOM 177  C C   . ARG A 1 27  ? -4.079  -34.278 216.806 1.00 30.00 ? 28  ARG A C   1 
ATOM 178  O O   . ARG A 1 27  ? -3.878  -34.703 215.671 1.00 30.00 ? 28  ARG A O   1 
ATOM 179  C CB  . ARG A 1 27  ? -5.404  -35.908 217.998 1.00 30.00 ? 28  ARG A CB  1 
ATOM 180  C CG  . ARG A 1 27  ? -5.592  -37.270 218.641 1.00 30.00 ? 28  ARG A CG  1 
ATOM 181  C CD  . ARG A 1 27  ? -6.871  -37.312 219.502 1.00 30.00 ? 28  ARG A CD  1 
ATOM 182  N NE  . ARG A 1 27  ? -6.945  -38.576 220.237 1.00 30.00 ? 28  ARG A NE  1 
ATOM 183  C CZ  . ARG A 1 27  ? -7.650  -39.640 219.783 1.00 30.00 ? 28  ARG A CZ  1 
ATOM 184  N NH1 . ARG A 1 27  ? -8.375  -39.567 218.630 1.00 30.00 ? 28  ARG A NH1 1 
ATOM 185  N NH2 . ARG A 1 27  ? -7.666  -40.770 220.529 1.00 30.00 ? 28  ARG A NH2 1 
ATOM 186  N N   . ALA A 1 28  ? -4.417  -33.006 216.995 1.00 30.00 ? 29  ALA A N   1 
ATOM 187  C CA  . ALA A 1 28  ? -4.496  -32.067 215.899 1.00 30.00 ? 29  ALA A CA  1 
ATOM 188  C C   . ALA A 1 28  ? -3.624  -30.910 216.279 1.00 30.00 ? 29  ALA A C   1 
ATOM 189  O O   . ALA A 1 28  ? -3.934  -30.236 217.280 1.00 30.00 ? 29  ALA A O   1 
ATOM 190  C CB  . ALA A 1 28  ? -5.844  -31.463 215.712 1.00 30.00 ? 29  ALA A CB  1 
ATOM 191  N N   . VAL A 1 29  ? -2.515  -30.650 215.573 1.00 30.00 ? 30  VAL A N   1 
ATOM 192  C CA  . VAL A 1 29  ? -1.797  -29.430 215.883 1.00 30.00 ? 30  VAL A CA  1 
ATOM 193  C C   . VAL A 1 29  ? -2.057  -28.559 214.660 1.00 30.00 ? 30  VAL A C   1 
ATOM 194  O O   . VAL A 1 29  ? -1.953  -29.136 213.573 1.00 30.00 ? 30  VAL A O   1 
ATOM 195  C CB  . VAL A 1 29  ? -0.364  -29.852 216.103 1.00 30.00 ? 30  VAL A CB  1 
ATOM 196  C CG1 . VAL A 1 29  ? 0.471   -28.678 216.546 1.00 30.00 ? 30  VAL A CG1 1 
ATOM 197  C CG2 . VAL A 1 29  ? -0.321  -30.881 217.201 1.00 30.00 ? 30  VAL A CG2 1 
ATOM 198  N N   . PHE A 1 30  ? -2.490  -27.295 214.644 1.00 30.00 ? 31  PHE A N   1 
ATOM 199  C CA  . PHE A 1 30  ? -2.651  -26.631 213.369 1.00 30.00 ? 31  PHE A CA  1 
ATOM 200  C C   . PHE A 1 30  ? -2.282  -25.210 213.447 1.00 30.00 ? 31  PHE A C   1 
ATOM 201  O O   . PHE A 1 30  ? -2.201  -24.730 214.562 1.00 30.00 ? 31  PHE A O   1 
ATOM 202  C CB  . PHE A 1 30  ? -4.058  -26.653 212.801 1.00 30.00 ? 31  PHE A CB  1 
ATOM 203  C CG  . PHE A 1 30  ? -5.231  -26.560 213.744 1.00 30.00 ? 31  PHE A CG  1 
ATOM 204  C CD1 . PHE A 1 30  ? -5.617  -27.691 214.448 1.00 30.00 ? 31  PHE A CD1 1 
ATOM 205  C CD2 . PHE A 1 30  ? -5.908  -25.366 213.890 1.00 30.00 ? 31  PHE A CD2 1 
ATOM 206  C CE1 . PHE A 1 30  ? -6.664  -27.658 215.301 1.00 30.00 ? 31  PHE A CE1 1 
ATOM 207  C CE2 . PHE A 1 30  ? -6.976  -25.343 214.763 1.00 30.00 ? 31  PHE A CE2 1 
ATOM 208  C CZ  . PHE A 1 30  ? -7.335  -26.483 215.451 1.00 30.00 ? 31  PHE A CZ  1 
ATOM 209  N N   . PRO A 1 31  ? -1.946  -24.548 212.330 1.00 30.00 ? 32  PRO A N   1 
ATOM 210  C CA  . PRO A 1 31  ? -1.807  -23.094 212.197 1.00 30.00 ? 32  PRO A CA  1 
ATOM 211  C C   . PRO A 1 31  ? -2.971  -22.224 212.703 1.00 30.00 ? 32  PRO A C   1 
ATOM 212  O O   . PRO A 1 31  ? -4.137  -22.470 212.306 1.00 30.00 ? 32  PRO A O   1 
ATOM 213  C CB  . PRO A 1 31  ? -1.514  -22.956 210.691 1.00 30.00 ? 32  PRO A CB  1 
ATOM 214  C CG  . PRO A 1 31  ? -0.629  -24.137 210.386 1.00 30.00 ? 32  PRO A CG  1 
ATOM 215  C CD  . PRO A 1 31  ? -1.352  -25.206 211.152 1.00 30.00 ? 32  PRO A CD  1 
ATOM 216  N N   . SER A 1 32  ? -2.734  -21.198 213.548 1.00 30.00 ? 33  SER A N   1 
ATOM 217  C CA  . SER A 1 32  ? -3.857  -20.365 213.998 1.00 30.00 ? 33  SER A CA  1 
ATOM 218  C C   . SER A 1 32  ? -4.165  -19.170 213.082 1.00 30.00 ? 33  SER A C   1 
ATOM 219  O O   . SER A 1 32  ? -3.972  -17.978 213.376 1.00 30.00 ? 33  SER A O   1 
ATOM 220  C CB  . SER A 1 32  ? -3.647  -19.829 215.449 1.00 30.00 ? 33  SER A CB  1 
ATOM 221  O OG  . SER A 1 32  ? -3.982  -20.766 216.473 1.00 30.00 ? 33  SER A OG  1 
ATOM 222  N N   . ILE A 1 33  ? -1.508  -19.345 212.958 1.00 30.00 ? 34  ILE A N   1 
ATOM 223  C CA  . ILE A 1 33  ? -2.185  -18.129 212.585 1.00 30.00 ? 34  ILE A CA  1 
ATOM 224  C C   . ILE A 1 33  ? -3.616  -18.368 212.081 1.00 30.00 ? 34  ILE A C   1 
ATOM 225  O O   . ILE A 1 33  ? -3.941  -19.476 211.602 1.00 30.00 ? 34  ILE A O   1 
ATOM 226  C CB  . ILE A 1 33  ? -1.354  -17.367 211.512 1.00 30.00 ? 34  ILE A CB  1 
ATOM 227  C CG1 . ILE A 1 33  ? 0.113   -17.759 211.318 1.00 30.00 ? 34  ILE A CG1 1 
ATOM 228  C CG2 . ILE A 1 33  ? -1.288  -15.965 212.083 1.00 30.00 ? 34  ILE A CG2 1 
ATOM 229  C CD1 . ILE A 1 33  ? 0.212   -18.793 210.214 1.00 30.00 ? 34  ILE A CD1 1 
ATOM 230  N N   . VAL A 1 34  ? -4.486  -17.367 212.325 1.00 30.00 ? 35  VAL A N   1 
ATOM 231  C CA  . VAL A 1 34  ? -5.863  -17.283 211.814 1.00 30.00 ? 35  VAL A CA  1 
ATOM 232  C C   . VAL A 1 34  ? -5.805  -16.141 210.825 1.00 30.00 ? 35  VAL A C   1 
ATOM 233  O O   . VAL A 1 34  ? -5.340  -15.036 211.157 1.00 30.00 ? 35  VAL A O   1 
ATOM 234  C CB  . VAL A 1 34  ? -6.909  -16.903 212.892 1.00 30.00 ? 35  VAL A CB  1 
ATOM 235  C CG1 . VAL A 1 34  ? -8.212  -16.483 212.256 1.00 30.00 ? 35  VAL A CG1 1 
ATOM 236  C CG2 . VAL A 1 34  ? -7.259  -18.128 213.736 1.00 30.00 ? 35  VAL A CG2 1 
ATOM 237  N N   . GLY A 1 35  ? -6.318  -16.328 209.620 1.00 30.00 ? 36  GLY A N   1 
ATOM 238  C CA  . GLY A 1 35  ? -6.238  -15.274 208.634 1.00 30.00 ? 36  GLY A CA  1 
ATOM 239  C C   . GLY A 1 35  ? -7.595  -14.914 208.099 1.00 30.00 ? 36  GLY A C   1 
ATOM 240  O O   . GLY A 1 35  ? -8.248  -15.754 207.470 1.00 30.00 ? 36  GLY A O   1 
ATOM 241  N N   . ARG A 1 36  ? -8.050  -13.694 208.353 1.00 30.00 ? 37  ARG A N   1 
ATOM 242  C CA  . ARG A 1 36  ? -9.352  -13.253 207.823 1.00 30.00 ? 37  ARG A CA  1 
ATOM 243  C C   . ARG A 1 36  ? -9.099  -12.321 206.613 1.00 30.00 ? 37  ARG A C   1 
ATOM 244  O O   . ARG A 1 36  ? -8.191  -11.486 206.625 1.00 30.00 ? 37  ARG A O   1 
ATOM 245  C CB  . ARG A 1 36  ? -10.184 -12.576 209.004 1.00 30.00 ? 37  ARG A CB  1 
ATOM 246  C CG  . ARG A 1 36  ? -11.185 -11.395 208.795 1.00 30.00 ? 37  ARG A CG  1 
ATOM 247  C CD  . ARG A 1 36  ? -12.340 -11.459 207.747 1.00 30.00 ? 37  ARG A CD  1 
ATOM 248  N NE  . ARG A 1 36  ? -12.899 -10.109 207.531 1.00 30.00 ? 37  ARG A NE  1 
ATOM 249  C CZ  . ARG A 1 36  ? -13.441 -9.612  206.382 1.00 30.00 ? 37  ARG A CZ  1 
ATOM 250  N NH1 . ARG A 1 36  ? -13.554 -10.320 205.233 1.00 30.00 ? 37  ARG A NH1 1 
ATOM 251  N NH2 . ARG A 1 36  ? -13.850 -8.326  206.388 1.00 30.00 ? 37  ARG A NH2 1 
ATOM 252  N N   . PRO A 1 37  ? -9.815  -12.518 205.490 1.00 30.00 ? 38  PRO A N   1 
ATOM 253  C CA  . PRO A 1 37  ? -9.696  -11.738 204.275 1.00 30.00 ? 38  PRO A CA  1 
ATOM 254  C C   . PRO A 1 37  ? -9.582  -10.245 204.353 1.00 30.00 ? 38  PRO A C   1 
ATOM 255  O O   . PRO A 1 37  ? -8.949  -9.723  203.455 1.00 30.00 ? 38  PRO A O   1 
ATOM 256  C CB  . PRO A 1 37  ? -10.879 -12.188 203.479 1.00 30.00 ? 38  PRO A CB  1 
ATOM 257  C CG  . PRO A 1 37  ? -10.935 -13.682 203.715 1.00 30.00 ? 38  PRO A CG  1 
ATOM 258  C CD  . PRO A 1 37  ? -10.550 -13.763 205.191 1.00 30.00 ? 38  PRO A CD  1 
ATOM 259  N N   . ARG A 1 38  ? -10.100 -9.469  205.315 1.00 30.00 ? 39  ARG A N   1 
ATOM 260  C CA  . ARG A 1 38  ? -10.014 -7.992  205.294 1.00 30.00 ? 39  ARG A CA  1 
ATOM 261  C C   . ARG A 1 38  ? -10.348 -7.384  203.900 1.00 30.00 ? 39  ARG A C   1 
ATOM 262  O O   . ARG A 1 38  ? -9.759  -6.406  203.399 1.00 30.00 ? 39  ARG A O   1 
ATOM 263  C CB  . ARG A 1 38  ? -8.583  -7.583  205.765 1.00 30.00 ? 39  ARG A CB  1 
ATOM 264  C CG  . ARG A 1 38  ? -8.218  -6.114  206.111 1.00 30.00 ? 39  ARG A CG  1 
ATOM 265  C CD  . ARG A 1 38  ? -6.807  -5.795  205.539 1.00 30.00 ? 39  ARG A CD  1 
ATOM 266  N NE  . ARG A 1 38  ? -6.022  -4.816  206.320 1.00 30.00 ? 39  ARG A NE  1 
ATOM 267  C CZ  . ARG A 1 38  ? -5.163  -3.935  205.766 1.00 30.00 ? 39  ARG A CZ  1 
ATOM 268  N NH1 . ARG A 1 38  ? -4.956  -3.864  204.445 1.00 30.00 ? 39  ARG A NH1 1 
ATOM 269  N NH2 . ARG A 1 38  ? -4.485  -3.108  206.565 1.00 30.00 ? 39  ARG A NH2 1 
ATOM 270  N N   . HIS A 1 39  ? -11.291 -8.105  203.248 1.00 30.00 ? 40  HIS A N   1 
ATOM 271  C CA  . HIS A 1 39  ? -11.952 -7.895  201.957 1.00 30.00 ? 40  HIS A CA  1 
ATOM 272  C C   . HIS A 1 39  ? -12.747 -9.158  201.799 1.00 30.00 ? 40  HIS A C   1 
ATOM 273  O O   . HIS A 1 39  ? -12.136 -10.207 201.626 1.00 30.00 ? 40  HIS A O   1 
ATOM 274  C CB  . HIS A 1 39  ? -11.121 -7.908  200.674 1.00 30.00 ? 40  HIS A CB  1 
ATOM 275  C CG  . HIS A 1 39  ? -10.742 -6.506  200.237 1.00 30.00 ? 40  HIS A CG  1 
ATOM 276  N ND1 . HIS A 1 39  ? -9.592  -6.103  199.706 1.00 30.00 ? 40  HIS A ND1 1 
ATOM 277  C CD2 . HIS A 1 39  ? -11.505 -5.394  200.451 1.00 30.00 ? 40  HIS A CD2 1 
ATOM 278  C CE1 . HIS A 1 39  ? -9.613  -4.803  199.622 1.00 30.00 ? 40  HIS A CE1 1 
ATOM 279  N NE2 . HIS A 1 39  ? -10.773 -4.390  200.070 1.00 30.00 ? 40  HIS A NE2 1 
ATOM 280  N N   . GLN A 1 40  ? -14.076 -9.060  201.973 1.00 30.00 ? 41  GLN A N   1 
ATOM 281  C CA  . GLN A 1 40  ? -15.023 -10.159 201.757 1.00 30.00 ? 41  GLN A CA  1 
ATOM 282  C C   . GLN A 1 40  ? -14.482 -11.053 200.630 1.00 30.00 ? 41  GLN A C   1 
ATOM 283  O O   . GLN A 1 40  ? -14.296 -10.620 199.465 1.00 30.00 ? 41  GLN A O   1 
ATOM 284  C CB  . GLN A 1 40  ? -16.414 -9.637  201.313 1.00 30.00 ? 41  GLN A CB  1 
ATOM 285  C CG  . GLN A 1 40  ? -17.584 -10.275 201.998 1.00 30.00 ? 41  GLN A CG  1 
ATOM 286  C CD  . GLN A 1 40  ? -17.655 -9.837  203.462 1.00 30.00 ? 41  GLN A CD  1 
ATOM 287  O OE1 . GLN A 1 40  ? -17.182 -10.482 204.418 1.00 30.00 ? 41  GLN A OE1 1 
ATOM 288  N NE2 . GLN A 1 40  ? -18.258 -8.662  203.618 1.00 30.00 ? 41  GLN A NE2 1 
ATOM 289  N N   . GLY A 1 41  ? -14.101 -12.226 201.135 1.00 30.00 ? 42  GLY A N   1 
ATOM 290  C CA  . GLY A 1 41  ? -13.531 -13.239 200.289 1.00 30.00 ? 42  GLY A CA  1 
ATOM 291  C C   . GLY A 1 41  ? -14.444 -14.446 200.332 1.00 30.00 ? 42  GLY A C   1 
ATOM 292  O O   . GLY A 1 41  ? -15.541 -14.393 200.918 1.00 30.00 ? 42  GLY A O   1 
ATOM 293  N N   . VAL A 1 42  ? -13.873 -15.468 199.644 1.00 30.00 ? 43  VAL A N   1 
ATOM 294  C CA  . VAL A 1 42  ? -14.277 -16.901 199.455 1.00 30.00 ? 43  VAL A CA  1 
ATOM 295  C C   . VAL A 1 42  ? -14.181 -17.423 198.002 1.00 30.00 ? 43  VAL A C   1 
ATOM 296  O O   . VAL A 1 42  ? -14.714 -16.892 197.001 1.00 30.00 ? 43  VAL A O   1 
ATOM 297  C CB  . VAL A 1 42  ? -15.751 -17.224 200.005 1.00 30.00 ? 43  VAL A CB  1 
ATOM 298  C CG1 . VAL A 1 42  ? -16.441 -18.518 199.545 1.00 30.00 ? 43  VAL A CG1 1 
ATOM 299  C CG2 . VAL A 1 42  ? -15.499 -17.360 201.484 1.00 30.00 ? 43  VAL A CG2 1 
ATOM 300  N N   . MET A 1 43  ? -13.369 -18.480 197.932 1.00 30.00 ? 44  MET A N   1 
ATOM 301  C CA  . MET A 1 43  ? -13.152 -19.188 196.683 1.00 30.00 ? 44  MET A CA  1 
ATOM 302  C C   . MET A 1 43  ? -14.455 -19.968 196.466 1.00 30.00 ? 44  MET A C   1 
ATOM 303  O O   . MET A 1 43  ? -15.061 -20.412 197.456 1.00 30.00 ? 44  MET A O   1 
ATOM 304  C CB  . MET A 1 43  ? -11.948 -20.124 196.860 1.00 30.00 ? 44  MET A CB  1 
ATOM 305  C CG  . MET A 1 43  ? -11.392 -20.724 195.594 1.00 30.00 ? 44  MET A CG  1 
ATOM 306  S SD  . MET A 1 43  ? -12.497 -21.917 194.787 1.00 30.00 ? 44  MET A SD  1 
ATOM 307  C CE  . MET A 1 43  ? -11.343 -23.265 195.072 1.00 30.00 ? 44  MET A CE  1 
ATOM 308  N N   . VAL A 1 44  ? -14.957 -20.164 195.230 1.00 30.00 ? 45  VAL A N   1 
ATOM 309  C CA  . VAL A 1 44  ? -16.160 -20.988 194.998 1.00 30.00 ? 45  VAL A CA  1 
ATOM 310  C C   . VAL A 1 44  ? -15.714 -22.449 194.746 1.00 30.00 ? 45  VAL A C   1 
ATOM 311  O O   . VAL A 1 44  ? -15.675 -23.103 193.700 1.00 30.00 ? 45  VAL A O   1 
ATOM 312  C CB  . VAL A 1 44  ? -16.955 -20.358 193.827 1.00 30.00 ? 45  VAL A CB  1 
ATOM 313  C CG1 . VAL A 1 44  ? -17.852 -21.340 193.076 1.00 30.00 ? 45  VAL A CG1 1 
ATOM 314  C CG2 . VAL A 1 44  ? -17.786 -19.239 194.474 1.00 30.00 ? 45  VAL A CG2 1 
ATOM 315  N N   . GLY A 1 45  ? -15.311 -22.907 195.918 1.00 30.00 ? 46  GLY A N   1 
ATOM 316  C CA  . GLY A 1 45  ? -14.835 -24.234 196.243 1.00 30.00 ? 46  GLY A CA  1 
ATOM 317  C C   . GLY A 1 45  ? -14.397 -24.135 197.700 1.00 30.00 ? 46  GLY A C   1 
ATOM 318  O O   . GLY A 1 45  ? -13.245 -24.413 198.076 1.00 30.00 ? 46  GLY A O   1 
ATOM 319  N N   . MET A 1 46  ? -15.353 -23.490 198.401 1.00 30.00 ? 47  MET A N   1 
ATOM 320  C CA  . MET A 1 46  ? -15.419 -23.286 199.835 1.00 30.00 ? 47  MET A CA  1 
ATOM 321  C C   . MET A 1 46  ? -16.619 -22.386 200.212 1.00 30.00 ? 47  MET A C   1 
ATOM 322  O O   . MET A 1 46  ? -17.147 -21.582 199.406 1.00 30.00 ? 47  MET A O   1 
ATOM 323  C CB  . MET A 1 46  ? -14.095 -22.676 200.391 1.00 30.00 ? 47  MET A CB  1 
ATOM 324  C CG  . MET A 1 46  ? -13.548 -21.311 200.023 1.00 30.00 ? 47  MET A CG  1 
ATOM 325  S SD  . MET A 1 46  ? -11.787 -21.221 200.492 1.00 30.00 ? 47  MET A SD  1 
ATOM 326  C CE  . MET A 1 46  ? -11.191 -22.511 199.411 1.00 30.00 ? 47  MET A CE  1 
ATOM 327  N N   . GLY A 1 47  ? -17.088 -22.638 201.468 1.00 30.00 ? 48  GLY A N   1 
ATOM 328  C CA  . GLY A 1 47  ? -18.259 -21.983 202.050 1.00 30.00 ? 48  GLY A CA  1 
ATOM 329  C C   . GLY A 1 47  ? -17.937 -20.506 202.228 1.00 30.00 ? 48  GLY A C   1 
ATOM 330  O O   . GLY A 1 47  ? -16.772 -20.165 201.960 1.00 30.00 ? 48  GLY A O   1 
ATOM 331  N N   . GLN A 1 48  ? -18.818 -19.566 202.653 1.00 30.00 ? 49  GLN A N   1 
ATOM 332  C CA  . GLN A 1 48  ? -18.333 -18.204 202.911 1.00 30.00 ? 49  GLN A CA  1 
ATOM 333  C C   . GLN A 1 48  ? -17.668 -18.426 204.284 1.00 30.00 ? 49  GLN A C   1 
ATOM 334  O O   . GLN A 1 48  ? -18.350 -18.686 205.291 1.00 30.00 ? 49  GLN A O   1 
ATOM 335  C CB  . GLN A 1 48  ? -19.501 -17.218 202.964 1.00 30.00 ? 49  GLN A CB  1 
ATOM 336  C CG  . GLN A 1 48  ? -19.161 -15.791 202.536 1.00 30.00 ? 49  GLN A CG  1 
ATOM 337  C CD  . GLN A 1 48  ? -18.662 -14.876 203.654 1.00 30.00 ? 49  GLN A CD  1 
ATOM 338  O OE1 . GLN A 1 48  ? -17.741 -15.269 204.358 1.00 30.00 ? 49  GLN A OE1 1 
ATOM 339  N NE2 . GLN A 1 48  ? -19.194 -13.678 203.942 1.00 30.00 ? 49  GLN A NE2 1 
ATOM 340  N N   . LYS A 1 49  ? -16.350 -18.712 204.085 1.00 30.00 ? 50  LYS A N   1 
ATOM 341  C CA  . LYS A 1 49  ? -15.237 -18.979 205.004 1.00 30.00 ? 50  LYS A CA  1 
ATOM 342  C C   . LYS A 1 49  ? -14.341 -17.748 205.012 1.00 30.00 ? 50  LYS A C   1 
ATOM 343  O O   . LYS A 1 49  ? -13.586 -17.464 204.069 1.00 30.00 ? 50  LYS A O   1 
ATOM 344  C CB  . LYS A 1 49  ? -14.405 -20.161 204.513 1.00 30.00 ? 50  LYS A CB  1 
ATOM 345  C CG  . LYS A 1 49  ? -14.786 -21.522 205.065 1.00 30.00 ? 50  LYS A CG  1 
ATOM 346  C CD  . LYS A 1 49  ? -14.068 -21.769 206.398 1.00 30.00 ? 50  LYS A CD  1 
ATOM 347  C CE  . LYS A 1 49  ? -12.522 -21.914 206.187 1.00 30.00 ? 50  LYS A CE  1 
ATOM 348  N NZ  . LYS A 1 49  ? -11.764 -21.861 207.422 1.00 30.00 ? 50  LYS A NZ  1 
ATOM 349  N N   . ASP A 1 50  ? -14.434 -16.953 206.067 1.00 30.00 ? 51  ASP A N   1 
ATOM 350  C CA  . ASP A 1 50  ? -13.576 -15.807 206.127 1.00 30.00 ? 51  ASP A CA  1 
ATOM 351  C C   . ASP A 1 50  ? -12.598 -15.898 207.293 1.00 30.00 ? 51  ASP A C   1 
ATOM 352  O O   . ASP A 1 50  ? -12.145 -14.858 207.761 1.00 30.00 ? 51  ASP A O   1 
ATOM 353  C CB  . ASP A 1 50  ? -14.467 -14.514 206.160 1.00 30.00 ? 51  ASP A CB  1 
ATOM 354  C CG  . ASP A 1 50  ? -15.044 -14.034 204.796 1.00 30.00 ? 51  ASP A CG  1 
ATOM 355  O OD1 . ASP A 1 50  ? -14.827 -14.663 203.745 1.00 30.00 ? 51  ASP A OD1 1 
ATOM 356  O OD2 . ASP A 1 50  ? -15.741 -13.018 204.781 1.00 30.00 ? 51  ASP A OD2 1 
ATOM 357  N N   . SER A 1 51  ? -12.253 -17.086 207.818 1.00 30.00 ? 52  SER A N   1 
ATOM 358  C CA  . SER A 1 51  ? -11.105 -17.229 208.710 1.00 30.00 ? 52  SER A CA  1 
ATOM 359  C C   . SER A 1 51  ? -10.423 -18.432 208.114 1.00 30.00 ? 52  SER A C   1 
ATOM 360  O O   . SER A 1 51  ? -11.068 -19.477 208.037 1.00 30.00 ? 52  SER A O   1 
ATOM 361  C CB  . SER A 1 51  ? -11.421 -17.568 210.203 1.00 30.00 ? 52  SER A CB  1 
ATOM 362  O OG  . SER A 1 51  ? -11.955 -18.860 210.560 1.00 30.00 ? 52  SER A OG  1 
ATOM 363  N N   . TYR A 1 52  ? -9.226  -18.362 207.552 1.00 30.00 ? 53  TYR A N   1 
ATOM 364  C CA  . TYR A 1 52  ? -8.554  -19.561 207.115 1.00 30.00 ? 53  TYR A CA  1 
ATOM 365  C C   . TYR A 1 52  ? -7.619  -19.810 208.294 1.00 30.00 ? 53  TYR A C   1 
ATOM 366  O O   . TYR A 1 52  ? -7.208  -18.856 208.953 1.00 30.00 ? 53  TYR A O   1 
ATOM 367  C CB  . TYR A 1 52  ? -7.916  -19.215 205.729 1.00 30.00 ? 53  TYR A CB  1 
ATOM 368  C CG  . TYR A 1 52  ? -9.020  -19.141 204.653 1.00 30.00 ? 53  TYR A CG  1 
ATOM 369  C CD1 . TYR A 1 52  ? -9.809  -20.273 204.438 1.00 30.00 ? 53  TYR A CD1 1 
ATOM 370  C CD2 . TYR A 1 52  ? -9.338  -17.984 203.965 1.00 30.00 ? 53  TYR A CD2 1 
ATOM 371  C CE1 . TYR A 1 52  ? -10.913 -20.284 203.591 1.00 30.00 ? 53  TYR A CE1 1 
ATOM 372  C CE2 . TYR A 1 52  ? -10.448 -17.987 203.104 1.00 30.00 ? 53  TYR A CE2 1 
ATOM 373  C CZ  . TYR A 1 52  ? -11.252 -19.127 202.918 1.00 30.00 ? 53  TYR A CZ  1 
ATOM 374  O OH  . TYR A 1 52  ? -12.438 -19.113 202.164 1.00 30.00 ? 53  TYR A OH  1 
ATOM 375  N N   . VAL A 1 53  ? -7.309  -21.038 208.687 1.00 30.00 ? 54  VAL A N   1 
ATOM 376  C CA  . VAL A 1 53  ? -6.509  -21.335 209.882 1.00 30.00 ? 54  VAL A CA  1 
ATOM 377  C C   . VAL A 1 53  ? -5.275  -22.188 209.526 1.00 30.00 ? 54  VAL A C   1 
ATOM 378  O O   . VAL A 1 53  ? -5.353  -23.079 208.654 1.00 30.00 ? 54  VAL A O   1 
ATOM 379  C CB  . VAL A 1 53  ? -7.470  -22.073 210.932 1.00 30.00 ? 54  VAL A CB  1 
ATOM 380  C CG1 . VAL A 1 53  ? -6.724  -22.726 212.078 1.00 30.00 ? 54  VAL A CG1 1 
ATOM 381  C CG2 . VAL A 1 53  ? -8.337  -21.043 211.633 1.00 30.00 ? 54  VAL A CG2 1 
ATOM 382  N N   . GLY A 1 54  ? -4.122  -22.019 210.174 1.00 30.00 ? 55  GLY A N   1 
ATOM 383  C CA  . GLY A 1 54  ? -3.002  -22.907 209.933 1.00 30.00 ? 55  GLY A CA  1 
ATOM 384  C C   . GLY A 1 54  ? -2.356  -22.653 208.587 1.00 30.00 ? 55  GLY A C   1 
ATOM 385  O O   . GLY A 1 54  ? -2.053  -21.522 208.224 1.00 30.00 ? 55  GLY A O   1 
ATOM 386  N N   . ASP A 1 55  ? -2.140  -23.718 207.803 1.00 30.00 ? 56  ASP A N   1 
ATOM 387  C CA  . ASP A 1 55  ? -1.434  -23.685 206.477 1.00 30.00 ? 56  ASP A CA  1 
ATOM 388  C C   . ASP A 1 55  ? -2.184  -23.292 205.186 1.00 30.00 ? 56  ASP A C   1 
ATOM 389  O O   . ASP A 1 55  ? -1.632  -22.688 204.254 1.00 30.00 ? 56  ASP A O   1 
ATOM 390  C CB  . ASP A 1 55  ? -0.730  -25.085 206.243 1.00 30.00 ? 56  ASP A CB  1 
ATOM 391  C CG  . ASP A 1 55  ? -1.477  -26.361 206.638 1.00 30.00 ? 56  ASP A CG  1 
ATOM 392  O OD1 . ASP A 1 55  ? -2.724  -26.390 206.769 1.00 30.00 ? 56  ASP A OD1 1 
ATOM 393  O OD2 . ASP A 1 55  ? -0.756  -27.345 206.814 1.00 30.00 ? 56  ASP A OD2 1 
ATOM 394  N N   . GLU A 1 56  ? -3.499  -23.540 205.195 1.00 30.00 ? 57  GLU A N   1 
ATOM 395  C CA  . GLU A 1 56  ? -4.412  -23.044 204.178 1.00 30.00 ? 57  GLU A CA  1 
ATOM 396  C C   . GLU A 1 56  ? -4.581  -21.543 204.324 1.00 30.00 ? 57  GLU A C   1 
ATOM 397  O O   . GLU A 1 56  ? -5.464  -20.966 203.699 1.00 30.00 ? 57  GLU A O   1 
ATOM 398  C CB  . GLU A 1 56  ? -5.794  -23.664 204.304 1.00 30.00 ? 57  GLU A CB  1 
ATOM 399  C CG  . GLU A 1 56  ? -6.509  -23.421 205.629 1.00 30.00 ? 57  GLU A CG  1 
ATOM 400  C CD  . GLU A 1 56  ? -7.875  -24.061 205.762 1.00 30.00 ? 57  GLU A CD  1 
ATOM 401  O OE1 . GLU A 1 56  ? -8.055  -25.206 205.362 1.00 30.00 ? 57  GLU A OE1 1 
ATOM 402  O OE2 . GLU A 1 56  ? -8.761  -23.409 206.295 1.00 30.00 ? 57  GLU A OE2 1 
ATOM 403  N N   . ALA A 1 57  ? -3.862  -20.911 205.248 1.00 30.00 ? 58  ALA A N   1 
ATOM 404  C CA  . ALA A 1 57  ? -3.887  -19.487 205.402 1.00 30.00 ? 58  ALA A CA  1 
ATOM 405  C C   . ALA A 1 57  ? -2.458  -19.043 205.212 1.00 30.00 ? 58  ALA A C   1 
ATOM 406  O O   . ALA A 1 57  ? -2.127  -17.869 205.146 1.00 30.00 ? 58  ALA A O   1 
ATOM 407  C CB  . ALA A 1 57  ? -4.336  -19.122 206.772 1.00 30.00 ? 58  ALA A CB  1 
ATOM 408  N N   . GLN A 1 58  ? -1.515  -19.937 205.116 1.00 30.00 ? 59  GLN A N   1 
ATOM 409  C CA  . GLN A 1 58  ? -0.150  -19.553 204.861 1.00 30.00 ? 59  GLN A CA  1 
ATOM 410  C C   . GLN A 1 58  ? -0.200  -19.238 203.349 1.00 30.00 ? 59  GLN A C   1 
ATOM 411  O O   . GLN A 1 58  ? 0.173   -18.162 202.856 1.00 30.00 ? 59  GLN A O   1 
ATOM 412  C CB  . GLN A 1 58  ? 0.688   -20.760 205.203 1.00 30.00 ? 59  GLN A CB  1 
ATOM 413  C CG  . GLN A 1 58  ? 2.160   -20.703 204.964 1.00 30.00 ? 59  GLN A CG  1 
ATOM 414  C CD  . GLN A 1 58  ? 2.890   -19.905 206.014 1.00 30.00 ? 59  GLN A CD  1 
ATOM 415  O OE1 . GLN A 1 58  ? 3.894   -20.364 206.540 1.00 30.00 ? 59  GLN A OE1 1 
ATOM 416  N NE2 . GLN A 1 58  ? 2.496   -18.721 206.444 1.00 30.00 ? 59  GLN A NE2 1 
ATOM 417  N N   . SER A 1 59  ? -0.830  -20.127 202.564 1.00 30.00 ? 60  SER A N   1 
ATOM 418  C CA  . SER A 1 59  ? -0.892  -20.054 201.108 1.00 30.00 ? 60  SER A CA  1 
ATOM 419  C C   . SER A 1 59  ? -1.933  -19.119 200.502 1.00 30.00 ? 60  SER A C   1 
ATOM 420  O O   . SER A 1 59  ? -2.522  -19.359 199.445 1.00 30.00 ? 60  SER A O   1 
ATOM 421  C CB  . SER A 1 59  ? -1.066  -21.493 200.696 1.00 30.00 ? 60  SER A CB  1 
ATOM 422  O OG  . SER A 1 59  ? -0.236  -22.306 201.543 1.00 30.00 ? 60  SER A OG  1 
ATOM 423  N N   . LYS A 1 60  ? -2.181  -18.033 201.220 1.00 30.00 ? 61  LYS A N   1 
ATOM 424  C CA  . LYS A 1 60  ? -3.047  -16.922 200.853 1.00 30.00 ? 61  LYS A CA  1 
ATOM 425  C C   . LYS A 1 60  ? -2.647  -15.815 201.829 1.00 30.00 ? 61  LYS A C   1 
ATOM 426  O O   . LYS A 1 60  ? -3.343  -14.810 201.885 1.00 30.00 ? 61  LYS A O   1 
ATOM 427  C CB  . LYS A 1 60  ? -4.510  -17.190 201.097 1.00 30.00 ? 61  LYS A CB  1 
ATOM 428  C CG  . LYS A 1 60  ? -5.156  -18.333 200.326 1.00 30.00 ? 61  LYS A CG  1 
ATOM 429  C CD  . LYS A 1 60  ? -6.677  -18.314 200.493 1.00 30.00 ? 61  LYS A CD  1 
ATOM 430  C CE  . LYS A 1 60  ? -7.366  -19.171 199.435 1.00 30.00 ? 61  LYS A CE  1 
ATOM 431  N NZ  . LYS A 1 60  ? -7.126  -20.600 199.619 1.00 30.00 ? 61  LYS A NZ  1 
ATOM 432  N N   . ARG A 1 61  ? -1.499  -15.937 202.541 1.00 30.00 ? 62  ARG A N   1 
ATOM 433  C CA  . ARG A 1 61  ? -1.017  -15.011 203.576 1.00 30.00 ? 62  ARG A CA  1 
ATOM 434  C C   . ARG A 1 61  ? -0.828  -13.611 203.029 1.00 30.00 ? 62  ARG A C   1 
ATOM 435  O O   . ARG A 1 61  ? -1.145  -12.591 203.636 1.00 30.00 ? 62  ARG A O   1 
ATOM 436  C CB  . ARG A 1 61  ? 0.295   -15.576 204.143 1.00 30.00 ? 62  ARG A CB  1 
ATOM 437  C CG  . ARG A 1 61  ? 1.608   -14.798 204.405 1.00 30.00 ? 62  ARG A CG  1 
ATOM 438  C CD  . ARG A 1 61  ? 2.713   -15.861 204.772 1.00 30.00 ? 62  ARG A CD  1 
ATOM 439  N NE  . ARG A 1 61  ? 3.847   -15.290 205.508 1.00 30.00 ? 62  ARG A NE  1 
ATOM 440  C CZ  . ARG A 1 61  ? 4.099   -15.494 206.830 1.00 30.00 ? 62  ARG A CZ  1 
ATOM 441  N NH1 . ARG A 1 61  ? 3.347   -16.286 207.661 1.00 30.00 ? 62  ARG A NH1 1 
ATOM 442  N NH2 . ARG A 1 61  ? 5.070   -14.731 207.366 1.00 30.00 ? 62  ARG A NH2 1 
ATOM 443  N N   . GLY A 1 62  ? -0.326  -13.650 201.789 1.00 30.00 ? 63  GLY A N   1 
ATOM 444  C CA  . GLY A 1 62  ? -0.157  -12.493 200.941 1.00 30.00 ? 63  GLY A CA  1 
ATOM 445  C C   . GLY A 1 62  ? -1.506  -11.861 200.678 1.00 30.00 ? 63  GLY A C   1 
ATOM 446  O O   . GLY A 1 62  ? -1.558  -10.650 200.715 1.00 30.00 ? 63  GLY A O   1 
ATOM 447  N N   . ILE A 1 63  ? -2.604  -12.571 200.420 1.00 30.00 ? 64  ILE A N   1 
ATOM 448  C CA  . ILE A 1 63  ? -3.880  -11.902 200.198 1.00 30.00 ? 64  ILE A CA  1 
ATOM 449  C C   . ILE A 1 63  ? -4.718  -11.741 201.442 1.00 30.00 ? 64  ILE A C   1 
ATOM 450  O O   . ILE A 1 63  ? -5.810  -11.188 201.304 1.00 30.00 ? 64  ILE A O   1 
ATOM 451  C CB  . ILE A 1 63  ? -4.742  -12.630 199.163 1.00 30.00 ? 64  ILE A CB  1 
ATOM 452  C CG1 . ILE A 1 63  ? -4.992  -14.062 199.517 1.00 30.00 ? 64  ILE A CG1 1 
ATOM 453  C CG2 . ILE A 1 63  ? -4.005  -12.525 197.815 1.00 30.00 ? 64  ILE A CG2 1 
ATOM 454  C CD1 . ILE A 1 63  ? -5.793  -14.797 198.427 1.00 30.00 ? 64  ILE A CD1 1 
ATOM 455  N N   . LEU A 1 64  ? -4.225  -12.128 202.641 1.00 30.00 ? 65  LEU A N   1 
ATOM 456  C CA  . LEU A 1 64  ? -5.052  -12.143 203.847 1.00 30.00 ? 65  LEU A CA  1 
ATOM 457  C C   . LEU A 1 64  ? -4.465  -11.391 205.018 1.00 30.00 ? 65  LEU A C   1 
ATOM 458  O O   . LEU A 1 64  ? -3.248  -11.188 205.068 1.00 30.00 ? 65  LEU A O   1 
ATOM 459  C CB  . LEU A 1 64  ? -5.293  -13.563 204.339 1.00 30.00 ? 65  LEU A CB  1 
ATOM 460  C CG  . LEU A 1 64  ? -5.984  -14.630 203.483 1.00 30.00 ? 65  LEU A CG  1 
ATOM 461  C CD1 . LEU A 1 64  ? -6.121  -15.910 204.261 1.00 30.00 ? 65  LEU A CD1 1 
ATOM 462  C CD2 . LEU A 1 64  ? -7.364  -14.171 203.103 1.00 30.00 ? 65  LEU A CD2 1 
ATOM 463  N N   . THR A 1 65  ? -5.268  -10.976 206.004 1.00 30.00 ? 66  THR A N   1 
ATOM 464  C CA  . THR A 1 65  ? -4.673  -10.443 207.256 1.00 30.00 ? 66  THR A CA  1 
ATOM 465  C C   . THR A 1 65  ? -4.689  -11.510 208.390 1.00 30.00 ? 66  THR A C   1 
ATOM 466  O O   . THR A 1 65  ? -5.699  -12.112 208.799 1.00 30.00 ? 66  THR A O   1 
ATOM 467  C CB  . THR A 1 65  ? -5.448  -9.120  207.602 1.00 30.00 ? 66  THR A CB  1 
ATOM 468  O OG1 . THR A 1 65  ? -4.685  -8.085  206.965 1.00 30.00 ? 66  THR A OG1 1 
ATOM 469  C CG2 . THR A 1 65  ? -5.638  -8.856  209.097 1.00 30.00 ? 66  THR A CG2 1 
ATOM 470  N N   . LEU A 1 66  ? -3.470  -11.801 208.834 1.00 30.00 ? 67  LEU A N   1 
ATOM 471  C CA  . LEU A 1 66  ? -3.212  -12.829 209.811 1.00 30.00 ? 67  LEU A CA  1 
ATOM 472  C C   . LEU A 1 66  ? -3.050  -12.436 211.278 1.00 30.00 ? 67  LEU A C   1 
ATOM 473  O O   . LEU A 1 66  ? -2.166  -11.650 211.625 1.00 30.00 ? 67  LEU A O   1 
ATOM 474  C CB  . LEU A 1 66  ? -1.983  -13.548 209.365 1.00 30.00 ? 67  LEU A CB  1 
ATOM 475  C CG  . LEU A 1 66  ? -1.862  -14.155 208.014 1.00 30.00 ? 67  LEU A CG  1 
ATOM 476  C CD1 . LEU A 1 66  ? -0.356  -14.301 207.785 1.00 30.00 ? 67  LEU A CD1 1 
ATOM 477  C CD2 . LEU A 1 66  ? -2.626  -15.462 207.885 1.00 30.00 ? 67  LEU A CD2 1 
ATOM 478  N N   . LYS A 1 67  ? -3.866  -12.959 212.191 1.00 30.00 ? 68  LYS A N   1 
ATOM 479  C CA  . LYS A 1 67  ? -3.724  -12.767 213.634 1.00 30.00 ? 68  LYS A CA  1 
ATOM 480  C C   . LYS A 1 67  ? -3.028  -14.000 214.277 1.00 30.00 ? 68  LYS A C   1 
ATOM 481  O O   . LYS A 1 67  ? -3.388  -15.171 214.047 1.00 30.00 ? 68  LYS A O   1 
ATOM 482  C CB  . LYS A 1 67  ? -5.103  -12.601 214.319 1.00 30.00 ? 68  LYS A CB  1 
ATOM 483  C CG  . LYS A 1 67  ? -5.825  -11.226 214.439 1.00 30.00 ? 68  LYS A CG  1 
ATOM 484  C CD  . LYS A 1 67  ? -7.271  -11.306 215.015 1.00 30.00 ? 68  LYS A CD  1 
ATOM 485  C CE  . LYS A 1 67  ? -8.360  -11.776 214.047 1.00 30.00 ? 68  LYS A CE  1 
ATOM 486  N NZ  . LYS A 1 67  ? -7.998  -12.942 213.238 1.00 30.00 ? 68  LYS A NZ  1 
ATOM 487  N N   . TYR A 1 68  ? -2.041  -13.737 215.147 1.00 30.00 ? 69  TYR A N   1 
ATOM 488  C CA  . TYR A 1 68  ? -1.274  -14.710 215.915 1.00 30.00 ? 69  TYR A CA  1 
ATOM 489  C C   . TYR A 1 68  ? -1.860  -14.790 217.324 1.00 30.00 ? 69  TYR A C   1 
ATOM 490  O O   . TYR A 1 68  ? -1.746  -13.823 218.094 1.00 30.00 ? 69  TYR A O   1 
ATOM 491  C CB  . TYR A 1 68  ? 0.166   -14.280 216.056 1.00 30.00 ? 69  TYR A CB  1 
ATOM 492  C CG  . TYR A 1 68  ? 0.945   -14.399 214.769 1.00 30.00 ? 69  TYR A CG  1 
ATOM 493  C CD1 . TYR A 1 68  ? 0.782   -13.473 213.739 1.00 30.00 ? 69  TYR A CD1 1 
ATOM 494  C CD2 . TYR A 1 68  ? 1.802   -15.467 214.668 1.00 30.00 ? 69  TYR A CD2 1 
ATOM 495  C CE1 . TYR A 1 68  ? 1.497   -13.637 212.559 1.00 30.00 ? 69  TYR A CE1 1 
ATOM 496  C CE2 . TYR A 1 68  ? 2.520   -15.631 213.509 1.00 30.00 ? 69  TYR A CE2 1 
ATOM 497  C CZ  . TYR A 1 68  ? 2.359   -14.716 212.475 1.00 30.00 ? 69  TYR A CZ  1 
ATOM 498  O OH  . TYR A 1 68  ? 3.096   -14.923 211.340 1.00 30.00 ? 69  TYR A OH  1 
ATOM 499  N N   . PRO A 1 69  ? -6.596  -14.631 214.736 1.00 30.00 ? 70  PRO A N   1 
ATOM 500  C CA  . PRO A 1 69  ? -7.485  -14.310 215.833 1.00 30.00 ? 70  PRO A CA  1 
ATOM 501  C C   . PRO A 1 69  ? -6.728  -13.978 217.109 1.00 30.00 ? 70  PRO A C   1 
ATOM 502  O O   . PRO A 1 69  ? -7.044  -13.026 217.807 1.00 30.00 ? 70  PRO A O   1 
ATOM 503  C CB  . PRO A 1 69  ? -8.316  -15.547 215.978 1.00 30.00 ? 70  PRO A CB  1 
ATOM 504  C CG  . PRO A 1 69  ? -7.956  -16.510 214.848 1.00 30.00 ? 70  PRO A CG  1 
ATOM 505  C CD  . PRO A 1 69  ? -6.558  -16.077 214.503 1.00 30.00 ? 70  PRO A CD  1 
ATOM 506  N N   . ILE A 1 70  ? -5.756  -14.819 217.465 1.00 30.00 ? 71  ILE A N   1 
ATOM 507  C CA  . ILE A 1 70  ? -5.131  -14.770 218.755 1.00 30.00 ? 71  ILE A CA  1 
ATOM 508  C C   . ILE A 1 70  ? -3.909  -13.940 218.498 1.00 30.00 ? 71  ILE A C   1 
ATOM 509  O O   . ILE A 1 70  ? -3.221  -14.161 217.503 1.00 30.00 ? 71  ILE A O   1 
ATOM 510  C CB  . ILE A 1 70  ? -4.816  -16.220 219.190 1.00 30.00 ? 71  ILE A CB  1 
ATOM 511  C CG1 . ILE A 1 70  ? -6.006  -17.146 219.153 1.00 30.00 ? 71  ILE A CG1 1 
ATOM 512  C CG2 . ILE A 1 70  ? -4.438  -16.203 220.612 1.00 30.00 ? 71  ILE A CG2 1 
ATOM 513  C CD1 . ILE A 1 70  ? -5.633  -18.646 218.927 1.00 30.00 ? 71  ILE A CD1 1 
ATOM 514  N N   . GLU A 1 71  ? -3.570  -13.050 219.411 1.00 30.00 ? 72  GLU A N   1 
ATOM 515  C CA  . GLU A 1 71  ? -2.516  -12.087 219.202 1.00 30.00 ? 72  GLU A CA  1 
ATOM 516  C C   . GLU A 1 71  ? -1.838  -11.725 220.510 1.00 30.00 ? 72  GLU A C   1 
ATOM 517  O O   . GLU A 1 71  ? -2.477  -11.198 221.410 1.00 30.00 ? 72  GLU A O   1 
ATOM 518  C CB  . GLU A 1 71  ? -3.201  -10.936 218.574 1.00 30.00 ? 72  GLU A CB  1 
ATOM 519  C CG  . GLU A 1 71  ? -2.346  -9.753  218.244 1.00 30.00 ? 72  GLU A CG  1 
ATOM 520  C CD  . GLU A 1 71  ? -3.085  -8.834  217.299 1.00 30.00 ? 72  GLU A CD  1 
ATOM 521  O OE1 . GLU A 1 71  ? -3.436  -9.321  216.195 1.00 30.00 ? 72  GLU A OE1 1 
ATOM 522  O OE2 . GLU A 1 71  ? -3.309  -7.672  217.684 1.00 30.00 ? 72  GLU A OE2 1 
ATOM 523  N N   . HIS A 1 72  ? -0.537  -11.973 220.668 1.00 30.00 ? 73  HIS A N   1 
ATOM 524  C CA  . HIS A 1 72  ? 0.156   -11.780 221.923 1.00 30.00 ? 73  HIS A CA  1 
ATOM 525  C C   . HIS A 1 72  ? -0.561  -12.555 223.017 1.00 30.00 ? 73  HIS A C   1 
ATOM 526  O O   . HIS A 1 72  ? -0.559  -12.175 224.187 1.00 30.00 ? 73  HIS A O   1 
ATOM 527  C CB  . HIS A 1 72  ? 0.221   -10.320 222.309 1.00 30.00 ? 73  HIS A CB  1 
ATOM 528  C CG  . HIS A 1 72  ? 1.155   -9.589  221.354 1.00 30.00 ? 73  HIS A CG  1 
ATOM 529  N ND1 . HIS A 1 72  ? 2.403   -9.908  220.968 1.00 30.00 ? 73  HIS A ND1 1 
ATOM 530  C CD2 . HIS A 1 72  ? 0.796   -8.465  220.640 1.00 30.00 ? 73  HIS A CD2 1 
ATOM 531  C CE1 . HIS A 1 72  ? 2.790   -9.049  220.061 1.00 30.00 ? 73  HIS A CE1 1 
ATOM 532  N NE2 . HIS A 1 72  ? 1.823   -8.173  219.867 1.00 30.00 ? 73  HIS A NE2 1 
ATOM 533  N N   . GLY A 1 73  ? -1.119  -13.703 222.600 1.00 30.00 ? 74  GLY A N   1 
ATOM 534  C CA  . GLY A 1 73  ? -1.860  -14.596 223.469 1.00 30.00 ? 74  GLY A CA  1 
ATOM 535  C C   . GLY A 1 73  ? -3.335  -14.280 223.668 1.00 30.00 ? 74  GLY A C   1 
ATOM 536  O O   . GLY A 1 73  ? -4.058  -15.187 224.090 1.00 30.00 ? 74  GLY A O   1 
ATOM 537  N N   . ILE A 1 74  ? -3.785  -13.043 223.371 1.00 30.00 ? 75  ILE A N   1 
ATOM 538  C CA  . ILE A 1 74  ? -5.128  -12.550 223.640 1.00 30.00 ? 75  ILE A CA  1 
ATOM 539  C C   . ILE A 1 74  ? -5.984  -12.577 222.376 1.00 30.00 ? 75  ILE A C   1 
ATOM 540  O O   . ILE A 1 74  ? -5.442  -12.300 221.311 1.00 30.00 ? 75  ILE A O   1 
ATOM 541  C CB  . ILE A 1 74  ? -5.009  -11.125 224.182 1.00 30.00 ? 75  ILE A CB  1 
ATOM 542  C CG1 . ILE A 1 74  ? -3.986  -11.046 225.319 1.00 30.00 ? 75  ILE A CG1 1 
ATOM 543  C CG2 . ILE A 1 74  ? -6.414  -10.655 224.582 1.00 30.00 ? 75  ILE A CG2 1 
ATOM 544  C CD1 . ILE A 1 74  ? -4.143  -11.930 226.556 1.00 30.00 ? 75  ILE A CD1 1 
ATOM 545  N N   . VAL A 1 75  ? -7.301  -12.855 222.390 1.00 30.00 ? 76  VAL A N   1 
ATOM 546  C CA  . VAL A 1 75  ? -8.099  -12.979 221.170 1.00 30.00 ? 76  VAL A CA  1 
ATOM 547  C C   . VAL A 1 75  ? -8.620  -11.588 220.881 1.00 30.00 ? 76  VAL A C   1 
ATOM 548  O O   . VAL A 1 75  ? -9.148  -10.883 221.754 1.00 30.00 ? 76  VAL A O   1 
ATOM 549  C CB  . VAL A 1 75  ? -9.248  -14.017 221.378 1.00 30.00 ? 76  VAL A CB  1 
ATOM 550  C CG1 . VAL A 1 75  ? -10.266 -14.019 220.251 1.00 30.00 ? 76  VAL A CG1 1 
ATOM 551  C CG2 . VAL A 1 75  ? -8.623  -15.413 221.389 1.00 30.00 ? 76  VAL A CG2 1 
ATOM 552  N N   . THR A 1 76  ? -8.252  -11.196 219.643 1.00 30.00 ? 77  THR A N   1 
ATOM 553  C CA  . THR A 1 76  ? -8.605  -9.893  219.089 1.00 30.00 ? 77  THR A CA  1 
ATOM 554  C C   . THR A 1 76  ? -9.823  -10.015 218.190 1.00 30.00 ? 77  THR A C   1 
ATOM 555  O O   . THR A 1 76  ? -10.581 -9.059  217.993 1.00 30.00 ? 77  THR A O   1 
ATOM 556  C CB  . THR A 1 76  ? -7.422  -9.295  218.273 1.00 30.00 ? 77  THR A CB  1 
ATOM 557  O OG1 . THR A 1 76  ? -6.988  -10.191 217.226 1.00 30.00 ? 77  THR A OG1 1 
ATOM 558  C CG2 . THR A 1 76  ? -6.277  -8.999  219.238 1.00 30.00 ? 77  THR A CG2 1 
ATOM 559  N N   . ASN A 1 77  ? -10.087 -11.198 217.645 1.00 30.00 ? 78  ASN A N   1 
ATOM 560  C CA  . ASN A 1 77  ? -11.158 -11.355 216.707 1.00 30.00 ? 78  ASN A CA  1 
ATOM 561  C C   . ASN A 1 77  ? -12.026 -12.496 217.146 1.00 30.00 ? 78  ASN A C   1 
ATOM 562  O O   . ASN A 1 77  ? -11.660 -13.667 217.063 1.00 30.00 ? 78  ASN A O   1 
ATOM 563  C CB  . ASN A 1 77  ? -10.570 -11.608 215.309 1.00 30.00 ? 78  ASN A CB  1 
ATOM 564  C CG  . ASN A 1 77  ? -11.646 -11.401 214.250 1.00 30.00 ? 78  ASN A CG  1 
ATOM 565  O OD1 . ASN A 1 77  ? -12.217 -12.391 213.807 1.00 30.00 ? 78  ASN A OD1 1 
ATOM 566  N ND2 . ASN A 1 77  ? -12.075 -10.189 213.885 1.00 30.00 ? 78  ASN A ND2 1 
ATOM 567  N N   . TRP A 1 78  ? -13.203 -12.191 217.628 1.00 30.00 ? 79  TRP A N   1 
ATOM 568  C CA  . TRP A 1 78  ? -14.050 -13.246 218.123 1.00 30.00 ? 79  TRP A CA  1 
ATOM 569  C C   . TRP A 1 78  ? -14.795 -14.094 217.116 1.00 30.00 ? 79  TRP A C   1 
ATOM 570  O O   . TRP A 1 78  ? -14.973 -15.268 217.415 1.00 30.00 ? 79  TRP A O   1 
ATOM 571  C CB  . TRP A 1 78  ? -14.996 -12.612 219.108 1.00 30.00 ? 79  TRP A CB  1 
ATOM 572  C CG  . TRP A 1 78  ? -14.298 -12.409 220.449 1.00 30.00 ? 79  TRP A CG  1 
ATOM 573  C CD1 . TRP A 1 78  ? -13.908 -11.184 220.906 1.00 30.00 ? 79  TRP A CD1 1 
ATOM 574  C CD2 . TRP A 1 78  ? -13.890 -13.437 221.233 1.00 30.00 ? 79  TRP A CD2 1 
ATOM 575  N NE1 . TRP A 1 78  ? -13.216 -11.427 221.970 1.00 30.00 ? 79  TRP A NE1 1 
ATOM 576  C CE2 . TRP A 1 78  ? -13.178 -12.762 222.203 1.00 30.00 ? 79  TRP A CE2 1 
ATOM 577  C CE3 . TRP A 1 78  ? -14.026 -14.809 221.211 1.00 30.00 ? 79  TRP A CE3 1 
ATOM 578  C CZ2 . TRP A 1 78  ? -12.559 -13.492 223.204 1.00 30.00 ? 79  TRP A CZ2 1 
ATOM 579  C CZ3 . TRP A 1 78  ? -13.411 -15.532 222.208 1.00 30.00 ? 79  TRP A CZ3 1 
ATOM 580  C CH2 . TRP A 1 78  ? -12.687 -14.869 223.185 1.00 30.00 ? 79  TRP A CH2 1 
ATOM 581  N N   . ASP A 1 79  ? -15.235 -13.700 215.921 1.00 30.00 ? 80  ASP A N   1 
ATOM 582  C CA  . ASP A 1 79  ? -15.928 -14.673 215.089 1.00 30.00 ? 80  ASP A CA  1 
ATOM 583  C C   . ASP A 1 79  ? -14.889 -15.521 214.396 1.00 30.00 ? 80  ASP A C   1 
ATOM 584  O O   . ASP A 1 79  ? -15.177 -16.685 214.099 1.00 30.00 ? 80  ASP A O   1 
ATOM 585  C CB  . ASP A 1 79  ? -16.795 -14.067 213.993 1.00 30.00 ? 80  ASP A CB  1 
ATOM 586  C CG  . ASP A 1 79  ? -17.504 -12.741 214.227 1.00 30.00 ? 80  ASP A CG  1 
ATOM 587  O OD1 . ASP A 1 79  ? -17.577 -12.213 215.345 1.00 30.00 ? 80  ASP A OD1 1 
ATOM 588  O OD2 . ASP A 1 79  ? -17.962 -12.194 213.229 1.00 30.00 ? 80  ASP A OD2 1 
ATOM 589  N N   . ASP A 1 80  ? -13.685 -15.005 214.101 1.00 30.00 ? 81  ASP A N   1 
ATOM 590  C CA  . ASP A 1 80  ? -12.703 -15.905 213.532 1.00 30.00 ? 81  ASP A CA  1 
ATOM 591  C C   . ASP A 1 80  ? -12.118 -16.860 214.580 1.00 30.00 ? 81  ASP A C   1 
ATOM 592  O O   . ASP A 1 80  ? -11.871 -18.037 214.271 1.00 30.00 ? 81  ASP A O   1 
ATOM 593  C CB  . ASP A 1 80  ? -11.678 -15.023 212.729 1.00 30.00 ? 81  ASP A CB  1 
ATOM 594  C CG  . ASP A 1 80  ? -12.396 -14.737 211.363 1.00 30.00 ? 81  ASP A CG  1 
ATOM 595  O OD1 . ASP A 1 80  ? -12.627 -15.691 210.613 1.00 30.00 ? 81  ASP A OD1 1 
ATOM 596  O OD2 . ASP A 1 80  ? -12.794 -13.614 211.020 1.00 30.00 ? 81  ASP A OD2 1 
ATOM 597  N N   . MET A 1 81  ? -11.994 -16.507 215.861 1.00 30.00 ? 82  MET A N   1 
ATOM 598  C CA  . MET A 1 81  ? -11.748 -17.562 216.864 1.00 30.00 ? 82  MET A CA  1 
ATOM 599  C C   . MET A 1 81  ? -12.954 -18.545 216.835 1.00 30.00 ? 82  MET A C   1 
ATOM 600  O O   . MET A 1 81  ? -12.749 -19.757 216.764 1.00 30.00 ? 82  MET A O   1 
ATOM 601  C CB  . MET A 1 81  ? -11.601 -16.954 218.271 1.00 30.00 ? 82  MET A CB  1 
ATOM 602  C CG  . MET A 1 81  ? -10.974 -17.893 219.316 1.00 30.00 ? 82  MET A CG  1 
ATOM 603  S SD  . MET A 1 81  ? -9.174  -18.252 219.362 1.00 30.00 ? 82  MET A SD  1 
ATOM 604  C CE  . MET A 1 81  ? -9.151  -19.982 218.975 1.00 30.00 ? 82  MET A CE  1 
ATOM 605  N N   . GLU A 1 82  ? -14.219 -18.115 216.727 1.00 30.00 ? 83  GLU A N   1 
ATOM 606  C CA  . GLU A 1 82  ? -15.328 -19.047 216.700 1.00 30.00 ? 83  GLU A CA  1 
ATOM 607  C C   . GLU A 1 82  ? -15.195 -20.019 215.580 1.00 30.00 ? 83  GLU A C   1 
ATOM 608  O O   . GLU A 1 82  ? -15.390 -21.216 215.786 1.00 30.00 ? 83  GLU A O   1 
ATOM 609  C CB  . GLU A 1 82  ? -16.653 -18.386 216.520 1.00 30.00 ? 83  GLU A CB  1 
ATOM 610  C CG  . GLU A 1 82  ? -17.255 -17.616 217.713 1.00 30.00 ? 83  GLU A CG  1 
ATOM 611  C CD  . GLU A 1 82  ? -18.751 -17.302 217.606 1.00 30.00 ? 83  GLU A CD  1 
ATOM 612  O OE1 . GLU A 1 82  ? -19.464 -18.049 216.918 1.00 30.00 ? 83  GLU A OE1 1 
ATOM 613  O OE2 . GLU A 1 82  ? -19.184 -16.319 218.231 1.00 30.00 ? 83  GLU A OE2 1 
ATOM 614  N N   . LYS A 1 83  ? -14.777 -19.539 214.427 1.00 30.00 ? 84  LYS A N   1 
ATOM 615  C CA  . LYS A 1 83  ? -14.461 -20.442 213.327 1.00 30.00 ? 84  LYS A CA  1 
ATOM 616  C C   . LYS A 1 83  ? -13.439 -21.516 213.716 1.00 30.00 ? 84  LYS A C   1 
ATOM 617  O O   . LYS A 1 83  ? -13.670 -22.716 213.470 1.00 30.00 ? 84  LYS A O   1 
ATOM 618  C CB  . LYS A 1 83  ? -13.842 -19.749 212.115 1.00 30.00 ? 84  LYS A CB  1 
ATOM 619  C CG  . LYS A 1 83  ? -14.435 -18.460 211.540 1.00 30.00 ? 84  LYS A CG  1 
ATOM 620  C CD  . LYS A 1 83  ? -15.943 -18.475 211.249 1.00 30.00 ? 84  LYS A CD  1 
ATOM 621  C CE  . LYS A 1 83  ? -16.329 -17.380 210.225 1.00 30.00 ? 84  LYS A CE  1 
ATOM 622  N NZ  . LYS A 1 83  ? -15.848 -17.708 208.889 1.00 30.00 ? 84  LYS A NZ  1 
ATOM 623  N N   . ILE A 1 84  ? -12.332 -21.124 214.356 1.00 30.00 ? 85  ILE A N   1 
ATOM 624  C CA  . ILE A 1 84  ? -11.270 -22.059 214.653 1.00 30.00 ? 85  ILE A CA  1 
ATOM 625  C C   . ILE A 1 84  ? -11.780 -23.192 215.493 1.00 30.00 ? 85  ILE A C   1 
ATOM 626  O O   . ILE A 1 84  ? -11.561 -24.368 215.166 1.00 30.00 ? 85  ILE A O   1 
ATOM 627  C CB  . ILE A 1 84  ? -10.105 -21.309 215.356 1.00 30.00 ? 85  ILE A CB  1 
ATOM 628  C CG1 . ILE A 1 84  ? -9.318  -20.568 214.286 1.00 30.00 ? 85  ILE A CG1 1 
ATOM 629  C CG2 . ILE A 1 84  ? -9.181  -22.253 216.105 1.00 30.00 ? 85  ILE A CG2 1 
ATOM 630  C CD1 . ILE A 1 84  ? -7.938  -20.096 214.724 1.00 30.00 ? 85  ILE A CD1 1 
ATOM 631  N N   . TRP A 1 85  ? -12.550 -22.823 216.518 1.00 30.00 ? 86  TRP A N   1 
ATOM 632  C CA  . TRP A 1 85  ? -13.085 -23.819 217.437 1.00 30.00 ? 86  TRP A CA  1 
ATOM 633  C C   . TRP A 1 85  ? -14.029 -24.726 216.678 1.00 30.00 ? 86  TRP A C   1 
ATOM 634  O O   . TRP A 1 85  ? -13.744 -25.912 216.666 1.00 30.00 ? 86  TRP A O   1 
ATOM 635  C CB  . TRP A 1 85  ? -13.788 -23.133 218.651 1.00 30.00 ? 86  TRP A CB  1 
ATOM 636  C CG  . TRP A 1 85  ? -12.794 -22.609 219.689 1.00 30.00 ? 86  TRP A CG  1 
ATOM 637  C CD1 . TRP A 1 85  ? -11.567 -23.199 219.797 1.00 30.00 ? 86  TRP A CD1 1 
ATOM 638  C CD2 . TRP A 1 85  ? -12.922 -21.519 220.522 1.00 30.00 ? 86  TRP A CD2 1 
ATOM 639  N NE1 . TRP A 1 85  ? -10.902 -22.493 220.656 1.00 30.00 ? 86  TRP A NE1 1 
ATOM 640  C CE2 . TRP A 1 85  ? -11.661 -21.491 221.115 1.00 30.00 ? 86  TRP A CE2 1 
ATOM 641  C CE3 . TRP A 1 85  ? -13.851 -20.555 220.879 1.00 30.00 ? 86  TRP A CE3 1 
ATOM 642  C CZ2 . TRP A 1 85  ? -11.273 -20.535 222.045 1.00 30.00 ? 86  TRP A CZ2 1 
ATOM 643  C CZ3 . TRP A 1 85  ? -13.476 -19.601 221.811 1.00 30.00 ? 86  TRP A CZ3 1 
ATOM 644  C CH2 . TRP A 1 85  ? -12.198 -19.590 222.388 1.00 30.00 ? 86  TRP A CH2 1 
ATOM 645  N N   . HIS A 1 86  ? -15.076 -24.275 215.999 1.00 30.00 ? 87  HIS A N   1 
ATOM 646  C CA  . HIS A 1 86  ? -15.910 -25.109 215.131 1.00 30.00 ? 87  HIS A CA  1 
ATOM 647  C C   . HIS A 1 86  ? -15.110 -26.113 214.306 1.00 30.00 ? 87  HIS A C   1 
ATOM 648  O O   . HIS A 1 86  ? -15.470 -27.271 214.282 1.00 30.00 ? 87  HIS A O   1 
ATOM 649  C CB  . HIS A 1 86  ? -16.692 -24.187 214.195 1.00 30.00 ? 87  HIS A CB  1 
ATOM 650  C CG  . HIS A 1 86  ? -17.885 -24.808 213.475 1.00 30.00 ? 87  HIS A CG  1 
ATOM 651  N ND1 . HIS A 1 86  ? -19.207 -24.590 213.655 1.00 30.00 ? 87  HIS A ND1 1 
ATOM 652  C CD2 . HIS A 1 86  ? -17.757 -25.728 212.453 1.00 30.00 ? 87  HIS A CD2 1 
ATOM 653  C CE1 . HIS A 1 86  ? -19.871 -25.331 212.788 1.00 30.00 ? 87  HIS A CE1 1 
ATOM 654  N NE2 . HIS A 1 86  ? -18.976 -25.997 212.085 1.00 30.00 ? 87  HIS A NE2 1 
ATOM 655  N N   . HIS A 1 87  ? -14.035 -25.709 213.632 1.00 30.00 ? 88  HIS A N   1 
ATOM 656  C CA  . HIS A 1 87  ? -13.075 -26.559 212.906 1.00 30.00 ? 88  HIS A CA  1 
ATOM 657  C C   . HIS A 1 87  ? -12.323 -27.548 213.830 1.00 30.00 ? 88  HIS A C   1 
ATOM 658  O O   . HIS A 1 87  ? -12.066 -28.700 213.430 1.00 30.00 ? 88  HIS A O   1 
ATOM 659  C CB  . HIS A 1 87  ? -12.036 -25.660 212.155 1.00 30.00 ? 88  HIS A CB  1 
ATOM 660  C CG  . HIS A 1 87  ? -10.974 -26.427 211.353 1.00 30.00 ? 88  HIS A CG  1 
ATOM 661  N ND1 . HIS A 1 87  ? -11.119 -27.152 210.244 1.00 30.00 ? 88  HIS A ND1 1 
ATOM 662  C CD2 . HIS A 1 87  ? -9.674  -26.605 211.755 1.00 30.00 ? 88  HIS A CD2 1 
ATOM 663  C CE1 . HIS A 1 87  ? -9.998  -27.764 209.982 1.00 30.00 ? 88  HIS A CE1 1 
ATOM 664  N NE2 . HIS A 1 87  ? -9.141  -27.423 210.900 1.00 30.00 ? 88  HIS A NE2 1 
ATOM 665  N N   . THR A 1 88  ? -11.862 -27.144 215.011 1.00 30.00 ? 89  THR A N   1 
ATOM 666  C CA  . THR A 1 88  ? -11.307 -28.068 216.012 1.00 30.00 ? 89  THR A CA  1 
ATOM 667  C C   . THR A 1 88  ? -12.266 -29.287 216.217 1.00 30.00 ? 89  THR A C   1 
ATOM 668  O O   . THR A 1 88  ? -11.914 -30.465 215.987 1.00 30.00 ? 89  THR A O   1 
ATOM 669  C CB  . THR A 1 88  ? -11.143 -27.321 217.386 1.00 30.00 ? 89  THR A CB  1 
ATOM 670  O OG1 . THR A 1 88  ? -10.401 -26.134 217.126 1.00 30.00 ? 89  THR A OG1 1 
ATOM 671  C CG2 . THR A 1 88  ? -10.510 -28.181 218.460 1.00 30.00 ? 89  THR A CG2 1 
ATOM 672  N N   . PHE A 1 89  ? -13.541 -29.028 216.577 1.00 30.00 ? 90  PHE A N   1 
ATOM 673  C CA  . PHE A 1 89  ? -14.483 -30.112 216.920 1.00 30.00 ? 90  PHE A CA  1 
ATOM 674  C C   . PHE A 1 89  ? -14.999 -30.868 215.702 1.00 30.00 ? 90  PHE A C   1 
ATOM 675  O O   . PHE A 1 89  ? -14.750 -32.063 215.507 1.00 30.00 ? 90  PHE A O   1 
ATOM 676  C CB  . PHE A 1 89  ? -15.691 -29.547 217.723 1.00 30.00 ? 90  PHE A CB  1 
ATOM 677  C CG  . PHE A 1 89  ? -15.347 -28.694 218.949 1.00 30.00 ? 90  PHE A CG  1 
ATOM 678  C CD1 . PHE A 1 89  ? -14.612 -29.202 220.003 1.00 30.00 ? 90  PHE A CD1 1 
ATOM 679  C CD2 . PHE A 1 89  ? -15.800 -27.401 219.020 1.00 30.00 ? 90  PHE A CD2 1 
ATOM 680  C CE1 . PHE A 1 89  ? -14.341 -28.410 221.110 1.00 30.00 ? 90  PHE A CE1 1 
ATOM 681  C CE2 . PHE A 1 89  ? -15.522 -26.631 220.113 1.00 30.00 ? 90  PHE A CE2 1 
ATOM 682  C CZ  . PHE A 1 89  ? -14.799 -27.119 221.167 1.00 30.00 ? 90  PHE A CZ  1 
ATOM 683  N N   . TYR A 1 90  ? -15.624 -30.116 214.806 1.00 30.00 ? 91  TYR A N   1 
ATOM 684  C CA  . TYR A 1 90  ? -16.272 -30.660 213.627 1.00 30.00 ? 91  TYR A CA  1 
ATOM 685  C C   . TYR A 1 90  ? -15.384 -31.064 212.492 1.00 30.00 ? 91  TYR A C   1 
ATOM 686  O O   . TYR A 1 90  ? -15.870 -31.706 211.578 1.00 30.00 ? 91  TYR A O   1 
ATOM 687  C CB  . TYR A 1 90  ? -17.270 -29.676 213.073 1.00 30.00 ? 91  TYR A CB  1 
ATOM 688  C CG  . TYR A 1 90  ? -18.337 -29.323 214.094 1.00 30.00 ? 91  TYR A CG  1 
ATOM 689  C CD1 . TYR A 1 90  ? -19.379 -30.174 214.394 1.00 30.00 ? 91  TYR A CD1 1 
ATOM 690  C CD2 . TYR A 1 90  ? -18.249 -28.094 214.692 1.00 30.00 ? 91  TYR A CD2 1 
ATOM 691  C CE1 . TYR A 1 90  ? -20.332 -29.754 215.294 1.00 30.00 ? 91  TYR A CE1 1 
ATOM 692  C CE2 . TYR A 1 90  ? -19.178 -27.671 215.593 1.00 30.00 ? 91  TYR A CE2 1 
ATOM 693  C CZ  . TYR A 1 90  ? -20.211 -28.511 215.878 1.00 30.00 ? 91  TYR A CZ  1 
ATOM 694  O OH  . TYR A 1 90  ? -21.123 -28.049 216.796 1.00 30.00 ? 91  TYR A OH  1 
ATOM 695  N N   . ASN A 1 91  ? -14.120 -30.710 212.414 1.00 30.00 ? 92  ASN A N   1 
ATOM 696  C CA  . ASN A 1 91  ? -13.321 -31.152 211.282 1.00 30.00 ? 92  ASN A CA  1 
ATOM 697  C C   . ASN A 1 91  ? -12.036 -31.792 211.765 1.00 30.00 ? 92  ASN A C   1 
ATOM 698  O O   . ASN A 1 91  ? -11.604 -32.757 211.140 1.00 30.00 ? 92  ASN A O   1 
ATOM 699  C CB  . ASN A 1 91  ? -12.985 -29.975 210.341 1.00 30.00 ? 92  ASN A CB  1 
ATOM 700  C CG  . ASN A 1 91  ? -14.155 -29.243 209.695 1.00 30.00 ? 92  ASN A CG  1 
ATOM 701  O OD1 . ASN A 1 91  ? -14.078 -28.068 209.345 1.00 30.00 ? 92  ASN A OD1 1 
ATOM 702  N ND2 . ASN A 1 91  ? -15.300 -29.841 209.531 1.00 30.00 ? 92  ASN A ND2 1 
ATOM 703  N N   . GLU A 1 92  ? -11.399 -31.314 212.850 1.00 30.00 ? 93  GLU A N   1 
ATOM 704  C CA  . GLU A 1 92  ? -10.181 -31.949 213.274 1.00 30.00 ? 93  GLU A CA  1 
ATOM 705  C C   . GLU A 1 92  ? -10.385 -33.124 214.225 1.00 30.00 ? 93  GLU A C   1 
ATOM 706  O O   . GLU A 1 92  ? -9.887  -34.224 213.972 1.00 30.00 ? 93  GLU A O   1 
ATOM 707  C CB  . GLU A 1 92  ? -9.308  -30.887 213.872 1.00 30.00 ? 93  GLU A CB  1 
ATOM 708  C CG  . GLU A 1 92  ? -7.916  -30.929 213.180 1.00 30.00 ? 93  GLU A CG  1 
ATOM 709  C CD  . GLU A 1 92  ? -7.739  -30.490 211.705 1.00 30.00 ? 93  GLU A CD  1 
ATOM 710  O OE1 . GLU A 1 92  ? -7.998  -31.259 210.767 1.00 30.00 ? 93  GLU A OE1 1 
ATOM 711  O OE2 . GLU A 1 92  ? -7.303  -29.366 211.475 1.00 30.00 ? 93  GLU A OE2 1 
ATOM 712  N N   . LEU A 1 93  ? -11.112 -33.005 215.325 1.00 30.00 ? 94  LEU A N   1 
ATOM 713  C CA  . LEU A 1 93  ? -11.202 -34.146 216.202 1.00 30.00 ? 94  LEU A CA  1 
ATOM 714  C C   . LEU A 1 93  ? -12.395 -35.014 215.845 1.00 30.00 ? 94  LEU A C   1 
ATOM 715  O O   . LEU A 1 93  ? -12.434 -36.191 216.221 1.00 30.00 ? 94  LEU A O   1 
ATOM 716  C CB  . LEU A 1 93  ? -11.242 -33.594 217.613 1.00 30.00 ? 94  LEU A CB  1 
ATOM 717  C CG  . LEU A 1 93  ? -9.936  -32.948 218.093 1.00 30.00 ? 94  LEU A CG  1 
ATOM 718  C CD1 . LEU A 1 93  ? -10.250 -32.011 219.248 1.00 30.00 ? 94  LEU A CD1 1 
ATOM 719  C CD2 . LEU A 1 93  ? -8.926  -34.024 218.467 1.00 30.00 ? 94  LEU A CD2 1 
ATOM 720  N N   . ARG A 1 94  ? -13.350 -34.419 215.080 1.00 30.00 ? 95  ARG A N   1 
ATOM 721  C CA  . ARG A 1 94  ? -14.576 -35.067 214.532 1.00 30.00 ? 95  ARG A CA  1 
ATOM 722  C C   . ARG A 1 94  ? -15.529 -35.507 215.689 1.00 30.00 ? 95  ARG A C   1 
ATOM 723  O O   . ARG A 1 94  ? -16.104 -36.608 215.780 1.00 30.00 ? 95  ARG A O   1 
ATOM 724  C CB  . ARG A 1 94  ? -14.160 -36.276 213.673 1.00 30.00 ? 95  ARG A CB  1 
ATOM 725  C CG  . ARG A 1 94  ? -13.109 -36.034 212.541 1.00 30.00 ? 95  ARG A CG  1 
ATOM 726  C CD  . ARG A 1 94  ? -13.747 -35.570 211.261 1.00 30.00 ? 95  ARG A CD  1 
ATOM 727  N NE  . ARG A 1 94  ? -14.687 -36.608 210.853 1.00 30.00 ? 95  ARG A NE  1 
ATOM 728  C CZ  . ARG A 1 94  ? -15.784 -36.306 210.153 1.00 30.00 ? 95  ARG A CZ  1 
ATOM 729  N NH1 . ARG A 1 94  ? -16.048 -35.031 209.774 1.00 30.00 ? 95  ARG A NH1 1 
ATOM 730  N NH2 . ARG A 1 94  ? -16.668 -37.282 209.924 1.00 30.00 ? 95  ARG A NH2 1 
ATOM 731  N N   . VAL A 1 95  ? -15.737 -34.488 216.530 1.00 30.00 ? 96  VAL A N   1 
ATOM 732  C CA  . VAL A 1 95  ? -16.365 -34.581 217.816 1.00 30.00 ? 96  VAL A CA  1 
ATOM 733  C C   . VAL A 1 95  ? -17.631 -33.703 217.858 1.00 30.00 ? 96  VAL A C   1 
ATOM 734  O O   . VAL A 1 95  ? -17.908 -32.823 217.020 1.00 30.00 ? 96  VAL A O   1 
ATOM 735  C CB  . VAL A 1 95  ? -15.219 -34.177 218.844 1.00 30.00 ? 96  VAL A CB  1 
ATOM 736  C CG1 . VAL A 1 95  ? -15.498 -32.904 219.652 1.00 30.00 ? 96  VAL A CG1 1 
ATOM 737  C CG2 . VAL A 1 95  ? -14.996 -35.412 219.707 1.00 30.00 ? 96  VAL A CG2 1 
ATOM 738  N N   . ALA A 1 96  ? -18.401 -33.971 218.904 1.00 30.00 ? 97  ALA A N   1 
ATOM 739  C CA  . ALA A 1 96  ? -19.620 -33.267 219.121 1.00 30.00 ? 97  ALA A CA  1 
ATOM 740  C C   . ALA A 1 96  ? -19.422 -32.528 220.411 1.00 30.00 ? 97  ALA A C   1 
ATOM 741  O O   . ALA A 1 96  ? -19.055 -33.131 221.412 1.00 30.00 ? 97  ALA A O   1 
ATOM 742  C CB  . ALA A 1 96  ? -20.722 -34.275 219.231 1.00 30.00 ? 97  ALA A CB  1 
ATOM 743  N N   . PRO A 1 97  ? -19.590 -31.227 220.410 1.00 30.00 ? 98  PRO A N   1 
ATOM 744  C CA  . PRO A 1 97  ? -19.334 -30.405 221.569 1.00 30.00 ? 98  PRO A CA  1 
ATOM 745  C C   . PRO A 1 97  ? -20.236 -30.686 222.740 1.00 30.00 ? 98  PRO A C   1 
ATOM 746  O O   . PRO A 1 97  ? -19.721 -30.704 223.863 1.00 30.00 ? 98  PRO A O   1 
ATOM 747  C CB  . PRO A 1 97  ? -19.437 -28.976 221.071 1.00 30.00 ? 98  PRO A CB  1 
ATOM 748  C CG  . PRO A 1 97  ? -18.914 -29.131 219.652 1.00 30.00 ? 98  PRO A CG  1 
ATOM 749  C CD  . PRO A 1 97  ? -19.617 -30.396 219.216 1.00 30.00 ? 98  PRO A CD  1 
ATOM 750  N N   . GLU A 1 98  ? -21.503 -31.083 222.512 1.00 30.00 ? 99  GLU A N   1 
ATOM 751  C CA  . GLU A 1 98  ? -22.486 -31.294 223.594 1.00 30.00 ? 99  GLU A CA  1 
ATOM 752  C C   . GLU A 1 98  ? -22.477 -32.551 224.469 1.00 30.00 ? 99  GLU A C   1 
ATOM 753  O O   . GLU A 1 98  ? -23.355 -32.785 225.314 1.00 30.00 ? 99  GLU A O   1 
ATOM 754  C CB  . GLU A 1 98  ? -23.883 -31.166 223.031 1.00 30.00 ? 99  GLU A CB  1 
ATOM 755  C CG  . GLU A 1 98  ? -24.215 -31.972 221.818 1.00 30.00 ? 99  GLU A CG  1 
ATOM 756  C CD  . GLU A 1 98  ? -23.965 -31.261 220.509 1.00 30.00 ? 99  GLU A CD  1 
ATOM 757  O OE1 . GLU A 1 98  ? -23.360 -30.183 220.474 1.00 30.00 ? 99  GLU A OE1 1 
ATOM 758  O OE2 . GLU A 1 98  ? -24.394 -31.795 219.491 1.00 30.00 ? 99  GLU A OE2 1 
ATOM 759  N N   . GLU A 1 99  ? -21.393 -33.304 224.287 1.00 30.00 ? 100 GLU A N   1 
ATOM 760  C CA  . GLU A 1 99  ? -21.145 -34.579 224.928 1.00 30.00 ? 100 GLU A CA  1 
ATOM 761  C C   . GLU A 1 99  ? -19.782 -34.621 225.649 1.00 30.00 ? 100 GLU A C   1 
ATOM 762  O O   . GLU A 1 99  ? -19.420 -35.644 226.250 1.00 30.00 ? 100 GLU A O   1 
ATOM 763  C CB  . GLU A 1 99  ? -21.182 -35.631 223.841 1.00 30.00 ? 100 GLU A CB  1 
ATOM 764  C CG  . GLU A 1 99  ? -22.462 -35.725 223.067 1.00 30.00 ? 100 GLU A CG  1 
ATOM 765  C CD  . GLU A 1 99  ? -22.423 -36.473 221.741 1.00 30.00 ? 100 GLU A CD  1 
ATOM 766  O OE1 . GLU A 1 99  ? -21.777 -37.528 221.620 1.00 30.00 ? 100 GLU A OE1 1 
ATOM 767  O OE2 . GLU A 1 99  ? -23.081 -35.987 220.811 1.00 30.00 ? 100 GLU A OE2 1 
ATOM 768  N N   . HIS A 1 100 ? -18.925 -33.583 225.544 1.00 30.00 ? 101 HIS A N   1 
ATOM 769  C CA  . HIS A 1 100 ? -17.554 -33.589 226.085 1.00 30.00 ? 101 HIS A CA  1 
ATOM 770  C C   . HIS A 1 100 ? -17.365 -32.292 226.823 1.00 30.00 ? 101 HIS A C   1 
ATOM 771  O O   . HIS A 1 100 ? -17.814 -31.227 226.385 1.00 30.00 ? 101 HIS A O   1 
ATOM 772  C CB  . HIS A 1 100 ? -16.472 -33.637 225.010 1.00 30.00 ? 101 HIS A CB  1 
ATOM 773  C CG  . HIS A 1 100 ? -16.494 -34.934 224.220 1.00 30.00 ? 101 HIS A CG  1 
ATOM 774  N ND1 . HIS A 1 100 ? -15.786 -36.036 224.455 1.00 30.00 ? 101 HIS A ND1 1 
ATOM 775  C CD2 . HIS A 1 100 ? -17.340 -35.203 223.161 1.00 30.00 ? 101 HIS A CD2 1 
ATOM 776  C CE1 . HIS A 1 100 ? -16.181 -36.969 223.598 1.00 30.00 ? 101 HIS A CE1 1 
ATOM 777  N NE2 . HIS A 1 100 ? -17.117 -36.463 222.825 1.00 30.00 ? 101 HIS A NE2 1 
ATOM 778  N N   . PRO A 1 101 ? -16.816 -32.336 228.021 1.00 30.00 ? 102 PRO A N   1 
ATOM 779  C CA  . PRO A 1 101 ? -16.380 -31.122 228.639 1.00 30.00 ? 102 PRO A CA  1 
ATOM 780  C C   . PRO A 1 101 ? -15.118 -30.614 227.943 1.00 30.00 ? 102 PRO A C   1 
ATOM 781  O O   . PRO A 1 101 ? -14.356 -31.414 227.380 1.00 30.00 ? 102 PRO A O   1 
ATOM 782  C CB  . PRO A 1 101 ? -16.282 -31.570 230.112 1.00 30.00 ? 102 PRO A CB  1 
ATOM 783  C CG  . PRO A 1 101 ? -16.004 -33.031 230.062 1.00 30.00 ? 102 PRO A CG  1 
ATOM 784  C CD  . PRO A 1 101 ? -16.969 -33.411 228.989 1.00 30.00 ? 102 PRO A CD  1 
ATOM 785  N N   . VAL A 1 102 ? -14.904 -29.305 227.888 1.00 30.00 ? 103 VAL A N   1 
ATOM 786  C CA  . VAL A 1 102 ? -13.661 -28.807 227.321 1.00 30.00 ? 103 VAL A CA  1 
ATOM 787  C C   . VAL A 1 102 ? -12.749 -28.066 228.304 1.00 30.00 ? 103 VAL A C   1 
ATOM 788  O O   . VAL A 1 102 ? -13.201 -27.337 229.212 1.00 30.00 ? 103 VAL A O   1 
ATOM 789  C CB  . VAL A 1 102 ? -13.946 -27.888 226.164 1.00 30.00 ? 103 VAL A CB  1 
ATOM 790  C CG1 . VAL A 1 102 ? -14.672 -28.696 225.098 1.00 30.00 ? 103 VAL A CG1 1 
ATOM 791  C CG2 . VAL A 1 102 ? -14.761 -26.692 226.613 1.00 30.00 ? 103 VAL A CG2 1 
ATOM 792  N N   . LEU A 1 103 ? -11.434 -28.311 228.246 1.00 30.00 ? 104 LEU A N   1 
ATOM 793  C CA  . LEU A 1 103 ? -10.583 -27.487 229.049 1.00 30.00 ? 104 LEU A CA  1 
ATOM 794  C C   . LEU A 1 103 ? -10.006 -26.559 228.000 1.00 30.00 ? 104 LEU A C   1 
ATOM 795  O O   . LEU A 1 103 ? -9.398  -27.023 227.034 1.00 30.00 ? 104 LEU A O   1 
ATOM 796  C CB  . LEU A 1 103 ? -9.500  -28.326 229.739 1.00 30.00 ? 104 LEU A CB  1 
ATOM 797  C CG  . LEU A 1 103 ? -8.520  -27.520 230.683 1.00 30.00 ? 104 LEU A CG  1 
ATOM 798  C CD1 . LEU A 1 103 ? -8.444  -28.168 232.064 1.00 30.00 ? 104 LEU A CD1 1 
ATOM 799  C CD2 . LEU A 1 103 ? -7.132  -27.432 230.037 1.00 30.00 ? 104 LEU A CD2 1 
ATOM 800  N N   . LEU A 1 104 ? -10.201 -25.253 228.044 1.00 30.00 ? 105 LEU A N   1 
ATOM 801  C CA  . LEU A 1 104 ? -9.637  -24.370 227.015 1.00 30.00 ? 105 LEU A CA  1 
ATOM 802  C C   . LEU A 1 104 ? -8.425  -23.736 227.644 1.00 30.00 ? 105 LEU A C   1 
ATOM 803  O O   . LEU A 1 104 ? -8.568  -23.418 228.821 1.00 30.00 ? 105 LEU A O   1 
ATOM 804  C CB  . LEU A 1 104 ? -10.542 -23.226 226.656 1.00 30.00 ? 105 LEU A CB  1 
ATOM 805  C CG  . LEU A 1 104 ? -11.889 -23.440 226.119 1.00 30.00 ? 105 LEU A CG  1 
ATOM 806  C CD1 . LEU A 1 104 ? -12.481 -22.082 226.020 1.00 30.00 ? 105 LEU A CD1 1 
ATOM 807  C CD2 . LEU A 1 104 ? -11.889 -24.005 224.729 1.00 30.00 ? 105 LEU A CD2 1 
ATOM 808  N N   . THR A 1 105 ? -7.248  -23.527 227.093 1.00 30.00 ? 106 THR A N   1 
ATOM 809  C CA  . THR A 1 105 ? -6.311  -22.774 227.915 1.00 30.00 ? 106 THR A CA  1 
ATOM 810  C C   . THR A 1 105 ? -6.380  -21.290 227.643 1.00 30.00 ? 106 THR A C   1 
ATOM 811  O O   . THR A 1 105 ? -6.989  -20.843 226.672 1.00 30.00 ? 106 THR A O   1 
ATOM 812  C CB  . THR A 1 105 ? -4.919  -23.304 227.702 1.00 30.00 ? 106 THR A CB  1 
ATOM 813  O OG1 . THR A 1 105 ? -4.656  -23.226 226.305 1.00 30.00 ? 106 THR A OG1 1 
ATOM 814  C CG2 . THR A 1 105 ? -4.768  -24.719 228.190 1.00 30.00 ? 106 THR A CG2 1 
ATOM 815  N N   . GLU A 1 106 ? -5.747  -20.483 228.464 1.00 30.00 ? 107 GLU A N   1 
ATOM 816  C CA  . GLU A 1 106 ? -5.768  -19.046 228.290 1.00 30.00 ? 107 GLU A CA  1 
ATOM 817  C C   . GLU A 1 106 ? -4.448  -18.356 228.683 1.00 30.00 ? 107 GLU A C   1 
ATOM 818  O O   . GLU A 1 106 ? -3.608  -18.953 229.350 1.00 30.00 ? 107 GLU A O   1 
ATOM 819  C CB  . GLU A 1 106 ? -6.896  -18.477 229.117 1.00 30.00 ? 107 GLU A CB  1 
ATOM 820  C CG  . GLU A 1 106 ? -6.751  -18.823 230.616 1.00 30.00 ? 107 GLU A CG  1 
ATOM 821  C CD  . GLU A 1 106 ? -7.330  -17.805 231.568 1.00 30.00 ? 107 GLU A CD  1 
ATOM 822  O OE1 . GLU A 1 106 ? -7.972  -16.859 231.150 1.00 30.00 ? 107 GLU A OE1 1 
ATOM 823  O OE2 . GLU A 1 106 ? -7.110  -17.948 232.751 1.00 30.00 ? 107 GLU A OE2 1 
ATOM 824  N N   . ALA A 1 107 ? -4.175  -17.165 228.181 1.00 30.00 ? 108 ALA A N   1 
ATOM 825  C CA  . ALA A 1 107 ? -3.009  -16.389 228.532 1.00 30.00 ? 108 ALA A CA  1 
ATOM 826  C C   . ALA A 1 107 ? -2.968  -16.031 229.999 1.00 30.00 ? 108 ALA A C   1 
ATOM 827  O O   . ALA A 1 107 ? -4.015  -15.707 230.562 1.00 30.00 ? 108 ALA A O   1 
ATOM 828  C CB  . ALA A 1 107 ? -2.985  -15.081 227.763 1.00 30.00 ? 108 ALA A CB  1 
ATOM 829  N N   . PRO A 1 108 ? -1.809  -16.054 230.670 1.00 30.00 ? 109 PRO A N   1 
ATOM 830  C CA  . PRO A 1 108 ? -1.571  -15.351 231.936 1.00 30.00 ? 109 PRO A CA  1 
ATOM 831  C C   . PRO A 1 108 ? -2.023  -13.915 231.773 1.00 30.00 ? 109 PRO A C   1 
ATOM 832  O O   . PRO A 1 108 ? -1.649  -13.250 230.782 1.00 30.00 ? 109 PRO A O   1 
ATOM 833  C CB  . PRO A 1 108 ? -0.094  -15.415 232.165 1.00 30.00 ? 109 PRO A CB  1 
ATOM 834  C CG  . PRO A 1 108 ? 0.370   -16.565 231.301 1.00 30.00 ? 109 PRO A CG  1 
ATOM 835  C CD  . PRO A 1 108 ? -0.569  -16.610 230.120 1.00 30.00 ? 109 PRO A CD  1 
ATOM 836  N N   . LEU A 1 109 ? -2.702  -13.400 232.782 1.00 30.00 ? 110 LEU A N   1 
ATOM 837  C CA  . LEU A 1 109 ? -3.253  -12.048 232.753 1.00 30.00 ? 110 LEU A CA  1 
ATOM 838  C C   . LEU A 1 109 ? -4.290  -11.781 231.609 1.00 30.00 ? 110 LEU A C   1 
ATOM 839  O O   . LEU A 1 109 ? -4.479  -10.642 231.152 1.00 30.00 ? 110 LEU A O   1 
ATOM 840  C CB  . LEU A 1 109 ? -2.093  -11.029 232.669 1.00 30.00 ? 110 LEU A CB  1 
ATOM 841  C CG  . LEU A 1 109 ? -1.153  -10.605 233.807 1.00 30.00 ? 110 LEU A CG  1 
ATOM 842  C CD1 . LEU A 1 109 ? 0.130   -10.143 233.148 1.00 30.00 ? 110 LEU A CD1 1 
ATOM 843  C CD2 . LEU A 1 109 ? -1.646  -9.420  234.614 1.00 30.00 ? 110 LEU A CD2 1 
ATOM 844  N N   . ASN A 1 110 ? -5.035  -12.798 231.121 1.00 30.00 ? 111 ASN A N   1 
ATOM 845  C CA  . ASN A 1 110 ? -6.036  -12.630 230.045 1.00 30.00 ? 111 ASN A CA  1 
ATOM 846  C C   . ASN A 1 110 ? -7.142  -11.674 230.488 1.00 30.00 ? 111 ASN A C   1 
ATOM 847  O O   . ASN A 1 110 ? -7.670  -11.854 231.605 1.00 30.00 ? 111 ASN A O   1 
ATOM 848  C CB  . ASN A 1 110 ? -6.607  -13.986 229.727 1.00 30.00 ? 111 ASN A CB  1 
ATOM 849  C CG  . ASN A 1 110 ? -7.684  -14.065 228.664 1.00 30.00 ? 111 ASN A CG  1 
ATOM 850  O OD1 . ASN A 1 110 ? -7.781  -13.308 227.715 1.00 30.00 ? 111 ASN A OD1 1 
ATOM 851  N ND2 . ASN A 1 110 ? -8.516  -15.080 228.685 1.00 30.00 ? 111 ASN A ND2 1 
ATOM 852  N N   . PRO A 1 111 ? -7.497  -10.619 229.751 1.00 30.00 ? 112 PRO A N   1 
ATOM 853  C CA  . PRO A 1 111 ? -8.541  -9.693  230.145 1.00 30.00 ? 112 PRO A CA  1 
ATOM 854  C C   . PRO A 1 111 ? -9.852  -10.316 230.623 1.00 30.00 ? 112 PRO A C   1 
ATOM 855  O O   . PRO A 1 111 ? -10.280 -11.338 230.114 1.00 30.00 ? 112 PRO A O   1 
ATOM 856  C CB  . PRO A 1 111 ? -8.661  -8.825  228.921 1.00 30.00 ? 112 PRO A CB  1 
ATOM 857  C CG  . PRO A 1 111 ? -7.226  -8.769  228.427 1.00 30.00 ? 112 PRO A CG  1 
ATOM 858  C CD  . PRO A 1 111 ? -6.844  -10.213 228.515 1.00 30.00 ? 112 PRO A CD  1 
ATOM 859  N N   . LYS A 1 112 ? -10.495 -9.755  231.644 1.00 30.00 ? 113 LYS A N   1 
ATOM 860  C CA  . LYS A 1 112 ? -11.781 -10.152 232.217 1.00 30.00 ? 113 LYS A CA  1 
ATOM 861  C C   . LYS A 1 112 ? -12.843 -10.561 231.236 1.00 30.00 ? 113 LYS A C   1 
ATOM 862  O O   . LYS A 1 112 ? -13.397 -11.649 231.338 1.00 30.00 ? 113 LYS A O   1 
ATOM 863  C CB  . LYS A 1 112 ? -12.487 -9.058  232.985 1.00 30.00 ? 113 LYS A CB  1 
ATOM 864  C CG  . LYS A 1 112 ? -11.822 -8.479  234.182 1.00 30.00 ? 113 LYS A CG  1 
ATOM 865  C CD  . LYS A 1 112 ? -12.005 -9.404  235.356 1.00 30.00 ? 113 LYS A CD  1 
ATOM 866  C CE  . LYS A 1 112 ? -12.280 -8.457  236.512 1.00 30.00 ? 113 LYS A CE  1 
ATOM 867  N NZ  . LYS A 1 112 ? -11.150 -7.614  236.895 1.00 30.00 ? 113 LYS A NZ  1 
ATOM 868  N N   . ALA A 1 113 ? -13.159 -9.656  230.321 1.00 30.00 ? 114 ALA A N   1 
ATOM 869  C CA  . ALA A 1 113 ? -14.214 -9.842  229.357 1.00 30.00 ? 114 ALA A CA  1 
ATOM 870  C C   . ALA A 1 113 ? -13.895 -10.922 228.345 1.00 30.00 ? 114 ALA A C   1 
ATOM 871  O O   . ALA A 1 113 ? -14.798 -11.466 227.721 1.00 30.00 ? 114 ALA A O   1 
ATOM 872  C CB  . ALA A 1 113 ? -14.438 -8.523  228.673 1.00 30.00 ? 114 ALA A CB  1 
ATOM 873  N N   . ASN A 1 114 ? -12.626 -11.255 228.182 1.00 30.00 ? 115 ASN A N   1 
ATOM 874  C CA  . ASN A 1 114 ? -12.228 -12.328 227.309 1.00 30.00 ? 115 ASN A CA  1 
ATOM 875  C C   . ASN A 1 114 ? -12.590 -13.601 227.940 1.00 30.00 ? 115 ASN A C   1 
ATOM 876  O O   . ASN A 1 114 ? -13.192 -14.399 227.254 1.00 30.00 ? 115 ASN A O   1 
ATOM 877  C CB  . ASN A 1 114 ? -10.736 -12.396 227.041 1.00 30.00 ? 115 ASN A CB  1 
ATOM 878  C CG  . ASN A 1 114 ? -10.356 -11.128 226.291 1.00 30.00 ? 115 ASN A CG  1 
ATOM 879  O OD1 . ASN A 1 114 ? -10.708 -10.045 226.750 1.00 30.00 ? 115 ASN A OD1 1 
ATOM 880  N ND2 . ASN A 1 114 ? -9.686  -11.051 225.161 1.00 30.00 ? 115 ASN A ND2 1 
ATOM 881  N N   . ARG A 1 115 ? -12.288 -13.792 229.221 1.00 30.00 ? 116 ARG A N   1 
ATOM 882  C CA  . ARG A 1 115 ? -12.601 -15.023 229.954 1.00 30.00 ? 116 ARG A CA  1 
ATOM 883  C C   . ARG A 1 115 ? -14.086 -15.276 229.885 1.00 30.00 ? 116 ARG A C   1 
ATOM 884  O O   . ARG A 1 115 ? -14.555 -16.365 229.569 1.00 30.00 ? 116 ARG A O   1 
ATOM 885  C CB  . ARG A 1 115 ? -12.185 -14.854 231.365 1.00 30.00 ? 116 ARG A CB  1 
ATOM 886  C CG  . ARG A 1 115 ? -10.698 -14.914 231.460 1.00 30.00 ? 116 ARG A CG  1 
ATOM 887  C CD  . ARG A 1 115 ? -10.083 -14.535 232.816 1.00 30.00 ? 116 ARG A CD  1 
ATOM 888  N NE  . ARG A 1 115 ? -10.494 -15.126 234.102 1.00 30.00 ? 116 ARG A NE  1 
ATOM 889  C CZ  . ARG A 1 115 ? -10.342 -16.382 234.534 1.00 30.00 ? 116 ARG A CZ  1 
ATOM 890  N NH1 . ARG A 1 115 ? -9.799  -17.361 233.830 1.00 30.00 ? 116 ARG A NH1 1 
ATOM 891  N NH2 . ARG A 1 115 ? -10.612 -16.637 235.813 1.00 30.00 ? 116 ARG A NH2 1 
ATOM 892  N N   . GLU A 1 116 ? -14.866 -14.222 230.072 1.00 30.00 ? 117 GLU A N   1 
ATOM 893  C CA  . GLU A 1 116 ? -16.318 -14.295 229.971 1.00 30.00 ? 117 GLU A CA  1 
ATOM 894  C C   . GLU A 1 116 ? -16.675 -14.547 228.539 1.00 30.00 ? 117 GLU A C   1 
ATOM 895  O O   . GLU A 1 116 ? -17.444 -15.487 228.377 1.00 30.00 ? 117 GLU A O   1 
ATOM 896  C CB  . GLU A 1 116 ? -17.059 -13.017 230.352 1.00 30.00 ? 117 GLU A CB  1 
ATOM 897  C CG  . GLU A 1 116 ? -16.660 -12.424 231.687 1.00 30.00 ? 117 GLU A CG  1 
ATOM 898  C CD  . GLU A 1 116 ? -17.558 -11.380 232.278 1.00 30.00 ? 117 GLU A CD  1 
ATOM 899  O OE1 . GLU A 1 116 ? -18.654 -11.149 231.774 1.00 30.00 ? 117 GLU A OE1 1 
ATOM 900  O OE2 . GLU A 1 116 ? -17.148 -10.824 233.291 1.00 30.00 ? 117 GLU A OE2 1 
ATOM 901  N N   . LYS A 1 117 ? -16.171 -13.887 227.488 1.00 30.00 ? 118 LYS A N   1 
ATOM 902  C CA  . LYS A 1 117 ? -16.655 -14.253 226.176 1.00 30.00 ? 118 LYS A CA  1 
ATOM 903  C C   . LYS A 1 117 ? -16.327 -15.679 225.832 1.00 30.00 ? 118 LYS A C   1 
ATOM 904  O O   . LYS A 1 117 ? -17.183 -16.308 225.215 1.00 30.00 ? 118 LYS A O   1 
ATOM 905  C CB  . LYS A 1 117 ? -16.099 -13.383 225.080 1.00 30.00 ? 118 LYS A CB  1 
ATOM 906  C CG  . LYS A 1 117 ? -17.028 -13.496 223.874 1.00 30.00 ? 118 LYS A CG  1 
ATOM 907  C CD  . LYS A 1 117 ? -17.207 -12.106 223.275 1.00 30.00 ? 118 LYS A CD  1 
ATOM 908  C CE  . LYS A 1 117 ? -18.087 -12.081 222.020 1.00 30.00 ? 118 LYS A CE  1 
ATOM 909  N NZ  . LYS A 1 117 ? -17.734 -13.087 221.025 1.00 30.00 ? 118 LYS A NZ  1 
ATOM 910  N N   . MET A 1 118 ? -15.218 -16.282 226.251 1.00 30.00 ? 119 MET A N   1 
ATOM 911  C CA  . MET A 1 118 ? -15.025 -17.660 225.892 1.00 30.00 ? 119 MET A CA  1 
ATOM 912  C C   . MET A 1 118 ? -15.878 -18.573 226.738 1.00 30.00 ? 119 MET A C   1 
ATOM 913  O O   . MET A 1 118 ? -16.146 -19.673 226.241 1.00 30.00 ? 119 MET A O   1 
ATOM 914  C CB  . MET A 1 118 ? -13.583 -18.027 226.005 1.00 30.00 ? 119 MET A CB  1 
ATOM 915  C CG  . MET A 1 118 ? -12.980 -18.474 227.297 1.00 30.00 ? 119 MET A CG  1 
ATOM 916  S SD  . MET A 1 118 ? -11.262 -18.959 226.930 1.00 30.00 ? 119 MET A SD  1 
ATOM 917  C CE  . MET A 1 118 ? -10.674 -17.301 227.112 1.00 30.00 ? 119 MET A CE  1 
ATOM 918  N N   . THR A 1 119 ? -16.344 -18.191 227.950 1.00 30.00 ? 120 THR A N   1 
ATOM 919  C CA  . THR A 1 119 ? -17.356 -18.959 228.700 1.00 30.00 ? 120 THR A CA  1 
ATOM 920  C C   . THR A 1 119 ? -18.740 -18.954 227.999 1.00 30.00 ? 120 THR A C   1 
ATOM 921  O O   . THR A 1 119 ? -19.424 -19.975 227.791 1.00 30.00 ? 120 THR A O   1 
ATOM 922  C CB  . THR A 1 119 ? -17.537 -18.379 230.095 1.00 30.00 ? 120 THR A CB  1 
ATOM 923  O OG1 . THR A 1 119 ? -16.258 -18.363 230.713 1.00 30.00 ? 120 THR A OG1 1 
ATOM 924  C CG2 . THR A 1 119 ? -18.508 -19.213 230.925 1.00 30.00 ? 120 THR A CG2 1 
ATOM 925  N N   . GLN A 1 120 ? -19.117 -17.738 227.638 1.00 30.00 ? 121 GLN A N   1 
ATOM 926  C CA  . GLN A 1 120 ? -20.245 -17.381 226.812 1.00 30.00 ? 121 GLN A CA  1 
ATOM 927  C C   . GLN A 1 120 ? -20.363 -18.263 225.589 1.00 30.00 ? 121 GLN A C   1 
ATOM 928  O O   . GLN A 1 120 ? -21.307 -19.064 225.595 1.00 30.00 ? 121 GLN A O   1 
ATOM 929  C CB  . GLN A 1 120 ? -20.040 -15.951 226.400 1.00 30.00 ? 121 GLN A CB  1 
ATOM 930  C CG  . GLN A 1 120 ? -21.069 -15.249 225.600 1.00 30.00 ? 121 GLN A CG  1 
ATOM 931  C CD  . GLN A 1 120 ? -21.783 -14.391 226.595 1.00 30.00 ? 121 GLN A CD  1 
ATOM 932  O OE1 . GLN A 1 120 ? -21.256 -13.500 227.288 1.00 30.00 ? 121 GLN A OE1 1 
ATOM 933  N NE2 . GLN A 1 120 ? -23.041 -14.792 226.646 1.00 30.00 ? 121 GLN A NE2 1 
ATOM 934  N N   . ILE A 1 121 ? -19.446 -18.145 224.582 1.00 30.00 ? 122 ILE A N   1 
ATOM 935  C CA  . ILE A 1 121 ? -19.429 -18.927 223.326 1.00 30.00 ? 122 ILE A CA  1 
ATOM 936  C C   . ILE A 1 121 ? -19.535 -20.442 223.557 1.00 30.00 ? 122 ILE A C   1 
ATOM 937  O O   . ILE A 1 121 ? -20.420 -21.166 223.039 1.00 30.00 ? 122 ILE A O   1 
ATOM 938  C CB  . ILE A 1 121 ? -18.099 -18.607 222.492 1.00 30.00 ? 122 ILE A CB  1 
ATOM 939  C CG1 . ILE A 1 121 ? -18.297 -17.241 221.869 1.00 30.00 ? 122 ILE A CG1 1 
ATOM 940  C CG2 . ILE A 1 121 ? -17.764 -19.629 221.369 1.00 30.00 ? 122 ILE A CG2 1 
ATOM 941  C CD1 . ILE A 1 121 ? -16.972 -16.605 221.501 1.00 30.00 ? 122 ILE A CD1 1 
ATOM 942  N N   . MET A 1 122 ? -18.606 -20.907 224.395 1.00 30.00 ? 123 MET A N   1 
ATOM 943  C CA  . MET A 1 122 ? -18.530 -22.315 224.676 1.00 30.00 ? 123 MET A CA  1 
ATOM 944  C C   . MET A 1 122 ? -19.858 -22.776 225.154 1.00 30.00 ? 123 MET A C   1 
ATOM 945  O O   . MET A 1 122 ? -20.357 -23.691 224.502 1.00 30.00 ? 123 MET A O   1 
ATOM 946  C CB  . MET A 1 122 ? -17.448 -22.562 225.697 1.00 30.00 ? 123 MET A CB  1 
ATOM 947  C CG  . MET A 1 122 ? -16.084 -22.567 224.989 1.00 30.00 ? 123 MET A CG  1 
ATOM 948  S SD  . MET A 1 122 ? -15.830 -24.075 224.022 1.00 30.00 ? 123 MET A SD  1 
ATOM 949  C CE  . MET A 1 122 ? -15.230 -23.357 222.524 1.00 30.00 ? 123 MET A CE  1 
ATOM 950  N N   . PHE A 1 123 ? -20.542 -22.086 226.081 1.00 30.00 ? 124 PHE A N   1 
ATOM 951  C CA  . PHE A 1 123 ? -21.827 -22.607 226.560 1.00 30.00 ? 124 PHE A CA  1 
ATOM 952  C C   . PHE A 1 123 ? -23.040 -22.430 225.690 1.00 30.00 ? 124 PHE A C   1 
ATOM 953  O O   . PHE A 1 123 ? -23.737 -23.406 225.408 1.00 30.00 ? 124 PHE A O   1 
ATOM 954  C CB  . PHE A 1 123 ? -22.223 -22.055 227.936 1.00 30.00 ? 124 PHE A CB  1 
ATOM 955  C CG  . PHE A 1 123 ? -21.502 -22.814 229.014 1.00 30.00 ? 124 PHE A CG  1 
ATOM 956  C CD1 . PHE A 1 123 ? -21.649 -24.160 229.105 1.00 30.00 ? 124 PHE A CD1 1 
ATOM 957  C CD2 . PHE A 1 123 ? -20.675 -22.149 229.854 1.00 30.00 ? 124 PHE A CD2 1 
ATOM 958  C CE1 . PHE A 1 123 ? -20.961 -24.837 230.041 1.00 30.00 ? 124 PHE A CE1 1 
ATOM 959  C CE2 . PHE A 1 123 ? -19.981 -22.835 230.797 1.00 30.00 ? 124 PHE A CE2 1 
ATOM 960  C CZ  . PHE A 1 123 ? -20.132 -24.171 230.883 1.00 30.00 ? 124 PHE A CZ  1 
ATOM 961  N N   . GLU A 1 124 ? -23.257 -21.212 225.234 1.00 30.00 ? 125 GLU A N   1 
ATOM 962  C CA  . GLU A 1 124 ? -24.403 -20.887 224.410 1.00 30.00 ? 125 GLU A CA  1 
ATOM 963  C C   . GLU A 1 124 ? -24.297 -21.305 222.946 1.00 30.00 ? 125 GLU A C   1 
ATOM 964  O O   . GLU A 1 124 ? -25.275 -21.804 222.379 1.00 30.00 ? 125 GLU A O   1 
ATOM 965  C CB  . GLU A 1 124 ? -24.617 -19.402 224.490 1.00 30.00 ? 125 GLU A CB  1 
ATOM 966  C CG  . GLU A 1 124 ? -24.976 -18.928 225.872 1.00 30.00 ? 125 GLU A CG  1 
ATOM 967  C CD  . GLU A 1 124 ? -25.135 -17.427 225.936 1.00 30.00 ? 125 GLU A CD  1 
ATOM 968  O OE1 . GLU A 1 124 ? -24.982 -16.749 224.922 1.00 30.00 ? 125 GLU A OE1 1 
ATOM 969  O OE2 . GLU A 1 124 ? -25.391 -16.896 227.014 1.00 30.00 ? 125 GLU A OE2 1 
ATOM 970  N N   . THR A 1 125 ? -23.114 -21.065 222.338 1.00 30.00 ? 126 THR A N   1 
ATOM 971  C CA  . THR A 1 125 ? -22.843 -21.357 220.945 1.00 30.00 ? 126 THR A CA  1 
ATOM 972  C C   . THR A 1 125 ? -22.439 -22.779 220.788 1.00 30.00 ? 126 THR A C   1 
ATOM 973  O O   . THR A 1 125 ? -22.866 -23.307 219.781 1.00 30.00 ? 126 THR A O   1 
ATOM 974  C CB  . THR A 1 125 ? -21.732 -20.454 220.427 1.00 30.00 ? 126 THR A CB  1 
ATOM 975  O OG1 . THR A 1 125 ? -22.171 -19.107 220.745 1.00 30.00 ? 126 THR A OG1 1 
ATOM 976  C CG2 . THR A 1 125 ? -21.380 -20.721 218.938 1.00 30.00 ? 126 THR A CG2 1 
ATOM 977  N N   . PHE A 1 126 ? -21.634 -23.444 221.638 1.00 30.00 ? 127 PHE A N   1 
ATOM 978  C CA  . PHE A 1 126 ? -21.348 -24.869 221.403 1.00 30.00 ? 127 PHE A CA  1 
ATOM 979  C C   . PHE A 1 126 ? -22.054 -25.853 222.306 1.00 30.00 ? 127 PHE A C   1 
ATOM 980  O O   . PHE A 1 126 ? -21.997 -27.070 222.079 1.00 30.00 ? 127 PHE A O   1 
ATOM 981  C CB  . PHE A 1 126 ? -19.847 -25.148 221.479 1.00 30.00 ? 127 PHE A CB  1 
ATOM 982  C CG  . PHE A 1 126 ? -19.139 -24.515 220.289 1.00 30.00 ? 127 PHE A CG  1 
ATOM 983  C CD1 . PHE A 1 126 ? -19.387 -24.959 219.002 1.00 30.00 ? 127 PHE A CD1 1 
ATOM 984  C CD2 . PHE A 1 126 ? -18.261 -23.461 220.475 1.00 30.00 ? 127 PHE A CD2 1 
ATOM 985  C CE1 . PHE A 1 126 ? -18.748 -24.334 217.941 1.00 30.00 ? 127 PHE A CE1 1 
ATOM 986  C CE2 . PHE A 1 126 ? -17.618 -22.836 219.406 1.00 30.00 ? 127 PHE A CE2 1 
ATOM 987  C CZ  . PHE A 1 126 ? -17.867 -23.273 218.130 1.00 30.00 ? 127 PHE A CZ  1 
ATOM 988  N N   . ASN A 1 127 ? -22.787 -25.330 223.298 1.00 30.00 ? 128 ASN A N   1 
ATOM 989  C CA  . ASN A 1 127 ? -23.622 -26.111 224.210 1.00 30.00 ? 128 ASN A CA  1 
ATOM 990  C C   . ASN A 1 127 ? -22.800 -27.214 224.812 1.00 30.00 ? 128 ASN A C   1 
ATOM 991  O O   . ASN A 1 127 ? -22.984 -28.400 224.560 1.00 30.00 ? 128 ASN A O   1 
ATOM 992  C CB  . ASN A 1 127 ? -24.854 -26.716 223.474 1.00 30.00 ? 128 ASN A CB  1 
ATOM 993  C CG  . ASN A 1 127 ? -25.901 -27.430 224.370 1.00 30.00 ? 128 ASN A CG  1 
ATOM 994  O OD1 . ASN A 1 127 ? -26.617 -26.798 225.158 1.00 30.00 ? 128 ASN A OD1 1 
ATOM 995  N ND2 . ASN A 1 127 ? -26.045 -28.761 224.337 1.00 30.00 ? 128 ASN A ND2 1 
ATOM 996  N N   . THR A 1 128 ? -21.880 -26.729 225.637 1.00 30.00 ? 129 THR A N   1 
ATOM 997  C CA  . THR A 1 128 ? -20.845 -27.565 226.252 1.00 30.00 ? 129 THR A CA  1 
ATOM 998  C C   . THR A 1 128 ? -21.371 -28.049 227.592 1.00 30.00 ? 129 THR A C   1 
ATOM 999  O O   . THR A 1 128 ? -21.853 -27.189 228.340 1.00 30.00 ? 129 THR A O   1 
ATOM 1000 C CB  . THR A 1 128 ? -19.459 -26.763 226.478 1.00 30.00 ? 129 THR A CB  1 
ATOM 1001 O OG1 . THR A 1 128 ? -19.027 -25.849 225.449 1.00 30.00 ? 129 THR A OG1 1 
ATOM 1002 C CG2 . THR A 1 128 ? -18.406 -27.832 226.435 1.00 30.00 ? 129 THR A CG2 1 
ATOM 1003 N N   . PRO A 1 129 ? -21.293 -29.340 227.955 1.00 30.00 ? 130 PRO A N   1 
ATOM 1004 C CA  . PRO A 1 129 ? -21.756 -29.872 229.203 1.00 30.00 ? 130 PRO A CA  1 
ATOM 1005 C C   . PRO A 1 129 ? -21.104 -29.131 230.357 1.00 30.00 ? 130 PRO A C   1 
ATOM 1006 O O   . PRO A 1 129 ? -21.775 -28.901 231.373 1.00 30.00 ? 130 PRO A O   1 
ATOM 1007 C CB  . PRO A 1 129 ? -21.388 -31.327 229.249 1.00 30.00 ? 130 PRO A CB  1 
ATOM 1008 C CG  . PRO A 1 129 ? -21.044 -31.694 227.863 1.00 30.00 ? 130 PRO A CG  1 
ATOM 1009 C CD  . PRO A 1 129 ? -20.552 -30.384 227.299 1.00 30.00 ? 130 PRO A CD  1 
ATOM 1010 N N   . ALA A 1 130 ? -19.819 -28.744 230.168 1.00 30.00 ? 131 ALA A N   1 
ATOM 1011 C CA  . ALA A 1 130 ? -18.944 -28.139 231.165 1.00 30.00 ? 131 ALA A CA  1 
ATOM 1012 C C   . ALA A 1 130 ? -17.672 -27.613 230.540 1.00 30.00 ? 131 ALA A C   1 
ATOM 1013 O O   . ALA A 1 130 ? -17.218 -28.040 229.477 1.00 30.00 ? 131 ALA A O   1 
ATOM 1014 C CB  . ALA A 1 130 ? -18.514 -29.148 232.198 1.00 30.00 ? 131 ALA A CB  1 
ATOM 1015 N N   . MET A 1 131 ? -17.044 -26.733 231.280 1.00 30.00 ? 132 MET A N   1 
ATOM 1016 C CA  . MET A 1 131 ? -15.808 -26.220 230.818 1.00 30.00 ? 132 MET A CA  1 
ATOM 1017 C C   . MET A 1 131 ? -14.976 -25.647 231.949 1.00 30.00 ? 132 MET A C   1 
ATOM 1018 O O   . MET A 1 131 ? -15.465 -25.398 233.051 1.00 30.00 ? 132 MET A O   1 
ATOM 1019 C CB  . MET A 1 131 ? -16.122 -25.173 229.671 1.00 30.00 ? 132 MET A CB  1 
ATOM 1020 C CG  . MET A 1 131 ? -16.699 -23.750 229.769 1.00 30.00 ? 132 MET A CG  1 
ATOM 1021 S SD  . MET A 1 131 ? -15.573 -22.383 230.150 1.00 30.00 ? 132 MET A SD  1 
ATOM 1022 C CE  . MET A 1 131 ? -14.875 -22.524 228.550 1.00 30.00 ? 132 MET A CE  1 
ATOM 1023 N N   . TYR A 1 132 ? -13.660 -25.559 231.683 1.00 30.00 ? 133 TYR A N   1 
ATOM 1024 C CA  . TYR A 1 132 ? -12.705 -24.909 232.548 1.00 30.00 ? 133 TYR A CA  1 
ATOM 1025 C C   . TYR A 1 132 ? -11.686 -24.193 231.626 1.00 30.00 ? 133 TYR A C   1 
ATOM 1026 O O   . TYR A 1 132 ? -11.431 -24.566 230.457 1.00 30.00 ? 133 TYR A O   1 
ATOM 1027 C CB  . TYR A 1 132 ? -12.095 -25.986 233.412 1.00 30.00 ? 133 TYR A CB  1 
ATOM 1028 C CG  . TYR A 1 132 ? -11.318 -25.441 234.579 1.00 30.00 ? 133 TYR A CG  1 
ATOM 1029 C CD1 . TYR A 1 132 ? -11.956 -25.075 235.739 1.00 30.00 ? 133 TYR A CD1 1 
ATOM 1030 C CD2 . TYR A 1 132 ? -9.957  -25.296 234.455 1.00 30.00 ? 133 TYR A CD2 1 
ATOM 1031 C CE1 . TYR A 1 132 ? -11.216 -24.555 236.778 1.00 30.00 ? 133 TYR A CE1 1 
ATOM 1032 C CE2 . TYR A 1 132 ? -9.226  -24.787 235.481 1.00 30.00 ? 133 TYR A CE2 1 
ATOM 1033 C CZ  . TYR A 1 132 ? -9.854  -24.415 236.633 1.00 30.00 ? 133 TYR A CZ  1 
ATOM 1034 O OH  . TYR A 1 132 ? -9.064  -23.894 237.649 1.00 30.00 ? 133 TYR A OH  1 
ATOM 1035 N N   . VAL A 1 133 ? -11.141 -23.109 232.191 1.00 30.00 ? 134 VAL A N   1 
ATOM 1036 C CA  . VAL A 1 133 ? -10.166 -22.286 231.553 1.00 30.00 ? 134 VAL A CA  1 
ATOM 1037 C C   . VAL A 1 133 ? -8.974  -22.246 232.522 1.00 30.00 ? 134 VAL A C   1 
ATOM 1038 O O   . VAL A 1 133 ? -8.954  -21.648 233.589 1.00 30.00 ? 134 VAL A O   1 
ATOM 1039 C CB  . VAL A 1 133 ? -10.655 -20.852 231.339 1.00 30.00 ? 134 VAL A CB  1 
ATOM 1040 C CG1 . VAL A 1 133 ? -9.773  -20.342 230.281 1.00 30.00 ? 134 VAL A CG1 1 
ATOM 1041 C CG2 . VAL A 1 133 ? -12.043 -20.667 230.792 1.00 30.00 ? 134 VAL A CG2 1 
ATOM 1042 N N   . ALA A 1 134 ? -7.903  -22.899 232.130 1.00 30.00 ? 135 ALA A N   1 
ATOM 1043 C CA  . ALA A 1 134 ? -6.632  -22.840 232.816 1.00 30.00 ? 135 ALA A CA  1 
ATOM 1044 C C   . ALA A 1 134 ? -5.567  -21.923 232.100 1.00 30.00 ? 135 ALA A C   1 
ATOM 1045 O O   . ALA A 1 134 ? -5.468  -21.784 230.859 1.00 30.00 ? 135 ALA A O   1 
ATOM 1046 C CB  . ALA A 1 134 ? -6.205  -24.318 232.941 1.00 30.00 ? 135 ALA A CB  1 
ATOM 1047 N N   . ILE A 1 135 ? -4.772  -21.187 232.890 1.00 30.00 ? 136 ILE A N   1 
ATOM 1048 C CA  . ILE A 1 135 ? -3.664  -20.374 232.406 1.00 30.00 ? 136 ILE A CA  1 
ATOM 1049 C C   . ILE A 1 135 ? -2.659  -21.334 231.825 1.00 30.00 ? 136 ILE A C   1 
ATOM 1050 O O   . ILE A 1 135 ? -2.426  -22.378 232.431 1.00 30.00 ? 136 ILE A O   1 
ATOM 1051 C CB  . ILE A 1 135 ? -3.080  -19.630 233.568 1.00 30.00 ? 136 ILE A CB  1 
ATOM 1052 C CG1 . ILE A 1 135 ? -4.045  -18.500 233.941 1.00 30.00 ? 136 ILE A CG1 1 
ATOM 1053 C CG2 . ILE A 1 135 ? -1.679  -19.140 233.238 1.00 30.00 ? 136 ILE A CG2 1 
ATOM 1054 C CD1 . ILE A 1 135 ? -3.835  -17.869 235.385 1.00 30.00 ? 136 ILE A CD1 1 
ATOM 1055 N N   . GLN A 1 136 ? -1.954  -21.026 230.743 1.00 30.00 ? 137 GLN A N   1 
ATOM 1056 C CA  . GLN A 1 136 ? -1.055  -22.024 230.111 1.00 30.00 ? 137 GLN A CA  1 
ATOM 1057 C C   . GLN A 1 136 ? 0.150   -22.440 230.885 1.00 30.00 ? 137 GLN A C   1 
ATOM 1058 O O   . GLN A 1 136 ? 0.427   -23.618 230.874 1.00 30.00 ? 137 GLN A O   1 
ATOM 1059 C CB  . GLN A 1 136 ? -0.567  -21.529 228.791 1.00 30.00 ? 137 GLN A CB  1 
ATOM 1060 C CG  . GLN A 1 136 ? -1.773  -21.223 227.939 1.00 30.00 ? 137 GLN A CG  1 
ATOM 1061 C CD  . GLN A 1 136 ? -1.498  -20.124 226.964 1.00 30.00 ? 137 GLN A CD  1 
ATOM 1062 O OE1 . GLN A 1 136 ? -0.341  -19.980 226.528 1.00 30.00 ? 137 GLN A OE1 1 
ATOM 1063 N NE2 . GLN A 1 136 ? -2.521  -19.420 226.496 1.00 30.00 ? 137 GLN A NE2 1 
ATOM 1064 N N   . ALA A 1 137 ? 0.866   -21.510 231.574 1.00 30.00 ? 138 ALA A N   1 
ATOM 1065 C CA  . ALA A 1 137 ? 2.053   -21.796 232.350 1.00 30.00 ? 138 ALA A CA  1 
ATOM 1066 C C   . ALA A 1 137 ? 1.786   -22.757 233.493 1.00 30.00 ? 138 ALA A C   1 
ATOM 1067 O O   . ALA A 1 137 ? 2.606   -23.618 233.833 1.00 30.00 ? 138 ALA A O   1 
ATOM 1068 C CB  . ALA A 1 137 ? 2.563   -20.514 232.880 1.00 30.00 ? 138 ALA A CB  1 
ATOM 1069 N N   . VAL A 1 138 ? 0.625   -22.706 234.121 1.00 30.00 ? 139 VAL A N   1 
ATOM 1070 C CA  . VAL A 1 138 ? 0.281   -23.599 235.213 1.00 30.00 ? 139 VAL A CA  1 
ATOM 1071 C C   . VAL A 1 138 ? 0.147   -25.047 234.738 1.00 30.00 ? 139 VAL A C   1 
ATOM 1072 O O   . VAL A 1 138 ? 0.415   -25.951 235.529 1.00 30.00 ? 139 VAL A O   1 
ATOM 1073 C CB  . VAL A 1 138 ? -1.031  -23.024 235.889 1.00 30.00 ? 139 VAL A CB  1 
ATOM 1074 C CG1 . VAL A 1 138 ? -1.611  -23.990 236.877 1.00 30.00 ? 139 VAL A CG1 1 
ATOM 1075 C CG2 . VAL A 1 138 ? -0.707  -21.792 236.726 1.00 30.00 ? 139 VAL A CG2 1 
ATOM 1076 N N   . LEU A 1 139 ? -0.222  -25.348 233.489 1.00 30.00 ? 140 LEU A N   1 
ATOM 1077 C CA  . LEU A 1 139 ? -0.321  -26.732 232.966 1.00 30.00 ? 140 LEU A CA  1 
ATOM 1078 C C   . LEU A 1 139 ? 1.068   -27.193 232.526 1.00 30.00 ? 140 LEU A C   1 
ATOM 1079 O O   . LEU A 1 139 ? 1.359   -28.401 232.603 1.00 30.00 ? 140 LEU A O   1 
ATOM 1080 C CB  . LEU A 1 139 ? -1.215  -26.882 231.744 1.00 30.00 ? 140 LEU A CB  1 
ATOM 1081 C CG  . LEU A 1 139 ? -2.716  -26.636 231.797 1.00 30.00 ? 140 LEU A CG  1 
ATOM 1082 C CD1 . LEU A 1 139 ? -2.958  -25.274 232.323 1.00 30.00 ? 140 LEU A CD1 1 
ATOM 1083 C CD2 . LEU A 1 139 ? -3.333  -26.608 230.413 1.00 30.00 ? 140 LEU A CD2 1 
ATOM 1084 N N   . SER A 1 140 ? 1.945   -26.289 232.050 1.00 30.00 ? 141 SER A N   1 
ATOM 1085 C CA  . SER A 1 140 ? 3.358   -26.607 231.896 1.00 30.00 ? 141 SER A CA  1 
ATOM 1086 C C   . SER A 1 140 ? 3.954   -27.148 233.208 1.00 30.00 ? 141 SER A C   1 
ATOM 1087 O O   . SER A 1 140 ? 4.658   -28.170 233.195 1.00 30.00 ? 141 SER A O   1 
ATOM 1088 C CB  . SER A 1 140 ? 4.146   -25.372 231.525 1.00 30.00 ? 141 SER A CB  1 
ATOM 1089 O OG  . SER A 1 140 ? 3.716   -24.845 230.271 1.00 30.00 ? 141 SER A OG  1 
ATOM 1090 N N   . LEU A 1 141 ? 3.684   -26.498 234.359 1.00 30.00 ? 142 LEU A N   1 
ATOM 1091 C CA  . LEU A 1 141 ? 4.170   -26.960 235.647 1.00 30.00 ? 142 LEU A CA  1 
ATOM 1092 C C   . LEU A 1 141 ? 3.659   -28.335 236.155 1.00 30.00 ? 142 LEU A C   1 
ATOM 1093 O O   . LEU A 1 141 ? 4.409   -29.254 236.569 1.00 30.00 ? 142 LEU A O   1 
ATOM 1094 C CB  . LEU A 1 141 ? 3.834   -25.890 236.631 1.00 30.00 ? 142 LEU A CB  1 
ATOM 1095 C CG  . LEU A 1 141 ? 4.695   -25.940 237.858 1.00 30.00 ? 142 LEU A CG  1 
ATOM 1096 C CD1 . LEU A 1 141 ? 6.115   -25.444 237.519 1.00 30.00 ? 142 LEU A CD1 1 
ATOM 1097 C CD2 . LEU A 1 141 ? 4.051   -25.109 238.928 1.00 30.00 ? 142 LEU A CD2 1 
ATOM 1098 N N   . TYR A 1 142 ? 2.337   -28.513 236.100 1.00 30.00 ? 143 TYR A N   1 
ATOM 1099 C CA  . TYR A 1 142 ? 1.733   -29.763 236.492 1.00 30.00 ? 143 TYR A CA  1 
ATOM 1100 C C   . TYR A 1 142 ? 2.308   -30.885 235.641 1.00 30.00 ? 143 TYR A C   1 
ATOM 1101 O O   . TYR A 1 142 ? 2.651   -31.929 236.198 1.00 30.00 ? 143 TYR A O   1 
ATOM 1102 C CB  . TYR A 1 142 ? 0.187   -29.714 236.318 1.00 30.00 ? 143 TYR A CB  1 
ATOM 1103 C CG  . TYR A 1 142 ? -0.484  -30.669 237.321 1.00 30.00 ? 143 TYR A CG  1 
ATOM 1104 C CD1 . TYR A 1 142 ? -0.335  -32.061 237.204 1.00 30.00 ? 143 TYR A CD1 1 
ATOM 1105 C CD2 . TYR A 1 142 ? -1.189  -30.156 238.413 1.00 30.00 ? 143 TYR A CD2 1 
ATOM 1106 C CE1 . TYR A 1 142 ? -0.873  -32.925 238.158 1.00 30.00 ? 143 TYR A CE1 1 
ATOM 1107 C CE2 . TYR A 1 142 ? -1.729  -31.028 239.372 1.00 30.00 ? 143 TYR A CE2 1 
ATOM 1108 C CZ  . TYR A 1 142 ? -1.565  -32.414 239.252 1.00 30.00 ? 143 TYR A CZ  1 
ATOM 1109 O OH  . TYR A 1 142 ? -2.067  -33.280 240.229 1.00 30.00 ? 143 TYR A OH  1 
ATOM 1110 N N   . ALA A 1 143 ? 2.463   -30.702 234.319 1.00 30.00 ? 144 ALA A N   1 
ATOM 1111 C CA  . ALA A 1 143 ? 3.021   -31.739 233.457 1.00 30.00 ? 144 ALA A CA  1 
ATOM 1112 C C   . ALA A 1 143 ? 4.504   -32.072 233.747 1.00 30.00 ? 144 ALA A C   1 
ATOM 1113 O O   . ALA A 1 143 ? 5.014   -33.092 233.275 1.00 30.00 ? 144 ALA A O   1 
ATOM 1114 C CB  . ALA A 1 143 ? 2.832   -31.288 231.999 1.00 30.00 ? 144 ALA A CB  1 
ATOM 1115 N N   . SER A 1 144 ? 5.270   -31.248 234.477 1.00 30.00 ? 145 SER A N   1 
ATOM 1116 C CA  . SER A 1 144 ? 6.641   -31.584 234.872 1.00 30.00 ? 145 SER A CA  1 
ATOM 1117 C C   . SER A 1 144 ? 6.640   -32.282 236.218 1.00 30.00 ? 145 SER A C   1 
ATOM 1118 O O   . SER A 1 144 ? 7.678   -32.705 236.731 1.00 30.00 ? 145 SER A O   1 
ATOM 1119 C CB  . SER A 1 144 ? 7.529   -30.354 235.014 1.00 30.00 ? 145 SER A CB  1 
ATOM 1120 O OG  . SER A 1 144 ? 7.176   -29.455 236.052 1.00 30.00 ? 145 SER A OG  1 
ATOM 1121 N N   . GLY A 1 145 ? 9.742   -27.291 237.875 1.00 30.00 ? 146 GLY A N   1 
ATOM 1122 C CA  . GLY A 1 145 ? 9.852   -28.124 239.050 1.00 30.00 ? 146 GLY A CA  1 
ATOM 1123 C C   . GLY A 1 145 ? 9.796   -27.242 240.241 1.00 30.00 ? 146 GLY A C   1 
ATOM 1124 O O   . GLY A 1 145 ? 10.576  -27.389 241.175 1.00 30.00 ? 146 GLY A O   1 
ATOM 1125 N N   . ARG A 1 146 ? 8.855   -26.331 240.255 1.00 30.00 ? 147 ARG A N   1 
ATOM 1126 C CA  . ARG A 1 146 ? 8.875   -25.377 241.312 1.00 30.00 ? 147 ARG A CA  1 
ATOM 1127 C C   . ARG A 1 146 ? 7.442   -25.039 241.628 1.00 30.00 ? 147 ARG A C   1 
ATOM 1128 O O   . ARG A 1 146 ? 6.494   -25.299 240.890 1.00 30.00 ? 147 ARG A O   1 
ATOM 1129 C CB  . ARG A 1 146 ? 9.714   -24.289 240.751 1.00 30.00 ? 147 ARG A CB  1 
ATOM 1130 C CG  . ARG A 1 146 ? 10.002  -23.011 241.429 1.00 30.00 ? 147 ARG A CG  1 
ATOM 1131 C CD  . ARG A 1 146 ? 10.971  -22.491 240.402 1.00 30.00 ? 147 ARG A CD  1 
ATOM 1132 N NE  . ARG A 1 146 ? 12.308  -22.890 240.789 1.00 30.00 ? 147 ARG A NE  1 
ATOM 1133 C CZ  . ARG A 1 146 ? 13.235  -23.314 239.946 1.00 30.00 ? 147 ARG A CZ  1 
ATOM 1134 N NH1 . ARG A 1 146 ? 13.030  -23.427 238.642 1.00 30.00 ? 147 ARG A NH1 1 
ATOM 1135 N NH2 . ARG A 1 146 ? 14.407  -23.650 240.452 1.00 30.00 ? 147 ARG A NH2 1 
ATOM 1136 N N   . THR A 1 147 ? 7.329   -24.543 242.846 1.00 30.00 ? 148 THR A N   1 
ATOM 1137 C CA  . THR A 1 147 ? 6.065   -24.251 243.486 1.00 30.00 ? 148 THR A CA  1 
ATOM 1138 C C   . THR A 1 147 ? 5.911   -22.817 244.009 1.00 30.00 ? 148 THR A C   1 
ATOM 1139 O O   . THR A 1 147 ? 4.795   -22.286 244.159 1.00 30.00 ? 148 THR A O   1 
ATOM 1140 C CB  . THR A 1 147 ? 5.970   -25.357 244.544 1.00 30.00 ? 148 THR A CB  1 
ATOM 1141 O OG1 . THR A 1 147 ? 7.320   -25.621 244.990 1.00 30.00 ? 148 THR A OG1 1 
ATOM 1142 C CG2 . THR A 1 147 ? 5.235   -26.582 243.988 1.00 30.00 ? 148 THR A CG2 1 
ATOM 1143 N N   . THR A 1 148 ? 7.006   -22.122 244.210 1.00 30.00 ? 149 THR A N   1 
ATOM 1144 C CA  . THR A 1 148 ? 6.941   -20.747 244.643 1.00 30.00 ? 149 THR A CA  1 
ATOM 1145 C C   . THR A 1 148 ? 7.808   -19.980 243.614 1.00 30.00 ? 149 THR A C   1 
ATOM 1146 O O   . THR A 1 148 ? 8.789   -20.555 243.113 1.00 30.00 ? 149 THR A O   1 
ATOM 1147 C CB  . THR A 1 148 ? 7.499   -20.674 246.073 1.00 30.00 ? 149 THR A CB  1 
ATOM 1148 O OG1 . THR A 1 148 ? 7.240   -21.905 246.736 1.00 30.00 ? 149 THR A OG1 1 
ATOM 1149 C CG2 . THR A 1 148 ? 6.788   -19.642 246.880 1.00 30.00 ? 149 THR A CG2 1 
ATOM 1150 N N   . GLY A 1 149 ? 7.542   -18.751 243.211 1.00 30.00 ? 150 GLY A N   1 
ATOM 1151 C CA  . GLY A 1 149 ? 8.350   -18.151 242.197 1.00 30.00 ? 150 GLY A CA  1 
ATOM 1152 C C   . GLY A 1 149 ? 7.489   -17.121 241.550 1.00 30.00 ? 150 GLY A C   1 
ATOM 1153 O O   . GLY A 1 149 ? 6.409   -16.850 242.065 1.00 30.00 ? 150 GLY A O   1 
ATOM 1154 N N   . ILE A 1 150 ? 7.930   -16.500 240.484 1.00 30.00 ? 151 ILE A N   1 
ATOM 1155 C CA  . ILE A 1 150 ? 7.108   -15.586 239.695 1.00 30.00 ? 151 ILE A CA  1 
ATOM 1156 C C   . ILE A 1 150 ? 7.559   -15.905 238.284 1.00 30.00 ? 151 ILE A C   1 
ATOM 1157 O O   . ILE A 1 150 ? 8.727   -16.238 238.026 1.00 30.00 ? 151 ILE A O   1 
ATOM 1158 C CB  . ILE A 1 150 ? 7.359   -14.067 240.073 1.00 30.00 ? 151 ILE A CB  1 
ATOM 1159 C CG1 . ILE A 1 150 ? 6.835   -13.067 239.030 1.00 30.00 ? 151 ILE A CG1 1 
ATOM 1160 C CG2 . ILE A 1 150 ? 8.838   -13.930 240.331 1.00 30.00 ? 151 ILE A CG2 1 
ATOM 1161 C CD1 . ILE A 1 150 ? 6.614   -11.657 239.628 1.00 30.00 ? 151 ILE A CD1 1 
ATOM 1162 N N   . VAL A 1 151 ? 6.559   -15.972 237.411 1.00 30.00 ? 152 VAL A N   1 
ATOM 1163 C CA  . VAL A 1 151 ? 6.757   -16.324 236.023 1.00 30.00 ? 152 VAL A CA  1 
ATOM 1164 C C   . VAL A 1 151 ? 6.543   -15.034 235.277 1.00 30.00 ? 152 VAL A C   1 
ATOM 1165 O O   . VAL A 1 151 ? 5.799   -14.140 235.707 1.00 30.00 ? 152 VAL A O   1 
ATOM 1166 C CB  . VAL A 1 151 ? 5.733   -17.396 235.641 1.00 30.00 ? 152 VAL A CB  1 
ATOM 1167 C CG1 . VAL A 1 151 ? 5.906   -17.887 234.244 1.00 30.00 ? 152 VAL A CG1 1 
ATOM 1168 C CG2 . VAL A 1 151 ? 5.966   -18.617 236.497 1.00 30.00 ? 152 VAL A CG2 1 
ATOM 1169 N N   . MET A 1 152 ? 7.232   -14.885 234.170 1.00 30.00 ? 153 MET A N   1 
ATOM 1170 C CA  . MET A 1 152 ? 7.035   -13.716 233.356 1.00 30.00 ? 153 MET A CA  1 
ATOM 1171 C C   . MET A 1 152 ? 6.613   -14.340 232.043 1.00 30.00 ? 153 MET A C   1 
ATOM 1172 O O   . MET A 1 152 ? 7.424   -14.993 231.378 1.00 30.00 ? 153 MET A O   1 
ATOM 1173 C CB  . MET A 1 152 ? 8.362   -13.009 233.329 1.00 30.00 ? 153 MET A CB  1 
ATOM 1174 C CG  . MET A 1 152 ? 8.260   -11.556 232.938 1.00 30.00 ? 153 MET A CG  1 
ATOM 1175 S SD  . MET A 1 152 ? 7.723   -11.243 231.237 1.00 30.00 ? 153 MET A SD  1 
ATOM 1176 C CE  . MET A 1 152 ? 9.297   -11.418 230.470 1.00 30.00 ? 153 MET A CE  1 
ATOM 1177 N N   . ASP A 1 153 ? 5.365   -14.215 231.643 1.00 30.00 ? 154 ASP A N   1 
ATOM 1178 C CA  . ASP A 1 153 ? 4.882   -15.007 230.524 1.00 30.00 ? 154 ASP A CA  1 
ATOM 1179 C C   . ASP A 1 153 ? 4.649   -14.136 229.330 1.00 30.00 ? 154 ASP A C   1 
ATOM 1180 O O   . ASP A 1 153 ? 3.823   -13.228 229.457 1.00 30.00 ? 154 ASP A O   1 
ATOM 1181 C CB  . ASP A 1 153 ? 3.623   -15.680 231.010 1.00 30.00 ? 154 ASP A CB  1 
ATOM 1182 C CG  . ASP A 1 153 ? 3.090   -16.817 230.167 1.00 30.00 ? 154 ASP A CG  1 
ATOM 1183 O OD1 . ASP A 1 153 ? 2.507   -16.536 229.125 1.00 30.00 ? 154 ASP A OD1 1 
ATOM 1184 O OD2 . ASP A 1 153 ? 3.235   -17.980 230.549 1.00 30.00 ? 154 ASP A OD2 1 
ATOM 1185 N N   . SER A 1 154 ? 5.322   -14.333 228.201 1.00 30.00 ? 155 SER A N   1 
ATOM 1186 C CA  . SER A 1 154 ? 5.128   -13.441 227.076 1.00 30.00 ? 155 SER A CA  1 
ATOM 1187 C C   . SER A 1 154 ? 4.818   -14.223 225.834 1.00 30.00 ? 155 SER A C   1 
ATOM 1188 O O   . SER A 1 154 ? 5.688   -14.849 225.203 1.00 30.00 ? 155 SER A O   1 
ATOM 1189 C CB  . SER A 1 154 ? 6.395   -12.579 226.847 1.00 30.00 ? 155 SER A CB  1 
ATOM 1190 O OG  . SER A 1 154 ? 6.189   -11.345 226.130 1.00 30.00 ? 155 SER A OG  1 
ATOM 1191 N N   . GLY A 1 155 ? 3.540   -14.116 225.520 1.00 30.00 ? 156 GLY A N   1 
ATOM 1192 C CA  . GLY A 1 155 ? 3.011   -14.790 224.346 1.00 30.00 ? 156 GLY A CA  1 
ATOM 1193 C C   . GLY A 1 155 ? 2.890   -13.905 223.098 1.00 30.00 ? 156 GLY A C   1 
ATOM 1194 O O   . GLY A 1 155 ? 3.832   -13.191 222.698 1.00 30.00 ? 156 GLY A O   1 
ATOM 1195 N N   . ASP A 1 156 ? 1.710   -13.878 222.465 1.00 30.00 ? 157 ASP A N   1 
ATOM 1196 C CA  . ASP A 1 156 ? 1.519   -13.104 221.239 1.00 30.00 ? 157 ASP A CA  1 
ATOM 1197 C C   . ASP A 1 156 ? 0.684   -11.885 221.527 1.00 30.00 ? 157 ASP A C   1 
ATOM 1198 O O   . ASP A 1 156 ? 0.907   -10.816 220.940 1.00 30.00 ? 157 ASP A O   1 
ATOM 1199 C CB  . ASP A 1 156 ? 0.824   -13.971 220.217 1.00 30.00 ? 157 ASP A CB  1 
ATOM 1200 C CG  . ASP A 1 156 ? 0.814   -13.560 218.754 1.00 30.00 ? 157 ASP A CG  1 
ATOM 1201 O OD1 . ASP A 1 156 ? 1.776   -13.884 218.068 1.00 30.00 ? 157 ASP A OD1 1 
ATOM 1202 O OD2 . ASP A 1 156 ? -0.175  -12.982 218.301 1.00 30.00 ? 157 ASP A OD2 1 
ATOM 1203 N N   . GLY A 1 157 ? -0.258  -12.024 222.460 1.00 30.00 ? 158 GLY A N   1 
ATOM 1204 C CA  . GLY A 1 157 ? -1.130  -10.926 222.736 1.00 30.00 ? 158 GLY A CA  1 
ATOM 1205 C C   . GLY A 1 157 ? -0.932  -10.347 224.110 1.00 30.00 ? 158 GLY A C   1 
ATOM 1206 O O   . GLY A 1 157 ? -1.442  -9.239  224.325 1.00 30.00 ? 158 GLY A O   1 
ATOM 1207 N N   . VAL A 1 158 ? -0.305  -10.981 225.109 1.00 30.00 ? 159 VAL A N   1 
ATOM 1208 C CA  . VAL A 1 158 ? -0.102  -10.369 226.417 1.00 30.00 ? 159 VAL A CA  1 
ATOM 1209 C C   . VAL A 1 158 ? 1.147   -10.885 227.125 1.00 30.00 ? 159 VAL A C   1 
ATOM 1210 O O   . VAL A 1 158 ? 1.816   -11.862 226.738 1.00 30.00 ? 159 VAL A O   1 
ATOM 1211 C CB  . VAL A 1 158 ? -1.388  -10.626 227.212 1.00 30.00 ? 159 VAL A CB  1 
ATOM 1212 C CG1 . VAL A 1 158 ? -1.377  -12.034 227.686 1.00 30.00 ? 159 VAL A CG1 1 
ATOM 1213 C CG2 . VAL A 1 158 ? -1.535  -9.664  228.350 1.00 30.00 ? 159 VAL A CG2 1 
ATOM 1214 N N   . THR A 1 159 ? 1.480   -10.121 228.157 1.00 30.00 ? 160 THR A N   1 
ATOM 1215 C CA  . THR A 1 159 ? 2.549   -10.445 229.062 1.00 30.00 ? 160 THR A CA  1 
ATOM 1216 C C   . THR A 1 159 ? 1.969   -10.240 230.450 1.00 30.00 ? 160 THR A C   1 
ATOM 1217 O O   . THR A 1 159 ? 1.150   -9.358  230.754 1.00 30.00 ? 160 THR A O   1 
ATOM 1218 C CB  . THR A 1 159 ? 3.760   -9.509  228.817 1.00 30.00 ? 160 THR A CB  1 
ATOM 1219 O OG1 . THR A 1 159 ? 4.297   -9.639  227.497 1.00 30.00 ? 160 THR A OG1 1 
ATOM 1220 C CG2 . THR A 1 159 ? 4.877   -9.930  229.713 1.00 30.00 ? 160 THR A CG2 1 
ATOM 1221 N N   . HIS A 1 160 ? 2.279   -11.173 231.313 1.00 30.00 ? 161 HIS A N   1 
ATOM 1222 C CA  . HIS A 1 160 ? 1.943   -10.974 232.717 1.00 30.00 ? 161 HIS A CA  1 
ATOM 1223 C C   . HIS A 1 160 ? 3.088   -11.439 233.571 1.00 30.00 ? 161 HIS A C   1 
ATOM 1224 O O   . HIS A 1 160 ? 3.870   -12.336 233.184 1.00 30.00 ? 161 HIS A O   1 
ATOM 1225 C CB  . HIS A 1 160 ? 0.814   -11.791 233.269 1.00 30.00 ? 161 HIS A CB  1 
ATOM 1226 C CG  . HIS A 1 160 ? -0.573  -11.469 232.816 1.00 30.00 ? 161 HIS A CG  1 
ATOM 1227 N ND1 . HIS A 1 160 ? -1.143  -11.736 231.653 1.00 30.00 ? 161 HIS A ND1 1 
ATOM 1228 C CD2 . HIS A 1 160 ? -1.484  -10.868 233.635 1.00 30.00 ? 161 HIS A CD2 1 
ATOM 1229 C CE1 . HIS A 1 160 ? -2.381  -11.321 231.726 1.00 30.00 ? 161 HIS A CE1 1 
ATOM 1230 N NE2 . HIS A 1 160 ? -2.576  -10.803 232.918 1.00 30.00 ? 161 HIS A NE2 1 
ATOM 1231 N N   . THR A 1 161 ? 3.158   -10.768 234.708 1.00 30.00 ? 162 THR A N   1 
ATOM 1232 C CA  . THR A 1 161 ? 4.051   -11.181 235.759 1.00 30.00 ? 162 THR A CA  1 
ATOM 1233 C C   . THR A 1 161 ? 3.071   -11.706 236.846 1.00 30.00 ? 162 THR A C   1 
ATOM 1234 O O   . THR A 1 161 ? 2.063   -11.057 237.184 1.00 30.00 ? 162 THR A O   1 
ATOM 1235 C CB  . THR A 1 161 ? 4.862   -9.934  236.056 1.00 30.00 ? 162 THR A CB  1 
ATOM 1236 O OG1 . THR A 1 161 ? 4.059   -8.766  236.136 1.00 30.00 ? 162 THR A OG1 1 
ATOM 1237 C CG2 . THR A 1 161 ? 5.856   -9.819  234.937 1.00 30.00 ? 162 THR A CG2 1 
ATOM 1238 N N   . VAL A 1 162 ? 3.280   -12.949 237.322 1.00 30.00 ? 163 VAL A N   1 
ATOM 1239 C CA  . VAL A 1 162 ? 2.348   -13.639 238.181 1.00 30.00 ? 163 VAL A CA  1 
ATOM 1240 C C   . VAL A 1 162 ? 3.206   -14.039 239.353 1.00 30.00 ? 163 VAL A C   1 
ATOM 1241 O O   . VAL A 1 162 ? 4.100   -14.849 239.083 1.00 30.00 ? 163 VAL A O   1 
ATOM 1242 C CB  . VAL A 1 162 ? 1.774   -14.873 237.357 1.00 30.00 ? 163 VAL A CB  1 
ATOM 1243 C CG1 . VAL A 1 162 ? 0.807   -15.743 238.129 1.00 30.00 ? 163 VAL A CG1 1 
ATOM 1244 C CG2 . VAL A 1 162 ? 0.861   -14.367 236.257 1.00 30.00 ? 163 VAL A CG2 1 
ATOM 1245 N N   . PRO A 1 163 ? 3.095   -13.574 240.611 1.00 30.00 ? 164 PRO A N   1 
ATOM 1246 C CA  . PRO A 1 163 ? 3.722   -14.225 241.756 1.00 30.00 ? 164 PRO A CA  1 
ATOM 1247 C C   . PRO A 1 163 ? 2.945   -15.461 242.246 1.00 30.00 ? 164 PRO A C   1 
ATOM 1248 O O   . PRO A 1 163 ? 1.733   -15.398 242.399 1.00 30.00 ? 164 PRO A O   1 
ATOM 1249 C CB  . PRO A 1 163 ? 3.832   -13.103 242.770 1.00 30.00 ? 164 PRO A CB  1 
ATOM 1250 C CG  . PRO A 1 163 ? 3.405   -11.855 242.085 1.00 30.00 ? 164 PRO A CG  1 
ATOM 1251 C CD  . PRO A 1 163 ? 2.447   -12.347 241.039 1.00 30.00 ? 164 PRO A CD  1 
ATOM 1252 N N   . ILE A 1 164 ? 3.565   -16.604 242.455 1.00 30.00 ? 165 ILE A N   1 
ATOM 1253 C CA  . ILE A 1 164 ? 2.928   -17.834 242.857 1.00 30.00 ? 165 ILE A CA  1 
ATOM 1254 C C   . ILE A 1 164 ? 3.530   -18.288 244.194 1.00 30.00 ? 165 ILE A C   1 
ATOM 1255 O O   . ILE A 1 164 ? 4.740   -18.467 244.312 1.00 30.00 ? 165 ILE A O   1 
ATOM 1256 C CB  . ILE A 1 164 ? 3.165   -18.876 241.751 1.00 30.00 ? 165 ILE A CB  1 
ATOM 1257 C CG1 . ILE A 1 164 ? 2.334   -18.403 240.588 1.00 30.00 ? 165 ILE A CG1 1 
ATOM 1258 C CG2 . ILE A 1 164 ? 2.860   -20.330 242.167 1.00 30.00 ? 165 ILE A CG2 1 
ATOM 1259 C CD1 . ILE A 1 164 ? 2.998   -18.794 239.261 1.00 30.00 ? 165 ILE A CD1 1 
ATOM 1260 N N   . TYR A 1 165 ? 2.710   -18.466 245.231 1.00 30.00 ? 166 TYR A N   1 
ATOM 1261 C CA  . TYR A 1 165 ? 3.089   -19.000 246.529 1.00 30.00 ? 166 TYR A CA  1 
ATOM 1262 C C   . TYR A 1 165 ? 2.430   -20.377 246.628 1.00 30.00 ? 166 TYR A C   1 
ATOM 1263 O O   . TYR A 1 165 ? 1.203   -20.519 246.612 1.00 30.00 ? 166 TYR A O   1 
ATOM 1264 C CB  . TYR A 1 165 ? 2.557   -18.115 247.645 1.00 30.00 ? 166 TYR A CB  1 
ATOM 1265 C CG  . TYR A 1 165 ? 2.757   -18.630 249.066 1.00 30.00 ? 166 TYR A CG  1 
ATOM 1266 C CD1 . TYR A 1 165 ? 3.900   -19.317 249.376 1.00 30.00 ? 166 TYR A CD1 1 
ATOM 1267 C CD2 . TYR A 1 165 ? 1.789   -18.424 250.026 1.00 30.00 ? 166 TYR A CD2 1 
ATOM 1268 C CE1 . TYR A 1 165 ? 4.106   -19.815 250.628 1.00 30.00 ? 166 TYR A CE1 1 
ATOM 1269 C CE2 . TYR A 1 165 ? 1.990   -18.917 251.285 1.00 30.00 ? 166 TYR A CE2 1 
ATOM 1270 C CZ  . TYR A 1 165 ? 3.151   -19.599 251.563 1.00 30.00 ? 166 TYR A CZ  1 
ATOM 1271 O OH  . TYR A 1 165 ? 3.441   -20.030 252.819 1.00 30.00 ? 166 TYR A OH  1 
ATOM 1272 N N   . GLU A 1 166 ? 3.282   -21.385 246.658 1.00 30.00 ? 167 GLU A N   1 
ATOM 1273 C CA  . GLU A 1 166 ? 2.892   -22.750 246.795 1.00 30.00 ? 167 GLU A CA  1 
ATOM 1274 C C   . GLU A 1 166 ? 1.896   -23.266 245.754 1.00 30.00 ? 167 GLU A C   1 
ATOM 1275 O O   . GLU A 1 166 ? 1.002   -24.027 246.102 1.00 30.00 ? 167 GLU A O   1 
ATOM 1276 C CB  . GLU A 1 166 ? 2.360   -22.890 248.191 1.00 30.00 ? 167 GLU A CB  1 
ATOM 1277 C CG  . GLU A 1 166 ? 3.347   -22.825 249.318 1.00 30.00 ? 167 GLU A CG  1 
ATOM 1278 C CD  . GLU A 1 166 ? 4.408   -23.911 249.317 1.00 30.00 ? 167 GLU A CD  1 
ATOM 1279 O OE1 . GLU A 1 166 ? 4.243   -24.943 248.652 1.00 30.00 ? 167 GLU A OE1 1 
ATOM 1280 O OE2 . GLU A 1 166 ? 5.419   -23.707 249.998 1.00 30.00 ? 167 GLU A OE2 1 
ATOM 1281 N N   . GLY A 1 167 ? 2.045   -22.977 244.464 1.00 30.00 ? 168 GLY A N   1 
ATOM 1282 C CA  . GLY A 1 167 ? 1.117   -23.404 243.426 1.00 30.00 ? 168 GLY A CA  1 
ATOM 1283 C C   . GLY A 1 167 ? -0.122  -22.512 243.233 1.00 30.00 ? 168 GLY A C   1 
ATOM 1284 O O   . GLY A 1 167 ? -1.077  -22.849 242.514 1.00 30.00 ? 168 GLY A O   1 
ATOM 1285 N N   . TYR A 1 168 ? -0.127  -21.328 243.833 1.00 30.00 ? 169 TYR A N   1 
ATOM 1286 C CA  . TYR A 1 168 ? -1.296  -20.485 243.870 1.00 30.00 ? 169 TYR A CA  1 
ATOM 1287 C C   . TYR A 1 168 ? -0.810  -19.121 243.466 1.00 30.00 ? 169 TYR A C   1 
ATOM 1288 O O   . TYR A 1 168 ? 0.101   -18.565 244.079 1.00 30.00 ? 169 TYR A O   1 
ATOM 1289 C CB  . TYR A 1 168 ? -1.910  -20.411 245.305 1.00 30.00 ? 169 TYR A CB  1 
ATOM 1290 C CG  . TYR A 1 168 ? -2.472  -21.745 245.848 1.00 30.00 ? 169 TYR A CG  1 
ATOM 1291 C CD1 . TYR A 1 168 ? -3.669  -22.234 245.369 1.00 30.00 ? 169 TYR A CD1 1 
ATOM 1292 C CD2 . TYR A 1 168 ? -1.732  -22.507 246.746 1.00 30.00 ? 169 TYR A CD2 1 
ATOM 1293 C CE1 . TYR A 1 168 ? -4.126  -23.457 245.748 1.00 30.00 ? 169 TYR A CE1 1 
ATOM 1294 C CE2 . TYR A 1 168 ? -2.180  -23.746 247.136 1.00 30.00 ? 169 TYR A CE2 1 
ATOM 1295 C CZ  . TYR A 1 168 ? -3.377  -24.190 246.621 1.00 30.00 ? 169 TYR A CZ  1 
ATOM 1296 O OH  . TYR A 1 168 ? -3.872  -25.425 247.021 1.00 30.00 ? 169 TYR A OH  1 
ATOM 1297 N N   . ALA A 1 169 ? -1.403  -18.639 242.392 1.00 30.00 ? 170 ALA A N   1 
ATOM 1298 C CA  . ALA A 1 169 ? -1.090  -17.357 241.801 1.00 30.00 ? 170 ALA A CA  1 
ATOM 1299 C C   . ALA A 1 169 ? -1.624  -16.300 242.731 1.00 30.00 ? 170 ALA A C   1 
ATOM 1300 O O   . ALA A 1 169 ? -2.727  -16.476 243.251 1.00 30.00 ? 170 ALA A O   1 
ATOM 1301 C CB  . ALA A 1 169 ? -1.772  -17.173 240.450 1.00 30.00 ? 170 ALA A CB  1 
ATOM 1302 N N   . LEU A 1 170 ? -0.947  -15.173 242.915 1.00 30.00 ? 171 LEU A N   1 
ATOM 1303 C CA  . LEU A 1 170 ? -1.468  -14.217 243.842 1.00 30.00 ? 171 LEU A CA  1 
ATOM 1304 C C   . LEU A 1 170 ? -2.151  -13.095 243.060 1.00 30.00 ? 171 LEU A C   1 
ATOM 1305 O O   . LEU A 1 170 ? -1.530  -12.064 242.809 1.00 30.00 ? 171 LEU A O   1 
ATOM 1306 C CB  . LEU A 1 170 ? -0.268  -13.770 244.731 1.00 30.00 ? 171 LEU A CB  1 
ATOM 1307 C CG  . LEU A 1 170 ? 0.511   -14.897 245.517 1.00 30.00 ? 171 LEU A CG  1 
ATOM 1308 C CD1 . LEU A 1 170 ? 1.702   -14.265 246.235 1.00 30.00 ? 171 LEU A CD1 1 
ATOM 1309 C CD2 . LEU A 1 170 ? -0.397  -15.635 246.485 1.00 30.00 ? 171 LEU A CD2 1 
ATOM 1310 N N   . PRO A 1 171 ? -3.453  -13.150 242.745 1.00 30.00 ? 172 PRO A N   1 
ATOM 1311 C CA  . PRO A 1 171 ? -4.145  -12.261 241.814 1.00 30.00 ? 172 PRO A CA  1 
ATOM 1312 C C   . PRO A 1 171 ? -3.975  -10.762 242.065 1.00 30.00 ? 172 PRO A C   1 
ATOM 1313 O O   . PRO A 1 171 ? -3.951  -9.957  241.128 1.00 30.00 ? 172 PRO A O   1 
ATOM 1314 C CB  . PRO A 1 171 ? -5.573  -12.644 241.881 1.00 30.00 ? 172 PRO A CB  1 
ATOM 1315 C CG  . PRO A 1 171 ? -5.419  -14.024 242.347 1.00 30.00 ? 172 PRO A CG  1 
ATOM 1316 C CD  . PRO A 1 171 ? -4.421  -13.946 243.447 1.00 30.00 ? 172 PRO A CD  1 
ATOM 1317 N N   . HIS A 1 172 ? -3.895  -10.290 243.311 1.00 30.00 ? 173 HIS A N   1 
ATOM 1318 C CA  . HIS A 1 172 ? -3.595  -8.869  243.510 1.00 30.00 ? 173 HIS A CA  1 
ATOM 1319 C C   . HIS A 1 172 ? -2.248  -8.359  242.922 1.00 30.00 ? 173 HIS A C   1 
ATOM 1320 O O   . HIS A 1 172 ? -2.106  -7.186  242.523 1.00 30.00 ? 173 HIS A O   1 
ATOM 1321 C CB  . HIS A 1 172 ? -3.627  -8.589  245.008 1.00 30.00 ? 173 HIS A CB  1 
ATOM 1322 C CG  . HIS A 1 172 ? -2.621  -9.477  245.705 1.00 30.00 ? 173 HIS A CG  1 
ATOM 1323 N ND1 . HIS A 1 172 ? -2.613  -10.815 245.793 1.00 30.00 ? 173 HIS A ND1 1 
ATOM 1324 C CD2 . HIS A 1 172 ? -1.540  -8.963  246.391 1.00 30.00 ? 173 HIS A CD2 1 
ATOM 1325 C CE1 . HIS A 1 172 ? -1.536  -11.110 246.528 1.00 30.00 ? 173 HIS A CE1 1 
ATOM 1326 N NE2 . HIS A 1 172 ? -0.904  -10.005 246.882 1.00 30.00 ? 173 HIS A NE2 1 
ATOM 1327 N N   . ALA A 1 173 ? -1.217  -9.223  242.890 1.00 30.00 ? 174 ALA A N   1 
ATOM 1328 C CA  . ALA A 1 173 ? 0.088   -8.764  242.477 1.00 30.00 ? 174 ALA A CA  1 
ATOM 1329 C C   . ALA A 1 173 ? 0.325   -9.107  241.028 1.00 30.00 ? 174 ALA A C   1 
ATOM 1330 O O   . ALA A 1 173 ? 1.422   -8.815  240.551 1.00 30.00 ? 174 ALA A O   1 
ATOM 1331 C CB  . ALA A 1 173 ? 1.172   -9.405  243.335 1.00 30.00 ? 174 ALA A CB  1 
ATOM 1332 N N   . ILE A 1 174 ? -0.650  -9.708  240.303 1.00 30.00 ? 175 ILE A N   1 
ATOM 1333 C CA  . ILE A 1 174 ? -0.530  -10.041 238.883 1.00 30.00 ? 175 ILE A CA  1 
ATOM 1334 C C   . ILE A 1 174 ? -0.659  -8.706  238.146 1.00 30.00 ? 175 ILE A C   1 
ATOM 1335 O O   . ILE A 1 174 ? -1.446  -7.808  238.487 1.00 30.00 ? 175 ILE A O   1 
ATOM 1336 C CB  . ILE A 1 174 ? -1.647  -11.013 238.407 1.00 30.00 ? 175 ILE A CB  1 
ATOM 1337 C CG1 . ILE A 1 174 ? -1.389  -12.421 238.929 1.00 30.00 ? 175 ILE A CG1 1 
ATOM 1338 C CG2 . ILE A 1 174 ? -1.623  -11.145 236.885 1.00 30.00 ? 175 ILE A CG2 1 
ATOM 1339 C CD1 . ILE A 1 174 ? -2.529  -13.388 238.562 1.00 30.00 ? 175 ILE A CD1 1 
ATOM 1340 N N   . LEU A 1 175 ? 0.189   -8.556  237.141 1.00 30.00 ? 176 LEU A N   1 
ATOM 1341 C CA  . LEU A 1 175 ? 0.273   -7.343  236.347 1.00 30.00 ? 176 LEU A CA  1 
ATOM 1342 C C   . LEU A 1 175 ? 0.289   -7.837  234.899 1.00 30.00 ? 176 LEU A C   1 
ATOM 1343 O O   . LEU A 1 175 ? 0.828   -8.904  234.568 1.00 30.00 ? 176 LEU A O   1 
ATOM 1344 C CB  . LEU A 1 175 ? 1.560   -6.588  236.822 1.00 30.00 ? 176 LEU A CB  1 
ATOM 1345 C CG  . LEU A 1 175 ? 1.584   -5.843  238.162 1.00 30.00 ? 176 LEU A CG  1 
ATOM 1346 C CD1 . LEU A 1 175 ? 2.928   -5.328  238.547 1.00 30.00 ? 176 LEU A CD1 1 
ATOM 1347 C CD2 . LEU A 1 175 ? 0.891   -4.567  237.995 1.00 30.00 ? 176 LEU A CD2 1 
ATOM 1348 N N   . ARG A 1 176 ? -0.444  -7.110  234.069 1.00 30.00 ? 177 ARG A N   1 
ATOM 1349 C CA  . ARG A 1 176 ? -0.699  -7.402  232.649 1.00 30.00 ? 177 ARG A CA  1 
ATOM 1350 C C   . ARG A 1 176 ? -0.145  -6.291  231.808 1.00 30.00 ? 177 ARG A C   1 
ATOM 1351 O O   . ARG A 1 176 ? -0.396  -5.125  232.128 1.00 30.00 ? 177 ARG A O   1 
ATOM 1352 C CB  . ARG A 1 176 ? -2.226  -7.535  232.385 1.00 30.00 ? 177 ARG A CB  1 
ATOM 1353 C CG  . ARG A 1 176 ? -2.821  -6.996  231.098 1.00 30.00 ? 177 ARG A CG  1 
ATOM 1354 C CD  . ARG A 1 176 ? -3.855  -7.961  230.554 1.00 30.00 ? 177 ARG A CD  1 
ATOM 1355 N NE  . ARG A 1 176 ? -4.856  -7.339  229.678 1.00 30.00 ? 177 ARG A NE  1 
ATOM 1356 C CZ  . ARG A 1 176 ? -5.802  -8.095  229.076 1.00 30.00 ? 177 ARG A CZ  1 
ATOM 1357 N NH1 . ARG A 1 176 ? -5.771  -9.434  229.197 1.00 30.00 ? 177 ARG A NH1 1 
ATOM 1358 N NH2 . ARG A 1 176 ? -6.753  -7.550  228.292 1.00 30.00 ? 177 ARG A NH2 1 
ATOM 1359 N N   . LEU A 1 177 ? 0.529   -6.693  230.733 1.00 30.00 ? 178 LEU A N   1 
ATOM 1360 C CA  . LEU A 1 177 ? 1.170   -5.777  229.801 1.00 30.00 ? 178 LEU A CA  1 
ATOM 1361 C C   . LEU A 1 177 ? 0.745   -6.239  228.430 1.00 30.00 ? 178 LEU A C   1 
ATOM 1362 O O   . LEU A 1 177 ? 0.910   -7.391  227.995 1.00 30.00 ? 178 LEU A O   1 
ATOM 1363 C CB  . LEU A 1 177 ? 2.694   -5.843  229.872 1.00 30.00 ? 178 LEU A CB  1 
ATOM 1364 C CG  . LEU A 1 177 ? 3.466   -4.529  229.873 1.00 30.00 ? 178 LEU A CG  1 
ATOM 1365 C CD1 . LEU A 1 177 ? 4.746   -4.738  230.646 1.00 30.00 ? 178 LEU A CD1 1 
ATOM 1366 C CD2 . LEU A 1 177 ? 3.675   -4.034  228.455 1.00 30.00 ? 178 LEU A CD2 1 
ATOM 1367 N N   . ASP A 1 178 ? 0.179   -5.243  227.773 1.00 30.00 ? 179 ASP A N   1 
ATOM 1368 C CA  . ASP A 1 178 ? -0.323  -5.513  226.464 1.00 30.00 ? 179 ASP A CA  1 
ATOM 1369 C C   . ASP A 1 178 ? 0.675   -5.080  225.406 1.00 30.00 ? 179 ASP A C   1 
ATOM 1370 O O   . ASP A 1 178 ? 0.615   -4.045  224.725 1.00 30.00 ? 179 ASP A O   1 
ATOM 1371 C CB  . ASP A 1 178 ? -1.721  -4.830  226.415 1.00 30.00 ? 179 ASP A CB  1 
ATOM 1372 C CG  . ASP A 1 178 ? -2.860  -5.681  227.055 1.00 30.00 ? 179 ASP A CG  1 
ATOM 1373 O OD1 . ASP A 1 178 ? -2.586  -6.776  227.561 1.00 30.00 ? 179 ASP A OD1 1 
ATOM 1374 O OD2 . ASP A 1 178 ? -4.028  -5.267  227.058 1.00 30.00 ? 179 ASP A OD2 1 
ATOM 1375 N N   . LEU A 1 179 ? 1.675   -5.933  225.361 1.00 30.00 ? 180 LEU A N   1 
ATOM 1376 C CA  . LEU A 1 179 ? 2.755   -5.807  224.417 1.00 30.00 ? 180 LEU A CA  1 
ATOM 1377 C C   . LEU A 1 179 ? 3.424   -7.174  224.492 1.00 30.00 ? 180 LEU A C   1 
ATOM 1378 O O   . LEU A 1 179 ? 3.864   -7.625  225.553 1.00 30.00 ? 180 LEU A O   1 
ATOM 1379 C CB  . LEU A 1 179 ? 3.654   -4.659  224.864 1.00 30.00 ? 180 LEU A CB  1 
ATOM 1380 C CG  . LEU A 1 179 ? 5.156   -4.766  224.838 1.00 30.00 ? 180 LEU A CG  1 
ATOM 1381 C CD1 . LEU A 1 179 ? 5.712   -4.868  223.446 1.00 30.00 ? 180 LEU A CD1 1 
ATOM 1382 C CD2 . LEU A 1 179 ? 5.701   -3.494  225.411 1.00 30.00 ? 180 LEU A CD2 1 
ATOM 1383 N N   . ALA A 1 180 ? 3.404   -7.876  223.373 1.00 30.00 ? 181 ALA A N   1 
ATOM 1384 C CA  . ALA A 1 180 ? 3.966   -9.204  223.300 1.00 30.00 ? 181 ALA A CA  1 
ATOM 1385 C C   . ALA A 1 180 ? 4.337   -9.459  221.846 1.00 30.00 ? 181 ALA A C   1 
ATOM 1386 O O   . ALA A 1 180 ? 4.248   -8.464  221.114 1.00 30.00 ? 181 ALA A O   1 
ATOM 1387 C CB  . ALA A 1 180 ? 2.942   -10.194 223.699 1.00 30.00 ? 181 ALA A CB  1 
ATOM 1388 N N   . GLY A 1 181 ? 4.657   -10.693 221.400 1.00 30.00 ? 182 GLY A N   1 
ATOM 1389 C CA  . GLY A 1 181 ? 5.081   -11.019 220.048 1.00 30.00 ? 182 GLY A CA  1 
ATOM 1390 C C   . GLY A 1 181 ? 4.459   -10.275 218.843 1.00 30.00 ? 182 GLY A C   1 
ATOM 1391 O O   . GLY A 1 181 ? 5.164   -9.936  217.875 1.00 30.00 ? 182 GLY A O   1 
ATOM 1392 N N   . ARG A 1 182 ? 3.172   -9.957  218.802 1.00 30.00 ? 183 ARG A N   1 
ATOM 1393 C CA  . ARG A 1 182 ? 2.590   -9.309  217.638 1.00 30.00 ? 183 ARG A CA  1 
ATOM 1394 C C   . ARG A 1 182 ? 3.042   -7.852  217.560 1.00 30.00 ? 183 ARG A C   1 
ATOM 1395 O O   . ARG A 1 182 ? 3.302   -7.284  216.493 1.00 30.00 ? 183 ARG A O   1 
ATOM 1396 C CB  . ARG A 1 182 ? 1.083   -9.414  217.758 1.00 30.00 ? 183 ARG A CB  1 
ATOM 1397 C CG  . ARG A 1 182 ? 0.263   -9.705  216.524 1.00 30.00 ? 183 ARG A CG  1 
ATOM 1398 C CD  . ARG A 1 182 ? -1.140  -10.137 217.060 1.00 30.00 ? 183 ARG A CD  1 
ATOM 1399 N NE  . ARG A 1 182 ? -1.876  -9.071  217.773 1.00 30.00 ? 183 ARG A NE  1 
ATOM 1400 C CZ  . ARG A 1 182 ? -3.111  -8.602  217.413 1.00 30.00 ? 183 ARG A CZ  1 
ATOM 1401 N NH1 . ARG A 1 182 ? -3.822  -9.070  216.351 1.00 30.00 ? 183 ARG A NH1 1 
ATOM 1402 N NH2 . ARG A 1 182 ? -3.625  -7.569  218.105 1.00 30.00 ? 183 ARG A NH2 1 
ATOM 1403 N N   . ASP A 1 183 ? 3.197   -7.254  218.733 1.00 30.00 ? 184 ASP A N   1 
ATOM 1404 C CA  . ASP A 1 183 ? 3.638   -5.887  218.849 1.00 30.00 ? 184 ASP A CA  1 
ATOM 1405 C C   . ASP A 1 183 ? 5.032   -5.779  218.297 1.00 30.00 ? 184 ASP A C   1 
ATOM 1406 O O   . ASP A 1 183 ? 5.345   -4.814  217.605 1.00 30.00 ? 184 ASP A O   1 
ATOM 1407 C CB  . ASP A 1 183 ? 3.601   -5.489  220.301 1.00 30.00 ? 184 ASP A CB  1 
ATOM 1408 C CG  . ASP A 1 183 ? 2.162   -5.476  220.797 1.00 30.00 ? 184 ASP A CG  1 
ATOM 1409 O OD1 . ASP A 1 183 ? 1.619   -6.544  221.085 1.00 30.00 ? 184 ASP A OD1 1 
ATOM 1410 O OD2 . ASP A 1 183 ? 1.607   -4.383  220.868 1.00 30.00 ? 184 ASP A OD2 1 
ATOM 1411 N N   . LEU A 1 184 ? 5.844   -6.816  218.481 1.00 30.00 ? 185 LEU A N   1 
ATOM 1412 C CA  . LEU A 1 184 ? 7.206   -6.862  218.027 1.00 30.00 ? 185 LEU A CA  1 
ATOM 1413 C C   . LEU A 1 184 ? 7.313   -7.255  216.571 1.00 30.00 ? 185 LEU A C   1 
ATOM 1414 O O   . LEU A 1 184 ? 8.227   -6.771  215.904 1.00 30.00 ? 185 LEU A O   1 
ATOM 1415 C CB  . LEU A 1 184 ? 7.923   -7.805  218.925 1.00 30.00 ? 185 LEU A CB  1 
ATOM 1416 C CG  . LEU A 1 184 ? 8.845   -7.234  220.005 1.00 30.00 ? 185 LEU A CG  1 
ATOM 1417 C CD1 . LEU A 1 184 ? 8.301   -6.144  220.859 1.00 30.00 ? 185 LEU A CD1 1 
ATOM 1418 C CD2 . LEU A 1 184 ? 9.075   -8.389  220.925 1.00 30.00 ? 185 LEU A CD2 1 
ATOM 1419 N N   . THR A 1 185 ? 6.458   -8.082  215.976 1.00 30.00 ? 186 THR A N   1 
ATOM 1420 C CA  . THR A 1 185 ? 6.456   -8.321  214.525 1.00 30.00 ? 186 THR A CA  1 
ATOM 1421 C C   . THR A 1 185 ? 6.094   -7.067  213.745 1.00 30.00 ? 186 THR A C   1 
ATOM 1422 O O   . THR A 1 185 ? 6.705   -6.724  212.740 1.00 30.00 ? 186 THR A O   1 
ATOM 1423 C CB  . THR A 1 185 ? 5.458   -9.431  214.180 1.00 30.00 ? 186 THR A CB  1 
ATOM 1424 O OG1 . THR A 1 185 ? 5.910   -10.597 214.880 1.00 30.00 ? 186 THR A OG1 1 
ATOM 1425 C CG2 . THR A 1 185 ? 5.373   -9.725  212.709 1.00 30.00 ? 186 THR A CG2 1 
ATOM 1426 N N   . ASP A 1 186 ? 5.112   -6.360  214.259 1.00 30.00 ? 187 ASP A N   1 
ATOM 1427 C CA  . ASP A 1 186 ? 4.654   -5.114  213.729 1.00 30.00 ? 187 ASP A CA  1 
ATOM 1428 C C   . ASP A 1 186 ? 5.628   -3.957  213.716 1.00 30.00 ? 187 ASP A C   1 
ATOM 1429 O O   . ASP A 1 186 ? 5.603   -3.117  212.807 1.00 30.00 ? 187 ASP A O   1 
ATOM 1430 C CB  . ASP A 1 186 ? 3.472   -4.664  214.497 1.00 30.00 ? 187 ASP A CB  1 
ATOM 1431 C CG  . ASP A 1 186 ? 2.217   -5.317  214.059 1.00 30.00 ? 187 ASP A CG  1 
ATOM 1432 O OD1 . ASP A 1 186 ? 2.225   -6.097  213.119 1.00 30.00 ? 187 ASP A OD1 1 
ATOM 1433 O OD2 . ASP A 1 186 ? 1.196   -5.037  214.666 1.00 30.00 ? 187 ASP A OD2 1 
ATOM 1434 N N   . TYR A 1 187 ? 6.382   -3.842  214.812 1.00 30.00 ? 188 TYR A N   1 
ATOM 1435 C CA  . TYR A 1 187 ? 7.349   -2.782  214.948 1.00 30.00 ? 188 TYR A CA  1 
ATOM 1436 C C   . TYR A 1 187 ? 8.583   -3.067  214.126 1.00 30.00 ? 188 TYR A C   1 
ATOM 1437 O O   . TYR A 1 187 ? 9.254   -2.134  213.687 1.00 30.00 ? 188 TYR A O   1 
ATOM 1438 C CB  . TYR A 1 187 ? 7.655   -2.668  216.399 1.00 30.00 ? 188 TYR A CB  1 
ATOM 1439 C CG  . TYR A 1 187 ? 8.711   -1.667  216.712 1.00 30.00 ? 188 TYR A CG  1 
ATOM 1440 C CD1 . TYR A 1 187 ? 8.524   -0.331  216.475 1.00 30.00 ? 188 TYR A CD1 1 
ATOM 1441 C CD2 . TYR A 1 187 ? 9.852   -2.141  217.271 1.00 30.00 ? 188 TYR A CD2 1 
ATOM 1442 C CE1 . TYR A 1 187 ? 9.528   0.561   216.820 1.00 30.00 ? 188 TYR A CE1 1 
ATOM 1443 C CE2 . TYR A 1 187 ? 10.854  -1.262  217.618 1.00 30.00 ? 188 TYR A CE2 1 
ATOM 1444 C CZ  . TYR A 1 187 ? 10.700  0.086   217.397 1.00 30.00 ? 188 TYR A CZ  1 
ATOM 1445 O OH  . TYR A 1 187 ? 11.732  0.939   217.781 1.00 30.00 ? 188 TYR A OH  1 
ATOM 1446 N N   . LEU A 1 188 ? 8.876   -4.336  213.895 1.00 30.00 ? 189 LEU A N   1 
ATOM 1447 C CA  . LEU A 1 188 ? 9.987   -4.742  213.063 1.00 30.00 ? 189 LEU A CA  1 
ATOM 1448 C C   . LEU A 1 188 ? 9.696   -4.320  211.627 1.00 30.00 ? 189 LEU A C   1 
ATOM 1449 O O   . LEU A 1 188 ? 10.564  -3.736  210.978 1.00 30.00 ? 189 LEU A O   1 
ATOM 1450 C CB  . LEU A 1 188 ? 10.151  -6.257  213.129 1.00 30.00 ? 189 LEU A CB  1 
ATOM 1451 C CG  . LEU A 1 188 ? 11.139  -6.860  212.140 1.00 30.00 ? 189 LEU A CG  1 
ATOM 1452 C CD1 . LEU A 1 188 ? 12.547  -6.627  212.651 1.00 30.00 ? 189 LEU A CD1 1 
ATOM 1453 C CD2 . LEU A 1 188 ? 10.853  -8.338  211.938 1.00 30.00 ? 189 LEU A CD2 1 
ATOM 1454 N N   . MET A 1 189 ? 8.493   -4.618  211.100 1.00 30.00 ? 190 MET A N   1 
ATOM 1455 C CA  . MET A 1 189 ? 8.066   -4.324  209.714 1.00 30.00 ? 190 MET A CA  1 
ATOM 1456 C C   . MET A 1 189 ? 8.096   -2.837  209.436 1.00 30.00 ? 190 MET A C   1 
ATOM 1457 O O   . MET A 1 189 ? 8.508   -2.480  208.336 1.00 30.00 ? 190 MET A O   1 
ATOM 1458 C CB  . MET A 1 189 ? 6.624   -4.848  209.452 1.00 30.00 ? 190 MET A CB  1 
ATOM 1459 C CG  . MET A 1 189 ? 5.771   -4.580  208.223 1.00 30.00 ? 190 MET A CG  1 
ATOM 1460 S SD  . MET A 1 189 ? 4.435   -5.833  208.102 1.00 30.00 ? 190 MET A SD  1 
ATOM 1461 C CE  . MET A 1 189 ? 3.547   -5.686  209.644 1.00 30.00 ? 190 MET A CE  1 
ATOM 1462 N N   . LYS A 1 190 ? 7.682   -1.991  210.402 1.00 30.00 ? 191 LYS A N   1 
ATOM 1463 C CA  . LYS A 1 190 ? 7.741   -0.541  210.289 1.00 30.00 ? 191 LYS A CA  1 
ATOM 1464 C C   . LYS A 1 190 ? 9.178   -0.129  210.319 1.00 30.00 ? 191 LYS A C   1 
ATOM 1465 O O   . LYS A 1 190 ? 9.507   0.639   209.429 1.00 30.00 ? 191 LYS A O   1 
ATOM 1466 C CB  . LYS A 1 190 ? 7.047   0.226   211.430 1.00 30.00 ? 191 LYS A CB  1 
ATOM 1467 C CG  . LYS A 1 190 ? 6.663   1.624   210.942 1.00 30.00 ? 191 LYS A CG  1 
ATOM 1468 C CD  . LYS A 1 190 ? 5.829   2.414   211.943 1.00 30.00 ? 191 LYS A CD  1 
ATOM 1469 C CE  . LYS A 1 190 ? 6.589   3.079   213.102 1.00 30.00 ? 191 LYS A CE  1 
ATOM 1470 N NZ  . LYS A 1 190 ? 7.497   2.169   213.793 1.00 30.00 ? 191 LYS A NZ  1 
ATOM 1471 N N   . ILE A 1 191 ? 10.069  -0.585  211.184 1.00 30.00 ? 192 ILE A N   1 
ATOM 1472 C CA  . ILE A 1 191 ? 11.408  -0.052  211.078 1.00 30.00 ? 192 ILE A CA  1 
ATOM 1473 C C   . ILE A 1 191 ? 12.010  -0.598  209.769 1.00 30.00 ? 192 ILE A C   1 
ATOM 1474 O O   . ILE A 1 191 ? 12.649  0.178   209.060 1.00 30.00 ? 192 ILE A O   1 
ATOM 1475 C CB  . ILE A 1 191 ? 12.267  -0.386  212.431 1.00 30.00 ? 192 ILE A CB  1 
ATOM 1476 C CG1 . ILE A 1 191 ? 12.413  -1.852  212.933 1.00 30.00 ? 192 ILE A CG1 1 
ATOM 1477 C CG2 . ILE A 1 191 ? 11.501  0.405   213.460 1.00 30.00 ? 192 ILE A CG2 1 
ATOM 1478 C CD1 . ILE A 1 191 ? 13.079  -2.258  214.312 1.00 30.00 ? 192 ILE A CD1 1 
ATOM 1479 N N   . LEU A 1 192 ? 11.718  -1.806  209.289 1.00 30.00 ? 193 LEU A N   1 
ATOM 1480 C CA  . LEU A 1 192 ? 12.221  -2.322  208.001 1.00 30.00 ? 193 LEU A CA  1 
ATOM 1481 C C   . LEU A 1 192 ? 11.694  -1.565  206.738 1.00 30.00 ? 193 LEU A C   1 
ATOM 1482 O O   . LEU A 1 192 ? 12.444  -1.230  205.815 1.00 30.00 ? 193 LEU A O   1 
ATOM 1483 C CB  . LEU A 1 192 ? 11.854  -3.813  207.982 1.00 30.00 ? 193 LEU A CB  1 
ATOM 1484 C CG  . LEU A 1 192 ? 12.918  -4.835  207.685 1.00 30.00 ? 193 LEU A CG  1 
ATOM 1485 C CD1 . LEU A 1 192 ? 14.129  -4.477  208.483 1.00 30.00 ? 193 LEU A CD1 1 
ATOM 1486 C CD2 . LEU A 1 192 ? 12.452  -6.236  208.011 1.00 30.00 ? 193 LEU A CD2 1 
ATOM 1487 N N   . THR A 1 193 ? 10.412  -1.212  206.686 1.00 30.00 ? 194 THR A N   1 
ATOM 1488 C CA  . THR A 1 193 ? 9.736   -0.393  205.666 1.00 30.00 ? 194 THR A CA  1 
ATOM 1489 C C   . THR A 1 193 ? 10.200  1.073   205.741 1.00 30.00 ? 194 THR A C   1 
ATOM 1490 O O   . THR A 1 193 ? 10.144  1.845   204.772 1.00 30.00 ? 194 THR A O   1 
ATOM 1491 C CB  . THR A 1 193 ? 8.148   -0.522  205.900 1.00 30.00 ? 194 THR A CB  1 
ATOM 1492 O OG1 . THR A 1 193 ? 7.777   -1.773  205.336 1.00 30.00 ? 194 THR A OG1 1 
ATOM 1493 C CG2 . THR A 1 193 ? 7.288   0.574   205.313 1.00 30.00 ? 194 THR A CG2 1 
ATOM 1494 N N   . GLU A 1 194 ? 10.634  1.522   206.930 1.00 30.00 ? 195 GLU A N   1 
ATOM 1495 C CA  . GLU A 1 194 ? 11.170  2.869   207.086 1.00 30.00 ? 195 GLU A CA  1 
ATOM 1496 C C   . GLU A 1 194 ? 12.473  2.884   206.322 1.00 30.00 ? 195 GLU A C   1 
ATOM 1497 O O   . GLU A 1 194 ? 12.733  3.876   205.637 1.00 30.00 ? 195 GLU A O   1 
ATOM 1498 C CB  . GLU A 1 194 ? 11.405  3.233   208.573 1.00 30.00 ? 195 GLU A CB  1 
ATOM 1499 C CG  . GLU A 1 194 ? 10.057  3.670   209.162 1.00 30.00 ? 195 GLU A CG  1 
ATOM 1500 C CD  . GLU A 1 194 ? 10.013  4.249   210.567 1.00 30.00 ? 195 GLU A CD  1 
ATOM 1501 O OE1 . GLU A 1 194 ? 10.826  3.831   211.406 1.00 30.00 ? 195 GLU A OE1 1 
ATOM 1502 O OE2 . GLU A 1 194 ? 9.154   5.126   210.808 1.00 30.00 ? 195 GLU A OE2 1 
ATOM 1503 N N   . ARG A 1 195 ? 13.215  1.769   206.263 1.00 30.00 ? 196 ARG A N   1 
ATOM 1504 C CA  . ARG A 1 195 ? 14.436  1.714   205.478 1.00 30.00 ? 196 ARG A CA  1 
ATOM 1505 C C   . ARG A 1 195 ? 14.103  1.587   203.965 1.00 30.00 ? 196 ARG A C   1 
ATOM 1506 O O   . ARG A 1 195 ? 14.903  1.142   203.149 1.00 30.00 ? 196 ARG A O   1 
ATOM 1507 C CB  . ARG A 1 195 ? 15.253  0.523   206.072 1.00 30.00 ? 196 ARG A CB  1 
ATOM 1508 C CG  . ARG A 1 195 ? 16.770  0.596   205.841 1.00 30.00 ? 196 ARG A CG  1 
ATOM 1509 C CD  . ARG A 1 195 ? 17.657  -0.302  206.679 1.00 30.00 ? 196 ARG A CD  1 
ATOM 1510 N NE  . ARG A 1 195 ? 18.476  -1.227  205.913 1.00 30.00 ? 196 ARG A NE  1 
ATOM 1511 C CZ  . ARG A 1 195 ? 19.565  -1.845  206.435 1.00 30.00 ? 196 ARG A CZ  1 
ATOM 1512 N NH1 . ARG A 1 195 ? 19.998  -1.691  207.691 1.00 30.00 ? 196 ARG A NH1 1 
ATOM 1513 N NH2 . ARG A 1 195 ? 20.349  -2.603  205.665 1.00 30.00 ? 196 ARG A NH2 1 
ATOM 1514 N N   . GLY A 1 196 ? 12.920  2.026   203.523 1.00 30.00 ? 197 GLY A N   1 
ATOM 1515 C CA  . GLY A 1 196 ? 12.456  1.860   202.162 1.00 30.00 ? 197 GLY A CA  1 
ATOM 1516 C C   . GLY A 1 196 ? 12.361  0.386   201.709 1.00 30.00 ? 197 GLY A C   1 
ATOM 1517 O O   . GLY A 1 196 ? 12.861  0.010   200.631 1.00 30.00 ? 197 GLY A O   1 
ATOM 1518 N N   . TYR A 1 197 ? 11.781  -0.501  202.528 1.00 30.00 ? 198 TYR A N   1 
ATOM 1519 C CA  . TYR A 1 197 ? 11.569  -1.886  202.142 1.00 30.00 ? 198 TYR A CA  1 
ATOM 1520 C C   . TYR A 1 197 ? 10.089  -1.993  201.887 1.00 30.00 ? 198 TYR A C   1 
ATOM 1521 O O   . TYR A 1 197 ? 9.269   -1.130  202.234 1.00 30.00 ? 198 TYR A O   1 
ATOM 1522 C CB  . TYR A 1 197 ? 11.905  -2.891  203.209 1.00 30.00 ? 198 TYR A CB  1 
ATOM 1523 C CG  . TYR A 1 197 ? 13.381  -3.158  203.320 1.00 30.00 ? 198 TYR A CG  1 
ATOM 1524 C CD1 . TYR A 1 197 ? 14.166  -3.456  202.237 1.00 30.00 ? 198 TYR A CD1 1 
ATOM 1525 C CD2 . TYR A 1 197 ? 13.937  -3.150  204.564 1.00 30.00 ? 198 TYR A CD2 1 
ATOM 1526 C CE1 . TYR A 1 197 ? 15.499  -3.748  202.436 1.00 30.00 ? 198 TYR A CE1 1 
ATOM 1527 C CE2 . TYR A 1 197 ? 15.262  -3.438  204.781 1.00 30.00 ? 198 TYR A CE2 1 
ATOM 1528 C CZ  . TYR A 1 197 ? 16.026  -3.740  203.708 1.00 30.00 ? 198 TYR A CZ  1 
ATOM 1529 O OH  . TYR A 1 197 ? 17.335  -4.080  203.964 1.00 30.00 ? 198 TYR A OH  1 
ATOM 1530 N N   . SER A 1 198 ? 9.754   -3.132  201.308 1.00 30.00 ? 199 SER A N   1 
ATOM 1531 C CA  . SER A 1 198 ? 8.435   -3.274  200.738 1.00 30.00 ? 199 SER A CA  1 
ATOM 1532 C C   . SER A 1 198 ? 7.875   -4.633  201.148 1.00 30.00 ? 199 SER A C   1 
ATOM 1533 O O   . SER A 1 198 ? 8.328   -5.671  200.640 1.00 30.00 ? 199 SER A O   1 
ATOM 1534 C CB  . SER A 1 198 ? 8.669   -3.100  199.213 1.00 30.00 ? 199 SER A CB  1 
ATOM 1535 O OG  . SER A 1 198 ? 9.549   -2.000  198.854 1.00 30.00 ? 199 SER A OG  1 
ATOM 1536 N N   . PHE A 1 199 ? 6.921   -4.681  202.097 1.00 30.00 ? 200 PHE A N   1 
ATOM 1537 C CA  . PHE A 1 199 ? 6.344   -5.972  202.494 1.00 30.00 ? 200 PHE A CA  1 
ATOM 1538 C C   . PHE A 1 199 ? 4.934   -6.012  202.000 1.00 30.00 ? 200 PHE A C   1 
ATOM 1539 O O   . PHE A 1 199 ? 3.974   -6.391  202.680 1.00 30.00 ? 200 PHE A O   1 
ATOM 1540 C CB  . PHE A 1 199 ? 6.393   -6.169  204.030 1.00 30.00 ? 200 PHE A CB  1 
ATOM 1541 C CG  . PHE A 1 199 ? 7.844   -6.443  204.381 1.00 30.00 ? 200 PHE A CG  1 
ATOM 1542 C CD1 . PHE A 1 199 ? 8.415   -7.637  203.981 1.00 30.00 ? 200 PHE A CD1 1 
ATOM 1543 C CD2 . PHE A 1 199 ? 8.567   -5.464  205.015 1.00 30.00 ? 200 PHE A CD2 1 
ATOM 1544 C CE1 . PHE A 1 199 ? 9.743   -7.844  204.221 1.00 30.00 ? 200 PHE A CE1 1 
ATOM 1545 C CE2 . PHE A 1 199 ? 9.886   -5.672  205.249 1.00 30.00 ? 200 PHE A CE2 1 
ATOM 1546 C CZ  . PHE A 1 199 ? 10.466  -6.855  204.854 1.00 30.00 ? 200 PHE A CZ  1 
ATOM 1547 N N   . THR A 1 200 ? 4.884   -5.727  200.700 1.00 30.00 ? 201 THR A N   1 
ATOM 1548 C CA  . THR A 1 200 ? 3.574   -5.456  200.170 1.00 30.00 ? 201 THR A CA  1 
ATOM 1549 C C   . THR A 1 200 ? 2.648   -6.641  199.950 1.00 30.00 ? 201 THR A C   1 
ATOM 1550 O O   . THR A 1 200 ? 1.445   -6.374  199.958 1.00 30.00 ? 201 THR A O   1 
ATOM 1551 C CB  . THR A 1 200 ? 3.760   -4.528  198.848 1.00 30.00 ? 201 THR A CB  1 
ATOM 1552 O OG1 . THR A 1 200 ? 4.818   -4.941  197.959 1.00 30.00 ? 201 THR A OG1 1 
ATOM 1553 C CG2 . THR A 1 200 ? 4.045   -3.101  199.364 1.00 30.00 ? 201 THR A CG2 1 
ATOM 1554 N N   . THR A 1 201 ? 3.059   -7.909  199.836 1.00 30.00 ? 202 THR A N   1 
ATOM 1555 C CA  . THR A 1 201 ? 2.048   -8.925  199.547 1.00 30.00 ? 202 THR A CA  1 
ATOM 1556 C C   . THR A 1 201 ? 1.712   -10.057 200.511 1.00 30.00 ? 202 THR A C   1 
ATOM 1557 O O   . THR A 1 201 ? 2.407   -11.079 200.535 1.00 30.00 ? 202 THR A O   1 
ATOM 1558 C CB  . THR A 1 201 ? 2.395   -9.480  198.139 1.00 30.00 ? 202 THR A CB  1 
ATOM 1559 O OG1 . THR A 1 201 ? 2.266   -8.297  197.353 1.00 30.00 ? 202 THR A OG1 1 
ATOM 1560 C CG2 . THR A 1 201 ? 1.502   -10.602 197.554 1.00 30.00 ? 202 THR A CG2 1 
ATOM 1561 N N   . THR A 1 202 ? 0.620   -9.866  201.271 1.00 30.00 ? 203 THR A N   1 
ATOM 1562 C CA  . THR A 1 202 ? -0.026  -10.810 202.221 1.00 30.00 ? 203 THR A CA  1 
ATOM 1563 C C   . THR A 1 202 ? 0.828   -11.862 202.945 1.00 30.00 ? 203 THR A C   1 
ATOM 1564 O O   . THR A 1 202 ? 1.031   -11.720 204.153 1.00 30.00 ? 203 THR A O   1 
ATOM 1565 C CB  . THR A 1 202 ? -1.260  -11.618 201.539 1.00 30.00 ? 203 THR A CB  1 
ATOM 1566 O OG1 . THR A 1 202 ? -1.650  -11.075 200.257 1.00 30.00 ? 203 THR A OG1 1 
ATOM 1567 C CG2 . THR A 1 202 ? -2.437  -11.569 202.524 1.00 30.00 ? 203 THR A CG2 1 
ATOM 1568 N N   . ALA A 1 203 ? 1.355   -12.869 202.209 1.00 30.00 ? 204 ALA A N   1 
ATOM 1569 C CA  . ALA A 1 203 ? 2.229   -13.925 202.697 1.00 30.00 ? 204 ALA A CA  1 
ATOM 1570 C C   . ALA A 1 203 ? 3.343   -13.123 203.290 1.00 30.00 ? 204 ALA A C   1 
ATOM 1571 O O   . ALA A 1 203 ? 3.449   -13.146 204.510 1.00 30.00 ? 204 ALA A O   1 
ATOM 1572 C CB  . ALA A 1 203 ? 2.913   -14.767 201.637 1.00 30.00 ? 204 ALA A CB  1 
ATOM 1573 N N   . GLU A 1 204 ? 4.020   -12.258 202.503 1.00 30.00 ? 205 GLU A N   1 
ATOM 1574 C CA  . GLU A 1 204 ? 5.144   -11.521 203.041 1.00 30.00 ? 205 GLU A CA  1 
ATOM 1575 C C   . GLU A 1 204 ? 4.856   -10.570 204.227 1.00 30.00 ? 205 GLU A C   1 
ATOM 1576 O O   . GLU A 1 204 ? 5.831   -10.066 204.800 1.00 30.00 ? 205 GLU A O   1 
ATOM 1577 C CB  . GLU A 1 204 ? 5.865   -10.812 201.853 1.00 30.00 ? 205 GLU A CB  1 
ATOM 1578 C CG  . GLU A 1 204 ? 5.374   -9.558  201.170 1.00 30.00 ? 205 GLU A CG  1 
ATOM 1579 C CD  . GLU A 1 204 ? 6.353   -9.012  200.116 1.00 30.00 ? 205 GLU A CD  1 
ATOM 1580 O OE1 . GLU A 1 204 ? 7.254   -8.239  200.451 1.00 30.00 ? 205 GLU A OE1 1 
ATOM 1581 O OE2 . GLU A 1 204 ? 6.240   -9.347  198.943 1.00 30.00 ? 205 GLU A OE2 1 
ATOM 1582 N N   . ARG A 1 205 ? 3.616   -10.424 204.738 1.00 30.00 ? 206 ARG A N   1 
ATOM 1583 C CA  . ARG A 1 205 ? 3.362   -9.735  206.024 1.00 30.00 ? 206 ARG A CA  1 
ATOM 1584 C C   . ARG A 1 205 ? 3.711   -10.694 207.188 1.00 30.00 ? 206 ARG A C   1 
ATOM 1585 O O   . ARG A 1 205 ? 4.010   -10.380 208.349 1.00 30.00 ? 206 ARG A O   1 
ATOM 1586 C CB  . ARG A 1 205 ? 1.878   -9.323  206.203 1.00 30.00 ? 206 ARG A CB  1 
ATOM 1587 C CG  . ARG A 1 205 ? 1.738   -8.104  207.152 1.00 30.00 ? 206 ARG A CG  1 
ATOM 1588 C CD  . ARG A 1 205 ? 1.110   -8.226  208.579 1.00 30.00 ? 206 ARG A CD  1 
ATOM 1589 N NE  . ARG A 1 205 ? 1.689   -9.132  209.591 1.00 30.00 ? 206 ARG A NE  1 
ATOM 1590 C CZ  . ARG A 1 205 ? 1.376   -8.967  210.888 1.00 30.00 ? 206 ARG A CZ  1 
ATOM 1591 N NH1 . ARG A 1 205 ? 0.572   -7.987  211.292 1.00 30.00 ? 206 ARG A NH1 1 
ATOM 1592 N NH2 . ARG A 1 205 ? 1.750   -9.864  211.788 1.00 30.00 ? 206 ARG A NH2 1 
ATOM 1593 N N   . GLU A 1 206 ? 3.566   -11.951 206.851 1.00 30.00 ? 207 GLU A N   1 
ATOM 1594 C CA  . GLU A 1 206 ? 4.012   -13.043 207.673 1.00 30.00 ? 207 GLU A CA  1 
ATOM 1595 C C   . GLU A 1 206 ? 5.494   -13.280 207.424 1.00 30.00 ? 207 GLU A C   1 
ATOM 1596 O O   . GLU A 1 206 ? 6.081   -14.110 208.094 1.00 30.00 ? 207 GLU A O   1 
ATOM 1597 C CB  . GLU A 1 206 ? 3.210   -14.302 207.323 1.00 30.00 ? 207 GLU A CB  1 
ATOM 1598 C CG  . GLU A 1 206 ? 2.459   -14.881 208.521 1.00 30.00 ? 207 GLU A CG  1 
ATOM 1599 C CD  . GLU A 1 206 ? 3.367   -15.110 209.747 1.00 30.00 ? 207 GLU A CD  1 
ATOM 1600 O OE1 . GLU A 1 206 ? 4.056   -16.142 209.788 1.00 30.00 ? 207 GLU A OE1 1 
ATOM 1601 O OE2 . GLU A 1 206 ? 3.386   -14.239 210.635 1.00 30.00 ? 207 GLU A OE2 1 
ATOM 1602 N N   . ILE A 1 207 ? 6.214   -12.597 206.541 1.00 30.00 ? 208 ILE A N   1 
ATOM 1603 C CA  . ILE A 1 207 ? 7.648   -12.853 206.377 1.00 30.00 ? 208 ILE A CA  1 
ATOM 1604 C C   . ILE A 1 207 ? 8.498   -12.017 207.359 1.00 30.00 ? 208 ILE A C   1 
ATOM 1605 O O   . ILE A 1 207 ? 9.685   -12.289 207.619 1.00 30.00 ? 208 ILE A O   1 
ATOM 1606 C CB  . ILE A 1 207 ? 7.965   -12.605 204.864 1.00 30.00 ? 208 ILE A CB  1 
ATOM 1607 C CG1 . ILE A 1 207 ? 8.536   -13.932 204.396 1.00 30.00 ? 208 ILE A CG1 1 
ATOM 1608 C CG2 . ILE A 1 207 ? 8.904   -11.427 204.534 1.00 30.00 ? 208 ILE A CG2 1 
ATOM 1609 C CD1 . ILE A 1 207 ? 7.429   -14.872 203.875 1.00 30.00 ? 208 ILE A CD1 1 
ATOM 1610 N N   . VAL A 1 208 ? 7.887   -10.993 207.972 1.00 30.00 ? 209 VAL A N   1 
ATOM 1611 C CA  . VAL A 1 208 ? 8.563   -10.284 209.043 1.00 30.00 ? 209 VAL A CA  1 
ATOM 1612 C C   . VAL A 1 208 ? 8.596   -11.183 210.289 1.00 30.00 ? 209 VAL A C   1 
ATOM 1613 O O   . VAL A 1 208 ? 9.626   -11.181 210.959 1.00 30.00 ? 209 VAL A O   1 
ATOM 1614 C CB  . VAL A 1 208 ? 7.868   -8.919  209.336 1.00 30.00 ? 209 VAL A CB  1 
ATOM 1615 C CG1 . VAL A 1 208 ? 8.192   -8.005  208.142 1.00 30.00 ? 209 VAL A CG1 1 
ATOM 1616 C CG2 . VAL A 1 208 ? 6.356   -9.024  209.489 1.00 30.00 ? 209 VAL A CG2 1 
ATOM 1617 N N   . ARG A 1 209 ? 7.581   -12.037 210.547 1.00 30.00 ? 210 ARG A N   1 
ATOM 1618 C CA  . ARG A 1 209 ? 7.518   -12.986 211.663 1.00 30.00 ? 210 ARG A CA  1 
ATOM 1619 C C   . ARG A 1 209 ? 8.760   -13.829 211.640 1.00 30.00 ? 210 ARG A C   1 
ATOM 1620 O O   . ARG A 1 209 ? 9.355   -14.028 212.666 1.00 30.00 ? 210 ARG A O   1 
ATOM 1621 C CB  . ARG A 1 209 ? 6.302   -13.933 211.540 1.00 30.00 ? 210 ARG A CB  1 
ATOM 1622 C CG  . ARG A 1 209 ? 5.805   -14.700 212.789 1.00 30.00 ? 210 ARG A CG  1 
ATOM 1623 C CD  . ARG A 1 209 ? 5.310   -16.197 212.650 1.00 30.00 ? 210 ARG A CD  1 
ATOM 1624 N NE  . ARG A 1 209 ? 6.311   -17.084 212.020 1.00 30.00 ? 210 ARG A NE  1 
ATOM 1625 C CZ  . ARG A 1 209 ? 6.666   -18.342 212.387 1.00 30.00 ? 210 ARG A CZ  1 
ATOM 1626 N NH1 . ARG A 1 209 ? 6.150   -19.027 213.420 1.00 30.00 ? 210 ARG A NH1 1 
ATOM 1627 N NH2 . ARG A 1 209 ? 7.654   -18.941 211.718 1.00 30.00 ? 210 ARG A NH2 1 
ATOM 1628 N N   . ASP A 1 210 ? 9.225   -14.348 210.514 1.00 30.00 ? 211 ASP A N   1 
ATOM 1629 C CA  . ASP A 1 210 ? 10.453  -15.157 210.476 1.00 30.00 ? 211 ASP A CA  1 
ATOM 1630 C C   . ASP A 1 210 ? 11.725  -14.326 210.615 1.00 30.00 ? 211 ASP A C   1 
ATOM 1631 O O   . ASP A 1 210 ? 12.692  -14.854 211.154 1.00 30.00 ? 211 ASP A O   1 
ATOM 1632 C CB  . ASP A 1 210 ? 10.696  -15.930 209.175 1.00 30.00 ? 211 ASP A CB  1 
ATOM 1633 C CG  . ASP A 1 210 ? 9.582   -16.865 208.809 1.00 30.00 ? 211 ASP A CG  1 
ATOM 1634 O OD1 . ASP A 1 210 ? 8.543   -16.406 208.272 1.00 30.00 ? 211 ASP A OD1 1 
ATOM 1635 O OD2 . ASP A 1 210 ? 9.786   -18.050 209.086 1.00 30.00 ? 211 ASP A OD2 1 
ATOM 1636 N N   . ILE A 1 211 ? 11.840  -13.084 210.125 1.00 30.00 ? 212 ILE A N   1 
ATOM 1637 C CA  . ILE A 1 211 ? 13.063  -12.301 210.360 1.00 30.00 ? 212 ILE A CA  1 
ATOM 1638 C C   . ILE A 1 211 ? 13.165  -12.081 211.898 1.00 30.00 ? 212 ILE A C   1 
ATOM 1639 O O   . ILE A 1 211 ? 14.169  -12.387 212.555 1.00 30.00 ? 212 ILE A O   1 
ATOM 1640 C CB  . ILE A 1 211 ? 12.948  -10.949 209.562 1.00 30.00 ? 212 ILE A CB  1 
ATOM 1641 C CG1 . ILE A 1 211 ? 12.824  -11.193 208.075 1.00 30.00 ? 212 ILE A CG1 1 
ATOM 1642 C CG2 . ILE A 1 211 ? 14.182  -10.126 209.774 1.00 30.00 ? 212 ILE A CG2 1 
ATOM 1643 C CD1 . ILE A 1 211 ? 12.041  -10.076 207.408 1.00 30.00 ? 212 ILE A CD1 1 
ATOM 1644 N N   . LYS A 1 212 ? 12.039  -11.689 212.506 1.00 30.00 ? 213 LYS A N   1 
ATOM 1645 C CA  . LYS A 1 212 ? 11.893  -11.359 213.895 1.00 30.00 ? 213 LYS A CA  1 
ATOM 1646 C C   . LYS A 1 212 ? 12.333  -12.540 214.662 1.00 30.00 ? 213 LYS A C   1 
ATOM 1647 O O   . LYS A 1 212 ? 13.220  -12.411 215.496 1.00 30.00 ? 213 LYS A O   1 
ATOM 1648 C CB  . LYS A 1 212 ? 10.461  -11.091 214.251 1.00 30.00 ? 213 LYS A CB  1 
ATOM 1649 C CG  . LYS A 1 212 ? 10.304  -10.455 215.590 1.00 30.00 ? 213 LYS A CG  1 
ATOM 1650 C CD  . LYS A 1 212 ? 8.885   -10.474 216.027 1.00 30.00 ? 213 LYS A CD  1 
ATOM 1651 C CE  . LYS A 1 212 ? 8.619   -11.874 216.486 1.00 30.00 ? 213 LYS A CE  1 
ATOM 1652 N NZ  . LYS A 1 212 ? 7.199   -12.102 216.564 1.00 30.00 ? 213 LYS A NZ  1 
ATOM 1653 N N   . GLU A 1 213 ? 11.789  -13.690 214.334 1.00 30.00 ? 214 GLU A N   1 
ATOM 1654 C CA  . GLU A 1 213 ? 12.147  -14.797 215.161 1.00 30.00 ? 214 GLU A CA  1 
ATOM 1655 C C   . GLU A 1 213 ? 13.517  -15.249 214.759 1.00 30.00 ? 214 GLU A C   1 
ATOM 1656 O O   . GLU A 1 213 ? 14.193  -15.773 215.643 1.00 30.00 ? 214 GLU A O   1 
ATOM 1657 C CB  . GLU A 1 213 ? 11.181  -15.967 215.019 1.00 30.00 ? 214 GLU A CB  1 
ATOM 1658 C CG  . GLU A 1 213 ? 9.731   -15.661 215.421 1.00 30.00 ? 214 GLU A CG  1 
ATOM 1659 C CD  . GLU A 1 213 ? 8.745   -16.737 214.969 1.00 30.00 ? 214 GLU A CD  1 
ATOM 1660 O OE1 . GLU A 1 213 ? 9.163   -17.752 214.414 1.00 30.00 ? 214 GLU A OE1 1 
ATOM 1661 O OE2 . GLU A 1 213 ? 7.549   -16.563 215.174 1.00 30.00 ? 214 GLU A OE2 1 
ATOM 1662 N N   . LYS A 1 214 ? 14.006  -15.056 213.521 1.00 30.00 ? 215 LYS A N   1 
ATOM 1663 C CA  . LYS A 1 214 ? 15.293  -15.630 213.188 1.00 30.00 ? 215 LYS A CA  1 
ATOM 1664 C C   . LYS A 1 214 ? 16.508  -14.815 213.465 1.00 30.00 ? 215 LYS A C   1 
ATOM 1665 O O   . LYS A 1 214 ? 17.565  -15.380 213.698 1.00 30.00 ? 215 LYS A O   1 
ATOM 1666 C CB  . LYS A 1 214 ? 15.401  -16.021 211.731 1.00 30.00 ? 215 LYS A CB  1 
ATOM 1667 C CG  . LYS A 1 214 ? 15.031  -17.490 211.487 1.00 30.00 ? 215 LYS A CG  1 
ATOM 1668 C CD  . LYS A 1 214 ? 13.538  -17.723 211.249 1.00 30.00 ? 215 LYS A CD  1 
ATOM 1669 C CE  . LYS A 1 214 ? 13.356  -18.923 210.313 1.00 30.00 ? 215 LYS A CE  1 
ATOM 1670 N NZ  . LYS A 1 214 ? 11.962  -19.099 209.955 1.00 30.00 ? 215 LYS A NZ  1 
ATOM 1671 N N   . LEU A 1 215 ? 16.419  -13.500 213.462 1.00 30.00 ? 216 LEU A N   1 
ATOM 1672 C CA  . LEU A 1 215 ? 17.600  -12.658 213.563 1.00 30.00 ? 216 LEU A CA  1 
ATOM 1673 C C   . LEU A 1 215 ? 17.544  -11.797 214.803 1.00 30.00 ? 216 LEU A C   1 
ATOM 1674 O O   . LEU A 1 215 ? 18.619  -11.339 215.207 1.00 30.00 ? 216 LEU A O   1 
ATOM 1675 C CB  . LEU A 1 215 ? 17.725  -11.754 212.290 1.00 30.00 ? 216 LEU A CB  1 
ATOM 1676 C CG  . LEU A 1 215 ? 17.676  -12.537 210.951 1.00 30.00 ? 216 LEU A CG  1 
ATOM 1677 C CD1 . LEU A 1 215 ? 17.258  -11.585 209.889 1.00 30.00 ? 216 LEU A CD1 1 
ATOM 1678 C CD2 . LEU A 1 215 ? 18.988  -13.266 210.657 1.00 30.00 ? 216 LEU A CD2 1 
ATOM 1679 N N   . CYS A 1 216 ? 16.374  -11.511 215.435 1.00 30.00 ? 217 CYS A N   1 
ATOM 1680 C CA  . CYS A 1 216 ? 16.399  -10.668 216.620 1.00 30.00 ? 217 CYS A CA  1 
ATOM 1681 C C   . CYS A 1 216 ? 17.120  -11.267 217.803 1.00 30.00 ? 217 CYS A C   1 
ATOM 1682 O O   . CYS A 1 216 ? 17.385  -12.457 217.863 1.00 30.00 ? 217 CYS A O   1 
ATOM 1683 C CB  . CYS A 1 216 ? 15.021  -10.294 216.997 1.00 30.00 ? 217 CYS A CB  1 
ATOM 1684 S SG  . CYS A 1 216 ? 14.649  -9.105  215.693 1.00 30.00 ? 217 CYS A SG  1 
ATOM 1685 N N   . TYR A 1 217 ? 17.544  -10.291 218.599 1.00 30.00 ? 218 TYR A N   1 
ATOM 1686 C CA  . TYR A 1 217 ? 18.487  -10.384 219.685 1.00 30.00 ? 218 TYR A CA  1 
ATOM 1687 C C   . TYR A 1 217 ? 18.068  -9.284  220.668 1.00 30.00 ? 218 TYR A C   1 
ATOM 1688 O O   . TYR A 1 217 ? 17.515  -8.236  220.288 1.00 30.00 ? 218 TYR A O   1 
ATOM 1689 C CB  . TYR A 1 217 ? 19.940  -10.031 219.238 1.00 30.00 ? 218 TYR A CB  1 
ATOM 1690 C CG  . TYR A 1 217 ? 20.848  -11.050 218.596 1.00 30.00 ? 218 TYR A CG  1 
ATOM 1691 C CD1 . TYR A 1 217 ? 20.434  -11.993 217.664 1.00 30.00 ? 218 TYR A CD1 1 
ATOM 1692 C CD2 . TYR A 1 217 ? 22.154  -11.088 219.037 1.00 30.00 ? 218 TYR A CD2 1 
ATOM 1693 C CE1 . TYR A 1 217 ? 21.311  -12.975 217.182 1.00 30.00 ? 218 TYR A CE1 1 
ATOM 1694 C CE2 . TYR A 1 217 ? 23.037  -12.059 218.562 1.00 30.00 ? 218 TYR A CE2 1 
ATOM 1695 C CZ  . TYR A 1 217 ? 22.626  -13.012 217.638 1.00 30.00 ? 218 TYR A CZ  1 
ATOM 1696 O OH  . TYR A 1 217 ? 23.546  -13.974 217.181 1.00 30.00 ? 218 TYR A OH  1 
ATOM 1697 N N   . VAL A 1 218 ? 18.422  -9.514  221.934 1.00 30.00 ? 219 VAL A N   1 
ATOM 1698 C CA  . VAL A 1 218 ? 18.269  -8.553  222.994 1.00 30.00 ? 219 VAL A CA  1 
ATOM 1699 C C   . VAL A 1 218 ? 19.712  -8.191  223.336 1.00 30.00 ? 219 VAL A C   1 
ATOM 1700 O O   . VAL A 1 218 ? 20.606  -9.028  223.483 1.00 30.00 ? 219 VAL A O   1 
ATOM 1701 C CB  . VAL A 1 218 ? 17.578  -9.159  224.229 1.00 30.00 ? 219 VAL A CB  1 
ATOM 1702 C CG1 . VAL A 1 218 ? 17.443  -8.075  225.291 1.00 30.00 ? 219 VAL A CG1 1 
ATOM 1703 C CG2 . VAL A 1 218 ? 16.200  -9.678  223.879 1.00 30.00 ? 219 VAL A CG2 1 
ATOM 1704 N N   . ALA A 1 219 ? 19.898  -6.877  223.392 1.00 30.00 ? 220 ALA A N   1 
ATOM 1705 C CA  . ALA A 1 219 ? 21.154  -6.212  223.686 1.00 30.00 ? 220 ALA A CA  1 
ATOM 1706 C C   . ALA A 1 219 ? 21.308  -6.095  225.181 1.00 30.00 ? 220 ALA A C   1 
ATOM 1707 O O   . ALA A 1 219 ? 20.277  -5.894  225.806 1.00 30.00 ? 220 ALA A O   1 
ATOM 1708 C CB  . ALA A 1 219 ? 21.190  -4.781  223.121 1.00 30.00 ? 220 ALA A CB  1 
ATOM 1709 N N   . LEU A 1 220 ? 22.542  -6.174  225.733 1.00 30.00 ? 221 LEU A N   1 
ATOM 1710 C CA  . LEU A 1 220 ? 22.844  -6.023  227.163 1.00 30.00 ? 221 LEU A CA  1 
ATOM 1711 C C   . LEU A 1 220 ? 22.863  -4.566  227.483 1.00 30.00 ? 221 LEU A C   1 
ATOM 1712 O O   . LEU A 1 220 ? 22.341  -4.085  228.481 1.00 30.00 ? 221 LEU A O   1 
ATOM 1713 C CB  . LEU A 1 220 ? 24.207  -6.567  227.566 1.00 30.00 ? 221 LEU A CB  1 
ATOM 1714 C CG  . LEU A 1 220 ? 24.320  -7.815  228.446 1.00 30.00 ? 221 LEU A CG  1 
ATOM 1715 C CD1 . LEU A 1 220 ? 25.720  -7.820  228.999 1.00 30.00 ? 221 LEU A CD1 1 
ATOM 1716 C CD2 . LEU A 1 220 ? 23.361  -7.798  229.652 1.00 30.00 ? 221 LEU A CD2 1 
ATOM 1717 N N   . ASP A 1 221 ? 23.514  -3.841  226.613 1.00 30.00 ? 222 ASP A N   1 
ATOM 1718 C CA  . ASP A 1 221 ? 23.486  -2.427  226.800 1.00 30.00 ? 222 ASP A CA  1 
ATOM 1719 C C   . ASP A 1 221 ? 23.031  -1.857  225.465 1.00 30.00 ? 222 ASP A C   1 
ATOM 1720 O O   . ASP A 1 221 ? 23.893  -1.679  224.588 1.00 30.00 ? 222 ASP A O   1 
ATOM 1721 C CB  . ASP A 1 221 ? 24.886  -1.929  227.201 1.00 30.00 ? 222 ASP A CB  1 
ATOM 1722 C CG  . ASP A 1 221 ? 24.784  -0.681  228.083 1.00 30.00 ? 222 ASP A CG  1 
ATOM 1723 O OD1 . ASP A 1 221 ? 24.151  0.307   227.682 1.00 30.00 ? 222 ASP A OD1 1 
ATOM 1724 O OD2 . ASP A 1 221 ? 25.306  -0.720  229.212 1.00 30.00 ? 222 ASP A OD2 1 
ATOM 1725 N N   . PHE A 1 222 ? 21.712  -1.587  225.285 1.00 30.00 ? 223 PHE A N   1 
ATOM 1726 C CA  . PHE A 1 222 ? 21.228  -0.998  224.030 1.00 30.00 ? 223 PHE A CA  1 
ATOM 1727 C C   . PHE A 1 222 ? 22.180  0.071   223.486 1.00 30.00 ? 223 PHE A C   1 
ATOM 1728 O O   . PHE A 1 222 ? 22.686  -0.068  222.378 1.00 30.00 ? 223 PHE A O   1 
ATOM 1729 C CB  . PHE A 1 222 ? 19.874  -0.354  224.222 1.00 30.00 ? 223 PHE A CB  1 
ATOM 1730 C CG  . PHE A 1 222 ? 19.160  0.069   222.955 1.00 30.00 ? 223 PHE A CG  1 
ATOM 1731 C CD1 . PHE A 1 222 ? 18.972  -0.823  221.916 1.00 30.00 ? 223 PHE A CD1 1 
ATOM 1732 C CD2 . PHE A 1 222 ? 18.741  1.374   222.824 1.00 30.00 ? 223 PHE A CD2 1 
ATOM 1733 C CE1 . PHE A 1 222 ? 18.378  -0.423  220.732 1.00 30.00 ? 223 PHE A CE1 1 
ATOM 1734 C CE2 . PHE A 1 222 ? 18.150  1.775   221.634 1.00 30.00 ? 223 PHE A CE2 1 
ATOM 1735 C CZ  . PHE A 1 222 ? 17.969  0.880   220.583 1.00 30.00 ? 223 PHE A CZ  1 
ATOM 1736 N N   . GLU A 1 223 ? 22.546  1.034   224.349 1.00 30.00 ? 224 GLU A N   1 
ATOM 1737 C CA  . GLU A 1 223 ? 23.448  2.163   224.071 1.00 30.00 ? 224 GLU A CA  1 
ATOM 1738 C C   . GLU A 1 223 ? 24.804  1.727   223.524 1.00 30.00 ? 224 GLU A C   1 
ATOM 1739 O O   . GLU A 1 223 ? 25.051  1.982   222.339 1.00 30.00 ? 224 GLU A O   1 
ATOM 1740 C CB  . GLU A 1 223 ? 23.500  2.928   225.385 1.00 30.00 ? 224 GLU A CB  1 
ATOM 1741 C CG  . GLU A 1 223 ? 24.647  3.799   225.881 1.00 30.00 ? 224 GLU A CG  1 
ATOM 1742 C CD  . GLU A 1 223 ? 24.429  4.235   227.358 1.00 30.00 ? 224 GLU A CD  1 
ATOM 1743 O OE1 . GLU A 1 223 ? 24.190  3.370   228.217 1.00 30.00 ? 224 GLU A OE1 1 
ATOM 1744 O OE2 . GLU A 1 223 ? 24.477  5.440   227.669 1.00 30.00 ? 224 GLU A OE2 1 
ATOM 1745 N N   . GLN A 1 224 ? 25.640  0.969   224.227 1.00 30.00 ? 225 GLN A N   1 
ATOM 1746 C CA  . GLN A 1 224 ? 26.852  0.538   223.613 1.00 30.00 ? 225 GLN A CA  1 
ATOM 1747 C C   . GLN A 1 224 ? 26.533  -0.468  222.528 1.00 30.00 ? 225 GLN A C   1 
ATOM 1748 O O   . GLN A 1 224 ? 27.403  -0.812  221.724 1.00 30.00 ? 225 GLN A O   1 
ATOM 1749 C CB  . GLN A 1 224 ? 27.745  -0.073  224.639 1.00 30.00 ? 225 GLN A CB  1 
ATOM 1750 C CG  . GLN A 1 224 ? 29.258  0.208   224.390 1.00 30.00 ? 225 GLN A CG  1 
ATOM 1751 C CD  . GLN A 1 224 ? 30.102  -0.927  223.797 1.00 30.00 ? 225 GLN A CD  1 
ATOM 1752 O OE1 . GLN A 1 224 ? 29.569  -2.000  223.486 1.00 30.00 ? 225 GLN A OE1 1 
ATOM 1753 N NE2 . GLN A 1 224 ? 31.424  -0.781  223.648 1.00 30.00 ? 225 GLN A NE2 1 
ATOM 1754 N N   . GLU A 1 225 ? 25.317  -0.978  222.353 1.00 30.00 ? 226 GLU A N   1 
ATOM 1755 C CA  . GLU A 1 225 ? 25.047  -1.880  221.254 1.00 30.00 ? 226 GLU A CA  1 
ATOM 1756 C C   . GLU A 1 225 ? 24.751  -1.105  219.999 1.00 30.00 ? 226 GLU A C   1 
ATOM 1757 O O   . GLU A 1 225 ? 25.044  -1.569  218.906 1.00 30.00 ? 226 GLU A O   1 
ATOM 1758 C CB  . GLU A 1 225 ? 23.882  -2.712  221.529 1.00 30.00 ? 226 GLU A CB  1 
ATOM 1759 C CG  . GLU A 1 225 ? 23.784  -3.848  220.575 1.00 30.00 ? 226 GLU A CG  1 
ATOM 1760 C CD  . GLU A 1 225 ? 24.777  -4.948  220.829 1.00 30.00 ? 226 GLU A CD  1 
ATOM 1761 O OE1 . GLU A 1 225 ? 25.111  -5.186  221.985 1.00 30.00 ? 226 GLU A OE1 1 
ATOM 1762 O OE2 . GLU A 1 225 ? 25.208  -5.599  219.873 1.00 30.00 ? 226 GLU A OE2 1 
ATOM 1763 N N   . MET A 1 226 ? 24.195  0.084   220.093 1.00 30.00 ? 227 MET A N   1 
ATOM 1764 C CA  . MET A 1 226 ? 23.894  0.826   218.886 1.00 30.00 ? 227 MET A CA  1 
ATOM 1765 C C   . MET A 1 226 ? 25.177  1.285   218.184 1.00 30.00 ? 227 MET A C   1 
ATOM 1766 O O   . MET A 1 226 ? 25.298  1.279   216.946 1.00 30.00 ? 227 MET A O   1 
ATOM 1767 C CB  . MET A 1 226 ? 23.002  2.000   219.248 1.00 30.00 ? 227 MET A CB  1 
ATOM 1768 C CG  . MET A 1 226 ? 21.517  1.683   219.403 1.00 30.00 ? 227 MET A CG  1 
ATOM 1769 S SD  . MET A 1 226 ? 20.638  1.125   217.903 1.00 30.00 ? 227 MET A SD  1 
ATOM 1770 C CE  . MET A 1 226 ? 20.981  2.466   216.797 1.00 30.00 ? 227 MET A CE  1 
ATOM 1771 N N   . ALA A 1 227 ? 26.226  1.656   218.917 1.00 30.00 ? 228 ALA A N   1 
ATOM 1772 C CA  . ALA A 1 227 ? 27.513  2.007   218.314 1.00 30.00 ? 228 ALA A CA  1 
ATOM 1773 C C   . ALA A 1 227 ? 28.355  0.777   218.011 1.00 30.00 ? 228 ALA A C   1 
ATOM 1774 O O   . ALA A 1 227 ? 29.436  0.872   217.428 1.00 30.00 ? 228 ALA A O   1 
ATOM 1775 C CB  . ALA A 1 227 ? 28.306  2.878   219.232 1.00 30.00 ? 228 ALA A CB  1 
ATOM 1776 N N   . THR A 1 228 ? 27.832  -0.363  218.442 1.00 30.00 ? 229 THR A N   1 
ATOM 1777 C CA  . THR A 1 228 ? 28.307  -1.663  218.032 1.00 30.00 ? 229 THR A CA  1 
ATOM 1778 C C   . THR A 1 228 ? 27.207  -2.261  217.104 1.00 30.00 ? 229 THR A C   1 
ATOM 1779 O O   . THR A 1 228 ? 26.674  -3.377  217.248 1.00 30.00 ? 229 THR A O   1 
ATOM 1780 C CB  . THR A 1 228 ? 28.542  -2.513  219.281 1.00 30.00 ? 229 THR A CB  1 
ATOM 1781 O OG1 . THR A 1 228 ? 29.432  -1.764  220.093 1.00 30.00 ? 229 THR A OG1 1 
ATOM 1782 C CG2 . THR A 1 228 ? 29.158  -3.893  218.966 1.00 30.00 ? 229 THR A CG2 1 
ATOM 1783 N N   . ALA A 1 229 ? 26.772  -1.328  216.234 1.00 30.00 ? 230 ALA A N   1 
ATOM 1784 C CA  . ALA A 1 229 ? 25.988  -1.536  215.037 1.00 30.00 ? 230 ALA A CA  1 
ATOM 1785 C C   . ALA A 1 229 ? 26.846  -0.561  214.210 1.00 30.00 ? 230 ALA A C   1 
ATOM 1786 O O   . ALA A 1 229 ? 27.421  -1.022  213.232 1.00 30.00 ? 230 ALA A O   1 
ATOM 1787 C CB  . ALA A 1 229 ? 24.581  -0.963  215.060 1.00 30.00 ? 230 ALA A CB  1 
ATOM 1788 N N   . ALA A 1 230 ? 27.066  0.746   214.527 1.00 30.00 ? 231 ALA A N   1 
ATOM 1789 C CA  . ALA A 1 230 ? 27.925  1.602   213.692 1.00 30.00 ? 231 ALA A CA  1 
ATOM 1790 C C   . ALA A 1 230 ? 29.339  1.040   213.498 1.00 30.00 ? 231 ALA A C   1 
ATOM 1791 O O   . ALA A 1 230 ? 29.939  1.373   212.489 1.00 30.00 ? 231 ALA A O   1 
ATOM 1792 C CB  . ALA A 1 230 ? 28.075  3.000   214.286 1.00 30.00 ? 231 ALA A CB  1 
ATOM 1793 N N   . SER A 1 231 ? 29.930  0.190   214.372 1.00 30.00 ? 232 SER A N   1 
ATOM 1794 C CA  . SER A 1 231 ? 31.198  -0.489  214.111 1.00 30.00 ? 232 SER A CA  1 
ATOM 1795 C C   . SER A 1 231 ? 30.848  -1.833  213.450 1.00 30.00 ? 232 SER A C   1 
ATOM 1796 O O   . SER A 1 231 ? 31.264  -2.920  213.858 1.00 30.00 ? 232 SER A O   1 
ATOM 1797 C CB  . SER A 1 231 ? 31.859  -0.714  215.422 1.00 30.00 ? 232 SER A CB  1 
ATOM 1798 O OG  . SER A 1 231 ? 30.956  -1.527  216.184 1.00 30.00 ? 232 SER A OG  1 
ATOM 1799 N N   . SER A 1 232 ? 30.058  -1.718  212.404 1.00 30.00 ? 233 SER A N   1 
ATOM 1800 C CA  . SER A 1 232 ? 29.407  -2.802  211.748 1.00 30.00 ? 233 SER A CA  1 
ATOM 1801 C C   . SER A 1 232 ? 30.213  -4.059  211.515 1.00 30.00 ? 233 SER A C   1 
ATOM 1802 O O   . SER A 1 232 ? 30.433  -4.806  212.468 1.00 30.00 ? 233 SER A O   1 
ATOM 1803 C CB  . SER A 1 232 ? 28.825  -2.181  210.460 1.00 30.00 ? 233 SER A CB  1 
ATOM 1804 O OG  . SER A 1 232 ? 28.013  -1.043  210.775 1.00 30.00 ? 233 SER A OG  1 
ATOM 1805 N N   . SER A 1 233 ? 30.727  -4.282  210.310 1.00 30.00 ? 234 SER A N   1 
ATOM 1806 C CA  . SER A 1 233 ? 31.295  -5.546  209.859 1.00 30.00 ? 234 SER A CA  1 
ATOM 1807 C C   . SER A 1 233 ? 30.251  -6.681  210.094 1.00 30.00 ? 234 SER A C   1 
ATOM 1808 O O   . SER A 1 233 ? 29.364  -6.909  209.245 1.00 30.00 ? 234 SER A O   1 
ATOM 1809 C CB  . SER A 1 233 ? 32.657  -5.826  210.595 1.00 30.00 ? 234 SER A CB  1 
ATOM 1810 O OG  . SER A 1 233 ? 33.128  -4.714  211.342 1.00 30.00 ? 234 SER A OG  1 
ATOM 1811 N N   . SER A 1 234 ? 30.200  -7.248  211.312 1.00 30.00 ? 235 SER A N   1 
ATOM 1812 C CA  . SER A 1 234 ? 29.441  -8.438  211.648 1.00 30.00 ? 235 SER A CA  1 
ATOM 1813 C C   . SER A 1 234 ? 27.951  -8.359  212.030 1.00 30.00 ? 235 SER A C   1 
ATOM 1814 O O   . SER A 1 234 ? 27.310  -9.386  212.280 1.00 30.00 ? 235 SER A O   1 
ATOM 1815 C CB  . SER A 1 234 ? 30.317  -9.067  212.728 1.00 30.00 ? 235 SER A CB  1 
ATOM 1816 O OG  . SER A 1 234 ? 31.739  -8.957  212.442 1.00 30.00 ? 235 SER A OG  1 
ATOM 1817 N N   . LEU A 1 235 ? 27.328  -7.182  212.077 1.00 30.00 ? 236 LEU A N   1 
ATOM 1818 C CA  . LEU A 1 235 ? 25.938  -7.100  212.535 1.00 30.00 ? 236 LEU A CA  1 
ATOM 1819 C C   . LEU A 1 235 ? 24.871  -7.237  211.436 1.00 30.00 ? 236 LEU A C   1 
ATOM 1820 O O   . LEU A 1 235 ? 23.734  -7.660  211.726 1.00 30.00 ? 236 LEU A O   1 
ATOM 1821 C CB  . LEU A 1 235 ? 25.678  -5.768  213.267 1.00 30.00 ? 236 LEU A CB  1 
ATOM 1822 C CG  . LEU A 1 235 ? 26.418  -5.321  214.571 1.00 30.00 ? 236 LEU A CG  1 
ATOM 1823 C CD1 . LEU A 1 235 ? 25.909  -6.212  215.704 1.00 30.00 ? 236 LEU A CD1 1 
ATOM 1824 C CD2 . LEU A 1 235 ? 27.972  -5.332  214.404 1.00 30.00 ? 236 LEU A CD2 1 
ATOM 1825 N N   . GLU A 1 236 ? 25.146  -6.868  210.169 1.00 30.00 ? 237 GLU A N   1 
ATOM 1826 C CA  . GLU A 1 236 ? 24.064  -6.943  209.214 1.00 30.00 ? 237 GLU A CA  1 
ATOM 1827 C C   . GLU A 1 236 ? 24.013  -8.420  208.806 1.00 30.00 ? 237 GLU A C   1 
ATOM 1828 O O   . GLU A 1 236 ? 25.003  -9.160  208.644 1.00 30.00 ? 237 GLU A O   1 
ATOM 1829 C CB  . GLU A 1 236 ? 24.299  -5.985  207.976 1.00 30.00 ? 237 GLU A CB  1 
ATOM 1830 C CG  . GLU A 1 236 ? 24.593  -4.440  208.075 1.00 30.00 ? 237 GLU A CG  1 
ATOM 1831 C CD  . GLU A 1 236 ? 23.565  -3.280  208.305 1.00 30.00 ? 237 GLU A CD  1 
ATOM 1832 O OE1 . GLU A 1 236 ? 22.533  -3.127  207.614 1.00 30.00 ? 237 GLU A OE1 1 
ATOM 1833 O OE2 . GLU A 1 236 ? 23.852  -2.436  209.174 1.00 30.00 ? 237 GLU A OE2 1 
ATOM 1834 N N   . LYS A 1 237 ? 22.790  -8.917  208.779 1.00 30.00 ? 238 LYS A N   1 
ATOM 1835 C CA  . LYS A 1 237 ? 22.533  -10.242 208.217 1.00 30.00 ? 238 LYS A CA  1 
ATOM 1836 C C   . LYS A 1 237 ? 21.470  -10.094 207.125 1.00 30.00 ? 238 LYS A C   1 
ATOM 1837 O O   . LYS A 1 237 ? 20.701  -9.118  207.097 1.00 30.00 ? 238 LYS A O   1 
ATOM 1838 C CB  . LYS A 1 237 ? 21.995  -11.212 209.269 1.00 30.00 ? 238 LYS A CB  1 
ATOM 1839 C CG  . LYS A 1 237 ? 22.961  -12.218 209.875 1.00 30.00 ? 238 LYS A CG  1 
ATOM 1840 C CD  . LYS A 1 237 ? 23.949  -11.558 210.792 1.00 30.00 ? 238 LYS A CD  1 
ATOM 1841 C CE  . LYS A 1 237 ? 24.837  -12.634 211.415 1.00 30.00 ? 238 LYS A CE  1 
ATOM 1842 N NZ  . LYS A 1 237 ? 26.011  -12.026 212.026 1.00 30.00 ? 238 LYS A NZ  1 
ATOM 1843 N N   . SER A 1 238 ? 21.426  -11.038 206.197 1.00 30.00 ? 239 SER A N   1 
ATOM 1844 C CA  . SER A 1 238 ? 20.437  -11.004 205.129 1.00 30.00 ? 239 SER A CA  1 
ATOM 1845 C C   . SER A 1 238 ? 19.377  -12.133 205.140 1.00 30.00 ? 239 SER A C   1 
ATOM 1846 O O   . SER A 1 238 ? 19.568  -13.324 205.510 1.00 30.00 ? 239 SER A O   1 
ATOM 1847 C CB  . SER A 1 238 ? 21.181  -10.993 203.772 1.00 30.00 ? 239 SER A CB  1 
ATOM 1848 O OG  . SER A 1 238 ? 21.894  -9.775  203.538 1.00 30.00 ? 239 SER A OG  1 
ATOM 1849 N N   . TYR A 1 239 ? 18.224  -11.612 204.705 1.00 30.00 ? 240 TYR A N   1 
ATOM 1850 C CA  . TYR A 1 239 ? 17.059  -12.417 204.498 1.00 30.00 ? 240 TYR A CA  1 
ATOM 1851 C C   . TYR A 1 239 ? 16.560  -12.286 203.042 1.00 30.00 ? 240 TYR A C   1 
ATOM 1852 O O   . TYR A 1 239 ? 16.569  -11.242 202.367 1.00 30.00 ? 240 TYR A O   1 
ATOM 1853 C CB  . TYR A 1 239 ? 16.029  -11.981 205.467 1.00 30.00 ? 240 TYR A CB  1 
ATOM 1854 C CG  . TYR A 1 239 ? 15.128  -13.156 205.755 1.00 30.00 ? 240 TYR A CG  1 
ATOM 1855 C CD1 . TYR A 1 239 ? 14.056  -13.409 204.921 1.00 30.00 ? 240 TYR A CD1 1 
ATOM 1856 C CD2 . TYR A 1 239 ? 15.364  -13.958 206.841 1.00 30.00 ? 240 TYR A CD2 1 
ATOM 1857 C CE1 . TYR A 1 239 ? 13.202  -14.460 205.156 1.00 30.00 ? 240 TYR A CE1 1 
ATOM 1858 C CE2 . TYR A 1 239 ? 14.503  -15.008 207.080 1.00 30.00 ? 240 TYR A CE2 1 
ATOM 1859 C CZ  . TYR A 1 239 ? 13.431  -15.245 206.239 1.00 30.00 ? 240 TYR A CZ  1 
ATOM 1860 O OH  . TYR A 1 239 ? 12.533  -16.254 206.504 1.00 30.00 ? 240 TYR A OH  1 
ATOM 1861 N N   . GLU A 1 240 ? 16.139  -13.457 202.557 1.00 30.00 ? 241 GLU A N   1 
ATOM 1862 C CA  . GLU A 1 240 ? 15.766  -13.687 201.183 1.00 30.00 ? 241 GLU A CA  1 
ATOM 1863 C C   . GLU A 1 240 ? 14.269  -13.743 201.082 1.00 30.00 ? 241 GLU A C   1 
ATOM 1864 O O   . GLU A 1 240 ? 13.624  -14.538 201.755 1.00 30.00 ? 241 GLU A O   1 
ATOM 1865 C CB  . GLU A 1 240 ? 16.333  -15.013 200.723 1.00 30.00 ? 241 GLU A CB  1 
ATOM 1866 C CG  . GLU A 1 240 ? 16.329  -15.223 199.212 1.00 30.00 ? 241 GLU A CG  1 
ATOM 1867 C CD  . GLU A 1 240 ? 16.163  -16.667 198.755 1.00 30.00 ? 241 GLU A CD  1 
ATOM 1868 O OE1 . GLU A 1 240 ? 17.130  -17.440 198.899 1.00 30.00 ? 241 GLU A OE1 1 
ATOM 1869 O OE2 . GLU A 1 240 ? 15.057  -16.977 198.262 1.00 30.00 ? 241 GLU A OE2 1 
ATOM 1870 N N   . LEU A 1 241 ? 13.729  -12.892 200.248 1.00 30.00 ? 242 LEU A N   1 
ATOM 1871 C CA  . LEU A 1 241 ? 12.323  -12.993 199.906 1.00 30.00 ? 242 LEU A CA  1 
ATOM 1872 C C   . LEU A 1 241 ? 12.013  -14.272 199.076 1.00 30.00 ? 242 LEU A C   1 
ATOM 1873 O O   . LEU A 1 241 ? 12.831  -14.782 198.293 1.00 30.00 ? 242 LEU A O   1 
ATOM 1874 C CB  . LEU A 1 241 ? 11.900  -11.752 199.112 1.00 30.00 ? 242 LEU A CB  1 
ATOM 1875 C CG  . LEU A 1 241 ? 11.859  -10.359 199.753 1.00 30.00 ? 242 LEU A CG  1 
ATOM 1876 C CD1 . LEU A 1 241 ? 11.017  -10.398 201.011 1.00 30.00 ? 242 LEU A CD1 1 
ATOM 1877 C CD2 . LEU A 1 241 ? 13.260  -9.894  200.083 1.00 30.00 ? 242 LEU A CD2 1 
ATOM 1878 N N   . PRO A 1 242 ? 10.813  -14.861 199.191 1.00 30.00 ? 243 PRO A N   1 
ATOM 1879 C CA  . PRO A 1 242 ? 10.209  -15.737 198.171 1.00 30.00 ? 243 PRO A CA  1 
ATOM 1880 C C   . PRO A 1 242 ? 10.429  -15.163 196.764 1.00 30.00 ? 243 PRO A C   1 
ATOM 1881 O O   . PRO A 1 242 ? 10.955  -15.828 195.876 1.00 30.00 ? 243 PRO A O   1 
ATOM 1882 C CB  . PRO A 1 242 ? 8.739   -15.826 198.614 1.00 30.00 ? 243 PRO A CB  1 
ATOM 1883 C CG  . PRO A 1 242 ? 8.623   -14.791 199.741 1.00 30.00 ? 243 PRO A CG  1 
ATOM 1884 C CD  . PRO A 1 242 ? 10.009  -14.870 200.405 1.00 30.00 ? 243 PRO A CD  1 
ATOM 1885 N N   . ASP A 1 243 ? 10.104  -13.889 196.580 1.00 30.00 ? 244 ASP A N   1 
ATOM 1886 C CA  . ASP A 1 243 ? 10.405  -13.090 195.399 1.00 30.00 ? 244 ASP A CA  1 
ATOM 1887 C C   . ASP A 1 243 ? 11.844  -13.220 194.867 1.00 30.00 ? 244 ASP A C   1 
ATOM 1888 O O   . ASP A 1 243 ? 12.111  -12.617 193.834 1.00 30.00 ? 244 ASP A O   1 
ATOM 1889 C CB  . ASP A 1 243 ? 10.037  -11.660 195.850 1.00 30.00 ? 244 ASP A CB  1 
ATOM 1890 C CG  . ASP A 1 243 ? 10.430  -10.400 195.074 1.00 30.00 ? 244 ASP A CG  1 
ATOM 1891 O OD1 . ASP A 1 243 ? 11.612  -10.150 194.874 1.00 30.00 ? 244 ASP A OD1 1 
ATOM 1892 O OD2 . ASP A 1 243 ? 9.536   -9.629  194.697 1.00 30.00 ? 244 ASP A OD2 1 
ATOM 1893 N N   . GLY A 1 244 ? 12.842  -13.903 195.478 1.00 30.00 ? 245 GLY A N   1 
ATOM 1894 C CA  . GLY A 1 244 ? 14.235  -13.936 195.003 1.00 30.00 ? 245 GLY A CA  1 
ATOM 1895 C C   . GLY A 1 244 ? 15.107  -12.834 195.633 1.00 30.00 ? 245 GLY A C   1 
ATOM 1896 O O   . GLY A 1 244 ? 16.300  -13.040 195.853 1.00 30.00 ? 245 GLY A O   1 
ATOM 1897 N N   . GLN A 1 245 ? 14.495  -11.660 195.892 1.00 30.00 ? 246 GLN A N   1 
ATOM 1898 C CA  . GLN A 1 245 ? 15.083  -10.449 196.472 1.00 30.00 ? 246 GLN A CA  1 
ATOM 1899 C C   . GLN A 1 245 ? 15.827  -10.555 197.820 1.00 30.00 ? 246 GLN A C   1 
ATOM 1900 O O   . GLN A 1 245 ? 15.560  -11.502 198.586 1.00 30.00 ? 246 GLN A O   1 
ATOM 1901 C CB  . GLN A 1 245 ? 13.963  -9.433  196.632 1.00 30.00 ? 246 GLN A CB  1 
ATOM 1902 C CG  . GLN A 1 245 ? 14.064  -8.086  195.922 1.00 30.00 ? 246 GLN A CG  1 
ATOM 1903 C CD  . GLN A 1 245 ? 14.992  -7.085  196.607 1.00 30.00 ? 246 GLN A CD  1 
ATOM 1904 O OE1 . GLN A 1 245 ? 16.230  -7.134  196.527 1.00 30.00 ? 246 GLN A OE1 1 
ATOM 1905 N NE2 . GLN A 1 245 ? 14.404  -6.144  197.324 1.00 30.00 ? 246 GLN A NE2 1 
ATOM 1906 N N   . VAL A 1 246 ? 16.649  -9.531  198.202 1.00 30.00 ? 247 VAL A N   1 
ATOM 1907 C CA  . VAL A 1 246 ? 17.345  -9.547  199.477 1.00 30.00 ? 247 VAL A CA  1 
ATOM 1908 C C   . VAL A 1 246 ? 17.008  -8.441  200.495 1.00 30.00 ? 247 VAL A C   1 
ATOM 1909 O O   . VAL A 1 246 ? 16.636  -7.298  200.197 1.00 30.00 ? 247 VAL A O   1 
ATOM 1910 C CB  . VAL A 1 246 ? 18.809  -9.567  199.139 1.00 30.00 ? 247 VAL A CB  1 
ATOM 1911 C CG1 . VAL A 1 246 ? 19.373  -8.146  198.966 1.00 30.00 ? 247 VAL A CG1 1 
ATOM 1912 C CG2 . VAL A 1 246 ? 19.476  -10.421 200.216 1.00 30.00 ? 247 VAL A CG2 1 
ATOM 1913 N N   . ILE A 1 247 ? 17.142  -8.771  201.766 1.00 30.00 ? 248 ILE A N   1 
ATOM 1914 C CA  . ILE A 1 247 ? 16.818  -7.882  202.863 1.00 30.00 ? 248 ILE A CA  1 
ATOM 1915 C C   . ILE A 1 247 ? 18.162  -7.791  203.529 1.00 30.00 ? 248 ILE A C   1 
ATOM 1916 O O   . ILE A 1 247 ? 18.922  -8.776  203.522 1.00 30.00 ? 248 ILE A O   1 
ATOM 1917 C CB  . ILE A 1 247 ? 15.808  -8.561  203.833 1.00 30.00 ? 248 ILE A CB  1 
ATOM 1918 C CG1 . ILE A 1 247 ? 14.557  -8.933  203.109 1.00 30.00 ? 248 ILE A CG1 1 
ATOM 1919 C CG2 . ILE A 1 247 ? 15.326  -7.624  204.901 1.00 30.00 ? 248 ILE A CG2 1 
ATOM 1920 C CD1 . ILE A 1 247 ? 13.687  -9.917  203.929 1.00 30.00 ? 248 ILE A CD1 1 
ATOM 1921 N N   . THR A 1 248 ? 18.478  -6.642  204.082 1.00 30.00 ? 249 THR A N   1 
ATOM 1922 C CA  . THR A 1 248 ? 19.585  -6.641  205.007 1.00 30.00 ? 249 THR A CA  1 
ATOM 1923 C C   . THR A 1 248 ? 19.142  -5.902  206.258 1.00 30.00 ? 249 THR A C   1 
ATOM 1924 O O   . THR A 1 248 ? 18.459  -4.873  206.206 1.00 30.00 ? 249 THR A O   1 
ATOM 1925 C CB  . THR A 1 248 ? 20.826  -6.025  204.327 1.00 30.00 ? 249 THR A CB  1 
ATOM 1926 O OG1 . THR A 1 248 ? 21.081  -6.929  203.249 1.00 30.00 ? 249 THR A OG1 1 
ATOM 1927 C CG2 . THR A 1 248 ? 22.103  -5.941  205.187 1.00 30.00 ? 249 THR A CG2 1 
ATOM 1928 N N   . ILE A 1 249 ? 19.445  -6.548  207.399 1.00 30.00 ? 250 ILE A N   1 
ATOM 1929 C CA  . ILE A 1 249 ? 19.051  -6.081  208.714 1.00 30.00 ? 250 ILE A CA  1 
ATOM 1930 C C   . ILE A 1 249 ? 20.275  -5.960  209.596 1.00 30.00 ? 250 ILE A C   1 
ATOM 1931 O O   . ILE A 1 249 ? 21.209  -6.741  209.583 1.00 30.00 ? 250 ILE A O   1 
ATOM 1932 C CB  . ILE A 1 249 ? 18.053  -7.050  209.340 1.00 30.00 ? 250 ILE A CB  1 
ATOM 1933 C CG1 . ILE A 1 249 ? 16.886  -7.170  208.412 1.00 30.00 ? 250 ILE A CG1 1 
ATOM 1934 C CG2 . ILE A 1 249 ? 17.445  -6.535  210.607 1.00 30.00 ? 250 ILE A CG2 1 
ATOM 1935 C CD1 . ILE A 1 249 ? 16.985  -8.567  207.740 1.00 30.00 ? 250 ILE A CD1 1 
ATOM 1936 N N   . GLY A 1 250 ? 20.296  -4.838  210.260 1.00 30.00 ? 251 GLY A N   1 
ATOM 1937 C CA  . GLY A 1 250 ? 21.380  -4.520  211.145 1.00 30.00 ? 251 GLY A CA  1 
ATOM 1938 C C   . GLY A 1 250 ? 20.846  -4.032  212.479 1.00 30.00 ? 251 GLY A C   1 
ATOM 1939 O O   . GLY A 1 250 ? 20.285  -4.866  213.213 1.00 30.00 ? 251 GLY A O   1 
ATOM 1940 N N   . ASN A 1 251 ? 20.826  -2.708  212.761 1.00 30.00 ? 252 ASN A N   1 
ATOM 1941 C CA  . ASN A 1 251 ? 20.491  -2.259  214.114 1.00 30.00 ? 252 ASN A CA  1 
ATOM 1942 C C   . ASN A 1 251 ? 19.095  -2.652  214.607 1.00 30.00 ? 252 ASN A C   1 
ATOM 1943 O O   . ASN A 1 251 ? 18.801  -2.796  215.802 1.00 30.00 ? 252 ASN A O   1 
ATOM 1944 C CB  . ASN A 1 251 ? 20.660  -0.738  214.234 1.00 30.00 ? 252 ASN A CB  1 
ATOM 1945 C CG  . ASN A 1 251 ? 19.549  0.161   213.737 1.00 30.00 ? 252 ASN A CG  1 
ATOM 1946 O OD1 . ASN A 1 251 ? 18.570  -0.246  213.115 1.00 30.00 ? 252 ASN A OD1 1 
ATOM 1947 N ND2 . ASN A 1 251 ? 19.705  1.443   213.983 1.00 30.00 ? 252 ASN A ND2 1 
ATOM 1948 N N   . GLU A 1 252 ? 18.272  -2.906  213.607 1.00 30.00 ? 253 GLU A N   1 
ATOM 1949 C CA  . GLU A 1 252 ? 16.943  -3.421  213.766 1.00 30.00 ? 253 GLU A CA  1 
ATOM 1950 C C   . GLU A 1 252 ? 16.787  -4.707  214.575 1.00 30.00 ? 253 GLU A C   1 
ATOM 1951 O O   . GLU A 1 252 ? 15.860  -4.848  215.376 1.00 30.00 ? 253 GLU A O   1 
ATOM 1952 C CB  . GLU A 1 252 ? 16.373  -3.605  212.352 1.00 30.00 ? 253 GLU A CB  1 
ATOM 1953 C CG  . GLU A 1 252 ? 16.237  -2.294  211.619 1.00 30.00 ? 253 GLU A CG  1 
ATOM 1954 C CD  . GLU A 1 252 ? 17.018  -2.166  210.319 1.00 30.00 ? 253 GLU A CD  1 
ATOM 1955 O OE1 . GLU A 1 252 ? 18.125  -2.709  210.189 1.00 30.00 ? 253 GLU A OE1 1 
ATOM 1956 O OE2 . GLU A 1 252 ? 16.483  -1.486  209.445 1.00 30.00 ? 253 GLU A OE2 1 
ATOM 1957 N N   . ARG A 1 253 ? 17.696  -5.656  214.394 1.00 30.00 ? 254 ARG A N   1 
ATOM 1958 C CA  . ARG A 1 253 ? 17.635  -6.945  215.065 1.00 30.00 ? 254 ARG A CA  1 
ATOM 1959 C C   . ARG A 1 253 ? 17.506  -6.865  216.575 1.00 30.00 ? 254 ARG A C   1 
ATOM 1960 O O   . ARG A 1 253 ? 16.761  -7.653  217.160 1.00 30.00 ? 254 ARG A O   1 
ATOM 1961 C CB  . ARG A 1 253 ? 18.860  -7.737  214.798 1.00 30.00 ? 254 ARG A CB  1 
ATOM 1962 C CG  . ARG A 1 253 ? 18.948  -8.281  213.447 1.00 30.00 ? 254 ARG A CG  1 
ATOM 1963 C CD  . ARG A 1 253 ? 20.386  -8.621  213.458 1.00 30.00 ? 254 ARG A CD  1 
ATOM 1964 N NE  . ARG A 1 253 ? 20.553  -10.021 213.638 1.00 30.00 ? 254 ARG A NE  1 
ATOM 1965 C CZ  . ARG A 1 253 ? 21.776  -10.532 213.847 1.00 30.00 ? 254 ARG A CZ  1 
ATOM 1966 N NH1 . ARG A 1 253 ? 22.886  -9.772  213.908 1.00 30.00 ? 254 ARG A NH1 1 
ATOM 1967 N NH2 . ARG A 1 253 ? 21.919  -11.858 213.930 1.00 30.00 ? 254 ARG A NH2 1 
ATOM 1968 N N   . PHE A 1 254 ? 18.266  -5.968  217.235 1.00 30.00 ? 255 PHE A N   1 
ATOM 1969 C CA  . PHE A 1 254 ? 18.205  -5.806  218.691 1.00 30.00 ? 255 PHE A CA  1 
ATOM 1970 C C   . PHE A 1 254 ? 17.225  -4.692  219.092 1.00 30.00 ? 255 PHE A C   1 
ATOM 1971 O O   . PHE A 1 254 ? 16.629  -4.758  220.163 1.00 30.00 ? 255 PHE A O   1 
ATOM 1972 C CB  . PHE A 1 254 ? 19.665  -5.549  219.247 1.00 30.00 ? 255 PHE A CB  1 
ATOM 1973 C CG  . PHE A 1 254 ? 20.419  -4.256  218.899 1.00 30.00 ? 255 PHE A CG  1 
ATOM 1974 C CD1 . PHE A 1 254 ? 20.054  -3.045  219.489 1.00 30.00 ? 255 PHE A CD1 1 
ATOM 1975 C CD2 . PHE A 1 254 ? 21.419  -4.310  217.945 1.00 30.00 ? 255 PHE A CD2 1 
ATOM 1976 C CE1 . PHE A 1 254 ? 20.666  -1.891  219.110 1.00 30.00 ? 255 PHE A CE1 1 
ATOM 1977 C CE2 . PHE A 1 254 ? 22.019  -3.141  217.589 1.00 30.00 ? 255 PHE A CE2 1 
ATOM 1978 C CZ  . PHE A 1 254 ? 21.639  -1.951  218.160 1.00 30.00 ? 255 PHE A CZ  1 
ATOM 1979 N N   . ARG A 1 255 ? 17.021  -3.670  218.232 1.00 30.00 ? 256 ARG A N   1 
ATOM 1980 C CA  . ARG A 1 255 ? 16.067  -2.573  218.384 1.00 30.00 ? 256 ARG A CA  1 
ATOM 1981 C C   . ARG A 1 255 ? 14.624  -3.100  218.404 1.00 30.00 ? 256 ARG A C   1 
ATOM 1982 O O   . ARG A 1 255 ? 13.706  -2.424  218.856 1.00 30.00 ? 256 ARG A O   1 
ATOM 1983 C CB  . ARG A 1 255 ? 16.135  -1.548  217.213 1.00 30.00 ? 256 ARG A CB  1 
ATOM 1984 C CG  . ARG A 1 255 ? 17.278  -0.554  216.957 1.00 30.00 ? 256 ARG A CG  1 
ATOM 1985 C CD  . ARG A 1 255 ? 16.636  0.666   216.278 1.00 30.00 ? 256 ARG A CD  1 
ATOM 1986 N NE  . ARG A 1 255 ? 16.503  0.595   214.817 1.00 30.00 ? 256 ARG A NE  1 
ATOM 1987 C CZ  . ARG A 1 255 ? 15.699  1.411   214.099 1.00 30.00 ? 256 ARG A CZ  1 
ATOM 1988 N NH1 . ARG A 1 255 ? 14.929  2.355   214.624 1.00 30.00 ? 256 ARG A NH1 1 
ATOM 1989 N NH2 . ARG A 1 255 ? 15.674  1.268   212.809 1.00 30.00 ? 256 ARG A NH2 1 
ATOM 1990 N N   . CYS A 1 256 ? 14.334  -4.265  217.844 1.00 30.00 ? 257 CYS A N   1 
ATOM 1991 C CA  . CYS A 1 256 ? 12.984  -4.838  217.872 1.00 30.00 ? 257 CYS A CA  1 
ATOM 1992 C C   . CYS A 1 256 ? 12.682  -5.292  219.324 1.00 30.00 ? 257 CYS A C   1 
ATOM 1993 O O   . CYS A 1 256 ? 11.955  -4.536  220.006 1.00 30.00 ? 257 CYS A O   1 
ATOM 1994 C CB  . CYS A 1 256 ? 12.975  -5.987  216.836 1.00 30.00 ? 257 CYS A CB  1 
ATOM 1995 S SG  . CYS A 1 256 ? 11.366  -6.696  216.510 1.00 30.00 ? 257 CYS A SG  1 
ATOM 1996 N N   . PRO A 1 257 ? 13.263  -6.375  219.924 1.00 30.00 ? 258 PRO A N   1 
ATOM 1997 C CA  . PRO A 1 257 ? 12.965  -6.794  221.285 1.00 30.00 ? 258 PRO A CA  1 
ATOM 1998 C C   . PRO A 1 257 ? 13.125  -5.680  222.282 1.00 30.00 ? 258 PRO A C   1 
ATOM 1999 O O   . PRO A 1 257 ? 12.425  -5.719  223.281 1.00 30.00 ? 258 PRO A O   1 
ATOM 2000 C CB  . PRO A 1 257 ? 13.893  -7.929  221.597 1.00 30.00 ? 258 PRO A CB  1 
ATOM 2001 C CG  . PRO A 1 257 ? 14.260  -8.425  220.226 1.00 30.00 ? 258 PRO A CG  1 
ATOM 2002 C CD  . PRO A 1 257 ? 14.431  -7.133  219.474 1.00 30.00 ? 258 PRO A CD  1 
ATOM 2003 N N   . GLU A 1 258 ? 13.926  -4.637  222.090 1.00 30.00 ? 259 GLU A N   1 
ATOM 2004 C CA  . GLU A 1 258 ? 14.034  -3.502  223.010 1.00 30.00 ? 259 GLU A CA  1 
ATOM 2005 C C   . GLU A 1 258 ? 12.764  -2.753  223.381 1.00 30.00 ? 259 GLU A C   1 
ATOM 2006 O O   . GLU A 1 258 ? 12.682  -1.995  224.359 1.00 30.00 ? 259 GLU A O   1 
ATOM 2007 C CB  . GLU A 1 258 ? 15.005  -2.520  222.420 1.00 30.00 ? 259 GLU A CB  1 
ATOM 2008 C CG  . GLU A 1 258 ? 16.407  -2.889  222.763 1.00 30.00 ? 259 GLU A CG  1 
ATOM 2009 C CD  . GLU A 1 258 ? 16.728  -2.469  224.169 1.00 30.00 ? 259 GLU A CD  1 
ATOM 2010 O OE1 . GLU A 1 258 ? 16.393  -1.356  224.564 1.00 30.00 ? 259 GLU A OE1 1 
ATOM 2011 O OE2 . GLU A 1 258 ? 17.320  -3.277  224.850 1.00 30.00 ? 259 GLU A OE2 1 
ATOM 2012 N N   . ALA A 1 259 ? 11.749  -2.906  222.552 1.00 30.00 ? 260 ALA A N   1 
ATOM 2013 C CA  . ALA A 1 259 ? 10.463  -2.336  222.868 1.00 30.00 ? 260 ALA A CA  1 
ATOM 2014 C C   . ALA A 1 259 ? 9.848   -3.052  224.079 1.00 30.00 ? 260 ALA A C   1 
ATOM 2015 O O   . ALA A 1 259 ? 8.953   -2.528  224.736 1.00 30.00 ? 260 ALA A O   1 
ATOM 2016 C CB  . ALA A 1 259 ? 9.576   -2.474  221.643 1.00 30.00 ? 260 ALA A CB  1 
ATOM 2017 N N   . LEU A 1 260 ? 10.289  -4.247  224.422 1.00 30.00 ? 261 LEU A N   1 
ATOM 2018 C CA  . LEU A 1 260 ? 9.873   -4.915  225.629 1.00 30.00 ? 261 LEU A CA  1 
ATOM 2019 C C   . LEU A 1 260 ? 10.373  -4.222  226.888 1.00 30.00 ? 261 LEU A C   1 
ATOM 2020 O O   . LEU A 1 260 ? 9.742   -4.201  227.948 1.00 30.00 ? 261 LEU A O   1 
ATOM 2021 C CB  . LEU A 1 260 ? 10.392  -6.327  225.589 1.00 30.00 ? 261 LEU A CB  1 
ATOM 2022 C CG  . LEU A 1 260 ? 9.634   -7.330  224.738 1.00 30.00 ? 261 LEU A CG  1 
ATOM 2023 C CD1 . LEU A 1 260 ? 10.408  -8.659  224.607 1.00 30.00 ? 261 LEU A CD1 1 
ATOM 2024 C CD2 . LEU A 1 260 ? 8.273   -7.539  225.410 1.00 30.00 ? 261 LEU A CD2 1 
ATOM 2025 N N   . PHE A 1 261 ? 11.586  -3.686  226.831 1.00 30.00 ? 262 PHE A N   1 
ATOM 2026 C CA  . PHE A 1 261 ? 12.220  -3.034  227.966 1.00 30.00 ? 262 PHE A CA  1 
ATOM 2027 C C   . PHE A 1 261 ? 11.910  -1.560  228.080 1.00 30.00 ? 262 PHE A C   1 
ATOM 2028 O O   . PHE A 1 261 ? 11.907  -1.026  229.197 1.00 30.00 ? 262 PHE A O   1 
ATOM 2029 C CB  . PHE A 1 261 ? 13.729  -3.236  227.894 1.00 30.00 ? 262 PHE A CB  1 
ATOM 2030 C CG  . PHE A 1 261 ? 14.000  -4.670  228.270 1.00 30.00 ? 262 PHE A CG  1 
ATOM 2031 C CD1 . PHE A 1 261 ? 13.946  -5.039  229.590 1.00 30.00 ? 262 PHE A CD1 1 
ATOM 2032 C CD2 . PHE A 1 261 ? 14.230  -5.609  227.305 1.00 30.00 ? 262 PHE A CD2 1 
ATOM 2033 C CE1 . PHE A 1 261 ? 14.106  -6.344  229.945 1.00 30.00 ? 262 PHE A CE1 1 
ATOM 2034 C CE2 . PHE A 1 261 ? 14.389  -6.927  227.673 1.00 30.00 ? 262 PHE A CE2 1 
ATOM 2035 C CZ  . PHE A 1 261 ? 14.328  -7.290  228.990 1.00 30.00 ? 262 PHE A CZ  1 
ATOM 2036 N N   . GLN A 1 262 ? 11.676  -0.947  226.924 1.00 30.00 ? 263 GLN A N   1 
ATOM 2037 C CA  . GLN A 1 262 ? 11.363  0.452   226.768 1.00 30.00 ? 263 GLN A CA  1 
ATOM 2038 C C   . GLN A 1 262 ? 10.137  0.572   225.859 1.00 30.00 ? 263 GLN A C   1 
ATOM 2039 O O   . GLN A 1 262 ? 10.262  0.718   224.649 1.00 30.00 ? 263 GLN A O   1 
ATOM 2040 C CB  . GLN A 1 262 ? 12.522  1.167   226.126 1.00 30.00 ? 263 GLN A CB  1 
ATOM 2041 C CG  . GLN A 1 262 ? 13.868  0.666   226.619 1.00 30.00 ? 263 GLN A CG  1 
ATOM 2042 C CD  . GLN A 1 262 ? 14.967  1.565   226.160 1.00 30.00 ? 263 GLN A CD  1 
ATOM 2043 O OE1 . GLN A 1 262 ? 14.751  2.757   226.031 1.00 30.00 ? 263 GLN A OE1 1 
ATOM 2044 N NE2 . GLN A 1 262 ? 16.157  1.057   225.937 1.00 30.00 ? 263 GLN A NE2 1 
ATOM 2045 N N   . PRO A 1 263 ? 8.904   0.537   226.293 1.00 30.00 ? 264 PRO A N   1 
ATOM 2046 C CA  . PRO A 1 263 ? 7.758   0.584   225.402 1.00 30.00 ? 264 PRO A CA  1 
ATOM 2047 C C   . PRO A 1 263 ? 7.488   1.992   224.898 1.00 30.00 ? 264 PRO A C   1 
ATOM 2048 O O   . PRO A 1 263 ? 6.451   2.269   224.295 1.00 30.00 ? 264 PRO A O   1 
ATOM 2049 C CB  . PRO A 1 263 ? 6.634   -0.004  226.236 1.00 30.00 ? 264 PRO A CB  1 
ATOM 2050 C CG  . PRO A 1 263 ? 7.380   -0.805  227.277 1.00 30.00 ? 264 PRO A CG  1 
ATOM 2051 C CD  . PRO A 1 263 ? 8.520   0.122   227.620 1.00 30.00 ? 264 PRO A CD  1 
ATOM 2052 N N   . SER A 1 264 ? 8.397   2.935   225.132 1.00 30.00 ? 265 SER A N   1 
ATOM 2053 C CA  . SER A 1 264 ? 8.356   4.264   224.556 1.00 30.00 ? 265 SER A CA  1 
ATOM 2054 C C   . SER A 1 264 ? 8.699   4.060   223.107 1.00 30.00 ? 265 SER A C   1 
ATOM 2055 O O   . SER A 1 264 ? 8.126   4.750   222.276 1.00 30.00 ? 265 SER A O   1 
ATOM 2056 C CB  . SER A 1 264 ? 9.385   5.180   225.221 1.00 30.00 ? 265 SER A CB  1 
ATOM 2057 O OG  . SER A 1 264 ? 10.498  4.448   225.759 1.00 30.00 ? 265 SER A OG  1 
ATOM 2058 N N   . PHE A 1 265 ? 9.559   3.080   222.775 1.00 30.00 ? 266 PHE A N   1 
ATOM 2059 C CA  . PHE A 1 265 ? 9.880   2.758   221.397 1.00 30.00 ? 266 PHE A CA  1 
ATOM 2060 C C   . PHE A 1 265 ? 8.630   2.494   220.644 1.00 30.00 ? 266 PHE A C   1 
ATOM 2061 O O   . PHE A 1 265 ? 8.543   2.906   219.519 1.00 30.00 ? 266 PHE A O   1 
ATOM 2062 C CB  . PHE A 1 265 ? 10.664  1.517   221.223 1.00 30.00 ? 266 PHE A CB  1 
ATOM 2063 C CG  . PHE A 1 265 ? 12.135  1.646   221.546 1.00 30.00 ? 266 PHE A CG  1 
ATOM 2064 C CD1 . PHE A 1 265 ? 12.568  2.566   222.461 1.00 30.00 ? 266 PHE A CD1 1 
ATOM 2065 C CD2 . PHE A 1 265 ? 13.011  0.825   220.873 1.00 30.00 ? 266 PHE A CD2 1 
ATOM 2066 C CE1 . PHE A 1 265 ? 13.898  2.658   222.701 1.00 30.00 ? 266 PHE A CE1 1 
ATOM 2067 C CE2 . PHE A 1 265 ? 14.342  0.931   221.125 1.00 30.00 ? 266 PHE A CE2 1 
ATOM 2068 C CZ  . PHE A 1 265 ? 14.763  1.847   222.033 1.00 30.00 ? 266 PHE A CZ  1 
ATOM 2069 N N   . LEU A 1 266 ? 7.678   1.819   221.241 1.00 30.00 ? 267 LEU A N   1 
ATOM 2070 C CA  . LEU A 1 266 ? 6.373   1.622   220.648 1.00 30.00 ? 267 LEU A CA  1 
ATOM 2071 C C   . LEU A 1 266 ? 5.402   2.802   220.839 1.00 30.00 ? 267 LEU A C   1 
ATOM 2072 O O   . LEU A 1 266 ? 4.284   2.761   220.315 1.00 30.00 ? 267 LEU A O   1 
ATOM 2073 C CB  . LEU A 1 266 ? 5.748   0.353   221.238 1.00 30.00 ? 267 LEU A CB  1 
ATOM 2074 C CG  . LEU A 1 266 ? 6.519   -0.908  221.036 1.00 30.00 ? 267 LEU A CG  1 
ATOM 2075 C CD1 . LEU A 1 266 ? 5.610   -2.078  221.175 1.00 30.00 ? 267 LEU A CD1 1 
ATOM 2076 C CD2 . LEU A 1 266 ? 7.031   -0.969  219.620 1.00 30.00 ? 267 LEU A CD2 1 
ATOM 2077 N N   . GLY A 1 267 ? 5.688   3.878   221.566 1.00 30.00 ? 268 GLY A N   1 
ATOM 2078 C CA  . GLY A 1 267 ? 4.722   4.960   221.656 1.00 30.00 ? 268 GLY A CA  1 
ATOM 2079 C C   . GLY A 1 267 ? 3.782   4.752   222.818 1.00 30.00 ? 268 GLY A C   1 
ATOM 2080 O O   . GLY A 1 267 ? 2.856   5.527   223.018 1.00 30.00 ? 268 GLY A O   1 
ATOM 2081 N N   . MET A 1 268 ? 4.127   3.762   223.653 1.00 30.00 ? 269 MET A N   1 
ATOM 2082 C CA  . MET A 1 268 ? 3.440   3.392   224.881 1.00 30.00 ? 269 MET A CA  1 
ATOM 2083 C C   . MET A 1 268 ? 4.102   3.938   226.135 1.00 30.00 ? 269 MET A C   1 
ATOM 2084 O O   . MET A 1 268 ? 5.319   3.944   226.350 1.00 30.00 ? 269 MET A O   1 
ATOM 2085 C CB  . MET A 1 268 ? 3.399   1.911   225.068 1.00 30.00 ? 269 MET A CB  1 
ATOM 2086 C CG  . MET A 1 268 ? 2.665   1.196   223.981 1.00 30.00 ? 269 MET A CG  1 
ATOM 2087 S SD  . MET A 1 268 ? 2.974   -0.514  224.423 1.00 30.00 ? 269 MET A SD  1 
ATOM 2088 C CE  . MET A 1 268 ? 1.738   -1.289  223.397 1.00 30.00 ? 269 MET A CE  1 
ATOM 2089 N N   . GLU A 1 269 ? 3.190   4.357   226.999 1.00 30.00 ? 270 GLU A N   1 
ATOM 2090 C CA  . GLU A 1 269 ? 3.589   4.878   228.277 1.00 30.00 ? 270 GLU A CA  1 
ATOM 2091 C C   . GLU A 1 269 ? 4.054   3.755   229.197 1.00 30.00 ? 270 GLU A C   1 
ATOM 2092 O O   . GLU A 1 269 ? 4.625   4.045   230.242 1.00 30.00 ? 270 GLU A O   1 
ATOM 2093 C CB  . GLU A 1 269 ? 2.404   5.630   228.922 1.00 30.00 ? 270 GLU A CB  1 
ATOM 2094 C CG  . GLU A 1 269 ? 2.106   7.109   228.578 1.00 30.00 ? 270 GLU A CG  1 
ATOM 2095 C CD  . GLU A 1 269 ? 1.537   7.490   227.199 1.00 30.00 ? 270 GLU A CD  1 
ATOM 2096 O OE1 . GLU A 1 269 ? 1.457   6.655   226.284 1.00 30.00 ? 270 GLU A OE1 1 
ATOM 2097 O OE2 . GLU A 1 269 ? 1.159   8.661   227.040 1.00 30.00 ? 270 GLU A OE2 1 
ATOM 2098 N N   . SER A 1 270 ? 3.820   2.467   228.903 1.00 30.00 ? 271 SER A N   1 
ATOM 2099 C CA  . SER A 1 270 ? 4.128   1.399   229.841 1.00 30.00 ? 271 SER A CA  1 
ATOM 2100 C C   . SER A 1 270 ? 5.594   1.238   230.204 1.00 30.00 ? 271 SER A C   1 
ATOM 2101 O O   . SER A 1 270 ? 6.532   1.459   229.432 1.00 30.00 ? 271 SER A O   1 
ATOM 2102 C CB  . SER A 1 270 ? 3.657   0.050   229.296 1.00 30.00 ? 271 SER A CB  1 
ATOM 2103 O OG  . SER A 1 270 ? 2.346   0.119   228.740 1.00 30.00 ? 271 SER A OG  1 
ATOM 2104 N N   . CYS A 1 271 ? 5.739   0.816   231.452 1.00 30.00 ? 272 CYS A N   1 
ATOM 2105 C CA  . CYS A 1 271 ? 6.984   0.342   232.014 1.00 30.00 ? 272 CYS A CA  1 
ATOM 2106 C C   . CYS A 1 271 ? 7.408   -0.824  231.155 1.00 30.00 ? 272 CYS A C   1 
ATOM 2107 O O   . CYS A 1 271 ? 6.554   -1.435  230.523 1.00 30.00 ? 272 CYS A O   1 
ATOM 2108 C CB  . CYS A 1 271 ? 6.756   -0.181  233.443 1.00 30.00 ? 272 CYS A CB  1 
ATOM 2109 S SG  . CYS A 1 271 ? 6.554   1.128   234.667 1.00 30.00 ? 272 CYS A SG  1 
ATOM 2110 N N   . GLY A 1 272 ? 8.670   -1.184  231.097 1.00 30.00 ? 273 GLY A N   1 
ATOM 2111 C CA  . GLY A 1 272 ? 9.014   -2.394  230.409 1.00 30.00 ? 273 GLY A CA  1 
ATOM 2112 C C   . GLY A 1 272 ? 8.913   -3.573  231.349 1.00 30.00 ? 273 GLY A C   1 
ATOM 2113 O O   . GLY A 1 272 ? 8.921   -3.501  232.579 1.00 30.00 ? 273 GLY A O   1 
ATOM 2114 N N   . ILE A 1 273 ? 9.087   -4.710  230.714 1.00 30.00 ? 274 ILE A N   1 
ATOM 2115 C CA  . ILE A 1 273 ? 9.077   -6.001  231.366 1.00 30.00 ? 274 ILE A CA  1 
ATOM 2116 C C   . ILE A 1 273 ? 9.900   -6.224  232.641 1.00 30.00 ? 274 ILE A C   1 
ATOM 2117 O O   . ILE A 1 273 ? 9.592   -7.059  233.499 1.00 30.00 ? 274 ILE A O   1 
ATOM 2118 C CB  . ILE A 1 273 ? 9.412   -6.966  230.160 1.00 30.00 ? 274 ILE A CB  1 
ATOM 2119 C CG1 . ILE A 1 273 ? 8.242   -7.930  230.241 1.00 30.00 ? 274 ILE A CG1 1 
ATOM 2120 C CG2 . ILE A 1 273 ? 10.794  -7.652  230.106 1.00 30.00 ? 274 ILE A CG2 1 
ATOM 2121 C CD1 . ILE A 1 273 ? 6.915   -7.184  229.988 1.00 30.00 ? 274 ILE A CD1 1 
ATOM 2122 N N   . HIS A 1 274 ? 10.943  -5.415  232.799 1.00 30.00 ? 275 HIS A N   1 
ATOM 2123 C CA  . HIS A 1 274 ? 11.871  -5.591  233.917 1.00 30.00 ? 275 HIS A CA  1 
ATOM 2124 C C   . HIS A 1 274 ? 11.358  -4.907  235.179 1.00 30.00 ? 275 HIS A C   1 
ATOM 2125 O O   . HIS A 1 274 ? 11.601  -5.307  236.312 1.00 30.00 ? 275 HIS A O   1 
ATOM 2126 C CB  . HIS A 1 274 ? 13.278  -5.046  233.522 1.00 30.00 ? 275 HIS A CB  1 
ATOM 2127 C CG  . HIS A 1 274 ? 13.330  -3.586  233.057 1.00 30.00 ? 275 HIS A CG  1 
ATOM 2128 N ND1 . HIS A 1 274 ? 12.831  -3.022  231.939 1.00 30.00 ? 275 HIS A ND1 1 
ATOM 2129 C CD2 . HIS A 1 274 ? 13.970  -2.600  233.766 1.00 30.00 ? 275 HIS A CD2 1 
ATOM 2130 C CE1 . HIS A 1 274 ? 13.150  -1.747  231.964 1.00 30.00 ? 275 HIS A CE1 1 
ATOM 2131 N NE2 . HIS A 1 274 ? 13.831  -1.505  233.059 1.00 30.00 ? 275 HIS A NE2 1 
ATOM 2132 N N   . GLU A 1 275 ? 10.566  -3.883  234.953 1.00 30.00 ? 276 GLU A N   1 
ATOM 2133 C CA  . GLU A 1 275 ? 9.975   -3.120  236.014 1.00 30.00 ? 276 GLU A CA  1 
ATOM 2134 C C   . GLU A 1 275 ? 8.714   -3.764  236.494 1.00 30.00 ? 276 GLU A C   1 
ATOM 2135 O O   . GLU A 1 275 ? 8.386   -3.658  237.649 1.00 30.00 ? 276 GLU A O   1 
ATOM 2136 C CB  . GLU A 1 275 ? 9.634   -1.799  235.530 1.00 30.00 ? 276 GLU A CB  1 
ATOM 2137 C CG  . GLU A 1 275 ? 10.879  -1.129  235.140 1.00 30.00 ? 276 GLU A CG  1 
ATOM 2138 C CD  . GLU A 1 275 ? 10.893  0.194   235.847 1.00 30.00 ? 276 GLU A CD  1 
ATOM 2139 O OE1 . GLU A 1 275 ? 11.159  0.224   237.051 1.00 30.00 ? 276 GLU A OE1 1 
ATOM 2140 O OE2 . GLU A 1 275 ? 10.632  1.190   235.184 1.00 30.00 ? 276 GLU A OE2 1 
ATOM 2141 N N   . THR A 1 276 ? 7.956   -4.376  235.615 1.00 30.00 ? 277 THR A N   1 
ATOM 2142 C CA  . THR A 1 276 ? 6.723   -5.026  235.936 1.00 30.00 ? 277 THR A CA  1 
ATOM 2143 C C   . THR A 1 276 ? 7.071   -6.256  236.767 1.00 30.00 ? 277 THR A C   1 
ATOM 2144 O O   . THR A 1 276 ? 6.414   -6.317  237.813 1.00 30.00 ? 277 THR A O   1 
ATOM 2145 C CB  . THR A 1 276 ? 6.075   -5.252  234.566 1.00 30.00 ? 277 THR A CB  1 
ATOM 2146 O OG1 . THR A 1 276 ? 5.888   -3.908  234.170 1.00 30.00 ? 277 THR A OG1 1 
ATOM 2147 C CG2 . THR A 1 276 ? 4.724   -5.941  234.451 1.00 30.00 ? 277 THR A CG2 1 
ATOM 2148 N N   . THR A 1 277 ? 8.005   -7.215  236.468 1.00 30.00 ? 278 THR A N   1 
ATOM 2149 C CA  . THR A 1 277 ? 8.410   -8.261  237.414 1.00 30.00 ? 278 THR A CA  1 
ATOM 2150 C C   . THR A 1 277 ? 8.668   -7.634  238.802 1.00 30.00 ? 278 THR A C   1 
ATOM 2151 O O   . THR A 1 277 ? 8.037   -7.926  239.814 1.00 30.00 ? 278 THR A O   1 
ATOM 2152 C CB  . THR A 1 277 ? 9.653   -8.904  236.794 1.00 30.00 ? 278 THR A CB  1 
ATOM 2153 O OG1 . THR A 1 277 ? 9.186   -9.385  235.539 1.00 30.00 ? 278 THR A OG1 1 
ATOM 2154 C CG2 . THR A 1 277 ? 10.308  -10.024 237.611 1.00 30.00 ? 278 THR A CG2 1 
ATOM 2155 N N   . PHE A 1 278 ? 9.490   -6.595  238.898 1.00 30.00 ? 279 PHE A N   1 
ATOM 2156 C CA  . PHE A 1 278 ? 9.755   -5.886  240.157 1.00 30.00 ? 279 PHE A CA  1 
ATOM 2157 C C   . PHE A 1 278 ? 8.521   -5.257  240.796 1.00 30.00 ? 279 PHE A C   1 
ATOM 2158 O O   . PHE A 1 278 ? 8.473   -5.096  242.018 1.00 30.00 ? 279 PHE A O   1 
ATOM 2159 C CB  . PHE A 1 278 ? 10.843  -4.804  239.885 1.00 30.00 ? 279 PHE A CB  1 
ATOM 2160 C CG  . PHE A 1 278 ? 11.187  -3.909  241.078 1.00 30.00 ? 279 PHE A CG  1 
ATOM 2161 C CD1 . PHE A 1 278 ? 10.469  -2.726  241.294 1.00 30.00 ? 279 PHE A CD1 1 
ATOM 2162 C CD2 . PHE A 1 278 ? 12.201  -4.271  241.947 1.00 30.00 ? 279 PHE A CD2 1 
ATOM 2163 C CE1 . PHE A 1 278 ? 10.764  -1.914  242.377 1.00 30.00 ? 279 PHE A CE1 1 
ATOM 2164 C CE2 . PHE A 1 278 ? 12.472  -3.435  243.018 1.00 30.00 ? 279 PHE A CE2 1 
ATOM 2165 C CZ  . PHE A 1 278 ? 11.761  -2.260  243.239 1.00 30.00 ? 279 PHE A CZ  1 
ATOM 2166 N N   . ASN A 1 279 ? 7.501   -4.853  240.091 1.00 30.00 ? 280 ASN A N   1 
ATOM 2167 C CA  . ASN A 1 279 ? 6.419   -4.200  240.781 1.00 30.00 ? 280 ASN A CA  1 
ATOM 2168 C C   . ASN A 1 279 ? 5.426   -5.241  241.227 1.00 30.00 ? 280 ASN A C   1 
ATOM 2169 O O   . ASN A 1 279 ? 4.606   -4.861  242.050 1.00 30.00 ? 280 ASN A O   1 
ATOM 2170 C CB  . ASN A 1 279 ? 5.605   -3.219  239.954 1.00 30.00 ? 280 ASN A CB  1 
ATOM 2171 C CG  . ASN A 1 279 ? 6.268   -1.939  239.477 1.00 30.00 ? 280 ASN A CG  1 
ATOM 2172 O OD1 . ASN A 1 279 ? 5.727   -1.272  238.588 1.00 30.00 ? 280 ASN A OD1 1 
ATOM 2173 N ND2 . ASN A 1 279 ? 7.429   -1.520  239.982 1.00 30.00 ? 280 ASN A ND2 1 
ATOM 2174 N N   . SER A 1 280 ? 5.418   -6.494  240.737 1.00 30.00 ? 281 SER A N   1 
ATOM 2175 C CA  . SER A 1 280 ? 4.536   -7.547  241.250 1.00 30.00 ? 281 SER A CA  1 
ATOM 2176 C C   . SER A 1 280 ? 5.163   -8.032  242.545 1.00 30.00 ? 281 SER A C   1 
ATOM 2177 O O   . SER A 1 280 ? 4.539   -8.032  243.580 1.00 30.00 ? 281 SER A O   1 
ATOM 2178 C CB  . SER A 1 280 ? 4.414   -8.710  240.230 1.00 30.00 ? 281 SER A CB  1 
ATOM 2179 O OG  . SER A 1 280 ? 3.630   -8.322  239.112 1.00 30.00 ? 281 SER A OG  1 
ATOM 2180 N N   . ILE A 1 281 ? 6.425   -8.385  242.544 1.00 30.00 ? 282 ILE A N   1 
ATOM 2181 C CA  . ILE A 1 281 ? 7.232   -8.703  243.717 1.00 30.00 ? 282 ILE A CA  1 
ATOM 2182 C C   . ILE A 1 281 ? 6.989   -7.684  244.802 1.00 30.00 ? 282 ILE A C   1 
ATOM 2183 O O   . ILE A 1 281 ? 6.822   -8.104  245.926 1.00 30.00 ? 282 ILE A O   1 
ATOM 2184 C CB  . ILE A 1 281 ? 8.733   -8.693  243.359 1.00 30.00 ? 282 ILE A CB  1 
ATOM 2185 C CG1 . ILE A 1 281 ? 9.053   -9.996  242.723 1.00 30.00 ? 282 ILE A CG1 1 
ATOM 2186 C CG2 . ILE A 1 281 ? 9.598   -8.440  244.554 1.00 30.00 ? 282 ILE A CG2 1 
ATOM 2187 C CD1 . ILE A 1 281 ? 10.445  -10.097 242.148 1.00 30.00 ? 282 ILE A CD1 1 
ATOM 2188 N N   . MET A 1 282 ? 6.914   -6.398  244.585 1.00 30.00 ? 283 MET A N   1 
ATOM 2189 C CA  . MET A 1 282 ? 6.701   -5.514  245.689 1.00 30.00 ? 283 MET A CA  1 
ATOM 2190 C C   . MET A 1 282 ? 5.317   -5.515  246.321 1.00 30.00 ? 283 MET A C   1 
ATOM 2191 O O   . MET A 1 282 ? 5.103   -4.980  247.411 1.00 30.00 ? 283 MET A O   1 
ATOM 2192 C CB  . MET A 1 282 ? 7.079   -4.188  245.173 1.00 30.00 ? 283 MET A CB  1 
ATOM 2193 C CG  . MET A 1 282 ? 8.586   -4.275  244.942 1.00 30.00 ? 283 MET A CG  1 
ATOM 2194 S SD  . MET A 1 282 ? 9.569   -4.259  246.469 1.00 30.00 ? 283 MET A SD  1 
ATOM 2195 C CE  . MET A 1 282 ? 8.717   -2.825  247.137 1.00 30.00 ? 283 MET A CE  1 
ATOM 2196 N N   . LYS A 1 283 ? 4.363   -6.120  245.630 1.00 30.00 ? 284 LYS A N   1 
ATOM 2197 C CA  . LYS A 1 283 ? 2.959   -6.201  245.984 1.00 30.00 ? 284 LYS A CA  1 
ATOM 2198 C C   . LYS A 1 283 ? 2.650   -7.471  246.762 1.00 30.00 ? 284 LYS A C   1 
ATOM 2199 O O   . LYS A 1 283 ? 1.529   -7.714  247.241 1.00 30.00 ? 284 LYS A O   1 
ATOM 2200 C CB  . LYS A 1 283 ? 2.133   -6.163  244.696 1.00 30.00 ? 284 LYS A CB  1 
ATOM 2201 C CG  . LYS A 1 283 ? 1.766   -4.758  244.219 1.00 30.00 ? 284 LYS A CG  1 
ATOM 2202 C CD  . LYS A 1 283 ? 1.014   -4.855  242.922 1.00 30.00 ? 284 LYS A CD  1 
ATOM 2203 C CE  . LYS A 1 283 ? 0.125   -3.641  242.803 1.00 30.00 ? 284 LYS A CE  1 
ATOM 2204 N NZ  . LYS A 1 283 ? -1.031  -3.798  243.670 1.00 30.00 ? 284 LYS A NZ  1 
ATOM 2205 N N   . CYS A 1 284 ? 3.617   -8.370  246.832 1.00 30.00 ? 285 CYS A N   1 
ATOM 2206 C CA  . CYS A 1 284 ? 3.431   -9.623  247.551 1.00 30.00 ? 285 CYS A CA  1 
ATOM 2207 C C   . CYS A 1 284 ? 3.806   -9.548  249.060 1.00 30.00 ? 285 CYS A C   1 
ATOM 2208 O O   . CYS A 1 284 ? 4.384   -8.601  249.597 1.00 30.00 ? 285 CYS A O   1 
ATOM 2209 C CB  . CYS A 1 284 ? 4.280   -10.665 246.851 1.00 30.00 ? 285 CYS A CB  1 
ATOM 2210 S SG  . CYS A 1 284 ? 3.912   -10.981 245.119 1.00 30.00 ? 285 CYS A SG  1 
ATOM 2211 N N   . ASP A 1 285 ? 3.466   -10.602 249.771 1.00 30.00 ? 286 ASP A N   1 
ATOM 2212 C CA  . ASP A 1 285 ? 3.824   -10.832 251.145 1.00 30.00 ? 286 ASP A CA  1 
ATOM 2213 C C   . ASP A 1 285 ? 5.306   -10.658 251.327 1.00 30.00 ? 286 ASP A C   1 
ATOM 2214 O O   . ASP A 1 285 ? 6.107   -11.397 250.771 1.00 30.00 ? 286 ASP A O   1 
ATOM 2215 C CB  . ASP A 1 285 ? 3.478   -12.252 251.560 1.00 30.00 ? 286 ASP A CB  1 
ATOM 2216 C CG  . ASP A 1 285 ? 3.278   -12.383 253.052 1.00 30.00 ? 286 ASP A CG  1 
ATOM 2217 O OD1 . ASP A 1 285 ? 4.149   -12.051 253.867 1.00 30.00 ? 286 ASP A OD1 1 
ATOM 2218 O OD2 . ASP A 1 285 ? 2.211   -12.853 253.413 1.00 30.00 ? 286 ASP A OD2 1 
ATOM 2219 N N   . VAL A 1 286 ? 5.614   -9.809  252.285 1.00 30.00 ? 287 VAL A N   1 
ATOM 2220 C CA  . VAL A 1 286 ? 6.961   -9.504  252.700 1.00 30.00 ? 287 VAL A CA  1 
ATOM 2221 C C   . VAL A 1 286 ? 7.796   -10.745 252.879 1.00 30.00 ? 287 VAL A C   1 
ATOM 2222 O O   . VAL A 1 286 ? 8.957   -10.733 252.520 1.00 30.00 ? 287 VAL A O   1 
ATOM 2223 C CB  . VAL A 1 286 ? 6.829   -8.690  253.986 1.00 30.00 ? 287 VAL A CB  1 
ATOM 2224 C CG1 . VAL A 1 286 ? 8.149   -8.409  254.606 1.00 30.00 ? 287 VAL A CG1 1 
ATOM 2225 C CG2 . VAL A 1 286 ? 6.317   -7.333  253.669 1.00 30.00 ? 287 VAL A CG2 1 
ATOM 2226 N N   . ASP A 1 287 ? 7.240   -11.866 253.341 1.00 30.00 ? 288 ASP A N   1 
ATOM 2227 C CA  . ASP A 1 287 ? 8.042   -13.079 253.627 1.00 30.00 ? 288 ASP A CA  1 
ATOM 2228 C C   . ASP A 1 287 ? 8.150   -14.040 252.407 1.00 30.00 ? 288 ASP A C   1 
ATOM 2229 O O   . ASP A 1 287 ? 8.667   -15.175 252.547 1.00 30.00 ? 288 ASP A O   1 
ATOM 2230 C CB  . ASP A 1 287 ? 7.460   -13.901 254.866 1.00 30.00 ? 288 ASP A CB  1 
ATOM 2231 C CG  . ASP A 1 287 ? 7.190   -13.226 256.248 1.00 30.00 ? 288 ASP A CG  1 
ATOM 2232 O OD1 . ASP A 1 287 ? 8.135   -12.950 257.023 1.00 30.00 ? 288 ASP A OD1 1 
ATOM 2233 O OD2 . ASP A 1 287 ? 6.002   -13.006 256.556 1.00 30.00 ? 288 ASP A OD2 1 
ATOM 2234 N N   . ILE A 1 288 ? 7.652   -13.724 251.189 1.00 30.00 ? 289 ILE A N   1 
ATOM 2235 C CA  . ILE A 1 288 ? 7.923   -14.635 250.107 1.00 30.00 ? 289 ILE A CA  1 
ATOM 2236 C C   . ILE A 1 288 ? 8.744   -13.936 249.084 1.00 30.00 ? 289 ILE A C   1 
ATOM 2237 O O   . ILE A 1 288 ? 9.386   -14.580 248.286 1.00 30.00 ? 289 ILE A O   1 
ATOM 2238 C CB  . ILE A 1 288 ? 6.629   -15.209 249.508 1.00 30.00 ? 289 ILE A CB  1 
ATOM 2239 C CG1 . ILE A 1 288 ? 5.544   -14.243 249.148 1.00 30.00 ? 289 ILE A CG1 1 
ATOM 2240 C CG2 . ILE A 1 288 ? 6.113   -16.104 250.610 1.00 30.00 ? 289 ILE A CG2 1 
ATOM 2241 C CD1 . ILE A 1 288 ? 4.171   -14.903 248.923 1.00 30.00 ? 289 ILE A CD1 1 
ATOM 2242 N N   . ARG A 1 289 ? 8.932   -12.629 249.114 1.00 30.00 ? 290 ARG A N   1 
ATOM 2243 C CA  . ARG A 1 289 ? 9.704   -11.874 248.137 1.00 30.00 ? 290 ARG A CA  1 
ATOM 2244 C C   . ARG A 1 289 ? 11.067  -12.472 247.848 1.00 30.00 ? 290 ARG A C   1 
ATOM 2245 O O   . ARG A 1 289 ? 11.467  -12.640 246.689 1.00 30.00 ? 290 ARG A O   1 
ATOM 2246 C CB  . ARG A 1 289 ? 9.915   -10.427 248.602 1.00 30.00 ? 290 ARG A CB  1 
ATOM 2247 C CG  . ARG A 1 289 ? 8.654   -9.642  248.651 1.00 30.00 ? 290 ARG A CG  1 
ATOM 2248 C CD  . ARG A 1 289 ? 8.859   -8.199  248.997 1.00 30.00 ? 290 ARG A CD  1 
ATOM 2249 N NE  . ARG A 1 289 ? 7.506   -7.711  249.180 1.00 30.00 ? 290 ARG A NE  1 
ATOM 2250 C CZ  . ARG A 1 289 ? 7.190   -6.509  249.659 1.00 30.00 ? 290 ARG A CZ  1 
ATOM 2251 N NH1 . ARG A 1 289 ? 8.062   -5.587  250.030 1.00 30.00 ? 290 ARG A NH1 1 
ATOM 2252 N NH2 . ARG A 1 289 ? 5.917   -6.211  249.804 1.00 30.00 ? 290 ARG A NH2 1 
ATOM 2253 N N   . LYS A 1 290 ? 11.758  -12.907 248.897 1.00 30.00 ? 291 LYS A N   1 
ATOM 2254 C CA  . LYS A 1 290 ? 13.084  -13.453 248.701 1.00 30.00 ? 291 LYS A CA  1 
ATOM 2255 C C   . LYS A 1 290 ? 12.967  -14.718 247.883 1.00 30.00 ? 291 LYS A C   1 
ATOM 2256 O O   . LYS A 1 290 ? 13.900  -15.111 247.190 1.00 30.00 ? 291 LYS A O   1 
ATOM 2257 C CB  . LYS A 1 290 ? 13.780  -13.783 250.021 1.00 30.00 ? 291 LYS A CB  1 
ATOM 2258 C CG  . LYS A 1 290 ? 13.159  -14.767 251.046 1.00 30.00 ? 291 LYS A CG  1 
ATOM 2259 C CD  . LYS A 1 290 ? 11.966  -14.280 251.942 1.00 30.00 ? 291 LYS A CD  1 
ATOM 2260 C CE  . LYS A 1 290 ? 12.115  -12.959 252.747 1.00 30.00 ? 291 LYS A CE  1 
ATOM 2261 N NZ  . LYS A 1 290 ? 11.156  -11.964 252.261 1.00 30.00 ? 291 LYS A NZ  1 
ATOM 2262 N N   . ASP A 1 291 ? 11.819  -15.369 247.923 1.00 30.00 ? 292 ASP A N   1 
ATOM 2263 C CA  . ASP A 1 291 ? 11.620  -16.560 247.158 1.00 30.00 ? 292 ASP A CA  1 
ATOM 2264 C C   . ASP A 1 291 ? 11.326  -16.203 245.728 1.00 30.00 ? 292 ASP A C   1 
ATOM 2265 O O   . ASP A 1 291 ? 11.828  -16.866 244.822 1.00 30.00 ? 292 ASP A O   1 
ATOM 2266 C CB  . ASP A 1 291 ? 10.468  -17.395 247.767 1.00 30.00 ? 292 ASP A CB  1 
ATOM 2267 C CG  . ASP A 1 291 ? 10.876  -18.167 249.011 1.00 30.00 ? 292 ASP A CG  1 
ATOM 2268 O OD1 . ASP A 1 291 ? 11.860  -18.904 248.975 1.00 30.00 ? 292 ASP A OD1 1 
ATOM 2269 O OD2 . ASP A 1 291 ? 10.203  -18.028 250.025 1.00 30.00 ? 292 ASP A OD2 1 
ATOM 2270 N N   . LEU A 1 292 ? 10.526  -15.167 245.531 1.00 30.00 ? 293 LEU A N   1 
ATOM 2271 C CA  . LEU A 1 292 ? 10.182  -14.701 244.187 1.00 30.00 ? 293 LEU A CA  1 
ATOM 2272 C C   . LEU A 1 292 ? 11.442  -14.151 243.433 1.00 30.00 ? 293 LEU A C   1 
ATOM 2273 O O   . LEU A 1 292 ? 11.643  -14.456 242.238 1.00 30.00 ? 293 LEU A O   1 
ATOM 2274 C CB  . LEU A 1 292 ? 9.132   -13.648 244.336 1.00 30.00 ? 293 LEU A CB  1 
ATOM 2275 C CG  . LEU A 1 292 ? 7.872   -13.982 245.035 1.00 30.00 ? 293 LEU A CG  1 
ATOM 2276 C CD1 . LEU A 1 292 ? 6.942   -12.820 244.849 1.00 30.00 ? 293 LEU A CD1 1 
ATOM 2277 C CD2 . LEU A 1 292 ? 7.262   -15.226 244.473 1.00 30.00 ? 293 LEU A CD2 1 
ATOM 2278 N N   . TYR A 1 293 ? 12.415  -13.438 244.043 1.00 30.00 ? 294 TYR A N   1 
ATOM 2279 C CA  . TYR A 1 293 ? 13.651  -13.118 243.330 1.00 30.00 ? 294 TYR A CA  1 
ATOM 2280 C C   . TYR A 1 293 ? 14.542  -14.286 242.969 1.00 30.00 ? 294 TYR A C   1 
ATOM 2281 O O   . TYR A 1 293 ? 15.329  -14.244 242.033 1.00 30.00 ? 294 TYR A O   1 
ATOM 2282 C CB  . TYR A 1 293 ? 14.500  -12.184 244.126 1.00 30.00 ? 294 TYR A CB  1 
ATOM 2283 C CG  . TYR A 1 293 ? 13.968  -10.784 244.137 1.00 30.00 ? 294 TYR A CG  1 
ATOM 2284 C CD1 . TYR A 1 293 ? 14.241  -9.910  243.112 1.00 30.00 ? 294 TYR A CD1 1 
ATOM 2285 C CD2 . TYR A 1 293 ? 13.272  -10.371 245.237 1.00 30.00 ? 294 TYR A CD2 1 
ATOM 2286 C CE1 . TYR A 1 293 ? 13.812  -8.598  243.207 1.00 30.00 ? 294 TYR A CE1 1 
ATOM 2287 C CE2 . TYR A 1 293 ? 12.850  -9.059  245.334 1.00 30.00 ? 294 TYR A CE2 1 
ATOM 2288 C CZ  . TYR A 1 293 ? 13.126  -8.178  244.324 1.00 30.00 ? 294 TYR A CZ  1 
ATOM 2289 O OH  . TYR A 1 293 ? 12.744  -6.855  244.488 1.00 30.00 ? 294 TYR A OH  1 
ATOM 2290 N N   . ALA A 1 294 ? 14.551  -15.351 243.740 1.00 30.00 ? 295 ALA A N   1 
ATOM 2291 C CA  . ALA A 1 294 ? 15.381  -16.515 243.480 1.00 30.00 ? 295 ALA A CA  1 
ATOM 2292 C C   . ALA A 1 294 ? 14.804  -17.408 242.408 1.00 30.00 ? 295 ALA A C   1 
ATOM 2293 O O   . ALA A 1 294 ? 15.469  -18.338 241.944 1.00 30.00 ? 295 ALA A O   1 
ATOM 2294 C CB  . ALA A 1 294 ? 15.496  -17.353 244.716 1.00 30.00 ? 295 ALA A CB  1 
ATOM 2295 N N   . ASN A 1 295 ? 13.530  -17.157 242.051 1.00 30.00 ? 296 ASN A N   1 
ATOM 2296 C CA  . ASN A 1 295 ? 12.795  -18.001 241.122 1.00 30.00 ? 296 ASN A CA  1 
ATOM 2297 C C   . ASN A 1 295 ? 12.016  -17.128 240.151 1.00 30.00 ? 296 ASN A C   1 
ATOM 2298 O O   . ASN A 1 295 ? 10.801  -16.954 240.236 1.00 30.00 ? 296 ASN A O   1 
ATOM 2299 C CB  . ASN A 1 295 ? 11.879  -18.878 241.937 1.00 30.00 ? 296 ASN A CB  1 
ATOM 2300 C CG  . ASN A 1 295 ? 12.604  -19.801 242.902 1.00 30.00 ? 296 ASN A CG  1 
ATOM 2301 O OD1 . ASN A 1 295 ? 13.074  -20.883 242.546 1.00 30.00 ? 296 ASN A OD1 1 
ATOM 2302 N ND2 . ASN A 1 295 ? 12.761  -19.414 244.163 1.00 30.00 ? 296 ASN A ND2 1 
ATOM 2303 N N   . THR A 1 296 ? 12.740  -16.415 239.298 1.00 30.00 ? 297 THR A N   1 
ATOM 2304 C CA  . THR A 1 296 ? 12.106  -15.642 238.265 1.00 30.00 ? 297 THR A CA  1 
ATOM 2305 C C   . THR A 1 296 ? 12.249  -16.571 237.079 1.00 30.00 ? 297 THR A C   1 
ATOM 2306 O O   . THR A 1 296 ? 13.375  -16.942 236.731 1.00 30.00 ? 297 THR A O   1 
ATOM 2307 C CB  . THR A 1 296 ? 12.865  -14.343 238.140 1.00 30.00 ? 297 THR A CB  1 
ATOM 2308 O OG1 . THR A 1 296 ? 12.658  -13.682 239.356 1.00 30.00 ? 297 THR A OG1 1 
ATOM 2309 C CG2 . THR A 1 296 ? 12.303  -13.354 237.165 1.00 30.00 ? 297 THR A CG2 1 
ATOM 2310 N N   . VAL A 1 297 ? 11.124  -17.058 236.525 1.00 30.00 ? 298 VAL A N   1 
ATOM 2311 C CA  . VAL A 1 297 ? 11.080  -17.999 235.395 1.00 30.00 ? 298 VAL A CA  1 
ATOM 2312 C C   . VAL A 1 297 ? 10.438  -17.254 234.229 1.00 30.00 ? 298 VAL A C   1 
ATOM 2313 O O   . VAL A 1 297 ? 9.470   -16.472 234.398 1.00 30.00 ? 298 VAL A O   1 
ATOM 2314 C CB  . VAL A 1 297 ? 10.212  -19.267 235.723 1.00 30.00 ? 298 VAL A CB  1 
ATOM 2315 C CG1 . VAL A 1 297 ? 10.348  -20.226 234.545 1.00 30.00 ? 298 VAL A CG1 1 
ATOM 2316 C CG2 . VAL A 1 297 ? 10.600  -19.909 237.103 1.00 30.00 ? 298 VAL A CG2 1 
ATOM 2317 N N   . LEU A 1 298 ? 10.984  -17.450 233.035 1.00 30.00 ? 299 LEU A N   1 
ATOM 2318 C CA  . LEU A 1 298 ? 10.416  -16.776 231.881 1.00 30.00 ? 299 LEU A CA  1 
ATOM 2319 C C   . LEU A 1 298 ? 9.667   -17.835 231.091 1.00 30.00 ? 299 LEU A C   1 
ATOM 2320 O O   . LEU A 1 298 ? 10.142  -18.990 231.057 1.00 30.00 ? 299 LEU A O   1 
ATOM 2321 C CB  . LEU A 1 298 ? 11.545  -16.130 231.024 1.00 30.00 ? 299 LEU A CB  1 
ATOM 2322 C CG  . LEU A 1 298 ? 12.656  -15.290 231.675 1.00 30.00 ? 299 LEU A CG  1 
ATOM 2323 C CD1 . LEU A 1 298 ? 13.502  -14.625 230.593 1.00 30.00 ? 299 LEU A CD1 1 
ATOM 2324 C CD2 . LEU A 1 298 ? 12.056  -14.220 232.576 1.00 30.00 ? 299 LEU A CD2 1 
ATOM 2325 N N   . SER A 1 299 ? 8.494   -17.545 230.534 1.00 30.00 ? 300 SER A N   1 
ATOM 2326 C CA  . SER A 1 299 ? 7.921   -18.563 229.688 1.00 30.00 ? 300 SER A CA  1 
ATOM 2327 C C   . SER A 1 299 ? 7.240   -17.956 228.502 1.00 30.00 ? 300 SER A C   1 
ATOM 2328 O O   . SER A 1 299 ? 6.986   -16.749 228.593 1.00 30.00 ? 300 SER A O   1 
ATOM 2329 C CB  . SER A 1 299 ? 6.963   -19.348 230.473 1.00 30.00 ? 300 SER A CB  1 
ATOM 2330 O OG  . SER A 1 299 ? 5.750   -18.703 230.840 1.00 30.00 ? 300 SER A OG  1 
ATOM 2331 N N   . GLY A 1 300 ? 6.930   -18.618 227.394 1.00 30.00 ? 301 GLY A N   1 
ATOM 2332 C CA  . GLY A 1 300 ? 6.233   -17.983 226.245 1.00 30.00 ? 301 GLY A CA  1 
ATOM 2333 C C   . GLY A 1 300 ? 7.128   -17.786 225.037 1.00 30.00 ? 301 GLY A C   1 
ATOM 2334 O O   . GLY A 1 300 ? 8.339   -17.674 225.263 1.00 30.00 ? 301 GLY A O   1 
ATOM 2335 N N   . GLY A 1 301 ? 6.645   -17.736 223.789 1.00 30.00 ? 302 GLY A N   1 
ATOM 2336 C CA  . GLY A 1 301 ? 7.452   -17.507 222.587 1.00 30.00 ? 302 GLY A CA  1 
ATOM 2337 C C   . GLY A 1 301 ? 8.246   -16.192 222.605 1.00 30.00 ? 302 GLY A C   1 
ATOM 2338 O O   . GLY A 1 301 ? 9.444   -16.167 222.318 1.00 30.00 ? 302 GLY A O   1 
ATOM 2339 N N   . THR A 1 302 ? 7.729   -15.059 223.064 1.00 30.00 ? 303 THR A N   1 
ATOM 2340 C CA  . THR A 1 302 ? 8.471   -13.812 223.050 1.00 30.00 ? 303 THR A CA  1 
ATOM 2341 C C   . THR A 1 302 ? 9.615   -13.855 224.092 1.00 30.00 ? 303 THR A C   1 
ATOM 2342 O O   . THR A 1 302 ? 10.351  -12.873 224.261 1.00 30.00 ? 303 THR A O   1 
ATOM 2343 C CB  . THR A 1 302 ? 7.361   -12.677 223.253 1.00 30.00 ? 303 THR A CB  1 
ATOM 2344 O OG1 . THR A 1 302 ? 6.548   -12.697 222.083 1.00 30.00 ? 303 THR A OG1 1 
ATOM 2345 C CG2 . THR A 1 302 ? 7.843   -11.241 223.348 1.00 30.00 ? 303 THR A CG2 1 
ATOM 2346 N N   . THR A 1 303 ? 9.886   -14.949 224.851 1.00 30.00 ? 304 THR A N   1 
ATOM 2347 C CA  . THR A 1 303 ? 11.008  -14.947 225.817 1.00 30.00 ? 304 THR A CA  1 
ATOM 2348 C C   . THR A 1 303 ? 12.170  -15.711 225.192 1.00 30.00 ? 304 THR A C   1 
ATOM 2349 O O   . THR A 1 303 ? 13.195  -15.996 225.800 1.00 30.00 ? 304 THR A O   1 
ATOM 2350 C CB  . THR A 1 303 ? 10.704  -15.644 227.221 1.00 30.00 ? 304 THR A CB  1 
ATOM 2351 O OG1 . THR A 1 303 ? 10.475  -17.005 226.990 1.00 30.00 ? 304 THR A OG1 1 
ATOM 2352 C CG2 . THR A 1 303 ? 9.525   -15.078 227.940 1.00 30.00 ? 304 THR A CG2 1 
ATOM 2353 N N   . MET A 1 304 ? 12.011  -16.047 223.930 1.00 30.00 ? 305 MET A N   1 
ATOM 2354 C CA  . MET A 1 304 ? 13.009  -16.856 223.293 1.00 30.00 ? 305 MET A CA  1 
ATOM 2355 C C   . MET A 1 304 ? 14.207  -16.086 222.729 1.00 30.00 ? 305 MET A C   1 
ATOM 2356 O O   . MET A 1 304 ? 15.136  -16.684 222.195 1.00 30.00 ? 305 MET A O   1 
ATOM 2357 C CB  . MET A 1 304 ? 12.259  -17.640 222.234 1.00 30.00 ? 305 MET A CB  1 
ATOM 2358 C CG  . MET A 1 304 ? 11.287  -18.618 222.802 1.00 30.00 ? 305 MET A CG  1 
ATOM 2359 S SD  . MET A 1 304 ? 12.247  -19.973 223.487 1.00 30.00 ? 305 MET A SD  1 
ATOM 2360 C CE  . MET A 1 304 ? 12.153  -21.002 222.048 1.00 30.00 ? 305 MET A CE  1 
ATOM 2361 N N   . TYR A 1 305 ? 14.231  -14.767 222.816 1.00 30.00 ? 306 TYR A N   1 
ATOM 2362 C CA  . TYR A 1 305 ? 15.265  -13.946 222.236 1.00 30.00 ? 306 TYR A CA  1 
ATOM 2363 C C   . TYR A 1 305 ? 16.606  -14.187 222.844 1.00 30.00 ? 306 TYR A C   1 
ATOM 2364 O O   . TYR A 1 305 ? 16.650  -14.076 224.070 1.00 30.00 ? 306 TYR A O   1 
ATOM 2365 C CB  . TYR A 1 305 ? 14.958  -12.518 222.448 1.00 30.00 ? 306 TYR A CB  1 
ATOM 2366 C CG  . TYR A 1 305 ? 13.759  -12.063 221.683 1.00 30.00 ? 306 TYR A CG  1 
ATOM 2367 C CD1 . TYR A 1 305 ? 13.703  -12.268 220.314 1.00 30.00 ? 306 TYR A CD1 1 
ATOM 2368 C CD2 . TYR A 1 305 ? 12.778  -11.392 222.318 1.00 30.00 ? 306 TYR A CD2 1 
ATOM 2369 C CE1 . TYR A 1 305 ? 12.653  -11.778 219.554 1.00 30.00 ? 306 TYR A CE1 1 
ATOM 2370 C CE2 . TYR A 1 305 ? 11.724  -10.905 221.575 1.00 30.00 ? 306 TYR A CE2 1 
ATOM 2371 C CZ  . TYR A 1 305 ? 11.684  -11.103 220.213 1.00 30.00 ? 306 TYR A CZ  1 
ATOM 2372 O OH  . TYR A 1 305 ? 10.651  -10.611 219.500 1.00 30.00 ? 306 TYR A OH  1 
ATOM 2373 N N   . PRO A 1 306 ? 17.717  -14.444 222.133 1.00 30.00 ? 307 PRO A N   1 
ATOM 2374 C CA  . PRO A 1 306 ? 19.063  -14.394 222.659 1.00 30.00 ? 307 PRO A CA  1 
ATOM 2375 C C   . PRO A 1 306 ? 19.286  -13.056 223.352 1.00 30.00 ? 307 PRO A C   1 
ATOM 2376 O O   . PRO A 1 306 ? 18.793  -12.006 222.908 1.00 30.00 ? 307 PRO A O   1 
ATOM 2377 C CB  . PRO A 1 306 ? 19.921  -14.638 221.458 1.00 30.00 ? 307 PRO A CB  1 
ATOM 2378 C CG  . PRO A 1 306 ? 19.104  -15.650 220.729 1.00 30.00 ? 307 PRO A CG  1 
ATOM 2379 C CD  . PRO A 1 306 ? 17.757  -14.939 220.758 1.00 30.00 ? 307 PRO A CD  1 
ATOM 2380 N N   . GLY A 1 307 ? 19.961  -13.215 224.522 1.00 30.00 ? 308 GLY A N   1 
ATOM 2381 C CA  . GLY A 1 307 ? 20.224  -12.183 225.507 1.00 30.00 ? 308 GLY A CA  1 
ATOM 2382 C C   . GLY A 1 307 ? 19.102  -11.901 226.520 1.00 30.00 ? 308 GLY A C   1 
ATOM 2383 O O   . GLY A 1 307 ? 19.356  -11.174 227.504 1.00 30.00 ? 308 GLY A O   1 
ATOM 2384 N N   . ILE A 1 308 ? 17.872  -12.466 226.444 1.00 30.00 ? 309 ILE A N   1 
ATOM 2385 C CA  . ILE A 1 308 ? 16.832  -11.979 227.357 1.00 30.00 ? 309 ILE A CA  1 
ATOM 2386 C C   . ILE A 1 308 ? 17.034  -12.406 228.795 1.00 30.00 ? 309 ILE A C   1 
ATOM 2387 O O   . ILE A 1 308 ? 16.722  -11.606 229.686 1.00 30.00 ? 309 ILE A O   1 
ATOM 2388 C CB  . ILE A 1 308 ? 15.418  -12.394 226.854 1.00 30.00 ? 309 ILE A CB  1 
ATOM 2389 C CG1 . ILE A 1 308 ? 14.514  -11.312 227.397 1.00 30.00 ? 309 ILE A CG1 1 
ATOM 2390 C CG2 . ILE A 1 308 ? 14.974  -13.781 227.247 1.00 30.00 ? 309 ILE A CG2 1 
ATOM 2391 C CD1 . ILE A 1 308 ? 13.124  -11.312 226.784 1.00 30.00 ? 309 ILE A CD1 1 
ATOM 2392 N N   . ALA A 1 309 ? 17.583  -13.595 229.070 1.00 30.00 ? 310 ALA A N   1 
ATOM 2393 C CA  . ALA A 1 309 ? 17.892  -14.001 230.443 1.00 30.00 ? 310 ALA A CA  1 
ATOM 2394 C C   . ALA A 1 309 ? 18.902  -13.081 231.068 1.00 30.00 ? 310 ALA A C   1 
ATOM 2395 O O   . ALA A 1 309 ? 18.624  -12.559 232.138 1.00 30.00 ? 310 ALA A O   1 
ATOM 2396 C CB  . ALA A 1 309 ? 18.474  -15.408 230.497 1.00 30.00 ? 310 ALA A CB  1 
ATOM 2397 N N   . ASP A 1 310 ? 20.060  -12.876 230.429 1.00 30.00 ? 311 ASP A N   1 
ATOM 2398 C CA  . ASP A 1 310 ? 21.080  -11.923 230.893 1.00 30.00 ? 311 ASP A CA  1 
ATOM 2399 C C   . ASP A 1 310 ? 20.590  -10.511 231.073 1.00 30.00 ? 311 ASP A C   1 
ATOM 2400 O O   . ASP A 1 310 ? 20.978  -9.862  232.033 1.00 30.00 ? 311 ASP A O   1 
ATOM 2401 C CB  . ASP A 1 310 ? 22.245  -11.693 229.967 1.00 30.00 ? 311 ASP A CB  1 
ATOM 2402 C CG  . ASP A 1 310 ? 23.026  -12.922 229.635 1.00 30.00 ? 311 ASP A CG  1 
ATOM 2403 O OD1 . ASP A 1 310 ? 23.944  -13.215 230.381 1.00 30.00 ? 311 ASP A OD1 1 
ATOM 2404 O OD2 . ASP A 1 310 ? 22.717  -13.567 228.642 1.00 30.00 ? 311 ASP A OD2 1 
ATOM 2405 N N   . ARG A 1 311 ? 19.825  -9.988  230.146 1.00 30.00 ? 312 ARG A N   1 
ATOM 2406 C CA  . ARG A 1 311 ? 19.363  -8.635  230.261 1.00 30.00 ? 312 ARG A CA  1 
ATOM 2407 C C   . ARG A 1 311 ? 18.279  -8.542  231.301 1.00 30.00 ? 312 ARG A C   1 
ATOM 2408 O O   . ARG A 1 311 ? 18.164  -7.492  231.913 1.00 30.00 ? 312 ARG A O   1 
ATOM 2409 C CB  . ARG A 1 311 ? 18.867  -8.210  228.921 1.00 30.00 ? 312 ARG A CB  1 
ATOM 2410 C CG  . ARG A 1 311 ? 18.188  -6.903  228.934 1.00 30.00 ? 312 ARG A CG  1 
ATOM 2411 C CD  . ARG A 1 311 ? 19.171  -5.844  229.268 1.00 30.00 ? 312 ARG A CD  1 
ATOM 2412 N NE  . ARG A 1 311 ? 18.397  -4.644  229.344 1.00 30.00 ? 312 ARG A NE  1 
ATOM 2413 C CZ  . ARG A 1 311 ? 18.060  -4.005  228.242 1.00 30.00 ? 312 ARG A CZ  1 
ATOM 2414 N NH1 . ARG A 1 311 ? 18.474  -4.500  227.093 1.00 30.00 ? 312 ARG A NH1 1 
ATOM 2415 N NH2 . ARG A 1 311 ? 17.200  -2.969  228.268 1.00 30.00 ? 312 ARG A NH2 1 
ATOM 2416 N N   . MET A 1 312 ? 17.432  -9.546  231.499 1.00 30.00 ? 313 MET A N   1 
ATOM 2417 C CA  . MET A 1 312 ? 16.453  -9.539  232.560 1.00 30.00 ? 313 MET A CA  1 
ATOM 2418 C C   . MET A 1 312 ? 17.250  -9.546  233.859 1.00 30.00 ? 313 MET A C   1 
ATOM 2419 O O   . MET A 1 312 ? 17.065  -8.633  234.651 1.00 30.00 ? 313 MET A O   1 
ATOM 2420 C CB  . MET A 1 312 ? 15.559  -10.773 232.405 1.00 30.00 ? 313 MET A CB  1 
ATOM 2421 C CG  . MET A 1 312 ? 14.342  -10.305 231.672 1.00 30.00 ? 313 MET A CG  1 
ATOM 2422 S SD  . MET A 1 312 ? 13.407  -9.285  232.850 1.00 30.00 ? 313 MET A SD  1 
ATOM 2423 C CE  . MET A 1 312 ? 11.944  -10.296 232.928 1.00 30.00 ? 313 MET A CE  1 
ATOM 2424 N N   . GLN A 1 313 ? 18.197  -10.450 234.093 1.00 30.00 ? 314 GLN A N   1 
ATOM 2425 C CA  . GLN A 1 313 ? 19.070  -10.484 235.256 1.00 30.00 ? 314 GLN A CA  1 
ATOM 2426 C C   . GLN A 1 313 ? 19.703  -9.141  235.508 1.00 30.00 ? 314 GLN A C   1 
ATOM 2427 O O   . GLN A 1 313 ? 19.323  -8.555  236.517 1.00 30.00 ? 314 GLN A O   1 
ATOM 2428 C CB  . GLN A 1 313 ? 20.106  -11.558 235.015 1.00 30.00 ? 314 GLN A CB  1 
ATOM 2429 C CG  . GLN A 1 313 ? 21.368  -11.567 235.815 1.00 30.00 ? 314 GLN A CG  1 
ATOM 2430 C CD  . GLN A 1 313 ? 21.296  -11.876 237.291 1.00 30.00 ? 314 GLN A CD  1 
ATOM 2431 O OE1 . GLN A 1 313 ? 21.934  -11.195 238.110 1.00 30.00 ? 314 GLN A OE1 1 
ATOM 2432 N NE2 . GLN A 1 313 ? 20.580  -12.952 237.621 1.00 30.00 ? 314 GLN A NE2 1 
ATOM 2433 N N   . LYS A 1 314 ? 20.535  -8.576  234.629 1.00 30.00 ? 315 LYS A N   1 
ATOM 2434 C CA  . LYS A 1 314 ? 21.144  -7.258  234.738 1.00 30.00 ? 315 LYS A CA  1 
ATOM 2435 C C   . LYS A 1 314 ? 20.171  -6.202  235.222 1.00 30.00 ? 315 LYS A C   1 
ATOM 2436 O O   . LYS A 1 314 ? 20.475  -5.378  236.093 1.00 30.00 ? 315 LYS A O   1 
ATOM 2437 C CB  . LYS A 1 314 ? 21.687  -6.996  233.348 1.00 30.00 ? 315 LYS A CB  1 
ATOM 2438 C CG  . LYS A 1 314 ? 22.474  -5.775  232.889 1.00 30.00 ? 315 LYS A CG  1 
ATOM 2439 C CD  . LYS A 1 314 ? 21.655  -4.542  232.557 1.00 30.00 ? 315 LYS A CD  1 
ATOM 2440 C CE  . LYS A 1 314 ? 22.494  -3.493  231.843 1.00 30.00 ? 315 LYS A CE  1 
ATOM 2441 N NZ  . LYS A 1 314 ? 21.601  -2.796  230.928 1.00 30.00 ? 315 LYS A NZ  1 
ATOM 2442 N N   . GLU A 1 315 ? 18.938  -6.247  234.740 1.00 30.00 ? 316 GLU A N   1 
ATOM 2443 C CA  . GLU A 1 315 ? 17.983  -5.204  235.073 1.00 30.00 ? 316 GLU A CA  1 
ATOM 2444 C C   . GLU A 1 315 ? 17.254  -5.382  236.383 1.00 30.00 ? 316 GLU A C   1 
ATOM 2445 O O   . GLU A 1 315 ? 16.910  -4.394  237.044 1.00 30.00 ? 316 GLU A O   1 
ATOM 2446 C CB  . GLU A 1 315 ? 16.976  -5.081  233.939 1.00 30.00 ? 316 GLU A CB  1 
ATOM 2447 C CG  . GLU A 1 315 ? 17.610  -4.701  232.622 1.00 30.00 ? 316 GLU A CG  1 
ATOM 2448 C CD  . GLU A 1 315 ? 18.091  -3.263  232.462 1.00 30.00 ? 316 GLU A CD  1 
ATOM 2449 O OE1 . GLU A 1 315 ? 18.495  -2.584  233.407 1.00 30.00 ? 316 GLU A OE1 1 
ATOM 2450 O OE2 . GLU A 1 315 ? 18.045  -2.794  231.335 1.00 30.00 ? 316 GLU A OE2 1 
ATOM 2451 N N   . ILE A 1 316 ? 16.989  -6.622  236.771 1.00 30.00 ? 317 ILE A N   1 
ATOM 2452 C CA  . ILE A 1 316 ? 16.332  -6.840  238.038 1.00 30.00 ? 317 ILE A CA  1 
ATOM 2453 C C   . ILE A 1 316 ? 17.385  -6.665  239.099 1.00 30.00 ? 317 ILE A C   1 
ATOM 2454 O O   . ILE A 1 316 ? 17.099  -6.089  240.150 1.00 30.00 ? 317 ILE A O   1 
ATOM 2455 C CB  . ILE A 1 316 ? 15.716  -8.218  238.034 1.00 30.00 ? 317 ILE A CB  1 
ATOM 2456 C CG1 . ILE A 1 316 ? 14.416  -8.135  237.231 1.00 30.00 ? 317 ILE A CG1 1 
ATOM 2457 C CG2 . ILE A 1 316 ? 15.348  -8.653  239.425 1.00 30.00 ? 317 ILE A CG2 1 
ATOM 2458 C CD1 . ILE A 1 316 ? 13.801  -9.463  236.796 1.00 30.00 ? 317 ILE A CD1 1 
ATOM 2459 N N   . THR A 1 317 ? 18.620  -7.080  238.838 1.00 30.00 ? 318 THR A N   1 
ATOM 2460 C CA  . THR A 1 317 ? 19.722  -6.789  239.729 1.00 30.00 ? 318 THR A CA  1 
ATOM 2461 C C   . THR A 1 317 ? 19.932  -5.309  240.005 1.00 30.00 ? 318 THR A C   1 
ATOM 2462 O O   . THR A 1 317 ? 20.416  -4.949  241.076 1.00 30.00 ? 318 THR A O   1 
ATOM 2463 C CB  . THR A 1 317 ? 20.966  -7.412  239.126 1.00 30.00 ? 318 THR A CB  1 
ATOM 2464 O OG1 . THR A 1 317 ? 20.660  -8.800  238.897 1.00 30.00 ? 318 THR A OG1 1 
ATOM 2465 C CG2 . THR A 1 317 ? 22.162  -7.279  240.047 1.00 30.00 ? 318 THR A CG2 1 
ATOM 2466 N N   . ALA A 1 318 ? 19.615  -4.396  239.090 1.00 30.00 ? 319 ALA A N   1 
ATOM 2467 C CA  . ALA A 1 318 ? 19.735  -2.975  239.392 1.00 30.00 ? 319 ALA A CA  1 
ATOM 2468 C C   . ALA A 1 318 ? 18.596  -2.473  240.285 1.00 30.00 ? 319 ALA A C   1 
ATOM 2469 O O   . ALA A 1 318 ? 18.862  -1.700  241.213 1.00 30.00 ? 319 ALA A O   1 
ATOM 2470 C CB  . ALA A 1 318 ? 19.723  -2.194  238.118 1.00 30.00 ? 319 ALA A CB  1 
ATOM 2471 N N   . LEU A 1 319 ? 17.318  -2.846  240.069 1.00 30.00 ? 320 LEU A N   1 
ATOM 2472 C CA  . LEU A 1 319 ? 16.241  -2.390  240.958 1.00 30.00 ? 320 LEU A CA  1 
ATOM 2473 C C   . LEU A 1 319 ? 16.180  -3.069  242.358 1.00 30.00 ? 320 LEU A C   1 
ATOM 2474 O O   . LEU A 1 319 ? 15.684  -2.508  243.346 1.00 30.00 ? 320 LEU A O   1 
ATOM 2475 C CB  . LEU A 1 319 ? 14.954  -2.620  240.249 1.00 30.00 ? 320 LEU A CB  1 
ATOM 2476 C CG  . LEU A 1 319 ? 14.754  -1.946  238.919 1.00 30.00 ? 320 LEU A CG  1 
ATOM 2477 C CD1 . LEU A 1 319 ? 14.181  -2.904  237.892 1.00 30.00 ? 320 LEU A CD1 1 
ATOM 2478 C CD2 . LEU A 1 319 ? 13.808  -0.780  239.115 1.00 30.00 ? 320 LEU A CD2 1 
ATOM 2479 N N   . ALA A 1 320 ? 16.658  -4.321  242.452 1.00 30.00 ? 321 ALA A N   1 
ATOM 2480 C CA  . ALA A 1 320 ? 16.493  -5.161  243.623 1.00 30.00 ? 321 ALA A CA  1 
ATOM 2481 C C   . ALA A 1 320 ? 17.369  -4.699  244.755 1.00 30.00 ? 321 ALA A C   1 
ATOM 2482 O O   . ALA A 1 320 ? 18.508  -4.287  244.455 1.00 30.00 ? 321 ALA A O   1 
ATOM 2483 C CB  . ALA A 1 320 ? 16.902  -6.563  243.335 1.00 30.00 ? 321 ALA A CB  1 
ATOM 2484 N N   . PRO A 1 321 ? 16.967  -4.801  246.059 1.00 30.00 ? 322 PRO A N   1 
ATOM 2485 C CA  . PRO A 1 321 ? 17.852  -4.506  247.215 1.00 30.00 ? 322 PRO A CA  1 
ATOM 2486 C C   . PRO A 1 321 ? 19.251  -5.127  247.001 1.00 30.00 ? 322 PRO A C   1 
ATOM 2487 O O   . PRO A 1 321 ? 19.407  -6.240  246.456 1.00 30.00 ? 322 PRO A O   1 
ATOM 2488 C CB  . PRO A 1 321 ? 17.093  -5.073  248.392 1.00 30.00 ? 322 PRO A CB  1 
ATOM 2489 C CG  . PRO A 1 321 ? 15.643  -4.878  247.973 1.00 30.00 ? 322 PRO A CG  1 
ATOM 2490 C CD  . PRO A 1 321 ? 15.655  -5.273  246.502 1.00 30.00 ? 322 PRO A CD  1 
ATOM 2491 N N   . SER A 1 322 ? 20.285  -4.433  247.495 1.00 30.00 ? 323 SER A N   1 
ATOM 2492 C CA  . SER A 1 322 ? 21.682  -4.755  247.149 1.00 30.00 ? 323 SER A CA  1 
ATOM 2493 C C   . SER A 1 322 ? 22.275  -6.132  247.544 1.00 30.00 ? 323 SER A C   1 
ATOM 2494 O O   . SER A 1 322 ? 23.445  -6.469  247.334 1.00 30.00 ? 323 SER A O   1 
ATOM 2495 C CB  . SER A 1 322 ? 22.461  -3.511  247.705 1.00 30.00 ? 323 SER A CB  1 
ATOM 2496 O OG  . SER A 1 322 ? 21.821  -2.253  247.334 1.00 30.00 ? 323 SER A OG  1 
ATOM 2497 N N   . THR A 1 323 ? 21.395  -6.980  248.045 1.00 30.00 ? 324 THR A N   1 
ATOM 2498 C CA  . THR A 1 323 ? 21.730  -8.258  248.577 1.00 30.00 ? 324 THR A CA  1 
ATOM 2499 C C   . THR A 1 323 ? 20.981  -9.396  247.936 1.00 30.00 ? 324 THR A C   1 
ATOM 2500 O O   . THR A 1 323 ? 21.517  -10.505 248.034 1.00 30.00 ? 324 THR A O   1 
ATOM 2501 C CB  . THR A 1 323 ? 21.432  -8.273  250.080 1.00 30.00 ? 324 THR A CB  1 
ATOM 2502 O OG1 . THR A 1 323 ? 20.625  -7.118  250.382 1.00 30.00 ? 324 THR A OG1 1 
ATOM 2503 C CG2 . THR A 1 323 ? 22.728  -8.326  250.899 1.00 30.00 ? 324 THR A CG2 1 
ATOM 2504 N N   . MET A 1 324 ? 19.824  -9.187  247.261 1.00 30.00 ? 325 MET A N   1 
ATOM 2505 C CA  . MET A 1 324 ? 18.979  -10.310 246.860 1.00 30.00 ? 325 MET A CA  1 
ATOM 2506 C C   . MET A 1 324 ? 19.727  -11.278 245.981 1.00 30.00 ? 325 MET A C   1 
ATOM 2507 O O   . MET A 1 324 ? 20.478  -10.805 245.145 1.00 30.00 ? 325 MET A O   1 
ATOM 2508 C CB  . MET A 1 324 ? 17.799  -9.859  246.091 1.00 30.00 ? 325 MET A CB  1 
ATOM 2509 C CG  . MET A 1 324 ? 16.966  -8.901  246.859 1.00 30.00 ? 325 MET A CG  1 
ATOM 2510 S SD  . MET A 1 324 ? 16.051  -9.726  248.189 1.00 30.00 ? 325 MET A SD  1 
ATOM 2511 C CE  . MET A 1 324 ? 16.337  -8.582  249.519 1.00 30.00 ? 325 MET A CE  1 
ATOM 2512 N N   . LYS A 1 325 ? 19.651  -12.594 246.131 1.00 30.00 ? 326 LYS A N   1 
ATOM 2513 C CA  . LYS A 1 325 ? 20.281  -13.518 245.210 1.00 30.00 ? 326 LYS A CA  1 
ATOM 2514 C C   . LYS A 1 325 ? 19.241  -13.446 244.123 1.00 30.00 ? 326 LYS A C   1 
ATOM 2515 O O   . LYS A 1 325 ? 18.093  -13.618 244.496 1.00 30.00 ? 326 LYS A O   1 
ATOM 2516 C CB  . LYS A 1 325 ? 20.316  -14.935 245.753 1.00 30.00 ? 326 LYS A CB  1 
ATOM 2517 C CG  . LYS A 1 325 ? 21.025  -15.897 244.816 1.00 30.00 ? 326 LYS A CG  1 
ATOM 2518 C CD  . LYS A 1 325 ? 21.390  -17.182 245.559 1.00 30.00 ? 326 LYS A CD  1 
ATOM 2519 C CE  . LYS A 1 325 ? 20.254  -18.208 245.725 1.00 30.00 ? 326 LYS A CE  1 
ATOM 2520 N NZ  . LYS A 1 325 ? 19.906  -18.802 244.443 1.00 30.00 ? 326 LYS A NZ  1 
ATOM 2521 N N   . ILE A 1 326 ? 19.527  -13.129 242.857 1.00 30.00 ? 327 ILE A N   1 
ATOM 2522 C CA  . ILE A 1 326 ? 18.503  -13.076 241.849 1.00 30.00 ? 327 ILE A CA  1 
ATOM 2523 C C   . ILE A 1 326 ? 18.821  -14.160 240.847 1.00 30.00 ? 327 ILE A C   1 
ATOM 2524 O O   . ILE A 1 326 ? 19.888  -14.201 240.243 1.00 30.00 ? 327 ILE A O   1 
ATOM 2525 C CB  . ILE A 1 326 ? 18.498  -11.689 241.220 1.00 30.00 ? 327 ILE A CB  1 
ATOM 2526 C CG1 . ILE A 1 326 ? 18.066  -10.684 242.245 1.00 30.00 ? 327 ILE A CG1 1 
ATOM 2527 C CG2 . ILE A 1 326 ? 17.455  -11.584 240.134 1.00 30.00 ? 327 ILE A CG2 1 
ATOM 2528 C CD1 . ILE A 1 326 ? 18.031  -9.286  241.688 1.00 30.00 ? 327 ILE A CD1 1 
ATOM 2529 N N   . LYS A 1 327 ? 17.907  -15.085 240.633 1.00 30.00 ? 328 LYS A N   1 
ATOM 2530 C CA  . LYS A 1 327 ? 18.184  -16.229 239.801 1.00 30.00 ? 328 LYS A CA  1 
ATOM 2531 C C   . LYS A 1 327 ? 17.057  -16.163 238.794 1.00 30.00 ? 328 LYS A C   1 
ATOM 2532 O O   . LYS A 1 327 ? 15.885  -16.233 239.151 1.00 30.00 ? 328 LYS A O   1 
ATOM 2533 C CB  . LYS A 1 327 ? 18.167  -17.392 240.770 1.00 30.00 ? 328 LYS A CB  1 
ATOM 2534 C CG  . LYS A 1 327 ? 18.580  -18.775 240.310 1.00 30.00 ? 328 LYS A CG  1 
ATOM 2535 C CD  . LYS A 1 327 ? 18.896  -19.488 241.606 1.00 30.00 ? 328 LYS A CD  1 
ATOM 2536 C CE  . LYS A 1 327 ? 19.850  -20.655 241.508 1.00 30.00 ? 328 LYS A CE  1 
ATOM 2537 N NZ  . LYS A 1 327 ? 19.300  -21.759 240.732 1.00 30.00 ? 328 LYS A NZ  1 
ATOM 2538 N N   . ILE A 1 328 ? 17.395  -15.816 237.557 1.00 30.00 ? 329 ILE A N   1 
ATOM 2539 C CA  . ILE A 1 328 ? 16.422  -15.710 236.471 1.00 30.00 ? 329 ILE A CA  1 
ATOM 2540 C C   . ILE A 1 328 ? 16.442  -17.143 235.916 1.00 30.00 ? 329 ILE A C   1 
ATOM 2541 O O   . ILE A 1 328 ? 17.557  -17.678 235.921 1.00 30.00 ? 329 ILE A O   1 
ATOM 2542 C CB  . ILE A 1 328 ? 16.928  -14.612 235.493 1.00 30.00 ? 329 ILE A CB  1 
ATOM 2543 C CG1 . ILE A 1 328 ? 16.176  -13.363 235.744 1.00 30.00 ? 329 ILE A CG1 1 
ATOM 2544 C CG2 . ILE A 1 328 ? 16.542  -14.869 234.046 1.00 30.00 ? 329 ILE A CG2 1 
ATOM 2545 C CD1 . ILE A 1 328 ? 16.327  -12.701 237.088 1.00 30.00 ? 329 ILE A CD1 1 
ATOM 2546 N N   . ILE A 1 329 ? 15.364  -17.839 235.476 1.00 30.00 ? 330 ILE A N   1 
ATOM 2547 C CA  . ILE A 1 329 ? 15.421  -19.252 235.093 1.00 30.00 ? 330 ILE A CA  1 
ATOM 2548 C C   . ILE A 1 329 ? 14.881  -19.202 233.693 1.00 30.00 ? 330 ILE A C   1 
ATOM 2549 O O   . ILE A 1 329 ? 13.864  -18.541 233.464 1.00 30.00 ? 330 ILE A O   1 
ATOM 2550 C CB  . ILE A 1 329 ? 14.497  -20.174 235.990 1.00 30.00 ? 330 ILE A CB  1 
ATOM 2551 C CG1 . ILE A 1 329 ? 15.128  -20.517 237.334 1.00 30.00 ? 330 ILE A CG1 1 
ATOM 2552 C CG2 . ILE A 1 329 ? 14.247  -21.502 235.259 1.00 30.00 ? 330 ILE A CG2 1 
ATOM 2553 C CD1 . ILE A 1 329 ? 14.850  -19.519 238.441 1.00 30.00 ? 330 ILE A CD1 1 
ATOM 2554 N N   . ALA A 1 330 ? 15.507  -19.870 232.745 1.00 30.00 ? 331 ALA A N   1 
ATOM 2555 C CA  . ALA A 1 330 ? 15.018  -19.755 231.396 1.00 30.00 ? 331 ALA A CA  1 
ATOM 2556 C C   . ALA A 1 330 ? 15.335  -21.092 230.787 1.00 30.00 ? 331 ALA A C   1 
ATOM 2557 O O   . ALA A 1 330 ? 16.365  -21.298 230.106 1.00 30.00 ? 331 ALA A O   1 
ATOM 2558 C CB  . ALA A 1 330 ? 15.726  -18.660 230.619 1.00 30.00 ? 331 ALA A CB  1 
ATOM 2559 N N   . PRO A 1 331 ? 14.430  -22.065 231.121 1.00 30.00 ? 332 PRO A N   1 
ATOM 2560 C CA  . PRO A 1 331 ? 14.564  -23.436 230.677 1.00 30.00 ? 332 PRO A CA  1 
ATOM 2561 C C   . PRO A 1 331 ? 14.508  -23.408 229.159 1.00 30.00 ? 332 PRO A C   1 
ATOM 2562 O O   . PRO A 1 331 ? 13.665  -22.734 228.572 1.00 30.00 ? 332 PRO A O   1 
ATOM 2563 C CB  . PRO A 1 331 ? 13.415  -24.153 231.353 1.00 30.00 ? 332 PRO A CB  1 
ATOM 2564 C CG  . PRO A 1 331 ? 12.343  -23.115 231.430 1.00 30.00 ? 332 PRO A CG  1 
ATOM 2565 C CD  . PRO A 1 331 ? 13.127  -21.879 231.780 1.00 30.00 ? 332 PRO A CD  1 
ATOM 2566 N N   . PRO A 1 332 ? 15.357  -24.146 228.471 1.00 30.00 ? 333 PRO A N   1 
ATOM 2567 C CA  . PRO A 1 332 ? 15.415  -24.104 227.037 1.00 30.00 ? 333 PRO A CA  1 
ATOM 2568 C C   . PRO A 1 332 ? 14.132  -24.600 226.377 1.00 30.00 ? 333 PRO A C   1 
ATOM 2569 O O   . PRO A 1 332 ? 14.017  -24.433 225.167 1.00 30.00 ? 333 PRO A O   1 
ATOM 2570 C CB  . PRO A 1 332 ? 16.679  -24.908 226.737 1.00 30.00 ? 333 PRO A CB  1 
ATOM 2571 C CG  . PRO A 1 332 ? 16.833  -25.903 227.865 1.00 30.00 ? 333 PRO A CG  1 
ATOM 2572 C CD  . PRO A 1 332 ? 16.374  -25.035 229.033 1.00 30.00 ? 333 PRO A CD  1 
ATOM 2573 N N   . GLU A 1 333 ? 13.118  -25.154 227.071 1.00 30.00 ? 334 GLU A N   1 
ATOM 2574 C CA  . GLU A 1 333 ? 11.929  -25.610 226.382 1.00 30.00 ? 334 GLU A CA  1 
ATOM 2575 C C   . GLU A 1 333 ? 10.737  -24.759 226.635 1.00 30.00 ? 334 GLU A C   1 
ATOM 2576 O O   . GLU A 1 333 ? 9.600   -25.186 226.439 1.00 30.00 ? 334 GLU A O   1 
ATOM 2577 C CB  . GLU A 1 333 ? 11.573  -27.036 226.776 1.00 30.00 ? 334 GLU A CB  1 
ATOM 2578 C CG  . GLU A 1 333 ? 12.431  -28.163 226.147 1.00 30.00 ? 334 GLU A CG  1 
ATOM 2579 C CD  . GLU A 1 333 ? 13.862  -28.308 226.672 1.00 30.00 ? 334 GLU A CD  1 
ATOM 2580 O OE1 . GLU A 1 333 ? 14.208  -27.747 227.729 1.00 30.00 ? 334 GLU A OE1 1 
ATOM 2581 O OE2 . GLU A 1 333 ? 14.626  -29.015 226.002 1.00 30.00 ? 334 GLU A OE2 1 
ATOM 2582 N N   . ARG A 1 334 ? 11.041  -23.516 226.972 1.00 30.00 ? 335 ARG A N   1 
ATOM 2583 C CA  . ARG A 1 334 ? 10.083  -22.499 227.396 1.00 30.00 ? 335 ARG A CA  1 
ATOM 2584 C C   . ARG A 1 334 ? 9.042   -21.902 226.449 1.00 30.00 ? 335 ARG A C   1 
ATOM 2585 O O   . ARG A 1 334 ? 8.118   -21.220 226.919 1.00 30.00 ? 335 ARG A O   1 
ATOM 2586 C CB  . ARG A 1 334 ? 10.905  -21.386 228.038 1.00 30.00 ? 335 ARG A CB  1 
ATOM 2587 C CG  . ARG A 1 334 ? 11.108  -20.116 227.277 1.00 30.00 ? 335 ARG A CG  1 
ATOM 2588 C CD  . ARG A 1 334 ? 12.294  -19.391 227.842 1.00 30.00 ? 335 ARG A CD  1 
ATOM 2589 N NE  . ARG A 1 334 ? 13.475  -20.054 227.342 1.00 30.00 ? 335 ARG A NE  1 
ATOM 2590 C CZ  . ARG A 1 334 ? 14.480  -19.348 226.894 1.00 30.00 ? 335 ARG A CZ  1 
ATOM 2591 N NH1 . ARG A 1 334 ? 14.464  -18.025 226.872 1.00 30.00 ? 335 ARG A NH1 1 
ATOM 2592 N NH2 . ARG A 1 334 ? 15.531  -19.996 226.452 1.00 30.00 ? 335 ARG A NH2 1 
ATOM 2593 N N   . LYS A 1 335 ? 7.836   -28.313 223.827 1.00 30.00 ? 336 LYS A N   1 
ATOM 2594 C CA  . LYS A 1 335 ? 7.091   -27.610 222.773 1.00 30.00 ? 336 LYS A CA  1 
ATOM 2595 C C   . LYS A 1 335 ? 5.616   -27.943 223.099 1.00 30.00 ? 336 LYS A C   1 
ATOM 2596 O O   . LYS A 1 335 ? 4.720   -27.141 222.900 1.00 30.00 ? 336 LYS A O   1 
ATOM 2597 C CB  . LYS A 1 335 ? 7.557   -28.183 221.393 1.00 30.00 ? 336 LYS A CB  1 
ATOM 2598 C CG  . LYS A 1 335 ? 7.409   -27.430 220.049 1.00 30.00 ? 336 LYS A CG  1 
ATOM 2599 C CD  . LYS A 1 335 ? 6.017   -27.460 219.374 1.00 30.00 ? 336 LYS A CD  1 
ATOM 2600 C CE  . LYS A 1 335 ? 5.139   -26.167 219.439 1.00 30.00 ? 336 LYS A CE  1 
ATOM 2601 N NZ  . LYS A 1 335 ? 3.783   -26.407 218.977 1.00 30.00 ? 336 LYS A NZ  1 
ATOM 2602 N N   . TYR A 1 336 ? 5.298   -29.116 223.678 1.00 30.00 ? 337 TYR A N   1 
ATOM 2603 C CA  . TYR A 1 336 ? 3.939   -29.506 224.031 1.00 30.00 ? 337 TYR A CA  1 
ATOM 2604 C C   . TYR A 1 336 ? 3.477   -29.470 225.506 1.00 30.00 ? 337 TYR A C   1 
ATOM 2605 O O   . TYR A 1 336 ? 2.370   -29.925 225.829 1.00 30.00 ? 337 TYR A O   1 
ATOM 2606 C CB  . TYR A 1 336 ? 3.791   -30.891 223.386 1.00 30.00 ? 337 TYR A CB  1 
ATOM 2607 C CG  . TYR A 1 336 ? 3.593   -30.733 221.905 1.00 30.00 ? 337 TYR A CG  1 
ATOM 2608 C CD1 . TYR A 1 336 ? 2.943   -29.610 221.463 1.00 30.00 ? 337 TYR A CD1 1 
ATOM 2609 C CD2 . TYR A 1 336 ? 4.126   -31.604 221.009 1.00 30.00 ? 337 TYR A CD2 1 
ATOM 2610 C CE1 . TYR A 1 336 ? 2.829   -29.315 220.130 1.00 30.00 ? 337 TYR A CE1 1 
ATOM 2611 C CE2 . TYR A 1 336 ? 4.019   -31.325 219.661 1.00 30.00 ? 337 TYR A CE2 1 
ATOM 2612 C CZ  . TYR A 1 336 ? 3.382   -30.180 219.245 1.00 30.00 ? 337 TYR A CZ  1 
ATOM 2613 O OH  . TYR A 1 336 ? 3.326   -29.801 217.930 1.00 30.00 ? 337 TYR A OH  1 
ATOM 2614 N N   . SER A 1 337 ? 4.262   -28.911 226.444 1.00 30.00 ? 338 SER A N   1 
ATOM 2615 C CA  . SER A 1 337 ? 3.938   -28.796 227.869 1.00 30.00 ? 338 SER A CA  1 
ATOM 2616 C C   . SER A 1 337 ? 2.531   -28.289 228.143 1.00 30.00 ? 338 SER A C   1 
ATOM 2617 O O   . SER A 1 337 ? 1.772   -29.018 228.772 1.00 30.00 ? 338 SER A O   1 
ATOM 2618 C CB  . SER A 1 337 ? 4.904   -27.852 228.598 1.00 30.00 ? 338 SER A CB  1 
ATOM 2619 O OG  . SER A 1 337 ? 6.186   -28.451 228.619 1.00 30.00 ? 338 SER A OG  1 
ATOM 2620 N N   . VAL A 1 338 ? 2.088   -27.156 227.651 1.00 30.00 ? 339 VAL A N   1 
ATOM 2621 C CA  . VAL A 1 338 ? 0.773   -26.704 227.984 1.00 30.00 ? 339 VAL A CA  1 
ATOM 2622 C C   . VAL A 1 338 ? -0.289  -27.753 227.610 1.00 30.00 ? 339 VAL A C   1 
ATOM 2623 O O   . VAL A 1 338 ? -1.105  -28.126 228.455 1.00 30.00 ? 339 VAL A O   1 
ATOM 2624 C CB  . VAL A 1 338 ? 0.609   -25.375 227.272 1.00 30.00 ? 339 VAL A CB  1 
ATOM 2625 C CG1 . VAL A 1 338 ? -0.816  -24.841 227.468 1.00 30.00 ? 339 VAL A CG1 1 
ATOM 2626 C CG2 . VAL A 1 338 ? 1.648   -24.392 227.830 1.00 30.00 ? 339 VAL A CG2 1 
ATOM 2627 N N   . TRP A 1 339 ? -0.227  -28.431 226.468 1.00 30.00 ? 340 TRP A N   1 
ATOM 2628 C CA  . TRP A 1 339 ? -1.246  -29.386 226.141 1.00 30.00 ? 340 TRP A CA  1 
ATOM 2629 C C   . TRP A 1 339 ? -1.117  -30.621 227.034 1.00 30.00 ? 340 TRP A C   1 
ATOM 2630 O O   . TRP A 1 339 ? -2.159  -31.074 227.518 1.00 30.00 ? 340 TRP A O   1 
ATOM 2631 C CB  . TRP A 1 339 ? -1.153  -29.760 224.657 1.00 30.00 ? 340 TRP A CB  1 
ATOM 2632 C CG  . TRP A 1 339 ? -2.366  -30.545 224.220 1.00 30.00 ? 340 TRP A CG  1 
ATOM 2633 C CD1 . TRP A 1 339 ? -3.508  -29.954 223.754 1.00 30.00 ? 340 TRP A CD1 1 
ATOM 2634 C CD2 . TRP A 1 339 ? -2.508  -31.891 224.391 1.00 30.00 ? 340 TRP A CD2 1 
ATOM 2635 N NE1 . TRP A 1 339 ? -4.388  -30.933 223.665 1.00 30.00 ? 340 TRP A NE1 1 
ATOM 2636 C CE2 . TRP A 1 339 ? -3.820  -32.095 224.040 1.00 30.00 ? 340 TRP A CE2 1 
ATOM 2637 C CE3 . TRP A 1 339 ? -1.671  -32.910 224.817 1.00 30.00 ? 340 TRP A CE3 1 
ATOM 2638 C CZ2 . TRP A 1 339 ? -4.284  -33.380 224.145 1.00 30.00 ? 340 TRP A CZ2 1 
ATOM 2639 C CZ3 . TRP A 1 339 ? -2.142  -34.187 224.909 1.00 30.00 ? 340 TRP A CZ3 1 
ATOM 2640 C CH2 . TRP A 1 339 ? -3.447  -34.406 224.577 1.00 30.00 ? 340 TRP A CH2 1 
ATOM 2641 N N   . ILE A 1 340 ? 0.019   -31.221 227.388 1.00 30.00 ? 341 ILE A N   1 
ATOM 2642 C CA  . ILE A 1 340 ? -0.011  -32.473 228.151 1.00 30.00 ? 341 ILE A CA  1 
ATOM 2643 C C   . ILE A 1 340 ? -0.248  -32.228 229.622 1.00 30.00 ? 341 ILE A C   1 
ATOM 2644 O O   . ILE A 1 340 ? -0.649  -33.144 230.348 1.00 30.00 ? 341 ILE A O   1 
ATOM 2645 C CB  . ILE A 1 340 ? 1.291   -33.257 227.973 1.00 30.00 ? 341 ILE A CB  1 
ATOM 2646 C CG1 . ILE A 1 340 ? 1.594   -33.472 226.469 1.00 30.00 ? 341 ILE A CG1 1 
ATOM 2647 C CG2 . ILE A 1 340 ? 1.144   -34.609 228.673 1.00 30.00 ? 341 ILE A CG2 1 
ATOM 2648 C CD1 . ILE A 1 340 ? 3.017   -33.100 226.053 1.00 30.00 ? 341 ILE A CD1 1 
ATOM 2649 N N   . GLY A 1 341 ? -0.069  -31.002 230.091 1.00 30.00 ? 342 GLY A N   1 
ATOM 2650 C CA  . GLY A 1 341 ? -0.457  -30.675 231.453 1.00 30.00 ? 342 GLY A CA  1 
ATOM 2651 C C   . GLY A 1 341 ? -1.968  -30.623 231.648 1.00 30.00 ? 342 GLY A C   1 
ATOM 2652 O O   . GLY A 1 341 ? -2.480  -30.931 232.725 1.00 30.00 ? 342 GLY A O   1 
ATOM 2653 N N   . GLY A 1 342 ? -2.676  -30.161 230.633 1.00 30.00 ? 343 GLY A N   1 
ATOM 2654 C CA  . GLY A 1 342 ? -4.121  -30.130 230.561 1.00 30.00 ? 343 GLY A CA  1 
ATOM 2655 C C   . GLY A 1 342 ? -4.677  -31.521 230.319 1.00 30.00 ? 343 GLY A C   1 
ATOM 2656 O O   . GLY A 1 342 ? -5.585  -31.921 231.028 1.00 30.00 ? 343 GLY A O   1 
ATOM 2657 N N   . SER A 1 343 ? -4.217  -32.299 229.333 1.00 30.00 ? 344 SER A N   1 
ATOM 2658 C CA  . SER A 1 343 ? -4.544  -33.702 229.240 1.00 30.00 ? 344 SER A CA  1 
ATOM 2659 C C   . SER A 1 343 ? -4.437  -34.526 230.519 1.00 30.00 ? 344 SER A C   1 
ATOM 2660 O O   . SER A 1 343 ? -5.204  -35.477 230.610 1.00 30.00 ? 344 SER A O   1 
ATOM 2661 C CB  . SER A 1 343 ? -3.664  -34.345 228.211 1.00 30.00 ? 344 SER A CB  1 
ATOM 2662 O OG  . SER A 1 343 ? -3.801  -35.767 228.216 1.00 30.00 ? 344 SER A OG  1 
ATOM 2663 N N   . ILE A 1 344 ? -3.500  -34.293 231.444 1.00 30.00 ? 345 ILE A N   1 
ATOM 2664 C CA  . ILE A 1 344 ? -3.296  -34.985 232.733 1.00 30.00 ? 345 ILE A CA  1 
ATOM 2665 C C   . ILE A 1 344 ? -4.405  -34.604 233.694 1.00 30.00 ? 345 ILE A C   1 
ATOM 2666 O O   . ILE A 1 344 ? -5.113  -35.411 234.318 1.00 30.00 ? 345 ILE A O   1 
ATOM 2667 C CB  . ILE A 1 344 ? -1.917  -34.595 233.417 1.00 30.00 ? 345 ILE A CB  1 
ATOM 2668 C CG1 . ILE A 1 344 ? -0.822  -35.292 232.675 1.00 30.00 ? 345 ILE A CG1 1 
ATOM 2669 C CG2 . ILE A 1 344 ? -1.797  -35.012 234.881 1.00 30.00 ? 345 ILE A CG2 1 
ATOM 2670 C CD1 . ILE A 1 344 ? 0.565   -34.859 233.206 1.00 30.00 ? 345 ILE A CD1 1 
ATOM 2671 N N   . LEU A 1 345 ? -4.462  -33.269 233.807 1.00 30.00 ? 346 LEU A N   1 
ATOM 2672 C CA  . LEU A 1 345 ? -5.393  -32.579 234.682 1.00 30.00 ? 346 LEU A CA  1 
ATOM 2673 C C   . LEU A 1 345 ? -6.796  -32.977 234.301 1.00 30.00 ? 346 LEU A C   1 
ATOM 2674 O O   . LEU A 1 345 ? -7.384  -33.683 235.100 1.00 30.00 ? 346 LEU A O   1 
ATOM 2675 C CB  . LEU A 1 345 ? -5.096  -31.073 234.533 1.00 30.00 ? 346 LEU A CB  1 
ATOM 2676 C CG  . LEU A 1 345 ? -5.533  -29.998 235.546 1.00 30.00 ? 346 LEU A CG  1 
ATOM 2677 C CD1 . LEU A 1 345 ? -6.678  -29.222 234.886 1.00 30.00 ? 346 LEU A CD1 1 
ATOM 2678 C CD2 . LEU A 1 345 ? -5.765  -30.628 236.956 1.00 30.00 ? 346 LEU A CD2 1 
ATOM 2679 N N   . ALA A 1 346 ? -7.317  -32.731 233.104 1.00 30.00 ? 347 ALA A N   1 
ATOM 2680 C CA  . ALA A 1 346 ? -8.670  -33.095 232.766 1.00 30.00 ? 347 ALA A CA  1 
ATOM 2681 C C   . ALA A 1 346 ? -8.980  -34.586 232.700 1.00 30.00 ? 347 ALA A C   1 
ATOM 2682 O O   . ALA A 1 346 ? -10.082 -34.935 232.241 1.00 30.00 ? 347 ALA A O   1 
ATOM 2683 C CB  . ALA A 1 346 ? -9.036  -32.493 231.431 1.00 30.00 ? 347 ALA A CB  1 
ATOM 2684 N N   . SER A 1 347 ? -8.018  -35.471 233.041 1.00 30.00 ? 348 SER A N   1 
ATOM 2685 C CA  . SER A 1 347 ? -8.280  -36.890 233.097 1.00 30.00 ? 348 SER A CA  1 
ATOM 2686 C C   . SER A 1 347 ? -8.411  -37.340 234.526 1.00 30.00 ? 348 SER A C   1 
ATOM 2687 O O   . SER A 1 347 ? -8.967  -38.420 234.742 1.00 30.00 ? 348 SER A O   1 
ATOM 2688 C CB  . SER A 1 347 ? -7.165  -37.722 232.432 1.00 30.00 ? 348 SER A CB  1 
ATOM 2689 O OG  . SER A 1 347 ? -5.847  -37.242 232.628 1.00 30.00 ? 348 SER A OG  1 
ATOM 2690 N N   . LEU A 1 348 ? -7.913  -36.597 235.518 1.00 30.00 ? 349 LEU A N   1 
ATOM 2691 C CA  . LEU A 1 348 ? -8.025  -37.014 236.920 1.00 30.00 ? 349 LEU A CA  1 
ATOM 2692 C C   . LEU A 1 348 ? -9.503  -36.954 237.377 1.00 30.00 ? 349 LEU A C   1 
ATOM 2693 O O   . LEU A 1 348 ? -10.246 -36.050 236.953 1.00 30.00 ? 349 LEU A O   1 
ATOM 2694 C CB  . LEU A 1 348 ? -7.148  -36.097 237.776 1.00 30.00 ? 349 LEU A CB  1 
ATOM 2695 C CG  . LEU A 1 348 ? -5.663  -36.044 237.429 1.00 30.00 ? 349 LEU A CG  1 
ATOM 2696 C CD1 . LEU A 1 348 ? -5.019  -34.821 238.040 1.00 30.00 ? 349 LEU A CD1 1 
ATOM 2697 C CD2 . LEU A 1 348 ? -4.972  -37.281 237.960 1.00 30.00 ? 349 LEU A CD2 1 
ATOM 2698 N N   . SER A 1 349 ? -9.996  -37.891 238.215 1.00 30.00 ? 350 SER A N   1 
ATOM 2699 C CA  . SER A 1 349 ? -11.375 -37.837 238.646 1.00 30.00 ? 350 SER A CA  1 
ATOM 2700 C C   . SER A 1 349 ? -11.547 -36.660 239.534 1.00 30.00 ? 350 SER A C   1 
ATOM 2701 O O   . SER A 1 349 ? -12.675 -36.192 239.698 1.00 30.00 ? 350 SER A O   1 
ATOM 2702 C CB  . SER A 1 349 ? -11.792 -39.029 239.412 1.00 30.00 ? 350 SER A CB  1 
ATOM 2703 O OG  . SER A 1 349 ? -12.659 -39.880 238.636 1.00 30.00 ? 350 SER A OG  1 
ATOM 2704 N N   . THR A 1 350 ? -10.419 -36.192 240.091 1.00 30.00 ? 351 THR A N   1 
ATOM 2705 C CA  . THR A 1 350 ? -10.260 -34.919 240.813 1.00 30.00 ? 351 THR A CA  1 
ATOM 2706 C C   . THR A 1 350 ? -10.955 -33.727 240.092 1.00 30.00 ? 351 THR A C   1 
ATOM 2707 O O   . THR A 1 350 ? -11.770 -32.975 240.612 1.00 30.00 ? 351 THR A O   1 
ATOM 2708 C CB  . THR A 1 350 ? -8.686  -34.740 240.927 1.00 30.00 ? 351 THR A CB  1 
ATOM 2709 O OG1 . THR A 1 350 ? -8.216  -35.939 241.537 1.00 30.00 ? 351 THR A OG1 1 
ATOM 2710 C CG2 . THR A 1 350 ? -8.224  -33.480 241.637 1.00 30.00 ? 351 THR A CG2 1 
ATOM 2711 N N   . PHE A 1 351 ? -10.696 -33.638 238.797 1.00 30.00 ? 352 PHE A N   1 
ATOM 2712 C CA  . PHE A 1 351 ? -11.036 -32.497 238.017 1.00 30.00 ? 352 PHE A CA  1 
ATOM 2713 C C   . PHE A 1 351 ? -12.512 -32.322 237.786 1.00 30.00 ? 352 PHE A C   1 
ATOM 2714 O O   . PHE A 1 351 ? -12.986 -31.196 237.682 1.00 30.00 ? 352 PHE A O   1 
ATOM 2715 C CB  . PHE A 1 351 ? -10.285 -32.626 236.706 1.00 30.00 ? 352 PHE A CB  1 
ATOM 2716 C CG  . PHE A 1 351 ? -10.295 -31.268 236.017 1.00 30.00 ? 352 PHE A CG  1 
ATOM 2717 C CD1 . PHE A 1 351 ? -9.638  -30.202 236.604 1.00 30.00 ? 352 PHE A CD1 1 
ATOM 2718 C CD2 . PHE A 1 351 ? -11.006 -31.076 234.872 1.00 30.00 ? 352 PHE A CD2 1 
ATOM 2719 C CE1 . PHE A 1 351 ? -9.698  -28.953 236.062 1.00 30.00 ? 352 PHE A CE1 1 
ATOM 2720 C CE2 . PHE A 1 351 ? -11.043 -29.818 234.359 1.00 30.00 ? 352 PHE A CE2 1 
ATOM 2721 C CZ  . PHE A 1 351 ? -10.410 -28.765 234.933 1.00 30.00 ? 352 PHE A CZ  1 
ATOM 2722 N N   . GLN A 1 352 ? -13.306 -33.391 237.720 1.00 30.00 ? 353 GLN A N   1 
ATOM 2723 C CA  . GLN A 1 352 ? -14.722 -33.229 237.438 1.00 30.00 ? 353 GLN A CA  1 
ATOM 2724 C C   . GLN A 1 352 ? -15.360 -32.374 238.511 1.00 30.00 ? 353 GLN A C   1 
ATOM 2725 O O   . GLN A 1 352 ? -16.367 -31.745 238.271 1.00 30.00 ? 353 GLN A O   1 
ATOM 2726 C CB  . GLN A 1 352 ? -15.427 -34.603 237.327 1.00 30.00 ? 353 GLN A CB  1 
ATOM 2727 C CG  . GLN A 1 352 ? -16.819 -34.587 236.538 1.00 30.00 ? 353 GLN A CG  1 
ATOM 2728 C CD  . GLN A 1 352 ? -17.046 -34.001 235.103 1.00 30.00 ? 353 GLN A CD  1 
ATOM 2729 O OE1 . GLN A 1 352 ? -17.987 -33.263 234.816 1.00 30.00 ? 353 GLN A OE1 1 
ATOM 2730 N NE2 . GLN A 1 352 ? -16.240 -34.277 234.097 1.00 30.00 ? 353 GLN A NE2 1 
ATOM 2731 N N   . GLN A 1 353 ? -14.760 -32.229 239.677 1.00 30.00 ? 354 GLN A N   1 
ATOM 2732 C CA  . GLN A 1 353 ? -15.266 -31.312 240.654 1.00 30.00 ? 354 GLN A CA  1 
ATOM 2733 C C   . GLN A 1 353 ? -14.200 -30.258 240.459 1.00 30.00 ? 354 GLN A C   1 
ATOM 2734 O O   . GLN A 1 353 ? -13.132 -30.330 241.071 1.00 30.00 ? 354 GLN A O   1 
ATOM 2735 C CB  . GLN A 1 353 ? -15.168 -31.820 242.101 1.00 30.00 ? 354 GLN A CB  1 
ATOM 2736 C CG  . GLN A 1 353 ? -14.886 -33.304 242.352 1.00 30.00 ? 354 GLN A CG  1 
ATOM 2737 C CD  . GLN A 1 353 ? -15.894 -34.230 241.670 1.00 30.00 ? 354 GLN A CD  1 
ATOM 2738 O OE1 . GLN A 1 353 ? -17.123 -34.067 241.818 1.00 30.00 ? 354 GLN A OE1 1 
ATOM 2739 N NE2 . GLN A 1 353 ? -15.362 -35.196 240.893 1.00 30.00 ? 354 GLN A NE2 1 
ATOM 2740 N N   . MET A 1 354 ? -14.398 -29.369 239.509 1.00 30.00 ? 355 MET A N   1 
ATOM 2741 C CA  . MET A 1 354 ? -13.498 -28.256 239.274 1.00 30.00 ? 355 MET A CA  1 
ATOM 2742 C C   . MET A 1 354 ? -14.036 -27.485 238.094 1.00 30.00 ? 355 MET A C   1 
ATOM 2743 O O   . MET A 1 354 ? -13.691 -26.321 237.967 1.00 30.00 ? 355 MET A O   1 
ATOM 2744 C CB  . MET A 1 354 ? -12.120 -28.723 238.950 1.00 30.00 ? 355 MET A CB  1 
ATOM 2745 C CG  . MET A 1 354 ? -11.046 -27.777 239.324 1.00 30.00 ? 355 MET A CG  1 
ATOM 2746 S SD  . MET A 1 354 ? -9.499  -28.732 239.280 1.00 30.00 ? 355 MET A SD  1 
ATOM 2747 C CE  . MET A 1 354 ? -9.761  -29.524 240.855 1.00 30.00 ? 355 MET A CE  1 
ATOM 2748 N N   . TRP A 1 355 ? -14.802 -28.136 237.198 1.00 30.00 ? 356 TRP A N   1 
ATOM 2749 C CA  . TRP A 1 355 ? -15.454 -27.508 236.058 1.00 30.00 ? 356 TRP A CA  1 
ATOM 2750 C C   . TRP A 1 355 ? -16.549 -26.532 236.451 1.00 30.00 ? 356 TRP A C   1 
ATOM 2751 O O   . TRP A 1 355 ? -17.069 -26.561 237.567 1.00 30.00 ? 356 TRP A O   1 
ATOM 2752 C CB  . TRP A 1 355 ? -16.235 -28.420 235.175 1.00 30.00 ? 356 TRP A CB  1 
ATOM 2753 C CG  . TRP A 1 355 ? -15.578 -29.594 234.564 1.00 30.00 ? 356 TRP A CG  1 
ATOM 2754 C CD1 . TRP A 1 355 ? -15.934 -30.764 235.106 1.00 30.00 ? 356 TRP A CD1 1 
ATOM 2755 C CD2 . TRP A 1 355 ? -14.613 -29.628 233.561 1.00 30.00 ? 356 TRP A CD2 1 
ATOM 2756 N NE1 . TRP A 1 355 ? -15.163 -31.590 234.454 1.00 30.00 ? 356 TRP A NE1 1 
ATOM 2757 C CE2 . TRP A 1 355 ? -14.356 -30.991 233.530 1.00 30.00 ? 356 TRP A CE2 1 
ATOM 2758 C CE3 . TRP A 1 355 ? -13.902 -28.795 232.687 1.00 30.00 ? 356 TRP A CE3 1 
ATOM 2759 C CZ2 . TRP A 1 355 ? -13.385 -31.519 232.654 1.00 30.00 ? 356 TRP A CZ2 1 
ATOM 2760 C CZ3 . TRP A 1 355 ? -12.936 -29.306 231.816 1.00 30.00 ? 356 TRP A CZ3 1 
ATOM 2761 C CH2 . TRP A 1 355 ? -12.673 -30.672 231.799 1.00 30.00 ? 356 TRP A CH2 1 
ATOM 2762 N N   . ILE A 1 356 ? -16.983 -25.752 235.468 1.00 30.00 ? 357 ILE A N   1 
ATOM 2763 C CA  . ILE A 1 356 ? -18.123 -24.870 235.535 1.00 30.00 ? 357 ILE A CA  1 
ATOM 2764 C C   . ILE A 1 356 ? -19.076 -25.675 234.659 1.00 30.00 ? 357 ILE A C   1 
ATOM 2765 O O   . ILE A 1 356 ? -18.718 -26.067 233.531 1.00 30.00 ? 357 ILE A O   1 
ATOM 2766 C CB  . ILE A 1 356 ? -17.784 -23.554 234.901 1.00 30.00 ? 357 ILE A CB  1 
ATOM 2767 C CG1 . ILE A 1 356 ? -16.557 -22.948 235.546 1.00 30.00 ? 357 ILE A CG1 1 
ATOM 2768 C CG2 . ILE A 1 356 ? -18.990 -22.658 235.031 1.00 30.00 ? 357 ILE A CG2 1 
ATOM 2769 C CD1 . ILE A 1 356 ? -15.858 -21.854 234.724 1.00 30.00 ? 357 ILE A CD1 1 
ATOM 2770 N N   . SER A 1 357 ? -20.241 -26.014 235.208 1.00 30.00 ? 358 SER A N   1 
ATOM 2771 C CA  . SER A 1 357 ? -21.193 -26.838 234.512 1.00 30.00 ? 358 SER A CA  1 
ATOM 2772 C C   . SER A 1 357 ? -22.202 -25.968 233.815 1.00 30.00 ? 358 SER A C   1 
ATOM 2773 O O   . SER A 1 357 ? -22.347 -24.784 234.176 1.00 30.00 ? 358 SER A O   1 
ATOM 2774 C CB  . SER A 1 357 ? -21.927 -27.733 235.493 1.00 30.00 ? 358 SER A CB  1 
ATOM 2775 O OG  . SER A 1 357 ? -22.529 -27.085 236.630 1.00 30.00 ? 358 SER A OG  1 
ATOM 2776 N N   . LYS A 1 358 ? -22.966 -26.584 232.893 1.00 30.00 ? 359 LYS A N   1 
ATOM 2777 C CA  . LYS A 1 358 ? -24.048 -25.928 232.150 1.00 30.00 ? 359 LYS A CA  1 
ATOM 2778 C C   . LYS A 1 358 ? -24.959 -25.331 233.172 1.00 30.00 ? 359 LYS A C   1 
ATOM 2779 O O   . LYS A 1 358 ? -25.148 -24.120 233.144 1.00 30.00 ? 359 LYS A O   1 
ATOM 2780 C CB  . LYS A 1 358 ? -24.839 -26.907 231.316 1.00 30.00 ? 359 LYS A CB  1 
ATOM 2781 C CG  . LYS A 1 358 ? -25.144 -26.367 229.909 1.00 30.00 ? 359 LYS A CG  1 
ATOM 2782 C CD  . LYS A 1 358 ? -25.836 -24.993 229.712 1.00 30.00 ? 359 LYS A CD  1 
ATOM 2783 C CE  . LYS A 1 358 ? -25.864 -24.679 228.200 1.00 30.00 ? 359 LYS A CE  1 
ATOM 2784 N NZ  . LYS A 1 358 ? -26.400 -23.357 227.930 1.00 30.00 ? 359 LYS A NZ  1 
ATOM 2785 N N   . GLN A 1 359 ? -25.404 -26.145 234.149 1.00 30.00 ? 360 GLN A N   1 
ATOM 2786 C CA  . GLN A 1 359 ? -26.203 -25.669 235.284 1.00 30.00 ? 360 GLN A CA  1 
ATOM 2787 C C   . GLN A 1 359 ? -25.681 -24.382 235.933 1.00 30.00 ? 360 GLN A C   1 
ATOM 2788 O O   . GLN A 1 359 ? -26.417 -23.382 236.093 1.00 30.00 ? 360 GLN A O   1 
ATOM 2789 C CB  . GLN A 1 359 ? -26.275 -26.695 236.421 1.00 30.00 ? 360 GLN A CB  1 
ATOM 2790 C CG  . GLN A 1 359 ? -25.807 -28.151 236.193 1.00 30.00 ? 360 GLN A CG  1 
ATOM 2791 C CD  . GLN A 1 359 ? -25.624 -28.972 237.489 1.00 30.00 ? 360 GLN A CD  1 
ATOM 2792 O OE1 . GLN A 1 359 ? -26.358 -29.934 237.723 1.00 30.00 ? 360 GLN A OE1 1 
ATOM 2793 N NE2 . GLN A 1 359 ? -24.658 -28.705 238.386 1.00 30.00 ? 360 GLN A NE2 1 
ATOM 2794 N N   . GLU A 1 360 ? -24.374 -24.360 236.256 1.00 30.00 ? 361 GLU A N   1 
ATOM 2795 C CA  . GLU A 1 360 ? -23.800 -23.204 236.944 1.00 30.00 ? 361 GLU A CA  1 
ATOM 2796 C C   . GLU A 1 360 ? -23.784 -21.982 236.085 1.00 30.00 ? 361 GLU A C   1 
ATOM 2797 O O   . GLU A 1 360 ? -24.043 -20.882 236.558 1.00 30.00 ? 361 GLU A O   1 
ATOM 2798 C CB  . GLU A 1 360 ? -22.390 -23.501 237.396 1.00 30.00 ? 361 GLU A CB  1 
ATOM 2799 C CG  . GLU A 1 360 ? -22.479 -24.629 238.433 1.00 30.00 ? 361 GLU A CG  1 
ATOM 2800 C CD  . GLU A 1 360 ? -21.182 -25.136 239.076 1.00 30.00 ? 361 GLU A CD  1 
ATOM 2801 O OE1 . GLU A 1 360 ? -20.376 -24.279 239.506 1.00 30.00 ? 361 GLU A OE1 1 
ATOM 2802 O OE2 . GLU A 1 360 ? -21.033 -26.386 239.167 1.00 30.00 ? 361 GLU A OE2 1 
ATOM 2803 N N   . TYR A 1 361 ? -23.527 -22.174 234.807 1.00 30.00 ? 362 TYR A N   1 
ATOM 2804 C CA  . TYR A 1 361 ? -23.492 -21.065 233.885 1.00 30.00 ? 362 TYR A CA  1 
ATOM 2805 C C   . TYR A 1 361 ? -24.864 -20.383 233.844 1.00 30.00 ? 362 TYR A C   1 
ATOM 2806 O O   . TYR A 1 361 ? -24.953 -19.161 233.744 1.00 30.00 ? 362 TYR A O   1 
ATOM 2807 C CB  . TYR A 1 361 ? -23.088 -21.586 232.475 1.00 30.00 ? 362 TYR A CB  1 
ATOM 2808 C CG  . TYR A 1 361 ? -23.062 -20.454 231.442 1.00 30.00 ? 362 TYR A CG  1 
ATOM 2809 C CD1 . TYR A 1 361 ? -22.145 -19.419 231.535 1.00 30.00 ? 362 TYR A CD1 1 
ATOM 2810 C CD2 . TYR A 1 361 ? -24.017 -20.426 230.446 1.00 30.00 ? 362 TYR A CD2 1 
ATOM 2811 C CE1 . TYR A 1 361 ? -22.182 -18.363 230.655 1.00 30.00 ? 362 TYR A CE1 1 
ATOM 2812 C CE2 . TYR A 1 361 ? -24.060 -19.362 229.573 1.00 30.00 ? 362 TYR A CE2 1 
ATOM 2813 C CZ  . TYR A 1 361 ? -23.147 -18.351 229.694 1.00 30.00 ? 362 TYR A CZ  1 
ATOM 2814 O OH  . TYR A 1 361 ? -23.278 -17.273 228.871 1.00 30.00 ? 362 TYR A OH  1 
ATOM 2815 N N   . ASP A 1 362 ? -25.946 -21.163 233.879 1.00 30.00 ? 363 ASP A N   1 
ATOM 2816 C CA  . ASP A 1 362 ? -27.312 -20.638 233.886 1.00 30.00 ? 363 ASP A CA  1 
ATOM 2817 C C   . ASP A 1 362 ? -27.587 -19.842 235.129 1.00 30.00 ? 363 ASP A C   1 
ATOM 2818 O O   . ASP A 1 362 ? -28.176 -18.771 235.098 1.00 30.00 ? 363 ASP A O   1 
ATOM 2819 C CB  . ASP A 1 362 ? -28.366 -21.701 233.914 1.00 30.00 ? 363 ASP A CB  1 
ATOM 2820 C CG  . ASP A 1 362 ? -28.581 -22.255 232.564 1.00 30.00 ? 363 ASP A CG  1 
ATOM 2821 O OD1 . ASP A 1 362 ? -28.834 -21.420 231.703 1.00 30.00 ? 363 ASP A OD1 1 
ATOM 2822 O OD2 . ASP A 1 362 ? -28.513 -23.477 232.388 1.00 30.00 ? 363 ASP A OD2 1 
ATOM 2823 N N   . GLU A 1 363 ? -27.194 -20.546 236.211 1.00 30.00 ? 364 GLU A N   1 
ATOM 2824 C CA  . GLU A 1 363 ? -27.315 -20.050 237.558 1.00 30.00 ? 364 GLU A CA  1 
ATOM 2825 C C   . GLU A 1 363 ? -26.649 -18.680 237.537 1.00 30.00 ? 364 GLU A C   1 
ATOM 2826 O O   . GLU A 1 363 ? -27.386 -17.702 237.732 1.00 30.00 ? 364 GLU A O   1 
ATOM 2827 C CB  . GLU A 1 363 ? -26.619 -21.070 238.530 1.00 30.00 ? 364 GLU A CB  1 
ATOM 2828 C CG  . GLU A 1 363 ? -26.231 -20.738 240.000 1.00 30.00 ? 364 GLU A CG  1 
ATOM 2829 C CD  . GLU A 1 363 ? -25.081 -21.615 240.581 1.00 30.00 ? 364 GLU A CD  1 
ATOM 2830 O OE1 . GLU A 1 363 ? -25.208 -22.864 240.650 1.00 30.00 ? 364 GLU A OE1 1 
ATOM 2831 O OE2 . GLU A 1 363 ? -24.048 -21.038 240.949 1.00 30.00 ? 364 GLU A OE2 1 
ATOM 2832 N N   . SER A 1 364 ? -25.362 -18.577 237.150 1.00 30.00 ? 365 SER A N   1 
ATOM 2833 C CA  . SER A 1 364 ? -24.653 -17.330 237.370 1.00 30.00 ? 365 SER A CA  1 
ATOM 2834 C C   . SER A 1 364 ? -24.596 -16.413 236.182 1.00 30.00 ? 365 SER A C   1 
ATOM 2835 O O   . SER A 1 364 ? -24.834 -15.201 236.265 1.00 30.00 ? 365 SER A O   1 
ATOM 2836 C CB  . SER A 1 364 ? -23.263 -17.656 237.822 1.00 30.00 ? 365 SER A CB  1 
ATOM 2837 O OG  . SER A 1 364 ? -23.179 -18.842 238.588 1.00 30.00 ? 365 SER A OG  1 
ATOM 2838 N N   . GLY A 1 365 ? -24.271 -16.974 235.042 1.00 30.00 ? 366 GLY A N   1 
ATOM 2839 C CA  . GLY A 1 365 ? -24.085 -16.175 233.862 1.00 30.00 ? 366 GLY A CA  1 
ATOM 2840 C C   . GLY A 1 365 ? -22.655 -16.412 233.440 1.00 30.00 ? 366 GLY A C   1 
ATOM 2841 O O   . GLY A 1 365 ? -22.125 -17.442 233.870 1.00 30.00 ? 366 GLY A O   1 
ATOM 2842 N N   . PRO A 1 366 ? -21.986 -15.571 232.624 1.00 30.00 ? 367 PRO A N   1 
ATOM 2843 C CA  . PRO A 1 366 ? -20.555 -15.687 232.289 1.00 30.00 ? 367 PRO A CA  1 
ATOM 2844 C C   . PRO A 1 366 ? -19.498 -15.296 233.337 1.00 30.00 ? 367 PRO A C   1 
ATOM 2845 O O   . PRO A 1 366 ? -18.355 -15.750 233.330 1.00 30.00 ? 367 PRO A O   1 
ATOM 2846 C CB  . PRO A 1 366 ? -20.444 -14.890 230.993 1.00 30.00 ? 367 PRO A CB  1 
ATOM 2847 C CG  . PRO A 1 366 ? -21.545 -13.883 231.117 1.00 30.00 ? 367 PRO A CG  1 
ATOM 2848 C CD  . PRO A 1 366 ? -22.653 -14.742 231.636 1.00 30.00 ? 367 PRO A CD  1 
ATOM 2849 N N   . SER A 1 367 ? -19.903 -14.442 234.278 1.00 30.00 ? 368 SER A N   1 
ATOM 2850 C CA  . SER A 1 367 ? -19.077 -13.958 235.359 1.00 30.00 ? 368 SER A CA  1 
ATOM 2851 C C   . SER A 1 367 ? -18.456 -15.122 236.126 1.00 30.00 ? 368 SER A C   1 
ATOM 2852 O O   . SER A 1 367 ? -17.255 -15.093 236.358 1.00 30.00 ? 368 SER A O   1 
ATOM 2853 C CB  . SER A 1 367 ? -19.960 -13.111 236.282 1.00 30.00 ? 368 SER A CB  1 
ATOM 2854 O OG  . SER A 1 367 ? -19.328 -12.019 236.973 1.00 30.00 ? 368 SER A OG  1 
ATOM 2855 N N   . ILE A 1 368 ? -19.184 -16.179 236.474 1.00 30.00 ? 369 ILE A N   1 
ATOM 2856 C CA  . ILE A 1 368 ? -18.687 -17.311 237.230 1.00 30.00 ? 369 ILE A CA  1 
ATOM 2857 C C   . ILE A 1 368 ? -17.279 -17.778 236.866 1.00 30.00 ? 369 ILE A C   1 
ATOM 2858 O O   . ILE A 1 368 ? -16.640 -18.312 237.789 1.00 30.00 ? 369 ILE A O   1 
ATOM 2859 C CB  . ILE A 1 368 ? -19.688 -18.503 237.087 1.00 30.00 ? 369 ILE A CB  1 
ATOM 2860 C CG1 . ILE A 1 368 ? -19.302 -19.550 238.106 1.00 30.00 ? 369 ILE A CG1 1 
ATOM 2861 C CG2 . ILE A 1 368 ? -19.691 -19.097 235.706 1.00 30.00 ? 369 ILE A CG2 1 
ATOM 2862 C CD1 . ILE A 1 368 ? -20.002 -20.915 238.055 1.00 30.00 ? 369 ILE A CD1 1 
ATOM 2863 N N   . VAL A 1 369 ? -16.735 -17.552 235.637 1.00 30.00 ? 370 VAL A N   1 
ATOM 2864 C CA  . VAL A 1 369 ? -15.372 -17.957 235.273 1.00 30.00 ? 370 VAL A CA  1 
ATOM 2865 C C   . VAL A 1 369 ? -14.408 -17.319 236.242 1.00 30.00 ? 370 VAL A C   1 
ATOM 2866 O O   . VAL A 1 369 ? -13.415 -17.925 236.552 1.00 30.00 ? 370 VAL A O   1 
ATOM 2867 C CB  . VAL A 1 369 ? -14.736 -17.461 233.980 1.00 30.00 ? 370 VAL A CB  1 
ATOM 2868 C CG1 . VAL A 1 369 ? -14.113 -18.619 233.302 1.00 30.00 ? 370 VAL A CG1 1 
ATOM 2869 C CG2 . VAL A 1 369 ? -15.702 -16.710 233.160 1.00 30.00 ? 370 VAL A CG2 1 
ATOM 2870 N N   . HIS A 1 370 ? -14.666 -16.131 236.768 1.00 30.00 ? 371 HIS A N   1 
ATOM 2871 C CA  . HIS A 1 370 ? -13.730 -15.454 237.647 1.00 30.00 ? 371 HIS A CA  1 
ATOM 2872 C C   . HIS A 1 370 ? -13.678 -16.086 239.011 1.00 30.00 ? 371 HIS A C   1 
ATOM 2873 O O   . HIS A 1 370 ? -12.710 -16.002 239.758 1.00 30.00 ? 371 HIS A O   1 
ATOM 2874 C CB  . HIS A 1 370 ? -14.082 -13.960 237.852 1.00 30.00 ? 371 HIS A CB  1 
ATOM 2875 C CG  . HIS A 1 370 ? -14.359 -13.197 236.555 1.00 30.00 ? 371 HIS A CG  1 
ATOM 2876 N ND1 . HIS A 1 370 ? -13.817 -13.352 235.346 1.00 30.00 ? 371 HIS A ND1 1 
ATOM 2877 C CD2 . HIS A 1 370 ? -15.343 -12.229 236.432 1.00 30.00 ? 371 HIS A CD2 1 
ATOM 2878 C CE1 . HIS A 1 370 ? -14.430 -12.536 234.513 1.00 30.00 ? 371 HIS A CE1 1 
ATOM 2879 N NE2 . HIS A 1 370 ? -15.349 -11.862 235.179 1.00 30.00 ? 371 HIS A NE2 1 
ATOM 2880 N N   . ARG A 1 371 ? -14.726 -16.781 239.345 1.00 30.00 ? 372 ARG A N   1 
ATOM 2881 C CA  . ARG A 1 371 ? -14.831 -17.305 240.667 1.00 30.00 ? 372 ARG A CA  1 
ATOM 2882 C C   . ARG A 1 371 ? -14.167 -18.626 240.595 1.00 30.00 ? 372 ARG A C   1 
ATOM 2883 O O   . ARG A 1 371 ? -13.325 -18.887 241.419 1.00 30.00 ? 372 ARG A O   1 
ATOM 2884 C CB  . ARG A 1 371 ? -16.332 -17.420 241.060 1.00 30.00 ? 372 ARG A CB  1 
ATOM 2885 C CG  . ARG A 1 371 ? -17.219 -16.131 240.912 1.00 30.00 ? 372 ARG A CG  1 
ATOM 2886 C CD  . ARG A 1 371 ? -17.398 -15.138 242.064 1.00 30.00 ? 372 ARG A CD  1 
ATOM 2887 N NE  . ARG A 1 371 ? -16.173 -14.510 242.522 1.00 30.00 ? 372 ARG A NE  1 
ATOM 2888 C CZ  . ARG A 1 371 ? -15.587 -13.432 241.984 1.00 30.00 ? 372 ARG A CZ  1 
ATOM 2889 N NH1 . ARG A 1 371 ? -16.111 -12.793 240.944 1.00 30.00 ? 372 ARG A NH1 1 
ATOM 2890 N NH2 . ARG A 1 371 ? -14.403 -13.033 242.468 1.00 30.00 ? 372 ARG A NH2 1 
ATOM 2891 N N   . LYS A 1 372 ? -14.498 -19.439 239.600 1.00 30.00 ? 373 LYS A N   1 
ATOM 2892 C CA  . LYS A 1 372 ? -14.078 -20.810 239.676 1.00 30.00 ? 373 LYS A CA  1 
ATOM 2893 C C   . LYS A 1 372 ? -12.778 -21.177 239.103 1.00 30.00 ? 373 LYS A C   1 
ATOM 2894 O O   . LYS A 1 372 ? -12.229 -22.239 239.426 1.00 30.00 ? 373 LYS A O   1 
ATOM 2895 C CB  . LYS A 1 372 ? -15.075 -21.715 239.049 1.00 30.00 ? 373 LYS A CB  1 
ATOM 2896 C CG  . LYS A 1 372 ? -16.408 -21.714 239.791 1.00 30.00 ? 373 LYS A CG  1 
ATOM 2897 C CD  . LYS A 1 372 ? -17.186 -22.982 239.644 1.00 30.00 ? 373 LYS A CD  1 
ATOM 2898 C CE  . LYS A 1 372 ? -16.511 -23.993 240.507 1.00 30.00 ? 373 LYS A CE  1 
ATOM 2899 N NZ  . LYS A 1 372 ? -17.356 -25.160 240.457 1.00 30.00 ? 373 LYS A NZ  1 
ATOM 2900 N N   . CYS A 1 373 ? -12.251 -20.271 238.306 1.00 30.00 ? 374 CYS A N   1 
ATOM 2901 C CA  . CYS A 1 373 ? -10.976 -20.523 237.659 1.00 30.00 ? 374 CYS A CA  1 
ATOM 2902 C C   . CYS A 1 373 ? -9.910  -19.600 238.284 1.00 30.00 ? 374 CYS A C   1 
ATOM 2903 O O   . CYS A 1 373 ? -9.419  -18.662 237.624 1.00 30.00 ? 374 CYS A O   1 
ATOM 2904 C CB  . CYS A 1 373 ? -11.222 -20.319 236.139 1.00 30.00 ? 374 CYS A CB  1 
ATOM 2905 S SG  . CYS A 1 373 ? -12.564 -21.354 235.408 1.00 30.00 ? 374 CYS A SG  1 
ATOM 2906 N N   . PHE A 1 374 ? -9.817  -19.809 239.665 1.00 30.00 ? 375 PHE A N   1 
ATOM 2907 C CA  . PHE A 1 374 ? -8.891  -19.368 240.771 1.00 30.00 ? 375 PHE A CA  1 
ATOM 2908 C C   . PHE A 1 374 ? -9.159  -18.979 242.253 1.00 30.00 ? 375 PHE A C   1 
ATOM 2909 O O   . PHE A 1 374 ? -8.242  -18.650 243.040 1.00 30.00 ? 375 PHE A O   1 
ATOM 2910 C CB  . PHE A 1 374 ? -8.006  -18.296 240.199 1.00 30.00 ? 375 PHE A CB  1 
ATOM 2911 C CG  . PHE A 1 374 ? -6.784  -19.093 239.769 1.00 30.00 ? 375 PHE A CG  1 
ATOM 2912 C CD1 . PHE A 1 374 ? -6.866  -20.443 239.458 1.00 30.00 ? 375 PHE A CD1 1 
ATOM 2913 C CD2 . PHE A 1 374 ? -5.583  -18.421 239.693 1.00 30.00 ? 375 PHE A CD2 1 
ATOM 2914 C CE1 . PHE A 1 374 ? -5.763  -21.115 239.076 1.00 30.00 ? 375 PHE A CE1 1 
ATOM 2915 C CE2 . PHE A 1 374 ? -4.467  -19.103 239.299 1.00 30.00 ? 375 PHE A CE2 1 
ATOM 2916 C CZ  . PHE A 1 374 ? -4.559  -20.451 238.991 1.00 30.00 ? 375 PHE A CZ  1 
ATOM 2917 O OXT . PHE A 1 374 ? -10.274 -19.240 242.669 1.00 30.00 ? 375 PHE A OXT 1 
ATOM 2918 N N   . ASP B 2 1   ? 6.162   -40.374 209.847 1.00 30.00 ? 388 ASP B N   1 
ATOM 2919 C CA  . ASP B 2 1   ? 5.497   -40.519 208.519 1.00 30.00 ? 388 ASP B CA  1 
ATOM 2920 C C   . ASP B 2 1   ? 5.100   -41.971 208.268 1.00 30.00 ? 388 ASP B C   1 
ATOM 2921 O O   . ASP B 2 1   ? 4.605   -42.311 207.194 1.00 30.00 ? 388 ASP B O   1 
ATOM 2922 C CB  . ASP B 2 1   ? 6.434   -40.055 207.404 1.00 30.00 ? 388 ASP B CB  1 
ATOM 2923 C CG  . ASP B 2 1   ? 7.653   -40.943 207.266 1.00 30.00 ? 388 ASP B CG  1 
ATOM 2924 O OD1 . ASP B 2 1   ? 8.437   -41.033 208.235 1.00 30.00 ? 388 ASP B OD1 1 
ATOM 2925 O OD2 . ASP B 2 1   ? 7.823   -41.553 206.187 1.00 30.00 ? 388 ASP B OD2 1 
ATOM 2926 N N   . VAL B 2 2   ? 5.333   -42.823 209.261 1.00 30.00 ? 389 VAL B N   1 
ATOM 2927 C CA  . VAL B 2 2   ? 4.998   -44.237 209.149 1.00 30.00 ? 389 VAL B CA  1 
ATOM 2928 C C   . VAL B 2 2   ? 3.526   -44.453 209.498 1.00 30.00 ? 389 VAL B C   1 
ATOM 2929 O O   . VAL B 2 2   ? 2.955   -45.501 209.198 1.00 30.00 ? 389 VAL B O   1 
ATOM 2930 C CB  . VAL B 2 2   ? 5.878   -45.095 210.087 1.00 30.00 ? 389 VAL B CB  1 
ATOM 2931 C CG1 . VAL B 2 2   ? 5.564   -44.774 211.541 1.00 30.00 ? 389 VAL B CG1 1 
ATOM 2932 C CG2 . VAL B 2 2   ? 5.663   -46.570 209.798 1.00 30.00 ? 389 VAL B CG2 1 
ATOM 2933 N N   . GLU B 2 3   ? 2.917   -43.452 210.133 1.00 30.00 ? 390 GLU B N   1 
ATOM 2934 C CA  . GLU B 2 3   ? 1.511   -43.533 210.510 1.00 30.00 ? 390 GLU B CA  1 
ATOM 2935 C C   . GLU B 2 3   ? 0.647   -43.405 209.262 1.00 30.00 ? 390 GLU B C   1 
ATOM 2936 O O   . GLU B 2 3   ? -0.490  -43.876 209.226 1.00 30.00 ? 390 GLU B O   1 
ATOM 2937 C CB  . GLU B 2 3   ? 1.142   -42.423 211.502 1.00 30.00 ? 390 GLU B CB  1 
ATOM 2938 C CG  . GLU B 2 3   ? 1.972   -42.411 212.777 1.00 30.00 ? 390 GLU B CG  1 
ATOM 2939 C CD  . GLU B 2 3   ? 3.183   -41.503 212.679 1.00 30.00 ? 390 GLU B CD  1 
ATOM 2940 O OE1 . GLU B 2 3   ? 2.992   -40.274 212.573 1.00 30.00 ? 390 GLU B OE1 1 
ATOM 2941 O OE2 . GLU B 2 3   ? 4.323   -42.014 212.706 1.00 30.00 ? 390 GLU B OE2 1 
ATOM 2942 N N   . THR B 2 4   ? 1.201   -42.762 208.239 1.00 30.00 ? 391 THR B N   1 
ATOM 2943 C CA  . THR B 2 4   ? 0.499   -42.568 206.976 1.00 30.00 ? 391 THR B CA  1 
ATOM 2944 C C   . THR B 2 4   ? 0.304   -43.917 206.287 1.00 30.00 ? 391 THR B C   1 
ATOM 2945 O O   . THR B 2 4   ? -0.728  -44.170 205.669 1.00 30.00 ? 391 THR B O   1 
ATOM 2946 C CB  . THR B 2 4   ? 1.292   -41.627 206.045 1.00 30.00 ? 391 THR B CB  1 
ATOM 2947 O OG1 . THR B 2 4   ? 1.504   -40.375 206.706 1.00 30.00 ? 391 THR B OG1 1 
ATOM 2948 C CG2 . THR B 2 4   ? 0.533   -41.385 204.750 1.00 30.00 ? 391 THR B CG2 1 
ATOM 2949 N N   . CYS B 2 5   ? 1.301   -44.783 206.406 1.00 30.00 ? 392 CYS B N   1 
ATOM 2950 C CA  . CYS B 2 5   ? 1.235   -46.107 205.807 1.00 30.00 ? 392 CYS B CA  1 
ATOM 2951 C C   . CYS B 2 5   ? 0.210   -46.972 206.535 1.00 30.00 ? 392 CYS B C   1 
ATOM 2952 O O   . CYS B 2 5   ? -0.491  -47.775 205.916 1.00 30.00 ? 392 CYS B O   1 
ATOM 2953 C CB  . CYS B 2 5   ? 2.609   -46.775 205.865 1.00 30.00 ? 392 CYS B CB  1 
ATOM 2954 S SG  . CYS B 2 5   ? 2.645   -48.446 205.182 1.00 30.00 ? 392 CYS B SG  1 
ATOM 2955 N N   . ARG B 2 6   ? 0.127   -46.809 207.853 1.00 30.00 ? 393 ARG B N   1 
ATOM 2956 C CA  . ARG B 2 6   ? -0.819  -47.576 208.657 1.00 30.00 ? 393 ARG B CA  1 
ATOM 2957 C C   . ARG B 2 6   ? -2.252  -47.127 208.381 1.00 30.00 ? 393 ARG B C   1 
ATOM 2958 O O   . ARG B 2 6   ? -3.154  -47.956 208.232 1.00 30.00 ? 393 ARG B O   1 
ATOM 2959 C CB  . ARG B 2 6   ? -0.506  -47.419 210.145 1.00 30.00 ? 393 ARG B CB  1 
ATOM 2960 C CG  . ARG B 2 6   ? 0.808   -48.044 210.577 1.00 30.00 ? 393 ARG B CG  1 
ATOM 2961 C CD  . ARG B 2 6   ? 1.031   -47.847 212.066 1.00 30.00 ? 393 ARG B CD  1 
ATOM 2962 N NE  . ARG B 2 6   ? 2.277   -48.449 212.528 1.00 30.00 ? 393 ARG B NE  1 
ATOM 2963 C CZ  . ARG B 2 6   ? 2.680   -48.455 213.796 1.00 30.00 ? 393 ARG B CZ  1 
ATOM 2964 N NH1 . ARG B 2 6   ? 1.935   -47.888 214.737 1.00 30.00 ? 393 ARG B NH1 1 
ATOM 2965 N NH2 . ARG B 2 6   ? 3.829   -49.033 214.125 1.00 30.00 ? 393 ARG B NH2 1 
ATOM 2966 N N   . ASP B 2 7   ? -2.464  -45.817 208.317 1.00 30.00 ? 394 ASP B N   1 
ATOM 2967 C CA  . ASP B 2 7   ? -3.798  -45.297 208.035 1.00 30.00 ? 394 ASP B CA  1 
ATOM 2968 C C   . ASP B 2 7   ? -4.221  -45.723 206.632 1.00 30.00 ? 394 ASP B C   1 
ATOM 2969 O O   . ASP B 2 7   ? -5.391  -46.028 206.394 1.00 30.00 ? 394 ASP B O   1 
ATOM 2970 C CB  . ASP B 2 7   ? -3.829  -43.769 208.139 1.00 30.00 ? 394 ASP B CB  1 
ATOM 2971 C CG  . ASP B 2 7   ? -3.580  -43.274 209.549 1.00 30.00 ? 394 ASP B CG  1 
ATOM 2972 O OD1 . ASP B 2 7   ? -4.124  -43.874 210.501 1.00 30.00 ? 394 ASP B OD1 1 
ATOM 2973 O OD2 . ASP B 2 7   ? -2.854  -42.270 209.704 1.00 30.00 ? 394 ASP B OD2 1 
ATOM 2974 N N   . GLU B 2 8   ? -3.265  -45.750 205.708 1.00 30.00 ? 395 GLU B N   1 
ATOM 2975 C CA  . GLU B 2 8   ? -3.574  -46.149 204.343 1.00 30.00 ? 395 GLU B CA  1 
ATOM 2976 C C   . GLU B 2 8   ? -4.169  -47.549 204.358 1.00 30.00 ? 395 GLU B C   1 
ATOM 2977 O O   . GLU B 2 8   ? -5.178  -47.805 203.701 1.00 30.00 ? 395 GLU B O   1 
ATOM 2978 C CB  . GLU B 2 8   ? -2.315  -46.120 203.465 1.00 30.00 ? 395 GLU B CB  1 
ATOM 2979 C CG  . GLU B 2 8   ? -2.593  -46.346 201.975 1.00 30.00 ? 395 GLU B CG  1 
ATOM 2980 C CD  . GLU B 2 8   ? -3.005  -47.777 201.653 1.00 30.00 ? 395 GLU B CD  1 
ATOM 2981 O OE1 . GLU B 2 8   ? -3.761  -47.982 200.679 1.00 30.00 ? 395 GLU B OE1 1 
ATOM 2982 O OE2 . GLU B 2 8   ? -2.561  -48.701 202.364 1.00 30.00 ? 395 GLU B OE2 1 
ATOM 2983 N N   . ARG B 2 9   ? -3.552  -48.455 205.114 1.00 30.00 ? 396 ARG B N   1 
ATOM 2984 C CA  . ARG B 2 9   ? -4.048  -49.828 205.203 1.00 30.00 ? 396 ARG B CA  1 
ATOM 2985 C C   . ARG B 2 9   ? -5.412  -49.868 205.890 1.00 30.00 ? 396 ARG B C   1 
ATOM 2986 O O   . ARG B 2 9   ? -6.355  -50.480 205.388 1.00 30.00 ? 396 ARG B O   1 
ATOM 2987 C CB  . ARG B 2 9   ? -3.078  -50.713 205.993 1.00 30.00 ? 396 ARG B CB  1 
ATOM 2988 C CG  . ARG B 2 9   ? -3.482  -52.189 206.013 1.00 30.00 ? 396 ARG B CG  1 
ATOM 2989 C CD  . ARG B 2 9   ? -2.686  -52.999 207.037 1.00 30.00 ? 396 ARG B CD  1 
ATOM 2990 N NE  . ARG B 2 9   ? -3.181  -52.800 208.397 1.00 30.00 ? 396 ARG B NE  1 
ATOM 2991 C CZ  . ARG B 2 9   ? -4.017  -53.623 209.026 1.00 30.00 ? 396 ARG B CZ  1 
ATOM 2992 N NH1 . ARG B 2 9   ? -4.465  -54.721 208.429 1.00 30.00 ? 396 ARG B NH1 1 
ATOM 2993 N NH2 . ARG B 2 9   ? -4.420  -53.340 210.259 1.00 30.00 ? 396 ARG B NH2 1 
ATOM 2994 N N   . CYS B 2 10  ? -5.496  -49.210 207.041 1.00 30.00 ? 397 CYS B N   1 
ATOM 2995 C CA  . CYS B 2 10  ? -6.719  -49.170 207.837 1.00 30.00 ? 397 CYS B CA  1 
ATOM 2996 C C   . CYS B 2 10  ? -7.980  -48.767 207.074 1.00 30.00 ? 397 CYS B C   1 
ATOM 2997 O O   . CYS B 2 10  ? -8.947  -49.526 207.015 1.00 30.00 ? 397 CYS B O   1 
ATOM 2998 C CB  . CYS B 2 10  ? -6.526  -48.229 209.027 1.00 30.00 ? 397 CYS B CB  1 
ATOM 2999 S SG  . CYS B 2 10  ? -8.001  -48.011 210.035 1.00 30.00 ? 397 CYS B SG  1 
ATOM 3000 N N   . TYR B 2 11  ? -7.973  -47.570 206.496 1.00 30.00 ? 398 TYR B N   1 
ATOM 3001 C CA  . TYR B 2 11  ? -9.136  -47.085 205.759 1.00 30.00 ? 398 TYR B CA  1 
ATOM 3002 C C   . TYR B 2 11  ? -9.388  -47.870 204.481 1.00 30.00 ? 398 TYR B C   1 
ATOM 3003 O O   . TYR B 2 11  ? -10.522 -47.955 204.014 1.00 30.00 ? 398 TYR B O   1 
ATOM 3004 C CB  . TYR B 2 11  ? -8.977  -45.594 205.453 1.00 30.00 ? 398 TYR B CB  1 
ATOM 3005 C CG  . TYR B 2 11  ? -8.945  -44.760 206.715 1.00 30.00 ? 398 TYR B CG  1 
ATOM 3006 C CD1 . TYR B 2 11  ? -7.826  -43.998 207.045 1.00 30.00 ? 398 TYR B CD1 1 
ATOM 3007 C CD2 . TYR B 2 11  ? -10.012 -44.787 207.615 1.00 30.00 ? 398 TYR B CD2 1 
ATOM 3008 C CE1 . TYR B 2 11  ? -7.770  -43.284 208.244 1.00 30.00 ? 398 TYR B CE1 1 
ATOM 3009 C CE2 . TYR B 2 11  ? -9.968  -44.081 208.813 1.00 30.00 ? 398 TYR B CE2 1 
ATOM 3010 C CZ  . TYR B 2 11  ? -8.846  -43.334 209.123 1.00 30.00 ? 398 TYR B CZ  1 
ATOM 3011 O OH  . TYR B 2 11  ? -8.795  -42.636 210.306 1.00 30.00 ? 398 TYR B OH  1 
ATOM 3012 N N   . ARG B 2 12  ? -8.333  -48.450 203.923 1.00 30.00 ? 399 ARG B N   1 
ATOM 3013 C CA  . ARG B 2 12  ? -8.470  -49.237 202.711 1.00 30.00 ? 399 ARG B CA  1 
ATOM 3014 C C   . ARG B 2 12  ? -9.289  -50.477 203.038 1.00 30.00 ? 399 ARG B C   1 
ATOM 3015 O O   . ARG B 2 12  ? -10.211 -50.841 202.306 1.00 30.00 ? 399 ARG B O   1 
ATOM 3016 C CB  . ARG B 2 12  ? -7.092  -49.656 202.197 1.00 30.00 ? 399 ARG B CB  1 
ATOM 3017 C CG  . ARG B 2 12  ? -7.113  -50.313 200.828 1.00 30.00 ? 399 ARG B CG  1 
ATOM 3018 C CD  . ARG B 2 12  ? -5.717  -50.733 200.403 1.00 30.00 ? 399 ARG B CD  1 
ATOM 3019 N NE  . ARG B 2 12  ? -5.403  -52.080 200.865 1.00 30.00 ? 399 ARG B NE  1 
ATOM 3020 C CZ  . ARG B 2 12  ? -4.295  -52.411 201.516 1.00 30.00 ? 399 ARG B CZ  1 
ATOM 3021 N NH1 . ARG B 2 12  ? -3.380  -51.490 201.793 1.00 30.00 ? 399 ARG B NH1 1 
ATOM 3022 N NH2 . ARG B 2 12  ? -4.101  -53.668 201.883 1.00 30.00 ? 399 ARG B NH2 1 
ATOM 3023 N N   . LEU B 2 13  ? -8.944  -51.121 204.148 1.00 30.00 ? 400 LEU B N   1 
ATOM 3024 C CA  . LEU B 2 13  ? -9.631  -52.329 204.585 1.00 30.00 ? 400 LEU B CA  1 
ATOM 3025 C C   . LEU B 2 13  ? -11.067 -52.020 205.006 1.00 30.00 ? 400 LEU B C   1 
ATOM 3026 O O   . LEU B 2 13  ? -11.980 -52.798 204.737 1.00 30.00 ? 400 LEU B O   1 
ATOM 3027 C CB  . LEU B 2 13  ? -8.861  -52.976 205.741 1.00 30.00 ? 400 LEU B CB  1 
ATOM 3028 C CG  . LEU B 2 13  ? -7.448  -53.458 205.387 1.00 30.00 ? 400 LEU B CG  1 
ATOM 3029 C CD1 . LEU B 2 13  ? -6.719  -53.902 206.640 1.00 30.00 ? 400 LEU B CD1 1 
ATOM 3030 C CD2 . LEU B 2 13  ? -7.527  -54.600 204.380 1.00 30.00 ? 400 LEU B CD2 1 
ATOM 3031 N N   . TRP B 2 14  ? -11.256 -50.878 205.662 1.00 30.00 ? 401 TRP B N   1 
ATOM 3032 C CA  . TRP B 2 14  ? -12.579 -50.457 206.105 1.00 30.00 ? 401 TRP B CA  1 
ATOM 3033 C C   . TRP B 2 14  ? -13.509 -50.222 204.909 1.00 30.00 ? 401 TRP B C   1 
ATOM 3034 O O   . TRP B 2 14  ? -14.631 -50.727 204.874 1.00 30.00 ? 401 TRP B O   1 
ATOM 3035 C CB  . TRP B 2 14  ? -12.473 -49.167 206.932 1.00 30.00 ? 401 TRP B CB  1 
ATOM 3036 C CG  . TRP B 2 14  ? -13.808 -48.596 207.344 1.00 30.00 ? 401 TRP B CG  1 
ATOM 3037 C CD1 . TRP B 2 14  ? -14.726 -49.175 208.170 1.00 30.00 ? 401 TRP B CD1 1 
ATOM 3038 C CD2 . TRP B 2 14  ? -14.376 -47.345 206.927 1.00 30.00 ? 401 TRP B CD2 1 
ATOM 3039 N NE1 . TRP B 2 14  ? -15.831 -48.363 208.296 1.00 30.00 ? 401 TRP B NE1 1 
ATOM 3040 C CE2 . TRP B 2 14  ? -15.642 -47.234 207.542 1.00 30.00 ? 401 TRP B CE2 1 
ATOM 3041 C CE3 . TRP B 2 14  ? -13.935 -46.306 206.091 1.00 30.00 ? 401 TRP B CE3 1 
ATOM 3042 C CZ2 . TRP B 2 14  ? -16.474 -46.128 207.352 1.00 30.00 ? 401 TRP B CZ2 1 
ATOM 3043 C CZ3 . TRP B 2 14  ? -14.762 -45.206 205.901 1.00 30.00 ? 401 TRP B CZ3 1 
ATOM 3044 C CH2 . TRP B 2 14  ? -16.021 -45.127 206.529 1.00 30.00 ? 401 TRP B CH2 1 
ATOM 3045 N N   . ILE B 2 15  ? -13.031 -49.456 203.932 1.00 30.00 ? 402 ILE B N   1 
ATOM 3046 C CA  . ILE B 2 15  ? -13.822 -49.146 202.742 1.00 30.00 ? 402 ILE B CA  1 
ATOM 3047 C C   . ILE B 2 15  ? -14.234 -50.396 201.971 1.00 30.00 ? 402 ILE B C   1 
ATOM 3048 O O   . ILE B 2 15  ? -15.349 -50.473 201.459 1.00 30.00 ? 402 ILE B O   1 
ATOM 3049 C CB  . ILE B 2 15  ? -13.046 -48.213 201.770 1.00 30.00 ? 402 ILE B CB  1 
ATOM 3050 C CG1 . ILE B 2 15  ? -12.718 -46.888 202.460 1.00 30.00 ? 402 ILE B CG1 1 
ATOM 3051 C CG2 . ILE B 2 15  ? -13.879 -47.958 200.518 1.00 30.00 ? 402 ILE B CG2 1 
ATOM 3052 C CD1 . ILE B 2 15  ? -11.814 -45.981 201.647 1.00 30.00 ? 402 ILE B CD1 1 
ATOM 3053 N N   . ASN B 2 16  ? -13.333 -51.373 201.896 1.00 30.00 ? 403 ASN B N   1 
ATOM 3054 C CA  . ASN B 2 16  ? -13.598 -52.613 201.172 1.00 30.00 ? 403 ASN B CA  1 
ATOM 3055 C C   . ASN B 2 16  ? -14.568 -53.566 201.874 1.00 30.00 ? 403 ASN B C   1 
ATOM 3056 O O   . ASN B 2 16  ? -14.965 -54.581 201.302 1.00 30.00 ? 403 ASN B O   1 
ATOM 3057 C CB  . ASN B 2 16  ? -12.281 -53.341 200.878 1.00 30.00 ? 403 ASN B CB  1 
ATOM 3058 C CG  . ASN B 2 16  ? -11.481 -52.683 199.760 1.00 30.00 ? 403 ASN B CG  1 
ATOM 3059 O OD1 . ASN B 2 16  ? -10.315 -53.008 199.545 1.00 30.00 ? 403 ASN B OD1 1 
ATOM 3060 N ND2 . ASN B 2 16  ? -12.110 -51.765 199.036 1.00 30.00 ? 403 ASN B ND2 1 
ATOM 3061 N N   . SER B 2 17  ? -14.953 -53.242 203.103 1.00 30.00 ? 404 SER B N   1 
ATOM 3062 C CA  . SER B 2 17  ? -15.877 -54.090 203.856 1.00 30.00 ? 404 SER B CA  1 
ATOM 3063 C C   . SER B 2 17  ? -17.245 -53.431 204.021 1.00 30.00 ? 404 SER B C   1 
ATOM 3064 O O   . SER B 2 17  ? -18.148 -54.003 204.631 1.00 30.00 ? 404 SER B O   1 
ATOM 3065 C CB  . SER B 2 17  ? -15.304 -54.404 205.242 1.00 30.00 ? 404 SER B CB  1 
ATOM 3066 O OG  . SER B 2 17  ? -15.202 -53.227 206.028 1.00 30.00 ? 404 SER B OG  1 
ATOM 3067 N N   . LEU B 2 18  ? -17.394 -52.231 203.466 1.00 30.00 ? 405 LEU B N   1 
ATOM 3068 C CA  . LEU B 2 18  ? -18.645 -51.488 203.569 1.00 30.00 ? 405 LEU B CA  1 
ATOM 3069 C C   . LEU B 2 18  ? -19.742 -51.942 202.605 1.00 30.00 ? 405 LEU B C   1 
ATOM 3070 O O   . LEU B 2 18  ? -20.895 -51.535 202.739 1.00 30.00 ? 405 LEU B O   1 
ATOM 3071 C CB  . LEU B 2 18  ? -18.378 -49.992 203.370 1.00 30.00 ? 405 LEU B CB  1 
ATOM 3072 C CG  . LEU B 2 18  ? -17.487 -49.311 204.417 1.00 30.00 ? 405 LEU B CG  1 
ATOM 3073 C CD1 . LEU B 2 18  ? -17.242 -47.861 204.021 1.00 30.00 ? 405 LEU B CD1 1 
ATOM 3074 C CD2 . LEU B 2 18  ? -18.149 -49.387 205.790 1.00 30.00 ? 405 LEU B CD2 1 
ATOM 3075 N N   . GLY B 2 19  ? -19.387 -52.787 201.642 1.00 30.00 ? 406 GLY B N   1 
ATOM 3076 C CA  . GLY B 2 19  ? -20.373 -53.247 200.680 1.00 30.00 ? 406 GLY B CA  1 
ATOM 3077 C C   . GLY B 2 19  ? -20.380 -52.356 199.453 1.00 30.00 ? 406 GLY B C   1 
ATOM 3078 O O   . GLY B 2 19  ? -21.321 -52.359 198.663 1.00 30.00 ? 406 GLY B O   1 
ATOM 3079 N N   . ILE B 2 20  ? -19.308 -51.585 199.309 1.00 30.00 ? 407 ILE B N   1 
ATOM 3080 C CA  . ILE B 2 20  ? -19.118 -50.664 198.192 1.00 30.00 ? 407 ILE B CA  1 
ATOM 3081 C C   . ILE B 2 20  ? -18.926 -51.460 196.892 1.00 30.00 ? 407 ILE B C   1 
ATOM 3082 O O   . ILE B 2 20  ? -18.472 -52.604 196.920 1.00 30.00 ? 407 ILE B O   1 
ATOM 3083 C CB  . ILE B 2 20  ? -17.876 -49.781 198.462 1.00 30.00 ? 407 ILE B CB  1 
ATOM 3084 C CG1 . ILE B 2 20  ? -17.611 -48.833 197.296 1.00 30.00 ? 407 ILE B CG1 1 
ATOM 3085 C CG2 . ILE B 2 20  ? -16.665 -50.675 198.710 1.00 30.00 ? 407 ILE B CG2 1 
ATOM 3086 C CD1 . ILE B 2 20  ? -16.380 -47.956 197.496 1.00 30.00 ? 407 ILE B CD1 1 
ATOM 3087 N N   . ASP B 2 21  ? -19.274 -50.860 195.756 1.00 30.00 ? 408 ASP B N   1 
ATOM 3088 C CA  . ASP B 2 21  ? -19.128 -51.539 194.468 1.00 30.00 ? 408 ASP B CA  1 
ATOM 3089 C C   . ASP B 2 21  ? -17.718 -51.470 193.892 1.00 30.00 ? 408 ASP B C   1 
ATOM 3090 O O   . ASP B 2 21  ? -17.372 -52.241 193.000 1.00 30.00 ? 408 ASP B O   1 
ATOM 3091 C CB  . ASP B 2 21  ? -20.112 -50.972 193.445 1.00 30.00 ? 408 ASP B CB  1 
ATOM 3092 C CG  . ASP B 2 21  ? -21.532 -51.428 193.692 1.00 30.00 ? 408 ASP B CG  1 
ATOM 3093 O OD1 . ASP B 2 21  ? -21.735 -52.648 193.870 1.00 30.00 ? 408 ASP B OD1 1 
ATOM 3094 O OD2 . ASP B 2 21  ? -22.443 -50.572 193.696 1.00 30.00 ? 408 ASP B OD2 1 
ATOM 3095 N N   . SER B 2 22  ? -16.911 -50.543 194.393 1.00 30.00 ? 409 SER B N   1 
ATOM 3096 C CA  . SER B 2 22  ? -15.541 -50.400 193.917 1.00 30.00 ? 409 SER B CA  1 
ATOM 3097 C C   . SER B 2 22  ? -14.584 -51.026 194.922 1.00 30.00 ? 409 SER B C   1 
ATOM 3098 O O   . SER B 2 22  ? -14.893 -51.109 196.110 1.00 30.00 ? 409 SER B O   1 
ATOM 3099 C CB  . SER B 2 22  ? -15.196 -48.923 193.738 1.00 30.00 ? 409 SER B CB  1 
ATOM 3100 O OG  . SER B 2 22  ? -16.107 -48.292 192.859 1.00 30.00 ? 409 SER B OG  1 
ATOM 3101 N N   . TYR B 2 23  ? -13.428 -51.471 194.444 1.00 30.00 ? 410 TYR B N   1 
ATOM 3102 C CA  . TYR B 2 23  ? -12.436 -52.075 195.320 1.00 30.00 ? 410 TYR B CA  1 
ATOM 3103 C C   . TYR B 2 23  ? -11.235 -51.144 195.426 1.00 30.00 ? 410 TYR B C   1 
ATOM 3104 O O   . TYR B 2 23  ? -10.774 -50.607 194.427 1.00 30.00 ? 410 TYR B O   1 
ATOM 3105 C CB  . TYR B 2 23  ? -12.002 -53.442 194.777 1.00 30.00 ? 410 TYR B CB  1 
ATOM 3106 C CG  . TYR B 2 23  ? -11.097 -54.210 195.717 1.00 30.00 ? 410 TYR B CG  1 
ATOM 3107 C CD1 . TYR B 2 23  ? -9.709  -54.087 195.641 1.00 30.00 ? 410 TYR B CD1 1 
ATOM 3108 C CD2 . TYR B 2 23  ? -11.630 -55.029 196.710 1.00 30.00 ? 410 TYR B CD2 1 
ATOM 3109 C CE1 . TYR B 2 23  ? -8.872  -54.764 196.536 1.00 30.00 ? 410 TYR B CE1 1 
ATOM 3110 C CE2 . TYR B 2 23  ? -10.806 -55.708 197.612 1.00 30.00 ? 410 TYR B CE2 1 
ATOM 3111 C CZ  . TYR B 2 23  ? -9.430  -55.572 197.519 1.00 30.00 ? 410 TYR B CZ  1 
ATOM 3112 O OH  . TYR B 2 23  ? -8.618  -56.243 198.408 1.00 30.00 ? 410 TYR B OH  1 
ATOM 3113 N N   . VAL B 2 24  ? -10.738 -50.956 196.645 1.00 30.00 ? 411 VAL B N   1 
ATOM 3114 C CA  . VAL B 2 24  ? -9.598  -50.081 196.886 1.00 30.00 ? 411 VAL B CA  1 
ATOM 3115 C C   . VAL B 2 24  ? -8.283  -50.843 197.062 1.00 30.00 ? 411 VAL B C   1 
ATOM 3116 O O   . VAL B 2 24  ? -8.149  -51.684 197.954 1.00 30.00 ? 411 VAL B O   1 
ATOM 3117 C CB  . VAL B 2 24  ? -9.838  -49.202 198.139 1.00 30.00 ? 411 VAL B CB  1 
ATOM 3118 C CG1 . VAL B 2 24  ? -8.637  -48.310 198.396 1.00 30.00 ? 411 VAL B CG1 1 
ATOM 3119 C CG2 . VAL B 2 24  ? -11.086 -48.356 197.949 1.00 30.00 ? 411 VAL B CG2 1 
ATOM 3120 N N   . ASN B 2 25  ? -7.316  -50.539 196.198 1.00 30.00 ? 412 ASN B N   1 
ATOM 3121 C CA  . ASN B 2 25  ? -6.001  -51.162 196.260 1.00 30.00 ? 412 ASN B CA  1 
ATOM 3122 C C   . ASN B 2 25  ? -5.044  -50.184 196.941 1.00 30.00 ? 412 ASN B C   1 
ATOM 3123 O O   . ASN B 2 25  ? -4.051  -50.586 197.545 1.00 30.00 ? 412 ASN B O   1 
ATOM 3124 C CB  . ASN B 2 25  ? -5.503  -51.493 194.853 1.00 30.00 ? 412 ASN B CB  1 
ATOM 3125 C CG  . ASN B 2 25  ? -6.396  -52.495 194.142 1.00 30.00 ? 412 ASN B CG  1 
ATOM 3126 O OD1 . ASN B 2 25  ? -6.563  -53.627 194.596 1.00 30.00 ? 412 ASN B OD1 1 
ATOM 3127 N ND2 . ASN B 2 25  ? -6.978  -52.081 193.022 1.00 30.00 ? 412 ASN B ND2 1 
ATOM 3128 N N   . ASN B 2 26  ? -5.369  -48.898 196.840 1.00 30.00 ? 413 ASN B N   1 
ATOM 3129 C CA  . ASN B 2 26  ? -4.574  -47.827 197.444 1.00 30.00 ? 413 ASN B CA  1 
ATOM 3130 C C   . ASN B 2 26  ? -5.462  -46.597 197.620 1.00 30.00 ? 413 ASN B C   1 
ATOM 3131 O O   . ASN B 2 26  ? -5.779  -45.907 196.651 1.00 30.00 ? 413 ASN B O   1 
ATOM 3132 C CB  . ASN B 2 26  ? -3.379  -47.478 196.554 1.00 30.00 ? 413 ASN B CB  1 
ATOM 3133 C CG  . ASN B 2 26  ? -2.496  -46.411 197.163 1.00 30.00 ? 413 ASN B CG  1 
ATOM 3134 O OD1 . ASN B 2 26  ? -2.941  -45.292 197.416 1.00 30.00 ? 413 ASN B OD1 1 
ATOM 3135 N ND2 . ASN B 2 26  ? -1.238  -46.751 197.407 1.00 30.00 ? 413 ASN B ND2 1 
ATOM 3136 N N   . VAL B 2 27  ? -5.851  -46.320 198.862 1.00 30.00 ? 414 VAL B N   1 
ATOM 3137 C CA  . VAL B 2 27  ? -6.731  -45.193 199.156 1.00 30.00 ? 414 VAL B CA  1 
ATOM 3138 C C   . VAL B 2 27  ? -6.274  -43.841 198.627 1.00 30.00 ? 414 VAL B C   1 
ATOM 3139 O O   . VAL B 2 27  ? -7.090  -43.055 198.154 1.00 30.00 ? 414 VAL B O   1 
ATOM 3140 C CB  . VAL B 2 27  ? -6.974  -45.048 200.673 1.00 30.00 ? 414 VAL B CB  1 
ATOM 3141 C CG1 . VAL B 2 27  ? -7.619  -46.300 201.211 1.00 30.00 ? 414 VAL B CG1 1 
ATOM 3142 C CG2 . VAL B 2 27  ? -5.670  -44.764 201.391 1.00 30.00 ? 414 VAL B CG2 1 
ATOM 3143 N N   . PHE B 2 28  ? -4.976  -43.568 198.712 1.00 30.00 ? 415 PHE B N   1 
ATOM 3144 C CA  . PHE B 2 28  ? -4.439  -42.293 198.258 1.00 30.00 ? 415 PHE B CA  1 
ATOM 3145 C C   . PHE B 2 28  ? -4.563  -42.083 196.754 1.00 30.00 ? 415 PHE B C   1 
ATOM 3146 O O   . PHE B 2 28  ? -4.713  -40.951 196.293 1.00 30.00 ? 415 PHE B O   1 
ATOM 3147 C CB  . PHE B 2 28  ? -2.975  -42.168 198.688 1.00 30.00 ? 415 PHE B CB  1 
ATOM 3148 C CG  . PHE B 2 28  ? -2.791  -41.982 200.171 1.00 30.00 ? 415 PHE B CG  1 
ATOM 3149 C CD1 . PHE B 2 28  ? -1.731  -42.593 200.836 1.00 30.00 ? 415 PHE B CD1 1 
ATOM 3150 C CD2 . PHE B 2 28  ? -3.665  -41.179 200.901 1.00 30.00 ? 415 PHE B CD2 1 
ATOM 3151 C CE1 . PHE B 2 28  ? -1.543  -42.410 202.201 1.00 30.00 ? 415 PHE B CE1 1 
ATOM 3152 C CE2 . PHE B 2 28  ? -3.487  -40.987 202.267 1.00 30.00 ? 415 PHE B CE2 1 
ATOM 3153 C CZ  . PHE B 2 28  ? -2.422  -41.604 202.920 1.00 30.00 ? 415 PHE B CZ  1 
ATOM 3154 N N   . GLU B 2 29  ? -4.501  -43.169 195.989 1.00 30.00 ? 416 GLU B N   1 
ATOM 3155 C CA  . GLU B 2 29  ? -4.610  -43.078 194.537 1.00 30.00 ? 416 GLU B CA  1 
ATOM 3156 C C   . GLU B 2 29  ? -6.029  -43.289 194.024 1.00 30.00 ? 416 GLU B C   1 
ATOM 3157 O O   . GLU B 2 29  ? -6.554  -42.465 193.281 1.00 30.00 ? 416 GLU B O   1 
ATOM 3158 C CB  . GLU B 2 29  ? -3.693  -44.105 193.865 1.00 30.00 ? 416 GLU B CB  1 
ATOM 3159 C CG  . GLU B 2 29  ? -2.241  -43.681 193.780 1.00 30.00 ? 416 GLU B CG  1 
ATOM 3160 C CD  . GLU B 2 29  ? -2.075  -42.350 193.073 1.00 30.00 ? 416 GLU B CD  1 
ATOM 3161 O OE1 . GLU B 2 29  ? -2.575  -42.212 191.936 1.00 30.00 ? 416 GLU B OE1 1 
ATOM 3162 O OE2 . GLU B 2 29  ? -1.445  -41.442 193.656 1.00 30.00 ? 416 GLU B OE2 1 
ATOM 3163 N N   . ASP B 2 30  ? -6.640  -44.392 194.434 1.00 30.00 ? 417 ASP B N   1 
ATOM 3164 C CA  . ASP B 2 30  ? -7.981  -44.754 193.992 1.00 30.00 ? 417 ASP B CA  1 
ATOM 3165 C C   . ASP B 2 30  ? -9.117  -43.832 194.424 1.00 30.00 ? 417 ASP B C   1 
ATOM 3166 O O   . ASP B 2 30  ? -10.257 -44.011 193.998 1.00 30.00 ? 417 ASP B O   1 
ATOM 3167 C CB  . ASP B 2 30  ? -8.282  -46.181 194.440 1.00 30.00 ? 417 ASP B CB  1 
ATOM 3168 C CG  . ASP B 2 30  ? -7.255  -47.169 193.937 1.00 30.00 ? 417 ASP B CG  1 
ATOM 3169 O OD1 . ASP B 2 30  ? -7.296  -48.348 194.346 1.00 30.00 ? 417 ASP B OD1 1 
ATOM 3170 O OD2 . ASP B 2 30  ? -6.399  -46.763 193.125 1.00 30.00 ? 417 ASP B OD2 1 
ATOM 3171 N N   . VAL B 2 31  ? -8.808  -42.838 195.246 1.00 30.00 ? 418 VAL B N   1 
ATOM 3172 C CA  . VAL B 2 31  ? -9.826  -41.925 195.744 1.00 30.00 ? 418 VAL B CA  1 
ATOM 3173 C C   . VAL B 2 31  ? -9.834  -40.563 195.026 1.00 30.00 ? 418 VAL B C   1 
ATOM 3174 O O   . VAL B 2 31  ? -10.749 -39.753 195.208 1.00 30.00 ? 418 VAL B O   1 
ATOM 3175 C CB  . VAL B 2 31  ? -9.620  -41.716 197.269 1.00 30.00 ? 418 VAL B CB  1 
ATOM 3176 C CG1 . VAL B 2 31  ? -8.594  -40.626 197.524 1.00 30.00 ? 418 VAL B CG1 1 
ATOM 3177 C CG2 . VAL B 2 31  ? -10.916 -41.405 197.932 1.00 30.00 ? 418 VAL B CG2 1 
ATOM 3178 N N   . ARG B 2 32  ? -8.824  -40.333 194.195 1.00 30.00 ? 419 ARG B N   1 
ATOM 3179 C CA  . ARG B 2 32  ? -8.659  -39.071 193.481 1.00 30.00 ? 419 ARG B CA  1 
ATOM 3180 C C   . ARG B 2 32  ? -9.705  -38.641 192.440 1.00 30.00 ? 419 ARG B C   1 
ATOM 3181 O O   . ARG B 2 32  ? -9.786  -37.458 192.112 1.00 30.00 ? 419 ARG B O   1 
ATOM 3182 C CB  . ARG B 2 32  ? -7.254  -39.037 192.868 1.00 30.00 ? 419 ARG B CB  1 
ATOM 3183 C CG  . ARG B 2 32  ? -6.174  -39.282 193.920 1.00 30.00 ? 419 ARG B CG  1 
ATOM 3184 C CD  . ARG B 2 32  ? -4.771  -39.294 193.359 1.00 30.00 ? 419 ARG B CD  1 
ATOM 3185 N NE  . ARG B 2 32  ? -4.340  -37.973 192.913 1.00 30.00 ? 419 ARG B NE  1 
ATOM 3186 C CZ  . ARG B 2 32  ? -3.115  -37.704 192.473 1.00 30.00 ? 419 ARG B CZ  1 
ATOM 3187 N NH1 . ARG B 2 32  ? -2.202  -38.664 192.428 1.00 30.00 ? 419 ARG B NH1 1 
ATOM 3188 N NH2 . ARG B 2 32  ? -2.804  -36.480 192.068 1.00 30.00 ? 419 ARG B NH2 1 
ATOM 3189 N N   . ASN B 2 33  ? -10.499 -39.565 191.905 1.00 30.00 ? 420 ASN B N   1 
ATOM 3190 C CA  . ASN B 2 33  ? -11.501 -39.141 190.934 1.00 30.00 ? 420 ASN B CA  1 
ATOM 3191 C C   . ASN B 2 33  ? -12.854 -38.925 191.606 1.00 30.00 ? 420 ASN B C   1 
ATOM 3192 O O   . ASN B 2 33  ? -13.865 -38.706 190.939 1.00 30.00 ? 420 ASN B O   1 
ATOM 3193 C CB  . ASN B 2 33  ? -11.624 -40.126 189.757 1.00 30.00 ? 420 ASN B CB  1 
ATOM 3194 C CG  . ASN B 2 33  ? -12.204 -41.460 190.155 1.00 30.00 ? 420 ASN B CG  1 
ATOM 3195 O OD1 . ASN B 2 33  ? -13.077 -41.539 191.018 1.00 30.00 ? 420 ASN B OD1 1 
ATOM 3196 N ND2 . ASN B 2 33  ? -11.739 -42.520 189.503 1.00 30.00 ? 420 ASN B ND2 1 
ATOM 3197 N N   . GLY B 2 34  ? -12.854 -38.997 192.934 1.00 30.00 ? 421 GLY B N   1 
ATOM 3198 C CA  . GLY B 2 34  ? -14.059 -38.759 193.718 1.00 30.00 ? 421 GLY B CA  1 
ATOM 3199 C C   . GLY B 2 34  ? -15.183 -39.778 193.778 1.00 30.00 ? 421 GLY B C   1 
ATOM 3200 O O   . GLY B 2 34  ? -16.040 -39.686 194.658 1.00 30.00 ? 421 GLY B O   1 
ATOM 3201 N N   . TRP B 2 35  ? -15.193 -40.750 192.874 1.00 30.00 ? 422 TRP B N   1 
ATOM 3202 C CA  . TRP B 2 35  ? -16.264 -41.739 192.858 1.00 30.00 ? 422 TRP B CA  1 
ATOM 3203 C C   . TRP B 2 35  ? -16.382 -42.575 194.131 1.00 30.00 ? 422 TRP B C   1 
ATOM 3204 O O   . TRP B 2 35  ? -17.436 -42.598 194.764 1.00 30.00 ? 422 TRP B O   1 
ATOM 3205 C CB  . TRP B 2 35  ? -16.110 -42.657 191.648 1.00 30.00 ? 422 TRP B CB  1 
ATOM 3206 C CG  . TRP B 2 35  ? -17.285 -43.560 191.435 1.00 30.00 ? 422 TRP B CG  1 
ATOM 3207 C CD1 . TRP B 2 35  ? -17.358 -44.896 191.719 1.00 30.00 ? 422 TRP B CD1 1 
ATOM 3208 C CD2 . TRP B 2 35  ? -18.564 -43.194 190.900 1.00 30.00 ? 422 TRP B CD2 1 
ATOM 3209 N NE1 . TRP B 2 35  ? -18.601 -45.383 191.391 1.00 30.00 ? 422 TRP B NE1 1 
ATOM 3210 C CE2 . TRP B 2 35  ? -19.363 -44.361 190.885 1.00 30.00 ? 422 TRP B CE2 1 
ATOM 3211 C CE3 . TRP B 2 35  ? -19.114 -41.991 190.427 1.00 30.00 ? 422 TRP B CE3 1 
ATOM 3212 C CZ2 . TRP B 2 35  ? -20.683 -44.363 190.418 1.00 30.00 ? 422 TRP B CZ2 1 
ATOM 3213 C CZ3 . TRP B 2 35  ? -20.428 -41.994 189.961 1.00 30.00 ? 422 TRP B CZ3 1 
ATOM 3214 C CH2 . TRP B 2 35  ? -21.198 -43.175 189.960 1.00 30.00 ? 422 TRP B CH2 1 
ATOM 3215 N N   . ILE B 2 36  ? -15.311 -43.262 194.507 1.00 30.00 ? 423 ILE B N   1 
ATOM 3216 C CA  . ILE B 2 36  ? -15.333 -44.097 195.706 1.00 30.00 ? 423 ILE B CA  1 
ATOM 3217 C C   . ILE B 2 36  ? -15.837 -43.342 196.935 1.00 30.00 ? 423 ILE B C   1 
ATOM 3218 O O   . ILE B 2 36  ? -16.665 -43.855 197.686 1.00 30.00 ? 423 ILE B O   1 
ATOM 3219 C CB  . ILE B 2 36  ? -13.932 -44.686 196.015 1.00 30.00 ? 423 ILE B CB  1 
ATOM 3220 C CG1 . ILE B 2 36  ? -13.525 -45.661 194.903 1.00 30.00 ? 423 ILE B CG1 1 
ATOM 3221 C CG2 . ILE B 2 36  ? -13.951 -45.400 197.365 1.00 30.00 ? 423 ILE B CG2 1 
ATOM 3222 C CD1 . ILE B 2 36  ? -12.175 -46.315 195.110 1.00 30.00 ? 423 ILE B CD1 1 
ATOM 3223 N N   . LEU B 2 37  ? -15.339 -42.127 197.141 1.00 30.00 ? 424 LEU B N   1 
ATOM 3224 C CA  . LEU B 2 37  ? -15.764 -41.336 198.288 1.00 30.00 ? 424 LEU B CA  1 
ATOM 3225 C C   . LEU B 2 37  ? -17.257 -41.046 198.257 1.00 30.00 ? 424 LEU B C   1 
ATOM 3226 O O   . LEU B 2 37  ? -17.886 -40.916 199.303 1.00 30.00 ? 424 LEU B O   1 
ATOM 3227 C CB  . LEU B 2 37  ? -14.977 -40.027 198.364 1.00 30.00 ? 424 LEU B CB  1 
ATOM 3228 C CG  . LEU B 2 37  ? -13.548 -40.192 198.876 1.00 30.00 ? 424 LEU B CG  1 
ATOM 3229 C CD1 . LEU B 2 37  ? -12.822 -38.848 198.863 1.00 30.00 ? 424 LEU B CD1 1 
ATOM 3230 C CD2 . LEU B 2 37  ? -13.583 -40.786 200.280 1.00 30.00 ? 424 LEU B CD2 1 
ATOM 3231 N N   . LEU B 2 38  ? -17.827 -40.934 197.062 1.00 30.00 ? 425 LEU B N   1 
ATOM 3232 C CA  . LEU B 2 38  ? -19.257 -40.687 196.967 1.00 30.00 ? 425 LEU B CA  1 
ATOM 3233 C C   . LEU B 2 38  ? -19.989 -41.949 197.403 1.00 30.00 ? 425 LEU B C   1 
ATOM 3234 O O   . LEU B 2 38  ? -21.016 -41.872 198.079 1.00 30.00 ? 425 LEU B O   1 
ATOM 3235 C CB  . LEU B 2 38  ? -19.661 -40.311 195.541 1.00 30.00 ? 425 LEU B CB  1 
ATOM 3236 C CG  . LEU B 2 38  ? -19.367 -38.870 195.121 1.00 30.00 ? 425 LEU B CG  1 
ATOM 3237 C CD1 . LEU B 2 38  ? -19.756 -38.662 193.667 1.00 30.00 ? 425 LEU B CD1 1 
ATOM 3238 C CD2 . LEU B 2 38  ? -20.136 -37.914 196.009 1.00 30.00 ? 425 LEU B CD2 1 
ATOM 3239 N N   . GLU B 2 39  ? -19.448 -43.108 197.025 1.00 30.00 ? 426 GLU B N   1 
ATOM 3240 C CA  . GLU B 2 39  ? -20.048 -44.388 197.387 1.00 30.00 ? 426 GLU B CA  1 
ATOM 3241 C C   . GLU B 2 39  ? -20.061 -44.564 198.902 1.00 30.00 ? 426 GLU B C   1 
ATOM 3242 O O   . GLU B 2 39  ? -21.074 -44.955 199.485 1.00 30.00 ? 426 GLU B O   1 
ATOM 3243 C CB  . GLU B 2 39  ? -19.274 -45.549 196.758 1.00 30.00 ? 426 GLU B CB  1 
ATOM 3244 C CG  . GLU B 2 39  ? -19.196 -45.510 195.243 1.00 30.00 ? 426 GLU B CG  1 
ATOM 3245 C CD  . GLU B 2 39  ? -18.818 -46.857 194.650 1.00 30.00 ? 426 GLU B CD  1 
ATOM 3246 O OE1 . GLU B 2 39  ? -19.677 -47.758 194.626 1.00 30.00 ? 426 GLU B OE1 1 
ATOM 3247 O OE2 . GLU B 2 39  ? -17.663 -47.018 194.215 1.00 30.00 ? 426 GLU B OE2 1 
ATOM 3248 N N   . VAL B 2 40  ? -18.933 -44.283 199.539 1.00 30.00 ? 427 VAL B N   1 
ATOM 3249 C CA  . VAL B 2 40  ? -18.842 -44.409 200.987 1.00 30.00 ? 427 VAL B CA  1 
ATOM 3250 C C   . VAL B 2 40  ? -19.851 -43.473 201.649 1.00 30.00 ? 427 VAL B C   1 
ATOM 3251 O O   . VAL B 2 40  ? -20.473 -43.825 202.645 1.00 30.00 ? 427 VAL B O   1 
ATOM 3252 C CB  . VAL B 2 40  ? -17.417 -44.075 201.484 1.00 30.00 ? 427 VAL B CB  1 
ATOM 3253 C CG1 . VAL B 2 40  ? -17.368 -44.090 203.008 1.00 30.00 ? 427 VAL B CG1 1 
ATOM 3254 C CG2 . VAL B 2 40  ? -16.431 -45.085 200.918 1.00 30.00 ? 427 VAL B CG2 1 
ATOM 3255 N N   . LEU B 2 41  ? -20.019 -42.279 201.083 1.00 30.00 ? 428 LEU B N   1 
ATOM 3256 C CA  . LEU B 2 41  ? -20.960 -41.313 201.632 1.00 30.00 ? 428 LEU B CA  1 
ATOM 3257 C C   . LEU B 2 41  ? -22.394 -41.813 201.520 1.00 30.00 ? 428 LEU B C   1 
ATOM 3258 O O   . LEU B 2 41  ? -23.186 -41.643 202.443 1.00 30.00 ? 428 LEU B O   1 
ATOM 3259 C CB  . LEU B 2 41  ? -20.833 -39.967 200.912 1.00 30.00 ? 428 LEU B CB  1 
ATOM 3260 C CG  . LEU B 2 41  ? -19.663 -39.055 201.288 1.00 30.00 ? 428 LEU B CG  1 
ATOM 3261 C CD1 . LEU B 2 41  ? -19.558 -37.912 200.290 1.00 30.00 ? 428 LEU B CD1 1 
ATOM 3262 C CD2 . LEU B 2 41  ? -19.861 -38.514 202.700 1.00 30.00 ? 428 LEU B CD2 1 
ATOM 3263 N N   . ASP B 2 42  ? -22.721 -42.436 200.391 1.00 30.00 ? 429 ASP B N   1 
ATOM 3264 C CA  . ASP B 2 42  ? -24.070 -42.944 200.165 1.00 30.00 ? 429 ASP B CA  1 
ATOM 3265 C C   . ASP B 2 42  ? -24.391 -44.104 201.111 1.00 30.00 ? 429 ASP B C   1 
ATOM 3266 O O   . ASP B 2 42  ? -25.551 -44.323 201.460 1.00 30.00 ? 429 ASP B O   1 
ATOM 3267 C CB  . ASP B 2 42  ? -24.230 -43.398 198.708 1.00 30.00 ? 429 ASP B CB  1 
ATOM 3268 C CG  . ASP B 2 42  ? -25.616 -43.091 198.144 1.00 30.00 ? 429 ASP B CG  1 
ATOM 3269 O OD1 . ASP B 2 42  ? -26.057 -43.800 197.213 1.00 30.00 ? 429 ASP B OD1 1 
ATOM 3270 O OD2 . ASP B 2 42  ? -26.258 -42.134 198.623 1.00 30.00 ? 429 ASP B OD2 1 
ATOM 3271 N N   . LYS B 2 43  ? -23.364 -44.843 201.523 1.00 30.00 ? 430 LYS B N   1 
ATOM 3272 C CA  . LYS B 2 43  ? -23.537 -45.975 202.432 1.00 30.00 ? 430 LYS B CA  1 
ATOM 3273 C C   . LYS B 2 43  ? -23.676 -45.516 203.878 1.00 30.00 ? 430 LYS B C   1 
ATOM 3274 O O   . LYS B 2 43  ? -24.569 -45.961 204.597 1.00 30.00 ? 430 LYS B O   1 
ATOM 3275 C CB  . LYS B 2 43  ? -22.345 -46.935 202.333 1.00 30.00 ? 430 LYS B CB  1 
ATOM 3276 C CG  . LYS B 2 43  ? -22.309 -47.784 201.075 1.00 30.00 ? 430 LYS B CG  1 
ATOM 3277 C CD  . LYS B 2 43  ? -23.407 -48.841 201.082 1.00 30.00 ? 430 LYS B CD  1 
ATOM 3278 C CE  . LYS B 2 43  ? -23.297 -49.739 199.859 1.00 30.00 ? 430 LYS B CE  1 
ATOM 3279 N NZ  . LYS B 2 43  ? -24.262 -50.872 199.898 1.00 30.00 ? 430 LYS B NZ  1 
ATOM 3280 N N   . VAL B 2 44  ? -22.779 -44.632 204.300 1.00 30.00 ? 431 VAL B N   1 
ATOM 3281 C CA  . VAL B 2 44  ? -22.778 -44.119 205.663 1.00 30.00 ? 431 VAL B CA  1 
ATOM 3282 C C   . VAL B 2 44  ? -23.920 -43.132 205.921 1.00 30.00 ? 431 VAL B C   1 
ATOM 3283 O O   . VAL B 2 44  ? -24.360 -42.966 207.059 1.00 30.00 ? 431 VAL B O   1 
ATOM 3284 C CB  . VAL B 2 44  ? -21.428 -43.434 205.984 1.00 30.00 ? 431 VAL B CB  1 
ATOM 3285 C CG1 . VAL B 2 44  ? -21.428 -42.912 207.403 1.00 30.00 ? 431 VAL B CG1 1 
ATOM 3286 C CG2 . VAL B 2 44  ? -20.290 -44.424 205.798 1.00 30.00 ? 431 VAL B CG2 1 
ATOM 3287 N N   . SER B 2 45  ? -24.392 -42.483 204.862 1.00 30.00 ? 432 SER B N   1 
ATOM 3288 C CA  . SER B 2 45  ? -25.488 -41.517 204.961 1.00 30.00 ? 432 SER B CA  1 
ATOM 3289 C C   . SER B 2 45  ? -26.400 -41.661 203.738 1.00 30.00 ? 432 SER B C   1 
ATOM 3290 O O   . SER B 2 45  ? -26.367 -40.843 202.822 1.00 30.00 ? 432 SER B O   1 
ATOM 3291 C CB  . SER B 2 45  ? -24.925 -40.098 205.031 1.00 30.00 ? 432 SER B CB  1 
ATOM 3292 O OG  . SER B 2 45  ? -25.961 -39.141 205.152 1.00 30.00 ? 432 SER B OG  1 
ATOM 3293 N N   . PRO B 2 46  ? -27.243 -42.708 203.727 1.00 30.00 ? 433 PRO B N   1 
ATOM 3294 C CA  . PRO B 2 46  ? -28.184 -43.027 202.649 1.00 30.00 ? 433 PRO B CA  1 
ATOM 3295 C C   . PRO B 2 46  ? -28.895 -41.843 201.997 1.00 30.00 ? 433 PRO B C   1 
ATOM 3296 O O   . PRO B 2 46  ? -29.385 -40.942 202.677 1.00 30.00 ? 433 PRO B O   1 
ATOM 3297 C CB  . PRO B 2 46  ? -29.158 -43.987 203.322 1.00 30.00 ? 433 PRO B CB  1 
ATOM 3298 C CG  . PRO B 2 46  ? -28.278 -44.715 204.281 1.00 30.00 ? 433 PRO B CG  1 
ATOM 3299 C CD  . PRO B 2 46  ? -27.474 -43.588 204.889 1.00 30.00 ? 433 PRO B CD  1 
ATOM 3300 N N   . SER B 2 47  ? -28.942 -41.867 200.667 1.00 30.00 ? 434 SER B N   1 
ATOM 3301 C CA  . SER B 2 47  ? -29.597 -40.832 199.875 1.00 30.00 ? 434 SER B CA  1 
ATOM 3302 C C   . SER B 2 47  ? -28.937 -39.461 199.956 1.00 30.00 ? 434 SER B C   1 
ATOM 3303 O O   . SER B 2 47  ? -29.497 -38.472 199.480 1.00 30.00 ? 434 SER B O   1 
ATOM 3304 C CB  . SER B 2 47  ? -31.064 -40.711 200.291 1.00 30.00 ? 434 SER B CB  1 
ATOM 3305 O OG  . SER B 2 47  ? -31.723 -41.959 200.161 1.00 30.00 ? 434 SER B OG  1 
ATOM 3306 N N   . SER B 2 48  ? -27.746 -39.391 200.544 1.00 30.00 ? 435 SER B N   1 
ATOM 3307 C CA  . SER B 2 48  ? -27.060 -38.107 200.657 1.00 30.00 ? 435 SER B CA  1 
ATOM 3308 C C   . SER B 2 48  ? -26.433 -37.657 199.339 1.00 30.00 ? 435 SER B C   1 
ATOM 3309 O O   . SER B 2 48  ? -26.287 -36.459 199.096 1.00 30.00 ? 435 SER B O   1 
ATOM 3310 C CB  . SER B 2 48  ? -25.967 -38.170 201.729 1.00 30.00 ? 435 SER B CB  1 
ATOM 3311 O OG  . SER B 2 48  ? -24.913 -39.034 201.348 1.00 30.00 ? 435 SER B OG  1 
ATOM 3312 N N   . VAL B 2 49  ? -26.071 -38.616 198.491 1.00 30.00 ? 436 VAL B N   1 
ATOM 3313 C CA  . VAL B 2 49  ? -25.434 -38.309 197.213 1.00 30.00 ? 436 VAL B CA  1 
ATOM 3314 C C   . VAL B 2 49  ? -26.403 -38.175 196.045 1.00 30.00 ? 436 VAL B C   1 
ATOM 3315 O O   . VAL B 2 49  ? -27.317 -38.982 195.880 1.00 30.00 ? 436 VAL B O   1 
ATOM 3316 C CB  . VAL B 2 49  ? -24.381 -39.390 196.845 1.00 30.00 ? 436 VAL B CB  1 
ATOM 3317 C CG1 . VAL B 2 49  ? -23.767 -39.082 195.483 1.00 30.00 ? 436 VAL B CG1 1 
ATOM 3318 C CG2 . VAL B 2 49  ? -23.293 -39.448 197.907 1.00 30.00 ? 436 VAL B CG2 1 
ATOM 3319 N N   . ASN B 2 50  ? -26.191 -37.142 195.236 1.00 30.00 ? 437 ASN B N   1 
ATOM 3320 C CA  . ASN B 2 50  ? -27.012 -36.902 194.055 1.00 30.00 ? 437 ASN B CA  1 
ATOM 3321 C C   . ASN B 2 50  ? -26.206 -37.394 192.858 1.00 30.00 ? 437 ASN B C   1 
ATOM 3322 O O   . ASN B 2 50  ? -25.352 -36.678 192.331 1.00 30.00 ? 437 ASN B O   1 
ATOM 3323 C CB  . ASN B 2 50  ? -27.318 -35.409 193.909 1.00 30.00 ? 437 ASN B CB  1 
ATOM 3324 C CG  . ASN B 2 50  ? -28.091 -35.087 192.637 1.00 30.00 ? 437 ASN B CG  1 
ATOM 3325 O OD1 . ASN B 2 50  ? -28.548 -33.960 192.450 1.00 30.00 ? 437 ASN B OD1 1 
ATOM 3326 N ND2 . ASN B 2 50  ? -28.236 -36.074 191.757 1.00 30.00 ? 437 ASN B ND2 1 
ATOM 3327 N N   . TRP B 2 51  ? -26.489 -38.623 192.439 1.00 30.00 ? 438 TRP B N   1 
ATOM 3328 C CA  . TRP B 2 51  ? -25.783 -39.248 191.330 1.00 30.00 ? 438 TRP B CA  1 
ATOM 3329 C C   . TRP B 2 51  ? -26.047 -38.614 189.970 1.00 30.00 ? 438 TRP B C   1 
ATOM 3330 O O   . TRP B 2 51  ? -25.337 -38.889 189.006 1.00 30.00 ? 438 TRP B O   1 
ATOM 3331 C CB  . TRP B 2 51  ? -26.117 -40.740 191.293 1.00 30.00 ? 438 TRP B CB  1 
ATOM 3332 C CG  . TRP B 2 51  ? -25.821 -41.400 192.606 1.00 30.00 ? 438 TRP B CG  1 
ATOM 3333 C CD1 . TRP B 2 51  ? -26.710 -41.670 193.607 1.00 30.00 ? 438 TRP B CD1 1 
ATOM 3334 C CD2 . TRP B 2 51  ? -24.532 -41.786 193.097 1.00 30.00 ? 438 TRP B CD2 1 
ATOM 3335 N NE1 . TRP B 2 51  ? -26.052 -42.195 194.695 1.00 30.00 ? 438 TRP B NE1 1 
ATOM 3336 C CE2 . TRP B 2 51  ? -24.714 -42.280 194.407 1.00 30.00 ? 438 TRP B CE2 1 
ATOM 3337 C CE3 . TRP B 2 51  ? -23.239 -41.763 192.554 1.00 30.00 ? 438 TRP B CE3 1 
ATOM 3338 C CZ2 . TRP B 2 51  ? -23.649 -42.742 195.188 1.00 30.00 ? 438 TRP B CZ2 1 
ATOM 3339 C CZ3 . TRP B 2 51  ? -22.177 -42.224 193.332 1.00 30.00 ? 438 TRP B CZ3 1 
ATOM 3340 C CH2 . TRP B 2 51  ? -22.393 -42.706 194.635 1.00 30.00 ? 438 TRP B CH2 1 
ATOM 3341 N N   . LYS B 2 52  ? -27.055 -37.756 189.895 1.00 30.00 ? 439 LYS B N   1 
ATOM 3342 C CA  . LYS B 2 52  ? -27.375 -37.089 188.645 1.00 30.00 ? 439 LYS B CA  1 
ATOM 3343 C C   . LYS B 2 52  ? -26.290 -36.056 188.327 1.00 30.00 ? 439 LYS B C   1 
ATOM 3344 O O   . LYS B 2 52  ? -26.158 -35.612 187.189 1.00 30.00 ? 439 LYS B O   1 
ATOM 3345 C CB  . LYS B 2 52  ? -28.745 -36.414 188.749 1.00 30.00 ? 439 LYS B CB  1 
ATOM 3346 C CG  . LYS B 2 52  ? -29.320 -35.957 187.423 1.00 30.00 ? 439 LYS B CG  1 
ATOM 3347 C CD  . LYS B 2 52  ? -30.722 -35.392 187.596 1.00 30.00 ? 439 LYS B CD  1 
ATOM 3348 C CE  . LYS B 2 52  ? -31.305 -34.956 186.261 1.00 30.00 ? 439 LYS B CE  1 
ATOM 3349 N NZ  . LYS B 2 52  ? -32.585 -34.211 186.425 1.00 30.00 ? 439 LYS B NZ  1 
ATOM 3350 N N   . HIS B 2 53  ? -25.507 -35.687 189.338 1.00 30.00 ? 440 HIS B N   1 
ATOM 3351 C CA  . HIS B 2 53  ? -24.434 -34.710 189.160 1.00 30.00 ? 440 HIS B CA  1 
ATOM 3352 C C   . HIS B 2 53  ? -23.056 -35.330 189.363 1.00 30.00 ? 440 HIS B C   1 
ATOM 3353 O O   . HIS B 2 53  ? -22.078 -34.627 189.622 1.00 30.00 ? 440 HIS B O   1 
ATOM 3354 C CB  . HIS B 2 53  ? -24.609 -33.542 190.135 1.00 30.00 ? 440 HIS B CB  1 
ATOM 3355 C CG  . HIS B 2 53  ? -25.832 -32.719 189.879 1.00 30.00 ? 440 HIS B CG  1 
ATOM 3356 N ND1 . HIS B 2 53  ? -26.087 -32.126 188.662 1.00 30.00 ? 440 HIS B ND1 1 
ATOM 3357 C CD2 . HIS B 2 53  ? -26.866 -32.385 190.685 1.00 30.00 ? 440 HIS B CD2 1 
ATOM 3358 C CE1 . HIS B 2 53  ? -27.229 -31.463 188.729 1.00 30.00 ? 440 HIS B CE1 1 
ATOM 3359 N NE2 . HIS B 2 53  ? -27.722 -31.606 189.946 1.00 30.00 ? 440 HIS B NE2 1 
ATOM 3360 N N   . ALA B 2 54  ? -22.983 -36.649 189.244 1.00 30.00 ? 441 ALA B N   1 
ATOM 3361 C CA  . ALA B 2 54  ? -21.723 -37.359 189.416 1.00 30.00 ? 441 ALA B CA  1 
ATOM 3362 C C   . ALA B 2 54  ? -21.383 -38.129 188.149 1.00 30.00 ? 441 ALA B C   1 
ATOM 3363 O O   . ALA B 2 54  ? -22.270 -38.488 187.379 1.00 30.00 ? 441 ALA B O   1 
ATOM 3364 C CB  . ALA B 2 54  ? -21.821 -38.313 190.599 1.00 30.00 ? 441 ALA B CB  1 
ATOM 3365 N N   . SER B 2 55  ? -20.095 -38.376 187.936 1.00 30.00 ? 442 SER B N   1 
ATOM 3366 C CA  . SER B 2 55  ? -19.644 -39.103 186.758 1.00 30.00 ? 442 SER B CA  1 
ATOM 3367 C C   . SER B 2 55  ? -18.940 -40.395 187.144 1.00 30.00 ? 442 SER B C   1 
ATOM 3368 O O   . SER B 2 55  ? -17.992 -40.394 187.928 1.00 30.00 ? 442 SER B O   1 
ATOM 3369 C CB  . SER B 2 55  ? -18.711 -38.225 185.930 1.00 30.00 ? 442 SER B CB  1 
ATOM 3370 O OG  . SER B 2 55  ? -19.358 -37.017 185.573 1.00 30.00 ? 442 SER B OG  1 
ATOM 3371 N N   . LYS B 2 56  ? -19.415 -41.500 186.580 1.00 30.00 ? 443 LYS B N   1 
ATOM 3372 C CA  . LYS B 2 56  ? -18.863 -42.822 186.854 1.00 30.00 ? 443 LYS B CA  1 
ATOM 3373 C C   . LYS B 2 56  ? -17.616 -43.122 186.024 1.00 30.00 ? 443 LYS B C   1 
ATOM 3374 O O   . LYS B 2 56  ? -17.588 -42.879 184.819 1.00 30.00 ? 443 LYS B O   1 
ATOM 3375 C CB  . LYS B 2 56  ? -19.937 -43.882 186.590 1.00 30.00 ? 443 LYS B CB  1 
ATOM 3376 C CG  . LYS B 2 56  ? -19.442 -45.316 186.553 1.00 30.00 ? 443 LYS B CG  1 
ATOM 3377 C CD  . LYS B 2 56  ? -20.613 -46.277 186.416 1.00 30.00 ? 443 LYS B CD  1 
ATOM 3378 C CE  . LYS B 2 56  ? -20.169 -47.617 185.871 1.00 30.00 ? 443 LYS B CE  1 
ATOM 3379 N NZ  . LYS B 2 56  ? -19.615 -47.473 184.496 1.00 30.00 ? 443 LYS B NZ  1 
ATOM 3380 N N   . PRO B 2 57  ? -16.563 -43.657 186.668 1.00 30.00 ? 444 PRO B N   1 
ATOM 3381 C CA  . PRO B 2 57  ? -15.312 -43.991 185.980 1.00 30.00 ? 444 PRO B CA  1 
ATOM 3382 C C   . PRO B 2 57  ? -15.484 -45.138 184.984 1.00 30.00 ? 444 PRO B C   1 
ATOM 3383 O O   . PRO B 2 57  ? -16.474 -45.872 185.039 1.00 30.00 ? 444 PRO B O   1 
ATOM 3384 C CB  . PRO B 2 57  ? -14.373 -44.351 187.129 1.00 30.00 ? 444 PRO B CB  1 
ATOM 3385 C CG  . PRO B 2 57  ? -15.309 -44.902 188.168 1.00 30.00 ? 444 PRO B CG  1 
ATOM 3386 C CD  . PRO B 2 57  ? -16.465 -43.936 188.112 1.00 30.00 ? 444 PRO B CD  1 
ATOM 3387 N N   . PRO B 2 58  ? -14.520 -45.310 184.062 1.00 30.00 ? 445 PRO B N   1 
ATOM 3388 C CA  . PRO B 2 58  ? -13.303 -44.502 183.923 1.00 30.00 ? 445 PRO B CA  1 
ATOM 3389 C C   . PRO B 2 58  ? -13.587 -43.050 183.560 1.00 30.00 ? 445 PRO B C   1 
ATOM 3390 O O   . PRO B 2 58  ? -14.547 -42.757 182.846 1.00 30.00 ? 445 PRO B O   1 
ATOM 3391 C CB  . PRO B 2 58  ? -12.535 -45.231 182.828 1.00 30.00 ? 445 PRO B CB  1 
ATOM 3392 C CG  . PRO B 2 58  ? -13.631 -45.747 181.954 1.00 30.00 ? 445 PRO B CG  1 
ATOM 3393 C CD  . PRO B 2 58  ? -14.613 -46.295 182.969 1.00 30.00 ? 445 PRO B CD  1 
ATOM 3394 N N   . ILE B 2 59  ? -12.749 -42.145 184.058 1.00 30.00 ? 446 ILE B N   1 
ATOM 3395 C CA  . ILE B 2 59  ? -12.905 -40.721 183.790 1.00 30.00 ? 446 ILE B CA  1 
ATOM 3396 C C   . ILE B 2 59  ? -11.647 -40.140 183.153 1.00 30.00 ? 446 ILE B C   1 
ATOM 3397 O O   . ILE B 2 59  ? -10.546 -40.266 183.690 1.00 30.00 ? 446 ILE B O   1 
ATOM 3398 C CB  . ILE B 2 59  ? -13.199 -39.926 185.086 1.00 30.00 ? 446 ILE B CB  1 
ATOM 3399 C CG1 . ILE B 2 59  ? -14.418 -40.513 185.801 1.00 30.00 ? 446 ILE B CG1 1 
ATOM 3400 C CG2 . ILE B 2 59  ? -13.445 -38.457 184.754 1.00 30.00 ? 446 ILE B CG2 1 
ATOM 3401 C CD1 . ILE B 2 59  ? -14.774 -39.793 187.092 1.00 30.00 ? 446 ILE B CD1 1 
ATOM 3402 N N   . LYS B 2 60  ? -11.820 -39.504 182.000 1.00 30.00 ? 447 LYS B N   1 
ATOM 3403 C CA  . LYS B 2 60  ? -10.710 -38.888 181.291 1.00 30.00 ? 447 LYS B CA  1 
ATOM 3404 C C   . LYS B 2 60  ? -10.796 -37.383 181.500 1.00 30.00 ? 447 LYS B C   1 
ATOM 3405 O O   . LYS B 2 60  ? -9.800  -36.722 181.803 1.00 30.00 ? 447 LYS B O   1 
ATOM 3406 C CB  . LYS B 2 60  ? -10.796 -39.201 179.793 1.00 30.00 ? 447 LYS B CB  1 
ATOM 3407 C CG  . LYS B 2 60  ? -9.823  -38.400 178.945 1.00 30.00 ? 447 LYS B CG  1 
ATOM 3408 C CD  . LYS B 2 60  ? -10.032 -38.642 177.461 1.00 30.00 ? 447 LYS B CD  1 
ATOM 3409 C CE  . LYS B 2 60  ? -9.168  -37.700 176.638 1.00 30.00 ? 447 LYS B CE  1 
ATOM 3410 N NZ  . LYS B 2 60  ? -7.731  -37.815 177.010 1.00 30.00 ? 447 LYS B NZ  1 
ATOM 3411 N N   . MET B 2 61  ? -12.002 -36.855 181.336 1.00 30.00 ? 448 MET B N   1 
ATOM 3412 C CA  . MET B 2 61  ? -12.249 -35.433 181.493 1.00 30.00 ? 448 MET B CA  1 
ATOM 3413 C C   . MET B 2 61  ? -12.027 -34.993 182.936 1.00 30.00 ? 448 MET B C   1 
ATOM 3414 O O   . MET B 2 61  ? -12.691 -35.476 183.855 1.00 30.00 ? 448 MET B O   1 
ATOM 3415 C CB  . MET B 2 61  ? -13.679 -35.108 181.064 1.00 30.00 ? 448 MET B CB  1 
ATOM 3416 C CG  . MET B 2 61  ? -14.020 -35.588 179.662 1.00 30.00 ? 448 MET B CG  1 
ATOM 3417 S SD  . MET B 2 61  ? -12.894 -34.924 178.418 1.00 30.00 ? 448 MET B SD  1 
ATOM 3418 C CE  . MET B 2 61  ? -13.524 -33.253 178.267 1.00 30.00 ? 448 MET B CE  1 
ATOM 3419 N N   . PRO B 2 62  ? -11.076 -34.074 183.157 1.00 30.00 ? 449 PRO B N   1 
ATOM 3420 C CA  . PRO B 2 62  ? -10.774 -33.573 184.499 1.00 30.00 ? 449 PRO B CA  1 
ATOM 3421 C C   . PRO B 2 62  ? -11.947 -32.853 185.162 1.00 30.00 ? 449 PRO B C   1 
ATOM 3422 O O   . PRO B 2 62  ? -12.087 -32.884 186.386 1.00 30.00 ? 449 PRO B O   1 
ATOM 3423 C CB  . PRO B 2 62  ? -9.572  -32.657 184.265 1.00 30.00 ? 449 PRO B CB  1 
ATOM 3424 C CG  . PRO B 2 62  ? -9.741  -32.214 182.851 1.00 30.00 ? 449 PRO B CG  1 
ATOM 3425 C CD  . PRO B 2 62  ? -10.163 -33.486 182.163 1.00 30.00 ? 449 PRO B CD  1 
ATOM 3426 N N   . PHE B 2 63  ? -12.793 -32.209 184.362 1.00 30.00 ? 450 PHE B N   1 
ATOM 3427 C CA  . PHE B 2 63  ? -13.945 -31.508 184.918 1.00 30.00 ? 450 PHE B CA  1 
ATOM 3428 C C   . PHE B 2 63  ? -14.809 -32.454 185.746 1.00 30.00 ? 450 PHE B C   1 
ATOM 3429 O O   . PHE B 2 63  ? -15.254 -32.108 186.839 1.00 30.00 ? 450 PHE B O   1 
ATOM 3430 C CB  . PHE B 2 63  ? -14.813 -30.900 183.812 1.00 30.00 ? 450 PHE B CB  1 
ATOM 3431 C CG  . PHE B 2 63  ? -16.143 -30.402 184.303 1.00 30.00 ? 450 PHE B CG  1 
ATOM 3432 C CD1 . PHE B 2 63  ? -16.219 -29.303 185.155 1.00 30.00 ? 450 PHE B CD1 1 
ATOM 3433 C CD2 . PHE B 2 63  ? -17.319 -31.066 183.962 1.00 30.00 ? 450 PHE B CD2 1 
ATOM 3434 C CE1 . PHE B 2 63  ? -17.446 -28.872 185.663 1.00 30.00 ? 450 PHE B CE1 1 
ATOM 3435 C CE2 . PHE B 2 63  ? -18.548 -30.645 184.464 1.00 30.00 ? 450 PHE B CE2 1 
ATOM 3436 C CZ  . PHE B 2 63  ? -18.613 -29.544 185.319 1.00 30.00 ? 450 PHE B CZ  1 
ATOM 3437 N N   . ARG B 2 64  ? -15.047 -33.647 185.215 1.00 30.00 ? 451 ARG B N   1 
ATOM 3438 C CA  . ARG B 2 64  ? -15.865 -34.630 185.908 1.00 30.00 ? 451 ARG B CA  1 
ATOM 3439 C C   . ARG B 2 64  ? -15.250 -35.091 187.225 1.00 30.00 ? 451 ARG B C   1 
ATOM 3440 O O   . ARG B 2 64  ? -15.967 -35.466 188.148 1.00 30.00 ? 451 ARG B O   1 
ATOM 3441 C CB  . ARG B 2 64  ? -16.136 -35.829 184.993 1.00 30.00 ? 451 ARG B CB  1 
ATOM 3442 C CG  . ARG B 2 64  ? -17.149 -35.527 183.901 1.00 30.00 ? 451 ARG B CG  1 
ATOM 3443 C CD  . ARG B 2 64  ? -17.458 -36.747 183.052 1.00 30.00 ? 451 ARG B CD  1 
ATOM 3444 N NE  . ARG B 2 64  ? -18.811 -36.692 182.498 1.00 30.00 ? 451 ARG B NE  1 
ATOM 3445 C CZ  . ARG B 2 64  ? -19.240 -35.768 181.647 1.00 30.00 ? 451 ARG B CZ  1 
ATOM 3446 N NH1 . ARG B 2 64  ? -18.423 -34.810 181.236 1.00 30.00 ? 451 ARG B NH1 1 
ATOM 3447 N NH2 . ARG B 2 64  ? -20.493 -35.793 181.215 1.00 30.00 ? 451 ARG B NH2 1 
ATOM 3448 N N   . LYS B 2 65  ? -13.925 -35.058 187.310 1.00 30.00 ? 452 LYS B N   1 
ATOM 3449 C CA  . LYS B 2 65  ? -13.234 -35.461 188.530 1.00 30.00 ? 452 LYS B CA  1 
ATOM 3450 C C   . LYS B 2 65  ? -13.429 -34.412 189.612 1.00 30.00 ? 452 LYS B C   1 
ATOM 3451 O O   . LYS B 2 65  ? -13.779 -34.730 190.749 1.00 30.00 ? 452 LYS B O   1 
ATOM 3452 C CB  . LYS B 2 65  ? -11.737 -35.643 188.269 1.00 30.00 ? 452 LYS B CB  1 
ATOM 3453 C CG  . LYS B 2 65  ? -11.398 -36.831 187.390 1.00 30.00 ? 452 LYS B CG  1 
ATOM 3454 C CD  . LYS B 2 65  ? -9.896  -37.022 187.261 1.00 30.00 ? 452 LYS B CD  1 
ATOM 3455 C CE  . LYS B 2 65  ? -9.589  -38.281 186.463 1.00 30.00 ? 452 LYS B CE  1 
ATOM 3456 N NZ  . LYS B 2 65  ? -8.137  -38.596 186.430 1.00 30.00 ? 452 LYS B NZ  1 
ATOM 3457 N N   . VAL B 2 66  ? -13.200 -33.155 189.245 1.00 30.00 ? 453 VAL B N   1 
ATOM 3458 C CA  . VAL B 2 66  ? -13.340 -32.047 190.178 1.00 30.00 ? 453 VAL B CA  1 
ATOM 3459 C C   . VAL B 2 66  ? -14.780 -31.910 190.664 1.00 30.00 ? 453 VAL B C   1 
ATOM 3460 O O   . VAL B 2 66  ? -15.021 -31.560 191.817 1.00 30.00 ? 453 VAL B O   1 
ATOM 3461 C CB  . VAL B 2 66  ? -12.866 -30.732 189.522 1.00 30.00 ? 453 VAL B CB  1 
ATOM 3462 C CG1 . VAL B 2 66  ? -13.088 -29.552 190.451 1.00 30.00 ? 453 VAL B CG1 1 
ATOM 3463 C CG2 . VAL B 2 66  ? -11.391 -30.851 189.175 1.00 30.00 ? 453 VAL B CG2 1 
ATOM 3464 N N   . GLU B 2 67  ? -15.736 -32.203 189.791 1.00 30.00 ? 454 GLU B N   1 
ATOM 3465 C CA  . GLU B 2 67  ? -17.143 -32.099 190.161 1.00 30.00 ? 454 GLU B CA  1 
ATOM 3466 C C   . GLU B 2 67  ? -17.512 -33.140 191.212 1.00 30.00 ? 454 GLU B C   1 
ATOM 3467 O O   . GLU B 2 67  ? -18.219 -32.833 192.169 1.00 30.00 ? 454 GLU B O   1 
ATOM 3468 C CB  . GLU B 2 67  ? -18.042 -32.266 188.935 1.00 30.00 ? 454 GLU B CB  1 
ATOM 3469 C CG  . GLU B 2 67  ? -19.398 -31.596 189.094 1.00 30.00 ? 454 GLU B CG  1 
ATOM 3470 C CD  . GLU B 2 67  ? -20.373 -31.954 187.989 1.00 30.00 ? 454 GLU B CD  1 
ATOM 3471 O OE1 . GLU B 2 67  ? -21.385 -31.235 187.839 1.00 30.00 ? 454 GLU B OE1 1 
ATOM 3472 O OE2 . GLU B 2 67  ? -20.134 -32.955 187.280 1.00 30.00 ? 454 GLU B OE2 1 
ATOM 3473 N N   . ASN B 2 68  ? -17.038 -34.373 191.037 1.00 30.00 ? 455 ASN B N   1 
ATOM 3474 C CA  . ASN B 2 68  ? -17.330 -35.433 191.997 1.00 30.00 ? 455 ASN B CA  1 
ATOM 3475 C C   . ASN B 2 68  ? -16.782 -35.077 193.373 1.00 30.00 ? 455 ASN B C   1 
ATOM 3476 O O   . ASN B 2 68  ? -17.486 -35.178 194.379 1.00 30.00 ? 455 ASN B O   1 
ATOM 3477 C CB  . ASN B 2 68  ? -16.719 -36.765 191.557 1.00 30.00 ? 455 ASN B CB  1 
ATOM 3478 C CG  . ASN B 2 68  ? -17.428 -37.374 190.367 1.00 30.00 ? 455 ASN B CG  1 
ATOM 3479 O OD1 . ASN B 2 68  ? -18.530 -36.965 190.011 1.00 30.00 ? 455 ASN B OD1 1 
ATOM 3480 N ND2 . ASN B 2 68  ? -16.802 -38.373 189.755 1.00 30.00 ? 455 ASN B ND2 1 
ATOM 3481 N N   . CYS B 2 69  ? -15.520 -34.664 193.408 1.00 30.00 ? 456 CYS B N   1 
ATOM 3482 C CA  . CYS B 2 69  ? -14.858 -34.303 194.652 1.00 30.00 ? 456 CYS B CA  1 
ATOM 3483 C C   . CYS B 2 69  ? -15.492 -33.099 195.350 1.00 30.00 ? 456 CYS B C   1 
ATOM 3484 O O   . CYS B 2 69  ? -15.485 -33.015 196.579 1.00 30.00 ? 456 CYS B O   1 
ATOM 3485 C CB  . CYS B 2 69  ? -13.366 -34.055 194.396 1.00 30.00 ? 456 CYS B CB  1 
ATOM 3486 S SG  . CYS B 2 69  ? -12.464 -35.552 193.847 1.00 30.00 ? 456 CYS B SG  1 
ATOM 3487 N N   . ASN B 2 70  ? -16.038 -32.166 194.582 1.00 30.00 ? 457 ASN B N   1 
ATOM 3488 C CA  . ASN B 2 70  ? -16.680 -31.004 195.190 1.00 30.00 ? 457 ASN B CA  1 
ATOM 3489 C C   . ASN B 2 70  ? -17.985 -31.421 195.872 1.00 30.00 ? 457 ASN B C   1 
ATOM 3490 O O   . ASN B 2 70  ? -18.363 -30.836 196.886 1.00 30.00 ? 457 ASN B O   1 
ATOM 3491 C CB  . ASN B 2 70  ? -16.935 -29.913 194.145 1.00 30.00 ? 457 ASN B CB  1 
ATOM 3492 C CG  . ASN B 2 70  ? -15.759 -28.950 194.005 1.00 30.00 ? 457 ASN B CG  1 
ATOM 3493 O OD1 . ASN B 2 70  ? -15.557 -28.343 192.955 1.00 30.00 ? 457 ASN B OD1 1 
ATOM 3494 N ND2 . ASN B 2 70  ? -14.990 -28.797 195.074 1.00 30.00 ? 457 ASN B ND2 1 
ATOM 3495 N N   . GLN B 2 71  ? -18.673 -32.430 195.339 1.00 30.00 ? 458 GLN B N   1 
ATOM 3496 C CA  . GLN B 2 71  ? -19.905 -32.874 195.985 1.00 30.00 ? 458 GLN B CA  1 
ATOM 3497 C C   . GLN B 2 71  ? -19.498 -33.595 197.260 1.00 30.00 ? 458 GLN B C   1 
ATOM 3498 O O   . GLN B 2 71  ? -20.195 -33.529 198.270 1.00 30.00 ? 458 GLN B O   1 
ATOM 3499 C CB  . GLN B 2 71  ? -20.728 -33.825 195.103 1.00 30.00 ? 458 GLN B CB  1 
ATOM 3500 C CG  . GLN B 2 71  ? -22.217 -33.819 195.497 1.00 30.00 ? 458 GLN B CG  1 
ATOM 3501 C CD  . GLN B 2 71  ? -23.035 -34.941 194.876 1.00 30.00 ? 458 GLN B CD  1 
ATOM 3502 O OE1 . GLN B 2 71  ? -22.912 -35.246 193.688 1.00 30.00 ? 458 GLN B OE1 1 
ATOM 3503 N NE2 . GLN B 2 71  ? -23.895 -35.549 195.682 1.00 30.00 ? 458 GLN B NE2 1 
ATOM 3504 N N   . VAL B 2 72  ? -18.361 -34.284 197.203 1.00 30.00 ? 459 VAL B N   1 
ATOM 3505 C CA  . VAL B 2 72  ? -17.850 -34.997 198.366 1.00 30.00 ? 459 VAL B CA  1 
ATOM 3506 C C   . VAL B 2 72  ? -17.612 -34.006 199.495 1.00 30.00 ? 459 VAL B C   1 
ATOM 3507 O O   . VAL B 2 72  ? -17.997 -34.249 200.636 1.00 30.00 ? 459 VAL B O   1 
ATOM 3508 C CB  . VAL B 2 72  ? -16.520 -35.724 198.059 1.00 30.00 ? 459 VAL B CB  1 
ATOM 3509 C CG1 . VAL B 2 72  ? -15.905 -36.259 199.354 1.00 30.00 ? 459 VAL B CG1 1 
ATOM 3510 C CG2 . VAL B 2 72  ? -16.767 -36.870 197.087 1.00 30.00 ? 459 VAL B CG2 1 
ATOM 3511 N N   . ILE B 2 73  ? -16.982 -32.884 199.167 1.00 30.00 ? 460 ILE B N   1 
ATOM 3512 C CA  . ILE B 2 73  ? -16.702 -31.859 200.160 1.00 30.00 ? 460 ILE B CA  1 
ATOM 3513 C C   . ILE B 2 73  ? -17.995 -31.230 200.661 1.00 30.00 ? 460 ILE B C   1 
ATOM 3514 O O   . ILE B 2 73  ? -18.162 -31.023 201.862 1.00 30.00 ? 460 ILE B O   1 
ATOM 3515 C CB  . ILE B 2 73  ? -15.788 -30.746 199.585 1.00 30.00 ? 460 ILE B CB  1 
ATOM 3516 C CG1 . ILE B 2 73  ? -14.411 -31.328 199.250 1.00 30.00 ? 460 ILE B CG1 1 
ATOM 3517 C CG2 . ILE B 2 73  ? -15.665 -29.598 200.580 1.00 30.00 ? 460 ILE B CG2 1 
ATOM 3518 C CD1 . ILE B 2 73  ? -13.704 -31.970 200.432 1.00 30.00 ? 460 ILE B CD1 1 
ATOM 3519 N N   . LYS B 2 74  ? -18.915 -30.937 199.747 1.00 30.00 ? 461 LYS B N   1 
ATOM 3520 C CA  . LYS B 2 74  ? -20.178 -30.330 200.142 1.00 30.00 ? 461 LYS B CA  1 
ATOM 3521 C C   . LYS B 2 74  ? -20.910 -31.193 201.167 1.00 30.00 ? 461 LYS B C   1 
ATOM 3522 O O   . LYS B 2 74  ? -21.249 -30.718 202.248 1.00 30.00 ? 461 LYS B O   1 
ATOM 3523 C CB  . LYS B 2 74  ? -21.097 -30.108 198.934 1.00 30.00 ? 461 LYS B CB  1 
ATOM 3524 C CG  . LYS B 2 74  ? -22.365 -29.358 199.318 1.00 30.00 ? 461 LYS B CG  1 
ATOM 3525 C CD  . LYS B 2 74  ? -23.593 -29.828 198.562 1.00 30.00 ? 461 LYS B CD  1 
ATOM 3526 C CE  . LYS B 2 74  ? -23.653 -29.265 197.160 1.00 30.00 ? 461 LYS B CE  1 
ATOM 3527 N NZ  . LYS B 2 74  ? -25.012 -29.475 196.576 1.00 30.00 ? 461 LYS B NZ  1 
ATOM 3528 N N   . ILE B 2 75  ? -21.149 -32.457 200.827 1.00 30.00 ? 462 ILE B N   1 
ATOM 3529 C CA  . ILE B 2 75  ? -21.846 -33.363 201.739 1.00 30.00 ? 462 ILE B CA  1 
ATOM 3530 C C   . ILE B 2 75  ? -21.081 -33.502 203.053 1.00 30.00 ? 462 ILE B C   1 
ATOM 3531 O O   . ILE B 2 75  ? -21.678 -33.701 204.112 1.00 30.00 ? 462 ILE B O   1 
ATOM 3532 C CB  . ILE B 2 75  ? -22.023 -34.771 201.129 1.00 30.00 ? 462 ILE B CB  1 
ATOM 3533 C CG1 . ILE B 2 75  ? -22.727 -34.673 199.771 1.00 30.00 ? 462 ILE B CG1 1 
ATOM 3534 C CG2 . ILE B 2 75  ? -22.842 -35.646 202.080 1.00 30.00 ? 462 ILE B CG2 1 
ATOM 3535 C CD1 . ILE B 2 75  ? -22.919 -36.010 199.087 1.00 30.00 ? 462 ILE B CD1 1 
ATOM 3536 N N   . GLY B 2 76  ? -19.757 -33.401 202.976 1.00 30.00 ? 463 GLY B N   1 
ATOM 3537 C CA  . GLY B 2 76  ? -18.939 -33.510 204.169 1.00 30.00 ? 463 GLY B CA  1 
ATOM 3538 C C   . GLY B 2 76  ? -19.213 -32.360 205.114 1.00 30.00 ? 463 GLY B C   1 
ATOM 3539 O O   . GLY B 2 76  ? -19.375 -32.564 206.315 1.00 30.00 ? 463 GLY B O   1 
ATOM 3540 N N   . LYS B 2 77  ? -19.267 -31.149 204.571 1.00 30.00 ? 464 LYS B N   1 
ATOM 3541 C CA  . LYS B 2 77  ? -19.536 -29.963 205.377 1.00 30.00 ? 464 LYS B CA  1 
ATOM 3542 C C   . LYS B 2 77  ? -20.975 -29.961 205.879 1.00 30.00 ? 464 LYS B C   1 
ATOM 3543 O O   . LYS B 2 77  ? -21.268 -29.440 206.957 1.00 30.00 ? 464 LYS B O   1 
ATOM 3544 C CB  . LYS B 2 77  ? -19.272 -28.689 204.568 1.00 30.00 ? 464 LYS B CB  1 
ATOM 3545 C CG  . LYS B 2 77  ? -17.813 -28.463 204.229 1.00 30.00 ? 464 LYS B CG  1 
ATOM 3546 C CD  . LYS B 2 77  ? -17.576 -27.052 203.720 1.00 30.00 ? 464 LYS B CD  1 
ATOM 3547 C CE  . LYS B 2 77  ? -16.104 -26.833 203.404 1.00 30.00 ? 464 LYS B CE  1 
ATOM 3548 N NZ  . LYS B 2 77  ? -15.815 -25.421 203.053 1.00 30.00 ? 464 LYS B NZ  1 
ATOM 3549 N N   . GLN B 2 78  ? -21.875 -30.538 205.090 1.00 30.00 ? 465 GLN B N   1 
ATOM 3550 C CA  . GLN B 2 78  ? -23.274 -30.617 205.481 1.00 30.00 ? 465 GLN B CA  1 
ATOM 3551 C C   . GLN B 2 78  ? -23.416 -31.523 206.699 1.00 30.00 ? 465 GLN B C   1 
ATOM 3552 O O   . GLN B 2 78  ? -24.267 -31.294 207.555 1.00 30.00 ? 465 GLN B O   1 
ATOM 3553 C CB  . GLN B 2 78  ? -24.122 -31.154 204.324 1.00 30.00 ? 465 GLN B CB  1 
ATOM 3554 C CG  . GLN B 2 78  ? -24.504 -30.101 203.290 1.00 30.00 ? 465 GLN B CG  1 
ATOM 3555 C CD  . GLN B 2 78  ? -25.266 -30.686 202.114 1.00 30.00 ? 465 GLN B CD  1 
ATOM 3556 O OE1 . GLN B 2 78  ? -25.978 -29.975 201.407 1.00 30.00 ? 465 GLN B OE1 1 
ATOM 3557 N NE2 . GLN B 2 78  ? -25.109 -31.986 201.890 1.00 30.00 ? 465 GLN B NE2 1 
ATOM 3558 N N   . LEU B 2 79  ? -22.569 -32.547 206.775 1.00 30.00 ? 466 LEU B N   1 
ATOM 3559 C CA  . LEU B 2 79  ? -22.585 -33.485 207.892 1.00 30.00 ? 466 LEU B CA  1 
ATOM 3560 C C   . LEU B 2 79  ? -21.847 -32.897 209.090 1.00 30.00 ? 466 LEU B C   1 
ATOM 3561 O O   . LEU B 2 79  ? -21.581 -33.587 210.071 1.00 30.00 ? 466 LEU B O   1 
ATOM 3562 C CB  . LEU B 2 79  ? -21.937 -34.811 207.483 1.00 30.00 ? 466 LEU B CB  1 
ATOM 3563 C CG  . LEU B 2 79  ? -22.646 -35.605 206.382 1.00 30.00 ? 466 LEU B CG  1 
ATOM 3564 C CD1 . LEU B 2 79  ? -21.797 -36.799 205.980 1.00 30.00 ? 466 LEU B CD1 1 
ATOM 3565 C CD2 . LEU B 2 79  ? -24.019 -36.053 206.869 1.00 30.00 ? 466 LEU B CD2 1 
ATOM 3566 N N   . LYS B 2 80  ? -21.514 -31.613 208.994 1.00 30.00 ? 467 LYS B N   1 
ATOM 3567 C CA  . LYS B 2 80  ? -20.823 -30.886 210.055 1.00 30.00 ? 467 LYS B CA  1 
ATOM 3568 C C   . LYS B 2 80  ? -19.361 -31.288 210.243 1.00 30.00 ? 467 LYS B C   1 
ATOM 3569 O O   . LYS B 2 80  ? -18.765 -31.009 211.288 1.00 30.00 ? 467 LYS B O   1 
ATOM 3570 C CB  . LYS B 2 80  ? -21.571 -31.051 211.383 1.00 30.00 ? 467 LYS B CB  1 
ATOM 3571 C CG  . LYS B 2 80  ? -23.083 -30.897 211.275 1.00 30.00 ? 467 LYS B CG  1 
ATOM 3572 C CD  . LYS B 2 80  ? -23.475 -29.611 210.563 1.00 30.00 ? 467 LYS B CD  1 
ATOM 3573 C CE  . LYS B 2 80  ? -24.987 -29.514 210.393 1.00 30.00 ? 467 LYS B CE  1 
ATOM 3574 N NZ  . LYS B 2 80  ? -25.393 -28.293 209.637 1.00 30.00 ? 467 LYS B NZ  1 
ATOM 3575 N N   . PHE B 2 81  ? -18.775 -31.945 209.244 1.00 30.00 ? 468 PHE B N   1 
ATOM 3576 C CA  . PHE B 2 81  ? -17.373 -32.341 209.337 1.00 30.00 ? 468 PHE B CA  1 
ATOM 3577 C C   . PHE B 2 81  ? -16.509 -31.082 209.328 1.00 30.00 ? 468 PHE B C   1 
ATOM 3578 O O   . PHE B 2 81  ? -16.987 -29.987 209.020 1.00 30.00 ? 468 PHE B O   1 
ATOM 3579 C CB  . PHE B 2 81  ? -16.980 -33.246 208.161 1.00 30.00 ? 468 PHE B CB  1 
ATOM 3580 C CG  . PHE B 2 81  ? -17.543 -34.643 208.239 1.00 30.00 ? 468 PHE B CG  1 
ATOM 3581 C CD1 . PHE B 2 81  ? -17.333 -35.547 207.195 1.00 30.00 ? 468 PHE B CD1 1 
ATOM 3582 C CD2 . PHE B 2 81  ? -18.269 -35.061 209.351 1.00 30.00 ? 468 PHE B CD2 1 
ATOM 3583 C CE1 . PHE B 2 81  ? -17.842 -36.837 207.256 1.00 30.00 ? 468 PHE B CE1 1 
ATOM 3584 C CE2 . PHE B 2 81  ? -18.780 -36.347 209.423 1.00 30.00 ? 468 PHE B CE2 1 
ATOM 3585 C CZ  . PHE B 2 81  ? -18.566 -37.240 208.374 1.00 30.00 ? 468 PHE B CZ  1 
ATOM 3586 N N   . SER B 2 82  ? -15.234 -31.238 209.663 1.00 30.00 ? 469 SER B N   1 
ATOM 3587 C CA  . SER B 2 82  ? -14.318 -30.107 209.692 1.00 30.00 ? 469 SER B CA  1 
ATOM 3588 C C   . SER B 2 82  ? -13.387 -30.094 208.477 1.00 30.00 ? 469 SER B C   1 
ATOM 3589 O O   . SER B 2 82  ? -12.427 -30.859 208.409 1.00 30.00 ? 469 SER B O   1 
ATOM 3590 C CB  . SER B 2 82  ? -13.491 -30.144 210.982 1.00 30.00 ? 469 SER B CB  1 
ATOM 3591 O OG  . SER B 2 82  ? -12.586 -29.056 211.038 1.00 30.00 ? 469 SER B OG  1 
ATOM 3592 N N   . LEU B 2 83  ? -13.686 -29.225 207.517 1.00 30.00 ? 470 LEU B N   1 
ATOM 3593 C CA  . LEU B 2 83  ? -12.877 -29.095 206.308 1.00 30.00 ? 470 LEU B CA  1 
ATOM 3594 C C   . LEU B 2 83  ? -12.591 -27.616 206.064 1.00 30.00 ? 470 LEU B C   1 
ATOM 3595 O O   . LEU B 2 83  ? -13.464 -26.871 205.614 1.00 30.00 ? 470 LEU B O   1 
ATOM 3596 C CB  . LEU B 2 83  ? -13.612 -29.679 205.094 1.00 30.00 ? 470 LEU B CB  1 
ATOM 3597 C CG  . LEU B 2 83  ? -13.975 -31.169 205.050 1.00 30.00 ? 470 LEU B CG  1 
ATOM 3598 C CD1 . LEU B 2 83  ? -12.735 -32.010 205.285 1.00 30.00 ? 470 LEU B CD1 1 
ATOM 3599 C CD2 . LEU B 2 83  ? -15.033 -31.472 206.086 1.00 30.00 ? 470 LEU B CD2 1 
ATOM 3600 N N   . VAL B 2 84  ? -11.371 -27.190 206.364 1.00 30.00 ? 471 VAL B N   1 
ATOM 3601 C CA  . VAL B 2 84  ? -11.000 -25.792 206.186 1.00 30.00 ? 471 VAL B CA  1 
ATOM 3602 C C   . VAL B 2 84  ? -9.881  -25.597 205.176 1.00 30.00 ? 471 VAL B C   1 
ATOM 3603 O O   . VAL B 2 84  ? -8.883  -26.321 205.189 1.00 30.00 ? 471 VAL B O   1 
ATOM 3604 C CB  . VAL B 2 84  ? -10.572 -25.149 207.532 1.00 30.00 ? 471 VAL B CB  1 
ATOM 3605 C CG1 . VAL B 2 84  ? -11.755 -25.110 208.489 1.00 30.00 ? 471 VAL B CG1 1 
ATOM 3606 C CG2 . VAL B 2 84  ? -9.428  -25.942 208.147 1.00 30.00 ? 471 VAL B CG2 1 
ATOM 3607 N N   . ASN B 2 85  ? -10.066 -24.615 204.299 1.00 30.00 ? 472 ASN B N   1 
ATOM 3608 C CA  . ASN B 2 85  ? -9.089  -24.277 203.274 1.00 30.00 ? 472 ASN B CA  1 
ATOM 3609 C C   . ASN B 2 85  ? -8.889  -25.388 202.256 1.00 30.00 ? 472 ASN B C   1 
ATOM 3610 O O   . ASN B 2 85  ? -7.800  -25.549 201.699 1.00 30.00 ? 472 ASN B O   1 
ATOM 3611 C CB  . ASN B 2 85  ? -7.752  -23.914 203.927 1.00 30.00 ? 472 ASN B CB  1 
ATOM 3612 C CG  . ASN B 2 85  ? -7.895  -22.811 204.961 1.00 30.00 ? 472 ASN B CG  1 
ATOM 3613 O OD1 . ASN B 2 85  ? -8.468  -21.755 204.682 1.00 30.00 ? 472 ASN B OD1 1 
ATOM 3614 N ND2 . ASN B 2 85  ? -7.379  -23.051 206.161 1.00 30.00 ? 472 ASN B ND2 1 
ATOM 3615 N N   . VAL B 2 86  ? -9.948  -26.148 202.010 1.00 30.00 ? 473 VAL B N   1 
ATOM 3616 C CA  . VAL B 2 86  ? -9.889  -27.238 201.048 1.00 30.00 ? 473 VAL B CA  1 
ATOM 3617 C C   . VAL B 2 86  ? -11.101 -27.219 200.131 1.00 30.00 ? 473 VAL B C   1 
ATOM 3618 O O   . VAL B 2 86  ? -12.087 -26.524 200.384 1.00 30.00 ? 473 VAL B O   1 
ATOM 3619 C CB  . VAL B 2 86  ? -9.824  -28.621 201.748 1.00 30.00 ? 473 VAL B CB  1 
ATOM 3620 C CG1 . VAL B 2 86  ? -8.504  -28.769 202.498 1.00 30.00 ? 473 VAL B CG1 1 
ATOM 3621 C CG2 . VAL B 2 86  ? -11.003 -28.781 202.700 1.00 30.00 ? 473 VAL B CG2 1 
ATOM 3622 N N   . ALA B 2 87  ? -11.013 -27.985 199.053 1.00 30.00 ? 474 ALA B N   1 
ATOM 3623 C CA  . ALA B 2 87  ? -12.090 -28.081 198.086 1.00 30.00 ? 474 ALA B CA  1 
ATOM 3624 C C   . ALA B 2 87  ? -11.906 -29.378 197.318 1.00 30.00 ? 474 ALA B C   1 
ATOM 3625 O O   . ALA B 2 87  ? -11.017 -30.164 197.630 1.00 30.00 ? 474 ALA B O   1 
ATOM 3626 C CB  . ALA B 2 87  ? -12.056 -26.882 197.142 1.00 30.00 ? 474 ALA B CB  1 
ATOM 3627 N N   . GLY B 2 88  ? -12.747 -29.596 196.313 1.00 30.00 ? 475 GLY B N   1 
ATOM 3628 C CA  . GLY B 2 88  ? -12.671 -30.815 195.530 1.00 30.00 ? 475 GLY B CA  1 
ATOM 3629 C C   . GLY B 2 88  ? -11.325 -31.106 194.896 1.00 30.00 ? 475 GLY B C   1 
ATOM 3630 O O   . GLY B 2 88  ? -10.863 -32.248 194.916 1.00 30.00 ? 475 GLY B O   1 
ATOM 3631 N N   . ASN B 2 89  ? -10.687 -30.087 194.330 1.00 30.00 ? 476 ASN B N   1 
ATOM 3632 C CA  . ASN B 2 89  ? -9.398  -30.296 193.678 1.00 30.00 ? 476 ASN B CA  1 
ATOM 3633 C C   . ASN B 2 89  ? -8.296  -30.757 194.629 1.00 30.00 ? 476 ASN B C   1 
ATOM 3634 O O   . ASN B 2 89  ? -7.245  -31.207 194.186 1.00 30.00 ? 476 ASN B O   1 
ATOM 3635 C CB  . ASN B 2 89  ? -8.978  -29.035 192.910 1.00 30.00 ? 476 ASN B CB  1 
ATOM 3636 C CG  . ASN B 2 89  ? -9.063  -27.778 193.749 1.00 30.00 ? 476 ASN B CG  1 
ATOM 3637 O OD1 . ASN B 2 89  ? -9.879  -27.685 194.669 1.00 30.00 ? 476 ASN B OD1 1 
ATOM 3638 N ND2 . ASN B 2 89  ? -8.231  -26.794 193.426 1.00 30.00 ? 476 ASN B ND2 1 
ATOM 3639 N N   . ASP B 2 90  ? -8.541  -30.659 195.933 1.00 30.00 ? 477 ASP B N   1 
ATOM 3640 C CA  . ASP B 2 90  ? -7.563  -31.117 196.916 1.00 30.00 ? 477 ASP B CA  1 
ATOM 3641 C C   . ASP B 2 90  ? -7.535  -32.646 196.919 1.00 30.00 ? 477 ASP B C   1 
ATOM 3642 O O   . ASP B 2 90  ? -6.482  -33.263 197.096 1.00 30.00 ? 477 ASP B O   1 
ATOM 3643 C CB  . ASP B 2 90  ? -7.919  -30.598 198.311 1.00 30.00 ? 477 ASP B CB  1 
ATOM 3644 C CG  . ASP B 2 90  ? -7.542  -29.147 198.503 1.00 30.00 ? 477 ASP B CG  1 
ATOM 3645 O OD1 . ASP B 2 90  ? -6.328  -28.848 198.537 1.00 30.00 ? 477 ASP B OD1 1 
ATOM 3646 O OD2 . ASP B 2 90  ? -8.455  -28.303 198.615 1.00 30.00 ? 477 ASP B OD2 1 
ATOM 3647 N N   . ILE B 2 91  ? -8.702  -33.256 196.722 1.00 30.00 ? 478 ILE B N   1 
ATOM 3648 C CA  . ILE B 2 91  ? -8.803  -34.708 196.680 1.00 30.00 ? 478 ILE B CA  1 
ATOM 3649 C C   . ILE B 2 91  ? -8.173  -35.198 195.380 1.00 30.00 ? 478 ILE B C   1 
ATOM 3650 O O   . ILE B 2 91  ? -7.445  -36.193 195.367 1.00 30.00 ? 478 ILE B O   1 
ATOM 3651 C CB  . ILE B 2 91  ? -10.279 -35.180 196.727 1.00 30.00 ? 478 ILE B CB  1 
ATOM 3652 C CG1 . ILE B 2 91  ? -10.933 -34.699 198.024 1.00 30.00 ? 478 ILE B CG1 1 
ATOM 3653 C CG2 . ILE B 2 91  ? -10.346 -36.708 196.606 1.00 30.00 ? 478 ILE B CG2 1 
ATOM 3654 C CD1 . ILE B 2 91  ? -12.418 -34.997 198.120 1.00 30.00 ? 478 ILE B CD1 1 
ATOM 3655 N N   . VAL B 2 92  ? -8.459  -34.489 194.290 1.00 30.00 ? 479 VAL B N   1 
ATOM 3656 C CA  . VAL B 2 92  ? -7.916  -34.831 192.977 1.00 30.00 ? 479 VAL B CA  1 
ATOM 3657 C C   . VAL B 2 92  ? -6.392  -34.732 192.978 1.00 30.00 ? 479 VAL B C   1 
ATOM 3658 O O   . VAL B 2 92  ? -5.714  -35.521 192.319 1.00 30.00 ? 479 VAL B O   1 
ATOM 3659 C CB  . VAL B 2 92  ? -8.472  -33.889 191.873 1.00 30.00 ? 479 VAL B CB  1 
ATOM 3660 C CG1 . VAL B 2 92  ? -7.840  -34.229 190.530 1.00 30.00 ? 479 VAL B CG1 1 
ATOM 3661 C CG2 . VAL B 2 92  ? -9.991  -34.016 191.797 1.00 30.00 ? 479 VAL B CG2 1 
ATOM 3662 N N   . GLN B 2 93  ? -5.857  -33.762 193.718 1.00 30.00 ? 480 GLN B N   1 
ATOM 3663 C CA  . GLN B 2 93  ? -4.411  -33.565 193.796 1.00 30.00 ? 480 GLN B CA  1 
ATOM 3664 C C   . GLN B 2 93  ? -3.759  -34.538 194.771 1.00 30.00 ? 480 GLN B C   1 
ATOM 3665 O O   . GLN B 2 93  ? -2.539  -34.531 194.947 1.00 30.00 ? 480 GLN B O   1 
ATOM 3666 C CB  . GLN B 2 93  ? -4.078  -32.132 194.214 1.00 30.00 ? 480 GLN B CB  1 
ATOM 3667 C CG  . GLN B 2 93  ? -4.578  -31.060 193.255 1.00 30.00 ? 480 GLN B CG  1 
ATOM 3668 C CD  . GLN B 2 93  ? -4.031  -29.681 193.581 1.00 30.00 ? 480 GLN B CD  1 
ATOM 3669 O OE1 . GLN B 2 93  ? -3.820  -29.341 194.748 1.00 30.00 ? 480 GLN B OE1 1 
ATOM 3670 N NE2 . GLN B 2 93  ? -3.814  -28.871 192.547 1.00 30.00 ? 480 GLN B NE2 1 
ATOM 3671 N N   . GLY B 2 94  ? -4.579  -35.365 195.409 1.00 30.00 ? 481 GLY B N   1 
ATOM 3672 C CA  . GLY B 2 94  ? -4.060  -36.343 196.344 1.00 30.00 ? 481 GLY B CA  1 
ATOM 3673 C C   . GLY B 2 94  ? -3.644  -35.834 197.713 1.00 30.00 ? 481 GLY B C   1 
ATOM 3674 O O   . GLY B 2 94  ? -2.791  -36.442 198.351 1.00 30.00 ? 481 GLY B O   1 
ATOM 3675 N N   . ASN B 2 95  ? -4.226  -34.730 198.170 1.00 30.00 ? 482 ASN B N   1 
ATOM 3676 C CA  . ASN B 2 95  ? -3.895  -34.194 199.492 1.00 30.00 ? 482 ASN B CA  1 
ATOM 3677 C C   . ASN B 2 95  ? -4.142  -35.318 200.501 1.00 30.00 ? 482 ASN B C   1 
ATOM 3678 O O   . ASN B 2 95  ? -5.282  -35.597 200.865 1.00 30.00 ? 482 ASN B O   1 
ATOM 3679 C CB  . ASN B 2 95  ? -4.788  -32.992 199.820 1.00 30.00 ? 482 ASN B CB  1 
ATOM 3680 C CG  . ASN B 2 95  ? -4.347  -32.257 201.078 1.00 30.00 ? 482 ASN B CG  1 
ATOM 3681 O OD1 . ASN B 2 95  ? -4.066  -32.872 202.107 1.00 30.00 ? 482 ASN B OD1 1 
ATOM 3682 N ND2 . ASN B 2 95  ? -4.301  -30.931 201.003 1.00 30.00 ? 482 ASN B ND2 1 
ATOM 3683 N N   . LYS B 2 96  ? -3.066  -35.965 200.939 1.00 30.00 ? 483 LYS B N   1 
ATOM 3684 C CA  . LYS B 2 96  ? -3.155  -37.079 201.877 1.00 30.00 ? 483 LYS B CA  1 
ATOM 3685 C C   . LYS B 2 96  ? -3.655  -36.674 203.255 1.00 30.00 ? 483 LYS B C   1 
ATOM 3686 O O   . LYS B 2 96  ? -4.354  -37.436 203.921 1.00 30.00 ? 483 LYS B O   1 
ATOM 3687 C CB  . LYS B 2 96  ? -1.789  -37.765 202.004 1.00 30.00 ? 483 LYS B CB  1 
ATOM 3688 C CG  . LYS B 2 96  ? -1.212  -38.218 200.675 1.00 30.00 ? 483 LYS B CG  1 
ATOM 3689 C CD  . LYS B 2 96  ? 0.098   -38.967 200.849 1.00 30.00 ? 483 LYS B CD  1 
ATOM 3690 C CE  . LYS B 2 96  ? 0.699   -39.318 199.498 1.00 30.00 ? 483 LYS B CE  1 
ATOM 3691 N NZ  . LYS B 2 96  ? 1.974   -40.076 199.627 1.00 30.00 ? 483 LYS B NZ  1 
ATOM 3692 N N   . LYS B 2 97  ? -3.293  -35.470 203.678 1.00 30.00 ? 484 LYS B N   1 
ATOM 3693 C CA  . LYS B 2 97  ? -3.710  -34.967 204.978 1.00 30.00 ? 484 LYS B CA  1 
ATOM 3694 C C   . LYS B 2 97  ? -5.228  -34.766 205.010 1.00 30.00 ? 484 LYS B C   1 
ATOM 3695 O O   . LYS B 2 97  ? -5.880  -35.031 206.021 1.00 30.00 ? 484 LYS B O   1 
ATOM 3696 C CB  . LYS B 2 97  ? -2.982  -33.653 205.268 1.00 30.00 ? 484 LYS B CB  1 
ATOM 3697 C CG  . LYS B 2 97  ? -3.075  -33.180 206.704 1.00 30.00 ? 484 LYS B CG  1 
ATOM 3698 C CD  . LYS B 2 97  ? -2.014  -32.125 206.996 1.00 30.00 ? 484 LYS B CD  1 
ATOM 3699 C CE  . LYS B 2 97  ? -0.610  -32.711 206.871 1.00 30.00 ? 484 LYS B CE  1 
ATOM 3700 N NZ  . LYS B 2 97  ? 0.453   -31.698 207.131 1.00 30.00 ? 484 LYS B NZ  1 
ATOM 3701 N N   . LEU B 2 98  ? -5.786  -34.306 203.893 1.00 30.00 ? 485 LEU B N   1 
ATOM 3702 C CA  . LEU B 2 98  ? -7.223  -34.087 203.787 1.00 30.00 ? 485 LEU B CA  1 
ATOM 3703 C C   . LEU B 2 98  ? -7.956  -35.414 203.620 1.00 30.00 ? 485 LEU B C   1 
ATOM 3704 O O   . LEU B 2 98  ? -9.001  -35.639 204.232 1.00 30.00 ? 485 LEU B O   1 
ATOM 3705 C CB  . LEU B 2 98  ? -7.542  -33.182 202.592 1.00 30.00 ? 485 LEU B CB  1 
ATOM 3706 C CG  . LEU B 2 98  ? -8.988  -33.218 202.075 1.00 30.00 ? 485 LEU B CG  1 
ATOM 3707 C CD1 . LEU B 2 98  ? -9.942  -32.661 203.122 1.00 30.00 ? 485 LEU B CD1 1 
ATOM 3708 C CD2 . LEU B 2 98  ? -9.083  -32.420 200.794 1.00 30.00 ? 485 LEU B CD2 1 
ATOM 3709 N N   . ILE B 2 99  ? -7.403  -36.288 202.785 1.00 30.00 ? 486 ILE B N   1 
ATOM 3710 C CA  . ILE B 2 99  ? -8.006  -37.588 202.530 1.00 30.00 ? 486 ILE B CA  1 
ATOM 3711 C C   . ILE B 2 99  ? -8.105  -38.425 203.806 1.00 30.00 ? 486 ILE B C   1 
ATOM 3712 O O   . ILE B 2 99  ? -9.127  -39.061 204.053 1.00 30.00 ? 486 ILE B O   1 
ATOM 3713 C CB  . ILE B 2 99  ? -7.215  -38.357 201.442 1.00 30.00 ? 486 ILE B CB  1 
ATOM 3714 C CG1 . ILE B 2 99  ? -7.386  -37.642 200.097 1.00 30.00 ? 486 ILE B CG1 1 
ATOM 3715 C CG2 . ILE B 2 99  ? -7.698  -39.803 201.352 1.00 30.00 ? 486 ILE B CG2 1 
ATOM 3716 C CD1 . ILE B 2 99  ? -6.668  -38.299 198.934 1.00 30.00 ? 486 ILE B CD1 1 
ATOM 3717 N N   . LEU B 2 100 ? -7.048  -38.416 204.616 1.00 30.00 ? 487 LEU B N   1 
ATOM 3718 C CA  . LEU B 2 100 ? -7.056  -39.164 205.870 1.00 30.00 ? 487 LEU B CA  1 
ATOM 3719 C C   . LEU B 2 100 ? -8.043  -38.528 206.851 1.00 30.00 ? 487 LEU B C   1 
ATOM 3720 O O   . LEU B 2 100 ? -8.767  -39.224 207.557 1.00 30.00 ? 487 LEU B O   1 
ATOM 3721 C CB  . LEU B 2 100 ? -5.660  -39.186 206.492 1.00 30.00 ? 487 LEU B CB  1 
ATOM 3722 C CG  . LEU B 2 100 ? -4.552  -39.873 205.688 1.00 30.00 ? 487 LEU B CG  1 
ATOM 3723 C CD1 . LEU B 2 100 ? -3.241  -39.752 206.440 1.00 30.00 ? 487 LEU B CD1 1 
ATOM 3724 C CD2 . LEU B 2 100 ? -4.897  -41.337 205.450 1.00 30.00 ? 487 LEU B CD2 1 
ATOM 3725 N N   . GLY B 2 101 ? -8.068  -37.201 206.882 1.00 30.00 ? 488 GLY B N   1 
ATOM 3726 C CA  . GLY B 2 101 ? -8.974  -36.499 207.773 1.00 30.00 ? 488 GLY B CA  1 
ATOM 3727 C C   . GLY B 2 101 ? -10.431 -36.746 207.430 1.00 30.00 ? 488 GLY B C   1 
ATOM 3728 O O   . GLY B 2 101 ? -11.270 -36.927 208.319 1.00 30.00 ? 488 GLY B O   1 
ATOM 3729 N N   . LEU B 2 102 ? -10.735 -36.750 206.136 1.00 30.00 ? 489 LEU B N   1 
ATOM 3730 C CA  . LEU B 2 102 ? -12.097 -36.983 205.670 1.00 30.00 ? 489 LEU B CA  1 
ATOM 3731 C C   . LEU B 2 102 ? -12.516 -38.419 205.968 1.00 30.00 ? 489 LEU B C   1 
ATOM 3732 O O   . LEU B 2 102 ? -13.646 -38.673 206.382 1.00 30.00 ? 489 LEU B O   1 
ATOM 3733 C CB  . LEU B 2 102 ? -12.189 -36.721 204.166 1.00 30.00 ? 489 LEU B CB  1 
ATOM 3734 C CG  . LEU B 2 102 ? -13.527 -36.990 203.474 1.00 30.00 ? 489 LEU B CG  1 
ATOM 3735 C CD1 . LEU B 2 102 ? -14.614 -36.111 204.064 1.00 30.00 ? 489 LEU B CD1 1 
ATOM 3736 C CD2 . LEU B 2 102 ? -13.381 -36.720 201.986 1.00 30.00 ? 489 LEU B CD2 1 
ATOM 3737 N N   . LEU B 2 103 ? -11.597 -39.355 205.759 1.00 30.00 ? 490 LEU B N   1 
ATOM 3738 C CA  . LEU B 2 103 ? -11.873 -40.763 206.003 1.00 30.00 ? 490 LEU B CA  1 
ATOM 3739 C C   . LEU B 2 103 ? -12.129 -41.056 207.480 1.00 30.00 ? 490 LEU B C   1 
ATOM 3740 O O   . LEU B 2 103 ? -13.063 -41.779 207.819 1.00 30.00 ? 490 LEU B O   1 
ATOM 3741 C CB  . LEU B 2 103 ? -10.716 -41.615 205.479 1.00 30.00 ? 490 LEU B CB  1 
ATOM 3742 C CG  . LEU B 2 103 ? -10.697 -41.751 203.956 1.00 30.00 ? 490 LEU B CG  1 
ATOM 3743 C CD1 . LEU B 2 103 ? -9.385  -42.384 203.501 1.00 30.00 ? 490 LEU B CD1 1 
ATOM 3744 C CD2 . LEU B 2 103 ? -11.889 -42.597 203.514 1.00 30.00 ? 490 LEU B CD2 1 
ATOM 3745 N N   . TRP B 2 104 ? -11.297 -40.502 208.353 1.00 30.00 ? 491 TRP B N   1 
ATOM 3746 C CA  . TRP B 2 104 ? -11.475 -40.701 209.786 1.00 30.00 ? 491 TRP B CA  1 
ATOM 3747 C C   . TRP B 2 104 ? -12.886 -40.293 210.187 1.00 30.00 ? 491 TRP B C   1 
ATOM 3748 O O   . TRP B 2 104 ? -13.641 -41.089 210.748 1.00 30.00 ? 491 TRP B O   1 
ATOM 3749 C CB  . TRP B 2 104 ? -10.467 -39.864 210.577 1.00 30.00 ? 491 TRP B CB  1 
ATOM 3750 C CG  . TRP B 2 104 ? -10.849 -39.695 212.020 1.00 30.00 ? 491 TRP B CG  1 
ATOM 3751 C CD1 . TRP B 2 104 ? -11.032 -38.518 212.683 1.00 30.00 ? 491 TRP B CD1 1 
ATOM 3752 C CD2 . TRP B 2 104 ? -11.140 -40.738 212.963 1.00 30.00 ? 491 TRP B CD2 1 
ATOM 3753 N NE1 . TRP B 2 104 ? -11.423 -38.759 213.978 1.00 30.00 ? 491 TRP B NE1 1 
ATOM 3754 C CE2 . TRP B 2 104 ? -11.498 -40.111 214.177 1.00 30.00 ? 491 TRP B CE2 1 
ATOM 3755 C CE3 . TRP B 2 104 ? -11.134 -42.137 212.898 1.00 30.00 ? 491 TRP B CE3 1 
ATOM 3756 C CZ2 . TRP B 2 104 ? -11.850 -40.838 215.322 1.00 30.00 ? 491 TRP B CZ2 1 
ATOM 3757 C CZ3 . TRP B 2 104 ? -11.485 -42.863 214.038 1.00 30.00 ? 491 TRP B CZ3 1 
ATOM 3758 C CH2 . TRP B 2 104 ? -11.839 -42.209 215.233 1.00 30.00 ? 491 TRP B CH2 1 
ATOM 3759 N N   . GLN B 2 105 ? -13.233 -39.042 209.895 1.00 30.00 ? 492 GLN B N   1 
ATOM 3760 C CA  . GLN B 2 105 ? -14.550 -38.516 210.217 1.00 30.00 ? 492 GLN B CA  1 
ATOM 3761 C C   . GLN B 2 105 ? -15.681 -39.359 209.628 1.00 30.00 ? 492 GLN B C   1 
ATOM 3762 O O   . GLN B 2 105 ? -16.760 -39.452 210.215 1.00 30.00 ? 492 GLN B O   1 
ATOM 3763 C CB  . GLN B 2 105 ? -14.653 -37.064 209.748 1.00 30.00 ? 492 GLN B CB  1 
ATOM 3764 C CG  . GLN B 2 105 ? -13.918 -36.095 210.659 1.00 30.00 ? 492 GLN B CG  1 
ATOM 3765 C CD  . GLN B 2 105 ? -13.941 -34.672 210.149 1.00 30.00 ? 492 GLN B CD  1 
ATOM 3766 O OE1 . GLN B 2 105 ? -13.197 -34.315 209.236 1.00 30.00 ? 492 GLN B OE1 1 
ATOM 3767 N NE2 . GLN B 2 105 ? -14.805 -33.850 210.730 1.00 30.00 ? 492 GLN B NE2 1 
ATOM 3768 N N   . LEU B 2 106 ? -15.434 -39.970 208.473 1.00 30.00 ? 493 LEU B N   1 
ATOM 3769 C CA  . LEU B 2 106 ? -16.438 -40.819 207.848 1.00 30.00 ? 493 LEU B CA  1 
ATOM 3770 C C   . LEU B 2 106 ? -16.591 -42.076 208.686 1.00 30.00 ? 493 LEU B C   1 
ATOM 3771 O O   . LEU B 2 106 ? -17.703 -42.531 208.947 1.00 30.00 ? 493 LEU B O   1 
ATOM 3772 C CB  . LEU B 2 106 ? -16.023 -41.203 206.423 1.00 30.00 ? 493 LEU B CB  1 
ATOM 3773 C CG  . LEU B 2 106 ? -16.191 -40.150 205.332 1.00 30.00 ? 493 LEU B CG  1 
ATOM 3774 C CD1 . LEU B 2 106 ? -15.513 -40.618 204.049 1.00 30.00 ? 493 LEU B CD1 1 
ATOM 3775 C CD2 . LEU B 2 106 ? -17.675 -39.898 205.107 1.00 30.00 ? 493 LEU B CD2 1 
ATOM 3776 N N   . MET B 2 107 ? -15.458 -42.630 209.108 1.00 30.00 ? 494 MET B N   1 
ATOM 3777 C CA  . MET B 2 107 ? -15.436 -43.842 209.924 1.00 30.00 ? 494 MET B CA  1 
ATOM 3778 C C   . MET B 2 107 ? -16.121 -43.612 211.272 1.00 30.00 ? 494 MET B C   1 
ATOM 3779 O O   . MET B 2 107 ? -16.928 -44.431 211.716 1.00 30.00 ? 494 MET B O   1 
ATOM 3780 C CB  . MET B 2 107 ? -13.990 -44.290 210.149 1.00 30.00 ? 494 MET B CB  1 
ATOM 3781 C CG  . MET B 2 107 ? -13.850 -45.561 210.970 1.00 30.00 ? 494 MET B CG  1 
ATOM 3782 S SD  . MET B 2 107 ? -12.123 -46.032 211.203 1.00 30.00 ? 494 MET B SD  1 
ATOM 3783 C CE  . MET B 2 107 ? -11.961 -47.325 209.971 1.00 30.00 ? 494 MET B CE  1 
ATOM 3784 N N   . ARG B 2 108 ? -15.784 -42.498 211.915 1.00 30.00 ? 495 ARG B N   1 
ATOM 3785 C CA  . ARG B 2 108 ? -16.360 -42.142 213.206 1.00 30.00 ? 495 ARG B CA  1 
ATOM 3786 C C   . ARG B 2 108 ? -17.848 -41.835 213.075 1.00 30.00 ? 495 ARG B C   1 
ATOM 3787 O O   . ARG B 2 108 ? -18.639 -42.173 213.956 1.00 30.00 ? 495 ARG B O   1 
ATOM 3788 C CB  . ARG B 2 108 ? -15.628 -40.929 213.787 1.00 30.00 ? 495 ARG B CB  1 
ATOM 3789 C CG  . ARG B 2 108 ? -16.299 -40.299 215.000 1.00 30.00 ? 495 ARG B CG  1 
ATOM 3790 C CD  . ARG B 2 108 ? -15.375 -39.289 215.659 1.00 30.00 ? 495 ARG B CD  1 
ATOM 3791 N NE  . ARG B 2 108 ? -16.008 -38.584 216.770 1.00 30.00 ? 495 ARG B NE  1 
ATOM 3792 C CZ  . ARG B 2 108 ? -16.997 -37.709 216.636 1.00 30.00 ? 495 ARG B CZ  1 
ATOM 3793 N NH1 . ARG B 2 108 ? -17.480 -37.424 215.432 1.00 30.00 ? 495 ARG B NH1 1 
ATOM 3794 N NH2 . ARG B 2 108 ? -17.498 -37.105 217.704 1.00 30.00 ? 495 ARG B NH2 1 
ATOM 3795 N N   . PHE B 2 109 ? -18.219 -41.192 211.971 1.00 30.00 ? 496 PHE B N   1 
ATOM 3796 C CA  . PHE B 2 109 ? -19.611 -40.841 211.717 1.00 30.00 ? 496 PHE B CA  1 
ATOM 3797 C C   . PHE B 2 109 ? -20.461 -42.099 211.576 1.00 30.00 ? 496 PHE B C   1 
ATOM 3798 O O   . PHE B 2 109 ? -21.537 -42.199 212.158 1.00 30.00 ? 496 PHE B O   1 
ATOM 3799 C CB  . PHE B 2 109 ? -19.725 -40.012 210.433 1.00 30.00 ? 496 PHE B CB  1 
ATOM 3800 C CG  . PHE B 2 109 ? -21.122 -39.544 210.136 1.00 30.00 ? 496 PHE B CG  1 
ATOM 3801 C CD1 . PHE B 2 109 ? -21.624 -38.392 210.733 1.00 30.00 ? 496 PHE B CD1 1 
ATOM 3802 C CD2 . PHE B 2 109 ? -21.942 -40.263 209.269 1.00 30.00 ? 496 PHE B CD2 1 
ATOM 3803 C CE1 . PHE B 2 109 ? -22.928 -37.959 210.470 1.00 30.00 ? 496 PHE B CE1 1 
ATOM 3804 C CE2 . PHE B 2 109 ? -23.247 -39.840 208.999 1.00 30.00 ? 496 PHE B CE2 1 
ATOM 3805 C CZ  . PHE B 2 109 ? -23.738 -38.685 209.600 1.00 30.00 ? 496 PHE B CZ  1 
ATOM 3806 N N   . HIS B 2 110 ? -19.971 -43.058 210.800 1.00 30.00 ? 497 HIS B N   1 
ATOM 3807 C CA  . HIS B 2 110 ? -20.698 -44.302 210.581 1.00 30.00 ? 497 HIS B CA  1 
ATOM 3808 C C   . HIS B 2 110 ? -20.860 -45.081 211.883 1.00 30.00 ? 497 HIS B C   1 
ATOM 3809 O O   . HIS B 2 110 ? -21.918 -45.651 212.152 1.00 30.00 ? 497 HIS B O   1 
ATOM 3810 C CB  . HIS B 2 110 ? -19.968 -45.173 209.558 1.00 30.00 ? 497 HIS B CB  1 
ATOM 3811 C CG  . HIS B 2 110 ? -20.771 -46.343 209.081 1.00 30.00 ? 497 HIS B CG  1 
ATOM 3812 N ND1 . HIS B 2 110 ? -20.191 -47.499 208.607 1.00 30.00 ? 497 HIS B ND1 1 
ATOM 3813 C CD2 . HIS B 2 110 ? -22.111 -46.524 208.980 1.00 30.00 ? 497 HIS B CD2 1 
ATOM 3814 C CE1 . HIS B 2 110 ? -21.138 -48.343 208.234 1.00 30.00 ? 497 HIS B CE1 1 
ATOM 3815 N NE2 . HIS B 2 110 ? -22.311 -47.774 208.450 1.00 30.00 ? 497 HIS B NE2 1 
ATOM 3816 N N   . MET B 2 111 ? -19.803 -45.104 212.686 1.00 30.00 ? 498 MET B N   1 
ATOM 3817 C CA  . MET B 2 111 ? -19.821 -45.821 213.955 1.00 30.00 ? 498 MET B CA  1 
ATOM 3818 C C   . MET B 2 111 ? -20.881 -45.250 214.893 1.00 30.00 ? 498 MET B C   1 
ATOM 3819 O O   . MET B 2 111 ? -21.664 -45.990 215.481 1.00 30.00 ? 498 MET B O   1 
ATOM 3820 C CB  . MET B 2 111 ? -18.444 -45.739 214.620 1.00 30.00 ? 498 MET B CB  1 
ATOM 3821 C CG  . MET B 2 111 ? -18.269 -46.640 215.836 1.00 30.00 ? 498 MET B CG  1 
ATOM 3822 S SD  . MET B 2 111 ? -18.231 -48.397 215.435 1.00 30.00 ? 498 MET B SD  1 
ATOM 3823 C CE  . MET B 2 111 ? -19.929 -48.865 215.743 1.00 30.00 ? 498 MET B CE  1 
ATOM 3824 N N   . LEU B 2 112 ? -20.905 -43.927 215.027 1.00 30.00 ? 499 LEU B N   1 
ATOM 3825 C CA  . LEU B 2 112 ? -21.868 -43.274 215.901 1.00 30.00 ? 499 LEU B CA  1 
ATOM 3826 C C   . LEU B 2 112 ? -23.298 -43.490 215.419 1.00 30.00 ? 499 LEU B C   1 
ATOM 3827 O O   . LEU B 2 112 ? -24.210 -43.706 216.218 1.00 30.00 ? 499 LEU B O   1 
ATOM 3828 C CB  . LEU B 2 112 ? -21.563 -41.779 215.998 1.00 30.00 ? 499 LEU B CB  1 
ATOM 3829 C CG  . LEU B 2 112 ? -20.213 -41.418 216.621 1.00 30.00 ? 499 LEU B CG  1 
ATOM 3830 C CD1 . LEU B 2 112 ? -20.073 -39.909 216.699 1.00 30.00 ? 499 LEU B CD1 1 
ATOM 3831 C CD2 . LEU B 2 112 ? -20.107 -42.029 218.007 1.00 30.00 ? 499 LEU B CD2 1 
ATOM 3832 N N   . GLN B 2 113 ? -23.490 -43.434 214.106 1.00 30.00 ? 500 GLN B N   1 
ATOM 3833 C CA  . GLN B 2 113 ? -24.807 -43.639 213.525 1.00 30.00 ? 500 GLN B CA  1 
ATOM 3834 C C   . GLN B 2 113 ? -25.298 -45.054 213.813 1.00 30.00 ? 500 GLN B C   1 
ATOM 3835 O O   . GLN B 2 113 ? -26.470 -45.256 214.127 1.00 30.00 ? 500 GLN B O   1 
ATOM 3836 C CB  . GLN B 2 113 ? -24.757 -43.387 212.017 1.00 30.00 ? 500 GLN B CB  1 
ATOM 3837 C CG  . GLN B 2 113 ? -24.587 -41.922 211.667 1.00 30.00 ? 500 GLN B CG  1 
ATOM 3838 C CD  . GLN B 2 113 ? -25.801 -41.092 212.049 1.00 30.00 ? 500 GLN B CD  1 
ATOM 3839 O OE1 . GLN B 2 113 ? -26.860 -41.201 211.431 1.00 30.00 ? 500 GLN B OE1 1 
ATOM 3840 N NE2 . GLN B 2 113 ? -25.656 -40.264 213.080 1.00 30.00 ? 500 GLN B NE2 1 
ATOM 3841 N N   . LEU B 2 114 ? -24.399 -46.029 213.705 1.00 30.00 ? 501 LEU B N   1 
ATOM 3842 C CA  . LEU B 2 114 ? -24.749 -47.420 213.974 1.00 30.00 ? 501 LEU B CA  1 
ATOM 3843 C C   . LEU B 2 114 ? -25.212 -47.584 215.416 1.00 30.00 ? 501 LEU B C   1 
ATOM 3844 O O   . LEU B 2 114 ? -26.249 -48.188 215.677 1.00 30.00 ? 501 LEU B O   1 
ATOM 3845 C CB  . LEU B 2 114 ? -23.550 -48.334 213.718 1.00 30.00 ? 501 LEU B CB  1 
ATOM 3846 C CG  . LEU B 2 114 ? -23.186 -48.597 212.256 1.00 30.00 ? 501 LEU B CG  1 
ATOM 3847 C CD1 . LEU B 2 114 ? -21.897 -49.402 212.189 1.00 30.00 ? 501 LEU B CD1 1 
ATOM 3848 C CD2 . LEU B 2 114 ? -24.320 -49.345 211.575 1.00 30.00 ? 501 LEU B CD2 1 
ATOM 3849 N N   . LEU B 2 115 ? -24.437 -47.047 216.350 1.00 30.00 ? 502 LEU B N   1 
ATOM 3850 C CA  . LEU B 2 115 ? -24.788 -47.132 217.761 1.00 30.00 ? 502 LEU B CA  1 
ATOM 3851 C C   . LEU B 2 115 ? -26.137 -46.464 217.998 1.00 30.00 ? 502 LEU B C   1 
ATOM 3852 O O   . LEU B 2 115 ? -26.992 -46.997 218.707 1.00 30.00 ? 502 LEU B O   1 
ATOM 3853 C CB  . LEU B 2 115 ? -23.713 -46.453 218.622 1.00 30.00 ? 502 LEU B CB  1 
ATOM 3854 C CG  . LEU B 2 115 ? -22.391 -47.215 218.769 1.00 30.00 ? 502 LEU B CG  1 
ATOM 3855 C CD1 . LEU B 2 115 ? -21.370 -46.366 219.514 1.00 30.00 ? 502 LEU B CD1 1 
ATOM 3856 C CD2 . LEU B 2 115 ? -22.648 -48.522 219.509 1.00 30.00 ? 502 LEU B CD2 1 
ATOM 3857 N N   . LYS B 2 116 ? -26.320 -45.304 217.381 1.00 30.00 ? 503 LYS B N   1 
ATOM 3858 C CA  . LYS B 2 116 ? -27.552 -44.535 217.515 1.00 30.00 ? 503 LYS B CA  1 
ATOM 3859 C C   . LYS B 2 116 ? -28.791 -45.316 217.070 1.00 30.00 ? 503 LYS B C   1 
ATOM 3860 O O   . LYS B 2 116 ? -29.871 -45.151 217.638 1.00 30.00 ? 503 LYS B O   1 
ATOM 3861 C CB  . LYS B 2 116 ? -27.432 -43.239 216.712 1.00 30.00 ? 503 LYS B CB  1 
ATOM 3862 C CG  . LYS B 2 116 ? -28.550 -42.244 216.942 1.00 30.00 ? 503 LYS B CG  1 
ATOM 3863 C CD  . LYS B 2 116 ? -28.329 -40.982 216.119 1.00 30.00 ? 503 LYS B CD  1 
ATOM 3864 C CE  . LYS B 2 116 ? -29.426 -39.959 216.361 1.00 30.00 ? 503 LYS B CE  1 
ATOM 3865 N NZ  . LYS B 2 116 ? -29.197 -38.705 215.588 1.00 30.00 ? 503 LYS B NZ  1 
ATOM 3866 N N   . SER B 2 117 ? -28.637 -46.169 216.060 1.00 30.00 ? 504 SER B N   1 
ATOM 3867 C CA  . SER B 2 117 ? -29.762 -46.948 215.558 1.00 30.00 ? 504 SER B CA  1 
ATOM 3868 C C   . SER B 2 117 ? -30.216 -48.010 216.553 1.00 30.00 ? 504 SER B C   1 
ATOM 3869 O O   . SER B 2 117 ? -31.230 -48.673 216.343 1.00 30.00 ? 504 SER B O   1 
ATOM 3870 C CB  . SER B 2 117 ? -29.394 -47.613 214.229 1.00 30.00 ? 504 SER B CB  1 
ATOM 3871 O OG  . SER B 2 117 ? -28.395 -48.599 214.408 1.00 30.00 ? 504 SER B OG  1 
ATOM 3872 N N   . LEU B 2 118 ? -29.463 -48.174 217.633 1.00 30.00 ? 505 LEU B N   1 
ATOM 3873 C CA  . LEU B 2 118 ? -29.802 -49.163 218.651 1.00 30.00 ? 505 LEU B CA  1 
ATOM 3874 C C   . LEU B 2 118 ? -30.718 -48.577 219.723 1.00 30.00 ? 505 LEU B C   1 
ATOM 3875 O O   . LEU B 2 118 ? -31.236 -49.304 220.571 1.00 30.00 ? 505 LEU B O   1 
ATOM 3876 C CB  . LEU B 2 118 ? -28.525 -49.712 219.296 1.00 30.00 ? 505 LEU B CB  1 
ATOM 3877 C CG  . LEU B 2 118 ? -27.863 -50.904 218.599 1.00 30.00 ? 505 LEU B CG  1 
ATOM 3878 C CD1 . LEU B 2 118 ? -27.770 -50.656 217.107 1.00 30.00 ? 505 LEU B CD1 1 
ATOM 3879 C CD2 . LEU B 2 118 ? -26.488 -51.145 219.198 1.00 30.00 ? 505 LEU B CD2 1 
ATOM 3880 N N   . ARG B 2 119 ? -30.912 -47.264 219.673 1.00 30.00 ? 506 ARG B N   1 
ATOM 3881 C CA  . ARG B 2 119 ? -31.758 -46.565 220.632 1.00 30.00 ? 506 ARG B CA  1 
ATOM 3882 C C   . ARG B 2 119 ? -33.191 -47.085 220.627 1.00 30.00 ? 506 ARG B C   1 
ATOM 3883 O O   . ARG B 2 119 ? -33.564 -47.898 219.780 1.00 30.00 ? 506 ARG B O   1 
ATOM 3884 C CB  . ARG B 2 119 ? -31.769 -45.067 220.327 1.00 30.00 ? 506 ARG B CB  1 
ATOM 3885 C CG  . ARG B 2 119 ? -30.448 -44.357 220.576 1.00 30.00 ? 506 ARG B CG  1 
ATOM 3886 C CD  . ARG B 2 119 ? -30.556 -42.895 220.174 1.00 30.00 ? 506 ARG B CD  1 
ATOM 3887 N NE  . ARG B 2 119 ? -29.441 -42.097 220.669 1.00 30.00 ? 506 ARG B NE  1 
ATOM 3888 C CZ  . ARG B 2 119 ? -29.337 -40.783 220.504 1.00 30.00 ? 506 ARG B CZ  1 
ATOM 3889 N NH1 . ARG B 2 119 ? -30.282 -40.119 219.850 1.00 30.00 ? 506 ARG B NH1 1 
ATOM 3890 N NH2 . ARG B 2 119 ? -28.295 -40.130 221.000 1.00 30.00 ? 506 ARG B NH2 1 
ATOM 3891 N N   . SER B 2 120 ? -33.990 -46.601 221.577 1.00 30.00 ? 507 SER B N   1 
ATOM 3892 C CA  . SER B 2 120 ? -35.389 -47.001 221.701 1.00 30.00 ? 507 SER B CA  1 
ATOM 3893 C C   . SER B 2 120 ? -35.521 -48.509 221.884 1.00 30.00 ? 507 SER B C   1 
ATOM 3894 O O   . SER B 2 120 ? -34.478 -49.173 222.071 1.00 30.00 ? 507 SER B O   1 
ATOM 3895 C CB  . SER B 2 120 ? -36.176 -46.547 220.473 1.00 30.00 ? 507 SER B CB  1 
ATOM 3896 N N   . GLU B 2 121 ? -32.342 -45.233 218.090 1.00 30.00 ? 513 GLU B N   1 
ATOM 3897 C CA  . GLU B 2 121 ? -31.441 -44.380 218.916 1.00 30.00 ? 513 GLU B CA  1 
ATOM 3898 C C   . GLU B 2 121 ? -30.288 -45.176 219.528 1.00 30.00 ? 513 GLU B C   1 
ATOM 3899 O O   . GLU B 2 121 ? -30.026 -45.098 220.729 1.00 30.00 ? 513 GLU B O   1 
ATOM 3900 C CB  . GLU B 2 121 ? -32.250 -43.685 220.015 1.00 30.00 ? 513 GLU B CB  1 
ATOM 3901 C CG  . GLU B 2 121 ? -33.274 -44.575 220.696 1.00 30.00 ? 513 GLU B CG  1 
ATOM 3902 C CD  . GLU B 2 121 ? -34.147 -43.809 221.667 1.00 30.00 ? 513 GLU B CD  1 
ATOM 3903 O OE1 . GLU B 2 121 ? -33.616 -43.317 222.686 1.00 30.00 ? 513 GLU B OE1 1 
ATOM 3904 O OE2 . GLU B 2 121 ? -35.364 -43.690 221.410 1.00 30.00 ? 513 GLU B OE2 1 
ATOM 3905 N N   . MET B 2 122 ? -29.599 -45.941 218.684 1.00 30.00 ? 514 MET B N   1 
ATOM 3906 C CA  . MET B 2 122 ? -28.466 -46.753 219.114 1.00 30.00 ? 514 MET B CA  1 
ATOM 3907 C C   . MET B 2 122 ? -27.269 -45.885 219.493 1.00 30.00 ? 514 MET B C   1 
ATOM 3908 O O   . MET B 2 122 ? -27.128 -44.759 219.019 1.00 30.00 ? 514 MET B O   1 
ATOM 3909 C CB  . MET B 2 122 ? -28.044 -47.711 217.996 1.00 30.00 ? 514 MET B CB  1 
ATOM 3910 C CG  . MET B 2 122 ? -29.050 -48.798 217.674 1.00 30.00 ? 514 MET B CG  1 
ATOM 3911 S SD  . MET B 2 122 ? -29.281 -49.917 219.055 1.00 30.00 ? 514 MET B SD  1 
ATOM 3912 C CE  . MET B 2 122 ? -27.726 -50.806 219.039 1.00 30.00 ? 514 MET B CE  1 
ATOM 3913 N N   . THR B 2 123 ? -26.407 -46.421 220.347 1.00 30.00 ? 515 THR B N   1 
ATOM 3914 C CA  . THR B 2 123 ? -25.213 -45.709 220.778 1.00 30.00 ? 515 THR B CA  1 
ATOM 3915 C C   . THR B 2 123 ? -24.065 -46.701 220.900 1.00 30.00 ? 515 THR B C   1 
ATOM 3916 O O   . THR B 2 123 ? -24.287 -47.911 220.934 1.00 30.00 ? 515 THR B O   1 
ATOM 3917 C CB  . THR B 2 123 ? -25.420 -45.033 222.147 1.00 30.00 ? 515 THR B CB  1 
ATOM 3918 O OG1 . THR B 2 123 ? -25.669 -46.034 223.141 1.00 30.00 ? 515 THR B OG1 1 
ATOM 3919 C CG2 . THR B 2 123 ? -26.594 -44.070 222.092 1.00 30.00 ? 515 THR B CG2 1 
ATOM 3920 N N   . ASP B 2 124 ? -22.840 -46.187 220.954 1.00 30.00 ? 516 ASP B N   1 
ATOM 3921 C CA  . ASP B 2 124 ? -21.673 -47.044 221.087 1.00 30.00 ? 516 ASP B CA  1 
ATOM 3922 C C   . ASP B 2 124 ? -21.796 -47.810 222.405 1.00 30.00 ? 516 ASP B C   1 
ATOM 3923 O O   . ASP B 2 124 ? -21.469 -48.994 222.486 1.00 30.00 ? 516 ASP B O   1 
ATOM 3924 C CB  . ASP B 2 124 ? -20.389 -46.205 221.089 1.00 30.00 ? 516 ASP B CB  1 
ATOM 3925 C CG  . ASP B 2 124 ? -20.214 -45.390 219.814 1.00 30.00 ? 516 ASP B CG  1 
ATOM 3926 O OD1 . ASP B 2 124 ? -19.226 -44.632 219.722 1.00 30.00 ? 516 ASP B OD1 1 
ATOM 3927 O OD2 . ASP B 2 124 ? -21.061 -45.505 218.905 1.00 30.00 ? 516 ASP B OD2 1 
ATOM 3928 N N   . ALA B 2 125 ? -22.294 -47.118 223.426 1.00 30.00 ? 517 ALA B N   1 
ATOM 3929 C CA  . ALA B 2 125 ? -22.468 -47.695 224.751 1.00 30.00 ? 517 ALA B CA  1 
ATOM 3930 C C   . ALA B 2 125 ? -23.415 -48.895 224.766 1.00 30.00 ? 517 ALA B C   1 
ATOM 3931 O O   . ALA B 2 125 ? -23.199 -49.847 225.520 1.00 30.00 ? 517 ALA B O   1 
ATOM 3932 C CB  . ALA B 2 125 ? -22.966 -46.626 225.715 1.00 30.00 ? 517 ALA B CB  1 
ATOM 3933 N N   . ASP B 2 126 ? -24.458 -48.858 223.939 1.00 30.00 ? 518 ASP B N   1 
ATOM 3934 C CA  . ASP B 2 126 ? -25.407 -49.964 223.887 1.00 30.00 ? 518 ASP B CA  1 
ATOM 3935 C C   . ASP B 2 126 ? -24.723 -51.214 223.346 1.00 30.00 ? 518 ASP B C   1 
ATOM 3936 O O   . ASP B 2 126 ? -25.056 -52.339 223.728 1.00 30.00 ? 518 ASP B O   1 
ATOM 3937 C CB  . ASP B 2 126 ? -26.609 -49.618 222.999 1.00 30.00 ? 518 ASP B CB  1 
ATOM 3938 C CG  . ASP B 2 126 ? -27.429 -48.460 223.545 1.00 30.00 ? 518 ASP B CG  1 
ATOM 3939 O OD1 . ASP B 2 126 ? -27.546 -48.332 224.786 1.00 30.00 ? 518 ASP B OD1 1 
ATOM 3940 O OD2 . ASP B 2 126 ? -27.972 -47.685 222.729 1.00 30.00 ? 518 ASP B OD2 1 
ATOM 3941 N N   . ILE B 2 127 ? -23.762 -51.005 222.454 1.00 30.00 ? 519 ILE B N   1 
ATOM 3942 C CA  . ILE B 2 127 ? -23.015 -52.099 221.853 1.00 30.00 ? 519 ILE B CA  1 
ATOM 3943 C C   . ILE B 2 127 ? -22.050 -52.667 222.887 1.00 30.00 ? 519 ILE B C   1 
ATOM 3944 O O   . ILE B 2 127 ? -21.880 -53.877 222.994 1.00 30.00 ? 519 ILE B O   1 
ATOM 3945 C CB  . ILE B 2 127 ? -22.226 -51.612 220.615 1.00 30.00 ? 519 ILE B CB  1 
ATOM 3946 C CG1 . ILE B 2 127 ? -23.192 -50.971 219.614 1.00 30.00 ? 519 ILE B CG1 1 
ATOM 3947 C CG2 . ILE B 2 127 ? -21.485 -52.776 219.971 1.00 30.00 ? 519 ILE B CG2 1 
ATOM 3948 C CD1 . ILE B 2 127 ? -22.520 -50.374 218.393 1.00 30.00 ? 519 ILE B CD1 1 
ATOM 3949 N N   . LEU B 2 128 ? -21.424 -51.773 223.647 1.00 30.00 ? 520 LEU B N   1 
ATOM 3950 C CA  . LEU B 2 128 ? -20.485 -52.161 224.692 1.00 30.00 ? 520 LEU B CA  1 
ATOM 3951 C C   . LEU B 2 128 ? -21.239 -53.004 225.722 1.00 30.00 ? 520 LEU B C   1 
ATOM 3952 O O   . LEU B 2 128 ? -20.758 -54.048 226.163 1.00 30.00 ? 520 LEU B O   1 
ATOM 3953 C CB  . LEU B 2 128 ? -19.905 -50.903 225.351 1.00 30.00 ? 520 LEU B CB  1 
ATOM 3954 C CG  . LEU B 2 128 ? -18.746 -51.017 226.345 1.00 30.00 ? 520 LEU B CG  1 
ATOM 3955 C CD1 . LEU B 2 128 ? -19.218 -51.674 227.622 1.00 30.00 ? 520 LEU B CD1 1 
ATOM 3956 C CD2 . LEU B 2 128 ? -17.610 -51.806 225.720 1.00 30.00 ? 520 LEU B CD2 1 
ATOM 3957 N N   . SER B 2 129 ? -22.435 -52.548 226.086 1.00 30.00 ? 521 SER B N   1 
ATOM 3958 C CA  . SER B 2 129 ? -23.275 -53.249 227.051 1.00 30.00 ? 521 SER B CA  1 
ATOM 3959 C C   . SER B 2 129 ? -23.674 -54.633 226.547 1.00 30.00 ? 521 SER B C   1 
ATOM 3960 O O   . SER B 2 129 ? -23.619 -55.614 227.290 1.00 30.00 ? 521 SER B O   1 
ATOM 3961 C CB  . SER B 2 129 ? -24.535 -52.425 227.346 1.00 30.00 ? 521 SER B CB  1 
ATOM 3962 O OG  . SER B 2 129 ? -25.430 -53.130 228.195 1.00 30.00 ? 521 SER B OG  1 
ATOM 3963 N N   . TRP B 2 130 ? -24.076 -54.713 225.282 1.00 30.00 ? 522 TRP B N   1 
ATOM 3964 C CA  . TRP B 2 130 ? -24.477 -55.987 224.694 1.00 30.00 ? 522 TRP B CA  1 
ATOM 3965 C C   . TRP B 2 130 ? -23.358 -57.029 224.727 1.00 30.00 ? 522 TRP B C   1 
ATOM 3966 O O   . TRP B 2 130 ? -23.588 -58.181 225.092 1.00 30.00 ? 522 TRP B O   1 
ATOM 3967 C CB  . TRP B 2 130 ? -24.921 -55.792 223.242 1.00 30.00 ? 522 TRP B CB  1 
ATOM 3968 C CG  . TRP B 2 130 ? -25.253 -57.082 222.562 1.00 30.00 ? 522 TRP B CG  1 
ATOM 3969 C CD1 . TRP B 2 130 ? -26.439 -57.749 222.614 1.00 30.00 ? 522 TRP B CD1 1 
ATOM 3970 C CD2 . TRP B 2 130 ? -24.358 -57.910 221.810 1.00 30.00 ? 522 TRP B CD2 1 
ATOM 3971 N NE1 . TRP B 2 130 ? -26.342 -58.948 221.944 1.00 30.00 ? 522 TRP B NE1 1 
ATOM 3972 C CE2 . TRP B 2 130 ? -25.075 -59.073 221.441 1.00 30.00 ? 522 TRP B CE2 1 
ATOM 3973 C CE3 . TRP B 2 130 ? -23.019 -57.786 221.411 1.00 30.00 ? 522 TRP B CE3 1 
ATOM 3974 C CZ2 . TRP B 2 130 ? -24.497 -60.108 220.696 1.00 30.00 ? 522 TRP B CZ2 1 
ATOM 3975 C CZ3 . TRP B 2 130 ? -22.442 -58.819 220.669 1.00 30.00 ? 522 TRP B CZ3 1 
ATOM 3976 C CH2 . TRP B 2 130 ? -23.185 -59.966 220.320 1.00 30.00 ? 522 TRP B CH2 1 
ATOM 3977 N N   . ALA B 2 131 ? -22.156 -56.624 224.325 1.00 30.00 ? 523 ALA B N   1 
ATOM 3978 C CA  . ALA B 2 131 ? -21.008 -57.525 224.299 1.00 30.00 ? 523 ALA B CA  1 
ATOM 3979 C C   . ALA B 2 131 ? -20.693 -58.078 225.687 1.00 30.00 ? 523 ALA B C   1 
ATOM 3980 O O   . ALA B 2 131 ? -20.557 -59.287 225.858 1.00 30.00 ? 523 ALA B O   1 
ATOM 3981 C CB  . ALA B 2 131 ? -19.781 -56.805 223.723 1.00 30.00 ? 523 ALA B CB  1 
ATOM 3982 N N   . ASN B 2 132 ? -20.577 -57.195 226.676 1.00 30.00 ? 524 ASN B N   1 
ATOM 3983 C CA  . ASN B 2 132 ? -20.284 -57.630 228.040 1.00 30.00 ? 524 ASN B CA  1 
ATOM 3984 C C   . ASN B 2 132 ? -21.373 -58.555 228.562 1.00 30.00 ? 524 ASN B C   1 
ATOM 3985 O O   . ASN B 2 132 ? -21.087 -59.593 229.155 1.00 30.00 ? 524 ASN B O   1 
ATOM 3986 C CB  . ASN B 2 132 ? -20.156 -56.427 228.982 1.00 30.00 ? 524 ASN B CB  1 
ATOM 3987 C CG  . ASN B 2 132 ? -18.820 -55.725 228.860 1.00 30.00 ? 524 ASN B CG  1 
ATOM 3988 O OD1 . ASN B 2 132 ? -17.763 -56.358 228.899 1.00 30.00 ? 524 ASN B OD1 1 
ATOM 3989 N ND2 . ASN B 2 132 ? -18.857 -54.405 228.723 1.00 30.00 ? 524 ASN B ND2 1 
ATOM 3990 N N   . ARG B 2 133 ? -22.624 -58.173 228.334 1.00 30.00 ? 525 ARG B N   1 
ATOM 3991 C CA  . ARG B 2 133 ? -23.756 -58.963 228.793 1.00 30.00 ? 525 ARG B CA  1 
ATOM 3992 C C   . ARG B 2 133 ? -23.812 -60.318 228.097 1.00 30.00 ? 525 ARG B C   1 
ATOM 3993 O O   . ARG B 2 133 ? -24.095 -61.336 228.730 1.00 30.00 ? 525 ARG B O   1 
ATOM 3994 C CB  . ARG B 2 133 ? -25.059 -58.194 228.549 1.00 30.00 ? 525 ARG B CB  1 
ATOM 3995 C CG  . ARG B 2 133 ? -26.311 -58.902 229.043 1.00 30.00 ? 525 ARG B CG  1 
ATOM 3996 C CD  . ARG B 2 133 ? -27.524 -57.983 228.977 1.00 30.00 ? 525 ARG B CD  1 
ATOM 3997 N NE  . ARG B 2 133 ? -27.766 -57.471 227.630 1.00 30.00 ? 525 ARG B NE  1 
ATOM 3998 C CZ  . ARG B 2 133 ? -27.710 -56.184 227.292 1.00 30.00 ? 525 ARG B CZ  1 
ATOM 3999 N NH1 . ARG B 2 133 ? -27.420 -55.267 228.204 1.00 30.00 ? 525 ARG B NH1 1 
ATOM 4000 N NH2 . ARG B 2 133 ? -27.946 -55.815 226.039 1.00 30.00 ? 525 ARG B NH2 1 
ATOM 4001 N N   . LYS B 2 134 ? -23.529 -60.331 226.798 1.00 30.00 ? 526 LYS B N   1 
ATOM 4002 C CA  . LYS B 2 134 ? -23.559 -61.567 226.022 1.00 30.00 ? 526 LYS B CA  1 
ATOM 4003 C C   . LYS B 2 134 ? -22.548 -62.594 226.529 1.00 30.00 ? 526 LYS B C   1 
ATOM 4004 O O   . LYS B 2 134 ? -22.822 -63.796 226.536 1.00 30.00 ? 526 LYS B O   1 
ATOM 4005 C CB  . LYS B 2 134 ? -23.292 -61.267 224.545 1.00 30.00 ? 526 LYS B CB  1 
ATOM 4006 C CG  . LYS B 2 134 ? -23.306 -62.491 223.638 1.00 30.00 ? 526 LYS B CG  1 
ATOM 4007 C CD  . LYS B 2 134 ? -24.672 -63.172 223.609 1.00 30.00 ? 526 LYS B CD  1 
ATOM 4008 C CE  . LYS B 2 134 ? -24.694 -64.290 222.576 1.00 30.00 ? 526 LYS B CE  1 
ATOM 4009 N NZ  . LYS B 2 134 ? -26.018 -64.960 222.472 1.00 30.00 ? 526 LYS B NZ  1 
ATOM 4010 N N   . VAL B 2 135 ? -21.380 -62.123 226.950 1.00 30.00 ? 527 VAL B N   1 
ATOM 4011 C CA  . VAL B 2 135 ? -20.350 -63.019 227.453 1.00 30.00 ? 527 VAL B CA  1 
ATOM 4012 C C   . VAL B 2 135 ? -20.729 -63.570 228.827 1.00 30.00 ? 527 VAL B C   1 
ATOM 4013 O O   . VAL B 2 135 ? -20.442 -64.727 229.137 1.00 30.00 ? 527 VAL B O   1 
ATOM 4014 C CB  . VAL B 2 135 ? -18.978 -62.301 227.542 1.00 30.00 ? 527 VAL B CB  1 
ATOM 4015 C CG1 . VAL B 2 135 ? -17.944 -63.221 228.171 1.00 30.00 ? 527 VAL B CG1 1 
ATOM 4016 C CG2 . VAL B 2 135 ? -18.522 -61.888 226.148 1.00 30.00 ? 527 VAL B CG2 1 
ATOM 4017 N N   . ARG B 2 136 ? -21.383 -62.747 229.640 1.00 30.00 ? 528 ARG B N   1 
ATOM 4018 C CA  . ARG B 2 136 ? -21.795 -63.175 230.973 1.00 30.00 ? 528 ARG B CA  1 
ATOM 4019 C C   . ARG B 2 136 ? -22.820 -64.304 230.964 1.00 30.00 ? 528 ARG B C   1 
ATOM 4020 O O   . ARG B 2 136 ? -23.003 -64.981 231.974 1.00 30.00 ? 528 ARG B O   1 
ATOM 4021 C CB  . ARG B 2 136 ? -22.345 -61.991 231.779 1.00 30.00 ? 528 ARG B CB  1 
ATOM 4022 C CG  . ARG B 2 136 ? -21.266 -61.217 232.519 1.00 30.00 ? 528 ARG B CG  1 
ATOM 4023 C CD  . ARG B 2 136 ? -21.834 -60.166 233.463 1.00 30.00 ? 528 ARG B CD  1 
ATOM 4024 N NE  . ARG B 2 136 ? -22.230 -58.938 232.775 1.00 30.00 ? 528 ARG B NE  1 
ATOM 4025 C CZ  . ARG B 2 136 ? -23.459 -58.666 232.353 1.00 30.00 ? 528 ARG B CZ  1 
ATOM 4026 N NH1 . ARG B 2 136 ? -24.445 -59.533 232.544 1.00 30.00 ? 528 ARG B NH1 1 
ATOM 4027 N NH2 . ARG B 2 136 ? -23.702 -57.522 231.736 1.00 30.00 ? 528 ARG B NH2 1 
ATOM 4028 N N   . THR B 2 137 ? -23.476 -64.525 229.827 1.00 30.00 ? 529 THR B N   1 
ATOM 4029 C CA  . THR B 2 137 ? -24.478 -65.583 229.736 1.00 30.00 ? 529 THR B CA  1 
ATOM 4030 C C   . THR B 2 137 ? -23.828 -66.954 229.591 1.00 30.00 ? 529 THR B C   1 
ATOM 4031 O O   . THR B 2 137 ? -24.484 -67.983 229.765 1.00 30.00 ? 529 THR B O   1 
ATOM 4032 C CB  . THR B 2 137 ? -25.433 -65.368 228.542 1.00 30.00 ? 529 THR B CB  1 
ATOM 4033 O OG1 . THR B 2 137 ? -24.745 -65.642 227.312 1.00 30.00 ? 529 THR B OG1 1 
ATOM 4034 C CG2 . THR B 2 137 ? -25.947 -63.936 228.527 1.00 30.00 ? 529 THR B CG2 1 
ATOM 4035 N N   . MET B 2 138 ? -22.540 -66.973 229.266 1.00 30.00 ? 530 MET B N   1 
ATOM 4036 C CA  . MET B 2 138 ? -21.828 -68.231 229.106 1.00 30.00 ? 530 MET B CA  1 
ATOM 4037 C C   . MET B 2 138 ? -21.117 -68.627 230.389 1.00 30.00 ? 530 MET B C   1 
ATOM 4038 O O   . MET B 2 138 ? -20.448 -69.658 230.447 1.00 30.00 ? 530 MET B O   1 
ATOM 4039 C CB  . MET B 2 138 ? -20.821 -68.135 227.958 1.00 30.00 ? 530 MET B CB  1 
ATOM 4040 C CG  . MET B 2 138 ? -21.456 -68.009 226.583 1.00 30.00 ? 530 MET B CG  1 
ATOM 4041 S SD  . MET B 2 138 ? -22.514 -69.415 226.160 1.00 30.00 ? 530 MET B SD  1 
ATOM 4042 C CE  . MET B 2 138 ? -21.338 -70.514 225.355 1.00 30.00 ? 530 MET B CE  1 
ATOM 4043 N N   . GLY B 2 139 ? -21.262 -67.802 231.420 1.00 30.00 ? 531 GLY B N   1 
ATOM 4044 C CA  . GLY B 2 139 ? -20.639 -68.096 232.695 1.00 30.00 ? 531 GLY B CA  1 
ATOM 4045 C C   . GLY B 2 139 ? -19.275 -67.468 232.887 1.00 30.00 ? 531 GLY B C   1 
ATOM 4046 O O   . GLY B 2 139 ? -18.674 -67.606 233.952 1.00 30.00 ? 531 GLY B O   1 
ATOM 4047 N N   . ARG B 2 140 ? -18.780 -66.778 231.865 1.00 30.00 ? 532 ARG B N   1 
ATOM 4048 C CA  . ARG B 2 140 ? -17.476 -66.136 231.947 1.00 30.00 ? 532 ARG B CA  1 
ATOM 4049 C C   . ARG B 2 140 ? -17.598 -64.769 232.612 1.00 30.00 ? 532 ARG B C   1 
ATOM 4050 O O   . ARG B 2 140 ? -18.625 -64.106 232.495 1.00 30.00 ? 532 ARG B O   1 
ATOM 4051 C CB  . ARG B 2 140 ? -16.867 -65.994 230.548 1.00 30.00 ? 532 ARG B CB  1 
ATOM 4052 C CG  . ARG B 2 140 ? -16.688 -67.317 229.802 1.00 30.00 ? 532 ARG B CG  1 
ATOM 4053 C CD  . ARG B 2 140 ? -15.956 -68.355 230.655 1.00 30.00 ? 532 ARG B CD  1 
ATOM 4054 N NE  . ARG B 2 140 ? -14.660 -67.881 231.139 1.00 30.00 ? 532 ARG B NE  1 
ATOM 4055 C CZ  . ARG B 2 140 ? -13.579 -67.741 230.379 1.00 30.00 ? 532 ARG B CZ  1 
ATOM 4056 N NH1 . ARG B 2 140 ? -13.629 -68.042 229.091 1.00 30.00 ? 532 ARG B NH1 1 
ATOM 4057 N NH2 . ARG B 2 140 ? -12.445 -67.295 230.905 1.00 30.00 ? 532 ARG B NH2 1 
ATOM 4058 N N   . LYS B 2 141 ? -16.546 -64.349 233.307 1.00 30.00 ? 533 LYS B N   1 
ATOM 4059 C CA  . LYS B 2 141 ? -16.551 -63.068 234.007 1.00 30.00 ? 533 LYS B CA  1 
ATOM 4060 C C   . LYS B 2 141 ? -15.754 -61.944 233.339 1.00 30.00 ? 533 LYS B C   1 
ATOM 4061 O O   . LYS B 2 141 ? -15.853 -60.788 233.753 1.00 30.00 ? 533 LYS B O   1 
ATOM 4062 C CB  . LYS B 2 141 ? -16.037 -63.256 235.438 1.00 30.00 ? 533 LYS B CB  1 
ATOM 4063 C CG  . LYS B 2 141 ? -16.983 -64.015 236.359 1.00 30.00 ? 533 LYS B CG  1 
ATOM 4064 C CD  . LYS B 2 141 ? -18.192 -63.167 236.733 1.00 30.00 ? 533 LYS B CD  1 
ATOM 4065 C CE  . LYS B 2 141 ? -19.037 -63.852 237.797 1.00 30.00 ? 533 LYS B CE  1 
ATOM 4066 N NZ  . LYS B 2 141 ? -20.167 -62.992 238.248 1.00 30.00 ? 533 LYS B NZ  1 
ATOM 4067 N N   . LEU B 2 142 ? -14.962 -62.266 232.318 1.00 30.00 ? 534 LEU B N   1 
ATOM 4068 C CA  . LEU B 2 142 ? -14.175 -61.233 231.649 1.00 30.00 ? 534 LEU B CA  1 
ATOM 4069 C C   . LEU B 2 142 ? -15.074 -60.211 230.957 1.00 30.00 ? 534 LEU B C   1 
ATOM 4070 O O   . LEU B 2 142 ? -16.010 -60.566 230.241 1.00 30.00 ? 534 LEU B O   1 
ATOM 4071 C CB  . LEU B 2 142 ? -13.212 -61.844 230.628 1.00 30.00 ? 534 LEU B CB  1 
ATOM 4072 C CG  . LEU B 2 142 ? -13.801 -62.550 229.408 1.00 30.00 ? 534 LEU B CG  1 
ATOM 4073 C CD1 . LEU B 2 142 ? -12.712 -62.744 228.366 1.00 30.00 ? 534 LEU B CD1 1 
ATOM 4074 C CD2 . LEU B 2 142 ? -14.400 -63.882 229.822 1.00 30.00 ? 534 LEU B CD2 1 
ATOM 4075 N N   . GLN B 2 143 ? -14.772 -58.937 231.179 1.00 30.00 ? 535 GLN B N   1 
ATOM 4076 C CA  . GLN B 2 143 ? -15.539 -57.836 230.610 1.00 30.00 ? 535 GLN B CA  1 
ATOM 4077 C C   . GLN B 2 143 ? -14.579 -56.746 230.149 1.00 30.00 ? 535 GLN B C   1 
ATOM 4078 O O   . GLN B 2 143 ? -13.369 -56.842 230.358 1.00 30.00 ? 535 GLN B O   1 
ATOM 4079 C CB  . GLN B 2 143 ? -16.476 -57.261 231.672 1.00 30.00 ? 535 GLN B CB  1 
ATOM 4080 C CG  . GLN B 2 143 ? -17.396 -58.285 232.305 1.00 30.00 ? 535 GLN B CG  1 
ATOM 4081 C CD  . GLN B 2 143 ? -18.700 -58.438 231.558 1.00 30.00 ? 535 GLN B CD  1 
ATOM 4082 O OE1 . GLN B 2 143 ? -19.571 -57.572 231.636 1.00 30.00 ? 535 GLN B OE1 1 
ATOM 4083 N NE2 . GLN B 2 143 ? -18.841 -59.534 230.822 1.00 30.00 ? 535 GLN B NE2 1 
ATOM 4084 N N   . ILE B 2 144 ? -15.122 -55.710 229.519 1.00 30.00 ? 536 ILE B N   1 
ATOM 4085 C CA  . ILE B 2 144 ? -14.303 -54.598 229.057 1.00 30.00 ? 536 ILE B CA  1 
ATOM 4086 C C   . ILE B 2 144 ? -14.953 -53.288 229.477 1.00 30.00 ? 536 ILE B C   1 
ATOM 4087 O O   . ILE B 2 144 ? -16.175 -53.196 229.561 1.00 30.00 ? 536 ILE B O   1 
ATOM 4088 C CB  . ILE B 2 144 ? -14.127 -54.620 227.524 1.00 30.00 ? 536 ILE B CB  1 
ATOM 4089 C CG1 . ILE B 2 144 ? -15.487 -54.572 226.830 1.00 30.00 ? 536 ILE B CG1 1 
ATOM 4090 C CG2 . ILE B 2 144 ? -13.377 -55.875 227.112 1.00 30.00 ? 536 ILE B CG2 1 
ATOM 4091 C CD1 . ILE B 2 144 ? -15.386 -54.586 225.314 1.00 30.00 ? 536 ILE B CD1 1 
ATOM 4092 N N   . GLU B 2 145 ? -14.134 -52.283 229.759 1.00 30.00 ? 537 GLU B N   1 
ATOM 4093 C CA  . GLU B 2 145 ? -14.654 -50.988 230.172 1.00 30.00 ? 537 GLU B CA  1 
ATOM 4094 C C   . GLU B 2 145 ? -14.978 -50.105 228.975 1.00 30.00 ? 537 GLU B C   1 
ATOM 4095 O O   . GLU B 2 145 ? -15.749 -49.153 229.085 1.00 30.00 ? 537 GLU B O   1 
ATOM 4096 C CB  . GLU B 2 145 ? -13.650 -50.284 231.088 1.00 30.00 ? 537 GLU B CB  1 
ATOM 4097 C CG  . GLU B 2 145 ? -13.517 -50.933 232.458 1.00 30.00 ? 537 GLU B CG  1 
ATOM 4098 C CD  . GLU B 2 145 ? -12.561 -50.190 233.369 1.00 30.00 ? 537 GLU B CD  1 
ATOM 4099 O OE1 . GLU B 2 145 ? -12.760 -48.971 233.571 1.00 30.00 ? 537 GLU B OE1 1 
ATOM 4100 O OE2 . GLU B 2 145 ? -11.614 -50.822 233.884 1.00 30.00 ? 537 GLU B OE2 1 
ATOM 4101 N N   . SER B 2 146 ? -14.385 -50.429 227.828 1.00 30.00 ? 538 SER B N   1 
ATOM 4102 C CA  . SER B 2 146 ? -14.604 -49.674 226.601 1.00 30.00 ? 538 SER B CA  1 
ATOM 4103 C C   . SER B 2 146 ? -13.960 -50.399 225.432 1.00 30.00 ? 538 SER B C   1 
ATOM 4104 O O   . SER B 2 146 ? -13.283 -51.411 225.616 1.00 30.00 ? 538 SER B O   1 
ATOM 4105 C CB  . SER B 2 146 ? -14.005 -48.272 226.725 1.00 30.00 ? 538 SER B CB  1 
ATOM 4106 O OG  . SER B 2 146 ? -12.609 -48.341 226.957 1.00 30.00 ? 538 SER B OG  1 
ATOM 4107 N N   . PHE B 2 147 ? -14.168 -49.876 224.227 1.00 30.00 ? 539 PHE B N   1 
ATOM 4108 C CA  . PHE B 2 147 ? -13.602 -50.476 223.026 1.00 30.00 ? 539 PHE B CA  1 
ATOM 4109 C C   . PHE B 2 147 ? -12.153 -50.035 222.830 1.00 30.00 ? 539 PHE B C   1 
ATOM 4110 O O   . PHE B 2 147 ? -11.553 -50.271 221.780 1.00 30.00 ? 539 PHE B O   1 
ATOM 4111 C CB  . PHE B 2 147 ? -14.446 -50.099 221.809 1.00 30.00 ? 539 PHE B CB  1 
ATOM 4112 C CG  . PHE B 2 147 ? -15.831 -50.688 221.829 1.00 30.00 ? 539 PHE B CG  1 
ATOM 4113 C CD1 . PHE B 2 147 ? -16.012 -52.066 221.824 1.00 30.00 ? 539 PHE B CD1 1 
ATOM 4114 C CD2 . PHE B 2 147 ? -16.951 -49.865 221.850 1.00 30.00 ? 539 PHE B CD2 1 
ATOM 4115 C CE1 . PHE B 2 147 ? -17.287 -52.616 221.837 1.00 30.00 ? 539 PHE B CE1 1 
ATOM 4116 C CE2 . PHE B 2 147 ? -18.233 -50.405 221.863 1.00 30.00 ? 539 PHE B CE2 1 
ATOM 4117 C CZ  . PHE B 2 147 ? -18.401 -51.783 221.857 1.00 30.00 ? 539 PHE B CZ  1 
ATOM 4118 N N   . LYS B 2 148 ? -11.604 -49.397 223.859 1.00 30.00 ? 540 LYS B N   1 
ATOM 4119 C CA  . LYS B 2 148 ? -10.226 -48.924 223.852 1.00 30.00 ? 540 LYS B CA  1 
ATOM 4120 C C   . LYS B 2 148 ? -9.453  -49.727 224.895 1.00 30.00 ? 540 LYS B C   1 
ATOM 4121 O O   . LYS B 2 148 ? -8.235  -49.602 225.025 1.00 30.00 ? 540 LYS B O   1 
ATOM 4122 C CB  . LYS B 2 148 ? -10.181 -47.434 224.211 1.00 30.00 ? 540 LYS B CB  1 
ATOM 4123 C CG  . LYS B 2 148 ? -8.776  -46.857 224.300 1.00 30.00 ? 540 LYS B CG  1 
ATOM 4124 C CD  . LYS B 2 148 ? -8.770  -45.498 224.981 1.00 30.00 ? 540 LYS B CD  1 
ATOM 4125 C CE  . LYS B 2 148 ? -7.344  -45.003 225.198 1.00 30.00 ? 540 LYS B CE  1 
ATOM 4126 N NZ  . LYS B 2 148 ? -7.305  -43.731 225.974 1.00 30.00 ? 540 LYS B NZ  1 
ATOM 4127 N N   . ASP B 2 149 ? -10.182 -50.557 225.635 1.00 30.00 ? 541 ASP B N   1 
ATOM 4128 C CA  . ASP B 2 149 ? -9.606  -51.387 226.683 1.00 30.00 ? 541 ASP B CA  1 
ATOM 4129 C C   . ASP B 2 149 ? -8.360  -52.132 226.199 1.00 30.00 ? 541 ASP B C   1 
ATOM 4130 O O   . ASP B 2 149 ? -8.409  -52.915 225.247 1.00 30.00 ? 541 ASP B O   1 
ATOM 4131 C CB  . ASP B 2 149 ? -10.662 -52.372 227.189 1.00 30.00 ? 541 ASP B CB  1 
ATOM 4132 C CG  . ASP B 2 149 ? -10.355 -52.896 228.573 1.00 30.00 ? 541 ASP B CG  1 
ATOM 4133 O OD1 . ASP B 2 149 ? -11.298 -53.359 229.251 1.00 30.00 ? 541 ASP B OD1 1 
ATOM 4134 O OD2 . ASP B 2 149 ? -9.175  -52.855 228.978 1.00 30.00 ? 541 ASP B OD2 1 
ATOM 4135 N N   . LYS B 2 150 ? -7.244  -51.877 226.876 1.00 30.00 ? 542 LYS B N   1 
ATOM 4136 C CA  . LYS B 2 150 ? -5.946  -52.469 226.548 1.00 30.00 ? 542 LYS B CA  1 
ATOM 4137 C C   . LYS B 2 150 ? -5.932  -53.997 226.498 1.00 30.00 ? 542 LYS B C   1 
ATOM 4138 O O   . LYS B 2 150 ? -5.246  -54.588 225.663 1.00 30.00 ? 542 LYS B O   1 
ATOM 4139 C CB  . LYS B 2 150 ? -4.903  -51.991 227.563 1.00 30.00 ? 542 LYS B CB  1 
ATOM 4140 C CG  . LYS B 2 150 ? -4.957  -50.490 227.832 1.00 30.00 ? 542 LYS B CG  1 
ATOM 4141 C CD  . LYS B 2 150 ? -4.242  -50.129 229.126 1.00 30.00 ? 542 LYS B CD  1 
ATOM 4142 C CE  . LYS B 2 150 ? -4.452  -48.662 229.485 1.00 30.00 ? 542 LYS B CE  1 
ATOM 4143 N NZ  . LYS B 2 150 ? -3.899  -48.325 230.832 1.00 30.00 ? 542 LYS B NZ  1 
ATOM 4144 N N   . SER B 2 151 ? -6.682  -54.632 227.394 1.00 30.00 ? 543 SER B N   1 
ATOM 4145 C CA  . SER B 2 151 ? -6.728  -56.088 227.453 1.00 30.00 ? 543 SER B CA  1 
ATOM 4146 C C   . SER B 2 151 ? -7.272  -56.729 226.177 1.00 30.00 ? 543 SER B C   1 
ATOM 4147 O O   . SER B 2 151 ? -7.098  -57.927 225.956 1.00 30.00 ? 543 SER B O   1 
ATOM 4148 C CB  . SER B 2 151 ? -7.565  -56.542 228.655 1.00 30.00 ? 543 SER B CB  1 
ATOM 4149 O OG  . SER B 2 151 ? -8.908  -56.102 228.552 1.00 30.00 ? 543 SER B OG  1 
ATOM 4150 N N   . LEU B 2 152 ? -7.927  -55.929 225.342 1.00 30.00 ? 544 LEU B N   1 
ATOM 4151 C CA  . LEU B 2 152 ? -8.494  -56.429 224.094 1.00 30.00 ? 544 LEU B CA  1 
ATOM 4152 C C   . LEU B 2 152 ? -7.445  -57.056 223.179 1.00 30.00 ? 544 LEU B C   1 
ATOM 4153 O O   . LEU B 2 152 ? -7.735  -58.007 222.455 1.00 30.00 ? 544 LEU B O   1 
ATOM 4154 C CB  . LEU B 2 152 ? -9.211  -55.293 223.350 1.00 30.00 ? 544 LEU B CB  1 
ATOM 4155 C CG  . LEU B 2 152 ? -10.579 -54.885 223.903 1.00 30.00 ? 544 LEU B CG  1 
ATOM 4156 C CD1 . LEU B 2 152 ? -11.057 -53.611 223.234 1.00 30.00 ? 544 LEU B CD1 1 
ATOM 4157 C CD2 . LEU B 2 152 ? -11.568 -56.016 223.678 1.00 30.00 ? 544 LEU B CD2 1 
ATOM 4158 N N   . SER B 2 153 ? -6.226  -56.527 223.225 1.00 30.00 ? 545 SER B N   1 
ATOM 4159 C CA  . SER B 2 153 ? -5.127  -57.011 222.391 1.00 30.00 ? 545 SER B CA  1 
ATOM 4160 C C   . SER B 2 153 ? -4.870  -58.514 222.472 1.00 30.00 ? 545 SER B C   1 
ATOM 4161 O O   . SER B 2 153 ? -4.336  -59.100 221.528 1.00 30.00 ? 545 SER B O   1 
ATOM 4162 C CB  . SER B 2 153 ? -3.837  -56.260 222.737 1.00 30.00 ? 545 SER B CB  1 
ATOM 4163 O OG  . SER B 2 153 ? -3.517  -56.395 224.111 1.00 30.00 ? 545 SER B OG  1 
ATOM 4164 N N   . SER B 2 154 ? -5.245  -59.135 223.588 1.00 30.00 ? 546 SER B N   1 
ATOM 4165 C CA  . SER B 2 154 ? -5.031  -60.570 223.759 1.00 30.00 ? 546 SER B CA  1 
ATOM 4166 C C   . SER B 2 154 ? -5.924  -61.361 222.819 1.00 30.00 ? 546 SER B C   1 
ATOM 4167 O O   . SER B 2 154 ? -5.545  -62.437 222.356 1.00 30.00 ? 546 SER B O   1 
ATOM 4168 C CB  . SER B 2 154 ? -5.314  -60.994 225.203 1.00 30.00 ? 546 SER B CB  1 
ATOM 4169 O OG  . SER B 2 154 ? -6.707  -61.027 225.464 1.00 30.00 ? 546 SER B OG  1 
ATOM 4170 N N   . GLY B 2 155 ? -7.107  -60.823 222.544 1.00 30.00 ? 547 GLY B N   1 
ATOM 4171 C CA  . GLY B 2 155 ? -8.043  -61.487 221.652 1.00 30.00 ? 547 GLY B CA  1 
ATOM 4172 C C   . GLY B 2 155 ? -8.945  -62.473 222.369 1.00 30.00 ? 547 GLY B C   1 
ATOM 4173 O O   . GLY B 2 155 ? -9.835  -63.078 221.764 1.00 30.00 ? 547 GLY B O   1 
ATOM 4174 N N   . LEU B 2 156 ? -8.720  -62.634 223.667 1.00 30.00 ? 548 LEU B N   1 
ATOM 4175 C CA  . LEU B 2 156 ? -9.505  -63.562 224.466 1.00 30.00 ? 548 LEU B CA  1 
ATOM 4176 C C   . LEU B 2 156 ? -10.974 -63.154 224.577 1.00 30.00 ? 548 LEU B C   1 
ATOM 4177 O O   . LEU B 2 156 ? -11.870 -64.000 224.495 1.00 30.00 ? 548 LEU B O   1 
ATOM 4178 C CB  . LEU B 2 156 ? -8.881  -63.696 225.855 1.00 30.00 ? 548 LEU B CB  1 
ATOM 4179 C CG  . LEU B 2 156 ? -7.490  -64.336 225.833 1.00 30.00 ? 548 LEU B CG  1 
ATOM 4180 C CD1 . LEU B 2 156 ? -6.902  -64.361 227.232 1.00 30.00 ? 548 LEU B CD1 1 
ATOM 4181 C CD2 . LEU B 2 156 ? -7.593  -65.746 225.277 1.00 30.00 ? 548 LEU B CD2 1 
ATOM 4182 N N   . PHE B 2 157 ? -11.221 -61.861 224.759 1.00 30.00 ? 549 PHE B N   1 
ATOM 4183 C CA  . PHE B 2 157 ? -12.589 -61.375 224.873 1.00 30.00 ? 549 PHE B CA  1 
ATOM 4184 C C   . PHE B 2 157 ? -13.395 -61.691 223.616 1.00 30.00 ? 549 PHE B C   1 
ATOM 4185 O O   . PHE B 2 157 ? -14.469 -62.286 223.696 1.00 30.00 ? 549 PHE B O   1 
ATOM 4186 C CB  . PHE B 2 157 ? -12.607 -59.866 225.114 1.00 30.00 ? 549 PHE B CB  1 
ATOM 4187 C CG  . PHE B 2 157 ? -13.984 -59.314 225.336 1.00 30.00 ? 549 PHE B CG  1 
ATOM 4188 C CD1 . PHE B 2 157 ? -14.672 -59.589 226.517 1.00 30.00 ? 549 PHE B CD1 1 
ATOM 4189 C CD2 . PHE B 2 157 ? -14.612 -58.557 224.352 1.00 30.00 ? 549 PHE B CD2 1 
ATOM 4190 C CE1 . PHE B 2 157 ? -15.967 -59.116 226.716 1.00 30.00 ? 549 PHE B CE1 1 
ATOM 4191 C CE2 . PHE B 2 157 ? -15.903 -58.080 224.538 1.00 30.00 ? 549 PHE B CE2 1 
ATOM 4192 C CZ  . PHE B 2 157 ? -16.584 -58.361 225.723 1.00 30.00 ? 549 PHE B CZ  1 
ATOM 4193 N N   . PHE B 2 158 ? -12.877 -61.290 222.457 1.00 30.00 ? 550 PHE B N   1 
ATOM 4194 C CA  . PHE B 2 158 ? -13.566 -61.536 221.196 1.00 30.00 ? 550 PHE B CA  1 
ATOM 4195 C C   . PHE B 2 158 ? -13.883 -63.017 220.996 1.00 30.00 ? 550 PHE B C   1 
ATOM 4196 O O   . PHE B 2 158 ? -15.001 -63.373 220.624 1.00 30.00 ? 550 PHE B O   1 
ATOM 4197 C CB  . PHE B 2 158 ? -12.727 -61.028 220.013 1.00 30.00 ? 550 PHE B CB  1 
ATOM 4198 C CG  . PHE B 2 158 ? -12.867 -59.550 219.753 1.00 30.00 ? 550 PHE B CG  1 
ATOM 4199 C CD1 . PHE B 2 158 ? -11.770 -58.700 219.880 1.00 30.00 ? 550 PHE B CD1 1 
ATOM 4200 C CD2 . PHE B 2 158 ? -14.093 -59.011 219.366 1.00 30.00 ? 550 PHE B CD2 1 
ATOM 4201 C CE1 . PHE B 2 158 ? -11.890 -57.336 219.628 1.00 30.00 ? 550 PHE B CE1 1 
ATOM 4202 C CE2 . PHE B 2 158 ? -14.227 -57.648 219.110 1.00 30.00 ? 550 PHE B CE2 1 
ATOM 4203 C CZ  . PHE B 2 158 ? -13.119 -56.806 219.241 1.00 30.00 ? 550 PHE B CZ  1 
ATOM 4204 N N   . LEU B 2 159 ? -12.899 -63.875 221.248 1.00 30.00 ? 551 LEU B N   1 
ATOM 4205 C CA  . LEU B 2 159 ? -13.090 -65.313 221.084 1.00 30.00 ? 551 LEU B CA  1 
ATOM 4206 C C   . LEU B 2 159 ? -14.160 -65.856 222.022 1.00 30.00 ? 551 LEU B C   1 
ATOM 4207 O O   . LEU B 2 159 ? -14.874 -66.798 221.681 1.00 30.00 ? 551 LEU B O   1 
ATOM 4208 C CB  . LEU B 2 159 ? -11.760 -66.045 221.288 1.00 30.00 ? 551 LEU B CB  1 
ATOM 4209 C CG  . LEU B 2 159 ? -10.784 -65.796 220.128 1.00 30.00 ? 551 LEU B CG  1 
ATOM 4210 C CD1 . LEU B 2 159 ? -9.400  -66.294 220.478 1.00 30.00 ? 551 LEU B CD1 1 
ATOM 4211 C CD2 . LEU B 2 159 ? -11.303 -66.486 218.870 1.00 30.00 ? 551 LEU B CD2 1 
ATOM 4212 N N   . ASN B 2 160 ? -14.276 -65.261 223.204 1.00 30.00 ? 552 ASN B N   1 
ATOM 4213 C CA  . ASN B 2 160 ? -15.290 -65.677 224.158 1.00 30.00 ? 552 ASN B CA  1 
ATOM 4214 C C   . ASN B 2 160 ? -16.654 -65.197 223.659 1.00 30.00 ? 552 ASN B C   1 
ATOM 4215 O O   . ASN B 2 160 ? -17.642 -65.933 223.707 1.00 30.00 ? 552 ASN B O   1 
ATOM 4216 C CB  . ASN B 2 160 ? -14.982 -65.092 225.540 1.00 30.00 ? 552 ASN B CB  1 
ATOM 4217 C CG  . ASN B 2 160 ? -14.128 -66.021 226.392 1.00 30.00 ? 552 ASN B CG  1 
ATOM 4218 O OD1 . ASN B 2 160 ? -14.630 -66.996 226.956 1.00 30.00 ? 552 ASN B OD1 1 
ATOM 4219 N ND2 . ASN B 2 160 ? -12.832 -65.732 226.478 1.00 30.00 ? 552 ASN B ND2 1 
ATOM 4220 N N   . LEU B 2 161 ? -16.696 -63.960 223.168 1.00 30.00 ? 553 LEU B N   1 
ATOM 4221 C CA  . LEU B 2 161 ? -17.933 -63.381 222.648 1.00 30.00 ? 553 LEU B CA  1 
ATOM 4222 C C   . LEU B 2 161 ? -18.418 -64.196 221.448 1.00 30.00 ? 553 LEU B C   1 
ATOM 4223 O O   . LEU B 2 161 ? -19.598 -64.528 221.348 1.00 30.00 ? 553 LEU B O   1 
ATOM 4224 C CB  . LEU B 2 161 ? -17.697 -61.922 222.236 1.00 30.00 ? 553 LEU B CB  1 
ATOM 4225 C CG  . LEU B 2 161 ? -18.871 -61.116 221.667 1.00 30.00 ? 553 LEU B CG  1 
ATOM 4226 C CD1 . LEU B 2 161 ? -19.979 -60.987 222.699 1.00 30.00 ? 553 LEU B CD1 1 
ATOM 4227 C CD2 . LEU B 2 161 ? -18.372 -59.739 221.259 1.00 30.00 ? 553 LEU B CD2 1 
ATOM 4228 N N   . LEU B 2 162 ? -17.495 -64.519 220.547 1.00 30.00 ? 554 LEU B N   1 
ATOM 4229 C CA  . LEU B 2 162 ? -17.825 -65.308 219.365 1.00 30.00 ? 554 LEU B CA  1 
ATOM 4230 C C   . LEU B 2 162 ? -18.294 -66.695 219.784 1.00 30.00 ? 554 LEU B C   1 
ATOM 4231 O O   . LEU B 2 162 ? -19.215 -67.260 219.194 1.00 30.00 ? 554 LEU B O   1 
ATOM 4232 C CB  . LEU B 2 162 ? -16.604 -65.433 218.452 1.00 30.00 ? 554 LEU B CB  1 
ATOM 4233 C CG  . LEU B 2 162 ? -16.263 -64.220 217.587 1.00 30.00 ? 554 LEU B CG  1 
ATOM 4234 C CD1 . LEU B 2 162 ? -14.939 -64.451 216.863 1.00 30.00 ? 554 LEU B CD1 1 
ATOM 4235 C CD2 . LEU B 2 162 ? -17.386 -63.992 216.588 1.00 30.00 ? 554 LEU B CD2 1 
ATOM 4236 N N   . TRP B 2 163 ? -17.638 -67.240 220.803 1.00 30.00 ? 555 TRP B N   1 
ATOM 4237 C CA  . TRP B 2 163 ? -17.981 -68.553 221.325 1.00 30.00 ? 555 TRP B CA  1 
ATOM 4238 C C   . TRP B 2 163 ? -19.375 -68.470 221.936 1.00 30.00 ? 555 TRP B C   1 
ATOM 4239 O O   . TRP B 2 163 ? -20.180 -69.392 221.801 1.00 30.00 ? 555 TRP B O   1 
ATOM 4240 C CB  . TRP B 2 163 ? -16.964 -68.971 222.387 1.00 30.00 ? 555 TRP B CB  1 
ATOM 4241 C CG  . TRP B 2 163 ? -17.278 -70.263 223.056 1.00 30.00 ? 555 TRP B CG  1 
ATOM 4242 C CD1 . TRP B 2 163 ? -17.300 -71.501 222.486 1.00 30.00 ? 555 TRP B CD1 1 
ATOM 4243 C CD2 . TRP B 2 163 ? -17.630 -70.447 224.432 1.00 30.00 ? 555 TRP B CD2 1 
ATOM 4244 N NE1 . TRP B 2 163 ? -17.647 -72.447 223.421 1.00 30.00 ? 555 TRP B NE1 1 
ATOM 4245 C CE2 . TRP B 2 163 ? -17.852 -71.826 224.626 1.00 30.00 ? 555 TRP B CE2 1 
ATOM 4246 C CE3 . TRP B 2 163 ? -17.776 -69.575 225.522 1.00 30.00 ? 555 TRP B CE3 1 
ATOM 4247 C CZ2 . TRP B 2 163 ? -18.219 -72.360 225.865 1.00 30.00 ? 555 TRP B CZ2 1 
ATOM 4248 C CZ3 . TRP B 2 163 ? -18.140 -70.106 226.756 1.00 30.00 ? 555 TRP B CZ3 1 
ATOM 4249 C CH2 . TRP B 2 163 ? -18.356 -71.487 226.916 1.00 30.00 ? 555 TRP B CH2 1 
ATOM 4250 N N   . ALA B 2 164 ? -19.653 -67.353 222.603 1.00 30.00 ? 556 ALA B N   1 
ATOM 4251 C CA  . ALA B 2 164 ? -20.956 -67.132 223.225 1.00 30.00 ? 556 ALA B CA  1 
ATOM 4252 C C   . ALA B 2 164 ? -22.038 -67.105 222.149 1.00 30.00 ? 556 ALA B C   1 
ATOM 4253 O O   . ALA B 2 164 ? -23.091 -67.716 222.306 1.00 30.00 ? 556 ALA B O   1 
ATOM 4254 C CB  . ALA B 2 164 ? -20.950 -65.820 223.990 1.00 30.00 ? 556 ALA B CB  1 
ATOM 4255 N N   . VAL B 2 165 ? -21.763 -66.399 221.054 1.00 30.00 ? 557 VAL B N   1 
ATOM 4256 C CA  . VAL B 2 165 ? -22.710 -66.296 219.948 1.00 30.00 ? 557 VAL B CA  1 
ATOM 4257 C C   . VAL B 2 165 ? -22.957 -67.656 219.300 1.00 30.00 ? 557 VAL B C   1 
ATOM 4258 O O   . VAL B 2 165 ? -24.101 -68.075 219.140 1.00 30.00 ? 557 VAL B O   1 
ATOM 4259 C CB  . VAL B 2 165 ? -22.203 -65.311 218.861 1.00 30.00 ? 557 VAL B CB  1 
ATOM 4260 C CG1 . VAL B 2 165 ? -23.107 -65.370 217.634 1.00 30.00 ? 557 VAL B CG1 1 
ATOM 4261 C CG2 . VAL B 2 165 ? -22.169 -63.895 219.416 1.00 30.00 ? 557 VAL B CG2 1 
ATOM 4262 N N   . GLU B 2 166 ? -21.880 -68.341 218.932 1.00 30.00 ? 558 GLU B N   1 
ATOM 4263 C CA  . GLU B 2 166 ? -21.982 -69.651 218.296 1.00 30.00 ? 558 GLU B CA  1 
ATOM 4264 C C   . GLU B 2 166 ? -20.758 -70.492 218.658 1.00 30.00 ? 558 GLU B C   1 
ATOM 4265 O O   . GLU B 2 166 ? -19.743 -70.457 217.962 1.00 30.00 ? 558 GLU B O   1 
ATOM 4266 C CB  . GLU B 2 166 ? -22.065 -69.489 216.776 1.00 30.00 ? 558 GLU B CB  1 
ATOM 4267 C CG  . GLU B 2 166 ? -22.291 -70.784 216.010 1.00 30.00 ? 558 GLU B CG  1 
ATOM 4268 C CD  . GLU B 2 166 ? -23.657 -71.390 216.272 1.00 30.00 ? 558 GLU B CD  1 
ATOM 4269 O OE1 . GLU B 2 166 ? -23.893 -71.879 217.394 1.00 30.00 ? 558 GLU B OE1 1 
ATOM 4270 O OE2 . GLU B 2 166 ? -24.502 -71.371 215.352 1.00 30.00 ? 558 GLU B OE2 1 
ATOM 4271 N N   . PRO B 2 167 ? -20.847 -71.265 219.750 1.00 30.00 ? 559 PRO B N   1 
ATOM 4272 C CA  . PRO B 2 167 ? -19.745 -72.117 220.210 1.00 30.00 ? 559 PRO B CA  1 
ATOM 4273 C C   . PRO B 2 167 ? -19.176 -73.055 219.150 1.00 30.00 ? 559 PRO B C   1 
ATOM 4274 O O   . PRO B 2 167 ? -18.023 -73.472 219.235 1.00 30.00 ? 559 PRO B O   1 
ATOM 4275 C CB  . PRO B 2 167 ? -20.364 -72.873 221.382 1.00 30.00 ? 559 PRO B CB  1 
ATOM 4276 C CG  . PRO B 2 167 ? -21.813 -72.952 220.999 1.00 30.00 ? 559 PRO B CG  1 
ATOM 4277 C CD  . PRO B 2 167 ? -22.075 -71.555 220.510 1.00 30.00 ? 559 PRO B CD  1 
ATOM 4278 N N   . ARG B 2 168 ? -19.987 -73.376 218.147 1.00 30.00 ? 560 ARG B N   1 
ATOM 4279 C CA  . ARG B 2 168 ? -19.562 -74.275 217.079 1.00 30.00 ? 560 ARG B CA  1 
ATOM 4280 C C   . ARG B 2 168 ? -18.523 -73.677 216.120 1.00 30.00 ? 560 ARG B C   1 
ATOM 4281 O O   . ARG B 2 168 ? -17.894 -74.413 215.359 1.00 30.00 ? 560 ARG B O   1 
ATOM 4282 C CB  . ARG B 2 168 ? -20.790 -74.752 216.292 1.00 30.00 ? 560 ARG B CB  1 
ATOM 4283 C CG  . ARG B 2 168 ? -21.882 -75.340 217.186 1.00 30.00 ? 560 ARG B CG  1 
ATOM 4284 C CD  . ARG B 2 168 ? -23.150 -75.720 216.420 1.00 30.00 ? 560 ARG B CD  1 
ATOM 4285 N NE  . ARG B 2 168 ? -22.988 -76.923 215.604 1.00 30.00 ? 560 ARG B NE  1 
ATOM 4286 C CZ  . ARG B 2 168 ? -23.982 -77.524 214.955 1.00 30.00 ? 560 ARG B CZ  1 
ATOM 4287 N NH1 . ARG B 2 168 ? -25.215 -77.039 215.026 1.00 30.00 ? 560 ARG B NH1 1 
ATOM 4288 N NH2 . ARG B 2 168 ? -23.747 -78.613 214.233 1.00 30.00 ? 560 ARG B NH2 1 
ATOM 4289 N N   . VAL B 2 169 ? -18.329 -72.361 216.156 1.00 30.00 ? 561 VAL B N   1 
ATOM 4290 C CA  . VAL B 2 169 ? -17.359 -71.724 215.262 1.00 30.00 ? 561 VAL B CA  1 
ATOM 4291 C C   . VAL B 2 169 ? -16.015 -71.406 215.912 1.00 30.00 ? 561 VAL B C   1 
ATOM 4292 O O   . VAL B 2 169 ? -15.109 -70.893 215.250 1.00 30.00 ? 561 VAL B O   1 
ATOM 4293 C CB  . VAL B 2 169 ? -17.913 -70.414 214.646 1.00 30.00 ? 561 VAL B CB  1 
ATOM 4294 C CG1 . VAL B 2 169 ? -19.167 -70.709 213.847 1.00 30.00 ? 561 VAL B CG1 1 
ATOM 4295 C CG2 . VAL B 2 169 ? -18.191 -69.390 215.740 1.00 30.00 ? 561 VAL B CG2 1 
ATOM 4296 N N   . VAL B 2 170 ? -15.880 -71.700 217.199 1.00 30.00 ? 562 VAL B N   1 
ATOM 4297 C CA  . VAL B 2 170 ? -14.622 -71.439 217.885 1.00 30.00 ? 562 VAL B CA  1 
ATOM 4298 C C   . VAL B 2 170 ? -14.019 -72.713 218.465 1.00 30.00 ? 562 VAL B C   1 
ATOM 4299 O O   . VAL B 2 170 ? -14.582 -73.324 219.374 1.00 30.00 ? 562 VAL B O   1 
ATOM 4300 C CB  . VAL B 2 170 ? -14.792 -70.418 219.034 1.00 30.00 ? 562 VAL B CB  1 
ATOM 4301 C CG1 . VAL B 2 170 ? -13.461 -70.214 219.746 1.00 30.00 ? 562 VAL B CG1 1 
ATOM 4302 C CG2 . VAL B 2 170 ? -15.294 -69.089 218.487 1.00 30.00 ? 562 VAL B CG2 1 
ATOM 4303 N N   . ASN B 2 171 ? -12.872 -73.118 217.928 1.00 30.00 ? 563 ASN B N   1 
ATOM 4304 C CA  . ASN B 2 171 ? -12.181 -74.303 218.421 1.00 30.00 ? 563 ASN B CA  1 
ATOM 4305 C C   . ASN B 2 171 ? -11.108 -73.788 219.364 1.00 30.00 ? 563 ASN B C   1 
ATOM 4306 O O   . ASN B 2 171 ? -10.126 -73.192 218.929 1.00 30.00 ? 563 ASN B O   1 
ATOM 4307 C CB  . ASN B 2 171 ? -11.548 -75.079 217.267 1.00 30.00 ? 563 ASN B CB  1 
ATOM 4308 C CG  . ASN B 2 171 ? -10.986 -76.418 217.703 1.00 30.00 ? 563 ASN B CG  1 
ATOM 4309 O OD1 . ASN B 2 171 ? -10.959 -77.367 216.925 1.00 30.00 ? 563 ASN B OD1 1 
ATOM 4310 N ND2 . ASN B 2 171 ? -10.524 -76.499 218.948 1.00 30.00 ? 563 ASN B ND2 1 
ATOM 4311 N N   . TRP B 2 172 ? -11.299 -74.017 220.658 1.00 30.00 ? 564 TRP B N   1 
ATOM 4312 C CA  . TRP B 2 172 ? -10.356 -73.527 221.650 1.00 30.00 ? 564 TRP B CA  1 
ATOM 4313 C C   . TRP B 2 172 ? -8.974  -74.165 221.660 1.00 30.00 ? 564 TRP B C   1 
ATOM 4314 O O   . TRP B 2 172 ? -8.043  -73.604 222.241 1.00 30.00 ? 564 TRP B O   1 
ATOM 4315 C CB  . TRP B 2 172 ? -10.992 -73.585 223.040 1.00 30.00 ? 564 TRP B CB  1 
ATOM 4316 C CG  . TRP B 2 172 ? -12.128 -72.621 223.155 1.00 30.00 ? 564 TRP B CG  1 
ATOM 4317 C CD1 . TRP B 2 172 ? -13.444 -72.863 222.884 1.00 30.00 ? 564 TRP B CD1 1 
ATOM 4318 C CD2 . TRP B 2 172 ? -12.030 -71.227 223.460 1.00 30.00 ? 564 TRP B CD2 1 
ATOM 4319 N NE1 . TRP B 2 172 ? -14.174 -71.704 222.997 1.00 30.00 ? 564 TRP B NE1 1 
ATOM 4320 C CE2 . TRP B 2 172 ? -13.331 -70.683 223.349 1.00 30.00 ? 564 TRP B CE2 1 
ATOM 4321 C CE3 . TRP B 2 172 ? -10.969 -70.382 223.812 1.00 30.00 ? 564 TRP B CE3 1 
ATOM 4322 C CZ2 . TRP B 2 172 ? -13.599 -69.330 223.579 1.00 30.00 ? 564 TRP B CZ2 1 
ATOM 4323 C CZ3 . TRP B 2 172 ? -11.234 -69.033 224.040 1.00 30.00 ? 564 TRP B CZ3 1 
ATOM 4324 C CH2 . TRP B 2 172 ? -12.542 -68.522 223.921 1.00 30.00 ? 564 TRP B CH2 1 
ATOM 4325 N N   . ASN B 2 173 ? -8.829  -75.323 221.027 1.00 30.00 ? 565 ASN B N   1 
ATOM 4326 C CA  . ASN B 2 173 ? -7.516  -75.949 220.968 1.00 30.00 ? 565 ASN B CA  1 
ATOM 4327 C C   . ASN B 2 173 ? -6.637  -75.063 220.091 1.00 30.00 ? 565 ASN B C   1 
ATOM 4328 O O   . ASN B 2 173 ? -5.415  -75.032 220.245 1.00 30.00 ? 565 ASN B O   1 
ATOM 4329 C CB  . ASN B 2 173 ? -7.587  -77.352 220.351 1.00 30.00 ? 565 ASN B CB  1 
ATOM 4330 C CG  . ASN B 2 173 ? -7.990  -78.418 221.354 1.00 30.00 ? 565 ASN B CG  1 
ATOM 4331 O OD1 . ASN B 2 173 ? -7.879  -78.222 222.565 1.00 30.00 ? 565 ASN B OD1 1 
ATOM 4332 N ND2 . ASN B 2 173 ? -8.443  -79.565 220.854 1.00 30.00 ? 565 ASN B ND2 1 
ATOM 4333 N N   . LEU B 2 174 ? -7.279  -74.332 219.182 1.00 30.00 ? 566 LEU B N   1 
ATOM 4334 C CA  . LEU B 2 174 ? -6.585  -73.448 218.249 1.00 30.00 ? 566 LEU B CA  1 
ATOM 4335 C C   . LEU B 2 174 ? -6.270  -72.063 218.811 1.00 30.00 ? 566 LEU B C   1 
ATOM 4336 O O   . LEU B 2 174 ? -5.437  -71.337 218.265 1.00 30.00 ? 566 LEU B O   1 
ATOM 4337 C CB  . LEU B 2 174 ? -7.415  -73.297 216.971 1.00 30.00 ? 566 LEU B CB  1 
ATOM 4338 C CG  . LEU B 2 174 ? -7.857  -74.592 216.281 1.00 30.00 ? 566 LEU B CG  1 
ATOM 4339 C CD1 . LEU B 2 174 ? -8.598  -74.255 214.993 1.00 30.00 ? 566 LEU B CD1 1 
ATOM 4340 C CD2 . LEU B 2 174 ? -6.649  -75.468 215.982 1.00 30.00 ? 566 LEU B CD2 1 
ATOM 4341 N N   . VAL B 2 175 ? -6.936  -71.691 219.896 1.00 30.00 ? 567 VAL B N   1 
ATOM 4342 C CA  . VAL B 2 175 ? -6.713  -70.383 220.500 1.00 30.00 ? 567 VAL B CA  1 
ATOM 4343 C C   . VAL B 2 175 ? -5.498  -70.392 221.422 1.00 30.00 ? 567 VAL B C   1 
ATOM 4344 O O   . VAL B 2 175 ? -5.186  -71.407 222.047 1.00 30.00 ? 567 VAL B O   1 
ATOM 4345 C CB  . VAL B 2 175 ? -7.942  -69.931 221.310 1.00 30.00 ? 567 VAL B CB  1 
ATOM 4346 C CG1 . VAL B 2 175 ? -7.703  -68.550 221.879 1.00 30.00 ? 567 VAL B CG1 1 
ATOM 4347 C CG2 . VAL B 2 175 ? -9.175  -69.939 220.430 1.00 30.00 ? 567 VAL B CG2 1 
ATOM 4348 N N   . THR B 2 176 ? -4.821  -69.254 221.509 1.00 30.00 ? 568 THR B N   1 
ATOM 4349 C CA  . THR B 2 176 ? -3.642  -69.136 222.356 1.00 30.00 ? 568 THR B CA  1 
ATOM 4350 C C   . THR B 2 176 ? -3.884  -68.090 223.430 1.00 30.00 ? 568 THR B C   1 
ATOM 4351 O O   . THR B 2 176 ? -4.964  -67.508 223.511 1.00 30.00 ? 568 THR B O   1 
ATOM 4352 C CB  . THR B 2 176 ? -2.414  -68.681 221.550 1.00 30.00 ? 568 THR B CB  1 
ATOM 4353 O OG1 . THR B 2 176 ? -2.536  -67.284 221.256 1.00 30.00 ? 568 THR B OG1 1 
ATOM 4354 C CG2 . THR B 2 176 ? -2.313  -69.452 220.249 1.00 30.00 ? 568 THR B CG2 1 
ATOM 4355 N N   . LYS B 2 177 ? -2.874  -67.866 224.263 1.00 30.00 ? 569 LYS B N   1 
ATOM 4356 C CA  . LYS B 2 177 ? -2.960  -66.852 225.305 1.00 30.00 ? 569 LYS B CA  1 
ATOM 4357 C C   . LYS B 2 177 ? -2.631  -65.538 224.606 1.00 30.00 ? 569 LYS B C   1 
ATOM 4358 O O   . LYS B 2 177 ? -1.926  -65.532 223.600 1.00 30.00 ? 569 LYS B O   1 
ATOM 4359 C CB  . LYS B 2 177 ? -1.926  -67.108 226.404 1.00 30.00 ? 569 LYS B CB  1 
ATOM 4360 C CG  . LYS B 2 177 ? -2.257  -68.244 227.352 1.00 30.00 ? 569 LYS B CG  1 
ATOM 4361 C CD  . LYS B 2 177 ? -1.139  -68.423 228.372 1.00 30.00 ? 569 LYS B CD  1 
ATOM 4362 C CE  . LYS B 2 177 ? -1.561  -69.322 229.525 1.00 30.00 ? 569 LYS B CE  1 
ATOM 4363 N NZ  . LYS B 2 177 ? -2.619  -68.689 230.363 1.00 30.00 ? 569 LYS B NZ  1 
ATOM 4364 N N   . GLY B 2 178 ? -3.140  -64.431 225.127 1.00 30.00 ? 570 GLY B N   1 
ATOM 4365 C CA  . GLY B 2 178 ? -2.852  -63.152 224.504 1.00 30.00 ? 570 GLY B CA  1 
ATOM 4366 C C   . GLY B 2 178 ? -1.679  -62.487 225.193 1.00 30.00 ? 570 GLY B C   1 
ATOM 4367 O O   . GLY B 2 178 ? -1.808  -61.387 225.731 1.00 30.00 ? 570 GLY B O   1 
ATOM 4368 N N   . GLU B 2 179 ? -0.529  -63.154 225.176 1.00 30.00 ? 571 GLU B N   1 
ATOM 4369 C CA  . GLU B 2 179 ? 0.659   -62.623 225.829 1.00 30.00 ? 571 GLU B CA  1 
ATOM 4370 C C   . GLU B 2 179 ? 1.695   -62.073 224.856 1.00 30.00 ? 571 GLU B C   1 
ATOM 4371 O O   . GLU B 2 179 ? 1.848   -60.860 224.730 1.00 30.00 ? 571 GLU B O   1 
ATOM 4372 C CB  . GLU B 2 179 ? 1.291   -63.701 226.709 1.00 30.00 ? 571 GLU B CB  1 
ATOM 4373 C CG  . GLU B 2 179 ? 0.353   -64.251 227.772 1.00 30.00 ? 571 GLU B CG  1 
ATOM 4374 C CD  . GLU B 2 179 ? 1.036   -65.233 228.705 1.00 30.00 ? 571 GLU B CD  1 
ATOM 4375 O OE1 . GLU B 2 179 ? 1.583   -66.248 228.215 1.00 30.00 ? 571 GLU B OE1 1 
ATOM 4376 O OE2 . GLU B 2 179 ? 1.025   -64.991 229.931 1.00 30.00 ? 571 GLU B OE2 1 
ATOM 4377 N N   . THR B 2 180 ? 2.407   -62.964 224.174 1.00 30.00 ? 572 THR B N   1 
ATOM 4378 C CA  . THR B 2 180 ? 3.430   -62.543 223.222 1.00 30.00 ? 572 THR B CA  1 
ATOM 4379 C C   . THR B 2 180 ? 2.785   -61.894 222.002 1.00 30.00 ? 572 THR B C   1 
ATOM 4380 O O   . THR B 2 180 ? 1.624   -62.160 221.686 1.00 30.00 ? 572 THR B O   1 
ATOM 4381 C CB  . THR B 2 180 ? 4.281   -63.729 222.743 1.00 30.00 ? 572 THR B CB  1 
ATOM 4382 O OG1 . THR B 2 180 ? 3.530   -64.510 221.807 1.00 30.00 ? 572 THR B OG1 1 
ATOM 4383 C CG2 . THR B 2 180 ? 4.672   -64.611 223.917 1.00 30.00 ? 572 THR B CG2 1 
ATOM 4384 N N   . ASP B 2 181 ? 3.542   -61.043 221.321 1.00 30.00 ? 573 ASP B N   1 
ATOM 4385 C CA  . ASP B 2 181 ? 3.042   -60.363 220.134 1.00 30.00 ? 573 ASP B CA  1 
ATOM 4386 C C   . ASP B 2 181 ? 2.670   -61.378 219.063 1.00 30.00 ? 573 ASP B C   1 
ATOM 4387 O O   . ASP B 2 181 ? 1.811   -61.118 218.219 1.00 30.00 ? 573 ASP B O   1 
ATOM 4388 C CB  . ASP B 2 181 ? 4.103   -59.404 219.593 1.00 30.00 ? 573 ASP B CB  1 
ATOM 4389 C CG  . ASP B 2 181 ? 4.482   -58.337 220.597 1.00 30.00 ? 573 ASP B CG  1 
ATOM 4390 O OD1 . ASP B 2 181 ? 3.587   -57.581 221.031 1.00 30.00 ? 573 ASP B OD1 1 
ATOM 4391 O OD2 . ASP B 2 181 ? 5.676   -58.255 220.954 1.00 30.00 ? 573 ASP B OD2 1 
ATOM 4392 N N   . ASP B 2 182 ? 3.322   -62.536 219.103 1.00 30.00 ? 574 ASP B N   1 
ATOM 4393 C CA  . ASP B 2 182 ? 3.054   -63.598 218.141 1.00 30.00 ? 574 ASP B CA  1 
ATOM 4394 C C   . ASP B 2 182 ? 1.728   -64.277 218.461 1.00 30.00 ? 574 ASP B C   1 
ATOM 4395 O O   . ASP B 2 182 ? 0.923   -64.537 217.565 1.00 30.00 ? 574 ASP B O   1 
ATOM 4396 C CB  . ASP B 2 182 ? 4.178   -64.639 218.169 1.00 30.00 ? 574 ASP B CB  1 
ATOM 4397 C CG  . ASP B 2 182 ? 5.528   -64.050 217.811 1.00 30.00 ? 574 ASP B CG  1 
ATOM 4398 O OD1 . ASP B 2 182 ? 6.050   -63.227 218.596 1.00 30.00 ? 574 ASP B OD1 1 
ATOM 4399 O OD2 . ASP B 2 182 ? 6.067   -64.411 216.741 1.00 30.00 ? 574 ASP B OD2 1 
ATOM 4400 N N   . GLU B 2 183 ? 1.515   -64.562 219.744 1.00 30.00 ? 575 GLU B N   1 
ATOM 4401 C CA  . GLU B 2 183 ? 0.291   -65.211 220.202 1.00 30.00 ? 575 GLU B CA  1 
ATOM 4402 C C   . GLU B 2 183 ? -0.928  -64.343 219.913 1.00 30.00 ? 575 GLU B C   1 
ATOM 4403 O O   . GLU B 2 183 ? -1.974  -64.844 219.503 1.00 30.00 ? 575 GLU B O   1 
ATOM 4404 C CB  . GLU B 2 183 ? 0.372   -65.493 221.708 1.00 30.00 ? 575 GLU B CB  1 
ATOM 4405 C CG  . GLU B 2 183 ? 1.451   -66.485 222.106 1.00 30.00 ? 575 GLU B CG  1 
ATOM 4406 C CD  . GLU B 2 183 ? 1.463   -66.775 223.597 1.00 30.00 ? 575 GLU B CD  1 
ATOM 4407 O OE1 . GLU B 2 183 ? 1.560   -65.817 224.394 1.00 30.00 ? 575 GLU B OE1 1 
ATOM 4408 O OE2 . GLU B 2 183 ? 1.379   -67.963 223.973 1.00 30.00 ? 575 GLU B OE2 1 
ATOM 4409 N N   . LYS B 2 184 ? -0.787  -63.041 220.133 1.00 30.00 ? 576 LYS B N   1 
ATOM 4410 C CA  . LYS B 2 184 ? -1.876  -62.105 219.884 1.00 30.00 ? 576 LYS B CA  1 
ATOM 4411 C C   . LYS B 2 184 ? -2.181  -62.061 218.395 1.00 30.00 ? 576 LYS B C   1 
ATOM 4412 O O   . LYS B 2 184 ? -3.340  -62.116 217.977 1.00 30.00 ? 576 LYS B O   1 
ATOM 4413 C CB  . LYS B 2 184 ? -1.491  -60.707 220.366 1.00 30.00 ? 576 LYS B CB  1 
ATOM 4414 C CG  . LYS B 2 184 ? -1.293  -60.590 221.865 1.00 30.00 ? 576 LYS B CG  1 
ATOM 4415 C CD  . LYS B 2 184 ? -0.976  -59.154 222.251 1.00 30.00 ? 576 LYS B CD  1 
ATOM 4416 C CE  . LYS B 2 184 ? -0.913  -58.986 223.756 1.00 30.00 ? 576 LYS B CE  1 
ATOM 4417 N NZ  . LYS B 2 184 ? -0.643  -57.571 224.120 1.00 30.00 ? 576 LYS B NZ  1 
ATOM 4418 N N   . ARG B 2 185 ? -1.123  -61.957 217.601 1.00 30.00 ? 577 ARG B N   1 
ATOM 4419 C CA  . ARG B 2 185 ? -1.237  -61.901 216.153 1.00 30.00 ? 577 ARG B CA  1 
ATOM 4420 C C   . ARG B 2 185 ? -2.021  -63.113 215.662 1.00 30.00 ? 577 ARG B C   1 
ATOM 4421 O O   . ARG B 2 185 ? -2.863  -63.010 214.770 1.00 30.00 ? 577 ARG B O   1 
ATOM 4422 C CB  . ARG B 2 185 ? 0.165   -61.902 215.532 1.00 30.00 ? 577 ARG B CB  1 
ATOM 4423 C CG  . ARG B 2 185 ? 0.361   -60.924 214.388 1.00 30.00 ? 577 ARG B CG  1 
ATOM 4424 C CD  . ARG B 2 185 ? -0.432  -61.319 213.155 1.00 30.00 ? 577 ARG B CD  1 
ATOM 4425 N NE  . ARG B 2 185 ? -0.245  -60.361 212.066 1.00 30.00 ? 577 ARG B NE  1 
ATOM 4426 C CZ  . ARG B 2 185 ? -0.747  -60.505 210.843 1.00 30.00 ? 577 ARG B CZ  1 
ATOM 4427 N NH1 . ARG B 2 185 ? -1.470  -61.575 210.542 1.00 30.00 ? 577 ARG B NH1 1 
ATOM 4428 N NH2 . ARG B 2 185 ? -0.526  -59.580 209.920 1.00 30.00 ? 577 ARG B NH2 1 
ATOM 4429 N N   . LEU B 2 186 ? -1.744  -64.261 216.268 1.00 30.00 ? 578 LEU B N   1 
ATOM 4430 C CA  . LEU B 2 186 ? -2.399  -65.503 215.888 1.00 30.00 ? 578 LEU B CA  1 
ATOM 4431 C C   . LEU B 2 186 ? -3.893  -65.520 216.205 1.00 30.00 ? 578 LEU B C   1 
ATOM 4432 O O   . LEU B 2 186 ? -4.700  -65.963 215.386 1.00 30.00 ? 578 LEU B O   1 
ATOM 4433 C CB  . LEU B 2 186 ? -1.700  -66.682 216.567 1.00 30.00 ? 578 LEU B CB  1 
ATOM 4434 C CG  . LEU B 2 186 ? -2.057  -68.083 216.066 1.00 30.00 ? 578 LEU B CG  1 
ATOM 4435 C CD1 . LEU B 2 186 ? -1.832  -68.178 214.561 1.00 30.00 ? 578 LEU B CD1 1 
ATOM 4436 C CD2 . LEU B 2 186 ? -1.203  -69.107 216.801 1.00 30.00 ? 578 LEU B CD2 1 
ATOM 4437 N N   . ASN B 2 187 ? -4.272  -65.048 217.389 1.00 30.00 ? 579 ASN B N   1 
ATOM 4438 C CA  . ASN B 2 187 ? -5.687  -65.028 217.744 1.00 30.00 ? 579 ASN B CA  1 
ATOM 4439 C C   . ASN B 2 187 ? -6.415  -64.030 216.849 1.00 30.00 ? 579 ASN B C   1 
ATOM 4440 O O   . ASN B 2 187 ? -7.475  -64.334 216.296 1.00 30.00 ? 579 ASN B O   1 
ATOM 4441 C CB  . ASN B 2 187 ? -5.886  -64.647 219.219 1.00 30.00 ? 579 ASN B CB  1 
ATOM 4442 C CG  . ASN B 2 187 ? -5.385  -65.719 220.179 1.00 30.00 ? 579 ASN B CG  1 
ATOM 4443 O OD1 . ASN B 2 187 ? -5.163  -66.865 219.791 1.00 30.00 ? 579 ASN B OD1 1 
ATOM 4444 N ND2 . ASN B 2 187 ? -5.222  -65.349 221.441 1.00 30.00 ? 579 ASN B ND2 1 
ATOM 4445 N N   . ALA B 2 188 ? -5.830  -62.843 216.704 1.00 30.00 ? 580 ALA B N   1 
ATOM 4446 C CA  . ALA B 2 188 ? -6.401  -61.784 215.877 1.00 30.00 ? 580 ALA B CA  1 
ATOM 4447 C C   . ALA B 2 188 ? -6.789  -62.301 214.497 1.00 30.00 ? 580 ALA B C   1 
ATOM 4448 O O   . ALA B 2 188 ? -7.925  -62.131 214.058 1.00 30.00 ? 580 ALA B O   1 
ATOM 4449 C CB  . ALA B 2 188 ? -5.406  -60.627 215.746 1.00 30.00 ? 580 ALA B CB  1 
ATOM 4450 N N   . THR B 2 189 ? -5.848  -62.943 213.814 1.00 30.00 ? 581 THR B N   1 
ATOM 4451 C CA  . THR B 2 189 ? -6.118  -63.472 212.485 1.00 30.00 ? 581 THR B CA  1 
ATOM 4452 C C   . THR B 2 189 ? -7.216  -64.521 212.546 1.00 30.00 ? 581 THR B C   1 
ATOM 4453 O O   . THR B 2 189 ? -7.994  -64.671 211.602 1.00 30.00 ? 581 THR B O   1 
ATOM 4454 C CB  . THR B 2 189 ? -4.859  -64.099 211.855 1.00 30.00 ? 581 THR B CB  1 
ATOM 4455 O OG1 . THR B 2 189 ? -3.818  -63.114 211.786 1.00 30.00 ? 581 THR B OG1 1 
ATOM 4456 C CG2 . THR B 2 189 ? -5.158  -64.589 210.451 1.00 30.00 ? 581 THR B CG2 1 
ATOM 4457 N N   . TYR B 2 190 ? -7.277  -65.247 213.660 1.00 30.00 ? 582 TYR B N   1 
ATOM 4458 C CA  . TYR B 2 190 ? -8.289  -66.283 213.837 1.00 30.00 ? 582 TYR B CA  1 
ATOM 4459 C C   . TYR B 2 190 ? -9.646  -65.618 214.047 1.00 30.00 ? 582 TYR B C   1 
ATOM 4460 O O   . TYR B 2 190 ? -10.654 -66.050 213.490 1.00 30.00 ? 582 TYR B O   1 
ATOM 4461 C CB  . TYR B 2 190 ? -7.936  -67.171 215.036 1.00 30.00 ? 582 TYR B CB  1 
ATOM 4462 C CG  . TYR B 2 190 ? -8.859  -68.362 215.226 1.00 30.00 ? 582 TYR B CG  1 
ATOM 4463 C CD1 . TYR B 2 190 ? -9.147  -69.222 214.166 1.00 30.00 ? 582 TYR B CD1 1 
ATOM 4464 C CD2 . TYR B 2 190 ? -9.437  -68.632 216.467 1.00 30.00 ? 582 TYR B CD2 1 
ATOM 4465 C CE1 . TYR B 2 190 ? -9.989  -70.320 214.334 1.00 30.00 ? 582 TYR B CE1 1 
ATOM 4466 C CE2 . TYR B 2 190 ? -10.286 -69.730 216.646 1.00 30.00 ? 582 TYR B CE2 1 
ATOM 4467 C CZ  . TYR B 2 190 ? -10.557 -70.567 215.578 1.00 30.00 ? 582 TYR B CZ  1 
ATOM 4468 O OH  . TYR B 2 190 ? -11.409 -71.639 215.739 1.00 30.00 ? 582 TYR B OH  1 
ATOM 4469 N N   . ILE B 2 191 ? -9.653  -64.553 214.841 1.00 30.00 ? 583 ILE B N   1 
ATOM 4470 C CA  . ILE B 2 191 ? -10.868 -63.801 215.134 1.00 30.00 ? 583 ILE B CA  1 
ATOM 4471 C C   . ILE B 2 191 ? -11.498 -63.251 213.856 1.00 30.00 ? 583 ILE B C   1 
ATOM 4472 O O   . ILE B 2 191 ? -12.698 -63.412 213.625 1.00 30.00 ? 583 ILE B O   1 
ATOM 4473 C CB  . ILE B 2 191 ? -10.562 -62.622 216.090 1.00 30.00 ? 583 ILE B CB  1 
ATOM 4474 C CG1 . ILE B 2 191 ? -10.263 -63.153 217.494 1.00 30.00 ? 583 ILE B CG1 1 
ATOM 4475 C CG2 . ILE B 2 191 ? -11.728 -61.641 216.108 1.00 30.00 ? 583 ILE B CG2 1 
ATOM 4476 C CD1 . ILE B 2 191 ? -9.800  -62.096 218.475 1.00 30.00 ? 583 ILE B CD1 1 
ATOM 4477 N N   . VAL B 2 192 ? -10.678 -62.602 213.031 1.00 30.00 ? 584 VAL B N   1 
ATOM 4478 C CA  . VAL B 2 192 ? -11.150 -62.016 211.784 1.00 30.00 ? 584 VAL B CA  1 
ATOM 4479 C C   . VAL B 2 192 ? -11.781 -63.042 210.852 1.00 30.00 ? 584 VAL B C   1 
ATOM 4480 O O   . VAL B 2 192 ? -12.778 -62.753 210.191 1.00 30.00 ? 584 VAL B O   1 
ATOM 4481 C CB  . VAL B 2 192 ? -9.998  -61.291 211.046 1.00 30.00 ? 584 VAL B CB  1 
ATOM 4482 C CG1 . VAL B 2 192 ? -10.461 -60.828 209.664 1.00 30.00 ? 584 VAL B CG1 1 
ATOM 4483 C CG2 . VAL B 2 192 ? -9.527  -60.100 211.869 1.00 30.00 ? 584 VAL B CG2 1 
ATOM 4484 N N   . SER B 2 193 ? -11.210 -64.242 210.804 1.00 30.00 ? 585 SER B N   1 
ATOM 4485 C CA  . SER B 2 193 ? -11.741 -65.290 209.939 1.00 30.00 ? 585 SER B CA  1 
ATOM 4486 C C   . SER B 2 193 ? -13.009 -65.931 210.499 1.00 30.00 ? 585 SER B C   1 
ATOM 4487 O O   . SER B 2 193 ? -13.938 -66.238 209.750 1.00 30.00 ? 585 SER B O   1 
ATOM 4488 C CB  . SER B 2 193 ? -10.679 -66.363 209.688 1.00 30.00 ? 585 SER B CB  1 
ATOM 4489 O OG  . SER B 2 193 ? -9.628  -65.861 208.874 1.00 30.00 ? 585 SER B OG  1 
ATOM 4490 N N   . VAL B 2 194 ? -13.055 -66.135 211.812 1.00 30.00 ? 586 VAL B N   1 
ATOM 4491 C CA  . VAL B 2 194 ? -14.233 -66.736 212.430 1.00 30.00 ? 586 VAL B CA  1 
ATOM 4492 C C   . VAL B 2 194 ? -15.420 -65.785 212.300 1.00 30.00 ? 586 VAL B C   1 
ATOM 4493 O O   . VAL B 2 194 ? -16.535 -66.209 212.003 1.00 30.00 ? 586 VAL B O   1 
ATOM 4494 C CB  . VAL B 2 194 ? -14.001 -67.055 213.929 1.00 30.00 ? 586 VAL B CB  1 
ATOM 4495 C CG1 . VAL B 2 194 ? -15.264 -67.657 214.536 1.00 30.00 ? 586 VAL B CG1 1 
ATOM 4496 C CG2 . VAL B 2 194 ? -12.836 -68.024 214.076 1.00 30.00 ? 586 VAL B CG2 1 
ATOM 4497 N N   . ALA B 2 195 ? -15.170 -64.494 212.511 1.00 30.00 ? 587 ALA B N   1 
ATOM 4498 C CA  . ALA B 2 195 ? -16.222 -63.489 212.401 1.00 30.00 ? 587 ALA B CA  1 
ATOM 4499 C C   . ALA B 2 195 ? -16.816 -63.488 210.990 1.00 30.00 ? 587 ALA B C   1 
ATOM 4500 O O   . ALA B 2 195 ? -18.032 -63.385 210.819 1.00 30.00 ? 587 ALA B O   1 
ATOM 4501 C CB  . ALA B 2 195 ? -15.667 -62.115 212.742 1.00 30.00 ? 587 ALA B CB  1 
ATOM 4502 N N   . ARG B 2 196 ? -15.955 -63.603 209.982 1.00 30.00 ? 588 ARG B N   1 
ATOM 4503 C CA  . ARG B 2 196 ? -16.408 -63.627 208.596 1.00 30.00 ? 588 ARG B CA  1 
ATOM 4504 C C   . ARG B 2 196 ? -17.156 -64.915 208.325 1.00 30.00 ? 588 ARG B C   1 
ATOM 4505 O O   . ARG B 2 196 ? -18.055 -64.964 207.484 1.00 30.00 ? 588 ARG B O   1 
ATOM 4506 C CB  . ARG B 2 196 ? -15.221 -63.510 207.639 1.00 30.00 ? 588 ARG B CB  1 
ATOM 4507 C CG  . ARG B 2 196 ? -14.649 -62.108 207.566 1.00 30.00 ? 588 ARG B CG  1 
ATOM 4508 C CD  . ARG B 2 196 ? -13.365 -62.050 206.763 1.00 30.00 ? 588 ARG B CD  1 
ATOM 4509 N NE  . ARG B 2 196 ? -12.828 -60.694 206.776 1.00 30.00 ? 588 ARG B NE  1 
ATOM 4510 C CZ  . ARG B 2 196 ? -11.592 -60.365 206.428 1.00 30.00 ? 588 ARG B CZ  1 
ATOM 4511 N NH1 . ARG B 2 196 ? -10.744 -61.296 206.029 1.00 30.00 ? 588 ARG B NH1 1 
ATOM 4512 N NH2 . ARG B 2 196 ? -11.203 -59.099 206.491 1.00 30.00 ? 588 ARG B NH2 1 
ATOM 4513 N N   . LYS B 2 197 ? -16.771 -65.961 209.046 1.00 30.00 ? 589 LYS B N   1 
ATOM 4514 C CA  . LYS B 2 197 ? -17.397 -67.266 208.909 1.00 30.00 ? 589 LYS B CA  1 
ATOM 4515 C C   . LYS B 2 197 ? -18.849 -67.168 209.382 1.00 30.00 ? 589 LYS B C   1 
ATOM 4516 O O   . LYS B 2 197 ? -19.718 -67.877 208.882 1.00 30.00 ? 589 LYS B O   1 
ATOM 4517 C CB  . LYS B 2 197 ? -16.622 -68.296 209.737 1.00 30.00 ? 589 LYS B CB  1 
ATOM 4518 C CG  . LYS B 2 197 ? -17.055 -69.740 209.535 1.00 30.00 ? 589 LYS B CG  1 
ATOM 4519 C CD  . LYS B 2 197 ? -16.182 -70.682 210.351 1.00 30.00 ? 589 LYS B CD  1 
ATOM 4520 C CE  . LYS B 2 197 ? -16.585 -72.135 210.149 1.00 30.00 ? 589 LYS B CE  1 
ATOM 4521 N NZ  . LYS B 2 197 ? -15.651 -73.072 210.845 1.00 30.00 ? 589 LYS B NZ  1 
ATOM 4522 N N   . LEU B 2 198 ? -19.102 -66.277 210.339 1.00 30.00 ? 590 LEU B N   1 
ATOM 4523 C CA  . LEU B 2 198 ? -20.448 -66.070 210.872 1.00 30.00 ? 590 LEU B CA  1 
ATOM 4524 C C   . LEU B 2 198 ? -21.296 -65.217 209.938 1.00 30.00 ? 590 LEU B C   1 
ATOM 4525 O O   . LEU B 2 198 ? -22.515 -65.375 209.873 1.00 30.00 ? 590 LEU B O   1 
ATOM 4526 C CB  . LEU B 2 198 ? -20.393 -65.390 212.244 1.00 30.00 ? 590 LEU B CB  1 
ATOM 4527 C CG  . LEU B 2 198 ? -20.107 -66.256 213.471 1.00 30.00 ? 590 LEU B CG  1 
ATOM 4528 C CD1 . LEU B 2 198 ? -20.165 -65.390 214.720 1.00 30.00 ? 590 LEU B CD1 1 
ATOM 4529 C CD2 . LEU B 2 198 ? -21.134 -67.377 213.560 1.00 30.00 ? 590 LEU B CD2 1 
ATOM 4530 N N   . GLY B 2 199 ? -20.644 -64.301 209.229 1.00 30.00 ? 591 GLY B N   1 
ATOM 4531 C CA  . GLY B 2 199 ? -21.359 -63.436 208.311 1.00 30.00 ? 591 GLY B CA  1 
ATOM 4532 C C   . GLY B 2 199 ? -20.934 -61.985 208.434 1.00 30.00 ? 591 GLY B C   1 
ATOM 4533 O O   . GLY B 2 199 ? -21.428 -61.125 207.704 1.00 30.00 ? 591 GLY B O   1 
ATOM 4534 N N   . CYS B 2 200 ? -20.016 -61.712 209.355 1.00 30.00 ? 592 CYS B N   1 
ATOM 4535 C CA  . CYS B 2 200 ? -19.533 -60.352 209.568 1.00 30.00 ? 592 CYS B CA  1 
ATOM 4536 C C   . CYS B 2 200 ? -18.695 -59.864 208.394 1.00 30.00 ? 592 CYS B C   1 
ATOM 4537 O O   . CYS B 2 200 ? -17.651 -60.435 208.078 1.00 30.00 ? 592 CYS B O   1 
ATOM 4538 C CB  . CYS B 2 200 ? -18.696 -60.274 210.845 1.00 30.00 ? 592 CYS B CB  1 
ATOM 4539 S SG  . CYS B 2 200 ? -19.518 -60.924 212.309 1.00 30.00 ? 592 CYS B SG  1 
ATOM 4540 N N   . SER B 2 201 ? -19.162 -58.803 207.751 1.00 30.00 ? 593 SER B N   1 
ATOM 4541 C CA  . SER B 2 201 ? -18.459 -58.220 206.622 1.00 30.00 ? 593 SER B CA  1 
ATOM 4542 C C   . SER B 2 201 ? -17.575 -57.095 207.159 1.00 30.00 ? 593 SER B C   1 
ATOM 4543 O O   . SER B 2 201 ? -17.877 -55.914 206.989 1.00 30.00 ? 593 SER B O   1 
ATOM 4544 C CB  . SER B 2 201 ? -19.470 -57.673 205.610 1.00 30.00 ? 593 SER B CB  1 
ATOM 4545 O OG  . SER B 2 201 ? -18.823 -57.115 204.484 1.00 30.00 ? 593 SER B OG  1 
ATOM 4546 N N   . VAL B 2 202 ? -16.489 -57.477 207.825 1.00 30.00 ? 594 VAL B N   1 
ATOM 4547 C CA  . VAL B 2 202 ? -15.556 -56.517 208.408 1.00 30.00 ? 594 VAL B CA  1 
ATOM 4548 C C   . VAL B 2 202 ? -14.268 -56.401 207.598 1.00 30.00 ? 594 VAL B C   1 
ATOM 4549 O O   . VAL B 2 202 ? -13.913 -57.309 206.853 1.00 30.00 ? 594 VAL B O   1 
ATOM 4550 C CB  . VAL B 2 202 ? -15.207 -56.905 209.859 1.00 30.00 ? 594 VAL B CB  1 
ATOM 4551 C CG1 . VAL B 2 202 ? -16.394 -56.610 210.766 1.00 30.00 ? 594 VAL B CG1 1 
ATOM 4552 C CG2 . VAL B 2 202 ? -14.841 -58.384 209.930 1.00 30.00 ? 594 VAL B CG2 1 
ATOM 4553 N N   . PHE B 2 203 ? -13.564 -55.284 207.751 1.00 30.00 ? 595 PHE B N   1 
ATOM 4554 C CA  . PHE B 2 203 ? -12.339 -55.082 206.992 1.00 30.00 ? 595 PHE B CA  1 
ATOM 4555 C C   . PHE B 2 203 ? -11.135 -54.624 207.798 1.00 30.00 ? 595 PHE B C   1 
ATOM 4556 O O   . PHE B 2 203 ? -10.154 -54.135 207.234 1.00 30.00 ? 595 PHE B O   1 
ATOM 4557 C CB  . PHE B 2 203 ? -12.606 -54.103 205.844 1.00 30.00 ? 595 PHE B CB  1 
ATOM 4558 C CG  . PHE B 2 203 ? -13.789 -54.483 205.005 1.00 30.00 ? 595 PHE B CG  1 
ATOM 4559 C CD1 . PHE B 2 203 ? -15.045 -53.937 205.265 1.00 30.00 ? 595 PHE B CD1 1 
ATOM 4560 C CD2 . PHE B 2 203 ? -13.669 -55.450 204.007 1.00 30.00 ? 595 PHE B CD2 1 
ATOM 4561 C CE1 . PHE B 2 203 ? -16.162 -54.348 204.551 1.00 30.00 ? 595 PHE B CE1 1 
ATOM 4562 C CE2 . PHE B 2 203 ? -14.780 -55.869 203.285 1.00 30.00 ? 595 PHE B CE2 1 
ATOM 4563 C CZ  . PHE B 2 203 ? -16.032 -55.318 203.558 1.00 30.00 ? 595 PHE B CZ  1 
ATOM 4564 N N   . LEU B 2 204 ? -11.197 -54.787 209.116 1.00 30.00 ? 596 LEU B N   1 
ATOM 4565 C CA  . LEU B 2 204 ? -10.075 -54.398 209.956 1.00 30.00 ? 596 LEU B CA  1 
ATOM 4566 C C   . LEU B 2 204 ? -8.964  -55.421 209.733 1.00 30.00 ? 596 LEU B C   1 
ATOM 4567 O O   . LEU B 2 204 ? -9.218  -56.514 209.233 1.00 30.00 ? 596 LEU B O   1 
ATOM 4568 C CB  . LEU B 2 204 ? -10.481 -54.380 211.432 1.00 30.00 ? 596 LEU B CB  1 
ATOM 4569 C CG  . LEU B 2 204 ? -10.729 -55.719 212.134 1.00 30.00 ? 596 LEU B CG  1 
ATOM 4570 C CD1 . LEU B 2 204 ? -10.922 -55.468 213.617 1.00 30.00 ? 596 LEU B CD1 1 
ATOM 4571 C CD2 . LEU B 2 204 ? -11.939 -56.422 211.540 1.00 30.00 ? 596 LEU B CD2 1 
ATOM 4572 N N   . LEU B 2 205 ? -7.736  -55.058 210.083 1.00 30.00 ? 597 LEU B N   1 
ATOM 4573 C CA  . LEU B 2 205 ? -6.593  -55.954 209.940 1.00 30.00 ? 597 LEU B CA  1 
ATOM 4574 C C   . LEU B 2 205 ? -6.357  -56.604 211.295 1.00 30.00 ? 597 LEU B C   1 
ATOM 4575 O O   . LEU B 2 205 ? -6.698  -56.030 212.327 1.00 30.00 ? 597 LEU B O   1 
ATOM 4576 C CB  . LEU B 2 205 ? -5.328  -55.178 209.551 1.00 30.00 ? 597 LEU B CB  1 
ATOM 4577 C CG  . LEU B 2 205 ? -5.220  -54.436 208.219 1.00 30.00 ? 597 LEU B CG  1 
ATOM 4578 C CD1 . LEU B 2 205 ? -3.957  -53.593 208.226 1.00 30.00 ? 597 LEU B CD1 1 
ATOM 4579 C CD2 . LEU B 2 205 ? -5.199  -55.427 207.066 1.00 30.00 ? 597 LEU B CD2 1 
ATOM 4580 N N   . PRO B 2 206 ? -5.762  -57.807 211.309 1.00 30.00 ? 598 PRO B N   1 
ATOM 4581 C CA  . PRO B 2 206 ? -5.487  -58.510 212.563 1.00 30.00 ? 598 PRO B CA  1 
ATOM 4582 C C   . PRO B 2 206 ? -4.791  -57.589 213.562 1.00 30.00 ? 598 PRO B C   1 
ATOM 4583 O O   . PRO B 2 206 ? -5.092  -57.611 214.753 1.00 30.00 ? 598 PRO B O   1 
ATOM 4584 C CB  . PRO B 2 206 ? -4.591  -59.659 212.115 1.00 30.00 ? 598 PRO B CB  1 
ATOM 4585 C CG  . PRO B 2 206 ? -5.145  -59.986 210.765 1.00 30.00 ? 598 PRO B CG  1 
ATOM 4586 C CD  . PRO B 2 206 ? -5.336  -58.614 210.152 1.00 30.00 ? 598 PRO B CD  1 
ATOM 4587 N N   . GLU B 2 207 ? -3.864  -56.776 213.062 1.00 30.00 ? 599 GLU B N   1 
ATOM 4588 C CA  . GLU B 2 207 ? -3.131  -55.845 213.911 1.00 30.00 ? 599 GLU B CA  1 
ATOM 4589 C C   . GLU B 2 207 ? -4.021  -54.748 214.491 1.00 30.00 ? 599 GLU B C   1 
ATOM 4590 O O   . GLU B 2 207 ? -3.605  -54.009 215.385 1.00 30.00 ? 599 GLU B O   1 
ATOM 4591 C CB  . GLU B 2 207 ? -1.962  -55.217 213.143 1.00 30.00 ? 599 GLU B CB  1 
ATOM 4592 C CG  . GLU B 2 207 ? -2.192  -55.053 211.649 1.00 30.00 ? 599 GLU B CG  1 
ATOM 4593 C CD  . GLU B 2 207 ? -1.852  -56.309 210.870 1.00 30.00 ? 599 GLU B CD  1 
ATOM 4594 O OE1 . GLU B 2 207 ? -0.681  -56.737 210.925 1.00 30.00 ? 599 GLU B OE1 1 
ATOM 4595 O OE2 . GLU B 2 207 ? -2.748  -56.868 210.203 1.00 30.00 ? 599 GLU B OE2 1 
ATOM 4596 N N   . ASP B 2 208 ? -5.243  -54.634 213.977 1.00 30.00 ? 600 ASP B N   1 
ATOM 4597 C CA  . ASP B 2 208 ? -6.181  -53.633 214.482 1.00 30.00 ? 600 ASP B CA  1 
ATOM 4598 C C   . ASP B 2 208 ? -6.686  -54.074 215.858 1.00 30.00 ? 600 ASP B C   1 
ATOM 4599 O O   . ASP B 2 208 ? -7.149  -53.258 216.657 1.00 30.00 ? 600 ASP B O   1 
ATOM 4600 C CB  . ASP B 2 208 ? -7.358  -53.470 213.516 1.00 30.00 ? 600 ASP B CB  1 
ATOM 4601 C CG  . ASP B 2 208 ? -7.020  -52.592 212.317 1.00 30.00 ? 600 ASP B CG  1 
ATOM 4602 O OD1 . ASP B 2 208 ? -7.674  -52.743 211.263 1.00 30.00 ? 600 ASP B OD1 1 
ATOM 4603 O OD2 . ASP B 2 208 ? -6.110  -51.742 212.431 1.00 30.00 ? 600 ASP B OD2 1 
ATOM 4604 N N   . ILE B 2 209 ? -6.586  -55.372 216.126 1.00 30.00 ? 601 ILE B N   1 
ATOM 4605 C CA  . ILE B 2 209 ? -7.013  -55.923 217.407 1.00 30.00 ? 601 ILE B CA  1 
ATOM 4606 C C   . ILE B 2 209 ? -5.827  -55.914 218.370 1.00 30.00 ? 601 ILE B C   1 
ATOM 4607 O O   . ILE B 2 209 ? -5.972  -55.586 219.546 1.00 30.00 ? 601 ILE B O   1 
ATOM 4608 C CB  . ILE B 2 209 ? -7.538  -57.367 217.244 1.00 30.00 ? 601 ILE B CB  1 
ATOM 4609 C CG1 . ILE B 2 209 ? -8.741  -57.374 216.297 1.00 30.00 ? 601 ILE B CG1 1 
ATOM 4610 C CG2 . ILE B 2 209 ? -7.931  -57.941 218.600 1.00 30.00 ? 601 ILE B CG2 1 
ATOM 4611 C CD1 . ILE B 2 209 ? -9.267  -58.755 215.971 1.00 30.00 ? 601 ILE B CD1 1 
ATOM 4612 N N   . VAL B 2 210 ? -4.651  -56.261 217.853 1.00 30.00 ? 602 VAL B N   1 
ATOM 4613 C CA  . VAL B 2 210 ? -3.434  -56.297 218.657 1.00 30.00 ? 602 VAL B CA  1 
ATOM 4614 C C   . VAL B 2 210 ? -3.045  -54.910 219.161 1.00 30.00 ? 602 VAL B C   1 
ATOM 4615 O O   . VAL B 2 210 ? -2.511  -54.770 220.261 1.00 30.00 ? 602 VAL B O   1 
ATOM 4616 C CB  . VAL B 2 210 ? -2.249  -56.870 217.846 1.00 30.00 ? 602 VAL B CB  1 
ATOM 4617 C CG1 . VAL B 2 210 ? -1.008  -56.943 218.717 1.00 30.00 ? 602 VAL B CG1 1 
ATOM 4618 C CG2 . VAL B 2 210 ? -2.601  -58.251 217.310 1.00 30.00 ? 602 VAL B CG2 1 
ATOM 4619 N N   . GLU B 2 211 ? -3.317  -53.889 218.352 1.00 30.00 ? 603 GLU B N   1 
ATOM 4620 C CA  . GLU B 2 211 ? -2.987  -52.513 218.712 1.00 30.00 ? 603 GLU B CA  1 
ATOM 4621 C C   . GLU B 2 211 ? -4.195  -51.788 219.294 1.00 30.00 ? 603 GLU B C   1 
ATOM 4622 O O   . GLU B 2 211 ? -4.103  -50.630 219.699 1.00 30.00 ? 603 GLU B O   1 
ATOM 4623 C CB  . GLU B 2 211 ? -2.471  -51.767 217.479 1.00 30.00 ? 603 GLU B CB  1 
ATOM 4624 C CG  . GLU B 2 211 ? -1.280  -52.449 216.812 1.00 30.00 ? 603 GLU B CG  1 
ATOM 4625 C CD  . GLU B 2 211 ? -0.892  -51.813 215.491 1.00 30.00 ? 603 GLU B CD  1 
ATOM 4626 O OE1 . GLU B 2 211 ? 0.057   -52.308 214.849 1.00 30.00 ? 603 GLU B OE1 1 
ATOM 4627 O OE2 . GLU B 2 211 ? -1.537  -50.820 215.090 1.00 30.00 ? 603 GLU B OE2 1 
ATOM 4628 N N   . VAL B 2 212 ? -5.327  -52.481 219.329 1.00 30.00 ? 604 VAL B N   1 
ATOM 4629 C CA  . VAL B 2 212 ? -6.574  -51.942 219.864 1.00 30.00 ? 604 VAL B CA  1 
ATOM 4630 C C   . VAL B 2 212 ? -7.030  -50.625 219.219 1.00 30.00 ? 604 VAL B C   1 
ATOM 4631 O O   . VAL B 2 212 ? -6.994  -49.567 219.847 1.00 30.00 ? 604 VAL B O   1 
ATOM 4632 C CB  . VAL B 2 212 ? -6.475  -51.743 221.402 1.00 30.00 ? 604 VAL B CB  1 
ATOM 4633 C CG1 . VAL B 2 212 ? -7.830  -51.336 221.968 1.00 30.00 ? 604 VAL B CG1 1 
ATOM 4634 C CG2 . VAL B 2 212 ? -5.996  -53.027 222.062 1.00 30.00 ? 604 VAL B CG2 1 
ATOM 4635 N N   . ASN B 2 213 ? -7.447  -50.708 217.958 1.00 30.00 ? 605 ASN B N   1 
ATOM 4636 C CA  . ASN B 2 213 ? -7.956  -49.549 217.219 1.00 30.00 ? 605 ASN B CA  1 
ATOM 4637 C C   . ASN B 2 213 ? -9.436  -49.480 217.604 1.00 30.00 ? 605 ASN B C   1 
ATOM 4638 O O   . ASN B 2 213 ? -10.272 -50.162 217.006 1.00 30.00 ? 605 ASN B O   1 
ATOM 4639 C CB  . ASN B 2 213 ? -7.801  -49.784 215.711 1.00 30.00 ? 605 ASN B CB  1 
ATOM 4640 C CG  . ASN B 2 213 ? -8.317  -48.624 214.871 1.00 30.00 ? 605 ASN B CG  1 
ATOM 4641 O OD1 . ASN B 2 213 ? -8.125  -48.598 213.651 1.00 30.00 ? 605 ASN B OD1 1 
ATOM 4642 N ND2 . ASN B 2 213 ? -8.980  -47.665 215.514 1.00 30.00 ? 605 ASN B ND2 1 
ATOM 4643 N N   . GLN B 2 214 ? -9.750  -48.658 218.601 1.00 30.00 ? 606 GLN B N   1 
ATOM 4644 C CA  . GLN B 2 214 ? -11.115 -48.551 219.112 1.00 30.00 ? 606 GLN B CA  1 
ATOM 4645 C C   . GLN B 2 214 ? -12.230 -48.397 218.084 1.00 30.00 ? 606 GLN B C   1 
ATOM 4646 O O   . GLN B 2 214 ? -13.303 -48.976 218.251 1.00 30.00 ? 606 GLN B O   1 
ATOM 4647 C CB  . GLN B 2 214 ? -11.214 -47.433 220.152 1.00 30.00 ? 606 GLN B CB  1 
ATOM 4648 C CG  . GLN B 2 214 ? -11.074 -46.027 219.619 1.00 30.00 ? 606 GLN B CG  1 
ATOM 4649 C CD  . GLN B 2 214 ? -11.330 -44.993 220.701 1.00 30.00 ? 606 GLN B CD  1 
ATOM 4650 O OE1 . GLN B 2 214 ? -12.405 -44.962 221.302 1.00 30.00 ? 606 GLN B OE1 1 
ATOM 4651 N NE2 . GLN B 2 214 ? -10.338 -44.143 220.960 1.00 30.00 ? 606 GLN B NE2 1 
ATOM 4652 N N   . LYS B 2 215 ? -11.991 -47.624 217.029 1.00 30.00 ? 607 LYS B N   1 
ATOM 4653 C CA  . LYS B 2 215 ? -13.012 -47.450 216.001 1.00 30.00 ? 607 LYS B CA  1 
ATOM 4654 C C   . LYS B 2 215 ? -13.288 -48.780 215.297 1.00 30.00 ? 607 LYS B C   1 
ATOM 4655 O O   . LYS B 2 215 ? -14.439 -49.134 215.053 1.00 30.00 ? 607 LYS B O   1 
ATOM 4656 C CB  . LYS B 2 215 ? -12.576 -46.384 214.986 1.00 30.00 ? 607 LYS B CB  1 
ATOM 4657 C CG  . LYS B 2 215 ? -12.796 -44.948 215.460 1.00 30.00 ? 607 LYS B CG  1 
ATOM 4658 C CD  . LYS B 2 215 ? -12.384 -43.929 214.393 1.00 30.00 ? 607 LYS B CD  1 
ATOM 4659 C CE  . LYS B 2 215 ? -12.820 -42.511 214.756 1.00 30.00 ? 607 LYS B CE  1 
ATOM 4660 N NZ  . LYS B 2 215 ? -12.271 -42.032 216.057 1.00 30.00 ? 607 LYS B NZ  1 
ATOM 4661 N N   . MET B 2 216 ? -12.229 -49.520 214.983 1.00 30.00 ? 608 MET B N   1 
ATOM 4662 C CA  . MET B 2 216 ? -12.377 -50.811 214.321 1.00 30.00 ? 608 MET B CA  1 
ATOM 4663 C C   . MET B 2 216 ? -12.951 -51.844 215.286 1.00 30.00 ? 608 MET B C   1 
ATOM 4664 O O   . MET B 2 216 ? -13.690 -52.745 214.878 1.00 30.00 ? 608 MET B O   1 
ATOM 4665 C CB  . MET B 2 216 ? -11.027 -51.288 213.780 1.00 30.00 ? 608 MET B CB  1 
ATOM 4666 C CG  . MET B 2 216 ? -10.488 -50.436 212.638 1.00 30.00 ? 608 MET B CG  1 
ATOM 4667 S SD  . MET B 2 216 ? -11.582 -50.419 211.189 1.00 30.00 ? 608 MET B SD  1 
ATOM 4668 C CE  . MET B 2 216 ? -12.510 -48.906 211.471 1.00 30.00 ? 608 MET B CE  1 
ATOM 4669 N N   . ILE B 2 217 ? -12.609 -51.708 216.564 1.00 30.00 ? 609 ILE B N   1 
ATOM 4670 C CA  . ILE B 2 217 ? -13.111 -52.619 217.584 1.00 30.00 ? 609 ILE B CA  1 
ATOM 4671 C C   . ILE B 2 217 ? -14.631 -52.479 217.662 1.00 30.00 ? 609 ILE B C   1 
ATOM 4672 O O   . ILE B 2 217 ? -15.359 -53.473 217.665 1.00 30.00 ? 609 ILE B O   1 
ATOM 4673 C CB  . ILE B 2 217 ? -12.506 -52.301 218.975 1.00 30.00 ? 609 ILE B CB  1 
ATOM 4674 C CG1 . ILE B 2 217 ? -11.000 -52.585 218.974 1.00 30.00 ? 609 ILE B CG1 1 
ATOM 4675 C CG2 . ILE B 2 217 ? -13.202 -53.117 220.047 1.00 30.00 ? 609 ILE B CG2 1 
ATOM 4676 C CD1 . ILE B 2 217 ? -10.633 -54.009 218.613 1.00 30.00 ? 609 ILE B CD1 1 
ATOM 4677 N N   . LEU B 2 218 ? -15.096 -51.233 217.716 1.00 30.00 ? 610 LEU B N   1 
ATOM 4678 C CA  . LEU B 2 218 ? -16.520 -50.933 217.800 1.00 30.00 ? 610 LEU B CA  1 
ATOM 4679 C C   . LEU B 2 218 ? -17.298 -51.602 216.674 1.00 30.00 ? 610 LEU B C   1 
ATOM 4680 O O   . LEU B 2 218 ? -18.284 -52.301 216.918 1.00 30.00 ? 610 LEU B O   1 
ATOM 4681 C CB  . LEU B 2 218 ? -16.735 -49.417 217.740 1.00 30.00 ? 610 LEU B CB  1 
ATOM 4682 C CG  . LEU B 2 218 ? -18.090 -48.816 218.145 1.00 30.00 ? 610 LEU B CG  1 
ATOM 4683 C CD1 . LEU B 2 218 ? -18.042 -47.321 217.915 1.00 30.00 ? 610 LEU B CD1 1 
ATOM 4684 C CD2 . LEU B 2 218 ? -19.229 -49.418 217.343 1.00 30.00 ? 610 LEU B CD2 1 
ATOM 4685 N N   . ILE B 2 219 ? -16.850 -51.390 215.440 1.00 30.00 ? 611 ILE B N   1 
ATOM 4686 C CA  . ILE B 2 219 ? -17.520 -51.959 214.274 1.00 30.00 ? 611 ILE B CA  1 
ATOM 4687 C C   . ILE B 2 219 ? -17.524 -53.490 214.230 1.00 30.00 ? 611 ILE B C   1 
ATOM 4688 O O   . ILE B 2 219 ? -18.509 -54.095 213.805 1.00 30.00 ? 611 ILE B O   1 
ATOM 4689 C CB  . ILE B 2 219 ? -16.890 -51.437 212.962 1.00 30.00 ? 611 ILE B CB  1 
ATOM 4690 C CG1 . ILE B 2 219 ? -16.932 -49.905 212.934 1.00 30.00 ? 611 ILE B CG1 1 
ATOM 4691 C CG2 . ILE B 2 219 ? -17.641 -52.007 211.766 1.00 30.00 ? 611 ILE B CG2 1 
ATOM 4692 C CD1 . ILE B 2 219 ? -18.328 -49.316 212.854 1.00 30.00 ? 611 ILE B CD1 1 
ATOM 4693 N N   . LEU B 2 220 ? -16.433 -54.123 214.651 1.00 30.00 ? 612 LEU B N   1 
ATOM 4694 C CA  . LEU B 2 220 ? -16.382 -55.587 214.639 1.00 30.00 ? 612 LEU B CA  1 
ATOM 4695 C C   . LEU B 2 220 ? -17.445 -56.103 215.603 1.00 30.00 ? 612 LEU B C   1 
ATOM 4696 O O   . LEU B 2 220 ? -18.269 -56.944 215.244 1.00 30.00 ? 612 LEU B O   1 
ATOM 4697 C CB  . LEU B 2 220 ? -15.009 -56.098 215.089 1.00 30.00 ? 612 LEU B CB  1 
ATOM 4698 C CG  . LEU B 2 220 ? -14.511 -57.444 214.533 1.00 30.00 ? 612 LEU B CG  1 
ATOM 4699 C CD1 . LEU B 2 220 ? -13.334 -57.925 215.366 1.00 30.00 ? 612 LEU B CD1 1 
ATOM 4700 C CD2 . LEU B 2 220 ? -15.611 -58.482 214.546 1.00 30.00 ? 612 LEU B CD2 1 
ATOM 4701 N N   . THR B 2 221 ? -17.415 -55.586 216.828 1.00 30.00 ? 613 THR B N   1 
ATOM 4702 C CA  . THR B 2 221 ? -18.363 -55.979 217.863 1.00 30.00 ? 613 THR B CA  1 
ATOM 4703 C C   . THR B 2 221 ? -19.800 -55.758 217.399 1.00 30.00 ? 613 THR B C   1 
ATOM 4704 O O   . THR B 2 221 ? -20.645 -56.652 217.515 1.00 30.00 ? 613 THR B O   1 
ATOM 4705 C CB  . THR B 2 221 ? -18.148 -55.166 219.151 1.00 30.00 ? 613 THR B CB  1 
ATOM 4706 O OG1 . THR B 2 221 ? -16.768 -55.236 219.534 1.00 30.00 ? 613 THR B OG1 1 
ATOM 4707 C CG2 . THR B 2 221 ? -19.021 -55.713 220.278 1.00 30.00 ? 613 THR B CG2 1 
ATOM 4708 N N   . ALA B 2 222 ? -20.075 -54.563 216.880 1.00 30.00 ? 614 ALA B N   1 
ATOM 4709 C CA  . ALA B 2 222 ? -21.412 -54.229 216.399 1.00 30.00 ? 614 ALA B CA  1 
ATOM 4710 C C   . ALA B 2 222 ? -21.831 -55.188 215.293 1.00 30.00 ? 614 ALA B C   1 
ATOM 4711 O O   . ALA B 2 222 ? -23.010 -55.519 215.155 1.00 30.00 ? 614 ALA B O   1 
ATOM 4712 C CB  . ALA B 2 222 ? -21.443 -52.796 215.889 1.00 30.00 ? 614 ALA B CB  1 
ATOM 4713 N N   . SER B 2 223 ? -20.861 -55.640 214.507 1.00 30.00 ? 615 SER B N   1 
ATOM 4714 C CA  . SER B 2 223 ? -21.139 -56.567 213.417 1.00 30.00 ? 615 SER B CA  1 
ATOM 4715 C C   . SER B 2 223 ? -21.452 -57.959 213.974 1.00 30.00 ? 615 SER B C   1 
ATOM 4716 O O   . SER B 2 223 ? -22.314 -58.666 213.451 1.00 30.00 ? 615 SER B O   1 
ATOM 4717 C CB  . SER B 2 223 ? -19.944 -56.626 212.460 1.00 30.00 ? 615 SER B CB  1 
ATOM 4718 O OG  . SER B 2 223 ? -20.239 -57.410 211.316 1.00 30.00 ? 615 SER B OG  1 
ATOM 4719 N N   . ILE B 2 224 ? -20.742 -58.351 215.032 1.00 30.00 ? 616 ILE B N   1 
ATOM 4720 C CA  . ILE B 2 224 ? -20.977 -59.647 215.666 1.00 30.00 ? 616 ILE B CA  1 
ATOM 4721 C C   . ILE B 2 224 ? -22.405 -59.603 216.203 1.00 30.00 ? 616 ILE B C   1 
ATOM 4722 O O   . ILE B 2 224 ? -23.187 -60.536 216.021 1.00 30.00 ? 616 ILE B O   1 
ATOM 4723 C CB  . ILE B 2 224 ? -20.036 -59.886 216.876 1.00 30.00 ? 616 ILE B CB  1 
ATOM 4724 C CG1 . ILE B 2 224 ? -18.567 -59.761 216.452 1.00 30.00 ? 616 ILE B CG1 1 
ATOM 4725 C CG2 . ILE B 2 224 ? -20.319 -61.255 217.484 1.00 30.00 ? 616 ILE B CG2 1 
ATOM 4726 C CD1 . ILE B 2 224 ? -18.124 -60.777 215.437 1.00 30.00 ? 616 ILE B CD1 1 
ATOM 4727 N N   . MET B 2 225 ? -22.721 -58.499 216.874 1.00 30.00 ? 617 MET B N   1 
ATOM 4728 C CA  . MET B 2 225 ? -24.037 -58.280 217.453 1.00 30.00 ? 617 MET B CA  1 
ATOM 4729 C C   . MET B 2 225 ? -25.102 -58.408 216.378 1.00 30.00 ? 617 MET B C   1 
ATOM 4730 O O   . MET B 2 225 ? -26.075 -59.139 216.533 1.00 30.00 ? 617 MET B O   1 
ATOM 4731 C CB  . MET B 2 225 ? -24.111 -56.884 218.069 1.00 30.00 ? 617 MET B CB  1 
ATOM 4732 C CG  . MET B 2 225 ? -25.365 -56.633 218.880 1.00 30.00 ? 617 MET B CG  1 
ATOM 4733 S SD  . MET B 2 225 ? -25.515 -54.934 219.455 1.00 30.00 ? 617 MET B SD  1 
ATOM 4734 C CE  . MET B 2 225 ? -24.048 -54.769 220.403 1.00 30.00 ? 617 MET B CE  1 
ATOM 4735 N N   . TYR B 2 226 ? -24.900 -57.688 215.281 1.00 30.00 ? 618 TYR B N   1 
ATOM 4736 C CA  . TYR B 2 226 ? -25.837 -57.703 214.168 1.00 30.00 ? 618 TYR B CA  1 
ATOM 4737 C C   . TYR B 2 226 ? -26.293 -59.111 213.804 1.00 30.00 ? 618 TYR B C   1 
ATOM 4738 O O   . TYR B 2 226 ? -27.492 -59.378 213.717 1.00 30.00 ? 618 TYR B O   1 
ATOM 4739 C CB  . TYR B 2 226 ? -25.212 -57.035 212.939 1.00 30.00 ? 618 TYR B CB  1 
ATOM 4740 C CG  . TYR B 2 226 ? -26.153 -56.947 211.756 1.00 30.00 ? 618 TYR B CG  1 
ATOM 4741 C CD1 . TYR B 2 226 ? -27.304 -56.162 211.814 1.00 30.00 ? 618 TYR B CD1 1 
ATOM 4742 C CD2 . TYR B 2 226 ? -25.910 -57.667 210.589 1.00 30.00 ? 618 TYR B CD2 1 
ATOM 4743 C CE1 . TYR B 2 226 ? -28.191 -56.099 210.740 1.00 30.00 ? 618 TYR B CE1 1 
ATOM 4744 C CE2 . TYR B 2 226 ? -26.791 -57.612 209.508 1.00 30.00 ? 618 TYR B CE2 1 
ATOM 4745 C CZ  . TYR B 2 226 ? -27.930 -56.827 209.593 1.00 30.00 ? 618 TYR B CZ  1 
ATOM 4746 O OH  . TYR B 2 226 ? -28.808 -56.774 208.534 1.00 30.00 ? 618 TYR B OH  1 
ATOM 4747 N N   . TRP B 2 227 ? -25.335 -60.012 213.600 1.00 30.00 ? 619 TRP B N   1 
ATOM 4748 C CA  . TRP B 2 227 ? -25.662 -61.384 213.228 1.00 30.00 ? 619 TRP B CA  1 
ATOM 4749 C C   . TRP B 2 227 ? -26.124 -62.256 214.385 1.00 30.00 ? 619 TRP B C   1 
ATOM 4750 O O   . TRP B 2 227 ? -26.817 -63.251 214.177 1.00 30.00 ? 619 TRP B O   1 
ATOM 4751 C CB  . TRP B 2 227 ? -24.474 -62.035 212.514 1.00 30.00 ? 619 TRP B CB  1 
ATOM 4752 C CG  . TRP B 2 227 ? -24.173 -61.373 211.196 1.00 30.00 ? 619 TRP B CG  1 
ATOM 4753 C CD1 . TRP B 2 227 ? -23.151 -60.509 210.922 1.00 30.00 ? 619 TRP B CD1 1 
ATOM 4754 C CD2 . TRP B 2 227 ? -24.956 -61.462 209.995 1.00 30.00 ? 619 TRP B CD2 1 
ATOM 4755 N NE1 . TRP B 2 227 ? -23.250 -60.051 209.629 1.00 30.00 ? 619 TRP B NE1 1 
ATOM 4756 C CE2 . TRP B 2 227 ? -24.349 -60.620 209.037 1.00 30.00 ? 619 TRP B CE2 1 
ATOM 4757 C CE3 . TRP B 2 227 ? -26.114 -62.170 209.637 1.00 30.00 ? 619 TRP B CE3 1 
ATOM 4758 C CZ2 . TRP B 2 227 ? -24.860 -60.462 207.742 1.00 30.00 ? 619 TRP B CZ2 1 
ATOM 4759 C CZ3 . TRP B 2 227 ? -26.623 -62.013 208.346 1.00 30.00 ? 619 TRP B CZ3 1 
ATOM 4760 C CH2 . TRP B 2 227 ? -25.993 -61.163 207.416 1.00 30.00 ? 619 TRP B CH2 1 
ATOM 4761 N N   . SER B 2 228 ? -25.751 -61.885 215.605 1.00 30.00 ? 620 SER B N   1 
ATOM 4762 C CA  . SER B 2 228 ? -26.163 -62.655 216.773 1.00 30.00 ? 620 SER B CA  1 
ATOM 4763 C C   . SER B 2 228 ? -27.663 -62.475 217.015 1.00 30.00 ? 620 SER B C   1 
ATOM 4764 O O   . SER B 2 228 ? -28.365 -63.427 217.353 1.00 30.00 ? 620 SER B O   1 
ATOM 4765 C CB  . SER B 2 228 ? -25.384 -62.202 218.011 1.00 30.00 ? 620 SER B CB  1 
ATOM 4766 O OG  . SER B 2 228 ? -25.780 -62.939 219.155 1.00 30.00 ? 620 SER B OG  1 
ATOM 4767 N N   . LEU B 2 229 ? -28.144 -61.247 216.831 1.00 30.00 ? 621 LEU B N   1 
ATOM 4768 C CA  . LEU B 2 229 ? -29.550 -60.925 217.033 1.00 30.00 ? 621 LEU B CA  1 
ATOM 4769 C C   . LEU B 2 229 ? -30.468 -61.467 215.938 1.00 30.00 ? 621 LEU B C   1 
ATOM 4770 O O   . LEU B 2 229 ? -31.660 -61.169 215.919 1.00 30.00 ? 621 LEU B O   1 
ATOM 4771 C CB  . LEU B 2 229 ? -29.724 -59.407 217.143 1.00 30.00 ? 621 LEU B CB  1 
ATOM 4772 C CG  . LEU B 2 229 ? -29.066 -58.730 218.347 1.00 30.00 ? 621 LEU B CG  1 
ATOM 4773 C CD1 . LEU B 2 229 ? -29.190 -57.223 218.227 1.00 30.00 ? 621 LEU B CD1 1 
ATOM 4774 C CD2 . LEU B 2 229 ? -29.719 -59.215 219.631 1.00 30.00 ? 621 LEU B CD2 1 
ATOM 4775 N N   . GLN B 2 230 ? -29.920 -62.267 215.029 1.00 30.00 ? 622 GLN B N   1 
ATOM 4776 C CA  . GLN B 2 230 ? -30.717 -62.837 213.950 1.00 30.00 ? 622 GLN B CA  1 
ATOM 4777 C C   . GLN B 2 230 ? -30.663 -64.360 213.957 1.00 30.00 ? 622 GLN B C   1 
ATOM 4778 O O   . GLN B 2 230 ? -31.223 -65.012 213.076 1.00 30.00 ? 622 GLN B O   1 
ATOM 4779 C CB  . GLN B 2 230 ? -30.225 -62.312 212.601 1.00 30.00 ? 622 GLN B CB  1 
ATOM 4780 C CG  . GLN B 2 230 ? -30.480 -60.834 212.380 1.00 30.00 ? 622 GLN B CG  1 
ATOM 4781 C CD  . GLN B 2 230 ? -29.840 -60.327 211.105 1.00 30.00 ? 622 GLN B CD  1 
ATOM 4782 O OE1 . GLN B 2 230 ? -28.618 -60.203 211.016 1.00 30.00 ? 622 GLN B OE1 1 
ATOM 4783 N NE2 . GLN B 2 230 ? -30.665 -60.039 210.104 1.00 30.00 ? 622 GLN B NE2 1 
ATOM 4784 N N   . ARG B 2 231 ? -29.988 -64.913 214.957 1.00 30.00 ? 623 ARG B N   1 
ATOM 4785 C CA  . ARG B 2 231 ? -29.842 -66.360 215.092 1.00 30.00 ? 623 ARG B CA  1 
ATOM 4786 C C   . ARG B 2 231 ? -31.132 -67.015 215.590 1.00 30.00 ? 623 ARG B C   1 
ATOM 4787 O O   . ARG B 2 231 ? -31.147 -67.501 216.741 1.00 30.00 ? 623 ARG B O   1 
ATOM 4788 C CB  . ARG B 2 231 ? -28.693 -66.678 216.052 1.00 30.00 ? 623 ARG B CB  1 
ATOM 4789 C CG  . ARG B 2 231 ? -27.354 -66.088 215.633 1.00 30.00 ? 623 ARG B CG  1 
ATOM 4790 C CD  . ARG B 2 231 ? -26.827 -66.738 214.363 1.00 30.00 ? 623 ARG B CD  1 
ATOM 4791 N NE  . ARG B 2 231 ? -25.617 -66.080 213.874 1.00 30.00 ? 623 ARG B NE  1 
ATOM 4792 C CZ  . ARG B 2 231 ? -24.901 -66.506 212.838 1.00 30.00 ? 623 ARG B CZ  1 
ATOM 4793 N NH1 . ARG B 2 231 ? -25.267 -67.595 212.177 1.00 30.00 ? 623 ARG B NH1 1 
ATOM 4794 N NH2 . ARG B 2 231 ? -23.822 -65.836 212.458 1.00 30.00 ? 623 ARG B NH2 1 
ATOM 4795 O OXT . ARG B 2 231 ? -32.119 -67.028 214.820 1.00 30.00 ? 623 ARG B OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   2   2   ASP ASP A . n 
A 1 2   ASP 2   3   3   ASP ASP A . n 
A 1 3   ASP 3   4   4   ASP ASP A . n 
A 1 4   ILE 4   5   5   ILE ILE A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   ALA 6   7   7   ALA ALA A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   VAL 8   9   9   VAL VAL A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  ASP 10  11  11  ASP ASP A . n 
A 1 11  ASN 11  12  12  ASN ASN A . n 
A 1 12  GLY 12  13  13  GLY GLY A . n 
A 1 13  SER 13  14  14  SER SER A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  MET 15  16  16  MET MET A . n 
A 1 16  CYS 16  17  17  CYS CYS A . n 
A 1 17  LYS 17  18  18  LYS LYS A . n 
A 1 18  ALA 18  19  19  ALA ALA A . n 
A 1 19  GLY 19  20  20  GLY GLY A . n 
A 1 20  PHE 20  21  21  PHE PHE A . n 
A 1 21  ALA 21  22  22  ALA ALA A . n 
A 1 22  GLY 22  23  23  GLY GLY A . n 
A 1 23  ASP 23  24  24  ASP ASP A . n 
A 1 24  ASP 24  25  25  ASP ASP A . n 
A 1 25  ALA 25  26  26  ALA ALA A . n 
A 1 26  PRO 26  27  27  PRO PRO A . n 
A 1 27  ARG 27  28  28  ARG ARG A . n 
A 1 28  ALA 28  29  29  ALA ALA A . n 
A 1 29  VAL 29  30  30  VAL VAL A . n 
A 1 30  PHE 30  31  31  PHE PHE A . n 
A 1 31  PRO 31  32  32  PRO PRO A . n 
A 1 32  SER 32  33  33  SER SER A . n 
A 1 33  ILE 33  34  34  ILE ILE A . n 
A 1 34  VAL 34  35  35  VAL VAL A . n 
A 1 35  GLY 35  36  36  GLY GLY A . n 
A 1 36  ARG 36  37  37  ARG ARG A . n 
A 1 37  PRO 37  38  38  PRO PRO A . n 
A 1 38  ARG 38  39  39  ARG ARG A . n 
A 1 39  HIS 39  40  40  HIS HIS A . n 
A 1 40  GLN 40  41  41  GLN GLN A . n 
A 1 41  GLY 41  42  42  GLY GLY A . n 
A 1 42  VAL 42  43  43  VAL VAL A . n 
A 1 43  MET 43  44  44  MET MET A . n 
A 1 44  VAL 44  45  45  VAL VAL A . n 
A 1 45  GLY 45  46  46  GLY GLY A . n 
A 1 46  MET 46  47  47  MET MET A . n 
A 1 47  GLY 47  48  48  GLY GLY A . n 
A 1 48  GLN 48  49  49  GLN GLN A . n 
A 1 49  LYS 49  50  50  LYS LYS A . n 
A 1 50  ASP 50  51  51  ASP ASP A . n 
A 1 51  SER 51  52  52  SER SER A . n 
A 1 52  TYR 52  53  53  TYR TYR A . n 
A 1 53  VAL 53  54  54  VAL VAL A . n 
A 1 54  GLY 54  55  55  GLY GLY A . n 
A 1 55  ASP 55  56  56  ASP ASP A . n 
A 1 56  GLU 56  57  57  GLU GLU A . n 
A 1 57  ALA 57  58  58  ALA ALA A . n 
A 1 58  GLN 58  59  59  GLN GLN A . n 
A 1 59  SER 59  60  60  SER SER A . n 
A 1 60  LYS 60  61  61  LYS LYS A . n 
A 1 61  ARG 61  62  62  ARG ARG A . n 
A 1 62  GLY 62  63  63  GLY GLY A . n 
A 1 63  ILE 63  64  64  ILE ILE A . n 
A 1 64  LEU 64  65  65  LEU LEU A . n 
A 1 65  THR 65  66  66  THR THR A . n 
A 1 66  LEU 66  67  67  LEU LEU A . n 
A 1 67  LYS 67  68  68  LYS LYS A . n 
A 1 68  TYR 68  69  69  TYR TYR A . n 
A 1 69  PRO 69  70  70  PRO PRO A . n 
A 1 70  ILE 70  71  71  ILE ILE A . n 
A 1 71  GLU 71  72  72  GLU GLU A . n 
A 1 72  HIS 72  73  73  HIS HIS A . n 
A 1 73  GLY 73  74  74  GLY GLY A . n 
A 1 74  ILE 74  75  75  ILE ILE A . n 
A 1 75  VAL 75  76  76  VAL VAL A . n 
A 1 76  THR 76  77  77  THR THR A . n 
A 1 77  ASN 77  78  78  ASN ASN A . n 
A 1 78  TRP 78  79  79  TRP TRP A . n 
A 1 79  ASP 79  80  80  ASP ASP A . n 
A 1 80  ASP 80  81  81  ASP ASP A . n 
A 1 81  MET 81  82  82  MET MET A . n 
A 1 82  GLU 82  83  83  GLU GLU A . n 
A 1 83  LYS 83  84  84  LYS LYS A . n 
A 1 84  ILE 84  85  85  ILE ILE A . n 
A 1 85  TRP 85  86  86  TRP TRP A . n 
A 1 86  HIS 86  87  87  HIS HIS A . n 
A 1 87  HIS 87  88  88  HIS HIS A . n 
A 1 88  THR 88  89  89  THR THR A . n 
A 1 89  PHE 89  90  90  PHE PHE A . n 
A 1 90  TYR 90  91  91  TYR TYR A . n 
A 1 91  ASN 91  92  92  ASN ASN A . n 
A 1 92  GLU 92  93  93  GLU GLU A . n 
A 1 93  LEU 93  94  94  LEU LEU A . n 
A 1 94  ARG 94  95  95  ARG ARG A . n 
A 1 95  VAL 95  96  96  VAL VAL A . n 
A 1 96  ALA 96  97  97  ALA ALA A . n 
A 1 97  PRO 97  98  98  PRO PRO A . n 
A 1 98  GLU 98  99  99  GLU GLU A . n 
A 1 99  GLU 99  100 100 GLU GLU A . n 
A 1 100 HIS 100 101 101 HIS HIS A . n 
A 1 101 PRO 101 102 102 PRO PRO A . n 
A 1 102 VAL 102 103 103 VAL VAL A . n 
A 1 103 LEU 103 104 104 LEU LEU A . n 
A 1 104 LEU 104 105 105 LEU LEU A . n 
A 1 105 THR 105 106 106 THR THR A . n 
A 1 106 GLU 106 107 107 GLU GLU A . n 
A 1 107 ALA 107 108 108 ALA ALA A . n 
A 1 108 PRO 108 109 109 PRO PRO A . n 
A 1 109 LEU 109 110 110 LEU LEU A . n 
A 1 110 ASN 110 111 111 ASN ASN A . n 
A 1 111 PRO 111 112 112 PRO PRO A . n 
A 1 112 LYS 112 113 113 LYS LYS A . n 
A 1 113 ALA 113 114 114 ALA ALA A . n 
A 1 114 ASN 114 115 115 ASN ASN A . n 
A 1 115 ARG 115 116 116 ARG ARG A . n 
A 1 116 GLU 116 117 117 GLU GLU A . n 
A 1 117 LYS 117 118 118 LYS LYS A . n 
A 1 118 MET 118 119 119 MET MET A . n 
A 1 119 THR 119 120 120 THR THR A . n 
A 1 120 GLN 120 121 121 GLN GLN A . n 
A 1 121 ILE 121 122 122 ILE ILE A . n 
A 1 122 MET 122 123 123 MET MET A . n 
A 1 123 PHE 123 124 124 PHE PHE A . n 
A 1 124 GLU 124 125 125 GLU GLU A . n 
A 1 125 THR 125 126 126 THR THR A . n 
A 1 126 PHE 126 127 127 PHE PHE A . n 
A 1 127 ASN 127 128 128 ASN ASN A . n 
A 1 128 THR 128 129 129 THR THR A . n 
A 1 129 PRO 129 130 130 PRO PRO A . n 
A 1 130 ALA 130 131 131 ALA ALA A . n 
A 1 131 MET 131 132 132 MET MET A . n 
A 1 132 TYR 132 133 133 TYR TYR A . n 
A 1 133 VAL 133 134 134 VAL VAL A . n 
A 1 134 ALA 134 135 135 ALA ALA A . n 
A 1 135 ILE 135 136 136 ILE ILE A . n 
A 1 136 GLN 136 137 137 GLN GLN A . n 
A 1 137 ALA 137 138 138 ALA ALA A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 LEU 139 140 140 LEU LEU A . n 
A 1 140 SER 140 141 141 SER SER A . n 
A 1 141 LEU 141 142 142 LEU LEU A . n 
A 1 142 TYR 142 143 143 TYR TYR A . n 
A 1 143 ALA 143 144 144 ALA ALA A . n 
A 1 144 SER 144 145 145 SER SER A . n 
A 1 145 GLY 145 146 146 GLY GLY A . n 
A 1 146 ARG 146 147 147 ARG ARG A . n 
A 1 147 THR 147 148 148 THR THR A . n 
A 1 148 THR 148 149 149 THR THR A . n 
A 1 149 GLY 149 150 150 GLY GLY A . n 
A 1 150 ILE 150 151 151 ILE ILE A . n 
A 1 151 VAL 151 152 152 VAL VAL A . n 
A 1 152 MET 152 153 153 MET MET A . n 
A 1 153 ASP 153 154 154 ASP ASP A . n 
A 1 154 SER 154 155 155 SER SER A . n 
A 1 155 GLY 155 156 156 GLY GLY A . n 
A 1 156 ASP 156 157 157 ASP ASP A . n 
A 1 157 GLY 157 158 158 GLY GLY A . n 
A 1 158 VAL 158 159 159 VAL VAL A . n 
A 1 159 THR 159 160 160 THR THR A . n 
A 1 160 HIS 160 161 161 HIS HIS A . n 
A 1 161 THR 161 162 162 THR THR A . n 
A 1 162 VAL 162 163 163 VAL VAL A . n 
A 1 163 PRO 163 164 164 PRO PRO A . n 
A 1 164 ILE 164 165 165 ILE ILE A . n 
A 1 165 TYR 165 166 166 TYR TYR A . n 
A 1 166 GLU 166 167 167 GLU GLU A . n 
A 1 167 GLY 167 168 168 GLY GLY A . n 
A 1 168 TYR 168 169 169 TYR TYR A . n 
A 1 169 ALA 169 170 170 ALA ALA A . n 
A 1 170 LEU 170 171 171 LEU LEU A . n 
A 1 171 PRO 171 172 172 PRO PRO A . n 
A 1 172 HIS 172 173 173 HIS HIS A . n 
A 1 173 ALA 173 174 174 ALA ALA A . n 
A 1 174 ILE 174 175 175 ILE ILE A . n 
A 1 175 LEU 175 176 176 LEU LEU A . n 
A 1 176 ARG 176 177 177 ARG ARG A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ASP 178 179 179 ASP ASP A . n 
A 1 179 LEU 179 180 180 LEU LEU A . n 
A 1 180 ALA 180 181 181 ALA ALA A . n 
A 1 181 GLY 181 182 182 GLY GLY A . n 
A 1 182 ARG 182 183 183 ARG ARG A . n 
A 1 183 ASP 183 184 184 ASP ASP A . n 
A 1 184 LEU 184 185 185 LEU LEU A . n 
A 1 185 THR 185 186 186 THR THR A . n 
A 1 186 ASP 186 187 187 ASP ASP A . n 
A 1 187 TYR 187 188 188 TYR TYR A . n 
A 1 188 LEU 188 189 189 LEU LEU A . n 
A 1 189 MET 189 190 190 MET MET A . n 
A 1 190 LYS 190 191 191 LYS LYS A . n 
A 1 191 ILE 191 192 192 ILE ILE A . n 
A 1 192 LEU 192 193 193 LEU LEU A . n 
A 1 193 THR 193 194 194 THR THR A . n 
A 1 194 GLU 194 195 195 GLU GLU A . n 
A 1 195 ARG 195 196 196 ARG ARG A . n 
A 1 196 GLY 196 197 197 GLY GLY A . n 
A 1 197 TYR 197 198 198 TYR TYR A . n 
A 1 198 SER 198 199 199 SER SER A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 THR 200 201 201 THR THR A . n 
A 1 201 THR 201 202 202 THR THR A . n 
A 1 202 THR 202 203 203 THR THR A . n 
A 1 203 ALA 203 204 204 ALA ALA A . n 
A 1 204 GLU 204 205 205 GLU GLU A . n 
A 1 205 ARG 205 206 206 ARG ARG A . n 
A 1 206 GLU 206 207 207 GLU GLU A . n 
A 1 207 ILE 207 208 208 ILE ILE A . n 
A 1 208 VAL 208 209 209 VAL VAL A . n 
A 1 209 ARG 209 210 210 ARG ARG A . n 
A 1 210 ASP 210 211 211 ASP ASP A . n 
A 1 211 ILE 211 212 212 ILE ILE A . n 
A 1 212 LYS 212 213 213 LYS LYS A . n 
A 1 213 GLU 213 214 214 GLU GLU A . n 
A 1 214 LYS 214 215 215 LYS LYS A . n 
A 1 215 LEU 215 216 216 LEU LEU A . n 
A 1 216 CYS 216 217 217 CYS CYS A . n 
A 1 217 TYR 217 218 218 TYR TYR A . n 
A 1 218 VAL 218 219 219 VAL VAL A . n 
A 1 219 ALA 219 220 220 ALA ALA A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 ASP 221 222 222 ASP ASP A . n 
A 1 222 PHE 222 223 223 PHE PHE A . n 
A 1 223 GLU 223 224 224 GLU GLU A . n 
A 1 224 GLN 224 225 225 GLN GLN A . n 
A 1 225 GLU 225 226 226 GLU GLU A . n 
A 1 226 MET 226 227 227 MET MET A . n 
A 1 227 ALA 227 228 228 ALA ALA A . n 
A 1 228 THR 228 229 229 THR THR A . n 
A 1 229 ALA 229 230 230 ALA ALA A . n 
A 1 230 ALA 230 231 231 ALA ALA A . n 
A 1 231 SER 231 232 232 SER SER A . n 
A 1 232 SER 232 233 233 SER SER A . n 
A 1 233 SER 233 234 234 SER SER A . n 
A 1 234 SER 234 235 235 SER SER A . n 
A 1 235 LEU 235 236 236 LEU LEU A . n 
A 1 236 GLU 236 237 237 GLU GLU A . n 
A 1 237 LYS 237 238 238 LYS LYS A . n 
A 1 238 SER 238 239 239 SER SER A . n 
A 1 239 TYR 239 240 240 TYR TYR A . n 
A 1 240 GLU 240 241 241 GLU GLU A . n 
A 1 241 LEU 241 242 242 LEU LEU A . n 
A 1 242 PRO 242 243 243 PRO PRO A . n 
A 1 243 ASP 243 244 244 ASP ASP A . n 
A 1 244 GLY 244 245 245 GLY GLY A . n 
A 1 245 GLN 245 246 246 GLN GLN A . n 
A 1 246 VAL 246 247 247 VAL VAL A . n 
A 1 247 ILE 247 248 248 ILE ILE A . n 
A 1 248 THR 248 249 249 THR THR A . n 
A 1 249 ILE 249 250 250 ILE ILE A . n 
A 1 250 GLY 250 251 251 GLY GLY A . n 
A 1 251 ASN 251 252 252 ASN ASN A . n 
A 1 252 GLU 252 253 253 GLU GLU A . n 
A 1 253 ARG 253 254 254 ARG ARG A . n 
A 1 254 PHE 254 255 255 PHE PHE A . n 
A 1 255 ARG 255 256 256 ARG ARG A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 PRO 257 258 258 PRO PRO A . n 
A 1 258 GLU 258 259 259 GLU GLU A . n 
A 1 259 ALA 259 260 260 ALA ALA A . n 
A 1 260 LEU 260 261 261 LEU LEU A . n 
A 1 261 PHE 261 262 262 PHE PHE A . n 
A 1 262 GLN 262 263 263 GLN GLN A . n 
A 1 263 PRO 263 264 264 PRO PRO A . n 
A 1 264 SER 264 265 265 SER SER A . n 
A 1 265 PHE 265 266 266 PHE PHE A . n 
A 1 266 LEU 266 267 267 LEU LEU A . n 
A 1 267 GLY 267 268 268 GLY GLY A . n 
A 1 268 MET 268 269 269 MET MET A . n 
A 1 269 GLU 269 270 270 GLU GLU A . n 
A 1 270 SER 270 271 271 SER SER A . n 
A 1 271 CYS 271 272 272 CYS CYS A . n 
A 1 272 GLY 272 273 273 GLY GLY A . n 
A 1 273 ILE 273 274 274 ILE ILE A . n 
A 1 274 HIS 274 275 275 HIS HIS A . n 
A 1 275 GLU 275 276 276 GLU GLU A . n 
A 1 276 THR 276 277 277 THR THR A . n 
A 1 277 THR 277 278 278 THR THR A . n 
A 1 278 PHE 278 279 279 PHE PHE A . n 
A 1 279 ASN 279 280 280 ASN ASN A . n 
A 1 280 SER 280 281 281 SER SER A . n 
A 1 281 ILE 281 282 282 ILE ILE A . n 
A 1 282 MET 282 283 283 MET MET A . n 
A 1 283 LYS 283 284 284 LYS LYS A . n 
A 1 284 CYS 284 285 285 CYS CYS A . n 
A 1 285 ASP 285 286 286 ASP ASP A . n 
A 1 286 VAL 286 287 287 VAL VAL A . n 
A 1 287 ASP 287 288 288 ASP ASP A . n 
A 1 288 ILE 288 289 289 ILE ILE A . n 
A 1 289 ARG 289 290 290 ARG ARG A . n 
A 1 290 LYS 290 291 291 LYS LYS A . n 
A 1 291 ASP 291 292 292 ASP ASP A . n 
A 1 292 LEU 292 293 293 LEU LEU A . n 
A 1 293 TYR 293 294 294 TYR TYR A . n 
A 1 294 ALA 294 295 295 ALA ALA A . n 
A 1 295 ASN 295 296 296 ASN ASN A . n 
A 1 296 THR 296 297 297 THR THR A . n 
A 1 297 VAL 297 298 298 VAL VAL A . n 
A 1 298 LEU 298 299 299 LEU LEU A . n 
A 1 299 SER 299 300 300 SER SER A . n 
A 1 300 GLY 300 301 301 GLY GLY A . n 
A 1 301 GLY 301 302 302 GLY GLY A . n 
A 1 302 THR 302 303 303 THR THR A . n 
A 1 303 THR 303 304 304 THR THR A . n 
A 1 304 MET 304 305 305 MET MET A . n 
A 1 305 TYR 305 306 306 TYR TYR A . n 
A 1 306 PRO 306 307 307 PRO PRO A . n 
A 1 307 GLY 307 308 308 GLY GLY A . n 
A 1 308 ILE 308 309 309 ILE ILE A . n 
A 1 309 ALA 309 310 310 ALA ALA A . n 
A 1 310 ASP 310 311 311 ASP ASP A . n 
A 1 311 ARG 311 312 312 ARG ARG A . n 
A 1 312 MET 312 313 313 MET MET A . n 
A 1 313 GLN 313 314 314 GLN GLN A . n 
A 1 314 LYS 314 315 315 LYS LYS A . n 
A 1 315 GLU 315 316 316 GLU GLU A . n 
A 1 316 ILE 316 317 317 ILE ILE A . n 
A 1 317 THR 317 318 318 THR THR A . n 
A 1 318 ALA 318 319 319 ALA ALA A . n 
A 1 319 LEU 319 320 320 LEU LEU A . n 
A 1 320 ALA 320 321 321 ALA ALA A . n 
A 1 321 PRO 321 322 322 PRO PRO A . n 
A 1 322 SER 322 323 323 SER SER A . n 
A 1 323 THR 323 324 324 THR THR A . n 
A 1 324 MET 324 325 325 MET MET A . n 
A 1 325 LYS 325 326 326 LYS LYS A . n 
A 1 326 ILE 326 327 327 ILE ILE A . n 
A 1 327 LYS 327 328 328 LYS LYS A . n 
A 1 328 ILE 328 329 329 ILE ILE A . n 
A 1 329 ILE 329 330 330 ILE ILE A . n 
A 1 330 ALA 330 331 331 ALA ALA A . n 
A 1 331 PRO 331 332 332 PRO PRO A . n 
A 1 332 PRO 332 333 333 PRO PRO A . n 
A 1 333 GLU 333 334 334 GLU GLU A . n 
A 1 334 ARG 334 335 335 ARG ARG A . n 
A 1 335 LYS 335 336 336 LYS LYS A . n 
A 1 336 TYR 336 337 337 TYR TYR A . n 
A 1 337 SER 337 338 338 SER SER A . n 
A 1 338 VAL 338 339 339 VAL VAL A . n 
A 1 339 TRP 339 340 340 TRP TRP A . n 
A 1 340 ILE 340 341 341 ILE ILE A . n 
A 1 341 GLY 341 342 342 GLY GLY A . n 
A 1 342 GLY 342 343 343 GLY GLY A . n 
A 1 343 SER 343 344 344 SER SER A . n 
A 1 344 ILE 344 345 345 ILE ILE A . n 
A 1 345 LEU 345 346 346 LEU LEU A . n 
A 1 346 ALA 346 347 347 ALA ALA A . n 
A 1 347 SER 347 348 348 SER SER A . n 
A 1 348 LEU 348 349 349 LEU LEU A . n 
A 1 349 SER 349 350 350 SER SER A . n 
A 1 350 THR 350 351 351 THR THR A . n 
A 1 351 PHE 351 352 352 PHE PHE A . n 
A 1 352 GLN 352 353 353 GLN GLN A . n 
A 1 353 GLN 353 354 354 GLN GLN A . n 
A 1 354 MET 354 355 355 MET MET A . n 
A 1 355 TRP 355 356 356 TRP TRP A . n 
A 1 356 ILE 356 357 357 ILE ILE A . n 
A 1 357 SER 357 358 358 SER SER A . n 
A 1 358 LYS 358 359 359 LYS LYS A . n 
A 1 359 GLN 359 360 360 GLN GLN A . n 
A 1 360 GLU 360 361 361 GLU GLU A . n 
A 1 361 TYR 361 362 362 TYR TYR A . n 
A 1 362 ASP 362 363 363 ASP ASP A . n 
A 1 363 GLU 363 364 364 GLU GLU A . n 
A 1 364 SER 364 365 365 SER SER A . n 
A 1 365 GLY 365 366 366 GLY GLY A . n 
A 1 366 PRO 366 367 367 PRO PRO A . n 
A 1 367 SER 367 368 368 SER SER A . n 
A 1 368 ILE 368 369 369 ILE ILE A . n 
A 1 369 VAL 369 370 370 VAL VAL A . n 
A 1 370 HIS 370 371 371 HIS HIS A . n 
A 1 371 ARG 371 372 372 ARG ARG A . n 
A 1 372 LYS 372 373 373 LYS LYS A . n 
A 1 373 CYS 373 374 374 CYS CYS A . n 
A 1 374 PHE 374 375 375 PHE PHE A . n 
B 2 1   ASP 1   388 388 ASP ASP B . n 
B 2 2   VAL 2   389 389 VAL VAL B . n 
B 2 3   GLU 3   390 390 GLU GLU B . n 
B 2 4   THR 4   391 391 THR THR B . n 
B 2 5   CYS 5   392 392 CYS CYS B . n 
B 2 6   ARG 6   393 393 ARG ARG B . n 
B 2 7   ASP 7   394 394 ASP ASP B . n 
B 2 8   GLU 8   395 395 GLU GLU B . n 
B 2 9   ARG 9   396 396 ARG ARG B . n 
B 2 10  CYS 10  397 397 CYS CYS B . n 
B 2 11  TYR 11  398 398 TYR TYR B . n 
B 2 12  ARG 12  399 399 ARG ARG B . n 
B 2 13  LEU 13  400 400 LEU LEU B . n 
B 2 14  TRP 14  401 401 TRP TRP B . n 
B 2 15  ILE 15  402 402 ILE ILE B . n 
B 2 16  ASN 16  403 403 ASN ASN B . n 
B 2 17  SER 17  404 404 SER SER B . n 
B 2 18  LEU 18  405 405 LEU LEU B . n 
B 2 19  GLY 19  406 406 GLY GLY B . n 
B 2 20  ILE 20  407 407 ILE ILE B . n 
B 2 21  ASP 21  408 408 ASP ASP B . n 
B 2 22  SER 22  409 409 SER SER B . n 
B 2 23  TYR 23  410 410 TYR TYR B . n 
B 2 24  VAL 24  411 411 VAL VAL B . n 
B 2 25  ASN 25  412 412 ASN ASN B . n 
B 2 26  ASN 26  413 413 ASN ASN B . n 
B 2 27  VAL 27  414 414 VAL VAL B . n 
B 2 28  PHE 28  415 415 PHE PHE B . n 
B 2 29  GLU 29  416 416 GLU GLU B . n 
B 2 30  ASP 30  417 417 ASP ASP B . n 
B 2 31  VAL 31  418 418 VAL VAL B . n 
B 2 32  ARG 32  419 419 ARG ARG B . n 
B 2 33  ASN 33  420 420 ASN ASN B . n 
B 2 34  GLY 34  421 421 GLY GLY B . n 
B 2 35  TRP 35  422 422 TRP TRP B . n 
B 2 36  ILE 36  423 423 ILE ILE B . n 
B 2 37  LEU 37  424 424 LEU LEU B . n 
B 2 38  LEU 38  425 425 LEU LEU B . n 
B 2 39  GLU 39  426 426 GLU GLU B . n 
B 2 40  VAL 40  427 427 VAL VAL B . n 
B 2 41  LEU 41  428 428 LEU LEU B . n 
B 2 42  ASP 42  429 429 ASP ASP B . n 
B 2 43  LYS 43  430 430 LYS LYS B . n 
B 2 44  VAL 44  431 431 VAL VAL B . n 
B 2 45  SER 45  432 432 SER SER B . n 
B 2 46  PRO 46  433 433 PRO PRO B . n 
B 2 47  SER 47  434 434 SER SER B . n 
B 2 48  SER 48  435 435 SER SER B . n 
B 2 49  VAL 49  436 436 VAL VAL B . n 
B 2 50  ASN 50  437 437 ASN ASN B . n 
B 2 51  TRP 51  438 438 TRP TRP B . n 
B 2 52  LYS 52  439 439 LYS LYS B . n 
B 2 53  HIS 53  440 440 HIS HIS B . n 
B 2 54  ALA 54  441 441 ALA ALA B . n 
B 2 55  SER 55  442 442 SER SER B . n 
B 2 56  LYS 56  443 443 LYS LYS B . n 
B 2 57  PRO 57  444 444 PRO PRO B . n 
B 2 58  PRO 58  445 445 PRO PRO B . n 
B 2 59  ILE 59  446 446 ILE ILE B . n 
B 2 60  LYS 60  447 447 LYS LYS B . n 
B 2 61  MET 61  448 448 MET MET B . n 
B 2 62  PRO 62  449 449 PRO PRO B . n 
B 2 63  PHE 63  450 450 PHE PHE B . n 
B 2 64  ARG 64  451 451 ARG ARG B . n 
B 2 65  LYS 65  452 452 LYS LYS B . n 
B 2 66  VAL 66  453 453 VAL VAL B . n 
B 2 67  GLU 67  454 454 GLU GLU B . n 
B 2 68  ASN 68  455 455 ASN ASN B . n 
B 2 69  CYS 69  456 456 CYS CYS B . n 
B 2 70  ASN 70  457 457 ASN ASN B . n 
B 2 71  GLN 71  458 458 GLN GLN B . n 
B 2 72  VAL 72  459 459 VAL VAL B . n 
B 2 73  ILE 73  460 460 ILE ILE B . n 
B 2 74  LYS 74  461 461 LYS LYS B . n 
B 2 75  ILE 75  462 462 ILE ILE B . n 
B 2 76  GLY 76  463 463 GLY GLY B . n 
B 2 77  LYS 77  464 464 LYS LYS B . n 
B 2 78  GLN 78  465 465 GLN GLN B . n 
B 2 79  LEU 79  466 466 LEU LEU B . n 
B 2 80  LYS 80  467 467 LYS LYS B . n 
B 2 81  PHE 81  468 468 PHE PHE B . n 
B 2 82  SER 82  469 469 SER SER B . n 
B 2 83  LEU 83  470 470 LEU LEU B . n 
B 2 84  VAL 84  471 471 VAL VAL B . n 
B 2 85  ASN 85  472 472 ASN ASN B . n 
B 2 86  VAL 86  473 473 VAL VAL B . n 
B 2 87  ALA 87  474 474 ALA ALA B . n 
B 2 88  GLY 88  475 475 GLY GLY B . n 
B 2 89  ASN 89  476 476 ASN ASN B . n 
B 2 90  ASP 90  477 477 ASP ASP B . n 
B 2 91  ILE 91  478 478 ILE ILE B . n 
B 2 92  VAL 92  479 479 VAL VAL B . n 
B 2 93  GLN 93  480 480 GLN GLN B . n 
B 2 94  GLY 94  481 481 GLY GLY B . n 
B 2 95  ASN 95  482 482 ASN ASN B . n 
B 2 96  LYS 96  483 483 LYS LYS B . n 
B 2 97  LYS 97  484 484 LYS LYS B . n 
B 2 98  LEU 98  485 485 LEU LEU B . n 
B 2 99  ILE 99  486 486 ILE ILE B . n 
B 2 100 LEU 100 487 487 LEU LEU B . n 
B 2 101 GLY 101 488 488 GLY GLY B . n 
B 2 102 LEU 102 489 489 LEU LEU B . n 
B 2 103 LEU 103 490 490 LEU LEU B . n 
B 2 104 TRP 104 491 491 TRP TRP B . n 
B 2 105 GLN 105 492 492 GLN GLN B . n 
B 2 106 LEU 106 493 493 LEU LEU B . n 
B 2 107 MET 107 494 494 MET MET B . n 
B 2 108 ARG 108 495 495 ARG ARG B . n 
B 2 109 PHE 109 496 496 PHE PHE B . n 
B 2 110 HIS 110 497 497 HIS HIS B . n 
B 2 111 MET 111 498 498 MET MET B . n 
B 2 112 LEU 112 499 499 LEU LEU B . n 
B 2 113 GLN 113 500 500 GLN GLN B . n 
B 2 114 LEU 114 501 501 LEU LEU B . n 
B 2 115 LEU 115 502 502 LEU LEU B . n 
B 2 116 LYS 116 503 503 LYS LYS B . n 
B 2 117 SER 117 504 504 SER SER B . n 
B 2 118 LEU 118 505 505 LEU LEU B . n 
B 2 119 ARG 119 506 506 ARG ARG B . n 
B 2 120 SER 120 507 507 SER SER B . n 
B 2 121 GLU 121 513 513 GLU GLU B . n 
B 2 122 MET 122 514 514 MET MET B . n 
B 2 123 THR 123 515 515 THR THR B . n 
B 2 124 ASP 124 516 516 ASP ASP B . n 
B 2 125 ALA 125 517 517 ALA ALA B . n 
B 2 126 ASP 126 518 518 ASP ASP B . n 
B 2 127 ILE 127 519 519 ILE ILE B . n 
B 2 128 LEU 128 520 520 LEU LEU B . n 
B 2 129 SER 129 521 521 SER SER B . n 
B 2 130 TRP 130 522 522 TRP TRP B . n 
B 2 131 ALA 131 523 523 ALA ALA B . n 
B 2 132 ASN 132 524 524 ASN ASN B . n 
B 2 133 ARG 133 525 525 ARG ARG B . n 
B 2 134 LYS 134 526 526 LYS LYS B . n 
B 2 135 VAL 135 527 527 VAL VAL B . n 
B 2 136 ARG 136 528 528 ARG ARG B . n 
B 2 137 THR 137 529 529 THR THR B . n 
B 2 138 MET 138 530 530 MET MET B . n 
B 2 139 GLY 139 531 531 GLY GLY B . n 
B 2 140 ARG 140 532 532 ARG ARG B . n 
B 2 141 LYS 141 533 533 LYS LYS B . n 
B 2 142 LEU 142 534 534 LEU LEU B . n 
B 2 143 GLN 143 535 535 GLN GLN B . n 
B 2 144 ILE 144 536 536 ILE ILE B . n 
B 2 145 GLU 145 537 537 GLU GLU B . n 
B 2 146 SER 146 538 538 SER SER B . n 
B 2 147 PHE 147 539 539 PHE PHE B . n 
B 2 148 LYS 148 540 540 LYS LYS B . n 
B 2 149 ASP 149 541 541 ASP ASP B . n 
B 2 150 LYS 150 542 542 LYS LYS B . n 
B 2 151 SER 151 543 543 SER SER B . n 
B 2 152 LEU 152 544 544 LEU LEU B . n 
B 2 153 SER 153 545 545 SER SER B . n 
B 2 154 SER 154 546 546 SER SER B . n 
B 2 155 GLY 155 547 547 GLY GLY B . n 
B 2 156 LEU 156 548 548 LEU LEU B . n 
B 2 157 PHE 157 549 549 PHE PHE B . n 
B 2 158 PHE 158 550 550 PHE PHE B . n 
B 2 159 LEU 159 551 551 LEU LEU B . n 
B 2 160 ASN 160 552 552 ASN ASN B . n 
B 2 161 LEU 161 553 553 LEU LEU B . n 
B 2 162 LEU 162 554 554 LEU LEU B . n 
B 2 163 TRP 163 555 555 TRP TRP B . n 
B 2 164 ALA 164 556 556 ALA ALA B . n 
B 2 165 VAL 165 557 557 VAL VAL B . n 
B 2 166 GLU 166 558 558 GLU GLU B . n 
B 2 167 PRO 167 559 559 PRO PRO B . n 
B 2 168 ARG 168 560 560 ARG ARG B . n 
B 2 169 VAL 169 561 561 VAL VAL B . n 
B 2 170 VAL 170 562 562 VAL VAL B . n 
B 2 171 ASN 171 563 563 ASN ASN B . n 
B 2 172 TRP 172 564 564 TRP TRP B . n 
B 2 173 ASN 173 565 565 ASN ASN B . n 
B 2 174 LEU 174 566 566 LEU LEU B . n 
B 2 175 VAL 175 567 567 VAL VAL B . n 
B 2 176 THR 176 568 568 THR THR B . n 
B 2 177 LYS 177 569 569 LYS LYS B . n 
B 2 178 GLY 178 570 570 GLY GLY B . n 
B 2 179 GLU 179 571 571 GLU GLU B . n 
B 2 180 THR 180 572 572 THR THR B . n 
B 2 181 ASP 181 573 573 ASP ASP B . n 
B 2 182 ASP 182 574 574 ASP ASP B . n 
B 2 183 GLU 183 575 575 GLU GLU B . n 
B 2 184 LYS 184 576 576 LYS LYS B . n 
B 2 185 ARG 185 577 577 ARG ARG B . n 
B 2 186 LEU 186 578 578 LEU LEU B . n 
B 2 187 ASN 187 579 579 ASN ASN B . n 
B 2 188 ALA 188 580 580 ALA ALA B . n 
B 2 189 THR 189 581 581 THR THR B . n 
B 2 190 TYR 190 582 582 TYR TYR B . n 
B 2 191 ILE 191 583 583 ILE ILE B . n 
B 2 192 VAL 192 584 584 VAL VAL B . n 
B 2 193 SER 193 585 585 SER SER B . n 
B 2 194 VAL 194 586 586 VAL VAL B . n 
B 2 195 ALA 195 587 587 ALA ALA B . n 
B 2 196 ARG 196 588 588 ARG ARG B . n 
B 2 197 LYS 197 589 589 LYS LYS B . n 
B 2 198 LEU 198 590 590 LEU LEU B . n 
B 2 199 GLY 199 591 591 GLY GLY B . n 
B 2 200 CYS 200 592 592 CYS CYS B . n 
B 2 201 SER 201 593 593 SER SER B . n 
B 2 202 VAL 202 594 594 VAL VAL B . n 
B 2 203 PHE 203 595 595 PHE PHE B . n 
B 2 204 LEU 204 596 596 LEU LEU B . n 
B 2 205 LEU 205 597 597 LEU LEU B . n 
B 2 206 PRO 206 598 598 PRO PRO B . n 
B 2 207 GLU 207 599 599 GLU GLU B . n 
B 2 208 ASP 208 600 600 ASP ASP B . n 
B 2 209 ILE 209 601 601 ILE ILE B . n 
B 2 210 VAL 210 602 602 VAL VAL B . n 
B 2 211 GLU 211 603 603 GLU GLU B . n 
B 2 212 VAL 212 604 604 VAL VAL B . n 
B 2 213 ASN 213 605 605 ASN ASN B . n 
B 2 214 GLN 214 606 606 GLN GLN B . n 
B 2 215 LYS 215 607 607 LYS LYS B . n 
B 2 216 MET 216 608 608 MET MET B . n 
B 2 217 ILE 217 609 609 ILE ILE B . n 
B 2 218 LEU 218 610 610 LEU LEU B . n 
B 2 219 ILE 219 611 611 ILE ILE B . n 
B 2 220 LEU 220 612 612 LEU LEU B . n 
B 2 221 THR 221 613 613 THR THR B . n 
B 2 222 ALA 222 614 614 ALA ALA B . n 
B 2 223 SER 223 615 615 SER SER B . n 
B 2 224 ILE 224 616 616 ILE ILE B . n 
B 2 225 MET 225 617 617 MET MET B . n 
B 2 226 TYR 226 618 618 TYR TYR B . n 
B 2 227 TRP 227 619 619 TRP TRP B . n 
B 2 228 SER 228 620 620 SER SER B . n 
B 2 229 LEU 229 621 621 LEU LEU B . n 
B 2 230 GLN 230 622 622 GLN GLN B . n 
B 2 231 ARG 231 623 623 ARG ARG B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'representative helical assembly'            ? eicosameric 20 
2 'helical asymmetric unit'                    ? dimeric     2  
3 'helical asymmetric unit, std helical frame' ? dimeric     2  
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-10)' A,B 
2 6        A,B 
3 H        A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
H  'transform to helical frame' ? ? 1.00000000  0.00000000  0.00000000 0.00000 0.00000000  1.00000000  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 0.00000    
1  'helical symmetry operation' ? ? -0.38268343 -0.92387953 0.00000000 0.00000 0.92387953  -0.38268343 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -136.50000 
2  'helical symmetry operation' ? ? 0.58778525  0.80901699  0.00000000 0.00000 -0.80901699 0.58778525  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -109.20000 
3  'helical symmetry operation' ? ? -0.76040597 -0.64944805 0.00000000 0.00000 0.64944805  -0.76040597 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -81.90000  
4  'helical symmetry operation' ? ? 0.89100652  0.45399050  0.00000000 0.00000 -0.45399050 0.89100652  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -54.60000  
5  'helical symmetry operation' ? ? -0.97236992 -0.23344536 0.00000000 0.00000 0.23344536  -0.97236992 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -27.30000  
6  'helical symmetry operation' ? ? 1.00000000  0.00000000  0.00000000 0.00000 0.00000000  1.00000000  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 0.00000    
7  'helical symmetry operation' ? ? -0.97236992 0.23344536  0.00000000 0.00000 -0.23344536 -0.97236992 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 27.30000   
8  'helical symmetry operation' ? ? 0.89100652  -0.45399050 0.00000000 0.00000 0.45399050  0.89100652  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 54.60000   
9  'helical symmetry operation' ? ? -0.76040597 0.64944805  0.00000000 0.00000 -0.64944805 -0.76040597 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 81.90000   
10 'helical symmetry operation' ? ? 0.58778525  -0.80901699 0.00000000 0.00000 0.80901699  0.58778525  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 109.20000  
# 
_pdbx_helical_symmetry.entry_id                  3BYH 
_pdbx_helical_symmetry.number_of_operations      10 
_pdbx_helical_symmetry.rotation_per_n_subunits   -166.500000 
_pdbx_helical_symmetry.rise_per_n_subunits       27.300000 
_pdbx_helical_symmetry.n_subunits_divisor        1 
_pdbx_helical_symmetry.dyad_axis                 no 
_pdbx_helical_symmetry.circular_symmetry         1 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-02-19 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
_em_3d_fitting.id                1 
_em_3d_fitting.entry_id          3BYH 
_em_3d_fitting.ref_protocol      ? 
_em_3d_fitting.ref_space         ? 
_em_3d_fitting.overall_b_value   ? 
_em_3d_fitting.target_criteria   ? 
_em_3d_fitting.details           ? 
_em_3d_fitting.method            ? 
# 
loop_
_em_3d_fitting_list.3d_fitting_id 
_em_3d_fitting_list.id 
_em_3d_fitting_list.pdb_entry_id 
_em_3d_fitting_list.pdb_chain_id 
_em_3d_fitting_list.details 
1 1 1PXY ? ? 
1 2 2BTF ? ? 
# 
_em_3d_reconstruction.entry_id                    3BYH 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.symmetry_type               HELICAL 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.method                      IHRSR 
_em_3d_reconstruction.nominal_pixel_size          2.38 
_em_3d_reconstruction.actual_pixel_size           2.38 
_em_3d_reconstruction.resolution                  12.0 
_em_3d_reconstruction.magnification_calibration   TMV 
_em_3d_reconstruction.details                     ? 
_em_3d_reconstruction.resolution_method           ? 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.num_particles               ? 
_em_3d_reconstruction.algorithm                   ? 
# 
_em_buffer.id            1 
_em_buffer.specimen_id   1 
_em_buffer.pH            . 
_em_buffer.name          ? 
_em_buffer.details       ? 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.name                 'Actin-Fimbrin ABD2 Complex' 
_em_entity_assembly.type                 COMPLEX 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.details              
'helical filament. rotation by -166.5 degrees about the z-axis (x=0, y=0), translation by 27.3 Angstroms along the z-axis' 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_image_scans.entry_id                3BYH 
_em_image_scans.id                      1 
_em_image_scans.image_recording_id      1 
_em_image_scans.scanner_model           'NIKON COOLSCAN' 
_em_image_scans.dimension_height        ? 
_em_image_scans.dimension_width         ? 
_em_image_scans.frames_per_image        ? 
_em_image_scans.sampling_size           ? 
_em_image_scans.citation_id             ? 
_em_image_scans.number_digital_images   ? 
_em_image_scans.od_range                ? 
_em_image_scans.quant_bit_size          ? 
_em_image_scans.details                 ? 
# 
_em_imaging.entry_id                        3BYH 
_em_imaging.id                              1 
_em_imaging.specimen_id                     1 
_em_imaging.accelerating_voltage            200 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.mode                            'BRIGHT FIELD' 
_em_imaging.microscope_model                'FEI TECNAI F20' 
_em_imaging.calibrated_defocus_max          ? 
_em_imaging.alignment_procedure             ? 
_em_imaging.c2_aperture_diameter            ? 
_em_imaging.calibrated_defocus_min          ? 
_em_imaging.calibrated_magnification        ? 
_em_imaging.cryogen                         ? 
_em_imaging.details                         ? 
_em_imaging.nominal_cs                      ? 
_em_imaging.nominal_defocus_max             ? 
_em_imaging.nominal_defocus_min             ? 
_em_imaging.nominal_magnification           ? 
_em_imaging.residual_tilt                   ? 
_em_imaging.specimen_holder_model           ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
_em_imaging.citation_id                     ? 
_em_imaging.date                            ? 
_em_imaging.temperature                     ? 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.specimen_holder_type            ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          ? 
_em_sample_support.method           ? 
_em_sample_support.film_material    ? 
_em_sample_support.grid_material    ? 
_em_sample_support.grid_mesh_size   ? 
_em_sample_support.grid_type        ? 
# 
_em_experiment.entry_id                3BYH 
_em_experiment.id                      1 
_em_experiment.aggregation_state       FILAMENT 
_em_experiment.entity_assembly_id      1 
_em_experiment.reconstruction_method   HELICAL 
# 
_em_single_particle_entity.entry_id              3BYH 
_em_single_particle_entity.id                    1 
_em_single_particle_entity.image_processing_id   1 
_em_single_particle_entity.point_symmetry        ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1   1 CD  A GLU 72  ? ? CZ  A ARG 183 ? ? 0.26 
2   1 CG  A LEU 110 ? ? CD2 A HIS 161 ? ? 0.46 
3   1 CG  B LEU 505 ? ? CE  B MET 514 ? ? 0.47 
4   1 OE1 A GLU 72  ? ? NH1 A ARG 183 ? ? 0.49 
5   1 CB  B SER 404 ? ? CD1 B PHE 595 ? ? 0.53 
6   1 OE2 A GLU 72  ? ? NH2 A ARG 183 ? ? 0.54 
7   1 CB  A LEU 110 ? ? NE2 A HIS 161 ? ? 0.59 
8   1 O   A GLY 63  ? ? OG1 A THR 203 ? ? 0.63 
9   1 CA  A HIS 73  ? ? C   A ASP 157 ? ? 0.67 
10  1 CA  A HIS 73  ? ? N   A GLY 158 ? ? 0.72 
11  1 N   B LEU 505 ? ? CG  B MET 514 ? ? 0.75 
12  1 CA  B SER 404 ? ? CE1 B PHE 595 ? ? 0.79 
13  1 CZ  B ARG 396 ? ? CD1 B LEU 597 ? ? 0.80 
14  1 CD  A ARG 95  ? ? CG  B GLN 492 ? ? 0.82 
15  1 CB  B LEU 505 ? ? SD  B MET 514 ? ? 0.82 
16  1 C   A HIS 73  ? ? N   A GLY 158 ? ? 0.83 
17  1 NH1 B ARG 396 ? ? CG  B LEU 597 ? ? 0.83 
18  1 CB  A ASN 92  ? ? CB  B SER 469 ? ? 0.83 
19  1 CG  B ARG 506 ? ? O   B GLU 513 ? ? 0.87 
20  1 CG  A ASN 92  ? ? CA  B SER 469 ? ? 0.88 
21  1 C   A GLY 63  ? ? OG1 A THR 203 ? ? 0.90 
22  1 C   A GLY 63  ? ? CB  A THR 203 ? ? 0.93 
23  1 NE  A ARG 95  ? ? CG  B GLN 492 ? ? 0.94 
24  1 CH2 B TRP 491 ? ? NZ  B LYS 607 ? ? 0.95 
25  1 CG  A GLU 72  ? ? NE  A ARG 183 ? ? 0.95 
26  1 OE2 A GLU 72  ? ? CZ  A ARG 183 ? ? 0.99 
27  1 CA  B LEU 505 ? ? SD  B MET 514 ? ? 1.00 
28  1 OH  A TYR 69  ? ? OE2 A GLU 207 ? ? 1.02 
29  1 CB  A LEU 110 ? ? CE1 A HIS 161 ? ? 1.03 
30  1 ND2 A ASN 92  ? ? CA  B SER 469 ? ? 1.03 
31  1 OG  B SER 404 ? ? CD1 B PHE 595 ? ? 1.05 
32  1 CA  A ASN 92  ? ? CB  B SER 469 ? ? 1.07 
33  1 CG  A GLU 57  ? ? ND2 B ASN 472 ? ? 1.08 
34  1 CD1 B LEU 502 ? ? OD2 B ASP 516 ? ? 1.10 
35  1 CB  B SER 404 ? ? CE1 B PHE 595 ? ? 1.10 
36  1 NE  B ARG 396 ? ? CD1 B LEU 597 ? ? 1.12 
37  1 CH2 B TRP 491 ? ? CE  B LYS 607 ? ? 1.13 
38  1 CB  A LEU 110 ? ? CD2 A HIS 161 ? ? 1.15 
39  1 CD  A GLU 57  ? ? ND2 B ASN 472 ? ? 1.19 
40  1 NE  A ARG 95  ? ? CB  B GLN 492 ? ? 1.20 
41  1 CB  A ASN 92  ? ? OG  B SER 469 ? ? 1.22 
42  1 CD  A GLU 72  ? ? NH1 A ARG 183 ? ? 1.22 
43  1 NH1 B ARG 396 ? ? CD1 B LEU 597 ? ? 1.25 
44  1 CA  B SER 404 ? ? CZ  B PHE 595 ? ? 1.27 
45  1 CA  B LEU 505 ? ? CG  B MET 514 ? ? 1.29 
46  1 CD2 B LEU 505 ? ? CE  B MET 514 ? ? 1.29 
47  1 O   A GLY 63  ? ? CB  A THR 203 ? ? 1.31 
48  1 CG  A PRO 112 ? ? NH2 A ARG 177 ? ? 1.31 
49  1 CG  A HIS 73  ? ? O   A ASP 157 ? ? 1.32 
50  1 O   A SER 33  ? ? N   A VAL 35  ? ? 1.32 
51  1 CD  A GLU 72  ? ? NE  A ARG 183 ? ? 1.32 
52  1 O   B LYS 503 ? ? N   B MET 514 ? ? 1.34 
53  1 CG  B ARG 506 ? ? C   B GLU 513 ? ? 1.34 
54  1 CB  B LEU 505 ? ? CE  B MET 514 ? ? 1.38 
55  1 O   B LEU 502 ? ? C   B MET 514 ? ? 1.39 
56  1 NH2 A ARG 62  ? ? O   A GLU 207 ? ? 1.39 
57  1 C   A SER 33  ? ? C   A ILE 34  ? ? 1.40 
58  1 O   A SER 33  ? ? C   A ILE 34  ? ? 1.40 
59  1 OE1 A GLU 57  ? ? O   B VAL 471 ? ? 1.40 
60  1 ND2 A ASN 92  ? ? N   B SER 469 ? ? 1.40 
61  1 CZ  A ARG 95  ? ? CB  B GLN 492 ? ? 1.42 
62  1 CA  A LEU 110 ? ? NE2 A HIS 161 ? ? 1.43 
63  1 OE2 A GLU 57  ? ? ND2 B ASN 472 ? ? 1.43 
64  1 CG  A LEU 110 ? ? CG  A HIS 161 ? ? 1.44 
65  1 CZ3 B TRP 491 ? ? CD  B LYS 607 ? ? 1.44 
66  1 CD  A ARG 95  ? ? CD  B GLN 492 ? ? 1.44 
67  1 OE1 A GLU 72  ? ? CZ  A ARG 183 ? ? 1.45 
68  1 O   B LEU 502 ? ? CB  B MET 514 ? ? 1.46 
69  1 CZ2 B TRP 491 ? ? NZ  B LYS 607 ? ? 1.46 
70  1 CD  A GLU 57  ? ? CG  B ASN 472 ? ? 1.48 
71  1 NH1 B ARG 396 ? ? CB  B LEU 597 ? ? 1.49 
72  1 CB  A ASN 92  ? ? CA  B SER 469 ? ? 1.49 
73  1 CD  A PRO 112 ? ? NH1 A ARG 177 ? ? 1.49 
74  1 N   A HIS 73  ? ? C   A ASP 157 ? ? 1.50 
75  1 CB  B ARG 506 ? ? CB  B GLU 513 ? ? 1.50 
76  1 C   A TYR 69  ? ? O   A ILE 71  ? ? 1.51 
77  1 NH2 A ARG 62  ? ? C   A GLU 207 ? ? 1.51 
78  1 C   B SER 404 ? ? CE1 B PHE 595 ? ? 1.51 
79  1 C   A SER 33  ? ? O   A ILE 34  ? ? 1.53 
80  1 CA  A GLY 63  ? ? CB  A THR 203 ? ? 1.53 
81  1 O   A HIS 73  ? ? N   A VAL 159 ? ? 1.53 
82  1 CA  A LEU 110 ? ? CE1 A HIS 161 ? ? 1.53 
83  1 CB  B SER 404 ? ? CG  B PHE 595 ? ? 1.54 
84  1 N   B LEU 505 ? ? CB  B MET 514 ? ? 1.54 
85  1 CD1 A LEU 110 ? ? CG  A HIS 161 ? ? 1.54 
86  1 CB  A HIS 73  ? ? CA  A GLY 158 ? ? 1.54 
87  1 CD1 B LEU 502 ? ? CG  B ASP 516 ? ? 1.54 
88  1 O   B LEU 502 ? ? CA  B MET 514 ? ? 1.55 
89  1 CZ3 B TRP 491 ? ? CE  B LYS 607 ? ? 1.56 
90  1 CB  A LEU 110 ? ? ND1 A HIS 161 ? ? 1.56 
91  1 CZ  A ARG 62  ? ? CB  A GLU 207 ? ? 1.57 
92  1 CA  A HIS 73  ? ? O   A ASP 157 ? ? 1.57 
93  1 CA  B LYS 503 ? ? O   B MET 514 ? ? 1.58 
94  1 CB  A LEU 110 ? ? CG  A HIS 161 ? ? 1.59 
95  1 CD  A GLU 72  ? ? NH2 A ARG 183 ? ? 1.59 
96  1 CE1 A HIS 73  ? ? N   A ARG 183 ? ? 1.60 
97  1 CB  B ARG 506 ? ? CA  B GLU 513 ? ? 1.60 
98  1 CB  A HIS 73  ? ? O   A ASP 157 ? ? 1.61 
99  1 CG  A GLU 72  ? ? CZ  A ARG 183 ? ? 1.61 
100 1 O   A TYR 69  ? ? O   A ILE 71  ? ? 1.62 
101 1 CB  B ARG 506 ? ? CG  B GLU 513 ? ? 1.63 
102 1 OH  A TYR 69  ? ? CD  A GLU 207 ? ? 1.63 
103 1 O   A ARG 95  ? ? NH1 B ARG 495 ? ? 1.64 
104 1 CA  B SER 404 ? ? CD1 B PHE 595 ? ? 1.64 
105 1 CG  A GLU 57  ? ? CG  B ASN 472 ? ? 1.66 
106 1 O   A ARG 95  ? ? CZ  B ARG 495 ? ? 1.66 
107 1 CZ  B ARG 396 ? ? CG  B LEU 597 ? ? 1.66 
108 1 N   A ASN 92  ? ? CB  B SER 469 ? ? 1.66 
109 1 CB  A PRO 32  ? ? CA  A GLY 55  ? ? 1.67 
110 1 CG  A ASN 92  ? ? C   B SER 469 ? ? 1.67 
111 1 CB  B ARG 506 ? ? C   B GLU 513 ? ? 1.69 
112 1 CG  A LEU 110 ? ? NE2 A HIS 161 ? ? 1.69 
113 1 OE2 A GLU 57  ? ? CG  B ASN 472 ? ? 1.70 
114 1 NH1 B ARG 396 ? ? CD2 B LEU 597 ? ? 1.70 
115 1 CG  A PRO 112 ? ? CZ  A ARG 177 ? ? 1.70 
116 1 CG  A ASN 92  ? ? CB  B SER 469 ? ? 1.71 
117 1 CG  A GLU 72  ? ? CD  A ARG 183 ? ? 1.73 
118 1 CD1 B LEU 502 ? ? CA  B ASP 516 ? ? 1.74 
119 1 ND2 A ASN 92  ? ? C   B PHE 468 ? ? 1.74 
120 1 CA  A HIS 73  ? ? CA  A GLY 158 ? ? 1.74 
121 1 C   A HIS 73  ? ? CA  A GLY 158 ? ? 1.75 
122 1 ND1 A HIS 73  ? ? O   A ASP 157 ? ? 1.75 
123 1 CD2 A LEU 110 ? ? CD2 A HIS 161 ? ? 1.76 
124 1 O   A HIS 73  ? ? N   A GLY 158 ? ? 1.76 
125 1 ND2 A ASN 92  ? ? O   B PHE 468 ? ? 1.77 
126 1 CG  A PRO 112 ? ? NH1 A ARG 177 ? ? 1.78 
127 1 CB  A HIS 73  ? ? N   A GLY 158 ? ? 1.78 
128 1 N   A ILE 64  ? ? OG1 A THR 203 ? ? 1.78 
129 1 CG  B LEU 505 ? ? SD  B MET 514 ? ? 1.79 
130 1 CD1 A LEU 110 ? ? CB  A HIS 161 ? ? 1.79 
131 1 CB  B ARG 506 ? ? O   B GLU 513 ? ? 1.79 
132 1 O   A TYR 69  ? ? OD2 A ASP 157 ? ? 1.79 
133 1 C   B SER 504 ? ? CG  B MET 514 ? ? 1.80 
134 1 CB  A HIS 73  ? ? C   A ASP 157 ? ? 1.81 
135 1 N   A HIS 73  ? ? N   A GLY 158 ? ? 1.81 
136 1 O   A PRO 109 ? ? ND1 A HIS 161 ? ? 1.82 
137 1 O   B LEU 400 ? ? CB  B PHE 595 ? ? 1.82 
138 1 CE  B MET 498 ? ? CD2 B LEU 610 ? ? 1.83 
139 1 O   B LEU 502 ? ? N   B THR 515 ? ? 1.83 
140 1 CD1 A LEU 110 ? ? CD2 A HIS 161 ? ? 1.84 
141 1 CD  B ARG 396 ? ? CD1 B LEU 597 ? ? 1.84 
142 1 CB  A VAL 35  ? ? CD  A PRO 70  ? ? 1.84 
143 1 CD  A GLU 57  ? ? CB  B ASN 472 ? ? 1.84 
144 1 CD1 B LEU 502 ? ? CB  B ASP 516 ? ? 1.86 
145 1 O   A HIS 73  ? ? C   A GLY 158 ? ? 1.87 
146 1 N   A HIS 73  ? ? O   A ASP 157 ? ? 1.87 
147 1 NH1 A ARG 62  ? ? CG  A GLU 207 ? ? 1.87 
148 1 CD  B ARG 506 ? ? CB  B GLU 513 ? ? 1.88 
149 1 OE1 A GLU 57  ? ? C   B VAL 471 ? ? 1.88 
150 1 N   A LEU 65  ? ? CG2 A THR 203 ? ? 1.88 
151 1 CE1 A HIS 73  ? ? O   A ALA 181 ? ? 1.89 
152 1 N   A GLY 74  ? ? N   A GLY 158 ? ? 1.89 
153 1 N   A GLY 63  ? ? N   A ALA 204 ? ? 1.90 
154 1 N   B LYS 503 ? ? O   B MET 514 ? ? 1.91 
155 1 NH2 A ARG 62  ? ? CB  A GLU 207 ? ? 1.91 
156 1 O   A GLU 72  ? ? CA  A GLY 158 ? ? 1.91 
157 1 C   B LYS 503 ? ? N   B MET 514 ? ? 1.91 
158 1 CB  A ASN 92  ? ? C   B SER 469 ? ? 1.91 
159 1 CB  B LEU 505 ? ? CG  B MET 514 ? ? 1.93 
160 1 CG  B ARG 506 ? ? CA  B GLU 513 ? ? 1.93 
161 1 O   B LYS 503 ? ? C   B GLU 513 ? ? 1.94 
162 1 CD1 B LEU 505 ? ? CE  B MET 514 ? ? 1.94 
163 1 CZ  A ARG 95  ? ? CG  B GLN 492 ? ? 1.94 
164 1 OE1 A GLU 57  ? ? CB  B ASN 472 ? ? 1.95 
165 1 C   B LEU 502 ? ? C   B MET 514 ? ? 1.96 
166 1 NH1 A ARG 95  ? ? NE2 B GLN 492 ? ? 1.96 
167 1 C   A LEU 110 ? ? CE1 A HIS 161 ? ? 1.97 
168 1 C   A SER 33  ? ? N   A VAL 35  ? ? 1.98 
169 1 O   A ARG 62  ? ? CG2 A THR 203 ? ? 1.99 
170 1 CH2 B TRP 491 ? ? CD  B LYS 607 ? ? 1.99 
171 1 N   A ILE 64  ? ? CB  A THR 203 ? ? 1.99 
172 1 O   A HIS 73  ? ? CA  A GLY 158 ? ? 2.00 
173 1 OE2 A GLU 72  ? ? NH1 A ARG 183 ? ? 2.00 
174 1 CG  B ARG 506 ? ? CB  B GLU 513 ? ? 2.00 
175 1 NE2 A HIS 73  ? ? N   A ASP 184 ? ? 2.00 
176 1 OE2 A GLU 72  ? ? NE  A ARG 183 ? ? 2.00 
177 1 CA  A GLY 63  ? ? N   A ALA 204 ? ? 2.01 
178 1 CB  A GLU 57  ? ? CB  B ASN 472 ? ? 2.01 
179 1 CD1 A LEU 110 ? ? O   A LEU 176 ? ? 2.01 
180 1 CD1 A TYR 53  ? ? OD1 B ASN 472 ? ? 2.01 
181 1 CZ2 B TRP 491 ? ? CE  B LYS 607 ? ? 2.01 
182 1 NH2 A ARG 62  ? ? CA  A GLU 207 ? ? 2.02 
183 1 NE  A ARG 95  ? ? CA  B GLN 492 ? ? 2.02 
184 1 CG  A ARG 62  ? ? CA  A ALA 204 ? ? 2.02 
185 1 NH1 A ARG 62  ? ? CB  A GLU 207 ? ? 2.02 
186 1 O   B SER 404 ? ? CE1 B PHE 595 ? ? 2.02 
187 1 CA  A HIS 73  ? ? CA  A ASP 157 ? ? 2.02 
188 1 NH2 A ARG 95  ? ? CB  B GLN 492 ? ? 2.03 
189 1 CD1 A LEU 110 ? ? CA  A HIS 161 ? ? 2.04 
190 1 NE2 A HIS 73  ? ? OD1 A ASP 184 ? ? 2.04 
191 1 CG  A ARG 95  ? ? CG  B GLN 492 ? ? 2.05 
192 1 CB  B SER 404 ? ? CZ  B PHE 595 ? ? 2.05 
193 1 C   A HIS 73  ? ? C   A ASP 157 ? ? 2.05 
194 1 CD1 B LEU 502 ? ? N   B ASP 516 ? ? 2.07 
195 1 O   A TYR 91  ? ? N   B SER 469 ? ? 2.07 
196 1 CG  A ASN 92  ? ? OG  B SER 469 ? ? 2.07 
197 1 C   B LEU 505 ? ? SD  B MET 514 ? ? 2.08 
198 1 OD2 A ASP 3   ? ? OE1 B GLN 606 ? ? 2.08 
199 1 OD1 A ASN 92  ? ? CA  B SER 469 ? ? 2.08 
200 1 CG2 A VAL 35  ? ? CG  A PRO 70  ? ? 2.08 
201 1 CD  A ARG 95  ? ? NE2 B GLN 492 ? ? 2.09 
202 1 C   A GLY 63  ? ? CG2 A THR 203 ? ? 2.09 
203 1 OG  B SER 404 ? ? CE1 B PHE 595 ? ? 2.09 
204 1 NH2 B ARG 396 ? ? CD1 B LEU 597 ? ? 2.10 
205 1 CZ  B ARG 396 ? ? CB  B LEU 597 ? ? 2.10 
206 1 N   B ARG 506 ? ? N   B MET 514 ? ? 2.11 
207 1 CA  A GLY 63  ? ? CA  A THR 203 ? ? 2.12 
208 1 CD2 A HIS 73  ? ? OD1 A ASP 184 ? ? 2.14 
209 1 CD  B ARG 506 ? ? CA  B GLU 513 ? ? 2.14 
210 1 CB  A HIS 73  ? ? C   A GLY 158 ? ? 2.14 
211 1 CA  A ASN 92  ? ? CA  B SER 469 ? ? 2.15 
212 1 OG  B SER 404 ? ? CG  B PHE 595 ? ? 2.15 
213 1 O   A GLY 63  ? ? CA  A THR 203 ? ? 2.15 
214 1 CZ  A TYR 69  ? ? OE2 A GLU 207 ? ? 2.16 
215 1 NE  A ARG 62  ? ? CB  A GLU 207 ? ? 2.16 
216 1 CG  A GLU 57  ? ? CB  B ASN 472 ? ? 2.16 
217 1 N   A PRO 112 ? ? NH1 A ARG 177 ? ? 2.17 
218 1 CD2 B LEU 502 ? ? CD1 B ILE 519 ? ? 2.17 
219 1 O   B LYS 503 ? ? CA  B GLU 513 ? ? 2.17 
220 1 CA  B SER 404 ? ? CE2 B PHE 595 ? ? 2.17 
221 1 NH2 B ARG 396 ? ? CB  B LEU 597 ? ? 2.17 
222 1 CA  A GLY 63  ? ? OG1 A THR 203 ? ? 2.17 
223 1 NH1 A ARG 95  ? ? CD  B GLN 492 ? ? 2.17 
224 1 CG  B LEU 502 ? ? OD2 B ASP 516 ? ? 2.17 
225 1 ND1 A HIS 73  ? ? C   A ALA 181 ? ? 2.17 
226 1 NH1 A ARG 95  ? ? CG  B PHE 468 ? ? 2.18 
227 1 O   A PRO 32  ? ? N   A GLY 55  ? ? 2.18 
228 1 N   B ARG 506 ? ? C   B GLU 513 ? ? 2.18 
229 1 N   B SER 404 ? ? CE1 B PHE 595 ? ? 2.19 
230 1 NE  A ARG 95  ? ? CD  B GLN 492 ? ? 2.19 
231 1 NH2 A ARG 95  ? ? O   B GLN 492 ? ? 2.19 
232 1 OH  A TYR 69  ? ? OE1 A GLU 207 ? ? 2.19 
233 1 CD1 B LEU 400 ? ? CD2 B LEU 597 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE2 A HIS 40  ? ? CD2 A HIS 40  ? ? 1.300 1.373 -0.073 0.011 N 
2 1 NE2 A HIS 87  ? ? CD2 A HIS 87  ? ? 1.301 1.373 -0.072 0.011 N 
3 1 NE2 A HIS 88  ? ? CD2 A HIS 88  ? ? 1.298 1.373 -0.075 0.011 N 
4 1 NE2 A HIS 371 ? ? CD2 A HIS 371 ? ? 1.306 1.373 -0.067 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N   A ASP 4   ? ? CA  A ASP 4   ? ? C   A ASP 4   ? ? 91.98  111.00 -19.02 2.70 N 
2  1 CA  A ASP 4   ? ? C   A ASP 4   ? ? N   A ILE 5   ? ? 98.06  117.20 -19.14 2.20 Y 
3  1 CA  A ILE 5   ? ? CB  A ILE 5   ? ? CG1 A ILE 5   ? ? 99.20  111.00 -11.80 1.90 N 
4  1 CA  A ILE 5   ? ? C   A ILE 5   ? ? N   A ALA 6   ? ? 91.26  117.20 -25.94 2.20 Y 
5  1 O   A ILE 5   ? ? C   A ILE 5   ? ? N   A ALA 6   ? ? 133.12 122.70 10.42  1.60 Y 
6  1 NE  A ARG 37  ? ? CZ  A ARG 37  ? ? NH1 A ARG 37  ? ? 123.87 120.30 3.57   0.50 N 
7  1 CA  A VAL 43  ? ? CB  A VAL 43  ? ? CG2 A VAL 43  ? ? 101.59 110.90 -9.31  1.50 N 
8  1 CA  A MET 47  ? ? CB  A MET 47  ? ? CG  A MET 47  ? ? 124.87 113.30 11.57  1.70 N 
9  1 CA  A ARG 62  ? ? CB  A ARG 62  ? ? CG  A ARG 62  ? ? 126.98 113.40 13.58  2.20 N 
10 1 NE  A ARG 62  ? ? CZ  A ARG 62  ? ? NH1 A ARG 62  ? ? 124.97 120.30 4.67   0.50 N 
11 1 NE  A ARG 62  ? ? CZ  A ARG 62  ? ? NH2 A ARG 62  ? ? 115.80 120.30 -4.50  0.50 N 
12 1 CB  A TYR 69  ? ? CG  A TYR 69  ? ? CD2 A TYR 69  ? ? 116.50 121.00 -4.50  0.60 N 
13 1 CD1 A TRP 79  ? ? CG  A TRP 79  ? ? CD2 A TRP 79  ? ? 113.65 106.30 7.35   0.80 N 
14 1 CE2 A TRP 79  ? ? CD2 A TRP 79  ? ? CG  A TRP 79  ? ? 101.01 107.30 -6.29  0.80 N 
15 1 CD1 A TRP 86  ? ? CG  A TRP 86  ? ? CD2 A TRP 86  ? ? 112.17 106.30 5.87   0.80 N 
16 1 CE2 A TRP 86  ? ? CD2 A TRP 86  ? ? CG  A TRP 86  ? ? 100.90 107.30 -6.40  0.80 N 
17 1 CG  A TRP 86  ? ? CD2 A TRP 86  ? ? CE3 A TRP 86  ? ? 140.22 133.90 6.32   0.90 N 
18 1 CB  A TYR 91  ? ? CG  A TYR 91  ? ? CD2 A TYR 91  ? ? 117.20 121.00 -3.80  0.60 N 
19 1 NE  A ARG 116 ? ? CZ  A ARG 116 ? ? NH1 A ARG 116 ? ? 124.76 120.30 4.46   0.50 N 
20 1 CA  A MET 132 ? ? CB  A MET 132 ? ? CG  A MET 132 ? ? 129.74 113.30 16.44  1.70 N 
21 1 CG  A MET 132 ? ? SD  A MET 132 ? ? CE  A MET 132 ? ? 89.70  100.20 -10.50 1.60 N 
22 1 CG1 A VAL 163 ? ? CB  A VAL 163 ? ? CG2 A VAL 163 ? ? 100.21 110.90 -10.69 1.60 N 
23 1 NE  A ARG 183 ? ? CZ  A ARG 183 ? ? NH1 A ARG 183 ? ? 123.96 120.30 3.66   0.50 N 
24 1 CB  A TYR 188 ? ? CG  A TYR 188 ? ? CD2 A TYR 188 ? ? 116.65 121.00 -4.35  0.60 N 
25 1 CA  A MET 190 ? ? CB  A MET 190 ? ? CG  A MET 190 ? ? 126.64 113.30 13.34  1.70 N 
26 1 NE  A ARG 196 ? ? CZ  A ARG 196 ? ? NH1 A ARG 196 ? ? 124.67 120.30 4.37   0.50 N 
27 1 NE  A ARG 210 ? ? CZ  A ARG 210 ? ? NH1 A ARG 210 ? ? 125.47 120.30 5.17   0.50 N 
28 1 CA  A CYS 217 ? ? CB  A CYS 217 ? ? SG  A CYS 217 ? ? 100.07 114.00 -13.93 1.80 N 
29 1 CB  A TYR 218 ? ? CG  A TYR 218 ? ? CD2 A TYR 218 ? ? 116.91 121.00 -4.09  0.60 N 
30 1 N   A ALA 230 ? ? CA  A ALA 230 ? ? C   A ALA 230 ? ? 92.95  111.00 -18.05 2.70 N 
31 1 NE  A ARG 256 ? ? CZ  A ARG 256 ? ? NH1 A ARG 256 ? ? 124.37 120.30 4.07   0.50 N 
32 1 NE  A ARG 290 ? ? CZ  A ARG 290 ? ? NH1 A ARG 290 ? ? 125.01 120.30 4.71   0.50 N 
33 1 CA  A LYS 315 ? ? CB  A LYS 315 ? ? CG  A LYS 315 ? ? 126.88 113.40 13.48  2.20 N 
34 1 CD1 A TRP 340 ? ? CG  A TRP 340 ? ? CD2 A TRP 340 ? ? 112.47 106.30 6.17   0.80 N 
35 1 CE2 A TRP 340 ? ? CD2 A TRP 340 ? ? CG  A TRP 340 ? ? 102.35 107.30 -4.95  0.80 N 
36 1 CD1 A TRP 356 ? ? CG  A TRP 356 ? ? CD2 A TRP 356 ? ? 117.06 106.30 10.76  0.80 N 
37 1 CB  A TRP 356 ? ? CG  A TRP 356 ? ? CD1 A TRP 356 ? ? 114.15 127.00 -12.85 1.30 N 
38 1 CG  A TRP 356 ? ? CD1 A TRP 356 ? ? NE1 A TRP 356 ? ? 101.19 110.10 -8.91  1.00 N 
39 1 CE2 A TRP 356 ? ? CD2 A TRP 356 ? ? CG  A TRP 356 ? ? 99.70  107.30 -7.60  0.80 N 
40 1 CG  A TRP 356 ? ? CD2 A TRP 356 ? ? CE3 A TRP 356 ? ? 141.86 133.90 7.96   0.90 N 
41 1 CB  A VAL 370 ? ? CA  A VAL 370 ? ? C   A VAL 370 ? ? 98.09  111.40 -13.31 1.90 N 
42 1 N   A PHE 375 ? ? CA  A PHE 375 ? ? C   A PHE 375 ? ? 131.76 111.00 20.76  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 3   ? ? 69.54   -61.23  
2  1 ILE A 5   ? ? 89.56   107.70  
3  1 ALA A 6   ? ? 177.37  137.39  
4  1 HIS A 40  ? ? 173.40  106.47  
5  1 GLN A 41  ? ? -31.94  110.51  
6  1 VAL A 43  ? ? 134.58  122.00  
7  1 MET A 47  ? ? 174.95  152.22  
8  1 SER A 60  ? ? -81.07  32.75   
9  1 LYS A 61  ? ? -164.35 14.21   
10 1 GLN A 121 ? ? -44.68  -70.52  
11 1 LEU A 180 ? ? -165.31 117.26  
12 1 ARG A 196 ? ? -76.30  24.39   
13 1 PHE A 200 ? ? -110.14 52.34   
14 1 THR A 203 ? ? 29.55   -68.90  
15 1 THR A 229 ? ? -108.87 44.29   
16 1 ALA A 230 ? ? -136.47 -56.88  
17 1 SER A 232 ? ? -90.97  52.52   
18 1 SER A 233 ? ? -42.68  -100.77 
19 1 SER A 234 ? ? 53.47   -84.44  
20 1 ASP A 244 ? ? -45.50  -6.45   
21 1 CYS A 257 ? ? -70.86  -71.67  
22 1 SER A 323 ? ? -62.92  7.34    
23 1 ALA A 347 ? ? -66.55  4.30    
24 1 MET A 355 ? ? 178.70  -25.49  
25 1 ILE A 369 ? ? -39.87  -25.05  
26 1 CYS A 374 ? ? -110.09 57.87   
27 1 PRO B 433 ? ? -39.39  134.85  
28 1 ASN B 482 ? ? -55.71  101.67  
29 1 ARG B 506 ? ? -59.00  172.85  
30 1 GLU B 571 ? ? -105.40 -74.59  
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ASP 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              4 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   10.11 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C A SER 33  ? ? N A ILE 34  ? ? 2.67 
2 1 C A TYR 69  ? ? N A PRO 70  ? ? 5.40 
3 1 C A SER 145 ? ? N A GLY 146 ? ? 6.11 
4 1 C A ARG 335 ? ? N A LYS 336 ? ? 7.03 
5 1 C B SER 507 ? ? N B GLU 513 ? ? 5.94 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     SER 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      507 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     OG 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    B 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    SER 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     120 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    OG 
# 
_em_ctf_correction.id        1 
_em_ctf_correction.details   
'micrographs were multiplied by the CTF function, and the final reconstruction was then divided by the summed squared CTFs' 
_em_ctf_correction.type      . 
# 
_em_image_processing.id                   1 
_em_image_processing.image_recording_id   1 
_em_image_processing.details              ? 
# 
_em_image_recording.id                            1 
_em_image_recording.imaging_id                    1 
_em_image_recording.film_or_detector_model        'GENERIC FILM' 
_em_image_recording.avg_electron_dose_per_image   . 
_em_image_recording.average_exposure_time         ? 
_em_image_recording.details                       ? 
_em_image_recording.num_grids_imaged              ? 
_em_image_recording.num_diffraction_images        ? 
_em_image_recording.num_real_images               ? 
_em_image_recording.detector_mode                 ? 
# 
_em_specimen.experiment_id           1 
_em_specimen.id                      1 
_em_specimen.concentration           ? 
_em_specimen.vitrification_applied   YES 
_em_specimen.staining_applied        NO 
_em_specimen.embedding_applied       NO 
_em_specimen.shadowing_applied       NO 
_em_specimen.details                 ? 
#